2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
b'PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
1OGAE 3W11C 4EI6A 3CFEA 1PAMA 1I3VA 3EO9H 2ADJB 3P4NA 2VL5B 3CVIL 1AQKH 1CL7I 1BREA 4FP8L 1M7IA 1A2YA 1T1YB 2FD6H 4N8VG 3TIDA 3D9AL 5CP7B 5A2KH 4UV4L 1HHIB 1XR9B 5EO1A 4QRSA 3BISA 4BFEA 5B39A 3TBSB 3ISWA 5C8JB 1D6EA 4Z7QF 1LEGB 2J1SA 5HJ3B 2OK0L 3IVKB 3BP6A 1UZ6E 1FHGA 2FJFA 4FQCH 4KRMB 4XZUB 5GRZA 4AM0A 1R5IB 3VFNB 1OPGL 1I1CA 3WF3A 3CFDB 3ETBF 5BCAA 1CF8L 3PGFH 1OGAD 1NCDL 4FQIH 4M02A 4GKNA 2GUOB 1MH5A 3KYOB 1T2QL 4G5ZL 3T3PF 5F3BA 5IW6A 4P0DA 5FGCB 3MQIA 1I1AD 2AXGA 3MLWL 4XVSH 4P46A 1HN1A 1K8IA 1R3HA 1J0ZA 5I66B 1RIHH 2IMMA 1JL8A 3QNZA 4JLRA 3SKVA 3KPLB 5GPRA 4I48A 32C2B 3AXLB 1NGWA 3P4MA 5TFSH 4BUHA 2R1XA 3IDJB 2KDGA 2QQLL 4HZLB 2IF7A 5I1LA 4R4BA 4J7RA 1RK0A 4XH2B 3Q48A 4LSQL 4F7TB 5IK3B 4CJ1A 2BJMH 1SBSH 2P8MA 3QFJE 2GI7A 3PV6B 1TG7A 3RWDA 1F4HA 4BA8A 1WKYA 5DJ6B 4R0LA 5MHSE 4LHSA 5IJVB 5CLTA 1G7JB 2BFVH 4F3FA 4RQQB 3KDMB 3ESVF 3Q0HA 3WKML 1R5WA 4N0FA 4YUEL 2VISA 4H26B 4PGBA 4WJ5B 1LK3H 4V2CB 4ONHB 3SDXF 1J1PL 5MERB 1U8OA 5IYYA 3PWJB 2D03L 4JFDB 3ARYA 2PCPB 2VAAB 2FIKA 5E9DB 1OAZL 1MJ8H 2NYYC 1S7QB 3ARGD 3UC0H 1QVOB 4YR6A 5I1HL 3CGTA 4PTUB 1X6NA 4XTRD 4QF1B 3LMJH 4Z7WF 3WDJA 2NXYD 1CIYA 4UV7H 3QFJD 4HC1L 3LEXB 4JFXA 3N1QC 3FONA 5DVOA 3HC4H 3WUWA 5MHSD 5CCKH 3GSUA 3Q6GL 4OZ4B 5C0NC 4X7TB 5AZ2H 2CO7B 3NZHL 1LGVA 5C0CB 5IB4B 3UO1H 4JVUA 3X3GL 1W0WB 3CK0L 3IT8D 2HRPH 3RKDD 3WDIA 1JUFB 1U58A 4MZ3A 4OZIB 4MDJB 3LN5B 4YE4L 5L2JA 1NC2A 1KENH 3PP3H 5F9WC 2ZUQC 2J6EH 3IXTA 1GGBL 3PNWB 3ARFB 4CKVX 2W0FB 4GG6B 2ZKHL 5F88B 3KPNA 1X5FA 1EVTC 4OIIH 3KYKH 3OKMA 2Z8VC 4ZXBD 3MBEC 1CD1A 2OMBA 4QB2A 1QQDA 1OT1A 4LP5A 1EERB 4MHHI 2XQBH 1N0XL 5BV7L 1UG9A 2DOCA 3S8WA 2XZQL 2VQTA 4PJGB 2WMPA 4JE4B 4BH8A 4IIQC 2HVJA 4HFWB 2E8ZA 2Z4FA 2VDLL 3HE6C 2ZEZA 4MNQB 4LK4A 2WWMC 4P3DB 3OKEB 1AFVH 5FF6B 2BVQA 4M4PA 1PD6A 4KV5E 3ZHDA 4E41A 3NABL 2P8PB 5CJOH 5CZVH 1FVDB 5BZWB 4QXTA 4U05A 4NRZB 4AJ0A 1CFSB 5IFJA 2C3HA 3R06A 4AIXA 3HPLA 2CKBB 1T89A 2FHFA 2XKSA 4CVXB 4Z7UE 3O2VL 5DEZA 5GGTL 4BFGA 4JQIH 1OOAA 3MRHB 2YD4A 1EK3A 3MRDB 3MFFA 2G5RA 3O45A 3GSXB 1EEUA 4PJDB 1G9MH 4CN6A 3QHTC 2EKJA 3BZEB 3OR6A 4FQJH 4FTVE 1YEGL 5EOTB 3ALPA 1Z3GL 5ADOL 2VN4A 4LSSL 3FB7B 3FB5A 5DSCA 1XR8A 4PJBF 4HIHB 5EU7E 4WDIB 5HXMA 4OZHA 3RUGE 3G5XA 2NY0C 3QUYB 1CFTB 5CIPA 5E99H 2VDKH 2W07A 5E00B 2Z92B 4P4KB 5IHLB 3QEGL 1IM9A 3WIIL 2AI0H 3DSFL 4NZDA 5D7JB 2JK5A 3WLWC 2EIZA 3V0VB 4ZO6A 2HT3D 3MCG1 4U3XA 5D6CB 1U8HB 4L4TB 3DUHA 4FTVD 1JGEA 1MIML 3STZA 1R6VA 2GSIB 3L7EA 2OQJA 2AV7A 2RJMA 2CIKA 1JTPA 4P5KA 5DMIL 2HFEB 4GBXB 4IS6A 3VXSA 4P23A 1JJUA 1RUML 4AEEA 2BK8A 3QDJE 4RWHA 4X5XB 3H9HB 2KPNA 3G6DH 3BJLA 3MRIA 3OJDA 3TH4T 3FQNB 3SDDA 4ELMF 2R0WL 4GH7B 3HC0A 2FCBA 3IB4A 1VKXB 4KJQD 4P2QA 4V2BA 3TBWB 4O2CA 3TA3C 1T7XA 2WAHA 1YEJL 1UWGL 4C4KO 5I1KL 3P0GB 4XPAH 4GKZA 3EW3B 2Y1VA 2R2BB 3FRUB 2QHLA 4Y1AB 4O58L 5LCWL 1UM5H 4U1LB 5E8DH 2EDTA 4HF5L 5H94A 4M6MH 3WNOA 3HOBA 3QDJD 3MRJB 1SYVA 5DQ0A 5CGYD 3P73A 3DGGA 5J11B 3RGVD 2P5WE 5LWYH 3O3EA 3QCUH 3I6LE 1BF8A 4YHNA 4LLQA 1T7VA 1MFDH 2IEPA 4U3CA 3BPLC 2Y4SA 2R0LH 1JZ5A 1AJ7H 2P7TA 2X4TB 4UILH 4XHQA 4OYUA 4QPWA 4L5FL 4J3OC 4KC3B 4QWWC 4X99B 1KN4H 2DDQL 2NY5C 4ZUVB 2D31A 3THDA 1JHTA 3OAUH 1FZJA 2SEBB 1MLBB 1ZHBB 2DKSA 3JZ7A 5J0BA 1T22A 5D5MB 1ZSDA 4DAGH 3GB7A 4QHKI 1OGAA 3AREC 2P5WD 3PP4L 3KWWB 3HJRA 3RIAK 2FO4B 1RZ7L 1I1AA 4XBEH 1I7RA 4AMKH 2C1OB 2XG4A 4W6WB 3G08B 3QA3B 1ADQA 4JO1H 4P9HL 3DRQA 1YEHL 3VI3E 1H8SA 4OT1L 2QADD 3DBXA 5EG6C 1JYNA 3IETA 2W60B 3F7PC 2RFXA 2G75A 2BRQA 3TBTB 5K9KA 2NLJA 3TYFB 5GISH 3VJ6B 5EUOF 1FIGL 5J9PB 4WV1B 2VDRH 4WTXA 4PY8J 4LOUD 4YO0A 5FUOH 3LEGA 3LQZA 2H2SC 3O11A 3ULUF 1D5BB 4JFDE 4XGZA 3GMMA 4M93C 3HZKB 3U37A 1F6LL 2F5BH 4OIAA 2WQ8A 4QB1A 3JVGA 2E7MA 4GSDL 1JI2A 4WFFE 5KVGH 5BO1H 2MQCA 4XNZB 3AS0A 1GAFL 3IAGC 4EI5C 2R2EB 5D2NC 5KN5B 2IANB 4UQ2A 3OG2A 2YD1A 3MRRB 4X8JA 1OH4A 4OKVA 3ARGA 4YDKH 3P9MB 2FNBA 3MJ8A 2ZJSL 4LKXA 3LV3B 3LKSA 4PJFA 3RVTC 3N85H 1N6UA 4P2RB 4D3CL 3BRGC 1UY1A 3CFIC 1YUHB 4I3SH 2DQDH 1MLCB 1AGFA 3QFJA 3OEBA 4X9BA 4NNYA 2HJLA 3KLAB 4R96B 4QHLA 3FRPG 4RNRA 3ARZA 1IARB 5EBGA 3IKCA 2V5SA 4PV8A 1U8MA 3IDAA 5L88L 1QLEH 4PUBH 2IQ9L 4KRNA 3THMH 5KS9F 3L5WA 1HINL 4JHWL 2Z31B 3ARQA 4RMRA 1RUKH 2J1TA 4KKCC 4AIZB 4HH9A 4HCRA 5E2UL 2NW3A 1IQWH 2FHBA 3QEQB 2VR4A 1DBKH 3RPIB 4UU9B 1RV6X 5DURD 3U0PB 3LB6C 3CFJB 2PXYC 2Y25A 1W8OA 1K8DB 3TJHD 4MA8L 4ZXBA 1J8KA 2P24A 2NW2B 3S4SB 3X17A 4OM1L 5AG8A 3QI9C 4QX1A 1WZMA 4B7IA 3F5WA 4PJ8D 4A4AA 4ENED 1OAXL 2WQRA 3MV9D 1JBJA 1TNNA 2I5YH 4L4VD 2VC2H 3QPXL 2XZZA 1Q9KA 3EDJA 4J3TA 5FYLE 1FVEA 4GKOA 4NN7B 2QL1A 1J1XH 5FXCH 5K59F 3RIFK 1IL1A 5FHBH 3T3PE 4Z0BH 1AR2A 1T1WB 3QULB 4FQ2L 2JCCE 2ZNWA 1AE6L 1LVEA 2APTA 1NCUA 3QXDB 4HWBA 4XUPA 2GSGA 4MDIB 2PW1B 2OJZL 3FAXA 4FQXB 3K2UL 1EEZA 4X9GA 1MCKA 3O4OC 5I1EL 3LN4A 3RVUD 3EKCA 5I16A 4RMSA 4W4OC 4JFPB 2R1YB 5LCVH 3BPNB 5D93B 2P48B 3DX8A 4HS3B 5LGJB 4MD0A 4Y88A 