5T5PA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
total genus 51
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5pA00
2P3JA 3JU9A 4YZ2A 5F9TA 1KQRA 1G9DA 3A0KA 3KQRA 1W6QA 2ZGNA 2UURA 2WSVA 1W6NB 4YFWA 1FV2A 3PMEA 2YZ4A 1WLWA 1WW4A 2YMZA 1QDOA 2GMMA 3BIWE 2DWRA 1WLDA 2ZAAA 1DQ0A 4JCKA 1SLBA 1UKGA 2C9AA 2A6YA 1SLCA 3NV4A 5DZEA 2EXKA 1LGBA 3NV1A 2ES3A 1Z0HA 1QNWA 4XTPA 5DXDA 4XJ9A 4WVWA 3M3CA 5SV8A 4FPCA 1DQ5A 5GZCA 1OKQA 2A75A 2DVFA 5H9PA 2PHRA 3A4UA 3WOGA 1JW6A 1CESA 1MS1A 4XZPA 2V5YA 5H9RA 5GZDA 4IQPA 4AVVA 2D43A 3WDUA 4FQZA 1GBGA 2A3WA 2EXJA 3AYEA 2UWCA 3O0WA 4XBNA 4LBQD 1LOFA 1Q8VA 2A6XA 2DVBA 2OW4A 2NYYA 2WQZC 3T1MA 4Y20A 3O12A 1FNYA 3FLTA 4FPFA 1Q8PA 1F9KA 1KJRA 1WD3A 2PHTA 3IPVA 4BQ1A 1GZ9A 2ZGKA 3FFZA 1LGNA 1NXD1 1UAIA 1URXA 2A5ZA 2E7QA 1CPNA 4YW1A 4BMBA 4Z8BA 1QNYA 1G7YA 3N35A 4MYEA 3ZXLA 2ZHKA 3WG3A 5DUXA 3R05A 5GLTA 1JHNA 1GICA 3DUIA 4PBPA 3V0AA 3HMYA 4LBJA 4Q1PA 1V6OA 2WNEA 3VV1A 1UZYA 2P34A 2JKBA 2ZHLA 2AGSA 4XIKA 4AVSA 2E6VA 1UL9A 4LBQB 1W0PA 1WW5A 1BJQA 1UN1A 2D7FA 4FPEA 4XJ8A 3HN1A 3TB0A 4OZXA 2VH9A 1GNZA 1KJLA 3U4XA 1GKBA 1SBDA 2AR6A 2ZMNA 2ZBJA 4Q27A 1H9WA 1S0FA 3A0NA 1AZDA 1CIWA 1AF9A 3ZSKA 1MS4A 4ITCA 1S1AA 5JLVA 1LU2A 1VLNA 1Q8OA 3V64A 1MZ6A 1SACA 1GZCA 3T2TA 4UW5A 1G86A 2LTNA 3AZWA 1LOCA 4Y22A 4R9DA 3WNXA 1SLTA 3AK0A 3WG2A 2OUHA 5JOZA 3O0VA 3L2YA 1WBFA 1QDCA 1IKQA 1KDKA 2EAKA 2CYFA 2D3RA 2W39A 2JE9A 4FPLA 1W6NA 3NWKA 5DUUA 4NO4A 1JOJA 3ZXKA 3ZVXA 2EIGA 3M2MA 4JC1A 2YXSA 1D0HA 3OYWA 4K1ZA 4YGCA 3O5SA 1G9AA 2AENA 1JBCA 2A6VA 3POSA 5JOWA 1LEDA 5EYXA 1DZQA 4YW2A 1O4YA 2XB6C 5GZFA 1QMJA 4CZSA 1VALA 3NV2A 3UK9A 3MW2A 3B00A 5IK8A 4FPHA 4K21A 2D44A 1N47A 3WZ1A 2AH2A 1W0OA 3ZSMA 2P37A 1DBNA 1H30A 5IUQA 1B09A 2AYHA 1UX6A 3RMXA 4XJUA 3ZSLA 1ENQA 3OPZA 3B01A 2LALA 2PELA 5H9SA 2D6LX 1IS3A 1BYHA 1MS8A 2DTYA 4XIOA 3RSJA 3R4SA 1MZ5A 2PHWA 2WT0A 1LULA 2SLIA 1V6JA 3ILRA 3OGGA 2WT1A 1N1TA 1WLCA 1CVNA 3T1LA 5HCAA 4Y1ZA 3VKFC 3FLRA 1KITA 4XYXA 5LK5A 3BODA 1V6MA 2D6NA 4BOWA 2R16A 4D69A 2DU1A 1LENA 2AREA 2ZMKA 3W58A 4XTMA 1LOGA 2DUQA 5HCBA 5AVAA 1AVBA 2G4IA 2ZZJA 2A6WA 4M3CA 5GJ6A 2EXIA 3AJZA 4XOGA 4YW3A 3V0BB 4LBQA 1AX0A 1MS3A 4DPNA 4GKXA 2DTWA 4PF5A 1V6KA 1DYPA 1S0IA 1W6MB 3OYWB 5HCFA 3RRDA 1C4RA 2JDZA 5T5OA 4BMEA 1N3OA 1LCLA 2EXHA 2BQPA 2ZGMA 5KXCA 3SH3A 3FBYA 3AZXA 3TAYA 5JOYA 3RQ0A 2P3KA 3AP5A 1CONA 1AX2A 1N3QA 4R9AA 3I8TA 5T55A 4XE9A 1LHWA 4PCRA 2UWAA 5JMCA 2UWBA 1QGLA 4F83A 1LODA 5IK4A 4YM2A 5T5PA 1GLHA 2P3IA 4DS0A 4UW6A 1JYCA 1V6LA 2ZHNA 1S0CA 3LSDA 4GALA 3O0XA 2E51A 1DQ1A 5FREA 3USUB 4XJAA 3PVNA 2NM1A 1DQ4A 1V6NA 4K1YA 3WCSA 4TZDA 4FP2A 5GZGA 1MVQA 3OJBA 3AZZA 4NOTA 2A71A 4YZ5A 4YG3A 1HDKA 1MS9A 5GM0A 3WDVA 2JECA 3D5OA 1ULDA 1DIWA 2D3SA 2GALA 3QCWA 1C1LA 4Y24A 1FNZA 1GV9A 1QKQA 5DZFA 3MW3A 4YW5A 2WSUA 4KBBA 4LBNA 3HR9A 3MW4A 1F5FA 2YY1A 1LOFC 1QU0A 1WUVA 4H55A 1ULCA 4M3CB 1RINA 1R1ZA 2JE7A 4AYUA 1EPWA 4BLJA 1C1FA 1VAVA 3SNMA 4YZ1A 4WZFA 3KM5A 1CQ9A 1ZM1A 3GNEA 3SH4A 1KRIA 1LESA 3JUUA 4FPGA 2GNMA 2PHUA 2W68A 4RA0A 3AZVA 5EWSA 4YM3A 3H0OA 1GSLA 3WVJA 3WDYA 4DRRA 2R49A 5GLZA 4Y1VA 1AXYA 1MR5A 3IKWA 1DFQA 3AP7A 2GNTA 2I2SA 5E89A 5IK7A 1SFYA 1A8DA 1FX5A 1UZZA 1BQPA 1YO8A 4UW4A 1Q8QA 2R0HA 3WV6A 4FVVA 2R1DA 1MVEA 2ZGQA 4FPKA 2C5DA 2A6ZA 1U0AA 4Q8KA 1AXKA 1YI7A 1C57A 1IS6A 4LBLA 5GLUA 4XBLA 5T52A 3QLQA 3RG0A 4TYSA 4ZXKA 2JJ6A 1UPSA 4R9CA 5GLWA 2ZMLA 1J1TA 3M3OA 3SLIA 3V0BA 2VXRA 1WW7A 3BOPA 4YFZA 1NLSA 3FUOA 3VKLA 1F31A 3W59A 2ZGTA 4YZ4A 2ARBA 1PZ9A 5FRAA 4Q2FA 1SLAA 1W6MA 3SH5A 3B9CA 1ENSA 1AXZA 1O4ZA 1GZWB 3INAA 4XBQA 3ZXFA 1I3HA 5T54A 4XXAA 4YW4A 3FLPA 4YM0A 4FQ4A 3ZYPA 3IMNA 1DLLA 2ZGLA 5T50A 1QOSA 1JUIA 3PVEA 2GN3A 5T5JA 1APNA 1IS5A 1Q56A 2FHRA 3D6EA 1VIWB 1CPMA 3IN9A 3Q9OA 4ISQA 4WV8A 5CAZA 4GWMA 1W6PA 4YLZA 3AZYA 4YG0A 2R0FA 2DYCA 3V65A 1SBEA 3WDWA 2NN8A 2ZHMA 2A7AA 3I4IA 3MEPA 3R4UA 5DG2A 1YXWA 3USUA 4Y26A 1IKPA 2DUPA 2WLQA 1SBFA 3N7MA 5F5QA 3M1HA 3POWA 1W6OB 4M00A 3SISA 4XHBA 3N3HA 3NV3A 3WG1A 4R9BA 5DUWA 2A3XA 3OY8B 4GWNA 1Z78A 3MPPG 3APBA 1BKZA 5BYNA 4XJWA 2OUJA 4FOWA 4ASMB 1YRZA 4GXLA 1HLCA 2EALA 1Q8SA 4XILA 1SCSA 2FMDA 3BTAA 3ZXJA 1YIFA 3PJQA 1UMZA 1LOAA 4I30A 3LSEA 4FPYA 1ULFA 5CB7A 5CBLA 4FP3A 1G9BA 2CWSA 2GN7A 2NZ9A 3WUCA 1LEMA 2H0BA 1XQNA 2YV8A 3ZSJA 3AX4A 2VU9A 3CNAA 1OFSA 4M01A 4BLIA 4Y1XA 5EXOA 4FOQA 1D2SA 2WT2A 1RITA 2XG3A 4M3CF 2CNAA 2EF6A 3N7KA 1N1SA 4AGRA 2VUAA 4FPJA 4K20A 2ARXA 2E53A 2A3YA 3ZPYA 2DVDA 1HKDA 1W6PB 4CRQA 4XDQA 1MACA 2GNDA 3SITA 4UW3A 3AFKA 1A3KA 2DVAA 1LGCA 4DQAA 5KXEA 1BXHA 2CL2A 4YM1A 3M3EA 4YGDA 5H9QA 2VY0A 4U2AA 2DVGA 2YROA 2ZA9A 3N36A 1GNHA 4JRAA 1MS0A 4AVTA 1KDMA 3POYA 2TEPA 2Q5TA 3VKNA 5KXBA 1IS4A 1A78A 2ZABA 5IT6A 1SLIA 2D6OX 5GALA 4DFSA 1BZWA 2E7TA 3DGTA 1X50A 3ILFA 3UJOA 2P2KA 1GZWA 3AYAA 3RS6A 4PBOA 2NP0A 4ATFA 3OBTA 2W52A 1WW6A 3VKOA 2ZGRA 1GANA 2NMNA 4HL0A 5KXDA 4RL7A 1N1VA 2CTVA 1V00A 3UJQA 4YZ3A 5EYYA 4P9WA 3AXDA 4AWDA 1MS5A 3AYDA 4YGEA 3WDTA 4ZKTB 3VUOA 2DUOA 4BM8A 2B7YA 2PHXA 4YG6A 3WUDA 1N3PA 2NMOA 1ONAA 5DG1A 