4XQWA

X-ray structure analysis of xylanase-n44e with mes at ph6.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGEFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqwA00
2BW8A 3RI9A 1QH6A 1BK1A 1H8VA 1XNKA 3B5LB 3VHNA 3MF9A 1XYOA 1UU5A 3VZNA 2DCYA 3B7MA 2F6BA 3VHOA 3WX5A 4HK8A 3HD8B 3WQ0A 1KS4A 4IXLA 3WQ7A 1OA4A 3WP5A 1UKRA 3AKPA 2DFCA 1OA3A 1HV1A 1UU4A 3VL8A 1BVVA 3VGIA 2BVVA 3MFCA 1H1AA 2B46X 2D97A 2NQYA 4XQWA 2DCZA 3VZKA 3MFAA 4S2DA 4XQDA 3O7OA 3AMQA 2VUJA 1TE1B 1OA2A 3WP6A 3WY6A 4HKWA 2VGDA 1XNBA 3WQ1A 1W2UA 1KS5A 2NLRA 1BCXA 1REFA 3EXUA 2Z79A 3VL9A 3AKRA 1XNCA 1H4GA 1XXNA 3WXPA 2QZ2A 5HXVA 3VZMA 4HK9A 1AXKA 1YNAA 5K7PA 2D98A 3AKTA 1OLRA 4H7MA 5EJ3A 3WT3A 1PVXA 1OLQA 1QH7A 4S2HA 3VLBB 3WR0A 1M4WA 1XYPA 4XQ4A 1NLRA 1H4HA 2VG9A 3AKQA 1IGOA 3RI8A 3LB9A 2JENA 1HIXA 2BWCA 3VZJA 2JEMA 5K9YA 2DFBA 1C5IA 3AKSA 1UU6A 1F5JA 1ENXA 1HV0A 1XNDA 2DCJA 4HKLA 3M4FA 1H0BA 2B42B 3WP4A 3AMNA 2DCKA 1C5HA 3LGRA 4HKOA 3WP3A 1XYNA 4NPRA 2VULA 3AMHA 2QZ3A 3MF6A 1REDA 3VHPA 3VZLA 1REEA 3AMMA 4XPVA 2B45X 2JICA 3ZSEA 4S2FA 1T6GC 2C1FA 3AMPA 4S2GA 3VZOA 2BWAA
chains in the Genus database with same CATH superfamily
3ZFGA 3MUZ1 3SMHA 2VZRA 1W6QB 4YZ3A 3RI9A 3ROUA 4CEYA 4JKKA 2J1AA 4COZA 2YDEA 2YUEA 1O7FA 3VHNA 3V0BA 1TMF1 1CIWA 2B39A 5C8CA 2BYVE 3JB8A 5FZ8A 5HV0A 5IHRA 1NXD1 1TMF2 1CX1A 4YLZA 3ZFEC 3SEPA 4IXLA 1DDLA 3PJQA 5CKMA 2JWPA 4QMAA 4V2WA 1PGW1 5AVPA 2NN8A 3OUHA 1G9CA 3WD5A 5FXWA 2JKXA 3WNMA 3CLPA 1YIPA 1PGW2 1U12A 5I0TA 3KT7A 1GOGA 5K0UB 1RUG1 4Q0QA 3MIHA 5D2AA 2GC2A 4MUVA 1L7RA 4BQXA 1S0IA 1HDKA 4DXSA 1RUG2 5DABA 2JX9A 1F31A 1PZ9A 5A1AA 1W9WA 4IEPA 5LBCA 3ZR6A 1KDMA 4CPBD 2ZA9A 2JE9A 5BV6A 2WL1A 4GMP1 1AL23 1SZBA 4NN0A 2EIDA 3JD71 4FP3A 4KWLA 1UPSA 3GHMA 2D6MA 2MEV3 2IXJA 3KV5A 3H3ZA 1SHWB 3DKQA 3UGFA 2WS91 4BLJA 1XNCA 3BI3A 2QZ2A 1A8MA 2UY9A 4LK6A 2WIIB 2WS92 2EICA 3HT1A 2NYYA 3KGZA 3BGAA 1CX4A 2UWAA 2YZ4A 3ACFA 1AXZA 2IVJA 1SLLA 4QHZA 2Q4SA 1UZYA 4FPEA 5GZCA 5J3UA 4B7EA 4TZDA 5JMCA 2K0GA 1URXA 4MV2A 2Y0IA 4NPLA 4OLLA 5LEKA 5EHDA 5JI7A 1PM7A 4XACA 3ORJA 5D8AA 1VBE3 3F2ZA 2Y6HA 4WBBA 3AL5A 3FX3A 3VD4A 1QQP1 1HW5A 2BDRA 1GFF2 4FPHA 2VMDA 1H4HA 4Y4YA 1W6OB 1QQP2 3FHAA 4NJ4A 1HIXA 3C7HA 3C8XA 4YWAA 5LBEA 4Q1PA 2ORXA 4C91A 1AJOA 3RMXA 1PNGA 3N9OA 4KWKA 4RGGA 2OYZA 2PHTA 1VE0A 4QPIB 1CWPA 4WM8C 4N43C 3WZ1A 1LEMA 3DV8A 4MGIE 2Y33A 2NZ9A 2WA3A 1X50A 4QQHA 1ND3B 2IFWA 3AXEA 3MIBA 4JKLA 1Q43A 5FO9B 3WP4A 2Q1ZB 4HKOA 4MZUA 3LA7A 3H7YA 4KBBA 3RS6A 3HIFA 4O9GA 1YJLA 4H55A 4JZRA 3U14A 5IJRA 3WNNA 4ASLA 2PQQA 3VZLA 4B1LA 4XAEA 3SITA 4XPVA 2W1QA 4I0BA 3TNQA 1EUUA 2EAAA 3RZGA 1Q8SA 4FTBA 3T0DA 1VBC3 2XKOA 2XLGA 2NMOA 4AWDA 2CSGA 1RGSA 4D3WA 2FCTA 2AEZA 2K46A 5T5OA 5EXOA 4AVTA 5BNPB 1V9U2 4M3CE 5EIYB 1BK1A 5JLVA 3O1PA 2I07B 2R041 4LORA 4OCTA 3O1VA 4M3CB 4C90A 5KHGA 4NWWA 2PQSA 4HK8A 5I93A 3NVCA 4ZPIA 4D94A 4MVTA 1DLLA 4L0PA 2E7TA 3GBFA 3ZYIB 4GZ9A 1W05A 4OHYA 4MYEA 4BB3A 1GYKA 2XG3A 3SNMA 4W65A 4P14A 4ZXKA 1BQPA 3O1SA 4HFSA 2FBEA 2QFEA 5L9BA 1NAEA 2XWJB 3ZDSA 1GP5A 1DQ1A 2JDAA 3PTYA 4S2DA 4ZONA 5FP7A 4FVVA 3O7OA 3LKJA 2DYCA 3WG3A 1GZTA 5C7GA 2WZEA 1OD5A 2JG9A 4IE0A 3ZFFB 4PLMA 1BCXA 2VOVA 1UMHA 1VIWB 3O1TA 2Y6LA 4UXAA 1SLIA 1UOFA 5JR7B 2WA4A 2W87A 5HXVA 3KCXA 1QU0A 2D3SA 4IEXA 5BYNA 1UMIA 1C8M1 1RIRA 3HMYA 5FO8B 1K3IA 1AUYA 2CYFA 3MLKA 3S0MA 1C8M2 1LU2A 1RJ8A 1YJKA 5A7PA 4ZZ5A 4B4RA 3HNMA 2ZMNA 4AW7A 1PO23 1UL9A 1ULOA 2WT0A 4GH4A 4AEJA 2VZ3A 1J1TA 2DUQA 2G9GA 2YPDA 3BODA 3PUAA 4I02A 4W4ZA 3PVEA 3WCRA 4YM2A 4ZU7A 4H2AA 1JU4A 4MG2A 1GNYA 4BDVB 5C5UA 4ZU4A 4FQ4A 4GMP0 4D6RA 5L9VA 5AC92 4EWEA 2HBUA 3HPNA 5T55A 3BU0A 4KQ7A 3NJVA 1W9TA 5CEHA 2Q1MA 2UWCA 3K2OA 4HVRA 2ET1A 4HLTA 1SQ4A 4UF0B 4XJ9A 3U1XA 3UK9A 4ARYA 3LEGA 4C0HA 1UCXA 2QQVA 2WNVB 5H9PA 5GLZA 1BXHA 3CBNA 4JRLA 3ZXDA 4A7YA 1BEV3 1HV0A 3E1F1 3KQRA 5KHKA 4FPYA 1YQCA 3N4MA 1EV13 3SHRA 4LULA 1MZ6A 4CDWA 1W8OA 4WVMB 4COUA 4EQVA 3MW2A 3JB4C 1E5IA 3K3NA 3NJYA 4N7IA 2ARAA 5EP9A 1POV1 1RUC3 2BPA2 4IE4A 4A7ZA 1DF0A 2D6KA 1WCUA 2ERFA 3N9LA 1VBA1 3A23A 1KJRA 4MH0E 4A3XA 5LZ6A 2WO7A 1UZZA 3ZYGA 2O14A 4URTA 3EBRA 1VBA2 5LEJA 1YI7A 3ZDVA 2ZKNA 1H9PA 1HKDA 4LUMA 4XE9A 5DUVA 2Z5WA 1LOAA 4QQOA 5CKNA 5J36A 3J7NA 3J8F1 2J1EA 1SG3A 3RYKA 4RQPB 3QD6A 4YW5A 4FAHA 2PLV3 2ZACA 4PQ9A 4CRQA 5JSPA 1QH6A 2Y8KA 3J8F2 3NMBA 5JIAA 3I2IA 4Q0VA 5I8YA 4PT6A 2WZR1 5FZMA 4FTSA 1AVBA 4AEDA 4LPLA 1V70A 5CFCB 1JBCA 2A3WA 2WZR2 1MS8A 4XUTA 3FFZA 5AVAA 2WO1A 4DIQA 4RR3B 5FY7A 1UOGA 5EV7A 1E57A 3CKHA 4IV3B 4YW3A 3S6PA 4LIUA 5A7OA 5J1XA 4K3UA 3I2DA 4GWJA 1ZBE3 4GB33 4HVQA 4AAXA 1WW4A 1H6YA 3O0XA 1Y43B 2RS11 4TSVA 5GM0A 3AKPA 4DNYA 5KXBA 1SBDA 2CTVA 4YGDA 1OBNA 3T2OA 5T5LA 2RS12 4NOTA 1X33A 1FOD3 5L73A 4CDUA 3RZLA 5KXDA 4CSWA 2CNAA 1OPOA 2WT1A 3H1MA 1UIKA 3P1IA 1AR81 1BK0A 1DYPA 1QNWA 1GBGA 3N7LA 4QT6A 1V0AA 5A7NA 3M3QA 3KGLA 1OKOA 1AR82 3E97A 4HKWA 5FPBA 3W9AA 5HXMA 1W2UA 2PHLA 1OVPA 3WG1A 4RL7A 2Q0AA 1WWYA 2J1UA 1RUJ3 4XXAA 3T2QA 3ZSJA 4PIXA 3ZFFC 3LEMA 5A70A 3M2MA 3TOJA 3CJXA 4M0NA 2D6LX 3VBSB 4CCJA 