5LY1A

Jmjd2a/ kdm4a complexed with ni(ii) and macrocyclic peptide inhibitor cp2 (13-mer)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title Highly selective inhibition of histone demethylases by de novo macrocyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ly1A01
5FZ8A 5FPUA 4GAZA 5A1LA 5ISLA 5FZOB 2OQ6A 3DXUA 2P5BA 5FPLA 3PU8A 5FY0A 5FZ7A 5FPBA 5IVFA 3N9NA 5FZBA 5FY7A 3RVHA 5A3PA 5FYHA 4BU2A 3N9OA 5IVVA 2PXJA 4QX7A 4D6RA 4QXHA 4HOOA 4EZHA 5CEHA 5IVCA 5FJKA 5F5CA 5FZ0A 5A3NA 2OQ7A 3N9QA 2YBSA 3DXTA 5LY1A 3OPTA 3KV5A 4IGPA 5FV3A 2GP5A 3K3OA 5IVYA 3K2OA 3N9PA 2OT7A 4CCMA 4LITA 4XDPA 4QX8A 5E6HA 3PURA 3LD8A 4QU1A 5IVJA 5FY8A 5FYZA 5FZ1A 5F37A 3N9LA 4LIVA 5FY1A 4CCOA 5A80A 4DIQA 4ASKA 4DO0A 5FPVA 5A7OA 5FJHA 4IGOA 5FYCA 5A7WA 2XXZA 5A1FA 2WWJA 3NJYA 5FP8A 2XDVA 2VD7A 4GJZA 3KV6A 5FZDA 5FZFA 5FYBA 3PTRB 5FWEA 2YU2A 5FPAA 5FP9A 3PUSA 4GJYA 5A3WA 3PUQA 5FUNA 5F3IA 4D6QA 5A7WB 5LW9A 5A3TA 4AI9A 4CUGA 5FXVA 4QXBA 4NUBA 4UF0A 4Y3OA 4BISA 4IGQA 5FYUA 3KV9A 3AVSA 2XUEA 2Q8CA 3OPWA 4V2WA 3KVBA 4EZ4A 3ZPOA 5FY4A 5FY9A 5FXWA 4URAA 5IW0A 5FZ3A 5FXZA 4CCNA 4UF0B 4GD4A 5IWFA 3PDQA 4LIUA 5F3GA 3K3NA 5FYTA 4E4HA 2GP3A 5FZKA 5FBJA 3KVAA 5FP7A 4D6SA 5IVEA 5FZLA 4CSWA 5F5IA 2YPDA 4EYUA 5FUPA 5K4LA 5F2WA 5FYMA 5FZEA 5FZMA 5FZ9A 5FZIA 5A7PA 5F3EA 2YBKA 4CCLA 5LWBA 5F5AA 3AL6A 5F2SA 5FP4A 5FZCA 3PUAA 5FYVA 5F3CA 2OS2A 3AL5A 4Y33A 5F32A 5FP3A 2YBPA 5FY5A 5KR7A 4AAPA 5F39A 2WWUA 5ANQA 5FYSA 4C8DA 4QWNA 2OX0A 4XDOA 4CCJA 4TN7A 3KV4A 4HONA 5A7SA 5FZHA 5FZOA 4LXLA 5A7NA 5LY2A 4CCKA 4QXCA 1VRBA 3PU3A 4Y4RA 5FXXA 2Q8EA 3U4SA 4BXFA 2W2IA 5IVBA 5FZ4A 2Q8DA 5FZAA 3ZLIA 5A7QA 5FZGA 3U78A 2XMLA 3N9MA 5FZ6A 3AVRA 3LDBA 5FYYA 3UYJA 5FWJA 2YU1A 4V2VA 5FYIA
chains in the Genus database with same CATH superfamily
4GAZA 5LEKA 3I7DA 2OQ6A 4KU7A 3WP3A 5HI0A 1ZYBA 1ASJ3 4A3ZA 1L3JA 2IC1A 5FQ0A 1DIWA 1RUH1 2DVDA 4B4RA 5GZGA 1AR81 2WN2A 1BEV3 3WDVA 4IQPA 1EAH3 2QTWB 3C8XA 4KWKA 5EYXA 2A70A 2WDBA 1MS0A 4OHVA 1N1SA 4XIOA 2HWB1 2Z79A 2A6WA 3VD4A 3VUOA 3AMMA 1UY4A 2PMWB 1S55A 2GNMA 2JE7A 3V65A 3ZMOA 3FUQA 5A3NA 5FZ0A 1FOD2 4BYYA 4FPYA 1CAXB 2H6CA 3BU7A 1QH6A 5FV3A 2HBTA 5GKAC 4N9HA 4AYUA 4Y4YA 5F5QA 1JZ6A 1POQA 2BP6A 1H4GA 4FFIA 4H14A 1CAWA 1K5JA 5KXEA 3C7EA 2QNKA 1UAIA 3K4AA 3A21A 1F15A 4CCOA 2UYBA 3ZN6A 2AYHA 3N7LA 4FP3A 1CJDA 2FQPA 2VQ0A 3NL1A 4UYBA 5A1FA 1QIQA 1A8DA 4J6GA 4OVEA 5I0SA 1W6NB 4B29A 2XDVA 1I5ZA 1H8VA 4JV4A 4DUWA 1DZQA 3V0AA 4YW3A 2YZ4A 1UF2C 4OZOA 1BK1A 3J7HA 1LENA 4R4ZA 2XOMA 4D6QA 3M3OA 5G04L 2LW8A 2ZEXA 3OY8A 3IKWA 4NAOA 5BY5A 4OUSA 1QJY3 3SMHA 3JD73 1KD7A 4ONUA 5CKMA 2NQYA 2GC3A 5BNNC 3ILFA 4ZZ5A 5LRSA 4FOVA 4MXVA 4CDUA 1NLRA 4E4SA 1KRIA 3AZVA 2QQPA 1HN0A 1SCRA 3UJQA 2D3RA 1LCLA 4HXCA 3WNMA 3U37A 2BBAA 3K4ZA 3GBWA 2F17A 4ATEA 1KJRA 5L36A 3M3CA 4YGEA 2Q30A 1PO23 4N43C 1OSGA 3AYDA 1GWLA 2PHLA 1PZ7A 4D6SA 1VMFA 4QT6A 4LO5B 3GALA 1HJGA 1QMJA 1OURA 3ZX7A 2WZEA 1IQDC 5L9RA 5FUPA 2ETEA 4CU7A 2WA4A 1V6MA 5FZIA 2VQUA 1AYN1 2ZGRA 5F2SA 1D4M3 3T2OA 4HK9A 3VBSA 1EYBA 2QDNA 2WNUA 5F3CA 2R062 4GMP0 1QXPA 1IGOA 1QF3A 1UIKA 2ZHNA 4OMDA 4XF9A 5T5LA 4NPLA 3WW4A 4CDQB 4Z2WA 2HWE3 3FWEA 2AC1A 3KF5A 3C3VA 5IT6A 1VAVA 2DUOA 4WVVA 5LBCA 3IIAA 2D6OX 2XL9A 3KV4A 4ISQA 5FK8A 1JYNA 1RUC1 2IFRA 2YHJA 4YGCA 4BXFA 3U4SA 4MGIE 4PF5A 1W04A 5KWRA 1TME1 1UPSA 4HG6B 3WCRA 4N7UA 5B4NA 1F9KA 3MLKA 1GOFA 3LDBA 1KS4A 5D8AB 5LW9A 2YU1A 5BPXA 4XUQA 2D5FA 2MEV2 2ZGMA 1GUIA 2VZ3A 1YC61 2UWAA 3CZUA 4EN6B 2XGXA 2OYZA 4YW2A 1JTZX 1UL9A 4OHZA 2J42A 1POV0 1MQTB 3WR0A 2CTVA 1S0DA 4J1WA 5DAXA 5DAQA 2RM21 3T1MA 2RJKA 4AEDB 3FL7A 4BU2A 1NZCA 2PXJA 1W3XA 2P3KA 2XL7A 3KGZA 4QXHA 3ETPA 2GC0A 2EXHA 1GQPA 3JBG3 5JI7A 1L7LA 5SV8A 1F4AA 2A6YA 3W21A 1DGLA 4UW3A 4C1XA 4ES8A 3ZYGA 3BODA 2AEYA 3O0XA 3WD5A 4BQXA 1DZRA 4CE8A 3K2OA 5EPAA 5I8TA 3VZMA 2OW4A 1DF0A 4OHYA 2HEYF 4P9GA 2H0BA 2Y6HA 3AKRA 5FZ1A 2JX9A 4LIVA 2OKXA 2ARXA 1H30A 2RR11 4A7KA 3AMNA 4DIQA 4ASKA 1NXMA 1BVP1 1OQ1A 4HKLA 4IV1B 4XF3A 2XPJA 5KXBA 1PM4A 4N53B 3CDZB 2WWJA 3NNLA 1ZZ7A 3WNPA 4QHOA 2XHKA 1TEIA 4PI0A 4QQLA 2VD7A 4CU8A 1LAJA 3KV6A 4YM1A 1YUDA 1J83A 4CEYB 5BNPC 3AK0A 4FI9A 2PHFA 1AR72 1W2AX 1AJKA 1RHI2 4MXWA 3LPGA 2ZEYA 3W5MA 1FMD1 1QKQA 3AKQA 3I59B 3ZXAC 5E16A 2ZX0A 4A4AA 2L9LA 2Y64A 2VVFA 5BNNA 2CGPA 4HN1A 3GNEA 4FPKA 2VZQA 5AFEA 4L0PA 2VO5A 1CAVA 3TBDA 5I0DA 1KITA 4Q27A 4E9KA 1QQP3 4RR3C 4X6RB 4Q4X1 3BCWA 3ABZA 5A6YA 1NT0A 5C3SA 1O3SA 3J8F1 2ZTNA 3KB5A 1CONA 4L97A 4DXRA 1JU4A 1H1MA 1YCIA 2W46A 1HQWA 2R16A 4N43A 4FTBA 3EJKA 3I49A 4QM9A 1KJLA 2Q1ZB 4WVMA 4YLZA 5FZLA 3VBUC 5AVPA 3MLLA 5M0TA 3MPBA 4IEUA 1A6CA 1HXS2 4W6WA 2R063 5ABJC 4XTMA 2D44A 3OG2A 2VTFA 4R9CA 5JXIA 4IXLA 3KZ4C 2FDFA 4YNIA 5LASA 4RGAA 4Y33A 5H9PA 2TEPA 2XUMA 2YBPA 4LE4A 4XC9A 1RXFA 1R64A 3LWCA 3POWA 5JIUA 1OUSA 1Q8PA 2HWD1 1W6QA 5FYSA 1NA1C 2VZVA 4YM0A 2VBBA 5L9BA 2OPKA 2VPVA 4ASMB 4GALA 1LOBA 2BRTA 2BVVA 2V4VA 4QPIB 5BXXA 3RWNA 3VGIA 4UW6A 2CL2A 3WX5A 2ZS6B 5FREA 1BLZA 1H4HA 3H7YA 4W6XA 3WDYA 1HIXA 3I2FA 1Z78A 5J96B 3T4HB 1XNBA 1YXWA 2XMLA 2Z5WA 2PHUA 4NWWA 2Q0AA 4QX5A 5DQ0A 4EQVA 4PIXA 4AE2A 1SLAA 1AX1A 3UL2A 4LLFA 2SBAA 4HK8A 5T3NA 4XFBA 2P34A 2RV9A 4LO7A 2A3XA 1HW5A 4HZFA 3DYPA 4MUVA 3W59A 1QNYA 3GZEA 1QOSA 5FAXA 4Q4Y1 3GCWA 4BH9A 4D7TA 1RUNA 5JOWA 4CDXC 1X33A 4TYSA 1S0BA 4OQ8A 1OPMA 2VCBA 2ZGPA 5GLZA 1OT5A 3UK9A 2CAUA 1GR3A 3NJZA 1OA4A 1HRV1 3KV5A 3D3AA 4KL1A 4RGKA 3M1HA 1RUJ2 5FMOS 2R072 4RFT0 1EV11 1H2NA 1CX1A 1J1TA 2BU9A 4A3XA 4GQ7A 5K9YA 3ROUA 2WQ4A 1GV9A 4H7MA 1LHVA 4FPOB 4H7LA 4AEKA 2HYXA 1WBFA 2WFF3 2WNOA 3N9LA 1ZBE1 1ZNPA 3ZFEA 4NHMA 3RZHA 1RINA 2RDRA 4B3NA 3TEWA 5A7WA 1QDOA 4LOSA 5IK4A 2VCMA 1VRH2 1XPWA 2BDRA 2ATFA 3MIFA 1IS3A 3OOXA 1AR73 1CAWB 1LOGA 2HEWF 2E63A 4NHLA 1RHI3 2ARBA 3N35A 4EJRA 2E31A 2WO3A 3LEKA 1OOPC 5DXDA 3ZN6B 5FYBA 3TRSB 1I5PA 2XQXA 3CF6E 1KDKA 2YU2A 5FPZA 2R32A 4GJYA 3T0BA 2PELA 4XHXA 4NIAA 5A3MA 3MIEA 1OKOA 5B4XA 3F95A 5H9QA 2Y6GA 5JZGB 1Z7S1 2WZR2 5CADA 5JMOA 3V0AB 1K45A 4BISA 5C71A 2YMZA 4NIGA 3D5OA 5CYYA 4CXXA 2OUHA 1ZA7A 2P2KA 1UY0A 2WQ8A 1ZA4A 4HSLA 2PQQA 1SDWA 1PO12 4P9XA 2J22A 3TEXA 3OY8B 4RR3A 1F8VA 2OPWA 4QQOA 4AF9A 1RMU1 1AXZA 2XBO2 2C9AA 3MHZA 4URTA 5DZFA 4LBQA 2BYVE 4UFIA 4CDUB 2Y6FA 1PGSA 1IS5A 2EAAA 2WL1A 4HANA 4LORA 4TXWA 1R091 4MOAA 1BBT2 3T08A 4AI3A 1HXS3 5AC92 1UOBA 3VBUA 1QJX3 4K9SA 5A3UA 5BUVA 3WHUA 4EYUA 2E6VA 3VKLA 2PHTA 4HVOA 5F2WA 3VZJA 2XQRA 4FPLA 3PIJA 4L2NA 5ABJA 4CCLA 1RUD2 1FT9A 1UU5A 5BV6A 1AX2A 4KWUA 2UY8A 4COVA 3KT1A 4NR1A 2C0ZA 2MPFA 3B3QE 3WY6A 3CQOA 1PVC1 5EP9A 3IMNA 1NA1A 1UXXX 3QH7A 1DQ5A 2B45X 1KFXL 4Z07A 2XVLA 2ZKLA 1RUG2 2VBPA 3AXEA 3VBSB 4CU6A 2WNUB 4L11A 2CYFA 2QJVA 4QQHA 3ACGA 2I2SA 3IAQA 4Q4W3 5DZGA 4FAGA 1JI6A 5A7QA 2Y34A 1GMMA 2OA2A 1R082 2YXSA 4P9IA 1A3KA 3AJZA 4INDA 3ZDVA 1GSLA 4AVAA 1Q5OA 3BN6A 3I97A 4QXKA 3AP6A 3B9IA 2B46X 4A2UA 4DY3A 1VAKA 4XBQA 1WWYA 5DAVA 1R1A1 2Y0IA 3N9OA 4D6RA 2X09A 2C24A 3VD9A 3NNGA 4CDXA 1OXCA 1QEXA 2JEMA 3IAPA 3S7IA 1ENRA 2YFZA 4COWA 4OYUA 2E33A 1ULOA 2DCYA 2XH6A 3AJYA 1VE0A 4K7JA 1G9FA 3AYCA 4JC1A 4CUBA 1BQPA 3WF1A 1O4ZA 4LBKA 4QX8A 4JKLA 2YY1A 4QU1A 2R042 2DCKA 1CAUB 1IKQA 5F37A 2ZACA 3CBNA 1OH4A 5EQUA 5HCBA 5J37A 2HLEA 2ZGQA 3BOWA 1XU1A 4FP2A 3DV8A 3RMYA 3MEPA 2BNOA 1VBA2 3H1MA 4HL0A 3MYXA 5K7PA 4BJ0A 4UBGA 4AI0A 4LBMA 4XJWA 3PTYA 3BIEA 1OOPA 1UYPA 1ZZ6A 4OI2A 1JMUB 1BKZA 2JG9C 3BALA 3PLQA 4QMAA 3VBOC 5A1AA 1N1TA 4KQ7A 1YEWA 4FOQA 1VMJA 3M2MA 4META 4XJUA 1QJU2 4DRRA 1DQ1A 2RMU3 4I3GA 1JYCA 4N53C 5FXVA 3GJBA 3IT8A 2CHHA 4UF0A 4KMQA 1H2MA 3O1SA 4E8CA 1V9U3 1B35C 2PFWA 1PO13 4XCAA 3O7OA 3U1XA 1WMFA 1NY72 3KV9A 3BGAA 2GMEA 3T4VA 1LB2A 2QQUA 4CEYC 1ZBA3 2XBO3 4MXWB 4BIOA 4XFAA 1IZ3A 4EZ4A 3PNAA 2BOJA 5A3OA 3S6PA 3EMRA 4AGVA 4MVTA 2IXLA 2DFBA 1JOPA 5A32A 1XRUA 1CQ9A 1JOBA 5FXZA 4GD4A 5BNNB 1W8WA 1JZ3A 5JOXA 2DVGA 4G4FA 5FPXA 1MPXA 1AJOA 2WYFA 3URFA 1CAVB 2VNOA 2O8OA 4I09A 4AVBA 1ULGA 2EIEA 1WUVA 5K4LA 1FATA 4S2HA 3H8OA 1W06A 3TN92 1NQJA 5APAA 2BW8A 2EIGA 3POSA 1LKNA 4ITCA 1W8UA 4M3CF 3O5SA 3MV01 5DDJ1 3I3EA 5LBEA 4SBVA 2QQKA 3NWKA 1GBGA 4GMP3 3RZZA 1SDDB 2VUDA 4BCUA 5DUUA 2CGOA 1UXZA 1DDLA 1VBB2 5FO8B 4CEWC 1HB2A 3NV4A 1SQ4A 4KGQA 3AP5A 4HONA 5L9VA 1LRHA 4IE5A 3SH3A 3RZMA 2ID4A 3OSDA 5FXXA 4RL7A 3J7MA 1AR63 3ILRA 1LGCA 2XR4A 4FFGA 4IEWA 1VBC1 4Q5OA 2Q8DA 1V6OA 3AKPA 3Q8EA 5FZ6A 3AP4A 4XOGA 3CZJA 4V2VA 1W8FA 1YJKA 3M4FA 4AVSA 3O1PA 4B7EA 1N3PA 1JBCA 2AR6A 2GH2A 4G3YC 1VBE1 2D5HA 4JQTA 2DVFA 4ZPIA 2RS51 3AFGA 3L2HA 5FY0A 3MIHA 2ZOEB 1X9TA 3ZSEA 5IVFA 1AXKA 3CJIC 2BGPA 3POJA 1QXRA 4LEJA 2I74A 5C8CC 2VMGA 4NHKA 2DTWA 1V70A 5D8AA 5FLJA 3WG3A 4OULA 1J3RA 3JU9A 4IEZA 1RUF3 4DINB 3KF3A 4Q0PA 4XFGA 3INAA 5K0UC 1I3HA 3KLSA 5GZDA 3JUUA 1JHNA 1DGWX 4W4ZA 3UKVA 2R043 3OUIA 1JZ4A 1WCDJ 4AEDA 2D98A 4I01A 4XQDA 3WW3A 4NJ4A 4XDPA 1UMIA 1FPN3 3FBMA 4XEZA 4Q8KA 1F31A 4RHV2 1HKDA 1VBA3 3EXUA 4BK5A 2BTVC 2EICA 4XBLA 1REEA 4JZRA 4A41A 1DYKA 5A7OA 5FJHA 4FTEA 2F6BA 2XXZA 1GP6A 2XJUA 2IXJA 2JD4A 3D6EA 4X8NA 5KHGA 2QQMA 5H9RA 1AR91 4GH4C 4Y1UA 1HQLA 2OZJA 4LQRA 3ZN4A 4AGRA 4E4ZA 2JKXA 4BQ3A 2JG9A 1B09A 3W5NA 4JVAA 3BU0A 5EIYB 4JGZC 1GICA 1LECA 5FFOC 5A7WB 4BQYA 1UX7A 2W3JA 4C90A 2VGDA 1SFPA 