3ZXEA 1DHKB 2GMEA 1W6OA 2ERFA 2VW0A 1CR7A 1JN2P 1CN1A 2R1BA 3OY8A 2ENRA 1W6QB 4HANA 1S0DA 3ILNA 2GDFA 1DYKA 2WKKA 2A70A 1HQWA 2D6PA 4P14A 2D3PA 4FOVA 4LBKA 1JXNA 1LTEA 5DUVA 5DZGA 1LHUA 2AUYA 2CY6A 3LCPA 3AP9A 1TEIA 1PZ8A 2D6MA 3WCRA 1CJPA 3GALA 1LJ7A 1N1YA 1Y7BA 3M3QA 1RIRA 3AP6A 3FUQA 1S0EA 4Y1YA 1HQLA 1LHNA 1LHOA 1AJOA 4AGGA 4PQ9A 4P9XA 2ZACA 3ASIA 5GLVA 4U36A 1G8WA 1FV3A 1S0BA 3AYCA 2D6KA 4XXPA 4C1WA 2HYKA 2Z42A 4M3CE 1SCRA 1QOTA 2W08A 3D4KA 1VAMA 4XJZA 1H9PA 4XMIA 4GKYA 3B3QE 2UU8A 3VKMA 4DRVA 5IK5A 4Y20B 2ZGOA 4FPOB 3AJYA 4YGBA 3IPVB 3WHUA 3WLUA 2CWMA 1FYUA 4XHXA 2DV9A 1ULEA 3ZYRA 4LBOA 1SLLA 2JD4A 1PZ7A 1AJKA 2V73A 5T5LA 5JVVA 1JYIA 2ZKNA 2RHPA 5E88A 4BPZA 4LBMA 3V0AB 4Q1RA 2KM2A 3B69A 2ZGUA 4ATEA 1V6IA 4ISRA 4L8QA 4FOYA 3IM0A 3AP4A 3C2UA 3PVOA 4Y1UA 2VW1A 1WBLA 3AXEA 1DGLA 1QF3A 2GMPA 3N7JA 1IOAA 1WCSA 2DU0A 2GNBA 1G9CA 1WD4A 4SLIA 5L73A 4Q8LA 1AX1A 5JOXA 3N7LA 5CNAA 1QOOA 1OQ1A 1DQ6A 1LOBA 1LU1A 1ULGA 4Q26A 1S0JA 5CA6A 1YYNA 1FAYA 4AGVA 4XMAA 4WVVA 1LHVA 2PHFA 1G9FA 3WG4A 2SBAA 3WHTA 1S0GA 3ENRA 4C1XA 2VW2A 4P9YA 1DQ2A 2ZGSA 1FATA 1LECA 1ENRA 5JDBA 2OVUA 2DURA 4GA9A 5GZEA 3ATGA 1LOEA 4Y22B 3WDXA 3UL2A 3RMYA 1I1EA 5E8AA 4W65A 2WJSA 1ZA4A 2ZGPA 3OBRA 1GYKA 4CTEA
chains in the Genus database with same CATH superfamily
3C7OA 1G9DA 4A7KA 2XVLA 3KQRA 3POJA 5C71A 5A7QA 2WSVA 1W6NB 5LEJA 2VZPA 3KWVA 4COYA 4D0QA 3VDCA 1XE8A 2HWE3 2LRPA 1HQNA 4MO3M 1QDOA 4XQWA 4DIQA 3EJKA 2JXAA 1REDA 1WLDA 1H1MA 2ZAAA 2OT7A 3J9SA 1UKGA 1KXGA 1BLZA 2JG9B 4KBZA 5JUVA 3PJYA 1OI6A 1Z0HA 2GZWA 4FPCA 5GZCA 1NZCA 1OKQA 4CDXB 4AHYA 2WA3A 4ONUA 3WF3A 1JW6A 2BPA2 1NCRC 4XZPA 5IVBA 4AVVA 3WDUA 2VNVA 1QJX1 5B2GB 3AYEA 3WSOA 4LBQD 1LOFA 3NNGA 1QHDA 2E7AA 4PHZA 4NIHA 4NPRA 2ZEZA 3LEKA 1YC61 2J22A 4Y20A 1FNYA 3FLTA 1RMU2 2RS33 1Q8PA 2FZ1A 1UD1A 3D0JA 1WD3A 4B7KA 4B4PA 3NSTA 2CU5A 3FFZA 1LGNA 2B9UA 5FZKA 1URXA 2A5ZA 4YW1A 4BMBA 2TBVA 3LIHA 1QNYA 1RUD1 1JMUB 5A6XA 1LNSA 5A1FA 5C9AA 4TTGA 3R05A 3DN7A 1JHNA 3QACA 3GZEA 3DUIA 3P3NA 4PLMA 2WNEA 2E31A 2JKXA 2BZDA 1VBC1 2ZHLA 1R083 4HZFA 1PHMA 4CU9A 4FPEA 4W6WA 5A3TA 4J1XA 2OPWA 2VH9A 3KHCA 1SBDA 2K9ZA 2AR6A 2ZMNA 2ZBJA 4Q27A 4S2FA 1AZDA 1CIWA 1AF9A 3A23A 2XR4A 1UWWA 1W39A 1VLNA 4UFKA 1YUDA 3LEMA 5KBFA 1SACA 4AQ2A 4EN7B 1E5SA 1G86A 5L7OB 1W8ZA 4Y22A 3OD0A 2QUOA 2VMGA 1XPWA 2HWF1 3ZYIB 1W2AX 3UESA 1OURA 2OUHA 5JOZA 2RS52 4XZUG 3RGBA 1QDCA 3PUQA 4AK3A 3SC7X 5K7PA 4MSVA 5LA1A 3LOBA 1KDKA 1UPIA 2EAKA 2JDKA 4MGYE 2W39A 4L0PA 4FPLA 5BNOB 3H1YA 5F6KA 1W6NA 3NWKA 3OUHA 5FYMA 1UU4A 4E4SA 3ZVXA 4GULA 3M2MA 1O3QA 5F1RA 2VOWA 3LAGA 1H1AA 5EYXA 1DZQA 4YW2A 5A80A 2JG9A 2W46A 5DAVA 4BQ3A 1QMJA 1EP0A 4EWDA 5D8AC 2B45X 2E33A 4BQ4A 4QMAA 2R041 1O8PA 5IK8A 2RR13 5LA2A 4CDXA 5F32A 1PX3A 1N47A 5CADA 2W9XA 1GQHA 3BOWA 2J1TA 1ZZCA 4HPKB 4IGOA 3OEBA 4AE2A 3VN4A 4XACA 4XJUA 3OPZA 4Q4X3 1XSRA 2W95A 3DXUA 3BCWA 3EQEA 4I01A 2VULA 4OLLA 4X8NA 3E6BA 2Y8KA 1T6GC 4LO7A 4LULA 3RSJA 1X8MA 2WO1A 2WT0A 1LULA 1YJKA 1NQJA 1RJ7A 3JCIA 1RUJ2 1W2TA 4PIXA 4ZS2A 1QJY1 1CVNA 4AFBA 4CU6A 2VUDA 3VKFC 4AXOA 1JZ5A 2XH6A 1KITA 4OMCA 3O1VA 3AMHA 4BA6A 3JB8A 3VBOB 2R16A 3IDAA 2X5IB 3W58A 1ASJ2 3LFMA 1OF4A 3EO6A 5CEHA 2MHFA 1LAJA 5AVAA 5LWBA 1DZRA 2G4IA 2ZZJA 1JYXA 2IFRA 5GJ6A 4GH4B 4QHZA 4XOGA 2QQKA 4QM9A 5A7SA 3WX5A 4TSVA 2Y64A 2DTWA 5SV5A 3ZR5A 4DPNA 4Q4Y2 2OXBA 1DYPA 4S2DA 5HCFA 3OYWB 1TQ5A 2JDZA 4XCBA 4Z2AA 2HBUA 4CCJA 4HVRA 2EXHA 4KG0A 4N53C 4DY5A 3KVAA 3SH3A 3GHNA 5FYHA 3AZXA 3G7DA 4QGNA 2HWC3 1W9YA 1BEV1 3FHIB 4XQDA 2BUKA 1F35A 2VZVA 4QXHA 3TRSB 1X36A 5FZLA 4PCRA 2RM23 4LT5A 3ZKUA 1QGLA 1WCDJ 4YVWA 2HWD1 2RG4A 5L7OA 2XJQA 4LITA 4EYUA 5IK4A 3I49A 3S5AA 2P3IA 2LROA 2ZPXA 5F6LB 1V6LA 4COZA 3C7EA 1S0CA 3LSDA 4D7SA 2YHJA 1DQ1A 5FYBA 4XJAA 3PVNA 4LE3A 4HVOA 4ZZ5A 1ODMA 4K1YA 3SHRA 3NKTA 5IVVA 2CSGA 5FY9A 4NOTA 4UFIA 5BNOA 4X6RB 1Y9QA 3KV6A 4KQ7A 1MS9A 3NKGA 2BBVA 3WXPA 2JECA 2XMLA 3KMHA 5F3GA 4ET7A 4LE4A 5BXXA 1BK0A 2GALA 4AFDA 2IXKA 1NLQA 2RDSA 4CCOA 5HV4A 3HR9A 3PDQA 3VHPA 5IVYA 3SQOA 4M3CB 4AYUA 3I2KA 2Q8EA 2HWB2 1EPWA 4CUGA 4N9IA 3WQBA 1C1FA 1XJAA 1HXS3 3I3EA 2EA7A 3LDBA 3O1PA 1ULPA 3JXSA 2RS13 2VMHA 4L11A 3DEMA 4UFLA 5IFPA 3MLJA 1A8MA 4RA0A 3ZFEC 5EWSA 3OPTA 4AFMA 4MH0E 1MEC2 2Y60A 3IWZA 3WW3A 3H0OA 4DRRA 2B46X 1WMDA 1E5RA 2YC2A 4WZCA 3ZIWA 2R49A 5GLZA 1O5UA 3IKWA 3LEGA 3AP7A 3T30A 5E89A 2QQUA 4LA3A 5IK7A 3ZFFB 1WKYA 1YO8A 3RNSA 4QPGB 3E5UA 3PNAA 1H8VA 4FVVA 3PIJA 1MVEA 2BV4A 1GFF2 5A6QA 2A6ZA 1ND2C 5IHRA 5A6YA 3VBOA 1U5YA 2I74A 2X5IA 4UXAA 1RUF2 4K9SA 1IS6A 5FZ3A 4PQQA 2VZ3A 4E8CA 3QLQA 1RUC1 3I2GA 4KWJA 4ZXKA 4GH4A 4YNIA 3KS7A 5FPAA 5GLWA 5L9BA 3S0MA 3BOPA 1NLSA 3DXTA 2ZKLA 1F31A 3FUOA 3NJZA 4LUMA 3NJVA 4YZ4A 3UNPA 1FI2A 3FX3A 4Y4RA 5JZGC 4Q2FA 1J3QA 1SPPB 2RMU3 2ZTNA 3FFQA 4OI2A 4CSWA 1W8FA 2WS92 3OGJA 4LJHA 1Y43B 2OYZA 3MFAA 3P1IA 4HMZA 4R4XA 4XXAA 5F5IA 4BXFA 4DXSA 1EYBA 3B94A 4FQ4A 4MHRA 3ZYPA 5JIAA 2DCJA 1QOSA 4NIIA 3PVEA 4N9HA 3ZSEA 3LA3A 4FBFA 1Q56A 2Y33A 4OUEA 4UBHA 1H4HA 1CPMA 1VIWB 4IERA 4WM7B 4BQ2A 4QPWA 