2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
4CDHA 3BHBA 1ZT4A 2GFBB 2F54B 4DN3L 1LWRA 3GSWA 4JFEB 3HFML 4P3WA 5E2VH 1G9MC 4M8QB 4LIQL 1S7UB 1QYGH 2BVOB 5CSBA 3O2VL 5GZNC 4NSKA 5HDQH 1NC2D 4NKOB 2N7AA 4JO3L 4YXLL 2QADB 4PJBB 5C3LD 1UACL 3TA3B 4BQ9A 4WO4A 4YPGB 1BGXL 4Y4KA 4J2XA 4M1CD 1F4AA 3OGCB 4M62L 2EDKA 4GZ9A 4JFXB 5DUPL 4QNPE 2AGJL 2APTA 4RDQF 4JN2B 3CIHA 4NN6C 4QTIL 4AT6B 1ED3B 4I9WE 3IS1X 3WS3A 32C2B 4GKNA 2OR8A 2RFXA 4UQ2A 4QXGH 3WXWL 3KYKH 5KW9L 4R0LC 5EO9A 3WLWC 1MFCL 3UC0H 3IAGC 5J6GA 2B5IC 4L5FH 5D5MA 4CADB 2R7EB 1RZGB 5ESVA 2WUBH 1XH3B 2X1XR 5I8KL 5IB4A 4XHQA 1OARL 2J3SA 2QQKH 4NP4H 4XVSL 4KHTL 2P42B 3U2SB 4GQ9L 3SCMD 2VXTH 5CHNB 2W1UA 3QJFB 1T04A 2BVOA 2VN7A 3R06B 3EYQC 5GGSA 2ZOLA 1NCWL 3CFDB 1LO3L 1QLFA 2XTJE 3OGSA 2VL5B 5EUOB 3WF2A 3WLWD 2WBJB 3DVNB 5FA3A 1T0NA 5DWUL 3B43A 4PJ5D 5IW1A 1SQ2N 1AXIB 4JVWA 1FG2B 3ZL4H 1D5BB 1IJ9A 3MNWB 5I1HH 1J5OL 1E27A 1ZT7A 3WV0A 1EV2E 1S7WB 4KDTC 4PGDB 3VWKC 4R90H 2DKSA 1TMCB 4AIXA 4QHKI 3E8UL 3GRWA 4XC3L 2WBJA 4G5ZL 3SDXB 3V0VB 1RJYB 1UX7A 1V8HA 2NY1B 3U7YL 12E8L 1UWGL 3CJJA 4HIIB 3TCLB 4JKWA 3FO0L 5D70L 2E9IA 3BN6A 2NY0C 3QJFA 3S96A 3FHAA 1CZTA 1E6OH 4PJAA 3BZEA 2HA1A 1R3JA 1NDGA 1NBVH 4I0KA 2GAZA 4UINH 1CFSB 4LSTH 3GSRA 1MFBH 3ZYJA 4IRJC 4GG8A 4RMRA 4M6NH 4F58L 2VR9A 3IU4H 4YFDB 2K3TA 4KKLC 4PJ5B 3MLUH 3T4AA 4L3AA 4LF3A 2EE6A 3ULVE 3FT3A 4JFPA 2BZDA 2X70A 3QO0B 4EN3A 1JP5A 2CGRH 2KD7A 5AD0A 2FX9H 4O00A 5EZLB 4HLZG 4LCCC 1JHTA 1YYMH 3HRPA 5FOBB 2EYTB 3OAYH 4XGZB 4P23D 3DX7A 3AY4C 3FO9A 5KOMC 1DANT 2DLTA 5EIIA 5CD3A 1S7QA 3QUKA 4N0UE 2WN2A 3NRUA 1KB5L 3Q48A 3WIIH 3DUUA 2WYSA 1J1XL 1S5HB 5C6WH 5F89A 1BOYA 1CVRA 4KK8D 3U9UB 3CFKA 5EZLA 3QJHB 4XNQA 3RU8H 5JXED 5JPNB 4M93B 3FMGL 5DJCA 1FH5H 2H32A 5C0BA 3TBYB 1MOEA 4NO3B 1U58A 3EOTL 2DKUA 2X4UA 1CL7I 1PY4A 2VL4A 4TUKH 1NBZB 3IDMA 4G6AC 1JGLH 5DJ6B 2C1OB 4UV7H 1CFVL 3OX8A 2VDRH 4YXHH 1HZHH 1QNZH 2VDPH 1JGEA 4JO4L 1D5MB 2ADGA 2NY5H 1U3JA 4MNQA 3UXFA 1Z9MA 4MNQD 3SE4C 4RNRB 3MV9A 3V5KA 3PNWA 4TOYL 4Y2DC 4S1QL 2J1VA 1NPUA 2YWZA 1D6EA 5E5MA 3Q5TA 3RNQA 1U42A 5MEQB 1BPVA 2OL3L 2WM0A 3JVGA 2IJ0C 4HBQA 5GS1A 5JHDB 4LQFH 1U8PA 3FZUD 4HMEA 4BFBD 3TP4A 4FXLA 1KELH 4HAFA 1VADA 5IMOA 3GUTA 1RZIA 5L88H 2AABL 4U05A 1I1AA 3EB7A 1T3FB 3B83A 4FZ8H 2ESVA 3QAZB 1KCKA 4IRJB 5I1IH 1T22A 3ZT7A 3P4NB 2J1TA 2CXKA 4NPYA 4IRSB 1V3JA 5HYSG 5JOPE 2KUTA 1O7SA 3KJ6H 1SY6H 4K3EH 5JZ7C 3DPBA 3L5HA 2ED7A 1C5CL 2YD4A 3PP3K 5I1AB 4YR6A 3ECBB 4X98A 3WDJA 2MCG1 1TITA 1RZJC 1ZA3A 2E32A 3CU7A 5HPMB 3ZSTA 2KPNA 1I7UB 4MX7B 2LE9A 1OSZA 2A83B 2XV6B 3RBSA 2XQYG 5FOJA 1QBMH 4O58L 2AV1B 1FL5A 3VWKB 1H15B 4KH2A 3I6GB 1BF8A 2GK0B 5CWSB 1YEGH 4M48L 5CEXB 2MPAH 3VE0B 2BERA 1F45A 4IDJH 5EUOE 3LN9A 1XCQB 1DFBH 2YR3A 3MBED 4DKFH 2X89D 1E4XL 4EZMA 4EDWL 4D94A 2CLRB 5SWZD 3LSOA 3VFNB 2GYSA 1G7MA 2WBKA 5I73C 4NYLB 3F7VA 1PEWA 3UAJD 5B8CB 5HPOA 2UWEF 3O6FA 4XNXH 1U9KA 2W9EL 4LVNC 3C9NB 2IAMB 1BWWA 4X6EB 5CINL 2NNAA 3MRQB 4PJDE 1BQHG 2NX5B 1QBAA 4LEXL 1AP2B 1P84J 3B2UC 4GXVH 3INUL 4YDVA 2DM3A 5EBGA 4MQTB 1T3FA 4QRSB 1JNHB 2YD3A 2QQKA 3OJDA 1KCLA 3U9PL 5FO8B 4QHKJ 3UMTA 1MFCH 1OY3B 2B9VA 1B2WH 1NL0L 1FYTD 4TULL 4JM4H 1AGCA 3D69B 5EDXA 5JUEL 3S37H 4PJHF 2WUCL 1DTUA 2WQRA 1JTOA 4MB4A 2VLJA 2Z9TA 5D1ZB 5AYUH 5FUCC 2QR0B 5B4MD 2VXTL 3HR5A 3VI3F 5CP3A 4CN6A 1J11A 1P7QD 3G5XA 2F74B 1LO3H 1S9KC 2ZZUT 4JO3H 1CLZL 4OF0A 2FWOB 2ED9A 1JGUH 