5HCAA 1GZTA 1VR3A 4N53A 4PLMA 3MBWA 3OD0A 2WNEA 4CYDA 4AFMA 2A71A 1B35A 2EALA 3R4DB 5BNPB 3CMGA 3H3UA 1ALYA 4K40A 5JR2A 2W0XA 4CEYA 4PBOA 3OPWA 4YGBA 2P37A 5CKNA 2VZUA 2KD7A 4JDNA 2A73B 5CFDC 3UNPA 5EXOA 5JZGC 1WMDA 3I59A 2NP0A 2VU9A 5GLTA 4AGGA 1UYXA 4BLJA 1MZEA 5JAXA 2C4XA 3TN93 2E9QA 1HX6A 2R1DA 2QQWA 5C33A 1JZ7A 4R9BA 5EWSA 4RR3B 2BGCA 3ME2A 3WP5A 4BXSV 4LBQB 4V1PA 2D40A 2HWB2 1CD3G 1TQ5A 3D82A 1GANA 1VBB3 1QJY2 4MGKE 4D69A 3JD72 4M3CE 3LKJA 3VBUB 1UX6A 1Y43B 1VLNA 4KI5M 4FCAA 2Z4FA 5JOYA 1QXJA 2GN7A 3CU7A 4NVPA 2OX0A 5GLUA 4CEWA 5ABJB 3LZZA 1TMF3 3JB4C 1E5RA 1PHMA 3D0JA 3POBA 1G86A 4P9YA 4AI1A 3AFKA 3MDPA 4AHYA 2Q1FA 3CLPA 3AKTA 2ZBJA 3PHMA 5A6ZA 1DLLA 1NA1B 1PO22 4QAWA 4QB6A 4MG2A 1UZWA 3T2QA 3HQXA 4AFDA 1ND3C 2OXBA 3NSTA 4LA3A 5LRRA 3T3YA 1OLME 1MS3A 1UZZA 2RS11 2B8MA 3DXUA 2ERFA 3USUB 4NO4A 1ULDA 1DGWA 2K46A 2WS93 3AYEA 4TTGA 1F2NA 2YYOA 2V4AA 1XC6A 1D4M2 3CJIA 4GZ9A 2H0VA 1US2A 1AYM1 4XQWA 5C8CA 3D4KA 3M70A 3ZXEA 3LFMA 4NHYA 2JDNA 1ST8A 2HWE2 4YG3A 5CEHA 1UY2A 5K0UA 3GBGA 4FQ4A 3BYWA 1ASJ1 1LTEA 2DU0A 4AG4A 2RS32 4BDVB 4O9EA 3M3EA 3OTFA 1BEV1 1UD1A 1OBNA 2OZ6A 4HKWA 2IXCA 1JZ2A 3PMEA 4CDXB 3WQ0A 4K8FA 3A0NA 5IFTA 4DXSA 2PA7A 4CRQA 2O8QA 4LK6A 4MLOA 2PAMA 2ORZA 2XWBB 4XXAA 3ZXLA 4DO0A 3AB0A 3BOPA 3KT4A 3OJBA 4BMEA 3MFAA 1C28A 1UKRA 3NJYA 3ORJA 4LR4A 1ODNA 1CN1A 4Q4V3 2A7AA 3K51A 4E2GA 4GJZA 1RUE2 2GH8A 3DEMA 4GH4A 4XCBA 4MGSA 1XNDA 3M3QA 1AZDA 1YHFA 2PLV3 3MW2A 1XU2A 1XE7A 4BQWA 5FP9A 3EO6A 1OD5A 3LOBA 1GFF2 4LHLA 3AXDA 2Q4SA 1W90A 3JBG2 3KD4A 1M4WA 4JGZA 4RQPC 3K48A 5J09A 1GZ9A 2NM1A 1XSRA 3OD4A 3IWZA 3ZXJA 1JZ8A 1HB1A 2J1SA 1W6MA 4H55A 3MPPG 3W20A 4R52A 4ZXKA 2IVJA 1GZWA 2DF7A 1OOPB 4COZA 3AVSA 3LGRA 2WAAA 3WDTA 2ET7A 5DUXA 4DZGA 3M7AA 5DZEA 1VBD1 4KWJA 3KVBA 2G19A 3THDA 1Y4WA 5FY9A 3ATGA 1RYYA 3KWVA 5CFDA 4UF0B 5JZGA 1DQ2A 3C7GA 2ZZQA 3EHKA 1RUH3 2VOTA 2VR4A 2Z42A 2J1RA 2DVAA 4MV2A 3N7JA 3G7DA 3VDCA 3GM8A 1CJPA 2ZMKA 4ZZ8A 2MNGA 2YPDA 3ZYJB 1AXYA 2HWB3 2RM22 5A32B 1MVQA 4XTPA 5CU1A 3RJRA 3V64A 2JDAA 4Z92B 3EQEA 3DN7A 2O14A 5EJZB 5A7PA 2ZCWA 3A7QA 2VC9A 5F3EA 2BV4A 1BHGA 1FNZA 2DCZA 4O65A 1F5JA 2OS2A 5FP3A 1W0OA 1COV2 3B00A 3I2HA 4LBNA 4XFIA 3WQ7A 2ZAHA 5DUWA 2EAKA 3MW3A 5DUVA 4DMIA 1QJEA 3A0KA 1XQNA 2D3PA 3N7MA 1XYNA 1BK0A 1Z0HA 1K42A 4C8DA 4H3WA 3VHOA 3LCPA 3HBZA 2J1VA 2Y38A 5A33A 3R0RA 4UFLA 1QQP2 4UFMA 3QACA 5FCCA 3ZYRA 3VHPA 1H1IA 1VRBA 3VHRA 3IDAA 2HBUA 3WNNA 1XNKA 1LOFC 2VQAA 3MUY1 3UYJA 2VNVA 3ACIA 3SLIA 1XE8A 1HRI1 4ORFA 1WW5A 2VTXA 1SFNA 3AKSA 4B8EA 4ET7A 5LA0A 2D6MA 4L9BA 1C8M1 1MZ6A 1UOJA 3PU8A 3TNPB 5GJ6A 4CP9B 3KQ4B 1C1LA 4AEMA 4YGDA 3J4UH 4C0BA 3PIGA 3NAPC 5A3PA 2EXKA 4PI2A 4Y5SA 4D8MA 5IVVA 2EXJA 1FMD2 3MGUA 4MGQA 3HEIA 2RS33 2K0GA 5IJRA 1AF9A 3CEWA 1DQ0A 3DXTA 2YUEA 2QQJA 1QJFA 1S2KA 4RN5A 1UOGA 2VH9A 3U75A 1G9DA 3JCIA 2UWCA 4GIQA 4Q4X2 4P02B 4CZSA 3IMMA 1HB3A 1OMIA 4MHRA 5F1RA 4E27A 3F2ZA 1FOD1 1GOHA 1WA6X 2B9VA 4P9LA 4A45A 4AK3A 1C1FA 5IK8A 1CVNA 1ZREA 3P3PA 3AMHA 4YFZA 2BNNA 2PYTA 3PJQA 4BB3A 2E26A 3VZKA 1V6IA 4XDQA 1RUE3 3NV1A 4MGYE 4ARYA 1AYN3 1W6OB 2VZ1A 3AZXA 2DBIA 1MVEA 3HR9A 5FP8A 3AZWA 5KBFA 3OB8A 5FZDA 2F4LA 4Q0UA 4RD7A 3LFIA 2J1TA 2JENA 4CU9A 1PVXA 1O3TA 1OC1A 3WQBA 1BMV2 5DN2A 4PLNA 1BZWA 1CAUA 5JMCA 4RQPA 2RJ2A 3HQRA 2A6ZA 3MUZ1 5T5OA 3SKVA 3D0SA 1RUC3 1YIPA 2LTNA 2VZSA 4LLOA 5T55A 3TEYA 4IGQA 4WVZA 4NN0A 1TME3 2JG9B 2ZPXA 3I2IA 4H2AA 1ZZ9A 2W68A 1DLCA 2KM2A 3E6BA 3GZTB 3VBOB 5CNAA 2VULA 3ZXKA 1YLLA 1JUHA 3NO8A 5FXWA 3H1YA 2WFF2 3N36A 1H2LA 5FTTC 3C7OA 3USSA 3WG4A 4B1MA 1JODA 2ZMLA 4UXAA 5FK7A 5JI9A 2UWBA 1B35B 4A42A 1DFQA 5IAVA 4NRQA 4NROA 3POIA 4E4HA 2RM23 5FR3A 3VKNA 2FD8A 2CSGA 1SLBA 2Y33A 3LIGA 5KHHA 1UMHA 4BOWA 3APBA 4NIIA 2RHPA 4QB1A 1WGPA 5FZMA 3KMHA 3TEZA 5AVAA 3N7KA 4GWMA 1COV3 2YC4A 3H0OA 4FOWA 4YZ2A 5LWBA 4JRAA 2QDRA 4QB2A 5FBZA 2W1UA 3AL5A 2WC2A 3JB8A 1I6XA 2XJTA 4BIFA 2WUHA 2J1EA 4EWEA 3ZXGA 3O1TA 3GXUA 4CCJA 4TLGA 4COUA 5CBLA 1GQGA 1GWMA 1Q8OA 4E8DA 3SKJE 2CV6A 1O6UA 3FLPA 4EV0A 3SXWA 3LEGA 2IVIB 4ZY9A 4L99A 4UOJA 1LOFA 5D21A 3VBFC 4LJHA 5FYYA 2Q8OA 1V6JA 3ZSKA 1ACCA 4CEWB 5KXCA 4Y1XA 5C3RA 5FYIA 4QPWA 1WKYA 4AZZA 3SHRA 4GWNA 5T52A 3BTXA 1QJX2 4A7ZA 5CG8A 1RITA 2WYSA 4M01A 3P5BA 1ZRCA 2DCTA 1SLTA 3ACFA 3I8TA 1FMD3 1C3HA 3BPSA 4XAAA 4Q2FA 4WZCA 1YQ2A 2GAUA 3E5XA 4QPYA 3RVHA 2MEV1 5FYHA 4OUMA 5C7GA 1DQ4A 1ZX5A 3ZR5A 1Q43A 1RXGA 1YQ8A 3K75B 3UKNA 1QGLA 2BWAA 5JXGA 1ZRDA 2YFUA 1J1LA 1PIV2 1UW8A 3UT0A 4QGNA 2DFCA 2YBSA 1R1ZA 4Q4X3 1W05A 2Q5TA 2N7GA 4GB32 1O4YA 1Y9QA 2EVXA 3CJIB 1OF4A 2JG8C 1GQHA 1NOVA 2NN8A 5C8CB 2QQVA 3SEPA 1CPMA 4Q4W2 3ECQA 4BQ1A 1FAYA 3PURA 5DG1A 4LO4B 4I0BA 3U07A 5FY8A 5IVJA 1U5YA 2HH9A 2VW1A 3H8UA 1W2NA 5J3UA 5K0UB 2PHWA 3AC0A 4IW3A 4AVTA 1Q8SA 3PVBB 4LE3A 5FPVA 4CXYA 4DXTA 4K1YA 1ZM1A 3NJVA 5I0TA 3SC7X 1YJLA 4LBLA 4Y26A 3FHAA 3OGJA 5GZFA 4BE3A 2D3SA 2HWD3 4LBQD 1WW4A 1CWPA 3WF4A 2LUWA 3B9CA 1CPNA 4UFKA 1FXZA 4X6QB 4AVCA 3FJSA 3MV11 1ND2C 1UCXA 1W2TA 2QQOA 4QXBA 4SLIA 2JDUA 4GH4B 4Q29A 3RMXA 1AR71 1W3VA 3DECA 3I2DA 5T5PA 4D0QA 4LOTA 1ENQA 3J9SA 2Q8CA 4BA6A 1G9AA 1DGRN 1PNGA 1W8HA 1CZVA 3PVEA 4JGZB 4M0HA 2G9ZA 2LS6A 4YVSC 3RG0A 2V5YA 3B7MA 3QLQA 5JSPA 2DBNA 1W6MB 4NRPA 5IWFA 1O5UA 4D7SA 1OH3A 3BTAA 4G9SB 1O8PA 1GZWB 4M4RA 4JAAA 4EWAA 4P5YA 4XJAA 4XYXA 2P3YA 4PQQA 5LZ6A 3AM2A 1VB4A 3WW1A 5BNPA 3HJRA 5GLVA 2A1XA 4Q4Y3 2ARAA 4QKFA 1G8WA 2W94A 4FT8A 2VZOA 4AEJA 5CFDB 3FMGA 5J1XA 2JJ6A 5AC91 3OUJA 5ACA1 5C9AC 2VUAA 3OBTA 2YBKA 1WW7A 3IDEA 3DKWA 4Y1ZA 3WDUA 5CAZA 5L7OC 2B7YA 1XYOA 2RMU2 1HRV3 3O0VA 4LKEA 3WDWA 5CKQA 3B5LB 4LBJA 5KR7A 1V9U2 3R4SA 5F39A 5J98B 1TVGA 2DYCA 1HXS1 5FMCA 3VL9A 1LNSA 2WNVC 1ZBA2 2XVKA 3RFRA 4PLOA 3IDCB 3MICA 3ZSLA 3MLJA 1YFUA 2P3JA 1W8NA 3PU3A 3ZO0B 5L19A 3BPZA 5IVBA 1E5HA 3RI8A 1CX4A 2LALA 3VBFA 3IM0A 3WF2A 2LM3A 3ELNA 5IAXA 2K9ZA 1LGBA 2JXAA 5A33B 1FNYA 2HEVF 3IB3A 5ISLA 2E32A 4HSJA 3J7NA 4XUTA 5E88A 3OBAA 3PMSA 4CDWC 2QZ3A 1IS4A 2DUQA 2ZZJA 2EIDA 2X05A 2NYYA 2YGLA 4PDWC 5GALA 5JUVA 1NAEA 3UJOA 1ND3B 1PIV3 5EFUA 4Y5Z0 2HJIA 2VECA 5CFCC 3LDRA 1YRZA 1AUYA 2RE9A 1JYVA 2D6NA 4IEQA 5F8PA 4GB33 4FO9A 2JECA 2Z69A 3USUA 1DBNA 2XB6C 5FDBA 1RMU3 2RDNA 3ZKUA 3U11A 2GP5A 3HWJA 3NVCA 1LU1A 5CVRA 2BWCA 2JG8A 5IVYA 1QWRA 3N9PA 1GNZA 1UYZA 1JXNA 4I02A 1AR62 1R093 1OUXA 1W9FA 4QGLA 2G9FA 1UOFA 4IEXA 1YYNA 1QOOA 2DWRA 1CZTA 1RUJ1 1NUKA 3WEZA 2R071 5FO7B 3POEA 3RDIA 3HMYA 1NE4A 5IUQA 4ZU7A 4PQ9A 4XHBA 5IHRA 4XUPA 4AVVA 3B93A 1HN1A 3ASIA 4IEPA 4IV3C 3H8RA 1PVC3 3NMBA 2D43A 2X8KA 3T2TA 4E4DX 4BLIA 3H7JA 1J84A 1VRH1 1LGNA 1TNRA 2D97A 3ILNA 4IUGA 3GGLA 1RUF2 4X8PA 1PGL1 5FIXA 4AI9A 2AENA 1OF3A 1SBDA 1SEFA 1W03A 4NUBA 5I0RA 3T30A 1XBFA 4S2GA 2ZX3A 4AHXA 1I1EA 1XOYA 1LESA 1PZ8A 3AZYA 1PMJX 3BVCA 4IESA 4JTNA 1YFWA 1NG0A 2BFUL 3PVNA 3FE5A 3WVJA 4RQPB 1FPN2 3WNXA 2W1QA 4QPGC 1VP6A 2WZR1 4XJ9A 4YVSA 1CZSA 5FUIA 4C1WA 1JZ5A 4QKNA 3EYPA 3ZPYA 2BEOA 3S0MA 4MHUA 5JIAA 2QKDA 3HNMA 2JE9A 1H9WA 3LEMA 4TWTA 4KG8A 3VDBA 1O3QA 1PO11 4BMBA 4AI2A 5I8SA 1ZRFA 4XZUG 1W8ZA 4XIKA 2RS52 1NCQC 4CSWA 5HCFA 1BCXA 1S1AA 1XSQA 4NPMA 3VL8A 4EN9B 1WMXA 3UETA 3KCXA 4OFGA 1RVF1 3T1LA 2ZAAA 4XF0A 5LA9A 1ONAA 3UV9A 2VG9A 1XNTA 5L7OA 4KBBA 1NXD1 4QKBA 3VHNA 1IQAA 1BBT1 1E57A 1JHJA 1XXNA 4GKXA 2JICA 4PBPA 5GM0A 1H2KA 3TOJA 2IXIA 4R9DA 1P8JA 5GZEA 1PM7A 2VZPA 1RUD1 2WNVA 1J3QA 4FVVA 5LEJA 4IEVA 3C2UA 4LXLA 4HFSA 1W28A 3KSCA 2ZXQA 3QCWA 2JKBA 4KG0A 2G9GA 1RIRA 3HPNA 3N9MA 4NMIA 4RA0A 5FWJA 5JVVA 2ZJCA 1S4CA 2R1BA 1FYUA 4MSVA 4UAPA 3S7EA 1RUG1 2CGNA 1BVVA 5A1LA 2ARCA 3NNMA 4W6YA 1GOGA 2VNGA 2XWJB 2NLRA 4MZUA 1A8MA 2A75A 1RUI1 1MEC1 2JD9A 5FPBA 1R081 1OLQA 4HKOA 1MS4A 1IPJA 2VNRA 5FY7A 4P9JA 4ATFA 1LEDA 1Y7BA 4B7KA 3BUCA 2ZX2A 4CCDA 4XBNA 4AL9A 4C0HA 3MIDA 1N47A 4F7ZA 1APNA 5JPMB 1UWWA 5CFCA 1SCSA 4JKMA 1JOJA 4WZFA 5A70A 2VMIA 2CDPA 4DEVA 5F5CA 4HLTA 3VD5A 2Z2SB 3N9QA 2P3IA 1JUIA 3LPFA 3CKHA 2W08A 3SQOA 5LY1A 1TMF2 2LRPA 3NAPB 2WINB 4IGPA 4CP9A 1F35A 2R30A 3DUIA 2V72A 1S0JA 4GXLA 1FV3A 3O14A 1SHWB 3OPZA 2TNFA 2QQIA 3LD8A 1O59A 4ES9A 2WJSA 2PAEA 2E7AA 1DQ6A 3GJAA 1S0FA 1POV3 4Y22A 3KT7A 4XVHA 4RGGA 1EY2A 1DZTA 2H6BA 5DDJ3 2EA7A 2VMFA 1X7NA 3DYOA 2YGMA 1OQEA 4ARXA 2WS92 2RJLA 4BM8A 3OEAA 3P3NA 4IV3A 3U14A 4NE9A 4N9IA 5LCWL 1JH5A 4CUAA 4N8MA 1VBA1 5C70A 3PUQA 2VY0A 2G1MA 4NOTA 3RS6A 4AWDA 5D1IA 3VKFC 4FQZA 2GZWA 3RZKA 1WLDA 2X53S 1W6OA 4LHKA 2W9XA 4UT5A 5FYUA 1RJ8A 1WCSA 2WR9A 3JXSA 3ZSJA 3WINE 1E5SA 5JCTA 2X5IC 2VUCA 2WLQA 1QJU1 4Q0VA 3U10A 4NIHA 3NV2A 4NRMA 4QPGA 4Q26A 4Q0SA 2DCJA 5CA6A 3VBRC 1DHKB 3J26N 3WUCA 3ES4A 2WZPP 1GYKA 1VBE3 1NY71 2XJVA 2YPJA 3NKGA 4IDZA 3RNSA 4MYEA 2RS53 3E97A 5C3OA 4EE2A 1H8TC 4W50A 1JYXA 3KVAA 5F6KA 4Q4V2 5IVEA 2JIGA 3M3IA 1NCQA 3VBOA 2UY9A 1MZ5A 2XJQA 4EWDA 2PLV2 2ZGUA 4LHNA 4FPFA 3LDKA 3KHCA 1AYM2 1X8EA 2WFPA 1L7QA 1PGW2 2WZ8A 5E89A 5HXVA 5C6CA 2XJRA 4KGGA 5F32A 1AL21 1O91A 2HWC1 1W9YA 2I07B 4K6BA 3TN91 1GKBA 1OLRA 1ULCA 2XLGA 1UKGA 1GP5A 1PMHX 1ULPA 3DPRC 3GBFA 3DYMA 1TNFA 4QWNA 2KA3A 2WT1A 2YC0A 4TN7A 4CXWA 1QH7A 4FXKB 3SITA 3ZN5A 3N4MA 3KM5A 4JHTA 1CR7A 3FZ3A 4Y4RA 1VBB1 2HWF1 4UWDA 3O12A 3S30A 1RUH2 1AR93 5ERLA 1AR82 2ZHMA 3OEBA 1YI7A 2WAOA 1LU2A 4B4QA 5IATA 