5T5LA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5lA00
4PQ9A 3SNMA 2EIGA 1ENSA 3HN1A 4FOWA 1LESA 3WLUA 2NN8A 1DYKA 3ATGA 1C1FA 2AR6A 4Q1RA 4Y22A 5IK5A 3SH5A 3HR9A 1VIWB 2JD4A 3AP5A 4FVVA 2ZAAA 2DYCA 2PELA 1LHUA 1G9DA 1GZ9A 5H9RA 1G9CA 1UL9A 2ENRA 3V0BB 3MEPA 1QGLA 3WDVA 1JUIA 1ULGA 1TEIA 2NMOA 4BPZA 4Y1YA 4XXPA 1JXNA 4WVWA 4U36A 2D6KA 1V6NA 3VKNA 4XJAA 3ZYRA 1G7YA 3O0WA 4YW2A 4R9CA 1S0JA 1UKGA 1ULEA 1WW7A 1GZWA 1NXD1 4YGBA 1DHKB 2AYHA 1AZDA 3NWKA 4ITCA 4XJ9A 4Y20A 3VKMA 1KJRA 1U0AA 4Q8KA 2OW4A 4Q26A 2B7YA 1B09A 3RMXA 4FPCA 2VY0A 4LBOA 2UURA 4XMIA 1GANA 3N35A 1URXA 4M3CA 1HLCA 3WVJA 3M3CA 4XXAA 4FPJA 2GDFA 2NMNA 5T5PA 1LEDA 1G9BA 2ZGKA 5JDBA 3R4UA 3FLTA 5GLUA 3AXEA 4FQ4A 3ASIA 2DUPA 4Y26A 2A7AA 3OBTA 2A6YA 2ZACA 4M3CF 5DUVA 1D2SA 1JOJA 4JRAA 4XHXA 1QKQA 2D6NA 3PMEA 2NYYA 5DZEA 3WDUA 1SLLA 2D3PA 4R9BA 4ATEA 5JOXA 2ES3A 1W6PA 1V6JA 1MACA 3MW2A 1WLDA 4FPKA 2LTNA 5KXEA 1LHNA 2LALA 5FREA 4BLJA 2NP0A 1GBGA 1KDMA 1SACA 2A6VA 2ZGPA 4AYUA 4ZXKA 2H0BA 1DLLA 1CJPA 4XTPA 4M3CE 2E7QA 3FFZA 1W0PA 3SITA 3RS6A 2P3KA 4IQPA 2DU0A 3GALA 1BYHA 4GWMA 1AX2A 2A6WA 1GNZA 1SLTA 5DUUA 1S0FA 1QNYA 5EWSA 5H9SA 3ZPYA 2W68A 1LU2A 1DQ0A 4FP3A 2R1BA 3AJYA 4BOWA 5GM0A 2RHPA 2DV9A 3ZVXA 3Q9OA 3N7MA 4AVVA 1CVNA 5T5LA 3D6EA 1Q56A 2CNAA 2EXKA 5CAZA 2D3SA 1N1TA 1BXHA 4LBLA 2PHXA 1SLBA 2P2KA 3N7LA 4XHBA 1UX6A 5SV8A 1IS3A 2WT0A 3MPPG 2JJ6A 1DBNA 2YXSA 3B00A 2CTVA 1J1TA 2PHFA 4BM8A 1DFQA 1ZA4A 2E53A 5JVVA 2YMZA 1LOEA 4Q2FA 4W65A 2CWSA 4YW4A 4CRQA 1DIWA 1CONA 4M3CB 3SH4A 4SLIA 4F83A 2DVFA 1ULFA 2DURA 1W6MA 1N1VA 4C1XA 1LULA 3IKWA 5DXDA 3BIWE 3B3QE 1AXKA 2SLIA 2WKKA 2A3YA 2DUOA 2UWAA 3DGTA 2CWMA 4K20A 1ONAA 3IN9A 4I30A 1F9KA 1KRIA 2AREA 2R49A 1GZCA 1Q8OA 4P9WA 3N36A 4YGCA 1JBCA 5T52A 3WCSA 3WG2A 1MS8A 1LOCA 1GNHA 1Q8QA 1HKDA 3IMNA 1W6PB 5CB7A 1LGCA 4FPFA 5DG1A 4XBLA 2D6OX 2ZGRA 3C2UA 1F31A 4JCKA 3B69A 1AF9A 4Y1UA 2A6XA 3B01A 1RITA 2GNBA 5JMCA 3R4SA 1WD4A 2D7FA 2ZABA 2D43A 1JN2P 4BMEA 4AGRA 4YZ4A 5HCBA 2KM2A 1V6IA 5GLVA 2A75A 3ZYPA 4XBQA 1PZ9A 3UJOA 3USUA 1W0OA 1Z0HA 5T54A 3PVOA 4GKYA 3W59A 4D69A 2EXJA 1Q8PA 3NV1A 4FPGA 1UZYA 1I1EA 3VKFC 1SBDA 4FOYA 4ZKTB 3AFKA 3ZXEA 4LBQA 5GZDA 4ISQA 5E8AA 1IS6A 3VV1A 4BLIA 1AX0A 4L8QA 1WLCA 2D6LX 3AYAA 3D5OA 1QU0A 3HMYA 2JKBA 1IS4A 3R05A 4RL7A 1ULCA 2OUHA 4M00A 1HQWA 4XJ8A 1WBFA 5F9TA 3WG3A 1QNWA 1LEMA 3APBA 4YM1A 4NO4A 1W6OA 5LK5A 1JHNA 5JOWA 1KITA 3TAYA 4P14A 3AP6A 1OFSA 3ILFA 4K21A 4WVVA 1LOFC 1MS3A 2PHTA 4XJWA 4Q8LA 1SLAA 3BOPA 5T55A 3WHUA 1AJOA 2G4IA 4FOVA 1WUVA 2WT2A 2AUYA 3WDYA 1A8DA 1MVQA 4Y1ZA 1JW6A 3M1HA 3ENRA 1JYIA 1C1LA 5GJ6A 1W6MB 1LHVA 2PHRA 3AYCA 3OY8A 2ZHLA 3UK9A 1WD3A 4CTEA 3O12A 4GKXA 2SBAA 2BQPA 2ZGUA 3M3EA 3FLPA 3AXDA 4NOTA 1FNZA 3AYEA 5IT6A 1YO8A 2R16A 1W6QA 4OZXA 4XOGA 3IPVB 2JE9A 4YM0A 4K1ZA 5F5QA 1LENA 4FP2A 1VAVA 2CY6A 3POSA 1QDCA 2EXIA 3H0OA 3AZXA 2CL2A 3AX4A 1N3PA 3IM0A 4LBNA 1IS5A 5E88A 4AVSA 1MS5A 3FLRA 3B9CA 1LGNA 1CR7A 3USUB 2VXRA 5EYXA 3WG4A 1APNA 4FPHA 1LOGA 1C4RA 5L73A 4Y24A 4UW4A 3AJZA 4Y22B 1MZ5A 1UN1A 1WW6A 3OGGA 5GLZA 4R9AA 4XJUA 4LBQB 3T2TA 1W6NA 5GALA 3T1LA 4AVTA 5H9PA 2VU9A 1SFYA 5CA6A 4M01A 4DRRA 3NV3A 4H55A 1CN1A 3RRDA 3INAA 1DQ5A 2ZGNA 4DPNA 4YW5A 4YW3A 2D3RA 1UAIA 2R0HA 2ZMLA 3PVEA 4YFWA 2DTYA 4K1YA 2YROA 3I8TA 4DS0A 1FATA 2WNEA 4LBKA 3WNXA 2TEPA 3BTAA 4XIOA 2WSUA 2ZGOA 5KXDA 1GZWB 4LBMA 4YGEA 4Y20B 4YM3A 3VKLA 1ULDA 2W52A 1Q8VA 1SLIA 2UWCA 3PVNA 4XIKA 2PHWA 2GMEA 4Z8BA 1LHWA 1SCSA 2P3JA 3WUDA 1YI7A 3ZXFA 1CPNA 3M2MA 3AP7A 4FQZA 2C5DA 3ZXLA 4YZ5A 5DZFA 4U2AA 1AXYA 2EAKA 1ENQA 2UU8A 3OY8B 4FPYA 3KM5A 4FPLA 3V64A 5EYYA 2C9AA 1DZQA 3O0VA 1LOAA 2ARXA 1GYKA 4YG0A 3WCRA 3WUCA 1H9WA 1DYPA 2ZMKA 3SLIA 4YZ2A 1GV9A 2A6ZA 1W6QB 4GALA 3LCPA 3WG1A 3O0XA 1MZ6A 4XTMA 4AGGA 3JUUA 5CBLA 5HCFA 2W39A 1BKZA 1AXZA 2P34A 1VALA 1X50A 4Q1PA 4RA0A 3AZVA 1KDKA 3RSJA 3ZSJA 3DUIA 4ATFA 3AK0A 4GA9A 1KJLA 2UWBA 1EPWA 2EALA 1FAYA 1LU1A 4FPOB 2DU1A 2YY1A 5KXBA 1WW4A 3U4XA 1S0IA 2R0FA 3AZZA 4YLZA 2ZGLA 3AYDA 3WZ1A 1GSLA 4YZ3A 1DQ4A 2E51A 4GWNA 3GNEA 3ILNA 1S1AA 1BZWA 1SCRA 5H9QA 3UJQA 1DQ1A 3SISA 1Z78A 1ZM1A 1GLHA 2A3XA 2ZA9A 4ASMB 3AP9A 3D4KA 2A70A 4DQAA 2I2SA 5BYNA 2DUQA 5JLVA 1Q8SA 3VUOA 1S0CA 3LSDA 3BODA 1LTEA 4PCRA 1CESA 2AH2A 2XB6C 1KQRA 2W08A 1YXWA 2WJSA 4WZFA 3CNAA 3NV4A 1SBFA 2NM1A 1SBEA 1HDKA 1PZ8A 1AVBA 3QCWA 1V6MA 3RMYA 1XQNA 4XJZA 1G8WA 3OYWA 1IOAA 1N1SA 5IK7A 1DQ6A 3UL2A 1VAMA 2Z42A 5IUQA 4WV8A 5CNAA 2ZZJA 1H9PA 3V0AA 1LHOA 2DTWA 2VW2A 4FPEA 3I4IA 1N1YA 3MW4A 3PJQA 1N47A 3ZSMA 1QOTA 2DVDA 1GICA 4YW1A 1NLSA 2ZGTA 2GMPA 4CZSA 3MW3A 1HQLA 5DZGA 1BQPA 2DWRA 1SLCA 1V00A 4JC1A 2DVAA 3JU9A 1CIWA 1CQ9A 2P37A 2GN7A 1R1ZA 2A3WA 1OKQA 2FHRA 1O4YA 3QLQA 4XILA 2D6PA 1D0HA 4P9YA 5FRAA 1IKPA 1LOBA 3SH3A 4ISRA 4MYEA 4DFSA 1DQ2A 2YV8A 4PBOA 3OBRA 4HANA 4YFZA 5T5OA 3ILRA 1LJ7A 2CYFA 3T1MA 3V65A 1UMZA 3M3OA 4BQ1A 3A0KA 4C1WA 3TB0A 2ERFA 3A4UA 3AZWA 2NZ9A 3FUOA 3POYA 3WHTA 1MS4A 2Q5TA 3W58A 5JOZA 2E7TA 2ZHNA 1A78A 2VUAA 3WOGA 5HCAA 3LSEA 3WDXA 4BMBA 1WLWA 3RQ0A 1RIRA 