2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
4KJQC 1I1AC 4Q9BA 1SHWB 4LSTH 4X5LA 1Y0LB 2DMKA 4JR9L 5ANMA 3RWFB 4LAQH 5T1LD 2BNQA 4OGYL 5T1KB 1RUKH 1U36A 2BVOB 3WHE1 1IGFH 2VXTL 4FA8A 3GZKA 4JQXA 5LWYL 1YQ2A 4QXTB 1C5BL 4QHMB 5T3ZH 2VC2L 1BFOB 1MVUB 2YHGA 3HRZA 4IDLA 1H3TA 3DVFA 1G9NC 2GJ6D 4PJ9B 4UQ2A 3TVMA 3U82B 5C09D 5IP4A 4F2MA 1LO0L 4I3RH 2OCFD 3LY6A 4YHIB 2R39A 2X44D 1L4IA 1MCEA 3GMMB 4LLQB 4PJHF 3GBMH 3SDXF 3H0TA 3MOBH 4UAOC 5IWLC 3V4PH 5AZ2L 2D7NA 3I3DA 1KEXA 1I1CA 4MAYC 4M7LT 1NGZB 2F58H 4XVJH 1LMKA 2JLLA 5DHVB 3KPOB 5EN2A 2E6QA 3UXFA 1MWAA 2N7AA 3CZUA 3VE0A 3O2DL 3UZQA 1ZHNA 3JVGA 3AU1A 5IB4A 3D9AL 3IDMA 4D0CB 1VGEL 4JN2A 3QDGA 3RA7L 4PG2A 4R4FH 3A67L 3QUYB 4RMQA 1MNUH 3MMEA 1FH5H 3VWKA 3THCA 4Y2DC 5HDOA 4OGAC 4AG4H 1X5IA 1XGRA 1X6LA 2ZKHH 1R0AH 1URLA 4DGVL 4PTUA 3UTZA 4UINH 1OGAA 1QNZH 3OF6A 2BDNL 1T0MA 1JWSB 2DL9A 2VLLA 3GRWL 4XBEH 2VXUL 3K4AA 4FFVC 2AK1L 1CGXA 4RQQA 4M5ZL 3Q2CA 5FFLA 1LO5B 5IK3A 5JW5A 4AM0A 4GT7A 1BPVA 1MIEH 4HUXA 3D18A 1MCCA 1K12A 1LK3H 3HI5H 4MGQA 5EO1B 3VH8B 2ZPKH 5B39A 1JUFA 5DC0A 2Z91A 4PRAA 3STLA 3O3AA 5GRVK 2P49B 4JPVH 4OKVA 1Q9WA 5AD0A 2YD7A 2KZWA 3C5ZD 1NGPH 4AQ1B 4XBPB 4ETYA 4L8SC 4PJEF 3JV6B 4HUUB 1ES0B 5LXGH 4PRID 4MZ2A 5IVZA 1UB6A 3L95B 3F12A 4IOSD 2Z31D 3W9DA 5IIEA 2LS6A 1QACA 2J8UB 5SX4I 5FHAL 3GMOB 5E1AA 2AEIT 4F58L 2F8XC 5FIEA 3VI3F 4JG1H 3AB0C 2OR8A 5MEPA 5B38G 3RVXD 5J89A 2MQ3A 3W2DL 3OB0K 1QVOB 2FJGA 3KYOA 4ZOEA 2A6JB 1FDLL 5FUIA 1IM9B 3D2UA 1DN2A 3LN5B 1I7TA 5I1IH 1A7PH 3ZL4H 3WIIL 3DIFB 2BY1A 3QNZB 3O81A 5DK0A 3RY6C 4UQ3B 1O8PA 2VH5H 3DYOA 1CZSA 5MP6L 4EXPX 4HK0A 1T7ZA 1CU4L 2CLVB 3SKJE 3I2IA 1CFVH 3QI9A 3LRSB 1T6WA 4Y8AA 1IGJB 1BD2A 5HVHB 1IE5A 4OM1L 3QA3B 3MLUH 3IU4L 4QHNA 5CILL 4I13B 1MLBB 5JXEA 1ZVHA 3I75A 3GKWH 5BW7C 3ZKNC 5IOPA 2Z4FA 1MIMH 5ALBL 5T1KD 2FATH 5FKAB 2EC9T 5DMIL 4IRJB 1JWMA 5JXGA 2WV3A 5DRWB 2UZIH 5ETUA 3TESA 4N8CL 3G6JE 5JR1H 2XTJC 3DX8B 1J1OH 1TVGA 4J1UB 2CUHA 2HT3C 4WU7A 2VQ1A 5JPNB 4S0TD 2OX5A 2YKLL 2OZ4L 4RGOL 1IQDB 3HTLX 4BJLA 5EU4B 2IQ9L 4U6VH 3DGGB 3WNNA 1JN6B 1UM4H 5DVKA 2QQOA 3LS5L 1XGYL 4XP6H 2F15A 3SDDD 1EVUA 1YNKH 2Q20A 3B6SB 7FABL 2J1RA 2YUVA 4OAWA 1MH5B 2ZOKA 1QSEB 3PGFL 4L9DA 3WFZA 8CGTA 2CQVA 1HCFX 5HI4C 1QSVA 4ODWA 4Z7WB 4C59B 5BOPA 3ZKMC 4C57C 4O2EB 2P8LB 5DO2D 4PJ7B 2VZPA 4KC3B 3I2CH 4X7TB 3REWA 1KXVC 4BFIB 1TG7A 3DPBA 2Y5EA 2GYSA 3CK0L 4LBEB 1V3KA 3WF2A 1YUHB 3D1MC 1BOGB 3AAZB 3QUML 4JRYA 5JPMB 1BMGA 3X14A 1YZZA 1F4YL 1VB9A 4JFQB 3DJ9A 3I50H 3OKKB 4GW5A 4NRYB 2UUDH 3RU8H 3VXSB 1RMFL 1WZKA 3QXDB 3VXNB 2BFVL 5D7IF 1UH2A 1F2QA 3UTTB 5C3LD 4WW1B 1Q9OA 4JPWH 5E8PB 1UG9A 3PABA 4P49A 3RRQA 4PRNB 2LVCA 5FM8A 2WANA 1H3XA 1OAUL 2YWYA 3T65A 5BV7B 5I0ZA 3DV4A 3WLBA 5CCKL 5I74B 1BGXL 5I73B 2R9HC 4P23C 4U3XA 2DQEH 5BVPL 3VXUB 4FQQA 4MJID 1IT9L 2XY1A 4AEHL 1G6RH 2FYYB 1U8HB 2BVQB 5CIPA 3A21A 5DGRA 2QHRH 3EYVA 4X4ME 1U6AL 2W1WA 3RTQD 3SKJH 1IQWH 1WSST 4F3FB 1D5ZB 1GGCL 4OD3L 2HJLB 2XRAH 1E27B 4MJIE 1A6WL 4KQ3H 3QIBC 4AL8L 5L6YH 4H88H 5EOCJ 1FZMA 1TVHB 2VZ1A 3U2SB 1ZLUH 1IM9D 3CFCH 1MFDL 3SJVB 3OG6B 2AS5M 1I5PA 3HPLB 4K71C 5C0GA 3BP5B 4L8BA 3RNQA 4FI9A 1P69B 3MNWA 2IC2A 2VXSL 4XVSH 4C83B 5BS0B 4QX1A 3GSWB 3IXTA 4LVOC 4U6HB 1ZHKA 1YN6A 1OP3H 1RUPH 4Z78A 1CGTA 4GG6F 5TQ0L 1NL0L 2WO2A 4HIIB 2XWJA 3S88H 1YECL 3KPSB 3C8KB 5ESQA 5D7SL 1FRGH 1OARH 4J4PD 1MRDH 3REVB 2ERJB 4NQDB 3DURB 4DVBB 1WFOA 3OJVC 2B4KA 2C4FT 3HB3D 4ODSL 5ITBL 4JFFA 1KNOB 4HQQL 4WY7L 1CCZA 2NXZD 4MD5A 5T33H 4WWID 1SEQL 2ORBH 4UT9L 4G8EA 3MV7A 3KNBA 1UEMA 4OIBA 2W9EL 2C26A 2E9BA 5TH2A 1M05A 4S1RH 5F3BB 4NM8L 1QBML 1QP1A 4JHWH 2CR3A 4LSDA 4KJWC 1GIGH 5GZOD 4X6CA 5KSBA 3PXJA 3RDTB 3VFMA 1A5FL 4H20H 4IS6B 2X4NB 1FYTA 4OD2A 1RHFA 3L3HA 3NH7H 5ADPL 5I1KH 3KPLA 1RJLA 1NAMH 5BJTA 2QKIB 1E28A 1FNFA 3ETBF 4EEEA 4PV8A 1KLUA 2XN9A 1EMTL 4XP9L 4KH2A 3T77A 4WEBL 1JZ5A 3MFFB 4GBXA 4PUBH 5DJXA 4RIRA 5L88L 1A6PA 4P46C 4QNPE 3SO5A 4JN1L 1NC2D 3GSRA 3ZDXF 4NRXA 3L3IB 4NP4H 3TYFB 1O5DT 3BZ4B 3TBSA 4LGSB 4MJ6A 4XRCB 1GU3A 3ZKQD 4AAXA 1IGYB 4LU5L 5BCAA 1OT1A 4A6YA 3DX9B 3VXSD 3ARVA 3S98A 1PKOA 3TBTB 3QXUA 3O45A 5DJ6A 5DJCB 5GGTL 5DD1L 3V79C 3PDDA 3VXMD 1A6TA 1Q1JH 4IMLB 5EG6C 3VXSE 5IFHH 1NKOA 1NCAH 3ZKXB 4TSCH 4GRWH 4KK6D 4FTVB 3PGCB 3CJJA 4R2GC 1YC7A 5I1LA 1HOCA 3UTTE 1F13A 2AABL 1PX4A 5IV2B 2DLEA 4UZGA 3PIQB 4DGIL 3VG0L 3VXME 4L4TB 1EFQA 1FORH 2HKHH 3FFDA 4GLRH 2L9LA 4F7TB 2IBBA 4MCZB 5DD6B 2R4SL 3IF1A 1DQJB 4HIEA 3V0WL 4H1LA 4R96A 3S5LA 1YQVL 3SKMB 3CVIH 5M94B 1QPPA 4HS3B 2AVGA 3NABH 5HXMA 1F2XK 2VLRA 4Y4KC 5D8JH 5B22A 5C0RL 4PJHB 3SDXB 3PHOB 4M03A 4ZO9A 3B9VA 5KVFL 1CYGA 5IMLB 1VPOH 3OR7A 5F70A 3PWJA 4CMMA 1H3PH 3LKQB 4NO0D 1KPUB 2Y6JA 3VXTA 3SJVE 1CFSB 1LILA 4HC1H 1S9WA 5CP7A 2JB6B 1TZHA 2Q6WB 2YBRB 3T8XB 3BZFA 3KPSD 3QJHA 4S11A 5LGJA 4Z0BH 4NQDD 3VD9A 4Y8DC 4TUJB 4FFZH 4BSWB 3F7RA 1TXKA 3QQ9D 4RFEB 3QQ4A 3TNMA 3S37H 3SQBA 1BZ7B 1FBIH 3UDWC 5C3TA 3KPSE 5K93A 5IT2H 2GTWA 1I7RA 1VFOA 1KEGL 2UY7A 4NQDE 1UACL 2WLYA 1ZS8A 4URTB 4WU5A 3OKEB 