4XQWA

X-ray structure analysis of xylanase-n44e with mes at ph6.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGEFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqwA00
3VZLA 2BWAA 2D98A 3EXUA 3AKTA 3AKRA 1XNCA 1REEA 3O7OA 1C5HA 1HV0A 2B46X 3AKQA 1REDA 2VUJA 4HKOA 1UU4A 2B45X 3M4FA 4HKLA 1OA3A 2DFBA 1BCXA 3VL8A 5K9YA 1ENXA 2DCYA 1UU5A 1XYPA 2QZ2A 3WQ0A 3HD8B 2VGDA 4H7MA 1UKRA 3B7MA 3AMHA 1OLRA 2NLRA 3MFCA 2VULA 3WQ7A 2DCJA 3VHOA 4HK8A 3LB9A 3WP6A 4S2FA 2D97A 5HXVA 3WX5A 1C5IA 4HK9A 1T6GC 2C1FA 2JEMA 1H4HA 2JICA 3B5LB 3VZOA 3WP5A 3ZSEA 4XQDA 2BVVA 3MF9A 1H1AA 3RI9A 1KS4A 3AKSA 1H8VA 1YNAA 3WP3A 1HV1A 2DCKA 4XQWA 1M4WA 2VG9A 1PVXA 1KS5A 3VLBB 3WQ1A 1F5JA 2B42B 2BW8A 3AKPA 3LGRA 1NLRA 1OA2A 4XPVA 1XYNA 2Z79A 4IXLA 5EJ3A 3VL9A 1BVVA 2F6BA 1REFA 3WR0A 1W2UA 4XQ4A 1H0BA 1QH7A 3VZKA 1H4GA 3WY6A 3AMMA 1QH6A 1OA4A 1BK1A 4S2DA 2JENA 3RI8A 3WT3A 4S2GA 3MFAA 4S2HA 3VHPA 1XNKA 1XYOA 1XNBA 1IGOA 3VGIA 3VHNA 3AMQA 3AMNA 3MF6A 5K7PA 1UU6A 2BWCA 3VZJA 1AXKA 1OLQA 2QZ3A 3WXPA 3VZNA 2NQYA 1TE1B 4NPRA 1XXNA 3AMPA 1XNDA 2DCZA 1HIXA 3VZMA 3WP4A 4HKWA 2DFCA
chains in the Genus database with same CATH superfamily
3DN7A 5BNNA 3WVJA 4Y1XA 3JUUA 1AVBA 2VBBA 4YW7A 3FL7A 4QXHA 1AYN3 4JHZA 3WF3A 3ZX7A 4QPIB 2WDBA 5KHIA 5T5OA 1O6UA 2HH9A 3EO6A 3SXWA 4GMP0 1ONAA 3IAQA 1CAXA 4N53A 4LIUA 1HRI2 3POJA 5DDJ2 4NE9A 4CEWC 1NQJA 2E33A 2WKKA 3QBQA 1N3QA 3DYMA 5FKBA 4CDUC 4B7EA 4XABA 4CU9A 4IUGA 4PJYA 5FZLA 3VBUC 1V0AA 1UKRA 1J3PA 4ORFA 4RS5A 4D8MA 4QQ2A 4TYSA 5T50A 3LFMA 2J7MA 1H30A 4XFBA 4Y22A 2JD4A 4HK8A 4PIXA 1GZCA 1Y9QA 5F5AA 2YY1A 4NHXA 2R043 3WX5A 1RUG2 3S57A 4LTAA 2DUOA 2XL9A 3JD71 5FY5A 1FX5A 1KJLA 4YW2A 1J3RA 1GOHA 4JX0A 4AHZA 1D4M1 1HXS3 3MO4A 5DG2A 5TSWA 4CCCA 2VMDA 4RQPC 3WUCA 5FJHA 3O1VA 1CPNA 4LO7A 1SBDA 3ZPOA 2EIEA 1HJFA 4EN7B 2NN8A 3MIEA 2Y38A 1PK6B 3POBA 2XVLA 2D6NA 3PU8A 1NT0A 1H2MA 4XFGA 5FWEA 5FZ9A 1K5MB 1W6PA 1L7RA 2MEV3 2Q5TA 1BKZA 1R092 1X7NA 2DBNA 4IQPA 4OUEA 5DZEA 4CPBD 3ES4A 3JBG2 2KR2A 4XJWA 1LHNA 4KBBA 4FTSA 1LHVA 4W50A 4Y1ZA 4Y5Z0 1M06G 1ZNPA 3EJKA 4MLOA 5FY1A 1GP5A 2PAEA 3BTYA 1CAVB 4P9WA 1RUI1 2QDRA 3CZUA 3DPRC 1JHNA 1EUTA 1J84A 2PLV3 1LGBA 2AGSA 2BERA 2E31A 4N43C 4MOAA 4P00B 4HZFA 5IHRA 4Y1VA 3S6PA 4BK5A 4EV0A 2JDUA 4WV8A 4MADA 1HRV2 1EAH2 3AC0A 4MGZE 1RHI3 1O3SA 1QH7A 4A44A 1ODNA 2B9VA 3VBRC 4COUA 3PUAA 3H7JA 2ZHLA 2Q0AA 3ZXKA 4S2GA 3M70A 1LU2A 1NE4A 5DAWA 1LJ7A 3M8LA 4GH4C 1VB4A 3N9MA 4IGPA 5CU1A 4YGCA 3HMYA 1V00A 1W3XA 3MEPA 3BB6A 1FMD3 2YROA 3AMQA 2J1AA 5F3GA 1Q8OA 1UO9A 5JDBA 2TNFA 2LTNA 3RZHA 3MUZ1 2Y6JA 2WQZC 5KC6A 1GMMA 1PM4A 3HJRA 3FUQA 1DG6A 2V09A 4JAAA 1CN1A 2RS13 1FOD3 2VD7A 4HONA 3ZSKA 3SCGA 1UY3A 1CZTA 1MZFA 3ZO0B 4RSUA 5C3PA 2R071 1COV2 3I59B 4MVTA 2DFCA 4NWVA 2WR9A 1JBCA 2Q8EA 4B8EA 1GNZA 2HKXA 1JZ7A 5IK8A 1WUVA 3SCFA 4B1LA 2OXBA 1NZCA 4GB33 2OIIA 2RE9A 4XUQA 4A41A 1Q8VA 1OQEA 5FLHA 3AYAA 4P9IA 4CP1A 4META 1VRH3 2B46X 4BZ4A 1GLHA 3ST7A 3ZXEA 4A4AA 4CCEA 3S5AA 1PNFA 1REDA 1VBA1 1VBD1 1ZM1A 3KGZA 1F2NA 1G9DA 5GLWA 4QX0A 1MQTB 3NNGA 2C0ZA 3OUJA 5CZKA 1XSRA 3TBDA 4AI1A 2HWB3 3WDVA 1WBLA 3RYRA 2W87A 3N7MA 1POQA 5E89A 1YLLA 4XC9A 1GU3A 5JSRA 2DTWA 1YJLA 2ZXQA 3FJSA 4JGYA 4FSJA 2YG0A 4IE4A 3NVCA 4YG0A 1R1A2 1VBC2 3MW2A 4XXPA 4PBPA 2HYKA 1WMDA 1C5IA 1QXPA 3T4HB 2P1BA 4HMZA 1W8OA 2C1FA 3SEEA 1W8ZA 4AFAA 3TAYA 3D6EA 1W6MA 3LEKA 3WP5A 3LAGA 2BNOA 2RMU1 3KCCA 1F8VA 1Z7S1 4N8MA 1MZEA 2WN3A 1LOFA 4FVVA 4I0WB 1PGW2 2DUPA 5A6ZA 5BY5A 2WC2A 1H8VA 2A3YA 4QGNA 4YW5A 4AHYA 1NYWA 2HWC1 2WS92 4OLLA 2LUWA 1SHWB 3M3QA 3WP3A 5C3SA 2E32A 2ADEA 1HRI3 1YFYA 1ZYBA 2J1TA 2XHNA 3CO2A 3N7JA 3NKTA 1JYCA 4FPLA 4FXKB 5DDJ3 5F3IA 1S1AA 4UI9L 5IYYA 2YDEA 4AW7A 4BIOA 1L7LA 1BMV2 3TEXA 4RD7A 2BGCA 3S0MA 5FPUA 3AKPA 3LGRA 4GWNA 4XUNA 1ALYA 2I07B 2VMFA 2ZZQA 4OYUA 4FAGA 1AJOA 1OA2A 1MS5A 4XPVA 4Z2AA 1LENA 5J37A 4LK6A 2VTFA 2PHRA 4CEWB 2WFF1 4JTOA 4CDUB 1RUG3 1H9WA 3BOWA 3LIHA 4XF9A 5FZHA 3RS6A 1N1TA 1QJFA 2V72A 2E63A 5AVAA 2W0XA 3ABZA 3MHZA 4GWMA 3RMYA 1LOGA 4DXSA 3AZXA 4B3NA 1WMXA 5EPAA 4V1PA 4BISA 1PGL2 2BVBA 1LOBA 4I01A 4UT5A 2ZEXA 1NX9A 1O91A 1QH6A 1LKNA 2UYAA 4IESA 3U78A 2ZEYA 4HL0A 1GZ9A 1KFUL 1PGSA 2XBO2 3C7OA 1UZWA 4QXKA 3J7LA 5JVVA 4YGDA 3RG0A 1ZREA 2QQLA 2RS51 4O65A 1XNKA 1WKYA 5LA9A 3WW3A 3RYKA 1R093 1XSQA 2W1SA 2YC4A 4E4ZA 3AZVA 5K7PA 4AE2A 3OEBA 3JBG3 2QQJA 5FK7A 4RQPB 4AEKA 3WUDA 4MGKE 3N7KA 5FXXA 4W8JA 3U14A 3HN3A 3HT2A 3O12A 1WD4A 3WDYA 3O1PA 5BNOA 2HEYF 4NRQA 5JXIA 1AL0G 3VZMA 3VDDA 4LBQB 4AEDC 1XNAA 3GBWA 3ZYBA 1HRV3 4IV1C 4UYBA 1G8WA 1EAH3 1VPHA 2E7TA 3I3MA 3JXSA 1RUJ2 1CAUA 4IGOA 1QJEA 3O0XA 3ZN6A 1XE8A 1J1TA 1ZRCA 1S0GA 3J8F2 4W6WA 3DPRB 4DUXA 1IS4A 3ETQA 5HXMA 1MPXA 1OPMA 5FYVA 4RGGA 2WZR1 3OB8A 1PVC1 1DQ6A 5DAVA 1QWRA 3KT4A 4AGRA 3VBSC 1R082 1OVPA 3LDBA 5LRRA 3VBRB 4BJ0A 1UU5A 4PI2A 2NM1A 2H6BA 4DQAA 3MGUA 1ENSA 2VE1A 2VMGA 2ZBJA 5F2WA 3DUIA 3LFIA 1RGSA 3GHMA 3VBFC 2ENRA 1MEC1 4GH4B 3ZLIA 4EE2A 3GM8A 4XUPA 4DRVA 3VKMA 3NJYA 5FZ3A 1O3QA 3W5MA 3T2QA 5FZDA 4FFIA 1ULFA 3IDEA 1W9SA 4XFFA 1COV3 