1REFA 4FPGA 4GA9A 5AFBA 1KFUL 4K1ZA 1IPSA 2JIJA 2E7TA 1ULEA 5FZ7A 3FBYA 3VBFB 2CNAA 2Y8KA 3ZFGC 1SMVA 4I30A 2G4IA 4U36A 3J7LA 3HT2A 4QX7A 3GCXA 3VDAA 1CGPA 3MIBA 4L92A 2VMCA 4JGYC 3RQ0A 3KGLA 2GC1A 2B39A 3HQUA 1W6PA 5LB6A 3UGFA 1UIJA 1W9TA 4Y1YA 1DGRA 2ILMA 3VD3A 1LOAA 3GF6A 1YFXA 1PX4A 1NLSA 1STMA 1G6NA 2YDEA 3GHNA 3K3OA 4QQ2A 1WZXA 2WN3A 5E6HA 5JLVA 3B94A 3ITQA 1C57A 1FX5A 5IK7A 3WUDA 1ENXA 3ZMNA 4AW7A 2FMYA 4Y20A 2Y6KA 2JG8B 3SNMA 1UZVA 4YM3A 4WM8C 2P6HA 4XACA 3H42B 4RHV1 5JXHA 4YARA 1D4VB 1S0EA 1L7RA 4A7YA 1V0AA 1AVBA 2NPIA 3PUSA 2FCVA 3K77A 2OUJA 5FUNA 3DCQA 2JDYA 1KXGA 5A3TA 4IEYA 1IPKA 1VAMA 1NLQA 2Y6JA 2ZGLA 3HN1A 2W87A 4QX0A 1SACA 2XG3A 3NJXA 1U5IA 1V00A 1WBLA 1EAH1 4OI0A 3VZLA 1ZZCA 2B42B 3GDBA 4YRDA 3AYAA 2Y60A 1NKGA 4OI1A 2XUEA 3GYDA 3ZPOA 4RFRB 1ND2B 4XW3A 1N3QA 4URAA 5T54A 1KEXA 2VOVA 4O61A 3VBRA 2RS13 2WO1A 1MS5A 3IZOA 2KR2A 2TBVA 4OZXA 4CCNA 4DXZA 3V0BA 4PIZA 1N3OA 4XJ8A 4LTAA 2RG4A 3A22A 4HVRA 1OHFA 1Q8QA 3EBRA 3GZUC 4LKDA 1AYN2 3VBHC 3L9JT 5FBJA 1UU4A 2VXRA 2AACA 3V56A 5DMYA 4OI4A 3HBKA 2ZGSA 4AQSA 1AYM3 3IN9A 5DG2A 4YVSB 1G9BA 3O1MA 3W58A 4R8HA 4L8QA 3RZGA 1C5IA 5FKCA 5FZEA 2VE1A 4BQ4A 2FDKA 4Z82A 5FZ9A 3RPQA 1W99A 4YVWC 5JOZA 1A34A 2VMHA 3ACLA 5H9SA 3MZHA 1RUC2 3M8LA 1EPWA 2A6XA 5T50A 2D6LX 1SBEA 3DPRA 4BK4A 2IXHA 1OQDA 1TME2 4QU2A 5C9AB 4XDOA 2A3YA 3BIWE 1TZOA 1AX0A 1DYOA 3ES1A 4RS5C 5L7OB 1QJY1 2BUKA 4FAHA 2EXIA 3JD71 2R0FA 4RYDA 1AR83 4QXCA 2Q8EA 2WSUA 1YI9A 2BOIA 1JW6A 3HIFA 1O4TA 1SPPA 3LA3A 5FZ4A 1LODA 2YB7A 2VCAA 2XLFA 2VQTA 1GP4A 1HB4A 4GWIA 3WSOA 3ZLIA 2WNVB 3QBQA 1JYTA 1S0IA 4YYOA 2GNBA 1IG3A 1VJ2A 1LHUA 1U5ZA 4M3CA 1LHOA 2P5BA 1PO21 4PJYA 3H1WA 3ZFGA 2J1UA 3NV3A 5FZBA 5JXJA 1XE0A 4AQTA 1CIYA 1U5XA 1WCQA 1E5IA 1M06G 4JGYA 1IHMA 1D2SA 3C7HA 2WQZC 3CJXA 1VBD3 2RDSA 4YW6A 4CDWB 1FV2A 5I8YA 2AEZA 4KWLA 2K2SA 4IERA 1D4M1 4PDWB 4QDSA 4HBNA 2RR12 1UNBA 2ZGTA 3WW2A 4XMIA 4C91A 2D6PA 2VCCA 5BNOB 1RJ7A 1OLMA 1NZIA 5CFCB 2HWE1 1ND3A 2CAVA 2QQNA 1JU3A 5J7MA 2XONA 5FYZA 4IE6A 5A6QA 5HBAA 4YZ4A 2RS31 3ST7A 2DURA 3THPA 2A3WA 1YIFA 3OUHA 3X29B 4U2AA 4ZKTB 1H6YA 1W2OA 4DOUA 1N1YA 2W95A 2WSVA 2ET1A 4ZU4A 4WM8A 4PF1A 2JDKA 2W91A 1C4RA 4M0NA 4KU8A 1TE1B 1SZBA 1V6LA 5FZFA 4UFHA 3B01A 3ZM8A 1DCSA 2P4EA 4UW4A 4Y22B 2V09A 2ZGOA 5FPAA 3LA2A 2FMDA 1GU3A 4J25A 2RDQA 4CA9A 3KHBA 1RUE1 4FFFA 4AHZA 4BWOA 2E51A 2WRAA 3VLBB 3L2YA 3KCYA 3B69A 1DG6A 4IV3B 4FOYA 2SLIA 1YO8A 3J8F2 4OUEA 4Q1RA 2KXLA 1GZCA 3DKQA 3JBG1 4WM7C 4XF4A 2WWSA 4YW1A 1HRI3 4QHZA 4AQ6A 5CG9A 5CISA 5IW0A 4Z2AA 4DPNA 5C4WC 4I2OA 4EN7B 4CP2A 1C8M3 3FN9A 5KC5A 5DAPA 2ADEA 4AOCA 4FPHA 1BJQA 3ACHA 4LMFA 3OGVA 3VBHA 4KNCA 1NCRC 1C5HA 4TLFA 4D94A 4QPGB 5F6LB 2BVBA 4LK7A 4MH0E 3H50A 2QBXA 2ES3A 2HYKA 4IE4A 4WVWA 2HWD2 4W65A 3H9AA 1DU3D 1WCKA 4YVWA 3VDDC 1WD3A 2VZRA 1EP0A 4XUNA 3DGTA 5CZKA 5FP4A 5FZCA 1UMZA 2DUPA 4XILA 3FHQA 4LBOA 4K21A 1UQXA 3K46A 2JDZA 1MS1A 3I2JA 2VOKA 4YPJA 1NCQB 5FMDA 3WP6A 3NQHA 4K3UA 4XFHA 2QE3A 2GDFA 2GMMA 2QUOA 2WWUA 1QU0A 5ANQA 3ZFFC 4E2QA 2CWMA 1OFSA 1FOD3 1US3A 2VOXA 3T0DA 5EJ1B 2GC2A 3TNQA 1PX3A 4CCEA 4COYA 4RS5A 5FZHA 5FZOA 1COV1 1ULFA 4ZU5A 2W39A 4LKSA 3WHTA 2FCUA 4FFHA 1VALA 5IFPA 2VOWA 1XJAA 2WA3A 3NNJA 1S0CA 2W2IA 5LBFA 3I54A 1KQRA 2CY6A 1K5MC 1WW6A 2BERA 3AVRA 3JQXA 1ZZ8A 1OKQA 2D6KA 1WLCA 2OIIA 1PNFA 2UURA 1QQP1 3POFA 1WLTA 4GKYA 4Q4Y2 3WF3A 4DB5A 3O1UA 1MACA 3LEIA 3MFCA 1Y9GA 1J3PA 2V73A 4P14A 3ZFEC 5GLWA 1HV0A 3T0AA 4CVUA 3TYJA 4ZHNA 1RGSA 1A78A 1VMHA 3O0WA 4W8JA 5LBBA 5HV0A 1HRV2 2FZ1A 3R6SA 4KBZA 4DQAA 1EV12 2GMPA 2ZMNA 2O0OA 4HT1T 3OBRA 2RR13 5E8AA 2R061 2DDUA 4BZ4A 2C9KA 5FJKA 1PK6C 1W39A 4P9WA 3IIIA 3LSDA 1WLWA 1ZBE2 1N1VA 3VD7A 1GWKA 4CUCA 2QQLA 1NYWA 1W0PA 2DTYA 2VW2A 2W1SA 2OT7A 3ZIXA 4CCMA 4LITA 4CTEA 5KHJA 3OCPA 5DABA 3ZVXA 4AFAA 3BI3A 4OQ9A 2QCSB 4YG6A 1W6PB 2VL4A 2ENRA 3I2KA 1LULA 1OPOA 2MHFA 4DUVA 5KHKA 1MZFA 5C5TA 1MS8A 1NE6A 1REDA 1Q3EA 5G05L 3NAPA 4DEQA 3OBZA 2AREA 4JDMA 3OGRA 1Z7S2 3WCSA 5ACA2 2W5FA 4XZPA 5EYYA 3WG2A 1I9RA 3T2PA 4Y20B 4HETA 2FHRA 4ZS3A 5F7UA 4UW5A 4Q8LA 2VJXA 4DY5A 3J8F3 4D7YA 5C3PA 3TWIA 1RMU2 2UYAA 5I0UA 3MIGA 1BMV1 3LOIA 3VKOA 1EUUA 4QHBA 1K3IA 2ZKNA 1J58A 4EROA 4WM7A 2V5DA 3OGGA 1R092 1PMIA 4AAXA 5FY4A 3LIHA 4Q0QA 4NHXA 1G7YA 5FZ3A 4YZ1A 5C4WA 2C1FA 2VMEA 4LIUA 1QDCA 5D2AA 5DPNA 1FI2A 2FDHA 2VTXJ 2X5IB 3RGBA 3E6CC 1NCRA 1S0GA 4XUOA 2MEV3 2ZEWA 1JYWA 2WFF1 3LE0A 3Q8BA 4BHPA 5JR7B 1ZZBA 2GSYA 2R49A 3VBRB 4JTOA 5FLIA 1PVC2 2A5ZA 4NPRA 5EZWA 3V0BB 1HQNA 3VDDA 5I93A 3AL6A 2HKXA 3RYRA 3RYPA 1H8TB 4IEOA 3C7FA 3FFZA 3MF9A 3SEEA 1RHI1 2QZ2A 4CPBD 4QGMA 3SCHA 3WDXA 5DAWA 3ZFFA 5I91A 4ASLA 1X9PA 3QH6A 4AQ2A 3R05A 4AXOA 3ALQA 5K8SA 4EN8B 5A7SA 3KS7A 1K12A 4LKFA 5FQ0B 4DNYA 2BFUS 4CCKA 3VN4A 4JHZA 3GZAA 2EF6A 3W9AA 1UN1A 1T6GC 5IYYA 2ZGNA 3DPRB 3I3QA 4K20A 1K5MA 5FZGA 5FZAA 4Z1VA 2I45A 1TG7A 3SCGA 1LOEA 4DRVA 1R1A2 5FZ8A 4PIYA 2VM9A 2XVGA 1F5FA 1LHWA 2ADDA 4FPEA 4TZDA 2BQPA 5FPLA 3ETQA 2W47A 3A4UA 1SPPB 3CNAA 3LF7A 2NMOA 3PUIA 4YW5A 2BBVA 3N9NA 1EV13 1RC6A 2PHDA 4LUMA 1PGL2 2FBEA 1IS6A 2R0HA 2Y26A 1RB8G 1QJX1 5FOBB 1W0NA 5A3LA 2IFWA 4HOOA 3N3HA 4EZHA 2BJSA 4P00B 1ZBE3 2WT2A 2BPA2 3NRUA 1MR5A 3EB7A 4M3CB 5IVCA 3AP9A 1D0HA 1PK6A 2JDPA 1OVPA 1SLIA 2R6QA 3LQCA 3ZFGB 4AI8A 4QKDA 4WBBA 4XE9A 2W1WA 3RZLA 3FHIB 5HCHA 5BNQA 2QFEA 4JGYB 3VB9A 5JWPA 1PIV1 3I3MA 4IETA 3ZKYA 4CPBA 4Z8BA 2JB8A 2PQSA 4GB31 4M00A 1WCUA 1KGYA 1EUTA 3A23A 1Z7S3 4YW7A 5ACA3 5LK7B 1G9CA 3BTYA 4QQPA 4Q4W1 5J36A 1RTVA 1YFYA 2D93A 1RVF2 4OLLA 5BNOC 2FDGA 3TAYA 3IPVA 3LSEA 2JE8A 2C26A 3PTRB 4LPLA 3WF0A 2IXKA 1VPHA 3LAGA 3JZVA 3QOPA 1AL0G 3ENRA 2BNMA 4WM8B 4CUGA 1S2BA 4BQ5A 2BGOA 4RSUA 1OA3A 3WXPA 1W9WA 4UBHA 1D2QA 1HDKA 3ZYHA 1ODMA 3VZOA 3O1VA 3IDBB 3WLUA 2GN3A 4V2WA 3THTA 2GNDA 3PL0A 1JN2P 2ZA9A 2YC2A 5EJ3A 1UO9A 1OFNA 3OF1A 1ZVFA 2EIBA 1F4HA 3HVDA 3ZDSA 1WMEA 3FX3A 3OYWA 2PHXA 5T5JA 5FYTA 2FCTA 1H0BA 2GP3A 5DDJ2 4YW4A 5FZKA 5HV4A 3ZYPA 1D7PM 1VB2A 2NMNA 1RUI2 1MEC2 1XNCA 4CDQC 4DFSA 5FO9B 2JWPA 1ND2A 4N7IA 5FYMA 3IBMA 4OHWA 2ZX4A 2W52A 2FDIA 4HPKA 5LK5A 3KQRA 4R9AA 4F8AA 4YWAA 2YROA 2P6CA 3VBHB 1LR5A 1CESA 5FYVA 3U4XA 3I2GA 3PUHA 5FY5A 1Q8VA 5LA1A 3WQ1A 1GNHA 1YQCA 3RJ2X 4AFBA 3TB0A 3HT1A 5FMOL 4GULA 1VBC2 1W2UA 2P1BA 5D8AC 4XXPA 2VVEA 4YVWB 3FUOA 4QX1A 3WV6A 4A6OA 2DVBA 2RMU1 1HJFA 1RUJ3 1T6BX 2WO7A 5JPNB 3HOBA 2R073 3NW4A 4I0AA 4J1XA 4AFCA 1O3RA 1V9U1 4LHSA 4NWVA 4ZONA 1VBE2 1MQTC 2JDHA 4M4PA 1R1A3 3E1F1 3S5QA 2LROA 3Q8FA 4NAMA 1ZBA1 2ORXA 3ZR6A 4AEDC 2GNTA 2XBO1 1H6XA 3CIHA 5FPUA 3I3DA 2QVSB 1Q56A 2Y0OA 4RS5B 5C9AA 5FZOB 1HLCA 1BYHA 4A6SA 4IE7A 1VRH3 5GZCA 4IE0A 1XYPA 5L73A 2ZGKA 3E5UA 1CAXA 1OVSA 1UZYA 4MO3M 2PTMA 2XHNA 5SV5A 2DU1A 1SLCA 1BXHA 3VV1A 3SH5A 3CO2A 2RVAA 1UPIA 2J1AA 1OD3A 1X82A 1X36A 2WZR3 3I4IA 2UU8A 1YWKA 3LB9A 4S2DA 2OQ7A 3G6JB 3H8XA 3P6BA 1QOTA 1WD4A 2JDMA 3OPTA 4IV1C 2VVDA 4GMP1 4JCKA 3PJYA 5FKBA 3T09A 3WZ1A 3NKTA 1ZRRA 4LNVA 4YM2A 3SISA 4HN0A 3UGHA 1W6NA 3AMQA 1D0GA 4IL7A 4N90A 4JDOA 2ZHLA 5F9TA 3ZSMA 1YQ5A 1AR92 4AR2A 3B02A 1YQ6A 5A80A 3AMPA 3D8CA 4Y1VA 4CDWA 2VMDA 4F3JA 4FXGB 1UY1A 4R4XA 1RVF3 1LJ7A 4PDWA 5FYCA 3U0ZA 1AR61 1UZ0A 3AP7A 4QDQA 1BBT3 3RWKX 1EPZA 3MF6A 5AC93 5BNOA 5JSRA 2GU9A 2OVUA 2P17A 4CP0A 3H3ZA 1V6KA 1W9SA 5A3WA 3ZXDA 1AL22 2HWC2 5ANNA 1POV1 1RUD3 2VW0A 3HD8B 5F3IA 5KXDA 2B4KA 3RRDA 3UGGA 1OA2A 3I3BA 1XB9A 3POGA 3VKMA 5BYNA 1RL3A 3MO4A 3E6DA 4N43B 1UY3A 1CIWA 2E7QA 2ZEZA 1KDMA 1QJZA 5FMBA 4WVMB 3FC0A 3Q8AA 4ISRA 4ZS2A 1RUF1 3RI9A 4F83A 2VBDA 3HN3A 4LA2A 2HWF2 1RUG3 2VUJA 2XKPA 1IKPA 1X50A 3SCFA 1OI6A 2XJSA 5C3QA 1VIWB 3PDQA 1WA4A 1J59A 2R041 1PZ9A 5F3GA 2F4PA 4B4PA 1RUI3 1C8NA 1MEC3 4XAEA 1R083 2E53A 4OHXA 1FPN1 1NQDA 4MX3A 2D7FA 4WM7B 1W6QB 4FPCA 4FTSA 4LULA 3WNLA 4CDQA 4B1LA 3RZJA 1SFYA 4QX2A 3ON7A 5C4WB 1LHNA 3P1IA 3AX4A 4FPJA 4LT5A 3RYKA 1DYPA 4HMZA 4XETA 2YV8A 3LA7A 3WOGA 4QPIC 4NIDA 3BB6A 2ZX1A 5C5UA 1NCRB 4LO6B 1VBC3 2IWGB 2YG0A 1O8SA 5KHIA 3AZZA 3VDDB 1IOAA 3VZNA 3S5AA 5C8WA 3K4DA 4JX0A 4XABA 1UYYA 3QD6A 4XMAA 5A7NA 5LY2A 3O1OA 1JYIA 2RS12 1Y3TA 2PN5A 1MQTA 3ZFFB 3WG1A 5LATA 4E2SA 2B5HA 2C5DA 1U0AA 3CHXA 3BTZA 2TUNA 3FFQA 2A6VA 3I2OA 1XNAA 3NNFA 1H9PA 4MGTA 1HV1A 3R4UA 4PCRA 5KC6A 3FLRA 4PT6A 1SBFA 2PHRA 2Y6LA 3ZYIB 3WT3A 2WKKA 4UFJA 2W92A 3UKTA 1K5MB 2WBKA 2X29A 4MADA 1ASJ2 1GNYA 4UI9L 1ZRIA 4FBFA 2IUWA 4GWJA 1BEV2 3GHMA 1EAH2 2ZABA 4Y5TA 1QJU3 2AZ5A 3ZFEB 1W8OA 4XFFA 4JRLA 2WO2A 4XFCA 2WIIB 4PHZA 4QD2A 4XPVA 4IV1A 2FZ2A 3MI8A 4OMCA 2DV9A 4OCTA 1LOCA 4MGZE 2O1QA 3WNOA 4Q1PA 1UU6A 2AUYA 5CIRA 3HAGA 3S57A 1PK6B 3DL3A 3DF0A 5FY1A 1TMF1 4XQ4A 1X8MA 2CDOA 2XLAA 5JDBA 3Q9OA 4YZ3A 1AHSA 4IGOA 3RSJA 4P08A 3OGSA 5A6XA 1W8TA 2XJPA 3HNBM 1O5LA 4QM8A 5JSOA 3PVOA 1IG0A 1KS5A 3THCA 2Q1MA 4XJZA 1AL23 1MS9A 2J7MA 2HWC3 1QNWA 2JB4A 4LO8A 2WT0A 5FWEA 2PAKA 2FDJA 1JS9A 3CL1A 3JQWA 3MW4A 4DS0A 1VBD2 2IZWA 4QDRA 4O7XA 3ZXFA 2WS91 1Y9MA 4CP1A 4BQ2A 5EV7A 4P5HA 5TSWA 4D3WA 2R7EB 4Y3OA 3POYA 4A44A 3IPVB 4CDUC 2HWF3 1O7FA 5EHDA 1SG3A 2CU5A 4I0WB 4WV8A 3ZOIA 5B2GB 1GLHA 3FLTA 5HXMA 5IK5A 3BKZA 5LA2A 4BPZA 2VZTA 2XKOA 3K3NA 4CCCA 2VAUA 2WABA 4I3PA 2C6SA 5FP7A 1T2XA 1V6NA 3WNKA 3WP4A 4XF1A 4ZXEA 2AH2A 5F5IA 5FLHA 2VXJA 5CB7A 1URXA 2CWSA 2ZHKA 2GALA 3UESA 1NX9A 4YFWA 4Y24A 3OYWB 1YNAA 4JQRA 4XURA 5F5AA 4QPIA 4S2FA 4Q4V1 1QY4A 3O1RA 3PUAA 3VBSC 2WNUC 5HPOA 1RUOA 4QX3A 4HVQA 2X5IA 4AAPA 4KH9A 2PLV1 3ZIWA 2B9UA 3H3LA 4YSFA 2BZDA 1H1AA 3HNYM 4YZ5A 5J48A 1DP0A 2WLPA 1PGW1 4HPKB 3KCCA 3ZYFA 2AGSA 4FSJA 4DUXA 5FOJB 1HRI2 5FRAA 2NZ9A 4EN0A 4LUKA 1QHDA 1H8TA 4TSVA 1U12A 4AHWA 1C8M2 4K8RB 1ENSA 1LEMA 5E1RA 1S2EA 4JKKA 1SLLA 3Q8CA 3U78A 2X10A 4RHV3 3E5QA 4YG0A 3SH4A 4O9GA 3ZYBA
