5T5PA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
total genus 51
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5pA00
3ZXFA 4ATFA 4M3CA 5E88A 2HYKA 3ILNA 2YXSA 2CYFA 4C1WA 2UWAA 2EXKA 4CZSA 2OW4A 4HANA 5EWSA 4Q8KA 4WVVA 1MS1A 1LULA 4YG6A 3AJZA 5GZFA 1W6OA 4YW2A 2DTWA 5JVVA 1LHOA 2GNDA 1AX0A 4AVVA 4TZDA 4Y20A 1WW7A 3M2MA 1WW5A 2DV9A 1VALA 3BTAA 2A3YA 2CTVA 2GN3A 1G86A 2ZGQA 2AR6A 1S0GA 1SCSA 4DRRA 5JOWA 1J1TA 3ASIA 3HR9A 3QCWA 2A6VA 2WJSA 3OGGA 4Z8BA 2D6NA 3FBYA 3ILFA 4XXPA 3PVEA 1G9CA 1LU2A 1H30A 1S0BA 1C1LA 4BQ1A 3ZXEA 1CQ9A 3ILRA 3ZXJA 4XILA 2EALA 1C4RA 3SH5A 1HLCA 4Q2FA 1C1FA 1AJKA 2W68A 4FPGA 2EXJA 1SLIA 1FX5A 4GKXA 1QOOA 5CNAA 5HCFA 1UZZA 4UW5A 1N3PA 3N7KA 1RITA 1ZA4A 4FPCA 1G9BA 1IKPA 4BLIA 5H9SA 1Q8OA 5AVAA 5F5QA 2ZAAA 2A6WA 3WVJA 2DU1A 1PZ8A 2PHRA 2LALA 4GKYA 4BMEA 1LEMA 1KDKA 2VW0A 4H55A 5JOZA 2P2KA 3AK0A 5KXEA 1MACA 1ULGA 2WT2A 2ZGUA 1G9AA 5GZGA 5IUQA 1CJPA 1G8WA 3O0VA 1MZ5A 1BZWA 2VW2A 5T5PA 1S0EA 3WOGA 4XJUA 1KRIA 2OVUA 1WW4A 3DUIA 4P14A 1Q56A 1W0OA 3I8TA 5IK7A 2GMPA 2JKBA 4YZ1A 2GNBA 3UJQA 1GSLA 3SLIA 1OKQA 4BM8A 1JW6A 1JHNA 2PHTA 1OFSA 3IPVA 4K1ZA 5H9PA 3WCRA 5JOYA 2WQZC 2V73A 4Y1XA 4AGVA 3KQRA 1JOJA 1N1VA 3OBTA 5EXOA 5GJ6A 3AZYA 3NV2A 4FVVA 4PF5A 3WDYA 1ULDA 3LSDA 1IS4A 4FOWA 1FV3A 4IQPA 3ATGA 4YG0A 1Q8SA 1H9WA 3OY8A 4Q27A 4LBOA 1JYCA 4XIKA 1CN1A 2JJ6A 1D0HA 3A4UA 1LOCA 2CWMA 3AYAA 3O5SA 3PMEA 1CIWA 4XJ9A 2ZBJA 5JLVA 1A3KA 4XE9A 1MS5A 4JCKA 3M3QA 2R16A 2PHXA 1HDKA 1WLWA 5CA6A 3ZVXA 2A70A 3PVOA 3ZPYA 1SLLA 3WZ1A 1AVBA 4JC1A 4ZKTB 1KQRA 2GALA 3RRDA 2ZMLA 1UKGA 2WLQA 3Q9OA 3ZYRA 3B9CA 3O0XA 2C5DA 3WDWA 1N1SA 3IM0A 1MS9A 4ASMB 2PHUA 3N3HA 2WNEA 3AJYA 2KM2A 4ITCA 1LECA 2AENA 1QU0A 2ZGKA 4LBKA 3AP4A 1AXKA 1LEDA 2Q5TA 1DIWA 2A7AA 1SBEA 2G4IA 4M3CF 1GZWB 4XJZA 1O4YA 4YFWA 2ZGOA 3USUA 2NM1A 4LBQA 4XBLA 1LOBA 1B09A 2YMZA 1DGLA 3WG3A 3WDTA 2CL2A 5IK8A 2BQPA 2ZGSA 2ZZJA 2FHRA 4FOYA 4WZFA 2R49A 2ARXA 4WV8A 4XJ8A 2ZHNA 3NV1A 4YGCA 1N1TA 2E51A 3WG1A 1G9FA 1LGCA 1SBFA 2YY1A 3OPZA 4GALA 3AP7A 1IS5A 2H0BA 2D3PA 1QMJA 2JE9A 1DQ5A 2D3SA 4BOWA 4K20A 4W65A 1LU1A 5T52A 1QOTA 3WHTA 4CRQA 1LHWA 1Z78A 4UW3A 1QDCA 1QGLA 4FPHA 3AZWA 2DUOA 1S0DA 3O12A 4Y22B 1IOAA 2UURA 4AVSA 1WD3A 1APNA 3PVNA 2DVFA 4FPEA 3VKOA 1W6MB 4K21A 3WUCA 2ZGNA 1SLCA 4F83A 1SLTA 1MS3A 5IT6A 1LTEA 1LODA 4AGGA 2C9AA 1NXD1 5DG1A 5H9RA 1BJQA 1IS3A 3RMXA 1BQPA 4DPNA 1QKQA 4XYXA 2JDZA 1F9KA 2OUJA 2OUHA 2ZA9A 3BOPA 4Q26A 1S0JA 1LOFC 3MEPA 3B3QE 5GLTA 1BYHA 3C2UA 4YGBA 2SLIA 2JE7A 1IS6A 4GA9A 4Q8LA 3B00A 3VKMA 2D6LX 3AP5A 1HQLA 2ZHMA 1SLAA 2NMNA 3VKFC 1JXNA 2ZHKA 2WKKA 4DFSA 3B01A 3A0NA 1UX6A 1F31A 3AYEA 1MVEA 1ENQA 3ZYPA 2E7QA 1AX2A 1DQ2A 1CPMA 5F9TA 1W6PB 2WT0A 1WUVA 3CNAA 3BIWE 4SLIA 3HMYA 2DVAA 1N3QA 1S0FA 1WW6A 3WG4A 4YLZA 3WDXA 4Y1UA 1LOEA 2ENRA 1ULFA 1MS8A 3FUQA 4DS0A 3A0KA 4JRAA 5GZCA 5DZFA 1W0PA 3AFKA 1GZCA 2UWCA 1XQNA 4PBPA 1AXZA 5GLUA 1LENA 1GV9A 2ZGLA 4YW5A 2D6PA 3RG0A 2NZ9A 3ZSMA 4DQAA 1N1YA 4Y1YA 3WDVA 1AX1A 1MVQA 1ENRA 5SV8A 2DVDA 1YI7A 2A75A 4L8QA 3ZXLA 4K1YA 2ZGMA 3L2YA 2UWBA 3N7MA 3APBA 4XMIA 1EPWA 1HKDA 3WHUA 1GANA 4ISQA 1JBCA 5HCAA 1V6OA 2RHPA 3N7JA 5KXDA 2AGSA 5EYXA 1QNWA 3WDUA 1JYIA 3R4UA 4YGEA 3AYDA 1QF3A 4HL0A 2P3IA 3UJOA 3KM5A 1WCSA 3QLQA 4YW4A 1W6QB 2ZMNA 1V00A 1QOSA 4R9CA 3TAYA 2EF6A 3INAA 4R9AA 1DQ0A 1WBFA 1VIWB 4YZ5A 1N47A 3IMNA 3DGTA 4XIOA 2D3RA 5KXBA 2GN7A 3R05A 1GNZA 1GZWA 2WSUA 3RQ0A 2R1BA 4M01A 4YM0A 2D44A 1CONA 4U2AA 3MW2A 3POSA 2D43A 1DYPA 5GM0A 2YZ4A 4D69A 3AP9A 1LHNA 1LOGA 2DVGA 4YFZA 2DTYA 1QDOA 2ZMKA 4XBNA 4RA0A 1LOFA 2B7YA 2CY6A 2W52A 4YM1A 4BMBA 1UZYA 1LCLA 4YZ3A 1Q8VA 1Z0HA 2SBAA 1V6JA 4FOVA 4FPOB 1JN2P 2DUPA 4XHBA 1DQ6A 5DUXA 2YV8A 5E8AA 3TB0A 3W59A 1GZ9A 1UMZA 3I4IA 1SFYA 4LBJA 4Q1PA 2WT1A 4YW3A 2TEPA 2EAKA 5T50A 3OYWB 2ZGRA 1LHVA 2NN8A 1GNHA 3MW4A 4YGDA 1DQ1A 3H0OA 4M3CE 2WSVA 4Y22A 3D4KA 2FMDA 1V6NA 4BLJA 1WLDA 2VH9A 4XOGA 4YW1A 5FRAA 4RL7A 1N3OA 2VY0A 3AXEA 1W6MA 5KXCA 3T1MA 1LGNA 1UPSA 2PHFA 3IN9A 2UU8A 3WLUA 5GLZA 2AYHA 1DZQA 5E89A 2EXHA 4YZ4A 5GZDA 4UW6A 3ZXKA 4LBMA 1SBDA 4Y26A 2PELA 1PZ9A 2LTNA 3V0BB 1V6KA 4AYUA 1ENSA 3V0AB 3B69A 1V6MA 1VAMA 3FUOA 2A6ZA 5DZEA 3AZVA 4GWNA 1Q8PA 1RIRA 2P3KA 4MYEA 5T5JA 2DWRA 5T54A 2JD4A 1FYUA 3HN1A 3WCSA 1MS0A 4ATEA 4XMAA 1WBLA 1YIFA 4FP3A 3M3EA 1DHKB 2AH2A 2ZGPA 3OBRA 1S0IA 3LCPA 1NLSA 2GDFA 2NYYA 1KJLA 2ARBA 5IK4A 1BKZA 3U4XA 2V5YA 2A71A 1GYKA 2R0FA 2DU0A 2EIGA 5DUWA 1V6LA 4YG3A 1O4ZA 1YRZA 4P9YA 4Q1RA 1DQ4A 1W6PA 1ULCA 2D6MA 1I3HA 4DRVA 1AZDA 2R1DA 3AZZA 1VLNA 4Y1ZA 1CESA 3USUB 4LBQB 5L73A 1DBNA 5EYYA 5H9QA 2DVBA 4C1XA 2E6VA 3N36A 1GICA 2D7FA 2EXIA 2W39A 3T2TA 5DUVA 3VUOA 5T55A 1W6NB 1V6IA 3FLTA 1DFQA 2AUYA 4AGRA 3NV3A 4LBNA 3MW3A 4M3CB 4P9WA 1MR5A 3AYCA 1HQWA 2ZGTA 4FOQA 1D2SA 4PQ9A 1I1EA 1A8DA 4AWDA 4OZXA 3M1HA 2CNAA 1ONAA 4XTPA 5T5OA 1S1AA 1W6OB 2JECA 3FLRA 3V65A 4Y1VA 1A78A 1ULEA 2E53A 5GALA 3JU9A 4Y20B 2DUQA 2YROA 5BYNA 2GMMA 2XB6C 4U36A 2ZACA 2ZKNA 1W6QA 3NV4A 1GKBA 1YYNA 5DUUA 1SACA 5GLVA 1X50A 1YXWA 2Z42A 1FNYA 2D6OX 1C57A 