5CG8A 3I8TA 5FYCA 2XWBB 3BB6A 3WF2A 2OZ6A 3DF0A 3I3MA 1W2AX 1PVXA 2W1WA 3KM5A 4XHBA 3VKLA 4QXKA 5B4NA 1PO12 2XONA 3PUSA 1QH7A 3SH5A 4PDWA 3ES4A 3JCIA 1ZZ8A 1VB4A 4ISRA 3SCHA 4I3GA 5DAVA 4DZGA 5DG1A 4O65A 4XJ8A 5FK7A 2BERA 5KHJA 1M4WA 3M7AA 5BNOA 4Z92B 3MV11 2PN5A 1AZDA 4LBKA 2BGPA 2JG8A 2ZGQA 1W39A 2QQWA 3ALQA 4CDXB 3IPVB 1NCQB 1OLMA 3MUY1 4OHZA 4LLFA 4OI2A 3POSA 3KQ4B 4Q1RA 3R05A 1GUIA 2RS31 3HNYM 4RGAA 1JZ2A 2FDIA 4LHLA 3RYPA 4AQ6A 2OUHA 4LOTA 2LS6A 2RS32 4JDOA 1LODA 1GWKA 4BZ4A 3RZJA 2VC9A 4UWDA 2JDUA 5C70A 1M06G 1AL21 4K6BA 3GCXA 2WNVC 1GR3A 4JKMA 3IDCB 3B02A 4JGZB 2YBPA 2QDNA 1I5ZA 4OZOA 2GZWA 2MEV1 3LGRA 1BJQA 5FAXA 2C5DA 4UW4A 4D0QA 2LTNA 1HX6A 1Z7S3 2VE1A 1XSQA 3M1HA 3TB0A 5C5TA 3CJIB 4B1MA 3VHPA 2XKPA 1O91A 1GZ9A 1VAKA 3N7MA 4AHXA 5CBLA 5T3NA 1TVGA 4AYUA 3FHIB 5C33A 2VVDA 4GWIA 5I0UA 5FXZA 4E2SA 4AFCA 1UMZA 1UZVA 3NL1A 1QKQA 4MGTA 4KG0A 3AP5A 2ZABA 1ND2A 3PIGA 1CIYA 2Y64A 3U11A 3FN9A 4D7YA 1F2NA 4NHXA 3ZIXA 4EE2A 2VBBA 4Z1VA 1O3QA 2DCYA 1G9AA 4RQPC 5FMDA 4CCOA 2YV8A 4D7TA 4GQ7A 1D4M3 4DXRA 5JDBA 3OBZA 1RUE3 5FZOB 1OA4A 4YW7A 2ZEYA 3CNAA 1UKRA 3MO4A 5CFCC 3PU3A 3C7FA 4YVSA 2TUNA 1EP0A 4Q4X3 2J7MA 1WKYA 3JZVA 4W6YA 2HWC3 4INDA 4ET7A 2KXLA 1UY4A 2H6BA 3GYDA 4K8RB 4M4PA 4RR3C 3VL8A 5IVCA 1OVSA 5BXXA 4YW1A 2BBVA 2VPVA 4RFRB 5CADA 3NAPA 2Y60A 4ZS3A 1GQGA 5CB7A 2JB8A 2ZOEB 2OS2A 3ZLIA 1MACA 5FPVA 1H2KA 3BCWA 1GANA 2VCCA 4FO9A 5A7SA 2R32A 2WSUA 4LBMA 2QQKA 4LHNA 1YIFA 4DOUA 3FHQA 3VD5A 1HB4A 2HWF3 1QJZA 1X9PA 2Z79A 4Q29A 1IS5A 5C4WA 4IDZA 1V6NA 3MGUA 1YYNA 4B4PA 3KD4A 1LHUA 4I3PA 2FMDA 2R073 3LSEA 1QOTA 3A7QA 1PMHX 5HV4A 3FE5A 4XCBA 3VZMA 5GZFA 3N9QA 2WZPP 2B7YA 2XR4A 3HOBA 1P8JA 4YGBA 3VBRA 5FZCA 3AYAA 3AKTA 2DVDA 2VUCA 3OBRA 4OMCA 1W6MB 2JDYA 2QNKA 1RUH3 4NIAA 3LE0A 4H7MA 4Y5TA 3TN93 2VMEA 1VAMA 1WMXA 3VBSC 2WRAA 5LY1A 1UNBA 3LFIA 3IDBB 2OQ6A 3FMGA 1WD3A 3THTA 2JD4A 1US2A 5HI0A 5FYUA 1DQ5A 4DY5A 3OY8B 5GLUA 5FR3A 4R8HA 3E6CC 2Y0OA 2ZEZA 1VBB3 3U37A 3RI8A 1DHKB 2ID4A 3LA2A 3PU8A 5J96B 2BWCA 2JXAA 2VUDA 1NZCA 1GKBA 4IGOA 3WW2A 4X8PA 4JHZA 5HBAA 4CXWA 1C1LA 3I2GA 1JODA 1C5IA 1VP6A 4MX3A 1EPWA 4HVOA 4META 4CDXC 4E2GA 3OGSA 3DECA 3B94A 3RJRA 1GZWB 2WZ8A 4DS0A 1DLCA 5LBFA 4XAAA 2ORZA 1DIWA 2RDQA 2XUMA 5IVYA 4LBQA 3VUOA 3O1OA 4FPOB 4XMIA 3IDAA 2ADEA 2QTWB 3HEIA 4BJ0A 4OHVA 1XYNA 1LEDA 2VCBA 1YQ8A 1ZYBA 2RMU2 2WNUA 1SBEA 2Q8DA 4JGZC 3P3NA 2A73B 1TNFA 4NPMA 2FZ2A 1B35B 1DBNA 4S2FA 2G9FA 4GXLA 1T6GC 3UKTA 1CN1A 2JG9C 5A32A 3ZXKA 3ZYFA 4HOOA 1PO21 1W3VA 3I3EA 4YG6A 2ZEXA 3WSOA 4E4SA 3GM8A 4Y1XA 1PO22 2YGMA 1A34A 4GWMA 1ALYA 3AP6A 3VZNA 1PK6A 4QWNA 1SFPA 4Q4Y1 3WQ0A 2CGOA 5KC6A 3IN9A 3RSJA 3MW4A 3E6DA 2GNMA 4YPJA 4LO8A 4Q4Y2 2VD7A 3HQUA 4GH4C 1A6CA 4KNCA 3VKMA 4C0BA 1EAH3 1CZTA 4RHV3 1GMMA 2BVVA 4QPGB 3IB3A 3WW4A 5KBFA 1BEV1 2XLAA 4BMBA 4AE2A 4AQTA 1IPSA 1Y7BA 1EV11 1BEV2 4IQPA 3ZFEB 2P6HA 1OI6A 3HAGA 2CY6A 3K51A 4QXBA 3VKOA 2OX0A 1VRBA 2JE8A 4HT1T 5A3TA 3KHCA 2Q30A 3JQXA 4UAPA 3LQCA 2BNNA 3IBMA 4CU6A 3O1RA 1R1A3 2GP3A 4SBVA 2JDMA 1Y3TA 1W2OA 3PIJA 1EYBA 1F4HA 3T4VA 2P34A 1UOBA 4CDQA 1H2NA 5L7OA 3IT8A 4YZ4A 1JYIA 4UW5A 1K5MB 1OLRA 2CWMA 4FFHA 1RVF3 1WMDA 2ZGRA 5LA9A 2PLV1 1SCSA 1DFQA 3A21A 2HWE3 4R52A 5FY4A 2GNTA 1NQDA 1JZ8A 1NE4A 5JIUA 1NCRA 4MHRA 4P08A 2PLV2 4U2AA 2R0FA 3QH7A 5HCBA 3H3UA 3W5MA 4WZCA 4IV1A 4CU7A 4BPZA 3NV3A 1CD3G 5C8WA 4CP9A 3VHRA 4XQ4A 3CZJA 1NLRA 1OH3A 1ZBE1 4GB31 2X10A 4GJZA 4EYUA 1OT5A 4N53B 4OQ8A 1ZRDA 4WM7A 2Y6JA 4ARXA 4CCCA 3E5UA 4KU8A 1FNYA 4GB32 1IPJA 2VZPA 3GHNA 4KGGA 3O12A 4QU2A 1ND3A 1FOD1 2RJ2A 4BQ5A 3VBOA 4QX7A 5A1FA 1UYZA 5C3PA 3AKSA 5LRSA 4YGCA 3ZX7A 4IEQA 1FOD2 4RSUA 4OYUA 1RINA 2GP5A 2RS53 3PUQA 5FY0A 4AEKA 3AFGA 2XXZA 5A3NA 1OH4A 1UAIA 2LM3A 2C24A 2ENRA 5A7WB 1PX3A 1DGRA 2A3YA 3LWCA 1NYWA 2W91A 4LA2A 1HB1A 2TEPA 4F3JA 1QXPA 1RUJ1 4CDUC 3TEZA 1TZOA 3I49A 2VZUA 1RUNA 4D6SA 3ABZA 4LE3A 2JDNA 5EJ1B 4AI2A 5SV5A 1RUJ2 2DVFA 2XL7A 4NMIA 4QX2A 4YFZA 4FPKA 5FP8A 5FZFA 1KITA 2QQMA 4AGVA 5LA1A 2ZS6B 5FZ3A 3UGHA 5FZBA 1W9YA 2A1XA 1G9DA 1W2NA 2GN3A 3NQHA 4EJRA 3PLQA 5CAZA 1B35C 4AQSA 2W1SA 1XNKA 3V0AA 3S57A 1KDKA 2XJRA 1X8EA 3AYCA 3VD3A 5A33A 4FOVA 2OKXA 3BIEA 2E26A 4XJUA 4AHZA 4LNVA 5CNAA 2CL2A 3ATGA 5JR2A 1YI9A 2R063 3SCFA 4ZHNA 2UY8A 3K4AA 4XF1A 5GALA 4QQLA 4KMQA 1NQJA 5FZ4A 4H14A 2C0ZA 1EY2A 2VECA 1ZRFA 5LB6A 3H1YA 3VD9A 4BYYA 1NA1B 1NY71 1JZ7A 4HN1A 3CHXA 2A7AA 3VGIA 4MXWB 3HNBM 1CZSA 4IL7A 4MLOA 4WVVA 1F5FA 1ZRIA 1NY72 1SLCA 1D2QA 3AZVA 5JXIA 1J59A 4XFBA 3K75B 2ETEA 1UZ0A 4KU7A 3AMQA 3WDWA 1BLZA 1TE1B 1WW6A 4UOJA 1XOYA 3WY6A 2EIBA 4QPGC 5FO7B 4YZ5A 3IIAA 4R4XA 1XNBA 3EMRA 4M01A 3ZN6B 2NLRA 1O8PA 4V2VA 3N35A 3USUA 3KS7A 4Z82A 2BU9A 3V65A 3MPPG 3ZXFA 5DAPA 4B7KA 3KVAA 5C9AA 1LOGA 1XXNA 1MPXA 1I6XA 5FZAA 1RB8G 1XC6A 3GZAA 3SC7X 3LOBA 4IUGA 4HK9A 4KWUA 5JSRA 5LATA 4XUQA 1RUI3 4XZPA 4ZZ8A 2VZ1A 3WOGA 4CUBA 3S7IA 4HG6B 1VJ2A 3ZXLA 2YPJA 4QM8A 3I54A 1UO9A 5GJ6A 4A6OA 4AOCA 1GLHA 4LT5A 1DP0A 2XVKA 1K5MC 2W52A 4ZU5A 2HJIA 3VLBB 5EWSA 3WR0A 3N9MA 2VAUA 2PHXA 3H42B 2X29A 1CQ9A 1D4M1 