4FOVA 3TNQA 4TN7A 3LB9A 2WT1A 4E4HA 2ETEA 4B4QA 4CP2A 1LTEA 4PDWA 2ZX1A 1SPPA 1W05A 4M00A 2WWJA 1UX7A 1JOPA 3IM0A 2NP0A 3BYWA 4XQDA 1XQNA 5DUWA 1QJY2 1TME1 5JIAA 3ZN4A 1Y4WA 1NCRC 2GNTA 5D2AA 3PMEA 5K0UC 1OQDA 1RUC2 3AVSA 4FPGA 1ACCA 2CYFA 4W6XA 5E16A 5F39A 4EYUA 3VD9A 3S7IA 2V4VA 2HWD1 4AG4A 3MIFA 3B3QE 5FUNA 4UFIA 1EV11 2ZKLA 1KJRA 1ST8A 3NO8A 1KS5A 1WMEA 2CV6A 4QHBA 1N47A 3WQ1A 1W6PB 1JXNA 2PAMA 1N3PA 3LEGA 4Q27A 3AB0A 1PO22 1R1A3 1UCXA 3PVOA 1VBC3 4OMCA 2N7GA 1DYOA 1V6JA 1Y43B 2RS32 1QHDA 1VBE1 4JQRA 4AFMA 3ZYIB 1QXJA 1TQ5A 3HIFA 1OLMA 2WNOA 5C70A 2RDQA 4OHVA 3ZFFA 4EWEA 4XFAA 5B2GB 2QCSB 5KR7A 1AL21 1W28A 2VOXA 3F95A 2ZAHA 3MUY1 3OY8A 4M3CF 1W8UA 4MO3M 3AP4A 3R4SA 1RC6A 2HWF2 2JENA 2VUCA 4URTA 3WT3A 4LHNA 3FLRA 4NMIA 4DEVA 2WS93 3SKJE 2CAUA 3NW4A 5DUUA 4Y5TA 1FAYA 2ZS6B 4BB3A 2QFEA 1XYOA 2KM2A 2VNOA 2VZRA 2WQ4A 1SLAA 2P6CA 4YW3A 1S0EA 5E88A 1CAWB 3BGAA 1UIJA 4QHOA 2VZ1A 1KITA 2HJIA 3I2GA 4PF1A 4BLJA 5I0RA 4NPRA 1WLCA 4GAZA 5LASA 1JUIA 3LKJA 1BVP1 4Q1RA 3GJBA 1KFXL 1GQHA 3RWKX 4QB1A 2ZJCA 4FPEA 3WP4A 5KXEA 2JG8A 4QX2A 2G4IA 2W2IA 3CLPA 2WSUA 2XKOA 3KCXA 3KVBA 1HX6A 1YQ2A 1JS9A 1SLTA 4XTPA 5L36A 1XNCA 4MSVA 4XAAA 1XNTA 1JYWA 2BPA2 1OH3A 3N9PA 1E5RA 3UESA 1WA6X 3M3IA 2GC3A 4AI2A 4A3XA 3RZMA 2OS2A 2XBO3 2ET7A 2E7QA 3CL1A 1RJ7A 3WHTA 4AXOA 2VH9A 4AVBA 1QGLA 1W8FA 3O1OA 1W6QA 1NG0A 2WABA 3N9OA 4LBMA 4ARYA 5JSPA 3H7YA 4MXWA 3OYWB 4Y20A 5LY2A 3BOPA 1KD7A 1ZZ7A 3DKWA 2QZ2A 5IVCA 2O0OA 3IIIA 3HD8B 3W59A 1W6NB 3ZVXA 4BYYA 1OD3A 4OULA 2NLRA 1YQCA 3R6SA 5C6CA 3OEAA 2V73A 2VULA 2XH6A 5A1LA 5FWJA 3LDKA 1XJAA 3DXUA 4IE0A 4S2FA 5T5JA 3UGGA 5IW0A 1QOSA 3KV4A 1AX2A 5EJZB 1DGLA 1RUJ3 2JDMA 3DF0A 3GYDA 5LEKA 2Q1ZB 1O8PA 2XXZA 1Z0HA 3C8XA 3ZIWA 4AI8A 1H4HA 2BU9A 4RA0A 3QH6A 4WM8B 3EYPA 3J8F3 4LOSA 4D94A 4A42A 2BVVA 1ND3A 5BPXA 2CNAA 1SCRA 2CDOA 3PVNA 4AEDB 1A8DA 3AKSA 1I5ZA 2CWMA 5CKNA 2WO1A 3KF5A 1GWMA 1C8M2 4XBLA 2D5FA 1DLLA 1ULOA 1R083 2WYFA 5A7WA 4QPGC 4M4PA 2XG3A 4CDWC 2JXAA 4I09A 4XJZA 4IV3A 2D3PA 1NXMA 1W03A 2P3JA 5JXGA 1CIYA 4OUSA 2IXJA 3AJZA 5I0UA 2WSVA 3AFGA 1D2QA 1GYKA 4JHTA 5A32A 5A7OA 2LM3A 4XBNA 1BEV1 4YVWC 4E2SA 3O1TA 4Q1PA 2PAKA 3H9AA 4Q4Y2 4RHV1 1BVVA 3C2UA 3PU3A 3VBFB 1H8TC 1W9WA 5C9AC 5JPNB 4Q29A 2X5IC 1QJY3 1RVF1 3KLSA 1QJU2 4ASKA 4FPKA 5JOZA 4ASMB 2OX0A 3MYXA 1IQDC 4Q4X1 1RUNA 1SCSA 3RI8A 2JECA 5H9SA 3I2KA 1OH4A 2H0BA 5FQ0B 3IPVA 3DCQA 3F2ZA 3K2OA 4P9GA 2ORZA 2VOWA 4QPYA 3BCWA 3GHNA 3NSTA 2XVGA 4FPOB 1X50A 1D7PM 3W58A 1QQP1 4M01A 5DXDA 3RZZA 4QPIC 3OUHA 4LHLA 2YXSA 3AK0A 4EN9B 1PO23 2RS33 2JDYA 2FHRA 1DYKA 1RXFA 3WDWA 4LA3A 4JKMA 4IEWA 5ACA2 1V9U1 1AR92 4OQ9A 4A6OA 3BTXA 2DTYA 4LO4B 1DGRA 2JDAA 4JGZA 3CJIA 1KQRA 4BPZA 3TOJA 4N9IA 1UZYA 2RDNA 3M3EA 3E5QA 1C5HA 4XJ9A 4E8CA 2HWF3 3THCA 3M3OA 5LBFA 5LY1A 3S5QA 3ZPYA 3ZXAC 1JHJA 2VUJA 1L3JA 1UU4A 1UXZA 1HJGA 3B69A 4J25A 1ZBE2 2Q4SA 5IATA 4N7UA 2BGOA 1VALA 3RNSA 3VUOA 5CAZA 2XONA 2WLQA 3UGHA 3FLTA 1B09A 1R64A 4JRAA 2OA2A 3SMHA 2W68A 3GCXA 1VMJA 1OLRA 2GU9A 2VNVA 3I2JA 4FOQA 3PUIA 2GP3A 3AXEA 4W4ZA 3TYJA 2WINB 3E6BA 3NJZA 4BM8A 3VHOA 3U4XA 3GF6A 2IXCA 3A22A 1DBNA 4Z92B 2XL7A 3H1WA 3BTZA 3KQ4B 4EWDA 1X33A 3VBOC 2JDPA 5JLVA 2JICA 2LALA 3A7QA 3MF9A 3I3BA 4D7YA 1XBFA 1GZWB 2FCTA 4FPYA 3J26N 5FOBB 2ORXA 1MS4A 3NV3A 5FZEA 1LHUA 2HWE3 2PHFA 5A6YA 4QB6A 2Z2SB 2BDRA 2AEZA 1I5PA 4B4RA 5L9BA 3UKVA 2QE3A 3RRDA 2JIJA 4IEXA 3KV5A 4WM7C 2R0FA 1PVXA 5F2SA 2VW2A 1JYNA 2WNUC 1U5ZA 3JCIA 1L7QA 4OHWA 4UW6A 5DZFA 2XWJB 1IKPA 3KVAA 4YYOA 1W9TA 3HAGA 3NNFA 5FZKA 3ZDSA 2WO7A 1JUHA 2Y34A 3JD72 4AAPA 4AAXA 1X36A 5A1AA 1OMIA 1OVSA 2AENA 2G9FA 2JE8A 5JZGC 2VJXA 2QQIA 3UK9A 1D4M2 1LESA 5EZWA 2D3SA 2ZGMA 4LORA 5C4WA 4BE3A 5F3CA 4GALA 3I2OA 3NV1A 3H1MA 3MPBA 3AYEA 2GH2A 4DB5A 1JI6A 5LATA 5A6QA 1UMIA 2ES3A 4B7KA 3ZM8A 5FYYA 5DABA 1OA4A 3LOBA 1NXD1 3K48A 4HFSA 1IZ3A 1WMFA 4YLZA 4GZ9A 4DMIA 1SBEA 2YPDA 2P3IA 3I54A 3M1HA 1WGPA 4N90A 3VHNA 3SKVA 2WT2A 2JIGA 4FQ4A 5JOYA 4QKFA 2BV4A 4B29A 2DBIA 4RL7A 2WWUA 2FBEA 4R4XA 1RUI2 4D3WA 4ZU7A 2JDHA 3Q8AA 1U5XA 1OKQA 3J7NA 3QLQA 2A75A 1TE1B 2Q1MA 3TNPB 2JB8A 3U10A 5IK4A 3WNLA 2W39A 4IL7A 4QPGB 4AVVA 4CDWB 2QNKA 4KGGA 4Q4Y3 5E1RA 1J1LA 1SMVA 2EIGA 4C1XA 2XB6C 4CCJA 3HQXA 1BYHA 5FYUA 5BXXA 4Q0QA 1QJU3 1CZSA 4NIGA 1QNYA 1N1SA 3BODA 5IWFA 5CFDA 1LEMA 3VBUA 2ADDA 4LOTA 2VQ0A 4YVWB 3THPA 3N3HA 1SBFA 2F4LA 4PQ9A 1AR61 2PFWA 1WW5A 3IAPA 1GP6A 4M0NA 1K12A 1O5LA 1OA3A 3N9QA 3WDTA 2P37A 5I0DA 1I6XA 4MHUA 2X5IB 1MS1A 1OC1A 3POSA 3T30A 2BQPA 5FZ0A 2JG9C 1ZBA1 2VZPA 4KQ7A 2VO5A 3L9JT 4AZZA 3NAPA 4R4ZA 4X8NA 1V70A 4DEQA 2NYYA 2DWRA 2X09A 3DYPA 3H42B 4CCDA 2OZ6A 3GALA 1SDWA 3FFZA 4FFGA 5CVRA 4Y20B 1D0HA 2EIBA 3IB3A 2R072 2VM9A 4A3ZA 1X8EA 1OBNA 3VBHA 3TEZA 1W6OA 1AR93 1YQ8A 2BOJA 3D5OA 3MLLA 1JTZX 5LZ6A 5E8AA 3WQBA 2DVFA 4Q8LA 3BALA 2PYTA 4YVSA 1GNYA 2AYHA 2CTVA 4BIFA 5ERLA 4YSFA 3I2HA 4Q0VA 3O1RA 3FUOA 1VBA2 1VBD2 2J1VA 4FPJA 2GNDA 3ZMNA 1ULPA 1GANA 4D6RA 1ZA4A 3WG2A 2ZMLA 2P3YA 2CDPA 3RI9A 4AFCA 2FDIA 1NQDA 3GGLA 3L2YA 1VMHA 1ZBE3 5C71A 1UY1A 4PCRA 4MZUA 