2ADFL 4ZTOH 3FQXA 2ESVE 5FYLD 3QDME 4OZFB 3BP7B 3I3BA 1F3RB 4I0PD 5G05L 2QQNL 1TVBB 2PO6D 3VFOA 1D6VH 4XWGL 3TV3H 1I3GH 4UB0H 4QRTA 4U6HB 4UAOB 2RCSL 5IB1B 2CR6A 1O7VA 3S88L 1KCSH 3SDXE 3O3BB 1IAIL 1P4BL 4NC1C 1TVHA 2OTPA 4NQVB 5ESVB 1XH3A 4NO5A 3ZYOA 2XTJC 4Z7UA 2A6DA 3OR7B 4HPOL 4IDJH 5BV7B 4P57A 1MQKH 2N7AA 4NKIL 1HH6B 4RA3A 2VLKB 5HDLA 5L8LB 2XPGA 3WFZA 4XXDA 4Z7WE 1FAKT 4NIKB 5A2JH 1FC1A 4U1JA 1ZK9A 4MMXC 1F3DJ 2Z8WC 3L5JA 3QDMD 4JJ5A 4G6AD 4FTVA 3TIEB 3QQ9D 1MI5B 5CWSA 4GW1B 3OKLA 5L9DH 2LAGB 3MLVL 3KR3L 3IFPA 1GIGL 1CDJA 1NAMH 2IPUK 4AQOA 3GUTB 1QOKA 3RUGA 2ZSVB 4WW2A 4U1IA 3N06B 2YPKA 2A9ML 1AI1L 3SDCD 1WT5A 2AEPH 3HB3D 3V6BR 1QTYT 2Z4QA 1I1FA 3OPZL 3L3OA 4QHUA 1XIWC 2RR3A 3CUPB 4MAUL 4K9EL 1RJYA 4ZTPH 3ZKNC 1CLZL 2JIXD 2ZOLA 3DX7B 2F53B 3QNYA 5IB3A 2VABB 1ZVSB 2IH1B 1XGTB 1P9MC 2NY5L 3T4YB 3HI1B 2YPLE 1UXSB 1CIDA 5E6ZA 2IGFL 3U4BL 2W1NA 1E0OB 3W5NA 1LILA 4O2FA 3VGAB 3QDJA 1JPGA 4MVBC 1GC1C 4YDVB 4IHOB 1GPOH 3HE7D 5IR1A 2R4RH 2MJWA 43C9B 1N2RA 1ED3B 3RPKA 3C7FA 1U8KB 3RGVA 2WP3T 5IEHB 1NEZB 3UZVB 5BS0B 1YY8A 5IVOA 5KTEL 1JZ4A 3RTQB 5IESL 1RUPH 1KIRA 1I4FA 3ZSTA 3UTTE 4O5LL 1L7TL 5HHOB 2VLJB 3GM0A 1F3DH 3G9AB 4YBLB 1G1CA 3ES6A 5IOPA 2DLGA 1T0NA 4XNXH 1WIOA 4LU5H 2YRPA 3HPJB 2LQRA 1JNLH 1CLYH 2W92A 1YYLL 1JHLL 2OTWA 5GS0C 1C08A 1TQBC 2V7NA 4HWZA 5IMLA 3PWLB 3S3SA 2J8HA 3MJ7B 4BQCA 5BVJB 5IUSA 4HUVA 3DJ9A 3LDBC 4F80A 2P5WA 1H3VA 2YD6A 3VD7A 1QR4A 4P2OC 3MRLB 5JA9A 1C7SA 3VCLA 3VG9C 3K8LA 5JW3H 4JM2F 4K7PH 4KRPD 5EIIA 2LU4A 1ACYH 2RBLA 2GTWA 5HHPA 2LTQC 1MQ8A 1EGJA 1S8DA 1FDLL 4Y2DD 2BNUB 2BSED 4MQ7B 2AJXL 5E6ID 1NSNL 2OCFD 4PREA 3TN0C 4DKFL 1S7SA 4O51A 1MY5A 3F12A 2MWCA 5GRVK 1TTGA 5TE4L 1JN6B 1GGIL 1G7LA 5DA4A 4I4WB 3IDNA 4PLOB 1GC1H 3MPCA 5DJYB 1U8PA 3RHWF 1IEBA 5JXED 1GU3A 2E9BA 3D0VA 1LNUA 3CXDL 2HFGH 1EJOH 4KXZH 5J57B 3M8OL 2Z9TA 2IPUG 3O8XC 4LHUG 4KKAD 5F7YC 3WIHA 2Q7NA 4G6JL 5EZJB 3MRCB 1H8OA 1NAEA 4X4ME 4JVWA 3EHBC 3RNQA 5B8CA 1BQLH 3SE9H 3CFKB 3CLEL 1UYWL 5E5MA 4RRPA 4PRPE 2W1SA 3PWVA 4DFIA 2GKIA 3OAYK 3UBXG 2QLVB 1A22B 1EMTH 5J1XA 1KEGH 5DK3A 2XQYK 3JV6B 5IMMA 3HC3H 1M71A 1L7IH 1AC6A 1DUYB 4HHAA 2FEDD 2J12B 5EU4B 1N8ZA 2ATKA 4XP5L 2QBXA 4GRWH 4J6RH 3B2VH 4ZFFB 2VCAA 1RUAH 3CFCH 2X41A 1X4YA 2Y07H 3CVHL 4HIEB 3WFCH 2BOCB 4YJZL 1B0RA 1Y0LB 4PRBB 5SWZB 1FAIH 1S5HA 1VFMA 3H8NA 3NPZB 2WUCL 3P77B 4M1CC 3QQ3B 1P84J 5KZCD 4PRPD 3VFSA 3CIQA 1UZ0A 5F3HB 2EXWC 5K93A 5C0RH 1F4WL 1FH5H 1UADC 3OGCA 4NOBA 4XPHL 3VRJB 1NFDB 2R0ZL 2BDNH 4G6FD 5BXFB 1BFTA 1BZ9B 2O5ZL 2G5BA 3UX9B 2XY2A 4X6CE 2V4VA 4JFFB 4JO2H 3QDGE 1B9ZA 3AMKA 2IAMC 4NUGH 4K07A 4HG4K 4KK5C 1MCEA 2FGWL 3B3IA 3MJ9H 4GXVL 5DHVA 1YJDC 5DD0H 4PJ8A 5LG1A 4NBYB 3MV9A 5CZXD 5KSUA 1KIPA 4FFZL 2XY1A 5TDPA 5ESQB 4L4VA 1U8QB 5F9WB 4LGSB 2ZUQB 2XZAH 1D9KD 3ZT7A 4L1HA 1LDPL 5HHMB 4IOSD 2Q6WA 1SHWB 3QCTH 3QFDB 2I60H 3QSKB 3DMMD 2BBAA 1F00I 2MSPA 4JRWA 1BFSA 4ELKA 2IPKA 3EYOA 4P48A 2YR3A 4XB7A 1A5FH 3T4AA 1QFUL 5JW4Q 1U8JB 5FO7B 4P5YA 4IOFD 3WNLA 3D5OF 3T77A 1IBGH 4QRRB 4JR9H 1R64A 4OLZH 3QDGD 5CD3A 5ANME 3C2AL 2ZPKL 4WHTB 4YFLF 2VH5L 4PYGA 3T0EE 4MAYD 4MXWL 5LAXA 4IIQB 5MP6L 2OI9B 1KULA 3ILPA 1KIQB 4RGOL 3DYMA 2OP4H 4WUUE 3IAPA 3DVGB 4YNYA 3OKNA 4OCXH 4WI2A 3V7AG 3P2TA 4NHCL 5IBTL 5LXGH 2NX5B 3ARXA 5IGXL 4TNVK 4I0PA 3E6HA 4C58B 4D8PB 3GJEB 2PO6A 3GI8L 3PIQA 5I75C 4FFVD 4XCEB 4DVBA 4N8PA 2AJYH 1FVCA 4JRXE 3Q3GB 3MLZH 4NO3B 4X98A 4OGAD 4TUOB 3WS6C 4D9RE 5HVHB 3WL9B 3CDFA 1TCRA 5HDQH 4NQUA 3BT2L 4U0RB 3VWKD 5JW4R 1A0QL 5I1GL 5JTWA 3C60C 4P49A 5HGGS 1GOFA 1OF3A 4KJPD 4WUUD 1ZANH 3EYQD 4U2YA 2XQYG 2WINB 4NWTH 5DC4B 4F7PA 3IDIB 4F2MB 1F90L 3QDMA 4YX2H 5DVNA 3CZFA 3ULUD 1X5YA 3KPTA 2W3JA 4XNUH 3O3DB 5TDNA 4GW5A 1NGZB 2NY0B 1VFOA 3K1DA 3O0RL 4OZGB 4YK4B 2OZ4H 4JRXD 4MCZA 4D0QA 4OSUH 4IMKA 4K8RC 3GO1L 1EHLL 3SDXA 2F74A 5JHLL 5CJXA 4D9RD 5KS9E 2PNDA 3ROLA 3SDCA 1Z5LB 5EJZB 1NKRA 1RIVL 2QHRH 1CG9B 5IBLD 4EOWH 1ITBB 2AJ3A 1GGCL 4LAQL 5CGMA 5IKCA 3QUMH 2JB5L 4OBSA 1OCWL 4Z7WA 4PJEE 3CVIH 2FSEB 2JIXA 3CMOH 1KXVC 5J3HC 3ZSSA 4FP8H 1YEKL 3RVVD 3IGAA 3D9AH 3OGOE 3DTXB 4ODSH 5GS0L 3RWGA 1CE1L 4U1KB 4HAGA 1JPSH 1X5ZA 4CADA 5E8EB 1J0JA 3UPRB 5IROA 1EUUA 2W95A 1CX1A 5SWQA 1OPGH 4LLYB 3HE7A 3C6LD 8FABA 1CF8H 4UT9L 1NJ9B 4PP2B 1A4KB 4YWGH 5GHWL 3W0WD 1MAML 1IM3A 3PGCA 2NY6B 5K59E 1BX2A 2ORBH 3MLWH 3JTTB 1UH3A 3FHAA 2YPVH 1BOGA 3MBXH 2H2PC 5IT2H 1NDMA 4HV8B 4KGJA 4XBGA 5F9JB 1JV5B 5GJSL 2J1EA 2R15A 3LRGA 3VXNA 2I27N 2QQLH 2VDNL 3EFFB 5FECB 3DOSA 1E28B 1CXIA 3QXVA 2B7DT 4ODHL 3BI9X 4KJYA 2NXZC 1A1NB 2CK2A 1CICC 4RIRA 4WWID 5LVEA 3WO4C 2UZXB 1WLHA 4F9LA 3BPLB 3BWAB 3H7BB 5DJ2B 1E4XH 4HZAA 4PP1C 5ACZA 3A6BH 1ZTXL 2W1UA 1BBJA 3MCKB 2ERJB 3O41A 2F54B 4W50A 2R29H 1J1PH 7CGTA 4KKLC 3WXVL 3VA2C 5IQ9A 4U6VL 4HLZG 3HI5H 4K3GA 3BZ4B 4Y2DA 3GSRB 3NJVA 3BIKA 4LLVA 5E6IA 1RJZB 2W38A 4EUPB 4YXHH 3SE4C 3AREB 5IQ7H 4XVJH 2WP3O 4BFIA 4JRYB 4N8VA 1XGPA 1JRHH 1KSRA 3K74B 3NPSB 1FZOA 3PWNB 4TVPL 1P1ZA 3H9SE 1S9WA 1KTDB 4C56B 3GIZL 5JXEA 3QXAB 1WZLA 4APQB 1ZA6A 3QIBD 