5LY1A

Jmjd2a/ kdm4a complexed with ni(ii) and macrocyclic peptide inhibitor cp2 (13-mer)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Highly selective inhibition of histone demethylases by de novo macrocyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ly1A01
4QXBA 5FZ9A 5A3PA 5FYHA 4GAZA 5F3IA 5A7QA 3ZPOA 2XDVA 5FYSA 2Q8CA 3N9MA 5FY1A 2XMLA 4UF0B 3PURA 4D6SA 3RVHA 5F2SA 5A3TA 3K3OA 2YU1A 5FV3A 4CCOA 5A3WA 4IGPA 5FJHA 5FY4A 5FP8A 2GP5A 2P5BA 3KV9A 4V2VA 5ANQA 5FXXA 5FYTA 3PTRB 5F3CA 5IVEA 5LW9A 5ISLA 2WWUA 3KV5A 4QX8A 5FZDA 5FZGA 5FZ0A 1VRBA 4ASKA 2GP3A 4XDPA 5FY9A 3LD8A 5FZ6A 5FZLA 4D6QA 3AVSA 4UF0A 5A7OA 5KR7A 3AVRA 5F5AA 5FYVA 4GJZA 4CSWA 5FP4A 4DO0A 4EZ4A 3PU3A 5FUPA 4BU2A 5A7NA 3N9QA 4QWNA 4IGQA 5FP3A 2PXJA 5FZFA 5F3EA 3PU8A 5IVVA 2OX0A 5FBJA 3K3NA 5FZHA 3DXUA 4AAPA 5A3NA 5FPUA 2YBKA 5FP7A 3PUQA 5FYIA 3OPWA 4LITA 5FY0A 5IVJA 5FWEA 5A7WB 4QXCA 5FYMA 2OQ7A 5FUNA 3PUAA 5F5CA 4C8DA 3DXTA 2OQ6A 2VD7A 4LIVA 3AL5A 5FY7A 2Q8EA 5F5IA 5FPBA 5A1FA 5CEHA 5FZ8A 3N9PA 5FY8A 5FZEA 5IW0A 4QXHA 5LY1A 4V2WA 5FZ1A 4BISA 3AL6A 2Q8DA 5A7SA 5FZ4A 2YBSA 4LIUA 5A1LA 4AI9A 4BXFA 5FYUA 2XXZA 5A7WA 2OT7A 3KVBA 4HOOA 5FZKA 4XDOA 5FZ3A 4CCNA 5FYCA 4HONA 5K4LA 3ZLIA 4TN7A 3K2OA 3KVAA 3PUSA 5FWJA 5LWBA 5FZCA 5FZOB 5FPLA 5FPAA 5FY5A 2YU2A 4URAA 5FXWA 3KV6A 5FPVA 4GD4A 4EZHA 5FJKA 5FXVA 5F39A 4Y3OA 5F3GA 5IVCA 2XUEA 5FXZA 5IVYA 3PDQA 2W2IA 4DIQA 5FYYA 4QU1A 5LY2A 5FZIA 5FZOA 5F2WA 4CCMA 3KV4A 2YPDA 3N9NA 2OS2A 5FYBA 4GJYA 4CCLA 4D6RA 4NUBA 5IVFA 3N9OA 4QX7A 4CUGA 4Y4RA 5FYZA 5FZ7A 3UYJA 3LDBA 5A80A 5E6HA 3OPTA 3U4SA 5F32A 2WWJA 5A7PA 4E4HA 5IVBA 3U78A 5FZMA 4CCKA 5F37A 4Y33A 2YBPA 5FZAA 4LXLA 5IWFA 4EYUA 4CCJA 3NJYA 4IGOA 5FZBA 5FP9A 3N9LA
chains in the Genus database with same CATH superfamily
4JHTA 4W6XA 1ULOA 2HBTA 5DDJ2 4LA3A 2R072 1RHI1 1RUI1 2WFPA 1GMMA 1HIXA 1X8EA 4Y24A 3VBRC 4DY5A 2XMLA 1QJX1 4XHXA 2G9ZA 2YC2A 2VUCA 3E5QA 5A3OA 3HT1A 1K42A 3ON7A 4LBQD 1OKOA 1PO12 4FSJA 3BTYA 1QH6A 4NAOA 3MGUA 1AYM2 2ZGLA 3FC0A 1QOOA 3ENRA 4OHXA 1QKQA 3GZUC 4AGRA 1UYPA 2WWUA 4LBQA 4AFBA 5FCCA 3IKWA 1LGCA 3J9SA 3ZFGB 3AMMA 5EFUA 5FY9A 3FBMA 3M8LA 4ORFA 2VZSA 3F2ZA 5A1AA 4CSWA 2I45A 4HBNA 4E8DA 1GZTA 2WO2A 4NRMA 4AYUA 2I07B 1AVBA 3J7HA 1EAH3 4LO7A 4XQDA 5C4WC 2OX0A 4GMP1 1C8NA 4ZS2A 4BZ4A 2Q0AA 3CJIA 4RA0A 1JU4A 4Q4V3 3M4FA 1J1LA 1BEV2 5CG8A 4AI0A 4Y5SA 2VCAA 2ZEXA 1ODNA 3WHTA 1O4YA 3WNXA 1WW7A 1YHFA 1FPN2 4EN8B 2Y6JA 2R061 2BDRA 1NY72 4MO3M 1OUSA 4GB33 4Y1UA 1WGPA 4V2WA 1JZ3A 3B94A 4LHNA 3RFRA 1VBA1 5A1LA 1WMFA 5JXJA 2D6MA 1NKGA 2XXZA 1IS4A 2PELA 1O3SA 5D1IA 5T55A 3ZPYA 1OMIA 4DXRA 4Q4W1 5FLHA 5ACA1 2JXAA 2W1WA 1UZYA 5EJ1B 3VHPA 3U4XA 2BQPA 3LCPA 1WW5A 3PVNA 1OFSA 2FBEA 1RMU2 3ZFEC 4Q0UA 1CAXA 5ABJB 3DEMA 3BYWA 2DCYA 3S5QA 4PLMA 4I2OA 1XRUA 4LE3A 4XABA 3NQHA 1CPMA 2GAUA 2XOMA 5LASA 3T2TA 4K21A 1SACA 1CPNA 1NLRA 1S0IA 1WLTA 2O8QA 2Y0IA 3ACGA 3ITQA 4G9SB 4AHZA 1QJFA 3BU0A 1SPPA 2WFF3 3TAYA 2DCTA 5IVYA 4R52A 2GSYA 1MVEA 2WAOA 1T6GC 1W8OA 5CAZA 3BODA 3DPRC 4XFIA 2ORXA 3CJXA 1PO21 2EAAA 2O1QA 2VMIA 2SLIA 3B00A 3KCCA 2RR11 3D0JA 3BTAA 1HB3A 3I8TA 4KG8A 5KC5A 3BTZA 4RYDA 1W39A 1O4ZA 1WMXA 2A71A 5FYZA 5HBAA 4ZS3A 1OF4A 5L73A 2OA2A 2D6LX 1B09A 1N1SA 5E6HA 3UETA 4A42A 4BDVB 4MGYE 5IATA 4HANA 1JZ5A 1V70A 4MXWA 4XFFA 1HXS3 3X29B 5FZAA 1OBNA 5FP9A 1MVQA 2EIGA 1L7RA 4Y20B 2CAUA 2DV9A 2LS6A 3SKJE 4B7KA 2D5HA 4XCBA 3VDDA 4A7ZA 1GZWB 1N3PA 2JENA 1AYN2 2VMFA 4WM7A 2QDRA 3NMBA 2PN5A 5CZKA 1XB9A 2ZAHA 2HWC3 2RHPA 1C8M1 1LOFA 3RYRA 4AVAA 4XF1A 1XU2A 2JG9A 5FJHA 4KQ7A 1PX3A 1VBB2 2VMCA 3GZAA 3N36A 1O3RA 1HV1A 5JOZA 1WBLA 3Q8AA 2LALA 3RPQA 5ISLA 1W8NA 2WNVA 2B4KA 1XE7A 2PMWB 3R0RA 1MR5A 3B69A 4OULA 5FZLA 4B7EA 1HRI3 2DTYA 3LEGA 4Y22B 1XNTA 2K2SA 5BNNC 1HV0A 3BALA 5J7MA 1MQTA 1QOTA 2NQYA 5FP3A 4LKSA 4MOAA 2VNGA 5FRAA 2EXIA 3K3NA 5FZHA 3TN91 5F9TA 5K7PA 4Q5OA 2Q30A 3ZMNA 5HCHA 1SLBA 5JR2A 4BCUA 5CKQA 2AACA 5SV5A 5IVJA 3B7MA 4HXCA 5A7WB 3AB0A 3FBYA 4K7JA 1UPIA 1UXXX 5DXDA 3NNLA 3AL5A 4BH9A 1S0JA 2IXIA 5C5UA 5F5IA 1P8JA 2ZX2A 1SG3A 5LK7B 3RZMA 2UY8A 1VAVA 4NHXA 4RHV2 2PAEA 5LY1A 2BYVE 4DY3A 1SDWA 1U0AA 3I59B 1EUTA 3V56A 4AVCA 4N53A 3NJZA 1OPOA 2E6VA 3NV1A 2YG0A 4COUA 5GLTA 4E4ZA 4GWMA 4IEZA 4DRVA 4Q4Y1 2HEVF 2HWF1 4XDOA 4JGZC 4EN9B 3IWZA 1RUC2 2EICA 2WZR2 3BOPA 4HONA 5G04L 4AI1A 5EIYB 3LE0A 3ZO0B 4OQ8A 3PUSA 3CIHA 3ZXKA 3CF6E 2D6PA 3A0NA 5BV6A 3VD7A 1SFYA 3WLUA 2A3YA 4LBLA 1GFF2 4QHOA 4H3WA 2DUQA 3SHRA 2WL1A 4P9YA 5F3GA 4FAHA 5J98B 5A6YA 3NWKA 1ASJ3 3ALQA 4UT5A 1CZVA 1PNGA 3RZLA 2WYFA 3ZSLA 1LAJA 2VOXA 5FO7B 4ZY9A 2CYFA 2ENRA 5LY2A 2XGXA 1IG3A 1ZYBA 2J1UA 1DQ4A 2VUJA 3KV4A 3N9NA 2RS13 2R30A 2WNVC 4FT8A 4Y1YA 2NMNA 3GBGA 1PVC3 1UKRA 3O7OA 4ARXA 5IFPA 3GGLA 4UFIA 3LFIA 4IDZA 4OI4A 1QMJA 4YGEA 3LDBA 4XVHA 2VMHA 1XNAA 3NKGA 3U4SA 2R0HA 4COZA 1QDOA 2E9QA 2VZUA 4Y5TA 5FK8A 2RDQA 4IEOA 4L97A 4AVSA 4IGOA 2QVSB 3ZDSA 1AR71 1RUF3 4Y26A 3VBRB 3QLQA 1YFWA 3C7OA 2W87A 4XUPA 4MV2A 4CPBD 5KBFA 2O0OA 2E32A 1DLCA 3PVEA 3NAPA 2XJTA 4JX0A 3DV8A 5E89A 3WDWA 1CWPA 1ENRA 2VECA 4CPBA 1W03A 1W2AX 5FV3A 4LNVA 4UFKA 4Z2WA 4OI2A 3W9AA 4DPNA 5FKCA 3WUDA 1RUNA 2NLRA 3T1LA 4FP3A 2VTXA 1H9PA 1EV13 1ZRRA 1PIV1 1U5YA 3KV5A 4KL1A 2EXKA 2JX9A 5FZ0A 4YLZA 3WUCA 1HJGA 5JAXA 4BQ1A 4QX3A 1R093 4YG0A 2RM22 2IWGB 1W8UA 3AVRA 5F5AA 3EMRA 4GJZA 3WW1A 5FP4A 3ZSKA 2ZPXA 3ZR5A 4M3CB 4Q26A 1UCXA 1Q43A 3B9IA 5A7NA 4BU2A 3D0SA 1G9DA 3N7JA 4N90A 2EIBA 3WQBA 4FPOB 4YW3A 3WF4A 3CU7A 3MIBA 1H30A 4N43A 5FPUA 4QB6A 4AEKA 5FP7A 5C3OA 4DFSA 2Q1ZB 1FOD1 5AC91 3B93A 3AZYA 1XYNA 2DBIA 2FMDA 2WWSA 1DLLA 2Q4SA 2VW2A 2Z5WA 4LEJA 1YQ8A 2Q8EA 1GBGA 1LEDA 2WFF1 2Y6FA 3U75A 3HWJA 2WLQA 1YQ2A 2HYKA 1W6MB 2FDFA 1XNKA 4AEMA 4Z8BA 3O1SA 4AFCA 1RUD3 2DU1A 2ZGRA 5HI0A 4NPRA 1JZ6A 4MHUA 5I0RA 3W5NA 3F95A 3ZFEB 1LOCA 4ARYA 5FZKA 5GLWA 1EAH2 4AI8A 1J3QA 1UN1A 4UOJA 5FYCA 4NIHA 3ZYIB 2J1EA 1A78A 3KCXA 3OY8A 4Q4V2 3MYXA 1DYKA 3U1XA 4NVPA 3ZFFC 1RITA 1FNZA 1RUG1 5FZOB 1J83A 3ST7A 3FZ3A 4CE8A 4ZU7A 5KXBA 1JYCA 2PHDA 3FHAA 3MF6A 3IAPA 1UPSA 4Y3OA 1SZBA 3DPRB 1BVVA 4NWVA 4OCTA 3K4ZA 4PF1A 3WF1A 4BJ0A 4GB32 4DOUA 1GKBA 1NA1C 3ZXFA 1FMD3 1RC6A 2A3XA 5FTTC 2VOWA 2IXJA 2JKBA 2ETEA 5EHDA 3MFAA 2QDNA 3OUHA 4UI9L 2VG9A 2AREA 4YM2A 5F2WA 1PGL2 5DG2A 2YPDA 3D6EA 4L99A 1UZ0A 5FREA 2EALA 1IS3A 2ZKNA 4OLLA 1Y9QA 2DBNA 2JDUA 3THTA 4CVUA 1ZVFA 4YG6A 1ZREA 1ZBA1 4S2DA 2TEPA 4QT6A 5F32A 1NLSA 1LGBA 2YGMA 3ZM8A 3ZXGA 5FZMA 2QCSB 1W9YA 4GKYA 2Y6HA 3KT7A 2VBDA 2EIEA 2MEV1 3HNYM 4X8NA 4DNYA 3V0AA 2VZVA 4M0NA 1AX0A 2N7GA 1DYOA 4QXBA 1UIKA 2XHNA 5JIUA 2QFEA 2QQUA 5FZ9A 1UOGA 2PHWA 4E27A 5A3PA 4NIIA 1QJEA 4XF9A 2OXBA 4AFAA 4WZCA 2X5IA 5A6ZA 4IEUA 2Y60A 2GNDA 4AHWA 1JUIA 3KGZA 3VZOA 3VZNA 4OYUA 3MHZA 1HW5A 2F4LA 1TEIA 2LW8A 1BBT1 2RE9A 4IETA 3ZSJA 3WQ1A 5F5QA 4YZ1A 3VHRA 1AR91 4KBZA 4BQ5A 1OOPC 1LHWA 2E26A 2VVDA 5BNNB 3VLBB 4K40A 4BIFA 1HXS2 2PLV1 1D0GA 3AP4A 4PIXA 3VKNA 1LTEA 2XJUA 3HNBM 4PCRA 3ACFA 3EXUA 2YPJA 4FTEA 2XLFA 1SPPB 1US3A 1W8FA 2FMYA 4KBBA 2WN2A 3IPVA 4Z1VA 5CFDC 2HWB3 4XBNA 2P3IA 2GN7A 2D6KA 5JIAA 3LGRA 4E2GA 3PUQA 3ROUA 5HV4A 2Y8KA 3A23A 2HWC2 1JOBA 3POEA 4D7YA 2P3JA 4JCKA 3RDIA 4NRPA 1X8MA 1I5PA 1ND3A 2IFRA 1W8HA 3ZYFA 1YXWA 5C3QA 4JGYA 2JDYA 4ES9A 4PQ9A 4I0BA 4YPJA 4F8AA 3QH6A 3TEZA 3JQWA 3IDCB 1HRI2 2L9LA 2YV8A 3PVBB 4QQHA 3WG2A 4YZ5A 5CKNA 1NXMA 4E2SA 4JGZB 1MZ6A 3N3HA 4UFLA 5D8AA 4HKWA 4LORA 1GV9A 1Q5OA 4AI9A 2Z4FA 1UY3A 1RHI3 1RUI3 1IOAA 3E1F1 1H2NA 2OT7A 4NWWA 4YGCA 4Q0SA 1W2TA 1RGSA 5KHJA 3WZ1A 3ACIA 3IIAA 1AXKA 5IAXA 1PVC1 1V6NA 4DQAA 1QJX3 1D4VB 5J37A 4XFAA 4QHZA 4X6QB 1IHMA 1RUE1 5L19A 5J96B 1FX5A 4YM1A 4GD4A 3I2FA 2YROA 4UAPA 2JE8A 3AP6A 2PQQA 1SLLA 3CBNA 4AAXA 4N8MA 3LEMA 1OUXA 1DHKB 1E5RA 4A6SA 4XUQA 3KSCA 2WNVB 4CA9A 4BMBA 4DIQA 5FYYA 4D94A 5I93A 3ETPA 3JBG1 3RJRA 1Q8VA 3MW4A 2XVGA 2NPIA 2BUKA 4YW1A 5IFTA 1CAVA 1DDLA 2W95A 3HIFA 3WXPA 2E7AA 1G86A 4GMP3 3RMXA 3WDYA 3NRUA 5LBEA 2VVEA 2D43A 1L3JA 2DCZA 2ORZA 1BXHA 4W65A 2PHUA 5J1XA 2YHJA 2VZOA 4GH4A 4LBJA 4CEYB 3GCXA 3D4KA 5FAXA 1LR5A 3T2OA 3VL8A 1MS0A 1E5HA 5CBLA 3V0BB 5BY5A 2R063 2RV9A 5SV8A 1K5JA 3IB3A 3N9LA 1ASJ2 4IV3C 1Z0HA 3AP5A 4JV4A 4B4PA 2ZGMA 2X05A 4XBLA 2WNUA 4BQYA 3ZPOA 1VBA3 2Z79A 5FYSA 2ZACA 2BV4A 4XTMA 3MF9A 4IEWA 2RS12 4P9LA 1DFQA 2A70A 1O91A 3K3OA 1YWKA 4Q4W3 5ACA3 1GWLA 5EYXA 1PVC2 5JPNB 3MLKA 4M01A 4XF3A 2FCUA 4XDQA 4R4ZA 5FP8A 4K20A 3I54A 1HRV1 2CY6A 5DPNA 5FUIA 4B1MA 1UZVA 4YWAA 2OZJA 4FAGA 2EVXA 2E63A 4ASKA 5J36A 1W6QA 3P6BA 4XETA 4BQWA 2CHHA 1BJQA 1AL0G 1JHNA 1EUUA 2R7EB 4MUVA 1RUF2 2D98A 3IMNA 1MZEA 4K1YA 2XLAA 4TTGA 5J3UA 3FJSA 2BGOA 1H4GA 3V65A 2WIIB 5KXDA 1CZSA 2D40A 3O14A 3VZJA 4CCCA 4CDWC 1PVXA 4FP2A 1CAUA 3VDBA 3KM5A 2Y6LA 1PO23 1TG7A 1DGWX 3NV4A 3I97A 3POBA 2RR13 3POSA 1H8VA 1DP0A 1AXZA 2KD7A 1OFNA 5EJZB 3BTXA 1B35C 2ARXA 3RRDA 1ZRFA 2V4VA 1EV12 3BB6A 4PF5A 2X53S 3BKZA 4AQ6A 5BNQA 3APBA 2ZZJA 3MUY1 1R092 3SCGA 4BWOA 4A3XA 2RS51 4BISA 3TOJA 3FLPA 4RGAA 1O8SA 4AXOA 1ZZ7A 4LUKA 2VOKA 4TXWA 3VBHA 1KJRA 5HCBA 1KS4A 2D93A 2W47A 4B1LA 1V6OA 1K5MA 1L7QA 1POV1 2ZA9A 3VKLA 1IKPA 3ZXDA 3ZFFB 4M0HA 3S5AA 1E5IA 4XZPA 3UGGA 3P3NA 4QPGB 2NP0A 1LULA 1URXA 3ME2A 3S57A 4IUGA 1C8M3 1VAMA 