2D6KA 1CPNA 3GNEA 3RMYA 3GALA 4ZXKA 3RSJA 4XZPA 2P3JA 2GNTA 3SH3A 5JDBA 4FP2A 3UK9A 2VUAA 3SNMA 5JOXA 3SITA 5IK5A 1URXA 2PHWA 3FLPA 2NP0A 1LOAA 3D6EA 4FPLA 1LHUA 1CVNA 3R4SA 1WD4A 3ZSJA 1Y7BA 3NWKA 4XDQA 1KJRA 1MZ6A 1U0AA 3W58A 3WUDA 4UW4A 4AVTA 1AJOA 4GWMA 3VKNA 2A6XA 1KDMA 4XTMA 1JUIA 3VKLA 1FV2A 1IKQA 4NO4A 1GLHA 4R9DA 4XBQA 3POWA 1ZM1A 2R0HA 3OYWA 5DZGA 1F5FA 1DYKA 1WLCA 3N35A 1FATA 4YM3A 2NMOA 3AX4A 3PJQA 3FFZA 4LBLA 3WG2A 3ZSLA 5DG2A 1OQ1A 5FREA 5CB7A 2P34A 1GBGA 3O0WA 5JMCA 1S0CA 1G9DA 2VXRA 4I30A 4WVWA 1FAYA 3UL2A 3POYA 5CBLA 3MPPG 2A6YA 4P9XA 1R1ZA 2DURA 3N7LA 1AF9A 3T1LA 1FNZA 1CR7A 2CWSA 1MS4A 1QNYA 4FPJA 1TEIA 4NOTA 4YM2A 1LESA 2W08A 3WNXA 1UN1A 1UAIA 3IPVB 2A3WA 2AREA 2E7TA 5GLWA 5T5LA 2XG3A 1SCRA 2ERFA 3D5OA 3IKWA 4ISRA 4XXAA 3RS6A 3V0BA 3V64A 3V0AA 1BXHA 4LBQD 1PZ7A 1UL9A 2GMEA 3AP6A 4R9BA 5GZEA 4TYSA 4CTEA 1KITA 4Y24A 1AXYA 2ES3A 3AZXA 3WV6A 3BODA 3OY8B 4FQZA 4FPFA 1YO8A 2DYCA 4XJWA 4XHXA 4BPZA 1G7YA 1LJ7A 2VU9A 3ENRA 3SH4A 1LGBA 4GXLA 2P37A 2A5ZA 4XJAA 5HCBA 5CAZA 1SLBA 4M00A 4FPKA 3VV1A 2GNMA 2ZHLA 1RINA 5DXDA 3M3CA 4YZ2A 3LSEA 4FQ4A 4PCRA 3AXDA 4FPYA 5LK5A 2ZABA 3M3OA 2I2SA 1Q8QA 3OJBA 4KBBA 4PBOA 2VW1A 3ZSKA 3SISA 1VAVA 1H9PA 1W6NA 1DLLA 3JUUA 2A3XA
chains in the Genus database with same CATH superfamily
5FJKA 2VZTA 4LNVA 1ZZ8A 2YXSA 3HOBA 1AYN3 4NN0A 4N7UA 5A70A 3MLKA 1LULA 3WF4A 1UCXA 3WF1A 1W6OA 3F95A 5KHIA 2BGOA 4DINB 1U5YA 4Q0UA 2VNOA 2G9FA 3Q8BA 2Y38A 3VHRA 3LKJA 5A7PA 5JZGA 3C3VA 2RS51 3NAPB 3AKQA 2JE8A 1E5IA 4GJYA 4Y20A 4WM7C 4DUVA 3M2MA 1AL21 1OA4A 3NNMA 4N9HA 5LA9A 2XPJA 1C5IA 1VALA 3FFQA 3ZFGC 2BUKA 4CCDA 1PO22 1UKRA 2XQXA 2AR6A 2JB4A 5DAVA 1UWWA 3N9LA 4RS5B 1J1TA 3OGGA 4FAHA 3HD8B 4OHWA 4Z8BA 3JD71 3FBYA 4HPKA 1COV1 2O1QA 3I3EA 1PGSA 3MGUA 1YJKA 5C9AC 4GIQA 2W92A 2XBO3 4JDNA 3AMNA 5D8AC 3ZXJA 2EALA 4K3UA 3NJYA 4Q2FA 2R071 2VQAA 1SLIA 1QOOA 2W47A 1X8EA 4UW5A 4FPCA 1G9BA 4TLFA 1IKPA 4BLIA 2QDRA 5H9SA 1Q8OA 5AVAA 3H9AA 4UBHA 2A6WA 4AHXA 3WVJA 4BMEA 1LEMA 5LA2A 2QQJA 5DN2A 1UYYA 3WNOA 2WAOA 2XJQA 3I59A 3SMHA 5JOZA 4K9SA 2VMDA 1MACA 3VDCA 5C71A 2VAUA 2QQLA 1HXS2 4TTGA 2VUCA 2QCSB 5D1IA 3J7NA 5A32B 4NIAA 3PU3A 1G8WA 2D97A 4OUEA 4V2WA 1UZWA 3KF5A 3PDQA 1R1A1 1KRIA 2OVUA 1WW4A 4OHYA 4AI1A 1VBD2 1S2KA 1L7RA 4L99A 4N43C 4YZ1A 5FUPA 1O8SA 1TME2 2WZR3 3JQXA 3POGA 4QB1A 5F2WA 2WNVC 4GMP1 4NIGA 1SHWB 1JW6A 2HLEA 2YU1A 4AL9A 4K1ZA 1PK6B 3IPVA 3WCRA 1XC6A 5K0UA 5FZ0A 2XWBB 1MQTB 3KQRA 1JOJA 1QHDA 4TLGA 5GJ6A 2VTXJ 4UFLA 3SKVA 3CLPA 4AI9A 4FFHA 1OOPA 1FV3A 3KQ4B 3KCXA 1H8TB 4YG0A 3OY8A 4BZ4A 4XIKA 4LBOA 1JYCA 2WIIB 4LK6A 3ZXAC 2W1SA 3TEYA 3A4UA 2CWMA 5FPUA 2W87A 3PMEA 4XJ9A 2ZBJA 1VBA2 3ZX7A 1NG0A 4XE9A 3ZFFC 3ACHA 3MIDA 3U78A 5FDBA 5I91A 5CA6A 3ZVXA 5LY1A 3NVCA 5B4XA 3VDDC 4BQXA 4KG0A 4JC1A 3RZZA 4LOTA 2FDFA 2ZMLA 1UKGA 3Q9OA 3CJIA 4H3WA 1NA1B 4AEMA 2GC0A 2C5DA 1N1SA 2WFF1 1RUG2 4ASMB 4Q4Y1 1RXGA 1KFXL 4MUVA 4ZPIA 5F6LB 3N3HA 5FYMA 1RUJ1 4F3JA 4QU1A 2VCBA 2KM2A 1GQGA 2XXZA 3GBGA 4QKDA 3KS7A 1W9YA 4ARYA 3HNBM 4ARXA 1NCRB 1QU0A 2ZGKA 1FI2A 2Y26A 3NNJA 4IGPA 4IV3B 4XABA 3ZYJB 3AP4A 1AXKA 3MIFA 3ZIXA 4BH9A 2IZWA 3VBSC 1SBEA 4M3CF 1GZWB 5FY0A 3CDZB 4LKSA 4WVZA 1O4YA 1JYNA 4YFWA 2WNUC 5FPBA 4LBQA 5BNOA 1XSRA 2MEV2 2YMZA 4CDWC 5IK8A 4JGYA 1UXXX 1X82A 3ME2A 1QJEA 3S5QA 4WV8A 1RVF2 4NIDA 3NV1A 3WXPA 1N1TA 3NNLA 5J7MA 1LGCA 1SBFA 4BK4A 2YY1A 3LGRA 3OPZA 4IV1B 1BMV2 2W1UA 3AP7A 4MH0E 2H6CA 4S2FA 4JGZB 1B35B 1DQ5A 1PO12 2JE9A 4S2DA 4K20A 3ITQA 2A73B 1LU1A 4R52A 4XEZA 1HB2A 2FCTA 3HQXA 3KGLA 4ZXEA 4G4FA 4RHV3 3WHTA 4CU8A 4DZGA 1QDCA 3AZWA 3RWNA 1S0DA 4Z82A 4AQ2A 1S55A 1IOAA 1PMJX 3LF7A 1WKYA 5E16A 4AVSA 3AMMA 5KC6A 4RGAA 1PIV2 4CEYC 3WP6A 4NHKA 2JX9A 4QQOA 2VUJA 5EZWA 2CDOA 3OUIA 1SLCA 3FN9A 4F83A 4O65A 5F2SA 2B8MA 3SCFA 1LODA 1K5JA 4EWAA 1NXD1 4NAMA 5H9RA 1OH4A 2XVGA 4XF1A 2Z4FA 4WVMB 1VRH2 3VB9A 4DB5A 4DPNA 1H1AA 1WMFA 4OZOA 4D7TA 2OUHA 2OUJA 4AVAA 4LLFA 3OCPA 2R062 5EQUA 1XE7A 3LPGA 1LOFC 4XFGA 4BU2A 1IPSA 2DBNA 2ZX4A 1ASJ1 2SLIA 3KV6A 1IS6A 1F8VA 2OX0A 5FP9A 4DUXA 4AW7A 4OHXA 3AP5A 4HN0A 4LK7A 1SLAA 1J3RA 3GM8A 4XFCA 2NMNA 5A1LA 4N53B 3B01A 3UV9A 1UX6A 3PUQA 1LR5A 2V4VA 2VOXA 3MHZA 3I3QA 2EIBA 2Z2SB 3NAPC 3WY6A 4A2UA 5F9TA 4HBNA 5JSRA 5HCHA 1WUVA 3BIWE 3MLJA 2DVAA 4LO7A 3W5MA 4Q0SA 3ZO0B 1LOEA 1MS8A 1NLQA 4UF0B 3A0KA 4RS5C 1V0AA 2OIIA 3USSA 3VD3A 3AFKA 1F2NA 5DDJ3 4OMCA 4XUOA 1XQNA 4AHZA 4EQVA 4DQAA 1RHI3 2NZ9A 5C5TA 2IXKA 2UY8A 4A3XA 4Q4V2 3WDVA 5F32A 4CUGA 3JBG2 1YI7A 2R042 3AKRA 3AKPA 4K1YA 3KVBA 3THTA 3OD0A 5CFCA 5L7OA 4GQ7A 4XMIA 3GBWA 5FZ1A 1EPWA 1HKDA 2RM22 2JG9C 3HT2A 5BNPB 3N7JA 1K45A 1R091 5LA1A 2ID4A 2DBIA 4XF4A 3A21A 1JHJA 1QF3A 2B45X 1GOHA 1VJ2A 2VMGA 2QQOA 4HL0A 4ORFA 2IFWA 5HV0A 2BPA2 3K4AA 4NHLA 3H8XA 2WINB 1JZ6A 4OI0A 1DQ0A 3AKSA 4ZU7A 4YZ5A 1N47A 4P9GA 2VMHA 4AI8A 3HNMA 2D3RA 1OXCA 3DKQA 2GN7A 5KXBA 3GBFA 2J1UA 4JQRA 3VZKA 1XE8A 2WSUA 2DCKA 2R1BA 3I2JA 4DOUA 2J1SA 3MW2A 4ZS3A 3HN3A 5FZEA 5FXWA 4AZZA 1HXS3 2D43A 5FLHA 2YZ4A 2HWB3 4MXWB 2J42A 2BBAA 2PQQA 4D69A 