4LARH 1EBAA 1CFSA 5DGQA 1CD9B 4PGCB 4AENA 1G84A 1JGVH 1BFOA 4HULB 3ZDXF 5JW5B 3T4YB 3CMGA 2XZCL 1JGDA 2MCPH 3U6RA 4OZGF 3IDNB 4PJ9A 4IJ3B 4O2CB 4O51B 1MRDH 3AM8C 1R5WA 2MHAA 4PJ7E 4Z78A 12E8H 1NCBL 1UWGH 3UETA 4HIEA 4Z77A 3UTZB 1C1EH 3QUXD 1RK1A 4JKPL 4PJDF 5CZVH 2QHLA 1F11A 4B53A 3WN5B 5BXFB 1YECL 3B2VL 5DR5H 2EE9A 4YDLC 5DRWB 5J12C 2ZXQA 2OM5A 3BQUB 4D2NA 4Y1AA 3GM0A 2FSEA 3CUPA 1XH3A 2C7UB 2AQ2A 2F19L 1H8NA 1X5JA 5DJAA 3KLHC 5F9OH 3H9SD 2H6PA 1FP5A 3EHBC 3L95A 4MHHI 3O9WA 1LVEA 2DB8A 1A7PL 5DJZB 4M1GL 5ALCL 4D3CL 2YHGA 1FDLL 1NCTA 4RFNC 5JUVA 4IMLB 4PJBE 3RA7H 3OKOA 1OGTB 1W9WA 2AAVA 1QR1B 2YPLD 2XFXA 4PJBF 2ZJSL 1NGYB 2BSTA 1G7JB 3GJFK 3FQRB 1BBDL 1IVLA 2DYPB 1RJLA 2VITA 2J6EL 4P23A 4AL8H 3P11L 2WZPD 4NCC1 3GJFA 5HI3D 5AD0B 5DJYA 4I3RH 5FGSA 5HJ3B 3UTZA 4OZIF 4OFDA 4WI2A 2IALB 4P5TD 4KRPB 3FO0H 1FE8H 2V17L 2F58H 1JUFA 3G04B 3H8NA 4JDZA 4WWKC 3RA7L 5E00B 3CX5K 3I2CH 4OCYL 4TTGA 1J9CT 5C9JB 3QHFL 3Q2CA 4GS7C 3L3IB 4LKXA 5HVGB 1WBZA 3ARWA 5GGUB 4HK3J 1MFBL 1SVZA 1Z0MA 4UU9A 2EIDA 3BT2L 2G75A 4KU1A 1A4KB 4HCRL 1AD0B 4M7LL 4FOMA 1QNZL 5B39B 5GGTA 1FN4A 4ZUTB 1KEMH 1II4E 1QUNA 4GJTB 2FO4A 1PZ5A 3OF6A 2WWMC 4NRYA 5C0AB 4UDUB 3T0WA 5H35B 5C2BL 5INDA 1U8NB 1A6WH 2W0LA 3LQCA 3D3VD 4A42A 4NT6A 4G9FA 5D7LD 2KQNA 2GJZA 4MB3A 3GSNH 3IF1A 3QDGD 5I19H 3QRGL 4M9OA 4OZHF 3PWNB 3TM6A 3KWWA 1BD2E 1X5IA 2VOTA 3G6JB 4YDJB 4LQFL 3K74B 1ODAA 4UUJA 4N8PA 2FEEI 3WIIL 2IBZX 3NTCL 1RUML 3EO1B 1XGPB 1N59B 2IANB 5BV7H 5JOFA 1JHKH 4L9DA 3D0VB 4JM2F 3RHWK 3EUUA 2FBOJ 2FEEL 5CZXD 1T5XB 5DA0B 1MFEL 4KQ3L 4L29B 4LSVL 5D1QD 4OKVB 3EOTH 4HUNB 4PLNC 5DK3A 1RUQL 5CUSL 3RJDA 5IMLA 3IETA 1K5NB 5ETUB 1IGIL 3RNKA 3PG2A 2VCBA 1CLYH 4KK6C 5CJXC 3TH3T 1MUJA 1IM9D 4IBLT 5GS3A 5IVOA 5KBNC 2BNUB 3DWTA 1Q9WB 5MEOB 5L2JA 4OBSA 1FNGB 3WO3B 4TUOA 3EYUH 5M95B 1CYGA 1F90L 3P9MA 2AKRB 4NM8L 1QSVA 1RIUL 5I1AA 3FB7B 1IC7H 4MD5A 4UU9B 3VDAA 1DN0A 3OAYK 5EU7C 5BOPA 5EZIH 3S7GA 3CXDH 2Z35A 1K8IA 3NZ8B 4TUJB 3KDMB 2L4OA 1R3IH 3T77B 3HE6D 4M7LT 4QRPA 4Y4KD 4HW6A 5KSAB 3CVHH 4JO1H 4PJFB 3B5HA 4G8IB 4YWGH 4DGVH 3MRLB 1ITBB 2VE6B 3CVIL 1W9SA 5DMYA 4N0UB 3WJJC 3MRGA 2ADJA 3M07A 4OLVL 5T3XH 4PJGB 4ELME 4OQTL 1B9ZA 2AJVL 5IR1A 5IV2B 3BXNA 5E9DD 3QXAA 4JRXE 3V0AC 1JHTB 1U3ZA 3AXLB 3CXDL 5C71A 1W8NA 2AQ3A 4FQHB 4CVXA 5CJXA 4JREC 1OWWA 3O41A 4GG6B 1AJ7H 1PSKL 3AC0A 1OB1A 4N0CD 1CXIA 1D5ZA 4PRDA 4MA8H 3BHBB 1Q0XL 2X9XA 3MJ9H 4HJGB 4NRYB 5C0AA 2OZ4H 4PJ7B 1F58H 4JDVA 1WKYA 2F54A 4OF6A 4LL9A 2FJHB 2QSTA 2LV4A 3V6OC 4U0QB 4Q9CA 5IF0A 2P8MB 3VD7A 5I71C 1I3VA 4TULH 3C2AL 2DWDA 4NO5A 4JGUA 5C8JB 4L4VA 1I9RL 1E4JA 4FP8L 1WIOA 4DOHB 1DZBA 4I18A 5L0QB 1E0OB 4JPIB 2VLRD 4ZSOB 4GW4B 2D2OA 4XMKH 4PG2C 1YMMD 1JFQH 2GY5A 4HIEB 4Z77B 3W82A 3P0YL 4LKCB 2EEBA 4K2UL 5JHDE 4NZUL 5KOVC 4KHXH 1KJMA 2ZUXA 7CGTA 5KTEL 2YB7A 2QR0A 3AM8A 5DFTA 2EC9U 4U31A 3LE0A 2DQJH 1UWXK 5EJ1B 5ESAA 2ILLA 1DBJL 2BK8A 1BM3H 2WINB 5BS0A 4DCQA 3LKPA 1DL7L 2APBA 2BVPA 3FFDB 5J11C 4JRXD 4HWBL 3MXVH 1BFSA 4KY1L 5E8NA 5IOPB 4LHUD 5DYOA 1IQWL 4LF3B 3QNZA 2WAAA 3DVIA 3EOAB 3NIGE 4FQ2L 1FSKB 3P9LA 4JO2L 1QFWM 2X4NB 3EW3B 1HCFX 3MR9A 4GKZA 1FV1B 4ODSH 3ZHLA 1OGAE 3Q1SL 1FO0B 2VLRA 4BKLB 3VI3E 1HH6B 3C6LC 2XRAL 4OAWB 5T1DH 4RIRB 2YUVA 4FQCL 3FO9B 5AYUL 4RWHA 5T1MA 4ZQKB 5KSUA 1SBBA 2R69L 5I1HL 1T2QH 4JY5L 5GSRA 3WFEH 5L9DH 5MEPB 3ZDYF 4QHLA 4QF1B 4N8VB 1GAFL 4AQOA 3MNVB 1MRCL 5DJ8A 4YDKH 3P9LB 