1X36A 2IXKA 3QLQA 1RUE1 5FCCA 2VL4A 1AX0A 1QGLA 3JD72 5CFDA 1XNAA 5ABJB 1FT9A 1D4M2 5F5IA 4QKFA 4FSJA 3J7MA 2VCMA 1RHI3 2HBTA 3POJA 4Q4X1 1LTEA 5JZGA 1RUD3 5IYYA 2HWC1 4BQ2A 3AJZA 3I4IA 3WHTA 1ACCA 2JJ6A 3O1UA 3POEA 4WVMA 2X05A 2HWC2 1CAWA 3PNAA 4L11A 4N53C 1ENXA 4ATEA 1NX9A 2EAKA 1OSGA 1MS5A 1VBD3 4JGYA 1LKNA 2EVXA 3DN7A 3QOPA 2XHKA 2RV9A 4FPLA 3BTYA 1U0AA 3OOXA 2B42B 1S55A 2EF6A 4YVSC 2VXRA 3GCWA 3AMNA 2HWF1 1YCIA 5FZLA 1YEWA 2QZ3A 1SLBA 1CAVA 2HWF2 3B9CA 2R071 3B69A 3NAPC 2V73A 1W6PB 3ZM8A 4LO4B 3AX4A 2JKBA 1YFXA 4BXSV 1PGL1 2R072 5KWRA 2WJSA 3UKNA 3H8OA 5J48A 4XF0A 1UQXA 2VM9A 4Q8LA 2ZX2A 5FOJB 5E6HA 1PGL2 3ZOIA 1XBFA 1PMIA 1T6BX 3NV2A 3WLUA 1LOFC 1RUH1 3C7OA 3D0SA 2DVGA 4XDQA 1RUH2 3GGLA 4CXXA 5BNNB 4RFT0 2XLFA 3FUQA 1H8VA 1KGYA 4K8FA 3MF9A 1IKQA 2HWD3 1YQ6A 3PVNA 1CR7A 5F8PA 1UXZA 5FYTA 2RR13 3SXWA 5FBJA 2AREA 3VDDA 3I7DA 1H30A 1KS4A 3UJOA 2DBNA 1VBB1 3ZXJA 3USSA 3POWA 1OOPA 1STMA 2WFF3 2C4XA 5GZDA 4YNIA 2KM2A 2R16A 3J9SA 3FC0A 1VBB2 3Q8BA 1LNSA 3OEAA 4LK7A 5FZ6A 2YY1A 3VBFB 2BOJA 1BVVA 5EYXA 2R49A 2ZHNA 3JXSA 4PBPA 1UKGA 2G9ZA 3WUCA 1H1AA 5T5JA 2BBAA 1LOBA 4UFKA 4MGQA 3WF1A 4B8EA 3ELNA 1N1YA 2XUEA 3BTAA 3RWKX 3NKGA 1OXCA 4O61A 4XZUG 1NA1C 1SFNA 1C8NA 1XSRA 1ZBA3 4UFIA 1XPWA 3RGBA 2R042 3EXUA 4BK5A 5FDBA 2XJSA 2YFUA 1ASJ3 5FY1A 2TBVA 3AK0A 3NNJA 3BU7A 5FZIA 4AQ2A 3TEWA 2E6VA 1BYHA 4FOWA 2VBPA 1K12A 2IVIB 1GOFA 1QJU3 4IESA 4JTNA 4MOAA 3D5OA 2WABA 2VR4A 5F39A 3ILFA 4LLOA 1HJGA 2UU8A 4AFAA 3L9JT 1O3TA 2X5IB 4HBNA 3UL2A 4ASMB 2O8QA 1W9SA 2PAEA 1JMUB 4HZFA 4E8DA 3R0RA 3M3OA 2WWJA 1JYVA 3OGVA 2IUWA 3AZXA 1US3A 1F9KA 2DVBA 4G3YC 4HXCA 5FP9A 3RRDA 1N3OA 2DURA 2FDFA 3WVJA 4LBNA 3T09A 4Q4V3 1JI6A 1A78A 1NLQA 3VDAA 2R30A 3BKZA 1JTZX 3KCYA 1HXS3 2HH9A 1GP6A 2R7EB 1W03A 2Y34A 1LHOA 1I1EA 2IXHA 1JZ3A 1GV9A 4J1WA 1OF4A 4XBQA 3H3LA 5LCWL 2ARCA 1KXGA 1ST8A 1EAH1 2GAUA 2VMFA 1R64A 2G4IA 5FZ1A 5ABJC 4JV4A 1VMJA 4FCAA 2WQZC 3OGRA 2ZJCA 4LO6B 1EAH2 3RWNA 4CTEA 3R4SA 5J37A 3O0VA 4ITCA 5FYMA 2WWUA 4HSLA 3WDUA 1FV3A 3AZZA 4Z8BA 1G86A 4YVWA 3P5BA 3ZFGB 3VBHA 3IDEA 3ECQA 1J84A 3IMNA 4XJWA 2WQ8A 4AK3A 4CEYB 2G19A 1UYPA 1A8DA 3PURA 4NAMA 5DUXA 1R1A1 3V0BB 5TSWA 3ST7A 2KA3A 5C8CB 2KD7A 3CL1A 2BVBA 3NJXA 1PVC3 3AMMA 1R1A2 3HN1A 3CQOA 1OKQA 1YQ5A 4XFAA 1PHMA 5J98B 1S1AA 1ZZBA 1E5SA 2C1FA 2P17A 1CAUA 5I0SA 3BUCA 3RDIA 1RVF1 4NROA 3AM2A 2AGSA 3GZEA 3OPZA 5D1IA 3WF0A 1JUIA 2BV4A 4AI0A 4E4DX 2DV9A 3I97A 4E4ZA 2J1RA 1RVF2 1XE8A 2WBKA 1W6NA 4LKFA 1XYOA 1UYYA 2VW1A 3DPRA 3B7MA 5L7OC 1AX2A 1RXFA 5FZGA 5FYSA 4K1ZA 2W47A 2P6CA 2V4VA 3HD8B 4W8JA 4AVSA 2WLPA 1R093 1MEC3 1RMU3 5BNNC 2IZWA 3LCPA 5LY2A 4ASKA 4QGMA 1Q5OA 1YC61 1QNYA 1OA3A 4AGGA 2RJKA 2YROA 1XU1A 3K77A 2D7FA 2DU1A 5B2GB 1U5IA 2WC2A 3B93A 2RS51 2HEVF 2VNVA 1LHVA 4A2UA 1V6JA 1X8MA 2VOKA 2NP0A 2YBSA 4R9AA 5CU1A 5FKBA 2RS52 4RS5A 1VR3A 4M4RA 2DUPA 4XFIA 3VBFC 4H3WA 2K9ZA 3INAA 4DY3A 3LIHA 1SDDB 3FLTA 4XTMA 5FY5A 3DXTA 5F3GA 4D8MA 5LRRA 5FZEA 4FPFA 3PMSA 4XW3A 4B3NA 1HJFA 3AB0A 3WCSA 2JIJA 3K46A 1OFNA 1O3SA 3KMHA 2PHWA 5FWJA 5JXJA 4PCRA 3G6JB 3S5QA 3ZKUA 3TEYA 5D8AB 3T4HB 2AR6A 3DEMA 2VTFA 4E27A 2CAVA 1H8TA 2ZGOA 1C3HA 1MQTA 1WLTA 1W0NA 2WAAA 1DGWA 1KEXA 3LOIA 3W20A 4DXZA 1ZREA 4AVAA 1ODNA 3POYA 2VBDA 2BOIA 3H8XA 1BBT3 4EN0A 1Y9MA 3OY8A 2X5IC 1XU2A 4Q4W3 3IKWA 4EN6B 1OLQA 3D82A 3GBGA 4K7JA 1AXYA 4W50A 4Q0SA 2G1MA 1ZNPA 2XH6A 1H2LA 4CCKA 1Q8PA 1N1TA 2VW2A 3FBYA 5FTTC 5F5CA 5GLTA 4EROA 4P5YA 1Q3EA 3BOPA 2E33A 3AKQA 5FV3A 2JDHA 4N8MA 1CPMA 4P9GA 5DQ0A 3WUDA 1X82A 3Q8CA 5FMOS 3ZSMA 1N3PA 1V6MA 2JEMA 3VBUA 4GALA 3ZYJB 5IAVA 4B29A 5JXHA 4OI4A 5K8SA 2VU9A 4NVPA 2HLEA 2J42A 3H0OA 1F5JA 2QQOA 2VY0A 4A41A 1XNDA 2DCJA 2YXSA 4KBZA 4RA0A 2C6SA 1ULPA 4I0WB 3C2UA 3APBA 1J1LA 1AJKA 3JQWA 3T2PA 3I3BA 4QKDA 2GC0A 3VV1A 1LAJA 1WCQA 3N3HA 1I9RA 1W0PA 4RGKA 2DCKA 4MGZE 2BGCA 4CUCA 3TNPB 4FFIA 4NIIA 3ZXEA 4IEUA 1HLCA 4Q0PA 3U07A 5JXGA 4LO5B 1REEA 3ZFGC 2F17A 4QKBA 2QQLA 4X6RB 4CEYC 1KQRA 2J1TA 3LPFA 1RUI1 4UI9L 1CJPA 3VKFC 3WV6A 4JTOA 3ZSEA 1R083 1WLDA 4NUBA 5FK8A 1CAXA 1WUVA 4CEWA 3AFKA 1NLSA 3KV4A 3OBAA 2BWAA 1RUI2 1EUTA 3R4DB 2PFWA 1W28A 1VMHA 2C9KA 3LD8A 1L7QA 4XXPA 3D4KA 5GKAC 4QU1A 3I2KA 5JAXA 5IVFA 1D7PM 4E2QA 3DYPA 2QBXA 2XJQA 3CEWA 4SLIA 4NRQA 2XJTA 4BIFA 4DEQA 4KH9A 2E32A 3O5SA 1AL22 3WQBA 3ZN5A 1TQ5A 1QDCA 3AP7A 1IG3A 2W08A 3D0JA 3KV6A 2OQ7A 1KD7A 1RHI1 2MEV2 3H7JA 2JG9B 3H8UA 1RUD1 3OD4A 5HCFA 1CZVA 3AP4A 4QKNA 4XCAA 1RHI2 2DCTA 1GQHA 2AC1A 5FYBA 1RUD2 4QDSA 1W3XA 3ZVXA 4BOWA 4PI0A 1FX5A 1V6IA 2B46X 2D97A 2E7QA 3WNXA 3DCQA 3RZKA 2OPWA 4Y4RA 1BHGA 4BWOA 4CE8A 2XOMA 1W8UA 3GDBA 4L2NA 5FQ0A 4MO3M 2I2SA 3OD0A 1KFUL 4GKXA 5EYYA 1KS5A 1VBE1 4HMZA 2CU5A 2R1DA 4GH4B 1UX7A 2EIEA 3MIGA 3T3YA 1Z0HA 2ZX1A 3EQEA 4LBLA 4AHYA 1VBE2 5FMCA 4LTAA 4P9LA 2FD8A 1U5YA 2UYBA 1POV0 4LBQD 3OYWA 2YHJA 1DZRA 1AXKA 1MS0A 4NE9A 1HN0A 1RUG3 1V00A 4EN7B 1JOJA 4YM3A 5BUVA 3PHMA 4IGQA 4IERA 4XABA 2R1BA 3U10A 2J1SA 5D8AC 3OGJA 3HN3A 3B01A 2UWBA 1DGLA 5LASA 5DAWA 2XPJA 4CYDA 3HJRA 2HWD1 2O0OA 1ZZCA 2RR11 4FFFA 