4HL0A 5GZCA 2P3IA 1LODA 3N7JA 1N3OA 1MS9A 1O4ZA 3O5SA 3RG0A 1FNYA 2ARBA 1F5FA 1LOFA 1C57A 1CPMA 1LCLA 4Q27A 2JE7A 4LBQD 3N3HA 3M3QA 4YM2A 3A0NA 5IK8A 3ZSLA 4DRVA 1WCSA 4TZDA 1BJQA 1FYUA 5T50A 1QF3A 2YZ4A 5DG2A 1I3HA 5GLTA 1S0DA 2GN3A 1S0BA 3ZSKA 1QOOA 1G86A 2GMMA 4AGVA 1G9FA 2GALA 2WQZC 4UW5A 3OYWB 3WDWA 1V6LA 2PHUA 1W6OB 2WSVA 2OUJA 4P9XA 1H30A 4Y1XA 2ZHKA 2OVUA 1UPSA 1MS1A 2VH9A 5GZFA 2FMDA 2JDZA 3L2YA 3V0AB 1V6KA 1MS0A 2E6VA 1FV3A 1UZZA 2ZHMA 2DVGA 1V6OA 2ZMNA 2VW0A 3AP4A 2AGSA 1OQ1A 4PF5A 4UW6A 4Y1VA 3POWA 1ENRA 2EXHA 4YGDA 3ZXJA 5DUXA 3V0BA 2JECA 5IK4A 2ZGMA 1FX5A 1MVEA 1G9AA 2DVBA 4XZPA 4YG3A 2WLQA 4XYXA 1YYNA 4R9DA 4YG6A 4YZ1A 1DGLA 5DUWA 5AVAA 1AJKA 1VLNA 1YRZA 1RINA 1WW5A 3WV6A 2V73A 3VKOA 1AX1A 4UW3A 1N3QA 1S0EA 4PBPA 5GLWA 5GZGA 1FV2A 1GKBA 3N7KA 2EF6A 4XMAA 3FUQA 2GNMA 5GZEA 5KXCA 2ZKNA 2R1DA 2AENA 2D6MA 2WT1A 1JYCA 5T5JA 3WDTA 4XBNA 3AZYA 1QDOA 3KQRA 1S0GA 5E89A 4GXLA 3OJBA 4XE9A 4TYSA 2A5ZA 4FOQA 2ZBJA 3ZXKA 3OPZA 1QOSA 1QMJA 4KBBA 2A71A 2ZGQA 1LGBA 5EXOA 1LECA 3IPVA 3FBYA 1W6NB 4AWDA 2GNTA 2HYKA 1YIFA 3NV2A 1A3KA 1WBLA 1IKQA 2GNDA 2V5YA 1Y7BA 2ZGSA 1MR5A 5JOYA 4LBJA 2VW1A 2D44A 2XG3A 1PZ7A 4XDQA
chains in the Genus database with same CATH superfamily
1RUJ2 4YNIA 2ZX0A 1FPN2 1W28A 4CU9A 5JZGB 3NJZA 2EIGA 2CU5A 1ENSA 4LKFA 5FV3A 4D6QA 5EPAA 1WA4A 2NN8A 4S2HA 2ORXA 1C1FA 1REDA 4Y22A 4YARA 3SH5A 3U14A 1VIWB 2ZEZA 3AP5A 2W87A 4FVVA 4IGQA 2BERA 3V0BB 1G9DA 5JSOA 3HQXA 3MEPA 1QGLA 1PHMA 3WDVA 2VVDA 2VOTA 1ULGA 2NMOA 2Q1MA 4OHVA 4Y1YA 4XXPA 1RHI1 5LRRA 5JSPA 5F1RA 4XJAA 3ZYRA 1JZ4A 1UNBA 2XXZA 4UBGA 1EPZA 3GHNA 3J7LA 4R9CA 2F6BA 3ZPOA 5FOBB 2D97A 3ITQA 1AYM1 1WW7A 1NXD1 1XOYA 1NA1B 4Y20A 2PMWB 3JD71 1BHGA 1KJRA 1VBC3 5FQ0B 4Z92B 4OHYA 1HRI3 2XMLA 4FPCA 1LB2A 2HWE2 1ASJ2 4KL1A 1WCUA 4XMIA 3N35A 1URXA 4M3CA 1HLCA 1OOPC 3S0MA 2BNOA 3F2ZA 1NY72 2QQMA 2G9FA 3HT1A 4LUKA 2B9UA 1LEDA 5BNPA 3R4UA 3VBSA 4A3XA 4F8AA 1EYBA 5A33B 4AI0A 1NLQA 1CAXA 1W0NA 1CAVB 2Y0OA 4H2AA 3TYJA 1AR82 1E57A 2A7AA 4CP9A 5FPZA 1JZ8A 3H7JA 2MNGA 4RHV2 1D2SA 1ZBA2 3LA7A 4MSVA 2PA7A 4XHXA 5DZEA 4B29A 4ATEA 2D3PA 4PIZA 3RZHA 1WA6X 3VBHB 1V6JA 1MACA 3BN6A 3MW2A 1W8TA 5KHGA 3MLJA 1Z7S3 4Q5OA 4A4AA 4BLJA 1IGOA 2VBBA 1PO11 1SACA 2RS13 2ZGPA 4L11A 1AR61 4LKSA 4I0BA 1PO21 4QDRA 5A80A 4JV4A 4ZXKA 1J3QA 2H0VA 1JH5A 2XJRA 3NAPC 1NCRC 1CJPA 3PTRB 4QD2A 1BYHA 4QQ2A 5FZMA 1G9AA 3POEA 3KB5A 3PUAA 1GNZA 2YC0A 1S0FA 4UXAA 5F37A 4MX3A 1XNCA 5A32A 3CZJA 4CDWA 3ZO0B 4BOWA 1TZOA 4AG4A 2VQAA 4XCAA 2XDVA 4D6RA 2RHPA 1QJZA 1C8M1 2DV9A 3ZVXA 2X53S 3Q9OA 4CEWA 1PMIA 1YFXA 2IVIB 5T5LA 3RVHA 3PIJA 4JTOA 1XNKA 4GD4A 4IV1C 5A3LA 2CGPA 4W6XA 2XJSA 1EV13 1YQ5A 2DCTA 4QQPA 3ZKYA 4XHBA 4GH4C 1OA3A 1AYN2 4PQQA 1IS3A 1RUG1 1QJX1 3I2JA 3QD6A 5FMCA 5SV8A 3VDBA 3B00A 1J3PA 1DBNA 3O1MA 1X9PA 3E5UA 2CTVA 2VMDA 1RC6A 1VBD1 4AI1A 2WQ4A 1ZA4A 3IDAA 1HRV1 1OFNA 5G05L 4NRMA 5FO8B 1KS5A 4M3CB 3MHZA 3SH4A 5HBAA 4WM8B 2E32A 4F83A 1VBA1 5FLHA 3ZYIB 2DVFA 5BNPB 5LBEA 1W6MA 3VBSB 4C1XA 3H8RA 4CDXC 5KR7A 2BV4A 4S2GA 5FUNA 2SLIA 2ADEA 3LF7A 3DGTA 2UWAA 1BBT2 1UPIA 2GSYA 2O8QA 1JBCA 4NRPA 5K7PA 3E97A 1BEV2 5D2AA 1SZBA 3WCSA 1Y3TA 4W6WA 1Q8QA 1BLZA 3KVBA 2OS2A 3Q8EA 1I5ZA 5CB7A 1LGCA 1KEXA 4ZU4A 4XBLA 1CIYA 2ZGRA 3C2UA 2R30A 2VOWA 1AF9A 3GJAA 3M8LA 3B01A 5AC93 1W9TA 2GNBA 5FYVA 1NYWA 1QEXA 5E1RA 5EHDA 3ZXDA 2ILMA 4YZ4A 5HCBA 1RVF2 2XGXA 5I0DA 3F95A 4XBQA 3USUA 3K4DA 1Z0HA 1US2A 3ZFGB 1W9WA 4COWA 5IATA 4LNVA 2EXJA 1Q8PA 4ZS3A 5A32B 5DDJ2 1PGL2 4CDWB 1UZYA 3WF1A 2PLV1 3WEZA 3VKFC 4FOYA 1TMF1 4XDPA 3ZXEA 1KFUL 4LBQA 1KS4A 4ISQA 5E8AA 4XPVA 2WWUA 1IS6A 4OZOA 4XFHA 5FKCA 2VC9A 1AX0A 4CCNA 4DZGA 1BCXA 1QJFA 3D5OA 3MPBA 4MXWA 2HWD2 2JKBA 4QPIB 2Q0AA 4GWJA 4CUAA 3K4AA 1WBFA 1ND3B 1UZVA 2FDIA 3NNMA 3HNMA 4I02A 2P6CA 2G9ZA 3APBA 4YM1A 3DXTA 1W6OA 1Y9QA 3J8F1 4CP1A 1WMFA 3AP6A 4PLMA 4K21A 4WVVA 2J7MA 2QCSB 2Y33A 5LA0A 4A41A 2ZAHA 2VUDA 1AJOA 2G4IA 4FOVA 2Y64A 4Q4Y3 4AZZA 5FZ4A 1JYIA 1C1LA 5GJ6A 1RUE1 1W6MB 1GWMA 5ANNA 4IETA 4XAAA 5A6XA 3O1UA 1H4GA 1NX9A 2YDEA 4QKFA 4E4HA 4Q0QA 2B42B 4E4ZA 3M3IA 3M3EA 1VBC2 3FLPA 2W1QA 3AXDA 3H1YA 3PU8A 1HRI2 2MEV3 3AYEA 5EP9A 5FYTA 1W8UA 2PHLA 4OZXA 2PFWA 2ZX3A 1YUDA 4XOGA 2V4AA 2J1VA 3RZJA 2VUCA 5FXXA 5F5QA 4UF0A 1LENA 4N7UA 4FP2A 2QE3A 3I2DA 3POSA 2CL2A 4IGPA 1N3PA 5IJRA 1ZZBA 2OT7A 3IM0A 3NNGA 3OBZA 1GOHA 1YNAA 3CDZB 4AQ6A 4WZCA 4CDUC 4M0HA 1LGNA 3ES1A 3USUB 3WG4A 5FBJA 3C8XA 2J1RA 3GGLA 1C4RA 3DPRB 4CCOA 1Z7S2 3I97A 3J7MA 3SCFA 2W5FA 3I49A 2LUWA 2ZKLA 3DKWA 3KF3A 3THDA 4LBQB 1OOPA 4MHUA 1D4VB 2VMIA 3OPTA 4AVTA 1CAUA 4MXWB 5C4WB 5H9PA 3MFAA 1K12A 5CA6A 2FCTA 4DRRA 4EN7B 3T09A 1R64A 3INAA 4GMP1 1H2KA 1DQ5A 2VMCA 2WS92 3I3EA 4X6QB 2QDNA 2RM23 2ZPXA 5FPAA 2VVEA 3DECA 4NE9A 4YW3A 3CJXA 3ZFFC 1FATA 5FBZA 2UYAA 2TEPA 2ZGOA 2H6BA 3SC7X 1GZWB 1JUHA 4YM3A 3VKLA 3UKTA 4LHLA 1SLIA 4XIKA 4Y33A 5J96B 2BDRA 1EV12 2DCYA 2WBKA 3FL7A 4ORFA 1YCIA 2QNKA 3M2MA 4HG6B 5CKMA 3ROUA 4YZ5A 5DZFA 3K48A 3NAPA 1R1A3 3ZMNA 1NCRA 1EAH3 1NT0A 3GZAA 5FMDA 4FPLA 1JI6A 