1ULFA

Cgl2 in complex with blood group a tetrasaccharide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords galectin-2
publication title Structure and Functional Analysis of the Fungal Galectin CGL2
pubmed doi rcsb
source organism Coprinopsis cinerea
total genus 38
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ulfA00
1Z78A 1APNA 1LHNA 5DXDA 2JECA 3ZSJA 3WV6A 1VLNA 4YM0A 2OUHA 3RRDA 1GANA 3ZVXA 3OY8A 2EXJA 4F83A 1PZ9A 3N35A 2WQZC 2D6PA 1I1EA 2A70A 2AH2A 3MEPA 2DVFA 2W52A 1W6PA 2ZMNA 4K1ZA 1DZQA 2ZGNA 2A5ZA 3N7KA 1XQNA 4AVSA 4W65A 1ONAA 2A7AA 4MYEA 2NYYA 1S0JA 4U2AA 5IK7A 5DG1A 2H0BA 3RMXA 3B3QE 5AVAA 3A0KA 1UAIA 5T54A 4CTEA 4WVWA 1S0DA 5SV8A 1UMZA 5F5QA 3FLTA 3IPVB 2DVAA 2YZ4A 5HCBA 1S0CA 5JDBA 4FPLA 5JLVA 1C1LA 3RMYA 3T2TA 2UU8A 5F9TA 1MS8A 3OBTA 1HDKA 3WOGA 1VAVA 4Y22B 1ENQA 3INAA 3U4XA 3ILFA 1W6QB 4FOWA 4U36A 4LBKA 3VKNA 3W58A 4BM8A 1N1VA 1YI7A 3MW3A 4IQPA 1CR7A 1HKDA 2ZBJA 4XE9A 1ULCA 1FX5A 4YGCA 4UW6A 4Y22A 3AP6A 5DZEA 1MACA 4XJWA 2XB6C 2I2SA 4GALA 4HANA 4XZPA 1LEDA 1CVNA 4M3CE 2EXKA 2ZGOA 1WW7A 3B69A 3IN9A 2DWRA 1V6KA 1LULA 3FLPA 1NLSA 2ZHMA 1R1ZA 4Y24A 4YGBA 4Z8BA 2R0HA 3VV1A 3ZYRA 3D6EA 2ERFA 3N7MA 3PMEA 1V6LA 1DQ1A 1UN1A 2CY6A 3TAYA 2YROA 1VIWB 4XHBA 2P3KA 3UK9A 2P3JA 3WG3A 4Q1RA 4K20A 2JJ6A 1BXHA 4CZSA 3AJYA 1JHNA 1W6NA 1W0PA 3BOPA 4WV8A 1DFQA 5T5PA 2DYCA 1LOEA 1D0HA 5HCAA 3AK0A 5FRAA 1JBCA 2UWBA 2ARXA 2D6MA 1MR5A 3IM0A 2JKBA 3ILRA 4AVVA 2EIGA 2VH9A 1SCRA 1W6MA 1OKQA 3C2UA 3DGTA 1G8WA 2ZGSA 4FOQA 4KBBA 3A4UA 1JN2P 2D6NA 3WUCA 5EXOA 4XIKA 2VW1A 3RQ0A 1MS3A 1GNZA 2ZGQA 1LOFA 3OPZA 1BQPA 1LHOA 3AZZA 5HCFA 4AGVA 5E89A 4YGDA 1SBFA 1N1TA 5H9PA 2GMMA 3LSEA 3JUUA 4XJ8A 3WCSA 2DUOA 1G9FA 1AXKA 1BYHA 1Q8OA 4K1YA 2GN7A 2R0FA 1GZ9A 2EF6A 3MW4A 3GNEA 1N47A 4UW5A 4RL7A 5GZEA 1URXA 2ZGMA 1AX1A 2VY0A 5E8AA 1Q56A 3AFKA 4XJZA 1NXD1 4XHXA 3VKOA 3SH4A 1AX2A 2BQPA 1IKPA 4PBOA 4Y20A 4XTMA 5GLTA 1UPSA 1MVQA 4FPYA 4WZFA 1GZWB 2CYFA 1C1FA 4JCKA 1DIWA 1MS9A 2DU0A 1SACA 4YZ5A 3AYAA 4ITCA 2W08A 5T50A 1LGBA 4WVVA 1GZWA 1O4YA 4Y1YA 4AWDA 4OZXA 3WHUA 1A8DA 3UL2A 3NV2A 5EYXA 5EYYA 2KM2A 1QNWA 4ZKTB 5CB7A 4Y1ZA 2EAKA 4Y1XA 1LHUA 2UURA 3ATGA 3NV1A 1V6OA 5DUXA 4FPKA 4ZXKA 3VKMA 3SNMA 4AGGA 5CA6A 2JDZA 3WLUA 2PHXA 3ZXLA 3D4KA 1Q8PA 4FQ4A 3OJBA 1SBDA 4YG6A 1LOFC 1GICA 3I8TA 3AYCA 1V6NA 5CAZA 2ZHNA 1SLAA 2EXIA 3SISA 5GLVA 4ATFA 1UL9A 1SFYA 2P34A 1X50A 1CONA 1S0IA 4XTPA 2A3YA 1GBGA 4Q2FA 2GNMA 3LSDA 2A6WA 3M3CA 3NV4A 3WVJA 1SLIA 1QF3A 1LODA 2E7QA 4YG3A 2TEPA 2R1BA 3OBRA 1G9CA 1CN1A 1SLLA 2ZHLA 3WG2A 4XJUA 4ASMB 5GZCA 1ULDA 1TEIA 2SLIA 3POWA 3PVOA 5T55A 1LHVA 1KQRA 1PZ7A 3A0NA 5GM0A 4DQAA 1DHKB 2DUPA 1JW6A 1LU1A 1UKGA 2PHWA 4FPGA 1QOTA 3IPVA 4UW4A 4XMAA 4XDQA 4AGRA 5GLZA 3AP7A 1S0GA 2ZGTA 1C4RA 1UZYA 1S0FA 2R1DA 4LBOA 5H9QA 2YV8A 4FOVA 3WZ1A 1W6QA 4LBQB 4YZ4A 1H30A 2D3RA 1IOAA 1SLBA 5GLWA 1LU2A 1WW4A 1LHWA 4YW4A 1IS4A 2ZA9A 2WSVA 4LBJA 1F5FA 1PZ8A 2ZGKA 1W0OA 4YGEA 2OW4A 4DS0A 4XYXA 2LALA 3O0XA 5KXEA 3ZPYA 5GALA 4FQZA 3B01A 2HYKA 1IS5A 1HLCA 1LOCA 4TYSA 3RSJA 1A3KA 3WNXA 5BYNA 2UWCA 3USUB 4CRQA 3WG1A 1JYCA 1MZ5A 1HQWA 1FATA 2DV9A 3OYWB 1AXZA 3ZSMA 1Q8QA 2A6XA 1WBFA 1DYPA 2CWMA 5H9RA 3AP5A 1KITA 4Q26A 4L8QA 2DU1A 2WKKA 4ISQA 2D6OX 2OUJA 1GNHA 4XBLA 2D6KA 3QLQA 1UX6A 3ZXJA 5IK4A 1IS6A 4R9AA 3RS6A 3FUQA 4P9XA 4BMEA 1D2SA 2P37A 3SH3A 5KXBA 4BMBA 4PF5A 5DZGA 5T5LA 4BLJA 1FYUA 1QDOA 1RINA 1VAMA 2AGSA 1ULGA 1QMJA 1SCSA 3CNAA 3FLRA 2GNDA 1GKBA 2WT1A 3M3QA 5H9SA 5IUQA 3RG0A 2VXRA 3ZSKA 1CPMA 1LOBA 1JOJA 1WD4A 2PHFA 4AYUA 3PVEA 1N3OA 1DBNA 3SLIA 4YG0A 5DUUA 4PQ9A 4DRRA 4Q8LA 1VALA 4GKXA 5E88A 2NM1A 1SLTA 3WDVA 1LEMA 1OQ1A 4XBQA 1F31A 2YY1A 1MVEA 3WDXA 3AP4A 2GNBA 1AZDA 4PBPA 1EPWA 2VW0A 2W68A 1YIFA 1W6OB 3WDWA 4LBNA 4M3CB 1FNYA 1QKQA 4I30A 2GDFA 4DPNA 1C57A 2VW2A 5KXCA 2D43A 3V0BB 1S0BA 2R49A 1LOAA 1GYKA 1JUIA 3ASIA 3B9CA 2ENRA 1GSLA 3UJOA 3IKWA 5EWSA 2PHTA 1W6OA 1JXNA 1WCSA 2PELA 4FP3A 4GKYA 3VKLA 4C1XA 5CBLA 5KXDA 5DUWA 1N3QA 4M3CF 1BZWA 3H0OA 2WSUA 3O0VA 4Y26A 3NV3A 5IK8A 2NN8A 1AX0A 1ULEA 1KDKA 1BJQA 1LJ7A 3AP9A 4YW5A 1DQ0A 1AVBA 2XG3A 4Y1VA 2YMZA 2NZ9A 1G9BA 2VUAA 2AUYA 3R4SA 4YZ1A 1AJOA 2B7YA 2DVBA 2VU9A 2E53A 4FPOB 4R9BA 3PJQA 1WLCA 4FVVA 2ZGUA 4ATEA 4JRAA 4LBLA 4M01A 4Q1PA 4RA0A 1G9DA 4AVTA 2D6LX 2W39A 3ZXEA 5JMCA 4FOYA 5JOZA 1DGLA 3KQRA 1FV3A 2DTYA 4GXLA 4YW3A 3VUOA 1LOGA 3AX4A 2C5DA 2SBAA 2WLQA 5GZGA 5JVVA 1DYKA 3GALA 3AZVA 1N3PA 1QU0A 3WDYA 1B09A 4XILA 4FPFA 1MS1A 1AF9A 5T52A 1QOOA 2ZACA 4Q27A 4Y1UA 2A3XA 1LCLA 3T1MA 4FPJA 5CNAA 2AYHA 2WJSA 2Z42A 3APBA 4LBMA 3MPPG 3O5SA 1QDCA 1ENSA 3SH5A 1WBLA 3QCWA 4YZ3A 2ZZJA 2CNAA 1ULFA 3OY8B 3T1LA 1G86A 4XJ9A 4YM1A 1SBEA 1WLWA 2ES3A 4SLIA 2P3IA 2V73A 4GWMA 4LBQD 1W6PB 1AXYA 2EXHA 1BKZA 5DUVA 3MW2A 3V0AB 1KJLA 3AZYA 3B00A 4YFWA 5IT6A 2DUQA 2V5YA 2A6ZA 3POSA 1JYIA 1H9PA 2D7FA 3N36A 2A3WA 3M1HA 1YYNA 1G7YA 3BIWE 3V0AA 4HL0A 5JOYA 3HMYA 4YM3A 2P2KA 2ZGRA 1QOSA 2PHRA 1V6IA 2A6YA 3VKFC 1GZCA 1MS0A 4R9CA 5GLUA 5DG2A 3WDUA 2ZGPA 1KJRA 1QNYA 3V64A 3WHTA 1LGNA 2D3SA 1V00A 4H55A 2D3PA 2ZKNA 4FPCA 