4Q0UA 4GA9A 2GH8A 4XDOA 1UYXA 1KFXL 1NOVA 3POFA 2MHFA 3PL0A 3I59A 4AZZA 4C8DA 2RR12 5IFPA 3HR9A 3IM0A 4QB6A 2WS93 1OC1A 4CDWB 2WFF1 2HEYF 1K5JA 1DU3D 2V09A 2D6PA 4N7UA 3T0BA 4KG8A 2B8MA 1DQ4A 4K21A 4XYXA 4DUVA 4BK4A 2WFF2 1XQNA 3AL6A 4BQ1A 3RQ0A 4P02B 1GSLA 1RJ7A 4AVVA 1VBC1 2O8OA 4ZY9A 1OQEA 3THCA 3L2YA 1S2KA 4J1XA 3VN4A 3H8RA 3R4UA 4UYBA 3VDDC 1VBC2 5HCAA 3LDRA 4Y22A 2WO2A 4CXYA 4NRPA 1OF3A 4BIOA 1J58A 2PHUA 1ZBA1 2QDRA 4LITA 5F32A 3WDTA 4DRVA 3N7KA 3PTRB 2NM1A 2XVGA 3GF6A 1ZBA2 3OJBA 1LHWA 1WW5A 4HONA 4N43A 4WM8A 1ASJ1 3L2HA 4QPWA 1W8WA 5C3QA 1QJU1 5HPOA 3AJYA 4JCKA 4AEDB 3CDZB 2EXKA 4XURA 2F4LA 3NV1A 1QJU2 5FZ7A 1AR63 3K3OA 4BM8A 3KT1A 4HPKA 2FMYA 3EJKA 2D3PA 2VVFA 2GMEA 2ZAHA 1JHNA 1UY1A 4ORFA 1YO8A 2MPFA 1S0DA 1WGPA 2A6VA 4Q4V1 4XIOA 1GZCA 3PVBB 4CDUB 1UY2A 5AFEA 3WNLA 4DB5A 1RUOA 5ACA3 1J83A 3KSCA 4Q4V2 1GOHA 5DUUA 2VQ0A 4NWVA 3Q9OA 2TNFA 4IE5A 1O4YA 5IFTA 3WQ7A 1OMIA 1BZWA 1GP4A 2PAKA 4BQWA 2W92A 4XHXA 2R6QA 5GLWA 4LHKA 1W6QA 3NV4A 5FOBB 4Y24A 4V1PA 2N7GA 4P9XA 1V9U3 3PVOA 3WG4A 2FDJA 5A6XA 5EZWA 5KXEA 2PELA 4AGRA 4EWAA 5FZKA 1MZEA 2IXLA 4N9HA 4QD2A 4J6GA 3U4SA 2QQPA 3AVSA 1JH5A 4BCUA 3GJBA 1NKGA 3MV01 5A6ZA 2ET7A 3D3AA 2PA7A 2P4EA 1WW7A 3CU7A 1NZIA 5L36A 5K0UA 2QE3A 3W21A 3T1MA 3GZUC 1ULCA 2ATFA 4PDWB 3WXPA 4YW6A 2FHRA 1S0GA 2I45A 2EXHA 1HQWA 2QQJA 4URAA 2RM23 5A3PA 1W9FA 3H1WA 1LJ7A 3LAGA 5LA2A 5BNOB 2GNBA 1QDOA 1OLME 1YFUA 3T30A 1YWKA 1YNAA 3IZOA 2VZOA 1W8HA 5K7PA 2Q8OA 1QJX3 4YVWC 5DUWA 2JG8B 3LA3A 4OULA 2HKXA 2OT7A 2A6WA 2VZQA 4Y20B 5F2WA 4XC9A 2VOWA 5KR7A 1J3QA 3X29B 2VOXA 2P2KA 5IK7A 4YGEA 3WT3A 2EXIA 5F3CA 4TWTA 4S2HA 3MIDA 2BFUS 3T2TA 5FPAA 1AYM3 4Z2AA 4WV8A 1PX4A 1EV12 2HYKA 2VTXA 5IATA 4R9CA 3UKVA 1RUC1 1G7YA 1MEC1 1R091 1RMU1 4TN7A 1SPPB 4GD4A 4QXHA 5IVEA 4I01A 1GWLA 1RUC2 1JHJA 3NSTA 4L97A 4QX3A 2ZGKA 4B4QA 1GQPA 1R092 1MEC2 4NHMA 3LB9A 4OUEA 2JENA 3WDXA 2KR2A 2GH2A 1J3PA 5FXVA 2ZTNA 1RL3A 1DZTA 2BGOA 3KF5A 2XHNA 3POBA 1TME3 4CDWC 3GBWA 1WA6X 4COVA 1J3RA 3N7JA 4FAGA 1YHFA 2PYTA 4UFHA 4CU8A 3K4ZA 5M0TA 3ZYPA 2CAUA 1VALA 5IAXA 4BISA 2GMPA 5IVJA 1QY4A 1BMV1 3IAQA 4AFBA 1LB2A 5H9SA 4QX0A 1JU3A 2YU2A 4K1YA 3S5AA 1W6OA 2ZX3A 4KL1A 4ZXEA 1BMV2 5AC93 3A4UA 5DDJ3 1ND2B 1CJDA 3JBG3 1SMVA 2E9QA 1Q8QA 3MF6A 3BPSA 2ILMA 2VQUA 4P00B 4YARA 1FXZA 3WNKA 2RJLA 5J09A 4DUWA 2DF7A 4QPIA 1MVQA 4XFHA 2V72A 3V56A 4FQZA 3POGA 1IG0A 1ZBE2 1XB9A 4Y3OA 2WDBA 4AAPA 1WCSA 1ENSA 3UT0A 1CPNA 2EALA 2ZZJA 1PIV3 1BBT1 2RDSA 4FPGA 4AEDC 4YVSB 4JRAA 1AHSA 4COYA 4E8CA 5IVVA 4Q4W1 3AVRA 4IETA 3LDKA 5IW0A 1BBT2 5BPXA 4N90A 1KJLA 2Y6GA 4ISQA 4ATFA 1O5UA 4LBJA 4IEYA 3C7EA 1UU5A 4LUKA 3J7HA 4Q4W2 4XF3A 3UNPA 3NAPB 2A70A 2D44A 4OUMA 4Y1UA 5FJHA 3MYXA 2SBAA 4AI8A 3FZ3A 1LENA 1O4ZA 3RZZA 5KHHA 5FPXA 1D0GA 4QX1A 2GU9A 1IS4A 3SLIA 2ZGUA 2P3IA 2QVSB 2NPIA 4MADA 3FBMA 3OPWA 1W99A 5C71A 4M00A 5E1RA 4CUAA 2DFCA 1AX1A 3UYJA 5BNPA 1LR5A 5FJKA 1OQDA 3M70A 5T54A 3Q8EA 5C4WB 3BIWE 4D6QA 4W6XA 4UFMA 4CCLA 1JW6A 2A5ZA 2JECA 3DL3A 1LCLA 2SLIA 2XGXA 5GZEA 2ZGMA 1DGRN 1ULEA 3J8F3 1PMJX 4XJAA 4M3CA 3M3EA 3THDA 2FDGA 1MZ5A 3JU9A 4QXCA 4XQDA 5G04L 3RYRA 3TYJA 3VBRB 3C7GA 2BRTA 3WP6A 5JSOA 4WVWA 3HBKA 1QIQA 2XMLA 2OUJA 4PF5A 4EZHA 5CA6A 3VBUC 5C3OA 3S30A 1LULA 5CYYA 5FYHA 3MW3A 1UZWA 4A4AA 2UURA 2L9LA 3KB5A 4Y33A 5FUIA 5T5PA 5I8SA 2RS13 3NJZA 4QX8A 2PXJA 5A7QA 1QJFA 1R081 2WN2A 1JZ6A 4OI1A 4LJHA 4FOYA 4EN8B 3MIEA 4PDWC 3ZN4A 5IVBA 1R082 2YBKA 2CWSA 4ONUA 5F3IA 3ZFFA 2WAOA 5BNOC 3MEPA 3Q8AA 2AYHA 1JYTA 1F4AA 5E8AA 1UX6A 2YU1A 2JG8C 1VAVA 2XL9A 5A80A 4LEJA 3QCWA 5L19A 4TXWA 4I0AA 1VLNA 3ZIWA 4CCNA 5JCTA 1Z7S1 5IWFA 1SCRA 1AYN3 1Y4WA 5B4XA 2CDOA 4LBQB 4MGKE 4QGLA 4YYOA 4I2OA 5T50A 1Z7S2 2HWB3 1H9WA 1FYUA 3MBWA 2AACA 2FCUA 1LHNA 2VXJA 3ILNA 3SKJE 3OPTA 4YZ1A 4JAAA 3R6SA 2A6ZA 3D6EA 1O6UA 2WNUB 1S0JA 1G9BA 3JUUA 5EQUA 1JUHA 2V4AA 3F95A 1CVNA 1PO13 2RE9A 4K40A 4A44A 2LUWA 1W8TA 5DAQA 2XBO3 3T0AA 1WZXA 5EPAA 1X9TA 5A32B 5EJZB 2JD9A 1OHFA 4JDNA 2ZHLA 1XE0A 4Q26A 1C1FA 4UF0A 2FDKA 2E7AA 1ENRA 1LU1A 3GZTB 1MVEA 1REDA 2EIGA 2WNVA 1OQ1A 1PK6B 4NHYA 2EA7A 2GALA 4UBHA 3ZMOA 5JPMB 2Y38A 1RUE2 2B5HA 2Y6FA 3SCGA 5K4LA 1FAYA 5JOZA 1ND2C 4NIGA 4IE7A 1QXRA 2RS33 1WA4A 2BUKA 4K20A 2IWGB 5I0DA 2VZSA 2CV6A 4OHWA 4Q4X2 4WVZA 1PZ8A 2FDHA 4GJYA 2MNGA 4NAOA 4R9BA 4CA9A 1TG7A 2VH9A 2OVUA 5F3EA 3AXDA 3K48A 3B5LB 2GC3A 3MLJA 1E5HA 1SLAA 3D8CA 4PBOA 4R4ZA 5ISLA 2F6BA 4O9EA 4YW4A 3VHOA 1W06A 4J25A 3EHKA 4XBNA 1FPN3 4QAWA 4GAZA 5FPLA 1PZ7A 5LK5A 1SACA 3T08A 3I2FA 2CGPA 3FLRA 2PMWB 2VZTA 4RQPA 3WDVA 1UU4A 2IXIA 1JN2P 1WMFA 3BYWA 4UFJA 4NR1A 2E31A 2AEYA 4AR2A 2JDPA 4XOGA 5A3UA 3I2JA 5JOWA 5FY8A 2YC4A 5EFUA 5F2SA 5FY9A 5CFCA 1YFYA 1IHMA 3TN91 2HYXA 4CDQB 5L7OB 3BTZA 4FXGB 5A6YA 4IW3A 2WN3A 1Q8OA 5C4WC 2YGLA 4GKYA 4JQTA 4RR3A 5E89A 2E51A 3TN92 2BEOA 4IV3A 1UW8A 2ZGPA 3ENRA 3KLSA 4JVAA 3E5XA 3ZYBA 3FLPA 1NCRB 1E5RA 3PUHA 2ZEWA 3NNMA 3VBRC 5I0RA 5JOXA 1JOBA 5KHIA 3PDQA 3ZPOA 4P5HA 3A0KA 2FCVA 4IV1B 1AR61 3WEZA 4CP9B 3OF1A 1H6XA 4X6QB 1C28A 3CF6E 4BLIA 2A3XA 2D98A 4CP2A 4IGPA 