4KRNA 4V1DB 3BYTA 5E2WL 5E1HB 3CGTA 3QEQB 1P69B 1N7ML 4G5ZH 3BPCB 1TVDA 3S3PA 4NRZB 1CFTB 1FYHB 4HQQL 3LHPL 2FL5A 4OUUA 2D7TL 4WHDA 3W0WA 4JZJA 4OT1L 5ECJE 4CW1A 1R24A 5ITFA 1I85C 1I7UA 4MMZC 4MX7A 5F7DB 3V2AR 3MV7A 1T7ZA 2N56A 1MCOL 3U4AA 2RR3A 1J12A 3O3BB 3I2HA 2R4SH 4RSVA 1RU9L 4Z7VF 1NKGA 2QQJA 4Y5YC 4ARXA 3E6HA 3TN0B 3VFUA 1P1ZB 4MS8C 1M6OA 3O6MH 4GAGH 4I0PB 2P24B 5HD8D 2ZEYA 5IMMA 3GMQB 1F8TH 2NX5E 1A0QL 3W5NA 4Z0BH 3EDDA 1LEIA 1TCRB 5I8CA 3MRKA 3RDTD 1BEYH 5GJTL 2KL6A 2HFTA 1AQKH 3D2UD 5EFIA 4UT7H 5IFPA 1RZ7H 1IAII 2Y64A 2BVPB 3FFDA 2JCCE 3O8XD 4I0PA 4WFHE 3QHFH 1CD1A 1OLLA 2BOBA 1MQKH 1OQOA 1J1OH 4JQVA 3IRZA 3BOVA 4BH8A 1AD9B 1CDYA 2A1WL 2BVTA 3PDGA 3OG2A 4AIZA 4L0PA 5CBAB 1RZKC 2KZ1B 2VQ1A 3THMH 2PUQT 4HDIB 3EYFB 4ZPVA 1MEXL 3H3PH 3MZGB 4H0IA 4YE4L 5GGUA 3A22A 5TDNB 2RGSA 2PO6A 1IZJA 1QRNE 1Z9SA 4Z7NF 1CDHA 4KK5C 5DRZB 5ENWA 3G9AB 2X42A 5T33L 2IH3B 4N8VA 4HC1A 3DSNA 4WI7A 3ROLB 1QSEA 2PXYC 1SYSB 4KKCD 1CBVL 1OAQL 2HFEB 1FVCA 2NY2C 4P59H 3DGGB 4QGTA 1QA9A 4NO3A 1QPPA 3ULVD 3WE6B 3ILPB 2A6KB 4APQC 1UXSA 4M6OL 4WU5B 1AR1D 3GI8L 2H8PA 2R0ZH 2IADA 1RURL 1OWRM 3C09C 5HY9B 4KK6D 1D6VH 2JK5A 1AR1C 1J18A 4WEUD 5CEZH 5EO0B 5FCUL 1JI2A 4U1HA 1FFRA 1WC7B 4R4FH 1LK2B 4XNYH 5IW6A 1AQDB 4QHUB 5EC2B 5KSBB 1CGXA 4QYOB 4XP6H 1I8MA 1X9QA 1FLTX 1OP5H 1IGTA 5SWQA 4ISVA 2PYEA 3WSQH 1LO4L 1L6ZA 1A1MB 3MBEC 2EXWC 4AG4L 2HAZA 2FNBA 5IR1B 2HFGL 1WTLA 2LQRA 4QRPD 5DRZA 4XX1G 1RULH 3OPZH 3KR3H 4QTHB 4PLJC 1YEHL 2V4VA 5GISH 5LCVL 3PXJA 1ZA6A 4WTXA 2BY2A 4NZTL 4P5TC 4RFOH 1Z5LA 1O8PA 2VXQH 1AIFB 1JNNL 4X4MA 5E6IB 4R6UA 1ADQA 5HXMA 3MC0A 1FGNH 1NGXB 4QWWC 2CK0H 2DIJA 4J12A 4Y16A 3CCHB 5ID1A 4DGVL 3TBSA 2CR6A 1CD0A 5CGYC 1TCMA 4YQXH 1F02I 4Z8FH 1RJZA 3NH7H 3KJ4C 1FZMB 1REIA 3DX8B 3IVKB 3GMPA 1E4KC 4NZDA 5F1NA 3UTSD 5HD8C 5AZEH 3STZA 2UWEE 4MXWH 3KS0J 3RI5F 4Q6IA 1CK0H 2GITB 1JNLH 3UJJL 3MUJA 4FFWD 2GHWB 2Z0BA 2EZ0D 3BH8A 4ONHB 4MGQA 1K45A 2LU7A 3S6CA 4ONGH 5D2NC 2A0LD 4ZMAT 5F88A 1M71A 3KLAA 1ZGLA 3PHSA 2Q76A 3HCVB 3RGHA 2Z4FA 3H42H 4GKSA 4Z7VA 1A2YB 1BIIB 5KJRH 3L3IA 4LKXB 1PLGL 3MYJA 3SY0B 1LK3H 4JDVB 2VZSA 1US3A 1DQTA 4U7MA 5DRNA 5DHYA 3OF6D 3HPJA 5MENE 1R3IL 4MVBD 2H3NA 4JRYD 5FM4A 4P9HC 5CHNA 4BFEA 2GTZA 1LP9F 3D3VE 3ARFB 4J1UA 2DI7A 2O61A 5F6IB 1URLA 2N4IA 5F9JA 3N9GL 1G7PB 5HGHB 4WCYH 3GB7B 3HRZA 1CT8A 4ZG1A 2H2PC 4NO2B 3IDXL 3RWEB 5HVHC 2R2HB 2E7HA 1Q94B 5I6XB 1I7ZB 1OCWL 2O5YH 2W0FA 5JORA 2JIXA 3TYFA 3FL7A 4X8JA 4BZ1L 1KEGH 4LEOB 3H7BB 1VCAA 5GS0D 1I9JH 2MFNA 3JWDH 4LSQH 4M43L 1UY0A 1A02N 4RAUA 3WHXA 2F15A 4NFBA 1FL3A 3R1GL 4QRTA 2XKNB 4ZUUA 3P30H 3QI9B 4F33B 2FGWH 2OMNA 1NANI 4MXQC 4DQOL 2AJXL 3FQXA 4QOKD 2JCCB 1QKZL 4XCCH 2IH1B 3FTGA 5DD5H 1X44A 1I9RH 4I4WB 3ARQA 1XF4B 4P4KC 4Z5RB 3ARFA 1JZ3A 4OM0L 4URTB 3NAAH 3NABL 3VWJD 1XF5A 5DD0L 4OBRA 4BXSV 2GQHA 1I9JL 4BFIA 3G5YA 5D6CB 1JF6A 3HEIA 1J88A 3MBWA 4KVCH 4OZGA 4MAUL 5T5FL 5AZ2H 4OLWL 3BN9C 3NQHA 3VXSE 3NCJL 1U3YA 4ZSOA 3WSOA 4XCNB 1KC5L 1IKNA 1T5WA 1HKFA 1Z2KA 2MQCA 4YHNA 5C08D 2VDKH 2UYLA 1EEYA 4D9LL 2FR4A 5GXBB 1ULOA 3CH1A 5IGXL 4JRXB 5SX5K 1QLRB 3O45A 4KQ4L 2XXMB 1S78D 1BF2A 1PG7X 2ED8A 5E9DA 1U91B 4NWTH 5DZNA 1I5PA 1OF2B 1U8PB 5HI4C 2B7DT 3LQAL 3IT8D 1NAKH 4RX4A 4N1EA 3IXAB 2LAGB 2P24A 1G7QA 4D9LH 2QBXA 2VQUA 4UT7L 2AK4A 5FGBC 1SY6A 3UX9B 4XWGL 3TT3H 3MFFA 5IQ7L 2XZQH 1J0IA 3T0EB 2GTWA 5ICZA 2D0FA 1TJHL 1LO2L 1Z0NA 3Q3GB 1MRCH 3GBML 