4YW2A 1DLLA 3W59A 3IMNA 2AENA 3HN1A 4NOTA 1S0EA 3N7JA 4ISRA 4TZDA 1UZZA 1MS5A 3O0WA 3R05A 5IK5A 4XMIA 4K21A 4LBQA 3POYA 4XIOA 2E6VA 3O12A 3M3EA 4XOGA 1ENRA 2JE7A 2UWAA 2CWSA 3DUIA 3Q9OA 3N3HA 3AJZA 1CPNA 1U0AA 1ZM1A 2C9AA 2E7TA 1I3HA 3L2YA 4BLIA 1DQ4A 2E51A 2DVGA 3JU9A 3AZWA 1J1TA 1V6JA 3USUA 1AJKA 2PHUA 2AR6A 1YRZA 4M00A 3OYWA 4D69A 1CIWA 3UJQA 1DQ6A 1Q8VA 1Y7BA 3N7LA 1YXWA 4BPZA 5JOWA 1G9AA 1N1SA 1SLCA 3ENRA 2GN3A 1A78A 3SITA 2GNTA 3NWKA 1W6NB 1LGCA 1Z0HA 5T5JA 2A6VA 2WT2A 3BTAA 1Q8SA 4C1WA 2GMEA 5L73A 2DURA 4YFZA 2OVUA 2ZMLA 1O4ZA 2NMNA 1CESA 3D5OA 4XBNA 1H9WA 4NO4A 1QGLA 1FNZA 1LENA 2CTVA 4P14A 3AXDA 4FPEA 1W6MB 2JE9A 3HR9A 1MS4A 4YW1A 1HQLA 2YXSA 4JC1A 3TB0A 1FAYA 1WLDA 1YO8A 2A75A 2NMOA 1KRIA 4XXPA 3WDTA 5FREA 1WW5A 3FBYA 5DZFA 1DQ2A 2GMPA 2ZHKA 3AYEA 3R4UA 4BOWA 2AREA 2JD4A 4YM2A 4Q8KA 4GA9A 1WW6A 4UW3A 4M3CA 5GZDA 2G4IA 1RITA 3V0BA 4DRVA 2EALA 3AZXA 5T5OA 2DVDA 2WNEA 5GJ6A 3FFZA 3ZXFA 1LTEA 3LCPA 3M3OA 1RIRA 1WD3A 1GLHA 3FUOA 4YZ2A 1MZ6A 5JOXA 3PVNA 2DTWA 2ZAAA 4XXAA 3V65A 1IS3A 1IKQA 4FP2A 3OGGA 3M2MA 3AXEA 5GZFA 4Y20B 5LK5A 3ILNA 3ZXKA 2ZMKA 4FPHA 1ZA4A 2D44A 1GV9A 3WG4A 2NP0A 2R16A 4BQ1A 1FV2A 2A71A 3WUDA 1CQ9A 3ZSLA 2FHRA 2LTNA 2CL2A 2ZGLA 3AYDA 3WCRA 2ZABA 1LECA 2WT0A 3BODA 2GALA 2RHPA 4XJAA 1KDMA 4P9YA 4R9DA 1F9KA 4YLZA 1OFSA 1DQ5A 1N1YA 1V6MA 3KM5A 2FMDA 3ZYPA 1CJPA 1LESA 2ARBA 4DFSA 2Q5TA 4P9WA 1WUVA 4PCRA 4GWNA 3I4IA 1S1AA
chains in the Genus database with same CATH superfamily
1COV2 1Z78A 4C91A 3SC7X 2B45X 3ZSJA 5A1AA 2W92A 3I7DA 1WMEA 3WV6A 1VBD2 3ZVXA 4RN5A 1QJX1 5AC91 3OEAA 3W5NA 2KXLA 3N35A 2WQZC 3ZFEA 2A70A 2X5IC 3VDBA 5JI7A 3I49A 4ASKA 4TLFA 4GJZA 2ZGNA 1GNYA 1XQNA 1IHMA 4XQDA 1QJU1 5FLIA 2A7AA 4MYEA 4PLNA 1S0JA 4U2AA 2RDQA 3IMMA 4NPMA 2H0BA 5FPUA 4CU7A 3B3QE 1WCUA 4WM7C 2QUOA 4WVWA 2YBKA 2I74A 5SV8A 4JKMA 1QJX3 2GAUA 3MIHA 3IPVB 2JIGA 2DBNA 3POEA 5JDBA 3RZMA 5JLVA 2VZ3A 1C1LA 1VR3A 3K4DA 2UU8A 1VAKA 4XF4A 2ATFA 1VB4A 5F2SA 2JDHA 4FT8A 1YQCA 4D7SA 1TME3 1VAVA 2H6BA 3INAA 3UKVA 4ZZ8A 2JXAA 4YVSB 3O1VA 1GP4A 4Q4X2 1L7QA 1CAUB 1RUH1 1UU4A 2C9KA 1N1VA 1WMFA 3WQ1A 1Z7S3 1HKDA 1W3XA 3W20A 1AYM1 2VR4A 5FY0A 5IVJA 1H4HA 2VZPA 4QDRA 3JZVA 4QWNA 4EV0A 4GALA 3GCWA 4XZPA 4M3CE 2EXKA 2XJQA 3ACLA 1WW7A 4A41A 2JD9A 2JDUA 4Q4V3 4DMIA 4COUA 1Y9GA 1S2BA 1RVF2 3DKWA 1PNGA 4Z8BA 5LW9A 4UYBA 1D4M3 3GZEA 2G1MA 1HXS3 3ZYRA 2J7MA 2GC3A 4EWDA 1XJAA 2EICA 3N7MA 1V6LA 4X8PA 1DQ1A 1OLMA 1UN1A 2CY6A 2QQWA 2YROA 1VIWB 4RHV1 2RS11 1DZTA 5FZ3A 3D3AA 2P3JA 3WG3A 4Q1RA 1BHGA 1BXHA 2XHKA 4IE0A 1NX9A 3AJYA 1HRI1 5BNOB 5JZGA 1DGWX 1W0PA 1ZREA 2BERA 4XUTA 4GB31 3SMHA 1D0HA 5HCAA 1YJKA 3AK0A 5AC92 3U75A 4Q0QA 1NCRB 1OOPB 1PX4A 2BFUS 2HWE3 2D6MA 2VQAA 2JKXA 3T0AA 3J8F1 3C7OA 3WR0A 4DXTA 4P9GA 1CX4A 1YFWA 3WQ0A 4UFKA 3ME2A 1G8WA 4KBBA 3GZAA 5JSRA 1QJU2 5A3LA 3WUCA 1Y43B 2VW1A 3C8XA 3MV01 2JENA 4HVOA 2RR11 1MS3A 1TZOA 3DV8A 3NJXA 3TN91 5FWJA 1BQPA 4AAPA 5LBEA 5LEKA 1SBFA 1N1TA 5H9PA 4LHNA 3T4VA 1UXXX 2OQ6A 4HSJA 4LIVA 1X8MA 1VRBA 1JZ8A 1AXKA 5FMOS 1QH7A 1Q8OA 3EXUA 2B42B 3J8F3 5A6QA 2R0FA 4K6BA 2Q8DA 5K0UB 2EF6A 1YQ5A 3UV9A 4BE3A 2RDSA 3WP5A 2D93A 3O1TA 3N9QA 1ZZ8A 4NR1A 1URXA 3LEMA 5GZEA 1GWLA 1HB1A 4LPLA 1Q56A 2NLRA 4D94A 4LKFA 3U14A 3H1YA 3VKOA 5JXJA 1HN0A 1RUH2 1AX2A 4BWOA 3DYOA 4NVPA 1IG0A 3O1UA 1AYM2 5LA1A 1FPN1 1UPSA 3I2IA 2VVDA 2L9LA 2CYFA 1O4TA 4P9LA 2ZEXA 1DIWA 1MS9A 5A7WA 5TSWA 2JE8A 2JG9A 4ITCA 4Y4YA 5A6YA 1OUSA 4AEDA 3VL9A 1JU3A 3W5MA 3LKJA 1MQTA 4WVVA 5L7OB 1K5MA 2Z5WA 3EBRA 4OZXA 5C8CB 3HBZA 4Z07A 5EYXA 1KS4A 1WMDA 1XSRA 4URTA 2Y60A 3B93A 5GKAC 2CGPA 4ZKTB 3IDEA 4QKBA 3ZN4A 1ND2C 2FZ1A 2WQ8A 4H2AA 4RHV2 2VECA 2RS51 1XC6A 4QGMA 2RS12 4W6WA 4FPKA 5DUXA 2WNVC 5SV5A 2D97A 1NLRA 4LULA 4AGGA 3WLUA 1LKNA 4Q4W1 4AHYA 1HRI2 3KB5A 1STMA 3D4KA 1E5RA 2BWAA 3ORJA 4GB32 1NA1B 2I45A 5D8AA 2CU5A 4QQHA 3KT7A 2EXIA 1RUI3 3SISA 5GLVA 5F5IA 1OUXA 2J42A 4IE6A 2P34A 1CONA 4XTPA 1RUF3 2VO5A 2GNMA 2JDYA 1JZ2A 3M3CA 3WVJA 1SLIA 3DF0A 3VBRA 3BOWA 2E7QA 3I2FA 4V1PA 5C70A 1YWKA 3GHNA 3OBRA 1CN1A 4A45A 2VNGA 5FYBA 3AKQA 4BQ3A 5GZCA 2SLIA 1W90A 2RR12 1F8VA 1LHVA 3TN92 1KQRA 5IW0A 5A7OA 5C5TA 4L99A 1ZRIA 1DHKB 2VOKA 3CL1A 1JZ7A 1H8VA 1W8OA 4RR3B 4E8CA 4XMAA 4EE2A 4W8JA 5T3NA 2D5HA 2IXLA 1UYPA 2O0OA 2VZOA 4JRLA 1S0GA 2OXBA 4IEZA 3ZR5A 4OLLA 4HPKB 1C4RA 1UZYA 2R1DA 4JGZC 1RMU3 1UW8A 4LBQB 1PVC2 2D3RA 2PMWB 1IOAA 4LOSA 5CVRA 5GLWA 4L2NA 1F5FA 1DU3D 3KV5A 4PLMA 1W0OA 5EHDA 1K3IA 1AR83 1ASJ3 4QQPA 4EN7B 4G3YC 4N90A 5FKCA 2LALA 3O0XA 1FPN2 1GQGA 5GALA 3HBKA 2VCAA 4OHZA 1IS5A 1HLCA 1LOCA 5A6XA 5I0DA 1ZZ6A 4B1LA 2UWCA 4CUCA 3ZN6B 2W9XA 3EHKA 5EFUA 3WG1A 4QPGA 5DAWA 2XJTA 4UF0A 2ARCA 2QJVA 1Q8QA 2A6XA 3DN7A 2CWMA 5H9RA 4M0HA 4XFGA 4CE8A 3N9LA 2WKKA 4IV3A 4JGYB 5ACA1 2OUJA 1ND3A 3I59A 5FY5A 1UX6A 4R9AA 4HKWA 4P9XA 5LA0A 2P37A 5HV0A 5KXBA 3LIHA 4BMBA 2RM21 2RS52 4KI5M 1OA2A 2AACA 1PIV3 2QQOA 1GKBA 4KG8A 4Q4W2 5H9SA 2BVBA 3RG0A 4QKFA 3I3MA 2JDNA 1FMD3 1LOBA 3ABZA 3RYRA 2VBPA 5CEHA 4ZHNA 1N3OA 4LQRA 5FZLA 4CDXC 1QWRA 4YG0A 2KA3A 4WVZA 3VN4A 4EJRA 4Q8LA 2HWF3 