2WC2A 3AP9A 2J1VA 5DABA 1CAUB 1LHNA 1LOGA 2OYZA 4I3GA 4NHYA 1FOD1 2OXBA 4XBNA 3RI8A 1EAH1 4M4PA 5GKAC 1VBD3 1PK6C 1Q8VA 1Z0HA 3EJKA 3LEKA 5F3IA 2DUPA 1VBC2 5DUXA 4W50A 2YV8A 1AR61 1SPPA 3MO4A 1OLMA 1VBE2 1TME3 1MQTC 1SFYA 5FMCA 1H1IA 4YW3A 4D94A 4Q0PA 1OLRA 4IGOA 3PURA 3OYWB 4TSVA 2VZPA 1J3PA 2NN8A 3KD4A 3SQOA 4B3NA 2HJIA 3THCA 2FMDA 1VBB2 1WCDJ 3IB3A 3OOXA 3WF3A 4CCNA 3DPRA 3AMQA 4RL7A 4UT5A 3U0ZA 2VOWA 3DL3A 3QH6A 1RUF1 5KXCA 3T1MA 1X33A 3THDA 1KFUL 2UU8A 2Q4SA 2ZEYA 3WLUA 5E89A 3UESA 5DMYA 3LZZA 5GZDA 1JZ3A 3VBFB 4DY5A 2Y60A 1NA1C 1YQ6A 1SBDA 2AZ5A 4Y26A 5IWFA 5LW9A 3LDBA 4CU7A 1XNCA 3VBOC 2ETEA 2BFUL 3TNPB 5J3UA 4HONA 2X09A 4AYUA 4NIHA 1ENSA 3B69A 1V6MA 3FUOA 5DZEA 2A6ZA 4MYEA 5A6XA 1Q8PA 2P3KA 1MZFA 4F8AA 1OH3A 3GZTB 1NCRC 2VNRA 2W46A 3KB5A 4IV3C 1DHKB 2K9ZA 2ZGPA 1PO21 2D93A 3LCPA 4XF0A 2NYYA 3P5BA 5IK4A 1JZ5A 4LR4A 2C0ZA 3WNMA 3WNKA 3ON7A 1OA2A 1NZIA 1GYKA 5FKBA 3C7GA 3LDRA 5DUWA 1V6LA 3RZKA 1OMIA 2R32A 4ZU4A 1O4ZA 2GU9A 1W6PA 1Y43B 2QJVA 5K9YA 2BVVA 1NX9A 1ZZ9A 4HK8A 4Y1ZA 4PDWA 5ISLA 4LBQB 5L73A 1DBNA 2JG8B 3O1PA 5E6HA 5FMOS 2RS52 4C1XA 4IV1C 4C91A 4QX2A 2IVIB 4JGZC 1AL22 1B35C 3PLQA 1W6NB 1H4HA 2ZX2A 3ZSEA 3FLTA 1PNGA 1XBFA 4HVOA 5FYTA 3QACA 3MW3A 1GFF2 1HQWA 2PLV3 2ZGTA 5FZKA 3AL5A 5I0DA 5BY5A 1A8DA 1PO13 2VBDA 4LO6B 4OULA 4XTPA 1H2KA 1EV13 5FFOC 2JECA 3FLRA 1T6GC 4NIIA 1CZTA 5C70A 4HT1T 2GSYA 3ZYHA 5GALA 1YJLA 3TEXA 5FZHA 3JU9A 3ACGA 1RUC1 5HI0A 2R072 2WUHA 4Y4YA 2VECA 2XB6C 2PFWA 2CAUA 2ZACA 3J7HA 4CVUA 1W6QA 3NV4A 1GKBA 5EJ3A 1RUD1 2Y6HA 3N9NA 1YYNA 2XLFA 4UXAA 3EMRA 5DUUA 4C0BA 5F5CA 4EE2A 1W2AX 1FMD2 3ABZA 1R081 1WGPA 5LATA 4B8EA 1ZBA1 1FNYA 3NJXA 2P1BA 2RJKA 3BU7A 4NVPA 2JB8A 2HEVF 3FMGA 1NZCA 1RTVA 2OPWA 2WDBA 4ZXKA 1XPWA 4MSVA 3BB6A 3LE0A 2RMU1 1WCQA 1YHFA 2J1EA 3HBZA 3D0SA 4IESA 4QM8A 5FXZA 3JXSA 2HH9A 3SH3A 3SNMA 4WM8B 1URXA 2WS91 4EZHA 5JCTA 4FPLA 4BQ5A 1WD4A 3ETQA 4N53C 1Y7BA 2XJVA 3WSOA 1ND3B 1G9CA 1AHSA 4BISA 3I2OA 1VBA1 4SBVA 3ELNA 1OA3A 3DV8A 2NQYA 2HWF3 4NRMA 5EP9A 4CCMA 1JUIA 1FV2A 1K42A 3FC0A 5IYYA 1GLHA 4XBQA 3POWA 2BW8A 3Q8FA 1OF4A 5JIAA 1RJ8A 2JXAA 3N35A 5CKNA 1FATA 3PJQA 3ZSLA 5FBZA 2MHFA 1CZVA 3KV4A 1BVP1 1X9PA 1RUG1 2WQ8A 2YUEA 4CPBA 4UFMA 4A45A 3PL0A 4RFT0 5JSPA 3POYA 4HETA 4IEXA 4LLOA 5FO7B 4P9XA 3TEWA 3U11A 1REEA 1O3SA 1AF9A 3CKHA 4QPGB 1QWRA 5FZ7A 3JQWA 3CF6E 4FPJA 3LD8A 5BNPC 1TEIA 2XDVA 4ZY9A 4Q5OA 3JBG3 3WNXA 1UAIA 2A3WA 5FZ6A 5GLWA 5T5LA 4EZ4A 2XG3A 3D5OA 4QX0A 3VBHB 4KBZA 5FPAA 5JPNB 2MEV1 2JDKA 4TYSA 1RUE2 4CTEA 2ES3A 2VMIA 3AZXA 2WFF2 3VHOA 1RVF1 3I3BA 3WV6A 4YVWB 2XL9A 1QY4A 4AI0A 4EROA 1YO8A 4UI9L 1G7YA 1RUJ2 2XJUA 1QH6A 3ROUA 2A5ZA 2YGLA 3KT1A 5CZKA 1NXMA 1QJY1 3E97A 2GNMA 2IFRA 1OUSA 3M3CA 4G3YC 4XW3A 3J4UH 4FQ4A 3UGFA 1NCQA 1HJFA 1AR92 5CG9A 2Q8EA 2QFEA 1JZ7A 1KS5A 3H1YA 2ZABA 3M3OA 3N9PA 4KBBA 4LITA 4GAZA 1PIV1 3IIAA 1GR3A 1TNRA 5HPOA 3LOIA 1ZRIA 2G1MA 2A3XA 5FZOA 4CUAA 5ERLA 4M0HA 4W6WA 4Q0VA 1NYWA 4OHZA 1VBC3 2CYFA 2J7MA 4CZSA 4LO4B 1QEXA 1VBE3 1VRH1 3K3NA 5A3NA 4TXWA 5JSOA 4LO8A 1K3IA 4WVVA 5GZFA 2E32A 3IIIA 1HRI3 2DF7A 2EVXA 4KMQA 5AC93 1LHOA 2R061 2JDPA 4OFGA 1O4TA 2FDKA 2VJXA 4QPYA 2E9QA 1AX0A 2C26A 2PAKA 4CDUA 1XNAA 1UW8A 1C5HA 2OPKA 3T09A 5BUVA 5HXMA 5IFPA 1Y4WA 4LE4A 2YGMA 3IDCB 4IEPA 5KHGA 1IZ3A 2DV9A 1BK1A 1OF3A 1DG6A 2ZPXA 4H14A 2F4PA 3OTFA 3VBFC 4CCOA 4DEQA 4ES8A 1W3XA 2Q1FA 2GN3A 1G86A 3TWIA 1U5ZA 1SCSA 4IE6A 5IFTA 1J83A 2ARCA 1IPJA 2WO2A 4META 5CVRA 3PIGA 1AYM2 4EN9B 2D6NA 1QXRA 3ILFA 4QU2A 4YPJA 3WR0A 3LOBA 2Y34A 1S0BA 2DFCA 2WWUA 4ONUA 5F3EA 3ILRA 2TBVA 3ZXEA 2WNVB 2VQUA 4EJRA 1C4RA 1ZZ6A 2W95A 3SH5A 3POJA 3J26N 1AJKA 2WWSA 2D40A 4GKXA 2V4AA 1FX5A 3B7MA 3PIJA 3R6SA 4DXRA 4CU6A 3OUJA 1N3PA 4PT6A 1ZA4A 3LWCA 4AEDB 4BE3A 4L11A 2ZAAA 2RVAA 3WW3A 2DDUA 1W8WA 2PHRA 3MICA 4GKYA 4Q4V1 4CU9A 3ZXGA 5FZFA 5A3WA 5LBEA 2R041 4OHVA 5FZ9A 2GC2A 3QOPA 4V1PA 4XACA 2JG8C 3AK0A 5BNOC 2ZKLA 5KXEA 1GWKA 2RM21 5FYBA 1ND2A 1UZ0A 4EWDA 2IXIA 5GZGA 1ZRCA 2YPJA 1CJPA 5FWJA 3RPQA 4A3ZA 4HSLA 2WABA 2XWJB 5T5PA 4PI2A 2RS53 5CEHA 1Q56A 1AL23 3QH7A 4QXBA 2GMPA 3M7AA 3BKZA 2VOKA 2KD7A 1O7FA 1NKGA 2XJTA 3T2QA 2ORXA 1GSLA 3RWKX 3GZEA 4X6RB 4R8HA 4QXHA 5F6KA 1HB3A 4K7JA 3JD73 2HBUA 1COV3 2X29A 4NR1A 4IE0A 5L9BA 1N1VA 2QTWB 2FDHA 1DDLA 1ULDA 5FZ8A 1R092 3VBSB 2ATFA 1YC61 3E6DA 4QX5A 4PLMA 3ATGA 2VE1A 4FXKB 3VBUB 2BOJA 3DCQA 2XL7A 3AYAA 3O5SA 1HRV1 1XNBA 2W94A 2HWE1 1ALYA 4JCKA 3UGGA 1C8NA 3ACFA 1OHFA 2PHXA 3O1SA 1WLWA 5C6CA 4QX7A 4WM8C 3O1OA 3KHBA 4LUMA 1JU4A 3PVOA 2PN5A 3G7DA 1AVBA 2UYBA 2ZTNA 1ND3C 2GALA 3FWEA 3GDBA 4JDOA 4R4ZA 2WLQA 3RRDA 3ZYRA 1VBB1 3GHMA 3O0XA 1KGYA 1US2A 5FZDA 1J58A 1NLRA 3BALA 3H1WA 3MUZ1 3AMPA 2Y33A 2PHUA 1S2EA 3T0DA 1R1A3 3P1IA 2WNEA 3KMHA 1EAH2 3ZYGA 2UY9A 2AENA 2K0GA 4PJYA 5APAA 1TE1B 4OUMA 5B4NA 2OS2A 4MGQA 1LEDA 1BCXA 1DIWA 4GMP3 2A7AA 4IEZA 2G4IA 2XHNA 1W8HA 2QQMA 3O14A 4LMFA 5KHJA 5A3LA 4MGKE 3PJYA 2ZGOA 4IEOA 4UFKA 4MGTA 4WZCA 4XBLA 1GQHA 1LOBA 3C7FA 4FXGB 4WBBA 4E8CA 3AC0A 3WG3A 3WDTA 4QPGC 3WQ0A 2ZZJA 2R49A 2VGDA 3RNSA 