4XQWA

X-ray structure analysis of xylanase-n44e with mes at ph6.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGEFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqwA00
3WP4A 3WR0A 3AKSA 3M4FA 2B42B 3WQ1A 4HKOA 1BCXA 2VUJA 2DCKA 2DCYA 2VG9A 1TE1B 2DFCA 1QH6A 4HKLA 1XYOA 1KS5A 4XQDA 2BVVA 2BWCA 3MFCA 3B5LB 5K7PA 4S2HA 1UKRA 2D98A 3VHNA 3WQ0A 1IGOA 3WP5A 1H0BA 3WXPA 1UU4A 2JEMA 4NPRA 1XNCA 3LB9A 1C5IA 1KS4A 3RI9A 1H4HA 3AMQA 2D97A 1H1AA 2JENA 3VL8A 5K9YA 3AKPA 2F6BA 3AKQA 1OA4A 5EJ3A 1H4GA 1REFA 3WQ7A 3AKRA 1BK1A 1XNDA 1BVVA 1HV0A 2VGDA 1ENXA 1HIXA 3EXUA 5HXVA 3WP6A 1XXNA 1OA3A 1UU5A 3RI8A 1XYNA 2Z79A 3VZOA 1H8VA 3VGIA 4HK8A 2B46X 1C5HA 4IXLA 3AMNA 2B45X 2DCZA 4XQ4A 3VHPA 4S2DA 1F5JA 1NLRA 1REEA 1REDA 3WP3A 4H7MA 3VL9A 1XNBA 3AMPA 3AMMA 4XPVA 4XQWA 2BWAA 2C1FA 3VZNA 3ZSEA 1OA2A 3O7OA 2QZ2A 2NQYA 1OLQA 4HK9A 3VZLA 1T6GC 3AMHA 1XYPA 2NLRA 3AKTA 2DCJA 2BW8A 1M4WA 2JICA 3VZMA 1AXKA 4S2GA 3VLBB 1PVXA 1QH7A 1W2UA 3VZJA 4HKWA 1OLRA 2QZ3A 3B7MA 3LGRA 1XNKA 2DFBA 3MF6A 3HD8B 3WX5A 1YNAA 3WY6A 3MFAA 3VZKA 4S2FA 1HV1A 1UU6A 3MF9A 3VHOA 3WT3A 2VULA
chains in the Genus database with same CATH superfamily
3WP4A 1BQPA 1E5RA 2B39A 4L11A 4PIXA 2WRAA 3FC0A 4Y4YA 5J98B 2V73A 3Q8FA 4URTA 3E6BA 1VLNA 2EIGA 3POIA 3Q8CA 4BQXA 4YVSC 2VU9A 1AZDA 1H2NA 1O6UA 1YQ2A 2RR11 1W2OA 2DCYA 4AYUA 4GWIA 1IPKA 2FHRA 5FZGA 4OCTA 1SCSA 5A70A 4JTNA 3I49A 4JDNA 2HWE3 4XFBA 3GCWA 1Y7BA 4N9HA 4IE4A 5EHDA 3SCHA 1BEV1 1U5ZA 2XJPA 2BWCA 4LHSA 1F8VA 1RMU3 4FT8A 4XFAA 5IVEA 1Q8OA 5M0TA 2WBKA 3BVCA 1ENQA 4COZA 3LFIA 3MEPA 1BEV2 5B2GB 3M70A 1L7RA 1HJFA 1FOD1 3GM8A 3R4DB 4KWJA 5D1IA 2WUHA 3HEIA 3M7AA 4AI9A 2ADDA 5A1AA 3LEMA 4NAMA 5A6YA 2QQJA 1SHWB 2PHFA 5LA1A 3OEAA 1FOD2 1W6QA 2QQWA 3INAA 5DG1A 5FP3A 1SFPA 5A3PA 3RVHA 3KT7A 3SLIA 4BK5A 3TEZA 3FE5A 4AQ6A 4CCJA 1PZ8A 3ST7A 4CP0A 1XRUA 2RDNA 5F5IA 5KBFA 1JS9A 4WM7A 2Z69A 1N1TA 3T0BA 2NN8A 4OQ9A 5K9YA 4CXYA 2SLIA 3DCQA 1LJ7A 2DUOA 5GZDA 3TOJA 1NQDA 3QH6A 4YW6A 1W8ZA 4ATFA 4YFZA 1NOVA 1REFA 4AW7A 5GLUA 4PLMA 4CUAA 2VZPA 1UIKA 5DAPA 2WNVA 2A3WA 1SEFA 2AEZA 5BNOC 2IUWA 5BNNA 4JX0A 1HIXA 2O0OA 2RR13 2Z42A 3EJKA 1RUNA 3WNOA 2C9AA 4DO0A 5JXHA 1ZX5A 1YRZA 5FYTA 5FXZA 1RB8G 5FZCA 1BEV3 5B4XA 4EJRA 3BOPA 3VZOA 4N43A 5K0UB 1NT0A 5FJHA 1JZ2A 2W9XA 4MGZE 1X82A 4GWMA 2D6MA 2OX0A 2P6CA 5BNPA 1VMFA 2DCZA 1E57A 1TEIA 2QQLA 2NZ9A 4QPYA 4CE8A 4NUBA 4NRQA 1FOD3 2AH2A 5D8AA 5SV8A 3MGUA 1PX4A 4H7MA 3NSTA 3SITA 3NAPC 3MIGA 1K45A 5AVAA 3WW1A 4UBHA 1D7PM 3D5OA 1W6NA 5AC91 1VMJA 4WVMB 2JG9C 3MIEA 1CZSA 4RR3A 2G9FA 1JZ6A 3THDA 3V0BA 3ZXEA 2NP0A 1R1A1 4MGSA 1GOGA 3JB4C 4B29A 4FBFA 5IK4A 3VDBA 3KVBA 5F9TA 2OA2A 3RZKA 1BHGA 4XF3A 3NV1A 4GB31 4BJ0A 2HWD2 1CWPA 1D4VB 3ZM8A 4ATEA 3POYA 4BHPA 4GAZA 1ENSA 1X9PA 2IWGB 4DEQA 4WBBA 3CLPA 1SQ4A 4GB32 3SKJE 2PA7A 2IVJA 1YQ6A 3L2HA 4LBOA 2GH8A 1IOAA 3MBWA 4Q4Y1 2XR4A 4IEPA 5J3UA 5FXWA 1LOGA 4HSLA 3MPPG 4IETA 5FY7A 5H9QA 2PQQA 3ZXDA 1UY4A 4Y5TA 5FY0A 3H42B 2WABA 3KZ4C 4Q4Y2 5FQ0A 4YGDA 3U10A 1NXMA 2WO1A 3OPWA 4BYYA 4K7JA 2WT1A 4LHKA 2R1BA 2DVGA 1GWKA 3CJIB 1ZYBA 3ACIA 5FXVA 3D4KA 3J8F2 4CDUC 2QQIA 4CEYA 3C7FA 4OZXA 4YW7A 3GF6A 2XVGA 2VCAA 2HH9A 4TSVA 2BDRA 3UGGA 3WQ1A 1UXXX 3ZN6B 5IYYA 2Y33A 1RXFA 1TE1B 4WVWA 5AC93 4P5HA 3VUOA 4IUGA 3CIHA 3FLTA 1HQNA 1LOFA 1NE6A 1WCDJ 1R1A3 3VHNA 2QQOA 2E31A 4JGZA 3K75B 5C7GA 3I2JA 2PLV2 1S2KA 1SLCA 4GB33 4UI9L 1DQ6A 5CVRA 2W94A 3TWIA 3I3EA 2FCTA 3RZGA 5DZEA 4NPRA 2JDZA 1IS5A 4OVEA 2ZGRA 1QDCA 3BODA 1NX9A 3ZFFC 4YG6A 1BVP1 4CEWC 1ULCA 4Q4Y3 2WYSA 5DUVA 5CADA 2O8QA 4LKDA 1QOOA 3BALA 4GWNA 2CGNA 5FPBA 4AFMA 1UOGA 5E1RA 4DINB 2PAMA 2F6BA 5HPOA 1ASJ1 4AEJA 3EMRA 4RQPA 2NPIA 2VECA 2W1UA 5A7SA 2YHJA 3N7JA 1OT5A 2A6VA 2VZVA 3ZIWA 1DG6A 1S0EA 1RL3A 1SLIA 3FJSA 4CVUA 2HKXA 2VZSA 4XETA 3K3OA 2D3PA 4YNIA 2EVXA 4OUEA 4XACA 5EJZB 4XW3A 2VCMA 4E2QA 1F2NA 1FNYA 3ECQA 1B35B 2ZZJA 3RZMA 3RI8A 4A2UA 5I93A 2H6BA 3KT1A 3LAGA 1QU0A 2DU0A 3MUZ1 3WUCA 1Q43A 2VBDA 4PDWA 5FZ3A 3PVBB 4Z2WA 1DLCA 4PJYA 4ZS2A 1W8FA 1EP0A 3O1VA 2ENRA 4RS5A 1FATA 2YFZA 1I9RA 3ETPA 3UKVA 3VBUA 1VAVA 2VW2A 5F5QA 4UW5A 1W05A 4YSFA 4A3ZA 4BQ5A 1NA1C 2QE3A 1LOEA 1G6NA 2TNFA 4KI5M 1YFUA 3VKMA 2C1FA 1XPWA 4YVWA 1MS3A 1XE0A 4D8MA 2UU8A 4JKMA 1AF9A 5FUPA 5FZFA 2PAKA 4Y5SA 4L99A 4GH4A 2ZAAA 3N9NA 1A6CA 2O8OA 2O1QA 4IV1C 1M4WA 3FL7A 1Q3EA 2KR2A 1JOPA 4GKXA 2ZGTA 5K8SA 5LW9A 1WZXA 3O5SA 2P37A 3A0NA 3AC0A 1FPN1 2OUHA 3NNMA 2N7GA 4LBLA 3QD6A 5DQ0A 3KS7A 2JJ6A 2YG0A 1Q8PA 1VB2A 1XNKA 2DVFA 2RE9A 2VTXA 2P5BA 4P9YA 3S57A 3GJBA 4DXRA 2Y6HA 1FPN2 1W8OA 2WWUA 5LB6A 2UY9A 1ND3C 2J7MA 2OT7A 5IFPA 4Y1VA 3N9PA 5JAXA 4Y26A 3ETQA 2J1RA 4QPIB 1LTEA 5FPVA 3WF0A 2VNOA 1QJY1 3J7NA 1MZFA 5F1RA 4C8DA 3L9JT 1G9BA 4LLFA 2JB8A 2QQKA 3IPVB 3WHUA 4KGGA 4XHXA 1TNFA 4GMP1 1DQ4A 4MLOA 1NCQB 5FZBA 3RG0A 2I2SA 4R52A 3HWJA 2KA3A 3MIFA 4HKOA 4JVAA 4UFJA 5FO7B 1PGL1 1K5MB 2ZHLA 4L9BA 2Z4FA 3IBMA 2PHRA 4JKKA 4E9KA 4LIVA 2D98A 5DZFA 3RSJA 4YZ5A 2PAEA 1KEXA 3I54A 3DV8A 1QDOA 4Q0PA 3HN3A 3S7IA 4BCUA 5JXGA 1IS3A 4OFGA 3H8UA 5FP7A 1FPN3 