3JCIA 4P5YA 3LA7A 5C9AA 4XBQA 1F31A 1ZZ9A 3NAPA 1US3A 5FYHA 2YG0A 3WXPA 1YIFA 3DEMA 4GH4B 4MHRA 5JI9A 4LBNA 4WZCA 1QJY3 1C57A 2D43A 3RJ2X 5IJRA 3LEKA 3OBZA 3Q8AA 2QTWB 5DABA 3WW1A 4YVSC 1GYKA 1POV1 2HBTA 1H2NA 4MUVA 2ENRA 3MPBA 4MV2A 4GKYA 1W6OA 1WCSA 2JDMA 1ZA7A 2V4AA 4XCAA 5CBLA 1MPXA 5DUWA 2GSYA 2QQJA 4QGLA 1NZIA 3HQUA 3O0VA 1O6UA 4S2FA 1O5UA 4Y26A 1NQJA 3TYJA 5IVVA 1GUIA 2VC9A 1KDKA 3MUZ1 3FJSA 3L2HA 4RYDA 2VMCA 4XETA 4YZ1A 1AJOA 5CADA 4XDPA 4CDUA 2QQUA 4FVVA 4K8RB 2OKXA 1POV3 3C7GA 2WN3A 3AFGA 1NCQB 4Q1PA 5I8SA 1G9DA 3BTYA 1PVXA 4FCAA 3MZHA 1AR93 4EWEA 1IGOA 1NG0A 4KGQA 3KQRA 1FV3A 3VUOA 4RFT0 4YW3A 1OVPA 2GP5A 2WLQA 1DYKA 5BNOC 3LFIA 1B09A 4B8EA 1MS1A 1UOJA 2HWB3 1O8SA 1QOOA 2ZACA 3FWEA 4Q27A 3VZNA 2XUEA 2V5DA 5B4NA 3I2GA 3ST7A 5KBFA 2AYHA 2WJSA 5FZHA 4BQ2A 5ACA2 1NCRC 1OOPC 3VD4A 4C90A 4GWIA 3O5SA 1UXZA 2NQYA 4QX7A 4JDMA 2P6CA 3QCWA 4S2GA 2WL1A 1OI6A 1ULFA 2EIBA 3T1LA 3VBUB 4DUXA 1G86A 1QXPA 1RUG3 4LE4A 3TOJA 1IG3A 4LK6A 4XQ4A 1WLWA 2XOMA 2LROA 4GWMA 1UYZA 2EXHA 2YFUA 1ZBA2 2Y6JA 2AEYA 2C4XA 1OLME 2PFWA 3LOIA 1W2OA 4LHSA 4F7ZA 1F5JA 1CAXB 1UOGA 2ZJCA 3PHMA 1J3RA 3U0ZA 2D7FA 4OHVA 4Y5TA 5DAQA 4P5HA 1PO13 3OGJA 2QVSB 2VTXJ 5K0UC 1RHI2 3FHAA 4HL0A 5JOYA 2HWD1 3RZJA 2P2KA 1QOSA 3VKFC 5J3UA 2A6YA 1GZCA 1MS0A 1YFUA 2LS6A 4R9CA 4X8NA 5GLUA 5DG2A 4ONUA 3WDUA 3RZZA 3MLKA 1QNYA 3WHTA 1UMIA 5C3QA 3NL1A 2XUMA 3FFQA 4H55A 4ZXEA 2I07B 4LKEA 5FZIA 3W59A 3IMNA 2AENA 4EQVA 3BPZA 4MGKE 3KS7A 2CSGA 4HFSA 4PLOA 2RV9A 4ISRA 4QU1A 1UZZA 2Y34A 3MV11 2YPJA 4K21A 4BXFA 1C8NA 1KFXL 1YJLA 2WNUA 3DXTA 2E6VA 1PX3A 3O12A 4OI0A 4IERA 5FO9B 2JE7A 1HQNA 5I8YA 4R4XA 4EROA 3NNFA 1NKGA 2UWAA 5L7OC 5JAXA 3N3HA 3AJZA 5A32B 1ZM1A 2DCKA 2VVEA 4BLIA 4AR2A 3ZFGA 5C8CC 5IAXA 3THCA 5HXMA 3WQ7A 3T30A 3VZLA 5FXXA 1AR73 2QCSB 2WINB 4AEMA 5KHHA 3FZ3A 4IESA 2PHUA 2AR6A 5FZ0A 5FOJB 4AI9A 4M00A 1CIYA 3RFRA 3ACHA 4FTBA 1A6CA 4YWAA 3JBG3 1YXWA 5JOWA 1G9AA 1NA1C 3PIJA 4W6XA 1QH6A 3CJIB 1A78A 3LE0A 3NO8A 1W6NB 3E1F1 5G05L 3FBMA 2P17A 3ZM8A 3K77A 4GMP0 1Q8SA 4C1WA 2RJKA 1D0GA 2PA7A 5FZDA 2NMNA 2VTXA 1CESA 1R091 4XBNA 2Q0AA 2FDFA 1FOD1 4UOJA 4LO7A 4O9GA 1LENA 2CTVA 4JKKA 5K9YA 1XNCA 4JTOA 5I0TA 2JE9A 4AZZA 4QM8A 1XXNA 4YW1A 1HQLA 1KD7A 4O7XA 5K8SA 1FAYA 1MEC1 1H8TB 2EA7A 1YO8A 2K9ZA 2XJRA 4Z2WA 4XXPA 4YYOA 1BEV1 4RR3C 1BBT1 2ZHKA 3WNOA 4JHZA 2DCYA 4LR4A 3GZTB 4LKDA 3K4ZA 1AR61 4MGYE 4M3CA 2ADDA 4HMZA 2EALA 5A1FA 3RZHA 3AZXA 1GWKA 3I2HA 2HWC1 3R6SA 3MICA 5KR7A 3O1RA 4IL7A 4CDWA 3J4UH 2ZEYA 2AEZA 3ZXFA 3BTZA 1EUUA 3M3OA 4QXCA 4YZ2A 1MZ6A 2ZTNA 4W6YA 2HLEA 4RSUA 1WCDJ 5A3WA 2GH8A 2ZAAA 3ROUA 1O3RA 3V65A 2QQPA 5FZ9A 3WW4A 4A6SA 3OGGA 2ZCWA 5BV6A 3AXEA 5IVBA 2VNRA 4QPIB 4FPHA 2FD8A 3VLBB 4ZU4A 1GV9A 3WG4A 2XPJA 4FO9A 1VMHA 4BQ1A 4UFHA 3WUDA 3ETPA 1CQ9A 3B02A 4NRPA 5F6LB 1RUD3 3P1IA 1UOFA 2FHRA 3KF5A 4AQTA 1MZEA 2BTVC 1EV12 3OUJA 2PHLA 4NPLA 2YB7A 3VD3A 1K5JA 2GALA 5CFCB 2O14A 1VBC3 1XNTA 3KF3A 5A70A 4N9IA 1AL0G 1OFSA 1DQ5A 4MGSA 4CP9B 4NIGA 4HETA 1ACCA 3F95A 4MOAA 4PF1A 3ZYPA 1CJPA 2RDNA 4LIUA 3WNKA 3TEYA 1HRV2 3P5BA 3S6PA 3AL5A 2A1XA 1EY2A 4LO8A 4LT5A 1NOVA 1NZCA 1APNA 1GR3A 1LHNA 2JECA 4E2GA 4YM0A 2Y6KA 2B9VA 4BA6A 3OSDA 2UYBA 3OY8A 5C4WA 1DLCA 3O1OA 4FAGA 2RS31 5DAVA 1FOD2 2AH2A 3MEPA 4XUOA 4GH4C 3KT1A 2W52A 5E1RA 4PT6A 2W87A 2PAEA 4BU2A 2P6HA 2XL7A 1ONAA 3PTYA 5E16A 2WFPA 3E6CC 2OT7A 1LR5A 3AMQA 1MEC2 4J25A 4YVWA 1NUKA 1NY71 3IDCB 1VJ2A 4JX0A 1UAIA 2R073 1BBT2 1S0DA 4D6RA 1UMZA 2VMFA 1RUNA 2VUCA 3HNMA 3NMBA 3SEPA 2B39A 1OBNA 1AR62 4N43A 2YZ4A 1S0CA 3POFA 4FPLA 1SG3A 1GWMA 2X05A 3RMYA 3T2TA 2JDKA 1J84A 4CUAA 3OBTA 3WOGA 5F7UA 3PVBB 2Y0OA 1C8M2 1UY4A 1UNBA 1ZRRA 1HV0A 4OUSA 2XMLA 1W6QB 2R041 3CZJA 2BWCA 5EV7A 4FOWA 1H4GA 2VJXA 4BM8A 2WS92 4E2QA 2DFBA 5JMOA 2X09A 1IQAA 1CR7A 4CEYB 2ZBJA 5LY1A 4YGCA 1FX5A 3KQ4B 2XVGA 1R1A3 3N9MA 4HXCA 4LA2A 1WZXA 4UW6A 3HVDA 5DZEA 5ERLA 4OHYA 1MACA 3OB8A 2XB6C 2I2SA 2J1AA 4N7UA 2XLFA 3WP6A 4N7IA 2IWGB 3SQOA 1LB2A 1OLRA 2FZ2A 3B69A 3A21A 2J1UA 1PO21 1QHDA 2Z69A 3BALA 3JB4C 5EJZB 5CFDB 1V6KA 5C33A 1R1ZA 3HAGA 4Y24A 1CX1A 5HI0A 3VV1A 2GU9A 5J96B 3D6EA 2ERFA 3PNAA 3VBUC 3VBHC 3T0BA 4BIFA 1AYN1 2P3KA 2VVFA 3SCFA 1XE8A 3NNLA 3UK9A 4AXOA 2JJ6A 4QX8A 2BGCA 1CAVB 4CZSA 1U5IA 3KV6A 3VBSC 4B29A 5T5PA 2ET1A 1XNKA 1LOEA 2HEYF 2XJUA 5A1LA 1HB4A 3C7EA 2VGDA 1VBA3 1H0BA 2UWBA 4XPVA 2UYAA 2W46A 1XYOA 2W1SA 3ILRA 4NE9A 4O9EA 4QM9A 2WFF3 5F39A 2P3YA 1W6MA 3C2UA 1OKQA 4FOQA 3ZYJB 4AI1A 4LUMA 1JN2P 2D6NA 3ZYFA 1GP5A 5EXOA 4XIKA 3WF1A 3ZR6A 1T6GC 4QPWA 1LOFA 5IVYA 3H1MA 2Y38A 4IEPA 1OA3A 3VDDC 3QH6A 2WYSA 1OQDA 5LASA 3WCSA 2DUOA 4CDQC 4QXBA 5A3NA 1BYHA 1U5YA 3OEBA 4K1YA 4XQWA 2PQQA 5A3TA 1OPMA 1PMIA 2GN7A 1EP0A 5F6KA 1GZ9A 3VB9A 1OPOA 4I0WB 3GNEA 4NJ4A 5FYCA 1JODA 3GCXA 4C0HA 1OD3A 5FYUA 4BISA 1RGSA 2CGOA 4OI1A 3AFKA 3IIIA 1NXD1 2R042 1W3VA 4W50A 4XJZA 3SH4A 4URAA 3UNPA 4WM8B 3SHRA 4NHMA 1IKPA 2MPFA 3AKPA 3V56A 3WDYA 3P3NA 4XTMA 5LZ6A 4GZ9A 1M4WA 3ZKYA 1MVQA 5DDJ3 4FPYA 4WZFA 5C3PA 2VQ0A 4QQ2A 4JCKA 1VMFA 1EYBA 4RS5B 5C8WA 3BU0A 2BP6A 5T50A 3CJIC 