1W6PA 4IW3A 4D7YA 1DP0A 3T0BA 2WIIB 3ACIA 2FDJA 1FXZA 4TLGA 2R0FA 1ULOA 3SEPA 2ZOEB 1YQCA 2ZHMA 1STMA 4M4RA 3MEPA 4NHMA 4R4ZA 3ACLA 1OXCA 3K46A 5HBAA 4Y26A 2WBKA 1JI6A 3ZLIA 1QJU1 1RUG1 3MUZ1 4MADA 1FPN1 3OY8B 4KWKA 1DLCA 1OUXA 1Z78A 3MPPG 3VZNA 4AEMA 3ETPA 5IYYA 1BKZA 5CZKA 4ZS3A 1UZWA 2PLV3 2R32A 4K40A 4NN0A 3RZHA 4FOWA 1PVC2 1FOD2 1X9PA 2ZEXA 5C4WB 3FMGA 2EALA 1C3HA 4BHPA 1ND3B 3WF0A 5LATA 1VRH3 1D0GA 1XNDA 4QPIC 5CB7A 1ZZ9A 3WNKA 1LEMA 2YV8A 1XQNA 1J3RA 1VMHA 1ZBE1 1OFSA 4OVEA 1OLQA 4CEYC 4FAGA 1XB9A 1NKGA 5A3UA 1NOVA 4BU2A 1M06G 5FR3A 3OSDA 2WT2A 1YHFA 3FE5A 4QAWA 2XG3A 4M3CF 4ORFA 1A6CA 2RVAA 2RE9A 3ABZA 2WFF1 4AGRA 3JBG1 3CHXA 3ZFFA 2ARXA 1V9U1 4DOUA 5ACA1 2A3YA 1E57A 4JKLA 4QWNA 2BFUL 2HEWF 1PGL2 1PO22 1HKDA 3IZOA 5A1AA 2J7MA 3VHRA 1U5XA 5LRRA 4UW3A 5A33B 1A3KA 3Q8BA 3VL8A 2F4LA 3MV01 3W5NA 2XHNA 1OBNA 2CL2A 1F15A 5FDBA 3M3EA 1RVF1 5DDJ3 4U2AA 2YROA 1GNHA 1VBE1 2PA7A 3H8UA 3J7HA 2Y0IA 3KD4A 1QXJA 1E5IA 1KDMA 3KV4A 2CDOA 4H7LA 4IV3B 4EN0A 5AC92 4P9IA 3OGSA 1RUH1 4BZ4A 2FD8A 2XBO3 3NVCA 1JYWA 1SLIA 2ORXA 5GALA 2HEYF 1SPPA 2QQVA 2E7TA 3EXUA 4RR3B 5F39A 4H3WA 3VD5A 4A7ZA 1X7NA 5FZDA 3AYAA 3E6CC 2E63A 2BEOA 2VD7A 4H14A 4Z82A 3JD72 4ATFA 4DXZA 4BK5A 1WW6A 3MBWA 1DYOA 2NMNA 2VZRA 5DAWA 4NRPA 2VQUA 4HL0A 3I2OA 4NVPA 3OCPA 2GP3A 3MIEA 1HN0A 2PXJA 4QHOA 5FV3A 1RUE2 3UJQA 4Q4W3 1OT5A 2JB8A 2WZR1 5FZMA 3AXDA 2IC1A 5FZGA 4COVA 4E9KA 3WDTA 4ZZ8A 3VUOA 2DUOA 3ACGA 2PHXA 4FT8A 3WUDA 4BM8A 5J3UA 2NMOA 2IVIB 3OUJA 5EJZB 5BNPA 1UY1A 2ERFA 2I07B 2VW0A 4DUWA 1R1A3 3OY8A 1W6QB 4UAPA 4B4RA 1Y3TA 2XJPA 2BDRA 3C3VA 5FLIA 3CJIC 2D6PA 1CX4A 2WQ4A 1LTEA 1R091 5C4WA 1F4AA 4LKFA 5DZGA 2ZAHA 1LHUA 1REEA 4KNCA 3LCPA 2W94A 5FQ0B 1ND3A 3NNMA 1TEIA 2P3YA 1QEXA 1NYWA 3T2PA 1CJPA 2W2IA 3GALA 2PFWA 1Y7BA 4RD7A 1HQLA 5E1RA 4HN1A 1W28A 4E2QA 1IPKA 2IXCA 3H3ZA 4PQ9A 4XETA 2AC1A 2ZACA 4HK8A 2JIJA 3RDIA 1FV3A 2HKXA 1H2LA 1HV1A 1CAXB 2JG8B 2EIEA 4V2WA 5FFOC 4C1WA 3LFIA 1AR71 2V4VA 3WW2A 1HJFA 4UFJA 1TG7A 1VAMA 3Q8EA 3UGHA 5F3EA 4GKYA 2BYVE 1O91A 4DRVA 1NLRA 5IK5A 2B8MA 2F6BA 3RYRA 4MGQA 4RQPC 3WF1A 1FYUA 2HWE1 2VZUA 3NJXA 2DV9A 3O1UA 3P6BA 1CZTA 5A33A 3H9AA 1VB4A 1AJKA 3MPBA 2Q1MA 2VBDA 4KG8A 4NR1A 5IVJA 1LB2A 1JYIA 1XNAA 3LE0A 2ZKNA 5E88A 2Q1ZB 3ELNA 2QCSB 1XE7A 4LBMA 3NO8A 4PDWC 2VZOA 4RYDA 3UV9A 4HXCA 3PUHA 4I3GA 3ZPOA 4CDUB 4IV3A 1V6IA 3IDBB 4ATEA 2ARAA 2XJRA 3SCHA 1UY3A 4ASLA 2JDUA 3PVOA 3AKRA 3AXEA 5FLJA 1DGLA 5FPVA 1QF3A 3G6JB 4RR3A 1WCSA 4UFMA 2GNBA 4EQVA 2WWUA 1VBB3 1GZTA 5L73A 5KHHA 4LO4B 3HVDA 3NMBA 5CNAA 2MPFA 2XHKA 1QOOA 1W99A 3WNNA 4A6SA 1DQ6A 1LU1A 2YGLA 3FC0A 4OFGA 2QKDA 4Q26A 1UOGA 1HN1A 1UOFA 4XMAA 5J1XA 2PHFA 2RS31 1ALYA 3PLQA 2KXLA 3TEXA 4D8MA 4DO0A 5JDBA 1ENRA 4FTEA 3OBZA 3HT1A 1ZZ7A 3ATGA 3WDXA 3UL2A 1VRBA 4HETA 3RMYA 4ARXA 4BK4A 1RB8G 2WJSA 1ZA4A 2ZGPA 3OBRA 2YB7A 4LHKA 1GYKA 5IAXA 3N9NA 5JAXA 2P3JA 2VZQA 4QKNA 5F9TA 1R081 4GWIA 4AEDB 3A0KA 1QJX2 1W6QA 3VBHA 3HWJA 2YZ4A 1GMMA 4YW6A 2A1XA 1Y9MA 1D4M3 2YMZA 1IPJA 2W1UA 4MVTA 1W90A 2DWRA 2C6SA 5FQ0A 5TSWA 1SLBA 2E32A 3H50A 3NV4A 2A6YA 4KWUA 1RUD2 2P6HA 2EXKA 2QZ3A 3NV1A 5F3CA 3MZHA 4I3PA 4WVWA 2JDYA 3M3CA 3K4DA 2WNOA 5F2SA 2A75A 4AHXA 1NA1C 1VBC2 3DKQA 4XDOA 1Q43A 3S7EA 4BXSV 1CESA 1CAXA 2J1VA 2JG8A 3FJSA 4LHLA 5H9RA 2DF7A 3P5BA 5I0DA 2Q4SA 2VNGA 1GBGA 2ZEYA 2X05A 2EXJA 4XBNA 2VAUA 4Q5OA 1HRI3 2OW4A 4L92A 2NYYA 3ZN4A 3I3BA 3O12A 5FP9A 2ZX3A 4FPFA 1F9KA 1HB2A 4GD4A 4B4QA 4ZY9A 1ENXA 1GZ9A 2ZGKA 4O61A 1UAIA 2E7QA 4P00B 2VPVA 4FXGB 1J83A 5C5UA 1K3IA 1YQ6A 2W92A 4MYEA 3WG3A 3NJYA 5DUXA 3ZXLA 1J1LA 3IIAA 5LY2A 1OA2A 4L99A 2CDPA 1UZYA 2VR4A 4RSUA 4CDUA 1SZBA 2P34A 2JKBA 2WNUC 5FXWA 2HWF2 4AVSA 2RR11 1UL9A 5AFBA 1W0PA 5LY1A 3WF2A 1BJQA 1UN1A 2ZX0A 3DPRC 3HJRA 1ZRRA 3HN1A 4OZXA 1GNZA 1AR83 1KJLA 1YFYA 2Q8OA 1GKBA 5EIYB 2OQ7A 4Q4X1 1H9WA 1S0FA 3FHAA 3IMMA 3ZSKA 4AI1A 5LA9A 3CQOA 1GUIA 2ZXQA 2IXIA 4MGIE 3ZIXA 1US3A 2QE3A 1FMD3 4AVCA 4RGKA 1AR93 1EPZA 4NMIA 3NW4A 4Y3OA 1SDWA 1GZCA 5ANNA 1RTVA 1KFUL 4EN8B 1LOCA 1RHI3 2HYXA 2R042 3X29B 4CDQB 3AK0A 4GIQA 4BE3A 1JU4A 4AG4A 1CGPA 1W05A 4OQ8A 2PAKA 1OC1A 1W8HA 4HBNA 1RYYA 3HPNA 4AEDA 4EZ4A 1U12A 2ADDA 2JE9A 3A7QA 3ZDVA 4AFAA 1MQTB 3MI8A 4QX3A 1E5HA 1OSGA 1JOJA 3VL9A 2Q1FA 2VMFA 2EIGA 3MYXA 4A44A 2YXSA 5FPUA 4YGCA 4LIUA 1G9AA 3PIGA 5ISLA 3OD4A 2AENA 4LKEA 1JBCA 1QJY2 3LB9A 1GOFA 2WN2A 3D0SA 3KT1A 3POSA 4LK7A 2UYAA 3VBRB 2HWC1 4EN6B 3U4SA 4YARA 5FY7A 1GWKA 3HD8B 4HN0A 5GZFA 3URFA 4QU2A 4CZSA 1R64A 3ES4A 2RM21 5ANQA 3R4DB 4DXTA 4JDOA 3USSA 5JIUA 1OOPA 5KHJA 3MGUA 1YQ5A 3WNOA 1W0OA 5JSOA 2G1MA 4ZU7A 4CDWB 3VDDB 3UKTA 3U0ZA 3RMXA 3ZSLA 2VUJA 1RJ8A 1RL3A 4PF1A 3GBFA 4LOTA 1BYHA 4OI0A 2DTYA 3E97A 4HSJA 4NROA 2PHWA 2JG9C 4DY3A 1QJEA 2X29A 2SLIA 5FXVA 1V6JA 3WNPA 4GAZA 1BEV2 3F2ZA 4CDXC 1GP6A 1XNBA 3FLRA 1Q5OA 1BBT3 1CJDA 2XUMA 2V5DA 2JIGA 3VZKA 4NAMA 4PT6A 2D6NA 4BOWA 4D69A 1LENA 4DXRA 2ZMKA 2HWD2 5FYIA 1U5IA 4LO8A 4N7UA 2WNVB 4H2AA 1AVBA 4QT6A 2WZEA 1W06A 2YUEA 5CFCC 4E4HA 1G6NA 4YW3A 1HXS1 2W91A 3D3AA 2D5FA 4QGLA 1HB3A 1AX0A 