5C5UA 3JZVA 4YGCA 1RUF2 1IQDC 3WG1A 1G9FA 1YQ2A 5IVBA 3M4FA 4Z07A 3LEGA 4QQPA 1YQCA 2ILMA 4GALA 5C8CB 1IS5A 1W39A 3VBHC 2TNFA 2D3SA 3M70A 4AXOA 4I3PA 1QXPA 3O7OA 4NJ4A 1G6NA 3SXWA 5A1AA 4FT8A 1UMHA 4QGLA 3FHIB 1Z78A 3N9OA 4YVWC 2Q0AA 1L7LA 5A6QA 1WZXA 4RQPB 3ZR6A 1O5LA 4Y22B 2YDEA 2UURA 1WD3A 3NRUA 3O1MA 2WFF3 3VKOA 1Q3EA 1W6MB 4Q4Y3 2XVKA 3GYDA 1RUJ3 5IT6A 1LTEA 1ZYBA 3CEWA 1V70A 3E5UA 4H7LA 2C9AA 1J3QA 3E1F1 1Y9QA 1IPKA 3D3AA 4KG8A 1HV1A 2Q8CA 1XYNA 2ZX0A 3RMXA 1QJU1 3HPNA 1FPN2 3RDIA 1F9KA 1C3HA 4Q26A 3BOPA 1S0JA 1SZBA 2C6SA 5GLTA 1AR81 3VBRA 4ZZ8A 4HVRA 2F17A 3BUCA 1OVSA 2VZ3A 4GA9A 2P17A 4Q8LA 2JG9B 1UY3A 2D6LX 1HQLA 2ZHMA 2WN3A 1RJ7A 4YVSA 4D6SA 5FZOB 4C90A 4RFRB 4XFIA 1FMD1 2WYSA 2ZHKA 5FZAA 1V9U1 1LAJA 1PGL1 4HVQA 1F31A 1F15A 1REDA 1CAWB 2VNVA 4ZU5A 5FPLA 1RUOA 1DQ2A 3HVDA 4L0PA 5FZ3A 1CPMA 1GNYA 5CKMA 3THPA 4IEWA 3CNAA 3WQBA 2BDRA 2QE3A 3HMYA 1S0FA 4Y33A 4Y1UA 2A1XA 5JPMB 1ULFA 3U4SA 4DS0A 5FYUA 1RUC2 2XJPA 3NO8A 5DZFA 5CISA 3MDPA 5FXXA 4AFDA 4PBPA 1AXZA 1PNFA 5GLUA 1RUD2 2BP6A 3I54A 3RG0A 4Y1YA 2J22A 5FP4A 4YSFA 5JAXA 1R082 4L8QA 3ZXLA 1ZBA2 4AK3A 2RS11 4YW6A 4B7EA 2UWBA 3N7MA 3APBA 1GANA 4L92A 4MOAA 2RDSA 2K46A 1JYTA 1POV0 2RHPA 2JENA 2RMU2 4AEDC 4E27A 3KZ4C 2JIGA 4HN1A 3WDUA 5IVVA 5A6YA 2OZJA 2WS92 3KWVA 2JD9A 4CP0A 1O6UA 1ASJ3 4MGIE 3M8LA 4EN0A 2ZMNA 2RV9A 4LE3A 4R9AA 1WBFA 4AE2A 1VIWB 1OKOA 1JUHA 4LKFA 4V2VA 3IMNA 4O9EA 4OLLA 2CV6A 5CIRA 3KT7A 2XGXA 1UY4A 3UYJA 3Q8EA 4PDWC 1J84A 2FDJA 1BBT1 1YUDA 3IDEA 1CONA 3HBKA 1DYPA 1EY2A 1RUE1 4RR3A 2WO1A 5CYYA 3LA2A 2HEWF 2DVGA 3B93A 5DAXA 3VBOB 3UKNA 2BYVE 2ZX1A 3KF3A 1LB2A 3LFIA 1GP4A 4GH4A 4UAPA 4KGQA 5JUVA 3VUOA 4LT5A 4YZ3A 3ACIA 4FOVA 2W91A 1DQ6A 2BGPA 4NE9A 4BCUA 1OVPA 1JTZX 4QQ2A 1R64A 5FPZA 4LTAA 1AR91 1LHVA 3MW4A 3LA3A 5A7WA 4ASKA 3VBUC 3BGAA 2WSVA 3ZKYA 4BLJA 3ES1A 3H1MA 3OBAA 1R093 4KU7A 5C4WB 1SDDB 2GC1A 5T3NA 4CDXA 3AXEA 5IVFA 2QDNA 1CJDA 2P6HA 3IN9A 4IEVA 1VMHA 3LIHA 1ZVFA 4CP9B 1CD3G 3PVBB 2V09A 4FI9A 2EXHA 4B4QA 4UW6A 2VMFA 1GOFA 4NAOA 1RB8G 5C7GA 1QJY2 3EO6A 2CSGA 1UX7A 3A7QA 3KT4A 4XFHA 1HB1A 3WNNA 1JZ2A 2E63A 5A33B 5CFDB 5LWBA 2BJSA 4LA3A 3V56A 1RUH2 1XNTA 2O8QA 5LBFA 5T54A 3ZDVA 5G04L 4QPIB 4RGGA 3HN1A 1MS0A 3ZKUA 3PUIA 4CUBA 4LQRA 4D7SA 1MEC1 3IDBB 1S0IA 1FOD3 2GDFA 3OUHA 1ZRFA 2BFUS 1EAH3 5FK7A 4A7KA 2DFBA 4EV0A 1AYM1 2R0FA 2G19A 4N7IA 2EIGA 1AR63 1J59A 2W3JA 4XFAA 2G9ZA 5A3UA 4XCBA 4KH9A 3ZN5A 1DQ4A 3OPWA 2D6MA 1I3HA 1TQ5A 1GUIA 5FYSA 1CESA 3WT3A 3MIBA 2X05A 1HV0A 1RL3A 3H8UA 5H9QA 2DVBA 4HZFA 4DO0A 3DKWA 5C8CC 3PUHA 4BXSV 4XAAA 1H2NA 4P9IA 1H1MA 5DUVA 5A3OA 3I7DA 2Q8DA 3T2TA 1NUKA 1V6IA 3ZYIB 3VD7A 4BIOA 3VN4A 1DFQA 2AUYA 2WZR1 4QHBA 1RUF3 3NV3A 3AM2A 4LBNA 2VZ1A 5FP3A 5BNQA 4FOQA 4IXLA 3RJ2X 3R4DB 5LEJA 1CAXA 4OZXA 4RQPC 2AACA 5A1FA 4AVCA 1K5MA 5FY8A 5KC5A 3VL9A 1W6OB 2E31A 3V65A 3C8XA 4XFBA 4JHZA 4Y1VA 3SKJE 3WEZA 3I3DA 2E53A 3ZYFA 5JZGB 4CCJA 4LHSA 2GP5A 1C8M1 4Y20B 2P5BA 5FIXA 4FTBA 1AR71 2GMMA 3S6PA 3ZFEA 4R4XA 2ZKNA 4JTOA 4IEUA 3VHPA 3B5LB 1SACA 3LEMA 5BNNA 1EP0A 4YNIA 1PO23 4B7KA 4CCCA 3NKGA 5FWEA 2Z42A 1JH5A 3GZUC 5FP8A 1C57A 2D6KA 1CPNA 3GNEA 5IJRA 4HPKB 1EUUA 3DXUA 4QQHA 1JZ4A 2ZS6B 4IW3A 2H6BA 2Y0IA 4EN6B 5FOBB 4XZPA 2LRPA 3H3UA 4LXLA 3E6CC 2HWC2 4AFBA 5IK5A 3VBRB 3FLPA 3S0MA 3D6EA 1YFYA 1RYYA 5C3RA 3VD4A 2NP0A 3W58A 1MZ6A 5C8WA 1GWMA 3WW1A 1AJOA 2XKOA 4C8DA 4YVSB 2A6XA 5TSWA 1U5XA 3T08A 4QHZA 4XTMA 3VKLA 4I0AA 2RE9A 3H3ZA 4NO4A 4Q4X1 2AEZA 3I59B 4RN5A 1TMF2 2R0HA 1DYKA 3SCHA 4MGZE 4AF9A 3AX4A 2JDYA 4BYYA 3T0AA 5ABJA 2BEOA 2K2SA 1GBGA 1HQNA 3KV9A 5JMCA 1S0CA 4LKDA 3BN6A 4LIVA 4QT6A 2VM9A 5A3TA 1WA4A 5FLIA 2TUNA 1RUC3 4KWLA 4A7ZA 1LNSA 3MPPG 3RZLA 3NJZA 2C24A 4J25A 1HRV2 3Q8AA 3BTXA 2Y6KA 2HWE2 2VQ0A 3K75B 1CR7A 3MLLA 3S7EA 5FLJA 4XQDA 4OUSA 3ZFGA 1CAVA 1R083 4YM2A 2O0OA 2PA7A 2J1TA 1ZBA3 3IPVB 3SHRA 4JKMA 1W06A 2AREA 5K0UB 2JDHA 4LKEA 2ERFA 4FFGA 3IKWA 3RS6A 4A4AA 3LAGA 3V0BA 3UETA 3M3IA 1WCKA 5F1RA 3V0AA 1KD7A 1PHMA 1PZ7A 1UL9A 5A7SA 4R9BA 2RMU3 5C9AA 2BOIA 2QZ3A 3WW4A 1AXYA 1OOPB 1PGW2 4HSJA 2WS93 3OY8B 5IAXA 4BQ4A 4FQZA 1POV1 3PHMA 4XJWA 2VU9A 1BK0A 3ENRA 1H6YA 5FY9A 1LGBA 3I2FA 4J1WA 2P37A 2R7EB 1VBA3 3B94A 4O7XA 5HCBA 5LCWL 1SLBA 2ZZQA 4LUKA 4GWJA 2O14A 3VV1A 1AL0G 2ZHLA 3AB0A 3GHNA 4I02A 4CCKA 5AFBA 2HWD2 3LSEA 3ECQA 5FUIA 3U75A 4EWEA 1OQEA 4OI2A 5LK5A 1HN1A 4K40A 4LORA 3F2ZA 4HK9A 3CJIB 1Q8QA 2QUOA 1XRUA 1WMXA 2ZCWA 3C7EA 4P02B 4PBOA 1DCSA 3ZSKA 4D6QA 5FXVA 3SISA 1RUG3 3BTZA 4BQ2A 2YC2A 4RSUA 3JB8A 1DLLA 3BI3A 1WA6X 4BQWA 3CZUA 4AG4A 4D3WA 1HB4A 2RR12 2YFUA 2HYKA 3HNYM 1UMIA 1VB4A 3ILNA 1SMVA 4M3CA 4C1WA 2EXKA 5K8SA 1SDWA 1X7NA 5EWSA 1E5HA 4AI3A 4XF3A 4Q8KA 3UT0A 4N43A 1FPN1 4YG6A 2ORZA 3LPFA 4YW2A 3SCGA 3FJSA 2GNDA 4QGMA 5A7WB 5C4WC 4Q0QA 3FL7A 2QQKA 2VBPA 3C7OA 3KV5A 1GMMA 4F7ZA 3D82A 4Z2AA 5HBAA 1UY2A 5BNOB 1WMEA 3I2DA 4G9SB 1JS9A 2MEV3 4Y4RA 4JGYB 1WW5A 3E6BA 1RVF3 4NUBA 3TEZA 3BTAA 2A3YA 2PAEA 2JEMA 5JOWA 1O3TA 1S0GA 1KS4A 3ASIA 4QKBA 1JYWA 3HR9A 2ZEWA 2A6VA 5CFDC 3H8RA 3BPZA 1WLTA 