4YRDA 1AR62 4QGNA 2LALA 4EZ4A 3U75A 2LRPA 2OPKA 4WM7B 3ZXGA 4PLNA 4YSFA 2X8KA 3UETA 4F8AA 4LOSA 5APAA 4JC1A 4TTGA 3RZHA 4DXTA 3RVHA 3VBOB 3E5QA 3B3QE 3SISA 4MSVA 1FNZA 1W90A 1UWWA 2VZVA 1NE6A 1XYPA 1DGWX 3SQOA 1WBFA 4Z07A 4G9SB 2RVAA 2ZMKA 3VBSA 2VTXJ 1G9FA 1OFSA 1IGOA 4CCEA 5C8CC 1O8SA 3DKWA 4RD7A 4CPBA 4YZ2A 4NIDA 4AFMA 3BOWA 4QM9A 2C9AA 1V9U1 3ZMNA 1ZA4A 2PTMA 3WHUA 3NNGA 3URFA 2DTWA 2VJXA 2WR9A 1ZRRA 1OUXA 2A71A 2P3KA 4AHWA 4DPNA 1HRI3 1LRHA 1X7NA 4LE4A 4AI3A 1IOAA 3DUIA 4CU9A 5FUNA 2X09A 2WNUC 4QX5A 3H9AA 4P9WA 3AYEA 4BH9A 4CDXA 4DFSA 2WYFA 1D0HA 1NCQA 3IPVA 2YB7A 4YW2A 1FI2A 1DYKA 1QOSA 4A45A 1S0BA 4CZSA 2VULA 5ANNA 3V0AB 4XBLA 4LKSA 5JVVA 5BNQA 2WUHA 2XJUA 2AUYA 4XTPA 1DG6A 1N1VA 4HANA 2RM21 5A33B 1W8ZA 1QMJA 3CMGA 5F9TA 3SEEA 3RZMA 1FMD3 2RM22 1QJX1 5L9RA 5KXCA 1HQLA 5FRAA 1G8WA 4RHV1 3FFQA 1L3JA 4MHUA 3FL7A 3HVDA 3IIIA 4JGZA 1PK6C 2WNEA 3QH6A 2ZAAA 1QJX2 5H9RA 4EV0A 4DUXA 4COWA 4RHV2 1C57A 1MS3A 5F6LB 3N9NA 5K0UC 3K4DA 4YM0A 1K42A 4FT8A 1AYM1 3CJIA 4EWDA 3ETPA 3NW4A 3RFRA 1W0OA 2RMU3 1HQNA 3WX5A 1AYM2 2Y26A 3TRSB 3TEXA 4HL0A 4OQ9A 5ACA1 5G05L 3M3IA 3J26N 3KT4A 1ONAA 3KV9A 3SH3A 2VVEA 3ME2A 4BXFA 5ACA2 2V5YA 2C26A 4QQ2A 4NO4A 3ZPYA 4DQAA 1QWRA 5A1LA 3M3CA 3USUB 4AVCA 1TME1 1AR93 1GU3A 3P6BA 4HN0A 4CCDA 5C9AB 2A6XA 1WCKA 5FLJA 3MFCA 4OUSA 2W5FA 1TME2 4PJYA 3OCPA 4P9YA 5FPUA 2QUOA 1W8FA 2HWE1 3BPZA 1H2MA 5FZHA 3VZKA 1XE7A 4QQPA 1O3RA 2ADDA 2VUJA 1OA2A 4JQRA 4KWJA 5FZOA 2HWE2 1K45A 3DGTA 5AC91 2VQAA 1MS1A 2VGDA 3U0ZA 5DDJ1 1JYCA 4CDQC 3JBG1 5T52A 4Q4Y3 3GALA 3WF4A 4FXKB 3ON7A 1AR73 5DDJ2 3ZSKA 5AFBA 2Z2SB 3JBG2 4E9KA 4XIKA 3QACA 3RNSA 2YC2A 2W2IA 2VO5A 2VOTA 4IEZA 1NCRC 5CFDB 1VB2A 2D5FA 1PIV1 1CGPA 4F83A 1QJY3 2DWRA 2J22A 5DMYA 3EB7A 5JZGB 2P3JA 4IV1C 5FYZA 4XUOA 4AVBA 1PIV2 1O4TA 1SEFA 1RUF3 1QXJA 2IFRA 3ACHA 3O14A 1HB2A 4GULA 3PMEA 4RN5A 2PHDA 3PJYA 5H9QA 4OHXA 1Q56A 1CAWB 4QPIC 1WLWA 5A6QA 1MS4A 1S0FA 2ZX4A 2A6YA 4WM7C 2WNOA 4YG3A 2BZDA 1UXXX 4JGYB 1WMEA 2F4PA 1ND3C 1V6KA 3VBOC 1MR5A 2I74A 5FKCA 3RMYA 2VG9A 1QOOA 4L8QA 4H7LA 2XDVA 1W6MA 3UV9A 4LO7A 1ZM1A 2RDNA 5FUPA 1OURA 4PHZA 4L92A 3POIA 4BU2A 1CAVB 2W3JA 4DEVA 2XB6C 5FZ9A 1DZQA 2CGNA 2DDUA 2WINB 5KC5A 5I8TA 2ZGLA 1LGNA 2Q8CA 4QHBA 4Y1VA 1WLCA 4HKLA 4UT5A 2D40A 2GC1A 2YYOA 3G7DA 5FMBA 4LHSA 5FMOL 1GWMA 1H0BA 3AYDA 2ZCWA 2VW0A 5CISA 2ZBJA 5BNPC 4FP2A 4YG0A 2VMCA 2XQRA 1COV3 5E88A 3AMHA 3DXUA 3Q8FA 3AZYA 4XEZA 4BQYA 2W68A 2R061 4FTEA 2UYAA 3TBDA 3W5NA 2QJVA 4Y26A 3VDDB 2Z4FA 1LGBA 1YRZA 1IQAA 2R062 3HQXA 4ES8A 1GZWA 2ZHKA 3J4UH 2P3YA 3AMPA 4S2GA 1HRV3 4YM1A 1OOPB 1Z78A 2W46A 4M3CF 2BW8A 4BA6A 1VRH3 1A3KA 1S0CA 3SH4A 2DUOA 3OG2A 1G6NA 1WD4A 1JS9A 2YMZA 4OFGA 4PI2A 3LDBA 1OUSA 2OZJA 3WNOA 1UD1A 4M0HA 5FFOC 3CIHA 3ZYHA 1W04A 3EYPA 5E16A 3W59A 1AYN1 1B35A 5FYYA 5LW9A 3U78A 4BQ4A 2D6OX 3KVBA 3WP5A 2HWB1 4OI0A 1JOPA 1AYN2 1F15A 5A3LA 1D4VB 3ILRA 4JX0A 1C4RA 2BP6A 5IK4A 1JZ5A 2HWB2 2DVAA 5LA0A 4LA3A 3DYOA 2BNMA 4CUGA 1R1ZA 2WQ4A 2ARXA 3TWIA 4XFCA 4IE6A 1PO11 1H1MA 4PIYA 1O59A 1KRIA 4XQWA 4D7SA 5HCHA 4FOQA 2XBO1 3WW3A 2OXBA 2GN7A 5FREA 1BKZA 2O1QA 4OVEA 1ZZ6A 4XMAA 5BY5A 5C9AC 4MGYE 4PLOA 2XBO2 4G4FA 3ACLA 3NRUA 3I2OA 3NO8A 2W94A 3PUIA 4XVHA 4KI5M 3HT2A 4QDRA 1CESA 4QPGA 4Q2FA 1H1IA 4Y20A 4GWNA 3OUIA 4FPCA 2ZHMA 4XF9A 3I2HA 4XFGA 1Y9GA 3A22A 1VMFA 4Q8KA 3I3DA 3ZFEA 3FJSA 4BMEA 1MZFA 3UJQA 3RJ2X 2VMHA 1QF3A 4I30A 1PM4A 1W2TA 1VBD1 1XNTA 4XDPA 1GICA 1SPPA 2VCAA 3WDYA 1JYXA 5CFDC 2QQNA 3CZUA 3ASIA 1TMF3 1VBD2 3N36A 3V64A 4L99A 5JZGC 4N9IA 3OGGA 2PAMA 2GSYA 4LKEA 1I3HA 2WYSA 1FPN1 1NUKA 3ZR5A 2VMGA 3MDPA 1LESA 4Z2WA 1FPN2 1L7LA 1K5MA 3OB8A 5DZGA 4YVWB 3VBHB 3LZZA 5FYIA 1HB3A 3T1LA 3BTXA 2V5DA 2WKKA 4EN9B 4JGYC 1SFYA 2P1BA 2VQTA 4XFFA 4A6SA 2DU0A 3TAYA 1UU6A 3A0NA 1XJAA 1QEXA 1U5XA 1OD3A 3ZSLA 1S4CA 1CAUB 4LIVA 3M4FA 4KGQA 1APNA 4FBFA 4FI9A 4GMP3 5C3RA 1YLLA 4N53A 1UN1A 5A3OA 3JD73 3WP3A 1C5HA 3OBTA 3MHZA 2HWD2 4FFGA 5CKQA 3DYMA 2QKDA 3ACIA 4QHOA 4MXVA 5F37A 1W6NB 3RPQA 5IUQA 5SV8A 5FBZA 3RG0A 3GXUA 4AXOA 1U5ZA 3DPRB 4AFDA 3C3VA 5ANQA 2ZKLA 5F7UA 2WFPA 2RDRA 1HN1A 1V6OA 2JICA 1ULDA 5FP3A 4IV3C 1PNFA 1ZZ9A 3HBZA 1SBFA 4FPJA 4C1WA 4Q5OA 5A7WA 1UY0A 2D6NA 2J1VA 3AP9A 3WNPA 1POQA 3BALA 1AF9A 5DZEA 4IEVA 2RHPA 5FPZA 1OOPC 1WCDJ 2DTYA 3FWEA 1IQDC 2BJSA 1LOFA 2Q8EA 1TEIA 5DPNA 4HETA 2H0VA 2ZXQA 5FZ0A 4RS5B 3WINE 1QQP3 1ULFA 2AZ5A 2E53A 2VMIA 2WWSA 1ASJ2 5GZGA 3KZ4C 1ZZ7A 3WW1A 4OMDA 4XJZA 2GDFA 3S7EA 1RXGA 1EPZA 5JWPA 2QQUA 1UOJA 4XUPA 2VNGA 1SDWA 1Y9QA 2JDZA 1HRI1 2Z42A 3U4XA 1H8TB 4LR4A 2ZX0A 3MFAA 1MQTB 2B9UA 2BTVC 2QQIA 3ACGA 4NRMA 4Y5SA 1HRI2 1UF2C 2Q1FA 2JE7A 2JDKA 3MIFA 4TYSA 2W1UA 3LF7A 4ZS2A 1BVP1 3WQ1A 1DCSA 3O1MA 1HXS1 1UY3A 2NMNA 1ZVFA 1REFA 3VL9A 2EXJA 2YC0A 1NA1A 3AKRA 1ZA7A 1HXS2 1V6LA 1H4GA 4MXWA 4A3ZA 1ENQA 2AENA 2VNOA 4YFWA 1RYYA 2PHFA 3LEKA 1FMD1 4AF9A 2B9VA 2XJPA 1D2SA 1N3QA 4IEWA 4DINB 2WSVA 3OUJA 4AG4A 1FMD2 1NCQC 2D3RA 1ZRCA 3ES1A 2GMMA 1AL0G 1T2XA 3IMMA 3NWKA 3ZN6A 2P5BA 1YXWA 4RYDA 3VBUB 3OEBA 1S2EA 1DYOA 2WT2A 1JYNA 1UPIA 