3H8XA 1CAVB 4PF5A 2P5BA 1EY2A 1QXRA 1SFNA 2RS11 2XQRA 4QQOA 4ES9A 5C8WA 1S55A 1YNAA 4P5HA 4XF1A 3ETQA 4BMEA 1N3OA 1LCLA 3LDRA 1EV13 3ST7A 1W8TA 1LR5A 2BQPA 2YGMA 3WDWA 5JI9A 5KXCA 5BUVA 1RC6A 1LRHA 1CONA 1AX2A 3AP5A 4GWJA 4R9AA 3OTFA 5T55A 1OA4A 4YW7A 2VCBA 4CYDA 3IDEA 2QDNA 5JMCA 4QQPA 2UYBA 1XNCA 4E8DA 1DF0A 4AFCA 1O59A 2PHDA 4CDQA 1OLRA 4GB33 1JUHA 4H7MA 3USUB 3GJBA 3PU8A 2NM1A 1DQ4A 3KF3A 4GMP0 4AW7A 5C5TA 1W9SA 3H3LA 3OJBA 3AZZA 1MQTA 4YG3A 1MPXA 4PLOA 3RVHA 1GR3A 1NQDA 4A6OA 2RMU1 1W2OA 3I3MA 4GQ7A 4GJZA 4W8JA 4L97A 4Y24A 4B1LA 5FWJA 3T3YA 2FQPA 3VBRA 2WSUA 2X10A 2QQWA 3VD7A 1QU0A 1AYN3 1WUVA 3GZUC 5DQ0A 1RINA 1R1ZA 2A73B 2JE7A 4AAXA 3SXWA 3KF5A 1XNTA 5JCTA 1H6XA 1K5JA 1VAVA 2Y6HA 3SNMA 2XJSA 5BNOC 1RUC2 3B9IA 2GH8A 2W87A 3M70A 2OPKA 3T0DA 1ZM1A 3GNEA 3JZVA 3VDDA 1WWYA 1KGYA 3ZN5A 4CDWA 4JQRA 4FPGA 1ZREA 2PHLA 2W68A 3CKHA 3AMMA 5JPMB 1JZ8A 1GSLA 3OG2A 4BQXA 2JX9A 5FZHA 4MG2A 2OZ6A 1DFQA 3WEZA 2I2SA 4EZHA 1A8DA 1UZZA 4O9GA 4UW4A 4CCLA 3WP3A 1Q8QA 2B42B 1BHGA 2R0HA 4YVWB 3WV6A 2R1DA 2PLV1 1ZZBA 2B9VA 3S30A 4K7JA 1UIJA 1OH4A 1B35B 2JB4A 1YI7A 1C57A 1ZRIA 5GLUA 4NUBA 2WNVA 1JYNA 3HNMA 3BTZA 2VZ1A 2JJ6A 1VRH1 4JKKA 5FK7A 4AQTA 2ZMLA 3M3OA 4E4ZA 1WW7A 2BRTA 1H2KA 1BMV2 3VKLA 1CAVA 4XF9A 5FRAA 5FZ0A 5FZFA 2NQYA 1ENSA 1QJU2 1RUG2 1O4ZA 1FPN2 4OCTA 4RHV3 1EUUA 3ZXFA 3VBOC 1I3HA 5T3NA 5FWEA 4JHTA 2RDNA 2X5IC 4YWAA 3T4HB 4XAEA 4YW4A 1K5MA 3IMNA 5FKBA 2ZGLA 5FZ8A 2QVSB 1J3PA 5T5JA 4IL7A 2FHRA 4CXYA 4XURA 3D6EA 4LUKA 4WV8A 5EFUA 4ISQA 4OHXA 4LTAA 5CFDB 3PMSA 1AYM3 2YU1A 1ZNPA 2DYCA 1CAUB 3V65A 1POV0 1SBEA 1UU6A 1ZBE2 2PQQA 2NN8A 3HBZA 3PTYA 5DDJ1 5KR7A 5LCWL 2WABA 5DG2A 3USUA 5F5QA 2J42A 3ECQA 4MHUA 3QOPA 5FZAA 4MXVA 2BU9A 3N3HA 4I0AA 2ET1A 4XHBA 3WG1A 2XBO1 5HPOA 3L2HA 4K8RB 4AZZA 2WFF2 4KU8A 2EICA 5BYNA 2H6BA 1IGOA 3FBMA 3JBG2 1V9U2 5ACA2 2VOXA 4ASMB 1UIKA 3VHOA 1YRZA 3CLPA 3POEA 4JGZB 4EROA 1HLCA 5LA0A 4XILA 1PO13 2FMDA 3HEIA 3NQHA 3QD6A 1F4HA 1YIFA 3GGLA 5FCCA 1UMZA 2CAUA 3D8CA 4BWOA 3VZMA 1LOAA 4G9SB 2DFBA 1AL23 1SDDB 1AR63 2FCTA 2B5HA 2CWSA 3CZJA 5JSPA 3OB8A 1RVF2 1G9BA 2NZ9A 5JI7A 5JXGA 3ZXAC 4IE5A 2H0BA 3QBQA 4Q4W1 4XAAA 3LA7A 1VBE2 3AX4A 3LQCA 5FZIA 3RI9A 3ZSJA 5EXOA 1EAH3 1RUH2 2HJIA 4OMDA 2Y6LA 4FXKB 3S57A 2KR2A 2Z4FA 2WYFA 1RITA 4Q0QA 3NAPB 2CNAA 2EF6A 3IIIA 3R6SA 4LXLA 3DF0A 4HG6B 5JPNB 5J7MA 1R1A1 5C70A 1N1SA 1YEWA 2VUAA 3ES1A 4NHYA 5FP4A 1OMIA 4XF4A 5D8AB 2E53A 3CMGA 3ZYGA 3ZPYA 4QX1A 2DVDA 2PAEA 1WCKA 4TXWA 1W6PB 4LHNA 4RS5B 1Z7S3 2WL1A 3ZXDA 1MACA 2YBSA 4M4PA 4DQAA 3AFKA 2DVAA 2K46A 1B35A 5KXEA 4YM1A 5FPXA 3KGLA 3LA2A 4YGDA 4AVAA 5HI0A 2WZR2 5G04L 2VY0A 2X53S 2ZX1A 2DVGA 4LOSA 4NPMA 5H9QA 1F8VA 5LBBA 1UU5A 2BJSA 3C7HA 4FFIA 3TN93 2TEPA 4NRQA 2R7EB 3VKNA 3ZFFC 1IS4A 2G9ZA 4UWDA 2BERA 4G4FA 4QD2A 4QPGC 1ZX5A 3ZXGA 3KZ4C 3UJOA 3ILFA 4JAAA 5FO7B 4G3YC 3ZYFA 4AHZA 4XFFA 3L9JT 3I3DA 5FP8A 3TBDA 4XUNA 5IWFA 5KWRA 3ZKYA 1VJ2A 4IEWA 2GC2A 2ZGRA 4CCDA 1R092 3P3PA 4YPJA 2GH2A 4RL7A 3K51A 3W21A 1N1VA 5KC6A 5CFDA 2EAAA 4BIOA 2CTVA 4UT5A 3VD9A 4YZ3A 5JSRA 3POIA 3VD3A 3LIGA 2J1EA 4L9BA 4IXLA 4AWDA 1MS5A 5LEKA 4YGEA 1CAUA 2VJXA 5LBFA 3TOJA 4JQTA 1UX7A 4OI1A 4YG6A 4B7EA 2GMEA 4QB6A 1VB2A 5FYUA 1AR72 5EJ3A 1JN2P 4QPYA 3T08A 4A4AA 5KHIA 1UZVA 4I2OA 4IEYA 4MGKE 4Q4V3 4WM7C 1VBB1 2MEV3 1JZ6A 2YPJA 3POFA 2D3PA 1TME3 1UMHA 2IXJA 2O14A 1JXNA 2OX0A 3HQXA 4FOVA 1PGW1 4JGZA 1T2XA 2AUYA 3W9AA 2LUWA 1HV0A 5FMBA 2HWE2 1REFA 3SCGA 3AP9A 2WO3A 4IE7A 3AMQA 2QNKA 3WCRA 1Q3EA 1LJ7A 1N1YA 4INDA 3FHQA 4CU8A 3AP6A 3FUQA 1S0EA 4A2UA 1YFXA 3BU7A 1KD7A 1LHNA 4DEVA 4QXCA 2BBAA 4MZUA 3POBA 4K8FA 5FBJA 3AYCA 1POQA 4XXPA 2QDRA 1WA6X 1QOTA 4AL9A 2OIIA 2FDGA 1I5PA 2JEMA 3NAPA 5C3SA 1ND3C 1CD3G 4XMIA 3B3QE 1RUI3 1OKOA 1PGSA 5D8AA 2R30A 3E5QA 3AJYA 4FPOB 4YGBA 3IPVB 3WHUA 1TMF3 4RS5A 2QQIA 4NPLA 1D4M1 3ZN6B 4XHXA 2RS32 3ZYRA 2R063 4X6QB 1A34A 4LBOA 1CX1A 4IV1B 1COV3 1PZ7A 1XYNA 2PMWB 3BGAA 2RHPA 3FZ3A 4KH9A 1VR3A 3IDCB 5FMDA 2XVKA 1TZOA 5BNPB 3V0AB 2KM2A 2WO2A 3UETA 3M3IA 1YLLA 1OVSA 5CG8A 1DGWA 4V2VA 3N4MA 4CCKA 2QJVA 3DECA 3DYPA 3I2HA 2YFZA 4ZONA 4FOYA 5JOWA 5FMCA 1C8M3 2DBIA 5CKMA 5C7GA 2GMPA 3N7JA 1R082 4SLIA 1W3XA 1XU2A 3ROUA 1ND2B 5JOXA 3N7LA 4NHLA 2RJKA 1PMIA 2R073 1OQ1A 4O7XA 1HW5A 3WT3A 1LOBA 1HRI1 1GWLA 4RN5A 4BPZA 2BWCA 1FAYA 1IG3A 1VBD3 2BVVA 4V1PA 4WVVA 1YQ2A 1G9FA 1NG0A 2BNOA 2KA3A 2VW2A 3B7MA 2VCCA 1O8SA 1FATA 3H7YA 1O7FA 5I0UA 3UKNA 1LECA 2YU2A 1HRV3 4LKDA 5JZGB 3BTYA 1NY71 2DURA 2WDBA 2XONA 3J26N 3J8F3 4WBBA 5GZEA 2BWAA 4RR3C 1XU1A 1JHJA 1QY4A 4CP2A 3OGVA 4N53A 3K4AA 4IEVA 3H8OA 2VG9A 2Y38A 4GJYA 5FP3A 1OUSA 3BODA 3GCXA 3IM0A 3PUAA 4NHKA 4KL1A 3ON7A 4GZ9A 2IUWA 2DCYA 4WM8B 2ZGNA 3DCQA 3OPWA 5A3NA 1AR81 1W9TA 4M0HA 4ARYA 1O6UA 1PIV3 4Q0VA 2Q8CA 4OZOA 4YVSC 1UCXA 4BJ0A 4JCKA 1QWRA 4OQ9A 4IDZA 4Z92B 1SLCA 5DZEA 5F5CA 1LGBA 1FMD1 2ES3A 3O1OA 2P4EA 1QNWA 1AR91 4XTPA 5DXDA 2VVFA 5C8CC 5SV8A 2JD9A 2EIDA 2DVFA 2PHRA 5FJHA 2VM9A 2BOIA 1RHI1 3A4UA 3WOGA 5B4NA 1UY0A 2RR12 5I8SA 1ZBA3 3VGIA 4IQPA 1XYPA 2WFPA 4FQZA 