4R9HA 4DOHE 1IFHH 1T21B 4KUZH 3C09B 5DFVC 5K33A 4HWZA 5EJZB 3OJMB 4OZIA 1NAMB 1WUNT 1NAKL 4I3RL 3MLSH 5D4QA 4X9HA 4PJ5A 3O2WH 3P4MB 4DN4L 3JV6A 5GGSB 5JORB 3BN3B 43C9B 2VR5A 5J1SC 1X4YA 2EKJA 3T3MF 1KG0B 4IOIB 1XGUA 3R8BB 4CVWA 1N5AB 5EUKB 3RKDC 2EDQA 4TSBL 5T3XD 1FNGA 4P4KB 4Z0BL 4JFZL 3L3GB 1QSFA 2QTEA 1NUDA 4ODVL 3CFJA 4PR5A 4ZD3L 4P08A 5DFWH 5DJDB 1XCQA 3QFDB 3LDBB 3PGFL 3B9KC 4PY8J 3FRUB 4K3HA 3MLPA 2YPVH 5DJXB 5T5NG 5D7IF 5BVPH 32C2A 2V2XA 1VGEH 3LEVH 2PCPB 1OGAB 4QHMB 1BECA 4KMLB 5C2BH 2HLEA 2D0GA 2ZCHL 2Y1VA 3QWRD 4X6FA 5AG9A 4M4PA 4LLVA 5I6XC 2E33A 3BDYL 2OTUB 3V4VL 3KLSA 1INEL 4OF3A 4BSVB 4YHNB 3ZM8A 1UJ3A 3GIVB 3GSOB 4HIJB 4LASL 5DQJB 5K9OB 1U3HB 1JF5A 3DECA 2IPKA 4WUUB 3S3JA 4PGEA 3A6CH 3STLA 1IEAB 3SDXA 5L6YL 4UI9L 4G6FD 3VXNB 1I8IB 1AHWB 3HNTL 2D9CA 4PJGF 3PF2A 3V52L 5GS0H 5I8EA 4Z7QF 4PJFF 4PY7B 3Q6GH 2CIIB 3UTQB 2R15A 4UQ3B 5JXIA 5E6YA 2CK0L 1VADB 3DUHA 3MREA 1F90H 1OAXL 1SEBA 5KAQG 4TVPH 5I1EL 5JDSA 1UA6L 3LQMA 4NWUH 3RNQB 4P9ML 1IQDC 3T1FA 1LD9B 5JR2A 2YD2A 3QXWA 4P4KA 3B8YA 1T0NB 3ARGB 2COQA 1LO4H 1UJ3B 3D39B 5IBTH 2Q8AL 3QDGB 4WHCA 2DI9A 1RJZB 3L9RB 5GS2D 5D7LB 5HGHA 3QXDA 5LXGH 1CF8H 4XMLH 1YEHH 4P2RA 3EOBA 1F3DH 3KYMA 3QNXA 3UJTH 3C60C 5IMKB 5DJ6A 1YEJH 5DD3H 4OQTH 1QRNB 4WW2F 3IRPX 5D1ZC 5LAXB 5TE4H 3WHXB 4BSWB 5KN5B 4QX3A 1WFTA 4NKMA 2Q8AH 1VERA 5C0IA 5DC9B 3JTTA 2Q3ZA 5CFHA 3PQYA 4L4VE 4L8DA 3HCVA 1K2DB 5GGRY 3VXSB 4XAWL 3FTGB 5DK0A 5CCKL 1LE5A 4S1SL 4JANA 2Z93B 2FGZA 2BNUA 2P44B 1P4IL 3BEVB 3CZFB 2OI9B 3RGVC 4ORZC 3FO2B 3QR2A 5L7XH 5CJBA 1AXTH 3MO1A 1TQCB 1P4LB 1NFDE 5CZKA 1A3RH 1PQZB 2EO9A 3R8QA 2IGFH 4WHYG 3JWOL 3GIZH 4A2LA 4EOWL 4NRXB 3C8KA 2OQJB 2IPUK 2J8UB 4GAYA 3RL2B 4OSUL 4NT6B 5I71B 3QG6B 1DYOA 1R3LA 4MLIA 3JXSA 4M7KL 3P4NA 1KB5A 5HHQA 2NW2B 3L7FA 1IGJB 3U6RB 4ERSL 3E2HB 4FTVD 2FR4B 3UO1H 1MRFL 3SQOH 4PJXB 3BE1H 5IB5B 3L6FA 5ILTL 2VUYA 2YRPA 4XPAL 5CEZE 1KXTB 4Z76A 1XC6A 2X1PA 3C5ZD 5EZJA 2IGFL 5F9DC 3T0EE 4CU9A 3WD5H 2BSED 4P46C 3QXTA 4GMSL 4HGWA 5A40E 3LRHA 1R3LB 4H0HB 5F9AC 3WN5A 1G7HB 1FH5L 3GGWA 3NFNB 3F58L 4FZEL 5TE7H 3ALWA 5EBLB 3FJTA 2VDLL 2LVCA 1NC4A 1L7TH 2F74A 3LEXB 3TPUA 4I3SL 4UTAL 3VFPB 4ODUA 2AERT 1HZHL 2VDPL 5IJKA 2BNRD 3DHMA 4G43A 3SGJA 1H6XA 1YEFL 3FRPG 4H25A 2BSSB 1PJ9A 1DLHA 4KZDH 2GEEA 1JK8A 2R4RL 1U8OB 2V9TA 3FB8A 1OCWH 2O5YL 1QO3A 4A6YL 4F57H 2YG0A 5IW1B 1NGQH 4LGPB 4TSCH 3KYOA 2XOTA 2Z35B 1MJJA 2W0PA 2HKHL 1ACYH 4M43H 2UWEB 1GAFH 1Q9OA 1G6VK 2ZSWA 4WEBL 4NO2A 1X3DA 4I3SH 4XPBL 4UDTA 5E2WH 3OEAA 1HCVA 2FWOA 3TWCH 3T0AA 5HJ3A 4LQ1A 1Q1JH 4QXUH 4OFIA 5HGAA 3LQAH 1KELL 4L4TE 5DGRA 2D9QB 1KLGA 3BVNB 2G9HB 2XN9E 4XVTL 1YUHB 5C0CE 5C0GB 2BDNL 4LPUA 1G7MB 1WWCA 3MUY1 4PLOB 5MEND 1YEDB 3IFPA 1BJMA 4TQEH 2GK0A 3MLWL 3DMMC 4JRYE 3QDMA 1XPWA 4WUUE 5DYOB 5EO0A 3VE0A 4JAMA 2Y8KA 5EOQH 5FV1L 4Z7UF 4LIQH 1GQPA 1US2A 3QEGL 5F6HJ 3ZKXC 4WRLA 3LKRB 5BXFA 4X6CF 4OGYH 1HKLH 5HHNB 1AO7D 1A64A 1H6YA 2X4QB 3QISA 2A6IA 1GOFA 1IEAA 1CGSH 1FNSH 3IU3A 3FHQA 2BMKB 5EH1A 5GGQH 2JB5L 3CDGA 1K8DB 1DBKL 3FB8B 1ES0B 2L7JA 1A2YA 1RFDL 2VDQL 5BJTA 1NBQA 4WTZG 6CGTA 3SBWC 3MRHB 3FZUC 4WHYH 2Z31B 1RZ8A 4LCYA 3VH8B 3O3BA 1MLBA 5EC1A 3BGMB 4WWKB 2GITA 4WY7H 5EU7E 3PWNA 4PRPE 1OARH 2QQKL 2L9LA 2AK4B 4G6KL 4PRID 3TEUA 1TG7A 1OGAA 4LEXH 2VLRE 4PF1A 2X10A 2YFZA 5EOCL 3O3AB 1UY3A 4OD1H 4HPYL 3RWHA 1YPZA 2Y06L 5LKNA 2CXGA 1KJ2A 5CBEA 3GSQB 4DTGL 3TNNB 1C12A 4NKIH 