2R043 4JDMA 2RMU1 3UGGA 3VDCA 3I3QA 5F5QA 2WLQA 3MPBA 1IS6A 5DN2A 5CIRA 5JI9A 1F8VA 1ULGA 4I09A 1B09A 4DRRA 3IWZA 3GNEA 3ITQA 4UW3A 1NG0A 1PVC1 2BFUL 2W0XA 3VZJA 1AR91 1GNZA 1ODMA 2OIIA 4L9BA 1PVC2 1N1SA 3CJIC 2D93A 2ZGNA 2OW4A 4NIHA 1AR92 4Y1YA 2RG4A 3VBHC 2ZMLA 4F7ZA 1VPHA 1LGCA 2JB4A 4CP1A 2H6CA 5F6KA 3MICA 5JOYA 2JIGA 1CAXB 4CEWB 5ABJA 1F35A 2GNDA 4LBOA 4C1XA 1IPKA 5LWBA 5C3SA 2LW8A 1DQ6A 1JXNA 1LOCA 4PQQA 4W6WA 4CCMA 2P37A 2IC1A 5IK8A 1LECA 4NPRA 3AZWA 1AR71 5DAXA 5D21A 4WZFA 4P9JA 3FUOA 2A75A 3ZYRA 1WBLA 2FQPA 2ZPXA 4QB1A 4BHPA 4DO0A 1AR72 4CVUA 1RMU2 4ZKTB 2B45X 4P9IA 4Y5Z0 4K9SA 1C8M3 1IS3A 2YG0A 3VDBA 1QJY1 3W58A 4A42A 2AH2A 3DPRC 3VZOA 3LIGA 4DMIA 2Z69A 2B4KA 2W39A 5A3WA 1RITA 1QJY2 1RUF1 1CONA 4PF1A 3THPA 4UW6A 1RC6A 1XRUA 1RUF2 2XQXA 3AC0A 5FYVA 4AL9A 1W6PA 2W9XA 1JYWA 1FV2A 5IK5A 2E63A 2K2SA 3KF3A 3VD7A 3IAPA 3NKTA 3H50A 4D69A 2DBIA 3N9PA 4U36A 5JPNB 5JUVA 2X53S 4XILA 1UIJA 3BN6A 3OSDA 1I5PA 5FQ0B 4GIQA 5FP4A 1QJEA 3B00A 4CP0A 2Q5TA 5ERLA 1MS9A 2BNOA 2ES3A 4O7XA 2D5HA 1HV1A 4NHLA 1S0EA 5F1RA 5FWEA 5BNNA 4RS5C 5IT6A 2ZZQA 3NNFA 1RTVA 1ZX5A 1IKPA 2ARBA 3LFMA 5J7MA 4IEOA 2H0BA 4BE3A 1IZ3A 2NQYA 3OYWB 5DZFA 5FLHA 2DCZA 3J7LA 5DXDA 3CO2A 4AEMA 1SLTA 1S2BA 4TLGA 4XUNA 3LPGA 1NT0A 5FIXA 5GLVA 3GJAA 1COV1 1H8TC 1POV3 3KCCA 3EO6A 5CVRA 3WF3A 1MQTC 3BVCA 3VB9A 3M8LA 5LK7B 3VBFA 1VBA3 1COV2 2CDPA 3ZXAC 4QB2A 1N47A 4Q27A 3P3PA 3QBQA 3I59B 3ETQA 2R0HA 1HRV1 3UESA 4AI1A 4ES9A 4X8NA 1YFWA 5FLIA 3LSDA 4QPYA 1YUDA 1VRH1 4XF4A 1W8NA 5CG9A 3MLLA 1HRV2 1LOEA 5CZKA 1DQ0A 4LQRA 2D43A 2WO3A 1VRH2 1OPMA 1GNHA 1QHDA 5EJ3A 3E6BA 2Y6KA 1Q8VA 5I91A 2XVLA 1NXMA 5C6CA 2WZR3 2ZGTA 4Y22B 1FATA 4LMFA 3WG2A 2X5IA 4NHKA 3SKVA 1JZ4A 4Y1ZA 3O0WA 3VKNA 5F5AA 4A7KA 2FZ1A 2OA2A 2CHHA 4E4HA 4LKDA 4OZXA 4N43B 2HEWF 3NNLA 4UBGA 4WM8B 5LBBA 4UFLA 2QCSB 4AI9A 5K9YA 2DFBA 5JMOA 4BQ3A 4PIZA 1DQ2A 3OTFA 2IXCA 3B9IA 2BQPA 1PGSA 4TLFA 4HPKB 5A3MA 1AR83 5DG2A 5FZDA 3MZHA 2VNRA 2ZGSA 3KHBA 3HQRA 3LEIA 5FXXA 3ZO0B 2W95A 2XJVA 2YFZA 3HWJA 4HSJA 4QDQA 4XETA 2VUAA 4JHTA 2LROA 3MI8A 4MGSA 4CEWC 4R9DA 3ZKYA 4LXLA 1O5LA 2PHRA 1YQ2A 3KWVA 1TNRA
chains in the Genus database with same CATH topology
3ZFGA 3SMHA 4YZ3A 1W6QB 3RI9A 3ROUA 4CEYA 4COZA 2YDEA 2YUEA 1O7FA 3VHNA 3V0BA 1TMF1 1CIWA 2B39A 5C8CA 2BYVE 3JB8A 1NXD1 1TMF2 4YLZA 3ZFEC 4IXLA 1DDLA 3PJQA 4QMAA 1PGW1 5AVPA 2NN8A 1G9CA 3WD5A 3CLPA 1YIPA 1PGW2 1U12A 5I0TA 3KT7A 5K0UB 1RUG1 4Q0QA 3MIHA 2GC2A 4MUVA 1S0IA 1HDKA 1RUG2 2JX9A 1F31A 1PZ9A 4IEPA 1KDMA 2ZA9A 2JE9A 5BV6A 2WL1A 4GMP1 1AL23 4NN0A 3JD71 4FP3A 4KWLA 1UPSA 3GHMA 2D6MA 2MEV3 2IXJA 3H3ZA 2WS91 4BLJA 1XNCA 2QZ2A 1A8MA 2UY9A 2WIIB 2WS92 3HT1A 2NYYA 3KGZA 1CX4A 2UWAA 2YZ4A 1AXZA 1SLLA 2Q4SA 1UZYA 4FPEA 5GZCA 5J3UA 4B7EA 4TZDA 5JMCA 2K0GA 1URXA 4MV2A 2Y0IA 4OLLA 5LEKA 5JI7A 1PM7A 5D8AA 1VBE3 4WBBA 3FX3A 1QQP1 1HW5A 1GFF2 4FPHA 1H4HA 4Y4YA 1W6OB 1QQP2 1HIXA 4Q1PA 4C91A 1AJOA 3RMXA 1PNGA 4KWKA 4RGGA 2OYZA 2PHTA 4QPIB 4WM8C 4N43C 3WZ1A 1LEMA 3DV8A 4MGIE 2NZ9A 2WA3A 1X50A 4QQHA 1ND3B 2IFWA 3AXEA 3MIBA 5FO9B 1Q43A 3WP4A 2Q1ZB 4HKOA 4MZUA 3LA7A 3H7YA 4KBBA 3RS6A 3HIFA 4O9GA 1YJLA 4H55A 4ASLA 2PQQA 3VZLA 3SITA 4XPVA 4I0BA 3TNQA 2EAAA 1Q8SA 4FTBA 1VBC3 2XKOA 2XLGA 2NMOA 4AWDA 1RGSA 4D3WA 5T5OA 5EXOA 4AVTA 5BNPB 1V9U2 4M3CE 1BK1A 5JLVA 2I07B 2R041 4M3CB 4C90A 5KHGA 4NWWA 4HK8A 5I93A 3NVCA 4D94A 4MVTA 1DLLA 2E7TA 3GBFA 3ZYIB 4OHYA 4MYEA 1GYKA 2XG3A 3SNMA 4W65A 4P14A 4ZXKA 1BQPA 4HFSA 2FBEA 2QFEA 2XWJB 3ZDSA 1DQ1A 3PTYA 4S2DA 4FVVA 3O7OA 3LKJA 2DYCA 3WG3A 1OD5A 2JG9A 3ZFFB 4PLMA 1BCXA 2VOVA 1VIWB 4UXAA 1SLIA 5JR7B 2WA4A 5HXVA 3KCXA 1QU0A 2D3SA 4IEXA 5BYNA 1C8M1 1RIRA 3HMYA 5FO8B 1AUYA 2CYFA 3MLKA 3S0MA 1C8M2 1LU2A 1RJ8A 1YJKA 4B4RA 2ZMNA 4AW7A 1PO23 1UL9A 4AEJA 2WT0A 4GH4A 1J1TA 2DUQA 2G9GA 3BODA 4I02A 3PVEA 3WCRA 4YM2A 4ZU7A 4ZU4A 4FQ4A 4GMP0 5AC92 4EWEA 5T55A 4KQ7A 2Q1MA 2UWCA 4HVRA 4XJ9A 2ET1A 4HLTA 1SQ4A 3UK9A 4C0HA 1UCXA 3ZXDA 2WNVB 5H9PA 5GLZA 1BXHA 4JRLA 4A7YA 1BEV3 1HV0A 3KQRA 5KHKA 4FPYA 3N4MA 1EV13 3SHRA 4LULA 1MZ6A 4CDWA 4WVMB 4COUA 3MW2A 3JB4C 4N7IA 1POV1 1RUC3 2BPA2 4A7ZA 1DF0A 2D6KA 2ERFA 4MH0E 4A3XA 1VBA1 1KJRA 3ZYGA 1UZZA 4URTA 3EBRA 1VBA2 5LEJA 1YI7A 2ZKNA 1H9PA 1HKDA 4LUMA 4XE9A 5DUVA 2Z5WA 1LOAA 4QQOA 5J36A 3J8F1 3RYKA 4RQPB 3QD6A 4YW5A 4FAHA 2PLV3 2ZACA 4PQ9A 4CRQA 5JSPA 1QH6A 3J8F2 5JIAA 4Q0VA 5I8YA 2WZR1 4FTSA 1AVBA 4AEDA 1V70A 5CFCB 1JBCA 2A3WA 2WZR2 1MS8A 5AVAA 3FFZA 4RR3B 5EV7A 2NP0A 1E57A 4IV3B 4YW3A 3S6PA 5JSOA 4K3UA 3I2DA 1ZBE3 4GB33 4HVQA 1WW4A 3O0XA 1Y43B 2RS11 4TSVA 5GM0A 3AKPA 4DNYA 5KXBA 1SBDA 2CTVA 4YGDA 5T5LA 2RS12 4NOTA 1X33A 1FOD3 5L73A 4CDUA 5KXDA 2CNAA 1OPOA 2WT1A 3H1MA 1UIKA 1AR81 1QNWA 1DYPA 1GBGA 3N7LA 4QT6A 3M3QA 3KGLA 1AR82 3E97A 4HKWA 3W9AA 1W2UA 2PHLA 3WG1A 4RL7A 2Q0AA 1RUJ3 4XXAA 3ZSJA 4PIXA 3ZFFC 3M2MA 3TOJA 3CJXA 4M0NA 2D6LX 3VBSB 5CG8A 3I8TA 2XWBB 3BB6A 2OZ6A 3DF0A 1PVXA 4XHBA 3KM5A 3VKLA 4QXKA 1PO12 1QH7A 3SH5A 4PDWA 3ES4A 3JCIA 1ZZ8A 1VB4A 4ISRA 3SCHA 4I3GA 4DZGA 5DG1A 5KHJA 4XJ8A 4Z92B 1M4WA 