4HBNA 3RVHA 1F9KA 2I74A 2QKDA 3HQUA 2ARCA 4OZOA 3RMXA 1DGWA 4WVMA 4CDXA 1DYPA 3GZUC 3ON7A 1RJ8A 5FZOA 4UWDA 3N35A 4MH0E 3USUA 1GUIA 5A7QA 2R32A 4IV3B 1H2NA 1LRHA 3PTYA 4XHBA 1TNFA 2PHUA 2R061 4G9SB 4NRPA 2WO2A 2RM21 2RMU2 5A32B 1Z7S2 4Y33A 4AR2A 5CIRA 1YUDA 1POV1 1QF3A 1C1FA 2OT7A 3TEWA 4KI5M 4F3JA 2A6YA 2HWC2 1ND2C 4LT5A 3RZKA 5AFBA 2LROA 2YC0A 2RJ2A 4AQSA 2OPKA 3K4ZA 1VJ2A 4NAOA 3VBOB 3LCPA 1QKQA 1MVQA 2LS6A 3AMNA 4BQ3A 2XJRA 3VHRA 5BNNC 2VZQA 4CU8A 1H1IA 3OGGA 2ZGSA 5FPXA 2WFF2 2IC1A 1XXNA 1FV3A 3UJOA 1C57A 1XNDA 2DCZA 3B93A 4QQPA 4GMP1 1X9PA 1NA1A 2V5YA 2WL1A 4WM7B 3ZXLA 4QT6A 4BHPA 2WNUB 5FO7B 1D4M3 1B35A 5FREA 1RUD1 2MHFA 5JR2A 4YARA 1PZ9A 4N53C 2NZ9A 3PUQA 1W9YA 2VR4A 2RS11 3PL0A 4OI1A 1FOD1 1UYXA 2BZDA 2RS52 3GBFA 4Q2FA 4FQZA 2LW8A 4IEZA 4KWUA 5FXVA 4FI9A 5JZGB 3R05A 2B45X 3ROUA 5LW9A 1VMFA 3ATGA 5JCTA 2I2SA 4CEYA 2ZGOA 5ANNA 1CESA 4JV4A 3USSA 2Y6LA 4ZXEA 1KDMA 4I0AA 5F5IA 1GWKA 2J22A 4Q0UA 4KBZA 1NZIA 5EP9A 1PMIA 2XVKA 3P3NA 2EXIA 4RR3A 4NPLA 2D40A 2C6SA 2VOTA 5F32A 2VMHA 2QBXA 3NKGA 5G05L 2DCJA 3P5BA 1WD3A 1OFNA 3PURA 5IJRA 3U37A 5D8AA 4IW3A 4XIKA 5C8CA 3U1XA 4CUCA 1Q5OA 5FR3A 2DUQA 2ZEWA 5A3WA 2ZTNA 5HXVA 1GOGA 1UWWA 4UFLA 3OG2A 1BK0A 1PMHX 4R52A 1F5FA 2EAAA 1OFSA 2ZGRA 1UOFA 3VZOA 2WBKA 1IOAA 4KH9A 1V6NA 4I2OA 4QU1A 2JKXA 2XHKA 3HOBA 3U0ZA 1PVC2 1A8MA 4OZXA 1CD3G 3VD5A 1AXZA 1CJPA 2W95A 3DEMA 3D0JA 1W0OA 2ZHMA 2CL2A 1CIWA 5FZBA 2GNMA 3V0BA 3M3CA 4L0PA 3UT0A 2GN3A 1AJKA 5FPVA 3LQCA 5FKCA 2VG9A 1ZX5A 2VTXA 2PHWA 1MEC2 1Y3TA 4NN0A 2XLAA 4QM9A 1LOAA 2PHXA 2R073 4YW4A 2FCVA 1RITA 4ET7A 4BXFA 5T54A 3A0NA 4JDNA 3IMMA 2C9AA 2JG9B 3AX4A 4AF9A 2IXKA 2UYBA 3O5SA 4PIZA 2K0GA 2EXJA 3OUIA 3A23A 4X6RB 4XFHA 4Y26A 1TME2 1HB2A 2IXHA 2VQAA 2R16A 1VBA3 5A3UA 3S30A 1VBD3 4K1ZA 5LEJA 1H4GA 3BU7A 2GMEA 4QKNA 3I2FA 1AYM1 3WINE 1PO11 2UURA 4K6BA 2PN5A 1OD5A 2HWD2 4OQ8A 5L7OA 1ZZCA 3WW2A 2QDNA 3I2DA 1EV12 1KXGA 3POYA 4U2AA 2HBUA 5IFPA 3SH5A 5BNQA 5DAXA 4ES9A 3LF7A 2J1SA 3VGIA 5F8PA 4AVAA 4MGIE 2B39A 2W92A 2P6HA 3HVDA 1AXYA 1DU3D 1V6IA 2QTWB 5CFCA 2AZ5A 4MGYE 1T2XA 3SH4A 3WD5A 2XJUA 1GV9A 2HYXA 4AVCA 4AQ6A 5T5LA 1RIRA 5F6LB 4AI3A 4COYA 1VBE2 1GOFA 3AMPA 1O4ZA 1UY4A 4E9KA 1W2OA 1G9AA 4QB2A 4LPLA 3TN91 2XR4A 5L73A 4UF0B 1AL22 2PHDA 3NMBA 4KMQA 4XEZA 3TB0A 2RMU3 4IEOA 5DN2A 1Z7S3 1DQ0A 3R4DB 2BWAA 4YGEA 3VBSA 3OF1A 3DECA 1O5UA 1WZXA 2ZACA 4QHZA 4LHSA 4L2NA 5DUXA 3FWEA 4QKBA 3GDBA 2GALA 2G9GA 1N1VA 3OGSA 5F1RA 4HN0A 2Y8KA 4QDRA 4ZU5A 5A70A 1XOYA 1HN0A 4JDMA 3T08A 3HNBM 5J36A 2OYZA 1FNYA 4XETA 1EAH1 4JGYC 4BA6A 1MR5A 2CGPA 1O3RA 5JOWA 2UU8A 4YM2A 4Y24A 2DYCA 5KBFA 1OOPA 2VQTA 4WM8C 2B5HA 2E9QA 4ZS2A 5FZ8A 1US3A 4UAPA 3E6DA 4BQXA 1ND2B 1OI6A 1FV2A 1NCQA 1CONA 5JIUA 5JI7A 1EPWA 2WFF3 1ZRDA 2VZUA 3AMHA 3WEZA 4ATFA 3ACLA 5BNPB 3WQ7A 4A2UA 1YQ5A 3MIGA 4P9LA 1LOFC 2DDUA 3H8UA 1SDDB 3RPQA 3MZHA 3WNPA 4WZFA 5BNNB 2Q30A 3WNNA 1I1EA 1A34A 1AZDA 2W46A 5FLJA 3H8XA 5KWRA 4XUOA 2RS53 4LNVA 1V6LA 5FYBA 1O4TA 4LIVA 2TUNA 1KS4A 2ID4A 2IWGB 5J48A 4K1YA 5FYZA 5DUVA 5HCHA 3B00A 4URAA 1CAXB 3VD4A 4N53B 3THDA 1PHMA 1TNRA 2ZHKA 4BQYA 3J9SA 1PIV1 2IVIB 2VNGA 4K8RB 2E6VA 4Q26A 1AR71 2D6KA 3JB4C 1SACA 5CKQA 4IEPA 5EHDA 4RS5B 3OTFA 2R30A 3KCYA 4R9BA 2AUYA 4WVMB 5A80A 1JN2P 1WBFA 2WJSA 4Y22B 4BQWA 2EIDA 3WG3A 3D4KA 3ENRA 4B1MA 5A3MA 4TLGA 5JSOA 2JDZA 4GWJA 4AGGA 2PQSA 4CCMA 3B02A 3NJVA 4H2AA 4XQ4A 1DP0A 3AVRA 2BP6A 1YJKA 3HR9A 3CQOA 4PLMA 2RV9A 1PVC3 3Q9OA 4BH9A 1VBC1 1S0DA 2GC0A 3C7FA 3HWJA 3Q8EA 3CF6E 4LLFA 4DFSA 1DQ2A 2RJKA 1TEIA 1ZA7A 1BQPA 2XOMA 4XW3A 5CYYA 4Q4W1 1XPWA 4HVOA 1Q8PA 2A1XA 1YHFA 2VZOA 3FBYA 3MF6A 4QXBA 3RYPA 3U11A 5BNOC 1MEC3 2HEWF 4YW1A 1JMUB 3POIA 4RFRB 1Z78A 2YBSA 5J1XA 1VR3A 5GLUA 4LKFA 1W90A 5GZCA 2MNGA 3VZJA 1W04A 2B4KA 4MUVA 2QQWA 3JQXA 4DXTA 5JOXA 1NUKA 1BEV2 4LHKA 4RHV2 1YQ6A 3RFRA 1LOEA 1VIWB 1LU1A 1V6OA 3AJYA 5G04L 5JI9A 1G9BA 5DAQA 3KHBA 1CPMA 1HIXA 4QQHA 4UW5A 2VZ3A 5CA6A 5JUVA 2YHJA 3DV8A 3A21A 4NROA 1TME3 1E57A 3IT8A 3OBZA 2VZSA 2GSYA 2D98A 3OBRA 3AKRA 4HSLA 4Q4X2 4L97A 1IPKA 4Y3OA 1HV0A 1FT9A 1QIQA 1LEDA 1IHMA 2HLEA 5FAXA 5CBLA 3ZFEA 5JAXA 2HWD3 1P8JA 3S7EA 3AKQA 1UYPA 1EV13 1U5IA 4TZDA 5EYYA 4IEYA 4JDOA 4FXGB 3KD4A 1UOJA 4M3CA 1AF9A 2C26A 2ZX0A 3FBMA 5FYHA 2W3JA 5K4LA 5T52A 3D3AA 1QQP2 2A6WA 3FC0A 4XHXA 1S4CA 5B4XA 5M0TA 1LODA 1XYPA 4YZ1A 1JODA 1DF0A 1QDOA 1RTVA 1S55A 2CGNA 4PDWC 2NMNA 4Y1YA 1VBE3 4K8FA 4MGSA 5D21A 4IGQA 4UBGA 1F35A 1V9U2 2VVDA 1PZ7A 3KM5A 2ATFA 1Y7BA 1CR7A 2OW4A 4QAWA 3AM2A 3B9IA 1AL23 3IN9A 5FZCA 4SLIA 4CU6A 5IVVA 2D97A 3WSOA 1W8TA 2OUHA 4JKKA 4PQQA 4YM1A 1JZ8A 3B5LB 2D44A 1MS0A 1XB9A 4CP9A 1S0BA 1F31A 5EJ1B 3KS7A 4NVPA 1A78A 1MS9A 3IDAA 4K7JA 5IT6A 2K46A 1U12A 3ZFGA 4AEMA 5A6XA 2JD9A 4QPWA 5GLVA 5CISA 3POFA 1MS8A 1YFUA 3AFKA 4XDPA 4ARXA 1VAVA 1H8TA 2NMOA 5FK8A 5C9AA 1BBT1 5KXCA 1NKGA 2BBVA 4LITA 3A0KA 1VBB1 3ZFFC 1VRBA 3ILRA 3NL1A 2Z42A 3ZDVA 5F6KA 1LB2A 4YZ4A 4JGYB 4CVUA 1MZ5A 5ABJA 1G7YA 2XUEA 2BUKA 2ZGNA 3HEIA 1ASJ1 3I3EA 4QX5A 5A3LA 3AP9A 3LPGA 2VVEA 1WW7A 2WNEA 2WNVA 3UGFA 