3WF4A 2QKIB 4PJBA 1DDHA 4HGWA 4F37K 5G04L 3NZHH 5DO2D 1YN7A 4JPVH 1IGFH 4LF3A 4WRLA 1ZLSL 3GXUA 3JWOL 4PG9B 1EEQA 2FATL 1PBYA 3RAJH 2X4SB 4Z7OE 1DBAL 4CNIA 1VERA 3ULVF 2WBKA 2E9WA 1QRNB 5EN2A 3X12A 5SX5H 1I8MA 3EB7A 4O2EA 2X1WL 3D0LB 4CMHC 4M93B 2BGPA 1FZMA 2NR6D 4UOW1 1NLDH 4Y5VA 3HFMH 2C9KA 3KPQA 5SWZE 1HHGA 3H9SD 2Z93B 3X3FL 5DK2A 1LE5A 4GMSL 1A6VL 4E9LA 5C0DA 4M7ZC 3V4VL 2CLZA 5D7IF 4EI5B 5EIVA 4JY6B 1KB5H 4HUUA 5BV7H 3I50L 1NCWH 2DQFA 2VUYA 5IB2B 2J4WL 4X4MA 1PVHA 2KBGA 2OR9L 1FPTL 4R7NA 4PRPA 4GG6F 1VPOL 5I8OH 4ELMA 1VGEL 4HAFA 4EN3C 2FYYA 5D8JL 1DVFD 5EZLB 2HLFD 3NABH 4XP9L 5C71A 2C26A 2DCJA 1K6QL 2NYYD 4LFHG 1A3RL 4J1UB 3FTGB 2DBLL 3MXWL 1FNEB 2W9EL 4V1DB 4NNPL 1P7QD 4MA3B 1H5BC 2YA2A 1QBLH 3QZWB 3KYMB 3BUYB 1PQZA 3O2VH 1OD9A 4PJGF 3MBWA 1D5MB 1WBZA 4C59B 4HSQA 12E8L 1G1YA 2A74B 4XPGL 3TVMB 1M7XA 3HUJB 4L8BA 2R8SH 4X7FC 4WU7B 1D9KA 3ALXA 3DETC 1YEIL 3DMMA 4KI5C 1AQDA 3I6KA 2HRLA 4S2SA 4GAFB 1PYWA 4EXKA 3R8BB 1D5IL 2X9YA 2EO1A 2AGJL 4ZFGH 5D9SB 1OAKL 2HMIC 3BZDA 5E6YA 5CBEA 1RULL 1G7PA 5F7MC 4BSWA 3QDGA 4PJXE 5KJRL 5JMRA 5CS7A 5SX5K 1H3XA 3E6FB 5E95B 1SG3A 4MAYA 3ARWA 3RWIB 4DXRA 1QP1A 1EJ6A 4U6TA 4KTEH 3CVHB 4NQEB 3QEGH 2ITCB 3GMPB 2BRRH 3WIIH 3S34H 1FYTE 3TO4C 1X5HA 4PB0H 2XN9B 1BQUA 5E2TL 1MIMH 4MQXD 4XPFH 1EA9C 2WBWB 3DVIA 1Q9LB 3QHZH 4K8RL 5FKAA 5D7LB 3WE6A 3I9GH 4R9HA 4X7CC 1JK8B 4JM2D 4LKCB 4Q9CA 3KYNB 1C5BL 3V6FB 3HE6D 3VXOB 5ANMA 1G7HA 5FGBA 4PJCB 2GAZA 3G04B 2G2RA 3VWKA 1NKGA 1ES0B 4GOSA 3SEPA 2R0WH 2GY5A 2X4PB 1AIFB 4WUUA 5I1JL 4RISH 1NUFA 2XKNB 5EUOA 3F2ZA 1PZ5B 4ZY9A 2QQIA 1FYTD 3GRWA 4LLMA 1DLFH 2E9IA 2UZIH 2VSDA 3O6FD 2DM4A 5EWIL 3GIVA 5BW7A 1T0PB 2X6MA 3TYGH 4CW1B 3FL7A 4O58H 1TIUA 2BVOA 4JRXA 1AH1A 1N5YL 4HBCH 3EYVA 2DL9A 2OMNA 3P30L 2YD5A 3ARRA 4IDLA 4GQ9H 4OFIA 5EU5B 3DHMA 5C08D 3MO1A 3UMTA 2YFUA 4YFLI 2HTKC 2VXSL 4JAMB 3WN5C 2C3VB 3LSOA 2W0KA 1BEYL 2BMKB 3RU8L 1EZVX 4OLWH 5L6YH 4X4XA 2N1KA 1NCBH 5F6IB 5TGBB 5HYSB 3ARBD 3L9RA 2YHGA 1ND0B 2P1YA 4L3EE 2NZ9D 5LA0A 1QO3B 3OKOB 5EA0L 3EOBA 5EU3B 2NY2C 3NIDF 3WLWD 4G8EB 4DCQB 5KS9A 3FQTB 2ICEB 1TPXC 4PRHB 1OP3K 1T3FA 3DHJA 4G9DB 3C6LA 3HG1B 1ORSB 1P7KA 3W0WA 2VIRA 3QG7L 4JY4B 1UM4H 4X5LA 5IMOA 3O9WD 4JGJA 3OAZH 1IGYA 1WBXA 2FEEL 3A7QA 3ET9F 3VFUB 1RZ7H 5IG7B 1UMIA 5ACMA 1NAKL 4OLVL 5TPWH 3FN3A 4M7KH 3VRIB 1WF5A 4E5XB 3ZL4H 2YC1B 1YEHH 3TC9A 3VFMA 2BNRD 3MXVH 4OT1H 1KTKE 3TBYA 1D5XB 3C9NB 5DQJB 2LVCA 4OLXL 2DYPD 1OHQA 5IWLA 5DJDB 4HX1A 2ORXA 3ACGA 3TA3D 3GMOB 1PEWA 1PG7W 1X5AA 4OBRA 1HSBB 4XRCA 3VFWA 5AD0B 4Y5YA 4PGDA 4X6FA 2C4FT 3VRLE 5A16B 1J0IA 4G8FA 1Q9WA 1RK1B 2Y23A 3TNNA 5E7BA 2DQEH 1CBVL 2C3GA 3PGDB 1CD8A 1MCOH 1CFVL 4NP4L 4U6YA 4LPLA 3W39A 3L3GB 2RAMA 3FOMB 1K4CB 2VLRB 5HHVL 1GCFA 4EJ1C 1T7ZA 2Q20A 3V7MA 2VO5A 4MNGA 4E0RB 5DRZA 1YPZE 4QNPE 3IYLW 3MR9A 2AS5M 2VR5A 4M03A 2MPAL 3F7QA 1KJ2L 3MX0A 3PHQB 5FCUL 3F6IA 5DEGB 3MSPA 5A43C 3PQYB 1FSKC 3UBXI 5DYOA 4D3CH 4XPTL 4OV5B 5BMFL 2VQUA 3LEYL 5C0IA 1NGYB 5L2KB 1MCJA 2Z91B 5D7SH 1FFNB 5ETUB 2XRAL 1FBIH 3QIBA 4I3RL 5EU6E 5L88H 2Y64A 1MCWW 4MNHB 4PJHF 4HDIA 3OAZK 1HINH 3LRHA 1DQDL 4JHWH 4MX7A 1L9NA 1L7RA 1MF2H 2A6IA 4NKMA 2H32H 1QA9B 4QT5B 1ONQB 3G5VA 1KPUA 2VDOL 5EIQA 5K9JH 5J7CC 4O9HH 4AQ1B 2CMRL 1R3LB 1WEJL 2ARWA 5F1IB 5D2NE 5JORA 5GSVA 2JB6A 3D6GA 4HIIB 2BCKA 2OSLA 4J8RB 3SE8L 4JZJC 1R3IH 2J6EA 5BVPH 4FQLL 2CDFB 2WW8A 2C9AA 5GGRB 3H9SA 4MA8H 4NO2B 3NCYP 1WCQA 3PWUA 4KJWD 3N1MC 3OF6D 3UJTL 4PGEA 2APVA 1LNSA 3OX8B 4ORZC 5FYKL 3VFGH 5GRUH 5HHNB 4MA7H 1E4KA 3O6LH 3TPKA 3OGSA 4YGAB 4XMPL 1C16B 1OF2B 3QPXH 3H3KA 1OF4A 3MMEA 1FZKA 1T5XB 3CU1A 3MZTA 1I75A 1IKFL 4OLUL 4V1DE 1A14L 3KPRB 2AJVL 3MUGA 3B5TA 1DVFA 3BN3B 4OAWA 4LHUD 5JUEL 2M8XA 3KPSB 3H7LA 4FQ2H 1K42A 5FA3A 1O8SA 1WWAX 4G6KH 5MI0C 1P2CA 1P7QA 1AGDB 1URLA 2OJZH 4K7FB 3WNMA 2FHCA 3K2UH 3D69B 3RWCB 4UZGA 4YQXL 2P46B 5CSGA 1INEL 5SX4I 5DS8A 3QUXB 2DRUA 5F89A 1GRWA 1TZIB 5CEYB 3L3JA 1H6YA 4ODXA 4OQTL 3RZCD 3ZE1F 4CL7A 1PW3A 1NCAL 2B20A 4JN1L 1UCBH 3HPNA 3WFDH 4ZUTB 3ZE2E 4XWGH 1T66D 3LKOA 3LEIA 2NTSP 4ODWA 1I1RA 2G60L 3GHBH 4JN2A 3VWJD 1HHKA 1ODAA 3U36B 5ADPH 4NQCE 1P4BH 1OTTD 2H9GA 4HULB 1QSFE 2BSRA 3T0XA 2X70B 4YH6A 2YWYA 4IMLB 5T1MB 4OD2A 5JPMB 1WBYA 3GMQA 4BQBA 4HS8L 1NDGB 2XWBB 1HQ4B 2PW2A 2PXYD 2D0FA 2DQJH 1ZHKA 3NGBC 4KK8D 1UH4A 1LEIA 2JDAA 1G9NL 2PR4H 4LLUB 5IJRA 1PJ9A 5IBUB 5C0AD 2RHEA 4JM2A 1RZKC 4ZFOL 2FECL 4RGNC 3BP5B 4EQ2A 3BYYA 3CSPA 3HE6A 1YNTA 2E6JA 4FZ8H 4NCC1 1DBJH 4NQCD 4PJXA 1DQML 3SJVE 4W8JA 1QSFD 1AI1H 1CFQA 3LKNA 4WEMB 3V7AE 4QYOB 4JY5L 4LARL 1Q0YL 5LGHH 1YEDB 2Q76B 2VDQH 4JDTL 2V17H 1FYTA 4P59L 2XTJE 4LRNL 5IM7B 1U92B 4HUNB 5CUSH 3O6FA 1NGQH 1WTLA 1BECA 1W72A 4P46C 4S1SL 2IGFH 3MRKB 1WC7A 3ROOB 3MRBB 2Y5TA 4XP4L 4TPRH 2QQJA 5D7IE 1A8JH 1V5JA 3DX9A 3MV7B 1XGRB 2QQKL 3SJVD 3LKRA 5FKPA 1SJHA 5ICYA 5EO9A 3S36H 2YD9A 1KLUB 5M7QA 4U3HA 4KXZI 1JWUA 5C08A 2J1VA 5FDWA 2EXYC 1X5GA 3ULVD 5KTEH 3VXPB 3ILQD 4Z18A 1BFOB 2XTJD 4NBZB 4HUMB 4PF1A 1AGCA 1FL6A 3K8MA 3FQUB 4HXAL 1S78C 3NBNA 2Y7QA 