3BU7A 3JQWA 1AL23 1IZ3A 1PO22 5L9RA 1O4YA 1F4HA 4Y1YA 5FMCA 1NYWA 3WHUA 2OPKA 3PDQA 3NV2A 3POBA 1PK6B 1QQP3 3KCXA 3UYJA 5EYYA 3LA2A 1QNWA 4Z92B 2CAVA 2JB8A 5BNPA 3ALQA 4CUGA 1LHUA 2UURA 3AMMA 2FDJA 3ATGA 3MI8A 1AYN2 4ZXKA 1H2MA 2E31A 1GFF2 4QDSA 3NKTA 1W8FA 2QQVA 3MGUA 2PQSA 5JXHA 4Y4RA 1H8TC 3Q8EA 5D21A 3TRSB 4I0BA 3OJBA 1TME1 4YG6A 3K51A 1GICA 2VBBA 3I8TA 5C3RA 5KC5A 1SLAA 3LB9A 1LAJA 4ATFA 4H7MA 1UL9A 1SFYA 2BNOA 3FE5A 2QZ2A 1X82A 2A3YA 1W2TA 3VGIA 1JZ5A 1Z7S1 5A80A 4CDXB 3QH7A 2CDPA 2FCTA 1O8PA 1QF3A 3I3EA 4YG3A 3WW3A 2WZPP 1SLLA 3DPRB 1JZ4A 4ASMB 3H3UA 4CP0A 4DB5A 2JB4A 4QPYA 2W47A 2Y6FA 3I3BA 4PDWA 1PZ7A 3OCPA 3EQEA 3KD4A 2DDUA 4A7YA 2VOWA 3CIHA 1E5IA 4Q4V1 1D7PM 2WA4A 3K75B 4QB2A 4XABA 1UKGA 2ZPXA 5FP8A 4COZA 4FPGA 2RDRA 5K4LA 1QOTA 1SPPB 5IFTA 4H14A 5AFBA 4QPIC 4XDQA 5FZBA 1J83A 1D4M1 1P8JA 1WA6X 2WZR1 1HXS1 4IEQA 5GLZA 5LBFA 4A2UA 4A4AA 5K7PA 5LRSA 1W0NA 5AVPA 3RI9A 5DQ0A 1GQPA 1E5HA 1PMJX 1G6NA 3PURA 4LBOA 2JWPA 2YBPA 4IV1B 4Q5OA 2VMDA 2YV8A 4FOVA 4MH0E 1Q3EA 4H7LA 4OZOA 3J7MA 2CDOA 1LNSA 1IS4A 2F6BA 2ZA9A 2WSVA 3I97A 3OF1A 4LBJA 1PZ8A 4DY5A 2EAAA 4UBGA 5CFCC 5J98B 5FZ1A 4XF1A 4CEWB 4NUBA 1YIPA 4XFCA 4WVMA 3ZFFB 1WA4A 3WF0A 1ALYA 4AEKA 2QE3A 3ZPYA 2HWE1 1XNDA 1ZZBA 3RSJA 1A3KA 2JX9A 2WZR3 3WNXA 2XBO2 2YBSA 4AHWA 5BYNA 3H8RA 5JUVA 3VBOC 3EYPA 3OYWB 1JYWA 1AXZA 1HN1A 3ZSMA 1J59A 4AHXA 3O14A 3AP5A 4BQXA 2HH9A 4XBLA 3QLQA 5IK4A 3JB8A 1T2XA 4LUKA 5ANNA 5BNNA 3S7EA 1B35B 2VE1A 1D2SA 2KR2A 1QJX2 1LRHA 1XU1A 4GD4A 3X29B 5DZGA 4A42A 1QDOA 3IDAA 3LDBA 3M7AA 4JGYA 1JOPA 1QMJA 1SCSA 3C3VA 5FP7A 2GNDA 3ZX7A 2B9UA 4XZUG 5APAA 1RJ7A 4HBNA 2PHFA 4AYUA 4HLTA 4RQPA 1DBNA 2VULA 2WO1A 3SLIA 1JYXA 5FZOB 2VBDA 2V72A 5E88A 2NM1A 5C71A 1OQ1A 5LBCA 4M4RA 3WDXA 1ZX5A 5ABJA 4LJHA 1Z7S2 3KVAA 4COVA 1AZDA 4UBHA 4KMQA 2OZJA 2Z79A 1C5HA 4Y5SA 2HEWF 3WDWA 2W3JA 3VBFB 1QKQA 3SXWA 4DPNA 3V0BB 1UZWA 1W9WA 2XH6A 5KXCA 4QGNA 4JZRA 5FZEA 2EVXA 3KV9A 3B9CA 1GSLA 3BIEA 3IKWA 4Q4V2 4FP3A 1JXNA 2PELA 4CEYC 1OH3A 4M3CF 1BZWA 3H0OA 2WSUA 4MLOA 1D4M2 1BCXA 1HXS2 2NN8A 1AX0A 4WBBA 5IAVA 1NQDA 3OG2A 2BRTA 2ZOEB 3AP9A 3K3NA 4QKNA 4YW5A 2XG3A 4Y1VA 2NZ9A 1POV0 3B94A 2AUYA 5CFDC 1G9BA 5FZ8A 4IGOA 4R9BA 4FFHA 3PJQA 3MIGA 3EO6A 4BDVB 4AVTA 4LK7A 3PUIA 4HK9A 1RUI1 4A3XA 4CXYA 4GXLA 5FY1A 1RUF1 5EP9A 1NCQA 1CAWB 3NVCA 5JVVA 3GALA 4O61A 2FBEA 1N3PA 3AZVA 2VQUA 3KLSA 4JTNA 4LKSA 4RGAA 1QEXA 4XILA 3LFMA 2WYFA 5KHIA 4Y1UA 1LCLA 3VD9A 2LRPA 1UYXA 4OMDA 5CNAA 4A7KA 1O5LA 1JS9A 2Z42A 4KNCA 4UFLA 2W2IA 1TG7A 4NRQA 1RXFA 5FOBB 4FI9A 5A3UA 1QDCA 1W8TA 3SH5A 4FXKB 3USSA 4MVTA 5F2WA 3LQCA 3OPWA 4XJ9A 3R0RA 4YM1A 3J8F2 2IVIB 1SBEA 2ES3A 2PN5A 2ZZQA 5FZ6A 2P3IA 2BOJA 3ZFEB 2PTMA 1AXYA 1W8HA 1XSQA 3OGSA 3VHPA 1RMU1 2P4EA 3V0AB 5I91A 1OFNA 3CDZB 4YFWA 2DUQA 2MEV3 5FAXA 1H9PA 4OI4A 5FV3A 2TNFA 3M1HA 1BK1A 2E32A 1YYNA 1AR81 1ASJ1 1W9TA 4YW7A 5DN2A 5FZFA 3WP4A 2ZAHA 1H6YA 3OD4A 3VL8A 5EZWA 1V6IA 4EN9B 4CU6A 4XUQA 2ZGPA 3OD0A 1RUOA 4WM8C 2CHHA 1V00A 5FYTA 2WO2A 2LW8A 4NAMA 1VP6A 4ZU7A 5AFEA 3M3IA 4H3WA 4I3GA 2VAUA 4TN7A 3R05A 1MS5A 3O0WA 4GJYA 4OHXA 4RS5C 4E4HA 4XMIA 5I0UA 2WWJA 1EAH3 3GBWA 3POYA 3M3EA 3H9AA 3D82A 5CISA 2IXHA 1PIV1 4HK8A 4ZPIA 4EZ4A 1H6XA 2D5FA 3Q9OA 1CPNA 2C9AA 3AVRA 3CHXA 1I3HA 4IGQA 5FTTC 1DQ4A 1PK6C 1JI6A 1FMD1 2XWBB 3JU9A 4IW3A 4GAZA 2BDRA 1RUI2 2R30A 2VOTA 5A33B 2HWF1 2R063 3USUA 1AJKA 3ZYIB 4NIDA 5FYVA 1RUF2 5FYYA 3GZUC 1YQ8A 2Y26A 3UJQA 1DQ6A 1Q8VA 4BPZA 1QJY1 1SLCA 3ENRA 2GN3A 2ZX4A 4N53C 1YHFA 2XVLA 2BVVA 2RMU3 5JZGB 1Z0HA 2WT2A 5L9VA 3BTAA 4YFZA 2DURA 2XKOA 1JYNA 2ZMLA 2Q8EA 3D5OA 2UY8A 2JG8A 3K2OA 4IEYA 1XOYA 1QGLA 4QB6A 3SCGA 3ZSEA 3DPRC 1RUJ3 2VZSA 4FPEA 1Y9MA 2WO3A 2J1TA 3TNPB 2XJVA 1MS4A 4L92A 4UFIA 1ZZ7A 4DUVA 1RMU2 4BK5A 3Q8BA 1REFA 1KRIA 1I9RA 1RXGA 1VBB3 1WLTA 5FREA 2ETEA 4UFMA 2IVJA 4NPRA 2VMIA 3VDCA 1OH4A 2JD4A 2X5IA 1ASJ2 2XONA 5FPVA 4BOWA 1AR91 4AI3A 1DZRA 4IV1C 4DRVA 1XE0A 4QMAA 5T5OA 2FDIA 2WNEA 4AFMA 4NIHA 3RYKA 4NIIA 2WWSA 5GJ6A 2HEVF 4BHPA 1LTEA 3LF7A 2O8QA 3KCCA 2HWB1 1GLHA 4WM7A 3CLPA 2VXJA 2XDVA 4CEWC 3GDBA 5FP3A 3GM8A 3OGRA 1IKQA 1UIKA 3ZFFC 2YU2A 2FDGA 3BUCA 3T0DA 1E57A 5GZFA 4XF3A 1OLQA 1PMHX 1UIJA 1ZBA3 3H42B 4XDOA 1DP0A 2ZMKA 1PGSA 4KGGA 5LK5A 4B1MA 1BVP1 5JSOA 2QDRA 1W03A 2R16A 4XCBA 1RUG1 2XLGA 1WCKA 1RUC3 4AW7A 1PIV2 4BZ4A 3RGBA 2BUKA 5FLHA 3K3OA 3MIEA 4EZHA 3HQXA 4QPIA 4JV4A 3S5QA 2E9QA 1SQ4A 4LE3A 1MQTB 1FMD2 1FXZA 2XR4A 1CZVA 5I0RA 1B35C 2ZABA 3AMNA 1K5MB 3BODA 3L9JT 4Q29A 4XF0A 3UKTA 4R9DA 2X53S 2D40A 3FHIB 3MO4A 2FMYA 1Q5OA 3N9NA 1PO11 2VTFA 4DUWA 2EIDA 4XW3A 2Y6LA 1J1LA 1OSGA 4IEUA 4HOOA 2RM22 1WUVA 3VBHB 4KU8A 4PCRA 3IAQA 4V2WA 1QJY2 4COWA 5DXDA 3O1MA 1SDWA 2FCUA 2JEMA 1VLNA 1RUE3 2OUHA 5FUNA 3RRDA 3JD73 4JDOA 4QX0A 4GQ7A 2XQXA 5D8AB 3VBSB 4AG4A 5F3IA 1PZ9A 5FPAA 1JZ6A 3U4SA 3DYPA 5F37A 1QXJA 1W6PA 3AKSA 3VBFC 4W65A 3RNSA 3D0JA 2RJLA 2RE9A 5FZKA 1CD3G 3MIDA 4C8DA 4E4DX 1TQ5A 3HQRA 1C5IA 1YQ2A 2WWUA 5AVAA 2VOXA 4CTEA 2B4KA 3O1PA 5KHKA 3D8CA 1AR71 3FLTA 1UU6A 3ACFA 4AQ2A 4AL9A 3GYDA 2DVAA 4I02A 4XUNA 3VDDB 5DPNA 