chains in the Genus database with same CATH topology
5FZ8A 5FPUA 4GAZA 5A1LA 5ISLA 5FZOB 2OQ6A 3DXUA 2P5BA 5FPLA 3PU8A 5FY0A 5FZ7A 5FPBA 5IVFA 3N9NA 5FZBA 5FY7A 3RVHA 5A3PA 5FYHA 4BU2A 3N9OA 5IVVA 2PXJA 4QX7A 4D6RA 4QXHA 4HOOA 4EZHA 5CEHA 5IVCA 5FJKA 5F5CA 5FZ0A 5A3NA 2OQ7A 3N9QA 2YBSA 3DXTA 5LY1A 3OPTA 3KV5A 4IGPA 5FV3A 2GP5A 3K3OA 5IVYA 3K2OA 3N9PA 2OT7A 4CCMA 4LITA 4XDPA 4QX8A 5E6HA 3PURA 3LD8A 4QU1A 5IVJA 5FY8A 5FYZA 5FZ1A 5F37A 3N9LA 4LIVA 5FY1A 4CCOA 5A80A 4DIQA 4ASKA 4DO0A 5FPVA 5A7OA 5FJHA 4IGOA 5FYCA 5A7WA 2XXZA 5A1FA 2WWJA 3NJYA 5FP8A 2XDVA 2VD7A 4GJZA 3KV6A 5FZDA 5FZFA 5FYBA 3PTRB 5FWEA 2YU2A 5FPAA 5FP9A 3PUSA 4GJYA 5A3WA 3PUQA 5FUNA 5F3IA 4D6QA 5A7WB 5LW9A 5A3TA 4AI9A 4CUGA 5FXVA 4QXBA 4NUBA 4UF0A 4Y3OA 4BISA 4IGQA 5FYUA 3KV9A 3AVSA 2XUEA 2Q8CA 3OPWA 4V2WA 3KVBA 4EZ4A 3ZPOA 5FY4A 5FY9A 5FXWA 4URAA 5IW0A 5FZ3A 5FXZA 4CCNA 4UF0B 4GD4A 5IWFA 3PDQA 4LIUA 5F3GA 3K3NA 5FYTA 4E4HA 2GP3A 5FZKA 5FBJA 3KVAA 5FP7A 4D6SA 5IVEA 5FZLA 4CSWA 5F5IA 2YPDA 4EYUA 5FUPA 5K4LA 5F2WA 5FYMA 5FZEA 5FZMA 5FZ9A 5FZIA 5A7PA 5F3EA 2YBKA 4CCLA 5LWBA 5F5AA 3AL6A 5F2SA 5FP4A 5FZCA 3PUAA 5FYVA 5F3CA 2OS2A 3AL5A 4Y33A 5F32A 5FP3A 2YBPA 5FY5A 5KR7A 4AAPA 5F39A 2WWUA 5ANQA 5FYSA 4C8DA 4QWNA 2OX0A 4XDOA 4CCJA 4TN7A 3KV4A 4HONA 5A7SA 5FZHA 5FZOA 4LXLA 5A7NA 5LY2A 4CCKA 4QXCA 1VRBA 3PU3A 4Y4RA 5FXXA 2Q8EA 3U4SA 4BXFA 2W2IA 5IVBA 5FZ4A 2Q8DA 5FZAA 3ZLIA 5A7QA 5FZGA 3U78A 2XMLA 3N9MA 5FZ6A 3AVRA 3LDBA 5FYYA 3UYJA 5FWJA 2YU1A 4V2VA 5FYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ8 A;  5FPU A;  4GAZ A;  5A1L A;  5ISL A;  5FZO B;  2OQ6 A;  3DXU A;  2P5B A;  5FPL A;  3PU8 A;  5FY0 A;  5FZ7 A;  5FPB A;  5IVF A;  3N9N A;  5FZB A;  5FY7 A;  3RVH A;  5A3P A;  5FYH A;  4BU2 A;  3N9O A;  5IVV A;  2PXJ A;  4QX7 A;  4D6R A;  4QXH A;  4HOO A;  4EZH A;  5CEH A;  5IVC A;  5FJK A;  5F5C A;  5FZ0 A;  5A3N A;  2OQ7 A;  3N9Q A;  2YBS A;  3DXT A;  5LY1 A;  3OPT A;  3KV5 A;  4IGP A;  5FV3 A;  2GP5 A;  3K3O A;  5IVY A;  3K2O A;  3N9P A;  2OT7 A;  4CCM A;  4LIT A;  4XDP A;  4QX8 A;  5E6H A;  3PUR A;  3LD8 A;  4QU1 A;  5IVJ A;  5FY8 A;  5FYZ A;  5FZ1 A;  5F37 A;  3N9L A;  4LIV A;  5FY1 A;  4CCO A;  5A80 A;  4DIQ A;  4ASK A;  4DO0 A;  5FPV A;  5A7O A;  5FJH A;  4IGO A;  5FYC A;  5A7W A;  2XXZ A;  5A1F A;  2WWJ A;  3NJY A;  5FP8 A;  2XDV A;  2VD7 A;  4GJZ A;  3KV6 A;  5FZD A;  5FZF A;  5FYB A;  3PTR B;  5FWE A;  2YU2 A;  5FPA A;  5FP9 A;  3PUS A;  4GJY A;  5A3W A;  3PUQ A;  5FUN A;  5F3I A;  4D6Q A;  5A7W B;  5LW9 A;  5A3T A;  4AI9 A;  4CUG A;  5FXV A;  4QXB A;  4NUB A;  4UF0 A;  4Y3O A;  4BIS A;  4IGQ A;  5FYU A;  3KV9 A;  3AVS A;  2XUE A;  2Q8C A;  3OPW A;  4V2W A;  3KVB A;  4EZ4 A;  3ZPO A;  5FY4 A;  5FY9 A;  5FXW A;  4URA A;  5IW0 A;  5FZ3 A;  5FXZ A;  4CCN A;  4UF0 B;  4GD4 A;  5IWF A;  3PDQ A;  4LIU A;  5F3G A;  3K3N A;  5FYT A;  4E4H A;  2GP3 A;  5FZK A;  5FBJ A;  3KVA A;  5FP7 A;  4D6S A;  5IVE A;  5FZL A;  4CSW A;  5F5I A;  2YPD A;  4EYU A;  5FUP A;  5K4L A;  5F2W A;  5FYM A;  5FZE A;  5FZM A;  5FZ9 A;  5FZI A;  5A7P A;  5F3E A;  2YBK A;  4CCL A;  5LWB A;  5F5A A;  3AL6 A;  5F2S A;  5FP4 A;  5FZC A;  3PUA A;  5FYV A;  5F3C A;  2OS2 A;  3AL5 A;  4Y33 A;  5F32 A;  5FP3 A;  2YBP A;  5FY5 A;  5KR7 A;  4AAP A;  5F39 A;  2WWU A;  5ANQ A;  5FYS A;  4C8D A;  4QWN A;  2OX0 A;  4XDO A;  4CCJ A;  4TN7 A;  3KV4 A;  4HON A;  5A7S A;  5FZH A;  5FZO A;  4LXL A;  5A7N A;  5LY2 A;  4CCK A;  4QXC A;  1VRB A;  3PU3 A;  4Y4R A;  5FXX A;  2Q8E A;  3U4S A;  4BXF A;  2W2I A;  5IVB A;  5FZ4 A;  2Q8D A;  5FZA A;  3ZLI A;  5A7Q A;  5FZG A;  3U78 A;  2XML A;  3N9M A;  5FZ6 A;  3AVR A;  3LDB A;  5FYY A;  3UYJ A;  5FWJ A;  2YU1 A;  4V2V A;  5FYI A; 
#chains in the Genus database with same CATH topology
 4GAZ A;  5LEK A;  3I7D A;  2OQ6 A;  4KU7 A;  3WP3 A;  5HI0 A;  1ZYB A;  1ASJ 3;  4A3Z A;  1L3J A;  2IC1 A;  5FQ0 A;  1DIW A;  1RUH 1;  2DVD A;  4B4R A;  5GZG A;  1AR8 1;  2WN2 A;  1BEV 3;  3WDV A;  4IQP A;  1EAH 3;  2QTW B;  3C8X A;  4KWK A;  5EYX A;  2A70 A;  2WDB A;  1MS0 A;  4OHV A;  1N1S A;  4XIO A;  2HWB 1;  2Z79 A;  2A6W A;  3VD4 A;  3VUO A;  3AMM A;  1UY4 A;  2PMW B;  1S55 A;  2GNM A;  2JE7 A;  3V65 A;  3ZMO A;  3FUQ A;  5A3N A;  5FZ0 A;  1FOD 2;  4BYY A;  4FPY A;  1CAX B;  2H6C A;  3BU7 A;  1QH6 A;  5FV3 A;  2HBT A;  5GKA C;  4N9H A;  4AYU A;  4Y4Y A;  5F5Q A;  1JZ6 A;  1POQ A;  2BP6 A;  1H4G A;  4FFI A;  4H14 A;  1CAW A;  1K5J A;  5KXE A;  3C7E A;  2QNK A;  1UAI A;  3K4A A;  3A21 A;  1F15 A;  4CCO A;  2UYB A;  3ZN6 A;  2AYH A;  3N7L A;  4FP3 A;  1CJD A;  2FQP A;  2VQ0 A;  3NL1 A;  4UYB A;  5A1F A;  1QIQ A;  1A8D A;  4J6G A;  4OVE A;  5I0S A;  1W6N B;  4B29 A;  2XDV A;  1I5Z A;  1H8V A;  4JV4 A;  4DUW A;  1DZQ A;  3V0A A;  4YW3 A;  2YZ4 A;  1UF2 C;  4OZO A;  1BK1 A;  3J7H A;  1LEN A;  4R4Z A;  2XOM A;  4D6Q A;  3M3O A;  5G04 L;  2LW8 A;  2ZEX A;  3OY8 A;  3IKW A;  4NAO A;  5BY5 A;  4OUS A;  1QJY 3;  3SMH A;  3JD7 3;  1KD7 A;  4ONU A;  5CKM A;  2NQY A;  2GC3 A;  5BNN C;  3ILF A;  4ZZ5 A;  5LRS A;  4FOV A;  4MXV A;  4CDU A;  1NLR A;  4E4S A;  1KRI A;  3AZV A;  2QQP A;  1HN0 A;  1SCR A;  3UJQ A;  2D3R A;  1LCL A;  4HXC A;  3WNM A;  3U37 A;  2BBA A;  3K4Z A;  3GBW A;  2F17 A;  4ATE A;  1KJR A;  5L36 A;  3M3C A;  4YGE A;  2Q30 A;  1PO2 3;  4N43 C;  1OSG A;  3AYD A;  1GWL A;  2PHL A;  1PZ7 A;  4D6S A;  1VMF A;  4QT6 A;  4LO5 B;  3GAL A;  1HJG A;  1QMJ A;  1OUR A;  3ZX7 A;  2WZE A;  1IQD C;  5L9R A;  5FUP A;  2ETE A;  4CU7 A;  2WA4 A;  1V6M A;  5FZI A;  2VQU A;  1AYN 1;  2ZGR A;  5F2S A;  1D4M 3;  3T2O A;  4HK9 A;  3VBS A;  1EYB A;  2QDN A;  2WNU A;  5F3C A;  2R06 2;  4GMP 0;  1QXP A;  1IGO A;  1QF3 A;  1UIK A;  2ZHN A;  4OMD A;  4XF9 A;  5T5L A;  4NPL A;  3WW4 A;  4CDQ B;  4Z2W A;  2HWE 3;  3FWE A;  2AC1 A;  3KF5 A;  3C3V A;  5IT6 A;  1VAV A;  2DUO A;  4WVV A;  5LBC A;  3IIA A;  2D6O X;  2XL9 A;  3KV4 A;  4ISQ A;  5FK8 A;  1JYN A;  1RUC 1;  2IFR A;  2YHJ A;  4YGC A;  4BXF A;  3U4S A;  4MGI E;  4PF5 A;  1W04 A;  5KWR A;  1TME 1;  1UPS A;  4HG6 B;  3WCR A;  4N7U A;  5B4N A;  1F9K A;  3MLK A;  1GOF A;  3LDB A;  1KS4 A;  5D8A B;  5LW9 A;  2YU1 A;  5BPX A;  4XUQ A;  2D5F A;  2MEV 2;  2ZGM A;  1GUI A;  2VZ3 A;  1YC6 1;  2UWA A;  3CZU A;  4EN6 B;  2XGX A;  2OYZ A;  4YW2 A;  1JTZ X;  1UL9 A;  4OHZ A;  2J42 A;  1POV 0;  1MQT B;  3WR0 A;  2CTV A;  1S0D A;  4J1W A;  5DAX A;  5DAQ A;  2RM2 1;  3T1M A;  2RJK A;  4AED B;  3FL7 A;  4BU2 A;  1NZC A;  2PXJ A;  1W3X A;  2P3K A;  2XL7 A;  3KGZ A;  4QXH A;  3ETP A;  2GC0 A;  2EXH A;  1GQP A;  3JBG 3;  5JI7 A;  1L7L A;  5SV8 A;  1F4A A;  2A6Y A;  3W21 A;  1DGL A;  4UW3 A;  4C1X A;  4ES8 A;  3ZYG A;  3BOD A;  2AEY A;  3O0X A;  3WD5 A;  4BQX A;  1DZR A;  4CE8 A;  3K2O A;  5EPA A;  5I8T A;  3VZM A;  2OW4 A;  1DF0 A;  4OHY A;  2HEY F;  4P9G A;  2H0B A;  2Y6H A;  3AKR A;  5FZ1 A;  2JX9 A;  4LIV A;  2OKX A;  2ARX A;  1H30 A;  2RR1 1;  4A7K A;  3AMN A;  4DIQ A;  4ASK A;  1NXM A;  1BVP 1;  1OQ1 A;  4HKL A;  4IV1 B;  4XF3 A;  2XPJ A;  5KXB A;  1PM4 A;  4N53 B;  3CDZ B;  2WWJ A;  3NNL A;  1ZZ7 A;  3WNP A;  4QHO A;  2XHK A;  1TEI A;  4PI0 A;  4QQL A;  2VD7 A;  4CU8 A;  1LAJ A;  3KV6 A;  4YM1 A;  1YUD A;  1J83 A;  4CEY B;  5BNP C;  3AK0 A;  4FI9 A;  2PHF A;  1AR7 2;  1W2A X;  1AJK A;  1RHI 2;  4MXW A;  3LPG A;  2ZEY A;  3W5M A;  1FMD 1;  1QKQ A;  3AKQ A;  3I59 B;  3ZXA C;  5E16 A;  2ZX0 A;  4A4A A;  2L9L A;  2Y64 A;  2VVF A;  5BNN A;  2CGP A;  4HN1 A;  3GNE A;  4FPK A;  2VZQ A;  5AFE A;  4L0P A;  2VO5 A;  1CAV A;  3TBD A;  5I0D A;  1KIT A;  4Q27 A;  4E9K A;  1QQP 3;  4RR3 C;  4X6R B;  4Q4X 1;  3BCW A;  3ABZ A;  5A6Y A;  1NT0 A;  5C3S A;  1O3S A;  3J8F 1;  2ZTN A;  3KB5 A;  1CON A;  4L97 A;  4DXR A;  1JU4 A;  1H1M A;  1YCI A;  2W46 A;  1HQW A;  2R16 A;  4N43 A;  4FTB A;  3EJK A;  3I49 A;  4QM9 A;  1KJL A;  2Q1Z B;  4WVM A;  4YLZ A;  5FZL A;  3VBU C;  5AVP A;  3MLL A;  5M0T A;  3MPB A;  4IEU A;  1A6C A;  1HXS 2;  4W6W A;  2R06 3;  5ABJ C;  4XTM A;  2D44 A;  3OG2 A;  2VTF A;  4R9C A;  5JXI A;  4IXL A;  3KZ4 C;  2FDF A;  4YNI A;  5LAS A;  4RGA A;  4Y33 A;  5H9P A;  2TEP A;  2XUM A;  2YBP A;  4LE4 A;  4XC9 A;  1RXF A;  1R64 A;  3LWC A;  3POW A;  5JIU A;  1OUS A;  1Q8P A;  2HWD 1;  1W6Q A;  5FYS A;  1NA1 C;  2VZV A;  4YM0 A;  2VBB A;  5L9B A;  2OPK A;  2VPV A;  4ASM B;  4GAL A;  1LOB A;  2BRT A;  2BVV A;  2V4V A;  4QPI B;  5BXX A;  3RWN A;  3VGI A;  4UW6 A;  2CL2 A;  3WX5 A;  2ZS6 B;  5FRE A;  1BLZ A;  1H4H A;  3H7Y A;  4W6X A;  3WDY A;  1HIX A;  3I2F A;  1Z78 A;  5J96 B;  3T4H B;  1XNB A;  1YXW A;  2XML A;  2Z5W A;  2PHU A;  4NWW