1YUDA 1S0FA 5FY5A 5LCWL 1OQEA 2GZWA 3GHMA 3K51A 1CR7A 1OKQA 2VO5A 1NA1B 3RZZA 4Q4X1 2ZKLA 5FXVA 4CU7A 3POGA 2FHRA 2GU9A 4MLOA 1H0BA 4V1PA 5LRRA 4HLTA 3VZKA 4N9IA 1MS8A 1RUD2 4DXZA 4XAEA 2ZHLA 5FZIA 1RXFA 1O3TA 1TMF3 4HKOA 1GP4A 4GALA 1I3HA 1UMIA 1QH7A 4KG0A 4AI2A 4CCLA 1LNSA 5IVFA 1LU2A 3TN93 1KITA 4CUGA 5A6QA 3NKTA 1MPXA 4Y4RA 2XUMA 4EN0A 3FFQA 4A7YA 1WCQA 3SQOA 2DVDA 2AENA 3O0XA 1NCRA 5F1RA 2BFUS 2B9VA 1XNBA 5DUWA 2JDPA 4XYXA 1RJ8A 3AKTA 2IZWA 3OYWB 1I5ZA 2JE7A 5FZBA 4CEWA 4KH9A 3POIA 4F3JA 2ET1A 1QNWA 5IT6A 1WMDA 3I49A 3JZVA 2W68A 1FMD2 3AMQA 4KGGA 4DRRA 4GAZA 3WDTA 5LEJA 2DYCA 3WG4A 2BVBA 2NN8A 2WAAA 2JDKA 1JYWA 5F2SA 1VMFA 1H8TC 4Q4Y3 3KCYA 1US2A 1V6JA 1AR81 2HWF3 2ZCWA 1KFXL 4O65A 3SKVA 5C9AC 3T2QA 2VBPA 2QE3A 2XQXA 4IERA 4CCOA 2OPWA 1OOPB 1UAIA 2QQPA 4I02A 5IVEA 1JYNA 1TQ5A 3L2YA 4A45A 2HBUA 5FZDA 1OQ1A 4QPWA 3VZMA 4PQQA 4NE9A 1OA3A 1K5MC 4YVSA 2P37A 3HMYA 3K75B 4XPVA 5FMCA 1PZ8A 1X9PA 4UF0A 1VIWB 1W6PA 2A6VA 4PJYA 3SLIA 5C7GA 5CFDB 4LTAA 4KWUA 2RJ2A 2VPVA 5L9RA 1WWYA 2A6YA 3K46A 4D69A 2F4PA 4JQRA 1DZTA 4QKFA 5JDBA 2V5DA 1S2KA 2ZGQA 5A33A 3NJXA 3OGJA 3T08A 5IK8A 4FTSA 3WNPA 2NMOA 5L9VA 4D7TA 4BQ2A 4YM0A 1X50A 3OPWA 2BOIA 5JZGA 3MW2A 5IUQA 3OB8A 2VD7A 3IT8A 1X36A 2CNAA 4NROA 4FI9A 1RINA 4CDUC 2VNVA 4IEYA 2VC9A 3MLJA 5FY8A 1D4M1 2BOJA 2YFUA 3O0VA 2WZPP 1RUH1 2WQ8A 1OQDA 4IQPA 4QKBA 3WOGA 3WCSA 5A7SA 1PK6C 1AR73 4XXAA 4LIUA 2R49A 1ZZ9A 4C0BA 5FYUA 1V6KA 1XOYA 5CKMA 5DZFA 4BPZA 1JZ4A 3Q8BA 3GNEA 3KVBA 2YDEA 4CP9B 2VQ0A 2HWB2 2VW0A 4AQSA 4XEZA 5EXOA 3MO4A 4XUTA 4P14A 2BJSA 2WO1A 2VZ1A 5C70A 3ZDVA 4Z07A 3ZKYA 2FDHA 4UFHA 1MS9A 1LENA 3MV11 3W5MA 2JKXA 4LQRA 1UU4A 3BVCA 1PMHX 4PIZA 3SH3A 1F35A 1PIV3 2VGDA 1JYIA 4K9SA 2E31A 2UYBA 3HBZA 1MS4A 5GZFA 2IXCA 3OCPA 5FPXA 2QZ3A 4K8FA 4W4ZA 1VB2A 4MGIE 3CKHA 2VVFA 4UFJA 1SLAA 4LO8A 4QU1A 3I2DA 2P6CA 3LAGA 1RHI2 1RUI2 1POQA 2W46A 3ILFA 2Z42A 3HN1A 1OH4A 4JQTA 4RS5C 4YVSC 3MPPG 2JB4A 1QJX2 2WN3A 3ZMOA 3HJRA 2GDFA 4RR3A 3IPVB 4LBNA 3OBRA 2VCBA 4YGDA 2RG4A 1FOD3 2R16A 5AC93 2EA7A 4MGKE 4IV3B 1IKQA 5C3RA 1W9WA 2RS31 3OD4A 4MYEA 2BWCA 1FXZA 1ENQA 5IWFA 4CCJA 5C3PA 5I8TA 3WP3A 2CSGA 2JE9A 2DWRA 1H1AA 3AZVA 4MX3A 3SH4A 4JTNA 2D97A 3SC7X 1PGW1 1AL21 1F2NA 2BGPA 5E16A 4QDRA 1SQ4A 3KT4A 4P9JA 1YFUA 3DN7A 4O61A 4WM8A 4XQWA 2XR4A 5LA2A 4Z2AA 3UT0A 1OC1A 2B39A 1WD3A 2IC1A 2XBO1 4AFMA 1WA6X 2BGCA 5F6KA 4GXLA 4CP2A 4C1WA 4UBGA 4A6OA 4HG6B 5A3WA 3VKFC 5DZEA 3ELNA 1FV3A 1Y9MA 2OPKA 3GXUA 1VPHA 1SCSA 2ZEZA 5FXXA 2HYXA 3PTRB 1RUG3 4PLOA 4LBOA 1C3HA 4AK3A 4LOSA 4NHLA 3KD4A 3LKJA 2C5DA 3RYKA 3Q8FA 5A7OA 1ND2A 2W52A 2R062 1O5UA 3MUZ1 3UESA 4X6RB 2F6BA 4CDWB 3CJIC 1COV1 1IS5A 2B7YA 4QU2A 3SCFA 1GWKA 5FBZA 1VBA2 3VBOA 2C6SA 4AHYA 2TUNA 4HZFA 3EO6A 4WVMB 4CCEA 1AR61 2AUYA 4AAPA 4F7ZA 1B35B 3GJAA 4ZPIA 4Q4W2 4PDWA 5ACA2 4YZ4A 2ZS6B 3USUB 5JOYA 1W6OA 1Y4WA 3OTFA 3JD71 2V09A 1UD1A 3E6CC 5FYMA 3LZZA 1F15A 1ZBA3 3U11A 3DKWA 4C8DA 4LIVA 5BNPA 5A32B 2XKPA 1T2XA 3W59A 3PTYA 4FTBA 5FQ0B 5FPBA 5CEHA 1PX4A 3WF2A 5FZ8A 1IPKA 2PHFA 3N9PA 4QPIA 1M06G 5FZEA 3OEAA 4XFBA 1UF2C 3NNJA 4WZFA 1H9WA 2MEV3 1LRHA 4W8JA 1GQPA 4XIOA 3VHOA 3WDUA 1GZCA 3E6DA 4FPGA 3I7DA 4RR3C 3NV2A 4EN6B 4W6WA 1QWRA 1QQP1 2WA4A 1TMF1 1LECA 1J84A 1PHMA 2EXJA 1FV2A 4L8QA 4MGTA 5KWRA 1NE4A 3ASIA 2W91A 5C8CA 2J1AA 1PO22 3O1UA 1O4TA 1OXCA 2Q8OA 3WNNA 2RR12 2GMEA 3I3MA 1VLNA 3H8RA 1R1A1 1GOHA 1HN0A 4J1XA 4URTA 2XPJA 4IEXA 5C33A 1BHGA 4BQ4A 1BBT3 3MV01 3S7EA 3AKQA 2HWD1 2EXHA 2A73B 3WG3A 1AR93 1OF3A 4FOVA 4MADA 5BXXA 5C6CA 3HVDA 4P5HA 2PLV3 2R041 4WV8A 3CZUA 1W6QB 4RQPA 2Y64A 3H50A 4AHXA 3KQ4B 1VBC1 3DUIA 1NCQB 4YVWA 3PHMA 1QU0A 3GZEA 2Y38A 3QBQA 4YZ3A 1OLQA 4NHMA 4HFSA 4HPKA 4ITCA 5FIXA 1V0AA 3O1VA 1SBDA 1W0OA 4ONUA 1C8M2 1SFNA 2XJQA 5FMBA 2HH9A 2GC1A 3OGVA 1QNYA 4NJ4A 4AWDA 1CZTA 3VDDC 2RJKA 4AVBA 1Q8QA 4EYUA 1WBFA 3USSA 3NJYA 3JXSA 5E1RA 4WM7C 2QQLA 3ZN6B 1VRH1 3D82A 1PM7A 4FCAA 2CWMA 2D3PA 3IZOA 4P02B 1BK0A 4NMIA 4PDWC 1ACCA 1LOFC 1OH3A 3OG2A 1H8TB 1ZNPA 1D2QA 2ZAAA 3DECA 1WLDA 2JG9C 2H6CA 1DF0A 4IE0A 4B4RA 1UY2A 5C9AB 4CRQA 3VUOA 2WBKA 3MIHA 4FOQA 1DG6A 1PM4A 3ABZA 1SMVA 4F83A 4K8RB 2UY9A 3VV1A 3WNKA 4QPIC 1VBE1 4Q0QA 3TN92 1EP0A 3FHQA 5F6LB 2XKOA 3FE5A 4Q2FA 2WINB 1QF3A 2P5BA 5LW9A 2NZ9A 2W1SA 3D8CA 1UQXA 1RUE3 1MS3A 3A21A 1JUHA 1VJ2A 4HSLA 1PMJX 4XJUA 5L7OA 4CXWA 1MQTC 4OUEA 3ZOIA 3NV3A 2X09A 3VBFA 4MXVA 4AGGA 1GU3A 2GC0A 5FYVA 3WW4A 1UYXA 5C8CC 1NOVA 3KT1A 3EYPA 1MS1A 5FUPA 3RYPA 5KC6A 1NG0A 1H2LA 2D6OX 2V72A 3O12A 3S7IA 1HX6A 4D7SA 4OI1A 1RUJ1 5F3EA 4AEDA 3JBG3 5IVVA 2ZXQA 5FBJA 4GWJA 4Q4Y2 2HWF2 4NAMA 2XONA 1A34A 2JG8A 5C8WA 4CDUB 1A6CA 2D3RA 3FLTA 4AW7A 2C9AA 2OQ7A 2D3SA 3DXTA 4N53C 4ZZ8A 1AJOA 4PT6A 1PK6B 4MGZE 3THCA 4I01A 4FVVA 2ILMA 3UNPA 3BOWA 4Q29A 2Q8DA 3AX4A 4XF0A 3T0AA 3I2HA 5C4WB 2IVIB 4JHZA 4DZGA 1OLMA 2QQMA 2J1SA 2W1QA 3R05A 4LBKA 1D2SA 4C1XA 4ATEA 5K4LA 3NVCA 1G9BA 1CAWB 4QX1A 4LLFA 5T5JA 4MGSA 4YG3A 3M2MA 3RS6A 4SBVA 2VZ3A 2BPA2 3SISA 3SH5A 1DGWA 2QQKA 2DUOA 1HRV3 5CVRA 1C5HA 4ZHNA 5IVCA 3RWNA 1XYOA 4NO4A 2WJSA 3JQXA 5JLVA 2IXLA 1RB8G 3J8F3 4DUXA 3VBSA 2XG3A 3M70A 1UZZA 2DF7A 1AR72 2QQOA 2XJRA 4I30A 1W9TA 4YARA 4RS5B 4XACA 4YVSB 1UOBA 5GALA 5DN2A 1K12A 1LHNA 3A7QA 4QMAA 5JXIA 1QJU1 4INDA 3VDCA 2ZEWA 3H42B 5DUVA 4NN0A 4CDXA 5ERLA 1ULGA 4CYDA 5ANNA 1YFXA 1YCIA 3GALA 3N7KA 3Q8EA 5LB6A 3VBFC 3A22A 1ULEA 3AFGA 1JYXA 1Z7S1 2WC2A 2ZGPA 3AMNA 2PAMA 4JRAA 5A80A 3U10A 2BNOA 4E4HA 5LA9A 4DUVA 3AJZA 3WCRA 1EPZA 5JSOA 1ZA4A 4Y1ZA 3BU7A 1PIV2 4AEDC 5HPOA 1W8ZA 1TME1 3NAPC 3R4DB 1WLWA 3H7JA 2GNMA 2Q1FA 2QJVA 2JG8C 3H1YA 2RS53 4LBQB 4XUNA 5C71A 5F3IA 2B8MA 2E7QA 3TRSB 1RVF1 1ZRCA 2AR6A 1HB1A 3LSEA 3RZKA 1POV3 2ZHMA 2C9KA 3T1MA 3ZYGA 5L36A 4R8HA 4NIGA 1VBD1 4EWEA 3O1OA 2GC3A 1W8WA 2XL9A 4AF9A 1X7NA 1KFUL 4YSFA 3P1IA 1FOD2 2Y34A 5AC92 3MLLA 2CWSA 5GZGA 1OLME 1JOPA 3AZZA 3CJIB 5J48A 4ET7A 2GP3A 5FZ6A 2CTVA 4Q4X3 2WUHA 5T3NA 2WFF2 2OKXA 3VKMA 5KR7A 4AI3A 3U0ZA 2D44A 4N43C 5D2AA 5G05L 4S2GA 4BE3A 1UX7A 1DGRA 1UYZA 3H8OA 2VCCA 4BXSV 3AFKA 1XNDA 2PHTA 4CUCA 2KA3A 3MEPA 3N9QA 5CNAA 3AP9A 4DXTA 3IMMA 5DZGA 2UYAA 1YYNA 3ETQA 2RMU1 1E5SA 3PLQA 5FMOS 1DBNA 3DXUA 1PGSA 4EJRA 3ZFGA 4R9DA 4OZOA 2BNNA 3AKSA 3BIEA 4WVVA 4R9CA 1R64A 2AZ5A 2XHKA 4EQVA 4B8EA 4AQTA 4FQZA 4QQ2A 4XJZA 4CUBA 1REEA 3PUAA 4OVEA 3FHIB 4E4SA 1RUG2 3C3VA 1BK1A 1ZBE1 4RGKA 4RR3B 1REFA 1CAXB 1XPWA 3AZXA 1W2UA 2YUEA 4QXHA 1SCRA 1N47A 2XQRA 4CDXC 5C3SA 1LKNA 1YI9A 2JD4A 1JXNA 1UY4A 4SLIA 3NSTA 2B42B 5A6XA 1RXGA 3OOXA 1H2KA 4XF4A 3ZXLA 2DVBA 3M3OA 3WD5A 3LQCA 1TNRA 1W2NA 4TN7A 5HCAA 1AR83 2WZEA 3DYPA 5L9BA 5FZCA 3LA2A 5A3MA 4XQ4A 3S30A 4URAA 1ZBA2 3IAQA 4GMP0 1WA4A 2Z69A 4FFGA 2WT0A 2XUEA 1JZ2A 1CN1A 1XJAA 4H55A 2ES3A 4OHWA 2PHRA 2MEV2 4LUMA 3GJBA 1XE0A 5JUVA 1G9AA 2ZHKA 4EROA 3K77A 4MXWB 4AEJA 4P9IA 4DXSA 1JTZX 2XL7A 3J7LA 2VE1A 5FYBA 1RUOA 1PZ9A 2G9GA 3ACLA 5JCTA 2PTMA 1V00A 2Q5TA 3WG1A 4UFMA 3VDDB 2WKKA 4P9GA 4RGGA 4ZZ5A 1H6YA 3HD8B 4QQOA 3VGIA 1VAKA 2AC1A 2H0BA 1U5XA 3AYAA 5FOBB 3HQXA 4ASLA 4WM7B 1DU3D 2P34A 4PDWB 5EV7A 3KB5A 5F37A 4IESA 1BBT2 4CXYA 1QOSA 2X29A 2ZGSA 2DURA 1AR92 2YGLA 3ZYJB 2X5IC 2JG9B 4JC1A 2XWBB 1D4M3 1GYKA 1JH5A 4IL7A 3LSDA 1RUH3 1YJKA 3C7EA 3FMGA 2PLV2 1NE6A 1N1VA 4FFHA 4FO9A 4PLNA 5A7QA 1C1LA 1C28A 3WP6A 3TWIA 3WV6A 4BA6A 2BEOA 1HB4A 3I3BA 4HL0A 4LK7A 4QPIB 3U14A 3U07A 2ZOEB 5BNOA 1BMV1 4J25A 3ZXEA 2G19A 2WSUA 3ECQA 4Q8LA 2HWE1 3GZTB 4OHVA 3AXEA 1MQTB 4IGPA 2ERFA 5E8AA 1OA4A 4Y20A 1CD3G 2P4EA 5I0SA 3HAGA 1NZCA 1UO9A 4QX8A 3C7GA 5CU1A 4YW4A 4IE6A 2IUWA 4I09A 1UMHA 2FDGA 3HT2A 1OSGA 5GZCA 3O5SA 5LA0A 3POWA 3EJKA 2JEMA 4FPHA 1MEC1 4WVWA 2ATFA 3ES1A 2IFWA 3V64A 3ZYHA 2ZMNA 1Y7BA 3GBWA 2CDOA 2VL4A 4R9AA 4BM8A 3I2GA 1ND3C 3WT3A 1IZ3A 1IGOA 5A3NA 4A2UA 1R081 4JGYC 3JU9A 4KWLA 4Q27A 3E97A 3VKOA 4N53B 2QQWA 1LEMA 4AR2A 1V6MA 5LK5A 3WX5A 4Y22A 2DFBA 4HKLA 1RUE2 2OQ6A 3B5LB 4L0PA 5D8AC 4HPKB 2FDKA 2NYYA 5JI9A 1IPSA 1GOGA 3AMPA 3U37A 4N7IA 2RS33 3J8F1 2A1XA 1HN1A 2UU8A 4A41A 1APNA 3WF3A 2SBAA 5K9YA 4I0AA 4JTOA 2CGPA 4AVVA 5FMDA 1O7FA 2JJ6A 2QQIA 3I3QA 3M1HA 5A7WA 4K1ZA 1AL23 5I0TA 2VUDA 5LA1A 3LFMA 1NLQA 1V9U1 3I2KA 4UYBA 3JBG2 3OGRA 5IHRA 2FDIA 4LMFA 1EYBA 4DB5A 4CU6A 2YB7A 3WW3A 4B4QA 2XBO3 1G8WA 1CX4A 3R4UA 5LWBA 5JMCA 4OQ9A 1GNHA 4HK8A 1JMUB 3I59A 5FPVA 5GLUA 1QIQA 3BN6A 3EQEA 4FXGB 3ZIXA 1OVPA 2UWCA 2ZBJA 3LIHA 5BNOC 1NQDA 5FXZA 2ZEYA 1OVSA 2WDBA 4EE2A 1S0DA 3VD9A 1QJY3 3PUIA 1J3RA 4K6BA 4IXLA 1DQ6A 3AYDA 4CP0A 1COV3 2B46X 4P08A 1JI6A 2C0ZA 4QM9A 3VBFB 3I3DA 1SBEA 3L2HA 1QEXA 1F31A 2OS2A 1Q8PA 4GH4C 4L9BA 1M4WA 1SDDB 3EBRA 4LHLA 1KQRA 1KD7A 4NUBA 1AR63 1DQ2A 1S2EA 2VCMA 4RFRB 3INAA 4BLJA 2W92A 5FO9B 1DYPA 4BQ3A 5T54A 4B3NA 1FNYA 2X10A 4WVZA 3A4UA 3PIJA 3UYJA 1LHOA 2D6NA 1UL9A 3NAPB 2ZX4A 3JD73 2WWJA 1O3QA 3RI8A 5CFCA 2A3WA 2WNUC 2YYOA 1HRV2 2JG8B 2UWBA 1GLHA 1SLIA 1W0PA 2VMEA 3PUHA 4UW5A 5DUUA 2JICA 1MZFA 2BFUL 2QUOA 2WS91 1OT5A 3J8F2 2EF6A 2WT2A 4NHKA 4OMDA 4FPYA 5IJRA 2K0GA 4Y1XA 1U12A 1UOJA 4IW3A 2ARBA 2XLGA 3TEYA 3UKTA 2JD9A 1S4CA 3O1PA 4IE7A 1QQP3 2ADEA 2Y33A 3KMHA 4AE2A 2VOTA 1VR3A 4AL9A 2W9XA 3NW4A 4A3ZA 1H4HA 5E88A 4GWIA 5DG1A 3VBRA 2BZDA 1DQ1A 1F5JA 1W3XA 3I2JA 4FPFA 4HN0A 4V2VA 