3ARBA 1OT2A 4H0GA 3BX7C 1MJJB 1VA9A 1DQTA 1UY0A 4IRSB 5I17B 4ZO8A 3WHE0 3GK8H 1WFTA 1IEAA 4A44A 1QZ1A 3PUHA 1JHLH 5TH2A 1IGJB 4ZS7L 4FXGA 4WW1A 1ZT1B 1IAKA 1MSPA 3V5KB 2O5XH 2GHWB 3EZ8A 3P0VL 4MS8D 3X11B 1JTTA 4OV6F 2ZSWB 1F13A 1JGDA 4LGRB 1B6DA 1J11A 3QAZC 3O9WA 4KQ4H 4DQOH 3HI6L 2B4CH 3TH2T 4HPYL 3SKJL 2J1UA 1IGTA 5IFAH 3HNTL 5DJAA 1I1YB 2AKRB 5HHXH 1H3GA 2BNRA 4MADA 4TULL 4XNYL 2EKSA 1MRFL 2DYPA 1FDLH 4DXSA 4NQSA 1ZHLB 3TA3A 4DKFH 2PYED 4P4RA 2FX9L 3OJ2C 5FO9A 5CJ8A 5CHNA 5TE4H 3MV8E 1MCQA 1G7IA 1RD6A 4RDQF 4NYLB 3I2JA 3G5YA 3STLA 3RWFA 1BZ7A 2YUXA 3F65A 1NLBH 3SKMA 3MUJA 5IVZB 3TNMB 3QO1B 5CGTA 3BH9B 1DTUA 1NMCC 3O4LE 3CKHA 1MOEA 1NUDA 3QWQB 3D3AA 4ODVH 4FQHA 2DWDA 4GRWE 1JGVL 2GJ6B 1YZZA 2DF3A 4XMLL 2P43B 1CE6B 1HHHA 1JPFB 1RVFH 1EEYB 1EZVY 3IU3A 5IW1B 5DD1H 2EZ0D 3BKCL 4JFZL 1YMMB 3BKJH 1CICB 4U1HB 3BHBB 2HVKB 3WO4B 2B5IC 4C54A 3ELAT 4OF7A 2IG2H 3BPOC 5EBWB 1R3KB 2L4OA 2OL3L 5JDSA 2FR4B 4S1QH 1CLOH 5DQ9B 3NCBB 1JPTL 3MLTA 5DJCA 2NPLX 4Q9RH 3O4LD 5JXAH 3S37H 3JTSA 1FYHB 3L3KB 4PD4J 3BMVA 3MA7B 5LA2A 3BW9B 2HH0H 3HZYB 3C8KA 1H3PH 1INQB 2J88L 4P4KD 1RZFH 1J05B 4M61B 2EEBA 4S10A 1RUQL 5E8OA 4Z0XB 5MEPA 5SWSB 2MKWA 1XF5B 4XX1G 3PDDA 3UYRH 5GZNC 4MJ2A 4X6EB 2CO6B 1BFVH 4PRNA 1PKQB 5E56A 5DQDL 4PS4H 3MRPB 3G6JE 1UJTA 3MA9L 1CDCA 4H1LG 1A1MA 3WS3A 3WUZA 3TN0D 3QXUA 5AWNL 4UIMB 1J9CT 2D7NA 4MJ6B 4NM4H 4LNVA 4D9QE 3VFVA 3OF6A 4OF0A 5T1LB 1K9TA 4OJFL 4TSAH 4KDWA 5IV2A 5JOPE 1RY7B 3KPRE 4EBQH 1DE4A 5F7UA 5T3ZH 2DI8A 2ZUVA 1G7MB 1P69B 2NY1C 3C5SB 2APFA 5FOJA 4MWFB 3HNYM 3VD4A 4GQPH 2BSSA 1NFDF 1KJ2B 43CAA 2ORZA 1FLRL 3O8XD 4CMHB 5D1QB 5FK9B 4ZUWA 3T65B 5IEKB 3F7YB 1S9YA 2C1PB 3OB0H 4AH2B 5D2NA 2XACC 3EHBD 1JI6A 1JF1A 4I2XB 5KVDH 1O7SA 4LHUA 4TNWK 3GMRA 1U91B 4BZ1L 4P23C 3RX8A 2ICWI 3I02B 4D9QD 2VH5H 5F7DA 2UY7A 3BUTA 5DTFA 4LEXH 5EZIL 3BSZL 3CSYA 5JOPD 5LQBL 2Y36L 3HR5B 3VGHA 3ZHLA 4NWUH 4R90L 1NMBL 3SY0A 4LLDA 5KVFL 3WBDA 4U1GC 3T0AA 4GW4B 2BSTB 3DVNB 5JQ6H 4WCYL 3ECBA 1M7DA 4NHCH 5IBTH 5DT1H 3ZE0F 3RZCA 1MCFA 1RZKL 4ZNEE 4W4NA 1U8NB 3K80A 1BVLB 1QLRB 1ZLUK 4L9LA 4O02L 1T1YA 1J18A 4X6DB 4ZUSB 4D9LL 1H5BB 1HHIA 4PQQA 1XR9A 5DMGD 2XZCL 3VWJA 5I74B 3DUSB 4KROD 5E08H 3QXTA 1FN4B 3TBSA 1F2QA 2GT9B 4HUWA 5C8JA 5HY9B 2D4FA 1UH2A 1LEGA 5T3XH 4CN4A 2AJUL 1S9XB 3BT2H 2NY4C 5DVLA 3VFNA 2XA8H 1F58H 5CIPH 3B9KD 4LFHD 1HH9A 2PKDA 1FORL 4N1CA 4DTGL 1JMXA 1ZA3A 3VXUB 5JO5A 1A9BA 1OWWA 3RVXD 1XGYH 1ULVA 1TJIH 3DROA 4NKOB 5C0AA 3S96B 1CFNB 3KPLA 1PY4A 4D2NA 1QLFB 4PJHE 4NQCA 2MCPH 2CLRB 1QSFA 3MRMB 1K2DB 3AXLA 1RJLB 1NAMA 3MZGB 1HK6A 1E4XI 3ZTNL 3UCRA 1CGVA 3TBVA 3GEWB 1DEEA 4HZLA 4Y19B 4BKLB 3V4UL 1AXSA 1OCWH 1DCLA 4JX0A 5TE7L 1MCLA 5DD6B 2VE6A 5DJ6A 3N1FC 1I1AC 3L5XL 5I1AB 3C08H 4OZGF 5CFHA 1G7JA 3GBNH 4RQQA 1JWMA 4H26A 1NL0L 1XZ0A 4WJ5A 2CDEB 4ONHA 4P5MB 1BHGA 3WIFA 3PWJA 1UXZA 1JRHI 4HQQL 3DVFA 1N3NB 2YC2A 3SJVA 1S7QA 5CP3H 3UTSE 5E2JA 3RVWC 4NZUH 5F21B 1Q94B 2AERT 2DB8A 5GHWH 5AZEL 4MXQD 3MFGB 2NZIA 5E94B 1KCRL 3LEXA 5JOFB 2QTEA 3QWOA 1C5DB 3UXFA 3BXNA 2YMXL 3NFNA 2HJKA 1TCMA 3C60D 4OZ4A 3JVGC 2DM7A 5C2UB 2DMKA 3CXHJ 3QT2A 1FJ1A 5IIEB 2B9VA 2QSCL 3QIWD 4WEBL 5FM8A 5D7IA 3D18A 4ZFOB 1RZJC 1CTOA 5IJKA 1HILA 1W0WA 2Z31D 4BELD 3ARGC 1JUFA 1GZPB 3UTSD 4ODHH 1OTSD 4MLIA 3LN5A 1FGVL 4GG8B 3RL2A 3SDAB 2V5RA 4XTRC 2R1WA 3PNWA 3ZKQD 1MWAH 2NXYC 4GG6A 3WUWG 4HFUL 5DK0B 3ZE1E 4DZBB 4I1NB 5D6DA 4WEUD 1G7QB 1J1OL 4WO4C 3UTQA 1NCCH 2JTDA 3BGAA 4PGCA 4Z95L 4X80H 2PYFA 3QJHB 1T0MB 1J5OL 4L8CB 1EO8L 4ZPVB 5J3HD 2VLME 1ADQH 4HFWA 5DUBB 1MCPL 4R6UA 1P9MA 1Q8MA 2PYEA 3RKDC 5B38A 3D39E 4HT1L 2FL5A 2J8OA 2HFFB 5FF6A 1BPVA 4NQXB 4HLJA 1I9EA 1S9VA 4TVPH 1IAIM 1A1OB 4FMFA 3RJDA 1DR9A 3GIZH 2AK4E 4BUGA 1MFEH 3EGSA 4ZXBC 3B9AA 5I8CB 1I3RB 2HT2D 3EIFA 4K2UH 4JB9H 2C4XA 4FQXD 4AEHH 4CDGC 5F1NA 4JFOB 4X7SL 4DOHE 4HKZA 2UWEE 1N64L 4GO6B 4LLWB 1J7VR 4KHTL 4M8VA 3GSWA 4TOYL 5CINH 4JGUA 3LKPB 1X3DA 3PJSB 2F58L 3D39D 1RZJH 2H2PD 3LEVH 3GKWH 1A6TB 4MJIE 4DKEH 3Q6FB 1FGNH 4A2LA 3FB7A 1F4XL 1AHWC 4EDWL 3X3FH 2Q8AH 1IC7L 2AK4D 1BWMA 4WDIA 4NZRL 3GJFH 3V4VH 3MLYH 3O4LA 4LNRB 1NUGA 1A6PA 4YAQA 2NXZD 5HGBB 3W9DB 4POZD 3L6FA 5FHAH 3CSGA 4Z76A 1VFAA 1YEEL 5DRWB 4F8TA 3JXSA 4GAGL 3TESA 1PKQE 4WTWA 3NNGA 2OR9H 1CR9H 2VJXA 4P4KA 4YDJB 3U4EB 3BKYH 4ZQKA 1VGEH 5J1AA 5KVEL 3D1MC 1HYRC 5EIYB 1T21A 2R56H 4MD4B 1T5WB 5HGHA 4FFWD 5A1AA 1N7ML 4MJID 4KKLD 4XP9H 5IHZA 2GSIA 5JLZB 1N4XL 4DW2L 3EJJX 1Q38A 1KEML 3TN0A 5M95B 4ZZ5A 4Y0GA 3BP4B 1AD0A 3ECQA 4LCCB 1SBBA 4JZOB 1CT8B 5IMKA 4X5XA 2BHUA 1YYMH 3H9HA 4G3YL 2BC4A 1WQVT 2DQTH 4UINH 4QHNB 3JBG7 4LSTL 1CQKA 4XVTL 2EDKA 2K3TA 3HEIA 3L3DA 4YC2C 1EAPB 1ZS8A 2YN5A 3X13A 4M6NH 3O8XA 3RWJB 3FFCE 2HT3C 4NCDA 4TRPH 1YNKH 2FH6A 3K1KC 4HS6B 1J86A 2AGJH 1ZT4A 2A1WH 2I9LA 3NN8B 3NIGF 1INDL 2OL3B 1RULH 4H1LB 1XF4A 3MLSH 3V6OE 1HI6A 1NGPL 1P5VA 3K4AA 1UWXH 5DUMH 4ERSH 5DPNA 5KJRH 5ALCL 4PJ7B 5DUPH 4WW2C 1VGKA 3WFHA 3HUJF 4UOJA 3EJYD 1WT5C 1KPRA 5LA1A 3GJFK 1OAUL 4KUZL 5BS0D 1LP9B 3VE0A 3OWEA 2BNQB 2QQMA 2R23B 