A;  2Q0A A;  4QX5 A;  5DQ0 A;  4EQV A;  4PIX A;  4AE2 A;  1SLA A;  1AX1 A;  3UL2 A;  4LLF A;  2SBA A;  4HK8 A;  5T3N A;  4XFB A;  2P34 A;  2RV9 A;  4LO7 A;  2A3X A;  1HW5 A;  4HZF A;  3DYP A;  4MUV A;  3W59 A;  1QNY A;  3GZE A;  1QOS A;  5FAX A;  4Q4Y 1;  3GCW A;  4BH9 A;  4D7T A;  1RUN A;  5JOW A;  4CDX C;  1X33 A;  4TYS A;  1S0B A;  4OQ8 A;  1OPM A;  2VCB A;  2ZGP A;  5GLZ A;  1OT5 A;  3UK9 A;  2CAU A;  1GR3 A;  3NJZ A;  1OA4 A;  1HRV 1;  3KV5 A;  3D3A A;  4KL1 A;  4RGK A;  3M1H A;  1RUJ 2;  5FMO S;  2R07 2;  4RFT 0;  1EV1 1;  1H2N A;  1CX1 A;  1J1T A;  2BU9 A;  4A3X A;  4GQ7 A;  5K9Y A;  3ROU A;  2WQ4 A;  1GV9 A;  4H7M A;  1LHV A;  4FPO B;  4H7L A;  4AEK A;  2HYX A;  1WBF A;  2WFF 3;  2WNO A;  3N9L A;  1ZBE 1;  1ZNP A;  3ZFE A;  4NHM A;  3RZH A;  1RIN A;  2RDR A;  4B3N A;  3TEW A;  5A7W A;  1QDO A;  4LOS A;  5IK4 A;  2VCM A;  1VRH 2;  1XPW A;  2BDR A;  2ATF A;  3MIF A;  1IS3 A;  3OOX A;  1AR7 3;  1CAW B;  1LOG A;  2HEW F;  2E63 A;  4NHL A;  1RHI 3;  2ARB A;  3N35 A;  4EJR A;  2E31 A;  2WO3 A;  3LEK A;  1OOP C;  5DXD A;  3ZN6 B;  5FYB A;  3TRS B;  1I5P A;  2XQX A;  3CF6 E;  1KDK A;  2YU2 A;  5FPZ A;  2R32 A;  4GJY A;  3T0B A;  2PEL A;  4XHX A;  4NIA A;  5A3M A;  3MIE A;  1OKO A;  5B4X A;  3F95 A;  5H9Q A;  2Y6G A;  5JZG B;  1Z7S 1;  2WZR 2;  5CAD A;  5JMO A;  3V0A B;  1K45 A;  4BIS A;  5C71 A;  2YMZ A;  4NIG A;  3D5O A;  5CYY A;  4CXX A;  2OUH A;  1ZA7 A;  2P2K A;  1UY0 A;  2WQ8 A;  1ZA4 A;  4HSL A;  2PQQ A;  1SDW A;  1PO1 2;  4P9X A;  2J22 A;  3TEX A;  3OY8 B;  4RR3 A;  1F8V A;  2OPW A;  4QQO A;  4AF9 A;  1RMU 1;  1AXZ A;  2XBO 2;  2C9A A;  3MHZ A;  4URT A;  5DZF A;  4LBQ A;  2BYV E;  4UFI A;  4CDU B;  2Y6F A;  1PGS A;  1IS5 A;  2EAA A;  2WL1 A;  4HAN A;  4LOR A;  4TXW A;  1R09 1;  4MOA A;  1BBT 2;  3T08 A;  4AI3 A;  1HXS 3;  5AC9 2;  1UOB A;  3VBU A;  1QJX 3;  4K9S A;  5A3U A;  5BUV A;  3WHU A;  4EYU A;  2E6V A;  3VKL A;  2PHT A;  4HVO A;  5F2W A;  3VZJ A;  2XQR A;  4FPL A;  3PIJ A;  4L2N A;  5ABJ A;  4CCL A;  1RUD 2;  1FT9 A;  1UU5 A;  5BV6 A;  1AX2 A;  4KWU A;  2UY8 A;  4COV A;  3KT1 A;  4NR1 A;  2C0Z A;  2MPF A;  3B3Q E;  3WY6 A;  3CQO A;  1PVC 1;  5EP9 A;  3IMN A;  1NA1 A;  1UXX X;  3QH7 A;  1DQ5 A;  2B45 X;  1KFX L;  4Z07 A;  2XVL A;  2ZKL A;  1RUG 2;  2VBP A;  3AXE A;  3VBS B;  4CU6 A;  2WNU B;  4L11 A;  2CYF A;  2QJV A;  4QQH A;  3ACG A;  2I2S A;  3IAQ A;  4Q4W 3;  5DZG A;  4FAG A;  1JI6 A;  5A7Q A;  2Y34 A;  1GMM A;  2OA2 A;  1R08 2;  2YXS A;  4P9I A;  1A3K A;  3AJZ A;  4IND A;  3ZDV A;  1GSL A;  4AVA A;  1Q5O A;  3BN6 A;  3I97 A;  4QXK A;  3AP6 A;  3B9I A;  2B46 X;  4A2U A;  4DY3 A;  1VAK A;  4XBQ A;  1WWY A;  5DAV A;  1R1A 1;  2Y0I A;  3N9O A;  4D6R A;  2X09 A;  2C24 A;  3VD9 A;  3NNG A;  4CDX A;  1OXC A;  1QEX A;  2JEM A;  3IAP A;  3S7I A;  1ENR A;  2YFZ A;  4COW A;  4OYU A;  2E33 A;  1ULO A;  2DCY A;  2XH6 A;  3AJY A;  1VE0 A;  4K7J A;  1G9F A;  3AYC A;  4JC1 A;  4CUB A;  1BQP A;  3WF1 A;  1O4Z A;  4LBK A;  4QX8 A;  4JKL A;  2YY1 A;  4QU1 A;  2R04 2;  2DCK A;  1CAU B;  1IKQ A;  5F37 A;  2ZAC A;  3CBN A;  1OH4 A;  5EQU A;  5HCB A;  5J37 A;  2HLE A;  2ZGQ A;  3BOW A;  1XU1 A;  4FP2 A;  3DV8 A;  3RMY A;  3MEP A;  2BNO A;  1VBA 2;  3H1M A;  4HL0 A;  3MYX A;  5K7P A;  4BJ0 A;  4UBG A;  4AI0 A;  4LBM A;  4XJW A;  3PTY A;  3BIE A;  1OOP A;  1UYP A;  1ZZ6 A;  4OI2 A;  1JMU B;  1BKZ A;  2JG9 C;  3BAL A;  3PLQ A;  4QMA A;  3VBO C;  5A1A A;  1N1T A;  4KQ7 A;  1YEW A;  4FOQ A;  1VMJ A;  3M2M A;  4MET A;  4XJU A;  1QJU 2;  4DRR A;  1DQ1 A;  2RMU 3;  4I3G A;  1JYC A;  4N53 C;  5FXV A;  3GJB A;  3IT8 A;  2CHH A;  4UF0 A;  4KMQ A;  1H2M A;  3O1S A;  4E8C A;  1V9U 3;  1B35 C;  2PFW A;  1PO1 3;  4XCA A;  3O7O A;  3U1X A;  1WMF A;  1NY7 2;  3KV9 A;  3BGA A;  2GME A;  3T4V A;  1LB2 A;  2QQU A;  4CEY C;  1ZBA 3;  2XBO 3;  4MXW B;  4BIO A;  4XFA A;  1IZ3 A;  4EZ4 A;  3PNA A;  2BOJ A;  5A3O A;  3S6P A;  3EMR A;  4AGV A;  4MVT A;  2IXL A;  2DFB A;  1JOP A;  5A32 A;  1XRU A;  1CQ9 A;  1JOB A;  5FXZ A;  4GD4 A;  5BNN B;  1W8W A;  1JZ3 A;  5JOX A;  2DVG A;  4G4F A;  5FPX A;  1MPX A;  1AJO A;  2WYF A;  3URF A;  1CAV B;  2VNO A;  2O8O A;  4I09 A;  4AVB A;  1ULG A;  2EIE A;  1WUV A;  5K4L A;  1FAT A;  4S2H A;  3H8O A;  1W06 A;  3TN9 2;  1NQJ A;  5APA A;  2BW8 A;  2EIG A;  3POS A;  1LKN A;  4ITC A;  1W8U A;  4M3C F;  3O5S A;  3MV0 1;  5DDJ 1;  3I3E A;  5LBE A;  4SBV A;  2QQK A;  3NWK A;  1GBG A;  4GMP 3;  3RZZ A;  1SDD B;  2VUD A;  4BCU A;  5DUU A;  2CGO A;  1UXZ A;  1DDL A;  1VBB 2;  5FO8 B;  4CEW C;  1HB2 A;  3NV4 A;  1SQ4 A;  4KGQ A;  3AP5 A;  4HON A;  5L9V A;  1LRH A;  4IE5 A;  3SH3 A;  3RZM A;  2ID4 A;  3OSD A;  5FXX A;  4RL7 A;  3J7M A;  1AR6 3;  3ILR A;  1LGC A;  2XR4 A;  4FFG A;  4IEW A;  1VBC 1;  4Q5O A;  2Q8D A;  1V6O A;  3AKP A;  3Q8E A;  5FZ6 A;  3AP4 A;  4XOG A;  3CZJ A;  4V2V A;  1W8F A;  1YJK A;  3M4F A;  4AVS A;  3O1P A;  4B7E A;  1N3P A;  1JBC A;  2AR6 A;  2GH2 A;  4G3Y C;  1VBE 1;  2D5H A;  4JQT A;  2DVF A;  4ZPI A;  2RS5 1;  3AFG A;  3L2H A;  5FY0 A;  3MIH A;  2ZOE B;  1X9T A;  3ZSE A;  5IVF A;  1AXK A;  3CJI C;  2BGP A;  3POJ A;  1QXR A;  4LEJ A;  2I74 A;  5C8C C;  2VMG A;  4NHK A;  2DTW A;  1V70 A;  5D8A A;  5FLJ A;  3WG3 A;  4OUL A;  1J3R A;  3JU9 A;  4IEZ A;  1RUF 3;  4DIN B;  3KF3 A;  4Q0P A;  4XFG A;  3INA A;  5K0U C;  1I3H A;  3KLS A;  5GZD A;  3JUU A;  1JHN A;  1DGW X;  4W4Z A;  3UKV A;  2R04 3;  3OUI A;  1JZ4 A;  1WCD J;  4AED A;  2D98 A;  4I01 A;  4XQD A;  3WW3 A;  4NJ4 A;  4XDP A;  1UMI A;  1FPN 3;  3FBM A;  4XEZ A;  4Q8K A;  1F31 A;  4RHV 2;  1HKD A;  1VBA 3;  3EXU A;  4BK5 A;  2BTV C;  2EIC A;  4XBL A;  1REE A;  4JZR A;  4A41 A;  1DYK A;  5A7O A;  5FJH A;  4FTE A;  2F6B A;  2XXZ A;  1GP6 A;  2XJU A;  2IXJ A;  2JD4 A;  3D6E A;  4X8N A;  5KHG A;  2QQM A;  5H9R A;  1AR9 1;  4GH4 C;  4Y1U A;  1HQL A;  2OZJ A;  4LQR A;  3ZN4 A;  4AGR A;  4E4Z A;  2JKX A;  4BQ3 A;  2JG9 A;  1B09 A;  3W5N A;  4JVA A;  3BU0 A;  5EIY B;  4JGZ C;  1GIC A;  1LEC A;  5FFO C;  5A7W B;  4BQY A;  1UX7 A;  2W3J A;  4C90 A;  2VGD A;  1SFP A;  5HCA A;  1GZT A;  1VR3 A;  4N53 A;  4PLM A;  3MBW A;  3OD0 A;  2WNE A;  4CYD A;  4AFM A;  2A71 A;  1B35 A;  2EAL A;  3R4D B;  5BNP B;  3CMG A;  3H3U A;  1ALY A;  4K40 A;  5JR2 A;  2W0X A;  4CEY A;  4PBO A;  3OPW A;  4YGB A;  2P37 A;  5CKN A;  2VZU A;  2KD7 A;  4JDN A;  2A73 B;  5CFD C;  3UNP A;  5EXO A;  5JZG C;  1WMD A;  3I59 A;  2NP0 A;  2VU9 A;  5GLT A;  4AGG A;  1UYX A;  4BLJ A;  1MZE A;  5JAX A;  2C4X A;  3TN9 3;  2E9Q A;  1HX6 A;  2R1D A;  2QQW A;  5C33 A;  1JZ7 A;  4R9B A;  5EWS A;  4RR3 B;  2BGC A;  3ME2 A;  3WP5 A;  4BXS V;  4LBQ B;  4V1P A;  2D40 A;  2HWB 2;  1CD3 G;  1TQ5 A;  3D82 A;  1GAN A;  1VBB 3;  1QJY 2;  4MGK E;  4D69 A;  3JD7 2;  4M3C E;  3LKJ A;  3VBU B;  1UX6 A;  1Y43 B;  1VLN A;  4KI5 M;  4FCA A;  2Z4F A;  5JOY A;  1QXJ A;  2GN7 A;  3CU7 A;  4NVP A;  2OX0 A;  5GLU A;  4CEW A;  5ABJ B;  3LZZ A;  1TMF 3;  3JB4 C;  1E5R A;  1PHM A;  3D0J A;  3POB A;  1G86 A;  4P9Y A;  4AI1 A;  3AFK A;  3MDP A;  4AHY A;  2Q1F A;  3CLP A;  3AKT A;  2ZBJ A;  3PHM A;  5A6Z A;  1DLL A;  1NA1 B;  1PO2 2;  4QAW A;  4QB6 A;  4MG2 A;  1UZW A;  3T2Q A;  3HQX A;  4AFD A;  1ND3 C;  2OXB A;  3NST A;  4LA3 A;  5LRR A;  3T3Y A;  1OLM E;  1MS3 A;  1UZZ A;  2RS1 1;  2B8M A;  3DXU A;  2ERF A;  3USU B;  4NO4 A;  1ULD A;  1DGW A;  2K46 A;  2WS9 3;  3AYE A;  4TTG A;  1F2N A;  2YYO A;  2V4A A;  1XC6 A;  1D4M 2;  3CJI A;  4GZ9 A;  2H0V A;  1US2 A;  1AYM 1;  4XQW A;  5C8C A;  3D4K A;  3M70 A;  3ZXE A;  3LFM A;  4NHY A;  2JDN A;  1ST8 A;  2HWE 2;  4YG3 A;  5CEH A;  1UY2 A;  5K0U A;  3GBG A;  4FQ4 A;  3BYW A;  1ASJ 1;  1LTE A;  2DU0 A;  4AG4 A;  2RS3 2;  4BDV B;  4O9E A;  3M3E A;  3OTF A;  1BEV 1;  1UD1 A;  1OBN A;  2OZ6 A;  4HKW A;  2IXC A;  1JZ2 A;  3PME A;  4CDX B;  3WQ0 A;  4K8F A;  3A0N A;  5IFT A;  4DXS A;  2PA7 A;  4CRQ A;  2O8Q A;  4LK6 A;  4MLO A;  2PAM A;  2ORZ A;  2XWB B;  4XXA A;  3ZXL A;  4DO0 A;  3AB0 A;  3BOP A;  3KT4 A;  3OJB A;  4BME A;  3MFA A;  1C28 A;  1UKR A;  3NJY A;  3ORJ A;  4LR4 A;  1ODN A;  1CN1 A;  4Q4V 3;  2A7A A;  3K51 A;  4E2G A;  4GJZ A;  1RUE 2;  2GH8 A;  3DEM A;  4GH4 A;  4XCB A;  4MGS A;  1XND A;  3M3Q A;  1AZD A;  1YHF A;  2PLV 3;  3MW2 A;  1XU2 A;  1XE7 A;  4BQW A;  5FP9 A;  3EO6 A;  1OD5 A;  3LOB A;  1GFF 2;  4LHL A;  3AXD A;  2Q4S A;  1W90 A;  3JBG 2;  3KD4 A;  1M4W A;  4JGZ A;  4RQP C;  3K48 A;  5J09 A;  1GZ9 A;  2NM1 A;  1XSR A;  3OD4 A;  3IWZ A;  3ZXJ A;  1JZ8 A;  1HB1 A;  2J1S A;  1W6M A;  4H55 A;  3MPP G;  3W20 A;  4R52 A;  4ZXK A;  2IVJ A;  1GZW A;  2DF7 A;  1OOP B;  4COZ A;  3AVS A;  3LGR A;  2WAA A;  3WDT A;  2ET7 A;  5DUX A;  4DZG A;  3M7A A;  5DZE A;  1VBD 1;  4KWJ A;  3KVB A;  2G19 A;  3THD A;  1Y4W A;  5FY9 A;  3ATG A;  1RYY A;  3KWV A;  5CFD A;  4UF0 B;  5JZG A;  1DQ2 A;  3C7G A;  2ZZQ A;  3EHK A;  1RUH 3;  2VOT A;  2VR4 A;  2Z42 A;  2J1R A;  2DVA A;  4MV2 A;  3N7J A;  3G7D A;  3VDC A;  3GM8 A;  1CJP A;  2ZMK A;  4ZZ8 A;  2MNG A;  2YPD A;  3ZYJ B;  1AXY A;  2HWB 3;  2RM2 2;  