3VDDB 1POV1 1GOGA 1QQP1 1DYPA 1T6GC 3SLIA 4KH9A 1IPSA 3WG1A 4RS5C 5DAXA 4YWAA 3OEAA 4NRQA 4UF0B 5CVRA 2XQRA 4QQLA 3QBQA 1O4TA 4GA9A 3U78A 3VD4A 5FLIA 1PM7A 1UOJA 5LW9A 4HXCA 2HBTA 4FPOB 4GB31 2P5BA 2DU1A 5KXBA 4QGLA 5FCCA 3BKZA 2JIJA 1RUH3 4GH4A 3ETPA 4PLNA 4UFMA 4Z07A 3VD9A 2QJVA 3DL3A 4URTA 3WY6A 5C5UA 3K46A 4I09A 1JYVA 2E51A 3I59A 4JGZC 3D0SA 1BZWA 3LDBA 3UJQA 3SISA 4RR3C 4I01A 1GLHA 5D8AB 1ODNA 2CGNA 5AC92 5JLVA 2A70A 3VZKA 4DQAA 3MDPA 1NCQC 1OOPB 3U75A 5F5IA 5JI9A 4XUQA 2WAAA 4ZONA 1CAUB 4NIGA 3KV4A 1KQRA 4BE3A 4PJYA 3PLQA 4CDXA 4WZFA 5ABJB 1MEC1 5HXMA 5CZKA 3S57A 1U5ZA 2VR4A 3DYPA 1SBFA 2NM1A 2RR13 1AVBA 1OQDA 3QCWA 3URFA 2Z5WA 1ZYBA 5IVEA 5BNQA 3OYWA 1PIV1 1PVC3 4GQ7A 1VAMA 2FZ1A 4IL7A 4LPLA 3BPSA 4XF4A 5CNAA 4YVWA 2RJ2A 2DTWA 2VW2A 4KG8A 4V2WA 4FPEA 4PDWC 1N1YA 4TLGA 3MW4A 4L9BA 1VRH1 4ZPIA 3ZSMA 5BNOC 4HMZA 2ZGTA 1VPHA 1HQLA 2PQQA 1R091 4EE2A 2IZWA 2FDFA 2DVAA 3JU9A 1ND2C 1NCRB 1CQ9A 3MIEA 4RQPB 1OKQA 4QU1A 1O4YA 2HWC1 5ACA1 1AL23 2ZEXA 3KF5A 1D0HA 1UU6A 3NRUA 4P9YA 5CKNA 5LEJA 2WZR3 2LW8A 2VBDA 3HBZA 1CZSA 1XNBA 3MIFA 4DFSA 2YV8A 4I0WB 4PBOA 1FI2A 5T5OA 1QJU2 2CYFA 4Q4Y2 3H3LA 1W3VA 3T1MA 3V65A 3K3OA 4A7KA 3TB0A 2ERFA 1V9U3 3FUOA 2VM9A 4GIQA 5FXVA 3U37A 2HWF1 4IV3B 3UGFA 1W8WA 3KCYA 3BU7A 3UGGA 4W50A 5IAVA 1OUSA 5HCAA 4OHZA 3NJVA 1COV3 3TRSB 3A23A 2MEV2 1U12A 3ZYHA 4JHTA 2Y6FA 5I0TA 3Q8FA 5FZ3A 1ZBE1 1DGRN 3MI8A 3M70A 3TN91 4JGYC 3I59B 1C57A 3C7OA 1PK6B 2XR4A 2JE7A 3M3QA 3ZSLA 4DRVA 1WCQA 1QJY1 1NAEA 3CIHA 4QXBA 2ET1A 4COYA 2QQNA 4NAMA 4CDXB 4XF1A 2YZ4A 2O0OA 1XNTA 1S0DA 2GN3A 1S0BA 2JDNA 3HIFA 2GMMA 4K40A 1G9FA 4IERA 2C4XA 3GBFA 2WIIB 1F5JA 4JKLA 3OYWB 1V6LA 5IHRA 4JHZA 5J3UA 1BVP1 2JE8A 4P9XA 5LY2A 2OUJA 3TNPB 5EIYB 4YVWB 3LOBA 1R083 2VH9A 1UPSA 3NNLA 1PMJX 1MS0A 1V6KA 1YFYA 4FBFA 1V6OA 1AR93 1MZEA 1IG0A 2AGSA 3AP4A 4UW6A 2BW8A 2RM22 5FPXA 4COUA 1OI6A 2EXHA 2IC1A 4CCKA 2JECA 5LASA 5IK4A 5K9YA 4CDUA 3AM2A 1IHMA 3CJIC 3ZIXA 1WLTA 1VLNA 4FTBA 4HBNA 1H8TC 2DCKA 1SDDB 3WV6A 5J37A 4N53C 4EROA 1AX1A 1JMUB 3ZYBA 3CMGA 1NZIA 1S0EA 3POBA 1D4M2 5GZGA 3TNQA 3E6DA 3PHMA 2BNNA 1L3JA 4QKNA 4CXYA 2B9VA 4XMAA 3WF4A 3RZZA 1RMU3 4QHBA 2RDNA 3ES4A 1HJFA 1E5SA 3RI9A 5IVFA 1HN0A 3WDTA 3IB3A 4I2OA 5J7MA 2YUEA 2WRAA 3KQRA 5JR2A 1ZVFA 4GXLA 3OJBA 3N9MA 4FOQA 4O65A 3I3QA 3AVSA 2HEVF 5L9VA 1QOSA 4XF0A 2ETEA 2ZGQA 1VB4A 1W39A 1FPN3 5GKAC 4ASKA 1LECA 3IPVA 1O3QA 4CP0A 2BGPA 1RUH2 1W6NB 2GNTA 3ZFEA 4OFGA 2XJQA 2VECA 2JG8C 3HPNA 2GC3A 4B1MA 2V5YA 2ZGSA 1SDWA 1MR5A 4A3ZA 4LBJA 4PIXA 1W8ZA 2VJXA 5A6ZA 3BTXA 2D44A 1ZA7A 1XXNA 3ALQA 2Y6GA 5IW0A 2VTXJ 1EY2A 4PQ9A 2VBPA 3S5AA 3P3PA 3N4MA 3SKJE 4RS5A 1BK1A 2IXJA 2QTWB 3ATGA 4NHLA 2HBUA 2WFF1 2BFUS 5IK5A 3RDIA 4CCDA 5A7WB 2JD4A 4DOUA 4BB3A 2ZAAA 4FO9A 4Q4V1 3ZM8A 1GR3A 2RR12 3JQWA 1LHUA 3GZEA 4RFRB 1B35C 3K75B 4LLFA 4ZHNA 1EUUA 4CDUB 2HWE3 2Y34A 1JUIA 3DYOA 1OH3A 2HJIA 4PT6A 5I91A 4WVWA 4U36A 4LKEA 2XJTA 1QH6A 1U5XA 5FOJB 4JGZA 1W8NA 4YW2A 5KWRA 1GP4A 4RR3A 1UKGA 3C7GA 5C8CB 1PX3A 1AR83 1DHKB 1MPXA 1AZDA 2AYHA 2Q1FA 1NCQA 4ITCA 1U0AA 1LKNA 3VD7A 4K7JA 4BHPA 1B09A 2HYXA 3IZOA 4LA2A 2KA3A 1YQ2A 1AL22 4KU8A 4FPJA 2IXHA 5J09A 3BTYA 4AHXA 3WNOA 1FOD3 3FLTA 4O9EA 2Q8OA 3JB4C 4KU7A 5GLUA 3WF2A 3AXEA 4UFLA 4W4ZA 5D1IA 4KMQA 2JIGA 3WNMA 4M3CF 4CPBA 2ZACA 1V9U2 3JXSA 3O1TA 3FFQA 3GBWA 4CSWA 4JRAA 1UIJA 2D6NA 3WDUA 1IQDC 4PDWA 2RG4A 2AEYA 3LDKA 1JYXA 4WVMA 3J7HA 3WXPA 3ELNA 1WLDA 4FPKA 3VBUC 3ZFEB 4AI2A 2LALA 1ND2A 2NP0A 1GBGA 1KDMA 3KV5A 3S6PA 4JRLA 4AAPA 2WLPA 2ORZA 3OBAA 5F8PA 2I74A 5LBBA 1O3RA 4QPGB 4QDSA 4XTPA 1GQGA 2E7QA 4JQRA 1W0PA 3RS6A 2J1TA 4IQPA 5F5AA 4GWMA 4RS5B 3M7AA 1BVVA 5A3OA 2A6WA 2O14A 2VMFA 4QX3A 4OUMA 1WGPA 1LU2A 2W68A 1GZTA 4DY3A 4FP3A 2G1MA 4WM7C 4OULA 3JBG2 5GM0A 3ON7A 2RVAA 4ET7A 5CISA 3LFIA 4PLOA 4QAWA 2CNAA 3QH6A 5CAZA 1N1TA 2BFUL 3NW4A 1BXHA 2OX0A 3MV01 2PHXA 2P2KA 1R082 3N7LA 3ZR6A 3ECQA 1UX6A 5EJZB 5A3UA 4JGYA 4AE2A 1UY2A 4JDOA 5JR7B 2JJ6A 4ES8A 2YBSA 4XQDA 1RUC3 4RR3B 1AR92 2VMHA 4CU6A 1J1TA 2PHFA 3H50A 4Q4X3 1ENXA 4QKBA 2XQXA 3LD8A 3JB8A 5B2GB 2X5IC 3UETA 4Z2AA 3B93A 3GM8A 4W65A 2WQ8A 4CRQA 1DIWA 1DYOA 1UYPA 4LO6B 3N9NA 5TSWA 1JZ2A 2F17A 2DURA 4OYUA 5A3PA 1JYNA 4XW3A 5EV7A 1O5LA 4IEUA 3ZR5A 2VNGA 5DXDA 1F8VA 3BIWE 3B3QE 4GZ9A 1AXKA 4XVHA 4AVBA 2G9GA 2WKKA 4BQ2A 2CWMA 4K20A 1ONAA 3IN9A 3MLLA 2WZPP 1KRIA 5C6CA 1Q8OA 4YGCA 3KV9A 1CD3G 1LNSA 2X29A 3G7DA 4PDWB 1RVF3 3LIHA 1X9TA 1MS8A 1LOCA 1RMU2 3BUCA 1HKDA 4DXRA 4WVMB 1RHI3 5DG1A 3NQHA 1YQ8A 5A6QA 1ND2B 3B69A 5DDJ3 1L7RA 2C0ZA 4KWJA 4YVSB 5AVPA 1AYM3 2FQPA 5IVBA 1AYN1 4D0QA 1WD4A 4FAHA 2D43A 2QQIA 3JD73 1O8PA 3CJIA 1TVGA 3POIA 5FLJA 4MLOA 3AL5A 3ZYPA 2HWD3 1H8TA 3PVOA 4HVOA 3W59A 4N53A 2QUOA 1VBE3 1RUD1 1I1EA 4BQWA 4IE4A 3DXUA 4B1LA 2OZ6A 4ZKTB 4OVEA 1RUNA 2Q30A 5GZDA 4DUWA 4FCAA 5L19A 4X6RB 4CE8A 4L8QA 3LQCA 1OA4A 3W9AA 2PXJA 2BUKA 5C3RA 3BB6A 1ULCA 4M00A 3LWCA 1BBT1 1HQWA 4RFT0 4JGYB 1QNWA 5FYUA 2XBO1 2FBEA 1BEV1 1UOFA 2XL7A 3FZ3A 5FYSA 3ZYFA 3BCWA 4PHZA 4NHYA 1PO13 4EZ4A 5JOWA 2R042 