3HMWL 4LIQH 5E2TH 5L0QC 2X4UA 3FFCD 5H2BB 3BEWA 3GSOB 4JCMA 5HHOD 5E7FA 3PF2A 1FC2D 3WD5H 1IGML 4OCLC 3JUZA 4MB3A 3EO1A 5E2WH 1T6WA 5HYJE 5TQ2H 4KI5E 1MHHA 4NZTL 3K3QA 3D85B 2SEBA 3NCJH 4KY1H 1F11A 2AEQL 5CGYC 5E0QA 4MSWB 2HLAB 3FO9A 3KAAA 4PJIB 2YB7A 2WLYA 3RGVC 4PLKD 1IC1A 4G43A 5EOQH 1LQSR 2V5TA 3B9KA 4WNQB 3OMZA 2B0SL 1FL3B 3WEXB 2FO4A 3V0WH 5EWIH 4ZNEA 4M7JL 1S7VB 4K3EL 2WZ8A 2X4OB 3LPFA 2FWOA 4JZNA 5C92A 3QA3A 4PPTA 3UTZB 1EFQA 2N7BA 4YFDB 4MLSA 1UACH 4PJCF 1KLGB 5DFTA 4LSUL 3P30H 2OZ4A 4LSVL 2Y06H 3EYUL 1LO5B 5HD8D 2R0KH 3I75B 2BVPA 1U8LB 4ACPA 3TYFA 2HMID 2A77L 3CFEB 5E1AA 1BEYH 3P4NB 1AGBA 3RU8H 1Q9OA 2QBWA 3S35L 4KZDL 4DK6A 1KV3A 4Y5XA 4WWKD 5C6PB 3QUMA 1RFDL 2W9XA 2DTML 4IJ3C 4S1DD 5LKNA 1QR1A 4RGNB 1JHJA 4QRSB 5B39B 1C1EL 1RU9L 1D6EB 2ED7A 2FZ3A 4HIJB 4HMEA 3TO4D 2QADC 1CL7L 3RA7L 3SO3C 1RMFH 4TSBL 4M9OA 2FX7H 3BP6B 2FJFB 3DXAE 4WFGE 5KN5A 4M5YH 4AM0B 4PJHA 5IHRA 4XP6L 3OJMB 4R4FL 2CGRL 4GKNB 2YD3A 1MH5B 4K94L 4DN4L 5IW6B 4L9DA 5F3BB 1MLCA 4ZFZB 4XAKE 1U95A 4LOUC 1KJMB 5GGRY 4P46B 1K8IB 1H9VA 1R3HB 3ARTA 3ZM8A 2VTFA 4XP1L 2DD8L 3C60A 2ENSA 4JLRB 4HK0A 4MXVF 4GAJH 1JWSB 3QIWA 4I48B 4J3SA 1NX9A 1MCSA 3C8XA 4TUKL 4EDXA 2R1XB 4WU5A 5B8CC 4MCYB 4S0SD 1LO3L 2Z31A 3KPPA 5I1LB 4R4BB 1AXTL 4S1RH 1RK0B 2DWEA 2AJSH 1G6VK 3UTSA 4XMKH 1NCTA 4TQEH 3U0WH 1KN2L 2QQLA 1DZBA 3RWDB 2QSVA 4JANB 5DJ8A 1CBVH 4R0LB 4NP4H 2CDPA 3SKUD 3U7WL 4RFNB 1B0WA 3U0PA 1IVLA 2HWZL 3FFDA 4N0FB 2BVEA 2VDPL 2VISB 1DLHA 4A2MA 2ZZUT 2HTKD 1U8OB 1Z6JT 5GGVL 2F15A 2J7LA 3K7UA 5GJTH 4NO0B 2APWA 4YR6B 2P45B 2OLDA 1GUIA 2CIIA 2E26A 5DLMH 3FO0H 4CU9A 4IRJB 1A7NH 1TDQA 2ZCKH 1IFHL 2V9RA 4JFXB 3QAZB 3LEYH 1ZEAH 4ONFL 4ZD3L 4HWBL 2HA1A 4F7MA 1T1WA 3GSUB 2H3NA 4DGIL 1HNGA 1VADA 2B2XL 4HC1A 3TJHC 2CSPA 5T1DL 1CLCA 1RZ8B 4ZPTB 4MDIA 3SQBA 4FQXA 4NC0B 4PJ8C 4ENEC 1U58B 2M2DA 5L2JB 3HAEH 1T4KB 3P6BA 3IXTB 4TVSa 2XG5A 2R1YA 1KCUH 3D39A 4UDTA 4NUJB 15C8H 1WISA 3KPNB 1H8NA 2NX5D 4M8QA 3OKMB 4M1DL 4F57L 3VMPA 1CD1B 1QG3A 1QQDB 5IB1A 2AK4A 1A7QL 4QDSA 1UY3A 1JFQH 1HHJB 3O3BA 3MODL 1HXMA 4RA0C 1KG0A 4NQVA 5ESVA 3IDUA 4XI5D 4R4NC 3SBWA 1UX7A 4BH8B 4XHJD 2HVJB 2X9XA 3BN9C 1KB5A 1MVFA 3C7HA 4XMPH 1IAOA 1KJ3L 1MHCA 3RVUC 2Y6JA 2E7CA 2BVQB 4H8WC 1MNUH 4E41B 3BPOB 2XNAA 1PZUB 4ODUA 4JKPH 2EC9T 3HS0B 4MJIA 2V72A 3TT3L 1T80A 4QXTB 2HKFL 4MQTB 4OCYL 1HEZA 2PO6C 5IFJB 1F97A 3R06B 1J0HA 3CLFH 2DQCH 5I19L 2WSKA 4BM7A 5TDOB 5CBAA 4XX1E 3MFFB 3O45B 2CK0H 2OJEB 4G6MH 3KHOA 2WZEA 1IC5L 1AC0A 3CUPA 5EZOH 4QAWA 4M7LH 3T09A 1YN6B 3OR6B 5DHVH 4QGYA 4RMVA 1XMWA 3F7RA 4OQTH 3U7YL 3DX7A 1DANT 2W9DL 3FB5B 4Z7VF 1XR8B 4G6AC 5FYJE 5DSCB 1OM3L 1ZVSA 4JG0L 5DD5H 3QQ9C 3OKDA 1UM6L 2VZPA 4OZHB 4D0DA 3RWEB 3G5XB 1W99A 1FE8L 4XUQA 1TXKA 3SKOA 4LRIA 4JFHE 4WHDA 1JF6A 4U1NA 4IMKC 1LP9E 3PHOA 2BNQE 5CJXC 3U83A 2NY1B 1IM9B 3HB3C 5H8DA 5DWUH 4AK1A 1EFXD 43C9A 2EIZB 3REVA 1U8KA 3V8CA 1F8TH 2NY6D 1DN0B 1C5CL 1JGEB 3WFEL 5BS0A 3STZB 1UXWB 3T2NL 5GS1A 2WN3A 3KHQA 5F44A 3FFCA 1S7UA 5DJZA 2YZ1A 4PFEA 2V2TA 4MMZC 2CIKB 4JFYB 5HHOA 4P5KB 5DXWA 4IS6B 4OGXL 3VXSB 3EZJB 3AMLA 4OCSH 4P9MH 1AKJB 3NTCH 3EOYG 2DQHH 3V6OA 3HPJA 4N0RA 3JV4A 1MEXL 5IROC 4JFHD 4MGQA 1JZ6A 3JV0A 3OJDB 2K9UA 3PWLA 5J1TC 3SDDB 4PR5B 1Y6MR 3UROR 2AP2A 3GHEL 3HE7C 5DHYA 5J8OA 1FFOB 4P2QB 3MGOB 4LCUB 1QFPA 5TQ0H 3CCHA 4JDTH 4I0KA 4O2CB 1P4IL 5DD3H 3TLRA 3ARPA 5F6HJ 2XWJA 1E6OH 4S1SH 1P7HL 3B83A 4GKZB 4XCCL 4Q9QH 4R8WH 3E3QC 2CLVB 4NN6C 3BZFA 3NH7L 5C9KA 2QR0B 1MHEB 1B0GB 2KH2B 3EJZD 1JYVA 4M48H 2I25N 5I73B 4MQ7A 3GNML 5ERWB 2CRZA 3TT1L 2F9BT 5AG9A 4L3CA 1OARL 2YEZA 4WY7H 3GFUA 3O3EB 4FNLL 4RGNE 4URTB 4YHNB 1JN6A 4LLQB 1IGCH 2B1HL 3OSKA 5HPOA 3D2UD 4I4WA 3J8F7 3EYSL 5CJQL 5DJYA 4F9LC 4WWKA 3WIHL 3QIUD 5B3JF 3ESUF 4HXAH 4D0BB 1VDGA 2VZUA 4KRPC 1AGEA 4CU7A 3S9DB 1JGUH 1WGOA 3AC0A 1WTGT 2YOCA 2D31B 1JHTB 3TO4A 3NACL 3WFBL 1FZJB 4QHMA 4RAVA 1GHFH 4Y2DC 1T22B 2HN7A 2VZTA 5E6IC 2Y72A 4KDVA 3IF1A 1ZSDB 3U30C 1RJCA 3GB7B 1J88A 1OGAB 2FRGP 5JR1L 3L1OL 4UTAH 5E03A 5HVFB 1Y18A 2BY2A 5KSVA 1SM3H 3PG2A 1I1AB 4L1DA 1C12B 1I7RB 1YC7A 7FABL 4HPYH 1C7TA 5JXEC 1SY6H 3HAEG 3NIGE 3DRQB 4FFYH 3CDGA 5ITBL 4YXLL 2AXFA 3AAZA 4FABH 4HGKC 2G75B 4HIEA 4KKAC 4O4YH 5JW5B 4RRPG 5JW4N 4NQDE 2RV9A 3QNXB 5ELIA 3RY4A 5JUVA 3ABZA 1HYSD 3P77A 1GNYA 4GS7C 1H3TA 1HIML 3RWHA 2BZDA 5IFHL 5FUZL 1A3LH 1I9IL 4YO0B 3LQZB 1NFDA 2CJUL 4N9GA 4WFEE 5E2VH 3TF7C 1T03L 4XGZB 3GMMB 3DRTB 1S7XA 3T8XB 1S3KL 4LPVA 4Y5VC 2ZEWA 4JFQA 2FEDC 4XWOC 1NCNA 3U48A 2EH7H 3IDMA 4UT7L 3FO1A 2D2OA 2QV2A 3F7VA 3VGDA 3WN5A 3DV4A 1F3JA 2PN5A 5CEZH 2EXYD 3KJ4C 3MLUL 4UQ2B 1RHHA 4CU8A 4X8JB 4OKVB 1PLGL 2PUQT 1CDYA 35C8H 1CS6A 1XF3B 3MJ8B 4LKXB 4NQDD 4PJFB 4QXUH 4UNVA 1S78D 1U8QA 2ED9A 3EOTL 4XC3L 3QEHB 3IRZA 4J23A 4WUKL 5I76A 3QFDA 4NRXA 4AEIL 3QFJB 1XEDA 1FV1B 4WFED 4QHLB 4RNRB 1DYOA 5FO7A 1UB6A 2BVUA 3IKCB 4PV8B 1U8MB 3MRQA 1DBMH 1CXLA 1I7UA 2B39A 3VD9A 4JDZA 5FO8A 4WHTA 3TCLA 3L5WB 4FZEH 3CDCA 4GT7A 4H8WL 2J88H 1KIQA 5ILTL 5CZXC 1E27B 5FYLL 1TTUA 3SGDH 3INUH 5T3ZE 