5ANQA 4DEQA 4A44A 4EWAA 5F3CA 1K45A 3CLPA 2WZ8A 2JDAA 3GF6A 4N43B 1FT9A 1R1A3 1VRBA 2VY0A 2ET7A 3VD3A 5FR3A 1I6XA 3B9CA 4Q1RA 5DDJ1 1U5IA 2R071 1W8TA 2GALA 1QDCA 2HWD3 4R9BA 5JWPA 2VZRA 3OJBA 1WCSA 2WNOA 2WO7A 3H3LA 4HVRA 4OFGA 2J22A 2RS52 2R043 2VZTA 2CGNA 1UX6A 5FZFA 3ZSEA 1QHDA 2VUAA 1PO11 1XU1A 1LESA 1VBC3 1Q3EA 3CEWA 1AYM1 2YBKA 4LK6A 3LOIA 3WQ7A 5IYYA 4CCDA 5FYIA 3H8XA 3OUJA 1HLCA 3FLRA 3WEZA 3ORJA 5LATA 1X9TA 4M3CA 4CDXB 1U5ZA 2GMMA 1DGLA 4GULA 4RFT0 3RWKX 3VBHC 4QHBA 2GNTA 2VU9A 3OGSA 2CV6A 1AHSA 3OY8B 1SLCA 4Q4X2 4QQPA 3WHUA 2QBXA 3C8XA 5A3UA 1W06A 1ZZBA 4CXXA 4ASMB 1VRH3 5FKBA 1JYVA 1XSQA 4QX0A 2YMZA 2GN3A 4YGBA 1N3OA 2WQ4A 4N7UA 5K0UA 3SEPA 2P6HA 5CFCC 2RDRA 2ARCA 1BEV1 3RZJA 5I8YA 2VXJA 5B2GB 4LR4A 2VAUA 1W6MA 5C5TA 5GM0A 2VM9A 5IAVA 1VBE3 5FPLA 1FPN1 1LOBA 1WCUA 4P00B 1UW8A 1EPWA 2YU2A 5K8SA 1NY71 3B3QE 1J58A 3PVOA 3OEBA 3H1MA 2C24A 3ZFEA 5M0TA 4ISRA 1AF9A 2WSVA 4ZXKA 3SXWA 3TNQA 3LA7A 4AQ2A 3MIGA 3HN3A 1H2MA 3LA3A 1WCDJ 4LULA 1TE1B 1LCLA 2Y6KA 4H2AA 3T4VA 3UKVA 4DS0A 2V4AA 2G4IA 2DVGA 3N7LA 5FZOA 5J09A 2GH2A 2K9ZA 4XAAA 4GWNA 4Y1VA 3V0AB 5BYNA 5T5OA 1RMU1 2AEYA 1RUJ3 1NCRC 4GJYA 3TEWA 4C90A 3DPRA 2VULA 3JUUA 3SEEA 1AR82 4CEWC 3AZWA 1REDA 2DCKA 2X5IB 3ZYPA 4HVQA 2DVFA 4QQLA 4P9WA 4QX5A 2YBPA 5DAXA 2E33A 2OUHA 1KDKA 4KWJA 4TYSA 2YC4A 1HJFA 2KXLA 4PBPA 3VZLA 4BMEA 5DMYA 1S0GA 4TWTA 1QXJA 3POFA 4ISQA 4YRDA 3WR0A 1S1AA 4HVOA 4CZSA 2P17A 5FK7A 2ZJCA 3H0OA 2I2SA 4P5YA 4I3PA 4M3CE 3MICA 1VB4A 3MW3A 4D6SA 3DF0A 1BYHA 3MZHA 4MZUA 1F4HA 2ZGOA 1CESA 1W05A 4XZUG 3M3CA 3A0KA 5BUVA 4IV1A 2ZTNA 4HETA 1YLLA 2VOVA 4OI0A 5FFOC 1S0EA 4XDPA 5JOXA 5K0UC 2MNGA 2OZ6A 4NRQA 3H3ZA 3QOPA 4PI2A 4AZZA 3HBKA 4QB2A 1ND3B 2JDNA 4QX2A 1D4M2 4AOCA 1WD4A 1AXYA 5JPMB 1RUH2 4JGYB 1AYN1 4RN5A 2D5FA 5EYYA 1XBFA 3KLSA 5JZGC 3UL2A 4QM8A 4QAWA 3FWEA 3DL3A 3OD0A 1XNCA 5JVVA 3NL1A 3ZSMA 5F8PA 1UNBA 3IN9A 1QJU3 1UOFA 1VBB1 5EWSA 1STMA 2BU9A 3AYEA 2J7MA 5D8AB 5BNNA 2X8KA 1W9FA 3GBFA 2EAKA 2AH2A 4AFDA 4QXCA 1GNYA 1MS5A 1J3PA 4D8MA 2Y0OA 1Z7S3 4JDOA 1W6NA 5IK4A 4FQ4A 1WLCA 3RI9A 2QKDA 1KXGA 5A1FA 1AX2A 1OD3A 4YW7A 5I8SA 1GICA 4FPCA 1GZ9A 1QJY1 2C4XA 5FZ1A 4CTEA 4XJ9A 3L9JT 5FLIA 1TME3 1H6XA 5DQ0A 2VXRA 1LB2A 4M4PA 2JECA 4FPEA 3UV9A 3IDAA 5T52A 4BXFA 2AYHA 3LIGA 2A75A 2ZMLA 3HNMA 1QJZA 3O0WA 1LHVA 1LHUA 4LHSA 5EQUA 4CCNA 2GC2A 1RVF3 1ST8A 2UWAA 3FUQA 2XJVA 4LKDA 1W9SA 4HN1A 5FWJA 1Z78A 2RDNA 1VBD3 1Q56A 1WW4A 5BNOB 4LO6B 4O7XA 3PL0A 2DVAA 4IEPA 4JGZA 5FXWA 4DUWA 5AFBA 1CAVB 1DZQA 2TNFA 2ZGNA 3AP7A 2OYZA 2OIIA 4RHV1 3WDXA 1LOAA 3ATGA 3P5BA 2QTWB 4XFGA 3E5UA 1RIRA 3J7NA 4OMCA 2RS32 3DYOA 1SEFA 4ATFA 2DDUA 1I9RA 4GH4B 5BPXA 4YM3A 2CU5A 2YC0A 1ONAA 2B5HA 2TBVA 3S6PA 3T4HB 1DCSA 1PGW2 4IV1C 3H8UA 1AL22 1RUC1 2WZR1 3RG0A 2ID4A 3HQUA 4FFIA 1RTVA 4EV0A 3H3UA 2VMGA 2A6WA 4D6RA 5HCFA 2RMU3 4WBBA 1HQWA 2G1MA 2GMPA 3N9OA 2XBO2 2WNUB 4PI0A 3BIWE 2FZ2A 5EJ3A 5A7PA 2XWJB 3BPSA 4L92A 4CCKA 1LGNA 1LOEA 1LU1A 3H9AA 4ZKTB 2ZGUA 3M3QA 1PNFA 4WM8C 1VE0A 2K46A 2H0VA 2EIDA 1ZBE3 2E51A 4AVTA 1QJY2 1Q8OA 2QNKA 1BQPA 5LBBA 2VZPA 1UU6A 1FYUA 5FYHA 2JDMA 4CDQA 2XDVA 1COV2 3NNGA 2Q8CA 3GHNA 4H14A 5DUXA 4M4RA 1JZ8A 4YYOA 2DU0A 4BOWA 4CEYA 1UZWA 3LWCA 4A4AA 2ZGTA 1AZDA 1AR62 1PZ7A 2P1BA 5AFEA 3V0BA 4IE5A 2JB8A 1ND2C 5FY4A 3B02A 3WF0A 1ENSA 4GQ7A 4P9XA 5FYTA 3WNOA 2YZ4A 1CAUB 4IE4A 3JD72 4XOGA 5FPZA 3W21A 1NAEA 3C2UA 4Y4YA 2CDPA 1CJDA 4AGVA 5JXHA 3WW2A 3VBUA 5AVAA 5DAQA 5CISA 4TSVA 3VBOC 4YZ2A 4D6QA 3AVSA 4FPLA 5EZWA 4LHKA 1Y3TA 2WNEA 4FFFA 4JDMA 1L7LA 4D3WA 4KWKA 4I3GA 1W04A 1JW6A 5HV0A 4LPLA 1DZRA 3URFA 1GANA 4IGQA 4XURA 4XMIA 3DGTA 2XVLA 4CU9A 5A3LA 3DYMA 3PU8A 1QQP2 3UGFA 1NT0A 4DMIA 1TMF2 5BNPC 5A70A 1KS5A 3JB8A 4PHZA 4D0QA 1WZXA 5KHIA 4JVAA 1HQLA 1JBCA 2XJSA 4LITA 1NQJA 4OUSA 3B01A 2WYSA 3LDKA 3VBHB 2ARAA 1GR3A 4PIYA 1K5MB 3MIFA 1WW6A 5JR7B 1KGYA 2PHXA 1G9CA 2RM21 4L11A 4N9HA 4JKKA 4XUOA 1Y9GA 1R1A2 4Q1PA 4ZXEA 1A8MA 1LJ7A 3R6SA 3TB0A 3CMGA 3FUOA 2HWD2 2A5ZA 4NIDA 3OBTA 1GP5A 5CFCB 3CL1A 4OZXA 5T50A 3KF3A 3T3YA 4EWDA 1N3QA 2R042 1W28A 1JN2P 4JKLA 4HOOA 3ZYRA 1VBC2 1F5FA 3MBWA 5CG9A 1W90A 3POYA 4RD7A 2JWPA 3E5XA 5FLJA 3ZLIA 5KXEA 3OGGA 4EN7B 4GZ9A 2HWE3 2R1BA 5LEKA 3D5OA 3PMEA 5DAVA 1YJLA 4KNCA 4ZONA 2PYTA 3R4SA 3UGHA 2J42A 4CDQC 1CQ9A 1F9KA 3VD4A 5GLVA 3ACHA 3LDRA 3M3IA 5FJKA 4RQPC 1XYPA 4CEYC 4GA9A 4U36A 4YVWC 1XE8A 3EHKA 3ZFFA 1DGRN 5FO8B 2VQTA 1YI7A 1ZRIA 3BI3A 1J59A 3ES4A 2HLEA 1GQHA 3WNLA 3ZYBA 3WSOA 2Y26A 1VRH2 1NCRB 3H1WA 4QPGA 1EAH1 1V6LA 1MEC3 2VBBA 2RJLA 2WA3A 3C7HA 4IEVA 4COVA 1SFPA 5DAPA 3THPA 4PBOA 2NM1A 4CEWB 3MDPA 1UMZA 4Q4V1 2QQVA 1NA1A 1OI6A 3IDEA 3VBUC 4BHPA 1R083 4UBHA 4LA2A 1S0BA 5FZ7A 3POJA 1KEXA 4G3YC 1VBE2 2ZMKA 2YFZA 1IQDC 1POV0 2LUWA 2R32A 2G9FA 4GB31 3HEIA 5I0DA 1UYYA 4IEQA 5F7UA 1ODMA 4UW4A 2ZX0A 3PIGA 5FY0A 3T30A 1NUKA 1ULFA 4MVTA 1W2OA 2W3JA 4COWA 1SLTA 2PA7A 4BIOA 1PGL1 4YNIA 4LO5B 5FY1A 3OBZA 2KM2A 4YW6A 1JU3A 2WABA 3LPFA 4R4XA 4CP1A 4KMQA 3PURA 4UF0B 1W6PB 3RVHA 3O1MA 4BYYA 2IVJA 4KI5M 4FBFA 1RUJ2 1V9U3 2ZX3A 5LBFA 5A3TA 5L7OC 3GDBA 4GKXA 4ES8A 3OYWA 2R1DA 1UXZA 4KU7A 5K0UB 5I0UA 1NZIA 4XHBA 2C1FA 4UW3A 2PHLA 2F17A 4E2QA 2UURA 5A33B 1BKZA 3LB9A 1YRZA 2BBAA 3CO2A 2BBVA 3ZN5A 3MPBA 1WCKA 1X82A 2WO3A 4K3UA 4U2AA 5JZGB 4E9KA 4DO0A 4EZ4A 3RGBA 3PU3A 1HQNA 1GQGA 1UKGA 1CIYA 5KXCA 1OOPA 3HOBA 4NIAA 2DUPA 1MACA 2PXJA 3LEKA 1NYWA 2VH9A 4AG4A 4Y5Z0 2B45X 4JDNA 2MPFA 3W58A 1UIJA 1YIFA 1JS9A 2BTVC 2BWAA 2CL2A 1W0NA 5FMOL 1O8PA 5CFDA 5TSWA 3AM2A 3T09A 5JMOA 3RJ2X 1ULCA 4QPGC 3N35A 4UW6A 4C91A 3RZGA 4TZDA 5CADA 1HXS1 4LE4A 4M3CF 5FOJB 5AVPA 1YQ6A 5IW0A 5EPAA 1C1FA 4Z82A 2FDJA 4HK9A 3WP5A 2XH6A 1D0HA 4KGQA 4ZU4A 5LZ6A 2YBSA 1VMJA 2WS93 4QGNA 2LROA 2W5FA 3AKPA 1ALYA 3IBMA 5GZDA 4QPYA 3SCHA 2OVUA 1JZ7A 1TNFA 2W94A 5FZ3A 2HWC1 2A7AA 4QKDA 1SBFA 1QJU2 1ZM1A 2J1TA 2YY1A 3J7MA 3M7AA 2HJIA 3HR9A 5DABA 3JCIA 4NOTA 1SHWB 4J1WA 1TVGA 3NO8A 4XJAA 2DTWA 3QH7A 3OSDA 5FPAA 3VBSC 2BVVA 1Z7S2 3N7MA 4EZHA 3UK9A 2IXHA 1HRI1 1BCXA 5H9RA 1KDMA 1PMIA 4CP9A 1Y43B 3FFZA 4E8CA 2GH8A 3KWVA 1ZRDA 4IV1B 5DDJ3 2R073 2JDZA 1OD5A 1TME2 3PDQA 3S0MA 5LRSA 1A3KA 4LO4B 4QB1A 2W2IA 1YO8A 4XFHA 1GUIA 1O59A 2BERA 2R6QA 1S55A 4BLIA 5JOWA 1JYTA 2WLPA 5DAWA 1O5LA 4XXPA 3KQRA 1YEWA 1Q8SA 1RVF2 2VNOA 1C57A 1PO13 2FD8A 1NXD1 1AYM3 1IQAA 4DEVA 1XC6A 1LOGA 1VBD2 3EB7A 3I4IA 4OUMA 4WM8B 2DFCA 1IPJA 1XXNA 2J1RA 2XB6C 3WVJA 3VHNA 3W20A 1GSLA 4LKEA 2CGOA 4Y33A 2WT1A 4JZRA 2PFWA 5T5LA 1F4AA 4META 4NPLA 2FQPA 4QKNA 1KRIA 5IK7A 1W6NB 1GOFA 1IG0A 5CYYA 5CA6A 5ABJA 2VW1A 3N9MA 2AGSA 5I91A 5H9QA 3UKNA 1ND2B 4IV3A 1IS6A 1YQCA 2A6ZA 3RSJA 3DKQA 2RMU2 4NHYA 1BEV3 4O9GA 3O1RA 3CDZB 4FOYA 1A8DA 2GP5A 3Q9OA 2LM3A 4TLGA 4XFCA 3VBOB 3CHXA 4BK4A 3WP4A 5FZGA 1FPN3 1N1YA 1BLZA 3NNFA 4QDSA 4XE9A 3MIDA 1FI2A 1ASJ1 1VALA 3LD8A 3CZJA 3LOBA 1OURA 1W6OB 2VJXA 3DCQA 4LLOA 4XC9A 1ZBE2 3THDA 3ZKUA 3PNAA 1CGPA 2KR2A 3ZFGC 5KHKA 5BNPB 2AEZA 2VZQA 1YNAA 4MSVA 2VMDA 5T5PA 4QWNA 3D3AA 4MH0E 2VR4A 2H6BA 2RS11 2OUJA 4L2NA 1KJLA 2BRTA 2JIGA 4Q0VA 3KHBA 3K4DA 4TLFA 1RL3A 2VTFA 3BCWA 5IK5A 2WRAA 4E4DX 3BPZA 1H1MA 1RMU3 2RDSA 1UU5A 3HPNA 3H7YA 5GJ6A 2VTXJ 2W0XA 3PJQA 1OHFA 4CDWA 2P3YA 3NJVA 1TZOA 3GCWA 5EP9A 3TNPB 2FCVA 4BK5A 5FY7A 4NPMA 1V6IA 5C8CB 3T2PA 2C26A 1GZWA 1RUF1 1S2BA 4WVMA 2I74A 1W3VA 2BP6A 2LRPA 3K4AA 5LBCA 1B35A 1G9FA 5FZ4A 3OPZA 3ZN4A 3MIEA 4W50A 2W1UA 3USUA 3PMSA 3LF7A 5A32A 4LOTA 4XTPA 1YFYA 5FQ0A 1E57A 1G7YA 1YC61 3K2OA 3KVAA 3MFCA 1CJPA 1OA2A 2IXKA 2WR9A 4CDQB 2QZ2A 1VP6A 4FPKA 1EV11 4RQPB 4XCAA 4RL7A 2XVKA 3LPGA 4YVWB 1S0CA 5GLZA 2W08A 5FDBA 4XMAA 5ABJC 1ZX5A 1R091 1N1TA 1BZWA 1CONA 1QGLA 3AK0A 3FX3A 5F39A 2JDHA 5GKAC 3K48A 3WINE 2B9UA 3HQRA 4Z92B 3PJYA 4W6YA 1QY4A 4XJ8A 1QXRA 3ILNA 3N4MA 1RJ7A 3VBUB 1CVNA 4MHRA 1EY2A 1AYN3 1UWWA 5D21A 1DIWA 2QQNA 3TYJA 3J26N 3KZ4C 1LODA 2BNMA 4B29A 3O1TA 5CB7A 1C5IA 4C0HA 4FOWA 4FPJA 1BMV2 2Q1MA 3T0BA 4QX7A 1K3IA 4A7KA 4COYA 1JODA 1VBB3 2HWE2 3TEXA 2Z2SB 1G6NA 2ZZQA 2VQUA 4XW3A 1GWMA 4LT5A 3RQ0A 1VMHA 3G6JB 4LKFA 2W39A 3GYDA 2E7TA 4S2HA 1C4RA 1NCQA 1RUD1 4CUAA 1AJKA 3MI8A 5KHHA 4G4FA 1X33A 3LEIA 4HSJA 3TBDA 5CIRA 1GNZA 4Q8KA 3BGAA 5APAA 5JSRA 5L7OB 1MEC2 4BB3A 1JOJA 3QD6A 1DQ0A 5B4NA 4J6GA 3FL7A 3P3PA 4JAAA 4BQXA 2YU1A 1ULPA 3ZX7A 3VB9A 1R082 1WMEA 3SNMA 1XQNA 2R0FA 3ZN6A 4QDQA 3KS7A 3KV9A 4XILA 4AEDB 3ILRA 5GZEA 1H1IA 1H8TA 2VNRA 1FATA 2V73A 1GP6A 4MGQA 5C9AA 1OLRA 1I1EA 2ZABA 4XBQA 4RSUA 4YFZA 4RHV3 1HB2A 1FMD1 1ZZ6A 4QD2A 4QGMA 2VQAA 3KHCA 5JSPA 4X8PA 1NX9A 1YIPA 2DCJA 2LTNA 2HEYF 3C7FA 3G7DA 3NNMA 4H7MA 3RZHA 2ZX1A 1YQ5A 5JXGA 5H9SA 1UY0A 5JI7A 1ZZ8A 4LJHA 4YFWA 2HEWF 1RUC3 2WZR3 1V9U2 3RNSA 3QCWA 3AJYA 5FWEA 1ULDA 4DINB 2A6XA 4GIQA 5F5CA 5FUNA 1AX1A 3OBAA 3SITA 1W99A 2WQZC 4S2FA 4UXAA 3JB4C 3ZXJA 1J1TA 3OUIA 3ZXAC 1ENXA 3CNAA 3FN9A 4FXKB 4OHZA 2GNBA 4HT1T 1ZZCA 3AL6A 1OPMA 2O14A 1XSRA 1BVP1 3IDBB 3KGLA 4UWDA 2YXSA 1ZA7A 1FAYA 2ZGKA 3M3EA 4CDUA 3WY6A 3CQOA 3KF5A 1AUYA 2OW4A 3AKRA 3ZVXA 4QGLA 1HKDA 4O9EA 2PAKA 3GM8A 1WKYA 2HKXA 2FCTA 1PK6A 2ZHNA 4XJWA 3VBSB 3E6BA 1NCQC 3IM0A 3ZIWA 2P3KA 3UJQA 1MZ5A 1JHJA 1CIWA 2V5YA 2ADDA 4JRLA 5B4XA 2CAVA 4NR1A 3KV6A 2Y6GA 4QXKA 4YW2A 2D7FA 5C4WA 4YW5A 2BW8A 3VN4A 3AXDA 3VD5A 2QQJA 3I2OA 2RVAA 4JKMA 4XIKA 3WDVA 5KHGA 2J1VA 2XJPA 3SMHA 1CAWA 1RYYA 1UY1A 2PQSA 2HWB1 2WS92 3AMHA 3IIIA 3I3EA 3Q8CA 4KU8A 3UJOA 4ZU5A 3ZR6A 2P2KA 1D7PM 4CCMA 3T0DA 3OF1A 5HXMA 3VL9A 1R1ZA 4LBMA 1CX1A 3WQ0A 1DQ5A 1O6UA 4CU8A 1WUVA 3J4UH 2O8OA 1QXPA 3WNMA 3BUCA 4Q0PA 4HMZA 1T6BX 2FZ1A 3OPTA 2MHFA 4H7LA 4OHYA 4I0WB 1HDKA 5IVBA 3AC0A 3QACA 4M00A 4RS5A 3AYCA 2JIJA 5H9PA 5HXVA 3RMYA 3U78A 1F8VA 4LXLA 3VDAA 2RM23 3I2IA 4MG2A 2E53A