5TJWK 4AEEA 3QIWB 3ISWA 4G42B 1OP9A 3TZVB 3LEYH 4HIJA 2VMDA 1JPFA 1Q9LB 1I7RA 1CDCA 2Q20A 4L4VB 3ZDZF 2E9JA 4TSBH 3OKNA 3MV7D 4OV6F 4HHAB 2P5EB 1PAMA 2XKNA 4ZUUB 3MROB 1J5OH 1ZV5A 4DKDC 3TESA 3VXMA 2NY4B 3KYKL 1NFDB 3OPZL 4ENEC 4HD9A 1MFAH 3FAXA 3VFTB 5EN2B 3BPNC 4YHYC 1S5HA 1XZ0A 3HNSL 1XR8B 3UTTA 3WDIA 3P3YA 3LEYL 3WS3B 4NZTH 3B9VA 3NJXA 5IP4A 5IB2A 5JPNA 3WN5C 1MELA 2DMBA 2Z93A 5IESL 1GL4B 3RWGB 3AAZB 3CNKA 4PJ8D 5I1GL 5IBTL 5DLMH 3C6SB 5CJOH 3KPMB 3ZE2E 3KNBB 3ILQC 4DGYH 4KJQC 4PJ9C 4C56E 1MREH 4F3FB 5BRZE 4R4BA 4HUUB 4BSJA 4L8CA 5EU4B 3UTTB 3C5ZC 4HKJA 3NCYP 3RZWA 4R4ND 15C8L 1FBIL 1RSFA 4N5UA 3X3FL 2HVJB 4J8RA 4X8JB 3AY4A 1PG7L 4M5YH 3BWAA 1F3DJ 3KYMB 5EC2A 5KSBA 1KTLA 4R7DA 5A2LH 1IGCH 2DQIL 3QQ9C 4RYDA 2D4DA 1WWAX 3GXUA 3T2NL 3DIFB 3UJJH 1CIYA 2R0WL 4N9GA 1M05A 3D25A 3WL9A 4XCNA 2WSKA 2IMNA 4Z18A 5C0DA 4XBEH 2YKLL 4XP1L 3TVMA 5BCAA 1LE9A 2HT3C 4M5ZH 1MCIA 3HMWH 4F7EA 3O0RL 5JXEC 1XF5B 2PXYA 3GRWH 5F8QC 5FYKD 2CLZB 4IS6B 2EDTA 1RUAH 4OZFA 2HT4C 2V7NA 4XAKD 4EI6A 3CFCL 3VW3L 1DLHB 2NXYD 4JR9H 2WO2A 3QCTL 4NC0B 2FJFB 2OXGA 5DEGA 3MRGB 4ZOEA 4Y2DB 4X6CE 3LN5B 3BGFB 5GRUL 5C0CB 1FZOA 1NSNH 2ATKA 3HMWL 1U8QA 2F58L 1IGJA 4Y5VB 4KPHH 3IKCA 1XGYH 2JB6A 1SBSH 4R96B 4H8WC 4UT6H 4S1QH 5D2LB 4OCXH 3KPRD 2C9KA 1ZWIB 4L9LA 1KEGL 4LGRB 5TE7L 3SDCD 3MRDA 1AGDB 1EAPB 3B9KD 5GGTL 4U2YA 3CSPA 4HKBB 4NOFA 2VB5A 1U0QA 1NGPH 4RAVA 3RWJB 1GIGL 1BFVL 2AJZA 1SDDB 3PABB 4F7CA 3DRQA 2PW1B 4FQXB 2MKLC 3JWOH 4XCCL 4NQEB 5DK0B 1UWEL 3MRLA 4KPHL 5FUOL 4W68A 3VMPA 2HG5B 4I77L 5JDJA 4UT6L 4F57L 4P3CH 2NY2B 4UT9L 4DCQB 4APQD 5KAQF 4AIOA 2OSLB 3MNVA 3QQ4A 1DQLL 1UMIA 1AGFA 1MNUL 3TBWA 4Y7MA 1T80A 3P6BA 2R0KH 4PLKC 5F1KC 4MAUH 4NRZA 3MRCB 2Y6SD 4BQ8A 1T03L 1NCUA 1S5IL 3FQTA 1MY5A 2QQQA 3HLAA 4MSWA 5T3ZE 4NBYB 5T3ZD 1MAML 5HVFB 1XGUB 4J3TA 3MRPA 4FG6C 1C08B 4ONFH 2DLGA 5FUCE 2GJ6D 5CEYA 3ZE0E 2VDNH 5EWIL 4JY4A 4KQ4H 2V5DA 5E8NB 5IOPA 1NMCC 1DN0B 4NO5B 3SE8L 1X5HA 2B1AH 5D71L 4M6ML 5HDBE 5MERA 4G3YH 4K07A 5F9WC 5J06A 1AI1H 1DQQB 1WTGT 2CDGB 3G6DH 3QDMD 3O8XC 1PKOA 1JRHH 3FN9A 1T7YA 4JFFA 2QQLL 5MEOA 3V4PL 1IGMH 3MLXL 1F3RB 1RIUH 1T89C 3QDGA 4PUBL 2UVFA 1ZVYA 2DICA 4HKZB 5I1CH 4MJ6B 4HKBA 3TN0C 5DZOA 4LCIH 1DLFL 5DJ0A 2IWGA 2B1AL 3AXLA 5HHVL 4DWHA 4HC1L 1N64H 2R0LL 3BAEH 4LQRA 1KIUA 5EIYB 3C5SB 3IDNA 1WICA 3CU1A 2VZUA 3QH3A 5DJYB 2MJWA 3VWJC 2R1WB 1RFDH 5H2BA 1A6AA 4MLSA 4WW1B 2NZIA 4N8CL 3MROA 5JLZA 1LNSA 3JTTB 3O6LH 4WW2A 5GSVB 2HN7B 4K23L 4U1JA 4HH9B 5I76B 3BZDA 1KJ2H 1MAJA 5EU6B 1H5BC 3SBWA 4Y5VC 2VM9A 1YN7A 1J0YA 3VD4A 5DJCB 3OKYA 1H0DA 3GFUA 3O41B 4GG6A 1Q0XH 2Y4SA 3MJ9L 3TBTB 4D0BA 1S9VB 4FABL 3PGFH 2FECI 3EYOB 5EOCH 1KGYA 8CGTA 3VFGL 1OQXA 2UZXB 4ELKB 4G7VL 3OKEA 3RVVC 2YEZB 5ISZD 4DTGH 3HOBA 1JHJA 1D5MA 4QHNA 4MYWB 1JGUL 4ZTOL 2JJUA 2VXVL 5BOZG 2ADFH 4L8DB 4DZBA 1VEPA 2C3HA 4D0DA 4HWEH 2P8PB 5B39G 3UYRL 4GQ9H 1UY4A 1SJEB 2HH0L 4JFFB 3BIAX 2WO1A 4FMFA 5ALBL 4FQJL 1AP2A 3NFPB 3IU3B 2WP3T 1MFNA 4OUEA 3MV8B 1BQLH 2WUCH 1OT1A 3BMWA 5IM7A 4HWBA 4JKPH 2P7TA 1KG0A 4DK3A 1GC1H 3WLBB 1H5BB 3C7EA 3RY6A 2GSGB 3VGBA 3BQUD 1OHQA 1S7VA 4PP1D 3W2DL 3N1QC 5C2UB 5I73B 1BVLB 2G60L 5HGDB 5HYQB 4JHWH 4YDLB 1MFDL 4UI2A 5KVEH 1G6RB 5KSVB 1XFPA 3VG0H 1TZHA 4TNWK 1MCEA 3FQWB 4KROB 5F7UA 5E03A 4ALAH 4X6BA 1R5IB 1GC1L 4PP2A 2DQIH 1I1YA 2HFFA 2BOBB 1KB9J 3QZWG 1NCWH 5L8JB 1TETL 1ZE3C 3W2DH 3MLYH 1TVBB 2EKSB 1I7RB 1NUKA 4M61A 