4WV8A 3UKNA 3VKLA 2Y6FA 1SPPA 2EA7A 2D6OX 3QLQA 1PIV2 4PF5A 2A5ZA 2CHHA 3O0WA 4AFCA 5JOZA 4FXKB 4FFGA 5FYVA 5CA6A 5KHGA 2G1MA 2Q30A 4XJZA 1VE0A 1EV11 3RYRA 3AKPA 3LA7A 3OBAA 1XE7A 4UFIA 4XURA 1QJY3 4QX2A 5EJ3A 3C7GA 1IG3A 4EE2A 3AKRA 5IATA 1JMUB 1GP6A 4GMP3 4JRAA 1XJAA 4R4ZA 4R8HA 4HG6B 4D6SA 2G4IA 3D0SA 5K0UA 1G9CA 5HCBA 1XXNA 2V72A 5FP9A 4XUQA 1S0JA 1UQXA 1W6MB 5FUIA 5CU1A 5A7WA 4AVBA 4I09A 3HMYA 2B46X 5LBEA 2BGPA 3GZTB 3MPBA 1JZ8A 2WINB 1JU4A 2ZGKA 4IV3A 3LEGA 3PNAA 4ZXEA 4CU7A 4X8PA 1QNYA 1OVPA 2ZOEB 4LBQA 1M06G 4LKEA 1ZM1A 2D3SA 1YFXA 4IEVA 4AGGA 1GKBA 2W87A 1N1YA 3LZZA 1C1FA 5ABJC 1RHI2 2JWPA 3OJBA 1GOHA 4XBLA 2Q8DA 1RUH1 4FFFA 5I8TA 1W39A 1EV13 5GJ6A 4WVZA 1HRV2 2XVKA 1Q8QA 4JTOA 1PO11 4ZXKA 3OEBA 1HX6A 4D69A 1RUH2 3VZMA 2OS2A 2R062 3PTRB 3GYDA 1OF4A 4CYDA 4EWAA 4IEQA 4OZOA 2ZGQA 1PO12 2D6KA 2ETEA 3WD5A 3E1F1 5LWBA 1XNAA 3QOPA 1RYYA 2DWRA 1PZ9A 2WN2A 1YNAA 4HETA 4BQ1A 4S2FA 2RJLA 1QGLA 3AZYA 3BB6A 4FAGA 5F7UA 2E63A 3PURA 4QGLA 4BK4A 3SQOA 2B5HA 4N53C 1WBLA 2B9VA 1R081 4CCCA 1S0DA 2FCVA 1WKYA 1WD4A 1N47A 3OUJA 1RHI3 2XHNA 3OUHA 3ZLIA 4B7KA 5CISA 2WQ8A 2D6PA 4AXOA 4L0PA 3G6JB 1Z0HA 3ZDSA 2VUCA 1CZVA 2YUEA 3LOBA 2HEYF 4TYSA 1RUH3 4Q0QA 3AYEA 1W3VA 2P34A 1ONAA 1PO13 3G7DA 5T5LA 4ZPIA 1H0BA 5KHKA 3J9SA 3OGRA 1J1LA 1PHMA 3W58A 3U07A 5FZIA 2J1VA 4ARYA 4AAPA 5CB7A 2WWSA 2P3JA 4UFHA 5L7OA 1AR82 1COV1 5F3GA 3U37A 4M3CE 1LHVA 1POV1 4YLZA 4QB6A 2UURA 3LEKA 1ZBE1 2XJUA 1STMA 3B9IA 1COV2 3ZVXA 5CFDB 1Z78A 1R083 1SFYA 2VOWA 2ZGUA 5A7PA 3WW3A 3WDXA 1V6LA 3KF3A 4LQRA 4XTPA 3V0AB 1ZBE2 2J1UA 4I0BA 1B35A 2R1DA 3BIWE 4OYUA 3UGFA 2VGDA 4B3NA 2WNUC 5ANNA 5LBFA 2EICA 4NWWA 1GZTA 5FOJB 1JBCA 4Q27A 3WP6A 3I3MA 3W59A 4M00A 4NRPA 3TB0A 1ZZ6A 2XL7A 2GC3A 1GZCA 3THPA 1C5HA 4YGBA 2WYFA 2P1BA 3TRSB 2K9ZA 2YPDA 5LBCA 4B4PA 1U5XA 5A32A 1ZRIA 4Q0SA 5GZEA 1W6QB 3DPRB 1WW7A 2WR9A 2DUPA 4FQ4A 1S0IA 3MIDA 4EN9B 1REDA 3WP3A 4ET7A 4AHYA 5ACA1 1EUUA 3O12A 4PBPA 4N90A 2K0GA 3AFKA 4WM7B 3ZPOA 2A1XA 4E8DA 2JECA 2P6HA 4PI2A 4HLTA 2X10A 4RA0A 4GJYA 4D0QA 1MPXA 4TXWA 1COV3 1KDKA 1WLCA 1HQWA 1POV3 1OLQA 1BBT1 2XUMA 4QPGC 2WNVB 4CSWA 1ZBE3 1HJGA 3ZMNA 4WZCA 4Y1XA 1ODNA 5AVPA 1BBT2 2Y6KA 3JQWA 2EXHA 3E5UA 2ZEWA 4E2SA 4N43B 3THCA 1G7YA 4BQ3A 4XUPA 3IAPA 1CAVB 4UW4A 5FBZA 2JDYA 2RDRA 3CU7A 4YARA 4XAEA 5BNPB 1PX3A 3AB0A 3UV9A 4QPIA 3LSEA 5CFCA 3MFAA 2R7EB 3H9AA 1I6XA 4UT5A 4XIOA 1LODA 2GZWA 5F2WA 5EYYA 2YB7A 2A70A 4CDXC 2ZZQA 3NNGA 4KQ7A 5F2SA 2CDPA 5E88A 4AHWA 2Q1MA 1MEC1 3GHNA 2BNOA 1K5MA 1FX5A 3T08A 5ACA3 3DL3A 1RTVA 4RR3B 1Y43B 3V0BB 4QX1A 2VOKA 3J26N 1DLLA 2XMLA 5DUWA 3M3OA 3AVRA 2D43A 2VH9A 3LSDA 5A3MA 2WSUA 3GZAA 1QH6A 4PIZA 2ZPXA 2WO2A 2I45A 4GULA 4IERA 1BBT3 4CPBD 2CGPA 3OBRA 4QQHA 3ZSKA 1FNZA 4Q0UA 1KQRA 4ARXA 5J7MA 4OLLA 4HN0A 2GNDA 1L7LA 3LDKA 2R49A 4PI0A 4AEDA 1OHFA 4WVVA 4L2NA 2XQXA 3DKQA 2GH2A 1GNYA 1D2SA 4I2OA 2VXJA 3AZZA 3I3BA 1POQA 4NO4A 1ULPA 1W9SA 1NZIA 2BEOA 3ZSMA 5FQ0B 4AVVA 3E6CC 1EAH1 2BU9A 3UGHA 4I0WB 2PHWA 4JGYA 2FDIA 2JDAA 2W68A 2VMFA 2L9LA 2V5YA 4AFDA 1UY0A 1WLDA 4CEYB 5C5TA 1DZTA 1EAH2 2ZGLA 5FLJA 1QJX1 5LRSA 1MS9A 4OMCA 1WCKA 1WLTA 2AENA 3CF6E 4EZHA 2QQPA 1O3RA 2YC4A 5DZGA 4E4SA 2FDKA 1MEC3 1DDLA 2BFUL 1QJX2 2BGCA 1IPJA 1YEWA 5JIUA 5H9RA 1F31A 3IDEA 1XQNA 5DAQA 4DRRA 1F15A 1GNZA 5CEHA 2ZJCA 1J58A 3H1MA 1V9U1 3HJRA 2DF7A 3IWZA 5GM0A 3KQRA 4JGZB 1UY2A 1OA3A 1OPOA 1UU5A 3DN7A 4A42A 3N9MA 3TAYA 3KCYA 4UOJA 1V9U2 2ZHNA 2ZBJA 4LBNA 4FTBA 1ZRDA 2ARBA 1X33A 3C7OA 5EXOA 4JQTA 1UL9A 1MZ5A 4P9XA 3O1MA 4O7XA 3LIGA 4S2DA 5FP8A 3W9AA 1F5JA 1OH3A 3IN9A 1BKZA 2WNOA 3AP9A 1VRBA 2JIJA 4M3CA 4DIQA 5FO8B 4QDQA 2CNAA 3V65A 2DBNA 2JKBA 1LESA 3MW2A 4E2GA 5IK5A 1ULOA 5FR3A 1EAH3 1LHWA 1X8MA 2BWAA 3ZSEA 4ZU5A 1FMD1 1AYN1 4RQPB 5AFEA 1AUYA 3VBFA 1IZ3A 5FMOL 2JE8A 2WA4A 1LHNA 3CHXA 4LHLA 4E4DX 2WT2A 1GICA 1QJX3 3AKTA 2RS32 4Q2FA 5FZ0A 3BCWA 3WCRA 1H6YA 4K20A 1XBFA 3WDYA 3PU8A 4QX8A 1GR3A 4WM7C 4DPNA 3WV6A 1K3IA 4IEYA 5FZEA 1PM7A 2ZXQA 1S0FA 3LGRA 3S7EA 1YC61 4A44A 5C8WA 1GWMA 2DFBA 2XWBB 1V9U3 4PDWB 2A75A 2QVSB 2R072 2UWCA 1OH4A 4PT6A 4LJHA 1J59A 2F17A 3VBOA 4K1ZA 3ZXFA 2WNVC 3KV9A 2CTVA 3EB7A 4RS5B 5FK7A 3VBUB 4BXSV 1XC6A 2BBAA 2J1SA 5BNNC 1V6IA 4Q8KA 2XQRA 1VALA 1AYM1 1JU3A 1OPMA 1RUG1 3MW4A 4K9SA 4C91A 2IXHA 2FZ1A 3HAGA 2ZEZA 4Q4X1 4W6WA 4YM3A 1C57A 3K2OA 3K46A 3SHRA 4A7KA 1AYM2 1CAUB 1RUG2 3WF4A 3N4MA 1HLCA 1IS6A 5BNPC 3H7JA 1GWLA 4GH4B 2W3JA 2VCCA 1JXNA 2C5DA 2OUJA 4QT6A 1FMD3 1YLLA 1AYN3 2RS33 3A4UA 2OKXA 5D8AC 2AUYA 4Q1RA 4CPBA 1LOAA 2GN7A 1SMVA 3VDDA 2NMNA 2PQSA 1UN1A 2QDRA 3ZYGA 1LKNA 1DQ5A 4FP2A 4IEWA 5FZ4A 2GC2A 2H6CA 1BZWA 4CP9A 2E7TA 5GLWA 4P9GA 2PHLA 3APBA 3DYOA 3BPZA 4RR3C 4CCMA 3EHKA 4IE5A 4L8QA 4LO4B 1GP4A 1WMXA 2QJVA 1AR61 5F32A 3WG2A 4I3PA 5A3UA 1ULFA 4LO6B 3K77A 1GLHA 2GDFA 1W6OA 3ES4A 1AR62 5CFDA 1H8TA 4YZ3A 1ZZ8A 2YDEA 1H2KA 1LOBA 1TQ5A 3IAQA 1UX7A 5J09A 4FPJA 3V0AA 1AYM3 1RUG3 2YMZA 1OA4A 3PVEA 4XJ8A 2RR12 4Q4X3 1AHSA 3S5AA 3WDTA 3LFMA 1YIPA 2DDUA 4CDWB 1IQAA 4WM8A 2C4XA 2WS91 3BGAA 4FO9A 2C6SA 3TBDA 5FAXA 4FOQA 