3M7AA 5BNOA 2PN5A 1AZDA 4LBKA 2JG8A 2ZGQA 1W39A 3ALQA 4CDXB 3IPVB 1NCQB 4OHZA 4LLFA 4OI2A 3POSA 4Q1RA 3R05A 2RS31 4RGAA 4LHLA 3RYPA 4AQ6A 2OUHA 2RS32 4JDOA 1LODA 4BZ4A 1M06G 1AL21 4K6BA 2WNVC 1GR3A 3IDCB 3B02A 4JGZB 2QDNA 1I5ZA 2GZWA 2MEV1 3LGRA 1BJQA 5FAXA 2C5DA 4UW4A 2LTNA 1HX6A 1Z7S3 3M1HA 3TB0A 3CJIB 3VHPA 2XKPA 1O91A 1GZ9A 1VAKA 3N7MA 4AHXA 5CBLA 5T3NA 5C33A 4AYUA 3FHIB 2VVDA 5I0UA 4E2SA 4AFCA 1UMZA 3NL1A 1QKQA 4KG0A 3AP5A 2ZABA 1ND2A 3U11A 4D7YA 1F2NA 3ZIXA 4Z1VA 1O3QA 2DCYA 1G9AA 4RQPC 2YV8A 4D7TA 4GQ7A 1D4M3 5JDBA 1RUE3 1OA4A 3CNAA 1UKRA 5CFCC 4YVSA 2TUNA 1EP0A 4Q4X3 3JZVA 4W6YA 2HWC3 4INDA 2KXLA 2H6BA 4RR3C 3GYDA 3VL8A 5BXXA 2BBVA 4YW1A 2VPVA 5CADA 3NAPA 1GQGA 5CB7A 2ZOEB 1MACA 1H2KA 3BCWA 1GANA 4FO9A 2R32A 2WSUA 4LBMA 4LHNA 1YIFA 4DOUA 2HWF3 1QJZA 2Z79A 4Q29A 1IS5A 5C4WA 1V6NA 3MGUA 1YYNA 4B4PA 3KD4A 1LHUA 4I3PA 2FMDA 2R073 3LSEA 1QOTA 3FE5A 3VZMA 5GZFA 2WZPP 2B7YA 4YGBA 3VBRA 3AYAA 3AKTA 2DVDA 3OBRA 1W6MB 2QNKA 1RUH3 3TN93 4H7MA 1VAMA 3VBSC 3IDBB 3FMGA 1WD3A 3THTA 2JD4A 5HI0A 1DQ5A 4DY5A 3OY8B 5GLUA 4R8HA 3E6CC 2Y0OA 1VBB3 3RI8A 1DHKB 3LA2A 5J96B 2BWCA 2JXAA 1NZCA 1GKBA 3WW2A 4X8PA 5HBAA 1C1LA 1C5IA 1VP6A 4MX3A 1EPWA 4HVOA 4META 4CDXC 4E2GA 3B94A 3RJRA 1GZWB 4DS0A 1DIWA 2XUMA 3VUOA 4LBQA 4FPOB 4XMIA 4OHVA 1XYNA 1LEDA 1ZYBA 2RMU2 2WNUA 1SBEA 4JGZC 3P3NA 2A73B 1TNFA 2FZ2A 1B35B 1DBNA 4S2FA 2G9FA 4GXLA 1T6GC 3UKTA 2JG9C 1CN1A 5A32A 3ZXKA 1PO21 4YG6A 4E4SA 4Y1XA 1PO22 2YGMA 4GWMA 1ALYA 3AP6A 3VZNA 1PK6A 4Q4Y1 3WQ0A 2CGOA 5KC6A 3IN9A 3RSJA 3MW4A 3E6DA 2GNMA 4LO8A 4Q4Y2 4GH4C 1A6CA 4KNCA 3VKMA 4C0BA 1EAH3 4RHV3 3WW4A 2BVVA 4QPGB 5KBFA 1BEV1 2XLAA 4BMBA 4AE2A 4AQTA 1Y7BA 1EV11 1BEV2 4IQPA 3ZFEB 1OI6A 3HAGA 2CY6A 3K51A 3VKOA 4HT1T 2Q30A 3JQXA 2BNNA 3IBMA 1R1A3 4SBVA 1Y3TA 1EYBA 2P34A 4CDQA 1H2NA 5L7OA 3IT8A 4YZ4A 1JYIA 4UW5A 1K5MB 1OLRA 2CWMA 1RVF3 1WMDA 2ZGRA 2PLV1 1SCSA 1DFQA 4R52A 2HWE3 2GNTA 1NQDA 1NE4A 5JIUA 1NCRA 2PLV2 4U2AA 2R0FA 3QH7A 5HCBA 3H3UA 4WZCA 4IV1A 5C8WA 4BPZA 3NV3A 1CD3G 3VHRA 4XQ4A 1NLRA 1ZBE1 4GB31 4N53B 1ZRDA 4WM7A 3E5UA 4KU8A 1FNYA 4GB32 1IPJA 3GHNA 4KGGA 3O12A 4QU2A 1ND3A 1FOD1 3VBOA 3AKSA 5LRSA 4YGCA 3ZX7A 4IEQA 1FOD2 4RSUA 1RINA 2RS53 4AEKA 3AFGA 1UAIA 2LM3A 2ENRA 1DGRA 2A3YA 3LWCA 1NYWA 4LA2A 2TEPA 4F3JA 1QXPA 1RUJ1 4CDUC 1RUNA 4LE3A 4AI2A 5SV5A 1RUJ2 2DVFA 2XL7A 4YFZA 4FPKA 4AGVA 1KITA 2ZS6B 1G9DA 2GN3A 4EJRA 3PLQA 5CAZA 1B35C 4AQSA 1XNKA 3V0AA 1KDKA 2XJRA 1X8EA 3AYCA 5A33A 4FOVA 4XJUA 4AHZA 4LNVA 5CNAA 2CL2A 3ATGA 1YI9A 2R063 3SCFA 2UY8A 4XF1A 5GALA 4QQLA 1NQJA 4H14A 2C0ZA 1EY2A 2VECA 1ZRFA 3H1YA 4BYYA 1NA1B 1NY71 4HN1A 2A7AA 3VGIA 4MXWB 4MLOA 4IL7A 4WVVA 1F5FA 1NY72 1SLCA 1D2QA 3AZVA 1J59A 4XFBA 2ETEA 4KU7A 3AMQA 3WDWA 1TE1B 1WW6A 3WY6A 4QPGC 4YZ5A 5FO7B 3IIAA 4R4XA 1XNBA 4M01A 3ZN6B 2NLRA 3N35A 3USUA 3KS7A 4Z82A 3V65A 3MPPG 3ZXFA 4B7KA 5C9AA 1LOGA 1XXNA 1RB8G 1I6XA 3GZAA 3LOBA 4HK9A 5JSRA 1RUI3 4XZPA 3WOGA 3S7IA 1VJ2A 3ZXLA 2YPJA 4QM8A 3I54A 5GJ6A 1GLHA 4LT5A 2XVKA 1K5MC 2W52A 4ZU5A 2HJIA 3VLBB 5EWSA 3WR0A 2PHXA 2X29A 1CQ9A 1D4M1 1X36A 2IXKA 3QLQA 1RUE1 5FCCA 1AX0A 1QGLA 3JD72 5CFDA 5ABJB 1FT9A 1D4M2 4FSJA 1RHI3 4Q4X1 1LTEA 5JZGA 1RUD3 2HWC1 3AJZA 3I4IA 3WHTA 2JJ6A 4WVMA 2HWC2 1CAWA 3PNAA 4L11A 4N53C 1ENXA 4ATEA 2EAKA 1OSGA 1MS5A 1VBD3 4JGYA 1LKNA 2EVXA 3DN7A 3QOPA 2XHKA 4FPLA 1U0AA 2B42B 1S55A 2EF6A 4YVSC 2VXRA 3AMNA 2HWF1 1YCIA 2QZ3A 1SLBA 1CAVA 2HWF2 3B9CA 2R071 3B69A 3NAPC 2V73A 1W6PB 4LO4B 3AX4A 2JKBA 1YFXA 1PGL1 2R072 5KWRA 2WJSA 3UKNA 5J48A 4XF0A 4Q8LA 2ZX2A 5FOJB 1PGL2 1PMIA 3WLUA 3NV2A 1LOFC 1RUH1 3D0SA 2DVGA 4XDQA 1RUH2 5BNNB 4RFT0 2XLFA 3FUQA 1H8VA 4K8FA 3MF9A 1IKQA 2HWD3 3PVNA 1CR7A 2RR13 3SXWA 2AREA 3VDDA 3I7DA 1H30A 1KS4A 3UJOA 1VBB1 3ZXJA 3USSA 3POWA 1OOPA 2WFF3 5GZDA 4YNIA 2KM2A 2R16A 3J9SA 3FC0A 1VBB2 2YY1A 3VBFB 1BVVA 2R49A 2ZHNA 4PBPA 1UKGA 3WUCA 1H1AA 5T5JA 1LOBA 4B8EA 3ELNA 1N1YA 3BTAA 3NKGA 1NA1C 1SFNA 1C8NA 1ZBA3 2R042 3EXUA 5FDBA 2XJSA 1ASJ3 2TBVA 3AK0A 4AQ2A 3BU7A 2E6VA 1BYHA 4FOWA 4JTNA 5EYXA 1QJU3 4IESA 3D5OA 3ILFA 4LLOA 2UU8A 4AFAA 1O3TA 3L9JT 2X5IB 4HBNA 3UL2A 4ASMB 2O8QA 2PAEA 4HZFA 3R0RA 3M3OA 3AZXA 1F9KA 2DVBA 4G3YC 3RRDA 1N3OA 2DURA 3WVJA 4LBNA 4Q4V3 1A78A 2R30A 1JTZX 3KCYA 1HXS3 1LHOA 1I1EA 2IXHA 1GV9A 4J1WA 4XBQA 1KXGA 1EAH1 2GAUA 2G4IA 5ABJC 4JV4A 4FCAA 2WQZC 2ZJCA 4LO6B 1EAH2 3RWNA 4CTEA 3R4SA 5J37A 3O0VA 4ITCA 4HSLA 3WDUA 1FV3A 3AZZA 4Z8BA 1G86A 4YVWA 3ZFGB 3VBHA 3IDEA 3ECQA 3IMNA 4XJWA 4CEYB 4AK3A 1A8DA 5DUXA 1R1A1 3V0BB 5TSWA 3ST7A 2KA3A 5C8CB 3CL1A 2BVBA 1PVC3 3AMMA 1R1A2 3HN1A 1OKQA 4XFAA 5J98B 1PHMA 1S1AA 1ZZBA 2P17A 2C1FA 5I0SA 1CAUA 3RDIA 1RVF1 4AI0A 3AM2A 2AGSA 3OPZA 5D1IA 4E4DX 1JUIA 2DV9A 4E4ZA 1RVF2 1XE8A 1W6NA 1XYOA 2VW1A 3DPRA 3B7MA 5L7OC 1AX2A 4K1ZA 3HD8B 4AVSA 5BNNC 2WLPA 1R093 1MEC3 1RMU3 2IZWA 3LCPA 4QGMA 1Q5OA 1QNYA 1OA3A 4AGGA 2RJKA 2YROA 1XU1A 2D7FA 2DU1A 5B2GB 1U5IA 2WC2A 3B93A 2RS51 2HEVF 1LHVA 4A2UA 1V6JA 1X8MA 2VOKA 4R9AA 5CU1A 2RS52 4RS5A 1VR3A 4XFIA 2DUPA 3VBFC 4H3WA 2K9ZA 3INAA 4DY3A 3FLTA 