2FO1A 3LKOA 4PRPD 1HSBB 2A83B 3SO3C 4ODVH 4Q9RH 4G6AC 3C7HA 1BZ9B 1FFQA 2FD6L 1MCOL 5DUML 4S1QH 2ARJA 2Z8RA 1KB5H 3WEXA 1AKJB 4HPOH 4O02L 5LCWL 3DMMD 4PRPE 4GMSH 1DP0A 3KYAA 1TZGH 4CN1A 4PJEB 2OTPA 1J10A 1I7UB 4NZRL 2CRZA 4JO4H 2AXGA 1JZ8A 4P4KC 4RDQF 2XI9A 3BFOA 1DQTA 1RD6A 2CK0H 3P77A 3VJ6B 3BE1H 5L9DH 2DWDA 5EZLB 3MUJA 1CXEA 4XMKH 3DROA 3DOSA 2DQGL 4PGDA 3GSUA 5SWQA 1DBML 2DQHL 1FL3B 2A6KA 4DEPB 3LZFH 1FAIH 3HCVA 4N1CA 4JY5L 4X83A 4JDVB 2BSTB 4RX4D 1X5HA 4POZD 1X44A 3ULUF 1EDQA 3G5YA 5C0CD 3AGVA 4YDKL 2BNRB 4CNIB 2G75B 5GGRA 4CU8A 3JWDC 1K4DA 1RULL 4LP5A 1TVBB 2ED9A 3U4EA 3J8F7 3VD3A 3S35X 2W94A 3HMWH 5C0CE 1CTOA 2ZUXA 4NHUA 4JHAL 4LQFH 2O93L 3MLRH 4M43H 3FMGH 5GGSA 3MNZA 4E42A 4NN6C 1OLLA 3U83A 1UCBH 3RL2B 2XACC 5C07D 1S7QA 1JNNL 2BVYA 1U91A 4FTVE 1RSFA 4KKCC 1F11B 1EFXD 5IHRA 2FJHA 1UQSA 2MHAA 3AVEA 4X4ZA 4TVSa 1BJ1J 4NCC2 5DTFB 4TNWK 3RWGB 2DQCL 2P8MA 4ZSOA 2WN2A 4GMTH 5C07E 3LIZH 1N0XL 1QFWM 2CO6B 3MREB 1TJHH 3WIFB 2Q7NA 4KZDL 5EBLA 3U30B 1CD1B 5F7NC 2FBOJ 5MENA 2PW2B 1NC4B 2DF3A 4LSUH 1JHTB 3P11H 3NMEA 3PGDB 1OGTA 3TN0A 1L0QA 2YMXL 4O2FB 3TA3A 3TWCL 4PJHE 5CGYD 4MHHI 4ZPTB 4UT7H 2PXYC 1AIFA 2BMKA 4MADA 1JV5B 3QPQD 4LHQB 1HQ4B 3CXDL 3BYTA 3UBXI 1OL0A 1FLRL 3SBWA 4HLZH 1NGYB 4YK4B 4EI5C 4HWBH 3V6OC 3Q48A 4X0KA 3LSOA 4TVPD 1J83A 5GSRA 4Z7NF 3ZTNL 4P5TB 5K9OB 2VUOA 3SCMA 4UI9L 1ZEAH 2NY5H 4DKEH 1JPTL 1ZT1B 4D2NA 4LVNC 4TVPE 4WENB 1LK2A 3MRDB 4XMLL 4Z7UA 3WJJC 3WO3B 4OCXH 4NRZB 5D7IB 3UTSA 1EHNA 3MRGA 5GS0H 3W0WA 4K94L 4E41A 2RGSA 3EHBC 5D6CB 1S9XA 3WXVL 2YD8A 5I8KH 4LKXA 1A6ZA 3TBVB 1HXYB 5DJ2A 2DD8L 1JGUL 4CADB 3C6SA 1U93A 5JQ6L 5C0JA 2XNAA 4A41A 3RVTD 2FIKB 5E6ID 5T3ZL 2OTUA 1SY6L 5KN5A 1UCTA 1EIBA 5AUMB 3Q1SL 2OLDA 1S78C 4ZYKB 3UMTA 4GO6B 1V3MA 1LP9A 2NMSA 3WN5B 2HYXA 4JFDD 1NBYA 1VKXB 3O9WC 1WCQA 3DV6B 2PCPB 4PIRF 4F80A 4UDUA 4Y2DA 3HAEA 5EZOL 5IKCB 1M6OA 2P5EA 5J8OA 1TETH 4TSBL 3R1GH 1Q9LB 5KSBF 4X6CF 2KPNA 4ZS7H 4GRMA 1A0QH 4GKSA 2Y64A 4GG6B 1CF8H 4NN5C 4CGTA 3HKFA 4YHNA 5I16B 2YD5A 3UPRB 4QRRD 2FH8A 1U3HC 2HKFL 1FJ1A 2DRUA 1AD0B 5FYKU 4AG4L 5KG9B 3VD5A 4LSVL 1NAKH 4BK4A 1VGKB 2OSLA 4RNRA 4XNXL 2K3TA 1ND0A 5E5MB 5EZIH 5L8LB 5F6HI 4R0LC 4X6DF 1F4HA 1LO2L 4QGTA 1QNZL 4XBEL 3RHWK 1HHHA 2ADJB 4QRRE 5D1QB 3FQWB 5I1EH 3HE7B 2CKBH 4OJFL 4GAYB 2E8ZA 4UV7H 2X4UB 1J05B 2D9CA 3BWAA 1F6FB 4HS8H 3UETA 4FHBD 4L8SA 2VMFA 1BX2A 4XPHH 3W39A 4PJDE 1XR8A 3A6BH 1CD8A 1LK3L 1VFBA 3DNKA 1Z9OA 3HI5L 6FABL 2EH8L 4S2SA 2Y1VA 4KK5C 1CGSH 4X4YA 2HVKB 1PYWA 3C60D 1NGPL 1CXHA 5ITFA 3HS0B 4LCIL 3QQ3A 1CFTB 3ESUF 2AQ3A 1QLEL 4YDVA 1N6VA 3SPVB 5LXGL 2HH0H 3V8OA 3F7PC 4JVWA 1A47A 1M7XA 3IXAB 5TF0A 5CJXA 4JG1L 1F45A 3UYRL 2G60L 4TVPH 3RY6A 1T66D 1FO0H 5DFVD 2V2TA 1FPTL 5ANMB 2IBZY 3EDJA 4Q6IC 3GSVA 4GLRI 1RIVH 1UWGH 4WUUA 2VLKB 2O5ZL 35C8H 1J0YA 4Y19A 4XCFH 1IKFH 3A6CL 4GRLB 1NLBH 5D2NE 1N7MH 4ZS6D 2VMCA 2OL3A 4BFBD 3HZMA 4NKDA 3T04D 3WLWC 2JIXD 5EIVA 3HRZB 3TEUA 4WVRA 2C9AA 2B4CH 4UQ2B 3TVMB 2ZJSL 5KOMC 4MHHG 4WCYL 1CFVL 2XZQH 4P3DA 4ALAH 3I3EA 4CMHB 1FN4A 3ARBB 4JO2L 3H0TB 2R0ZH 3MCKA 3T0DA 3CUPA 4QGYA 3BO8B 1HH6A 4FG6D 3SGKA 2RV9A 1EO8H 4A44A 3MLUL 5EN2B 2VCBA 4K23H 1MWAB 2EZ0C 4NZDA 1UWEH 1VADA 2NY7H 3C6LC 3VE0B 3BPOB 2F5BL 5LA2A 1ZHNB 5BO1H 3AU1B 1ORSA 1IBGL 3D0VA 3IDMB 3PUIA 4JN2B 3QDGB 2FATL 2ADGA 3MMEB 3ROOA 3VWKB 4XB7A 4S1SL 4PFEA 4MO3M 1J1OL 2WZPD 4AIZA 1UT9A 5DMYA 2HP4A 1QFHA 4PTUB 3QIUD 3UTZB 1OGAB 1QSZA 3MFGB 5TGBB 1T0MB 2VLLB 1MAML 5FGBC 4TQEH 4JQVC 4XP6L 5BOZG 4A45A 3RZCB 4RQQB 1YNKL 5IK3B 3UZEA 5J1TC 3H42H 1JJUA 4AM0B 3GDBA 1OW0A 3ZE1E 1FNEA 4HUXB 3D18B 1V8HA 1C8PA 3ARYA 3MRPA 4MA7L 4Y0GA 5LA0A 3FFCA 1CR9H 4EIGB 2DQTH 1JUFB 5B39B 1JU4A 4PRAB 3STLB 3SOBH 4OKVB 4FFWC 3A22A 5AD0B 1K3ZA 1H15A 2J5LB 2IFGA 3F7VA 5I8OH 3NA4A 5EU6B 4JO1H 1OP5H 2VZVA 5IVZB 1UB6B 3F12B 1GUIA 1IC5L 1VERA 3W9DB 5IIEB 4H25B 5E1AB 3I50L 1K5NA 4MA3A 2R2CA 3UTQA 5MEPB 3F7YA 4TTDC 3RU8L 4M6OL 1UJ3C 1IC7H 4XNMA 1HKLL 2FJGB 2UV3A 5AAMA 2VERN 4P23A 3KYOB 5IJKC 1J88A 3D2UB 4XUTA 3O41A 1I7TB 5IEHB 2HN7B 3O4LB 5DK0B 2J1KA 2H2SD 3KLHD 4R4ND 3U4BH 4I9WD 4XWGL 2I60H 4HK0B 1JU3A 1QFOA 4NC1C 2Z9TA 1F90H 4ERSH 5JZ7D 2BBAA 3QI9B 2DJ4A 4FQXA 1KJMA 1PSKH 2BSSB 4HV8A 5E8DH 1W9WA 1HILA 3IU3A 3LB6C 2VOTA 3BKML 4I9WE 3GI8H 4ZO7A 5IFPA 1UZ6E 4QB1A 1NSNH 4NUJA 1QO3A 3I75B 1J8HB 5IOPB 1NMAL 2BNQD 2OM5A 4Y4FC 3CFCL 4ZXBD 3SE4A 1DL7H 1PY4A 3ZT6A 2L4OA 5ETUB 3O2VH 2VC9A 12E8H 5TF1H 1S8DA 1KV3A 2VQ1B 4XVSL 3SE3C 5ANME 5KW9L 3CPLA 3TVMD 2BNQE 1MFEL 4QRSA 4PTTA 3H9HA 3IDJA 3DI3B 4ZNEE 2NY6B 4HAGA 1R5WA 4ZO8A 3S4SA 3DUHA 1TCRA 2A77H 4OAWB 2E7HA 4M48H 2ZOKB 3N1FC 4LLAA 5GRZA 3RPKA 3NIFE 3SGEH 3PDGA 4ODWB 3H6JA 2HT2D 5F7EH 1G7QB 1FFOA 3TZVD 5SV4A 3O8XC 2ZWLT 5L2KD 2CDFB 5T33L 1GPOH 4F9LC 3ULVD 2ORBL 3QDGD 4RFOH 5HHNA 4N0UE 3GHBL 1JF5A 3VWKD 1KACB 3KPQA 3ZDYF 1DVFA 5L2KE 3I2JA 1HDMB 3CC5A 3ULVE 3QDGE 5KAQG 3OF6D 4JRYB 4BSVA 2CLZA 4P99A 5C08B 4AJ0A 1MFCL 2VXVH 1FL5A 4GW5B 1MQKL 1FC1A 2Y9RT 4ENED 3LEKA 3NH7L 5E2WH 2E6JA 5I1KL 3WF1A 