3JQXA 4CDQB 3S0MA 1DF0A 4YARA 1VRH3 1MS8A 1GOFA 1HDKA 3MF9A 3U10A 1W8NA 2FDKA 4Y22B 1ENQA 1VMJA 3JBG1 3ZDVA 2O1QA 5JSPA 1SDDB 2HWB2 3E5QA 3U4XA 3P6BA 2ZS6B 5E6HA 4LBKA 3GGLA 3RVHA 3VKNA 1YI7A 3W58A 4R52A 5JCTA 5CG9A 4Y33A 4XE9A 2YDEA 1UPIA 1RJ8A 4XJWA 3RDIA 5IWFA 4HANA 5BXXA 2ZXQA 2PLV3 4ZONA 1CVNA 3IBMA 4MGQA 4CEYA 4QPGB 2VMGA 4XAEA 2WA3A 3OPTA 4D6SA 2DWRA 2VMEA 1LULA 4K3UA 4RD7A 1JH5A 4YPJA 3WEZA 5F3EA 5FDBA 1KS5A 4IV3B 4K40A 1ND3B 1VBE3 3S5AA 3I59B 3PMEA 1W05A 3AKTA 3H8OA 3TEXA 1UZVA 2WZ8A 3ZFEC 4HKLA 1WWYA 1E5SA 1OF4A 2FCVA 3RZKA 1U5ZA 4IE7A 1BLZA 4BXSV 2VZVA 3ZN5A 5FY7A 5FRAA 5FPXA 4MZUA 3RJRA 1MR5A 1ND2A 4B7EA 4AVVA 3MHZA 4KH9A 2WNVA 2XGXA 5C9AB 2IFRA 4P9JA 2VQTA 2ZGSA 3DXUA 5FFOC 4DXSA 1NAEA 2YYOA 1EV13 2HWD2 2WIIB 2ZGQA 1RC6A 4L0PA 3OPZA 4AI2A 3KSCA 1LHOA 3AZZA 5HCFA 2OPWA 1UMHA 4YGDA 4Q0VA 3WF3A 5IFPA 1RUD1 3HD8B 2Q1ZB 3JXSA 1XPWA 1HRV3 3OGVA 4XJ8A 3T2QA 2VMHA 1G9FA 5A7NA 1AR72 4E4ZA 3HNYM 5FMDA 3BB6A 4A3ZA 1CJDA 1VBC1 1DG6A 4A44A 3EB7A 3MW4A 4KL1A 4OQ8A 1N47A 4UW5A 4PJYA 2JDPA 4JKLA 1PGL1 1TMF1 2ZGMA 1HIXA 2DF7A 3JBG2 3M4FA 1AX1A 4UWDA 4X6QB 5E8AA 4AEJA 5A3PA 3WNNA 1Y3TA 4XHXA 4F3JA 5JPMB 3G6JB 2MHFA 3TBDA 4CDUB 2BQPA 4Y20A 1V9U1 4B4PA 4D6QA 1DGRA 5FP9A 1PM7A 1CGPA 1GZWB 3BPSA 2XHNA 4JGZA 1W06A 4J1XA 1R083 3W21A 5A7QA 4CCCA 1GQHA 1FT9A 3KWVA 5FXZA 1SFPA 3GXUA 1TMF3 5JZGC 3VBOB 4AWDA 1YEWA 2JIJA 2X10A 4KG0A 3A23A 3CKHA 4HN0A 5L36A 2R071 2BZDA 1V9U3 5CB7A 4Y1ZA 4Y1XA 2XVKA 3NV1A 1V6OA 2XWJB 1HW5A 1R092 1UZ0A 5LWBA 4CP1A 2JDZA 2WS93 5LY2A 5LCWL 3FC0A 1AHSA 3ZXLA 1NT0A 1ZBE3 1Q8PA 2VD7A 3K48A 3ELNA 3BN6A 3AYCA 5FCCA 5CAZA 2ZHNA 2ET7A 4NWVA 1PM4A 1REEA 3MF6A 1W8UA 3UGGA 1S0IA 1BEV2 1GBGA 3CEWA 4Q2FA 3LSDA 5C7GA 3UESA 3WQBA 1ST8A 1R1A1 1LODA 1DGRN 1O7FA 2R1BA 3WG2A 2ZHLA 4XFAA 4XJUA 3PVOA 1IPKA 3IZOA 1YLLA 5T55A 4BCUA 4GIQA 2VZ1A 2HWC2 3A0NA 4DQAA 4A6OA 4CDXA 3RYPA 1S2EA 3MLJA 1GU3A 3RWNA 2QQLA 4HKOA 1JW6A 4DNYA 5L19A 2WDBA 1RUD2 2PHWA 5F5CA 3POIA 3IPVA 3PU8A 3E5XA 4MXWB 5IVEA 4UW4A 4TWTA 2DCTA 1VBC2 3AP7A 3EMRA 5F3GA 3NNGA 3E6DA 2C24A 5BPXA 2BFUL 1S0FA 1SPPA 4YVSA 2WNUB 1H30A 4OYUA 4D7TA 4IEXA 3BTXA 1PGL2 1CAUA 2CAUA 1LU2A 1WW4A 1LHWA 1MQTC 4Z82A 1K5MC 1H2KA 3URFA 4CA9A 3ZFGB 2OW4A 2TUNA 3A7QA 1VBA1 2VCMA 5KXEA 4P02B 4RGKA 3VDAA 2DCZA 3OUIA 1OURA 1ZVFA 3G7DA 5FYZA 3MYXA 1RL3A 2WFF1 1YQ6A 3THDA 1JYCA 1MZ5A 1HQWA 1FATA 3K4AA 5FMOL 4CCJA 4CEWA 3ZIXA 4ET7A 1WBFA 5EJ3A 4AQ6A 3WSOA 1KITA 2GP3A 3WF4A 4L8QA 1PGW1 2DU1A 1XBFA 2W95A 3OTFA 5D8AC 1SMVA 3HT2A 1J58A 4BYYA 3RS6A 1L7RA 1VPHA 2R072 3WW2A 4BMEA 4CCLA 5A3MA 4D8MA 2QQMA 2Z2SB 1BVVA 5T5LA 4BLJA 2RS32 3HOBA 2HBUA 1RINA 1VAMA 2AGSA 3WNLA 5BNOA 3CNAA 3VBRC 3HNBM 4L9BA 3M3QA 4I3PA 5IUQA 1JYTA 3AB0A 2VXRA 4ES9A 1CPMA 2G9ZA 1JOJA 1WD4A 5C5UA 1NCRA 1OOPA 4QHOA 4GMP3 4DRRA 1K12A 5L9BA 1VALA 5J7MA 1NY72 3CZUA 3WDVA 1CWPA 2GNBA 2R6QA 5FPLA 3WNPA 4PBPA 1R1A2 3KHBA 2W68A 4KQ7A 4XF9A 3OBAA 1QXRA 2WAOA 5DDJ1 4M3CB 4MXVA 1FNYA 2DCJA 1COV3 4LMFA 4I30A 2GDFA 4Q4Y3 2V4VA 2VW2A 4XFIA 1HJGA 1LOAA 5FYMA 1JUIA 3ASIA 1VBD3 4CDWB 1AL21 4AAXA 1UU5A 4LLOA 5EWSA 4BQ5A 4O65A 3VBFA 4J6GA 2B8MA 5FY9A 1QQP1 3LWCA 5K0UA 3RI8A 5FY4A 3VZOA 2ORZA 3NV3A 5A7SA 5IK8A 3TNQA 4HVQA 2BNNA 1TNFA 1UF2C 2Q8CA 4Z2AA 2O8OA 2Y6HA 1OKOA 1WGPA 1AVBA 4QPGC 1JHJA 2YMZA 1X9TA 3NRUA 4OUMA 3CQOA 3R4SA 2B7YA 1NXMA 2DVBA 2VU9A 2E53A 1XB9A 1WLCA 5CIRA 4JHTA 4ATEA 3U07A 4JRAA 4LBLA 5KWRA 4N9HA 3CBNA 2W39A 4IV3C 3ZXEA 1ND3C 2QBXA 1VBA2 4FOYA 4DEVA 1ZZCA 1DGLA 4TTGA 4QD2A 2DTYA 3KMHA 1PHMA 1LOGA 2Y6GA 2ILMA 2G19A 2WFF2 3AM2A 5GZGA 5HCHA 3FL7A 2Z4FA 3J7NA 1AF9A 4ZS3A 5T52A 2Q8OA 2TBVA 5L7OA 1XYPA 2OQ7A 3Q8FA 2UY9A 3ITQA 4Q4X3 1O59A 3T1MA 1KFUL 4CXXA 5C8CA 3KHCA 1PGW2 1POQA 3APBA 4S2DA 5LA2A 3MPPG 3I2OA 4FSJA 4HG6B 1ENSA 3ZOIA 4N53B 2ZZJA 3OY8B 5C4WB 5C9AC 3NAPC 4KBZA 2OIIA 4UT5A 1UO9A 3C7FA 3HPNA 2ZX3A 1NA1A 1GOGA 3CMGA 3SKVA 1BKZA 2MNGA 3MW2A 5DUVA 2D98A 1RVF3 3AZYA 3B00A 1GP6A 2DFCA 3POSA 2A6ZA 2XBO3 1JYIA 4YVWB 4DXRA 2BJSA 2WQ4A 1JTZX 2P1BA 1C3HA 5DAXA 4IUGA 5FMBA 3UGFA 2Y64A 3TWIA 3V0AA 5EQUA 1M06G 3HMYA 3N4MA 1XE7A 2Y0IA 2ZGRA 5DDJ2 4N43B 3T08A 2PHRA 1H1AA 3CO2A 4Y5Z0 4ES8A 2NPIA 1IPJA 1KJRA 2IXKA 4IGPA 3V64A 4E2SA 2Y33A 3WF2A 1AL22 2WC2A 4CDUC 4RR3A 3VHRA 4CYDA 2D3PA 4DEQA 4FPCA 5AC93 1DLLA 2OZ6A 4MADA 3HN1A 2YFZA 2F4LA 1FI2A 1QQP2 1S0EA 4HPKA 3H3LA 1U5XA 1QJU3 5IK5A 2VUDA 2VG9A 2BU9A 3MBWA 4LBQA 3J7HA 4XOGA 5LB6A 4BIOA 2C1FA 1XNAA 2WNOA 4QX2A 2P5BA 1W8ZA 1H1MA 1KXGA 5JWPA 5CKNA 5FQ0B 3PLQA 2CV6A 4IEVA 5I93A 3MIFA 3WP3A 5FP4A 1REDA 1J1TA 3AL6A 3THTA 4PI2A 4PIYA 3ZN6A 2BV4A 4QX1A 4DOUA 3DECA 3DKQA 1YRZA 4AFCA 1Y7BA 5B2GB 3N7LA 4EYUA 1A34A 1N1SA 2YC2A 5A33A 1ZNPA 2PXJA 4AQSA 4QX3A 1RUH3 4LEJA 2PAKA 4EWAA 2Q4SA 1LGCA 2VZTA 5T5JA 3I3QA 1AYM3 4AFBA 4SBVA 4QXKA 2GMEA 5L73A 4D7YA 4Z1VA 1TME2 4HONA 5HV4A 5I0SA 1O4ZA 4B7KA 4BH9A 1H9WA 4NO4A 4ZZ5A 5C3OA 5EIYB 3H8XA 1ZRCA 5KC6A 3U11A 2WBKA 4XC9A 1FNZA 2IXJA 4AFDA 5IVFA 3AXDA 1SZBA 5C3SA 4ARXA 4ARYA 1W6MB 3PUQA 1U12A 2C0ZA 4XURA 5FR3A 2YXSA 4PHZA 3A22A 5FXWA 2BNMA 1WLDA 2HYXA 