4MGSA 4MHUA 3ZM8A 5I0RA 1PVC2 2YBPA 3ZXDA 4CCLA 1H30A 1OSGA 1C1LA 1QJY3 1QJU2 4QPIC 4UWDA 3ZFFA 2LUWA 4BQ1A 3RZMA 1BHGA 2VO5A 1HLCA 2VZOA 2Y6FA 1YNAA 1UU6A 2W68A 2EXJA 1AR82 5CNAA 5DQ0A 3HEIA 1W8NA 3VDDA 2F4LA 1ZZCA 2VL4A 1NE4A 1PIV3 1RITA 3LEIA 3BIEA 1QJX1 5FQ0A 2WLPA 3MI8A 1XE0A 2ZEXA 2DU1A 4J6GA 2LALA 5D2AA 1W90A 3WNLA 1V9U2 5D21A 3BVCA 1PGL2 4QD2A 2VW0A 3I2HA 4H55A 1GZTA 2P2KA 1VRH3 2WWJA 3TNQA 5KHHA 1YCIA 1ULGA 2ZGUA 2VZQA 5J36A 3MFAA 1JZ8A 1D4M2 1X9TA 5A6ZA 1G9AA 2R063 1BEV2 2FQPA 1MZ5A 1BZWA 1Q43A 1UY0A 2VOVA 1W04A 2VW2A 3WOGA 4MO3M 3DUIA 3D0JA 2WNUA 3K51A 4P14A 3MV11 4QKNA 3K77A 1OLQA 5I8YA 2JKBA 3EBRA 4KQ7A 3O1VA 1JU3A 2GNBA 1OBNA 4JTNA 3WP5A 3UJQA 3SLIA 2ZEZA 2L9LA 4BM8A 2BU9A 4AHYA 1JHNA 3PNAA 2PHTA 1OFSA 3W9AA 1XB9A 5H9PA 3CO2A 5JOYA 2RS12 5JZGC 2WQZC 4XUQA 4Y1XA 5EIYB 4Q4W2 4AGVA 4AEJA 2RS32 1W9SA 3CL1A 2JDAA 3GGLA 3OBTA 3NKTA 1OLME 4PF5A 5EXOA 5FY7A 3WDYA 2CAVA 2RDQA 1L3JA 4FOWA 4IQPA 3I49A 1Q8SA 4Q27A 1YI9A 1CN1A 4XCAA 2RG4A 1D0GA 1SG3A 1LOCA 3LB9A 2VNGA 1A3KA 1QH7A 5EPAA 4ASLA 4CEYA 1MS5A 2WFPA 3M3QA 2R16A 3GCXA 5FTTC 2EICA 4HKLA 4L9BA 4Q4V3 3UKVA 3ZN6A 3ZN4A 2JDUA 1HDKA 5CFCB 5L7OB 2B4KA 2R043 4NHMA 3VBRC 1BBT2 3MZHA 1SLLA 2VZUA 2RM23 4QPWA 2XJRA 3B9CA 4NMIA 4YVSC 2BRTA 3IM0A 1UF2C 2E26A 5A3PA 1LECA 1OPMA 1W0NA 4Y5Z0 1AYN2 2HKXA 2IC1A 2WZPP 4CCEA 4LBKA 4H7MA 3I2IA 1REFA 2Q5TA 4IEYA 5F7UA 3IMMA 1W03A 5LASA 5I0SA 1F5JA 1RUH1 4N8MA 1F4HA 1QQP1 2P3YA 4PLOA 1RUI1 5ABJB 1XU2A 2W9XA 3NAPA 3I3MA 3POBA 2BQPA 2ZGSA 2FHRA 4FOYA 4XJ8A 2ARXA 4Z2WA 2D5HA 1W8TA 3TN91 1PM4A 4RS5A 3T4VA 5K0UC 4JZRA 1HRV3 1SPPB 1W8OA 2HWE3 2D3PA 1QMJA 1OD3A 4B1MA 4BOWA 2W1WA 4HG6B 4MLOA 3T0BA 5T52A 1QOTA 2PHDA 4CRQA 1OOPC 4UW3A 2X5IA 1NOVA 5IVYA 2BNNA 4FPHA 3WINE 2FCVA 3P3NA 1UOGA 4JQTA 1APNA 3PVNA 1PVXA 1VBB3 3DPRB 1WCUA 1UZVA 2QZ2A 3S30A 3DF0A 2WR9A 2MPFA 2ZGNA 4K21A 3WUCA 3CJXA 4CP2A 1MEC2 1MS3A 5JXHA 1TVGA 5KHKA 1O5UA 5FMOL 3RJRA 5DG1A 5CG8A 1BJQA 3SEPA 1PMIA 4LIUA 5LBCA 4BA6A 4JAAA 3CJIC 1Q5OA 1IS3A 2VR4A 1QKQA 1UNBA 1ZRRA 5LZ6A 4P9JA 2JDZA 2ZA9A 4AFMA 2RJLA 5A32A 3O1RA 4A42A 3J7LA 1E5SA 2LW8A 2P6CA 4FBFA 1BYHA 3C2UA 3OSDA 4YGBA 2JE7A 2FZ2A 2QQVA 4DXTA 1FXZA 4HOOA 2C9KA 2VXJA 2XVLA 3ST7A 2WZR2 1JXNA 5J48A 4DFSA 3A0NA 4QGNA 3MYXA 1ENQA 5FZBA 3ZYPA 2NLRA 1PK6A 1AX2A 3Q8CA 2Z5WA 2FMYA 3NJVA 1MQTA 1W6PB 2WT0A 4HLTA 4JGYC 4SLIA 5IVCA 5JR2A 1A34A 1E57A 1CGPA 2HWC1 4X6QB 1FT9A 1WW6A 1HN0A 4PDWB 4YLZA 3WDXA 2ENRA 4AFCA 1C8M2 4ATFA 1H8TA 3K2OA 1D7PM 1I6XA 5FZLA 1W0PA 5FZGA 1AR72 5KR7A 2UWCA 3J8F1 4IEQA 2KA3A 3AMHA 3DN7A 1GV9A 2ZGLA 4IE4A 2D6PA 4X8PA 4YW5A 3ZSMA 3OGVA 4FTEA 5I0TA 4AAPA 1RMU1 1PX3A 1TMF1 2DVDA 3WF0A 4AVBA 3HIFA 1VR3A 1JOPA 1IHMA 4PIYA 3WHUA 2J1RA 1OPOA 4QWNA 4CA9A 5ACA1 1QJU3 3PTRB 5IVJA 3MIHA 3VDAA 5KXDA 4GB31 1NA1A 2AGSA 4AFAA 5J09A 4W8JA 1QNWA 2DCJA 3K48A 4YGEA 2W5FA 3URFA 1L7QA 3UJOA 1AR83 2P3IA 2YC0A 2R073 3PTYA 3KM5A 1ULPA 1WCSA 3GF6A 4YW4A 4XDPA 1W6QB 1V00A 1QOSA 2WN2A 4R9CA 3TAYA 3BCWA 2EF6A 1W28A 3GXUA 1YFUA 4AR2A 4DY3A 1Y3TA 4P9LA 4PIZA 3TYJA 1GU3A 1NCRA 5KBFA 1YIPA 4IV3A 1FMD3 3DGTA 3IBMA 3J7MA 4XIOA 1V9U3 5AFEA 4QMAA 1UOBA 4Q4X2 1GNZA 1YFWA 1GZWA 1AUYA 4XF9A 5L9RA 4M01A 2D44A 4AQSA 4U2AA 4UOJA 3WQ1A 4IETA 3POSA 1O3QA 1PGW1 1CX1A 4BB3A 3K46A 3OEBA 2XKPA 2IWGB 5FYCA 5JWPA 1J1LA 1QDOA 4LJHA 1Z7S1 4RA0A 4BK5A 2B7YA 4OQ8A 3H7JA 4BMBA 1LCLA 3H42B 2WZ8A 4FPOB 4IV1A 5E8AA 3GJAA 3TB0A 4A44A 4DMIA 2X53S 1B35A 3CZJA 3LIGA 4LBJA 4Q1PA 2ARAA 2WT1A 4N9IA 2TEPA 2EAKA 1HRI1 5T50A 3N9QA 3WW2A 2HWD1 3ACLA 3MPBA 4RHV2 4O61A 2ZGRA 4YGDA 2RS13 1GNHA 1ACCA 1GOGA 2EA7A 2Y8KA 3H0OA 2ZXQA 3FZ3A 4CDWB 1PM7A 4XDOA 3BPSA 3POIA 4NPRA 1V6NA 2VH9A 4YW1A 2JKXA 4AHWA 1N3OA 2AC1A 2VY0A 3PU8A 1F35A 1UPSA 5CFCC 5L7OC 2RR11 2AYHA 1DZQA 2W0XA 2WL1A 4D7YA 4PQQA 3ZN6B 4WVMA 4TWTA 2XHKA 4XPVA 3ZXKA 2B9VA 2PELA 1W05A 2WAAA 2W1QA 3U1XA 1OURA 4EYUA 5J96B 1BBT3 4C0HA 1DGRA 1V6KA 4E2SA 3UNPA 4D8MA 5T5JA 1HW5A 2DWRA 1KXGA 2JD4A 1FYUA 1RUE3 3EXUA 4BWOA 4XMAA 4FP3A 4MVTA 5EFUA 3ZR5A 3M3EA 5FO9B 4X8NA 1OQDA 2AH2A 4PLNA 1NLSA 2R6QA 2Y64A 1NT0A 3U4XA 1NY72 4N53A 2CU5A 1ENXA 2A71A 3ZOIA 4E2GA 5FYVA 2DU0A 3OD4A 1PVC1 2OKXA 1YLLA 2Y6JA 5ABJC 1ZBE1 1YRZA 4P9YA 4Q1RA 1NCQB 4A7YA 1ULCA 4DRVA 1AZDA 2LM3A 3OBZA 1AR93 2VZRA 5FO8B 1O91A 4JKLA 3U14A 4CSWA 4UF0A 1RXFA 2E6VA 3N36A 5FUNA 2KR2A 1GICA 5DDJ2 2EIDA 4UFJA 5T55A 1RHI2 4LPLA 2XLAA 4DEVA 4P9WA 4PQ9A 1I1EA 4AWDA 1XNDA 2OQ7A 4DUWA 1ONAA 5T5OA 1S1AA 3LA7A 4BJ0A 3DPRC 2X5IB 1D4M1 5BNPA 3H8OA 3KLSA 1BEV1 1ULEA 4CDUB 1WWYA 1ST8A 3E5XA 5BYNA 2DCYA 5I93A 4NWWA 2CHHA 1H2MA 3B9IA 1QJX2 4ZZ5A 1XOYA 4CXXA 3N4MA 4P5HA 1HX6A 4PF1A 4CP1A 4CEWA 1MEC3 1DGWA 2OT7A 3LDKA 1RC6A 2QNKA 1AYM3 3RMYA 1DGWX 4D0QA 4DIQA 2YHJA 3BOWA 3GALA 4Q4W1 2RS31 2IUWA 4Z1VA 2MNGA 2NPIA 2HWB2 1XXNA 2P3JA 2GNTA 4FP2A 4MXWA 3UK9A 3SITA 2PHWA 2EAAA 5FJHA 1LOAA 3VZLA 1CAUA 2VVDA 1LHUA 3R4SA 4O9GA 3WUDA 1DP0A 4P00B 5FV3A 4CDQA 2JDNA 4HXCA 3VKNA 5FCCA 5EJZB 5BV6A 4A6SA 1Y9MA 1XYOA 2FBEA 3U37A 3BYWA 3RYPA 3OYWA 4RD7A 1XNKA 3HQUA 