5A32 B;  1MVQ A;  4XTP A;  5CU1 A;  3RJR A;  3V64 A;  2JDA A;  4Z92 B;  3EQE A;  3DN7 A;  2O14 A;  5EJZ B;  5A7P A;  2ZCW A;  3A7Q A;  2VC9 A;  5F3E A;  2BV4 A;  1BHG A;  1FNZ A;  2DCZ A;  4O65 A;  1F5J A;  2OS2 A;  5FP3 A;  1W0O A;  1COV 2;  3B00 A;  3I2H A;  4LBN A;  4XFI A;  3WQ7 A;  2ZAH A;  5DUW A;  2EAK A;  3MW3 A;  5DUV A;  4DMI A;  1QJE A;  3A0K A;  1XQN A;  2D3P A;  3N7M A;  1XYN A;  1BK0 A;  1Z0H A;  1K42 A;  4C8D A;  4H3W A;  3VHO A;  3LCP A;  3HBZ A;  2J1V A;  2Y38 A;  5A33 A;  3R0R A;  4UFL A;  1QQP 2;  4UFM A;  3QAC A;  5FCC A;  3ZYR A;  3VHP A;  1H1I A;  1VRB A;  3VHR A;  3IDA A;  2HBU A;  3WNN A;  1XNK A;  1LOF C;  2VQA A;  3MUY 1;  3UYJ A;  2VNV A;  3ACI A;  3SLI A;  1XE8 A;  1HRI 1;  4ORF A;  1WW5 A;  2VTX A;  1SFN A;  3AKS A;  4B8E A;  4ET7 A;  5LA0 A;  2D6M A;  4L9B A;  1C8M 1;  1MZ6 A;  1UOJ A;  3PU8 A;  3TNP B;  5GJ6 A;  4CP9 B;  3KQ4 B;  1C1L A;  4AEM A;  4YGD A;  3J4U H;  4C0B A;  3PIG A;  3NAP C;  5A3P A;  2EXK A;  4PI2 A;  4Y5S A;  4D8M A;  5IVV A;  2EXJ A;  1FMD 2;  3MGU A;  4MGQ A;  3HEI A;  2RS3 3;  2K0G A;  5IJR A;  1AF9 A;  3CEW A;  1DQ0 A;  3DXT A;  2YUE A;  2QQJ A;  1QJF A;  1S2K A;  4RN5 A;  1UOG A;  2VH9 A;  3U75 A;  1G9D A;  3JCI A;  2UWC A;  4GIQ A;  4Q4X 2;  4P02 B;  4CZS A;  3IMM A;  1HB3 A;  1OMI A;  4MHR A;  5F1R A;  4E27 A;  3F2Z A;  1FOD 1;  1GOH A;  1WA6 X;  2B9V A;  4P9L A;  4A45 A;  4AK3 A;  1C1F A;  5IK8 A;  1CVN A;  1ZRE A;  3P3P A;  3AMH A;  4YFZ A;  2BNN A;  2PYT A;  3PJQ A;  4BB3 A;  2E26 A;  3VZK A;  1V6I A;  4XDQ A;  1RUE 3;  3NV1 A;  4MGY E;  4ARY A;  1AYN 3;  1W6O B;  2VZ1 A;  3AZX A;  2DBI A;  1MVE A;  3HR9 A;  5FP8 A;  3AZW A;  5KBF A;  3OB8 A;  5FZD A;  2F4L A;  4Q0U A;  4RD7 A;  3LFI A;  2J1T A;  2JEN A;  4CU9 A;  1PVX A;  1O3T A;  1OC1 A;  3WQB A;  1BMV 2;  5DN2 A;  4PLN A;  1BZW A;  1CAU A;  5JMC A;  4RQP A;  2RJ2 A;  3HQR A;  2A6Z A;  3MUZ 1;  5T5O A;  3SKV A;  3D0S A;  1RUC 3;  1YIP A;  2LTN A;  2VZS A;  4LLO A;  5T55 A;  3TEY A;  4IGQ A;  4WVZ A;  4NN0 A;  1TME 3;  2JG9 B;  2ZPX A;  3I2I A;  4H2A A;  1ZZ9 A;  2W68 A;  1DLC A;  2KM2 A;  3E6B A;  3GZT B;  3VBO B;  5CNA A;  2VUL A;  3ZXK A;  1YLL A;  1JUH A;  3NO8 A;  5FXW A;  3H1Y A;  2WFF 2;  3N36 A;  1H2L A;  5FTT C;  3C7O A;  3USS A;  3WG4 A;  4B1M A;  1JOD A;  2ZML A;  4UXA A;  5FK7 A;  5JI9 A;  2UWB A;  1B35 B;  4A42 A;  1DFQ A;  5IAV A;  4NRQ A;  4NRO A;  3POI A;  4E4H A;  2RM2 3;  5FR3 A;  3VKN A;  2FD8 A;  2CSG A;  1SLB A;  2Y33 A;  3LIG A;  5KHH A;  1UMH A;  4BOW A;  3APB A;  4NII A;  2RHP A;  4QB1 A;  1WGP A;  5FZM A;  3KMH A;  3TEZ A;  5AVA A;  3N7K A;  4GWM A;  1COV 3;  2YC4 A;  3H0O A;  4FOW A;  4YZ2 A;  5LWB A;  4JRA A;  2QDR A;  4QB2 A;  5FBZ A;  2W1U A;  3AL5 A;  2WC2 A;  3JB8 A;  1I6X A;  2XJT A;  4BIF A;  2WUH A;  2J1E A;  4EWE A;  3ZXG A;  3O1T A;  3GXU A;  4CCJ A;  4TLG A;  4COU A;  5CBL A;  1GQG A;  1GWM A;  1Q8O A;  4E8D A;  3SKJ E;  2CV6 A;  1O6U A;  3FLP A;  4EV0 A;  3SXW A;  3LEG A;  2IVI B;  4ZY9 A;  4L99 A;  4UOJ A;  1LOF A;  5D21 A;  3VBF C;  4LJH A;  5FYY A;  2Q8O A;  1V6J A;  3ZSK A;  1ACC A;  4CEW B;  5KXC A;  4Y1X A;  5C3R A;  5FYI A;  4QPW A;  1WKY A;  4AZZ A;  3SHR A;  4GWN A;  5T52 A;  3BTX A;  1QJX 2;  4A7Z A;  5CG8 A;  1RIT A;  2WYS A;  4M01 A;  3P5B A;  1ZRC A;  2DCT A;  1SLT A;  3ACF A;  3I8T A;  1FMD 3;  1C3H A;  3BPS A;  4XAA A;  4Q2F A;  4WZC A;  1YQ2 A;  2GAU A;  3E5X A;  4QPY A;  3RVH A;  2MEV 1;  5FYH A;  4OUM A;  5C7G A;  1DQ4 A;  1ZX5 A;  3ZR5 A;  1Q43 A;  1RXG A;  1YQ8 A;  3K75 B;  3UKN A;  1QGL A;  2BWA A;  5JXG A;  1ZRD A;  2YFU A;  1J1L A;  1PIV 2;  1UW8 A;  3UT0 A;  4QGN A;  2DFC A;  2YBS A;  1R1Z A;  4Q4X 3;  1W05 A;  2Q5T A;  2N7G A;  4GB3 2;  1O4Y A;  1Y9Q A;  2EVX A;  3CJI B;  1OF4 A;  2JG8 C;  1GQH A;  1NOV A;  2NN8 A;  5C8C B;  2QQV A;  3SEP A;  1CPM A;  4Q4W 2;  3ECQ A;  4BQ1 A;  1FAY A;  3PUR A;  5DG1 A;  4LO4 B;  4I0B A;  3U07 A;  5FY8 A;  5IVJ A;  1U5Y A;  2HH9 A;  2VW1 A;  3H8U A;  1W2N A;  5J3U A;  5K0U B;  2PHW A;  3AC0 A;  4IW3 A;  4AVT A;  1Q8S A;  3PVB B;  4LE3 A;  5FPV A;  4CXY A;  4DXT A;  4K1Y A;  1ZM1 A;  3NJV A;  5I0T A;  3SC7 X;  1YJL A;  4LBL A;  4Y26 A;  3FHA A;  3OGJ A;  5GZF A;  4BE3 A;  2D3S A;  2HWD 3;  4LBQ D;  1WW4 A;  1CWP A;  3WF4 A;  2LUW A;  3B9C A;  1CPN A;  4UFK A;  1FXZ A;  4X6Q B;  4AVC A;  3FJS A;  3MV1 1;  1ND2 C;  1UCX A;  1W2T A;  2QQO A;  4QXB A;  4SLI A;  2JDU A;  4GH4 B;  4Q29 A;  3RMX A;  1AR7 1;  1W3V A;  3DEC A;  3I2D A;  5T5P A;  4D0Q A;  4LOT A;  1ENQ A;  3J9S A;  2Q8C A;  4BA6 A;  1G9A A;  1DGR N;  1PNG A;  1W8H A;  1CZV A;  3PVE A;  4JGZ B;  4M0H A;  2G9Z A;  2LS6 A;  4YVS C;  3RG0 A;  2V5Y A;  3B7M A;  3QLQ A;  5JSP A;  2DBN A;  1W6M B;  4NRP A;  5IWF A;  1O5U A;  4D7S A;  1OH3 A;  3BTA A;  4G9S B;  1O8P A;  1GZW B;  4M4R A;  4JAA A;  4EWA A;  4P5Y A;  4XJA A;  4XYX A;  2P3Y A;  4PQQ A;  5LZ6 A;  3AM2 A;  1VB4 A;  3WW1 A;  5BNP A;  3HJR A;  5GLV A;  2A1X A;  4Q4Y 3;  2ARA A;  4QKF A;  1G8W A;  2W94 A;  4FT8 A;  2VZO A;  4AEJ A;  5CFD B;  3FMG A;  5J1X A;  2JJ6 A;  5AC9 1;  3OUJ A;  5ACA 1;  5C9A C;  2VUA A;  3OBT A;  2YBK A;  1WW7 A;  3IDE A;  3DKW A;  4Y1Z A;  3WDU A;  5CAZ A;  5L7O C;  2B7Y A;  1XYO A;  2RMU 2;  1HRV 3;  3O0V A;  4LKE A;  3WDW A;  5CKQ A;  3B5L B;  4LBJ A;  5KR7 A;  1V9U 2;  3R4S A;  5F39 A;  5J98 B;  1TVG A;  2DYC A;  1HXS 1;  5FMC A;  3VL9 A;  1LNS A;  2WNV C;  1ZBA 2;  2XVK A;  3RFR A;  4PLO A;  3IDC B;  3MIC A;  3ZSL A;  3MLJ A;  1YFU A;  2P3J A;  1W8N A;  3PU3 A;  3ZO0 B;  5L19 A;  3BPZ A;  5IVB A;  1E5H A;  3RI8 A;  1CX4 A;  2LAL A;  3VBF A;  3IM0 A;  3WF2 A;  2LM3 A;  3ELN A;  5IAX A;  2K9Z A;  1LGB A;  2JXA A;  5A33 B;  1FNY A;  2HEV F;  3IB3 A;  5ISL A;  2E32 A;  4HSJ A;  3J7N A;  4XUT A;  5E88 A;  3OBA A;  3PMS A;  4CDW C;  2QZ3 A;  1IS4 A;  2DUQ A;  2ZZJ A;  2EID A;  2X05 A;  2NYY A;  2YGL A;  4PDW C;  5GAL A;  5JUV A;  1NAE A;  3UJO A;  1ND3 B;  1PIV 3;  5EFU A;  4Y5Z 0;  2HJI A;  2VEC A;  5CFC C;  3LDR A;  1YRZ A;  1AUY A;  2RE9 A;  1JYV A;  2D6N A;  4IEQ A;  5F8P A;  4GB3 3;  4FO9 A;  2JEC A;  2Z69 A;  3USU A;  1DBN A;  2XB6 C;  5FDB A;  1RMU 3;  2RDN A;  3ZKU A;  3U11 A;  2GP5 A;  3HWJ A;  3NVC A;  1LU1 A;  5CVR A;  2BWC A;  2JG8 A;  5IVY A;  1QWR A;  3N9P A;  1GNZ A;  1UYZ A;  1JXN A;  4I02 A;  1AR6 2;  1R09 3;  1OUX A;  1W9F A;  4QGL A;  2G9F A;  1UOF A;  4IEX A;  1YYN A;  1QOO A;  2DWR A;  1CZT A;  1RUJ 1;  1NUK A;  3WEZ A;  2R07 1;  5FO7 B;  3POE A;  3RDI A;  3HMY A;  1NE4 A;  5IUQ A;  4ZU7 A;  4PQ9 A;  4XHB A;  5IHR A;  4XUP A;  4AVV A;  3B93 A;  1HN1 A;  3ASI A;  4IEP A;  4IV3 C;  3H8R A;  1PVC 3;  3NMB A;  2D43 A;  2X8K A;  3T2T A;  4E4D X;  4BLI A;  3H7J A;  1J84 A;  1VRH 1;  1LGN A;  1TNR A;  2D97 A;  3ILN A;  4IUG A;  3GGL A;  1RUF 2;  4X8P A;  1PGL 1;  5FIX A;  4AI9 A;  2AEN A;  1OF3 A;  1SBD A;  1SEF A;  1W03 A;  4NUB A;  5I0R A;  3T30 A;  1XBF A;  4S2G A;  2ZX3 A;  4AHX A;  1I1E A;  1XOY A;  1LES A;  1PZ8 A;  3AZY A;  1PMJ X;  3BVC A;  4IES A;  4JTN A;  1YFW A;  1NG0 A;  2BFU L;  3PVN A;  3FE5 A;  3WVJ A;  4RQP B;  1FPN 2;  3WNX A;  2W1Q A;  4QPG C;  1VP6 A;  2WZR 1;  4XJ9 A;  4YVS A;  1CZS A;  5FUI A;  4C1W A;  1JZ5 A;  4QKN A;  3EYP A;  3ZPY A;  2BEO A;  3S0M A;  4MHU A;  5JIA A;  2QKD A;  3HNM A;  2JE9 A;  1H9W A;  3LEM A;  4TWT A;  4KG8 A;  3VDB A;  1O3Q A;  1PO1 1;  4BMB A;  4AI2 A;  5I8S A;  1ZRF A;  4XZU G;  1W8Z A;  4XIK A;  2RS5 2;  1NCQ C;  4CSW A;  5HCF A;  1BCX A;  1S1A A;  1XSQ A;  4NPM A;  3VL8 A;  4EN9 B;  1WMX A;  3UET A;  3KCX A;  4OFG A;  1RVF 1;  3T1L A;  2ZAA A;  4XF0 A;  5LA9 A;  1ONA A;  3UV9 A;  2VG9 A;  1XNT A;  5L7O A;  4KBB A;  1NXD 1;  4QKB A;  3VHN A;  1IQA A;  1BBT 1;  1E57 A;  1JHJ A;  1XXN A;  4GKX A;  2JIC A;  4PBP A;  5GM0 A;  1H2K A;  3TOJ A;  2IXI A;  4R9D A;  1P8J A;  5GZE A;  1PM7 A;  2VZP A;  1RUD 1;  2WNV A;  1J3Q A;  4FVV A;  5LEJ A;  4IEV A;  3C2U A;  4LXL A;  4HFS A;  1W28 A;  3KSC A;  2ZXQ A;  3QCW A;  2JKB A;  4KG0 A;  2G9G A;  1RIR A;  3HPN A;  3N9M A;  4NMI A;  4RA0 A;  5FWJ A;  5JVV A;  2ZJC A;  1S4C A;  2R1B A;  1FYU A;  4MSV A;  4UAP A;  3S7E A;  1RUG 1;  2CGN A;  1BVV A;  5A1L A;  2ARC A;  3NNM A;  4W6Y A;  1GOG A;  2VNG A;  2XWJ B;  2NLR A;  4MZU A;  1A8M A;  2A75 A;  1RUI 1;  1MEC 1;  2JD9 A;  5FPB A;  1R08 1;  1OLQ A;  4HKO A;  1MS4 A;  1IPJ A;  2VNR A;  5FY7 A;  4P9J A;  4ATF A;  1LED A;  1Y7B A;  4B7K A;  3BUC A;  2ZX2 A;  4CCD A;  4XBN A;  4AL9 A;  4C0H A;  3MID A;  1N47 A;  4F7Z A;  1APN A;  5JPM B;  1UWW A;  5CFC A;  1SCS A;  4JKM A;  1JOJ A;  4WZF A;  5A70 A;  2VMI A;  2CDP A;  4DEV A;  5F5C A;  4HLT A;  3VD5 A;  2Z2S B;  3N9Q A;  2P3I A;  1JUI A;  3LPF A;  3CKH A;  2W08 A;  3SQO A;  5LY1 A;  1TMF 2;  2LRP A;  3NAP B;  2WIN B;  4IGP A;  4CP9 A;  1F35 A;  2R30 A;  3DUI A;  2V72 A;  1S0J A;  4GXL A;  1FV3 A;  3O14 A;  1SHW B;  3OPZ A;  2TNF A;  2QQI A;  3LD8 A;  1O59 A;  4ES9 A;  2WJS A;  2PAE A;  2E7A A;  1DQ6 A;  3GJA A;  1S0F A;  1POV 3;  4Y22 A;  3KT7 A;  4XVH A;  4RGG A;  1EY2 A;  1DZT A;  2H6B A;  5DDJ 