chains in the Genus database with same CATH topology
4QXBA 5FZ9A 5A3PA 5FYHA 4GAZA 5F3IA 5A7QA 3ZPOA 2XDVA 5FYSA 2Q8CA 3N9MA 5FY1A 2XMLA 4UF0B 3PURA 4D6SA 3RVHA 5F2SA 5A3TA 3K3OA 2YU1A 5FV3A 4CCOA 5A3WA 4IGPA 5FJHA 5FY4A 5FP8A 2GP5A 2P5BA 3KV9A 4V2VA 5ANQA 5FXXA 5FYTA 3PTRB 5F3CA 5IVEA 5LW9A 5ISLA 2WWUA 3KV5A 4QX8A 5FZDA 5FZGA 5FZ0A 1VRBA 4ASKA 2GP3A 4XDPA 5FY9A 3LD8A 5FZ6A 5FZLA 4D6QA 3AVSA 4UF0A 5A7OA 5KR7A 3AVRA 5F5AA 5FYVA 4GJZA 4CSWA 5FP4A 4DO0A 4EZ4A 3PU3A 5FUPA 4BU2A 5A7NA 3N9QA 4QWNA 4IGQA 5FP3A 2PXJA 5FZFA 5F3EA 3PU8A 5IVVA 2OX0A 5FBJA 3K3NA 5FZHA 3DXUA 4AAPA 5A3NA 5FPUA 2YBKA 5FP7A 3PUQA 5FYIA 3OPWA 4LITA 5FY0A 5IVJA 5FWEA 5A7WB 4QXCA 5FYMA 2OQ7A 5FUNA 3PUAA 5F5CA 4C8DA 3DXTA 2OQ6A 2VD7A 4LIVA 3AL5A 5FY7A 2Q8EA 5F5IA 5FPBA 5A1FA 5CEHA 5FZ8A 3N9PA 5FY8A 5FZEA 5IW0A 4QXHA 5LY1A 4V2WA 5FZ1A 4BISA 3AL6A 2Q8DA 5A7SA 5FZ4A 2YBSA 4LIUA 5A1LA 4AI9A 4BXFA 5FYUA 2XXZA 5A7WA 2OT7A 3KVBA 4HOOA 5FZKA 4XDOA 5FZ3A 4CCNA 5FYCA 4HONA 5K4LA 3ZLIA 4TN7A 3K2OA 3KVAA 3PUSA 5FWJA 5LWBA 5FZCA 5FZOB 5FPLA 5FPAA 5FY5A 2YU2A 4URAA 5FXWA 3KV6A 5FPVA 4GD4A 4EZHA 5FJKA 5FXVA 5F39A 4Y3OA 5F3GA 5IVCA 2XUEA 5FXZA 5IVYA 3PDQA 2W2IA 4DIQA 5FYYA 4QU1A 5LY2A 5FZIA 5FZOA 5F2WA 4CCMA 3KV4A 2YPDA 3N9NA 2OS2A 5FYBA 4GJYA 4CCLA 4D6RA 4NUBA 5IVFA 3N9OA 4QX7A 4CUGA 4Y4RA 5FYZA 5FZ7A 3UYJA 3LDBA 5A80A 5E6HA 3OPTA 3U4SA 5F32A 2WWJA 5A7PA 4E4HA 5IVBA 3U78A 5FZMA 4CCKA 5F37A 4Y33A 2YBPA 5FZAA 4LXLA 5IWFA 4EYUA 4CCJA 3NJYA 4IGOA 5FZBA 5FP9A 3N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXB A;  5FZ9 A;  5A3P A;  5FYH A;  4GAZ A;  5F3I A;  5A7Q A;  3ZPO A;  2XDV A;  5FYS A;  2Q8C A;  3N9M A;  5FY1 A;  2XML A;  4UF0 B;  3PUR A;  4D6S A;  3RVH A;  5F2S A;  5A3T A;  3K3O A;  2YU1 A;  5FV3 A;  4CCO A;  5A3W A;  4IGP A;  5FJH A;  5FY4 A;  5FP8 A;  2GP5 A;  2P5B A;  3KV9 A;  4V2V A;  5ANQ A;  5FXX A;  5FYT A;  3PTR B;  5F3C A;  5IVE A;  5LW9 A;  5ISL A;  2WWU A;  3KV5 A;  4QX8 A;  5FZD A;  5FZG A;  5FZ0 A;  1VRB A;  4ASK A;  2GP3 A;  4XDP A;  5FY9 A;  3LD8 A;  5FZ6 A;  5FZL A;  4D6Q A;  3AVS A;  4UF0 A;  5A7O A;  5KR7 A;  3AVR A;  5F5A A;  5FYV A;  4GJZ A;  4CSW A;  5FP4 A;  4DO0 A;  4EZ4 A;  3PU3 A;  5FUP A;  4BU2 A;  5A7N A;  3N9Q A;  4QWN A;  4IGQ A;  5FP3 A;  2PXJ A;  5FZF A;  5F3E A;  3PU8 A;  5IVV A;  2OX0 A;  5FBJ A;  3K3N A;  5FZH A;  3DXU A;  4AAP A;  5A3N A;  5FPU A;  2YBK A;  5FP7 A;  3PUQ A;  5FYI A;  3OPW A;  4LIT A;  5FY0 A;  5IVJ A;  5FWE A;  5A7W B;  4QXC A;  5FYM A;  2OQ7 A;  5FUN A;  3PUA A;  5F5C A;  4C8D A;  3DXT A;  2OQ6 A;  2VD7 A;  4LIV A;  3AL5 A;  5FY7 A;  2Q8E A;  5F5I A;  5FPB A;  5A1F A;  5CEH A;  5FZ8 A;  3N9P A;  5FY8 A;  5FZE A;  5IW0 A;  4QXH A;  5LY1 A;  4V2W A;  5FZ1 A;  4BIS A;  3AL6 A;  2Q8D A;  5A7S A;  5FZ4 A;  2YBS A;  4LIU A;  5A1L A;  4AI9 A;  4BXF A;  5FYU A;  2XXZ A;  5A7W A;  2OT7 A;  3KVB A;  4HOO A;  5FZK A;  4XDO A;  5FZ3 A;  4CCN A;  5FYC A;  4HON A;  5K4L A;  3ZLI A;  4TN7 A;  3K2O A;  3KVA A;  3PUS A;  5FWJ A;  5LWB A;  5FZC A;  5FZO B;  5FPL A;  5FPA A;  5FY5 A;  2YU2 A;  4URA A;  5FXW A;  3KV6 A;  5FPV A;  4GD4 A;  4EZH A;  5FJK A;  5FXV A;  5F39 A;  4Y3O A;  5F3G A;  5IVC A;  2XUE A;  5FXZ A;  5IVY A;  3PDQ A;  2W2I A;  4DIQ A;  5FYY A;  4QU1 A;  5LY2 A;  5FZI A;  5FZO A;  5F2W A;  4CCM A;  3KV4 A;  2YPD A;  3N9N A;  2OS2 A;  5FYB A;  4GJY A;  4CCL A;  4D6R A;  4NUB A;  5IVF A;  3N9O A;  4QX7 A;  4CUG A;  4Y4R A;  5FYZ A;  5FZ7 A;  3UYJ A;  3LDB A;  5A80 A;  5E6H A;  3OPT A;  3U4S A;  5F32 A;  2WWJ A;  5A7P A;  4E4H A;  5IVB A;  3U78 A;  5FZM A;  4CCK A;  5F37 A;  4Y33 A;  2YBP A;  5FZA A;  4LXL A;  5IWF A;  4EYU A;  4CCJ A;  3NJY A;  4IGO A;  5FZB A;  5FP9 A;  3N9L A; 
#chains in the Genus database with same CATH topology
 4JHT A;  4W6X A;  1ULO A;  2HBT A;  5DDJ 2;  4LA3 A;  2R07 2;  1RHI 1;  1RUI 1;  2WFP A;  1GMM A;  1HIX A;  1X8E A;  4Y24 A;  3VBR C;  4DY5 A;  2XML A;  1QJX 1;  4XHX A;  2G9Z A;  2YC2 A;  2VUC A;  3E5Q A;  5A3O A;  3HT1 A;  1K42 A;  3ON7 A;  4LBQ D;  1OKO A;  1PO1 2;  4FSJ A;  3BTY A;  1QH6 A;  4NAO A;  3MGU A;  1AYM 2;  2ZGL A;  3FC0 A;  1QOO A;  3ENR A;  4OHX A;  1QKQ A;  3GZU C;  4AGR A;  1UYP A;  2WWU A;  4LBQ A;  4AFB A;  5FCC A;  3IKW A;  1LGC A;  3J9S A;  3ZFG B;  3AMM A;  5EFU A;  5FY9 A;  3FBM A;  3M8L A;  4ORF A;  2VZS A;  3F2Z A;  5A1A A;  4CSW A;  2I45 A;  4HBN A;  4E8D A;  1GZT A;  2WO2 A;  4NRM A;  4AYU A;  2I07 B;  1AVB A;  3J7H A;  1EAH 3;  4LO7 A;  4XQD A;  5C4W C;  2OX0 A;  4GMP 1;  1C8N A;  4ZS2 A;  4BZ4 A;  2Q0A A;  3CJI A;  4RA0 A;  1JU4 A;  4Q4V 3;  3M4F A;  1J1L A;  1BEV 2;  5CG8 A;  4AI0 A;  4Y5S A;  2VCA A;  2ZEX A;  1ODN A;  3WHT A;  1O4Y A;  3WNX A;  1WW7 A;  1YHF A;  1FPN 2;  4EN8 B;  2Y6J A;  2R06 1;  2BDR A;  1NY7 2;  4MO3 M;  1OUS A;  4GB3 3;  4Y1U A;  1WGP A;  4V2W A;  1JZ3 A;  3B94 A;  4LHN A;  3RFR A;  1VBA 1;  5A1L A;  1WMF A;  5JXJ A;  2D6M A;  1NKG A;  2XXZ A;  1IS4 A;  2PEL A;  1O3S A;  5D1I A;  5T55 A;  3ZPY A;  1OMI A;  4DXR A;  4Q4W 1;  5FLH A;  5ACA 1;  2JXA A;  2W1W A;  1UZY A;  5EJ1 B;  3VHP A;  3U4X A;  2BQP A;  3LCP A;  1WW5 A;  3PVN A;  1OFS A;  2FBE A;  1RMU 2;  3ZFE C;  4Q0U A;  1CAX A;  5ABJ B;  3DEM A;  3BYW A;  2DCY A;  3S5Q A;  4PLM A;  4I2O A;  1XRU A;  4LE3 A;  4XAB A;  3NQH A;  1CPM A;  2GAU A;  2XOM A;  5LAS A;  3T2T A;  4K21 A;  1SAC A;  1CPN A;  1NLR A;  1S0I A;  1WLT A;  2O8Q A;  2Y0I A;  3ACG A;  3ITQ A;  4G9S B;  4AHZ A;  1QJF A;  3BU0 A;  1SPP A;  2WFF 3;  3TAY A;  2DCT A;  5IVY A;  4R52 A;  2GSY A;  1MVE A;  2WAO A;  1T6G C;  1W8O A;  5CAZ A;  3BOD A;  3DPR C;  4XFI A;  2ORX A;  3CJX A;  1PO2 1;  2EAA A;  2O1Q A;  2VMI A;  2SLI A;  3B00 A;  3KCC A;  2RR1 1;  3D0J A;  3BTA A;  1HB3 A;  3I8T A;  4KG8 A;  5KC5 A;  3BTZ A;  4RYD A;  1W39 A;  1O4Z A;  1WMX A;  2A71 A;  5FYZ A;  5HBA A;  4ZS3 A;  1OF4 A;  5L73 A;  2OA2 A;  2D6L X;  1B09 A;  1N1S A;  5E6H A;  3UET A;  4A42 A;  4BDV B;  4MGY E;  5IAT A;  4HAN A;  1JZ5 A;  1V70 A;  4MXW A;  4XFF A;  1HXS 3;  3X29 B;  5FZA A;  1OBN A;  5FP9 A;  1MVQ A;  2EIG A;  1L7R A;  4Y20 B;  2CAU A;  2DV9 A;  2LS6 A;  3SKJ E;  4B7K A;  2D5H A;  4XCB A;  3VDD A;  4A7Z A;  1GZW B;  1N3P A;  2JEN A;  1AYN 2;  2VMF A;  4WM7 A;  2QDR A;  3NMB A;  2PN5 A;  5CZK A;  1XB9 A;  2ZAH A;  2HWC 3;  2RHP A;  1C8M 1;  1LOF A;  3RYR A;  4AVA A;  4XF1 A;  1XU2 A;  2JG9 A;  5FJH A;  4KQ7 A;  1PX3 A;  1VBB 2;  2VMC A;  3GZA A;  3N36 A;  1O3R A;  1HV1 A;  5JOZ A;  1WBL A;  3Q8A A;  2LAL A;  3RPQ A;  5ISL A;  1W8N A;  2WNV A;  2B4K A;  1XE7 A;  2PMW B;  3R0R A;  1MR5 A;  3B69 A;  4OUL A;  5FZL A;  4B7E A;  1HRI 3;  2DTY A;  3LEG A;  4Y22 B;  1XNT A;  2K2S A;  5BNN C;  1HV0 A;  3BAL A;  5J7M A;  1MQT A;  1QOT A;  2NQY A;  5FP3 A;  4LKS A;  4MOA A;  2VNG A;  5FRA A;  2EXI A;  3K3N A;  5FZH A;  3TN9 1;  5F9T A;  5K7P A;  4Q5O A;  2Q30 A;  3ZMN A;  5HCH A;  1SLB A;  5JR2 A;  4BCU A;  5CKQ A;  2AAC A;  5SV5 A;  5IVJ A;  3B7M A;  4HXC A;  5A7W B;  3AB0 A;  3FBY A;  4K7J A;  1UPI A;  1UXX X;  5DXD A;  3NNL A;  3AL5 A;  4BH9 A;  1S0J A;  2IXI A;  5C5U A;  5F5I A;  1P8J A;  2ZX2 A;  1SG3 A;  5LK7 B;  3RZM A;  2UY8 A;  1VAV A;  4NHX A;  4RHV 2;  2PAE A;  5LY1 A;  2BYV E;  4DY3 A;  1SDW A;  1U0A A;  3I59 B;  1EUT A;  3V56 A;  4AVC A;  4N53 A;  3NJZ A;  1OPO A;  2E6V A;  3NV1 A;  2YG0 A;  4COU A;  5GLT A;  4E4Z A;  4GWM A;  4IEZ A;  4DRV A;  4Q4Y 1;  2HEV F;  2HWF 1;  4XDO A;  4JGZ C;  4EN9 B;  3IWZ A;  1RUC 2;  2EIC A;  2WZR 2;  3BOP A;  4HON A;  5G04 L;  4AI1 A;  5EIY B;  3LE0 A;  3ZO0 B;  4OQ8 A;  3PUS A;  3CIH A;  3ZXK A;  3CF6 E;  2D6P A;  3A0N A;  5BV6 A;  3VD7 A;  1SFY A;  3WLU A;  2A3Y A;  4LBL A;  1GFF 2;  4QHO A;  4H3W A;  2DUQ A;  3SHR A;  2WL1 A;  4P9Y A;  5F3G A;  4FAH A;  5J98 B;  5A6Y A;  3NWK A;  1ASJ 3;  3ALQ A;  4UT5 A;  1CZV A;  1PNG A;  3RZL A;  2WYF A;  3ZSL A;  1LAJ A;  2VOX A;  5FO7 B;  4ZY9 A;  2CYF A;  2ENR A;  5LY2 A;  2XGX A;  1IG3 A;  1ZYB A;  2J1U A;  1DQ4 A;  2VUJ A;  3KV4 A;  3N9N A;  2RS1 3;  2R30 A;  2WNV C;  4FT8 A;  4Y1Y A;  2NMN A;  3GBG A;  1PVC 3;  1UKR A;  3O7O A;  4ARX A;  5IFP A;  3GGL A;  4UFI A;  3LFI A;  4IDZ A;  4OI4 A;  1QMJ A;  4YGE A;  3LDB A;  4XVH A;  2VMH A;  1XNA A;  3NKG A;  3U4S A;  2R0H A;  4COZ A;  1QDO A;  2E9Q A;  2VZU A;  4Y5T A;  5FK8 A;  2RDQ A;  4IEO A;  4L97 A;  4AVS A;  4IGO A;  2QVS B;  3ZDS A;  1AR7 1;  1RUF 3;  4Y26 A;  3VBR B;  3QLQ A;  1YFW A;  3C7O A;  2W87 A;  4XUP A;  4MV2 A;  4CPB D;  5KBF A;  2O0O A;  2E32 A;  1DLC A;  3PVE A;  3NAP A;  2XJT A;  4JX0 A;  3DV8 A;  5E89 A;  3WDW A;  1CWP A;  1ENR A;  2VEC A;  4CPB