4HH9B 5KSAB 5D1ZD 4KPHH 1D9KC 2NW3B 4OCWH 5BQ7B 4NNXA 2XN9D 4XBPA 3RZWA 3VGBA 2E27H 1V7NL 2H32A 2NX5A 3RY6A 2YFZA 5C70A 3SOBL 5ISZE 4D8PA 4DEQA 4IOFC 3O3UN 1B4JH 2P24B 2H26B 2VUOA 5F96L 3T2OA 3SGEH 3QEUA 2D7MA 1MJUH 2IQAB 3F5WB 1MCCA 1D5ZA 3U4AA 4RFOH 5JMOA 4JFED 1XGUA 2ZUWA 3IDYB 1BM3L 4MAYC 5DR5H 4DN3L 4ZG1A 2RB8A 3JUYA 1Q9KB 1MFBH 1FVEB 5T3ZD 3BH8A 1KXQE 5I15H 1QUNA 3WCYA 3IDIA 3MV11 4F2MA 4Y8DC 5F9AC 1IGIH 2J1KA 2FB4L 5ISZD 4NT6A 4FFVC 5BJTA 4OZGA 3U7AA 4BZ1H 3VXQA 2BERA 1EEZB 1MIEH 4R3SA 5FGBC 5EZIH 3BSZH 2OTUA 3WF0A 1RZIA 1QACA 2Y36H 3LN4B 4PJAF 5E70A 4LP4A 2V7HA 5T3XE 2FBJH 3VWKC 3BDYH 5I16B 2DMCA 1V8HA 2A6KA 3LZFL 4HJJH 3DX8B 1A6UL 1U2CA 4MD0B 2X5PA 4KJPC 4LDOB 3FQXB 3P1IA 5BZDB 4X9IA 5F7FA 3RRQA 1KELH 2VXQL 3T0VA 4QRTB 4O02H 4HKBA 3ULUC 2V6HA 5BW7C 1MJ7H 2XZCH 3C5ZD 2QQOA 1XH3B 4NO5B 4ZO9A 4Z7UB 4YZFF 2A6DB 2YC4A 3IJYB 2BXYA 3LS4L 2HT4D 5T3XD 4Z8FL 1XF2A 5TE6L 1Q1JH 2XPGB 4LLYA 4XXDB 4KKBD 2YA1A 4Y4FD 4YC2B 3NJXA 4UDUA 3HG1D 5IBLC 2UYLB 1EFXA 4U1JB 4YDIL 1FL5B 4I77L 3LHPH 4FTVB 2XICA 5GRXG 3VDBA 1E4WH 4X6DF 3IFNH 3DSNA 1OAYL 2KL6A 2J1AA 3JTTA 3LPGA 4IRZL 1NGXA 3IFPB 1R5VA 3EYFA 4WFHE 3I2CL 3OKYA 2YKLH 2A9NH 3RUGB 3UYPA 4WW2B 4U1IB 1RPQA 1VFBA 4DEPB 2YPKB 5LBSL 4XCFH 1JV5A 3I2GA 3W2DH 5I8EB 1JU4A 1BOYA 5GSRA 3AROA 5C07E 1I1FB 2EO9A 3L3OB 3NAAH 4QHUB 3EFFA 1RJYB 1A21A 1D7FA 2WIMA 3C6LC 3VXRE 2X2YA 1FCCA 3QNYB 5IB3B 4UNTA 3NZ8A 3VH8A 3QWRD 3BPCA 4DKAA 3MCKA 5C7XL 2LV4A 3GSNH 4GUPA 2XKUA 1KBGH 4O2FB 4OD1L 3VA6A 3QDJB 4HQQH 3ULUH 5IWLC 3BZ4A 3W9EA 1GZQA 4GLRH 5C07D 5KW9H 5IR1B 1GGYA 1N2RB 3PQYD 1HOCA 3RGVB 4Y5YC 5DC0A 5GS3A 1EHXA 5AZEH 1U9KA 3GI9H 1RHFA 3BQUB 4OGZA 5K9OA 3VXRD 5MEOA 3QUZD 3D2UA 2EC8A 1KIRB 1I4FB 4ZODA 3LQAL 1JNNL 2Z0BA 5T33H 3QIUA 1KTDA 2FX8H 5DF0A 1T0NB 4QTHB 1R24A 1YY9C 1OGTA 5HBBA 1G0DA 3E8UH 2OTWB 4B7LA 2VWEE 2V7NB 4ZOEA 4HWZB 1NBVL 2ZNXA 1BLNA 4JPWH 4CUCA 4P3WA 1OLLA 3ZMRA 2DLEA 3ZTJG 3P11H 5I30L 4XPBH 2P5WB 5CJ5A 5C6TL 2VXTL 4M62L 3ME0A 3D0LA 3IIIA 4Z7VE 2KQNA 5EIIB 1GL4B 4M6OH 1SJXA 5T5NG 3IJHB 4QRUA 5DMYA 3U6RA 4TUJA 3QIBC 4HXBH 4Z95H 2GTWB 1JNHA 4TYUA 1OAQL 2AABH 4L8DB 5HHPB 3SO3B 5IB5A 4JY6A 3PWPE 1S8DB 4LPYA 5DO2C 1EPFA 1GOHA 4PREB 3DO7A 1S7SB 4O51B 2YA0A 3F12B 5I9QC 5LJYH 1UGNA 4N0YL 4HT1H 4H0IA 1G7LB 2EDBA 4JQXA 3IDNB 3TO2B 4DVRL 3O2DL 1U8PB 4QTIL 1TQCC 1IEBB 1HKLH 4BQ8A 1A7RL 5F8RC 5JHDE 1VENA 2NR6C 2P4AB 3KPSD 3S7GA 2AK1H 2XTLA 3GGLA 2Y8KA 4J1UA 3FTGA 4PJFE 3RVWD 3WSQH 4TVPD 4DGYL 1YNLL 3IU4L 4LQFL 4KVNL 4HKXA 4MA3A 3DV6B 4AG4L 4M43H 2Q87A 5I18L 3BUYA 1YQVH 3PWPD 3RNQB 5B8CB 1KEXA 4UT6L 2DKUA 3BN6A 2VZ1A 1E4KC 3O2WL 1WIPA 3HUJA 3PWVB 4QEGA 4AYFA 1QBMH 4NQDA 4TOYH 3T3MF 1DQQA 4DGVL 1DSFL 1VESA 2F58H 1MCBA 1GMMA 1NC4B 1IRAY 2VERN 3HNBM 2X4QA 4NDMA 3MCLH 5HPMA 1XF1A 5IFPA 1DVFC 1N8ZB 2HLFC 1A9EA 4JG1L 2DM2A 1WFUA 3RL1B 5JHDD 3L5IA 4NZRH 3V4PH 6FABH 5E4EC 2ZEXA 1B0RB 3MLRL 1KJVB 5DGQA 3QQ4A 4OUOA 2EDRA 1S5HB 1BJMA 3CVHA 3QO0B 4WO4D 2VMCA 3GMPA 3AS2A 4LPUA 4NQTA 3VFSB 3WJJA 1U3HD 4LSPH 5GIRA 5D1ZA 2IPTL 4ODTH 3MGAA 4KWUA 3T0DA 4Y89A 4OB5L 1MHPL 3GSVB 1QBBA 5DDHA 2XN9A 1G9MC 2D7TL 2IBZX 2G5BB 4KHXL 3EO0A 1DQLL 4HW6A 4DW2H 4A6YH 3NCMA 1KEMH 2UY6A 1GSMA 3S35X 2Y6KA 1O5DT 2E7BA 1X7QA 3KYNA 3HNVL 3V6FA 3B3IB 3VXOA 4BZ2L 4ZZ8A 4PJ8B 1JZ8A 4JFEA 4PJCA 3WXWH 3U9PH 3MYZA 4XCNB 3GRWL 4LSTH 3UTOA 1QFWI 2Q6WB 3LH2H 1ULPA 1LO0L 2C7UA 1QRKA 4ELKB 1PMHX 3B6SA 1ZE3C 2EEDA 5L7XH 3T4AB 1AO7E 4QX0A 1A7PH 4ZUUA 5AYUL 4MQXC 3T77B 4LIQE 3FT2A 4Z6AT 5ISZA 2H6PA 3BYTA 1HDMA 3PE9A 4JM2C 1CU4H 5EBLB 4YXKL 4CW1A 4JREC 5ALCH 1E4JA 2CRIA 4H88H 1PG7X 3ILPB 1DP0A 2ENYA 4M9PA 4ZAKC 4YNYB 3JWDH 3OKNB 3C5JA 2C3VA 3BOVA 1CI5A 1OAUH 2BMKA 1AQKL 2Z35A 4I0PB 3E6HB 5FB8B 2PO6B 3PIQB 4B0MM 1S5IH 1ZVYA 2FD6L 3O6FC 1AO7D 5T5FL 5TGBA 5HYSA 5ESAA 1FVCB 3IDXH 3BD4A 2JCCB 1ND0A 1ZAGA 4IRSD 5CD5D 1HE7A 1N5AA 4X98B 4POYA 1QO3A 5ALBL 3C5ZA 3FMGH 5EU3A 1FNSH 1TCRB 4FQCL 1OSZA 4Z7NF 2VXUH 4XNMB 3A67H 3FQTA 2ICEA 4R7DB 3PGFL 4N0UE 5KSBF 1PX3A 4Y4FA 4G9DA 3E1F1 4JPIB 5DJXB 5T5NF 3HG1A 1ORSA 4RWYH 1KIUA 1ZLVH 3PP3K 4RFEA 2ESVB 3UAJD 3QDMB 1K45A 4OD3H 4PRDA 1HWGB 3CZFB 4NM8H 3LE0A 4XVSL 5TDNB 4GW5B 1RIHL 3Q1SL 3ARBC 1SJVA 3MRNA 4XAWH 4MCZB 4P02B 3P0YH 2NZ9C 3WHXA 4YEEA 4GKSA 4OLYL 3SDXB 5C6WH 2VSCA 3ROLB 3SDCB 5TFSL 1MFAH 1F4YH 2IALA 1BF2A 3AM8A 4C83A 5EC1B 4K23L 1SVCP 4PJIF 2AJ3B 3V8OA 1KTRL 4F58L 5IKCB 2BJML 4Z7WB 1HWHB 2X1OA 4WI8A 4A3ZA 5C9JA 4Y4KB 1NBZA 3O9WC 3ZDYF 3WV0A 3IGAB 4GRLD 1RFDH 1XCTB 3QWRA 4MGXA 5ABDE 3L3GA 1A64A 1K4CA 4LMQI 2WUBH 4CADB 2A73B 2GJ6D 1UWEH 4E0RA 5CSBA 3RDTD 4YIQB 1W72H 4G7YH 2F19H 3UC0L 5SWQB 4KK6D 3R1GH 5D2LF 8FABB 5C07A 3B43A 3PQYA 1IM3B 3PGCB 4I18A 5F97E 2VMFA 5CP3A 4UV7L 4H20H 1BX2B 3GSQA 2AXHA 3QUZA 3VXRA 1BQHA 1T20B 3HC4L 3M45A 3K2MC 5CCKL 1WCBA 2KQMA 2YPLB 2Z91A 1FFNA 1BOGB 4NN6B 5I1IL 1OB1A 1NDMB 2JJUA 5AZ2L 1ZLVK 4BSVA 3UO1L 1KPVB 1RIUH 3VXNB 2HRPL 5F7WC 2DQUH 4PJAE 4JHAH 3KPMB 2EDYA 1AXTH 4BQ9A 3U9UA 2GITB 3QBTB 2J6EL 1ONQA 3AB0C 5SWSD 4LMQE 1KN2H 1R3LA 