4BU2A 4P9YA 4K21A 1G9FA 1ULGA 4Q0PA 1UPIA 1GICA 3INAA 2YV8A 3K4AA 2P5BA 1OPOA 1W6MB 4Q8KA 5KHGA 1HKDA 2J1UA 4AHWA 2R6QA 3RZJA 2D5HA 4KWJA 1DQ5A 1OLME 1MVEA 1YFWA 3HBZA 1C4RA 3BTAA 4OFGA 1QMJA 4QPIA 5EXOA 4YFZA 5KXDA 2EF6A 5FZ7A 2XUMA 3V0AB 4UOJA 5FCCA 3GZTB 1FPN1 4X6QB 4D6QA 2ZKNA 1XNBA 3UYJA 3LOIA 2FDFA 3ZYRA 1YIFA 1SLCA 4UFKA 4ZZ5A 4XILA 5FRAA 2BWCA 2JG8C 4UW3A 3WHUA 4NUBA 4CXWA 4NAMA 2A73B 4GULA 2RJLA 4LBJA 3WXPA 2YYOA 3SQOA 2IUWA 3FHIB 4TXWA 3PTRB 4ZPIA 1UIKA 3NNMA 1I9RA 3H8OA 4M3CE 3CBNA 5LK5A 1G9CA 1UF2C 4HKWA 2UY9A 4LE4A 1RUF1 3I2IA 4AL9A 4LUKA 4AWDA 1RUC3 3EXUA 4H3WA 5FXZA 4CCNA 3GBGA 3KWVA 4CRQA 3OPWA 2A6XA 2OKXA 1UMZA 4UFMA 3BPZA 3OD0A 1GFF2 4NHMA 3ELNA 4D69A 4IE6A 2FD8A 4NOTA 1HN1A 3VKLA 3KT7A 4INDA 4Y4YA 4COZA 1RYYA 3OOXA 2B8MA 3MLKA 4UW4A 3CJXA 4L92A 5FO9B 1BCXA 1PK6A 1RUE1 3W5NA 4W6YA 2XPJA 1K5MA 2ZMKA 3NQHA 2ZOEB 2WWSA 2F17A 1ENXA 3C7GA 3CKHA 2R49A 1EYBA 4DPNA 1QOTA 3ZYFA 2RR11 2DVGA 1DFQA 2VY0A 4YZ2A 1BEV3 2Y6HA 3AP7A 3OPTA 4BQ5A 4RHV3 5F7UA 3UKTA 1ZZBA 3AYCA 1D2SA 1QJX1 1AX1A 5FMDA 2JJ6A 3SITA 1ND3C 5BNOB 1VP6A 4XCAA 2XLFA 3P6BA 3WW1A 5AC91 3VDDB 3ZYGA 4EN8B 5JR7B 4ZHNA 4GQ7A 2CAVA 3E97A 1WCUA 1NY71 5HCAA 5IVJA 5AFEA 1CAUB 4Q4X3 2QQMA 4K40A 2JEMA 4QX7A 3ZN6B 3O0WA 4BCUA 1H2LA 1AR62 4G4FA 4AGVA 3KF3A 4QGMA 5FZAA 4IV3C 3K3NA 1OT5A 1WCKA 3POWA 5EIYB 1ZRIA 5IVFA 3POGA 2Q8DA 1ZBA2 2KXLA 3WF0A 2DCKA 1H1MA 1QQP3 4AQ2A 1JW6A 5IK7A 1M4WA 3MIBA 1J83A 3CDZB 4A45A 1IG0A 1D4VB 1UAIA 2O8QA 1IS3A 1ZZ8A 4HSJA 5FO8B 3ZYHA 2WUHA 3CHXA 2Z5WA 1HDKA 1YXWA 4XJUA 5FBJA 3H3UA 1YIPA 5FYMA 1V9U3 3LSEA 3J7HA 3B9CA 3T3YA 1Q3EA 1RMU1 5FY7A 2D6MA 2HWE1 5FZFA 4EQVA 2R0HA 1XYNA 3EMRA 4N9HA 4M0HA 5H9PA 2H6CA 4JTNA 3I59A 2F4PA 4XURA 3T2TA 1UQXA 2R7EB 4CCLA 4PDWB 1O4YA 3ZN5A 1SPPB 5HI0A 1LCLA 5IVYA 1HB1A 2VCBA 3RZLA 2BFUL 4TWTA 1UYZA 4CDQA 2W1WA 3BIWE 1OXCA 1IPSA 4XUTA 4S2DA 3WZ1A 3E6CC 3ZXFA 1SQ4A 1WCSA 1WA4A 4DOUA 1MQTA 3KMHA 4Z82A 3UNPA 2EXKA 3AL5A 4FFHA 3UV9A 2AR6A 1AR81 4ES8A 5C5TA 3BKZA 3MIHA 5FYIA 4AI9A 5CEHA 4XYXA 2BBAA 4LKEA 5T5PA 1J3QA 2O8OA 1DDLA 2PHLA 2VAUA 4JCKA 3WV6A 1JH5A 1YCIA 3QD6A 4JGZC 1SLIA 3CJIC 3FE5A 4Q4V1 4HANA 1OLQA 4V2WA 5IK5A 1R1ZA 5HV4A 1V6MA 4PT6A 3RWNA 3J7MA 2CHHA 2R062 2WFPA 4BMEA 4NIHA 3W20A 2RM22 2D7FA 4DUWA 3WY6A 5KC5A 2GNBA 1BXHA 2TEPA 3VZLA 4P02B 4DIQA 1DQ4A 4DO0A 1URXA 3ZFFB 3AKTA 4J6GA 3ZSJA 4K3UA 3N7LA 5C3RA 3IDBB 2VUAA 1C8M3 3ACGA 3T0AA 1OF4A 3PIJA 3OY8B 1TVGA 1K45A 4XTMA 3EBRA 3OD4A 1GR3A 1EY2A 4OMDA 5FZ6A 5J96B 3O14A 2CU5A 5KXBA 3MW3A 5BV6A 3BU0A 5GZFA 2UY8A 2WA3A 4HPKA 2JX9A 3TEYA 2CGOA 3I7DA 4FOWA 3WF4A 4CA9A 1XU1A 1JZ3A 2WZEA 2DCYA 3FLPA 4XIOA 5C33A 1ULCA 2C4XA 2DURA 2GDFA 2VBDA 2VMCA 2VGDA 4QQOA 5L9VA 2VPVA 3B7MA 4M4RA 5IFTA 2YPJA 4WVWA 2ZCWA 1W3VA 1OQ1A 3NNLA 4B4PA 1RUH1 2YGLA 1RUD2 1JZ4A 5A7PA 1GSLA 3DGTA 4CEWA 2JG8B 2P17A 5C7GA 4CDUA 2IZWA 1TMF1 4I3PA 4OHZA 5J7MA 2RS12 4WVVA 2GMMA 2FZ2A 1GNHA 1C28A 3K77A 2Y33A 3AZWA 4COWA 3DL3A 5F37A 3NV2A 3ASIA 3R4UA 2BEOA 1J59A 2XDVA 1UZZA 3ETPA 2I45A 2J1RA 2UWAA 3AZZA 1AYN1 3IWZA 4D7SA 4LBNA 1W6QB 1F4AA 3K3OA 3K75B 4MXWB 3T09A 4HVQA 2X05A 4I02A 2EVXA 1UY2A 5T55A 4AVTA 3QCWA 2YGMA 4FBFA 2VU9A 4RQPA 4RN5A 1CZVA 5ACA3 2G1MA 2QVSB 5KHHA 4XF3A 2BW8A 1OF3A 1ULDA 3BIEA 2OZJA 5ANQA 3HPNA 2FDGA 2W94A 2AEYA 1POV0 4XCBA 4LBQA 4OI2A 5KHJA 2ERFA 4LO6B 3R0RA 1C1LA 1QNWA 3HT1A 3LWCA 4JVAA 4OVEA 4UFJA 2VMIA 4ITCA 5FBZA 1NLSA 2ZMNA 4CE8A 1AR63 3VZKA 5J09A 1WLTA 2R041 3DPRA 1ND3B 4LUMA 2IXLA 2WLPA 4LKDA 3X29B 2VBPA 5T3NA 4N43A 4KWKA 2UWCA 3RGBA 3FFQA 1ZBA3 1G86A 3PUHA 1HXS1 4LJHA 2PTMA 1GP4A 3WF1A 2CWSA 1JZ2A 5A7WB 5LBCA 3U4SA 3VBRA 3V0AA 4FPHA 1SZBA 1WW6A 3QOPA 4P9XA 1W2AX 3LA2A 1K42A 3PVEA 2ZGUA 1WCDJ 4LBLA 2Y6KA 2MEV1 2D6LX 3GXUA 3GZAA 4XDQA 1N1YA 4MGQA 2A6ZA 4GH4A 4P14A 5I8SA 4P5HA 1HQLA 1UW8A 3MPPG 4BQ1A 2QQPA 4XMIA 3AP5A 2QQOA 2Y0OA 4HG6B 1JOBA 5CFDC 3T1LA 3CZJA 2AH2A 1OHFA 4LEJA 3ZYPA 1H6XA 2UWBA 5I8TA 4CUAA 4LA2A 2VXRA 3WG1A 5A3NA 4WBBA 5LBEA 4FTBA 1AYM2 4DY5A 1PO12 4PF5A 2VOKA 3BUCA 2Y60A 2PLV1 4YRDA 2ARAA 2OUJA 1HW5A 4KWLA 4CU7A 5LA2A 2CY6A 3O1SA 2JKBA 4NHLA 3NAPC 4HVRA 1GBGA 5BNPC 5C3OA 1RHI1 2VCAA 3IPVB 2FDJA 4ASLA 1A3KA 4HKLA 3GJAA 4RFT0 2VQUA 2DFBA 3NJXA 1YYNA 2FZ1A 4TSVA 3I97A 4MYEA 4JQTA 1RXGA 1HQWA 3VBHC 1PZ8A 3RZGA 1O7FA 4XAEA 5C3QA 4KGQA 2VL4A 4NHYA 3JD73 2ZABA 4DS0A 5I91A 2PHTA 2JE9A 4YVSC 1FMD1 1O59A 2RDRA 5FMOL 4IEUA 1IKQA 1W0PA 2R063 3TN92 5F9TA 2RM23 4XVHA 3NWKA 3WP6A 2BGPA 2D93A 5H9RA 4AEJA 2GC1A 4CP0A 1NE6A 1POV3 2J42A 3E1F1 4GD4A 4JGZB 4ZKTB 3CJIB 3WG4A 5A3TA 4LO5B 1VB2A 5BUVA 1W0NA 1F15A 1W2TA 5JXHA 2RDSA 4Y4RA 1GQPA 4RS5C 1UKGA 4LMFA 5FY9A 4IE7A 2XGXA 1RUOA 4GB31 4XFIA 1H1AA 3MICA 5FDBA 2VTXJ 4CDXC 5IAXA 2X8KA 3EHKA 3T2OA 1OSGA 1RUI3 1LGNA 3PVBB 2GC2A 1VRH1 2YFZA 4Y1UA 3LDRA 2ZX2A 3WCRA 4DZGA 1V6KA 4AHXA 2JWPA 1BLZA 2CSGA 1CAWA 2FMDA 2L9LA 5F3EA 3URFA 3WNXA 2HWB1 5A3PA 4EZ4A 4GMP3 1IS5A 4PLNA 1W8NA 3Q8CA 1CX1A 4YZ5A 3NRUA 3K51A 4GKYA 1RUD3 3POEA 1WLWA 3AXDA 4U36A 1W2NA 3O1MA 4I0BA 1VE0A 2W1QA 2VVFA 5EJ3A 3LIGA 2VW0A 