1KITA 1PO23 2VZ3A 3ILFA 1H1IA 3WQ0A 4D8MA 4COZA 4OHWA 1NG0A 4Z82A 3SHRA 3WF3A 3WHUA 1VB2A 5T55A 1E5HA 1VP6A 4AQ2A 2W1SA 1WCDJ 2JG8A 2AUYA 1ODMA 1A8DA 4RD7A 4Y1ZA 2WUHA 4EWAA 3M1HA 3ENRA 2W94A 5FZAA 4OLLA 1LHVA 2W9XA 1XBFA 3AYCA 5F2WA 4I0AA 2WN2A 5J36A 2HKXA 2OXBA 1PMHX 4GKXA 4BK4A 4ZZ5A 2RS31 3S7EA 1C8M3 2AEZA 2ZOEB 4Q0SA 3ZDSA 4GJYA 4NOTA 1FNZA 5FZKA 2RDQA 1TME1 2NQYA 4TTGA 4K9SA 2VE1A 4UFJA 1A8MA 5DAQA 2RMU1 3VBOC 1XU1A 3RJ2X 1VBB1 5LA2A 5JXHA 1RUG3 1FOD2 1QJX3 4K1ZA 3ZN6B 1VAVA 2HEWF 1B35A 1TG7A 2CY6A 1QDCA 5LATA 3K2OA 2BNMA 1HXS1 3S30A 3PJYA 1TQ5A 5E88A 3VHRA 1IS5A 2VAUA 5LK7B 2C6SA 5DABA 5K4LA 1MS5A 3CJIB 4NHKA 2WWSA 2P1BA 3B9CA 3EB7A 2LM3A 1W2NA 1GOFA 3HQRA 3WP6A 1H8TB 2GH8A 1VRBA 1J83A 2VGDA 5B4XA 1UMHA 1APNA 1YJKA 4N53B 1LOGA 4XCBA 2PTMA 5L7OC 2WS93 2YU2A 4FTEA 4P08A 4Y22B 4AEKA 1WW6A 5FYYA 5GLZA 2QZ2A 1K42A 2GC1A 1UIKA 5IFTA 4MGZE 1NE6A 4AK3A 4OMCA 3T30A 2IXIA 3RZMA 1Y9MA 4G4FA 1JZ6A 4H55A 5FY8A 3RRDA 1H2LA 5ISLA 2WYFA 2ARCA 3LA2A 3RFRA 2ZGNA 3QACA 4NIAA 2I07B 1WZXA 3PVEA 2WNOA 4DS0A 2YROA 4LA3A 2CGOA 5F39A 1OSGA 3BTAA 4HONA 2WSUA 3MUZ1 1O91A 4LBMA 3AC0A 4Y20B 3VBRA 1ULDA 5E16A 1Q5OA 2PHWA 3KV6A 4QPWA 3SKVA 2R6QA 3VBUA 5L9BA 2JG8B 4QX7A 3WUDA 2VTXA 3D8CA 1YI7A 3CO2A 3ZXFA 4EQVA 4FQZA 2XWBB 2C5DA 5F6LB 2WA3A 3ZSEA 2VZTA 4U2AA 1AXYA 2EAKA 4FPYA 5JSRA 4I3PA 3MUY1 1RUC2 4ONUA 3OF1A 3V64A 1CAXB 5EYYA 2RS51 4Q4X2 1BMV1 3O0VA 3LEMA 1TMF3 5FMBA 4CP9B 4YG0A 4YZ2A 2RS11 4NJ4A 4CEYC 1MZ6A 4AGGA 3ZXLA 3JUUA 3LOIA 4WM7A 1TNRA 3UKVA 3HD8B 5CBLA 5HCFA 2JDKA 4Q1PA 3SMHA 1O7FA 4BK5A 1RUF1 3AZVA 1KDKA 4ATFA 3DUIA 2FDKA 4HN0A 1RYYA 1KJLA 1X33A 2UWBA 3J8F3 5LRSA 2EALA 4UOJA 2X8KA 2W92A 3ZN5A 4IW3A 5K8SA 1OPOA 3RWKX 3SCHA 1J84A 3ZXAC 3FWEA 4MGKE 3ZYJB 1RHI2 3KT4A 5LA1A 4AR2A 2X5IA 1RUE3 3GNEA 4N90A 2V09A 4QX0A 5H9QA 2A3XA 3U0ZA 4RSUA 5IWFA 2ZA9A 4ASMB 3AP9A 1AYM2 3JCIA 5FZDA 4OUSA 4E4SA 1AR71 4CEWB 5CADA 3AMHA 1S0CA 3JD72 4C0HA 2W46A 2AH2A 1H1AA 1UY1A 2XB6C 4HVQA 4QX2A 2WJSA 4J1XA 2R32A 3RGBA 5C7GA 2VOKA 4PI2A 4R8HA 1W06A 4F7ZA 4DY5A 1V6MA 5FJHA 1VBE2 4B7KA 4DUVA 2QKDA 4XUPA 1N1SA 3C3VA 1OXCA 1JODA 5IUQA 3VBRB 3P5BA 3V0AA 1L7QA 2WAOA 2WC2A 3DF0A 4KGGA 5A6YA 4ASLA 3PJQA 1N47A 1WMXA 2DVDA 3FHAA 3FBMA 1NLSA 2XKOA 3THTA 5BY5A 5C8WA 4UAPA 1QJU3 1UX7A 2B5HA 1UXXX 1V00A 3OPWA 3ZX7A 1CIWA 4OMDA 1IQAA 3B94A 1R1ZA 2A3WA 2FHRA 1PO12 3AKRA 5C71A 3QLQA 2L9LA 5APAA 1PO22 4EZHA 4LO7A 1SMVA 5HPOA 2D6PA 4FXGB 5FYCA 1IKPA 3SH3A 3WP4A 4XUOA 4AFDA 4FFHA 1QXPA 5AC91 3H9AA 4QMAA 1UYXA 4N43C 4YPJA 1LJ7A 4CUCA 4H7MA 4E8DA 5IAXA 2EIEA 3M3OA 4A6OA 4OQ8A 4CU8A 2PHDA 1QY4A 3A4UA 1AUYA 3UNPA 5FZOA 4LIUA 3G6JB 2LRPA 4HSLA 2R071 2W1WA 4FI9A 4MZUA 3WD5A 4BQXA 2E7TA 2ZHNA 1A78A 2VUAA 3LSEA 3WDXA 4HKLA 1C8M2 2PAEA 3KHBA 5LEKA 3C7EA 2RDSA 1RIRA 2VULA 5FY0A 4QDQA 3LA3A 1LODA 5K0UC 3H3ZA 1SEFA 2ARBA 4XFFA 1RUG2 1QJX2 4Q27A 1LCLA 2ZCWA 4GWIA 3IDCB 4MADA 5FAXA 5IK8A 1WCSA 2BGCA 4LHSA 4AI8A 4IEXA 4TZDA 1BJQA 2PN5A 3RWNA 2DF7A 3CZUA 2K46A 2GZWA 1EP0A 4OUEA 2C9KA 5JAXA 5FYZA 2WA4A 4LOSA 3ZIWA 1VBA2 5C33A 1QOOA 1KD7A 1ZRCA 3TEWA 1W9FA 3VZMA 2GALA 2VQTA 2FZ2A 2Y60A 2FDJA 3A22A 4Y4RA 5JPMB 1MQTC 3Q8BA 2QQKA 1K5JA 2ZS6B 1W6OB 4IDZA 4LMFA 1H30A 4QM8A 2QQUA 4Y1XA 3VBOA 1CX4A 2ZHKA 2OVUA 4GB33 5FY5A 4DXTA 2FMDA 2JDZA 3V0AB 1PGSA 2E6VA 1FV3A 2Y6HA 2BP6A 1UZZA 2ZHMA 5I93A 2DVGA 1ST8A 4OCTA 4QKDA 4XURA 5SV5A 1DDLA 1W8HA 3J26N 3ZXJA 4H14A 5M0TA 4Y5Z0 1D4M3 1OVSA 3USSA 1UYYA 4AEDC 1OVPA 4ZZ8A 3OG2A 3IBMA 4QHZA 4L0PA 1ZRDA 1YYNA 5L7OA 3I2IA 1POQA 3IWZA 3T0BA 4YZ1A 5DUWA 5AVAA 5JCTA 1AJKA 2OKXA 1YRZA 1UZWA 3POJA 4INDA 3OUHA 4QGMA 5FP7A 5FZCA 3VGIA 4AFMA 4NPLA 4N9HA 1MEC3 4FFGA 4CCJA 2FDHA 2PAMA 3TBDA 1CZTA 4KGQA 5FZOB 4E4DX 5FWEA 2WINB 1OLRA 1GKBA 4RYDA 1W8FA 4Q29A 3OCPA 1PIV3 1X8MA 4IV1A 3FUQA 4R52A 1D0GA 4XDOA 2GNMA 4LOTA 1TMF2 2ZTNA 5GZEA 5KXCA 2AENA 1JYCA 4UFKA 2J1AA 3U1XA 5LY1A 1STMA 5T5JA 1VRH3 5FZGA 1S4CA 2GAUA 3KD4A 5E89A 4EWDA 3WQ7A 3GXUA 2UY9A 2JD9A 3LGRA 1R093 3MIDA 1NOVA 3ZMOA 4LT5A 1X36A 2JKXA 1NLRA 2MHFA 3FMGA 1RGSA 2A71A 3J4UH 4KBBA 1MZFA 3VHOA 4YRDA 1Y9GA 5EXOA 5JOYA 1ZX5A 3AKQA 2HWC3 3J8F2 3RPQA 5ACA3 1RJ8A 4OI2A 3IDEA 4BA6A 4E2QA 4L2NA 2Z69A 4P9GA 3NV2A 4Y5TA 1A3KA 4MV2A 2BVVA 1Y7BA 2IUWA 1UOGA 4MGTA 1JU4A 1RUE2 2NPIA 2XG3A 4QQHA 3AFGA 4IEPA 5FK8A 4A6SA 1ZRRA 2P17A 5CYYA 4M4RA 4CEYA 3VBOB 4CU7A 3WNPA 4J25A 3IAPA 4FOWA 4BQ3A 1CWPA 1R1A1 1ZZ9A 4KQ7A 1EAH1 3EQEA 3ABZA 2JDYA 3KWVA 3HR9A 1ZBE3 4AI9A 1HV1A 1W8OA 4XUNA 1WMEA 2PELA 4MH0E 5H9RA 4ZY9A 3NAPB 4X8PA 4TWTA 5CFCC 2UY8A 5A1AA 2BWCA 3KGLA 5A3MA 2JICA 1HB4A 4QHOA 4QWNA 5L7OB 3RZLA 4CDQC 4IEQA 4C0BA 2D6KA 4I3GA 4BQ4A 5ANQA 2XLFA 3O0WA 4LR4A 5FWJA 1S0JA 5F7UA 2YFZA 4Q8KA 4DINB 2VOXA 2B7YA 4JDNA 5L36A 4CP2A 4LBOA 4XC9A 2UURA 4IV1B 1GANA 4MO3M 3WVJA 4QXKA 2VG9A 3M3CA 4XXAA 3S5QA 5T3NA 4EN9B 5JDBA 4GH4B 4D94A 2C26A 5C70A 1UZ0A 3DEMA 1Q3EA 1H1MA 3AMPA 3ASIA 3OGRA 2DUPA 4AAXA 4Y26A 5I0RA 5HXVA 2Y6LA 3MBWA 1U5IA 2A6YA 5DUVA 4AFAA 3WNKA 3PMEA 3ORJA 2EICA 2NYYA 4CA9A 5JZGC 1SLLA 4R9BA 