4OULA 1D4M1 3GHMA 2WN3A 2Y26A 2DCTA 4CEYC 2TBVA 4DFSA 1HN0A 4MGYE 2WS92 4LE4A 4AF9A 2P3IA 5BUVA 1RINA 3WOGA 1JYVA 3DPRA 1OUXA 3T2TA 4AHXA 1O3TA 3SEPA 2YBPA 4J1XA 1SPPB 3KB5A 4FP3A 4XQ4A 3BUCA 1UO9A 1JYTA 3NQHA 4QQOA 1OMIA 2EIEA 1LOFC 5FCCA 1LHUA 3GZUC 1CAWA 3ZX7A 1AR63 3H3ZA 4JDOA 4LE3A 4SLIA 2ZGPA 4OHWA 3T1MA 4MZUA 4LT5A 4RN5A 4FFHA 3IIIA 3H1WA 3LCPA 1US3A 3VZLA 4ES9A 3WG4A 4YWAA 2XJQA 4AQ2A 3BKZA 1T6GC 5B4NA 3AMHA 4NHYA 1QJFA 1H6XA 4BMBA 2D44A 2ZX4A 3NKTA 1CAVA 3P6BA 4LHNA 3WW4A 2FD8A 2WS93 5A7WB 2CV6A 2JDMA 1RUI1 4LBKA 5GLTA 5C4WC 1VJ2A 1D4M3 3NJVA 5JPMB 4NROA 2UYAA 4Q4V1 3PUAA 3UK9A 4ONUA 3DUIA 2DURA 3IMNA 2FDGA 4CCOA 3AZWA 1RUI2 4IV3B 2D5FA 5FP4A 4NAOA 1E5SA 4KH9A 3AYAA 4YRDA 3PU3A 4BLIA 3LPFA 3ILNA 1UX6A 2LROA 4Q4V2 4LBQB 2AREA 2VULA 1VR3A 1FAYA 3HBKA 4NRMA 4DQAA 5DMYA 3IMMA 1OOPA 4TN7A 5AC92 4QHOA 2B42B 5C3QA 4AAXA 4HSJA 5C8CA 4EN0A 4PDWC 3RNSA 1BCXA 1U5IA 4LKSA 5IVBA 3ZR5A 3GGLA 1R1A2 3MW3A 3FZ3A 2IXKA 4ZU4A 4D94A 3ROUA 3VBUC 4DNYA 3JD71 3OY8A 4NIIA 3ZYHA 4GJZA 1QY4A 4BIFA 4I30A 4MX3A 5C9AB 2YC2A 3ZKYA 4A41A 4BXFA 2VQAA 4LORA 4YZ1A 1IGOA 5J36A 4YVWC 4FQZA 4QX3A 4MHRA 1W9YA 1O91A 4O61A 2WL1A 3Q8AA 2XHKA 1WWYA 1EUTA 1OQDA 1RUI3 3AK0A 2VVDA 3RI9A 4XFCA 3VDAA 3SH4A 4Q4V3 2PELA 2DBIA 4YZ4A 2GU9A 5EZWA 3RZHA 4IL7A 3WLUA 4RGAA 2JENA 2PHXA 2A6YA 2HJIA 5FZOA 4XFIA 2BNNA 2J1TA 3FBMA 3NNLA 5GLZA 1W9WA 5K4LA 1YHFA 5LEJA 3K48A 4JV4A 1BMV1 4G4FA 1O8PA 1RUD1 3D0JA 3E5XA 1Q5OA 2Y0IA 4XIKA 5CKMA 1C8NA 2D6NA 1KJLA 1ND2A 2EALA 3ZIXA 1RUD2 1VBD1 1PNFA 4LMFA 5CIRA 5FWJA 2ILMA 4QB2A 3W20A 2FDJA 3ILFA 2WDBA 3JUUA 4UW6A 1KFXL 2LALA 3JD73 1VBD2 4C1XA 2X8KA 3PMEA 2F4PA 1V6NA 3LA2A 1DHKB 4IESA 5IK7A 3PUHA 3CQOA 3N9OA 2FMDA 1L3JA 3UL2A 4AOCA 5L7OB 2XOMA 4G3YC 2R32A 4ZZ5A 2GMPA 1DYOA 3BTXA 1OXCA 1YQCA 2BOIA 4QAWA 2GALA 1YWKA 3N9LA 4I01A 4QGNA 5BNOA 1ASJ2 4EN7B 4QKNA 2ZGMA 4MGKE 4Y22B 3ASIA 5I0TA 4AK3A 1WD3A 2E7AA 1GMMA 1WCQA 2GMMA 4HK9A 5E89A 1IKPA 5F8PA 1UWWA 5E6HA 2CSGA 4XILA 3TEXA 1CVNA 1OURA 4ZZ8A 2VW0A 1RUD3 1WBFA 1ZRFA 5JLVA 3RYPA 3PUIA 1ST8A 3MUY1 4O9EA 5JZGA 1QHDA 3OSDA 1BYHA 4DUXA 2BRTA 1W6PA 1VBD3 5FZDA 1V6OA 1YIFA 5A32B 1A78A 4QM8A 4XBNA 2K2SA 3DYPA 1KITA 4FPYA 1NUKA 2FCUA 5JUVA 1UYZA 1LEMA 2BQPA 4R9AA 3BTZA 5AFBA 2BZDA 1N3PA 4LBQD 1NE4A 3UNPA 3WT3A 5K0UC 3N9QA 2IC1A 1CAUA 2GSYA 2RJKA 1CIWA 4X6QB 2QCSB 5F37A 2O14A 1ASJ3 4YM1A 1W8HA 1W9FA 2R6QA 4LUKA 3RFRA 1SZBA 2D40A 3VKFC 4HONA 2GC1A 1RUE1 2YU2A 1O3SA 4BISA 5FZ7A 4Z92B 4P9JA 4LTAA 4XQDA 2VUDA 3N3HA 3NJZA 4YGEA 3LQCA 1YI7A 1ZA4A 4KG8A 3H8RA 3KT4A 4PIYA 4R9BA 3SKVA 3RWNA 3JZVA 3X29B 2ZACA 1C8M1 5IT6A 1J3QA 3SMHA 5CZKA 3ES1A 3OBZA 1UKGA 4FTEA 4XFHA 2JEMA 5CFCB 2WC2A 2A6WA 3AYDA 3MHZA 4A7YA 1C8M2 4QQPA 3EO6A 4CDUA 2OPKA 3LB9A 3TYJA 4A45A 5EYXA 2OW4A 4KBZA 2JB4A 3T4HB 2CYFA 4FPGA 4Q0VA 4BPZA 4Q5OA 1QJY2 4YYOA 1PK6A 2WLPA 3VL8A 4B4RA 2Y6GA 4DEVA 2YFUA 5I0DA 5EV7A 5KC6A 2HYKA 5JWPA 4UW3A 3AP5A 4CDWA 5FMCA 4RD7A 2ZX1A 4XBQA 1HRI1 5FYYA 3MZHA 1JUIA 3ZFGB 4WZFA 4D7TA 1KFUL 2R0FA 3MV01 5FBJA 4AZZA 3CJIC 1JZ7A 4QB1A 4AHZA 3A0KA 3KGZA 5F6KA 4FPOB 3KCXA 1RUOA 1RGSA 1HRI2 2WKKA 2ZGNA 3KSCA 3OCPA 4AVCA 1DYKA 2ARXA 4I0AA 2WLQA 1MQTA 3UJOA 1RUE3 2LTNA 4LK6A 1RUC1 5DAXA 4AEDB 3ZYRA 5LA9A 3VD5A 2P17A 4GD4A 3KF5A 4YM2A 5A3NA 1FI2A 2WA3A 2R041 2CL2A 1OVSA 3AMNA 1C8M3 4FPFA 2E9QA 5FLIA 1RUC2 5J96B 3ZYIB 3OD0A 2ZX2A 3USUA 3PJYA 5HCHA 1DBNA 1HB1A 5DG2A 1NLRA 3M3CA 2DVBA 1WMEA 2J1EA 1W04A 4JGYB 2QQVA 4LUMA 3OPZA 4NOTA 4R9DA 1K12A 1ZREA 2D3RA 1EV12 2EXKA 1QWRA 3CZUA 4RFRB 5GZGA 4BQ4A 4QX7A 4F8AA 1GV9A 1XYPA 2DCJA 3TNQA 5J1XA 4W8JA 3FHAA 3ZFEA 1QJEA 1HRI3 1W0NA 1KRIA 5L7OC 1IHMA 5G05L 1W2UA 3ABZA 5FZMA 4URAA 1AR91 3KV4A 4HPKB 1X36A 3LKJA 3AL6A 1YFYA 4XC9A 3POBA 1DFQA 1V6MA 3HQRA 1S4CA 3FX3A 4INDA 2WFPA 1I5PA 1AR92 1BJQA 3DF0A 3HD8B 2EIDA 4U36A 1RUC3 3ZN5A 1IKQA 4CXXA 4W50A 1B35C 3M2MA 3GDBA 1X50A 2VVFA 4XEZA 1YYNA 3SH3A 4MG2A 1C3HA 1XOYA 1EYBA 2D5HA 2LW8A 2R043 1AL21 1JHNA 4M3CB 1G9DA 1R091 5JR2A 2XJVA 1W2NA 2IXJA 1PMIA 1N1VA 1W90A 4OI2A 1LRHA 5EIYB 2KXLA 4GWJA 4OHZA 1ZVFA 2PHUA 1VBC1 5T50A 3VBFB 4V1PA 1R092 3FLRA 2JDUA 1LHOA 4K6BA 3WG3A 5KHJA 5JSOA 1NCRB 2R16A 5FKBA 5C9AA 1DGWX 3I2HA 2XJTA 5IUQA 2RS11 5JOXA 4JKLA 2DUQA 1WW5A 3DGTA 4YG0A 1JODA 1SACA 5T54A 1SLLA 3AZXA 2Z5WA 2ZA9A 1X7NA 4HOOA 2A3YA 1UMZA 3ITQA 1AXZA 1VRH1 4BH9A 1P8JA 3W21A 2KD7A 4G9SB 4QKBA 5A6QA 4NPMA 1AR93 3HVDA 5KHIA 3VBOB 1W06A 2JE7A 4YW4A 4NWVA 2QQUA 2Y64A 4Q4W1 4UXAA 3U78A 3BTYA 1GQPA 1TNRA 3ZYFA 1NG0A 2P4EA 5FY8A 5C3OA 4ZS3A 2E7QA 1R082 4NIGA 2C9KA 4H7LA 4UWDA 1NZCA 4B8EA 1DF0A 5JIAA 3WCSA 4D7SA 1AL23 4LULA 1R093 5FPZA 4R9CA 5CFCC 3M3EA 2YYOA 4QPIC 1GU3A 3RJRA 4C0HA 3VBHB 3T30A 3PDQA 4EN8B 2WO7A 4XJUA 1VAKA 3ATGA 2F4LA 1NCQC 1ULEA 3HQXA 3IDCB 1BK0A 1JI6A 2WAOA 4NR1A 5HXVA 3VDDB 1OC1A 2ARAA 2WZR1 2YZ4A 1QNWA 4CP9B 2RS13 1K5MC 1YO8A 1GQHA 1O5UA 4FPEA 3AP6A 1SLAA 4ZKTB 1JYCA 3O1RA 1RUJ1 1LB2A 4NVPA 1RITA 3VHPA 5DAWA 3H8XA 1VRH3 2XWJB 4CCEA 3CEWA 1T6BX 4CUCA 2DU1A 1W6OB 3UETA 3TN91 2ZEYA 4OHYA 1H8TB 1YXWA 