5AVPA 5JMOA 2WZR2 1YI9A 3MV11 2VXJA 4N7IA 1LULA 4YG6A 2WZPP 5B4NA 3KHCA 1H9PA 5GZEA 3LA7A 4IERA 1E5SA 2BOIA 4Q5OA 4RYDA 4Y5SA 4TTGA 2B9UA 1JYVA 1LR5A 3LSDA 3Q8BA 3CNAA 4ZS3A 1JYXA 2FDKA 1QEXA 4CXXA 1PIV2 4CDQB 4DY3A 1AR72 1CGPA 4GJZA 3ME2A 5BYNA 2IFWA 4DINB 3NV4A 1T6BX 3OYWA 3WLUA 3ILFA 1NA1C 3V56A 2H0VA 2XQXA 4E4SA 4Z8BA 2XKPA 3KT1A 5KHKA 3ZXJA 2C9KA 1B35C 3HBKA 4XZPA 3P1IA 1HRI1 5HCBA 2HEVF 1H6YA 5DDJ1 1U5YA 3OCPA 1W6NA 4XZUG 4J1WA 4LBOA 4O9EA 4YNIA 1DHKB 4UFHA 3CMGA 4C90A 1KRIA 4GA9A 1E5IA 4A6SA 1ULEA 3AZYA 3N9NA 4LO8A 3MDPA 4QQLA 4FPCA 4NHKA 2W5FA 4Z1VA 1YEWA 3DXTA 4H7LA 3DYOA 3RJ2X 4DNYA 4QX8A 2O1QA 4CEYC 3UETA 5C4WB 3I8TA 4HXCA 4WM8A 4K20A 1REEA 3O7OA 1RUG1 4HN1A 1EP0A 5FZIA 4CCKA 1YRZA 2OQ6A 3RJRA 4AEDA 4E27A 4E4DX 4Q4W2 2DU1A 1PM7A 3P3PA 4IV1A 5CADA 4XJ8A 5FY8A 4RR3C 1S0CA 2YC2A 5I0TA 4NO4A 4LLOA 2J1EA 4ONUA 1UN1A 5I8YA 1AHSA 2ZX4A 3B01A 1HB3A 5FYSA 5D8AC 5C8CC 4CSWA 4L11A 4R9DA 2ZA9A 4HPKB 5FPZA 4D7TA 2DF7A 4QDSA 2EXHA 3G7DA 3LEMA 1R091 3ILNA 4A7ZA 1CX4A 3SEPA 4QXCA 3JBG1 2BJSA 3EQEA 1ODMA 3MBWA 3O0VA 4IE5A 3FHAA 3JB8A 5LRSA 5FUIA 1WWYA 1AYM3 2HWC3 3ACHA 4KU7A 3ZR6A 1PO13 2WIIB 1FXZA 3VBFA 4YGBA 3AL6A 2GP5A 5K8SA 1QXRA 1UD1A 2A3XA 5LWBA 3ZSEA 2YU2A 1HRV1 1IPJA 1UY0A 5FY4A 5I93A 3WW4A 2WAAA 3VBUB 5CFDB 1CJDA 1SEFA 5FQ0A 5EV7A 1CVNA 2VZTA 3AP6A 2DVBA 2YBPA 4XQWA 5A7NA 4Z2WA 4SBVA 1MS3A 2GH8A 1S0IA 4CCOA 1OKOA 3E5XA 1O3TA 5DG1A 1NCRA 3NAPB 3SH3A 1MZ6A 2W91A 4XF1A 2GAUA 2VZVA 1G6NA 5K0UA 4CUBA 3VKFC 2E51A 4MV2A 5FUPA 1F5JA 3J4UH 4YW6A 3TN93 1WCQA 5FP7A 3D82A 1GZTA 4WVZA 2RHPA 1YWKA 1ZRRA 2VCCA 4P5YA 4V2VA 1CQ9A 2Y26A 3ORJA 1WLDA 3VBHB 3ZSLA 3HN1A 2ET1A 1W6OB 4XF4A 2Y64A 3LA3A 1RB8G 2WQ8A 4FOYA 2XQRA 2W1UA 4IXLA 4LQRA 5A7SA 3Q8FA 3OPZA 4AYUA 4C0BA 4HOOA 5L7OC 2PA7A 5L19A 4R9CA 4YVSB 4NIAA 1PX4A 1W2UA 3C3VA 1YFXA 1COV1 4H14A 4L99A 3VV1A 3WF2A 2SLIA 5A1FA 4XDOA 2VOVA 5A3OA 3VKOA 1UPSA 2QQVA 4A7KA 2X53S 2RG4A 2C24A 1GWLA 5CFCC 4FCAA 4KG8A 2AREA 4BK4A 1GQGA 4BXSV 3I4IA 2SBAA 3MFAA 1D0GA 2WYSA 4LR4A 5GZGA 3U75A 1JZ6A 3M2MA 3N9LA 4ZZ8A 1BBT2 2DCTA 3QACA 4N43B 4MXVA 5IAVA 4OI0A 1VBB2 4HT1T 3OBTA 4XOGA 1HB4A 3BI3A 1W9FA 3G6JB 4EN6B 4CDXB 4PIYA 1AXKA 1ASJ2 4YG3A 5GM0A 2V5DA 4P9JA 5EQUA 5FZOB 4L9BA 1XE7A 2BTVC 3USUB 4LXLA 5FV3A 1Q8SA 5LBBA 1NOVA 2GN7A 4A7YA 2ZAAA 3SLIA 2WZR3 4XFCA 1S2KA 1UYYA 1R1A1 1YI7A 3ZMOA 5FIXA 4LULA 5GALA 2Q8OA 2EICA 4KNCA 1OOPC 1Y9MA 1GZWA 3T4VA 3WCSA 5CB7A 3MI8A 5JMCA 1FPN2 4JKLA 5LK7B 1NCQC 2D6OX 1PIV3 3H3ZA 2EALA 1I3HA 3M7AA 4HKOA 3VDDC 3VB9A 1BJQA 1AR73 3WDUA 4CPBA 4CTEA 1PGW1 4IDZA 3SISA 3U07A 1LHOA 4C0HA 2E7AA 2WS91 1VAMA 2YB7A 1VLNA 4XXAA 1ENRA 3THTA 2VCMA 3HNMA 1DGWX 2DU0A 5HCFA 3LE0A 2AACA 2WZ8A 4PBOA 4ISRA 2DVAA 4FO9A 4QU2A 4RGKA 5F5QA 2WO3A 4PI0A 4C8DA 1Y9GA 5FXWA 3CEWA 1RVF2 1BMV1 3I3QA 3MFCA 3SC7X 1RUF2 1K3IA 1YO8A 3CIHA 1NA1B 3OBAA 1JOJA 3OGVA 2QQNA 3ACIA 5FPLA 1B35B 3KSCA 1T6GC 2A7AA 5D1IA 4D0QA 2EA7A 4BMBA 3CU7A 4QKDA 4MHRA 1PNGA 3UJQA 4EN0A 4Q4W3 5IVBA 3GNEA 4AVSA 4F7ZA 2ZGKA 1PGL1 1RUE2 4XJAA 3KV6A 2VC9A 1DQ1A 3T0BA 5JWPA 1YNAA 5FZMA 2BYVE 4OHXA 4CUGA 4CEYB 5LCWL 3I3DA 5A33A 2XBO1 2A5ZA 3V64A 2YU1A 2RR12 4ZU4A 2ZPXA 1QU0A 4G3YC 2WAOA 3T1MA 1QJZA 3B94A 3HQRA 3N4MA 1DZQA 3IZOA 3VLBB 1SLLA 3KV9A 5CG9A 1QJX2 1UOBA 4RR3B 4BQ4A 5AC92 1NLRA 3RDIA 3QH7A 3WOGA 1APNA 1NY72 3APBA 3FMGA 4QPGA 5D8AB 4CDWA 5C8CB 3BPSA 2PMWB 4XACA 3VD7A 2E53A 5JPMB 3ZOIA 1LHWA 4NRMA 3BVCA 3VDAA 5CG8A 2W08A 3ALQA 3JQWA 3PMSA 3HNYM 5CKMA 3OGRA 1RUJ1 1EUUA 4AK3A 2XJPA 4E2QA 1JU4A 2WT0A 5CNAA 4YVWA 4C1WA 3J8F1 4CXYA 5IVEA 2ZGTA 3VHPA 2PQQA 5E6HA 4GJYA 5FMBA 2JE7A 1NLQA 3AYDA 3V0BB 5SV5A 3KB5A 1IGOA 2X5IA 4KL1A 2C5DA 5FP8A 3OJBA 1QOOA 5FYCA 4AQTA 4NR1A 2IVJA 4MX3A 1R081 1QY4A 1RMU2 4FFFA 1DCSA 2HWE2 2VECA 3ZYJB 4BWOA 5ISLA 4ZY9A 5FMCA 2QZ3A 2YMZA 2P4EA 1W8WA 4OI4A 4NIDA 1PX3A 5GJ6A 4R8HA 4NJ4A 3H3LA 3MV01 4H55A 4DXZA 1EPZA 3ZFEC 1OUXA 2A70A 4ISQA 3E5UA 3SCHA 1W39A 1JYIA 2VNRA 1UXXX 3LPFA 3RQ0A 4LBQD 5IUQA 4BLIA 4E2GA 3PDQA 5DAPA 5APAA 3ZXGA 3IBMA 4BDVB 2JDNA 5FPBA 3ZXDA 2GZWA 4O61A 1AR82 2B7YA 1QJY1 4JZRA 4UXAA 5L7OB 3O1UA 2FCUA 3M4FA 5DQ0A 3ZSMA 2IXIA 2YZ4A 1BBT3 1RUC1 4YZ3A 2VW1A 1VBB3 2VMEA 4YFWA 2ARXA 5K9YA 4Q4V2 4IV1B 5J3UA 1UZVA 3ZKYA 2OVUA 5CFCB 2DVDA 2MPFA 3C7HA 2BNNA 2A71A 3PUSA 3LZZA 1ASJ3 3WQ0A 4OCTA 1US2A 3ZR5A 1ENQA 1F4HA 5FZGA 5FZ1A 5HPOA 3IMNA 3SNMA 1DGRN 2BFUS 5DMYA 2GMPA 1JYTA 2Y6FA 1AX0A 4QD2A 1PO21 1WW4A 2RS31 2K9ZA 3VBSB 3ZFGC 1BHGA 3TRSB 3WNOA 1H2KA 2R1DA 4BQ2A 4E8DA 1FPN3 2X29A 3PIGA 4PLOA 1Q56A 1LNSA 3ITQA 3UKNA 2JB4A 4JRLA 4W65A 1AUYA 2HWF1 5EYXA 3VBOA 1HV1A 2ZHNA 3OGJA 1SFPA 2WRAA 5ABJC 1N3OA 1OURA 4OHYA 1OOPB 1RL3A 5FFOC 1UNBA 3PLQA 1CAVA 1X8MA 2WNVC 4YM3A 1TZOA 1ZRFA 2D6PA 4LKSA 2W52A 4AFBA 1NCQB 2XLGA 3RSJA 1RUH2 1RVF3 2YUEA 3H50A 1S2BA 4LK7A 4QMAA 4QWNA 4FP3A 1RUF3 1NCRB 1C8NA 1TMF2 4YM0A 4AFDA 5K0UB 3ZKUA 3SHRA 2XMLA 5EFUA 4WM7A 4MGTA 3VL9A 2WNUA 2F6BA 3H0OA 1REFA 4ZONA 2D3RA 3C7EA 2Z4FA 3L2HA 1DIWA 4FAHA 2KD7A 1H0BA 2A3WA 3WNMA 1ZVFA 5H9QA 4C91A 3UL2A 1LOCA 