2A75A 2NMOA 2GC1A 2ZEZA 4HT1T 4UXAA 1HX6A 3WDTA 1WW5A 1DQ2A 4IXLA 1T6BX 1YCIA 1XNBA 4Q8KA 4KWJA 4RHV3 3H3ZA 4GH4A 5FYIA 2RS13 2YGLA 4UW3A 2X29A 1RITA 1VE0A 4AVAA 4CVUA 4MGZE 1HRI3 2WZR2 2WNUC 1TNRA 4GB33 4AVCA 3FFZA 4CCMA 3HJRA 1US2A 1H1IA 4IETA 5EPAA 3VZJA 3FUOA 5HXVA 5JOXA 3PVNA 4XXAA 2GZWA 3ZFGC 5FPZA 1IS3A 4LNVA 1JZ3A 2VPVA 4CU9A 4CU8A 3SKJE 2XQRA 4CCDA 1ODMA 1UD1A 3QBQA 3ILNA 4Y3OA 3B7MA 2NP0A 1PVC1 3F2ZA 4IE5A 4YNIA 5CKQA 2HWE2 2RR13 3U1XA 1FV2A 2A71A 2RG4A 3HIFA 3OUHA 3TN93 3ZSLA 1WCQA 4FBFA 3N9OA 5FZ7A 1HV1A 2LTNA 2CL2A 2BGOA 3AYDA 5FXVA 2WABA 3WCRA 1DGWA 1GOHA 2MEV1 2WT0A 2RHPA 3LZZA 4E8DA 1KDMA 3M70A 4P9YA 3WD5A 4PIZA 1N1YA 3FX3A 4INDA 1S2KA 5LRRA 1JYVA 5LBBA 5FJKA 1SFNA 3KM5A 2FMDA 1OD5A 3UGHA 1ZRFA 2ARBA 3OOXA 4DFSA 5BNPB 1PVC3 4P9WA 4OUEA 3I4IA 1S1AA 2ARAA 4MSVA 3RWKX 5D1IA 1K42A 2IXCA 4LXLA 3CU7A 5FIXA 1X33A 2J22A 3WT3A 1GANA 5JR7B 1FPN3 2EXJA 3DYMA 4F83A 3VBUA 3LGRA 3VBHA 3PU3A 5J36A 4QDQA 1I1EA 2D6PA 3KT4A 4RFRB 5FY8A 1L3JA 1OXCA 2DVFA 1A8MA 2JICA 2R32A 4PIXA 2Q1FA 2ZMNA 4K1ZA 1DZQA 3N7KA 1IQDC 1UX7A 2GC0A 2A5ZA 2VOVA 1W9YA 4AVSA 2E26A 4NHKA 4CPBA 1SHWB 3BI3A 1EAH1 2K46A 3I3DA 2XXZA 4M0NA 5FLJA 1GZTA 2NYYA 3VBSA 3ZYHA 4CDWC 5IK7A 1KGYA 1CAXA 4JQTA 5DG1A 3RMXA 5IHRA 1TE1B 3A0KA 1GMMA 4PDWB 5T54A 1UCXA 1OHFA 2B46X 4UAPA 2OYZA 2YHJA 1EUTA 5F5QA 4JQRA 2RS53 4BQWA 3PUHA 1CZSA 4CCEA 5HCBA 4AHZA 2R061 2N7GA 4AK3A 2IZWA 4Q4W3 4UI9L 5C6CA 1VB2A 5CYYA 5F9TA 4UFJA 4QB1A 3ILFA 2ORXA 2LUWA 5FO7B 3VDDA 2BBAA 1YFYA 3NKGA 4U36A 3VHOA 2RMU1 2ZX2A 4CDQA 3MW3A 4I2OA 4IQPA 4DIQA 1ULCA 1QJZA 2QDNA 2QQKA 4Y22A 3AP6A 1WMXA 1F35A 4WVMB 4FAHA 2BW8A 1LEDA 5A32A 3ES1A 2ZGOA 3RZGA 4LO6B 5IVCA 1RUJ1 3IN9A 1OF3A 1F2NA 3AMHA 3FLPA 1NLSA 1C28A 1HJFA 2ZHMA 1HB3A 4YGBA 2MEV2 1VBB1 2R0HA 3AKRA 3LIGA 5C4WC 1V70A 3ON7A 3M8LA 5FUIA 5BNNB 3TAYA 4YSFA 4XHBA 3T4HB 3FN9A 4MX3A 1X8EA 3CJIA 4K20A 4QU2A 1D2QA 2RJ2A 5J48A 1PNFA 1JHNA 1W6NA 4AF9A 3BOPA 4WV8A 1DFQA 2DYCA 4ZY9A 4K8FA 4QXHA 3ECQA 4YVWC 5FPBA 1JBCA 3ES4A 3FHQA 4RQPB 1RTVA 2ARXA 1DCSA 2FQPA 3IM0A 2JKBA 2VZQA 2ADEA 3WNMA 2EIGA 2VH9A 4N43C 1SCRA 4DY3A 5ABJB 3DGTA 1AR82 1ZBA1 3A4UA 1EAH2 3I2KA 1H8TA 2CGNA 2WAAA 3ZPOA 3MIBA 3RPQA 5I8TA 3PMSA 3RQ0A 1GNZA 1RUC1 4GWJA 1DYOA 1XYNA 5ACA3 1J3QA 4AGVA 1I5ZA 2C26A 1UYYA 4XEZA 3T2PA 5E89A 4CCKA 4K9SA 2Y8KA 1RHI1 3N9PA 1JU4A 2GMMA 3JUUA 3LSEA 3VZMA 2RM23 5LEJA 3PJYA 4MGTA 4LHKA 5F8PA 2R062 1QY4A 2YC0A 2G9GA 4KWLA 5FWEA 3S7IA 2B5HA 4P00B 1Y9QA 4KU7A 2OS2A 3IAPA 4RL7A 4DXZA 3ZMOA 2VUJA 2WR9A 2VY0A 3WY6A 3ZLIA 2Q30A 2YPDA 4AVBA 4FFFA 4OMCA 5A3OA 5A7WB 4FXGB 5B4XA 2RMU2 2JG9B 3E5UA 4PBOA 1RUE1 3DL3A 4AEDB 3IT8A 3BGAA 3JD71 2AC1A 1RHI3 2DBIA 5GLTA 3NJVA 3D0SA 1UKRA 1C1FA 2C6SA 1IPSA 2HWF2 4L97A 2VZRA 2DU0A 1SACA 4IEOA 4YZ5A 1SEFA 3AYAA 4E27A 2W08A 4HZFA 3LAGA 1J3PA 4OI2A 1RUJ2 1LGBA 4MHUA 3KGZA 4LA3A 3BCWA 3CJXA 1GZWA 5CFCA 3E97A 1W9SA 1UQXA 3ACIA 1A8DA 4XAAA 4OFGA 3UL2A 4CP9A 1VBB2 4D0QA 2KM2A 1UY3A 4FTSA 3ZKUA 2V09A 2EAKA 1UY0A 2W1WA 4HVRA 4GULA 4KWKA 1OT5A 3VBOA 1QIQA 3QACA 4B4RA 3VKMA 3SNMA 3GHMA 5CA6A 2ID4A 1W2AX 2PHXA 3NNMA 1HB2A 4TXWA 1VRH1 3H1WA 1W2NA 4QT6A 5DAPA 1O3SA 3BVCA 4QKDA 3PUSA 4FQ4A 1SBDA 1UWWA 1LOFC 2W5FA 3VBRB 1DDLA 1JOBA 1V6NA 3UT0A 3KVBA 4BB3A 4LTAA 1X36A 3LA3A 5FK7A 4E4SA 2W1QA 1X50A 1NE4A 3VZKA 4A7ZA 2IUWA 3O7OA 3R4DB 3VD7A 2A6WA 3J7LA 3NV4A 4NHLA 5FZMA 1TVGA 2TEPA 4K7JA 1AR92 1G9CA 1S4CA 1W9FA 2PLV1 4NN0A 1ULDA 1TEIA 2VL4A 3POWA 4EN8B 2ZEWA 3ZYGA 1RUC2 5GM0A 2RVAA 3H7YA 5F1RA 2IXIA 1ULPA 3UKNA 2DUPA 1LU1A 3IB3A 4OCTA 4QQLA 2E63A 3ZMNA 2XL9A 2VZUA 3HWJA 1H2LA 1YFXA 1VBE1 5IYYA 4Q0UA 2ZGTA 3LDRA 3NJYA 4OQ9A 5H9QA 3WZ1A 1ZYBA 3U78A 5J1XA 1BMV1 1W6QA 1BK0A 4MXWA 4YZ4A 1OMIA 4LOTA 1SLBA 2HKXA 4YW4A 1RUG2 5LA9A 2W1UA 1CZTA 2ZGKA 4UF0B 4YRDA 4YGEA 1RUE2 4YW6A 3ZO0B 4BQ4A 3GBFA 3JD72 4DS0A 4XYXA 2HWD3 2WZEA 4FQZA 3B01A 2HYKA 4FFGA 4TYSA 4XFFA 3PTRB 3GBGA 1W39A 3ZYBA 5BNPC 3USUB 4CRQA 2J1RA 2BYVE 4BJ0A 4D3WA 1PO12 3DCQA 2DV9A 1EPZA 3ZXAC 5CFDA 4CSWA 2FDHA 1DYPA 5FKBA 5FBZA 1EV11 1YI9A 4CCNA 4Q26A 5J09A 5FO8B 4ISQA 4G9SB 2D6OX 1GNHA 5CKMA 2D6KA 4CP2A 4CXWA 3LD8A 3ZXJA 1IS6A 4N8MA 3FUQA 4QHBA 3LOBA 1RYYA 2LM3A 4MGIE 4AOCA 3SH3A 1HRV1 4AFAA 4PF5A 4I0AA 2J1EA 3AC0A 1CAVA 1FYUA 5EJ1B 1JMUB 1ULGA 2BGPA 2JG8B 3FLRA 2WT1A 4FTEA 2WN2A 4XFBA 5JIAA 3GJAA 3NAPB 1VRH2 2G9FA 4JDNA 3ZSKA 4RGGA 4X6RB 5FZCA 4PDWC 2R7EB 1L7LA 3PVEA 4AI8A 5D2AA 5DUUA 4QAWA 4PQ9A 2W0XA 2XJPA 4GKXA 5JIUA 1SLTA 1QJEA 1LEMA 2YY1A 3H7JA 1MVEA 3AP4A 4LHLA 1ODNA 1EPWA 2VW0A 2X5IB 1W6OB 3T3YA 5A7PA 1UY1A 4HN1A 2PLV2 1W28A 4C0BA 1R081 1S0BA 2R49A 4S2HA 5G04L 3SEEA 4HSLA 3EJKA 2BPA2 3UJOA 1ULOA 4OVEA 4L11A 2PHTA 1S55A 2PYTA 3POGA 3VKLA 4C1XA 1R093 5KXDA 1N3QA 4WM7B 2VNOA 1FOD3 3PL0A 4IEWA 2YU1A 4NIAA 3ZDSA 2E7AA 1OA4A 2YC4A 1VBE2 1NLQA 1ULEA 3T09A 1YUDA 2QQIA 5FK8A 1BJQA 1C8M1 1LJ7A 3J9SA 4XVHA 5A6ZA 2ZX0A 1DQ0A 1K45A 1D4VB 1MEC3 1BMV2 5CG8A 2VUAA 3KV4A 4WM8A 4FPOB 2WS91 2QQNA 1BEV3 3I2JA 4MO3M 1YNAA 2ZGUA 4NROA 1BBT3 5FYSA 2XLAA 4M01A 4RA0A 4DZGA 5JXIA 1ZBE1 2H6CA 2JDAA 