1RXGA 2VE1A 4Q26A 2H0BA 4Y22A 4Q4W3 5KHHA 3T2OA 3WNNA 4C90A 2EXJA 2GN3A 4AEDC 4AVTA 3TN92 4DUWA 1D0GA 3ACFA 4P08A 3ZSLA 3GBGA 4QXBA 4WM8B 1OF3A 2B8MA 2XPJA 1DP0A 4Y20B 2QBXA 1ZBA1 1Y9GA 1W2AX 3RZZA 2JICA 2UWAA 4XYXA 3ME2A 4AFBA 3MI8A 4H14A 1A8MA 2PN5A 3I7DA 4YGCA 3RDIA 5LEKA 2CGOA 5LY1A 4LIUA 4W6XA 4M4RA 3PTYA 3BN6A 4BA6A 1MVEA 1ZBA2 3KV5A 3GZEA 4XF0A 5JVVA 4BLJA 4ES8A 4M3CF 1TG7A 4M0NA 1O3QA 4IE7A 2UYBA 2J22A 3MDPA 2FZ2A 2WZR3 2Q8OA 2LS6A 4LK7A 5I0RA 1OD5A 4KMQA 2ORZA 2ZGSA 4B7EA 2JE9A 4NE9A 3ALQA 4F83A 5ACA2 3M1HA 5JXJA 1CAWB 4LO8A 1U5YA 2Q1FA 2FMYA 3WR0A 3ZKUA 2X5IA 2BTVC 2Q8CA 4COUA 5A3OA 3TN93 5KXCA 3P3PA 1XU2A 5FFOC 3JXSA 2QQMA 3AZVA 3NJYA 3VBRB 1CN1A 2DFCA 4D7YA 1S1AA 5JPNB 4MADA 4IEXA 1QXPA 2BVVA 4KL1A 4F7ZA 2VUAA 2VW1A 3ZN4A 2EF6A 1F5FA 5FMOS 1PNGA 2W39A 4XDPA 3SNMA 2I74A 5KXDA 5DAVA 2OZJA 1ZBA3 2WFF1 4XJ9A 2VMIA 2IFRA 3VBFC 3RRDA 4LOSA 3IKWA 5FYUA 2JIGA 1NAEA 2WFF2 1UYYA 3IDBB 2VZQA 4CDQA 4GMP0 2A7AA 3ENRA 2D7FA 3J7MA 4XCAA 1W8WA 3PIJA 4YM0A 2NM1A 4EROA 4C1WA 4DMIA 5FREA 3BU0A 2JG8B 1OI6A 1CJDA 5G04L 4QXKA 1PMHX 1OOPB 2KM2A 1MEC2 2VZ3A 1NY71 3C7HA 3KMHA 3AM2A 4IGPA 4L97A 5CYYA 3ZFGA 3RJ2X 1JOJA 1QQP1 2CWMA 2D6LX 5C8CB 3VKNA 3HT1A 3CDZB 3K4AA 1OFNA 4HANA 4CUGA 2VQ0A 4CCKA 3EBRA 4P9IA 4UBGA 5FYIA 4AE2A 4DZGA 3VBOC 4KU8A 2PHTA 4E4ZA 4XTMA 2P3KA 1BVVA 2UY8A 4XVHA 1K42A 5ANQA 5KXBA 4PCRA 3OY8B 1ENXA 3TEYA 2MNGA 3EXUA 3NW4A 3RMYA 5EFUA 2W2IA 1D2QA 4H2AA 3SXWA 2YBSA 3O1UA 4AEKA 1QKQA 2V4AA 3U14A 3JB8A 2VM9A 4CCDA 3MIBA 4NHXA 4IQPA 1VIWB 3B01A 1QXJA 2Z79A 4KWUA 4BMEA 5IHRA 1SBFA 4IDZA 5FPAA 3WDWA 1DCSA 2B45X 2WFF3 3FMGA 4BIOA 3FWEA 4YVSB 5JMOA 3AVSA 5LASA 2W5FA 4AI3A 4E8CA 3VKOA 4TZDA 3F2ZA 3NJXA 3U11A 3PJQA 3I2KA 2B9UA 4NMIA 1J3RA 1LULA 3AMPA 4YW5A 1UZYA 3AMMA 4RGKA 5FZOB 3E5QA 5FTTC 4XMAA 1WA6X 2NMOA 4N7UA 5JI7A 1ACCA 1MS8A 4FAHA 1CGPA 2CWSA 2HWB1 4LR4A 1Q56A 4UYBA 1DGRN 5IVYA 3POGA 2UWBA 2A6ZA 2VAUA 3H0OA 1MR5A 1U12A 4K40A 2XVLA 1H2MA 2XKOA 1ND2B 3PVOA 4HPKA 1QOTA 2HWB2 1G86A 1CQ9A 2BVBA 1RC6A 2WJSA 1NQJA 3H3UA 5CFDC 1H8TC 3LOIA 5T52A 4QPWA 3I2DA 3OBTA 1QOSA 1VPHA 5EQUA 1KD7A 2MEV1 3I59A 5BPXA 4PLOA 4CUBA 5A6ZA 3OOXA 1GFF2 3C8XA 4HN1A 5FZAA 5FO9B 4A7ZA 2MEV2 1S2EA 1UMIA 5C6CA 1W8NA 2JX9A 2IFWA 1HW5A 3PMSA 2Y34A 2E51A 3OGGA 3IDAA 3ZXLA 2W47A 1V00A 2ZKNA 4XCBA 4MGTA 2YGLA 4FCAA 1EY2A 3H3LA 5BNOB 1NCRA 4EQVA 4MHUA 4Z8BA 1FMD2 1LR5A 1AYN2 3D6EA 3GBFA 3DPRC 3GBWA 2JD9A 4QQ2A 5BYNA 2XJSA 4J1WA 2AC1A 2W1SA 4QU1A 4U2AA 4MGIE 4LBMA 2E26A 4I02A 2DV9A 4IE6A 4Q8LA 4NIHA 1CD3G 4X6RB 4A4AA 3RS6A 5JSRA 3MFCA 3H8OA 2HWB3 1R64A 4JHTA 1TME1 3WDVA 3U4XA 3BTAA 2Y8KA 3M3QA 3I97A 4K3UA 2WZ8A 5JZGB 4NIAA 5I91A 5FIXA 3Q9OA 1SDWA 1W6PB 4XF1A 3N7MA 1UU4A 4CDXA 3A21A 1FV2A 2ZMLA 2XL9A 1PM4A 4XXPA 5IFTA 2MEV3 1WGPA 3WNMA 2W46A 2JG9B 4JDMA 2FDFA 4JRLA 4RHV1 1E5HA 1AXYA 3NO8A 4N43C 1AJOA 3AMQA 4Q29A 1DGWA 4P9LA 3T4VA 4DOUA 5L36A 4MVTA 5J37A 3IT8A 4Q4X2 4K1YA 5CKQA 4PBOA 1YFWA 3K4ZA 4RHV2 5F39A 1GOFA 3VBHA 1S55A 1GYKA 2PMWB 3RWKX 3ZYBA 1WCUA 1VB4A 4FI9A 1CAXB 1JHJA 3CO2A 1T2XA 2Q1ZB 4QDSA 4GIQA 4A3XA 4BQYA 3WNXA 5FYSA 2XG3A 2OYZA 5HXMA 4IE0A 2EIBA 1GUIA 4GKYA 5FPLA 2CDOA 5FZHA 4FOWA 1OOPC 1XYNA 3S30A 1H2LA 2AEYA 4OQ8A 1UZWA 2A6XA 4ASMB 2V09A 5A7OA 3T0DA 2Y60A 3WDUA 1QJU1 2VMEA 5C8CC 4ISRA 5I8YA 2XLFA 3ILRA 1CJPA 4CDUB 4FSJA 4C0BA 1I1EA 3AP4A 1I3HA 4PLNA 1POV0 3PHMA 4NN0A 5FZ1A 5BXXA 1A34A 1QJU2 2HYXA 2ZX0A 1QJZA 4QWNA 4BQ2A 1Y9QA 5EWSA 1REEA 3WINE 1PK6B 3R6SA 2VZ1A 2EXIA 2RS51 3L2YA 4GA9A 1JYIA 2OQ6A 4QGMA 1JYXA 2XLAA 4RHV3 4XJWA 4UFKA 3U1XA 3KCCA 1ZZ9A 1W2TA 2ZABA 1DZQA 3P5BA 4K8RB 3T09A 3KVAA 5I0SA 3MYXA 2RS52 3O7OA 2RM21 4Y20A 3WF3A 2HWF1 1JW6A 2ATFA 3SCGA 1WLWA 3POFA 5IVVA 2ZX3A 3H50A 3J7HA 2RM22 2MPFA 2BPA2 4JAAA 2HWF2 1MQTB 2B7YA 1AX2A 1D4M2 2Q4SA 4MXWA 4Y3OA 3ZFFB 5IVCA 1SLTA 1W03A 2WAAA 3VZJA 1GNHA 4CEWB 1N3QA 1OLRA 5JMCA 5FK8A 4OI1A 3RZLA 3LPGA 3MF6A 2QDNA 1SG3A 5A7QA 1W8TA 1UPIA 4ORFA 3VBSA 3USUB 5HCAA 4JGZC 5C70A 3VD3A 1QJU3 1UU6A 3VHRA 3VHOA 1ND2C 2BV4A 2NYYA 1H9WA 5C71A 1LU1A 4LEJA 1MS1A 1ZZ7A 1HB3A 3MLKA 4XUTA 3PLQA 1LNSA 3VBRA 4XDQA 4Y33A 1SCRA 3IM0A 3ACLA 5DABA 1A3KA 3A23A 4XHBA 4JCKA 5IAVA 2RS53 2C0ZA 2GNMA 2VUJA 5FZ6A 3FHQA 5JXIA 2VG9A 1JZ4A 3QBQA 3VD7A 3SEEA 2BBVA 2BERA 4Z07A 3NWKA 1XYOA 4LKFA 2JXAA 1KS5A 3ZFEB 1CIYA 2AR6A 2RM23 2HWF3 4Q1PA 3B69A 4META 4DUVA 1JN2P 1SFNA 2BGOA 4RQPC 1ENRA 4MSVA 2A71A 2EAAA 5F3IA 5IVFA 1HKDA 1MACA 3NL1A 1YCIA 1XSQA 1FXZA 1UY3A 2FBEA 1N1SA 5LBBA 2B4KA 3HOBA 3KQ4B 4QHZA 1ZZCA 2XONA 1LGCA 4TWTA 3B00A 1IG0A 1NA1B 2QKDA 4YFWA 3C2UA 3EQEA 2GMEA 1X8EA 4ISQA 2JG8A 1XE8A 2LUWA 5FKCA 5DXDA 3CJXA 5DUXA 3WW2A 5LK7B 4ZHNA 3O1PA 1WMDA 2ZKLA 1AX1A 1SLBA 2ET1A 4XF9A 1NKGA 4ASKA 3BPSA 3FBYA 1HDKA 1YI9A 4CRQA 1PZ7A 4H3WA 5JZGC 4IV1B 1L7QA 1UOFA 4IEUA 4UFMA 4LOTA 1DQ0A 1KDMA 2J42A 4IGQA 4RS5C 4BZ4A 1IPSA 2W1QA 3CKHA 3WSOA 5FYZA 3R4SA 3VN4A 3WQ7A 1G9AA 1BK1A 4FPLA 2I07B 3OGVA 2W92A 3OTFA 4LXLA 4XJAA 5FMBA 3R05A 2VMHA 3KD4A 2BUKA 4QM9A 2GNBA 1HB4A 2OXBA 3JD72 2HWD1 5A3LA 2BNMA 3S0MA 5H9PA 