2IFRA 4R9AA 1JZ5A 5GZDA 3PJYA 2FQPA 2KA3A 1AYN2 3AMMA 1RUE3 1X9TA 1BK1A 1DZTA 3KZ4C 3ZIXA 5LA1A 1YC61 2XJSA 3N36A 5JZGA 1GKBA 3WDXA 2OQ7A 2FMYA 5FZ4A 4LE3A 5HBAA 5FP3A 5C5UA 3T2PA 3LD8A 4EJRA 2RR13 4HETA 1S0FA 1UU6A 2O14A 4IEVA 1LGCA 3D8CA 4BOWA 2ARBA 2XJQA 4QX1A 1QJX3 5GKAC 3W9AA 4ATEA 3MLJA 4DUVA 4F8AA 4P08A 4COVA 1S2EA 3V65A 5AC93 1MACA 1FI2A 1KGYA 5LA0A 2G9ZA 3VN4A 2ZX3A 3K46A 1UX6A 1A6CA 3A4UA 4IEQA 2K2SA 5FYTA 1TG7A 2BNMA 2W47A 5DZGA 1XU2A 4FPFA 1K5JA 1XE0A 3VDCA 5L9RA 2EAKA 4J1XA 2R042 4K9SA 1PK6C 2DV9A 3WNKA 5LB6A 1K5MC 5C8WA 2RVAA 3IKWA 4TLFA 4YWAA 3IDCB 1SFNA 2P2KA 3MW4A 5GLTA 1HXS2 5FP9A 5I0SA 3K4DA 4O9GA 1FNZA 3NNJA 2PXJA 1VAKA 1SFYA 4EWAA 5J98B 3VDBA 2VUDA 1SLBA 2XJTA 1X82A 3LEIA 5FLIA 2NPIA 2ZEZA 4XE9A 3VL8A 1C8M1 2G19A 1ZZ6A 2MEV2 2ZGQA 3EB7A 1RMU3 3FZ3A 4L8QA 4FP2A 2X10A 4FTEA 2AC1A 4H7MA 3D0SA 3KQRA 4IETA 1E5HA 4XBQA 2Q8CA 4I3GA 2Y0IA 2ZGPA 2JDKA 4KU8A 4QDQA 1IG3A 4XMAA 5FTTC 2YBKA 3GZEA 4D6SA 4I30A 2P34A 2JG9A 5FOJB 1BZWA 1W06A 3PHMA 4GKXA 5EWSA 4CYDA 1S0JA 2PLV2 4GIQA 4GXLA 1QDCA 1O8SA 4HK9A 4O7XA 3JU9A 4Q4Y1 1Q43A 2ILMA 1RHI2 3T0DA 5SV8A 3IIAA 4OUMA 5F5CA 3W21A 3ZFEB 1AR83 1HQNA 1QJU1 1LECA 4Q0SA 2TBVA 2Z69A 3FHQA 2HBTA 1SG3A 2W9XA 4KG0A 2QJVA 2R1BA 1XC6A 4AI0A 2Q1FA 5GLZA 3H1YA 4M3CB 4QGLA 4Q4V3 1DZRA 1Q8QA 2LRPA 2V4AA 4CZSA 5HV0A 1UOGA 1CWPA 1ZZ9A 1FMD2 1J58A 4LBKA 4X8PA 1IQAA 1C3HA 2XWBB 2A6VA 2QUOA 4AOCA 1DLCA 5A33B 2QQUA 3BN6A 2B42B 1W99A 2FDHA 1OUSA 4EZHA 4PHZA 4CDQC 4UBHA 1FOD2 1FATA 4ZXKA 1UZ0A 4NIIA 5FJKA 2Z79A 2BRTA 4EROA 1UMHA 4QM8A 4UF0A 3VKNA 3KGLA 5DPNA 1MQTC 2WA4A 3WR0A 3FX3A 4JC1A 5ACA1 4RGAA 2PELA 3VD3A 1AR91 4QX3A 4GB32 3OSDA 4DRRA 4FT8A 4YPJA 1LAJA 4CP9B 3FN9A 2ZGLA 1VRH2 5FP4A 5FY0A 1XRUA 4S2HA 2E26A 3ZFGB 4HLTA 4NWWA 3ECQA 3I49A 2P3KA 1STMA 1FYUA 2OPWA 5C4WC 2HWB2 1HLCA 4Z07A 5FMOS 3TWIA 1ZBE1 3MIDA 1U0AA 4DXRA 2D43A 3H8RA 1H8TB 1PMJX 3JZVA 5C9AB 1ND2A 2QQKA 2XJVA 4NPMA 1RUH3 2YFUA 4MG2A 4XF0A 3VZNA 1W8HA 1IS6A 1KEXA 1TMF3 2NQYA 2WN2A 1NAEA 3ES1A 5ABJB 3GCWA 4GWIA 3PNAA 2Y6GA 5BNPA 1UL9A 2ZZJA 3ACFA 4F83A 5FPAA 3PJQA 3DKQA 1JU3A 1KDKA 2WNVB 4WZCA 5JXJA 1RINA
chains in the Genus database with same CATH topology
3DN7A 5BNNA 3WVJA 4Y1XA 3JUUA 1AVBA 1AYN3 3ZX7A 4QPIB 5KHIA 5T5OA 3SXWA 3EO6A 4GMP0 1ONAA 1CAXA 4N53A 1HRI2 5DDJ2 4CEWC 1NQJA 2WKKA 3QBQA 4CDUC 1N3QA 4B7EA 4PJYA 3VBUC 1UKRA 1J3PA 4ORFA 4RS5A 4QQ2A 4TYSA 5T50A 1H30A 4XFBA 4Y22A 2JD4A 4HK8A 4PIXA 1GZCA 1Y9QA 2YY1A 2R043 3WX5A 1RUG2 4LTAA 2DUOA 2XL9A 3JD71 1FX5A 1KJLA 4YW2A 1J3RA 4AHZA 1D4M1 1HXS3 5DG2A 5TSWA 4RQPC 1CPNA 4LO7A 1SBDA 4EN7B 2NN8A 3MIEA 2Y38A 1PK6B 4XFGA 2XVLA 2D6NA 3WUCA 1H2MA 4Z2WA 1K5MB 1W6PA 2MEV3 2Q5TA 4IQPA 1BKZA 1R092 1X7NA 5DZEA 5IUQA 3ES4A 3JBG2 4XJWA 1LHNA 4KBBA 4FTSA 1LHVA 4Y5Z0 4Y1ZA 1M06G 1ZNPA 3EJKA 4MLOA 2PAEA 1CAVB 4P9WA 1RUI1 2QDRA 3DPRC 1JHNA 2PLV3 1LGBA 2AGSA 4N43C 4HZFA 4Y1VA 3S6PA 4EV0A 4WV8A 1HRV2 1EAH2 4MGZE 1RHI3 1O3SA 1QH7A 3VBRC 4COUA 3H7JA 2ZHLA 2Q0AA 3ZXKA 4S2GA 3M70A 1LU2A 1NE4A 1LJ7A 3M8LA 4GH4C 1VB4A 5CU1A 4YGCA 3HMYA 1V00A 3MEPA 3BB6A 1FMD3 2YROA 3AMQA 1Q8OA 5JDBA 2TNFA 2LTNA 5KC6A 2WQZC 3FUQA 1DG6A 2V09A 4JAAA 1CN1A 2RS13 1FOD3 3ZSKA 3SCGA 1MZFA 3ZO0B 4RSUA 2R071 1COV2 3I59B 4MVTA 2DFCA 4NWVA 1JBCA 4B8EA 1GNZA 2HKXA 5IK8A 1WUVA 3SCFA 1NZCA 4GB33 2OIIA 2RE9A 1Q8VA 1OQEA 5FLHA 3AYAA 4P9IA 4CP1A 4META 1VRH3 2B46X 4BZ4A 1GLHA 3ST7A 3ZXEA 1PNFA 1REDA 1VBA1 1VBD1 1ZM1A 3KGZA 1F2NA 1G9DA 5GLWA 1MQTB 2C0ZA 3TBDA 4AI1A 2HWB3 3WDVA 1WBLA 3RYRA 3N7MA 5E89A 1YLLA 5JSRA 2DTWA 1YJLA 3FJSA 4JGYA 4FSJA 3NVCA 4YG0A 1R1A2 1VBC2 3MW2A 4XXPA 4PBPA 2HYKA 1WMDA 1C5IA 1QXPA 4HMZA 2C1FA 4AFAA 3TAYA 3D6EA 1W6MA 3WP5A 3LAGA 2BNOA 2RMU1 3KCCA 1F8VA 1Z7S1 1MZEA 1LOFA 4FVVA 4I0WB 1PGW2 2DUPA 5BY5A 2WC2A 1H8VA 2A3YA 4QGNA 4YW5A 4AHYA 1NYWA 2HWC1 2WS92 4OLLA 2LUWA 3WP3A 3M3QA 1HRI3 1ZYBA 1YFYA 3CO2A 4FXKB 3N7JA 5DDJ3 3NKTA 4FPLA 1JYCA 1S1AA 2YDEA 4AW7A 4BIOA 1BMV2 4RD7A 2BGCA 3S0MA 3AKPA 3LGRA 4GWNA 1ALYA 2I07B 2ZZQA 4FAGA 1AJOA 1OA2A 1MS5A 4XPVA 1LENA 5J37A 2PHRA 4CEWB 2WFF1 4JTOA 4CDUB 1RUG3 1H9WA 3BOWA 3RS6A 4XF9A 4CYDA 1N1TA 4BCUA 2E63A 5AVAA 2W0XA 4GWMA 3RMYA 1LOGA 3AZXA 4B3NA 4V1PA 1PGL2 2BVBA 1LOBA 4I01A 4IESA 1O91A 1QH6A 1LKNA 2UYAA 4HL0A 1GZ9A 1KFUL 1PGSA 2XBO2 4QXKA 5JVVA 3RG0A 1ZREA 4YGDA 2RS51 1XNKA 3WW3A 3RYKA 1R093 4E4ZA 3AZVA 5K7PA 4AE2A 3JBG3 4RQPB 4AEKA 3WUDA 4MGKE 3N7KA 3HT2A 3O12A 1WD4A 3WDYA 5BNOA 2HEYF 1AL0G 3VZMA 3VDDA 4LBQB 4AEDC 3GBWA 1HRV3 4IV1C 1G8WA 1EAH3 2E7TA 1RUJ2 1CAUA 3O0XA 3ZN6A 1XE8A 1J1TA 1ZRCA 1S0GA 3J8F2 4W6WA 3DPRB 1IS4A 3ETQA 1OPMA 4RGGA 2WZR1 1PVC1 1DQ6A 1QWRA 3KT4A 4AGRA 3VBSC 1R082 5LRRA 3VBRB 1UU5A 2NM1A 2H6BA 4DQAA 3MGUA 1ENSA 2VMGA 2ZBJA 3DUIA 3VBFC 1RGSA 3GHMA 2ENRA 1MEC1 4GH4B 4DRVA 3VKMA 4C1XA 1ULFA 3IDEA 4XFFA 1COV3 4FOVA 3TNQA 3LB9A 2WT1A 2ETEA 4B4QA 4CP2A 1LTEA 4PDWA 2ZX1A 4M00A 3IM0A 2NP0A 4XQDA 1XQNA 5DUWA 1QJY2 1TME1 5JIAA 3ZN4A 1NCRC 2GNTA 3PMEA 5K0UC 1OQDA 1RUC2 4FPGA 2CYFA 4W6XA 5E16A 3S7IA 2HWD1 4AG4A 3MIFA 3B3QE 1EV11 2ZKLA 