4OZFH 4NNYB 2QQMA 3QEQA 7FABH 2DIBA 3OXSA 2DJSA 1KPVA 3L3OB 4U1MA 4Y19D 3RUGF 1EAPA 4I13B 3JWDC 5A2IH 1FE8L 4CU6A 5KSAC 2BVYA 1H3VA 3BP4A 3FCTB 4KMTH 2CDFA 3EKCA 4XNMA 3L1OL 4CKVX 1YY8B 4JRXA 4LCUB 5TH2A 5KVFL 2CJUL 3TH2T 4F15C 2F8OA 3LRGA 3HE6C 3E6HB 4AENB 4L8BB 4KTEL 4LRNH 4PRPB 1NDMB 3JV5A 1KPRA 2BVQA 2ARJQ 2F19H 5GHWL 2BSSA 5BQ7B 1SJHA 1CLCA 3B9AA 3LQZB 2DQEL 3QUMB 2BVEA 4M1GH 2EZ0C 4PTUB 1F3JB 4P2CG 4EOWH 4QTHA 4Y4FC 4XCFL 4HFUH 4Z5RA 1YQVH 4RGOL 3VXOB 3O6FC 4GWIA 2E31A 2E7CA 2QADC 3A67L 3KXFE 2B4CC 3MPCA 2VZ3A 3ES6B 3D5OF 3S36L 2J6EH 4ISVB 3PGCB 2DQEH 4LLDB 2UZIL 2YUXA 4MAYD 3P9WB 2Q1EA 2VE6A 2NY2D 3CC5B 3RIFK 1RUMH 4QX0A 4QX2A 3WD5L 3SDAB 2H2SC 4J6RH 1QBLH 2FLRT 3E3QE 4O02L 2YUZA 3I2CL 4OCYH 3I75B 4WW2C 3PIQA 3GHBL 1EGJA 2W0FB 4UQ2B 4FQXD 2VMFA 1WCBA 4JGMA 1HXYA 5FYLD 5B4NA 5I2IA 4I5BB 4PYGA 3K1KC 3QUMA 4OIIH 3SKMA 1FVCB 4GBXC 3GKZA 4L3CB 1I1AB 2GJ6E 3EDJA 4P2OC 5E08L 2PYEE 4TSAH 2B4CH 2B1HL 5BRZB 2HWZL 4AEFA 1HHKA 5DMGD 3VA2C 2WZ8A 4Y1AB 3O8XA 3I97A 4LPYA 4O02H 4OCRL 1Q72H 4X4ZA 4LCUA 1X5AA 2DQGL 3F12B 4E9LA 4PBXA 3HJRA 3TNMB 4YR6B 2IFGA 1Y0LA 4GAJH 2P49B 2PKDA 4Z2AA 3SOBH 4LAQL 3L3HA 4RGND 4RMTA 1JGLL 4NNYA 4RBPH 3CX2A 4E41A 1YMHA 5JTWA 4CU7A 1GGCL 2QLVB 1DBML 3RY4A 1V7MH 4X83A 4HUVA 3PWPE 2EC9T 4HZAA 4TPRH 3CCHA 1FJ1B 1NFDF 2A9MH 4HIXL 3S5LA 3U7WL 1S8DB 4AM0B 1QFUH 4LFHD 3CH1B 5TQ0L 4K7PY 3PUCA 3HPLA 1UC6A 1WBYB 4X6DF 1L9NA 2P45B 3L3JB 3WJLC 3ZKNC 5H35A 3S4SB 2PXYD 3FT2B 3WHE1 4TNVF 3MV9D 2EDFA 1T03H 1KJ2B 4QO1A 2EDHA 3LS4L 1IMHC 4P02B 1DFBL 2OZ4L 1MAMH 3HPNA 3FO2A 5E2TL 2XQYK 1F6AA 3MV8E 3DVFA 4UAOB 1OTSD 1Z9OA 3DX7B 3QG7H 1KTLB 4R7DB 4U7SA 2X05A 3SHSA 5DQ9A 4X6FB 3U4BH 2XACC 3O6LL 1MF2H 1LP9E 2JCCA 5FYJU 5HVHB 3TV3H 1TFHA 3MOBL 1KNOB 3PWJA 5D71H 2G5BA 1OP3H 1AI1L 1K4CB 1RJCA 4O2FA 2ERJB 3U79A 4LCWA 1UWWA 3FRUA 4NJ9L 2P5WB 2D7QA 3HA0A 5E8OB 5F6IC 1A5FH 4JM2B 2WBJC 1IC5H 3GMLB 1HYRC 4IJ3C 4PS4H 4CVZA 4ARYA 2AJSL 3UBXG 8FABA 2A77H 4TTDC 1RQ5A 1A9EB 4U1GC 1SHMA 5CLTA 4IOIA 2DCJA 4UOW1 2XYCA 3GGLA 1G7PA 3ARXA 2XWTA 4MS8D 4LCWB 1A7RH 4Z7WF 4M62H 2E9BA 1DUZA 4RQQA 2R0LH 4M8QA 3GMLA 4OKVA 3O9WB 4UIKH 2ESVB 3KPOB 1FPTH 1E4XH 2Q6WB 2GTZB 1CG9B 3L7EB 5CILH 1BREA 4NQCE 1DQDL 3VI4E 4P5KA 4H26A 4GOSA 5TDPA 4N1HB 3SO3C 1T1YB 2ICCA 3UTPE 3D0LA 3QUYD 1XGPA 3QIWD 4XNXL 5BZDB 1MI5A 1NCDH 1W0VA 3ZHKA 1HEZA 5I8KH 1A6VH 3UESA 4R2GC 3TPKA 3CMOH 1YMMA 4P2OD 2R9HC 2ITDA 1ZLUH 3U0TA 1F2QA 3VJ6B 2VWEC 3IDGB 2VAAB 3MMEB 4F2MA 2Z31C 3V4UL 4NPYB 3U83A 5GZOC 4K9EL 4N0RA 4JFHD 1J8HB 3ARRA 2J8HA 4X9GA 1HDMB 4OZIB 3DVGB 3NBNA 1QSFD 3BO8B 5C07B 4XMPL 2NY1D 2EEDA 2KKQA 3KXFB 1ZHLA 3ET9F 2VLKD 4Z6AT 4Y4HD 1OF4A 1ETZA 4WHTB 3X17A 1LEGA 3DV6B 4Q2ZB 3UTOA 4CMMB 1N6UA 3O6ML 1DQQA 1FZKB 1QSZA 5FA4A 1A22B 3CPLA 3VFPA 5F9OL 3WNPA 3RWHB 4PQQA 1D5ZB 4PRDB 4WFFE 1MCPH 4G9FE 1BQLL 1S7QB 4GMTL 4NRXA 2OL3B 2I25N 1ZT7B 3F5WB 4G80B 5IKCB 1GZPA 4DKAA 3PQYB 4JY5H 2BSRB 3WFEL 5KVFH 1PMJX 1CFQB 1L7IL 4KMQA 4RNRA 2PYEB 4LHUA 5IT2L 3B6SB 4NWTL 3EYVB 3PHQA 1IT9L 5JR1H 1P6AB 2APWA 4JB9H 3EJZC 3VFWB 1GC1C 4Y1AE 4FFVC 5IVNA 3T4AB 5HYSB 3RZCB 1KLUA 4LLYB 5I2IB 5DJ8B 2QHRL 3BUYB 3GHEH 2J5LC 2RBLA 1P6FA 1G1YA 1DJSA 1P4BL 2FX9L 3SE9L 5J1TC 1OVZA 1UY1A 4LSRH 3QDJB 1N4XL 2GTWB 1NCAL 5IEKA 3MJ8B 2OR9L 1SM3L 4H88L 1A3QA 5IVZA 5I1DA 1D7FA 4M7ZB 1EGJH 5E94A 1NEZG 4XUNA 1CFNB 3I6LD 2H45A 3K3QA 1CQYA 3RKDD 1W0YT 5HGBB 1WBXB 2ARJA 