A;  1W03 A;  1W2A X;  5FV3 A;  4LNV A;  4UFK A;  4Z2W A;  4OI2 A;  3W9A A;  4DPN A;  5FKC A;  3WUD A;  1RUN A;  2NLR A;  3T1L A;  4FP3 A;  2VTX A;  1H9P A;  1EV1 3;  1ZRR A;  1PIV 1;  1U5Y A;  3KV5 A;  4KL1 A;  2EXK A;  2JX9 A;  5FZ0 A;  4YLZ A;  3WUC A;  1HJG A;  5JAX A;  4BQ1 A;  4QX3 A;  1R09 3;  4YG0 A;  2RM2 2;  2IWG B;  1W8U A;  3AVR A;  5F5A A;  3EMR A;  4GJZ A;  3WW1 A;  5FP4 A;  3ZSK A;  2ZPX A;  3ZR5 A;  4M3C B;  4Q26 A;  1UCX A;  1Q43 A;  3B9I A;  5A7N A;  4BU2 A;  3D0S A;  1G9D A;  3N7J A;  4N90 A;  2EIB A;  3WQB A;  4FPO B;  4YW3 A;  3WF4 A;  3CU7 A;  3MIB A;  1H30 A;  4N43 A;  5FPU A;  4QB6 A;  4AEK A;  5FP7 A;  5C3O A;  4DFS A;  2Q1Z B;  1FOD 1;  5AC9 1;  3B93 A;  3AZY A;  1XYN A;  2DBI A;  2FMD A;  2WWS A;  1DLL A;  2Q4S A;  2VW2 A;  2Z5W A;  4LEJ A;  1YQ8 A;  2Q8E A;  1GBG A;  1LED A;  2WFF 1;  2Y6F A;  3U75 A;  3HWJ A;  2WLQ A;  1YQ2 A;  2HYK A;  1W6M B;  2FDF A;  1XNK A;  4AEM A;  4Z8B A;  3O1S A;  4AFC A;  1RUD 3;  2DU1 A;  2ZGR A;  5HI0 A;  4NPR A;  1JZ6 A;  4MHU A;  5I0R A;  3W5N A;  3F95 A;  3ZFE B;  1LOC A;  4ARY A;  5FZK A;  5GLW A;  1EAH 2;  4AI8 A;  1J3Q A;  1UN1 A;  4UOJ A;  5FYC A;  4NIH A;  3ZYI B;  2J1E A;  1A78 A;  3KCX A;  3OY8 A;  4Q4V 2;  3MYX A;  1DYK A;  3U1X A;  4NVP A;  3ZFF C;  1RIT A;  1FNZ A;  1RUG 1;  5FZO B;  1J83 A;  3ST7 A;  3FZ3 A;  4CE8 A;  4ZU7 A;  5KXB A;  1JYC A;  2PHD A;  3FHA A;  3MF6 A;  3IAP A;  1UPS A;  4Y3O A;  1SZB A;  3DPR B;  1BVV A;  4NWV A;  4OCT A;  3K4Z A;  4PF1 A;  3WF1 A;  4BJ0 A;  4GB3 2;  4DOU A;  1GKB A;  1NA1 C;  3ZXF A;  1FMD 3;  1RC6 A;  2A3X A;  5FTT C;  2VOW A;  2IXJ A;  2JKB A;  2ETE A;  5EHD A;  3MFA A;  2QDN A;  3OUH A;  4UI9 L;  2VG9 A;  2ARE A;  4YM2 A;  5F2W A;  1PGL 2;  5DG2 A;  2YPD A;  3D6E A;  4L99 A;  1UZ0 A;  5FRE A;  2EAL A;  1IS3 A;  2ZKN A;  4OLL A;  1Y9Q A;  2DBN A;  2JDU A;  3THT A;  4CVU A;  1ZVF A;  4YG6 A;  1ZRE A;  1ZBA 1;  4S2D A;  2TEP A;  4QT6 A;  5F32 A;  1NLS A;  1LGB A;  2YGM A;  3ZM8 A;  3ZXG A;  5FZM A;  2QCS B;  1W9Y A;  4GKY A;  2Y6H A;  3KT7 A;  2VBD A;  2EIE A;  2MEV 1;  3HNY M;  4X8N A;  4DNY A;  3V0A A;  2VZV A;  4M0N A;  1AX0 A;  2N7G A;  1DYO A;  4QXB A;  1UIK A;  2XHN A;  5JIU A;  2QFE A;  2QQU A;  5FZ9 A;  1UOG A;  2PHW A;  4E27 A;  5A3P A;  4NII A;  1QJE A;  4XF9 A;  2OXB A;  4AFA A;  4WZC A;  2X5I A;  5A6Z A;  4IEU A;  2Y60 A;  2GND A;  4AHW A;  1JUI A;  3KGZ A;  3VZO A;  3VZN A;  4OYU A;  3MHZ A;  1HW5 A;  2F4L A;  1TEI A;  2LW8 A;  1BBT 1;  2RE9 A;  4IET A;  3ZSJ A;  3WQ1 A;  5F5Q A;  4YZ1 A;  3VHR A;  1AR9 1;  4KBZ A;  4BQ5 A;  1OOP C;  1LHW A;  2E26 A;  2VVD A;  5BNN B;  3VLB B;  4K40 A;  4BIF A;  1HXS 2;  2PLV 1;  1D0G A;  3AP4 A;  4PIX A;  3VKN A;  1LTE A;  2XJU A;  3HNB M;  4PCR A;  3ACF A;  3EXU A;  2YPJ A;  4FTE A;  2XLF A;  1SPP B;  1US3 A;  1W8F A;  2FMY A;  4KBB A;  2WN2 A;  3IPV A;  4Z1V A;  5CFD C;  2HWB 3;  4XBN A;  2P3I A;  2GN7 A;  2D6K A;  5JIA A;  3LGR A;  4E2G A;  3PUQ A;  3ROU A;  5HV4 A;  2Y8K A;  3A23 A;  2HWC 2;  1JOB A;  3POE A;  4D7Y A;  2P3J A;  4JCK A;  3RDI A;  4NRP A;  1X8M A;  1I5P A;  1ND3 A;  2IFR A;  1W8H A;  3ZYF A;  1YXW A;  5C3Q A;  4JGY A;  2JDY A;  4ES9 A;  4PQ9 A;  4I0B A;  4YPJ A;  4F8A A;  3QH6 A;  3TEZ A;  3JQW A;  3IDC B;  1HRI 2;  2L9L A;  2YV8 A;  3PVB B;  4QQH A;  3WG2 A;  4YZ5 A;  5CKN A;  1NXM A;  4E2S A;  4JGZ B;  1MZ6 A;  3N3H A;  4UFL A;  5D8A A;  4HKW A;  4LOR A;  1GV9 A;  1Q5O A;  4AI9 A;  2Z4F A;  1UY3 A;  1RHI 3;  1RUI 3;  1IOA A;  3E1F 1;  1H2N A;  2OT7 A;  4NWW A;  4YGC A;  4Q0S A;  1W2T A;  1RGS A;  5KHJ A;  3WZ1 A;  3ACI A;  3IIA A;  1AXK A;  5IAX A;  1PVC 1;  1V6N A;  4DQA A;  1QJX 3;  1D4V B;  5J37 A;  4XFA A;  4QHZ A;  4X6Q B;  1IHM A;  1RUE 1;  5L19 A;  5J96 B;  1FX5 A;  4YM1 A;  4GD4 A;  3I2F A;  2YRO A;  4UAP A;  2JE8 A;  3AP6 A;  2PQQ A;  1SLL A;  3CBN A;  4AAX A;  4N8M A;  3LEM A;  1OUX A;  1DHK B;  1E5R A;  4A6S A;  4XUQ A;  3KSC A;  2WNV B;  4CA9 A;  4BMB A;  4DIQ A;  5FYY A;  4D94 A;  5I93 A;  3ETP A;  3JBG 1;  3RJR A;  1Q8V A;  3MW4 A;  2XVG A;  2NPI A;  2BUK A;  4YW1 A;  5IFT A;  1CAV A;  1DDL A;  2W95 A;  3HIF A;  3WXP A;  2E7A A;  1G86 A;  4GMP 3;  3RMX A;  3WDY A;  3NRU A;  5LBE A;  2VVE A;  2D43 A;  1L3J A;  2DCZ A;  2ORZ A;  1BXH A;  4W65 A;  2PHU A;  5J1X A;  2YHJ A;  2VZO A;  4GH4 A;  4LBJ A;  4CEY B;  3GCX A;  3D4K A;  5FAX A;  1LR5 A;  3T2O A;  3VL8 A;  1MS0 A;  1E5H A;  5CBL A;  3V0B B;  5BY5 A;  2R06 3;  2RV9 A;  5SV8 A;  1K5J A;  3IB3 A;  3N9L A;  1ASJ 2;  4IV3 C;  1Z0H A;  3AP5 A;  4JV4 A;  4B4P A;  2ZGM A;  2X05 A;  4XBL A;  2WNU A;  4BQY A;  3ZPO A;  1VBA 3;  2Z79 A;  5FYS A;  2ZAC A;  2BV4 A;  4XTM A;  3MF9 A;  4IEW A;  2RS1 2;  4P9L A;  1DFQ A;  2A70 A;  1O91 A;  3K3O A;  1YWK A;  4Q4W 3;  5ACA 3;  1GWL A;  5EYX A;  1PVC 2;  5JPN B;  3MLK A;  4M01 A;  4XF3 A;  2FCU A;  4XDQ A;  4R4Z A;  5FP8 A;  4K20 A;  3I54 A;  1HRV 1;  2CY6 A;  5DPN A;  5FUI A;  4B1M A;  1UZV A;  4YWA A;  2OZJ A;  4FAG A;  2EVX A;  2E63 A;  4ASK A;  5J36 A;  1W6Q A;  3P6B A;  4XET A;  4BQW A;  2CHH A;  1BJQ A;  1AL0 G;  1JHN A;  1EUU A;  2R7E B;  4MUV A;  1RUF 2;  2D98 A;  3IMN A;  1MZE A;  4K1Y A;  2XLA A;  4TTG A;  5J3U A;  3FJS A;  2BGO A;  1H4G A;  3V65 A;  2WII B;  5KXD A;  1CZS A;  2D40 A;  3O14 A;  3VZJ A;  4CCC A;  4CDW C;  1PVX A;  4FP2 A;  1CAU A;  3VDB A;  3KM5 A;  2Y6L A;  1PO2 3;  1TG7 A;  1DGW X;  3NV4 A;  3I97 A;  3POB A;  2RR1 3;  3POS A;  1H8V A;  1DP0 A;  1AXZ A;  2KD7 A;  1OFN A;  5EJZ B;  3BTX A;  1B35 C;  2ARX A;  3RRD A;  1ZRF A;  2V4V A;  1EV1 2;  3BB6 A;  4PF5 A;  2X53 S;  3BKZ A;  4AQ6 A;  5BNQ A;  3APB A;  2ZZJ A;  3MUY 1;  1R09 2;  3SCG A;  4BWO A;  4A3X A;  2RS5 1;  4BIS A;  3TOJ A;  3FLP A;  4RGA A;  1O8S A;  4AXO A;  1ZZ7 A;  4LUK A;  2VOK A;  4TXW A;  3VBH A;  1KJR A;  5HCB A;  1KS4 A;  2D93 A;  2W47 A;  4B1L A;  1V6O A;  1K5M A;  1L7Q A;  1POV 1;  2ZA9 A;  3VKL A;  1IKP A;  3ZXD A;  3ZFF B;  4M0H A;  3S5A A;  1E5I A;  4XZP A;  3UGG A;  3P3N A;  4QPG B;  2NP0 A;  1LUL A;  1URX A;  3ME2 A;  3S57 A;  4IUG A;  1C8M 3;  1VAM A;  1YUD A;  1S0F A;  5FY5 A;  5LCW L;  1OQE A;  2GZW A;  3GHM A;  3K51 A;  1CR7 A;  1OKQ A;  2VO5 A;  1NA1 B;  3RZZ A;  4Q4X 1;  2ZKL A;  5FXV A;  4CU7 A;  3POG A;  2FHR A;  2GU9 A;  4MLO A;  1H0B A;  4V1P A;  5LRR A;  4HLT A;  3VZK A;  4N9I A;  1MS8 A;  1RUD 2;  4DXZ A;  4XAE A;  2ZHL A;  5FZI A;  1RXF A;  1O3T A;  1TMF 3;  4HKO A;  1GP4 A;  4GAL A;  1I3H A;  1UMI A;  1QH7 A;  4KG0 A;  4AI2 A;  4CCL A;  1LNS A;  5IVF A;  1LU2 A;  3TN9 3;  1KIT A;  4CUG A;  5A6Q A;  3NKT A;  1MPX A;  4Y4R A;  2XUM A;  4EN0 A;  3FFQ A;  4A7Y A;  1WCQ A;  3SQO A;  2DVD A;  2AEN A;  3O0X A;  1NCR A;  5F1R A;  2BFU S;  2B9V A;  1XNB A;  5DUW A;  2JDP A;  4XYX A;  1RJ8 A;  3AKT A;  2IZW A;  3OYW B;  1I5Z A;  2JE7 A;  5FZB A;  4CEW A;  4KH9 A;  3POI A;  4F3J A;  2ET1 A;  1QNW A;  5IT6 A;  1WMD A;  3I49 A;  3JZV A;  2W68 A;  1FMD 2;  3AMQ A;  4KGG A;  4DRR A;  4GAZ A;  3WDT A;  5LEJ A;  2DYC A;  3WG4 A;  2BVB A;  2NN8 A;  2WAA A;  2JDK A;  1JYW A;  5F2S A;  1VMF A;  1H8T C;  4Q4Y 3;  3KCY A;  1US2 A;  1V6J A;  1AR8 1;  2HWF 3;  2ZCW A;  1KFX L;  4O65 A;  3SKV A;  5C9A C;  3T2Q A;  2VBP A;  2QE3 A;  2XQX A;  4IER A;  4CCO A;  2OPW A;  1OOP B;  1UAI A;  2QQP A;  4I02 A;  5IVE A;  1JYN A;  1TQ5 A;  3L2Y A;  4A45 A;  2HBU A;  5FZD A;  1OQ1 A;  4QPW A;  3VZM A;  4PQQ A;  4NE9 A;  1OA3 A;  1K5M C;  4YVS A;  2P37 A;  3HMY A;  3K75 B;  4XPV A;  5FMC A;  1PZ8 A;  1X9P A;  4UF0 A;  1VIW B;  1W6P A;  2A6V A;  4PJY A;  3SLI A;  5C7G A;  5CFD B;  4LTA A;  4KWU A;  2RJ2 A;  2VPV A;  5L9R A;  1WWY A;  2A6Y A;  3K46 A;  4D69 A;  2F4P A;  4JQR A;  1DZT A;  4QKF A;  5JDB A;  2V5D A;  1S2K A;  2ZGQ A;  5A33 A;  3NJX A;  3OGJ A;  3T08 A;  5IK8 A;  4FTS A;  3WNP A;  2NMO A;  5L9V A;  4D7T A;  4BQ2 A;  4YM0 A;  1X50 A;  3OPW A;  2BOI A;  5JZG A;  3MW2 A;  5IUQ A;  3OB8 A;  2VD7 A;  3IT8 A;  1X36 A;  2CNA A;  4NRO A;  4FI9 A;  1RIN A;  4CDU C;  2VNV A;  4IEY A;  2VC9 A;  3MLJ A;  5FY8 A;  1D4M 1;  2BOJ A;  2YFU A;  3O0V A;  2WZP P;  1RUH 1;  2WQ8 A;  1OQD A;  4IQP A;  4QKB A;  3WOG A;  3WCS A;  5A7S A;  1PK6 C;  1AR7 3;  4XXA A;  4LIU A;  2R49 A;  1ZZ9 A;  4C0B A;  5FYU A;  1V6K A;  1XOY A;  5CKM A;  5DZF A;  4BPZ A;  1JZ4 A;  3Q8B A;  3GNE A;  3KVB A;  2YDE A;  4CP9 B;  2VQ0 A;  2HWB 2;  2VW0 A;  4AQS A;  4XEZ A;  5EXO A;  3MO4 A;  4XUT A;  4P14 A;  2BJS A;  2WO1 A;  2VZ1 A;  5C70 A;  3ZDV A;  4Z07 A;  3ZKY A;  2FDH A;  4UFH A;  1MS9 A;  1LEN A;  3MV1 1;  3W5M A;  2JKX A;  4LQR A;  1UU4 A;  3BVC A;  1PMH X;  4PIZ A;  3SH3 A;  1F35 A;  1PIV 3;  2VGD A;  1JYI A;  4K9S A;  2E31 A;  2UYB A;  3HBZ A;  1MS4 A;  5GZF A;  2IXC A;  3OCP A;  5FPX A;  2QZ3 A;  4K8F A;  4W4Z A;  1VB2 A;  4MGI E;  3CKH A;  2VVF A;  4UFJ A;  1SLA A;  4LO8 A;  4QU1 A;  3I2D A;  2P6C A;  3LAG A;  1RHI 2;  1RUI 2;  1POQ A;  2W46 A;  3ILF A;  2Z42 A;  3HN1 A;  1OH4 A;  4JQT A;  4RS5 C;  4YVS C;  3MPP G;  2JB4 A;  1QJX 2;  2WN3 A;  3ZMO A;  3HJR A;  2GDF A;  4RR3 A;  3IPV B;  4LBN A;  