1KJRA 3NO8A 1KS5A 1WMEA 2CV6A 4QHBA 1N47A 3WQ1A 1W6PB 1JXNA 2PAMA 1N3PA 4Q27A 3AB0A 1PO22 1R1A3 1UCXA 3PVOA 1VBC3 2N7GA 1V6JA 1Y43B 2RS32 4JQRA 1QHDA 1VBE1 4AFMA 3ZYIB 1QXJA 1TQ5A 3HIFA 4EWEA 4OHVA 3ZFFA 5B2GB 4XFAA 2QCSB 1AL21 2VOXA 2ZAHA 3OY8A 4M3CF 3AP4A 3R4SA 1RC6A 2HWF2 2JENA 4URTA 3WT3A 4LHNA 3FLRA 2WS93 2CAUA 3NW4A 5DUUA 1FAYA 2ZS6B 2QFEA 1XYOA 2KM2A 2VNOA 2WQ4A 1SLAA 4YW3A 1S0EA 5E88A 1CAWB 1UIJA 1KITA 2HJIA 4BLJA 5I0RA 4NPRA 1WLCA 1JUIA 3LKJA 1BVP1 4Q1RA 1KFXL 1GQHA 5KXEA 2ZJCA 4FPEA 3WP4A 2JG8A 2G4IA 3CLPA 2WSUA 2XKOA 3KCXA 1HX6A 1SLTA 4XTPA 5L36A 1XNCA 4MSVA 2BPA2 3M3IA 2GC3A 4AI2A 4A3XA 2XBO3 2ET7A 2E7QA 3CL1A 1RJ7A 3WHTA 4AXOA 2VH9A 4AVBA 1QGLA 1W6QA 1NG0A 4LBMA 5JSPA 3H7YA 4MXWA 3OYWB 4Y20A 3BOPA 1KD7A 1ZZ7A 3DKWA 2QZ2A 2O0OA 3HD8B 3W59A 1W6NB 3ZVXA 4BYYA 4OULA 2NLRA 3R6SA 5C6CA 2V73A 2VULA 2XH6A 4S2FA 5T5JA 1QOSA 1AX2A 1DGLA 1RUJ3 3DF0A 3GYDA 5LEKA 2Q1ZB 1Z0HA 3ZIWA 4AI8A 1H4HA 4RA0A 3QH6A 4WM8B 3J8F3 4D94A 2BVVA 1ND3A 5BPXA 2CNAA 1SCRA 3PVNA 4AEDB 1A8DA 3AKSA 1I5ZA 2CWMA 1C8M2 4XBLA 2D5FA 1DLLA 1R083 4QPGC 4CDWC 2XG3A 2JXAA 4I09A 4XJZA 4IV3A 2D3PA 1NXMA 2P3JA 4OUSA 2IXJA 3AJZA 5I0UA 2WSVA 3AFGA 1D2QA 1GYKA 5A32A 2LM3A 4XBNA 1BEV1 4YVWC 4E2SA 4Q1PA 2PAKA 3H9AA 4Q4Y2 4RHV1 1BVVA 3C2UA 3VBFB 1H8TC 5C9AC 5JPNB 4Q29A 2X5IC 1QJY3 1RVF1 3KLSA 1QJU2 4FPKA 5JOZA 4ASMB 3MYXA 4Q4X1 1RUNA 1SCSA 3RI8A 2JECA 5H9SA 2H0BA 5FQ0B 3IPVA 4P9GA 2VOWA 4QPYA 3BCWA 3GHNA 3NSTA 2XVGA 4FPOB 1X50A 3W58A 1QQP1 4M01A 5DXDA 3RZZA 4QPIC 4LHLA 2YXSA 3AK0A 4EN9B 1PO23 2RS33 2FHRA 1DYKA 3WDWA 4LA3A 4IEWA 5ACA2 1V9U1 1AR92 2DTYA 4LO4B 1DGRA 4JGZA 3CJIA 1KQRA 4BPZA 3TOJA 4N9IA 1UZYA 3M3EA 3E5QA 1C5HA 4XJ9A 2HWF3 3M3OA 3ZPYA 3ZXAC 2VUJA 1L3JA 1UU4A 3B69A 1ZBE2 2Q4SA 4N7UA 1VALA 3RNSA 3VUOA 5CAZA 2WLQA 3FLTA 1B09A 4JRAA 2OA2A 3SMHA 2W68A 4AI3A 1OLRA 2GU9A 4FOQA 3AXEA 3TYJA 2WINB 3E6BA 3NJZA 4BM8A 3VHOA 3U4XA 3GF6A 2IXCA 4Z92B 1DBNA 2XL7A 3H1WA 4EWDA 1X33A 3VBOC 5JLVA 2JICA 2LALA 3MF9A 4D7YA 1GZWB 4FPYA 3J26N 5FOBB 1MS4A 3NV3A 1LHUA 2HWE3 2PHFA 2Z2SB 4B4RA 3UKVA 2QE3A 3RRDA 4IEXA 4WM7C 2R0FA 1PVXA 2VW2A 2WNUC 1U5ZA 3JCIA 4OHWA 4UW6A 5DZFA 2XWJB 1IKPA 4YYOA 3HAGA 3ZDSA 1JUHA 3JD72 1X36A 1OMIA 2AENA 2G9FA 5JZGC 3UK9A 1D4M2 1LESA 5EZWA 2D3SA 2ZGMA 5C4WA 4BE3A 4GALA 3NV1A 3H1MA 3MPBA 3AYEA 2GH2A 4DB5A 2ES3A 4B7KA 3LOBA 1OA4A 1NXD1 3K48A 4HFSA 1IZ3A 1WMFA 4YLZA 4DMIA 1SBEA 2P3IA 3I54A 3M1HA 1WGPA 4N90A 3VHNA 2WT2A 4FQ4A 5JOYA 4B29A 4RL7A 2FBEA 4R4XA 1RUI2 4D3WA 4ZU7A 1U5XA 1OKQA 3QLQA 2A75A 1TE1B 2Q1MA 3TNPB 3U10A 5IK4A 2W39A 4IL7A 4QPGB 4AVVA 4CDWB 2QNKA 4KGGA 4Q4Y3 5E1RA 1J1LA 1SMVA 2EIGA 2XB6C 3HQXA 1BYHA 5BXXA 4Q0QA 1QJU3 1QNYA 1N1SA 3BODA 5CFDA 1LEMA 3VBUA 4YVWB 2VQ0A 3THPA 3N3HA 1SBFA 4PQ9A 1AR61 2PFWA 1WW5A 4M0NA 1O5LA 1OA3A 3WDTA 2P37A 1I6XA 2X5IB 1MS1A 3POSA 2BQPA 2JG9C 1ZBA1 4KQ7A 3L9JT 3NAPA 4R4ZA 4X8NA 1V70A 2NYYA 2DWRA 2OZ6A 3GALA 1SDWA 3FFZA 5CVRA 4Y20B 1D0HA 2R072 1X8EA 3VBHA 1W6OA 1AR93 3D5OA 3MLLA 1JTZX 5E8AA 2DVFA 4Q8LA 3BALA 2PYTA 4YVSA 2AYHA 2CTVA 4BIFA 4YSFA 4Q0VA 3FUOA 1VBA2 1VBD2 4FPJA 3ZMNA 2GNDA 1GANA 1ZA4A 3WG2A 2ZMLA 3RI9A 4AFCA 1NQDA 3L2YA 1ZBE3 4PCRA 4MZUA 4HBNA 1F9KA 2I74A 2QKDA 3RMXA 1DGWA 4WVMA 4CDXA 1DYPA 3GZUC 1RJ8A 3N35A 4MH0E 3USUA 2R32A 4IV3B 1H2NA 1LRHA 3PTYA 4XHBA 1TNFA 2PHUA 2R061 4G9SB 2RM21 2RMU2 5A32B 1Z7S2 5CIRA 1YUDA 1POV1 1QF3A 1C1FA 4F3JA 2A6YA 2HWC2 1ND2C 4LT5A 5AFBA 2YC0A 4AQSA 2OPKA 1VJ2A 3VBOB 3LCPA 1QKQA 1MVQA 3AMNA 2XJRA 3VHRA 5BNNC 1H1IA 3OGGA 2ZGSA 5FPXA 2WFF2 2IC1A 1XXNA 1FV3A 3UJOA 1C57A 1XNDA 2DCZA 3B93A 4QQPA 4GMP1 2V5YA 1NA1A 4BHPA 2WL1A 4WM7B 3ZXLA 4QT6A 2WNUB 5FO7B 1D4M3 1B35A 5FREA 1RUD1 2MHFA 4YARA 1PZ9A 4N53C 2NZ9A 2RS11 4OI1A 1FOD1 2RS52 3GBFA 4Q2FA 4FQZA 4IEZA 5JZGB 3R05A 2B45X 3ROUA 3ATGA 5JCTA 2I2SA 4CEYA 2ZGOA 1CESA 4JV4A 3USSA 1KDMA 4I0AA 4Q0UA 1PMIA 2XVKA 3P3NA 2EXIA 4RR3A 2D40A 2VMHA 3NKGA 2DCJA 1WD3A 1OFNA 5D8AA 4XIKA 5C8CA 1Q5OA 2DUQA 2ZTNA 5HXVA 4R52A 1F5FA 2EAAA 1OFSA 2ZGRA 3VZOA 1IOAA 4KH9A 1V6NA 4I2OA 2XHKA 3U0ZA 1PVC2 1A8MA 4OZXA 1CD3G 1AXZA 1CJPA 3D0JA 1W0OA 2ZHMA 2CL2A 1CIWA 2GNMA 3V0BA 3M3CA 2GN3A 1AJKA 2VG9A 1ZX5A 2PHWA 1MEC2 1Y3TA 4NN0A 2XLAA 4QM9A 1LOAA 2PHXA 2R073 4YW4A 1RITA 5T54A 3A0NA 4JDNA 2C9AA 2JG9B 3AX4A 4AF9A 2IXKA 2UYBA 3O5SA 4PIZA 2K0GA 2EXJA 4X6RB 4XFHA 4Y26A 1TME2 2IXHA 2VQAA 2R16A 1VBA3 3S30A 1VBD3 4K1ZA 5LEJA 1H4GA 3BU7A 2GMEA 3WINE 1AYM1 1PO11 2UURA 4K6BA 2PN5A 1OD5A 2HWD2 5L7OA 1ZZCA 3WW2A 2QDNA 3I2DA 1EV12 1KXGA 3POYA 4U2AA 3SH5A 5BNQA 4ES9A 3VGIA 4AVAA 4MGIE 2B39A 1AXYA 1DU3D 1V6IA 5CFCA 2AZ5A 4MGYE 3SH4A 3WD5A 4AQ6A 2XJUA 1GV9A 4AVCA 5T5LA 1RIRA 5F6LB 4COYA 1VBE2 3AMPA 1O4ZA 4E9KA 1G9AA 3TN91 5L73A 1AL22 2PHDA 4XEZA 3TB0A 2RMU3 4IEOA 1Z7S3 1DQ0A 3R4DB 2BWAA 4YGEA 3VBSA 3OF1A 1O5UA 2ZACA 5DUXA 4L2NA 3FWEA 2GALA 2G9GA 1N1VA 5F1RA 4HN0A 4ZU5A 4JDMA 5J36A 2OYZA 1FNYA 4XETA 1EAH1 4JGYC 4BA6A 1MR5A 2CGPA 1O3RA 5JOWA 2UU8A 4YM2A 4Y24A 2DYCA 5KBFA 1OOPA 4WM8C 2B5HA 2E9QA 3E6DA 1ND2B 1OI6A 1FV2A 1NCQA 1CONA 5JIUA 5JI7A 