3;  2EA7 A;  2VMF A;  1X7N A;  3DYO A;  2YGM A;  1OQE A;  4ARX A;  2WS9 2;  2RJL A;  4BM8 A;  3OEA A;  3P3N A;  4IV3 A;  3U14 A;  4NE9 A;  4N9I A;  5LCW L;  1JH5 A;  4CUA A;  4N8M A;  1VBA 1;  5C70 A;  3PUQ A;  2VY0 A;  2G1M A;  4NOT A;  3RS6 A;  4AWD A;  5D1I A;  3VKF C;  4FQZ A;  2GZW A;  3RZK A;  1WLD A;  2X53 S;  1W6O A;  4LHK A;  2W9X A;  4UT5 A;  5FYU A;  1RJ8 A;  1WCS A;  2WR9 A;  3JXS A;  3ZSJ A;  3WIN E;  1E5S A;  5JCT A;  2X5I C;  2VUC A;  2WLQ A;  1QJU 1;  4Q0V A;  3U10 A;  4NIH A;  3NV2 A;  4NRM A;  4QPG A;  4Q26 A;  4Q0S A;  2DCJ A;  5CA6 A;  3VBR C;  1DHK B;  3J26 N;  3WUC A;  3ES4 A;  2WZP P;  1GYK A;  1VBE 3;  1NY7 1;  2XJV A;  2YPJ A;  3NKG A;  4IDZ A;  3RNS A;  4MYE A;  2RS5 3;  3E97 A;  5C3O A;  4EE2 A;  1H8T C;  4W50 A;  1JYX A;  3KVA A;  5F6K A;  4Q4V 2;  5IVE A;  2JIG A;  3M3I A;  1NCQ A;  3VBO A;  2UY9 A;  1MZ5 A;  2XJQ A;  4EWD A;  2PLV 2;  2ZGU A;  4LHN A;  4FPF A;  3LDK A;  3KHC A;  1AYM 2;  1X8E A;  2WFP A;  1L7Q A;  1PGW 2;  2WZ8 A;  5E89 A;  5HXV A;  5C6C A;  2XJR A;  4KGG A;  5F32 A;  1AL2 1;  1O91 A;  2HWC 1;  1W9Y A;  2I07 B;  4K6B A;  3TN9 1;  1GKB A;  1OLR A;  1ULC A;  2XLG A;  1UKG A;  1GP5 A;  1PMH X;  1ULP A;  3DPR C;  3GBF A;  3DYM A;  1TNF A;  4QWN A;  2KA3 A;  2WT1 A;  2YC0 A;  4TN7 A;  4CXW A;  1QH7 A;  4FXK B;  3SIT A;  3ZN5 A;  3N4M A;  3KM5 A;  4JHT A;  1CR7 A;  3FZ3 A;  4Y4R A;  1VBB 1;  2HWF 1;  4UWD A;  3O12 A;  3S30 A;  1RUH 2;  1AR9 3;  5ERL A;  1AR8 2;  2ZHM A;  3OEB A;  1YI7 A;  2WAO A;  1LU2 A;  4B4Q A;  5IAT A;  1REF A;  4FPG A;  4GA9 A;  5AFB A;  1KFU L;  4K1Z A;  1IPS A;  2JIJ A;  2E7T A;  1ULE A;  5FZ7 A;  3FBY A;  3VBF B;  2CNA A;  2Y8K A;  3ZFG C;  1SMV A;  4I30 A;  2G4I A;  4U36 A;  3J7L A;  3HT2 A;  4QX7 A;  3GCX A;  3VDA A;  1CGP A;  3MIB A;  4L92 A;  2VMC A;  4JGY C;  3RQ0 A;  3KGL A;  2GC1 A;  2B39 A;  3HQU A;  1W6P A;  5LB6 A;  3UGF A;  1UIJ A;  1W9T A;  4Y1Y A;  1DGR A;  2ILM A;  3VD3 A;  1LOA A;  3GF6 A;  1YFX A;  1PX4 A;  1NLS A;  1STM A;  1G6N A;  2YDE A;  3GHN A;  3K3O A;  4QQ2 A;  1WZX A;  2WN3 A;  5E6H A;  5JLV A;  3B94 A;  3ITQ A;  1C57 A;  1FX5 A;  5IK7 A;  3WUD A;  1ENX A;  3ZMN A;  4AW7 A;  2FMY A;  4Y20 A;  2Y6K A;  2JG8 B;  3SNM A;  1UZV A;  4YM3 A;  4WM8 C;  2P6H A;  4XAC A;  3H42 B;  4RHV 1;  5JXH A;  4YAR A;  1D4V B;  1S0E A;  1L7R A;  4A7Y A;  1V0A A;  1AVB A;  2NPI A;  3PUS A;  2FCV A;  3K77 A;  2OUJ A;  5FUN A;  3DCQ A;  2JDY A;  1KXG A;  5A3T A;  4IEY A;  1IPK A;  1VAM A;  1NLQ A;  2Y6J A;  2ZGL A;  3HN1 A;  2W87 A;  4QX0 A;  1SAC A;  2XG3 A;  3NJX A;  1U5I A;  1V00 A;  1WBL A;  1EAH 1;  4OI0 A;  3VZL A;  1ZZC A;  2B42 B;  3GDB A;  4YRD A;  3AYA A;  2Y60 A;  1NKG A;  4OI1 A;  2XUE A;  3GYD A;  3ZPO A;  4RFR B;  1ND2 B;  4XW3 A;  1N3Q A;  4URA A;  5T54 A;  1KEX A;  2VOV A;  4O61 A;  3VBR A;  2RS1 3;  2WO1 A;  1MS5 A;  3IZO A;  2KR2 A;  2TBV A;  4OZX A;  4CCN A;  4DXZ A;  3V0B A;  4PIZ A;  1N3O A;  4XJ8 A;  4LTA A;  2RG4 A;  3A22 A;  4HVR A;  1OHF A;  1Q8Q A;  3EBR A;  3GZU C;  4LKD A;  1AYN 2;  3VBH C;  3L9J T;  5FBJ A;  1UU4 A;  2VXR A;  2AAC A;  3V56 A;  5DMY A;  4OI4 A;  3HBK A;  2ZGS A;  4AQS A;  1AYM 3;  3IN9 A;  5DG2 A;  4YVS B;  1G9B A;  3O1M A;  3W58 A;  4R8H A;  4L8Q A;  3RZG A;  1C5I A;  5FKC A;  5FZE A;  2VE1 A;  4BQ4 A;  2FDK A;  4Z82 A;  5FZ9 A;  3RPQ A;  1W99 A;  4YVW C;  5JOZ A;  1A34 A;  2VMH A;  3ACL A;  5H9S A;  3MZH A;  1RUC 2;  3M8L A;  1EPW A;  2A6X A;  5T50 A;  2D6L X;  1SBE A;  3DPR A;  4BK4 A;  2IXH A;  1OQD A;  1TME 2;  4QU2 A;  5C9A B;  4XDO A;  2A3Y A;  3BIW E;  1TZO A;  1AX0 A;  1DYO A;  3ES1 A;  4RS5 C;  5L7O B;  1QJY 1;  2BUK A;  4FAH A;  2EXI A;  3JD7 1;  2R0F A;  4RYD A;  1AR8 3;  4QXC A;  2Q8E A;  2WSU A;  1YI9 A;  2BOI A;  1JW6 A;  3HIF A;  1O4T A;  1SPP A;  3LA3 A;  5FZ4 A;  1LOD A;  2YB7 A;  2VCA A;  2XLF A;  2VQT A;  1GP4 A;  1HB4 A;  4GWI A;  3WSO A;  3ZLI A;  2WNV B;  3QBQ A;  1JYT A;  1S0I A;  4YYO A;  2GNB A;  1IG3 A;  1VJ2 A;  1LHU A;  1U5Z A;  4M3C A;  1LHO A;  2P5B A;  1PO2 1;  4PJY A;  3H1W A;  3ZFG A;  2J1U A;  3NV3 A;  5FZB A;  5JXJ A;  1XE0 A;  4AQT A;  1CIY A;  1U5X A;  1WCQ A;  1E5I A;  1M06 G;  4JGY A;  1IHM A;  1D2S A;  3C7H A;  2WQZ C;  3CJX A;  1VBD 3;  2RDS A;  4YW6 A;  4CDW B;  1FV2 A;  5I8Y A;  2AEZ A;  4KWL A;  2K2S A;  4IER A;  1D4M 1;  4PDW B;  4QDS A;  4HBN A;  2RR1 2;  1UNB A;  2ZGT A;  3WW2 A;  4XMI A;  4C91 A;  2D6P A;  2VCC A;  5BNO B;  1RJ7 A;  1OLM A;  1NZI A;  5CFC B;  2HWE 1;  1ND3 A;  2CAV A;  2QQN A;  1JU3 A;  5J7M A;  2XON A;  5FYZ A;  4IE6 A;  5A6Q A;  5HBA A;  4YZ4 A;  2RS3 1;  3ST7 A;  2DUR A;  3THP A;  2A3W A;  1YIF A;  3OUH A;  3X29 B;  4U2A A;  4ZKT B;  1H6Y A;  1W2O A;  4DOU A;  1N1Y A;  2W95 A;  2WSV A;  2ET1 A;  4ZU4 A;  4WM8 A;  4PF1 A;  2JDK A;  2W91 A;  1C4R A;  4M0N A;  4KU8 A;  1TE1 B;  1SZB A;  1V6L A;  5FZF A;  4UFH A;  3B01 A;  3ZM8 A;  1DCS A;  2P4E A;  4UW4 A;  4Y22 B;  2V09 A;  2ZGO A;  5FPA A;  3LA2 A;  2FMD A;  1GU3 A;  4J25 A;  2RDQ A;  4CA9 A;  3KHB A;  1RUE 1;  4FFF A;  4AHZ A;  4BWO A;  2E51 A;  2WRA A;  3VLB B;  3L2Y A;  3KCY A;  3B69 A;  1DG6 A;  4IV3 B;  4FOY A;  2SLI A;  1YO8 A;  3J8F 2;  4OUE A;  4Q1R A;  2KXL A;  1GZC A;  3DKQ A;  3JBG 1;  4WM7 C;  4XF4 A;  2WWS A;  4YW1 A;  1HRI 3;  4QHZ A;  4AQ6 A;  5CG9 A;  5CIS A;  5IW0 A;  4Z2A A;  4DPN A;  5C4W C;  4I2O A;  4EN7 B;  4CP2 A;  1C8M 3;  3FN9 A;  5KC5 A;  5DAP A;  2ADE A;  4AOC A;  4FPH A;  1BJQ A;  3ACH A;  4LMF A;  3OGV A;  3VBH A;  4KNC A;  1NCR C;  1C5H A;  4TLF A;  4D94 A;  4QPG B;  5F6L B;  2BVB A;  4LK7 A;  4MH0 E;  3H50 A;  2QBX A;  2ES3 A;  2HYK A;  4IE4 A;  4WVW A;  2HWD 2;  4W65 A;  3H9A A;  1DU3 D;  1WCK A;  4YVW A;  3VDD C;  1WD3 A;  2VZR A;  1EP0 A;  4XUN A;  3DGT A;  5CZK A;  5FP4 A;  5FZC A;  1UMZ A;  2DUP A;  4XIL A;  3FHQ A;  4LBO A;  4K21 A;  1UQX A;  3K46 A;  2JDZ A;  1MS1 A;  3I2J A;  2VOK A;  4YPJ A;  1NCQ B;  5FMD A;  3WP6 A;  3NQH A;  4K3U A;  4XFH A;  2QE3 A;  2GDF A;  2GMM A;  2QUO A;  2WWU A;  1QU0 A;  5ANQ A;  3ZFF C;  4E2Q A;  2CWM A;  1OFS A;  1FOD 3;  1US3 A;  2VOX A;  3T0D A;  5EJ1 B;  2GC2 A;  3TNQ A;  1PX3 A;  4CCE A;  4COY A;  4RS5 A;  5FZH A;  5FZO A;  1COV 1;  1ULF A;  4ZU5 A;  2W39 A;  4LKS A;  3WHT A;  2FCU A;  4FFH A;  1VAL A;  5IFP A;  2VOW A;  1XJA A;  2WA3 A;  3NNJ A;  1S0C A;  2W2I A;  5LBF A;  3I54 A;  1KQR A;  2CY6 A;  1K5M C;  1WW6 A;  2BER A;  3AVR A;  3JQX A;  1ZZ8 A;  1OKQ A;  2D6K A;  1WLC A;  2OII A;  1PNF A;  2UUR A;  1QQP 1;  3POF A;  1WLT A;  4GKY A;  4Q4Y 2;  3WF3 A;  4DB5 A;  3O1U A;  1MAC A;  3LEI A;  3MFC A;  1Y9G A;  1J3P A;  2V73 A;  4P14 A;  3ZFE C;  5GLW A;  1HV0 A;  3T0A A;  4CVU A;  3TYJ A;  4ZHN A;  1RGS A;  1A78 A;  1VMH A;  3O0W A;  4W8J A;  5LBB A;  5HV0 A;  1HRV 2;  2FZ1 A;  3R6S A;  4KBZ A;  4DQA A;  1EV1 2;  2GMP A;  2ZMN A;  2O0O A;  4HT1 T;  3OBR A;  2RR1 3;  5E8A A;  2R06 1;  2DDU A;  4BZ4 A;  2C9K A;  5FJK A;  1PK6 C;  1W39 A;  4P9W A;  3III A;  3LSD A;  1WLW A;  1ZBE 2;  1N1V A;  3VD7 A;  1GWK A;  4CUC A;  2QQL A;  1NYW A;  1W0P A;  2DTY A;  2VW2 A;  2W1S A;  2OT7 A;  3ZIX A;  4CCM A;  4LIT A;  4CTE A;  5KHJ A;  3OCP A;  5DAB A;  3ZVX A;  4AFA A;  3BI3 A;  4OQ9 A;  2QCS B;  4YG6 A;  1W6P B;  2VL4 A;  2ENR A;  3I2K A;  1LUL A;  1OPO A;  2MHF A;  4DUV A;  5KHK A;  1MZF A;  5C5T A;  1MS8 A;  1NE6 A;  1RED A;  1Q3E A;  5G05 L;  3NAP A;  4DEQ A;  3OBZ A;  2ARE A;  4JDM A;  3OGR A;  1Z7S 2;  3WCS A;  5ACA 2;  2W5F A;  4XZP A;  5EYY A;  3WG2 A;  1I9R A;  3T2P A;  4Y20 B;  4HET A;  2FHR A;  4ZS3 A;  5F7U A;  4UW5 A;  4Q8L A;  2VJX A;  4DY5 A;  3J8F 3;  4D7Y A;  5C3P A;  3TWI A;  1RMU 2;  2UYA A;  5I0U A;  3MIG A;  1BMV 1;  3LOI A;  3VKO A;  1EUU A;  4QHB A;  1K3I A;  2ZKN A;  1J58 A;  4ERO A;  4WM7 A;  2V5D A;  3OGG A;  1R09 2;  1PMI A;  4AAX A;  5FY4 A;  3LIH A;  4Q0Q A;  4NHX A;  1G7Y A;  5FZ3 A;  4YZ1 A;  5C4W A;  2C1F A;  2VME A;  4LIU A;  1QDC A;  5D2A A;  5DPN A;  1FI2 A;  2FDH A;  2VTX J;  2X5I B;  3RGB A;  3E6C C;  1NCR A;  1S0G A;  4XUO A;  2MEV 3;  2ZEW A;  1JYW A;  2WFF 1;  3LE0 A;  3Q8B A;  4BHP A;  5JR7 B;  1ZZB A;  2GSY A;  2R49 A;  3VBR B;  4JTO A;  5FLI A;  1PVC 2;  2A5Z A;  4NPR A;  5EZW A;  3V0B B;  1HQN A;  3VDD A;  5I93 A;  3AL6 A;  2HKX A;  3RYR A;  3RYP A;  1H8T B;  4IEO A;  3C7F A;  3FFZ A;  3MF9 A;  3SEE A;  1RHI 1;  2QZ2 A;  4CPB D;  4QGM A;  3SCH A;  3WDX A;  5DAW A;  3ZFF A;  5I91 A;  4ASL A;  1X9P A;  3QH6 A;  4AQ2 A;  3R05 A;  4AXO A;  3ALQ A;  5K8S A;  4EN8 B;  5A7S A;  3KS7 A;  1K12 A;  4LKF A;  5FQ0 B;  4DNY A;  2BFU S;  4CCK A;  3VN4 A;  4JHZ A;  3GZA A;  2EF6 A;  3W9A A;  1UN1 A;  1T6G C;  5IYY A;  2ZGN A;  3DPR B;  3I3Q A;  4K20 A;  1K5M A;  5FZG A;  5FZA A;  4Z1V A;  2I45 A;  1TG7 A;  3SCG A;  1LOE A;  4DRV A;  1R1A 2;  5FZ8 A;  4PIY A;  2VM9 A;  2XVG A;  1F5F A;  1LHW A;  2ADD A;  4FPE A;  4TZD A;  2BQP A;  5FPL A;  3ETQ A;  2W47 A;  3A4U A;  1SPP B;  3CNA A;  3LF7 A;  2NMO A;  3PUI A;  4YW5 A;  2BBV A;  3N9N A;  1EV1 3;  1RC6 A;  2PHD A;  4LUM A;  1PGL 2;  2FBE A;  1IS6 A;  2R0H A;  