2BHZA 5DFVD 5FA4A 4ALAH 3L5HA 4OIIL 3KYKL 1I8IA 3IRPX 4LVOB 4YHLH 5F7EH 1MWAA 3U7WH 3UTTB 4KRPB 3WQBA 1FIEA 2HWZH 3NFSH 4HUKB 2VDPH 3O41B 2WBJB 4YBHA 4QXGH 1F6AB 1MCHA 4QO1A 4YEFA 5GXBB 4ZS6D 1OP5H 3KLHD 1O0VA 1ZWIA 3OX8A 1N6QH 2DLFL 3BIKB 4LLVB 2HG5B 1DL7L 3U30B 1T2JA 1IFHH 4N8VB 1AFVL 1XGPB 3UJJH 4OTXH 1WWWX 3QDAA 3QH3B 5D1QD 2DMBA 3TWCH 1R0AL 3F58H 1FO0L 1P1ZB 1U93B 1RURH 3RHWK 4I3GA 4HWNA 5CJOL 5CZVL 4N0CC 1JZ2A 3KPSA 4LPWA 2Q3AA 4Z7VA 1BVKB 1DDHB 4WENB 4HGWB 1V7ML 1I9RH 5JR2A 1BIIB 1YN7B 4KJWC 4LF3B 4OGYH 4JQIL 3LD8C 2PTVA 3PWPA 3D69A 3BAEH 3RWCA 4PGJA 4CNIB 1G9ML 5C2BH 1S7WB 2F5AH 3GBMH 1ZXQA 1TZIA 1X5XA 3X12B 4FQJL 5D71H 4O2EB 2J3SA 3V0AC 4KQ3L 4LCWE 2VNCA 3KS0J 2X10A 3HNMA 4UNUA 4Y5VB 2L0DA 1HHGB 1G6RH 1LE5B 1T1XA 1UZ8B 4R97B 4KH2A 4RAUA 5C0DB 5JHDA 2C4FU 1A7QH 4HUUB 2GFBB 3KJ4B 4NFBA 5E99L 1JCKA 3TM6A 1SEBB 2VDKL 5GRWA 2DQFB 3GJFA 5GRJH 4YHOH 5FUCC 4IMLA 5T1MA 2JE8A 1JNJA 4UUJA 5KZCB 4WO4A 2AI0L 4PRPB 4Q2ZA 1MCNA 1FNLA 1U3HA 3EDFA 1MVUA 2FYYB 4FXKA 3HCVA 3V5DA 4CGTA 4IM8A 4ETYA 3EDKA 3RZCC 4LCWD 2ZUXA 4KUCF 2DICA 3TT3H 2CUIA 3MV9E 3L3HA 4KDTA 3VXUD 4X4YA 1HZHH 4L9LC 1OP9A 4L4VE 4X7DC 3DIFA 4YHMH 1T66C 2NMSA 4B50A 3VWJC 5L8KB 3HZMA 1PQZB 4NHUA 1WBZB 1VACB 3FN0H 4OCRH 1OTTC 4CUBA 1WITA 4QYOA 4IOIB 4KMTH 4Z78A 2O61A 3X14A 1QYGH 3GMLA 1N59B 4YDLC 4LPTA 2WANA 3BMWA 3DMMB 5JQHC 1NPUA 3I6KB 4S2SB 3U7YH 4KK8C 1PYWB 3MRGA 5DRXB 2EDEA 2DTSA 3U0TA 4Z7QE 1OM3H 1OSPH 4POUB 3MYJB 4X6CB 2W65A 5CBEB 1G7PB 4OUEA 3KS0H 4BSWB 1MRDH 3QDGB 3ROOA 3PUIA 3MLXH 5C0BE 1UM5L 5E8DL 4MAYB 2CXGA 4NFCA 4M6ML 2V2XA 3N9GH 3ARDD 3I6GA 3S5LG 4KK9D 1DFBH 3QCVL 4QY8A 4NPYA 1XGQB 3OL2A 1VB9A 4XXCA 2DQIH 1AHWA 5FV2A 3VXME 3CFBA 1W0NA 3QCUL 1BP3B 4DK3A 4H5SA 4PB9H 3RX5A 3KNBA 4HKJA 1C5CH 1UKQA 1WZ1H 1MFDL 4R4ND 5FKAB 4OZHF 1MPAH 5J13B 3BN9D 3WE6B 1AO7A 4CUAA 2WV3A 1CDGA 2R0LL 3EUUA 4OGXH 1AJ7L 4UILL 4IRSA 5CMAA 4OCNC 3PXJA 1KN4L 5ANMB 5C0BD 2GJZA 3T0EB 5JIHA 3OAUL 1W0YT 4Q0XL 5DI8A 5EOCJ 2GAZB 2LVEA 4PJ9D 3DO3A 1ZLWH 4CJ0A 4I8DA 2NY7H 4WUUB 2IBZY 1J12A 4DAGL 3X11A 5J6GA 1ULOA 3VXMD 3R8QA 5F6HI 3ULVC 4ONGH 5JZ7D 3FQRA 4HWEH 2VMDA 2J8UF 4QHKJ 3ILQC 4O00A 4BSJA 2VITA 4MZ2A 2BVOB 4JRXB 1BBDH 1JHKH 4YHKL 5C0FB 2GTZA 3EYVB 5B3NA 2JELH 4QB6A 5IJKC 5GISL 1ZHLA 3MO1B 4K3JH 3MO4A 1FRGH 1AD9A 5D7KE 4YHYB 4MS8C 4N0UA 2VDRL 2FJHB 3ARFC 5FGRA 4CVZA 3IDGA 5D6DC 2ZCHH 1JF5A 2CUHA 3L9RB 4GRLA 3QO1A 2F5BL 3FHQA 1U6AH 1VCAA 3MREA 1W0VA 2ITDB 5KVGL 5BO1L 4QDRA 4GMTL 3ACHA 3D25A 2GJ6A 5AUMB 3RDTA 3H3PH 2X1QA 3A6OA 5INCA 5KS9B 5ICXA 5JNYA 4N8CL 4YDKL 4YLQT 1T3FB 1GYAA 1EEYA 2E9JA 2LW8A 3C6LB 4B41A 3N85L 2WIIA 5EOCH 3T1WA 3E3QE 4HJ0D 4F8QA 3FCTA 3VG0H 1MCRA 3L1OH 5D7KD 3BHBA 1X4XA 3H3BC 4RX4D 5IMOB 3U2SA 1IGYB 1WBXB 3TZVD 2UVEA 4PJEB 1W9WA 3CZUA 4RGMC 5EBWA 1R3KA 2YD8A 5DMKA 1A4JA 4RMTA 4NKDA 2DN7A 1SQ2N 3T04D 4NN5B 3VFMB 3ULVH 1WWBX 3LRSB 3TBYB 4PUBL 1KTLA 4HH8A 4JO4H 4DUVA 1EX0A 3MA7A 3THML 5GGVY 4ZO7A 1I85A 5CEZE 4XUTA 4M5ZH 2DIAA 3VFWB 4XRCB 3VFRA 1RUKL 2P42B 4Y5YB 4CVUA 4PGDB 4X6FB 1V3JA 2CH8A 4M61A 4R26H 2EZ0C 5DC9B 1CZ8H 3SGEI 2DBJA 4G8FB 1Q9WB 4Y4HD 5GGUA 3I3DA 5SWSA 2XI9A 3BO8A 4ZXEA 1UJ3A 5GS2H 1H3UA 1X6LA 1DBKL 3BESR 4U6YB 1Q0XH 3W39B 5EC2B 1SEQH 1BD2E 2R39A 2RGSA 4P5TD 1TTFA 5DRZB 4Q7DA 4MJ6A 5HHQA 4LCIH 4LDLB 3MLUH 3OXRA 4OMCA 3C09C 3RBSA 1UZ6F 2I5YL 1IC4H 4U6XB 5FAAA 5CEZD 2EDNA 4Z7NE 3IJSA 5F9DC 4P4KC 3JV5A 4LASH 2VC2L 4PJAA 2EIBA 4J3WA 5DYOB 4XC3H 3E2HC 4MWFA 4PJBE 5KSBE 4WUKH 5C0IB 5D1QA 3T65A 2XV6B 4BYHA 3BGFC 5GZOD 2BY1A 3L7FA 2C1PA 1CK0H 1I8LC 3UEZA 3C2SA 3PABA 4ZYKA 2VR9A 4I2XA 5INDB 2KD7A 3QIBB 1BD2D 1I9JL 4QCIA 3P4LA 3THCA 4HDIB 3I02A 5F1OB 1BGXH 4MX7B 4KTDL 5F7LB 1YDPB 2VZQA 1CTNA 2FJGA 3FN9A 2A6IB 2CKBH 2X1XR 4PJ5E 3G5VB 4NJ9H 5LCVL 1KPUB 3PDGA 4FQQB 1LO4L 4ZTOL 1CGYA 3UPCA 2BSTA 5JORB 5GSVB 2JB6B 2BCKB 2OSLB 3HAEA 4G42A 4U7MA 1G84A 2D4DA 1D6VL 3SOBH 4OM0L 1T1ZA 3TV3L 3OV6A 3H9SB 1I3GL 4UB0L 3N1GC 3PWUB 4X6DA 4X6BA 5CKGA 4PGEB 1MELA 4ELME 1KCSL 2G9HA 5HY9A 2YWZA 2YZ8A 5DJ0A 4IDJL 1A7OH 1X4ZA 2IC2A 2P5EE 3ARVA 3MMEB 5D2LE 5I71C 1FZKB 1DBBL 4XWOD 5J11C 3ZO0A 3DYOA 4PJ5D 3MUGB 1TZGH 3WLBA 2J5LC 3L95A 1DVFB 3OBAA 4PYHA 4XNQA 4OAWB 4LCWA 5FA3B 3DNKA 5IVXF 3VXUA 5L9DL 1FO0B 1P2CB 5E4EB 1NAML 2DI7A 5HGDA 4UIKH 5DMGC 5E8NA 4KROC 3QRGL 5I8KH 2A83B 4XZUG 4JM4H 2IH3B 1QLFA 1BAFH 3IFLH 2AEPL 2CLRA 3MRMA 5DS8B 2P5ED 5T1KD 1D7PM 1LEKA 5GGSB 4BKLA 4ZTPL 1UQSB 3B8SA 2VQ1A 3B9KC 1T2XA 2VXQH 2CDGA 5AEAA 1T6VN 3UETA 4ARYA 4GLRI 3ZZ1A 4ODWB 3M1BA 4OQTA 2J2ZA 5DEFB 5GRVL 3C8HA 5L8JB 1J87A 4MB4A 1EVUA 3HMXL 3RVXC 2H9GB 2BSRB 4AENA 4P5MA 4QOKE 2EDQA 3OXSB 3ARDA 1GPOL 3GMQB 2PW2B 3RY5A 3P4OA 2IFFH 2R4RL 1ZHKB 3MBEB 3D3VE 2V5DA 2E5EA 3CH8A 1LEIB 4KV5F 1T04A 3TFKD 3BGMB 1RUPL 3AUVA 4Y5XC 1I5PA 1XFPA 1OAYH 3LVEA 1JZ7A 4XNXL 3I2CH 3HE6B 5EUOE 1TJHH 1YNTB 2YUZA 4LU5L 1JNLL 4XNZC 4PJXB 1CLYL 1LO2H 5C0BA 4GWIA 1CFQB 3LKNB 4NGHH 3O6KH 4QOKD 4U1MA 3UTPE 4PV9B 4PJ9A 1K85A 3ULUE 1JGLH 2LFGA 1GZPA 2OXGA 3GM8A 2EDOA 3NFPB 4PRIE 3D3VD 