4XTMA 5LRRA 4FPFA 3PMSA 4XW3A 4B3NA 3AB0A 3WCSA 1OFNA 1O3SA 3KMHA 2PHWA 4PCRA 3G6JB 5D8AB 2AR6A 4E27A 2CAVA 1H8TA 2ZGOA 1C3HA 1MQTA 1WLTA 3LOIA 1DGWA 1ZREA 4DXZA 4AVAA 3POYA 1BBT3 4EN0A 3OY8A 2X5IC 1XU2A 4Q4W3 3IKWA 4EN6B 1OLQA 3D82A 3GBGA 4K7JA 1AXYA 4Q0SA 1ZNPA 2XH6A 1H2LA 1Q8PA 1N1TA 2VW2A 3FBYA 5FTTC 5GLTA 4EROA 1Q3EA 3BOPA 3AKQA 4P9GA 1CPMA 3WUDA 1X82A 5FMOS 3ZSMA 1N3PA 1V6MA 2JEMA 3VBUA 4GALA 3ZYJB 5K8SA 4B29A 4OI4A 2VU9A 4NVPA 3H0OA 1F5JA 2VY0A 1XNDA 2DCJA 2YXSA 4RA0A 4I0WB 3C2UA 3APBA 1J1LA 1AJKA 3JQWA 3VV1A 2GC0A 3N3HA 1I9RA 1W0PA 2DCKA 4MGZE 2BGCA 3TNPB 3ZXEA 4IEUA 1HLCA 4Q0PA 3U07A 4LO5B 1REEA 3ZFGC 4X6RB 4CEYC 1KQRA 1RUI1 3VKFC 1CJPA 3ZSEA 3WV6A 4JTOA 1R083 1WLDA 1CAXA 1WUVA 4CEWA 3AFKA 1NLSA 5C8CC 2BWAA 1RUI2 3R4DB 2PFWA 4XXPA 3D4KA 5GKAC 5JAXA 4E2QA 2XJQA 3CEWA 4SLIA 2XJTA 4BIFA 4KH9A 3O5SA 1AL22 3ZN5A 1TQ5A 1QDCA 3AP7A 2W08A 3D0JA 1KD7A 1RHI1 2MEV2 3H7JA 2JG9B 3H8UA 1RUD1 3OD4A 5HCFA 3AP4A 1RHI2 2DCTA 1GQHA 1RUD2 3ZVXA 4BOWA 1FX5A 1V6IA 2B46X 2D97A 2E7QA 3WNXA 4BWOA 4L2NA 5FQ0A 2I2SA 3OD0A 1KFUL 4GKXA 5EYYA 1KS5A 1VBE1 4HMZA 4GH4B 2R1DA 3MIGA 1Z0HA 2ZX1A 3EQEA 4LBLA 4AHYA 1VBE2 4LTAA 4P9LA 1U5YA 2UYBA 1POV0 4LBQD 3OYWA 2YHJA 1DZRA 1AXKA 1MS0A 5BUVA 1RUG3 1V00A 4EN7B 1JOJA 4YM3A 3PHMA 4IERA 2R1BA 3U10A 5D8AC 3OGJA 3B01A 2UWBA 1DGLA 2XPJA 4CYDA 2HWD1 2O0OA 1ZZCA 2RR11 4Q0UA 4GA9A 2GH8A 1KFXL 1NOVA 2MHFA 3I59A 2RR12 3HR9A 3IM0A 2WS93 4CDWB 2WFF1 2HEYF 1DU3D 2V09A 2D6PA 4N7UA 4KG8A 2B8MA 1DQ4A 4K21A 4XYXA 2WFF2 1XQNA 4BQ1A 3RQ0A 1GSLA 1RJ7A 4AVVA 1VBC1 2O8OA 1OQEA 3L2YA 1S2KA 4J1XA 3VN4A 3R4UA 3VDDC 1VBC2 5HCAA 4Y22A 4BIOA 1J58A 2PHUA 1ZBA1 2QDRA 3WDTA 4DRVA 3N7KA 2NM1A 2XVGA 3GF6A 1ZBA2 3OJBA 1LHWA 1WW5A 4N43A 4WM8A 1ASJ1 3L2HA 1QJU1 3AJYA 4JCKA 4AEDB 2EXKA 3NV1A 1QJU2 1AR63 4BM8A 3KT1A 4HPKA 2FMYA 3EJKA 2D3PA 2VVFA 2GMEA 2ZAHA 1JHNA 4ORFA 1YO8A 2MPFA 1S0DA 1WGPA 2A6VA 4Q4V1 4XIOA 1GZCA 3PVBB 4CDUB 5AFEA 4DB5A 1RUOA 3KSCA 4Q4V2 5DUUA 2VQ0A 4NWVA 3Q9OA 2TNFA 1O4YA 3WQ7A 1OMIA 1BZWA 2PAKA 4XHXA 2R6QA 5GLWA 4LHKA 1W6QA 3NV4A 5FOBB 4Y24A 4V1PA 2N7GA 4P9XA 1V9U3 3PVOA 3WG4A 5EZWA 5KXEA 2PELA 4AGRA 4EWAA 1MZEA 2IXLA 4N9HA 4QD2A 4J6GA 2QQPA 1JH5A 4BCUA 2ET7A 2PA7A 1WW7A 3CU7A 5L36A 5K0UA 2QE3A 3T1MA 3GZUC 1ULCA 2ATFA 4PDWB 3WXPA 2FHRA 1S0GA 2I45A 2EXHA 1HQWA 2RM23 3H1WA 3LAGA 1LJ7A 5BNOB 1QDOA 1YFUA 2GNBA 1YWKA 1YNAA 5K7PA 2Q8OA 1QJX3 4YVWC 5DUWA 2JG8B 3LA3A 4OULA 2HKXA 2A6WA 4Y20B 2VOWA 1J3QA 3X29B 2VOXA 2P2KA 5IK7A 4YGEA 3WT3A 2EXIA 4TWTA 4S2HA 3MIDA 2BFUS 3T2TA 1AYM3 4WV8A 2HYKA 1EV12 4R9CA 3UKVA 1RUC1 1G7YA 1MEC1 1R091 1RMU1 4I01A 1RUC2 3NSTA 4L97A 4B4QA 2ZGKA 5ACA3 1R092 1MEC2 4NHMA 3LB9A 2JENA 3WDXA 2GH2A 1J3PA 2ZTNA 1RL3A 1DZTA 1TME3 4CDWC 3GBWA 4COVA 1J3RA 3N7JA 4FAGA 1YHFA 2PYTA 3ZYPA 2CAUA 1VALA 2GMPA 1QY4A 1BMV1 4AFBA 1LB2A 5H9SA 4K1YA 1W6OA 2ZX3A 4KL1A 1BMV2 5AC93 3A4UA 5DDJ3 1ND2B 1CJDA 3JBG3 1SMVA 2E9QA 1Q8QA 3MF6A 2ILMA 4YARA 1FXZA 2RJLA 5J09A 2DF7A 4QPIA 1MVQA 4XFHA 3V56A 4FQZA 1ZBE2 1WCSA 1ENSA 1CPNA 2EALA 2ZZJA 1PIV3 1BBT1 4FPGA 4AEDC 4YVSB 4JRAA 1AHSA 4COYA 4Q4W1 4IETA 5BPXA 1BBT2 4N90A 1KJLA 4ISQA 4ATFA 1O5UA 4LBJA 4IEYA 4LUKA 1UU5A 4Q4W2 4XF3A 3NAPB 2A70A 2D44A 4OUMA 4Y1UA 3MYXA 2SBAA 4AI8A 3FZ3A 1LENA 1O4ZA 3RZZA 5KHHA 5FPXA 1D0GA 2GU9A 1IS4A 3SLIA 2ZGUA 2P3IA 2QVSB 2NPIA 3FBMA 4M00A 5E1RA 2DFCA 1AX1A 5BNPA 1LR5A 5T54A 1OQDA 3M70A 5C4WB 3BIWE 4W6XA 1JW6A 2A5ZA 2JECA 3DL3A 2XGXA 1LCLA 2SLIA 5GZEA 2ZGMA 1DGRN 1ULEA 3J8F3 4XJAA 4M3CA 3M3EA 1MZ5A 3JU9A 4XQDA 3RYRA 3TYJA 3VBRB 3WP6A 4WVWA 2OUJA 4PF5A 5CA6A 3VBUC 3S30A 1LULA 3MW3A 2UURA 3KB5A 5T5PA 5I8SA 2RS13 3NJZA 1R081 4OI1A 4FOYA 4EN8B 3MIEA 4PDWC 3ZN4A 1R082 2CWSA 4ONUA 3ZFFA 5BNOC 3MEPA 2AYHA 5E8AA 1UX6A 2JG8C 1VAVA 2XL9A 4LEJA 3QCWA 5L19A 4I0AA 1VLNA 3ZIWA 5JCTA 1Z7S1 1SCRA 1AYN3 4LBQB 4QGLA 4MGKE 4YYOA 4I2OA 5T50A 1Z7S2 2HWB3 1H9WA 1FYUA 3ILNA 1LHNA 4YZ1A 4JAAA 3R6SA 2A6ZA 3D6EA 2WNUB 1S0JA 1G9BA 3JUUA 1JUHA 1CVNA 1PO13 2RE9A 4K40A 2LUWA 2XBO3 5A32B 4JDNA 1OHFA 2ZHLA 4Q26A 1C1FA 2E7AA 1ENRA 1LU1A 3GZTB 2WNVA 1MVEA 1REDA 2EIGA 1OQ1A 1PK6B 5JPMB 2EA7A 2GALA 4UBHA 3ZMOA 2Y38A 1RUE2 2B5HA 3SCGA 5JOZA 1FAYA 1ND2C 4K20A 1QXRA 2RS33 1WA4A 2BUKA 2IWGB 2CV6A 4OHWA 4Q4X2 4WVZA 1PZ8A 2MNGA 4R9BA 2VH9A 2OVUA 3AXDA 3K48A 3B5LB 2GC3A 3MLJA 1SLAA 3D8CA 4PBOA 4R4ZA 2F6BA 4O9EA 4YW4A 3VHOA 3EHKA 4XBNA 1FPN3 5LK5A 1PZ7A 1SACA 2CGPA 3FLRA 4RQPA 3WDVA 1UU4A 2IXIA 1JN2P 1WMFA 4NR1A 4XOGA 5JOWA 5EFUA 5CFCA 1YFYA 1IHMA 3TN91 4CDQB 5L7OB 4FXGB 1Q8OA 5C4WC 2YGLA 4GKYA 4RR3A 5E89A 2E51A 3TN92 2BEOA 4IV3A 1UW8A 2ZGPA 3ENRA 3KLSA 4JVAA 3E5XA 3FLPA 1NCRB 3VBRC 5I0RA 5JOXA 5KHIA 4P5HA 3A0KA 4IV1B 1AR61 3OF1A 4X6QB 1C28A 3CF6E 4BLIA 2A3XA 2D98A 4CP2A 4YRDA 1AR62 4QGNA 2LALA 2OPKA 4WM7B 3ZXGA 4PLNA 4YSFA 2X8KA 4F8AA 4JC1A 3VBOB 3E5QA 3B3QE 3SISA 4MSVA 1FNZA 1NE6A 1XYPA 1DGWX 1WBFA 4Z07A 4G9SB 3VBSA 2ZMKA 1G9FA 1OFSA 1IGOA 3DKWA 4RD7A 4YZ2A 4AFMA 3BOWA 4QM9A 2C9AA 1V9U1 3ZMNA 1ZA4A 2PTMA 3WHUA 3URFA 2DTWA 4DPNA 1ZRRA 2A71A 2P3KA 4AHWA 1HRI3 1LRHA