1O4YA 1ZZBA 1IS4A 2BOJA 2E6VA 2ET7A 3GCXA 1ND3B 3UYJA 3VB9A 1S0CA 5C3SA 4XUOA 1WW4A 2ORXA 4YW3A 4GH4C 2W91A 4IGOA 4QQLA 1WCSA 3HN1A 4LBJA 3J7LA 1ZA7A 3O0VA 4MYEA 4YVSA 3VGIA 4IXLA 2OVUA 3OG2A 1MVQA 1LOCA 5CNAA 2QUOA 1GZ9A 1QXRA 2IZWA 1UIJA 1PO21 3NRUA 4QU2A 3FUOA 5F5CA 3IB3A 3POWA 5ISLA 1G9FA 4DB5A 5GZCA 1UZ0A 3ACHA 2QTWB 3FHIB 1PO22 3MLJA 4P02B 3T3YA 4ASLA 1GZWB 2VMDA 3J8F1 3CZJA 2RMU1 4M0HA 2C24A 4W65A 1CR7A 4XUNA 1OBNA 2VZUA 2YROA 2QZ2A 3MV11 1BMV2 3NV4A 4UF0B 5FZ8A 4LPLA 4KBBA 1SBDA 1TVGA 3DKWA 3NV2A 3ZXGA 1JYWA 2RMU2 3I8TA 3R0RA 2YXSA 1FV3A 5T3NA 3I3DA 1XU1A 1PGW1 1V6JA 1PK6C 2W52A 1AXKA 3BU7A 4XFGA 4I3GA 3VLBB 1PMJX 1PVXA 3N7LA 5FYCA 4AVSA 5JOWA 2Q0AA 3N7KA 2XDVA 2QZ3A 2PLV1 2XLGA 4P9WA 4CZSA 1RIRA 1PGW2 2HWD3 4PF1A 4CDWC 1F4HA 4SBVA 5CG8A 3S6PA 2Y38A 3AL5A 3NNJA 4AGRA 1JZ5A 3QCWA 1ALYA 3T1LA 1OFSA 3HBZA 3B94A 4ZY9A 3ZYPA 4CA9A 4AI0A 4EWEA 2VNRA 3HQUA 1DZRA 1LEDA 3MO4A 3MF9A 4KWLA 4AR2A 1X9TA 1ZRRA 2ADEA 1MQTC 1CPNA 3F95A 5FYMA 4E27A 2AACA 3IIAA 5JI9A 3I2IA 1PO23 5FLHA 4Y5Z0 1K5JA 4XAAA 1OKOA 1UZZA 2ES3A 4HFSA 1O7FA 4JZRA 1OLME 2VMGA 2DYCA 4IW3A 5D2AA 4CU6A 3J8F3 3ORJA 2YPJA 1GQGA 3MICA 3ZSJA 5BNQA 2CAVA 3AFGA 3NNFA 2RMU3 4FFIA 2ZHKA 2JD4A 1FYUA 1Q8SA 2CAUA 3NVCA 4IEOA 5GZFA 4KU7A 5C4WA 4DS0A 5FY1A 3LDBA 4A6OA 3NAPA 1UAIA 5LATA 4XF4A 2W95A 4OI0A 4KG0A 2VBBA 2WNEA 1HQLA 4XABA 3WP5A 3HNBM 2JG9A 2X53S 2YV8A 3IZOA 3HNYM 1DQ2A 1D0HA 5F3EA 4TLGA 2PLV3 3CBNA 1C5IA 1KS4A 4H55A 4AI8A 4AVAA 2XJRA 5ABJB 5A33A 4FPHA 1ULDA 3ZFEC 3C3VA 2IXCA 2YU1A 1C1LA 5FOBB 5JSPA 5L9BA 2YC0A 2JKXA 2X5IB 1CAXA 3LIHA 1AJKA 3KGLA 2VC9A 1HB2A 4IV3C 1VP6A 1W0PA 5H9SA 3CL1A 4D3WA 4PQ9A 1RUE2 1XNDA 1GANA 4N8MA 2P3YA 1HV0A 3RQ0A 4UAPA 2VZRA 4AEMA 2OIIA 3D82A 2HEWF 3B9CA 4HXCA 4K21A 3LE0A 2CY6A 2TUNA 3OUIA 1XSRA 5EJ1B 1U0AA 1H8VA 1WMFA 5DN2A 4N53B 3U4SA 1PGSA 4HK8A 3SISA 4L92A 4CU8A 5FPXA 1JH5A 2GNTA 5E8AA 3JQXA 5LY2A 2FQPA 5C9AC 1I5ZA 4CDQB 5L9VA 1LENA 2IXLA 4DXZA 3OYWA 2ERFA 3KWVA 4EN6B 3LF7A 2DVDA 2LM3A 3VL9A 3BOWA 1KGYA 4QKFA 4R4XA 1WUVA 1WA4A 5LZ6A 2TEPA 4QX0A 1DGRA 4KWKA 1OA2A 3C7EA 5IW0A 2RJ2A 4COWA 3FFZA 2QFEA 3GNEA 2JDHA 4XDOA 3ZFFA 4CTEA 4MXVA 4A6SA 1OD3A 4CEWA 3WF2A 3ZR6A 2W1WA 4RFT0 1Q8VA 3Q8BA 2VQTA 4GALA 4B4QA 1Y9MA 1LGNA 2YY1A 3B7MA 5BY5A 5IK8A 2OQ7A 2IXIA 3OPTA 4Z2AA 1VAMA 1F9KA 2VTFA 5CBLA 3AP7A 2XGXA 2VZTA 1WW6A 2R042 3W5MA 4COYA 3P1IA 2AYHA 2OPWA 3E6DA 3WX5A 4DXSA 4XOGA 2AGSA 1VBA1 1JUHA 2J1AA 2XH6A 4BB3A 1HV1A 1PIV1 5GALA 3GJAA 1AX0A 5IAXA 3LA3A 2PTMA 1J3PA 3E97A 1VBA2 5EPAA 3U75A 3D3AA 3Q8EA 4MGQA 4YPJA 2WNUB 1F35A 5FZLA 5L73A 2PFWA 1PVC1 1V0AA 1OQEA 2VY0A 1VMHA 1H30A 3N36A 4QHBA 2QQNA 5FYHA 4AQTA 4NIDA 3URFA 4PQQA 5C33A 4HKLA 1BXHA 2ZEXA 1OSGA 1PVC2 4MO3M 5IWFA 2VVEA 4AGVA 4CCLA 3I2OA 4OI4A 5CG9A 1LAJA 4PHZA 4BQWA 4TTGA 5F6LB 5DPNA 3U0ZA 3I59B 1NA1A 1O5LA 2Z2SB 1YQ5A 2X09A 1MS5A 3DECA 3FN9A 1IQDC 2HBUA 1HN1A 4AL9A 2R0HA 1UXZA 1XNCA 1RUF1 4GZ9A 5T5OA 5HV4A 3GXUA 3ON7A 1DU3D 3ZDVA 2VQUA 2GAUA 5L9RA 4DXTA 4IV1A 3B02A 1RUF2 1AL22 4O9GA 1UCXA 4QPGB 1V6KA 1VBA3 1EPZA 2PYTA 5F3CA 1AVBA 5DDJ1 1PIV3 3OGJA 3H1YA 1OLMA 4AI1A 4HVQA 1H1MA 2X29A 1VBC2 4MUVA 3FLPA 3ZO0B 3PL0A 1ZRCA 1RHI1 4WVMA 3WVJA 2PXJA 1H4GA 3DXTA 1DGLA 4XZUG 1GP5A 5DDJ2 1J83A 5FYBA 1HRV1 1LECA 3PIGA 2YBKA 1ND3A 2RS12 1PVC3 3V56A 2RDQA 3DEMA 2MHFA 1W99A 5HCFA 1B09A 3T2PA 4XMIA 3QH7A 5LK5A 1V70A 2R061 3A7QA 4GQ7A 1CESA 4LNVA 2WZPP 1YJKA 2BYVE 2VNGA 3OB8A 4Y1ZA 3LDRA 2WQ4A 5E16A 5FZ9A 2VXRA 2X5IC 4NPLA 3R4UA 5C3RA 1VRH2 2WSVA 4CDXB 4NHKA 4KNCA 2ZGOA 1CX1A 1JTZX 2E33A 3RGBA 5APAA 1R1ZA 4Q4W2 3WNKA 4BM8A 3KLSA 1CONA 1MS0A 1GZWA 3WUDA 5LA2A 1RUF3 2IVIB 1DIWA 1JZ3A 3JU9A 4XFFA 1XNBA 2GC0A 2WWJA 3CJIA 4UF0A 3WHTA 1S0BA 1YJLA 1VBC3 1UF2C 3O0XA 3VV1A 2AZ5A 1EPWA 3HNMA 4JC1A 3ZN6A 4HZFA 3THTA 5DDJ3 1RJ8A 4N9IA 3OD4A 4DY5A 4NHLA 4CDQC 4GXLA 2XKPA 3O14A 1JYNA 3K4DA 4Y24A 4S2GA 3VDCA 1ODMA 2WZR2 3UKTA 1HRV3 4COVA 4HKWA 4HMZA 3ZFGC 3ZXKA 3SCFA 1HXS1 1OKQA 1TZOA 5GKAC 4EZ4A 3S5QA 2R063 1OUSA 3A22A 1RUJ2 1NYWA 4QXHA 1KXGA 1HXS2 1APNA 1QEXA 2WIIB 1FT9A 5LCWL 1OQ1A 3PUQA 1W9TA 2D93A 2JDNA 3K51A 4FPKA 3WF1A 4AWDA 4DY3A 2X05A 4LO7A 1AR81 3M4FA 1XB9A 2DVAA 4Y1UA 3BI3A 2H0VA 4OUSA 3LD8A 1LGBA 4MV2A 1UYXA 3MIHA 2ID4A 4XXAA 2DCKA 3O1TA 5A7NA 3ZOIA 2ARCA 4JGYC 2BFUS 2G9ZA 2RG4A 4QMAA 2WO3A 5C5UA 3KHBA 3P3NA 2HEVF 3POSA 1Y4WA 2A3XA 1URXA 5K7PA 4EWDA 4MXWB 1NLQA 5L19A 3DYMA 1RJ7A 4OHXA 4CU9A 3HPNA 3WQ0A 4O65A 4MH0E 4CP2A 1PGL2 2RDSA 4D6RA 1G8WA 3QACA 1GBGA 4BE3A 1TMF1 4FOVA 4YG3A 3T2QA 3USSA 4YZ2A 5ABJA 5FPUA 2VNVA 1UZVA 4OHVA 5FJKA 4DRVA 4EYUA 3TEWA 3FUQA 3RMXA 1RUJ3 3B3QE 4UFLA 3VBSB 3NV3A 1UOBA 2BP6A 1HXS3 1H9PA 4QKDA 5FRAA 2ZMKA 1TMF2 1US2A 1SDDB 1NXD1 1N3OA 2HLEA 3I2FA 4HVRA 3TNPB 2G9GA 2VOTA 4V2VA 3HIFA 2FDHA 5J48A 1H1AA 2VZOA 4W6YA 4HT1T 4RYDA 3KHCA 4F3JA 5BV6A 3RPQA 2XBO1 3AKQA 2Q8EA 3V64A 5FMDA 1AR83 2Y6LA 5FZKA 4BU2A 1H1IA 3HR9A 4BOWA 4HBNA 2VBPA 2XBO2 5FY9A 1ZNPA 4P5YA 4LA2A 3WQBA 1UNBA 2RVAA 4ITCA 1DQ1A 1Z7S1 3ZMOA 4N53A 3HT2A 1NCRC 3D8CA 4LA3A 3WNPA 5BNNB 