4M9PA 1EA9C 1KCVL 4FP8H 3NFNA 3SQOH 3K80A 2VLJA 1T1XB 4LHUD 1Q9OB 5J3HC 3L3GB 4HMCA 3NCYS 3PABB 4K94C 4F37K 3QB7C 3HN3A 4MB5A 5DVOA 4ZFOL 3BH8A 4TUKL 5ERWB 1EGJL 2F5AL 4I2XB 3T65B 2AGJL 1PLGL 4P2QB 2ZG3A 3WLBB 1CDIA 1DBKH 2WUBH 4JHZA 3GBLA 4NP4L 1JZ4A 4FQQB 1UKTA 2P8PB 1CLZH 5CIPB 2FGWH 5E8OA 4M61A 3EYVB 2LAGB 1F02I 4R90H 4UU9A 4JM2A 1WLHA 1LP9F 2OI9C 4M1GH 3WDJA 2JJTA 1MAKA 5INCA 5FUOL 5C9JB 1FZMB 1E4WH 3IETA 4I18C 2HMIC 1QQDA 3D2UD 3SE8L 1D9KC 2EKJA 3GI9H 1Q1JL 3NZHL 3MJ7A 5TDPB 3RNQB 1VEPA 4L8BB 4AEEA 5C0GB 4LK4A 1N6QH 1JIBA 3IXTB 1FVDB 4MVBD 1ZHKB 1HIMH 3ZZ1A 1YN6B 4Z78B 4XI5D 4NC0B 5C0NC 3CZJA 1U8LB 3GRWA 4NQEA 5EOQH 4Y4KA 2XWJB 4MNHB 1BD2D 1FORL 4QX3A 5I8EA 3SGDH 5ESQB 2FHCA 2F54D 2LFGA 1YMMA 3OQ3B 2LE9A 1INEL 1ED3A 5CZVH 3E6HB 1UB5A 4U1SA 1FZKA 4ESKA 3T2NH 2LAAA 1CZ8H 3WO4C 5JXED 4I3SL 1RK1B 4JFFB 2J6EL 1BD2E 3WFBH 1LNUA 3BKJH 4MD5B 2YPLD 2F54E 3MV7B 2YR3A 3KNBB 1TNMA 5TH2B 1M05B 5D1XC 2HRPL 1KYOK 4AIOA 1P2CA 3ARUA 4MB3A 5KZCD 5DDHA 2YPLE 1TCMA 5HYIA 1KCSH 1MCJA 4X7CC 1EBPA 4X6CB 5KSBB 4PGBA 2FBJH 4QPWA 4HC1L 3VFMB 1IKNC 4LSRH 5LGHH 1FIGH 4OLZL 1MHPH 3L5XH 3GMLA 1FYTB 1P8JA 4OD2B 3L3HB 3R4DA 3KPLB 1I3RB 2MNUA 1RJLB 5EWIH 5BJTB 1DLFH 1E28B 2AW2A 4Y5YA 5ESAA 1G0XA 4PV8B 1KLUB 4X6DB 3WL9A 4CL7A 1UADC 4LARH 5GRYA 3S37L 2X4QB 3O4OB 2XN9B 2V9RA 3LEYH 4QO1A 5J1XA 3T77B 1J5OL 1DR9A 4GBXB 4FZ8H 4LLUA 1QFWI 4RIRB 5DJXB 1FG2A 3QWQB 1A3QA 4G6JH 3GSRB 2RJMA 4Q9RL 4NRXB 4Y5VC 1UMHA 5AYUL 5FV1L 4APQC 3TBSB 1QR1A 4S1QL 1PMJX 4MJ6B 4P4KA 3M07A 2Q86A 3BPNC 4KFZC 5CBAB 3MGOA 4A6YB 3PF2A 5HVFB 4Y5XA 5F9WB 3EO1A 3OAZK 3U1SH 3KS0H 4G42B 3QXAA 4JREC 4GMSL 4X6FA 4NT6A 3O45B 5DJ6B 1FVCA 1F3RB 4HLZG 4PGJA 3EYQD 3WFDL 2EDQA 4JO4L 3HE6C 3HZKB 1F97A 2CK0L 2A2QT 1OWWA 5KSVB 1WBZA 4NZUH 2FLBT 2WIIA 1IM3A 2VSCA 2ZCLL 1E4XL 1CXFA 5I1LB 1AXTH 1HOCB 5CKAA 1T0NA 5JUEH 4GSDH 2VDPH 1VESA 1TTGA 4O58L 1OWRM 3GM8A 4KTDL 1V7MH 3FFDB 1H6XA 3IF1B 3NNGA 5TQ2H 2Y25A 2NW3A 4H1LB 1FZOB 4R96B 3S5LB 1ZHBA 3OAUH 1EO7A 3P0YH 1BJ1H 1LO3H 3SDCC 2CRYA 2VLRB 1A7RH 2NY1B 4Z7NE 4NWTL 1CK0L 4R26L 1JHKH 4LEOA 4YWGH 4LQFL 2Y07H 5HPOA 1ZA3A 3OR7B 3KJ4C 2L7UA 1RFDH 1CLYH 1MOEA 3PWJB 5J9PA 1X5FA 4CMMB 2DCJA 5HD8C 4QTHB 2B1HH 4MXWH 2VDML 5HJ3A 1KN2L 1JP5A 5F9OL 1S9WB 3L7EA 5CP7B 4M3KB 5B38A 1TZHB 3KYKH 2HFTA 3QJHB 3PJSA 4L5FH 3JV0A 5LGJB 5EO0A 1O7VA 3UC0H 4RGMB 1XGUA 2ADIA 4FQ2L 1P6FA 1P7HL 1G84A 1KULA 3ZE2F 3TNMB 2JK5A 4YHKH 3NVQA 4RN5A 4JFFD 4YH6A 1OAQL 3C09C 3BP4A 4GMTL 3LIZL 5GS3A 3NACH 1YEFL 3MV7D 2JJUA 5DT1L 4WTXA 3RUGF 4UT6H 1ZS8B 4LEXL 2DTMH 1AQKH 3LQZA 3LKOB 4EI5A 2NY0C 3V6OA 4JFFE 4AENB 4YNYA 5TDNA 4H26B 1NX9A 4D9LL 3QG6A 5D1ZD 5D96B 5IB1A 4W4ZA 1IAIH 2ARJB 3MV7E 4KVNH 2EE6A 3VFOA 3WEXB 2ITDA 4WJ5B 5C0FA 1NFDA 3HI6H 3RFZC 4IDJL 5KSBE 4X6CE 1GJIA 1GXEA 4WWKD 2ZUSA 5DHYA 2AERT 2AXGB 4DAGH 5ECJE 2D4FA 4GS7C 4XP1L 1FYTE 1JRHL 3PHQA 4MDIA 2O5YH 4HXAH 1NCBH 3FO1A 4DKEL 2DWDB 2DQFA 4PGEA 5FF6A 5JW4Q 2GJZA 4N9GA 3AS2A 43CAA 1ZANH 3DROB 4PGDB 3GSUB 4NNXB 5SWQB 1S5HA 2W9DH 3LEVH 2A6KB 4K8RL 2XN9E 1NKRA 2YA1A 3HCVB 5GS0L 3OB0H 1QRND 1XGTA 3FT2A 4HFUL 4ISVA 3O6MH 4KWUA 4DOHB 5MEOA 3G5YB 1XIWC 1NBVL 1N2RA 1MVFA 5I8KL 4L3CB 1AE6H 4PJBA 5I1GL 5GGRB 3WFEL 1NCUA 1K4DB 1QRNE 1U0QA 2KDGA 4OCYH 4M00A 1JK8A 4HJ0D 1QYGL 4JAMA 3HC4H 4NPYA 2OK0H 2D7OA 2Y7QB 2JDAA 2ZZUT 5DQ0A 2QADD 4MQ7A 2ZEYA 4NHUB 4MXQC 5DS8A 4KRNA 2WABA 3BH9A 4E42B 1U8IA 1YPZA 2JJVA 4KKBD 2VKWA 1S7QB 4QX2A 4EDXA 3CIQA 3EDFA 1TJGL 3BN3B 1QG3A 2FJHB 1UQSB 2MHAB 3NCJL 3PP4L 4R0LA 5CHNA 4Z8FL 3R1GL 4PYHA 1W72H 1S9YB 3U0PA 1NUNB 2YRZA 5HI5C 2P8MB 4ZSOB 2X2YA 1A0QL 1ZLWK 3CLEH 1HH9B 4TRPH 1NCCL 3RWJA 4AMKL 2NY1D 3QPXH 2YD9A 5EBLB 5ENWA 2CLRA 3MLPA 1MRFH 3OKLA 5MENB 2H9GA 1J0JA 5EZIL 3QISA 3L3KA 4MLIA 1PZUB 2DLHA 5IROA 2ICES 1OGTB 3TN0B 1YEHH 2VLRE 1YNLH 3TA3B 4MNQA 3TO4D 1KCRH 2FCBA 4UIKH 3P9MA 5F7LB 2VZQA 5B4XA 1U58B 1AIFB 2BMKB 3B3IA 4UV7L 4PJ8A 4X6EA 1ORQA 5DRXA 3UJIH 4S10A 5SWZA 3CVHH 4MA8H 3LN4A 4OCRH 5FHBH 3EJJX 3EYPA 4R3SB 1BF8A 1HI6A 4P48A 2W92A 4Y4HC 3LSOB 5GGTA 3A6BL 1JCKA 3EBAA 3GO1L 2DM2A 4ODBD 5GSRB 3G04B 4JM2F 1PZ5A 4WHDA 5I9QB 3WIHL 2OP4H 2IEPA 3ULSA 4POUB 3NRUA 1AGBA 1NFIA 3W5MA 1T5XB 1W99A 2YPVH 4Q6IA 4UAPA 1LK2B 2CDPA 1M7IA 1RUQL 4NO5A 3UTSB 3MRGB 1A3RH 4OF6A 1DQQA 5EIYB 3OX8A 3W0WB 2PETA 4E41B 5HGGS 4QWWD 3SGJC 2OJZH 3V0AC 3DLQR 3B2UD 1SEBA 4LKXB 4G80A 1A6ZB 5DJ2B 3IJSA 3VGDA 4XUNA 3RAJL 4WW2C 3SGDI 4DTGL 1U93B 5B4NA 5C0JB 4KRPD 1XZ0A 5GS2H 1N7ML 1AC0A 5HI3D 1U8OA 3D85D 2DKUA 3L5JA 3O3EA 2HLEA 1PX3A 5KN5B 5JIHA 3V95A 1MCKA 4B50A 4NHCL 3GK8H 3QQNA 4ELMF 3IDYB 5FA4B 3UEZA 4GXVH 1LP9B 2DQDH 4ALAL 2APBA 3C5SA 2N1KA 4M6NH 2R0ZL 3Q6FA 3BX7C 5FDYA 4Y2DB 1PGRB 1IC4H 3ALXA 3U9PH 4UBDD 1M6OB 5ABDE 2ENSA 2IH3A 3CLFH 4UI2A 4TN9A 3WKNA 4V2CB 4IHOA 3CDFA 2DMBA 5C70A 4WDIA 5FGBA 5BO1L 4GRMB 1Y18A 4GKSB 5AG9A 4NFBA 3BXNA 4YHNB 1PAMA 2UVFA 1RZIA 4DOHE 1G7JA 1FJ1B 1KGCD 1P4IL 4L4VA 1FIEA 5IQ9B 2OSLB 4ZPVA 1I3VA 1ND0B 4XZUB 4IRSC 1WT5A 1S7XA 1HHHB 4P2RA 4HJJL 4WV1A 4F33A 