5FYZA 4E4DX 1ND2B 2YU2A 4LBLA 4FFFA 2BGCA 4K8RB 2CDPA 5IAVA 3RI9A 3H7YA 1OQ1A 5FREA 5CB7A 2PQSA 1POQA 5DAWA 2ZAHA 3O0WA 1G9DA 5JIUA 3VZMA 2YG0A 1C8M3 3MUY1 4I30A 4HKOA 3O1TA 1O8PA 2JICA 4IGQA 5CBLA 1AR73 1GWLA 3QD6A 2A6YA 4XURA 3I97A 1UYXA 1R1ZA 2XOMA 3A23A 3N9MA 4HKWA 3SEEA 1AYN1 2XR4A 3WX5A 1UQXA 2CWSA 5CKQA 1MS4A 3WQ7A 1W2TA 3VBFA 2I74A 4NOTA 3VZJA 2W08A 3GCWA 4NROA 5FYYA 1SCRA 1M4WA 4AEKA 2C4XA 3I2KA 4IDZA 4K6BA 1UPIA 4QX1A 1BXHA 4LBQD 1STMA 1E5RA 5ANNA 5GZEA 2XUEA 2D98A 4PI0A 3ZMOA 4Y24A 5F3GA 4UBGA 1UY1A 1I5ZA 3OGJA 4AOCA 4COZA 5EV7A 3ES4A 5FY4A 2VZSA 4FPFA 2DYCA 4XHXA 4BPZA 3IWZA 1JYVA 4JV4A 4XJAA 5FPVA 3UKTA 4M00A 4QDSA 3H3LA 5LRRA 4J1XA 2XBO1 2YFZA 4NPMA 4Q4X3 5DXDA 4YZ2A 3RZGA 1GQPA 3R0RA 4PCRA 3VZOA 1W2UA 4QDQA 4CYDA 4JRLA 5LRSA 1ZREA 3HWJA 1OD5A 4XUNA 1VB2A 4Y3OA 1LRHA 2JG8A 1QQP2 2OQ6A 5FYIA 1NQDA 1RUI2 4QXCA 4OQ9A 1MZEA 4KWUA 1ODMA 1VAVA 5FZ4A 2B42B 1H9PA 1W6NA 2OZ6A 3CBNA 3JUUA 4QX3A 5JR7B 2WZEA 1GP5A 4M4RA 1M06G 3ZXFA 1SFPA 2PLV2 5E88A 3TN92 1SFNA 3IT8A 3K4ZA 1VAKA 2IXCA 4KL1A 2UWAA 4FCAA 4GJZA 2OW4A 3DECA 4XQ4A 5BXXA 2VC9A 4HANA 3O1UA 2ZX3A 3HJRA 1EV12 1MS1A 4W6XA 3AJZA 3CMGA 2DTWA 2XH6A 5JVVA 4FTSA 4D6RA 5C33A 2AEYA 4AVVA 5F5IA 5L19A 3SC7X 1VP6A 4TZDA 4INDA 1WW7A 1K12A 1ZA7A 2LS6A 5M0TA 4FSJA 4YWAA 5JI9A 1POV3 2CTVA 4RYDA 2ZGQA 4DRRA 4DXZA 3QCWA 2WJSA 2Y6LA 5A80A 4XXPA 3PVEA 1LU2A 1UXZA 4XZUG 1CQ9A 4XILA 3P6BA 3HAGA 1H8VA 1D2QA 5AVPA 3OF1A 1C1FA 3DEMA 4WM8A 4FPGA 5HCFA 1UZZA 1ND3A 3N7KA 5BPXA 2XUMA 5F5QA 2HWF2 2YBSA 4CXYA 1PZ8A 1EYBA 1OC1A 4AQTA 2VZVA 1NCQC 2YBKA 3KGZA 1KDKA 3S57A 2ADEA 3ZPOA 3TRSB 4AQ6A 4KGGA 4QQLA 3P3PA 2WT2A 1FPN3 2CGPA 3LFMA 1WMDA 1EUTA 5IUQA 3VLBB 2GC3A 3O0VA 1HIXA 3S5AA 2VBBA 4QB2A 1S0EA 4XJUA 2V5DA 1C28A 2WQ4A 2QQNA 1T2XA 2KXLA 1W0OA 3I8TA 3J8F2 5IK7A 4QPGA 2EIEA 2PTMA 4HFSA 1OKQA 2X5IC 1RMU2 2HEYF 3RYKA 3WNPA 4CDUC 3MF6A 4Z92B 2V73A 4W4ZA 4NRPA 3EHKA 3VBHA 2X8KA 5ACA2 4COWA 3AZYA 3NV2A 4FVVA 4E4SA 2CGNA 2FDIA 4GB32 4BQYA 3LSDA 1IS4A 1LKNA 2QQIA 4I09A 5I8SA 3AFGA 4RGKA 4BQ3A 5KWRA 1H9WA 4YVWA 5FZCA 2E33A 2GZWA 4ES9A 2JJ6A 1D0HA 2XONA 1JMUB 1CIWA 1QJX3 4LEJA 4MZUA 4WM7A 1RUD3 3ALQA 5JLVA 4CEWB 3FE5A 4LO5B 3ZIWA 2D5FA 4QDRA 5F8PA 2VVFA 4RHV1 3EB7A 2WA3A 4QHOA 5LK7B 2A70A 4I2OA 3VD9A 3ZPYA 3ZYBA 3WZ1A 3RFRA 1KQRA 2IXLA 4XETA 2P4EA 3WDWA 3KSCA 1MS9A 5D8AA 5ANQA 5J98B 4EN8B 4CDQB 1Z7S2 3WP3A 3AJYA 3MIEA 4ITCA 4XQWA 3RYRA 1MPXA 1ND2C 3ZMNA 4UYBA 3WP4A 1X8MA 5FY1A 4GWIA 1HRI2 5AC92 1W8FA 5B2GB 5L36A 4XUPA 1BVVA 4XJZA 1NE6A 1H8TC 2RDRA 1NQJA 3WF2A 3USUA 3VL8A 3DYOA 2NM1A 4RR3B 3NSTA 4QKFA 2BBVA 1B09A 1JOBA 1DGLA 2CL2A 4WZFA 3B02A 3DYPA 1DU3D 3QBQA 1IQAA 4FO9A 2ZHNA 1TZOA 4GH4B 3T2PA 1ZZ7A 2E51A 5FY5A 1NY71 1OT5A 3IDAA 5FAXA 5C3PA 2H0BA 4I01A 3E5QA 5F5AA 5I8TA 2PXJA 4W65A 1W8UA 5JXGA 3FHAA 1CIYA 1LHWA 1VMFA 4COUA 4IE5A 2Z79A 5C3SA 2WNVA 1GP6A 1H6XA 3OEAA 3X29B 1QGLA 2DUOA 3O12A 1YQ5A 2PMWB 3J9SA 1VPHA 2CGOA 5IVEA 5DDJ1 1PMHX 2DVFA 3POEA 4LULA 4FPEA 4CDXB 4AEDA 2JDMA 1RHI1 3C7HA 4KWKA 1TNFA 1SLTA 4M0NA 4JDMA 4B29A 2N7GA 4IERA 1OFNA 4AGGA 5IATA 4K8FA 1EPZA 4NPLA 1A8MA 3ZLIA 4OCTA 5SV5A 4JVAA 4DXSA 4A41A 1IGOA 2DCTA 2VUDA 2JWPA 1BQPA 3CIHA 3TBDA 4XYXA 4HMZA 5FBJA 4PIXA 1ZBE2 4S2HA 2C1FA 2R30A 3MEPA 3B3QE 4KU8A 5DPNA 4COVA 1BLZA 1RUH3 1VRBA 4DNYA 1QQP3 4KNCA 4XVHA 1RUI3 3U10A 5LY2A 2Q8OA 1UU5A 3T4HB 3B00A 3VKMA 5J1XA 4KWJA 1DYOA 3PMSA 2VVEA 2Y0OA 4OI4A 2BWCA 2PHLA 3VKFC 3GJBA 2WKKA 3TN93 2B46X 3AYEA 1MVEA 2FDGA 5F39A 1PX4A 2E7QA 2PYTA 3JD72 2YC4A 5DAQA 3TOJA 1COV2 5J37A 3CQOA 3I2GA 3KVAA 1HXS1 3NL1A 2HWB1 5FZIA 1F4AA 2QQWA 4BXFA 2WRAA 4OYUA 1N3QA 3S7IA 3WG4A 1QJFA 4W6YA 3VBSA 4CE8A 3BU0A 4YW7A 3FUQA 3T3YA 1W3VA 4JRAA 5GZCA 1VBD1 3VBUA 3PUSA 1GZCA 1HJGA 3VHNA 4IE7A 4L97A 1LENA 3FX3A 1TME1 4CDWA 4LOSA 1N1YA 3NNFA 4P5YA 5E1RA 1QIQA 1AX1A 1MVQA 4XAEA 3U07A 1ENRA 5SV8A 1RUNA 1CAXB 1XSQA 2A75A 3H50A 1IG0A 2ZGMA 3L2YA 1K5MB 2I07B 3MFCA 4ZS2A 4ISQA 1JBCA 2O8OA 5HCAA 1V6OA 4I0BA 4CPBD 5EYXA 1JYIA 1YFXA 4OI1A 1W9TA 3R4UA 4S2GA 3AYDA 3NQHA 4Q29A 1R1A2 4URTA 5K4LA 4AAXA 3QLQA 3ZFEB 1VMJA 2PAMA 1CWPA 3NW4A 3INAA 3UGHA 4YRDA 5BNNB 2VQTA 4YYOA 3L9JT 1YWKA 4UFIA 4IUGA 4QB6A 3R05A 5IW0A 3RQ0A 4H2AA 4NRQA 4YM0A 3NMBA 2VULA 2F6BA 1I5PA 1D4VB 3AKTA 5GM0A 1DLCA 4NHXA 3GZAA 2VMCA 1YEWA 2HWC3 2VTXA 4YFZA 2DTYA 1OUXA 1ZX5A 2ZMKA 5JMOA 4ZHNA 4MG2A 2WBKA 1LOFA 1QXJA 2CY6A 2W52A 1X36A 4YM1A 3FBMA 1UZYA 4XHBA 2SBAA 1V6JA 1JN2P 3J8F3 3W59A 5C8CA 1UYZA 4LHKA 2XJSA 1GZ9A 1UMZA 1Y9GA 3I4IA 3IZOA 3IAPA 1ZNPA 4JX0A 2YYOA 5A7QA 1XU1A 3ZDSA 1RMU3 4XUTA 1TMF3 2VD7A 2W2IA 2WYFA 5EJ1B 4B1LA 1DQ1A 2Q30A 3K4DA 1ODNA 3D8CA 4M3CE 3L2HA 4RQPA 5ACA3 2UYAA 4Y22A 3D4KA 5I0UA 2FCUA 1WLDA 4GB33 4XOGA 4BHPA 5FRAA 2I45A 4CEWC 2E7AA 5IHRA 5LA0A 4Q4Y2 2GAUA 1W6MA 1W99A 1S2BA 1LGNA 2V72A 4URAA 1BMV1 2PHFA 4E4ZA 2PLV1 4WM7B 5GLZA 4OMDA 5L9VA 1A6CA 3AVSA 5HXVA 1PO11 1US3A 3EYPA 4YZ4A 3W20A 1H2LA 5A7OA 1ZRDA 1CZSA 5FPXA 3ZFGB 4AI2A 1CAVB 1EV11 1ULOA 4L2NA 4LBMA 1UU4A 1S4CA 2XBO2 1XYPA 1PZ9A 3VDBA 1JODA 2LTNA 2VMEA 