5JOXA 5L9RA 3J9SA 3OEBA 5A7NA 1OA2A 4B4QA 3HAGA 1UY3A 1LHNA 4LO8A 1PVC1 5FZLA 5FY7A 4AYUA 3H8OA 1OD5A 2Y0IA 3JBG3 2H0BA 1DLLA 4WVZA 4MVTA 2W2IA 4NAOA 4V2VA 3P1IA 1SFPA 5FXWA 3K4ZA 3SITA 2BBVA 2P3KA 2VMEA 3I54A 2DU0A 3GALA 4CEYB 4D3WA 4N43A 1W9YA 4SBVA 1M06G 3GBGA 3TOJA 3ZPYA 5EWSA 1QNYA 1XSRA 3IT8A 3HQUA 5H9SA 5I8TA 1QIQA 5CG8A 3HOBA 1DQ0A 1OLME 5A7QA 2R1BA 3AJYA 2WZR1 4HOOA 4QQOA 1W05A 2QFEA 3N7MA 2VCMA 2YYOA 3D6EA 1W2OA 3AMQA 5FYBA 3T0DA 2W1UA 4IESA 1UKRA 4W8JA 5K0UA 5FP9A 4LLOA 2WO1A 4GB32 2WT0A 3THCA 3HBKA 3MPPG 3H1MA 2YXSA 2OZJA 4MOAA 2CHHA 3WNLA 1COV1 3POGA 2DDUA 4AXOA 4DMIA 4M0NA 3IAQA 3WQ1A 5JVVA 3ZN4A 2YMZA 4AW7A 3ZXGA 5BPXA 2CWSA 2D5HA 4YW4A 5A7SA 1VMHA 2CAUA 1UU5A 2BZDA 4P00B 3VBHC 2DCJA 2XHNA 2R061 1WCKA 1M4WA 1ULFA 3MICA 4KWKA 2TUNA 1N1VA 2WWJA 1D7PM 3CBNA 3H8XA 3IKWA 2WFF3 3ZFFA 1MQTA 1RUI1 1MEC2 3OD4A 1XSQA 2A3YA 4A45A 4Q4V3 1JOPA 4I30A 2AREA 1GZCA 4P9WA 4DEVA 4HPKA 1HJGA 5T52A 1F35A 1XNAA 5LA9A 4P5YA 4DIQA 5LCWL 1PIV2 2MPFA 3W5MA 2HWB1 3IMNA 4BCUA 4FPFA 4Q4W1 1O3TA 5FYMA 2D6OX 3BPZA 4HFSA 4EWEA 3EBRA 4BWOA 1C5HA 2A6XA 1E5IA 3I3DA 1VRH2 4N8MA 4NVPA 4AEDA 3I2OA 4NHMA 5JMCA 1YQ6A 2NLRA 1R092 2ZABA 2G19A 4FSJA 3K3NA 4AGRA 3R0RA 1YFWA 1SPPA 1ZREA 1V6IA 2E26A 5GLVA 2WO7A 1YQCA 1S2KA 2HWC2 1O8SA 5ACA2 3BTZA 1W99A 5FJKA 1FXZA 3NV1A 4C91A 4NROA 4FPGA 4JX0A 2ZX4A 4OI0A 4H7LA 2QQWA 5JIAA 5DPNA 5F32A 2R043 3RJRA 5J1XA 1FMD1 4E8CA 1KFXL 1WLCA 2HWF2 2Q8EA 1QU0A 3HMYA 2FCVA 2JEMA 4RL7A 4WM8C 5BNPC 2OUHA 1OLQA 2IVJA 2IXLA 3KZ4C 4QB1A 1I9RA 1PGW1 1W3XA 3GZTB 4BDVB 4Y5SA 4KWUA 4YSFA 1LEMA 1RXGA 3RZGA 2VPVA 4AF9A 2K9ZA 4XFAA 1RMU1 1OUXA 5EFUA 1ZBE2 1JHNA 5LK5A 5BUVA 1W90A 3FHIB 3TN92 4BH9A 3B9IA 2BOJA 5AFBA 1C28A 4LEJA 2WT2A 1X82A 1MVQA 5JXGA 3SCGA 3NMBA 1UYZA 4O9GA 3SEEA 5C9AC 3T2QA 1UOBA 2GC0A 1RUJ1 4GAZA 3UK9A 4CCEA 1FPN1 3O12A 2J22A 1MQTB 1HN1A 3EO6A 3RYKA 3ZFFB 4MG2A 2SBAA 4K6BA 4QX8A 2BQPA 2ZGUA 2XOMA 1G6NA 2XUEA 5FP3A 4AQSA 3EYPA 1YO8A 4DEQA 2HH9A 1W6QA 3ACHA 3ZFGC 5FP8A 2BRTA 1EUTA 5BNOA 1DF0A 4QXCA 3IPVB 5CKQA 1CGPA 2QQOA 4YM0A 3AMMA 5JXJA 3QH7A 2EXIA 1YLLA 4AEDB 3ST7A 2EAAA 3FJSA 3GDBA 2OA2A 1DGRA 2AC1A 4LBNA 1UWWA 4UWDA 4CDQA 2BOIA 5CFDC 1SPPB 5KHKA 4QPIC 1OURA 3GCXA 2VXRA 5EYXA 1ND3C 3ZLIA 2JXAA 4FPHA 1GWKA 2Y38A 4GULA 4W6YA 5L73A 5FZFA 2BWAA 2BVBA 4LK7A 3OD0A 2HWE1 3RNSA 1ASJ1 2HEYF 4DXZA 1UN1A 3OGGA 4R9AA 2WNVC 1NY71 1XPWA 2D93A 3IMMA 4MHRA 4JVAA 3OGSA 5FUIA 2RV9A 5FZ0A 5GALA 1VAKA 2VZQA 1SFYA 1XNDA 1AR81 2OQ7A 4E2SA 3TEYA 1CN1A 4XF9A 2AZ5A 4NIDA 1C3HA 1W03A 4RHV1 1ZBA1 4YW5A 4DPNA 2D3RA 2R0HA 2ZMLA 4JGZB 5KC5A 1US3A 3VBFC 4L97A 4LBKA 3WNXA 5JZGA 3EMRA 4P9IA 5KXDA 5CIRA 3ME2A 1NCQB 2W52A 5IYYA 1UY0A 2UWCA 3BI3A 3MF6A 4HKOA 3I3BA 2GMEA 3HEIA 5FZ6A 2R7EB 1SCSA 2VTFA 1V0AA 2VXJA 1CPNA 3MLKA 1PX4A 1H2MA 3AP7A 2XPJA 1ENQA 3CEWA 2P6HA 3KM5A 3ACFA 4OI4A 4BISA 2C9AA 1DZQA 1DZRA 2WYSA 4Z1VA 2ARXA 1GYKA 2YPJA 2BEOA 3WUCA 2A6ZA 1W6QB 5CEHA 2VMGA 4E2GA 2W3JA 4XQ4A 1GUIA 4XTMA 2OYZA 5AFEA 5BNOB 1XE0A 3DPRC 1BKZA 1AXZA 2OPWA 1X50A 4UBHA 5FQ0A 1NE4A 2Y6JA 4JDMA 4RA0A 4LITA 3ZSJA 2WFF2 3I2GA 1ZZ8A 3AK0A 4M4PA 3HNBM 3HJRA 1LU1A 4Q4V2 1DG6A 3U11A 4CDQB 5C4WC 3P3NA 4QB6A 1S0IA 4QM9A 1CAVA 3AZZA 3NJXA 4YLZA 2ZGLA 3L9JT 4MGSA 4YZ3A 3VD3A 1DQ4A 3W21A 4GWNA 4HK8A 4IEVA 2Z4FA 3ILNA 3LIGA 1SCRA 1DQ1A 5A70A 1Z78A 1ZM1A 2B46X 2LROA 1I6XA 3M4FA 3FE5A 1XYOA 3VBHA 2DUQA 1DP0A 3PURA 3I2KA 4V1PA 1OF3A 3BODA 1LTEA 3H7YA 1RUC1 2F4PA 1CESA 3NNFA 4PCRA 4A42A 5J48A 4IE0A 5JXIA 2W08A 1TME3 1YXWA 2ZXQA 2EIDA 4QXHA 3CNAA 2JDPA 2RMU3 3NV4A 4MGQA 1SBEA 1HDKA 1OH4A 1RB8G 3MO4A 5J98B 3SQOA 3VDDC 1XQNA 1K45A 3VD5A 1NUKA 1IOAA 1H6YA 4HZFA 4MGIE 3UL2A 1AR63 1HXS3 5JWPA 4WV8A 5LB6A 4CCLA 3EXUA 1UD1A 1H4HA 2VUJA 5DMYA 4YW1A 1KGYA 2GMPA 4CZSA 1RXFA 5DZGA 4LORA 3FX3A 3O1SA 2VZ1A 3KS7A 2OIIA 4HKWA 5C3PA 1RVF1 2GN7A 3PUIA 2LS6A 4S2FA 4XILA 2WDBA 1LRHA 4EJRA 3D3AA 5FRAA 1LOBA 2BU9A 3LEIA 3KVAA 4ISRA 5BXXA 4QPYA 3AMNA 1VMFA 4MYEA 5DDJ1 3U07A 1PGL1 3FHQA 1HW5A 1KXGA 4D7YA 4YFZA 3ILRA 1PNFA 2YBPA 4ZU5A 1UMZA 2JDMA 2PAKA 3EHKA 5FTTC 4C1WA 1QXJA 5FYIA 4A2UA 5FZ1A 2N7GA 4X8NA 2NZ9A 4WBBA 3POYA 3SEPA 1MS4A 4TXWA 5D8AC 1F4AA 3W58A 2HWD1 1TNFA 3WOGA 5EJ3A 4WM8A 1O3SA 4J1WA 5FPVA 2KD7A 1VBD3 1ZNPA 1VBE1 2WNUC 1HRV3 3RQ0A 1X8EA 3KMHA 4HL0A 2P3IA 1OT5A 2DBIA 4NUBA 5ABJC 4XFBA 1SHWB 1UMIA 1VE0A 1N3OA 2GC2A 3E5XA 1MS9A 1O4ZA 2JG9C 3O5SA 3VDCA 3WF0A 1FNYA 3WW3A 4AFCA 5FP4A 1VBA3 4IEWA 4NWVA 4A7YA 4COVA 4LBQD 4YM2A 2RS53 3GJBA 2VOVA 2B39A 1YIPA 3LAGA 4N9IA 3GYDA 5IVJA 2YC2A 5C9AA 4NMIA 1V70A 2XHKA 1FYUA 5FFOC 4E9KA 2WR9A 5KHHA 1UQXA 5DG2A 1I3HA 5DAWA 4D6SA 3O1VA 3ZSKA 2GU9A 1G86A 1H0BA 1VBC1 4AGVA 3HT2A 1GQPA 1HRI1 5DAPA 5JMOA 4RQPC 4UW5A 1RUF3 5JPNB 3GCWA 4QT6A 2VL4A 2WSVA 2W0XA 3ZFGA 4BYYA 5A1FA 2CAVA 3L2YA 3WINE 1OQEA 3Q8CA 4K8RB 3NNJA 2XJVA 2ZMNA 5I0UA 2VO5A 4URAA 2WABA 4PF5A 3UKNA 4PI0A 4HN1A 1JYTA 1S2BA 3IIIA 2VZPA 4IV3C 4KG0A 4XFGA 4XUTA 1GWLA 2YGLA 2ZGMA 5CFDA 1FX5A 3WW4A 3E6CC 3QOPA 4QU2A 1A6CA 2DVBA 3OUIA 2PLV3 4IE6A 3IDBB 