5B8CA 1KGCE 3VFUA 4X7SH 3U9UA 4OZIA 1NEUA 4W4OC 3BWAB 1T7WA 1WJ3A 5F96H 5JIKA 1KIRB 3CX5K 4GAJH 3ZYIA 3CDCA 3IFNL 1EX0A 5EUKA 3ARDD 5FDWB 1XR8B 1VFBB 5I1DA 4MXVF 4UB0H 1RVFL 4S2SB 1I9RH 2CGRH 4X4YB 3BP7B 4OF7A 3V0VA 2QBXA 1PYWB 4P0DA 3CQOA 2HJKA 1CDHA 3OBAA 4M7JH 3QQ3B 1CIYA 2AV7A 2O5XH 1O7SA 5EPMA 4K3EL 4KTEH 5AAWA 5CLWA 3TN0D 4M9OA 3TA3D 5GS1A 3MOAL 3WJLC 1B88A 1QSFD 1JPGA 5EZJB 1WBYA 3QO1A 3AS1A 4WTZG 1ZTXH 5I1CL 4LGRB 1YY9C 3V52L 3V5DA 2V2TB 4P3CH 1ADQH 1IC7L 3GSVB 4WUUB 3U79A 5I30H 3ARGD 3NPSC 4MSWA 2P24A 4Y19B 1P5UA 3FN9A 2X1QA 4OZGF 5K9QI 1QSFE 4ZXEA 3CNKA 3WQBA 2YRLA 1XGQB 2DM7A 4F57H 1KXTB 1BBDH 2OL3B 3HZMB 3SCMD 3LAFA 4KJQD 2F9BT 3U4BL 2IPUK 1I1AD 2I60L 1OSZA 1T7VA 4FXKA 1U8JA 2Q1EA 4N0YH 4ERSL 1F90L 3FAXA 4P3DB 1JL8A 5DD0L 1OD7A 1FN4B 3DETC 4UDTA 4Y4FA 4ODXA 1QBBA 3MCKB 4B7LA 4NYLA 2EICA 3CUPB 5E8DL 4E41D 2AI0H 2HG5A 3VXRD 3K4ZA 1HH6B 1NUGA 4QKXB 1KEMH 1D5IH 3ACHA 3SE3A 2WMPA 2Q7YA 4U1MA 4Y7MA 3MRKA 1I8MA 1VADB 4Z7UE 1A6UH 4WGWB 3NPZB 3KPPA 4XAWH 1FFNA 2DIJA 1R24A 3RGVA 2XKUA 4E41E 3D0VB 4GZ9A 3VXRE 4Q9QL 3BMWA 3T2PA 3O6FC 1MELA 3OXSA 5JDJA 5JR2A 2ADGB 1DL7L 5FK9A 3ROOB 1OCWL 1JHLH 1S5IL 4MAYD 1BFVL 3VFPB 2IH1A 5LQBH 4AIZB 4GWJA 3LD8C 1SJHA 4JB9H 1IZJA 1W0WA 1EK3A 3O8XA 2DM4A 3G5ZA 2D4DA 4NZJA 4LSSL 2VCAA 2PYFA 4XHJC 5T5NF 4PJAA 2DBJA 2P7TA 4Y2DD 1MJ7L 4OGAD 2WUHA 2P5ED 3VGAC 1NPUA 2FNBA 1HYSC 5E00A 3VI4E 1WICA 4KMQA 3MRPB 3FFCB 3MA9H 1UY1A 15C8H 1IGML 1NGQH 4FFVD 4RFOL 2P5EE 4BZ2L 1Y6KR 1CE6A 3H7BA 1SQ2N 3F7VB 1NFDF 1GAFH 3PP3K 5HHQA 1A6AA 1TLKA 3N1PC 5F7MC 1KJ3L 2CRMA 4HT1H 5B3JF 1ZSDA 3JSSA 5SX5K 4OQTA 1K5NB 4MA3B 5DA4A 3UTQB 3ARPA 3F7YB 2ZCHL 1D6EB 3T0VA 1A7QH 1JGLH 3RUGB 5E2WL 5HYJA 4XNMB 1AGFB 1A1NA 1X4YA 2XA8H 4P23B 5EBWB 1HE7A 3WDIA 2UWEE 5DMJB 3IJHA 4K8RC 1TPXC 3ABZA 5GS0C 4N90D 4EDWL 2Y6LA 3S36X 4IOFC 4PJBF 1U8PA 3N1MC 4OUUA 1YEKL 1DBKL 3P4NA 5CWSA 3LPGA 4N90E 4GW4A 1CLZL 3QEUA 1KJMB 4FQXB 4HV8B 2FGWL 2YK1H 5DUPL 5E99H 4K71B 1HILB 4YAQA 3IU3B 3QDHA 4LMQE 5IMOA 2WYSA 3G08B 4LVOB 2YOCA 5L7XL 4LHUG 4NUJB 1QO3B 1HINH 4M7KH 1YPZF 1R3JA 4WUUD 1EHAA 3IJYA 1JZ3A 1MHHA 5FO9A 2ZNWA 4Y19D 4KI5F 3GI9L 2XZCH 1DE4A 4AG4A 1S8DB 5GRUH 3MV9A 3CPLB 1HIML 4WUUE 2VLMD 1BIIA 4KROB 4QRSB 4Y19E 1F58H 3ZKND 4PTTB 3IDJB 3MRIA 1MEXH 1R5WB 3S4SB 5KANI 3EGSB 1REIA 1TCRB 2R0WH 2XTJD 3HHRB 5DJ0A 2HT3D 2VLME 1FVEA 3GIVA 4IOIB 3T2NL 1FFOB 4YE4L 5JLZA 4FRWA 2FR4A 2VUYA 3LKPA 4DGYH 3HEIA 4BZ1L 1ZA6A 2EYRA 1IKNA 4JFPB 5HHNB 2XTJE 1AR1C 4U1KA 2AK4D 2K7PA 1CDYA 4RFNC 4XCEA 3O6LH 1AO7A 4U1LA 3KPQB 4MNGA 1E6JH 4I77H 1DVFB 4NC2B 4X80H 5DWUH 1NJ9A 2R29L 5HI4D 4ZTOH 2DLFH 4BQBA 2QQLL 3P40A 4L9LC 1P7QD 3BVNA 3TFKC 3ZKMD 4NCDA 5C6TL 2AK4E 1L7TL 2VWEE 2F19L 1FL5B 2VDKL 3QDMA 2ORZA 3Q6GH 4LSRL 1K45A 1GHFH 1FIGL 1MHPL 4GQ9H 3OPZL 5KVGH 4G6FD 1ZAGA 3NFNB 1LEKA 4E0RA 2VLJB 2BY2A 2EIEA 3QHFH 3LEYL 2NY2C 3ZSTA 4BA8A 4Z7VF 1CDGA 4F9PC 2W47A 1Z9LA 3KYMA 5J6HA 3WF4A 3ME0A 1KTLA 4G6JL 2WLZA 4DK3A 1RZ7L 3JWOL 5J1AA 4QHLA 4CVZA 5E8OB 3MRRB 1T2XA 1WFNA 1XF2A 3P1IA 5T1LA 1NLDH 2FEEL 5TE4L 4UU9B 4JM2B 1WZ1H 4R2GB 1ETZA 3HNYM 4ARXA 1RZGB 5D2LA 2V5YA 2R9HD 4P23D 3IETB 1F5WA 1BAFH 3DUUB 3IDGA 1KCKA 2GJ6A 1QQDB 5FGCB 5D5MA 5C09A 3TBYA 5D71L 4NZUL 1NUFA 3UYPA 4U2YA 4G5ZL 5DSCA 3FTGA 1AXTL 5GPRA 1S7TA 3MTRA 3QIBD 5B3NA 3STBA 4NQEB 4Y4KB 5DRZB 1OP3K 2WO1A 3ROLA 1FNLA 1UA6H 3BWUC 1P84J 5I8EB 2VMEA 1KCLA 2R0KH 4KUCF 3DTXA 4BK5A 1YMMB 5TQ2L 2IALA 4NQCD 1ED3B 1MSPA 5GGRY 2X05A 1UB5B 3OAUL 4U1SB 1IEBB 2HFGH 5GISH 1K6QH 3F58H 4K7PH 3HMXL 3ZLQC 1LO3L 2NTFA 5A16A 3N85H 4ELMB 2R8SH 1LNUB 2V5RA 3FONA 5ICXA 2XV6B 4LRIA 5K33A 4D8PB 4NQCE 2GW5A 1H5BA 5DJDA 2H32H 1JHKL 4BQCA 3DHMA 4XX1G 3F7QA 2Y07L 4NKOA 5GGSY 4V1DD 5E8EA 1P2CB 5DDHB 3VG9C 5C86A 5CKGA 4PB9H 5TDOA 1J8KA 3FO9A 3NFPB 5HHPA 3PUHA 4PGBB 1OTSC 2D7QA 5SWSA 2DWEA 2XFXA 1KIQA 3EOTH 2LV4A 3RI5K 2QTEA 4P5MA 2NZ9C 3GMLB 4V1DE 1EZVX 4YX2H 1U8KB 3FRPG 1JPSH 5HDQH 4Y5YB 5ESAB 3WL9B 4ZUWA 3C5ZA 4KJWD 3PE9A 4WO4C 5BRZD 3WE6A 1SJEB 2ESVD 4LLYA 5CEZD 3OKYA 4JM4H 3MLZH 4PRIA 3IDXH 5E4IA 5H35B 1ZT4A 1FG2B 1WVZA 2K9UA 4UT6L 4OLVH 2Z31A 1AQKL 3WS6A 2JJSC 4YEEA 5BRZE 3EDKA 4F7MA 3OKNB 4YBHA 5CEZE 4M1DH 3UBXA 1G6RA 1IAIL 1TVDA 4HUVA 1DZBA 2Q86B 2EDLA 3QIWC 3MGOB 2XHNA 3VD4A 4Y5XB 4AY0A 3EO1B 2C3GA 3EB7A 4MAUH 1S7SA 4OSUL 4P46D 3QXAB 3S34H 4X6FB 5D72H 3FN0L 4NT6B 4FQ1H 1RUMH 1OF2A 4LIQE 4JFOA 1W2KT 4QHUA 2VLJD 3O6KL 4I8DA 4JKLA 4UTAL 1MFAL 1XC6A 3DSFH 4Z9KB 3C2AH 4I0CC 1WBZB 3RWEA 2WIIB 1IM3B 1QPXA 4G3YH 1MRCL 2BVTA 3W81A 2YC1B 2VLJE 2YEZA 1DJSA 3WSOA 1T0NB 3L3OA 3OGCB 4E8DA 5IHUH 3VXPA 5C6WH 4JFEA 3TH4T 3X11B 5C9KA 3AREC 1JGDA 4OZGB 4P9HL 2HYMA 3GNMH 1KJ2B 4YDLB 5EDXA 1ZHBB 4R2GD 5L2JA 3IFOA 1AE6L 5HSFA 2AXFA 4W6YB 5EC2A 1CVSC 5F7DA 4PQQA 1OAYH 2JJWA 5DEGA 4OCYL 3BQUC 2OK0L 4PJAF 5DEZA 3BSZL 3MBEC 1W9SA 1VCAA 3TBWA 4LEOB 3MR9A 3RWDB 4ONGL 2BNUB 5HGAA 1ZA3B 5DUBA 5J9PB 4LVHB 1I4FA 5FGCE 5HJ3B 4YHLH 3I6GA 1PD6A 4Y4KD 4QY8A 3L7EB 5B38B 3VCLA 1OM3H 3MJ9H 3PJSB 3S8WA 5F6IC 5EO0B 3ALWA 