2B9UA 2ZOEB 2B39A 2QVSB 5A7NA 3W21A 5LB6A 3V0BB 2GH2A 4CDQC 4FAGA 5CU1A 3V0AB 4COYA 3MBWA 1VAMA 3HQRA 2Z69A 3AZVA 4GWNA 1RIRA 5C9AB 3WD5A 4ATEA 5D8AB 3WCSA 3RZJA 1WBLA 1YIFA 2JG9A 5C3OA 3LQCA 2QBXA 2VCMA 3OBRA 1Z7S3 1KJLA 2ARBA 1BKZA 4LHLA 2V5YA 3MF9A 3A22A 1W9FA 4I0WB 3KCYA 1CAWA 1NAEA 3K3OA 4A6OA 4RR3C 4YG3A 5JXJA 4MXVA 3ETPA 3JB4C 2HWD3 1DZRA 3POFA 3MIGA 3OGRA 1YQ8A 2R1DA 1VLNA 3AZZA 2YB7A 3USUB 2QQPA 2IVJA 4GH4C 3VGIA 2GP3A 2OA2A 5EYYA 4JHTA 1W2NA 1W2OA 2D7FA 2EXIA 2W39A 4GMP0 4N90A 2Y6GA 2B5HA 2WO3A 5DAPA 4ZKTB 2HWF1 5FOJB 3BTYA 4AGRA 2BNMA 2Q1ZB 4M3CB 5FKCA 1MR5A 3AYCA 2RR13 2XQRA 1D2SA 2BERA 4XC9A 2BWAA 4E2QA 4TN7A 3M1HA 2CNAA 4N43B 4E8DA 3DYMA 1UOFA 3PUAA 2FD8A 2X10A 4E4HA 1RGSA 1A78A 5EHDA 4CDXC 5C3QA 2IXJA 1SQ4A 1XJAA 3G6JB 2DUQA 4BIFA 2YROA 2H0VA 4MGYE 1ASJ2 1TG7A 4KI5M 4QM9A 4U36A 3DXTA 4LA2A 1UYPA 3HT1A 5FR3A 1QJZA 1I9RA 3VD5A 1DZTA 5GLVA 1X50A 1YXWA 5LBBA 3T30A 1UO9A 3JBG1 2D6OX 2IXHA 3MV01 3FHQA 1JYXA 1PVC3 3ZFFB 3RSJA 1ZBE3 5JDBA 1IG3A 5JOXA 2VUAA 2RDNA 4QX8A 4E9KA 4OVEA 3VBOA 1CVNA 2QQUA 3VDDB 3ZSJA 1H4GA 3NWKA 4XDQA 1KJRA 1U0AA 2JIJA 5F37A 1JI6A 4UW4A 5FQ0B 4QXKA 4AVTA 2ET7A 4GWMA 4EN7B 2BV4A 1O59A 2VCAA 4CUCA 4JKKA 5G05L 1KDMA 1W9WA 2XMLA 1IKQA 2HYXA 3NNGA 1OI6A 2BZDA 4R9DA 5LEKA 4Y5TA 3AL6A 1ZM1A 5DZGA 4XFFA 5HV4A 1F5FA 1CX4A 1WLCA 3KHCA 4YM3A 2NMOA 3WG2A 1W8ZA 3FFZA 3EQEA 5DG2A 2WO7A 1D4M3 2P34A 1BEV3 3CHXA 4ET7A 2Q1MA 2VXRA 2YPDA 5C4WA 5K7PA 4WVWA 1VE0A 1FAYA 1UOJA 5FYHA 2WNUB 3UL2A 4CXWA 2ZJCA 5A3MA 4QAWA 1U5IA 1VBC1 2BTVC 1T6BX 1SEFA 2DURA 2ADDA 1K5MC 3N7LA 1VBE1 2VCCA 4PHZA 3T1LA 2RJ2A 1FNZA 4CP9A 4JGZA 4MADA 2BVBA 1QNYA 1O3RA 2VTFA 1UD1A 1LESA 2BNOA 5AC91 1UN1A 5FK8A 1UIJA 2FZ1A 2J1AA 3IAQA 2E7TA 4IL7A 4UFHA 3OPTA 4ZONA 3T2OA 4B4RA 4XXAA 4ISRA 5A33A 5FZMA 2HBTA 5CFDA 3ZFEC 5F3CA 4Q4W3 3V64A 2VOTA 3W5NA 2GMEA 2RS33 2XLGA 3AP6A 3KCCA 1KITA 2GH8A 3VZNA 4QPIA 5BNNC 3BODA 3ORJA 2VG9A 2ET1A 1FOD2 4NWVA 2DCZA 4BDVB 1LJ7A 1UIKA 2VPVA 4MX3A 5FMBA 3SH4A 4GULA 5JXIA 4GXLA 4Y5SA 2G9GA 2QKDA 5FP7A 3RVHA 4CEYB 2WNOA 4GD4A 4MV2A 1ZZBA 4P08A 1AR62 1DGRN 4B4PA 2WA4A 3OG2A 5JI7A 5CAZA 3RZHA 3RGBA 4FPKA 1U12A 1RINA 3CU7A 5FMDA 4GZ9A 5CADA 3AXDA 4FFIA 4FPYA 1DF0A 2I2SA 3JCIA 3OJBA 2VW1A 2LROA 3OGSA 1H0BA 4LHNA 4YARA 4MHRA 1KEXA 1P8JA 3OB8A 3AVRA
chains in the Genus database with same CATH topology
4LNVA 1ZZ8A 2YXSA 1AYN3 4NN0A 4N7UA 3MLKA 1LULA 1UCXA 1W6OA 5KHIA 4DINB 1U5YA 4Q0UA 2VNOA 2G9FA 2Y38A 3VHRA 3LKJA 5JZGA 3C3VA 2RS51 3NAPB 3AKQA 4Y20A 4WM7C 3M2MA 1AL21 1OA4A 4N9HA 2XPJA 1C5IA 1VALA 3FFQA 3ZFGC 2BUKA 1PO22 1UKRA 2AR6A 4RS5B 1J1TA 3OGGA 4FAHA 3HD8B 4OHWA 4Z8BA 3JD71 3FBYA 4HPKA 1COV1 2O1QA 1PGSA 3MGUA 1YJKA 5C9AC 4GIQA 2XBO3 4JDNA 3AMNA 5D8AC 3ZXJA 2EALA 4K3UA 4Q2FA 2R071 2VQAA 1SLIA 1QOOA 1X8EA 4UW5A 4FPCA 1G9BA 4TLFA 1IKPA 4BLIA 2QDRA 5H9SA 1Q8OA 5AVAA 3H9AA 4UBHA 2A6WA 4AHXA 3WVJA 4BMEA 1LEMA 2XJQA 3I59A 3SMHA 5JOZA 4K9SA 1MACA 1HXS2 5D1IA 2QCSB 5A32B 1G8WA 2D97A 1KRIA 1R1A1 2OVUA 1WW4A 4OHYA 4AI1A 1VBD2 1S2KA 4L99A 4N43C 4YZ1A 1TME2 2WZR3 3JQXA 2WNVC 4GMP1 1JW6A 4K1ZA 1PK6B 3IPVA 3WCRA 5K0UA 2XWBB 1MQTB 3KQRA 1JOJA 1QHDA 5GJ6A 3CLPA 1OOPA 1FV3A 3KCXA 1H8TB 4YG0A 3OY8A 4BZ4A 4XIKA 4LBOA 1JYCA 2WIIB 3ZXAC 3A4UA 2CWMA 3PMEA 4XJ9A 2ZBJA 1VBA2 3ZX7A 1NG0A 4XE9A 3ZFFC 5FDBA 3MIDA 5I91A 5CA6A 3ZVXA 3NVCA 3VDDC 4KG0A 4JC1A 3RZZA 2ZMLA 1UKGA 3Q9OA 3CJIA 4H3WA 1NA1B 4AEMA 2GC0A 2C5DA 1N1SA 2WFF1 1RUG2 4ASMB 4Q4Y1 1KFXL 4MUVA 5F6LB 3N3HA 4F3JA 1RUJ1 2KM2A 1GQGA 3GBGA 3KS7A 1NCRB 1QU0A 2ZGKA 1FI2A 2Y26A 4IV3B 3ZYJB 3AP4A 1AXKA 3MIFA 3ZIXA 4BH9A 2IZWA 3VBSC 1SBEA 4M3CF 1GZWB 4WVZA 1O4YA 4YFWA 2WNUC 4LBQA 5BNOA 2MEV2 2YMZA 4CDWC 5IK8A 4JGYA 1X82A 3ME2A 4WV8A 1RVF2 3NV1A 3WXPA 1N1TA 5J7MA 1LGCA 1SBFA 2YY1A 3LGRA 3OPZA 4IV1B 1BMV2 3AP7A 4MH0E 2H6CA 4S2FA 4JGZB 1B35B 1DQ5A 1PO12 2JE9A 4S2DA 4K20A 2A73B 1LU1A 4R52A 4XEZA 3WHTA 3HQXA 3KGLA 4DZGA 4G4FA 4RHV3 1QDCA 3AZWA 3RWNA 1S0DA 4Z82A 4AQ2A 1S55A 1IOAA 5E16A 4AVSA 5KC6A 3AMMA 4RGAA 1PIV2 4CEYC 3WP6A 4NHKA 2JX9A 4QQOA 2VUJA 5EZWA 1SLCA 4F83A 2B8MA 3SCFA 1LODA 4EWAA 1NXD1 5H9RA 2XVGA 4XF1A 4WVMB 1VRH2 4DB5A 4DPNA 1H1AA 1WMFA 4D7TA 2OUHA 2OUJA 4AVAA 4LLFA 3OCPA 2R062 1XE7A 1LOFC 4XFGA 2ZX4A 1ASJ1 2SLIA 1IS6A 1F8VA 4AW7A 4OHXA 3AP5A 4HN0A 1SLAA 1J3RA 4XFCA 2NMNA 4N53B 3B01A 3UV9A 1UX6A 1LR5A 2VOXA 3NAPC 2Z2SB 4A2UA 3WY6A 5F9TA 4HBNA 5JSRA 1WUVA 3BIWE 3MLJA 2DVAA 4LO7A 4Q0SA 3ZO0B 1LOEA 1MS8A 3A0KA 4RS5C 2OIIA 3USSA 3AFKA 1F2NA 5DDJ3 1XQNA 4AHZA 4DQAA 1RHI3 2NZ9A 2IXKA 2UY8A 4A3XA 4Q4V2 3WDVA 3JBG2 1YI7A 2R042 3AKRA 3AKPA 4K1YA 3THTA 5CFCA 3OD0A 5L7OA 4GQ7A 4XMIA 3GBWA 1EPWA 1HKDA 2RM22 2JG9C 3HT2A 5BNPB 3N7JA 1R091 4XF4A 1QF3A 2B45X 1VJ2A 2VMGA 4HL0A 4ORFA 2BPA2 2IFWA 4NHLA 2WINB 4OI0A 1DQ0A 3AKSA 4ZU7A 4YZ5A 1N47A 4P9GA 2VMHA 4AI8A 2D3RA 5KXBA 2GN7A 3GBFA 4JQRA 3VZKA 1XE8A 2WSUA 2DCKA 2R1BA 4DOUA 3MW2A 1HXS3 2D43A 5FLHA 2YZ4A 2HWB3 4MXWB 2PQQA 4D69A 2WC2A 3AP9A 1CAUB 1LHNA 1LOGA 2OYZA 4I3GA 1FOD1 4XBNA 3RI8A 1EAH1 5GKAC 1VBD3 1PK6C 