2D6LX 3KCYA 3SCHA 5JMCA 5ISLA 4NRMA 1AR63 1X9PA 1OVSA 3FMGA 4DO0A 5BNNC 4RS5A 3NQHA 3H50A 5JOZA 5J37A 3K46A 2HWC3 3AX4A 3P3PA 3VHNA 2C5DA 2SBAA 2X8KA 2K2SA 5FUPA 4ORFA 3QOPA 1MZFA 4NHYA 1QU0A 1C8M3 4JGYC 3VD5A 2ZKLA 2VCBA 4FPFA 4MG2A 3ZXDA 2A3XA 4PI0A 1PK6A 4FPJA 5FJHA 2PAMA 2F4PA 4RQPC 3U37A 4LBMA 3B9IA 5BNQA 2WRAA 4LO4B 4META 1WBLA 3HT1A 4YZ3A 5BUVA 1X7NA 2CNAA 3RZLA 5ABJC 4EN6B 1ZRDA 1UOBA 1O3QA 1YC61 4SLIA 4LBQD 2V73A 3HN3A 1W6PB 2OA2A 5CU1A 4N53A 2XJSA 3LEGA 2WO7A 3T2OA 1KJLA 5IT6A 2VM9A 2V5YA 3WX5A 4ZS2A 3N36A 2A3WA 4I09A 3BYWA 4NWWA 4W4ZA 1G7YA 2YUEA 3BIWE 5DMYA 3DPRA 4YM3A 5JXGA 5BY5A 3PUAA 3Q8CA 4AGRA 4R4ZA 4EN0A 1OQEA 1O3TA 4Q0SA 1OC1A 1R082 4BQYA 2W91A 2F17A 2BBVA 4V2VA 1XRUA 1XU2A 4AE2A 2PHDA 1LGNA 2D3SA 3C7HA 3NNJA 2JG9C 1TMF2 2ZKNA 4P08A 4YW2A 2HJIA 2RS33 1KEXA 4JAAA 5F32A 4AEDC 2J1VA 2EIEA 4IE4A 4NOTA 4ZU5A 3N7JA 3IWZA 4CUBA 3GF6A 4IV1A 4TZDA 1V9U2 4F8AA 1F15A 3NW4A 4XIOA 1NCQC 3MLLA 1ENRA 4R8HA 2CWSA 3DUIA 2J1SA 2BEOA 3S30A 1U0AA 2E7TA 3H8UA 2Q1MA 3L2YA 2BOIA 4J1WA 4LORA 3ZFFA 1ZBE2 4QQOA 2E51A 2DVGA 5KHJA 3AZWA 2WLPA 2YGMA 4GMP1 1V6JA 1R64A 1JUHA 4AI0A 5LK7B 3ZXGA 3TEZA 1V0AA 3I2DA 3OYWA 4D69A 2IC1A 3E6BA 1CIWA 5FQ0A 5KHGA 3MFAA 1W99A 3ACGA 4IDZA 4ASLA 4Q4Y1 1COV1 1UY2A 2R043 3CF6E 3WINE 1AUYA 3SITA 3S57A 2H0VA 5HBAA 2GNTA 3LPFA 3NWKA 2QZ3A 1B35A 4LITA 3GJBA 1F4AA 1VBD1 1O91A 2A6VA 3AVSA 4NMIA 4XACA 4PQQA 4TSVA 2OVUA 1ENXA 3PIGA 4KWUA 3QD6A 4QX5A 1I5PA 5F3CA 1ND2B 5FZGA 1QJFA 3MDPA 4P14A 4E9KA 2WNVB 1PO23 3HR9A 5IATA 4OULA 3AMPA 4CCOA 2E33A 4JC1A 3TB0A 5FZOA 1W04A 3B5LB 4P9IA 2VCCA 5JR2A 4LO5B 2VNVA 3FBYA 4LLFA 5DZFA 3TEWA 2GMPA 5FZ4A 2A73B 3AYEA 1Y4WA 2K0GA 2QNKA 3LEIA 3R4UA 2AREA 5M0TA 4YM2A 4GA9A 1WW6A 2WUHA 1AYN3 3IIAA 4TLGA 5GZDA 2G4IA 5FBJA 3V0BA 3NJZA 5F5AA 5LATA 4DINB 3LDKA 1W2UA 2DVDA 3O1SA 4BK4A 1WKYA 2AZ5A 3THPA 1RB8G 3MFCA 3LCPA 3NSTA 4XUPA 1RIRA 1WD3A 5FZAA 4COYA 4Q0PA 4OHWA 4B4QA 1W8WA 5JPNB 2DTWA 4Q4X1 4FFIA 5HPOA 2QKDA 4JVAA 4FP2A 3UETA 3ETQA 3M2MA 1I6XA 4Y20B 3ZXKA 2W94A 4I01A 2GC2A 4NAOA 1ZA4A 2D44A 5CZKA 2ZX1A 4B3NA 3HEIA 3POJA 5ANQA 4JGZB 3MUY1 4NHXA 4CPBD 1NE6A 3I54A 4QHZA 4M4PA 2ZGLA 1RVF1 2KD7A 3KGLA 4G4FA 1LECA 2GH2A 3IDBB 4XJAA 2XBO1 1F9KA 4YLZA 2OX0A 1CAWA 2QFEA 3ZIWA 4XFHA 1V6MA 2IFWA 3LPGA 2JG8C 3W9AA 1LESA 3KZ4C 3J26N 1Q43A 2Q5TA 2XKPA 3BKZA 4GWNA 4Q4Y2
chains in the Genus database with same CATH topology
1COV2 1Z78A 4C91A 2B45X 3ZSJA 3I7DA 3WV6A 1WMEA 1VBD2 3ZVXA 1QJX1 5AC91 2KXLA 3N35A 2WQZC 3ZFEA 2A70A 2X5IC 5JI7A 4TLFA 2ZGNA 1XQNA 1IHMA 4XQDA 1QJU1 5FLIA 2A7AA 4MYEA 4PLNA 1S0JA 4U2AA 2H0BA 3B3QE 4WM7C 2QUOA 4WVWA 2I74A 5SV8A 1QJX3 2GAUA 3MIHA 3IPVB 5JDBA 5JLVA 1C1LA 1VR3A 2UU8A 1VAKA 4XF4A 2ATFA 1VB4A 4FT8A 4D7SA 1TME3 1VAVA 2H6BA 3INAA 3UKVA 2JXAA 4YVSB 4Q4X2 1UU4A 1CAUB 1RUH1 1N1VA 1WMFA 3WQ1A 1Z7S3 1HKDA 1AYM1 1H4HA 4EV0A 3JZVA 4GALA 4XZPA 4M3CE 2EXKA 2XJQA 3ACLA 1WW7A 4DMIA 4Q4V3 4COUA 1S2BA 1RVF2 3DKWA 1PNGA 4Z8BA 1D4M3 1HXS3 3ZYRA 2GC3A 4EWDA 3N7MA 1V6LA 4X8PA 1DQ1A 1UN1A 2CY6A 2YROA 4RHV1 1VIWB 2RS11 1DZTA 2P3JA 3WG3A 4Q1RA 1BXHA 2XHKA 3AJYA 1HRI1 5BNOB 5JZGA 1DGWX 1W0PA 1ZREA 4GB31 3SMHA 1D0HA 5HCAA 1YJKA 3AK0A 5AC92 4Q0QA 1NCRB 1OOPB 2BFUS 2D6MA 2HWE3 3WR0A 2VQAA 3J8F1 4P9GA 1CX4A 1YFWA 3WQ0A 3ME2A 1G8WA 4KBBA 3GZAA 5JSRA 1QJU2 5A3LA 3WUCA 1Y43B 2VW1A 4HVOA 2JENA 2RR11 1MS3A 3DV8A 3TN91 1BQPA 5LEKA 1SBFA 1N1TA 5H9PA 4LHNA 4HSJA 1X8MA 1AXKA 5FMOS 1QH7A 1Q8OA 3EXUA 2B42B 3J8F3 2R0FA 4K6BA 5K0UB 2EF6A 3UV9A 4BE3A 3WP5A 2D93A 4NR1A 1ZZ8A 5GZEA 1URXA 1Q56A 2NLRA 4D94A 3VKOA 3H1YA 1RUH2 1AX2A 4BWOA 4NVPA 1AYM2 1FPN1 1UPSA 2VVDA 2CYFA 1O4TA 4P9LA 1DIWA 1MS9A 5TSWA 4ITCA 2JG9A 4Y4YA 4AEDA 3VL9A 3LKJA 1MQTA 4WVVA 5L7OB 1K5MA 2Z5WA 3EBRA 4OZXA 5C8CB 3HBZA 4Z07A 5EYXA 1KS4A 1WMDA 4URTA 3B93A 5GKAC 2CGPA 4ZKTB 3IDEA 3ZN4A 1ND2C 2FZ1A 4RHV2 2VECA 2RS51 4QGMA 5SV5A 2RS12 4W6WA 4FPKA 5DUXA 2WNVC 2D97A 1NLRA 4LULA 4AGGA 3WLUA 1LKNA 4Q4W1 4AHYA 1HRI2 3KB5A 3D4KA 2BWAA 4GB32 1NA1B 2I45A 5D8AA 4QQHA 3KT7A 2EXIA 1RUI3 3SISA 5GLVA 2P34A 1CONA 4XTPA 1RUF3 2GNMA 3M3CA 3WVJA 1SLIA 3DF0A 3VBRA 3BOWA 2E7QA 4V1PA 1YWKA 3GHNA 3OBRA 1CN1A 5GZCA 2VNGA 3AKQA 2SLIA 2RR12 1F8VA 1LHVA 3TN92 1KQRA 4L99A 1DHKB 2VOKA 3CL1A 1H8VA 4RR3B 4XMAA 5T3NA 2D5HA 2IXLA 2O0OA 4JRLA 1S0GA 4IEZA 4OLLA 4HPKB 1C4RA 1UZYA 2R1DA 4JGZC 1RMU3 1UW8A 4LBQB 1PVC2 2D3RA 5CVRA 1IOAA 5GLWA 4L2NA 1F5FA 1DU3D 4PLMA 1W0OA 1AR83 1ASJ3 4QQPA 4EN7B 4G3YC 4N90A 2LALA 3O0XA 1FPN2 1GQGA 5GALA 4OHZA 1ZRDA 1IS5A 1HLCA 1LOCA 1ZZ6A 2UWCA 3ZN6B 3EHKA 5EFUA 3WG1A 4QPGA 2XJTA 2QJVA 1Q8QA 2A6XA 3DN7A 2CWMA 5H9RA 4M0HA 4XFGA 2WKKA 4IV3A 4JGYB 5ACA1 2OUJA 1ND3A 3I59A 1UX6A 4R9AA 4HKWA 4P9XA 2P37A 5KXBA 4BMBA 2RM21 2RS52 1OA2A 1PIV3 1GKBA 4KG8A 4Q4W2 5H9SA 2BVBA 3RG0A 3RYRA 1FMD3 1LOBA 1N3OA 4CDXC 1QWRA 4YG0A 2KA3A 4WVZA 3VN4A 4EJRA 4Q8LA 2HWF3 3JCIA 3LA7A 5C9AA 4XBQA 1F31A 1ZZ9A 3NAPA 3WXPA 1YIFA 4GH4B 5JI9A 4LBNA 4WZCA 1QJY3 1C57A 2D43A 3RJ2X 3WW1A 4YVSC 1GYKA 1POV1 1H2NA 4MUVA 2ENRA 3MPBA 4MV2A 4GKYA 1W6OA 1WCSA 5CBLA 5DUWA 2GSYA 