5CAZA 2V4VA 5EP9A 4M4PA 1Z7S2 4ZONA 2HBTA 1AL0G 4LO5B 3WZ1A 4AQSA 3WG1A 4BDVB 2Y0OA 5JCTA 4CCNA 1TMF3 4LITA 4N7IA 5FWEA 4B1MA 3I2GA 5I8SA 1J84A 1NY72 1KJRA 1YQ8A 4XPVA 4XQWA 1UPSA 2VPVA 5D8AB 5FV3A 3IPVA 1QQP2 2W08A 3VZNA 5HI0A 1C28A 1NCQA 1O4ZA 1Y3TA 3CMGA 3GALA 5KR7A 4OMDA 2RV9A 3KV6A 5A6XA 4W4ZA 1W6NB 4QX5A 3PVNA 1UD1A 2Q5TA 2XBO3 3J4UH 4NJ4A 2SBAA 2VMCA 2G19A 3AJYA 5LRRA 3O1OA 5A3WA 3VD9A 3BYWA 3ACGA 1F4AA 2VL4A 1QH7A 1W3XA 4Y4RA 1UW8A 4CP1A 1QF3A 3ZXAC 4EV0A 3VBHC 4AFAA 1VBB1 3AXEA 4YW1A 5KXEA 2A73B 1Z7S3 2HWC1 2R30A 3NMBA 3PUSA 4HL0A 2GP3A 1C4RA 3ZXJA 3VDDC 3LWCA 3N35A 5KWRA 2WT0A 1XNTA 2VR4A 3WY6A 1VBB2 2OZ6A 4MOAA 5KC5A 2E32A 2HWC2 1BLZA 2WNUA 1O8SA 4FOYA 5FDBA 2ZTNA 1GSLA 1O4TA 3AKSA 1UMHA 5CKNA 3MLLA 2DTYA 1QIQA 2VJXA 4AG4A 5C3PA 4FTSA 1QQP3 3FFQA 2JDPA 3LEIA 4AI2A 2Y6JA 5F5AA 4Z1VA 2CU5A 1E5IA 2RHPA 3KM5A 2VO5A 5GLVA 5T5JA 3SC7X 1VBE1 3UT0A 4QXCA 3M3IA 5IVJA 3RZJA 3B5LB 3DXUA 4S2HA 1UKRA 4P00B 2VD7A 1VBE2 5A3TA 3K3NA 4FVVA 4K8FA 4Z82A 3WXPA 4WM8C 1W6MA 1AR71 2ZS6B 4E4HA 5A1LA 3BIEA 1CX4A 1W0OA 4QPGA 5LA0A 3OF1A 1VBB3 4HVOA 1AR72 2WQZC 2QNKA 2HWC3 3AJZA 4KGQA 4XE9A 1H4HA 3EYPA 4CXWA 2BJSA 3ELNA 2DTWA 1RVF1 2V5DA 3B93A 2D97A 5D21A 1QMJA 2C26A 4J25A 3VD4A 3UJQA 3ZYJB 4RL7A 5JOYA 5A80A 4OUMA 3ZPYA 2E53A 5HBAA 1LU2A 5IJRA 1RVF2 2VCBA 4M01A 2VOXA 3T0AA 1SBEA 1O59A 3VBSC 1MS4A 2EAKA 2JDKA 2ZAHA 4X8NA 1A8DA 3I4IA 5FY4A 5C4WB 2RS31 2K46A 3JCIA 1J1TA 4JHZA 5FY5A 1TME2 3I3QA 3JBG1 3NAPB 4YW2A 2W0XA 1VBE3 5HV0A 3VBRC 1UOJA 1ULGA 4RSUA 3H7YA 3JBG2 5FXXA 3O1SA 3AYCA 1CPMA 1YUDA 2R071 2WZEA 5FUNA 4FPCA 4RGGA 3RYKA 5A1FA 5A33B 1CZTA 4LLOA 4BWOA 1AR73 1UY1A 1UYPA 3AXDA 1LCLA 2LRPA 3W5NA 5I0UA 1S0GA 2GP5A 2VTXJ 4NHMA 4ZU7A 2XUEA 4P14A 3UESA 2YGMA 2HWE1 2P2KA 2VOVA 4IEZA 1RVF3 1W28A 5TSWA 1RMU1 2NQYA 1MZEA 2JG8C 4J6GA 4YVWB 2XB6C 2HWE2 2NLRA 3POEA 2BW8A 3M8LA 1RMU2 4QDRA 1MZ6A 1TME3 3POJA 2ZMNA 1W8UA 3WNLA 4B1LA 2PHDA 3NKGA 3WEZA 4D6QA 5T55A 1S2BA 4TLFA 3JBG3 3OGSA 5DUUA 1NLSA 3SH5A 2ZCWA 4FXGB 5JDBA 1JOBA 4XZPA 1DYPA 4Y1YA 5T5PA 3CNAA 4JQRA 3AX4A 3VZKA 3OYWB 2XXZA 5JR7B 5SV5A 5ERLA 4QD2A 2ZHMA 2R073 4V2WA
chains in the Genus database with same CATH topology
3WP4A 1BQPA 2B39A 4L11A 4PIXA 3FC0A 4Y4YA 5J98B 2V73A 4URTA 3E6BA 1VLNA 2EIGA 4YVSC 2VU9A 1AZDA 1H2NA 2RR11 2DCYA 4AYUA 1IPKA 2FHRA 1SCSA 4JTNA 4JDNA 2HWE3 4XFBA 1Y7BA 4N9HA 3SCHA 1BEV1 1U5ZA 2XJPA 2BWCA 1F8VA 1RMU3 4FT8A 4XFAA 1Q8OA 1ENQA 4COZA 3MEPA 1BEV2 5B2GB 3M70A 1FOD1 3R4DB 4KWJA 5D1IA 3M7AA 2PHFA 1FOD2 1W6QA 3INAA 5DG1A 3KT7A 3SLIA 3FE5A 4AQ6A 1PZ8A 3ST7A 4CP0A 1XRUA 5KBFA 4WM7A 2Z69A 1N1TA 2NN8A 5K9YA 2SLIA 5GZDA 1LJ7A 2DUOA 3TOJA 1NQDA 3QH6A 4YFZA 4ATFA 1NOVA 1REFA 4AW7A 5GLUA 4PLMA 1UIKA 2WNVA 2A3WA 1SEFA 5BNOC 5BNNA 1HIXA 2O0OA 2RR13 2Z42A 3EJKA 1RUNA 2C9AA 1ZX5A 1YRZA 1RB8G 1BEV3 4EJRA 3BOPA 3VZOA 4N43A 5K0UB 4MGZE 1X82A 4GWMA 2D6MA 5BNPA 2DCZA 1E57A 1TEIA 2NZ9A 4QPYA 1FOD3 2AH2A 5D8AA 5SV8A 3MGUA 4H7MA 3NSTA 3SITA 3NAPC 3MIGA 5AVAA 3WW1A 4UBHA 3D5OA 1W6NA 5AC91 4WVMB 2JG9C 3MIEA 4RR3A 2G9FA 3V0BA 3ZXEA 2NP0A 1R1A1 3JB4C 4B29A 4FBFA 5IK4A 5F9TA 2OA2A 4XF3A 3NV1A 4GB31 2HWD2 1D4VB 4ATEA 3POYA 4BHPA 1ENSA 2IWGB 4WBBA 3CLPA 1SQ4A 4GB32 2PA7A 3L2HA 4LBOA 2GH8A 1IOAA 4Q4Y1 4IEPA 5J3UA 1LOGA 4HSLA 3MPPG 4IETA 3ZXDA 5H9QA 2PQQA 3KZ4C 4Q4Y2 5FQ0A 4YGDA 3U10A 1NXMA 4BYYA 4K7JA 2WT1A 4LHKA 2R1BA 2DVGA 3CJIB 1ZYBA 3D4KA 3J8F2 4CDUC 4CEYA 4OZXA 3GF6A 2XVGA 4TSVA 3WQ1A 3ZN6B 1TE1B 4WVWA 5AC93 4P5HA 3VUOA 3FLTA 1HQNA 1LOFA 1NE6A 1WCDJ 1R1A3 3VHNA 4JGZA 2PLV2 1S2KA 1SLCA 4GB33 1DQ6A 5CVRA 3TWIA 5DZEA 4NPRA 2JDZA 1IS5A 4OVEA 2ZGRA 1QDCA 3BODA 3ZFFC 4YG6A 1BVP1 4CEWC 1ULCA 4Q4Y3 5DUVA 5CADA 2O8QA 1QOOA 3BALA 4GWNA 2CGNA 4AFMA 5E1RA 4DINB 2PAMA 2F6BA 1ASJ1 4AEJA 4RQPA 2NPIA 2VECA 2YHJA 3N7JA 2A6VA 3ZIWA 1DG6A 1S0EA 1RL3A 1SLIA 3FJSA 2HKXA 4XETA 2D3PA 4YNIA 2EVXA 4XW3A 4E2QA 1F2NA 1FNYA 3ECQA 1B35B 2ZZJA 3RI8A 4A2UA 5I93A 2H6BA 3KT1A 3LAGA 1QU0A 2DU0A 3WUCA 1Q43A 4PDWA 3PVBB 4Z2WA 4PJYA 1EP0A 2ENRA 4RS5A 1FATA 3VBUA 1I9RA 3UKVA 1VAVA 2VW2A 5F5QA 4UW5A 4YSFA 1NA1C 2QE3A 1LOEA 1G6NA 2TNFA 1YFUA 3VKMA 2C1FA 4YVWA 1MS3A 2UU8A 1AF9A 2PAKA 4L99A 4GH4A 2ZAAA 1A6CA 2O8OA 2O1QA 4IV1C 1M4WA 1Q3EA 4GKXA 2ZGTA 5K8SA 3O5SA 2P37A 3A0NA 1FPN1 2OUHA 2N7GA 4LBLA 3QD6A 3KS7A 2JJ6A 1Q8PA 1VB2A 1XNKA 2DVFA 2RE9A 4P9YA 1FPN2 2UY9A 1ND3C 5JAXA 4Y1VA 4Y26A 3ETQA 4QPIB 1LTEA 2VNOA 1QJY1 5F1RA 1MZFA 3L9JT 1G9BA 4LLFA 3WHUA 3IPVB 4KGGA 4XHXA 1TNFA 4GMP1 1DQ4A 4MLOA 1NCQB 3RG0A 2I2SA 4R52A 3HWJA 2KA3A 3MIFA 4HKOA 4JVAA 5FO7B 1K5MB 2ZHLA 4L9BA 3IBMA 2PHRA 4E9KA 2D98A 5DZFA 3RSJA 4YZ5A 2PAEA 3I54A 3DV8A 1QDOA 4Q0PA 3S7IA 4BCUA 1IS3A 4OFGA 3H8UA 1FPN3 4WV8A 3UKNA 3VKLA 2EA7A 2D6OX 3QLQA 1PIV2 4PF5A 2A5ZA 3O0WA 4AFCA 5JOZA 4FXKB 5CA6A 5KHGA 2Q30A 4XJZA 3RYRA 1EV11 3AKPA 3LA7A 1XE7A 1QJY3 5EJ3A 3AKRA 4JRAA 4GMP3 4R4ZA 4R8HA 2G4IA 3D0SA 5K0UA 1G9CA 5HCBA 1XXNA 1S0JA 1W6MB 4AVBA 5CU1A 4I09A 3HMYA 2B46X 3GZTB 3MPBA 2WINB 2ZGKA 4IV3A 3PNAA 4X8PA 1QNYA 2ZOEB 1M06G 4LBQA 1ZM1A 2D3SA 1YFXA 