4JGUA 5GJSL 1XGUB 5EU7E 2ADIB 3I6LD 3B5TA 1NAMA 1W72L 2PR4L 4C55A 1Q0YH 4U2ZA 4MOAA 5I18H 3QFDA 2I5YL 2J7MA 5F7WC 1G0DA 3I6LE 1MRFL 4G6MH 3LQZB 4EI5B 1NEZG 1CE1H 4YNYB 5TDNB 4LDLB 4N0FA 4EKXA 2WN3A 1YNLL 1SJXA 3OL2A 3QG6B 4LASH 5IB1B 2BHZA 4NBYB 2BXYA 1KCRL 3A6OA 3QCVH 3QT2A 1J87A 3VFOB 1DQMH 1T20B 1SBBA 5DQDL 1F6AA 2ITDB 5JHLH 3A0OA 4G7VH 1YEDA 3S96A 3SE9H 3UAJC 2BGPA 3NTCL 1NFDB 1PW3A 4EUPH 4P59L 4G6AD 2ZUUA 1S7UB 2NZIA 5DHYB 3OGRA 4I0PC 1XF3A 2Z93A 3SGJA 4PY8J 4KPHL 3PHQB 3OHXA 4M02A 4A42A 1ROWA 3FO1B 4MJIA 2UZYB 1H6YA 2DQFB 1FLTX 2GJZB 3KPMA 4N9GB 2JCCA 43CAB 1IL1B 2YPVL 2YFZA 1SBSL 3EDEA 1S5HB 4Y16B 5EA0L 3VMPA 3RTQA 2P5WA 3CX5J 1C1EL 1XGTB 3FT2B 4P4KD 5IW1A 4ISVB 1YDPB 4JR9H 5MEOB 2J88L 4LCCB 4OGYH 1N2RB 1U92A 3HUJE 1ZHLA 4HMEA 4KKLC 5LVEA 4PJBB 5F71A 3C7OA 5LWYH 5C7XL 1C5BH 4NJ9L 2VC2H 1JK8B 4JAMB 2W60A 1ACZA 4NPYB 5CINL 3R0NA 4MXVE 1UXWA 5JUVA 4Q2ZA 4MQ7B 4IBLT 2WO3A 2X7LA 3CFBB 3GK8L 3EJZC 2P42B 5AZ2H 4ZUSA 4HZLA 2EDWA 3JTTA 2DBLL 3HRPA 4NN5B 2VKXA 5JIPA 1U8IB 1YPZB 2EE2A 3RBSA 3RWIA 4HC1A 4CJ0A 4XVHA 1IC4L 4EDXB 1RJCA 3BI9X 3O2DH 4LPLA 3CLFL 4P4RA 3PNWA 1UM5L 2IQAB 3D9AH 3HNSH 1N3NA 1VGEH 5F72S 5CHNB 3RA7H 4P3WA 4IRSA 4JRXD 4YC2B 3A67H 2QQKL 3B9KC 1CTNA 5EOTB 4B41A 4XPBH 3MRLB 1FP5A 5KTEL 2Q76A 3PWNA 1MCQA 3MBWA 4DGVH 4OZFH 4W4OA 5ENWB 3WF3A 2CLRB 4KKCD 5HDBE 2BDNH 1MUJA 4JRXE 2VXUH 3MNVA 3OKLB 2H9GB 4UUJA 4PLKC 5MI0B 1G7MA 2AK1H 1T83A 4M5ZH 3HZYB 2WBWB 2ZG2A 3RGHA 4ZTPL 4MNQB 4DZBA 1AFVH 3ARWA 2BRRL 2PF6A 3B3IB 1KB5A 3KJ6H 3HI1A 4TUOA 1QOKA 4PJ8B 1ORQB 5DRXB 3QEQA 1NUDA 5HHOA 5F96L 1X5XA 5SWZB 2NNAA 3FO2A 3KG5A 3LN4B 3TH2T 5IM7A 1GGIL 5DD5L 5IEKA 3JWOC 4X4XA 4PR5A 2VZ3A 5JW4M 2WBJB 1NC2A 4JANB 2PXYD 1PZ5B 2SEBA 5D2LF 3ULSB 2GQHA 4P02B 1AGBB 3U48A 1NMCC 1NFIB 4LMQI 3OG2A 2FX8L 1FCGA 4M7JL 4Q6IB 5FHAH 4EI5D 1M7IB 3IRZA 1WKYA 5D5MF 2ED7A 4KTEL 2XWBA 5I1HH 2UY6A 3DARA 3OX8B 5DRNA 1BQLH 3W2DH 4OGXL 3FZUC 2J8HA 4YHML 4Z7VB 1SEBB 4G80B 1X6NA 1HSAA 3QXTA 1Z2KA 3IJSB 3V6OE 4P3CL 1ADQL 3H7LA 3VXMA 5IB5B 1YEGH 3QFJA 4E5XA 1I8LC 4HWZA 1XZ0B 5MP6H 4F57L 4O51A 1BBDL 3EHBD 4PLOB 1U8OB 5K59E 2IMNA 4GG8B 3EYUL 4G9FA 1N64H 4U05A 2JTDA 2F53A 4N1EA 3T0XA 3UROR 4N0YL 5B3JE 2YN3A 3C5SB 4X5XA 1WWCA 3Q6FB 4KI5M 4X6BA 5SV3A 4MWFA 2IH3B 1BZQK 4FQPA 1KEML 5ALBH 4MGXA 4IHOB 3AMKA 4WI4A 1UM6L 4GUPA 1A6UL 1S78D 1T04A 2C1OA 1X4ZA 4WDIB 2GTZA 1Y18B 4N8CH 4HGMA 3O9WD 4XPTH 5HPMA 2EDBA 3QXVA 3BXNB 3MV11 3HNMA 2OZ4H 1RZIB 4OBRA 2A6DA 1I3UA 1G7JB 4C56A 4XNZB 2IQ9H 5IMKA 4L4VB 4NO0A 3D3AA 1AR2A 3LS5H 4PJBE 1XGYH 4ZPVB 4JB9L 3MLWL 2CDGA 4DKAA 3O3BA 1LEIA 1S7XB 4P2RB 4WV1B 4F33B 4U1HA 3PGFH 3GKZA 3H9YA 5B8CB 3Q3GA 3MJ6A 4OV5A 4NFDA 3U9UB 4Q6YA 1U3HD 5D6DA 2V2XA 1NCTA 3VRLF 3ZE0F 2BERA 1UKSA 2I9LA 3UPCA 4HBCL 4NJAL 5EUKB 1ITCA 1OY3B 4OFKA 4HWBA 5BV7L 3BHBA 2QSQA 5I1DB 5FYJL 3RY4A 15C8L 2GI7A 1NGQL 4PRPA 1A4KA 2GFBB 5IVXA 3V0VB 2QEJA 4H8WL 4MMZC 1GAFL 2HJKB 3QUMH 4RMRA 2E3VA 1C7TA 4FQIL 4U0RC 4F15B 1F4YH 2AV7B 2VDNL 4M6MH 5EPMB 3CDZB 4UILL 3LPWA 5GS1B 1RMFH 4LFHG 4MNQD 1WC7A 3GHEL 2W9XA 4KK5D 4CUCA 2A9MH 5ACLA 2BFVH 1JPGB 3HZVA 1WBYB 3QO1B 2QHLA 3VWJC 4PLNC 3V5DB 3U46B 3VGHA 3FCTA 3ULUH 2XA8L 2Z92A 2B1AL 4MNQE 2YD4A 3G6JF 4MSWB 2P24B 5E2VL 4M8QB 3CU7A 2HFEA 5BMFL 5I75B 2VDLL 2ZSWA 4P9HC 5CCKH 2I26N 1V3LA 5BVPH 3BDBA 3IRPX 4JO3L 1IT9H 4AEHH 4RX4A 1OSZB 4FXKB 1U8JB 2DIBA 1A2YA 2ZG1A 3OAZH 1U6AH 1VFAA 2H1PL 3BD3A 3F6IA 4UDTB 5C0CA 4K3DH 4ODXB 1P1ZA 4NYLB 2HG5B 3FRUA 1A6WH 3WLWD 4AL8H 1C08A 4U1MB 1M1SA 3MRKB 4LPYA 2C4XA 3K77A 1MFDH 3KPPB 1FFNB 1R24B 5D93B 3RGVB 3K75B 1AY1H 1S7WA 4JZNA 4KKNA 5CSBA 2AEQL 2VXSH 3OXSB 3X12A 5FK9B 3E6FA 4HCRH 1S7RA 3ZSSA 2IH1B 3IKCA 5TQ0H 1NL0H 2OYPA 1SJHB 2EZ0D 4BH8A 1W0WB 3C6LD 4YQXH 2BXZA 2PTVA 1F58L 3G5ZB 2WZEA 1EFXA 2PYFB 2CJUL 1RIUL 4KDWA 4PJAB 2CKBA 2PNDA 2P7TB 4XNUL 2DKMA 5E7FA 4ODSH 2R0WL 5FA3A 5ITBH 2YZ8A 5D7JC 4HH9A 1SEQH 4UT9H 1WGOA 5E00B 5E0QA 4WI7A 2W9EH 1FZJB 1RIHH 2M26A 3O11A 5E08H 4WHCA 4JFXA 1CE6B 2Q3ZA 3H7BB 1QBMH 4G43A 4NM8H 5ID0A 4AEIH 4JPIA 1NFKA 1J1PH 4JFHD 5HHQB 4I77L 5GRJL 1A6AB 5DWUL 2XZZA 3I2KA 4CN6A 3H2WA 4PJ9C 4MCYA 1GVIA 1YEEL 1ZSDB 2VITA 5TE6H 1BFTA 2KQMA 4QT5A 2F8OA 5ADPH 5DZLA 4JFHE 4FFWD 5AEAA 5FOBA 4GRWF 1PKQE 2JCCF 4YHYB 5T3XE 2FRGP 1FO0A 4TULH 5HYJB 4OFDA 4CUAA 5F93C 4J2XA 1EMTH 3MC0A 4D94A 3NFSL 4OZOA 3IJHB 5L88H 4OF8A 5IJVA 4OZIE 5JO5A 5ACMA 1I1YA 2MWCA 3WD5H 4TTDD 2W3JA 1U8PB 3QUYC 3GSQA 4OUUB 3QUKA 4RAVA 3C08H 2EO9A 3GSOA 3P4NB 5CWSB 5CS7A 4LU5H 4U7SA 4GW4B 2UZXB 5CD5C 3QEUB 4YAQB 4EVNA 5J6GB 3C8DA 1DANU 5A2IH 1LVEA 3ZKSD 1NLDL 3QWRD 2BK8A 3NCBB 5DD1H 1ZLVK 5KAQF 5FECA 1QLFA 5F6HJ 4PLJC 5E6IA 3MYJA 3EW3B 1BLNA 1R3JB 2EC8A 3QO0A 3WSQH 4ZNCD 1FE8L 3IJYB 1MHHB 4GAFB 3D39B 3L7FA 4XT1C 2YUWA 3LB6D 1DE4B 1CD0A 4JFDA 4DGIH 1SJVA 2W1QA 4NC1E 1DBJH 2NX5B 3MV9B 5D70L 3T4YA 1NMBH 1BIIB 3D3VB 3U7WH 2R4SH 3HNTH 4PRHA 3MRIB 2I9TA 2NY3B 4Y4FD 1YQVH 4YDIL 4XH2A 1J86A 2R2HA 4KY1L 1QFPA 1AJ7L 5DJ0B 3GXUA 1J12A 1QHPA 1FVEB 3GIVB 2WWKO 3I9GH 