4QGLA 3O0VA 4Y26A 4S2FA 1O5UA 3TYJA 1NQJA 1KDKA 3FJSA 3L2HA 4XETA 4YZ1A 1AJOA 5CADA 4CDUA 4FVVA 1POV3 3AFGA 4Q1PA 1NCQB 5I8SA 1G9DA 1PVXA 4FCAA 3MZHA 1AR93 4EWEA 1IGOA 1NG0A 4KGQA 3KQRA 1FV3A 3VUOA 4RFT0 4YW3A 2WLQA 1DYKA 5BNOC 1B09A 4B8EA 1MS1A 2HWB3 3FWEA 1QOOA 2ZACA 4Q27A 3VZNA 3ST7A 5KBFA 2AYHA 2WJSA 5ACA2 1NCRC 1OOPC 4C90A 3O5SA 2NQYA 4JDMA 3QCWA 4S2GA 2WL1A 1OI6A 1ULFA 3T1LA 3VBUB 1G86A 1QXPA 1RUG3 4LE4A 3TOJA 4XQ4A 1WLWA 4GWMA 2EXHA 1ZBA2 2PFWA 3LOIA 4F7ZA 1F5JA 1CAXB 2ZJCA 3PHMA 3U0ZA 1J3RA 2D7FA 4OHVA 4P5HA 1PO13 3OGJA 2QVSB 5K0UC 1RHI2 4HL0A 5JOYA 2HWD1 2P2KA 1QOSA 3VKFC 5J3UA 2A6YA 1GZCA 1MS0A 1YFUA 4R9CA 4X8NA 5GLUA 5DG2A 4ONUA 3WDUA 3RZZA 3MLKA 1QNYA 3WHTA 3NL1A 2XUMA 3FFQA 4H55A 2I07B 3W59A 3IMNA 2AENA 3BPZA 4MGKE 3KS7A 4HFSA 4PLOA 4ISRA 1UZZA 2YPJA 4K21A 1C8NA 1KFXL 1YJLA 2WNUA 2E6VA 3O12A 4OI0A 4IERA 5FO9B 2JE7A 1HQNA 5I8YA 4R4XA 4EROA 2UWAA 5L7OC 5JAXA 3N3HA 3AJZA 5A32B 1ZM1A 2DCKA 2VVEA 4BLIA 5C8CC 3ZFGA 3WQ7A 3VZLA 1AR73 2QCSB 2WINB 4AEMA 5KHHA 3FZ3A 4IESA 2PHUA 2AR6A 5FOJB 4M00A 4FTBA 1A6CA 3JBG3 1YXWA 5JOWA 1G9AA 1NA1C 4W6XA 1QH6A 3CJIB 1A78A 3NO8A 1W6NB 3FBMA 2P17A 4GMP0 1Q8SA 4C1WA 2RJKA 1D0GA 2PA7A 2NMNA 1CESA 1R091 4XBNA 2Q0AA 1FOD1 4LO7A 4O9GA 1LENA 2CTVA 5K9YA 1XNCA 4JTOA 5I0TA 2JE9A 4QM8A 1XXNA 4YW1A 1HQLA 1KD7A 5K8SA 1FAYA 1MEC1 1H8TB 1YO8A 2EA7A 2XJRA 2K9ZA 4Z2WA 4XXPA 4YYOA 1BEV1 4RR3C 1BBT1 2ZHKA 2DCYA 4LR4A 3GZTB 4MGYE 1AR61 4M3CA 4HMZA 2EALA 3AZXA 2HWC1 3R6SA 3MICA 4IL7A 4CDWA 3J4UH 3ZXFA 3M3OA 4YZ2A 1MZ6A 2ZTNA 4W6YA 4RSUA 1WCDJ 2GH8A 2ZAAA 3ROUA 1O3RA 3V65A 2QQPA 3WW4A 3OGGA 2ZCWA 5BV6A 3AXEA 2VNRA 4QPIB 4FPHA 3VLBB 4ZU4A 1GV9A 3WG4A 2XPJA 4FO9A 4BQ1A 3WUDA 1CQ9A 3B02A 5F6LB 1RUD3 2FHRA 4AQTA 1MZEA 2BTVC 1EV12 2PHLA 5CFCB 2GALA 1VBC3 4N9IA 1AL0G 1OFSA 1DQ5A 4HETA 3ZYPA 1CJPA 1HRV2 3S6PA 1EY2A 4LO8A 4LT5A 1NOVA 1NZCA 1APNA 1GR3A 1LHNA 2JECA 4E2GA 4YM0A 4BA6A 2UYBA 3OY8A 5C4WA 4FAGA 2RS31 1FOD2 2AH2A 3MEPA 4GH4C 3KT1A 2W52A 5E1RA 2PAEA 2XL7A 1ONAA 3PTYA 5E16A 2WFPA 3E6CC 1LR5A 3AMQA 1MEC2 4YVWA 1NY71 3IDCB 1VJ2A 1UAIA 2R073 1BBT2 1S0DA 1UMZA 1RUNA 2B39A 1AR62 4N43A 2YZ4A 1S0CA 4FPLA 3RMYA 3T2TA 3OBTA 3WOGA 3PVBB 2Y0OA 1C8M2 1ZRRA 1HV0A 4OUSA 1W6QB 2R041 2BWCA 5EV7A 4FOWA 1H4GA 4BM8A 4E2QA 2WS92 2DFBA 1IQAA 1CR7A 4CEYB 2ZBJA 4YGCA 1FX5A 2XVGA 1R1A3 4LA2A 4UW6A 4OHYA 5DZEA 1MACA 2XB6C 2I2SA 4N7UA 2XLFA 3WP6A 4N7IA 2IWGB 1LB2A 1OLRA 2FZ2A 3B69A 1PO21 1QHDA 2Z69A 3BALA 3JB4C 5CFDB 1V6KA 5C33A 1R1ZA 3HAGA 4Y24A 5HI0A 3VV1A 2GU9A 5J96B 3D6EA 2ERFA 3PNAA 3VBUC 3VBHC 4BIFA 1AYN1 2P3KA 2VVFA 3SCFA 1XE8A 3UK9A 4AXOA 2JJ6A 2BGCA 1CAVB 4CZSA 1U5IA 3VBSC 4B29A 5T5PA 2ET1A 1XNKA 1LOEA 2HEYF 2XJUA 2VGDA 1VBA3 1H0BA 2UWBA 4XPVA 2UYAA 1XYOA 3ILRA 4O9EA 4QM9A 2WFF3 3ZYJB 1W6MA 3C2UA 1OKQA 4FOQA 4AI1A 4LUMA 1JN2P 2D6NA 5EXOA 4XIKA 1T6GC 1LOFA 3H1MA 2Y38A 4IEPA 1OA3A 3VDDC 3QH6A 3WCSA 1OQDA 4CDQC 2DUOA 1BYHA 1U5YA 4K1YA 4XQWA 2PQQA 1OPMA 1PMIA 2GN7A 1EP0A 5F6KA 1GZ9A 1OPOA 4I0WB 3GNEA 4C0HA 1RGSA 2CGOA 4OI1A 3AFKA 4XJZA 1NXD1 2R042 3SH4A 4WM8B 3SHRA 4NHMA 1IKPA 2MPFA 3AKPA 3V56A 3P3NA 4XTMA 1M4WA 1MVQA 5DDJ3 4FPYA 4WZFA 2VQ0A 4QQ2A 4JCKA 4RS5B 1EYBA 5C8WA 5T50A 3CJIC 3BU7A 3JQWA 1AL23 1IZ3A 1PO22 1O4YA 4Y1YA 1NYWA 3WHUA 2OPKA 3NV2A 1PK6B 1QQP3 3KCXA 5EYYA 3LA2A 1QNWA 4Z92B 2CAVA 5BNPA 3ALQA 1LHUA 2UURA 3AMMA 3ATGA 3MI8A 1AYN2 4ZXKA 1H2MA 1GFF2 3NKTA 3MGUA 3TRSB 1H8TC 4I0BA 3OJBA 1TME1 4YG6A 3K51A 1GICA 3I8TA 5KC5A 1SLAA 3LB9A 4ATFA 4H7MA 1UL9A 1SFYA 2BNOA 3FE5A 2QZ2A 1X82A 2A3YA 3VGIA 1Z7S1 4CDXB 3QH7A 1QF3A 4YG3A 3WW3A 2WZPP 1SLLA 3DPRB 4ASMB 3H3UA 4CP0A 4DB5A 4QPYA 4PDWA 1PZ7A 3OCPA 3EQEA 3KD4A 4A7YA 2VOWA 4Q4V1 2WA4A 1UKGA 2ZPXA 4COZA 4FPGA 1QOTA 4H14A 5AFBA 4QPIC 4XDQA 4AGRA 1D4M1 5GLZA 2WZR1 4IEQA 1HXS1 4A2UA 5K7PA 5LRSA 5AVPA 3RI9A 1G6NA 4LBOA 4IV1B 2YV8A 4FOVA 4MH0E 1Q3EA 4H7LA 4DY5A 1IS4A 2F6BA 2ZA9A 2WSVA 3OF1A 4LBJA 1PZ8A 2EAAA 4UBGA 5CFCC 5J98B 4XF1A 4CEWB 1YIPA 4XFCA 4WVMA 3ZFFB 1WA4A 1ALYA 4AEKA 2QE3A 3ZPYA 2HWE1 1XNDA 1ZZBA 3RSJA 1A3KA 2JX9A 2WZR3 3WNXA 2XBO2 4AHWA 5BYNA 3VBOC 3OYWB 1AXZA 3ZSMA 1J59A 4AHXA 3O14A 3AP5A 4XBLA 3QLQA 5IK4A 3JB8A 4LUKA 5BNNA 3S7EA 1B35B 1D2SA 1QJX2 1LRHA 1XU1A 3X29B 5DZGA 1QDOA 3M7AA 4JGYA 1QMJA 1SCSA 3C3VA 2GNDA 3ZX7A 2B9UA 1RJ7A 4HBNA 2PHFA 4AYUA 4HLTA 4RQPA 1DBNA 2VULA 3SLIA 5E88A 2NM1A 1OQ1A 3WDXA 5ABJA 1ZX5A 1Z7S2 4COVA 1AZDA 4UBHA 2OZJA 2Z79A 1C5HA 3WDWA 2HEWF 3VBFB 1QKQA 3SXWA 4DPNA 3V0BB 5KXCA 2XH6A 4QGNA 2EVXA 3B9CA 1GSLA 3IKWA 4Q4V2 4FP3A 1JXNA 2PELA 4CEYC 4M3CF 1BZWA 3H0OA 2WSUA 4MLOA 1D4M2 1BCXA 1HXS2 2NN8A 1AX0A 4WBBA 1NQDA 2ZOEB 3AP9A 4YW5A 2XG3A 4Y1VA 2NZ9A 1POV0 3B94A 2AUYA 5CFDC 1G9BA 4R9BA 3PJQA 3MIGA 3EO6A 4AVTA 4HK9A 1RUI1 4A3XA 4GXLA 1RUF1 1NCQA 1CAWB 3NVCA 5JVVA 3GALA 2FBEA 1N3PA 3AZVA 3KLSA 4JTNA 4RGAA 4XILA 3WDYA 4AI8A 5KHIA 4Y1UA 1LCLA 5CNAA 4A7KA 1O5LA 2Z42A 4KNCA 5FOBB 1QDCA 3SH5A 4FXKB 3USSA 4MVTA 4XJ9A 3R0RA 4YM1A 3J8F2 3ZFEB 1SBEA 2ES3A 2PN5A 2ZZQA 2P3IA 2PTMA 1AXYA 3VHPA 1RMU1 3V0AB 5I91A 1OFNA 4YFWA 2DUQA 2MEV3 5FAXA 1H9PA