3OBR A;  2VCB A;  4YGD A;  2RG4 A;  1FOD 3;  2R16 A;  5AC9 3;  2EA7 A;  4MGK E;  4IV3 B;  1IKQ A;  5C3R A;  1W9W A;  2RS3 1;  3OD4 A;  4MYE A;  2BWC A;  1FXZ A;  1ENQ A;  5IWF A;  4CCJ A;  5C3P A;  5I8T A;  3WP3 A;  2CSG A;  2JE9 A;  2DWR A;  1H1A A;  3AZV A;  4MX3 A;  3SH4 A;  4JTN A;  2D97 A;  3SC7 X;  1PGW 1;  1AL2 1;  1F2N A;  2BGP A;  5E16 A;  4QDR A;  1SQ4 A;  3KT4 A;  4P9J A;  1YFU A;  3DN7 A;  4O61 A;  4WM8 A;  4XQW A;  2XR4 A;  5LA2 A;  4Z2A A;  3UT0 A;  1OC1 A;  2B39 A;  1WD3 A;  2IC1 A;  2XBO 1;  4AFM A;  1WA6 X;  2BGC A;  5F6K A;  4GXL A;  4CP2 A;  4C1W A;  4UBG A;  4A6O A;  4HG6 B;  5A3W A;  3VKF C;  5DZE A;  3ELN A;  1FV3 A;  1Y9M A;  2OPK A;  3GXU A;  1VPH A;  1SCS A;  2ZEZ A;  5FXX A;  2HYX A;  3PTR B;  1RUG 3;  4PLO A;  4LBO A;  1C3H A;  4AK3 A;  4LOS A;  4NHL A;  3KD4 A;  3LKJ A;  2C5D A;  3RYK A;  3Q8F A;  5A7O A;  1ND2 A;  2W52 A;  2R06 2;  1O5U A;  3MUZ 1;  3UES A;  4X6R B;  2F6B A;  4CDW B;  3CJI C;  1COV 1;  1IS5 A;  2B7Y A;  4QU2 A;  3SCF A;  1GWK A;  5FBZ A;  1VBA 2;  3VBO A;  2C6S A;  4AHY A;  2TUN A;  4HZF A;  3EO6 A;  4WVM B;  4CCE A;  1AR6 1;  2AUY A;  4AAP A;  4F7Z A;  1B35 B;  3GJA A;  4ZPI A;  4Q4W 2;  4PDW A;  5ACA 2;  4YZ4 A;  2ZS6 B;  3USU B;  5JOY A;  1W6O A;  1Y4W A;  3OTF A;  3JD7 1;  2V09 A;  1UD1 A;  3E6C C;  5FYM A;  3LZZ A;  1F15 A;  1ZBA 3;  3U11 A;  3DKW A;  4C8D A;  4LIV A;  5BNP A;  5A32 B;  2XKP A;  1T2X A;  3W59 A;  3PTY A;  4FTB A;  5FQ0 B;  5FPB A;  5CEH A;  1PX4 A;  3WF2 A;  5FZ8 A;  1IPK A;  2PHF A;  3N9P A;  4QPI A;  1M06 G;  5FZE A;  3OEA A;  4XFB A;  1UF2 C;  3NNJ A;  4WZF A;  1H9W A;  2MEV 3;  1LRH A;  4W8J A;  1GQP A;  4XIO A;  3VHO A;  3WDU A;  1GZC A;  3E6D A;  4FPG A;  3I7D A;  4RR3 C;  3NV2 A;  4EN6 B;  4W6W A;  1QWR A;  1QQP 1;  2WA4 A;  1TMF 1;  1LEC A;  1J84 A;  1PHM A;  2EXJ A;  1FV2 A;  4L8Q A;  4MGT A;  5KWR A;  1NE4 A;  3ASI A;  2W91 A;  5C8C A;  2J1A A;  1PO2 2;  3O1U A;  1O4T A;  1OXC A;  2Q8O A;  3WNN A;  2RR1 2;  2GME A;  3I3M A;  1VLN A;  3H8R A;  1R1A 1;  1GOH A;  1HN0 A;  4J1X A;  4URT A;  2XPJ A;  4IEX A;  5C33 A;  1BHG A;  4BQ4 A;  1BBT 3;  3MV0 1;  3S7E A;  3AKQ A;  2HWD 1;  2EXH A;  2A73 B;  3WG3 A;  1AR9 3;  1OF3 A;  4FOV A;  4MAD A;  5BXX A;  5C6C A;  3HVD A;  4P5H A;  2PLV 3;  2R04 1;  4WV8 A;  3CZU A;  1W6Q B;  4RQP A;  2Y64 A;  3H50 A;  4AHX A;  3KQ4 B;  1VBC 1;  3DUI A;  1NCQ B;  4YVW A;  3PHM A;  1QU0 A;  3GZE A;  2Y38 A;  3QBQ A;  4YZ3 A;  1OLQ A;  4NHM A;  4HFS A;  4HPK A;  4ITC A;  5FIX A;  1V0A A;  3O1V A;  1SBD A;  1W0O A;  4ONU A;  1C8M 2;  1SFN A;  2XJQ A;  5FMB A;  2HH9 A;  2GC1 A;  3OGV A;  1QNY A;  4NJ4 A;  4AWD A;  1CZT A;  3VDD C;  2RJK A;  4AVB A;  1Q8Q A;  4EYU A;  1WBF A;  3USS A;  3NJY A;  3JXS A;  5E1R A;  4WM7 C;  2QQL A;  3ZN6 B;  1VRH 1;  3D82 A;  1PM7 A;  4FCA A;  2CWM A;  2D3P A;  3IZO A;  4P02 B;  1BK0 A;  4NMI A;  4PDW C;  1ACC A;  1LOF C;  1OH3 A;  3OG2 A;  1H8T B;  1ZNP A;  1D2Q A;  2ZAA A;  3DEC A;  1WLD A;  2JG9 C;  2H6C A;  1DF0 A;  4IE0 A;  4B4R A;  1UY2 A;  5C9A B;  4CRQ A;  3VUO A;  2WBK A;  3MIH A;  4FOQ A;  1DG6 A;  1PM4 A;  3ABZ A;  1SMV A;  4F83 A;  4K8R B;  2UY9 A;  3VV1 A;  3WNK A;  4QPI C;  1VBE 1;  4Q0Q A;  3TN9 2;  1EP0 A;  3FHQ A;  5F6L B;  2XKO A;  3FE5 A;  4Q2F A;  2WIN B;  1QF3 A;  2P5B A;  5LW9 A;  2NZ9 A;  2W1S A;  3D8C A;  1UQX A;  1RUE 3;  1MS3 A;  3A21 A;  1JUH A;  1VJ2 A;  4HSL A;  1PMJ X;  4XJU A;  5L7O A;  4CXW A;  1MQT C;  4OUE A;  3ZOI A;  3NV3 A;  2X09 A;  3VBF A;  4MXV A;  4AGG A;  1GU3 A;  2GC0 A;  5FYV A;  3WW4 A;  1UYX A;  5C8C C;  1NOV A;  3KT1 A;  3EYP A;  1MS1 A;  5FUP A;  3RYP A;  5KC6 A;  1NG0 A;  1H2L A;  2D6O X;  2V72 A;  3O12 A;  3S7I A;  1HX6 A;  4D7S A;  4OI1 A;  1RUJ 1;  5F3E A;  4AED A;  3JBG 3;  5IVV A;  2ZXQ A;  5FBJ A;  4GWJ A;  4Q4Y 2;  2HWF 2;  4NAM A;  2XON A;  1A34 A;  2JG8 A;  5C8W A;  4CDU B;  1A6C A;  2D3R A;  3FLT A;  4AW7 A;  2C9A A;  2OQ7 A;  2D3S A;  3DXT A;  4N53 C;  4ZZ8 A;  1AJO A;  4PT6 A;  1PK6 B;  4MGZ E;  3THC A;  4I01 A;  4FVV A;  2ILM A;  3UNP A;  3BOW A;  4Q29 A;  2Q8D A;  3AX4 A;  4XF0 A;  3T0A A;  3I2H A;  5C4W B;  2IVI B;  4JHZ A;  4DZG A;  1OLM A;  2QQM A;  2J1S A;  2W1Q A;  3R05 A;  4LBK A;  1D2S A;  4C1X A;  4ATE A;  5K4L A;  3NVC A;  1G9B A;  1CAW B;  4QX1 A;  4LLF A;  5T5J A;  4MGS A;  4YG3 A;  3M2M A;  3RS6 A;  4SBV A;  2VZ3 A;  2BPA 2;  3SIS A;  3SH5 A;  1DGW A;  2QQK A;  2DUO A;  1HRV 3;  5CVR A;  1C5H A;  4ZHN A;  5IVC A;  3RWN A;  1XYO A;  4NO4 A;  2WJS A;  3JQX A;  5JLV A;  2IXL A;  1RB8 G;  3J8F 3;  4DUX A;  3VBS A;  2XG3 A;  3M70 A;  1UZZ A;  2DF7 A;  1AR7 2;  2QQO A;  2XJR A;  4I30 A;  1W9T A;  4YAR A;  4RS5 B;  4XAC A;  4YVS B;  1UOB A;  5GAL A;  5DN2 A;  1K12 A;  1LHN A;  3A7Q A;  4QMA A;  5JXI A;  1QJU 1;  4IND A;  3VDC A;  2ZEW A;  3H42 B;  5DUV A;  4NN0 A;  4CDX A;  5ERL A;  1ULG A;  4CYD A;  5ANN A;  1YFX A;  1YCI A;  3GAL A;  3N7K A;  3Q8E A;  5LB6 A;  3VBF C;  3A22 A;  1ULE A;  3AFG A;  1JYX A;  1Z7S 1;  2WC2 A;  2ZGP A;  3AMN A;  2PAM A;  4JRA A;  5A80 A;  3U10 A;  2BNO A;  4E4H A;  5LA9 A;  4DUV A;  3AJZ A;  3WCR A;  1EPZ A;  5JSO A;  1ZA4 A;  4Y1Z A;  3BU7 A;  1PIV 2;  4AED C;  5HPO A;  1W8Z A;  1TME 1;  3NAP C;  3R4D B;  1WLW A;  3H7J A;  2GNM A;  2Q1F A;  2QJV A;  2JG8 C;  3H1Y A;  2RS5 3;  4LBQ B;  4XUN A;  5C71 A;  5F3I A;  2B8M A;  2E7Q A;  3TRS B;  1RVF 1;  1ZRC A;  2AR6 A;  1HB1 A;  3LSE A;  3RZK A;  1POV 3;  2ZHM A;  2C9K A;  3T1M A;  3ZYG A;  5L36 A;  4R8H A;  4NIG A;  1VBD 1;  4EWE A;  3O1O A;  2GC3 A;  1W8W A;  2XL9 A;  4AF9 A;  1X7N A;  1KFU L;  4YSF A;  3P1I A;  1FOD 2;  2Y34 A;  5AC9 2;  3MLL A;  2CWS A;  5GZG A;  1OLM E;  1JOP A;  3AZZ A;  3CJI B;  5J48 A;  4ET7 A;  2GP3 A;  5FZ6 A;  2CTV A;  4Q4X 3;  2WUH A;  5T3N A;  2WFF 2;  2OKX A;  3VKM A;  5KR7 A;  4AI3 A;  3U0Z A;  2D44 A;  4N43 C;  5D2A A;  5G05 L;  4S2G A;  4BE3 A;  1UX7 A;  1DGR A;  1UYZ A;  3H8O A;  2VCC A;  4BXS V;  3AFK A;  1XND A;  2PHT A;  4CUC A;  2KA3 A;  3MEP A;  3N9Q A;  5CNA A;  3AP9 A;  4DXT A;  3IMM A;  5DZG A;  2UYA A;  1YYN A;  3ETQ A;  2RMU 1;  1E5S A;  3PLQ A;  5FMO S;  1DBN A;  3DXU A;  1PGS A;  4EJR A;  3ZFG A;  4R9D A;  4OZO A;  2BNN A;  3AKS A;  3BIE A;  4WVV A;  4R9C A;  1R64 A;  2AZ5 A;  2XHK A;  4EQV A;  4B8E A;  4AQT A;  4FQZ A;  4QQ2 A;  4XJZ A;  4CUB A;  1REE A;  3PUA A;  4OVE A;  3FHI B;  4E4S A;  1RUG 2;  3C3V A;  1BK1 A;  1ZBE 1;  4RGK A;  4RR3 B;  1REF A;  1CAX B;  1XPW A;  3AZX A;  1W2U A;  2YUE A;  4QXH A;  1SCR A;  1N47 A;  2XQR A;  4CDX C;  5C3S A;  1LKN A;  1YI9 A;  2JD4 A;  1JXN A;  1UY4 A;  4SLI A;  3NST A;  2B42 B;  5A6X A;  1RXG A;  3OOX A;  1H2K A;  4XF4 A;  3ZXL A;  2DVB A;  3M3O A;  3WD5 A;  3LQC A;  1TNR A;  1W2N A;  4TN7 A;  5HCA A;  1AR8 3;  2WZE A;  3DYP A;  5L9B A;  5FZC A;  3LA2 A;  5A3M A;  4XQ4 A;  3S30 A;  4URA A;  1ZBA 2;  3IAQ A;  4GMP 0;  1WA4 A;  2Z69 A;  4FFG A;  2WT0 A;  2XUE A;  1JZ2 A;  1CN1 A;  1XJA A;  4H55 A;  2ES3 A;  4OHW A;  2PHR A;  2MEV 2;  4LUM A;  3GJB A;  1XE0 A;  5JUV A;  1G9A A;  2ZHK A;  4ERO A;  3K77 A;  4MXW B;  4AEJ A;  4P9I A;  4DXS A;  1JTZ X;  2XL7 A;  3J7L A;  2VE1 A;  5FYB A;  1RUO A;  1PZ9 A;  2G9G A;  3ACL A;  5JCT A;  2PTM A;  1V00 A;  2Q5T A;  3WG1 A;  4UFM A;  3VDD B;  2WKK A;  4P9G A;  4RGG A;  4ZZ5 A;  1H6Y A;  3HD8 B;  4QQO A;  3VGI A;  1VAK A;  2AC1 A;  2H0B A;  1U5X A;  3AYA A;  5FOB B;  3HQX A;  4ASL A;  4WM7 B;  1DU3 D;  2P34 A;  4PDW B;  5EV7 A;  3KB5 A;  5F37 A;  4IES A;  1BBT 2;  4CXY A;  1QOS A;  2X29 A;  2ZGS A;  2DUR A;  1AR9 2;  2YGL A;  3ZYJ B;  2X5I C;  2JG9 B;  4JC1 A;  2XWB B;  1D4M 3;  1GYK A;  1JH5 A;  4IL7 A;  3LSD A;  1RUH 3;  1YJK A;  3C7E A;  3FMG A;  2PLV 2;  1NE6 A;  1N1V A;  4FFH A;  4FO9 A;  4PLN A;  5A7Q A;  1C1L A;  1C28 A;  3WP6 A;  3TWI A;  3WV6 A;  4BA6 A;  2BEO A;  1HB4 A;  3I3B A;  4HL0 A;  4LK7 A;  4QPI B;  3U14 A;  3U07 A;  2ZOE B;  5BNO A;  1BMV 1;  4J25 A;  3ZXE A;  2G19 A;  2WSU A;  3ECQ A;  4Q8L A;  2HWE 1;  3GZT B;  4OHV A;  3AXE A;  1MQT B;  4IGP A;  2ERF A;  5E8A A;  1OA4 A;  4Y20 A;  1CD3 G;  2P4E A;  5I0S A;  3HAG A;  1NZC A;  1UO9 A;  4QX8 A;  3C7G A;  5CU1 A;  4YW4 A;  4IE6 A;  2IUW A;  4I09 A;  1UMH A;  2FDG A;  3HT2 A;  1OSG A;  5GZC A;  3O5S A;  5LA0 A;  3POW A;  3EJK A;  2JEM A;  4FPH A;  1MEC 1;  4WVW A;  2ATF A;  3ES1 A;  2IFW A;  3V64 A;  3ZYH A;  2ZMN A;  1Y7B A;  3GBW A;  2CDO A;  2VL4 A;  4R9A A;  4BM8 A;  3I2G A;  1ND3 C;  3WT3 A;  1IZ3 A;  1IGO A;  5A3N A;  4A2U A;  1R08 1;  4JGY C;  3JU9 A;  4KWL A;  4Q27 A;  3E97 A;  3VKO A;  4N53 B;  2QQW A;  1LEM A;  4AR2 A;  1V6M A;  5LK5 A;  3WX5 A;  4Y22 A;  2DFB A;  4HKL A;  1RUE 2;  2OQ6 A;  3B5L B;  4L0P A;  5D8A C;  4HPK B;  2FDK A;  2NYY A;  5JI9 A;  1IPS A;  1GOG A;  3AMP A;  3U37 A;  4N7I A;  2RS3 3;  3J8F 1;  2A1X A;  1HN1 A;  2UU8 A;  4A41 A;  1APN A;  3WF3 A;  2SBA A;  5K9Y A;  4I0A A;  4JTO A;  2CGP A;  4AVV A;  5FMD A;  1O7F A;  2JJ6 A;  2QQI A;  3I3Q A;  3M1H A;  5A7W A;  4K1Z A;  1AL2 3;  5I0T A;  2VUD A;  5LA1 A;  3LFM A;  1NLQ A;  1V9U 1;  3I2K