1VBA3 4HKOA 1XRUA 2FZ2A 2UWCA 3O0WA 4Y5SA 1QIQA 3AFGA 2WA4A 4XUPA 5CKNA 5J48A 1BK1A 2WQZC 4NHXA 4BH9A 3KCXA 4Q4X2 4EWAA 1KS4A 3PVBB 1KJRA 3IPVA 4BQ1A 3PL0A 3ZN6A 3KCCA 4IV1A 5DMYA 2DCZA 1G7YA 3N35A 3EHKA 3KGZA 2JG8C 4QHBA 4SBVA 3U37A 4JX0A 4XW3A 4XQ4A 1X33A 5GLTA 3V0AA 4PBPA 2IXHA 3RZKA 2DFCA 2QFEA 4Q1PA 4LO6B 1XXNA 4PJYA 1WLTA 4QU1A 1H4GA 4LBQB 3VBHB 1AUYA 4ES8A 4J1WA 1WW5A 4XJ8A 2VE1A 4GMP3 5FYZA 3VBSB 1S2EA 2D97A 3U4XA 1ND2A 3CF6E 4DUVA 4CXWA 1XOYA 2JWPA 4JTNA 3A0NA 4HONA 1XNKA 1OPOA 1VMJA 1LU2A 2J1AA 4HFSA 5C3PA 1Q8OA 4I0BA 4CDUC 1NXMA 2HWC2 3PTRB 1MZ6A 3V64A 5IVCA 3NRUA 4IEXA 5JZGA 4CE8A 1BBT1 4UW5A 5FYCA 5E16A 2C0ZA 3POGA 2IVJA 2RM22 2LTNA 4LBKA 1SG3A 2QTWB 3AZWA 1TVGA 1QQP3 5I93A 4LA2A 1UOBA 3WNXA 1SLTA 2XXZA 1DGWX 3N9PA 5FYVA 4QDRA 3RYKA 3WG2A 4EJRA 2CAVA 3L2YA 1WBFA 1HX6A 5EJ1B 1UNBA 5HXVA 3WY6A 2JDHA 4CEWC 1H2NA 2WYSA 2VQTA 1OHFA 4WM8A 1I6XA 4MX3A 3IBMA 2VXJA 3IAQA 5DUUA 4DUXA 2G19A 4QKFA 3ACFA 4PI0A 4W4ZA 3ZXKA 3I2DA 1EV11 2V4AA 3PURA 1D0HA 4K1ZA 3O5SA 4QX0A 2OQ6A 4QDSA 2YC0A 1LEDA 3ME2A 4UYBA 3I7DA 2FCVA 3KT7A 1O4YA 2XB6C 4AEJA 1KS5A 3TEZA 3UK9A 1NT0A 2W1SA 3H1WA 3MW2A 4AEDC 4K21A 2D44A 2ORZA 3FN9A 4YSFA 3DKWA 4DEQA 3ZSMA 1HXS2 3MUY1 1H30A 4GB31 3KCYA 1B09A 2JE8A 1I9RA 2AYHA 2Y0OA 4IEZA 5J98B 3KHBA 3UKVA 4BIFA 2RS12 3MFCA 4ZPIA 2LALA 4IEUA 5H9SA 1RMU3 1S2BA 3W20A 4OHWA 2VZSA 4XIOA 4IUGA 1IQAA 1CIYA 1MZ5A 4I02A 2WZ8A 2H0VA 4W6YA 3OGRA 3OGGA 4WVZA 1WLCA 5DN2A 3T1LA 4LO5B 4AI2A 5HCAA 5HXMA 5E6HA 4D3WA 3MLLA 4OHYA 3C8XA 3GM8A 3THTA 4XYXA 5LK5A 4C0HA 4JZRA 2BTVC 2WLPA 4IETA 3RI8A 2DU1A 2JENA 5JR7B 2AREA 3VBUC 4B1MA 5FY5A 1LOGA 1AYN1 2WWSA 4LIVA 5HCBA 1SEFA 1ST8A 2LS6A 4UF0B 5F37A 5IATA 5CISA 2AEZA 3VDBA 1POV3 4LBQA 1ZRFA 3MV11 1MS3A 1W8UA 3OF1A 4GKXA 4RQPB 2XJVA 3VBSA 4XC9A 2FCUA 1C4RA 2J1RA 4Y4YA 2FMYA 4TLFA 4A41A 3WR0A 2ZGMA 3M8LA 2RMU2 3FBYA 1UO9A 3TAYA 5A3PA 3RQ0A 3GDBA 2GSYA 1PM4A 1W0NA 3Q8AA 1JOPA 4IEPA 3RZLA 3I8TA 5A32B 1MZEA 4CUBA 4XE9A 4D94A 1GWMA 1LHWA 1OOPB 1JZ4A 2XPJA 3MO4A 2UWBA 3T0AA 2WINB 4F83A 2RDRA 3IAPA 4EV0A 1J84A 4YM2A 2WRAA 1RGSA 3VD4A 2RS53 4DS0A 3AL5A 5A7OA 2K2SA 5M0TA 2OKXA 1BVP1 3O1TA 3AVSA 5FREA 3U75A 4XF0A 4JGYB 3JQXA 1V6NA 1UY2A 5FZOB 3WCSA 1PK6B 4FP2A 2VCAA 3WQ7A 4YZ5A 2AEYA 2Y26A 5GZGA 2I45A 4XABA 5A3MA 3H1MA 1W3VA 5ABJB 3WDVA 2GP5A 2NPIA 1ULDA 4RHV1 1DIWA 1OQEA 3QCWA 4QM8A 4CXXA 5DZFA 1GV9A 4YW5A 2PLV2 4LBNA 4FTBA 1F5FA 2YY1A 1LOFC 4H55A 1ULCA 2FDHA 5ERLA 4BQ5A 4JHZA 1FT9A 5F2WA 1OA3A 1YCIA 1U5ZA 1MQTC 1AYM1 1VRH2 3I2IA 4URTA 4X8PA 3CJIA 3VB9A 1CQ9A 1D2QA 5K9YA 4RGAA 5C9AC 3JUUA 1KRIA 1JTZX 2GNMA 2PHUA 3VBFB 3AZVA 4YM3A 3I3QA 3U1XA 4MGZE 3WF4A 3VBRC 3WVJA 4HSLA 1RUJ3 1AXYA 2OZJA 2VVEA 3RZMA 2GNTA 3GZTB 1FX5A 3AMPA 2VCMA 1UZ0A 1VE0A 2VQ0A 3KT4A 4JDMA 4C0BA 4QQHA 5DPNA 5EP9A 3U14A 2ZGQA 4FPKA 3ZR6A 1ASJ3 4XCAA 3QH6A 4Q8KA 5I8YA 2P6CA 1PO11 5IFTA 3RZJA 3RYPA 4BDVB 4XBLA 4HLTA 1D7PM 3RG0A 4QB2A 4BQWA 3MHZA 4UF0A 4TYSA 2ATFA 1DZTA 1X8EA 5BY5A 1AL21 5J37A 1AR61 1J1TA 4Q4Y3 1JYTA 5EPAA 2VXRA 5J96B 3BKZA 5DDJ2 5EQUA 1W8NA 1RUNA 3W59A 3DYOA 2ARBA 2JDMA 4RQPA 4CUAA 5LZ6A 2ETEA 2WWJA 3KLSA 3SH5A 1EAH1 1W9WA 2VMCA 2XBO2 5JXIA 1F2NA 1PNGA 1YWKA 3PUSA 3BB6A 1C8NA 2NLRA 3ZFGB 3FLPA 4AR2A 2WNVC 1JS9A 2HEVF 2LM3A 3ACHA 4IE6A 3BIEA 1XYOA 2YC4A 3GF6A 4N43B 5A32A 1APNA 4K3UA 2O8OA 4URAA 1Z7S1 3IN9A 3AMNA 3DPRB 4XF3A 3TEYA 4GWMA 3TYJA 5A1LA 1WMFA 1WCUA 4MUVA 3E5XA 1NAEA 4Q4W2 3R4UA 3I4IA 2VO5A 1YXWA 1UYXA 3K4ZA 2DUPA 2WLQA 4JGYA 1SBFA 2MNGA 5FZOA 3POWA 4M00A 3SISA 3TN91 1PK6A 3EMRA 3VZLA 2VZTA 3J4UH 5DUWA 2A3XA 4CA9A 4GWNA 3WQ0A 1T6BX 4D6SA 5ABJA 4UI9L 1R1A2 5JXJA 2BVBA 2XLFA 3RWKX 5FYYA 4HVQA 2OUJA 5FY8A 1UKRA 3OOXA 4GXLA 2J1UA 4TN7A 1H8TB 1SCSA 3ZXJA 2HWB3 2W0XA 3N9MA 4D6RA 2BOJA 4FTSA 3NNLA 1NUKA 2WN3A 1OPMA 4O9EA 4PLNA 5APAA 4FPYA 1ULFA 4ZU5A 1HB4A 2W1WA 4FP3A 4OI4A 5CBLA 2GN7A 4NJ4A 4OHVA 4CVUA 5BNNB 3WUCA 3LPFA 4P02B 5KHGA 1NCQB 4Y5TA 4BLIA 2VU9A 1MEC3 3J7NA 4Y1XA 2HLEA 1D2SA 3HN3A 3VBFA 1Y4WA 3T2QA 2D93A 5BNQA 1WA4A 3H3UA 3KV5A 5HV0A 1US2A 3EBRA 1K5MB 3LWCA 2IZWA 1QH6A 2R6QA 4K20A 5L36A 3VLBB 2ZX4A 5FY1A 1I5ZA 1HB1A 3SCFA 4Q4V1 4QXBA 1ZZ6A 2JDPA 2MEV1 3LEIA 1NA1A 1W8OA 1RUF3 1TME1 3BN6A 3RZGA 4IGQA 3I54A 1LGCA 2YFUA 4BYYA 5F7UA 2B39A 4CP0A 1BXHA 5CVRA 2WQ8A 4F8AA 1L7LA 1IQDC 5FKCA 4Z07A 3PUIA 1QXPA 2Z69A 2ZABA 5IT6A 5K0UB 2WS93 4IEQA 4YVWC 3ALQA 4S2GA 4M0NA 1BZWA 3HOBA 3WD5A 1X50A 1PMHX 5G05L 5L7OC 5LW9A 2XL9A 4PBOA 4QDQA 4COUA 2NP0A 2HH9A 1B35C 3OBTA 4QX2A 1YQ8A 2W52A 5L9RA 1YI9A 1VBB2 3S7IA 3ZFGA 4HKWA 1RUI1 2D5HA 4QQ2A 1PNFA 2ZX2A 2WNUA 5CFCB 5KXDA 1PGW2 4N43A 2ET7A 2X09A 3BVCA 1TMF1 2TNFA 3JB4C 3R0RA 5FZ6A 2YBKA 3DPRA 2R061 4LMFA 1COV1 2VOVA 5EYYA 4P9WA 2D98A 2C1FA 1WMEA 4TWTA 4ZKTB 2B7YA 1N3PA 4LORA 5JXHA 3B5LB 1KEXA 1ONAA 3KQ4B 3LZZA 5DG1A 3ZXEA 3AKSA 1UYPA 2Q0AA 1C8M1 4XUTA 1CR7A 4W6XA 1CN1A 4IE4A 4HANA 3AVRA 4NWVA 3ITQA 1S0DA 1OLME 1FOD3 1PVC3 3ILNA 1DYKA 2WKKA 5CFDC 1NCRB 1HQWA 1P8JA 1EUTA 5FUPA 1C5HA 2R071 3EB7A 1H8TA 1D4M2 4I0WB 4LLOA 1VBD1 1GQPA 