3TA3D 3WJJA 3K80A 2EH7L 1FZJA 4YBLC 3QDHA 3RU8L 4OZHE 1JGDB 5F7HA 1BX2A 3PWLB 3TA3C 4K7FA 4UUJB 4XPTL 1AC0A 3K46A 4S1RH 1M4KA 5CD5D 4XCEA 2QEJA 1EZVY 4NQVA 2FD6L 4JRWA 2NW3A 2K9UA 2WAHA 3L6FB 4ZOCA 2B4CL 1IBGL 1CXFA 3CAFA 4P9HL 2NZ9D 4OD2A 2KQMA 1K42A 4B5EA 1B90A 5GZOD 3R4DA 2ZPKH 3V6OA 3SKOB 2EXYD 1ITCA 1GH7A 2DF3A 3E6FA 4GBXB 5T33H 4LSSL 3AGVA 1FNHA 2DQFA 3MV8D 3M45A 2FH6A 4MJ5B 1WT5A 3HPJB 3CVHB 5ADPL 1XF3B 2XQXA 3C6LD 3MGTA 5FKPB 3HS0B 4X5XA 1CDJA 3R0NA 3UPAA 4DFIA 5IB5A 4XP5L 1YJDH 2NXZD 1DBMH 4U6VH 3KPSD 1JPTL 3D85B 3ZYIA 3LKQB 5BZWA 2ZPKL 3FO1B 4H8WH 3A6CL 3BGFC 1T5WB 3RGVB 2YMXL 4LSSH 4ONFL 4XNYL 1ND0B 3VA6A 1X4XA 5FKPA 2VDNL 5EWIH 5F3HA 4PJ8A 5CJ8A 4ODHH 1VA9A 5I17A 3WSQL 2A6JA 5LAXA 2BY1A 5A43C 5AZEL 3AS0A 4AG4H 4FQQB 4H20L 3K8LA 4MXWL 2VDRL 4YXHL 3H3KA 2ADGB 1MCCA 4XWOC 1FGVL 1RULL 2DJUA 3B9EA 2VMCA 4HBCH 3RWJA 5JMOC 4LLQB 3FQRA 5IB1A 2DQCH 4ZTPL 4E42A 2Y5TA 1SG3A 2P7TB 1AD0A 2IQ9H 5IB2B 5DD6B 3MFGB 5SX4H 5LG1A 4V2CB 5M7QA 3PUHA 2NTFA 1RVFL 4XXCC 1P5VA 4JDZB 3DXAD 4OQ1A 3MRIA 1J8HE 3GSNB 4W6YB 4HWZB 2Z8VC 4Z7NE 4DKFL 3W9DA 4OFVA 3MV7E 4OZIE 1KCRH 5FCSH 4XPHL 1YEJL 3C5SA 3MCKB 5JW4Q 5DDHA 4JANB 1FRGH 5CJQH 1KCVH 4E41B 3C08L 4PD4J 4DZ8B 3EYPA 1BZQK 1NGZA 4S2SB 3KWWB 3GSUA 5CSZA 5JW4M 4JFHE 4PJ9B 5FO9A 5FUZH 4HPOL 4JHAL 5HHOA 1KJ2L 4PJDA 1MIEH 3ZKND 3KPSA 4F7PB 2Q86B 4OIBA 3HE7B 1EFXA 1IAOA 1AQDA 4QHUA 2H1PL 4A44A 2AJYH 3RVVD 1ULPA 3O3AA 2VC9A 2OBGA 2V2TB 1NCCH 4E5XA 4XUOA 5E5RB 5IUSA 1JYVA 4KUCF 5IK3B 3BP6B 3GJEA 5D5MF 2LTQB 1CIDA 4JVUA 3V5DA 5K9JL 1NJ9B 4O58H 3CUPB 4R26L 1RZ8B 1UACH 4LCYB 3EO0A 2Y6KA 3PL6A 3OKNB 1OH4A 5H37G 1KTDA 2R56L 4NUJB 1NUFA 4PRIE 3QEHB 4OZFB 2H1PH 4A4AA 2AJYL 2VL5A 3EFFA 1FNEB 5DRXA 2FX8H 4J4PA 1AXSB 3DO7B 3W0WE 1P5UA 2EDLA 2IBGA 3F65A 4JFDB 1VFUA 2BC4A 1MRFH 3KG5A 1DN2A 1H3UA 1H3PL 3GIVA 3GSOA 3GK8L 1KGCE 35C8L 5KW9H 3HLAB 4MSWB 2Z91A 3CLFL 2I9TB 2B4KA 2MSPA 1QACA 4WCYL 1I1FA 2BFVL 1EUUA 5FOBA 4XMPH 3HUJF 4WWKA 5KSAA 4MO3M 4FP8H 4BDVB 1DQJB 2VLKB 4FZEH 4GRMB 3R0MA 1A6PA 2R69H 4FQIH 4N0UA 5T5NF 2YD8A 1MIMH 3G04A 3OGRA 2H9GA 4IMLA 1R24B 1X6NA 1A7NH 3BO8A 1CE6A 3MODL 5IJKC 5DJDA 4XNQB 4HS8H 3RUGB 5GIRB 4WFEE 1N7MH 2PW1A 4YFLI 2MQ0A 2BFVH 2C26A 5FYLH 5KVDH 5CJ5A 1JV5B 4Y4FA 2V9QA 3KPRB 5DHVH 5GZND 2O61B 4NN5C 3S98A 5A1AA 5IMMB 1HXMA 4HHAA 3ARGC 1DBJH 2EH8L 3AREA 4ZUWA 4A6YH 3BKYH 1I9EA 3TLRA 4RISH 3X3GL 2EICA 3P4OA 3BUTA 4QB2A 1HE7A 4KKBD 3EDKA 4GAGL 3SKJL 5BZDA 4ACPA 1W72H 3GSWB 1LO5A 1UVQA 3QUYB 2ZP0T 2P5WE 4QY8A 2XOMA 4B0MM 1QBBA 1EJOL 2HJKA 1G9ML 2VLKA 3BKCL 1UY2A 4PRIA 5D8JL 1S9XA 2M26A 1JWSA 5DRWA 5IHZA 1M7XA 2Q76B 1AHWC 3NJVA 1HNGA 4X6DA 4QLRA 1Q9KB 4PRHB 5C0JB 3WXVL 3HC4H 2NY4C 4GBXA 3O6KL 4F58H 2ESVE 2IALA 3JTSA 2J88H 3UJIL 1SVCP 4JM2D 2WANA 2PW2A 3BDXA 5L8LB 1NUGA 4YIQA 1ZLWH 1VGEL 5L2KD 3T2PA 3QHZL 2XFXB 3IFNL 2G5BB 1D9KA 4ZYKB 4PRHA 3TZVC 1X6LA 2X40A 2Y36L 2LW8A 5HHNA 4OGXH 5LCWL 4HJ0C 3RTQD 5CGMA 5INCB 2APVA 3TC9A 4PB9L 4ZS7L 1M7IB 3HC4L 1FNSL 1JTTA 3V4VH 3TJHD 4GXUN 5GGQL 5TDPB 5J1AB 4HUXA 3D87B 4YDIL 1NC2A 1K8DA 1QBLL 2HT4D 2XA8H 3RWFA 2R2EB 2VABA 5IVXE 1WJ3A 4YJZL 5L6YH 1J0ZA 4YK4B 1HOCA 3MO4A 2D03L 1WZMA 4H88H 1UGNA 4PJGA 4M1DL 2J8OA 3ACIA 2VDML 2Y72A 2D4FA 3T0DA 2ORXA 4ZD3H 3DURB 1VB9A 4H26B 3GZKA 1QD0A 3GKWL 1ROWA 1ZT1B 4FXGA 1CR9H 1VFMA 5ACZB 3KR3L 3W39B 2FYYB 4M02A 2VZQA 4P49A 5F89B 5LCVH 5ICYA 3KPPA 4YX2L 4WNQB 2NLJB 1N6QH 