2Y26 A;  1RB8 G;  1QJX 1;  5FOB B;  1W0N A;  5A3L A;  2IFW A;  4HOO A;  3N3H A;  4EZH A;  2BJS A;  4P00 B;  1ZBE 3;  2WT2 A;  2BPA 2;  3NRU A;  1MR5 A;  3EB7 A;  4M3C B;  5IVC A;  3AP9 A;  1D0H A;  1PK6 A;  2JDP A;  1OVP A;  1SLI A;  2R6Q A;  3LQC A;  3ZFG B;  4AI8 A;  4QKD A;  4WBB A;  4XE9 A;  2W1W A;  3RZL A;  3FHI B;  5HCH A;  5BNQ A;  2QFE A;  4JGY B;  3VB9 A;  5JWP A;  1PIV 1;  3I3M A;  4IET A;  3ZKY A;  4CPB A;  4Z8B A;  2JB8 A;  2PQS A;  4GB3 1;  4M00 A;  1WCU A;  1KGY A;  1EUT A;  3A23 A;  1Z7S 3;  4YW7 A;  5ACA 3;  5LK7 B;  1G9C A;  3BTY A;  4QQP A;  4Q4W 1;  5J36 A;  1RTV A;  1YFY A;  2D93 A;  1RVF 2;  4OLL A;  5BNO C;  2FDG A;  3TAY A;  3IPV A;  3LSE A;  2JE8 A;  2C26 A;  3PTR B;  4LPL A;  3WF0 A;  2IXK A;  1VPH A;  3LAG A;  3JZV A;  3QOP A;  1AL0 G;  3ENR A;  2BNM A;  4WM8 B;  4CUG A;  1S2B A;  4BQ5 A;  2BGO A;  4RSU A;  1OA3 A;  3WXP A;  1W9W A;  4UBH A;  1D2Q A;  1HDK A;  3ZYH A;  1ODM A;  3VZO A;  3O1V A;  3IDB B;  3WLU A;  2GN3 A;  4V2W A;  3THT A;  2GND A;  3PL0 A;  1JN2 P;  2ZA9 A;  2YC2 A;  5EJ3 A;  1UO9 A;  1OFN A;  3OF1 A;  1ZVF A;  2EIB A;  1F4H A;  3HVD A;  3ZDS A;  1WME A;  3FX3 A;  3OYW A;  2PHX A;  5T5J A;  5FYT A;  2FCT A;  1H0B A;  2GP3 A;  5DDJ 2;  4YW4 A;  5FZK A;  5HV4 A;  3ZYP A;  1D7P M;  1VB2 A;  2NMN A;  1RUI 2;  1MEC 2;  1XNC A;  4CDQ C;  4DFS A;  5FO9 B;  2JWP A;  1ND2 A;  4N7I A;  5FYM A;  3IBM A;  4OHW A;  2ZX4 A;  2W52 A;  2FDI A;  4HPK A;  5LK5 A;  3KQR A;  4R9A A;  4F8A A;  4YWA A;  2YRO A;  2P6C A;  3VBH B;  1LR5 A;  1CES A;  5FYV A;  3U4X A;  3I2G A;  3PUH A;  5FY5 A;  1Q8V A;  5LA1 A;  3WQ1 A;  1GNH A;  1YQC A;  3RJ2 X;  4AFB A;  3TB0 A;  3HT1 A;  5FMO L;  4GUL A;  1VBC 2;  1W2U A;  2P1B A;  5D8A C;  4XXP A;  2VVE A;  4YVW B;  3FUO A;  4QX1 A;  3WV6 A;  4A6O A;  2DVB A;  2RMU 1;  1HJF A;  1RUJ 3;  1T6B X;  2WO7 A;  5JPN B;  3HOB A;  2R07 3;  3NW4 A;  4I0A A;  4J1X A;  4AFC A;  1O3R A;  1V9U 1;  4LHS A;  4NWV A;  4ZON A;  1VBE 2;  1MQT C;  2JDH A;  4M4P A;  1R1A 3;  3E1F 1;  3S5Q A;  2LRO A;  3Q8F A;  4NAM A;  1ZBA 1;  2ORX A;  3ZR6 A;  4AED C;  2GNT A;  2XBO 1;  1H6X A;  3CIH A;  5FPU A;  3I3D A;  2QVS B;  1Q56 A;  2Y0O A;  4RS5 B;  5C9A A;  5FZO B;  1HLC A;  1BYH A;  4A6S A;  4IE7 A;  1VRH 3;  5GZC A;  4IE0 A;  1XYP A;  5L73 A;  2ZGK A;  3E5U A;  1CAX A;  1OVS A;  1UZY A;  4MO3 M;  2PTM A;  2XHN A;  5SV5 A;  2DU1 A;  1SLC A;  1BXH A;  3VV1 A;  3SH5 A;  3CO2 A;  2RVA A;  1UPI A;  2J1A A;  1OD3 A;  1X82 A;  1X36 A;  2WZR 3;  3I4I A;  2UU8 A;  1YWK A;  3LB9 A;  4S2D A;  2OQ7 A;  3G6J B;  3H8X A;  3P6B A;  1QOT A;  1WD4 A;  2JDM A;  3OPT A;  4IV1 C;  2VVD A;  4GMP 1;  4JCK A;  3PJY A;  5FKB A;  3T09 A;  3WZ1 A;  3NKT A;  1ZRR A;  4LNV A;  4YM2 A;  3SIS A;  4HN0 A;  3UGH A;  1W6N A;  3AMQ A;  1D0G A;  4IL7 A;  4N90 A;  4JDO A;  2ZHL A;  5F9T A;  3ZSM A;  1YQ5 A;  1AR9 2;  4AR2 A;  3B02 A;  1YQ6 A;  5A80 A;  3AMP A;  3D8C A;  4Y1V A;  4CDW A;  2VMD A;  4F3J A;  4FXG B;  1UY1 A;  4R4X A;  1RVF 3;  1LJ7 A;  4PDW A;  5FYC A;  3U0Z A;  1AR6 1;  1UZ0 A;  3AP7 A;  4QDQ A;  1BBT 3;  3RWK X;  1EPZ A;  3MF6 A;  5AC9 3;  5BNO A;  5JSR A;  2GU9 A;  2OVU A;  2P17 A;  4CP0 A;  3H3Z A;  1V6K A;  1W9S A;  5A3W A;  3ZXD A;  1AL2 2;  2HWC 2;  5ANN A;  1POV 1;  1RUD 3;  2VW0 A;  3HD8 B;  5F3I A;  5KXD A;  2B4K A;  3RRD A;  3UGG A;  1OA2 A;  3I3B A;  1XB9 A;  3POG A;  3VKM A;  5BYN A;  1RL3 A;  3MO4 A;  3E6D A;  4N43 B;  1UY3 A;  1CIW A;  2E7Q A;  2ZEZ A;  1KDM A;  1QJZ A;  5FMB A;  4WVM B;  3FC0 A;  3Q8A A;  4ISR A;  4ZS2 A;  1RUF 1;  3RI9 A;  4F83 A;  2VBD A;  3HN3 A;  4LA2 A;  2HWF 2;  1RUG 3;  2VUJ A;  2XKP A;  1IKP A;  1X50 A;  3SCF A;  1OI6 A;  2XJS A;  5C3Q A;  1VIW B;  3PDQ A;  1WA4 A;  1J59 A;  2R04 1;  1PZ9 A;  5F3G A;  2F4P A;  4B4P A;  1RUI 3;  1C8N A;  1MEC 3;  4XAE A;  1R08 3;  2E53 A;  4OHX A;  1FPN 1;  1NQD A;  4MX3 A;  2D7F A;  4WM7 B;  1W6Q B;  4FPC A;  4FTS A;  4LUL A;  3WNL A;  4CDQ A;  4B1L A;  3RZJ A;  1SFY A;  4QX2 A;  3ON7 A;  5C4W B;  1LHN A;  3P1I A;  3AX4 A;  4FPJ A;  4LT5 A;  3RYK A;  1DYP A;  4HMZ A;  4XET A;  2YV8 A;  3LA7 A;  3WOG A;  4QPI C;  4NID A;  3BB6 A;  2ZX1 A;  5C5U A;  1NCR B;  4LO6 B;  1VBC 3;  2IWG B;  2YG0 A;  1O8S A;  5KHI A;  3AZZ A;  3VDD B;  1IOA A;  3VZN A;  3S5A A;  5C8W A;  3K4D A;  4JX0 A;  4XAB A;  1UYY A;  3QD6 A;  4XMA A;  5A7N A;  5LY2 A;  3O1O A;  1JYI A;  2RS1 2;  1Y3T A;  2PN5 A;  1MQT A;  3ZFF B;  3WG1 A;  5LAT A;  4E2S A;  2B5H A;  2C5D A;  1U0A A;  3CHX A;  3BTZ A;  2TUN A;  3FFQ A;  2A6V A;  3I2O A;  1XNA A;  3NNF A;  1H9P A;  4MGT A;  1HV1 A;  3R4U A;  4PCR A;  5KC6 A;  3FLR A;  4PT6 A;  1SBF A;  2PHR A;  2Y6L A;  3ZYI B;  3WT3 A;  2WKK A;  4UFJ A;  2W92 A;  3UKT A;  1K5M B;  2WBK A;  2X29 A;  4MAD A;  1ASJ 2;  1GNY A;  4UI9 L;  1ZRI A;  4FBF A;  2IUW A;  4GWJ A;  1BEV 2;  3GHM A;  1EAH 2;  2ZAB A;  4Y5T A;  1QJU 3;  2AZ5 A;  3ZFE B;  1W8O A;  4XFF A;  4JRL A;  2WO2 A;  4XFC A;  2WII B;  4PHZ A;  4QD2 A;  4XPV A;  4IV1 A;  2FZ2 A;  3MI8 A;  4OMC A;  2DV9 A;  4OCT A;  1LOC A;  4MGZ E;  2O1Q A;  3WNO A;  4Q1P A;  1UU6 A;  2AUY A;  5CIR A;  3HAG A;  3S57 A;  1PK6 B;  3DL3 A;  3DF0 A;  5FY1 A;  1TMF 1;  4XQ4 A;  1X8M A;  2CDO A;  2XLA A;  5JDB A;  3Q9O A;  4YZ3 A;  1AHS A;  4IGO A;  3RSJ A;  4P08 A;  3OGS A;  5A6X A;  1W8T A;  2XJP A;  3HNB M;  1O5L A;  4QM8 A;  5JSO A;  3PVO A;  1IG0 A;  1KS5 A;  3THC A;  2Q1M A;  4XJZ A;  1AL2 3;  1MS9 A;  2J7M A;  2HWC 3;  1QNW A;  2JB4 A;  4LO8 A;  2WT0 A;  5FWE A;  2PAK A;  2FDJ A;  1JS9 A;  3CL1 A;  3JQW A;  3MW4 A;  4DS0 A;  1VBD 2;  2IZW A;  4QDR A;  4O7X A;  3ZXF A;  2WS9 1;  1Y9M A;  4CP1 A;  4BQ2 A;  5EV7 A;  4P5H A;  5TSW A;  4D3W A;  2R7E B;  4Y3O A;  3POY A;  4A44 A;  3IPV B;  4CDU C;  2HWF 3;  1O7F A;  5EHD A;  1SG3 A;  2CU5 A;  4I0W B;  4WV8 A;  3ZOI A;  5B2G B;  1GLH A;  3FLT A;  5HXM A;  5IK5 A;  3BKZ A;  5LA2 A;  4BPZ A;  2VZT A;  2XKO A;  3K3N A;  4CCC A;  2VAU A;  2WAB A;  4I3P A;  2C6S A;  5FP7 A;  1T2X A;  1V6N A;  3WNK A;  3WP4 A;  4XF1 A;  4ZXE A;  2AH2 A;  5F5I A;  5FLH A;  2VXJ A;  5CB7 A;  1URX A;  2CWS A;  2ZHK A;  2GAL A;  3UES A;  1NX9 A;  4YFW A;  4Y24 A;  3OYW B;  1YNA A;  4JQR A;  4XUR A;  5F5A A;  4QPI A;  4S2F A;  4Q4V 1;  1QY4 A;  3O1R A;  3PUA A;  3VBS C;  2WNU C;  5HPO A;  1RUO A;  4QX3 A;  4HVQ A;  2X5I A;  4AAP A;  4KH9 A;  2PLV 1;  3ZIW A;  2B9U A;  3H3L A;  4YSF A;  2BZD A;  1H1A A;  3HNY M;  4YZ5 A;  5J48 A;  1DP0 A;  2WLP A;  1PGW 1;  4HPK B;  3KCC A;  3ZYF A;  2AGS A;  4FSJ A;  4DUX A;  5FOJ B;  1HRI 2;  5FRA A;  2NZ9 A;  4EN0 A;  4LUK A;  1QHD A;  1H8T A;  4TSV A;  1U12 A;  4AHW A;  1C8M 2;  4K8R B;  1ENS A;  1LEM A;  5E1R A;  1S2E A;  4JKK A;  1SLL A;  3Q8C A;  3U78 A;  2X10 A;  4RHV 3;  3E5Q A;  4YG0 A;  3SH4 A;  4O9G A;  3ZYB A; 
#chains in the Genus database with same CATH homology
 5FZ8 A;  5FPU A;  4GAZ A;  5A1L A;  5ISL A;  5FZO B;  2OQ6 A;  3DXU A;  2P5B A;  5FPL A;  3PU8 A;  5FY0 A;  5FZ7 A;  5FPB A;  5IVF A;  3N9N A;  5FZB A;  5FY7 A;  3RVH A;  5A3P A;  5FYH A;  4BU2 A;  3N9O A;  5IVV A;  2PXJ A;  4QX7 A;  4D6R A;  4QXH A;  4HOO A;  4EZH A;  5CEH A;  5IVC A;  5FJK A;  5F5C A;  5FZ0 A;  5A3N A;  2OQ7 A;  3N9Q A;  2YBS A;  3DXT A;  5LY1 A;  3OPT A;  3KV5 A;  4IGP A;  5FV3 A;  2GP5 A;  3K3O A;  5IVY A;  3K2O A;  3N9P A;  2OT7 A;  4CCM A;  4LIT A;  4XDP A;  4QX8 A;  5E6H A;  3PUR A;  3LD8 A;  4QU1 A;  5IVJ A;  5FY8 A;  5FYZ A;  5FZ1 A;  5F37 A;  3N9L A;  4LIV A;  5FY1 A;  4CCO A;  5A80 A;  4DIQ A;  4ASK A;  4DO0 A;  5FPV A;  5A7O A;  5FJH A;  4IGO A;  5FYC A;  5A7W A;  2XXZ A;  5A1F A;  2WWJ A;  3NJY A;  5FP8 A;  2XDV A;  2VD7 A;  4GJZ A;  3KV6 A;  5FZD A;  5FZF A;  5FYB A;  3PTR B;  5FWE A;  2YU2 A;  5FPA A;  5FP9 A;  3PUS A;  4GJY A;  5A3W A;  3PUQ A;  5FUN A;  5F3I A;  4D6Q A;  5A7W B;  5LW9 A;  5A3T A;  4AI9 A;  4CUG A;  5FXV A;  4QXB A;  4NUB A;  4UF0 A;  4Y3O A;  4BIS A;  4IGQ A;  5FYU A;  3KV9 A;  3AVS A;  2XUE A;  2Q8C A;  3OPW A;  4V2W A;  3KVB A;  4EZ4 A;  3ZPO A;  5FY4 A;  5FY9 A;  5FXW A;  4URA A;  5IW0 A;  5FZ3 A;  5FXZ A;  4CCN A;  4UF0 B;  4GD4 A;  5IWF A;  3PDQ A;  4LIU A;  5F3G A;  3K3N A;  5FYT A;  4E4H A;  2GP3 A;  5FZK A;  5FBJ A;  3KVA A;  5FP7 A;  4D6S A;  5IVE A;  5FZL A;  4CSW A;  5F5I A;  2YPD A;  4EYU A;  5FUP A;  5K4L A;  5F2W A;  5FYM A;  5FZE A;  5FZM A;  5FZ9 A;  5FZI A;  5A7P A;  5F3E A;  2YBK A;  4CCL A;  5LWB A;  5F5A A;  3AL6 A;  5F2S A;  5FP4 A;  5FZC A;  3PUA A;  5FYV A;  5F3C A;  2OS2 A;  3AL5 A;  4Y33 A;  5F32 A;  5FP3 A;  2YBP A;  5FY5 A;  5KR7 A;  4AAP A;  5F39 A;  2WWU A;  5ANQ A;  5FYS A;  4C8D A;  4QWN A;  2OX0 A;  4XDO A;  4CCJ A;  4TN7 A;  3KV4 A;  4HON A;  5A7S A;  5FZH A;  5FZO A;  4LXL A;  5A7N A;  5LY2 A;  4CCK A;  4QXC A;  1VRB A;  3PU3 A;  4Y4R A;  5FXX A;  2Q8E A;  3U4S A;  4BXF A;  2W2I A;  5IVB A;  5FZ4 A;  2Q8D A;  5FZA A;  3ZLI A;  5A7Q A;  5FZG A;  3U78 A;  2XML A;  3N9M A;  5FZ6 A;  3AVR A;  3LDB A;  5FYY A;  3UYJ A;  5FWJ A;  2YU1 A;  4V2V A;  5FYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...