3QDHA 1FYTB 4OFPA 3VXMA 4MXQC 4WVRA 1QEWA 5D70H 3CDZB 3O6FB 4DZBA 1G7QA 5JW3L 3CPLA 5EUKA 4K7PL 2LS6A 2R7EB 1WC7B 2Y5TB 1ACYL 1IQDA 2R2HB 2XXMB 3DX9B 4NRYB 1MY7A 3NQHA 5DRNA 1QSEE 3QIWC 2AV1A 1T0MA 3LKRB 5FKPB 4NO0D 5ICYB 5EO9B 3CX5J 2R69H 4K3DL 4TSCH 1EHNA 2Z31C 1CGSH 3UTPD 4F33B 2VLLA 4KAQH 5DUBA 3FT4A 2H8PB 4IRJD 5FDWB 4HD9A 1TJGH 1OTSC 4G7VL 2V9TA 1GC1L 4PRID 2HFFA 2E6QA 4NQXA 1AGCB 1FL6B 3B9VA 1A1OA 2Y7QB 3ARBB 1EJOL 2Q8BH 1L6XA 2ZG2A 2C3XA 5EH1A 3HZVA 1IEAB 1KB9J 5BRZE 3W0WE 2DCKA 5TH2B 1I7ZA 4FXGB 4WW1B 3CC5B 4X5WA 1QSED 3SE9L 5B38G 4S11A 1HQRA 3QJFA 5E24E 1R3JA 4LLWA 4U4BA 2VZOA 3OEAA 1EMTL 1KEGL 4UV4H 4NN7C 2ZUSA 3O9WB 1A6TA 2VXTH 4RX4A 1L7IL 3TZVA 5IHUL 1P84K 3Q6FA 2IBGA 4KUCD 1IGTB 2OK0H 4J6RL 5DJAB 3VW3L 3B2VL 2PTTA 4L3EB 3FB8A 1RUAL 1M4KA 3FJTA 1FNFA 3CFCL 4LNRA 4X0KA 2Y07L 2EKSB 5CSZA 3VMOA 2HT2C 5HGBA 1SY6A 2DYPB 3MGTA 5BRZD 1NCDH 4FQXC 1OT5A 4Q6IA 1FAIL 3OKKB 2D0GA 3TA3B 1T2QH 4G5ZH 3OHXA 2VCBA 4P4RB 5FO9B 3O3AA 1G7IB 5C0RL 5H37H 3G5YB 3BPNC 5D93C 1FH5L 1BZ7B 4MNGE 4Y4HA 3RWFB 4MD4A 3EOAB 3O2DH 5JIKA 3SKMB 3I84A 5ICZB 2DLHA 4EVNB 3KPOA 5CEXA 4G8GE 5KAQF 1XCQA 4JO2L 5JLZA 4FQHB 2DWDB 4LLAA 4NUGL 3IU4H 3L3IA 4P5TA 4AG4H 4UQ3B 4JZOA 2IADA 4LSQH 3MJ9L 5DD0L 5HYEA 1HHHB 1A6ZA 1WICA 4POZC 3SBWC 2WUHA 1S7TB 3IU3B 5BOPA 5BV7C 3UZQA 2XZAL 5JPNA 3AB0B 1DSFH 1CZVA 4J3VA 4OZOA 3V79C 3QCTL 2I60L 1YY9D 3WKMH 1EAPA 2HYXA 4YUEH 3D87B 4XVUD 2LE9A 2P8LA 2I07A 5JDSB 4FFWC 1WAAF 2MTPA 1A5FL 2J8UE 2D03H 3MLTB 5DJCB 4L8SA 3B5HA 2K1MA 1CQYA 1IBGL 1OAZH 3NN8A 4G8GD 4JR9L 2ZOKA 4OLZL 3VI3F 5I1HH 1BD2A 1UC6A 4A45A 4QRPE 2XOTA 4DKDC 3MLRH 1KCVL 3C8KB 1YPZB 4NC2B 2VZRA 2DAVA 3NCFB 4HC1H 1L0XA 1QKZL 2OP4L 4Y16D 1N0LA 5MEPB 4TTDD 3MV01 4OCXL 3Q6GH 4XUNA 5KSBA 2YD2A 4PRNB 5LXGL 2D7TH 5ID1A 1IMHC 4LKSA 3X3GH 1XT5A 1A1MB 5H2BA 3CK0H 1UVQB 2AJZA 3QPQD 4RZCA 1UA6L 3VFVB 1AKJD 5EU6B 5A40E 3MLZL 4OZFH 4YE4H 3HNVH 5IV2B 4QRPD 4LRIC 3BD5A 1GGBH 5HDQL 2O26U 1DE4B 4U49A 3U82B 3VGAC 2ZKHH 3EJYC 5MENE 2EYSB 1U8IA 2Z8SA 2BSSB 4X7EC 43CAB 2HLAA 4MJ5B 4PJ5A 1YJDL 4PJIA 4NWTL 2XFXB 4ZUWB 1S9YB 4WNQA 1N0XH 1YMHA 2AQ2A 4H25B 5D2NB 4I5BA 1FL3A 1JF1B 4YX2L 1TETL 2ADIA 1M1SA 4JKKA 5GS1C 4LHUB 2XZQH 4XNUL 4Q9BA 3UDWA 4OZIF 1S7VA 1X5IA 2VN7A 3GMRB 4YBLC 2OZ4L 2VDLH 3BEVB 4P2CG 1LMKA 4OSUL 5DTFB 5ENWB 3V6OC 2IJ0C 3CSYB 3UBXB 2L7UA 3DARA 3SY0B 4LLDB 4BQ6A 4WIQA 4F7CA 2QHRL 1M05A 2P5EA 4LBEB 4ESKA 5ID0A 5MEND 5T1KA 4D0CA 4EOWL 5D2LA 3ECBB 3QUML 1M7DB 1P53A 4PLKC 3RZCB 4G80A 3CMOL 2V5YA 3NOIA 1EBPA 1ZT7B 3ULSA 4L9LB 5GGTH 2WNGA 5T5FH 1QHOA 4ODSL 3GGWB 3VFPA 3VWJB 4YGVB 4QDQA 4HUWB 1JPSL 5HYQA 5IVNA 5ALBH 4HIJA 4LCYB 5MEQA 4HIXL 1YEGH 3UESA 5JIIA 1Z3GH 5ADOH 4LSSH 2M26A 2PXYB 5HD8C 1QHPA 4YDLB 1KOAA 3IFOA 2A0LD 4YWGL 5AYQA 1HH9B 1OLZA 4X9HA 3QI9B 1NKOA 3TPUA 1ZA3B 4ZFZA 1L6ZA 1VEOA 2ORBL 5JO5B 1KJMA 1A9BB 2JCCF 4WWKC 3Q1SH 2NY3D 2YPVL 4PJDF 5C0AB 3DROB 3MBXL 4S1DC 3DX6A 5IT2L 3FZUC 2GQHA 4OLYH 3DSFH 1QSVA 4NQCB 1JWSA 1QSFB 3FKUS 1WSST 8CGTA 1NAMB 2GW5A 1BMGA 3NCEB 4QOKA 3TBVB 4MCYA 1DEEB 4K23H 4BK5A 1KGCE 1AXSB 2DLIA 4F58H 5HI5D 2AW2A 5DMIH 2VB5A 3D3VA 3H0TA 1HXYB 5KANG 4JEGB 1RUMH 2DL2A 4JANA 2VE6B 3VXTB 1CVRA 1E4XL 5E8PB 4OI7A 1WFOA 3I2FA 5FYKU 3O4OB 3A6BL 4E8DA 3OJVC 4ZAKD 5C09E 1K4DA 5B4XA 1JZ3A 1EIBA 1JWMB 5C08E 4DZ8A 1XZ0B 3AS1A 5H37G 2R29L 1HSAB 3WIFB 1KUMA 1LE9B 3H9YA 3HI5L 4UBDD 4P9HC 3SJVB 1OTUD 4NO0A 5EFIA 3BDXA 2X7LB 4E8CA 3GSNA 1CGTA 1CIUA 4YXHL 3VGFA 2GEEA 5IQ7L 2VDML 4XVJL 1YEJH 4IRJA 1UWGH 5I1KH 1KGCD 1JRHL 4PRIA 3QWOB 2IMNA 4CMMA 2XTJB 2ARJA 4HUXA 3BWUC 4HF5H 5DMJB 3MRFA 5HI3C 3BXNB 3IXAB 1I7TA 3NFNB 5GQBA 2HJKB 5IVXE 5I1CL 3S4SG 1MRCL 4F7EA 1CXHA 1KNOB 5I1IH 1UYZA 2W9LA 3LOWA 3IKKA 5C09D 1FJ1B 5DHXB 4BJLA 3DGCR 1RZ8A 4JPVL 4ZPTA 3SGJA 1IGFL 5D7IB 3D18B 5KG9A 1HILB 1MUJA 1QSEA 2R9HD 3RAJL 2F8OA 5KSAD 3RL2B 1T4KA 1U41A 2I9TA 1DJSA 2R1WB 2ATPA 2BNRE 4OCMC 3LY6A 4NUJA 4L5FH 2DDQH 4YPGB 3UTQB 1NLDL 3HFML 5D1XD 1H0DA 4PGCB 1XIWB 1KB5L 2PYFB 5BOZG 2W5FA 1HHJA 1NCWL 2YG0A 3PP4H 5BRZA 4KZEL 1Z9SA 2VMEA 2D0HA 2DLFH 3VI4F 4MYWB 2OI9C 3VGEA 2PYEB 4LQ1A 5B38B 1DL7H 3HHRB 5I8OL 1M6OB 2FL5B 4OZFG 4X9FA 2W46A 3T1FA 1FFPA 4P9HH 3ZLQC 4RGMB 1S9VB 1R0AH 3HS0A 1FO0H 2F8XC 3RY6C 1KT2B 2EYRA 3T2QA 3EGSB 4XCYA 3OG4B 1V7MH 5D5MF 4PY8I 1QBLL 3SPVA 1FIGH 2H1PL 2MHAA 5F1NB 5HVHC 4ZSOE 4HKZB 5TDOA 5JMOC 3BRDA 4XI5C 4XHJC 3GSWB 4LPCA 4N9OB 4U0RC 3QUKA 5J6HB 2R8SL 1XC6A 2OJEA 3CIHA 5C3TA 1X5KA 3MV8B 1YN6A 4GSDH 4NZJA 4KQ3H 4R2GD 4FG6D 3HLAB 5GGQL 1GAFH 1TQBB 2DJ4A 5IW3A 1S7RB 4ZFGL 1PKOA 4YHPB 2ZG1A 4PTTA 4G8GA 3O4LB 4P3CL 4YAQB 3RWEA 2ZJSH 4YK4C 3LDBB 3SO5A 4GRWB 2GIYA 3C09B 3L6FB 4Z76B 1VFAB 3RI5F 4AIOA 1ZKAA 1J8HE 4P2OB 4KTEL 5IP4A 3VG9B 2BRRL 3HRZA 3E2HB 4Y16A 3S34L 4ZQKB 5EPMB 4OFYD 5J1AB 1T21B 2AQ1A 5HGHB 1NBYA 4PB0L 4WI4A 3BGFB 4RMUA 2LTQB 1DN0A 2IQ9H 1AP2A 3OB8A 5IHZB 4XPFL 1UXWA 3ZDZF 4N5ED 3RNKA 3LPWA 3QHZL 3PL6D 2J8UA 3I9GL 3TN0B 4ARXA 2NNAA 4JFYA 3UJIL 1AD0B 1AKJA 2RVAA 3LKQA 1GGUA 5IMKB 3AVEA 2XWTB 4QRPA 3V6Z