1Q8VA 1Z0HA 3EJKA 2DUPA 1VBC2 5DUXA 2YV8A 1AR61 1VBE2 1TME3 1MQTC 1SFYA 1H1IA 4YW3A 4D94A 4Q0PA 1OLRA 3OYWB 4TSVA 1J3PA 2NN8A 3KD4A 4B3NA 2HJIA 2FMDA 1VBB2 1WCDJ 3DPRA 3AMQA 4RL7A 3U0ZA 2VOWA 3DL3A 3QH6A 1RUF1 5KXCA 3T1MA 1X33A 1KFUL 2UU8A 2Q4SA 3WLUA 5E89A 3LZZA 5GZDA 3VBFB 4DY5A 1NA1C 2AZ5A 1SBDA 4Y26A 1XNCA 3VBOC 2ETEA 2BFUL 3TNPB 5J3UA 4AYUA 1ENSA 3B69A 1V6MA 3FUOA 5DZEA 2A6ZA 4MYEA 1Q8PA 2P3KA 1MZFA 4F8AA 3GZTB 1NCRC 2VNRA 3KB5A 4IV3C 1DHKB 2K9ZA 2ZGPA 1PO21 2D93A 3LCPA 4XF0A 2NYYA 5IK4A 4LR4A 2C0ZA 1OA2A 1GYKA 5DUWA 1V6LA 1OMIA 2R32A 4ZU4A 1O4ZA 2GU9A 1W6PA 2QJVA 1Y43B 5K9YA 2BVVA 4Y1ZA 1ZZ9A 4HK8A 4PDWA 4LBQB 5L73A 1DBNA 2JG8B 5FMOS 2RS52 4C1XA 4IV1C 4C91A 4JGZC 1AL22 1B35C 3PLQA 1W6NB 1H4HA 2ZX2A 3ZSEA 3FLTA 1PNGA 4HVOA 3QACA 3MW3A 1GFF2 1HQWA 2PLV3 2ZGTA 5BY5A 1A8DA 1PO13 4LO6B 4OULA 4XTPA 1H2KA 1EV13 5FFOC 2JECA 3FLRA 1T6GC 4HT1T 2GSYA 5GALA 1YJLA 3JU9A 1RUC1 5HI0A 2R072 4Y4YA 2VECA 2XB6C 2PFWA 2CAUA 2ZACA 4Z1VA 1W6QA 3NV4A 1GKBA 5EJ3A 1RUD1 1YYNA 2XLFA 4UXAA 5DUUA 4C0BA 1FMD2 1R081 1WGPA 4B8EA 1ZBA1 1FNYA 2RJKA 3BU7A 4NVPA 2HEVF 3FMGA 1NZCA 1RTVA 4ZXKA 4MSVA 3BB6A 2RMU1 1YHFA 4IESA 3HBZA 3D0SA 4QM8A 3SH3A 1M06G 3SNMA 4WM8B 1URXA 2WS91 5JCTA 4FPLA 1WD4A 3ETQA 4N53C 1Y7BA 2XJVA 1G9CA 1ND3B 1AHSA 1VBA1 4SBVA 3ELNA 1OA3A 3DV8A 2NQYA 2HWF3 1JUIA 1FV2A 3FC0A 1GLHA 4XBQA 3POWA 2BW8A 5JIAA 1RJ8A 2JXAA 3N35A 1FATA 3PJQA 3ZSLA 5FBZA 2MHFA 1BVP1 1RUG1 2YUEA 4RFT0 5JSPA 3POYA 4HETA 4IEXA 4LLOA 5FO7B 4P9XA 3U11A 1REEA 1O3SA 1AF9A 4QPGB 1QWRA 3JQWA 3CF6E 4FPJA 5BNPC 1TEIA 3JBG3 3WNXA 1UAIA 2A3WA 5GLWA 5T5LA 2XG3A 3D5OA 3VBHB 5JPNB 2MEV1 4TYSA 4CTEA 1RUE2 2ES3A 2VMIA 3AZXA 2WFF2 3VHOA 1RVF1 3WV6A 4AI0A 4YVWB 2XL9A 1QY4A 4EROA 1YO8A 1G7YA 1RUJ2 2XJUA 1QH6A 3ROUA 2A5ZA 2YGLA 3KT1A 1NXMA 1QJY1 3E97A 2GNMA 2IFRA 3M3CA 4G3YC 4XW3A 3J4UH 4FQ4A 1NCQA 1AR92 5CG9A 2QFEA 1KS5A 3H1YA 2ZABA 3M3OA 4KBBA 1PIV1 3IIAA 1GR3A 1TNRA 3LOIA 2A3XA 4M0HA 4W6WA 4Q0VA 1NYWA 4OHZA 1VBC3 2CYFA 4CZSA 4LO4B 1VBE3 1VRH1 5JSOA 4LO8A 4WVVA 5GZFA 1HRI3 2DF7A 2EVXA 5AC93 1LHOA 2R061 4OFGA 1O4TA 4QPYA 4CDUA 2E9QA 1AX0A 2PAKA 5BUVA 1UW8A 1C5HA 2OPKA 4LE4A 2YGMA 3IDCB 4IEPA 5KHGA 1IZ3A 2DV9A 1BK1A 1DG6A 2ZPXA 4H14A 2F4PA 3OTFA 3VBFC 4ES8A 2GN3A 1G86A 3TWIA 1U5ZA 1SCSA 1IPJA 4META 5CVRA 1AYM2 4EN9B 2D6NA 1QXRA 3ILFA 4QU2A 3WR0A 3LOBA 1S0BA 2DFCA 4ONUA 3ZXEA 3ILRA 2TBVA 2WNVB 4EJRA 1C4RA 1ZZ6A 3SH5A 3J26N 1AJKA 2WWSA 2D40A 4GKXA 1FX5A 3B7MA 3R6SA 1N3PA 1ZA4A 3LWCA 4AEDB 4BE3A 4L11A 2ZAAA 3WW3A 2PHRA 4GKYA 3MICA 4Q4V1 3ZXGA 2R041 4OHVA 2GC2A 3QOPA 4V1PA 2JG8C 3AK0A 5BNOC 2ZKLA 5KXEA 2RM21 1ND2A 4EWDA 2IXIA 5GZGA 1ZRCA 2YPJA 1CJPA 3RPQA 4HSLA 2XWJB 5T5PA 2RS53 1Q56A 1AL23 3QH7A 2GMPA 3M7AA 2VOKA 1O7FA 2XJTA 1GSLA 4X6RB 4R8HA 5F6KA 4K7JA 3JD73 1COV3 2X29A 4NR1A 1N1VA 1DDLA 1ULDA 3VBSB 1R092 2ATFA 4QX5A 3E6DA 4PLMA 3ATGA 4FXKB 3VBUB 2XL7A 3AYAA 3O5SA 1HRV1 1XNBA 2HWE1 1ALYA 4JCKA 1C8NA 1OHFA 2PHXA 1WLWA 5C6CA 4WM8C 4LUMA 3PVOA 2PN5A 3G7DA 1AVBA 2UYBA 2ZTNA 1ND3C 2GALA 3FWEA 4JDOA 4R4ZA 3RRDA 2WLQA 3ZYRA 1VBB1 3GHMA 3O0XA 1J58A 1NLRA 3BALA 3H1WA 3AMPA 2PHUA 1R1A3 2WNEA 3KMHA 1EAH2 3ZYGA 2UY9A 2AENA 2K0GA 4PJYA 1TE1B 4OUMA 1LEDA 1BCXA 1DIWA 4GMP3 2A7AA 4IEZA 2G4IA 3O14A 5KHJA 5A3LA 4MGKE 3PJYA 2ZGOA 4IEOA 4WZCA 4XBLA 1GQHA 1LOBA 4FXGB 4WBBA 3WG3A 3WDTA 4QPGC 3WQ0A 2ZZJA 2R49A 2VGDA 3RNSA 3JZVA 4YGCA 1RUF2 3WG1A 1G9FA 3M4FA 4Z07A 4QQPA 5C8CB 4GALA 2ILMA 1IS5A 1W39A 3VBHC 2TNFA 2D3SA 3M70A 4AXOA 4I3PA 1QXPA 3O7OA 1G6NA 3SXWA 4FT8A 4QGLA 3FHIB 1Z78A 4YVWC 2Q0AA 4RQPB 1O5LA 4Y22B 2YDEA 2UURA 1WD3A 2WFF3 3VKOA 1Q3EA 1W6MB 4Q4Y3 2XVKA 3GYDA 1RUJ3 5IT6A 1LTEA 1ZYBA 3CEWA 1V70A 3E5UA 4H7LA 2C9AA 1J3QA 1Y9QA 1IPKA 4KG8A 1HV1A 1XYNA 2ZX0A 3RMXA 1QJU1 1FPN2 3RDIA 1F9KA 1C3HA 4Q26A 3BOPA 1S0JA 5GLTA 1AR81 3VBRA 4HVRA 4GA9A 2P17A 4Q8LA 2JG9B 2D6LX 1HQLA 2ZHMA 4YVSA 1RJ7A 4C90A 4XFIA 1FMD1 2ZHKA 1V9U1 1PGL1 4HVQA 1F31A 1REDA 1CAWB 4ZU5A 1RUOA 1DQ2A 1CPMA 3THPA 4IEWA 3CNAA 2QE3A 3HMYA 1S0FA 4Y1UA 5JPMB 1ULFA 4DS0A 1RUC2 2XJPA 3NO8A 5DZFA 3MDPA 4AFDA 4PBPA 1AXZA 1PNFA 5GLUA 1RUD2 3I54A 3RG0A 4Y1YA 4YSFA 5JAXA 1R082 4L8QA 3ZXLA 1ZBA2 4AK3A 2RS11 4B7EA 2UWBA 3N7MA 3APBA 1GANA 4L92A 1POV0 2RHPA 2JENA 2RMU2 4AEDC 4E27A 3KZ4C 4HN1A 3WDUA 2OZJA 2WS92 4CP0A 1ASJ3 4MGIE 3M8LA 4EN0A 2ZMNA 4LE3A 4R9AA 1WBFA 4AE2A 1VIWB 1JUHA 3IMNA 4O9EA 4OLLA 2CV6A 5CIRA 3KT7A 2XGXA 4PDWC 1BBT1 1YUDA 3IDEA 1CONA 1DYPA 1EY2A 1RUE1 4RR3A 3LA2A 2HEWF 2DVGA 3B93A 3VBOB 3UKNA 2BYVE 2ZX1A 1LB2A 4GH4A 4KGQA 4LT5A 4YZ3A 4FOVA 1DQ6A 4BCUA 1JTZX 4QQ2A 5FPZA 4LTAA 1AR91 1LHVA 3MW4A 3LA3A 3VBUC 2WSVA 4BLJA 3ES1A 3H1MA 1R093 4KU7A 5C4WB 5T3NA 2GC1A 4CDXA 3AXEA 2QDNA 1CJDA 4IEVA 3IN9A 1ZVFA 1CD3G 3PVBB 2V09A 2EXHA 4B4QA 4UW6A 1RB8G 1QJY2 3EO6A 4XFHA 3KT4A 2E63A 5A33B 5CFDB 4LA3A 3V56A 1RUH2 2O8QA 5T54A 4QPIB 4RGGA 3HN1A 1MS0A 4D7SA 1MEC1 3IDBB 1S0IA 1FOD3 2GDFA 1ZRFA 2BFUS 1EAH3 4A7KA 2DFBA 4EV0A 1AYM1 2R0FA 4N7IA 2EIGA 1AR63 1J59A 4XFAA 4KH9A 3ZN5A 1DQ4A 2D6MA 1I3HA 1TQ5A 1CESA 3WT3A 3MIBA