4OZHB 3TCLA 4B5EA 4QRRA 3F58L 5C0RH 5GXBB 2WP3O 2FR4B 3N85L 1A6VL 1RK0A 3LKPB 5E2JA 2R8SL 1MHEA 1U9KA 1ZA6B 2EYRB 4QNPF 5KVFH 3IB3A 4DVRL 1UVQB 4U1KB 2FEDC 1AO7B 4U1LB 3BKYL 1J84A 4MNGB 4PJDA 1NJ9B 4LKCA 5EUOE 1JTTA 1HKFA 4BXSV 4TNVF 2RQ8A 3TH3T 3BVNB 3O8XD 1KC5H 4WO4A 4U49A 4J6RL 1VHPA 3FT4A 3EOTL 3CAFA 4JVPA 1ZLWH 5L0QB 5ISZA 4TPRL 5DEFA 2B2XL 2VABB 3G6DL 1G7PA 5HDQL 2DCKA 1LEKB 2VDRH 4E0RB 1F8TH 1II4E 1UACH 3C60A 3QXWA 2YD3A 4HAFA 5E2UL 3BPNB 4OLWL 3DYPA 3MLZL 1I1RA 2QSVA 1Z0MA 5FM5M 1AGEB 2FJFA 3KYMB 3ILQC 1CGWA 4DKFL 5A2JH 1MCOH 2VL5A 4IRJC 1GOGA 4U1JA 4MQTB 3C8XA 5HGDA 1MAJA 5D2NA 4QHLB 5J1AB 4M1DL 5J3HD 4CVZB 1K85A 3ZM8A 1WBXA 1D5BA 1IQDC 1HHIA 1OAZL 1XF2B 5GZOC 5T1LB 3BESR 4W4NA 3GSXA 1YY8A 1ETZB 4HEPG 2IBGA 1I8KA 5D2LB 4YZFF 4NZRH 3S34L 3CCHA 2EXYC 4FQ1L 4FZEL 2JIXA 1FFPA 3IDGB 2CIIB 2GJ6B 3GMRA 2BVPA 3LQCA 4EUPG 5D5MB 2APVA 3AREA 5C09B 2XWTA 5H2BA 5I71B 2MPAL 3L9RA 2FWOB 3TBYB 4ZUVA 2DQGH 2Y6KA 2FSEA 4WRLA 1DBMH 2DQHH 4U1IA 5T3ZD 1HWHB 4YDJA 3KVQA 4G3YL 3FTGB 5D7LA 4JY5H 1S7TB 3MODH 3VFNA 4ONOA 2J8OA 3BQUA 2HMID 3U7AA 1WAAE 3ELAT 3BMVA 3ROLB 4QXUL 1AXSA 1D9KD 2J7LA 2E9IA 2XG4A 1JNHA 2Z8WC 5F7FA 4YDKH 3C7GA 5T3ZE 2NLJA 4LHJB 3DTXB 4Y2OA 4PV9A 4XCCL 3V4UL 1GRWA 5EOCL 2YC2A 5DJZA 2NTFB 5A16B 5C0ND 4OI8A 2H3NB 1OAYL 3S6CA 4JHAH 3FONB 2DDQL 5ICXB 1CS6A 1DTUA 5EFIA 1C7SA 1H5BB 1XF5A 5DJDB 3S35L 3RVVC 4DJMA 4ELKB 4LHSA 3OKDA 4NKOB 5E8EB 4DQOL 25C8L 1INDL 1YYLH 5TDOB 1X5KA 3FO9B 5HHPB 1JNNH 3THDA 1V7NL 1G9ML 1JF6A 3L6FB 4M93C 5F9JA 5BV7C 2H41A 1LEGA 2DWEB 4XHQA 1KIQB 5IVXF 5I73C 3UYOD 2Y23A 3NA9L 4P5MB 1OM3L 5HYFA 4JDZA 2DQCH 3MV9E 4D9QD 4LSQL 3S3SA 5D1XD 4XXCC 2A74A 4KZDH 3C5ZB 2CPCA 3OV6A 3I02A 3WE6B 4LLYB 3RIAF 1I85C 1HEZA 4I48A 3GJFK 3L1OL 4PRIB 4D9QE 3PWLA 4OGZA 43C9A 3NZ8A 1ZT4B 3O0RH 4NOFA 3TWCH 1AO7D 4G6ML 2Z31B 4OZFG 4GKOA 4KJPC 3BGFB 4PGZA 4F7MB 1F3DJ 3VFVA 5IHLB 4HKBA 3MJ8A 4LASL 3UBXB 3CXDH 1G6RB 1UWWA 1FLRH 4HUVB 1RJZB 1AO7E 3QDMD 2EH7L 2MCPL 4U3HA 5H94A 4D0DA 2EDNA 4G7VL 4FMFA 5KOVC 3TT3L 2XQYK 4JFOB 3VXOA 2X4SA 4APQD 1JPTH 3QDME 3HC0B 3H9SD 1NAEA 4AT6A 5EC1A 4XMLH 5CP3H 1QBLH 3BDYH 3VXQA 3RWEB 4JZOB 4K94H 4RZCB 2YEZB 1KXQE 3LKSA 3KDMB 2V7NA 3L3OB 3H9SE 1PG7W 1T4KB 3IT8D 3WXVH 4FQLH 3OJMB 3HE6D 3G6JB 3MROB 1JGDB 4XP4H 4CU9A 2DD8H 1JGUH 1D5MA 1Z9MA 1G7LA 1C5DB 5JQ6H 3RDTC 5L2JB 1RZFH 3IFOB 3WNMA 1Q9KB 4ZXBA 2AXFB 4ZNEA 5EC2B 5F7DB 3UO1L 1FL6A 1LD9A 1T7XA 5DEGB 1A9BA 3DWTA 3VGGA 1SY6H 3THML 1C5CL 3V5KA 3Q1SH 3TBWB 3SEPA 5D2LE 3MR9B 3QNYA 4OCWL 1A7NH 3BRDA 3C7FA 5HGAB 3SDDB 5DUBB 3HR6A 3B9KA 3QEHA 1BFSA 1GGBH 2GJ6E 5EZOH 3SDCD 3T1FB 4OZ4A 1I4FB 5D5ME 4N0UA 3I6GB 2V7HA 3OJ2C 5C09E 3JTSA 4QY8B 3EO9L 3WHXA 4TSBH 3VCLB 3LRGA 5TJWK 3TZVA 5A43C 4LLWA 4Z7OE 5L2KA 2YUXA 3HNSL 4OCLC 1TZIA 1NAMB 1AD9A 5HD8D 2HKFH 4XPBL 5GGVH 4FXLA 4XC1H 4LSVH 1QEWA 4XNXH 3QFDB 5HHMD 4ODTH 5EJZB 1LO2H 1WFUA 4U7KA 4OLXL 5ALCL 4OJFH 4N0FB 2VIRA 4OKDA 4HKXA 3ZKXC 1JTPA 1HQRA 5HHME 2X4RA 2VR4A 1AFVL 1MCHA 4X8JA 1UMIA 5SWSD 4F7EA 3LHPH 3KJ6L 1F6AB 4LHUA 1YEDB 1I75A 1YN7A 3CZFA 3S96B 6FABH 5KVDH 4BJ0A 2EH8H 3KPRA 2NY0D 5C0AD 3PP3H 5SWSE 5HGHA 4DUXA 3D69A 1XF3B 3CXHJ 2Z93B 3BIBX 4LCIH 4Q74A 3T3ME 3OHXB 1QLEH 2JKXA 3PWVA 4MJIB 3ZYJA 4GAGL 5C0AE 4GRWB 5KSUA 5SX5H 2D0GA 3KPMB 2JCCB 5JOPD 2GT9A 1I8LA 2HAZA 3RTQB 2P5WB 2G60H 3JV5A 3UYRH 4RDQG 3HR5A 5I1HL 4QXGL 1BQLL 4PRIE 2PTUA 4XPAH 5IW1B 1FPTH 1HN1A 1A1OB 3LCYA 2VJXA 4PJIA 2O5ZH 5JOPE 2B5IB 3VRLE 4FMKA 1U92B 3ZE0E 4DEQA 1ZHLB 3A6CH 5C0EA 4NOBA 4JJHA 4YHZH 4HG6B 1YEGL 3FOMB 1M71A 2IPTL 4PYGA 4R7DB 2IGFL 5KS9A 1T2QH 1UXWB 1EEQA 3GSNH 2ZJSH 3QP3A 4RSVA 4JZJB 4WCYH 1XIWD 4YR6A 3MXVL 1NCWL 1N64L 4JO2H 4U1NA 3NBNA 4ZUSB 2F54A 4HZLB 3TLRA 3JTTB 3FB7B 3RX8A 3RWIB 4RA3A 3P0VH 4JFED 5MERA 3EO0A 3LS4H 2F5BH 4P4RB 4PJDF 2NXZB 1IBGH 2VAAA 4MXQD 3DSNA 2YPLA 3EOAA 4IRSB 1FHGA 5I15L 4NUGL 3FJTA 4JFEE 4S1SH 3P6BA 4XPTL 5C7GA 1LO4L 2Q76B 1DLHA 4XPFH 1CL7L 5DLMH 3PWNB 1S7VA 4HZAA 3WKML 2DLIA 3S3PA 4PJXE 1MUJB 1MAMH 3MNVB 4UUJB 4ZY9A 1G7MB 1BVKB 2D03H 2IBZX 2DM3A 2C3VA 5HI5D 1XNTA 1CIDA 4HIXH 4DZBB 1QA9A 3R0MA 2MFNA 1KB5B 4TUOB 3QEQB 4MA7H 1IGIL 1CN4A 2NNAB 3FO2B 4KXZH 2XONA 5IM7B 1U2HA 3BGAA 2CXGA 4HX1A 5IEKB 4X4XB 4PR5B 1MFBL 2VN7A 5JOEA 1Q94A 4U6XA 1NC2B 3INUL 4Q58C 4AZ8A 2SEBB 2GEEA 3VWJA 4K3HA 3PWUA 3RX5A 1TTFA 1IC5H 3P9LA 4XWOC 4NSKA 5JQHC 4M6ML 4Y4HD 1YEIL 2XWBB 4JX0A 4M6OH 5DRNB 3VRIA 2EO1A 2DKSA 2VZRA 1HKLH 2A9ML 3ORJA 1HSAB 5HHVL 4ZODA 1XF4A 3HPJA 4KRMB 3QUZC 3VXMB 3ULUL 3QFJB 4D9RD 1FCCA 3EYSL 4E5XB 5CJBA 4HWZB 1WWBX 1KCUH 3ZYZA 1CXKA 2X9YA 4XWGH 4WFFD 3B2VL 4O51B 3HC3L 1NANI 3MGAA 4KUZL 3MZGB 1D7FA 4D9RE 2W9LA 5DF0A 2F53B 1OD3A 3NN8A 3A23A 5AZEL 3U30C 5CEXA 3BKMH 3EAKA 4WFFE 4X5XB 1DBAL 4I4WA 2P5WD 4K3DL 2VYRE 3VGFA 3ZE1F 4X6BB 1ZGLA 4XC3L 2BY0A 4MWFB 3G9VA 4GRWE 1NMAH 3FRPA 2JCCE 1NDMA 4GUPB 1T04B 2C1OB 2AXJA 2P5WE 2AAVA 3G6AA 1TENA 1W72A 2GTZB 3HNVL 2EEBA 4WI3A 1AY1L 5HPMB 3WBDA 1G9MC 4JFYA 5KW9H 4PY7A 3SKOA 1MFEH 4NO0B 5D7JA 4FFYH 4HCRL 3WS3A 