4QPIA 4XZPA 4YG3A 5IFPA 4XYXA 5EQUA 4R9DA 5LWBA 1ND3A 1AR73 1YJLA 2GP5A 2J1UA 4YG6A 4ZU7A 5JUVA 1Z7S1 2QQJA 2XKPA 2A1XA 1WW5A 5FKBA 3BOWA 3N9LA 1DU3D 1OKOA 1GU3A 5CG9A 1T6BX 2V73A 4JZRA 2W95A 2WNVA 4UW3A 3RI8A 1N3QA 1PK6C 3LEKA 3UT0A 3LFMA 4PBPA 4AEMA 2QQVA 1AHSA 3N7KA 1RUD2 2H6CA 4PF1A 2VQ0A 1B35B 1GQHA 2GP3A 2WS91 2WT1A 2QVSB 4IUGA 1T2XA 3T4VA 2Q8DA 4NPMA 3VBFA 2YPDA 3L2HA 4XBNA 1QDOA 2QQPA 2EA7A 2BJSA 4XE9A 4MGYE 1LR5A 3MZHA 2ZEYA 3TEZA 1ZRIA 2QBXA 2W47A 2XBO2 1QMJA 3WP3A 3KLSA 2Q1ZB 2PQSA 1EV11 4NN0A 4HSJA 4YVWC 1VJ2A 3OGJA 5JIUA 1FT9A 2ET7A 4YW7A 2V4VA 4EN0A 3THPA 1S55A 1NQJA 4Y4YA 4AWDA 5C9AB 2VZOA 2CDPA 1WBLA 5FYHA 1IKQA 3B7MA 2DFCA 2HLEA 4AHZA 2JDAA 4B4PA 4ZS2A 2VW1A 4FT8A 5I8SA 1PZ7A 1K3IA 3N9OA 2R073 3VL9A 5FPLA 3SNMA 4AHWA 5IVYA 2QZ3A 1XU2A 4CVUA 3HN1A 2RS32 4XABA 1LESA 3WLUA 1NKGA 3DPRA 3NVCA 1J3RA 1DYKA 4Q1RA 2AR6A 3O1OA 3VBUB 1TME2 2ATFA 4S2DA 2RMU2 3B5LB 4N7IA 2DYCA 2CDOA 1VBB2 1G9CA 1GZ9A 1UL9A 2ENRA 3HN3A 4K3UA 1REFA 5C4WA 5CFDB 4O61A 2J42A 3VZLA 4BPZA 1TEIA 5F3CA 1HXS2 1AR62 1JXNA 5A3TA 1NQDA 1NZCA 1F4HA 3KCXA 3VLBB 1V6NA 3VKNA 1G7YA 2Y8KA 1ULEA 1GZWA 1JOBA 4YGBA 4WM7B 3NWKA 2WNVB 4GMP3 4XJ9A 5DAVA 3VKMA 2E33A 1S2EA 2OW4A 4P5HA 4Q26A 5EZWA 3RMXA 3O1PA 2VY0A 3JZVA 2FCUA 1VMJA 1C5IA 2IXKA 3LZZA 5I8YA 5FZ9A 2GDFA 2NMNA 5T5PA 1G9BA 4Q0UA 2ZGKA 3O1RA 3SXWA 3VDDA 3VBFB 5LBCA 3NJYA 4FQ4A 3OTFA 2QDRA 3VHPA 5F2SA 3DN7A 1OLMA 3OBTA 3WW2A 4LHKA 3ZOIA 2X5IB 1J58A 4BIFA 1JOJA 1QKQA 3VZJA 2ES3A 2K2SA 2KXLA 2VZVA 1POV3 1W6PA 1VBD2 4META 3KHCA 4JAAA 2CSGA 3A7QA 4UYBA 1HRV2 4JQTA 2ZJCA 2LTNA 5KXEA 1YI9A 3KGZA 1QQP3 4OHXA 5FREA 2AACA 2YG0A 2A6VA 2Y6KA 3E1F1 4J6GA 5FUPA 3VDAA 4CCCA 1A34A 1Y43B 5KHIA 5FZBA 5C3OA 2XVLA 5FMOS 3K51A 4XZUG 3ETQA 4LJHA 4M3CE 3FFZA 4NIIA 4EYUA 1L7LA 3EJKA 1UCXA 1QJU1 2RS52 4Q4Y1 1BMV2 5D21A 4PIYA 1ULPA 4LIVA 1AX2A 1SLTA 5DUUA 3O7OA 3GF6A 4CXWA 4XF3A 2RS12 5C8CC 5D8AA 3KT7A 3BU0A 3T2PA 4AVVA 1WWYA 1CVNA 2MEV1 1VR3A 1RUF2 1Q56A 2WNUA 5FO9B 1F2NA 1XE8A 2D3SA 2EXKA 5ABJA 1O5UA 2ZEWA 4LBLA 3UV9A 1SLBA 3PDQA 1OMIA 1ZZCA 1LAJA 2JG9A 2WN3A 1X7NA 3H1WA 3B02A 3PVBB 3W5NA 5F3GA 4OQ9A 3OOXA 1YC61 3HVDA 4BM8A 1DFQA 3CF6E 2E53A 4EN8B 2JX9A 4UI9L 1LOEA 2X05A 2JWPA 1ULOA 4Q2FA 1QHDA 2C1FA 3POFA 5FZ8A 5HV0A 1CONA 2BGOA 2PLV2 4SLIA 3WW1A 2DCZA 4IEYA 1AR72 4CCMA 1JHJA 3ZFEC 2BYVE 1LULA 4RQPA 2WO2A 3BVCA 2DUOA 3H42B 5A7PA 4QPGC 1F9KA 3ACLA 2R49A 4NIHA 5FZEA 3N36A 1W2AX 1DGWX 2YGMA 2E63A 4NWWA 3WG2A 3HWJA 1GNHA 3WR0A 2B8MA 4BXFA 1W6PB 4D7TA 2JDHA 3KSCA 2RM21 3D0JA 3JQXA 4JKKA 2FDGA 1F31A 1K5MC 4IV3A 4JCKA 5IVVA 4Y1UA 1RITA 2X10A 4LULA 1H2NA 4XQWA 3R4SA 2D7FA 1JN2P 4BMEA 3CL1A 4Q0PA 4AEJA 4B7EA 2KM2A 2HWF3 2A75A 2WFPA 3OB8A 1PZ9A 4KBZA 3UJOA 1W0OA 1XYPA 5T54A 3MV11 4GKYA 4D69A 5FMOL 1D4M1 1PK6A 4MXVA 4RGGA 4JKMA 5BNNC 3PL0A 1IZ3A 4Y3OA 5FPBA 3WP5A 2K0GA 1JS9A 1SBDA 4GMP0 3AFKA 3LE0A 4H3WA 2GH2A 2F4LA 4QGNA 3TN93 1OBNA 3VV1A 4BLIA 4CUGA 2WNUB 4YW6A 1ZZ6A 2D6LX 3AYAA 1GMMA 2R072 4AHYA 3GHMA 5A3NA 1IS4A 3R05A 1PM4A 4BJ0A 4B8EA 1GFF2 2JG9B 4XJ8A 1QJY3 2XUMA 3WG3A 1TE1B 1XC6A 4K8FA 5C3SA 4DUXA 5C3QA 4NO4A 3BIEA 1AL0G 1W2UA 4ZXEA 4RGKA 1SFNA 3TAYA 1HIXA 3RYPA 4P14A 3UESA 1OFSA 2VNRA 1LOFC 1RUH1 2RJLA 2XVGA 3E5QA 1MS3A 2PHTA 2V72A 4Q8LA 4XJWA 4Z2WA 1SLAA 3BOPA 3AL6A 3AKTA 2Q4SA 3BYWA 4ARYA 1QJEA 1WUVA 3I2FA 4AL9A 1POV0 3WDYA 4HK9A 5HV4A 1JW6A 4OI1A 2W91A 5FPUA 1ACCA 1JYWA 3OUJA 2PHRA 1YWKA 3OY8A 2ID4A 3V56A 2ZHLA 3TWIA 1WD3A 4CTEA 4YVSC 2YFUA 4IEZA 3PTYA 4HT1T 2X09A 5CU1A 2YB7A 1RTVA 5IT6A 4AFBA 2R16A 1J59A 4AQTA 4UT5A 2WZEA 5FY4A 4P9LA 2RR11 2JE9A 4LK6A 5A7OA 3U4SA 4AI3A 2VCBA 5F3IA 4NR1A 1IPKA 3H0OA 3AZXA 3AKPA 3MIBA 3AX4A 1H6XA 2XLGA 4DB5A 4AVSA 3FLRA 3MFCA 4L92A 4QX5A 3DV8A 1CR7A 3GZUC 2E31A 4LUMA 5FK7A 3VZNA 3C7HA 2TBVA 2FD8A 2R063 4YYOA 2D40A 3R4DB 2TNFA 4FFFA 4UW4A 2WZ8A 4Y24A 1QQP2 5KHJA 3AJZA 1MZ5A 1C8NA 4A7ZA 1RUI3 1AL21 1NA1C 4XJUA 3DKQA 4IE5A 3T2TA 1CJDA 1W6NA 2WL1A 3T1LA 3K77A 5FXZA 3VB9A 5IVCA 2VU9A 2C24A 4M01A 3NV3A 3VL8A 2HWB3 2P4EA 3RZKA 1V9U1 2VCCA 4Q4W3 3T4HB 3AKSA 2YC4A 5F9TA 1UAIA 1DZTA 4HLTA 2DTYA 4K1YA 3I8TA 4YFWA 3LEGA 2WNEA 4XIOA 1UF2C 4CUBA 1HQNA 3RYRA 3R6SA 3WQBA 4YGEA 3W20A 2RE9A 2VD7A 1OHFA 1Q8VA 3PVNA 3N9PA 5I0SA 4EN6B 4Z8BA 2VZRA 1LHWA 2CV6A 4LE4A 5F5CA 2P3JA 5A7WA 4BXSV 2B45X 3AVRA 1IPJA 4XFIA 4KWLA 2UU8A 4F3JA 3OY8B 4A44A 3BGAA 2RDRA 4CPBD 4NPRA 2EVXA 3CU7A 5DQ0A 4BQYA 1U5YA 2JENA 3O14A 1LOAA 4ES9A 1FMD3 2IXCA 2OPKA 3WCRA 4QX1A 1H9WA 2DBNA 2ZMKA 4O7XA 1XYNA 3TEXA 1GV9A 4GALA 5B4NA 3LCPA 5C8CA 3O0XA 3JBG1 4XACA 1SG3A 3KQ4B 3WX5A 2W39A 1R1A2 2P34A 1REEA 1VALA 2J1EA 2ZX1A 1EAH2 1XB9A 3IIAA 4GJZA 1GP6A 2ZX2A 4LXLA 3RSJA 3WSOA 5E6HA 4AVAA 2BPA2 4RGAA 1NXMA 3OSDA 4P02B 3N9QA 1H8VA 4L99A 1ZZ7A 4E27A 2E7AA 1EPWA 1R081 1FAYA 2YY1A 4R4ZA 1F15A 3PNAA 1WW4A 2VZUA 3U4XA 3T08A 2QQLA 5FR3A 1AR91 2R0FA 3CQOA 1W04A 1HB2A 1BK0A 3AYDA 3WZ1A 3Q8AA 4N43B 5FZ7A 1GSLA 4FAGA 2RJKA 5F6KA 3T0AA 1Y4WA 3DCQA 5HI0A 1S1AA 2B4KA 4MUVA 1RUJ3 2FMYA 3BALA 1RJ7A 5BYNA 3D4KA 4ARXA 