2OS2A 1O3TA 4MGTA 2W3JA 4MLOA 1OFNA 1RIRA 2Y6KA 4META 4Y1YA 4AI9A 2CGNA 2OA2A 4EE2A 1AJOA 1HRV1 4IESA 5BNNA 1NCQA 4P9XA 3J8F1 4WVMA 3LOIA 3RPQA 1PM7A 3ASIA 3DL3A 3D82A 4U36A 3LDKA 3O1MA 4L2NA 5F8PA 3ZYJB 2Z42A 5F3IA 4M3CE 4CP1A 4MXWB 1ZZ8A 2CGPA 4JGZC 4XJZA 3D4KA 4KU7A 4FSJA 1H9PA 1QJFA 1PO23 4GH4C 3VKMA 5FY4A 2ARCA 2O0OA 2ZGOA 1S4CA 1HRI2 2CWMA 5IVEA 1WZXA 1IHMA 1PIV1 4LK6A 4XFHA 3ZDSA 1VP6A 2RJLA 2XJUA 4COWA 1D4VB 1F5JA 4YRDA 5JVVA 5FZ7A 1NY72 1ZA7A 4ZU4A 2IFWA 3NAPC 3ZM8A 5AC93 5EZWA 3B69A 2ZGUA 4LR4A 4A3ZA 4ISRA 3N9QA 2PQSA 4MOAA 4BCUA 5K0UA 4Y1UA 3I2JA 4Y33A 2VW1A 3RJRA 1ZBA1 2DU0A 3JD73 4RS5C 2XJTA 1ZRCA 4Q8LA 1VBA1 1AX1A 3VHNA 4FO9A 5FZ4A 2WR9A 3UGFA 5D2AA 1AR82 2VECA 1ULGA 1S0JA 1YYNA 5CFCA 3WINE 1LHVA 2N7GA 4JRLA 3WG4A 1RUE3 2SBAA 1S0GA 2W1QA 2ZGSA 1K42A 1XC6A 3N9OA 1GP4A 3AL6A 1H2MA 4QB1A 5A7NA 2OVUA 1FMD2 4GA9A 5FPZA 2K0GA 1AR92 2GU9A 3ZMNA 1LOEA 5A3LA 2WZPP 5AVPA 5E8AA 4W65A 4IE0A 3S6PA 1RHI2 3JU9A 2WAAA 4YZ2A 3BTXA 4DNYA 1KQRA 5DABA 4R8HA 4ZHNA 1CWPA 3Q8FA 4N8MA 5BV6A 2UURA 4YFWA 4XVHA 4GMP1 1FV2A 2D40A 3PMEA 1NCRA 1WLWA 1WW4A 2W47A 3ZMOA 2XQXA 3WP5A 3KV9A 2GMMA 3BIWE 4QKDA 1DQ0A 3V56A 3NNFA 4R52A 2C9AA 3BI3A 5KHKA 2UY8A 1JOBA 3MIGA 4QXKA 4RFRB 3S5QA 4XJ9A 5FZ9A 5LB6A 1DQ5A 4AEKA 4XFGA 4PIZA 5HCHA 5H9PA 4AI8A 2PAMA 4CPBD 1QQP1 3K75B 2DDUA 1MS1A 4CUCA 2YDEA 4NRMA 2V5YA 4AF9A 5GZDA 4MXWA 2D43A 5FOJB 2A3WA 5CIRA 1KFXL 1Q8VA 2A6XA 2DVBA 3MIFA 1ZYBA 3T1MA 2P1BA 3GBWA 5KC5A 2ZEWA 4XFBA 2PHTA 4XFIA 1NXD1 4JKMA 1CPNA 3ZYBA 5GKAC 4Z8BA 3GHMA 4N53B 2ZHKA 3GBGA 5DAXA 5J36A 4LNVA 3THDA 1L7RA 1BBT2 1C28A 1GICA 1GOGA 2VMIA 3O14A 3ORJA 3HMYA 4LBJA 1UYYA 1V6OA 2HBTA 2XL7A 2VTXJ 3HQRA 3VV1A 2O1QA 2Y6GA 3HIFA 4LKSA 2AGSA 3HBKA 4XIKA 4YYOA 3RWNA 3SMHA 2E6VA 1CAWB 4NIDA 1RXGA 1WMXA 2C4XA 5C3QA 5CG9A 2D7FA 2GC3A 3W5MA 1GQGA 3TB0A 1J59A 4F3JA 4HPKA 4IV1C 4NWWA 2ZJCA 2Q8DA 1RMU1 2TUNA 3AKPA 1DG6A 1MS4A 1EV12 1S1AA 4ITCA 5BNPC 5JLVA 1UW8A 1JU3A 5A7WB 5FO9B 4Z2WA 4Q0SA 4LEJA 1H0BA 4Y5Z0 5I8TA 4I09A 3UYJA 3MIDA 1H6YA 3T2TA 2XKPA 4C90A 3I59B 4BISA 4R9DA 3WW4A 5C4WC 4JDNA 3O0VA 4Q29A 1QJX3 4NIGA 4S2HA 2GAUA 2F17A 4GB32 1XSQA 2IXLA 1O4TA 1IKQA 1POV1 3I2FA 1SMVA 2CYFA 2D3RA 5EV7A 3ZO0B 4LQRA 2PN5A 2P17A 4AOCA 4K6BA 1YFUA 4NO4A 4EWEA 4JC1A 3OYWA 1K12A 3B93A 3ZFEB 3T2OA 1BMV1 1RUD3 2A6VA 1GNYA 4AI3A 1C5IA 5FY0A 4AQSA 5LK7B 3BYWA 3K2OA 4LPLA 1VALA 1O3RA 3NV2A 2XDVA 3B00A 1VBC3 4CCNA 1JH5A 1IZ3A 5C6CA 4FI9A 4FPHA 1AYN2 1MZFA 3FL7A 4WM8C 2QQNA 2XKOA 3WZ1A 3Q8CA 2JDAA 2RS51 4PI2A 2ADEA 2AH2A 1OVPA 1DBNA 2P37A 3AKQA 2YBPA 3AC0A 3GZAA 1SHWB 5FYTA 5IUQA 2XWBB 4J25A 1UX6A 1OLMA 5FYSA 1ENQA 2XLGA 1SFPA 3B01A 2Z79A 2IWGB 2PELA 2D6LX 1IS3A 2F4PA 1MS8A 3BPZA 3TNQA 1HJGA 3J7LA 3R4SA 4IV3C 2ZS6B 3UT0A 1RUOA 3ILRA 1NE4A 2WT1A 1DDLA 1N1TA 5FJKA 4BB3A 2XWJB 4Y1ZA 2AACA 3TWIA 3U11A 4N7IA 3MLKA 4B3NA 1V6MA 2WUHA 4FCAA 4QX5A 1PX4A 1V70A 4XTMA 2HWF3 1HIXA 2DUQA 3WP4A 2A6WA 4M3CA 4UBGA 2EXIA 3AJZA 2CV6A 3V0BB 1CAWA 4XEZA 2FDIA 2VL4A 3K48A 5FK8A 3CIHA 4LLFA 1V6KA 1S0IA 1W6MB 2XVGA 3EYPA 3RRDA 5T5OA 3UGGA 1UXZA 2O8QA 4AHWA 5L9VA 4QKBA 5FP7A 3SKVA 4HK9A 4P9GA 2DBNA 1J58A 5JOYA 3OEAA 1RUJ1 2P3KA 4RHV2 1N3QA 5F5AA 2RJ2A 3O1SA 5A7WA 2QQPA 1ODNA 2LW8A 2VOKA 3WP6A 4JVAA 2UWAA 3PHMA 2GC0A 4HKLA 5FPLA 1LKNA 2R043 4QPGA 3VBHC 3M4FA 1ASJ1 3E1F1 5FTTC 1L7QA 1LODA 2VUCA 1GP5A 2YPDA 5T5PA 1GLHA 3I59A 3VBSC 2QQLA 4UW6A 5I0SA 1JYCA 2ZHNA 1GU3A 3H8RA 1AYM2 3LGRA 3VZJA 2WAOA 3MF6A 3O0XA 2E51A 4GALA 1UF2C 4Q4Y1 5FLHA 4QPIB 4TZDA 3F95A 3NL1A 1O5LA 5EHDA 1MVQA 5I0TA 1VAKA 1OH3A 2A71A 4AVBA 1HDKA 1UY4A 3BALA 5GM0A 3M7AA 1QJY3 1XE0A 3D5OA 4CEYB 4FFGA 2ID4A 3ZFEA 2BGOA 2D3SA 1JYVA 1C1LA 1YJLA 1FNZA 1QKQA 4XUQA 5FUIA 3MW3A 3BU0A 3T09A 4KBBA 4Q0UA 3MW4A 1JZ2A 2DCTA 2Y34A 1PO12 3CEWA 5B4XA 4LHSA 4A45A 2QQMA 4FAHA 1GOHA 4BLJA 1QJZA 3THPA 1S2KA 4YZ1A 1OF3A 3OUIA 1OQDA 2EIBA 1AL22 2X8KA 4WM7A 1AR62 4WZFA 3KM5A 3ZYHA 4QGMA 3O1RA 4FFFA 5IJRA 1DGRN 3SH4A 1LESA 4YVSB 4BQYA 4XDPA 5CU1A 5LRSA 1IG0A 4MV2A 1EAH2 3WDYA 1K45A 4Y1VA 1MR5A 2E26A 2VBBA 1BEV3 2VC9A 2Z5WA 1SFYA 2VMDA 3RFRA 5C8CB 5L19A 1BQPA 3O7OA 5AFEA 3U10A 4UOJA 3DV8A 2C5DA 2JICA 2BP6A 2HWD3 3A21A 1U0AA 3LKJA 3HNBM 1AXKA 1Z7S2 2HWB1 3MF9A 4LBLA 3T4VA 5K8SA 5T52A 3CBNA 3ZOIA 1UPSA 4P9LA 4R9CA 2QQOA 3KSCA 3SLIA 3V0BA 4YFZA 5IAVA 4CU7A 2J1SA 3QH7A 2ZGTA 4O65A 3SKJE 1WGPA 1UXXX 1MEC1 1PZ9A 4KWLA 1SLAA 3TN92 1W6MA 4NE9A 1OD3A 1TE1B 3B9CA 5D1IA 2Y6JA 1AXZA 2XGXA 1GZWB 3INAA 5FIXA 4XBQA 3IT8A 5T54A 2V09A 3B02A 1O3SA 1TNRA 4YM0A 3C7GA 2VOTA 1DLLA 2B4KA 4IGPA 1JZ3A 5T50A 1JUIA 2YG0A 2GN3A 3H7JA 1XBFA 5JR2A 1IS5A 3TEWA 3WW1A 3FWEA 4AAPA 1NX9A 2Y6FA 4QX8A 3CJIB 1RUF1 1UYZA 3Q9OA 4UFHA 4ZXEA 5CAZA 4YLZA 3AZYA 4YG0A 4D6QA 2C9KA 4QQLA 2JDNA 2ILMA 5C33A 2FDKA 2A7AA 4NIAA 4AQ6A 1IKPA 3N7MA 1YFWA 4C91A 4A3XA 4QPIA 3M1HA 5IVFA 1W6OB 4Z1VA 3NV3A 4R9BA 3BUCA 2WS91 1OOPC 5K4LA 2BFUS 1ACCA 4CEYA 4EN9B 2VTXA 3APBA 4DINB 3CZUA 4XJWA 5FXXA 5IW0A 2VBPA 4KMQA 1VPHA 4Q4V2 5DAPA 2MEV2 1Q8SA 1YIPA 3BTAA 1SQ4A 2PYTA 3HNYM 3TNPB 3HT2A 