4F7PA 1MJ8H 4P5TC 4WEUD 2CDGB 4KK9C 4QOKA 4YQXL 4PY8I 3O3BB 1LEIB 3R8BB 2CDEB 4O4YH 1Y0LA 2AJYL 1EVTC 3RWFA 3Q3GB 4OV5B 5DYOA 2AEPH 4JQIL 2BVOA 4LKSA 4PJ5D 2V2XB 3VD7A 5JW4N 2I9LB 4F8TA 2R1XA 3CVHA 4LDEB 3Q0HA 1BFOA 1BVZA 4IRSD 2E7LC 3GHBH 4PJ9A 1UZ0A 1X5ZA 3BHBB 4IJ3B 1RIHL 1TQCB 3SY0B 4YHIA 3K74B 5E08L 4DW2L 4PJ5E 1MCWW 2XTLA 4PRPB 3MCG1 1A4KB 1QD0A 5IVXB 4AEIL 4XAKD 3UZVB 3VFGL 1J1PL 5D1ZA 4K9EH 2W0FA 2KKQA 1KPVA 1MFCH 1UYYA 1GGYA 1MQKH 2B7DT 4QYOA 4XCYA 3ZTJG 4W8JA 3DMMB 4FQJH 2W0LA 4Y1AD 1DQLL 2DLGA 5TE6L 1UZ6F 1WC7B 4XAKE 3WN5C 1KCVH 3HZVB 5DJAA 4KKAC 5LKNA 3AFLA 4WWKA 5HHOD 3QEQD 4N8PA 5F7KC 2FX7L 3E2HB 1BJMA 2IJ0C 3IB4A 4TULL 3FCTB 4Y1AE 3ARXA 4KVCL 4TUKH 3OKOA 2IPKB 1EGJH 2F5AH 2J4WL 3GMQA 4R4BA 2AGJH 1PLGH 2HFEB 2PUQT 1JWSA 5HHOE 3M8OH 3QEQE 2ZSWB 1MCPL 4QDRA 3P4MA 3WD5L 3D48R 1YY9D 1QRNA 5HVWA 1A2YB 2WUCL 3C08L 1DUZA 4JKPL 1VFAB 4OFIA 5C0CB 4OTXL 3NIFF 1EJOL 1ZGLP 1UC6A 3PL6A 1MCNA 3FRUB 5FUOH 5D1QC 1C08B 3HE7C 3DUSB 3K46A 1OTUC 4WI9A 1F6LL 3SE8H 3ES6A 3NZHH 3QFJD 5J4MA 4YXLL 1S7WB 4JZNB 3WSQL 3DETD 4Z95L 1T3FB 4UV4L 3CSYB 1A64A 3X12B 1BJ8A 3E6FB 1G7HA 3QEGH 4KV5E 3ULVF 1QZ1A 1S7RB 1NEZA 2J8UA 2AEWA 3IKCB 3JV4A 4G9FD 1DBJL 1WIOA 1YYML 3QFJE 4BH8B 1WITA 1PG7X 2H2SC 1NMBL 2F53D 2X1PA 5D9SA 5C07B 3U7WL 3RX7A 3HNTL 1EFXB 5GGQL 1INEH 1QVOA 3O6FD 3RL1A 2CKBB 4G9FE 4I3SH 4B0MM 1D3CA 2J6EH 3GIZH 4HH9B 2F53E 3I9GL 4YZFE 2RR3A 5ICYA 3DIFA 2Y06L 5FO8A 3QNZA 3MRQA 4LPTA 3O11B 5K9KA 1FYHB 2CLVA 4XHJD 1AHWC 2HRPH 3LRSA 4JFXB 3V5HA 4G43B 4QF1A 5ID0B 4JPIB 4C56D 2XQXA 3I97A 3NGBB 1HXMB 3TO4A 4GRLC 4JQXC 1SMOA 5I17A 1HYSD 4A6YL 2LU7A 3PV6A 4KDTC 1EBAA 2YSSA 5JW4R 1KC5L 4MCYB 4OLZH 2VITB 4NKQB 4QT5B 4UOW1 3CIHA 4IIQA 2ZUVA 4C56E 1KN4L 4DZ8A 1VACA 1JPFA 4IRZL 5FOBB 2BP3A 3ARBC 4G7YL 1IJ9A 2X70A 1FO0B 5FUCC 1ADQA 3B83A 3MSPA 3WFHB 5JPNA 5TPWH 2VDRL 1F8TL 5AWNH 1J5OH 4HSQA 5EU4A 3BPOC 4PJIF 5JO5B 4M1CC 1I1YB 1L9MA 1X5LA 2B39A 3BJLA 4DXSA 4IM8A 5AYUH 4PG2C 1DN0B 4K3GA 4PB0L 4LRNH 3BRGC 3K2UL 3QUKB 3VWKC 1FNAA 4YBQC 3GSOB 3TIDB 1IAKA 1QSEA 2Q8BH 5KS9F 2ITCB 3JUYA 3DO3A 3KLAA 3TT1L 4K8RD 2HVJA 4HD9A 5CMAA 2ATKA 5GS0D 5IVXE 3V2AR 4G8IA 5F89B 4IOFD 3RZCC 3MO4A 3WFDH 1QLFB 2GY5A 1U42A 2B20A 5IR1A 3LKRB 5E6IB 3MYJB 4WNQB 3D85A 2BC4A 1BLNB 4X7TA 3QO0B 4BFIA 5J7CC 3V4VL 3SKNA 2ZCLH 2VR5A 1E4XH 2MOVA 3L7FB 1JVKA 4F8QA 3AAZA 3B5HA 4LLVA 3F8UB 4JFDB 4JE4B 4O58H 4L1DA 4KTDH 3MODL 5EBGA 2J5LC 3K8KA 5J1SC 4X9GA 4E9LA 2I9TB 4K7FA 4XH2B 3KS0J 4U1GB 1EHXA 2P48B 4KHTL 1VENA 2R2HB 1P53A 5C2UB 4U3CA 1YC8A 1FV1B 2E7MA 1GQPA 2VISB 1TIUA 3TCLB 4HXBH 1IMHC 3MRMA 4QRRB 2GSIA 5DJ8A 5IBUB 4BM7A 4NWTH 1RK0B 1B9ZA 1CK0H 4R26H 1MHEB 1IGCL 3RKDC 4OD1H 4DFHA 1BQHG 1AGCA 4RWYL 2IPUG 4KXZI 1RAMA 4OYUA 2VDMH 4PJDB 1KN2H 2HLAB 5F9OH 4LKCB 3U7YL 3RIFK 1XGPA 2X1WL 4DK6A 1YYLL 2WW8A 2AV1A 1F3DH 1BHGA 1OHQA 1D5ZA 3EOBA 1PVHA 2GIYA 1W8NA 2AJ3A 3FT4B 3QI9C 4FQ2H 3ARDA 1AR1D 2GITA 2DOCA 5DEFB 1OAQH 1GC1H 4ZAKC 4NFCA 1G7PB 5CJOH 3OSKA 1YEFH 3U0WL 4R8WL 1H0DB 3TFKD 2BRQA 3C60B 3GSWA 5DT1H 4Q0XL 4LEXH 3OMZA 2EDTA 3WF0A 3MV8D 2FJFB 1HNFA 4X7FC 3O0RL 4D9LH 2VL5B 4CAGA 3B9AA 4U1JB 1KJ2H 1AGDA 3B9DA 5HGDB 1QSFA 3ULUC 5D2NB 1AI1H 5IGXL 3BZEA 1WBXB 3L5HA 1D5BB 3MV8E 1HHIB 2NY2D 3ZT7A 4IDJH 3ARGA 1YY8B 1MCRA 1I8KB 2NY6C 4NO2A 2RB8A 4GJTB 3CCHB 4QB2A 4XP1H 4LLMB 1JRHH 2JIXB 1FFPB 3K8LA 3GMRB 2BVPB 2R2BB 4XCNB 1I1AA 3AREB 3X13A 5H2BB 2C7UA 3BZDA 2FSEB 4U1IB 1QBLL 3BDYL 4K8RH 4YDJB 1K3IA 5F8RC 3VFNB 3VXRA 4HFUH 3JWNC 1N4XL 4YJZL 4OUEA 4FQLL 1NBVH 5HYQA 3GMNA 1JNHB 4JFZL 2NLJB 3KAAA 4XP4L 4M7ZB 5I1GH 2X4TA 5JTWA 3WFEH 4OLEA 4PV9B 2AJZA 5JORA 1QYGH 1RZFL 5IWLA 4K2UH 5DJZB 5EULV 1RHHA 4YO0A 4MAYA 2J1VA 1CDCA 2CMRH 4YFLI 5BZWA 4ODUA 3STZA 2ZUQB 4JGJA 4OT1L 3QIUB 4P5KA 1CLOH 1KFAH 4XZUG 3NAAL 1F3JA 4RAUB 1UX7A 4XRCA 3PWPA 3EYFA 1A7NL 1PDKA 1KBGL 4RAHA 4PBXA 3WCYA 1H9VA 2R15A 1BQUA 1GGBL 4Z7QE 5LG1A 1K9TA 5F9JB 4PRHD 1TJGH 4W70A 1LEGB 4ZD3L 3TBTA 3NCJH 3PP4H 5DJCA 4Z8FH 4JFDE 2FDBP 4JDZB 3TC9A 3BKCL 1LE9A 4HFWB 1LWRA 2PKDA 1NCCH 2A74B 4PRHE 4AMKH 3CU1A 1BP3B 5B21A 3I02B 5GGVL 1OTSD 1A14L 2PN5A 4XC1L 1J9CT 1HEZB 4XUPA 4JY4A 4XVTH 4I48B 2D0FA 3PIQA 4KHXL 4AEFA 3NCCB 2NZ9D 3PWLB 4ODTL 4PS4H 43C9B 1KPRA 4GKZA 3NZ8B 1E0OB 1U8NB 3P2TA 4YHOL 4F7TA 4H0HB 4RRPG 2BVEA 5DD6A 1G9NL 2UWEA 4OB5L 1DQJA 3VFVB 3MJ8B 4NN7B 4WO4D 3W82A 2GK2A 1A02N 3LHPL 3KHOA 3JZ7A 1OQXA 5H94B 1X7QB 2N56A 5ISZD 5E95B 5KVDL 3RWHA 3GO1H 5INDA 4PT6A 4YFEA 3VXOB 2BJML 3WIHH 2X4SB 5IMLA 4AT6B 4Z76A 5EC1B 1KPUA 3QIWD 5ISZE 1RUQH 1CFSA 2PTTA 1X5YA 5EO9A 2IF7A 2WQ8A 2V7NB 3QCUL 4JKMA 1L7RA 4TUJA 4XPAL 5C0BD 3RAJH 5IHBA 1BZ7A 2J8UF 5C92A 1D5MB 5ADOL 2BNQB 1G7LB 2N4IA 4DTGH 1J0HA 2EXWC 4ZXBB 3B5GA 1FG9C 4YHZL 4LP4A 3ESVF 1FGVH 4MA1B 1FL6B 3IDAA 1WIPA 4CUBA 1UXSA 4K07A 1A9BB 5C0BE 2QQNH 3BJ91 1T2QL 4NHCH 3V5KB 3ARED 3GSNL 4ZG1A 1B0RA 4F2MB 1A1MA 5BW7A 2R23A 3BPCA 2H32A 3QNYB 3O4OC 2ICWI 2JELH 3B8SA 4BZYA 5HYSG 3CH8A 3B9KB 3QEHB 5D7LD 5F3HA 4GBXC 4A2MA 3KGRA 4OZ4B 4N0UB 3BQUD 2V7HB 