A;  4UYB A;  3JBG 2;  3OGR A;  5IHR A;  2FDI A;  4LMF A;  1EYB A;  4DB5 A;  4CU6 A;  2YB7 A;  3WW3 A;  4B4Q A;  2XBO 3;  1G8W A;  1CX4 A;  3R4U A;  5LWB A;  5JMC A;  4OQ9 A;  1GNH A;  4HK8 A;  1JMU B;  3I59 A;  5FPV A;  5GLU A;  1QIQ A;  3BN6 A;  3EQE A;  4FXG B;  3ZIX A;  1OVP A;  2UWC A;  2ZBJ A;  3LIH A;  5BNO C;  1NQD A;  5FXZ A;  2ZEY A;  1OVS A;  2WDB A;  4EE2 A;  1S0D A;  3VD9 A;  1QJY 3;  3PUI A;  1J3R A;  4K6B A;  4IXL A;  1DQ6 A;  3AYD A;  4CP0 A;  1COV 3;  2B46 X;  4P08 A;  1JI6 A;  2C0Z A;  4QM9 A;  3VBF B;  3I3D A;  1SBE A;  3L2H A;  1QEX A;  1F31 A;  2OS2 A;  1Q8P A;  4GH4 C;  4L9B A;  1M4W A;  1SDD B;  3EBR A;  4LHL A;  1KQR A;  1KD7 A;  4NUB A;  1AR6 3;  1DQ2 A;  1S2E A;  2VCM A;  4RFR B;  3INA A;  4BLJ A;  2W92 A;  5FO9 B;  1DYP A;  4BQ3 A;  5T54 A;  4B3N A;  1FNY A;  2X10 A;  4WVZ A;  3A4U A;  3PIJ A;  3UYJ A;  1LHO A;  2D6N A;  1UL9 A;  3NAP B;  2ZX4 A;  3JD7 3;  2WWJ A;  1O3Q A;  3RI8 A;  5CFC A;  2A3W A;  2WNU C;  2YYO A;  1HRV 2;  2JG8 B;  2UWB A;  1GLH A;  1SLI A;  1W0P A;  2VME A;  3PUH A;  4UW5 A;  5DUU A;  2JIC A;  1MZF A;  2BFU L;  2QUO A;  2WS9 1;  1OT5 A;  3J8F 2;  2EF6 A;  2WT2 A;  4NHK A;  4OMD A;  4FPY A;  5IJR A;  2K0G A;  4Y1X A;  1U12 A;  1UOJ A;  4IW3 A;  2ARB A;  2XLG A;  3TEY A;  3UKT A;  2JD9 A;  1S4C A;  3O1P A;  4IE7 A;  1QQP 3;  2ADE A;  2Y33 A;  3KMH A;  4AE2 A;  2VOT A;  1VR3 A;  4AL9 A;  2W9X A;  3NW4 A;  4A3Z A;  1H4H A;  5E88 A;  4GWI A;  5DG1 A;  3VBR A;  2BZD A;  1DQ1 A;  1F5J A;  1W3X A;  3I2J A;  4FPF A;  4HN0 A;  4V2V A;  5ANQ A;  4DEQ A;  4A44 A;  4EWA A;  5F3C A;  1K45 A;  3CLP A;  2WZ8 A;  2JDA A;  3GF6 A;  4N43 B;  1FT9 A;  1R1A 3;  1VRB A;  2VY0 A;  2ET7 A;  3VD3 A;  5FR3 A;  1I6X A;  3B9C A;  4Q1R A;  5DDJ 1;  1U5I A;  2R07 1;  1W8T A;  2GAL A;  1QDC A;  2HWD 3;  4R9B A;  5JWP A;  2VZR A;  3OJB A;  1WCS A;  2WNO A;  2WO7 A;  3H3L A;  4HVR A;  4OFG A;  2J22 A;  2RS5 2;  2R04 3;  2VZT A;  2CGN A;  1UX6 A;  5FZF A;  3ZSE A;  1QHD A;  2VUA A;  1PO1 1;  1XU1 A;  1LES A;  1VBC 3;  1Q3E A;  3CEW A;  1AYM 1;  2YBK A;  4LK6 A;  3LOI A;  3WQ7 A;  5IYY A;  4CCD A;  5FYI A;  3H8X A;  3OUJ A;  1HLC A;  3FLR A;  3WEZ A;  3ORJ A;  5LAT A;  1X9T A;  4M3C A;  4CDX B;  1U5Z A;  2GMM A;  1DGL A;  4GUL A;  4RFT 0;  3RWK X;  3VBH C;  4QHB A;  2GNT A;  2VU9 A;  3OGS A;  2CV6 A;  1AHS A;  3OY8 B;  1SLC A;  4Q4X 2;  4QQP A;  3WHU A;  2QBX A;  3C8X A;  5A3U A;  1W06 A;  1ZZB A;  4CXX A;  4ASM B;  1VRH 3;  5FKB A;  1JYV A;  1XSQ A;  4QX0 A;  2YMZ A;  2GN3 A;  4YGB A;  1N3O A;  2WQ4 A;  4N7U A;  5K0U A;  3SEP A;  2P6H A;  5CFC C;  2RDR A;  2ARC A;  1BEV 1;  3RZJ A;  5I8Y A;  2VXJ A;  5B2G B;  4LR4 A;  2VAU A;  1W6M A;  5C5T A;  5GM0 A;  2VM9 A;  5IAV A;  1VBE 3;  5FPL A;  1FPN 1;  1LOB A;  1WCU A;  4P00 B;  1UW8 A;  1EPW A;  2YU2 A;  5K8S A;  1NY7 1;  3B3Q E;  1J58 A;  3PVO A;  3OEB A;  3H1M A;  2C24 A;  3ZFE A;  5M0T A;  4ISR A;  1AF9 A;  2WSV A;  4ZXK A;  3SXW A;  3TNQ A;  3LA7 A;  4AQ2 A;  3MIG A;  3HN3 A;  1H2M A;  3LA3 A;  1WCD J;  4LUL A;  1TE1 B;  1LCL A;  2Y6K A;  4H2A A;  3T4V A;  3UKV A;  4DS0 A;  2V4A A;  2G4I A;  2DVG A;  3N7L A;  5FZO A;  5J09 A;  2GH2 A;  2K9Z A;  4XAA A;  4GWN A;  4Y1V A;  3V0A B;  5BYN A;  5T5O A;  1RMU 1;  2AEY A;  1RUJ 3;  1NCR C;  4GJY A;  3TEW A;  4C90 A;  3DPR A;  2VUL A;  3JUU A;  3SEE A;  1AR8 2;  4CEW C;  3AZW A;  1RED A;  2DCK A;  2X5I B;  3ZYP A;  4HVQ A;  2DVF A;  4QQL A;  4P9W A;  4QX5 A;  2YBP A;  5DAX A;  2E33 A;  2OUH A;  1KDK A;  4KWJ A;  4TYS A;  2YC4 A;  1HJF A;  2KXL A;  4PBP A;  3VZL A;  4BME A;  5DMY A;  1S0G A;  4TWT A;  1QXJ A;  3POF A;  4ISQ A;  4YRD A;  3WR0 A;  1S1A A;  4HVO A;  4CZS A;  2P17 A;  5FK7 A;  2ZJC A;  3H0O A;  2I2S A;  4P5Y A;  4I3P A;  4M3C E;  3MIC A;  1VB4 A;  3MW3 A;  4D6S A;  3DF0 A;  1BYH A;  3MZH A;  4MZU A;  1F4H A;  2ZGO A;  1CES A;  1W05 A;  4XZU G;  3M3C A;  3A0K A;  5BUV A;  4IV1 A;  2ZTN A;  4HET A;  1YLL A;  2VOV A;  4OI0 A;  5FFO C;  1S0E A;  4XDP A;  5JOX A;  5K0U C;  2MNG A;  2OZ6 A;  4NRQ A;  3H3Z A;  3QOP A;  4PI2 A;  4AZZ A;  3HBK A;  4QB2 A;  1ND3 B;  2JDN A;  4QX2 A;  1D4M 2;  4AOC A;  1WD4 A;  1AXY A;  5JPM B;  1RUH 2;  4JGY B;  1AYN 1;  4RN5 A;  2D5F A;  5EYY A;  1XBF A;  3KLS A;  5JZG C;  3UL2 A;  4QM8 A;  4QAW A;  3FWE A;  3DL3 A;  3OD0 A;  1XNC A;  5JVV A;  3NL1 A;  3ZSM A;  5F8P A;  1UNB A;  3IN9 A;  1QJU 3;  1UOF A;  1VBB 1;  5EWS A;  1STM A;  2BU9 A;  3AYE A;  2J7M A;  5D8A B;  5BNN A;  2X8K A;  1W9F A;  3GBF A;  2EAK A;  2AH2 A;  4AFD A;  4QXC A;  1GNY A;  1MS5 A;  1J3P A;  4D8M A;  2Y0O A;  1Z7S 3;  4JDO A;  1W6N A;  5IK4 A;  4FQ4 A;  1WLC A;  3RI9 A;  2QKD A;  1KXG A;  5A1F A;  1AX2 A;  1OD3 A;  4YW7 A;  5I8S A;  1GIC A;  4FPC A;  1GZ9 A;  1QJY 1;  2C4X A;  5FZ1 A;  4CTE A;  4XJ9 A;  3L9J T;  5FLI A;  1TME 3;  1H6X A;  5DQ0 A;  2VXR A;  1LB2 A;  4M4P A;  2JEC A;  4FPE A;  3UV9 A;  3IDA A;  5T52 A;  4BXF A;  2AYH A;  3LIG A;  2A75 A;  2ZML A;  3HNM A;  1QJZ A;  3O0W A;  1LHV A;  1LHU A;  4LHS A;  5EQU A;  4CCN A;  2GC2 A;  1RVF 3;  1ST8 A;  2UWA A;  3FUQ A;  2XJV A;  4LKD A;  1W9S A;  4HN1 A;  5FWJ A;  1Z78 A;  2RDN A;  1VBD 3;  1Q56 A;  1WW4 A;  5BNO B;  4LO6 B;  4O7X A;  3PL0 A;  2DVA A;  4IEP A;  4JGZ A;  5FXW A;  4DUW A;  5AFB A;  1CAV B;  1DZQ A;  2TNF A;  2ZGN A;  3AP7 A;  2OYZ A;  2OII A;  4RHV 1;  3WDX A;  1LOA A;  3ATG A;  3P5B A;  2QTW B;  4XFG A;  3E5U A;  1RIR A;  3J7N A;  4OMC A;  2RS3 2;  3DYO A;  1SEF A;  4ATF A;  2DDU A;  1I9R A;  4GH4 B;  5BPX A;  4YM3 A;  2CU5 A;  2YC0 A;  1ONA A;  2B5H A;  2TBV A;  3S6P A;  3T4H B;  1DCS A;  1PGW 2;  4IV1 C;  3H8U A;  1AL2 2;  1RUC 1;  2WZR 1;  3RG0 A;  2ID4 A;  3HQU A;  4FFI A;  1RTV A;  4EV0 A;  3H3U A;  2VMG A;  2A6W A;  4D6R A;  5HCF A;  2RMU 3;  4WBB A;  1HQW A;  2G1M A;  2GMP A;  3N9O A;  2XBO 2;  2WNU B;  4PI0 A;  3BIW E;  2FZ2 A;  5EJ3 A;  5A7P A;  2XWJ B;  3BPS A;  4L92 A;  4CCK A;  1LGN A;  1LOE A;  1LU1 A;  3H9A A;  4ZKT B;  2ZGU A;  3M3Q A;  1PNF A;  4WM8 C;  1VE0 A;  2K46 A;  2H0V A;  2EID A;  1ZBE 3;  2E51 A;  4AVT A;  1QJY 2;  1Q8O A;  2QNK A;  1BQP A;  5LBB A;  2VZP A;  1UU6 A;  1FYU A;  5FYH A;  2JDM A;  4CDQ A;  2XDV A;  1COV 2;  3NNG A;  2Q8C A;  3GHN A;  4H14 A;  5DUX A;  4M4R A;  1JZ8 A;  4YYO A;  2DU0 A;  4BOW A;  4CEY A;  1UZW A;  3LWC A;  4A4A A;  2ZGT A;  1AZD A;  1AR6 2;  1PZ7 A;  2P1B A;  5AFE A;  3V0B A;  4IE5 A;  2JB8 A;  1ND2 C;  5FY4 A;  3B02 A;  3WF0 A;  1ENS A;  4GQ7 A;  4P9X A;  5FYT A;  3WNO A;  2YZ4 A;  1CAU B;  4IE4 A;  3JD7 2;  4XOG A;  5FPZ A;  3W21 A;  1NAE A;  3C2U A;  4Y4Y A;  2CDP A;  1CJD A;  4AGV A;  5JXH A;  3WW2 A;  3VBU A;  5AVA A;  5DAQ A;  5CIS A;  4TSV A;  3VBO C;  4YZ2 A;  4D6Q A;  3AVS A;  4FPL A;  5EZW A;  4LHK A;  1Y3T A;  2WNE A;  4FFF A;  4JDM A;  1L7L A;  4D3W A;  4KWK A;  4I3G A;  1W04 A;  1JW6 A;  5HV0 A;  4LPL A;  1DZR A;  3URF A;  1GAN A;  4IGQ A;  4XUR A;  4XMI A;  3DGT A;  2XVL A;  4CU9 A;  5A3L A;  3DYM A;  3PU8 A;  1QQP 2;  3UGF A;  1NT0 A;  4DMI A;  1TMF 2;  5BNP C;  5A70 A;  1KS5 A;  3JB8 A;  4PHZ A;  4D0Q A;  1WZX A;  5KHI A;  4JVA A;  1HQL A;  1JBC A;  2XJS A;  4LIT A;  1NQJ A;  4OUS A;  3B01 A;  2WYS A;  3LDK A;  3VBH B;  2ARA A;  1GR3 A;  4PIY A;  1K5M B;  3MIF A;  1WW6 A;  5JR7 B;  1KGY A;  2PHX A;  1G9C A;  2RM2 1;  4L11 A;  4N9H A;  4JKK A;  4XUO A;  1Y9G A;  1R1A 2;  4Q1P A;  4ZXE A;  1A8M A;  1LJ7 A;  3R6S A;  3TB0 A;  3CMG A;  3FUO A;  2HWD 2;  2A5Z A;  4NID A;  3OBT A;  1GP5 A;  5CFC B;  3CL1 A;  4OZX A;  5T50 A;  3KF3 A;  3T3Y A;  4EWD A;  1N3Q A;  2R04 2;  1W28 A;  1JN2 P;  4JKL A;  4HOO A;  3ZYR A;  1VBC 2;  1F5F A;  3MBW A;  5CG9 A;  1W90 A;  3POY A;  4RD7 A;  2JWP A;  3E5X A;  5FLJ A;  3ZLI A;  5KXE A;  3OGG A;  4EN7 B;  4GZ9 A;  2HWE 3;  2R1B A;  5LEK A;  3D5O A;  3PME A;  5DAV A;  1YJL A;  4KNC A;  4ZON A;  2PYT A;  3R4S A;  3UGH A;  2J42 A;  4CDQ C;  1CQ9 A;  1F9K A;  3VD4 A;  5GLV A;  3ACH A;  3LDR A;  3M3I A;  5FJK A;  4RQP C;  1XYP A;  4CEY C;  4GA9 A;  4U36 A;  4YVW C;  1XE8 A;  3EHK A;  3ZFF A;  1DGR N;  5FO8 B;  2VQT A;  1YI7 A;  1ZRI A;  3BI3 A;  1J59 A;  3ES4 A;  2HLE A;  1GQH A;  3WNL A;  3ZYB A;  3WSO A;  2Y26 A;  1VRH 2;  1NCR B;  3H1W A;  4QPG A;  1EAH 1;  1V6L A;  1MEC 3;  2VBB A;  2RJL A;  2WA3 A;  3C7H A;  4IEV A;  4COV A;  1SFP A;  5DAP A;  3THP A;  4PBO A;  2NM1 A;  4CEW B;  3MDP A;  1UMZ A;  4Q4V 1;  2QQV A;  1NA1 A;  1OI6 A;  3IDE A;  3VBU C;  4BHP A;  1R08 3;  4UBH A;  4LA2 A;  1S0B A;  5FZ7 A;  3POJ A;  1KEX A;  4G3Y C;  1VBE 2;  2ZMK A;  2YFZ A;  1IQD C;  1POV 0;  2LUW A;  2R32 A;  2G9F A;  4GB3 1;  3HEI A;  5I0D A;  1UYY A;  4IEQ A;  5F7U A;  1ODM A;  4UW4 A;  2ZX0 A;  3PIG A;  5FY0 A;  3T30 A;  1NUK A;  1ULF A;  4MVT A;  1W2O A;  2W3J A;  4COW A;  1SLT A;  2PA7 A;  4BIO A;  1PGL 1;  4YNI A;  4LO5 B;  5FY1 A;  3OBZ A;  2KM2 A;  4YW6 A;  1JU3 A;  2WAB A;  3LPF A;  4R4X A;  4CP1 A;  4KMQ A;  3PUR A;  4UF0 B;  1W6P B;  3RVH A;  3O1M A;  4BYY A;  2IVJ A;  4KI5 M;  4FBF A;  1RUJ 2;  1V9U 3;  2ZX3 A;  5LBF A;  5A3T A;  5L7O C;  3GDB A;  