1EPWA 2WFF3 1ZRDA 3AMHA 4ATFA 3ACLA 5BNPB 3WQ7A 4A2UA 3MIGA 4P9LA 1LOFC 3H8UA 3RPQA 3MZHA 4WZFA 5BNNB 2Q30A 1I1EA 1AZDA 5FLJA 5KWRA 2RS53 4LNVA 1V6LA 1O4TA 2TUNA 1KS4A 2IWGB 5J48A 4K1YA 5DUVA 3B00A 1CAXB 4N53B 1PHMA 1TNRA 2ZHKA 3J9SA 1PIV1 2VNGA 2E6VA 4Q26A 1AR71 2D6KA 3JB4C 1SACA 4IEPA 4RS5B 3OTFA 2R30A 3KCYA 4R9BA 2AUYA 4WVMB 1JN2P 1WBFA 2WJSA 4Y22B 3WG3A 3D4KA 3ENRA 5A3MA 5JSOA 2JDZA 4AGGA 3B02A 4XQ4A 3HR9A 1YJKA 4PLMA 3Q9OA 1PVC3 4BH9A 1VBC1 1S0DA 2GC0A 3HWJA 3CF6E 4LLFA 4DFSA 1DQ2A 2RJKA 1TEIA 1BQPA 4XW3A 4Q4W1 4HVOA 1Q8PA 3FBYA 1YHFA 3U11A 3MF6A 5BNOC 3RYPA 1MEC3 2HEWF 4YW1A 1Z78A 1VR3A 5GLUA 5GZCA 2MNGA 3VZJA 4MUVA 3JQXA 5JOXA 1BEV2 4LHKA 4RHV2 1LOEA 1VIWB 1LU1A 1V6OA 3AJYA 5JI9A 1CPMA 1HIXA 4QQHA 4UW5A 5CA6A 2YHJA 3DV8A 1TME3 1E57A 3IT8A 2GSYA 2D98A 3OBRA 3AKRA 4HSLA 4Q4X2 4L97A 1IPKA 1HV0A 1FT9A 5FAXA 1LEDA 1IHMA 5CBLA 3ZFEA 5JAXA 2HWD3 3S7EA 3AKQA 1EV13 1U5IA 4TZDA 5EYYA 4IEYA 4JDOA 4FXGB 3KD4A 4M3CA 1AF9A 2ZX0A 3FBMA 5T52A 1QQP2 2A6WA 3FC0A 4XHXA 1LODA 1XYPA 4YZ1A 4Y1YA 1DF0A 1QDOA 1RTVA 1S55A 2CGNA 4PDWC 2NMNA 1VBE3 4K8FA 4UBGA 1V9U2 2VVDA 1PZ7A 3KM5A 2ATFA 1Y7BA 1CR7A 2OW4A 3AM2A 3B9IA 1AL23 3IN9A 4SLIA 2D97A 2OUHA 4YM1A 3B5LB 2D44A 1MS0A 1S0BA 1F31A 3KS7A 4NVPA 1A78A 1MS9A 4K7JA 5IT6A 1U12A 3ZFGA 4AEMA 5GLVA 1MS8A 1YFUA 3AFKA 1VAVA 1H8TA 2NMOA 5C9AA 5KXCA 1BBT1 2BBVA 3A0KA 1VBB1 3ZFFC 3ILRA 3NL1A 2Z42A 5F6KA 1LB2A 4YZ4A 4JGYB 1MZ5A 5ABJA 1G7YA 2BUKA 2ZGNA 1ASJ1 4QX5A 5A3LA 3AP9A 2VVEA 1WW7A 2WNEA 2WNVA 4P9YA 4K21A 1G9FA 1ULGA 4Q0PA 1UPIA 1GICA 3INAA 2YV8A 1OPOA 1W6MB 4Q8KA 5KHGA 1HKDA 4AHWA 2R6QA 2D5HA 4KWJA 1DQ5A 1YFWA 1MVEA 4OFGA 3HBZA 1C4RA 3BTAA 4QPIA 1QMJA 5EXOA 4YFZA 5KXDA 2EF6A 2XUMA 3V0AB 5FCCA 3GZTB 1FPN1 4X6QB 2ZKNA 1XNBA 3LOIA 3ZYRA 1YIFA 1SLCA 4XILA 5FRAA 2BWCA 2JG8C 4UW3A 3WHUA 2A73B 4GULA 2RJLA 4LBJA 3WXPA 2YYOA 3FHIB 1UIKA 1I9RA 4M3CE 5LK5A 1G9CA 1UF2C 4HKWA 2UY9A 4LE4A 1RUF1 4LUKA 4AWDA 1RUC3 3EXUA 4H3WA 3GBGA 4CRQA 2A6XA 1UMZA 3BPZA 3OD0A 1GFF2 4NHMA 3ELNA 4D69A 4NOTA 3VKLA 3KT7A 4INDA 4Y4YA 4COZA 2B8MA 3MLKA 4UW4A 3CJXA 4L92A 5FO9B 1BCXA 1PK6A 1RUE1 4W6YA 2XPJA 1K5MA 2ZMKA 2ZOEB 2WWSA 1ENXA 2R49A 1EYBA 4DPNA 1QOTA 2RR11 2DVGA 1DFQA 2VY0A 4YZ2A 1BEV3 3AP7A 4RHV3 3UKTA 1ZZBA 3AYCA 1D2SA 1QJX1 1AX1A 3SITA 2JJ6A 1ND3C 5BNOB 1VP6A 2XLFA 3WW1A 5AC91 3VDDB 3ZYGA 4EN8B 5JR7B 4GQ7A 2CAVA 3E97A 5HCAA 1NY71 5AFEA 1CAUB 4Q4X3 4K40A 2JEMA 3ZN6B 3O0WA 1H2LA 1AR62 4G4FA 4AGVA 4QGMA 4IV3C 1WCKA 3POWA 1ZBA2 2KXLA 2DCKA 1H1MA 1QQP3 4AQ2A 1JW6A 5IK7A 1M4WA 3MIBA 1D4VB 1UAIA 2O8QA 1IS3A 1ZZ8A 4HSJA 5FO8B 2Z5WA 1HDKA 1YXWA 4XJUA 3H3UA 1YIPA 1V9U3 3LSEA 3B9CA 1Q3EA 1RMU1 2D6MA 2HWE1 2R0HA 1XYNA 4N9HA 4M0HA 5H9PA 2H6CA 4JTNA 3I59A 2F4PA 3T2TA 4PDWB 1O4YA 3ZN5A 5HI0A 1LCLA 2BFUL 4TWTA 4CDQA 3BIWE 4S2DA 3WZ1A 3E6CC 3ZXFA 1SQ4A 1WCSA 1WA4A 4DOUA 1MQTA 3KMHA 4Z82A 2EXKA 3UV9A 2AR6A 1AR81 4ES8A 3MIHA 4XYXA 5T5PA 1J3QA 2O8OA 1DDLA 2PHLA 4JCKA 3WV6A 1JH5A 1YCIA 3QD6A 4JGZC 1SLIA 3CJIC 3FE5A 4Q4V1 4HANA 1OLQA 5IK5A 1R1ZA 1V6MA 3RWNA 2R062 2WFPA 4BMEA 2RM22 2D7FA 3WY6A 5KC5A 1BXHA 2GNBA 2TEPA 3VZLA 1DQ4A 1URXA 3ZFFB 3AKTA 4J6GA 3ZSJA 4K3UA 3N7LA 3IDBB 2VUAA 1C8M3 3OY8B 4XTMA 3EBRA 3OD4A 1GR3A 1EY2A 5J96B 3O14A 5KXBA 3MW3A 5BV6A 5GZFA 2UY8A 2WA3A 4HPKA 2JX9A 2CGOA 3I7DA 4FOWA 1XU1A 2DCYA 3FLPA 4XIOA 5C33A 1ULCA 2DURA 2GDFA 2VGDA 4QQOA 2VPVA 3B7MA 2YPJA 4WVWA 2ZCWA 1OQ1A 4B4PA 1RUH1 2YGLA 1RUD2 1GSLA 3DGTA 4CEWA 2JG8B 2P17A 4CDUA 2IZWA 1TMF1 4I3PA 4OHZA 5J7MA 2RS12 4WVVA 2GMMA 2FZ2A 1GNHA 1C28A 3AZWA 4COWA 3DL3A 3NV2A 3ASIA 3R4UA 2BEOA 1J59A 1UZZA 2I45A 2UWAA 3AZZA 1AYN1 3IWZA 4D7SA 4LBNA 1W6QB 4MXWB 4HVQA 4I02A 2EVXA 5T55A 4AVTA 3QCWA 2YGMA 4FBFA 2VU9A 4RQPA 5ACA3 2QVSB 5KHHA 4XF3A 2BW8A 1ULDA 2OZJA 1POV0 4LBQA 4OI2A 5KHJA 2ERFA 4LO6B 3R0RA 1C1LA 1QNWA 3HT1A 3LWCA 4JVAA 4OVEA 2VMIA 4ITCA 5FBZA 1NLSA 2ZMNA 1AR63 3VZKA 5J09A 1WLTA 2R041 3DPRA 1ND3B 4LUMA 2IXLA 2WLPA 3X29B 5T3NA 4N43A 4KWKA 2UWCA 3FFQA 1ZBA3 1G86A 1HXS1 2PTMA 2CWSA 3VBRA 3V0AA 4FPHA 1WW6A 3QOPA 4P9XA 3LA2A 3PVEA 2ZGUA 1WCDJ 4LBLA 3GZAA 2MEV1 2D6LX 4XDQA 5I8SA 1N1YA 2A6ZA 4GH4A 4P14A 4P5HA 1HQLA 1UW8A 3MPPG 4BQ1A 2QQPA 4XMIA 3AP5A 2Y0OA 5CFDC 3T1LA 2AH2A 1OHFA 4LEJA 3ZYPA 2UWBA 5I8TA 4LA2A 2VXRA 3WG1A 4WBBA 4FTBA 1AYM2 4DY5A 1PO12 4PF5A 2VOKA 2PLV1 4YRDA 2OUJA 1HW5A 4KWLA 2CY6A 2JKBA 4NHLA 3NAPC 4HVRA 1GBGA 5BNPC 1RHI1 3IPVB 4ASLA 1A3KA 4HKLA 4RFT0 2DFBA 4TSVA 1YYNA 2FZ1A 4MYEA 3VBHC 1HQWA 1PZ8A 1O7FA 4KGQA 3JD73 2ZABA 4DS0A 5I91A 2PHTA 2JE9A 4YVSC 1FMD1 5FMOL 4IEUA 1IKQA 1W0PA 2R063 3TN92 5F9TA 2RM23 3NWKA 3WP6A 2D93A 5H9RA 4AEJA 2GC1A 4CP0A 1NE6A 1POV3 4ZKTB 4JGZB 3CJIB 3WG4A 4LO5B 1VB2A 5BUVA 4RS5C 1UKGA 2XGXA 1RUOA 4GB31 4XFIA 1H1AA 3MICA 5FDBA 4CDXC 2X8KA 3EHKA 1OSGA 1RUI3 1LGNA 3PVBB 2GC2A 1VRH1 4Y1UA 2ZX2A 3WCRA 4DZGA 1V6KA 4AHXA 1CAWA 2FMDA 3URFA 3WNXA 2HWB1 4GMP3 1IS5A 4PLNA 4YZ5A 3K51A 4GKYA 1RUD3 1WLWA 3AXDA 4U36A 4I0BA 2VVFA 5EJ3A 2VW0A 5AVPA 2WZR2 1YI9A 4N7IA 4YG6A 1LULA 2WZPP 1H9PA 5GZEA 3LA7A 4IERA 2B9UA 1LR5A 3LSDA