4IEVA 4AGGA 1GKBA 1N1YA 3LZZA 1C1FA 5ABJC 1RHI2 3OJBA 4XBLA 1RUH1 5I8TA 1W39A 1EV13 5GJ6A 4WVZA 1HRV2 2XVKA 1Q8QA 4JTOA 1PO11 4ZXKA 1HX6A 4D69A 1RUH2 3VZMA 2R062 3GYDA 4CYDA 4EWAA 4IEQA 2ZGQA 1PO12 2D6KA 2ETEA 3WD5A 3QOPA 2DWRA 1PZ9A 1YNAA 4HETA 4BQ1A 4S2FA 2RJLA 1QGLA 3AZYA 3BB6A 4FAGA 2E63A 4QGLA 2B5HA 4N53C 1WBLA 1R081 1S0DA 1WD4A 1N47A 1RHI3 4B7KA 2D6PA 4AXOA 3G6JB 1Z0HA 3ZDSA 2YUEA 3LOBA 2HEYF 4TYSA 1RUH3 4Q0QA 3AYEA 2P34A 1ONAA 1PO13 3G7DA 5T5LA 1H0BA 5KHKA 3J9SA 1J1LA 1PHMA 3W58A 3U07A 5CB7A 2WWSA 2P3JA 5L7OA 1AR82 1COV1 4M3CE 1LHVA 1POV1 4YLZA 2UURA 1ZBE1 2XJUA 3B9IA 5CFDB 1COV2 3ZVXA 1Z78A 1R083 1SFYA 2VOWA 2ZGUA 3WW3A 3WDXA 1V6LA 4XTPA 3V0AB 1ZBE2 4I0BA 1B35A 2R1DA 3BIWE 4B3NA 2VGDA 2WNUC 4NWWA 5FOJB 1JBCA 4Q27A 3WP6A 3W59A 4M00A 3TB0A 1ZZ6A 2XL7A 2GC3A 1GZCA 3THPA 1C5HA 4YGBA 3TRSB 2K9ZA 4B4PA 5A32A 1U5XA 4Q0SA 5GZEA 1W6QB 3DPRB 1WW7A 2DUPA 4FQ4A 1S0IA 3MIDA 4EN9B 1REDA 3WP3A 5ACA1 4AHYA 3O12A 4PBPA 4N90A 2K0GA 3AFKA 4WM7B 2JECA 4HLTA 4RA0A 1COV3 1KDKA 1WLCA 1HQWA 1POV3 1OLQA 1BBT1 2XUMA 4QPGC 2WNVB 1ZBE3 3ZMNA 4WZCA 4Y1XA 5AVPA 1BBT2 3JQWA 2EXHA 3E5UA 4E2SA 4N43B 1G7YA 1CAVB 4UW4A 5FBZA 3CU7A 4YARA 5CFCA 5BNPB 3AB0A 3UV9A 4QPIA 3LSEA 3MFAA 3H9AA 1I6XA 4XIOA 1LODA 2GZWA 5EYYA 2A70A 4CDXC 2ZZQA 4KQ7A 5E88A 4AHWA 2Q1MA 1MEC1 3GHNA 2BNOA 1K5MA 1FX5A 5ACA3 3DL3A 1RTVA 4RR3B 1Y43B 3V0BB 2VOKA 3J26N 1DLLA 5DUWA 3M3OA 2D43A 2VH9A 3LSDA 5A3MA 2WSUA 3GZAA 1QH6A 4PIZA 2ZPXA 4GULA 2I45A 4IERA 1BBT3 2CGPA 3OBRA 4QQHA 3ZSKA 1FNZA 4Q0UA 1KQRA 5J7MA 4OLLA 4HN0A 2GNDA 2R49A 4AEDA 1OHFA 4WVVA 4L2NA 2GH2A 4I2OA 1D2SA 3AZZA 4NO4A 3ZSMA 2BEOA 4AVVA 5FQ0B 3E6CC 1EAH1 4I0WB 2PHWA 4JGYA 4AFDA 2W68A 4CEYB 2V5YA 1WLDA 1DZTA 1EAH2 2ZGLA 5FLJA 1QJX1 5LRSA 1MS9A 1WCKA 1WLTA 2AENA 3CF6E 2QQPA 1O3RA 5DZGA 4E4SA 1MEC3 1DDLA 2BFUL 1QJX2 2BGCA 1IPJA 5JIUA 5H9RA 1F31A 3IDEA 1XQNA 4DRRA 1GNZA 2ZJCA 1J58A 3H1MA 1V9U1 2DF7A 3IWZA 5GM0A 3KQRA 4JGZB 1OA3A 1OPOA 1UU5A 3DN7A 3TAYA 3KCYA 1V9U2 2ZHNA 2ZBJA 4LBNA 4FTBA 1ZRDA 2ARBA 1X33A 5EXOA 1UL9A 1MZ5A 4P9XA 4S2DA 3W9AA 1F5JA 3IN9A 1BKZA 3AP9A 4M3CA 5FO8B 2CNAA 3V65A 2JKBA 1LESA 3MW2A 4E2GA 5IK5A 1EAH3 1LHWA 1X8MA 2BWAA 3ZSEA 4ZU5A 1FMD1 1AYN1 4RQPB 5AFEA 1AUYA 3VBFA 1IZ3A 5FMOL 2WA4A 1LHNA 4LHLA 4E4DX 2WT2A 1GICA 1QJX3 3AKTA 2RS32 4Q2FA 3BCWA 3WCRA 4K20A 3WDYA 1GR3A 4WM7C 4DPNA 3WV6A 4IEYA 1PM7A 1S0FA 3LGRA 3S7EA 5C8WA 4PDWB 2DFBA 2XWBB 1V9U3 2A75A 2QVSB 2R072 2UWCA 1J59A 3VBOA 4K1ZA 3ZXFA 2WNVC 2CTVA 4RS5B 3VBUB 5BNNC 1V6IA 4Q8KA 1VALA 1AYM1 1RUG1 1OPMA 3MW4A 4K9SA 4C91A 2IXHA 2FZ1A 3HAGA 4Q4X1 4W6WA 4YM3A 1C57A 3SHRA 4A7KA 1AYM2 1CAUB 1RUG2 3N4MA 1HLCA 1IS6A 5BNPC 3H7JA 4GH4B 1JXNA 2C5DA 2OUJA 4QT6A 1FMD3 1YLLA 1AYN3 2RS33 3A4UA 5D8AC 2AUYA 4Q1RA 1LOAA 2GN7A 1SMVA 3VDDA 2NMNA 1UN1A 2QDRA 3ZYGA 1LKNA 1DQ5A 4FP2A 4IEWA 2GC2A 2H6CA 1BZWA 2E7TA 5GLWA 4P9GA 2PHLA 3APBA 3BPZA 4RR3C 3EHKA 4L8QA 4LO4B 2QJVA 1AR61 3WG2A 4I3PA 1ULFA 4LO6B 1GLHA 2GDFA 1W6OA 3ES4A 1AR62 5CFDA 1H8TA 4YZ3A 1ZZ8A 2YDEA 1H2KA 1LOBA 1TQ5A 5J09A 4FPJA 3V0AA 1AYM3 1RUG3 2YMZA 1OA4A 3PVEA 4XJ8A 2RR12 4Q4X3 1AHSA 3WDTA 1YIPA 4CDWB 1IQAA 4WM8A 2WS91 3TBDA 4FO9A 5FAXA 4FOQA 4OULA 1D4M1 3GHMA 2Y26A 2DCTA 4CEYC 2TBVA 4DFSA 4MGYE 2WS92 4LE4A 4AF9A 2P3IA 5BUVA 1RINA 3WOGA 3DPRA 4AHXA 3T2TA 1O3TA 4J1XA 3KB5A 4FP3A 4XQ4A 4QQOA 1OMIA 1LOFC 5FCCA 1LHUA 3GZUC 1CAWA 3ZX7A 1AR63 3H3ZA 4JDOA 4LE3A 4SLIA 2ZGPA 4OHWA 3T1MA 4MZUA 4LT5A 3H1WA 3LCPA 3VZLA 4ES9A 3WG4A 2XJQA 4AQ2A 1T6GC 3AMHA 4BMBA 2D44A 2ZX4A 3NKTA 1CAVA 4LHNA 3WW4A 2WS93 2CV6A 1RUI1 4LBKA 5GLTA 5C4WC 1VJ2A 1D4M3 5JPMB 2UYAA 4Q4V1 3UK9A 4ONUA 3DUIA 2DURA 3IMNA 3AZWA 1RUI2 4IV3B 2D5FA 4BLIA 4KH9A 4YRDA 3AYAA 3ILNA 1UX6A 4Q4V2 4LBQB 2AREA 2VULA 1VR3A 1FAYA 4DQAA 1OOPA 5AC92 2B42B 4HSJA 5C8CA 4EN0A 4PDWC 3RNSA 1BCXA 1U5IA 3MW3A 1R1A2 3FZ3A 2IXKA 4ZU4A 4D94A 3ROUA 3VBUC 4DNYA 3JD71 3OY8A 4BIFA 1QY4A 4I30A 4MX3A 5C9AB 2VQAA 4YZ1A 1IGOA 5J36A 4YVWC 4FQZA 1O91A 2WL1A 2XHKA 1OQDA 1RUI3 3AK0A 2VVDA 3RI9A 4XFCA 3SH4A 4Q4V3 2PELA 4YZ4A 2GU9A 5EZWA 4IL7A 3WLUA 4RGAA 2JENA 2PHXA 2A6YA 2HJIA 4XFIA 2BNNA 3FBMA 5GLZA 1YHFA 5LEJA 3K48A 4JV4A 1BMV1 4G4FA 1RUD1 3D0JA 3E5XA 1Q5OA 2Y0IA 4XIKA 1C8NA 2D6NA 1KJLA 1ND2A 2EALA 3ZIXA 1RUD2 1VBD1 1PNFA 5CIRA 2ILMA 3ILFA 3JUUA 4UW6A 1KFXL 2LALA 3JD73 1VBD2 4C1XA 2X8KA 3PMEA 2F4PA 1V6NA 3LA2A 1DHKB 4IESA 5IK7A 2FMDA 1L3JA 3UL2A 5L7OB 4G3YC 2R32A 2GMPA 2GALA 1YWKA 4I01A 4QGNA 5BNOA 1ASJ2 4EN7B 2ZGMA 4MGKE 4Y22B 3ASIA 5I0TA 4AK3A 1WD3A 2E7AA 2GMMA 4HK9A 5E89A 1IKPA 4XILA 1CVNA 2VW0A 1RUD3 1WBFA 1ZRFA 5JLVA 3RYPA 4O9EA 5JZGA 1QHDA 1BYHA 1W6PA 1VBD3 1V6OA 1YIFA 5A32B 1A78A 4QM8A 4XBNA 2K2SA 4FPYA 1KITA 1LEMA 2BQPA 4R9AA 5AFBA 1N3PA 4LBQD 1NE4A 3WT3A 5K0UC 2IC1A 1CAUA 2GSYA 2RJKA 1CIWA 4X6QB 2QCSB 1ASJ3 4YM1A 2R6QA 4LUKA 2D40A 3VKFC 2GC1A 1RUE1 1O3SA 4Z92B 4P9JA 4LTAA 4XQDA 3NJZA 3N3HA 4YGEA 4KG8A 1YI7A 1ZA4A 3KT4A 4PIYA 4R9BA 3RWNA 3JZVA 3X29B 2ZACA 1C8M1 5IT6A 1J3QA 3SMHA 3ES1A 1UKGA 4FTEA 4XFHA 2JEMA 5CFCB 2WC2A 2A6WA 3AYDA 4A7YA 1C8M2 