2I2SA 5F3EA 1QH7A 1Q8SA 3VUOA 2VQUA 1UXZA 5FY1A 3LSDA 2Z2SB 4TLFA 4AOCA 2D98A 5LBFA 2XH6A 1J1LA 2V5DA 1GP5A 5K0UB 2O1QA 1PZ8A 3RMYA 4LE3A 4QPGA 3VBSC 3H3UA 5KC6A 4BZ4A 4HETA 4XJZA 4DXSA 2DFBA 1G8WA 1Q43A 1IG3A 2YHJA 4B4RA 2BBAA 1DQ6A 4DO0A 4DNYA 5IK7A 2Y26A 2Z42A 4LKDA 2ZZJA 2VCAA 1H9PA 2KR2A 1LHOA 3WT3A 3CLPA 3I4IA 1K5MA 5HCHA 2WO3A 2PYTA 1QOTA 1GICA 3DYMA 2XVKA 3MW3A 3A21A 1O6UA 1QJY2 1BQPA 2DWRA 1SLCA 2VZSA 2JDUA 4JC1A 3MYXA 3NKTA 2UYBA 2P37A 1JU3A 2O8OA 1GNYA 1ASJ3 1PVC2 4UFHA 1YHFA 3X29B 1E5RA 4CYDA 1CAWA 3P6BA 4HPKB 1D2QA 3NKGA 1DQ2A 1ALYA 3HNYM 2ADDA 3OBRA 4HANA 5FO7B 5BNNA 2JB4A 1I5PA 4LHNA 4BQ1A 3A0KA 3I2HA 5G04L 2XJUA 1UY4A 3AZWA 4RHV3 1ZBA3 3WHTA 2Q5TA 4CDWC 3J7NA 4G9SB 2I45A 4Q0VA 5FIXA 5FY9A 3WNNA 3T3YA 5JOZA 2J1SA 1JTZX 3PMSA 5CFCA 4CEWC 1UO9A 2WZR2 3ACIA 1WLWA 4FXKB 4XAEA 4BMBA 4BIOA 4RN5A 5GZCA 2D5FA 1W9SA 3I3MA 3N7JA 1YEWA 2R041 4G3YC 3RG0A 4IE7A 4B3NA 1F5FA 1LOFA 1CPMA 1OPMA 2ZZQA 4LQRA 4QB2A 3LPGA 3N3HA 3LPFA 5A1LA 3A0NA 1COV2 2XWJB 3E6BA 3VBRC 5FDBA 3ZKUA 3MF9A 2YU1A 4XEZA 5T50A 2IFRA 5C5TA 4EV0A 1HX6A 1QF3A 4YVSA 5A3WA 5GLTA 1OC1A 1SQ4A 2R062 3ACGA 2WQZC 2XJPA 4LTAA 3WDWA 2PHUA 4P9JA 4UFIA 1RUI2 1QWRA 1XE7A 2Z79A 3C7FA 1PVXA 1CZVA 1XJAA 5GZFA 1MS1A 4CXXA 1HB1A 1AYN3 4BU2A 1FOD1 4LO4B 2VNVA 1K5MB 4LO5B 4JTNA 2VW0A 3NSTA 1OQ1A 2E9QA 2HWB2 4Y1VA 3POWA 1HV0A 1DCSA 3PIGA 1DGWA 2XL9A 4IXLA 4Q4W2 1ENRA 4YGDA 2A73B 3V0BA 5DUXA 1RUOA 3OGVA 3U10A 4TN7A 2IFWA 3AB0A 3VN4A 3ZDVA 1MVEA 3D82A 2VNOA 2EIBA 1RUD3 3FC0A 1PNGA 4XETA 4C90A 1JZ5A 2P3YA 3NL1A 5DN2A 2OQ6A 2WLQA 3MIGA 3T2OA 3I7DA 5KBFA 1CAWB 1DGLA 4NHXA 1P8JA 1DLCA 1RINA 5BNNB 3CHXA 3MIHA 2IWGB 4HVRA 4D7SA 1ZRFA 3FN9A 1UW8A 3VKOA 1NA1A 1BBT3 1QXRA 3LKJA 3PU3A 5GLWA 3S7IA 1FV2A 2ARAA 2XBO3 3KCCA 1BEV3 2EF6A 4BQ5A 3NO8A 5CFCB 2ZKNA 2R1DA 4FTSA 1FMD2 2D6MA 1HB3A 1OD3A 1WKYA 3CKHA 1WMDA 5A33A 2XONA 3AZYA 3KT1A 1S0GA 2VVFA 3VZOA 2JB8A 4TYSA 1PGW2 2A5ZA 4IGOA 3ZYGA 2ZBJA 3ZXKA 3OPZA 5ERLA 1RL3A 4AVCA 4C8DA 5BV6A 1XRUA 1O59A 4XFCA 3UYJA 1LGBA 4TSVA 1W2TA 5FZIA 1YFUA 1CX1A 4R4XA 3UGHA 2XLAA 2YBKA 3FBYA 1UU4A 2RS33 1OF4A 3LDRA 2HYKA 4IEOA 1YIFA 5EJ1B 4FFIA 5FZHA 3ZN6A 3MGUA 1JZ3A 2GNDA 3PUSA 4Q4X1 4KNCA 3PUHA 5JI7A 3VHNA 4KI5M 3LB9A 3PUQA 1VBB3 5LZ6A 3H8UA 2Q8CA 2BTVC 1JZ7A 4XDQA
chains in the Genus database with same CATH topology
1RUJ2 4YNIA 2ZX0A 1FPN2 5JZGB 3NJZA 2EIGA 1ENSA 1WA4A 2NN8A 4S2HA 1C1FA 1REDA 4Y22A 4YARA 3SH5A 1VIWB 3AP5A 4FVVA 3V0BB 1G9DA 5JSOA 3HQXA 3MEPA 1QGLA 1PHMA 3WDVA 2VVDA 1ULGA 2NMOA 2Q1MA 4OHVA 4Y1YA 4XXPA 1RHI1 5LRRA 5JSPA 5F1RA 4XJAA 3ZYRA 4UBGA 1EPZA 3GHNA 4R9CA 2F6BA 5FOBB 2D97A 1AYM1 1WW7A 1NXD1 4Y20A 1NA1B 3JD71 1KJRA 1VBC3 5FQ0B 4Z92B 4OHYA 1HRI3 4FPCA 1LB2A 2HWE2 1ASJ2 4KL1A 4XMIA 3N35A 1URXA 4M3CA 1HLCA 1OOPC 3S0MA 2BNOA 5BNPA 1NY72 4LUKA 2G9FA 3HT1A 2B9UA 1LEDA 3R4UA 3VBSA 4A3XA 4F8AA 1EYBA 5A33B 4AI0A 1CAXA 2Y0OA 1CAVB 3TYJA 1AR82 1E57A 2A7AA 5FPZA 3H7JA 2MNGA 4RHV2 1D2SA 1ZBA2 3LA7A 4MSVA 2PA7A 4XHXA 5DZEA 4B29A 4ATEA 2D3PA 4PIZA 3VBHB 1V6JA 1MACA 3MW2A 5KHGA 3MLJA 1Z7S3 4BLJA 1IGOA 4L11A 1PO11 1SACA 2RS13 2ZGPA 1AR61 4I0BA 1PO21 4JV4A 4ZXKA 1J3QA 2H0VA 1JH5A 2XJRA 3NAPC 1NCRC 1CJPA 4QD2A 1BYHA 4QQ2A 3KB5A 1GNZA 2YC0A 1S0FA 4UXAA 4MX3A 1XNCA 5A32A 4CDWA 3ZO0B 4BOWA 4AG4A 2VQAA 2RHPA 1QJZA 1C8M1 2DV9A 3ZVXA 2X53S 3Q9OA 4CEWA 1PMIA 1YFXA 5T5LA 4JTOA 1XNKA 4IV1C 5A3LA 2CGPA 4W6XA 2XJSA 1EV13 2DCTA 4QQPA 4XHBA 4GH4C 1OA3A 1AYN2 5SV8A 1IS3A 1RUG1 1QJX1 3QD6A 3B00A 1J3PA 1DBNA 3E5UA 2CTVA 1RC6A 1VBD1 4AI1A 2WQ4A 1ZA4A 1HRV1 1OFNA 5FO8B 1KS5A 4M3CB 3SH4A 5HBAA 4WM8B 4F83A 5BNPB 1VBA1 5FLHA 3ZYIB 2DVFA 1W6MA 3VBSB 4C1XA 4CDXC 4S2GA 2SLIA 3DGTA 2UWAA 1BBT2 1UPIA 2GSYA 2O8QA 1JBCA 5K7PA 3E97A 1BEV2 3WCSA 1Y3TA 4W6WA 1Q8QA 1I5ZA 5CB7A 1LGCA 4ZU4A 4XBLA 2ZGRA 3C2UA 2R30A 2VOWA 1AF9A 3M8LA 3B01A 5AC93 2GNBA 1NYWA 5E1RA 3ZXDA 2ILMA 4YZ4A 5HCBA 1RVF2 2XGXA 4XBQA 3USUA 1Z0HA 3ZFGB 4COWA 4LNVA 2EXJA 1Q8PA 5A32B 5DDJ2 1PGL2 4CDWB 1UZYA 2PLV1 3VKFC 4FOYA 1TMF1 3ZXEA 1KFUL 4LBQA 1KS4A 4ISQA 5E8AA 4XPVA 1IS6A 4XFHA 4DZGA 1AX0A 1BCXA 3MPBA 3D5OA 4MXWA 2HWD2 2JKBA 4QPIB 2Q0AA 1WBFA 1ND3B 4I02A 3APBA 4YM1A 1W6OA 1Y9QA 3J8F1 4CP1A 1WMFA 3AP6A 4PLMA 4K21A 4WVVA 2QCSB 2ZAHA 1AJOA 2G4IA 4FOVA 4Q4Y3 1JYIA 1C1LA 5GJ6A 1RUE1 1W6MB 4IETA 1H4GA 2YDEA 4Q0QA 2B42B 4E4ZA 3M3IA 3M3EA 1VBC2 3FLPA 3AXDA 3H1YA 1HRI2 2MEV3 3AYEA 2PHLA 4OZXA 2PFWA 2ZX3A 1YUDA 4XOGA 5F5QA 1LENA 4N7UA 4FP2A 2QE3A 3I2DA 3POSA 2CL2A 1N3PA 1ZZBA 3IM0A 1YNAA 4AQ6A 4WZCA 4CDUC 4M0HA 1LGNA 3ES1A 3USUB 3WG4A 1C4RA 3DPRB 1Z7S2 3SCFA 2LUWA 2ZKLA 3DKWA 4LBQB 1OOPA 1D4VB 2VMIA 4AVTA 1CAUA 4MXWB 5C4WB 5H9PA 3MFAA 5CA6A 4DRRA 4EN7B 4GMP1 3INAA 1H2KA 1DQ5A 2WS92 4X6QB 2QDNA 2RM23 2ZPXA 2VVEA 4YW3A 3CJXA 3ZFFC 1FATA 5FBZA 2UYAA 2TEPA 2ZGOA 2H6BA 1GZWB 1JUHA 4YM3A 3VKLA 3UKTA 4LHLA 1SLIA 4XIKA 5J96B 1EV12 2DCYA 4ORFA 1YCIA 2QNKA 3M2MA 3ROUA 4YZ5A 5DZFA 3K48A 3NAPA 1R1A3 3ZMNA 1NCRA 1EAH3 3GZAA 4FPLA 3VDDB 1POV1 1QQP1 1DYPA 1T6GC 3SLIA 4KH9A 3WG1A 4RS5C 5CVRA 