3AM2A 1TME2 3PJQA 5C3RA 2VTFA 4I30A 4CEWB 3LSEA 1RUC3 1IPSA 4JGYC 2VGDA 3LD8A 2XUEA 1JZ7A 1PK6C 2VNRA 3KB5A 2G9GA 4N90A 1V0AA 3HAGA 2WO7A 3CNAA 4M01A 5ABJC 5FMOL 1W9FA 5FXZA 5FOBB 3U07A 1W2NA 4FOQA 1UMIA 4XFAA 4YVSA 3WNMA 4PDWB 5FZEA 4D7TA 1ZRDA 1AL0G 2Q30A 3I97A 3N7KA 4AI0A 2ZCWA 4FPJA 5BPXA 4CCMA 3RZZA 5C8CA 3CJXA 3GJAA 1PVC1 1FOD1 4XFCA 2RDQA 1RUI2 1X9TA 4CRQA 1M4WA 4OULA 4XDQA 2GNDA 1DGRA 3SITA 4E2GA 5I0RA 3U78A 3K77A 1JODA 4J6GA 1TMF2 3CL1A 1W04A 1X82A 2R062 4DMIA 3VBFC 2YYOA 1COV2 1UOJA 5C3OA 2ZA9A 4JRAA 3N36A 1MS0A 4AVTA 4C8DA 5LBEA 3POYA 5FZCA 2Q5TA 3CU7A 5KXBA 1A78A 1QJU3 1RUG3 3J7MA 1FPN3 2D6OX 4DFSA 4OYUA 2H6CA 3DGTA 1C8M2 3HQUA 4KI5M 1W03A 2P2KA 1GZWA 4CDQC 3RS6A 2VQAA 1WCQA 3VBUB 4CP9B 2Z2SB 4HT1T 4W50A 1PGL1 3GXUA 3VKOA 4ASKA 1PO21 2BGPA 4OUMA 2KD7A 4B29A 1GANA 4IEOA 3H42B 2R072 2G9FA 3ZX7A 4PIYA 1VBD2 2VNOA 2VVDA 1V00A 2PTMA 4HOOA 3BPSA 3PU3A 1PVXA 1Y9GA 1ZBE3 2CGOA 3GYDA 3VZOA 5A70A 3DYMA 1TNFA 1HRV2 3AYDA 5FAXA 4CCCA 3J8F2 5CKQA 5FPBA 5AC91 3GCWA 2BNMA 3RJ2X 5J09A 1DHKB 4E27A 1W6OA 3ZFGC 3WQ1A 4A7YA 2WFF3 4E2SA 2W5FA 4DB5A 3JBG3 2R1BA 4N43C 4KGGA 1V9U3 2ENRA 5ACA3 1NA1B 4XUOA 2GDFA 2V72A 3JD71 3MIBA 4XPVA 2A70A 4QX7A 4P14A 4CDWC 3VDDC 5DUVA 3VDAA 3MIHA 1DU3D 2CY6A 5FUNA 5A7PA 4OUSA 1PIV2 1PZ8A 2D6MA 1AHSA 2BGCA 4P9JA 1RVF3 1RUE1 4CEWA 2FDFA 4RFT0 3M3QA 4FFHA 1CZVA 1VBE3 2RV9A 1LHOA 2E9QA 4F7ZA 4AGGA 4DZGA 1RUH3 2C26A 5GLVA 1G8WA 2EVXA 1S0BA 3CO2A 4JTOA 2D6KA 2HYKA 1QH7A 1SCRA 2UY9A 4PDWA 2W08A 3AB0A 1ZBA2 3C7FA 1H8TC 3WNLA 2WNUB 1VBA2 1W2UA 2UU8A 1PMJX 2XOMA 5D21A 4Y20B 3IB3A 4OHZA 3WLUA 3A22A 2QBXA 5BNNC 1RXFA 1NZIA 1NCQC 4MGSA 1BVVA 1ULEA 5FMOS 4NAOA 1SLLA 2JD4A 2V73A 2WZR3 1W8WA 5T5LA 4CCEA 5C9AB 2L9LA 2C24A 5LASA 4P5YA 3OBAA 2GC1A 4Q1RA 1H1IA 3MICA 1BCXA 1K5MC 4L8QA 4A42A 5JMOA 2FBEA 3AP4A 3N9LA 3C2UA 4Q0PA 2QZ2A 5I91A 3JQWA 1WBLA 3E6DA 1ZVFA 1IOAA 3LPGA 5FZ1A 1G9CA 1CZSA 1WD4A 3MDPA 5A6ZA 4E4DX 2DCKA 2ZZQA 4RGGA 3VBUA 4CP9A 2BW8A 1R093 5FO8B 5JWPA 2WC2A 3NNJA 5CA6A 5CYYA 2XLAA 1NE6A 4AGVA 3THCA 4B8EA 5A3OA 3AKTA 3ENRA 3WHTA 4C1XA 2CHHA 4P9YA 1DQ2A 5DAQA 3K3NA 3SEEA 2AZ5A 1VMFA 4WVMB 4KGQA 5K0UC 5FZBA 4JV4A 5FBZA 3LF7A 3K3OA 2VMEA 3CDZB 4P08A 4Y22B 2BNNA 2QQJA 5LBCA 1I1EA 3KVBA 1AR73 1OD5A 4CPBA 1DCSA 1QQP2 5A3WA 1L3JA 4CTEA 1UQXA
chains in the Genus database with same CATH topology
1G9DA 4A7KA 2XVLA 3KQRA 5LEJA 2WSVA 1W6NB 4COYA 1XE8A 2HWE3 1HQNA 1QDOA 4XQWA 3EJKA 2JXAA 1REDA 1WLDA 1H1MA 2ZAAA 3J9SA 1UKGA 1KXGA 2JG9B 3PJYA 1OI6A 1Z0HA 2GZWA 4FPCA 5GZCA 1NZCA 1OKQA 4CDXB 4AHYA 2WA3A 4ONUA 1JW6A 2BPA2 1NCRC 4XZPA 4AVVA 3WDUA 1QJX1 5B2GB 3AYEA 4LBQD 1LOFA 1QHDA 2E7AA 4NPRA 4Y20A 5E16A 1FNYA 3FLTA 1RMU2 2RS33 1Q8PA 2FZ1A 1UD1A 3D0JA 1WD3A 4B7KA 4B4PA 3NSTA 3FFZA 1LGNA 2B9UA 1URXA 2A5ZA 4YW1A 4BMBA 2TBVA 1QNYA 1RUD1 5C9AA 3R05A 3DN7A 1JHNA 3QACA 3P3NA 3DUIA 4PLMA 2WNEA 1VBC1 2ZHLA 1R083 4HZFA 1PHMA 4FPEA 4W6WA 4J1XA 2VH9A 1SBDA 2K9ZA 2AR6A 2ZMNA 2ZBJA 4Q27A 4S2FA 1AZDA 1CIWA 1AF9A 1W39A 1VLNA 1YUDA 5KBFA 1SACA 4AQ2A 4EN7B 1G86A 5L7OB 4Y22A 3OD0A 2QUOA 2VMGA 2HWF1 3ZYIB 2OUHA 5JOZA 2RS52 1QDCA 4AK3A 5K7PA 3LOBA 4MSVA 1KDKA 1UPIA 2EAKA 4MGYE 2W39A 5BNOB 4FPLA 3H1YA 5F6KA 1W6NA 3NWKA 1UU4A 4E4SA 3ZVXA 4GULA 3M2MA 1O3QA 5F1RA 2VOWA 3LAGA 1H1AA 5EYXA 1DZQA 4YW2A 2JG9A 1QMJA 1EP0A 4EWDA 5D8AC 2B45X 4QMAA 2R041 5IK8A 2RR13 4CDXA 1N47A 5CADA 1GQHA 3BOWA 1ZZCA 4HPKB 4AE2A 3VN4A 4XJUA 3OPZA 4Q4X3 4I01A 3BCWA 3EQEA 4OLLA 2VULA 4X8NA 4COZA 3E6BA 1T6GC 4LO7A 4LULA 3RSJA 1X8MA 2WT0A 1LULA 1YJKA 1NQJA 1RJ7A 3JCIA 1RUJ2 4PIXA 4AFBA 1QJY1 1CVNA 3VKFC 4AXOA 2XH6A 1KITA 3AMHA 4BA6A 3JB8A 3VBOB 2R16A 2X5IB 3W58A 1ASJ2 3EO6A 2MHFA 5AVAA 1DZRA 2G4IA 2ZZJA 2IFRA 5GJ6A 4GH4B 4XOGA 4QM9A 3WX5A 4TSVA 4DPNA 2DTWA 5SV5A 4Q4Y2 1DYPA 4S2DA 5HCFA 3OYWB 1TQ5A 2JDZA 4HVRA 2EXHA 4KG0A 4N53C 4DY5A 3SH3A 3GHNA 3AZXA 3G7DA 4QGNA 2HWC3 1BEV1 3FHIB 4XQDA 2BUKA 3TRSB 1X36A 4PCRA 2RM23 4LT5A 1QGLA 1WCDJ 4YVWA 2HWD1 5L7OA 2XJQA 5IK4A 2P3IA 2ZPXA 5F6LB 1V6LA 1S0CA 3LSDA 4D7SA 2YHJA 1DQ1A 4XJAA 3PVNA 4LE3A 4HVOA 3SHRA 4K1YA 3NKTA 5BNOA 4NOTA 4X6RB 1Y9QA 4KQ7A 1MS9A 3NKGA 2BBVA 3WXPA 2JECA 3KMHA 4LE4A 5BXXA 2GALA 4AFDA 2IXKA 3HR9A 3VHPA 4M3CB 4AYUA 2HWB2 1EPWA 4N9IA 1C1FA 1HXS3 2EA7A 2RS13 2VMHA 4L11A 3MLJA 1A8MA 4RA0A 3ZFEC 5EWSA 4AFMA 4MH0E 1MEC2 3IWZA 3WW3A 3H0OA 4DRRA 2B46X 1WMDA 4WZCA 3ZIWA 2R49A 5GLZA 1O5UA 3IKWA 3AP7A 5IK7A 5E89A 4LA3A 3ZFFB 1YO8A 3RNSA 4QPGB 3E5UA 3PNAA 1H8VA 4FVVA 1MVEA 1GFF2 2A6ZA 1ND2C 3VBOA 1U5YA 2I74A 2X5IA 4UXAA 1RUF2 4K9SA 1IS6A 3QLQA 1RUC1 4KWJA 4ZXKA 4GH4A 4YNIA 3KS7A 5GLWA 3S0MA 3BOPA 1NLSA 3FUOA 2ZKLA 1F31A 3NJZA 4LUMA 4YZ4A 1FI2A 3FX3A 5JZGC 4Q2FA 1J3QA 2RMU3 2ZTNA 3FFQA 4OI2A 2WS92 3OGJA 1Y43B 2OYZA 3MFAA 4HMZA 4R4XA 4XXAA 1EYBA 3B94A 4FQ4A 3ZYPA 5JIAA 2DCJA 1QOSA 3ZSEA 3PVEA 4N9HA 4FBFA 3LA3A 1Q56A 4UBHA 1H4HA 1CPMA 1VIWB 4IERA 4WM7B 1W6PA 4D7YA 2WIIB 1FXZA 2R0FA 2ZOEB 4NHMA 2ZHMA 3WDWA 4R4ZA 3MEPA 5HBAA 1BMV1 3ACLA 4Y26A 1QJU1 1RUG1 1FPN1 3OY8B 4KWKA 1Z78A 3VZNA 3MPPG 