4QQPA 3EO6A 4CDUA 2OPKA 3LB9A 3TYJA 5EYXA 2OW4A 2CYFA 4FPGA 4Q0VA 4BPZA 1QJY2 4YYOA 1PK6A 2WLPA 3VL8A 4B4RA 5EV7A 5KC6A 2HYKA 5JWPA 4UW3A 3AP5A 4CDWA 4RD7A 2ZX1A 4XBQA 1HRI1 3MZHA 1JUIA 3ZFGB 4WZFA 4D7TA 1KFUL 2R0FA 3CJIC 4AHZA 3A0KA 3KGZA 5F6KA 4FPOB 3KCXA 1RUOA 1RGSA 1HRI2 2WKKA 2ZGNA 3KSCA 3OCPA 4AVCA 1DYKA 2ARXA 4I0AA 2WLQA 1MQTA 3UJOA 1RUE3 2LTNA 1RUC1 4AEDB 3ZYRA 2P17A 4YM2A 1FI2A 2WA3A 2R041 2CL2A 4FPFA 3AMNA 1C8M3 5FLIA 2E9QA 5J96B 1RUC2 3ZYIB 3OD0A 2ZX2A 3USUA 3PJYA 1DBNA 5DG2A 1NLRA 3M3CA 2DVBA 1WMEA 4LUMA 4NOTA 4JGYB 3OPZA 4R9DA 1ZREA 2D3RA 1EV12 2EXKA 1QWRA 5GZGA 4F8AA 1GV9A 1XYPA 2DCJA 3TNQA 3ZFEA 1HRI3 1KRIA 5L7OC 1IHMA 1W2UA 1AR91 4HPKB 1X36A 3LKJA 1YFYA 1DFQA 1V6MA 3FX3A 4INDA 2WFPA 1AR92 1BJQA 3DF0A 3HD8B 4U36A 1RUC3 3ZN5A 1IKQA 1B35C 3M2MA 4XEZA 1X50A 2VVFA 1YYNA 3SH3A 1C3HA 2D5HA 1EYBA 2R043 4M3CB 1G9DA 1AL21 1JHNA 1R091 2XJVA 2IXJA 1PMIA 1N1VA 4OI2A 1LRHA 2KXLA 4OHZA 1ZVFA 2PHUA 1VBC1 5T50A 3VBFB 4V1PA 1R092 3FLRA 4K6BA 1LHOA 3WG3A 5KHJA 5JSOA 1NCRB 2R16A 5C9AA 1DGWX 2XJTA 5IUQA 2RS11 5JOXA 2DUQA 1WW5A 3DGTA 4YG0A 1SACA 5T54A 1SLLA 3AZXA 2Z5WA 2ZA9A 1X7NA 2A3YA 1UMZA 1AXZA 1VRH1 4BH9A 4G9SB 1AR93 5KHIA 3VBOB 2JE7A 4YW4A 4NWVA 4UXAA 4Q4W1 1TNRA 1NG0A 2E7QA 1R082 4H7LA 1NZCA 4B8EA 1DF0A 5JIAA 3WCSA 4D7SA 1AL23 4LULA 1R093 5FPZA 4R9CA 5CFCC 3M3EA 2YYOA 4QPIC 3RJRA 4C0HA 3VBHB 4EN8B 4XJUA 1VAKA 3ATGA 3HQXA 1NCQC 1ULEA 3IDCB 3VDDB 4NR1A 5HXVA 2WZR1 2YZ4A 1QNWA 2RS13 1K5MC 1YO8A 1GQHA 1O5UA 4FPEA 3AP6A 1SLAA 4ZKTB 1JYCA 1RUJ1 1LB2A 4NVPA 1RITA 3VHPA 1VRH3 2XWJB 3CEWA 2DU1A 1W6OB 3TN91 4OHYA 1H8TB 1YXWA 4Y22A 4Q26A 5KHHA 2H0BA 4Q4W3 4C90A 2EXJA 2GN3A 4AEDC 4AVTA 3TN92 1D0GA 3ZSLA 3GBGA 4WM8B 2B8MA 2XPJA 4Y20B 1ZBA1 3RZZA 4AFBA 2JICA 2UWAA 4XYXA 3ME2A 3MI8A 4H14A 1A8MA 2PN5A 3I7DA 4YGCA 3RDIA 5LEKA 2CGOA 4W6XA 4BA6A 3PTYA 1PGL1 4ES8A 1MVEA 1ZBA2 4XF0A 5JVVA 4BLJA 4M3CF 1O3QA 4M0NA 2UYBA 3MDPA 2FZ2A 2WZR3 2Q8OA 5I0RA 1OD5A 2ZGSA 4B7EA 2JE9A 5ACA2 3ALQA 4F83A 3M1HA 1CAWB 4LO8A 1U5YA 2FMYA 3WR0A 2X5IA 2BTVC 4COUA 3TN93 5KXCA 3P3PA 1XU2A 5FFOC 3AZVA 3VBRB 1CN1A 2DFCA 4D7YA 1S1AA 5JPNB 4IEXA 1QXPA 2BVVA 4KL1A 4F7ZA 2VW1A 2VUAA 3ZN4A 2EF6A 1F5FA 5FMOS 1PNGA 2W39A 3SNMA 2I74A 5KXDA 2OZJA 1ZBA3 2WFF1 4XJ9A 2VMIA 2IFRA 3VBFC 3RRDA 3IKWA 2WFF2 3IDBB 4CDQA 4GMP0 2A7AA 3ENRA 2D7FA 4YM0A 4EROA 2NM1A 4C1WA 4DMIA 5FREA 2JG8B 1OI6A 1CJDA 4QXKA 1OOPB 2KM2A 1MEC2 3KMHA 1NY71 3AM2A 4L97A 3ZFGA 3RJ2X 1JOJA 1QQP1 2CWMA 2D6LX 5C8CB 3VKNA 3HT1A 4HANA 1OFNA 2VQ0A 3EBRA 4P9IA 4UBGA 4AE2A 4DZGA 3VBOC 4KU8A 2PHTA 4E4ZA 4XTMA 2P3KA 1BVVA 2UY8A 5KXBA 4PCRA 3OY8B 1ENXA 2MNGA 3EXUA 3NW4A 3RMYA 5EFUA 3SXWA 1D2QA 4AEKA 1QKQA 3JB8A 3MIBA 4IQPA 1VIWB 3B01A 1QXJA 2Z79A 4BMEA 1SBFA 3WDWA 2B45X 2WFF3 3FMGA 4BIOA 3FWEA 4YVSB 4AI3A 4TZDA 3VKOA 3U11A 3PJQA 2B9UA 4YW5A 1J3RA 1LULA 3AMPA 1UZYA 3AMMA 3E5QA 5FTTC 4XMAA 2NMOA 4N7UA 5JI7A 1MS8A 4FAHA 1CGPA 2CWSA 2HWB1 4LR4A 1Q56A 1DGRN 2UWBA 2A6ZA 3H0OA 1MR5A 1U12A 4K40A 2XVLA 1H2MA 2XKOA 1ND2B 3PVOA 4HPKA 1QOTA 2HWB2 1G86A 1CQ9A 2BVBA 1RC6A 2WJSA 1NQJA 3H3UA 5CFDC 1H8TC 3LOIA 5T52A 3I2DA 3OBTA 1QOSA 1KD7A 2MEV1 3I59A 5BPXA 4PLOA 4HN1A 1GFF2 5FO9B 4A7ZA 2MEV2 5C6CA 2JX9A 2IFWA 1HW5A 3PMSA 2E51A 3OGGA 3ZXLA 1V00A 2ZKNA 2YGLA 4FCAA 1EY2A 5BNOB 1NCRA 4Z8BA 1FMD2 1LR5A 1AYN2 3D6EA 3GBFA 3DPRC 3GBWA 4QQ2A 5BYNA 2XJSA 4J1WA 4U2AA 4MGIE 4LBMA 4I02A 2DV9A 4Q8LA 1CD3G 4X6RB 3RS6A 5JSRA 3MFCA 2HWB3 3WDVA 1TME1 3U4XA 3BTAA 3M3QA 4K3UA 5JZGB 5I91A 3Q9OA 1SDWA 1W6PB 4XF1A 3N7MA 1UU4A 4CDXA 1FV2A 2ZMLA 2XL9A 4XXPA 2MEV3 1WGPA 2JG9B 4JDMA 4JRLA 4RHV1 1AXYA 3NO8A 4N43C 1AJOA 3AMQA 4Q29A 1DGWA 4P9LA 4DOUA 5L36A 4MVTA 5J37A 3IT8A 4Q4X2 4K1YA 4PBOA 1YFWA 4RHV2 3VBHA 1S55A 1GYKA 1VB4A 1CAXB 3CO2A 2Q1ZB 4GIQA 4A3XA 3WNXA 2XG3A 2OYZA 4GKYA 4FOWA 1OOPC 1XYNA 3S30A 1H2LA 4ASMB 2A6XA 2V09A 3WDUA 1QJU1 5C8CC 4ISRA 5I8YA 2XLFA 3ILRA 1CJPA 4CDUB 4FSJA 4C0BA 1I1EA 3AP4A 1I3HA 4PLNA 1POV0 3PHMA 4NN0A 5BXXA 1QJU2 2ZX0A 1QJZA 1Y9QA 5EWSA 1REEA 3WINE 1PK6B 3R6SA 2EXIA 2RS51 3L2YA 4GA9A 1JYIA 4QGMA 2XLAA 4RHV3 4XJWA 3KCCA 1ZZ9A 2ZABA 1DZQA 5I0SA 3MYXA 2RS52 3O7OA 2RM21 4Y20A 2HWF1 1JW6A 2ATFA 3SCGA 1WLWA 2ZX3A 3H50A 2RM22 2MPFA 2BPA2 4JAAA 2HWF2 1MQTB 2B7YA 1AX2A 1D4M2 2Q4SA 4MXWA 3ZFFB 1SLTA 3VZJA 1GNHA 4CEWB 1N3QA 1OLRA 5JMCA 4OI1A 3MF6A 2QDNA 1UPIA 4ORFA 3VBSA 3USUB 5HCAA 4JGZC 1QJU3 1UU6A 3VHRA 3VHOA 1ND2C 2NYYA 1H9WA 1LU1A 4LEJA 1MS1A 1ZZ7A 3MLKA 3PLQA 3VBRA 4XDQA 1SCRA 3IM0A 3ACLA 1A3KA 4XHBA 4JCKA 2RS53 2C0ZA 2GNMA 2VUJA 2VG9A 3QBQA 2BBVA 4Z07A 3NWKA 1XYOA 3ZFEB 2JXAA 1KS5A 2AR6A 2RM23 2HWF3 4Q1PA 3B69A 4META 1JN2P 1SFNA 4RQPC 1ENRA 4MSVA 2A71A 2EAAA 1HKDA 1MACA 3NL1A 1YCIA 1FXZA 2FBEA 1N1SA 1ZZCA 1LGCA 4TWTA 3B00A 1NA1B 2QKDA 4YFWA 3C2UA 3EQEA 2GMEA 1X8EA 4ISQA 2JG8A 1XE8A 2LUWA 3WW2A 5DXDA 3CJXA 5DUXA 5LK7B 1WMDA 2ZKLA 1AX1A 1SLBA 2ET1A 4XF9A 3FBYA 1HDKA 1YI9A 4CRQA 1PZ7A 4H3WA 5JZGC 4IV1B 4IEUA 1DQ0A 1KDMA 4BZ4A 4RS5C 3R4SA 3VN4A 3WQ7A 1G9AA 1BK1A 4FPLA 2I07B 3OTFA 4XJAA 3R05A 2VMHA 3KD4A 2BUKA 4QM9A