1OF4A 3JTSB 4ZDHA 3WHXB 1R5IA 1SMAA 7CGTA 3P0VL 2FECL 3MBED 5J13C 3TZVB 1NUKA 3LS4L 4LLWB 5L2KB 5IB4B 3IAGC 2OR9L 4KZEL 3LH2H 4KMTL 4LLDA 4NZTL 5D7LE 2DL2A 3QAZB 3BIKA 1AD9B 2XKNA 2QQMA 2AK4A 3GMPA 1JZ7A 1P4IH 5C0DA 5A3IC 1CDBA 1XGRB 3IVKA 1QEWB 4XPFL 5DLML 1I1FA 1FL3A 2Q8AL 1P7QA 4MX7A 4HJJH 2F74A 3PG2A 2D03L 1WISA 2XICA 3S97C 2VIRB 3LN9A 1LDSA 2I07A 5JW5B 2ATPA 1KSRA 1HQRB 2X4RB 4HIXL 4CNIA 4X8JB 3N1QC 4DN4H 3IFNH 4F7EB 3PUCA 1FGNH 4LHUB 5E56A 3CZFB 2OL3L 2RIKA 2Z91B 1RVFH 2X4PA 3O3AB 2DQUL 1DSFL 1MI5A 1Q9WB 5HGHB 3D69B 4D3CL 3N9GH 4QLRA 4XUQA 4P2CG 1L6ZA 3T4AA 3VFWA 4K3EH 3PWVB 2CRIA 5IVOA 3UAJD 1VEMA 3QUZA 3FQTA 3MRFA 3UCRA 3MOAH 1E4XI 1RU9L 4UMGA 3HR5B 2X1XR 4HPYL 5I1CH 4I0PD 3CFKA 3V52H 5DQJA 1RJYA 4PJIB 2J1TA 4OI9A 5C0EB 1CD1A 4YEFA 1M71B 4HK3N 1ZWIA 2Z8VC 5E8NA 2PW2A 5C6PB 2OKXA 5KS9B 1KCUL 3MCLH 4Q97A 4RGMC 2CIKA 1L7IL 2CKNA 2OMNA 1JHTA 2WWKT 5CSZA 3QIBA 1TNNA 5F9DC 5DD0H 2NY4C 3RZWA 1LHZA 1I7ZA 4YR6B 1BD2B 5DVLA 5JHDD 4KKLD 1MCWM 4ONFL 2F54B 1ZLVH 4NQCA 4LPVA 4QHNB 1YJDL 3QUXC 5MERB 5F88A 1US3A 3LEXA 3EO0B 1YA5A 3WXWH 2VTFA 3MJ9A 1K2DA 5D96C 2VAAB 2YPLB 3EOAB 5C2BL 5K9OA 4Q9QH 2DI7A 4GXUM 3EJZD 1JWMB 2IADA 2OJEA 1OCWH 1MCIA 2AQ2A 1S5IH 3G9AB 1ZT1A 1BFVH 4EI6A 1DLHB 1TQBB 4WU7B 4V1DA 4XMPL 5KZCB 2OXGA 4NBXB 4FFYL 5CZXC 4LSSH 1MJ8L 3X3GL 5D6CA 2C3VB 3B9KD 3ZT5A 2JD9A 1CG9A 3DX7A 4QRPA 1MJ7H 4O4YL 1QA9B 2QJDA 4OV6F 4IEFB 5JMRA 2AEPL 3E0GA 5BRZA 2ESVA 1PFCA 4PLKD 3S9DB 1IGMH 4Z6AT 4BZ2H 4EUPA 2FX9L 5I66A 5AUMA 3TF7C 4V2BA 1MJUH 5I1AA 1Q94B 4U6XB 3REWB 3S3JA 1FNSL 1KJ3H 2FB4L 2AJXL 1VKXA 1X9QA 4H0GA 5JA9A 3VWJB 1JRHI 3PWUB 1R64A 4P57A 1KTKE 4K9EL 4EBQL 2MTPA 3P9LB 3X14B 3I2HA 2P46B 4NSKB 2XOMA 4FQJL 2ZCHH 2X4OA 4P46A 3RWCA 3VRIB 1KLFA 4Z7UF 4NNPL 2ZSVA 4KI1A 1XF4B 3HPJB 1MREL 2X5PA 2ZP0T 4FXGA 2M1KA 5IW6A 3OJDA 5JW3H 5KG9A 3KPRD 3KYNA 4EDWH 4DXTA 2RVAA 3O3DA 3MLYH 1T22A 1N59A 3DV4B 3M8OL 1YEKH 3FZUD 1EO5A 5D1QA 3VRJA 2YA2A 1PEZA 3ACGA 3KPRE 3S36L 5DUPH 3NN8B 2MCG1 5CEXB 1PY9A 1CGUA 3L5IA 4KU1A 4N0RA 4I4WB 4X5WA 1OP9A 3F5WA 1JGVL 2R4RL 5TE7L 4N9OB 5L7XH 3MUHL 1XMWA 1ZGLB 4DXRA 1OB1A 3VI4F 3O2DA 3H3PL 1NDMB 3AS0A 2W07A 1OPGH 2HVKA 1NBZA 1VDGA 1W72B 1O0VA 3G6AB 1XNAA 1V5JA 1CFTA 3OAYK 1A8JH 4JFYB 3SBWC 3MNWB 4TNWF 4PY7B 4PJIE 1FSKB 5LCVH 3QEGL 2XOTA 4LIQL 3SKOB 4H5SA 4OZFA 5D7JB 3MA7A 1IFHL 1EUUA 4KGLA 3LQAL 4F7PB 3FT3A 5I9QC 5KS9E 4X9HA 3HFML 1IAIM 1NGWA 1C12A 1AHWA 3KLSA 5DYOB 2VLKA 4MQXC 4ETQA 4YE4H 3GIZL 4GRLA 4GH7B 2UWEF 4BZ1H 2R1XB 3CVHB 4KDTA 4G8EB 3QDJD 1OSPL 2W91A 5F1SA 4Z2AA 5EIQA 4L8DA 4WFED 2R29H 4WTWA 1BECA 2QQLH 1AQDA 3ARBA 1T5WA 5B4MD 3MV01 5HTSA 4JG0H 4J7RA 5D1ZB 1RZJH 2W0FB 3UDWA 3QDJE 1H3WM 1WWAX 3SDAC 3BO8A 5C6TH 1L7TH 1KPVB 2QSCL 2F19H 5DA0B 3BRFA 2VDKH 1OTTC 4J3TA 2BOBA 2P43B 4PP1C 4QYOB 4FS0A 4XCYB 4WFEE 1ZVSA 5GZNC 1QR4A 3OPZH 4YUEH 1ZLSL 2B8OT 5MHSD 3BT2L 3IDYC 4BFGA 5DJAB 3BW9A 1MCFA 2MQ0A 4WWKB 3H3KA 3LV3A 3GJFH 3NCFB 5TPWL 5MHSE 5FYKL 3BEWA 5AWNL 1E4JA 3OKOB 4YPJA 3GMQB 4R4BB 5TGBA 5BQ7A 3HUJA 3P4MB 1RZ7H 2D7MA 3RZCA 3JWOH 3VWJD 1QRNB 2DJUA 3DI2B 2C1PA 3MRHA 2EC9U 4LRNL 4OLUL 1DUZB 2Q8BL 3V7MA 4A6OA 5TE4H 3HG1D 3QZWG 2J1UA 1ZGLM 3PL6B 4OM0H 1CICC 2HTKC 3ILPA 4Q7DA 1HZHH 4LCUA 2FO4A 4JHBA 2NR6C 3M1BA 2B0SH 1KGYA 3ES6B 3HG1E 9CGTA 1JMXA 2QADB 1A6TB 4W50A 5J12C 5D71H 5EU6A 5I1JL 4DN3L 5JDSA 4G5ZH 2PO6C 1G7HB 2OZ4A 1S9VA 1NEZB 4H25A 3JV4B 4RMVA 3OZ9L 3UTOA 4G8FA 5D9SB 5FM4A 1DEDA 1PBYA 4HIEB 2H45A 3QCTH 4XX1E 3RHWF 3RL1B 1MCSA 4JRXA 1QKZH 3K1KC 3HMXH 2Z4QA 4ET7A 4PREA 4NQVA 4RA0C 5ICYB 5IEHA 4J3WA 5FO8B 4HXBL 1NGXA 2HN7A 3O4LA 5CJXC 3MRQB 5T5NG 5JXIA 4OD1L 5K9KB 1XH3A 1EEUA 3V5HB 1ULVA 3UJTL 2XPGA 3LEIA 4QF1B 4HG4K 3FO0L 2HTLC 5D7JD 4G6KL 2BSSA 3CFEA 3TO4B 4LCWA 4ZAKA 3VXTB 3QUMA 1BIHA 5CJ5A 5I17B 3PV6B 1EPFA 2YSSB 4HKZA 4QOKD 2XZAL 3BZFB 1DEEA 4IIQB 1J8HA 1N26A 4DZ8B 1VACB 1JPFB 3FQUA 3QQ4B 2X70B 4QOKE 4J8RA 4XNYL 4HW6A 1GC1L 2PYEA 2X6MA 3OGVA 3QULA 2PXYA 5CJOL 2QBWA 2ZCKH 4RISL 3SGKC 1LE5A 2XYCA 2GTWB 1CIUA 1I7RB 2DS4A 4PJ9D 1RUAL 3PXHA 4N1HB 3JWDL 3KLDA 4WU5B 1IAMA 3WNOA 2YB7A 4XP5L 5J11B 2NW2A 2P45B 3P30H 5E2TL 4HS6A 2VWEC 3QNXA 1KJ2L 1IAKB 4B53A 2XQBL 1AI1L 3KLAB 2HVJB 1OT5A 3D25A 1CFQA 1G7QA 2ATKB 2BSRA 2X42A 3PHSA 4OSUH 4X7EC 5CMAB 3JXSA 3FN0H 1KELH 4QDQA 2CDFA 3WJJA 4G8IB 4YPGA 5DI8A 3T1WA 4KRPB 3O6KH 3DO7A 3QUYD 5IR1B 5E03A 3D85B 2BC4B 3ARQA 1MCLA 1MFAH 2EYTA 4KK8C 4YBLB 3P77B 4UTAH 3OEAA 3ARFC 1OW0C 4O5LL 5CD5D 3SKNB 1OOAA 1R3IH 2C4FU 1HDMA 1MRCH 1YJDC 4LLVB 5GS2D 4M3JA 4M6AA 3IDNA 5C08A 2DQJL 2WSKA 4HCRA 5IBTL 3L3DA 3BN9C 3VFSA 3FB6A 4PLJD 1JWUA 4P9HH 5E4EB 1WK0A 3EDDA 4MMXC 4BKLA 4K7FB 4O9HH 4EN3C 4C58B 2EDEA 4JRWA 1T1XA 4L3EA 1RI8A 3PL6D 5I6XC 2FZ3A 3L3GA 3NQHA 3O9WA 2K1MA 1R3LA 4OIIH 3AMLA 3MRMB 3U4EB 4K2UL 3SGEI 3M45A 2GSIB 5DJ8B 3BSZH 5ERWA 4M93B 2IFFL 4I2XA 2CMRL 2E5EA 3CDGA 4P2QA 2V5MA 5FYLL 4ONGH 1AGCB 1P5VA 1DLCA 1LQSR 2YWZA 4EQ3A 1CLOL 1KFAL 3TIEA 1K8DA 2P8PA 5GGSB 3MNZB 2CUMA 4P2OC 1NCDL 3ET9F 1XGPB 2AV1B 4DUWA 1U3H