4QQLA 3QBQA 1O4TA 4GA9A 5FLIA 1PM7A 4FPOB 4GB31 2DU1A 5KXBA 4QGLA 5FCCA 4GH4A 1RUH3 4PLNA 4Z07A 2QJVA 3DL3A 4URTA 3WY6A 4I09A 2E51A 3I59A 4JGZC 3D0SA 1BZWA 3UJQA 3SISA 4RR3C 4I01A 1GLHA 5D8AB 2CGNA 5AC92 5JLVA 2A70A 3VZKA 4DQAA 3MDPA 1NCQC 1OOPB 5JI9A 1CAUB 1KQRA 4BE3A 4PJYA 3PLQA 4CDXA 4WZFA 5ABJB 1MEC1 1U5ZA 1SBFA 2NM1A 2RR13 1AVBA 1OQDA 3QCWA 3URFA 2Z5WA 1ZYBA 5BNQA 3OYWA 1PIV1 1PVC3 4GQ7A 1VAMA 2FZ1A 4IL7A 4XF4A 5CNAA 4YVWA 2DTWA 2VW2A 4KG8A 4FPEA 4PDWC 1N1YA 3MW4A 4L9BA 1VRH1 3ZSMA 5BNOC 4HMZA 2ZGTA 1HQLA 2PQQA 1R091 2IZWA 2DVAA 3JU9A 1ND2C 1NCRB 1CQ9A 3MIEA 4RQPB 1OKQA 1O4YA 2HWC1 5ACA1 1AL23 1D0HA 1UU6A 4P9YA 5LEJA 2WZR3 3HBZA 1XNBA 3MIFA 4DFSA 2YV8A 4I0WB 4PBOA 1FI2A 5T5OA 1QJU2 2CYFA 4Q4Y2 3T1MA 3V65A 4A7KA 3TB0A 2ERFA 1V9U3 3FUOA 4GIQA 2HWF1 4IV3B 3KCYA 3BU7A 5HCAA 4OHZA 1COV3 3TRSB 2MEV2 1U12A 5I0TA 1ZBE1 1DGRN 3MI8A 3M70A 3TN91 4JGYC 3I59B 1C57A 1PK6B 2JE7A 3M3QA 3ZSLA 4DRVA 1QJY1 2ET1A 4COYA 4CDXB 4XF1A 2YZ4A 2O0OA 1S0DA 2GN3A 1S0BA 3HIFA 2GMMA 4K40A 1G9FA 4IERA 3GBFA 2WIIB 1F5JA 3OYWB 1V6LA 5J3UA 1BVP1 4P9XA 2OUJA 3TNPB 4YVWB 3LOBA 1R083 2VH9A 1UPSA 1V6KA 1MS0A 1YFYA 4FBFA 1V6OA 1AR93 1MZEA 3AP4A 2AGSA 4UW6A 2BW8A 2RM22 5FPXA 4COUA 1OI6A 2EXHA 2IC1A 2JECA 5IK4A 5K9YA 4CDUA 3AM2A 1IHMA 3CJIC 3ZIXA 1WLTA 1VLNA 4FTBA 4HBNA 1H8TC 2DCKA 3WV6A 5J37A 4N53C 4EROA 1AX1A 1S0EA 1D4M2 5GZGA 3TNQA 3E6DA 3PHMA 2BNNA 1L3JA 4XMAA 3RZZA 1RMU3 4QHBA 3ES4A 3RI9A 3WDTA 4I2OA 5J7MA 2YUEA 3KQRA 1ZVFA 4GXLA 3OJBA 4FOQA 2HEVF 1QOSA 4XF0A 2ETEA 2ZGQA 1VB4A 1W39A 1FPN3 5GKAC 1LECA 3IPVA 1O3QA 4CP0A 1RUH2 1W6NB 2GNTA 3ZFEA 4OFGA 2XJQA 2VECA 2JG8C 2GC3A 2V5YA 2ZGSA 1SDWA 1MR5A 5JOYA 4LBJA 4PIXA 2D44A 1XXNA 3ALQA 4PQ9A 1EY2A 3N4MA 3P3PA 4RS5A 1BK1A 2IXJA 3ATGA 4NHLA 2WFF1 2BFUS 5IK5A 3RDIA 2JD4A 4DOUA 2ZAAA 4FO9A 4Q4V1 1GR3A 2RR12 3JQWA 1LHUA 1B35C 4LLFA 4CDUB 2HWE3 1JUIA 2HJIA 5I91A 4WVWA 4U36A 2XJTA 1QH6A 1U5XA 5FOJB 4JGZA 4YW2A 5KWRA 4RR3A 1UKGA 5C8CB 1AR83 1DHKB 2AYHA 1AZDA 4ITCA 1NCQA 1U0AA 1LKNA 4BHPA 4K7JA 1B09A 4LA2A 2KA3A 1AL22 4KU8A 4FPJA 2IXHA 5J09A 4AHXA 1FOD3 3FLTA 4O9EA 2Q8OA 3JB4C 4KU7A 5GLUA 3AXEA 5D1IA 4M3CF 2ZACA 1V9U2 3FFQA 3GBWA 4JRAA 1UIJA 2D6NA 3WDUA 4PDWA 4WVMA 3WXPA 3ELNA 1WLDA 4FPKA 3VBUC 3ZFEB 4AI2A 2LALA 1ND2A 2NP0A 1GBGA 1KDMA 3S6PA 4JRLA 2WLPA 1O3RA 2I74A 4QPGB 4XTPA 1GQGA 2E7QA 4JQRA 1W0PA 3RS6A 4IQPA 4GWMA 4RS5B 3M7AA 1BVVA 2A6WA 4OUMA 1WGPA 1LU2A 2W68A 4DY3A 4FP3A 4WM7C 4OULA 3JBG2 5GM0A 4PLOA 2CNAA 3QH6A 5CAZA 1N1TA 2BFUL 3NW4A 1BXHA 2PHXA 2P2KA 1R082 3N7LA 3ECQA 1UX6A 4JGYA 4AE2A 5JR7B 4JDOA 4ES8A 2JJ6A 4XQDA 1RUC3 4RR3B 1AR92 2VMHA 1J1TA 2PHFA 3H50A 4Q4X3 1ENXA 3JB8A 5B2GB 2X5IC 3B93A 4W65A 4CRQA 1DIWA 4LO6B 5TSWA 2DURA 4XW3A 5EV7A 1O5LA 4IEUA 2VNGA 5DXDA 1F8VA 3BIWE 3B3QE 1AXKA 4AVBA 2G9GA 2WKKA 2CWMA 4K20A 1ONAA 3IN9A 3MLLA 2WZPP 1KRIA 5C6CA 1Q8OA 4YGCA 1CD3G 2X29A 3G7DA 4PDWB 1RVF3 1MS8A 1LOCA 1RMU2 1HKDA 4WVMB 1RHI3 5DG1A 1ND2B 3B69A 5DDJ3 2C0ZA 4KWJA 4YVSB 5AVPA 1AYM3 2FQPA 1AYN1 1WD4A 4FAHA 2D43A 3JD73 3CJIA 5FLJA 4MLOA 3ZYPA 2HWD3 1H8TA 3PVOA 4HVOA 3W59A 4N53A 2QUOA 1VBE3 1RUD1 1I1EA 1RUNA 2OZ6A 4ZKTB 4OVEA 2Q30A 5GZDA 4FCAA 5L19A 4X6RB 4L8QA 1OA4A 3W9AA 2BUKA 3BB6A 1ULCA 4M00A 3LWCA 1BBT1 1HQWA 4RFT0 4JGYB 1QNWA 2XBO1 2FBEA 1BEV1 2XL7A 3FZ3A 3BCWA 1PO13 5JOWA 2R042 1KITA 1PO23 3ILFA 1H1IA 3WQ0A 4COZA 4OHWA 1NG0A 4Z82A 3SHRA 3WHUA 1VB2A 5T55A 1VP6A 4AQ2A 1WCDJ 2JG8A 2AUYA 1A8DA 4RD7A 4Y1ZA 4EWAA 3M1HA 3ENRA 4OLLA 1LHVA 3AYCA 4I0AA 5J36A 2HKXA 4GKXA 2RS31 3S7EA 1C8M3 2ZOEB 4Q0SA 3ZDSA 4NOTA 1FNZA 1TME1 2NQYA 4K9SA 1A8MA 2RMU1 3VBOC 1XU1A 3RJ2X 1VBB1 1RUG3 1FOD2 1QJX3 4K1ZA 3ZN6B 1VAVA 2HEWF 1B35A 2CY6A 1QDCA 2BNMA 1HXS1 3S30A 3PJYA 1TQ5A 5E88A 3VHRA 1IS5A 5LK7B 1MS5A 3CJIB 4NHKA 2WWSA 3B9CA 2LM3A 3WP6A 1H8TB 2GH8A 2VGDA 5L7OC 1YJKA 1APNA 4N53B 1LOGA 2PTMA 2WS93 4FTEA 4Y22B 4AEKA 1WW6A 5GLZA 2QZ2A 2GC1A 1UIKA 4MGZE 1NE6A 4AK3A 2IXIA 4G4FA 4H55A 3RRDA 1H2LA 3LA2A 2ZGNA 3QACA 2I07B 3PVEA 4DS0A 2YROA 4LA3A 2CGOA 1OSGA 3BTAA 2WSUA 1O91A 4LBMA 4Y20B 3VBRA 1ULDA 5E16A 1Q5OA 2PHWA 3VBUA 2R6QA 2JG8B 3WUDA 3D8CA 1YI7A 3CO2A 3ZXFA 4FQZA 2XWBB 2C5DA 5F6LB 2WA3A 3ZSEA 3ZXLA 4U2AA 1AXYA 2EAKA 4FPYA 5JSRA 4I3PA 1RUC2 4ONUA 3OF1A 3V64A 1CAXB 5EYYA 2RS51 4Q4X2 1BMV1 3O0VA 1TMF3 4YG0A 4YZ2A 2RS11 4CEYC 1MZ6A 4AGGA 3JUUA 3LOIA 4WM7A 1TNRA 3UKVA 3HD8B 5CBLA 5HCFA 4Q1PA 3SMHA 1O7FA 1RUF1 3AZVA 1KDKA 4ATFA 3DUIA 4HN0A 1X33A 1KJLA 2UWBA 3J8F3 5LRSA 2EALA 2X8KA 3ZN5A 5K8SA 1OPOA 3SCHA 3ZXAC 3FWEA 4MGKE 3ZYJB 1RHI2 3KT4A 2X5IA 1RUE3 3GNEA 4N90A 2V09A 5H9QA 2A3XA 3U0ZA 4RSUA 2ZA9A 4ASMB 3AP9A 1AYM2 3JCIA 4OUSA 4E4SA 1AR71 4CEWB 5CADA 3AMHA 1S0CA 3JD72 4C0HA 2AH2A 1H1AA 2XB6C 4HVQA 2WJSA 4J1XA 2R32A 2VOKA 4R8HA 4F7ZA 4DY5A 1V6MA 1VBE2 4B7KA 2QKDA 1N1SA 3C3VA 5IUQA 3VBRB 3V0AA 2WC2A 3DF0A 4KGGA 4ASLA 3PJQA 1N47A 5C8WA 2DVDA 5BY5A 3FBMA 1NLSA 2XKOA 3THTA 1QJU3 2B5HA 1V00A 3ZX7A 1CIWA 1IQAA 3B94A 1R1ZA 2A3WA 2FHRA 1PO12 3AKRA 3QLQA 1PO22 4LO7A 1SMVA 2D6PA 4FXGB 1IKPA 3SH3A 3WP4A