4AEMA 1BKZA 2R32A 2PLV3 4K40A 4NN0A 4FOWA 1PVC2 1FOD2 5C4WB 3FMGA 2EALA 1C3HA 4BHPA 1ND3B 1VRH3 1D0GA 1XNDA 4QPIC 5CB7A 1ZZ9A 1LEMA 2YV8A 1XQNA 1J3RA 1ZBE1 1OFSA 4OVEA 1OLQA 4CEYC 4FAGA 1NOVA 1M06G 2WT2A 1YHFA 3FE5A 2XG3A 4M3CF 4ORFA 1A6CA 2RE9A 2WFF1 4AGRA 3JBG1 3ZFFA 2ARXA 1V9U1 4DOUA 5ACA1 2A3YA 1E57A 2BFUL 2HEWF 1PGL2 1PO22 1HKDA 3VHRA 1U5XA 5LRRA 4UW3A 5A33B 1A3KA 3VL8A 2CL2A 5FDBA 3M3EA 1RVF1 5DDJ3 4U2AA 2YROA 1GNHA 1VBE1 2PA7A 3H8UA 4IV3B 2Y0IA 3KD4A 1QXJA 4QQ2A 1KDMA 4H7LA 4EN0A 5AC92 4P9IA 4BZ4A 1RUH1 2XBO3 3NVCA 1SLIA 5GALA 2HEYF 4RR3B 2E7TA 3EXUA 4A7ZA 4H3WA 1X7NA 3AYAA 3E6CC 2E63A 2BEOA 4H14A 4Z82A 3JD72 4ATFA 4DXZA 1WW6A 2NMNA 4HL0A 4NVPA 3OCPA 3MIEA 1RUE2 3UJQA 4Q4W3 2WZR1 3AXDA 2IC1A 4COVA 4E9KA 3WDTA 3VUOA 2DUOA 4BM8A 2PHXA 4FT8A 3WUDA 5J3UA 2NMOA 5BNPA 2ERFA 2I07B 2VW0A 1R1A3 3OY8A 1W6QB 1Y3TA 2XJPA 3C3VA 5FLIA 3CJIC 2D6PA 1CX4A 2WQ4A 1LTEA 1R091 5C4WA 5DZGA 2ZAHA 1LHUA 1REEA 4KNCA 3LCPA 5FQ0B 1ND3A 1TEIA 1NYWA 1CJPA 3GALA 2PFWA 1Y7BA 4RD7A 1HQLA 5E1RA 4HN1A 4E2QA 1IPKA 2IXCA 3H3ZA 4PQ9A 4XETA 2ZACA 4HK8A 3RDIA 1FV3A 2HKXA 1H2LA 1HV1A 1CAXB 2JG8B 5FFOC 4C1WA 1AR71 3WW2A 1VAMA 4GKYA 2BYVE 1O91A 4DRVA 1NLRA 5IK5A 2B8MA 2F6BA 3RYRA 4RQPC 1FYUA 2HWE1 2DV9A 5A33A 3H9AA 1VB4A 1AJKA 3MPBA 2Q1MA 4NR1A 4KG8A 1LB2A 1JYIA 2ZKNA 5E88A 2Q1ZB 3ELNA 2QCSB 1XE7A 4LBMA 3NO8A 4PDWC 3UV9A 4BPZA 4I3GA 4CDUB 4IV3A 1V6IA 3IDBB 4ATEA 2XJRA 3SCHA 4ASLA 3PVOA 3AKRA 3AXEA 5FLJA 1DGLA 1QF3A 3G6JB 4RR3A 1WCSA 2GNBA 5L73A 1VBB3 5KHHA 4LO4B 5CNAA 2XHKA 2MPFA 1QOOA 2YGLA 1DQ6A 1LU1A 3FC0A 4OFGA 2QKDA 4Q26A 4XMAA 2PHFA 2RS31 1ALYA 3PLQA 2KXLA 5JDBA 1ENRA 4FTEA 3HT1A 1ZZ7A 3ATGA 3WDXA 3UL2A 3RMYA 4HETA 1RB8G 2WJSA 1ZA4A 2ZGPA 3OBRA 4LHKA 5JAXA 1GYKA 2P3JA 5F9TA 1R081 4AEDB 3A0KA 1QJX2 1W6QA 3VBHA 3HWJA 2YZ4A 1D4M3 2YMZA 1IPJA 4MVTA 2DWRA 5FQ0A 5TSWA 1SLBA 3H50A 3NV4A 2A6YA 1RUD2 2QZ3A 2EXKA 3NV1A 3MZHA 4I3PA 4WVWA 3M3CA 2A75A 4AHXA 1NA1C 1VBC2 3S7EA 1Q43A 1CESA 1CAXA 2JG8A 3FJSA 4LHLA 5H9RA 2DF7A 2Q4SA 2VNGA 1GBGA 2EXJA 4XBNA 1HRI3 2OW4A 4L92A 2NYYA 3ZN4A 3O12A 2ZX3A 4FPFA 1F9KA 4B4QA 1ENXA 1GZ9A 2ZGKA 1UAIA 2E7QA 2VPVA 4FXGB 4MYEA 3ZXLA 3WG3A 5DUXA 1J1LA 3IIAA 1OA2A 4L99A 1UZYA 4RSUA 4CDUA 2WNUC 2P34A 2JKBA 2HWF2 4AVSA 2RR11 1UL9A 5AFBA 1W0PA 1BJQA 1UN1A 2ZX0A 3DPRC 1ZRRA 3HN1A 4OZXA 1GNZA 1AR83 1KJLA 1YFYA 2Q8OA 1GKBA 4Q4X1 1H9WA 1S0FA 3ZSKA 4AI1A 4MGIE 2IXIA 3ZIXA 2QE3A 1FMD3 4AVCA 1AR93 1EPZA 3NW4A 1SDWA 1GZCA 1RTVA 1KFUL 4EN8B 1LOCA 1RHI3 2R042 3X29B 4CDQB 3AK0A 4GIQA 4BE3A 4AG4A 2PAKA 4HBNA 4AEDA 1U12A 2JE9A 4AFAA 1MQTB 3MI8A 1OSGA 1JOJA 3VL9A 2EIGA 3MYXA 1G9AA 2YXSA 4YGCA 3OD4A 2AENA 1JBCA 1QJY2 3LB9A 3POSA 5JOWA 3D0SA 3KT1A 3VBRB 2UYAA 2HWC1 4EN6B 4YARA 3HD8B 4HN0A 3URFA 5GZFA 4QU2A 4CZSA 3ES4A 2RM21 3R4DB 4JDOA 3USSA 5JIUA 1OOPA 5KHJA 3MGUA 1W0OA 5JSOA 4ZU7A 4CDWB 3VDDB 3UKTA 3U0ZA 3RMXA 3ZSLA 2VUJA 1RJ8A 1RL3A 3GBFA 1BYHA 4OI0A 2DTYA 3E97A 4HSJA 2PHWA 2JG9C 4DY3A 2X29A 2SLIA 1V6JA 1BEV2 4CDXC 1XNBA 3FLRA 1Q5OA 1BBT3 1CJDA 2XUMA 3VZKA 2D6NA 4BOWA 4D69A 1LENA 2ZMKA 2HWD2 1U5IA 4LO8A 4N7UA 2WNVB 1AVBA 4QT6A 2YUEA 5CFCC 1G6NA 4YW3A 1HXS1 4QGLA 2D5FA 1AX0A 1CAVB 4PF5A 1EY2A 1QXRA 1SFNA 2RS11 4QQOA 5C8WA 4ES9A 1S55A 1YNAA 4P5HA 4XF1A 3ETQA 4BMEA 1N3OA 1LCLA 1EV13 3ST7A 2YGMA 1LR5A 2BQPA 5JI9A 5KXCA 5BUVA 1RC6A 1LRHA 1CONA 1AX2A 3AP5A 4R9AA 3OTFA 5T55A 1OA4A 4CYDA 3IDEA 2QDNA 5JMCA 4QQPA 2UYBA 1XNCA 1DF0A 4AFCA 2PHDA 4CDQA 1OLRA 4GB33 1JUHA 4H7MA 3USUB 2NM1A 1DQ4A 4GMP0 4AW7A 3OJBA 3AZZA 1MQTA 4YG3A 4PLOA 1GR3A 1NQDA 2RMU1 4GQ7A 4L97A 4Y24A 2FQPA 3VBRA 2WSUA 1QU0A 1AYN3 1WUVA 3GZUC 1RINA 1R1ZA 2A73B 2JE7A 3SXWA 5JCTA 5BNOC 1VAVA 3SNMA 2XJSA 1RUC2 3B9IA 2GH8A 3M70A 2OPKA 1ZM1A 3GNEA 3JZVA 3VDDA 3ZN5A 4CDWA 1ZREA 4JQRA 4FPGA 2PHLA 2W68A 3AMMA 5JPMB 1GSLA 2JX9A 2OZ6A 1DFQA 2I2SA 1A8DA 1UZZA 4O9GA 4UW4A 3WP3A 1Q8QA 2B42B 2R0HA 4YVWB 3WV6A 2R1DA 2PLV1 1ZZBA 3S30A 4K7JA 1UIJA 1B35B 1YI7A 1C57A 5GLUA 2WNVA 2JJ6A 1VRH1 4AQTA 2ZMLA 3M3OA 4E4ZA 1WW7A 1H2KA 1BMV2 3VKLA 1CAVA 4XF9A 5FRAA 2NQYA 1ENSA 1QJU2 1RUG2 1O4ZA 1FPN2 4RHV3 3ZXFA 3VBOC 1I3HA 5T3NA 2X5IC 4YW4A 1K5MA 3IMNA 2ZGLA 2QVSB 1J3PA 5T5JA 4IL7A 2FHRA 3D6EA 4LUKA 4WV8A 5EFUA 4ISQA 4OHXA 4LTAA 5CFDB 3PMSA 1AYM3 1ZNPA 2DYCA 1CAUB 3V65A 1POV0 1SBEA 1UU6A 1ZBE2 2PQQA 2NN8A 3HBZA 3PTYA 5DDJ1 5DG2A 3USUA 5F5QA 3ECQA 3QOPA 4MXVA 4XHBA 3N3HA 4I0AA 2ET1A 3WG1A 2XBO1 3L2HA 2WFF2 4KU8A 5BYNA 2H6BA 1IGOA 3FBMA 3JBG2 1V9U2 5ACA2 2VOXA 4ASMB 1UIKA 3VHOA 1YRZA 3CLPA 4JGZB 4EROA 1HLCA 4XILA 1PO13 2FMDA 3QD6A 1YIFA 5FCCA 1UMZA 2CAUA 3D8CA 4BWOA 3VZMA 1LOAA 4G9SB 2DFBA 1AL23 1AR63 2B5HA 2CWSA 5JSPA 1G9BA 1RVF2 2NZ9A 5JI7A 3ZXAC 4Q4W1 2H0BA 3QBQA 3RI9A 3ZSJA 3LA7A 1VBE2 3AX4A 5EXOA 1EAH3 1RUH2 2HJIA 4FXKB 1RITA 4Q0QA 3NAPB 2CNAA 2EF6A 3R6SA 3DF0A 5JPNB 5J7MA 1R1A1 1N1SA 3ES1A 2VUAA 1OMIA 4XF4A 5D8AB 2E53A 3ZYGA 3ZPYA 2DVDA 2PAEA 1WCKA 3ZXDA 1W6PB 4LHNA 4RS5B 1Z7S3 2WL1A 1MACA 4DQAA 3AFKA 2DVAA 1B35A 5KXEA 4YM1A 5FPXA 3KGLA 3LA2A 4YGDA 4AVAA 5HI0A 2WZR2 5H9QA 2VY0A 2X53S