4GKX A;  4ES8 A;  3OYW A;  2R1D A;  1UXZ A;  4KU7 A;  5K0U B;  5I0U A;  1NZI A;  4XHB A;  2C1F A;  4UW3 A;  2PHL A;  2F17 A;  4E2Q A;  2UUR A;  5A33 B;  1BKZ A;  3LB9 A;  1YRZ A;  2BBA A;  3CO2 A;  2BBV A;  3ZN5 A;  3MPB A;  1WCK A;  1X82 A;  2WO3 A;  4K3U A;  4U2A A;  5JZG B;  4E9K A;  4DO0 A;  4EZ4 A;  3RGB A;  3PU3 A;  1HQN A;  1GQG A;  1UKG A;  1CIY A;  5KXC A;  1OOP A;  3HOB A;  4NIA A;  2DUP A;  1MAC A;  2PXJ A;  3LEK A;  1NYW A;  2VH9 A;  4AG4 A;  4Y5Z 0;  2B45 X;  4JDN A;  2MPF A;  3W58 A;  1UIJ A;  1YIF A;  1JS9 A;  2BTV C;  2BWA A;  2CL2 A;  1W0N A;  5FMO L;  1O8P A;  5CFD A;  5TSW A;  3AM2 A;  3T09 A;  5JMO A;  3RJ2 X;  1ULC A;  4QPG C;  3N35 A;  4UW6 A;  4C91 A;  3RZG A;  4TZD A;  5CAD A;  1HXS 1;  4LE4 A;  4M3C F;  5FOJ B;  5AVP A;  1YQ6 A;  5IW0 A;  5EPA A;  1C1F A;  4Z82 A;  2FDJ A;  4HK9 A;  3WP5 A;  2XH6 A;  1D0H A;  4KGQ A;  4ZU4 A;  5LZ6 A;  2YBS A;  1VMJ A;  2WS9 3;  4QGN A;  2LRO A;  2W5F A;  3AKP A;  1ALY A;  3IBM A;  5GZD A;  4QPY A;  3SCH A;  2OVU A;  1JZ7 A;  1TNF A;  2W94 A;  5FZ3 A;  2HWC 1;  2A7A A;  4QKD A;  1SBF A;  1QJU 2;  1ZM1 A;  2J1T A;  2YY1 A;  3J7M A;  3M7A A;  2HJI A;  3HR9 A;  5DAB A;  3JCI A;  4NOT A;  1SHW B;  4J1W A;  1TVG A;  3NO8 A;  4XJA A;  2DTW A;  3QH7 A;  3OSD A;  5FPA A;  3VBS C;  2BVV A;  1Z7S 2;  3N7M A;  4EZH A;  3UK9 A;  2IXH A;  1HRI 1;  1BCX A;  5H9R A;  1KDM A;  1PMI A;  4CP9 A;  1Y43 B;  3FFZ A;  4E8C A;  2GH8 A;  3KWV A;  1ZRD A;  4IV1 B;  5DDJ 3;  2R07 3;  2JDZ A;  1OD5 A;  1TME 2;  3PDQ A;  3S0M A;  5LRS A;  1A3K A;  4LO4 B;  4QB1 A;  2W2I A;  1YO8 A;  4XFH A;  1GUI A;  1O59 A;  2BER A;  2R6Q A;  1S55 A;  4BLI A;  5JOW A;  1JYT A;  2WLP A;  5DAW A;  1O5L A;  4XXP A;  3KQR A;  1YEW A;  1Q8S A;  1RVF 2;  2VNO A;  1C57 A;  1PO1 3;  2FD8 A;  1NXD 1;  1AYM 3;  1IQA A;  4DEV A;  1XC6 A;  1LOG A;  1VBD 2;  3EB7 A;  3I4I A;  4OUM A;  4WM8 B;  2DFC A;  1IPJ A;  1XXN A;  2J1R A;  2XB6 C;  3WVJ A;  3VHN A;  3W20 A;  1GSL A;  4LKE A;  2CGO A;  4Y33 A;  2WT1 A;  4JZR A;  2PFW A;  5T5L A;  1F4A A;  4MET A;  4NPL A;  2FQP A;  4QKN A;  1KRI A;  5IK7 A;  1W6N B;  1GOF A;  1IG0 A;  5CYY A;  5CA6 A;  5ABJ A;  2VW1 A;  3N9M A;  2AGS A;  5I91 A;  5H9Q A;  3UKN A;  1ND2 B;  4IV3 A;  1IS6 A;  1YQC A;  2A6Z A;  3RSJ A;  3DKQ A;  2RMU 2;  4NHY A;  1BEV 3;  4O9G A;  3O1R A;  3CDZ B;  4FOY A;  1A8D A;  2GP5 A;  3Q9O A;  2LM3 A;  4TLG A;  4XFC A;  3VBO B;  3CHX A;  4BK4 A;  3WP4 A;  5FZG A;  1FPN 3;  1N1Y A;  1BLZ A;  3NNF A;  4QDS A;  4XE9 A;  3MID A;  1FI2 A;  1ASJ 1;  1VAL A;  3LD8 A;  3CZJ A;  3LOB A;  1OUR A;  1W6O B;  2VJX A;  3DCQ A;  4LLO A;  4XC9 A;  1ZBE 2;  3THD A;  3ZKU A;  3PNA A;  1CGP A;  2KR2 A;  3ZFG C;  5KHK A;  5BNP B;  2AEZ A;  2VZQ A;  1YNA A;  4MSV A;  2VMD A;  5T5P A;  4QWN A;  3D3A A;  4MH0 E;  2VR4 A;  2H6B A;  2RS1 1;  2OUJ A;  4L2N A;  1KJL A;  2BRT A;  2JIG A;  4Q0V A;  3KHB A;  3K4D A;  4TLF A;  1RL3 A;  2VTF A;  3BCW A;  5IK5 A;  2WRA A;  4E4D X;  3BPZ A;  1H1M A;  1RMU 3;  2RDS A;  1UU5 A;  3HPN A;  3H7Y A;  5GJ6 A;  2VTX J;  2W0X A;  3PJQ A;  1OHF A;  4CDW A;  2P3Y A;  3NJV A;  1TZO A;  3GCW A;  5EP9 A;  3TNP B;  2FCV A;  4BK5 A;  5FY7 A;  4NPM A;  1V6I A;  5C8C B;  3T2P A;  2C26 A;  1GZW A;  1RUF 1;  1S2B A;  4WVM A;  2I74 A;  1W3V A;  2BP6 A;  2LRP A;  3K4A A;  5LBC A;  1B35 A;  1G9F A;  5FZ4 A;  3OPZ A;  3ZN4 A;  3MIE A;  4W50 A;  2W1U A;  3USU A;  3PMS A;  3LF7 A;  5A32 A;  4LOT A;  4XTP A;  1YFY A;  5FQ0 A;  1E57 A;  1G7Y A;  1YC6 1;  3K2O A;  3KVA A;  3MFC A;  1CJP A;  1OA2 A;  2IXK A;  2WR9 A;  4CDQ B;  2QZ2 A;  1VP6 A;  4FPK A;  1EV1 1;  4RQP B;  4XCA A;  4RL7 A;  2XVK A;  3LPG A;  4YVW B;  1S0C A;  5GLZ A;  2W08 A;  5FDB A;  4XMA A;  5ABJ C;  1ZX5 A;  1R09 1;  1N1T A;  1BZW A;  1CON A;  1QGL A;  3AK0 A;  3FX3 A;  5F39 A;  2JDH A;  5GKA C;  3K48 A;  3WIN E;  2B9U A;  3HQR A;  4Z92 B;  3PJY A;  4W6Y A;  1QY4 A;  4XJ8 A;  1QXR A;  3ILN A;  3N4M A;  1RJ7 A;  3VBU B;  1CVN A;  4MHR A;  1EY2 A;  1AYN 3;  1UWW A;  5D21 A;  1DIW A;  2QQN A;  3TYJ A;  3J26 N;  3KZ4 C;  1LOD A;  2BNM A;  4B29 A;  3O1T A;  5CB7 A;  1C5I A;  4C0H A;  4FOW A;  4FPJ A;  1BMV 2;  2Q1M A;  3T0B A;  4QX7 A;  1K3I A;  4A7K A;  4COY A;  1JOD A;  1VBB 3;  2HWE 2;  3TEX A;  2Z2S B;  1G6N A;  2ZZQ A;  2VQU A;  4XW3 A;  1GWM A;  4LT5 A;  3RQ0 A;  1VMH A;  3G6J B;  4LKF A;  2W39 A;  3GYD A;  2E7T A;  4S2H A;  1C4R A;  1NCQ A;  1RUD 1;  4CUA A;  1AJK A;  3MI8 A;  5KHH A;  4G4F A;  1X33 A;  3LEI A;  4HSJ A;  3TBD A;  5CIR A;  1GNZ A;  4Q8K A;  3BGA A;  5APA A;  5JSR A;  5L7O B;  1MEC 2;  4BB3 A;  1JOJ A;  3QD6 A;  1DQ0 A;  5B4N A;  4J6G A;  3FL7 A;  3P3P A;  4JAA A;  4BQX A;  2YU1 A;  1ULP A;  3ZX7 A;  3VB9 A;  1R08 2;  1WME A;  3SNM A;  1XQN A;  2R0F A;  3ZN6 A;  4QDQ A;  3KS7 A;  3KV9 A;  4XIL A;  4AED B;  3ILR A;  5GZE A;  1H1I A;  1H8T A;  2VNR A;  1FAT A;  2V73 A;  1GP6 A;  4MGQ A;  5C9A A;  1OLR A;  1I1E A;  2ZAB A;  4XBQ A;  4RSU A;  4YFZ A;  4RHV 3;  1HB2 A;  1FMD 1;  1ZZ6 A;  4QD2 A;  4QGM A;  2VQA A;  3KHC A;  5JSP A;  4X8P A;  1NX9 A;  1YIP A;  2DCJ A;  2LTN A;  2HEY F;  3C7F A;  3G7D A;  3NNM A;  4H7M A;  3RZH A;  2ZX1 A;  1YQ5 A;  5JXG A;  5H9S A;  1UY0 A;  5JI7 A;  1ZZ8 A;  4LJH A;  4YFW A;  2HEW F;  1RUC 3;  2WZR 3;  1V9U 2;  3RNS A;  3QCW A;  3AJY A;  5FWE A;  1ULD A;  4DIN B;  2A6X A;  4GIQ A;  5F5C A;  5FUN A;  1AX1 A;  3OBA A;  3SIT A;  1W99 A;  2WQZ C;  4S2F A;  4UXA A;  3JB4 C;  3ZXJ A;  1J1T A;  3OUI A;  3ZXA C;  1ENX A;  3CNA A;  3FN9 A;  4FXK B;  4OHZ A;  2GNB A;  4HT1 T;  1ZZC A;  3AL6 A;  1OPM A;  2O14 A;  1XSR A;  1BVP 1;  3IDB B;  3KGL A;  4UWD A;  2YXS A;  1ZA7 A;  1FAY A;  2ZGK A;  3M3E A;  4CDU A;  3WY6 A;  3CQO A;  3KF5 A;  1AUY A;  2OW4 A;  3AKR A;  3ZVX A;  4QGL A;  1HKD A;  4O9E A;  2PAK A;  3GM8 A;  1WKY A;  2HKX A;  2FCT A;  1PK6 A;  2ZHN A;  4XJW A;  3VBS B;  3E6B A;  1NCQ C;  3IM0 A;  3ZIW A;  2P3K A;  3UJQ A;  1MZ5 A;  1JHJ A;  1CIW A;  2V5Y A;  2ADD A;  4JRL A;  5B4X A;  2CAV A;  4NR1 A;  3KV6 A;  2Y6G A;  4QXK A;  4YW2 A;  2D7F A;  5C4W A;  4YW5 A;  2BW8 A;  3VN4 A;  3AXD A;  3VD5 A;  2QQJ A;  3I2O A;  2RVA A;  4JKM A;  4XIK A;  3WDV A;  5KHG A;  2J1V A;  2XJP A;  3SMH A;  1CAW A;  1RYY A;  1UY1 A;  2PQS A;  2HWB 1;  2WS9 2;  3AMH A;  3III A;  3I3E A;  3Q8C A;  4KU8 A;  3UJO A;  4ZU5 A;  3ZR6 A;  2P2K A;  1D7P M;  4CCM A;  3T0D A;  3OF1 A;  5HXM A;  3VL9 A;  1R1Z A;  4LBM A;  1CX1 A;  3WQ0 A;  1DQ5 A;  1O6U A;  4CU8 A;  1WUV A;  3J4U H;  2O8O A;  1QXP A;  3WNM A;  3BUC A;  4Q0P A;  4HMZ A;  1T6B X;  2FZ1 A;  3OPT A;  2MHF A;  4H7L A;  4OHY A;  4I0W B;  1HDK A;  5IVB A;  3AC0 A;  3QAC A;  4M00 A;  4RS5 A;  3AYC A;  2JIJ A;  5H9P A;  5HXV A;  3RMY A;  3U78 A;  1F8V A;  4LXL A;  3VDA A;  2RM2 3;  3I2I A;  4MG2 A;  2E53 A; 
#chains in the Genus database with same CATH homology
 4QXB A;  5FZ9 A;  5A3P A;  5FYH A;  4GAZ A;  5F3I A;  5A7Q A;  3ZPO A;  2XDV A;  5FYS A;  2Q8C A;  3N9M A;  5FY1 A;  2XML A;  4UF0 B;  3PUR A;  4D6S A;  3RVH A;  5F2S A;  5A3T A;  3K3O A;  2YU1 A;  5FV3 A;  4CCO A;  5A3W A;  4IGP A;  5FJH A;  5FY4 A;  5FP8 A;  2GP5 A;  2P5B A;  3KV9 A;  4V2V A;  5ANQ A;  5FXX A;  5FYT A;  3PTR B;  5F3C A;  5IVE A;  5LW9 A;  5ISL A;  2WWU A;  3KV5 A;  4QX8 A;  5FZD A;  5FZG A;  5FZ0 A;  1VRB A;  4ASK A;  2GP3 A;  4XDP A;  5FY9 A;  3LD8 A;  5FZ6 A;  5FZL A;  4D6Q A;  3AVS A;  4UF0 A;  5A7O A;  5KR7 A;  3AVR A;  5F5A A;  5FYV A;  4GJZ A;  4CSW A;  5FP4 A;  4DO0 A;  4EZ4 A;  3PU3 A;  5FUP A;  4BU2 A;  5A7N A;  3N9Q A;  4QWN A;  4IGQ A;  5FP3 A;  2PXJ A;  5FZF A;  5F3E A;  3PU8 A;  5IVV A;  2OX0 A;  5FBJ A;  3K3N A;  5FZH A;  3DXU A;  4AAP A;  5A3N A;  5FPU A;  2YBK A;  5FP7 A;  3PUQ A;  5FYI A;  3OPW A;  4LIT A;  5FY0 A;  5IVJ A;  5FWE A;  5A7W B;  4QXC A;  5FYM A;  2OQ7 A;  5FUN A;  3PUA A;  5F5C A;  4C8D A;  3DXT A;  2OQ6 A;  2VD7 A;  4LIV A;  3AL5 A;  5FY7 A;  2Q8E A;  5F5I A;  5FPB A;  5A1F A;  5CEH A;  5FZ8 A;  3N9P A;  5FY8 A;  5FZE A;  5IW0 A;  4QXH A;  5LY1 A;  4V2W A;  5FZ1 A;  4BIS A;  3AL6 A;  2Q8D A;  5A7S A;  5FZ4 A;  2YBS A;  4LIU A;  5A1L A;  4AI9 A;  4BXF A;  5FYU A;  2XXZ A;  5A7W A;  2OT7 A;  3KVB A;  4HOO A;  5FZK A;  4XDO A;  5FZ3 A;  4CCN A;  5FYC A;  4HON A;  5K4L A;  3ZLI A;  4TN7 A;  3K2O A;  3KVA A;  3PUS A;  5FWJ A;  5LWB A;  5FZC A;  5FZO B;  5FPL A;  5FPA A;  5FY5 A;  2YU2 A;  4URA A;  5FXW A;  3KV6 A;  5FPV A;  4GD4 A;  4EZH A;  5FJK A;  5FXV A;  5F39 A;  4Y3O A;  5F3G A;  5IVC A;  2XUE A;  5FXZ A;  5IVY A;  3PDQ A;  2W2I A;  4DIQ A;  5FYY A;  4QU1 A;  5LY2 A;  5FZI A;  5FZO A;  5F2W A;  4CCM A;  3KV4 A;  2YPD A;  3N9N A;  2OS2 A;  5FYB A;  4GJY A;  4CCL A;  4D6R A;  4NUB A;  5IVF A;  3N9O A;  4QX7 A;  4CUG A;  4Y4R A;  5FYZ A;  5FZ7 A;  3UYJ A;  3LDB A;  5A80 A;  5E6H A;  3OPT A;  3U4S A;  5F32 A;  2WWJ A;  5A7P A;  4E4H A;  5IVB A;  3U78 A;  5FZM A;  4CCK A;  5F37 A;  4Y33 A;  2YBP A;  5FZA A;  4LXL A;  5IWF A;  4EYU A;  4CCJ A;  3NJY A;  4IGO A;  5FZB A;  5FP9 A;  3N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...