3BQUC 2OMBA 3NOIA 1ETZB 4WHTA 4GAJL 3V9FA 1CBVH 1UVQB 4GAYB 2EYRA 2AW2A 1Y0LB 5CUSH 2YD1A 1BJ1J 5I9QB 4YHZL 1I8LC 3VXUA 2WMPA 4ZAKB 5HHMB 2DL2A 2ZEXA 1IKNC 3I2GA 4Y1AD 3FN0H 3NIFE 2W1SA 1DVFD 5LBSL 4L4TA 5E4IA 1Z6JT 5FM8A 5F72S 3FB6B 5TQ0H 2XKUA 3NH7L 4OGZA 4YUEH 2K7PA 4BJ0A 5KZCB 1U8QB 1R0AL 1BLNA 4XZUA 5GPRA 4PJAF 1C5CH 1OSPL 4N1CA 3QDJE 5F3BB 2A6DA 1HQ4B 3W39A 3UZEA 2W46A 1SJHB 3KJ4B 2B2XH 4U6XB 3ULVH 1RZIB 3S88H 1FNAA 4ONGL 5CP7A 3MJ9A 3KXFA 3DGGA 4ZY9A 4G6ML 4YGVA 4XVHA 1UZ6E 4ODHL 4XTRD 3QIUD 1RV6X 1ZSDB 4TNWF 5D96B 3T0VA 4OB5H 1LE9B 2ZNWA 2V2WA 1IGCL 1MIEL 1XGTB 3EJYC 2MPAL 1PSKH 1I1YB 1K12A 4CL7A 3NFSH 2E7MA 4S2SA 3TT1H 1IQDB 3OG4B 3DIFA 1A5FL 1X5KA 3DETD 2PO6C 1WFOA 2VIRA 1KACB 3GDBA 1TQBB 4YHOH 4I2XA 5T1LB 5F44A 4AIZB 5BJTB 3N9GH 1SEQL 5K9KA 1UQSB 4R26H 1WISA 2VR4A 2V7HA 2WIMA 4GMSH 4E5XB 3OBAA 3BPLC 5F7DA 5FK9A 3NFSL 4NQDD 4OFKA 4MJIB 3LPFA 5CEYB 3B9KA 2GK2A 4XPHH 3CK0H 1P4IH 4MXVE 4OD2B 4EBQH 3SKJE 4I4WA 2VUOA 3D1MC 3TIEB 4QF1A 4QHLB 3R06A 3OWEA 4X5LA 3P30L 2A73A 3LSOB 4PREA 3QXDB 4DQOH 1QA9B 2O5ZH 2MQ3A 5DD5L 4HG4J 3W9DB 5GGSY 3ACGA 3HI5L 3VXRA 5HYJA 4EUPA 4AH2A 5TDOB 1T0MB 3QNYA 3X12B 3VFSA 4CMHB 1EFQA 3T04D 5AAWA 3NGBC 1I1RA 4K9EH 4R7NB 3SQOL 1EH9A 1R3KB 5HGDA 4NHUB 1UB6A 4IM8A 1HSAA 3A6OA 3QUZD 2EDNA 3U1SL 4GRMA 3RY5A 4CNIA 3S34L 3DBXA 3V7MA 3HZKA 4PB0H 4F7CB 1LE5B 1RAMA 4FFYL 1GGIH 3IDXH 3JBG7 3T0BA 4RDQG 1A1NB 3MJ8A 1A4JB 43CAA 4X5XB 4BZ2H 4JZOA 1PY9A 3KPNA 4WI8A 4PRNB 5DN2A 1T2QL 2F5BH 5IB4B 5C0FB 3ARGA 1LK2A 4DAGL 4Z95H 2W0KA 5I18L 5D7IB 5EU5B 4Q9QL 2HTLC 3MYJB 5IF0B 4Q0XH 3QUZC 4R3SA 5IVXB 3PL6D 1NLBH 2X4TB 4L3EE 1R6VA 4P2QD 3LN4A 1FIGH 3B4NA 2LVEA 1Q38A 2P1YA 2I60L 2ZUWA 3U0PB 1JMZA 4QCIB 1IQDA 1DL7H 1Q9LA 4YDJA 2Z8SA 3OB0K 4ZS6D 3MXVL 4NHCL 2GUOB 4WEBH 5JR1L 4G9DB 1DEEA 3TWCL 4M6MH 3ZKXB 5I8CB 5ITFB 3H3BC 2SEBA 1I9IH 5ISZB 2JLLA 2EDWA 3E6FB 5D7JC 1CZVA 1BEYL 4U1LB 5LWYL 2EH8H 4K7PH 1QEWB 4JPWL 4ETYA 5L9DL 4X6DE 3TBVB 4IIQC 2R39A 4I5BA 4F33A 4P46D 4WW2B 3ZE0F 3KPRA 3ARDD 5C0BB 3JZ7A 3MUHL 1CFTA 1NAEA 4HC1H 3OJDB 3ULUF 4NQSB 1MCJA 1UZ6F 3FB7A 3SDXE 3PWVB 3SDAA 3PUIA 1G9MH 3BKCH 3H3PL 3TYFB 5LA1A 1X5LA 2M8XA 1JYXA 4AZ8A 3Q5OA 5HGBA 3LEVL 3O4LD 5EUOF 3D39D 2ZUTA 4NUGH 1C5DA 2YZ8A 2X1QA 2OTUA 3VU2A 4OD3H 1JWUB 1I8LA 4ZAKA 4EN3C 1E4KA 4IRZL 3P77B 5HYEA 4EQ2A 5DS8A 3IFLH 1G7JA 3MBXH 1N6VA 2VISA 3FQUB 5DVMA 2ADJB 2VZTA 2JB5H 5JOPD 4M6OH 1AQKL 3SJVA 3BKML 1Q9OB 1ZKAA 4P9HH 1QYGL 4ZZ8A 3QDMB 1TVBA 2EKSA 2ZCKL 1D6VL 1CDBA 2ORZA 4Z7QE 4QRQA 3IKKA 3UTPD 1XGRA 4IIQA 2RQ8A 2XTJD 4YHPB 1BGXH 2D0HA 4JHZA 3MRNA 5FHBL 2HP4A 5F88B 3WE6A 3RY6C 4RFNB 4YO0B 1S3KH 3HRZB 4OLXH 1JRHI 1KB9K 4LDOB 4KKAC 2PYED 3L5WA 1N0XL 2XA3A 1YY8A 4KKNA 4CN4A 1U3HD 4RZCA 3MJ6A 4QAWA 3OZ9H 1OT5A 5I16B 1LD9A 1OTTD 1A7QL 4ZFOB 3VGHA 1AFVH 2ICWB 5JXGA 4NO0D 4I18B 1AGEA 1C5BL 3MRRA 2Q86A 5INDB 4LRIA 4ZFZB 4X4YA 1KOAA 4MJIE 3QT2A 4C57C 4M5YL 4KHTH 4JZNB 4XXDB 4Z7VB 3JWNC 1YYLH 3LKRA 4NQXA 3GJEB 3VXUE 3UYOD 2ENSA 4J7RA 4Y4HB 2R0ZL 5EULV 4YHKL 4NQVB 1QLEL 1JYNA 1F6AB 3S37X 2AVGA 2DQDH 3GO1L 1F4YH 4JN1H 3MRRB 3DROB 5C07D 5CEZL 4FFZL 2V5RA 1N6QL 1I8KA 3U48A 4DVBB 1UM6L 5FUIA 3OKLA 4LMQE 1N8ZA 1FFPA 3FFCD 3TGXA 3STZB 5IESH 5FFLA 4HKZA 3WNOA 1RVFH 2PETA 5DLML 5FYJH 2NCMA 1GGUA 5L2KA 2YA2A 4LSPH 3GMMA 5F1SA 4KC3B 5D96C 4ZS6C 4X7TA 3E8UH 1N5YL 1U8JB 1UM4H 4FFZH 5L2JB 2BXZA 2N1KA 2YD5A 5ACMA 2GJ6A 1FRGL 3HZMA 4L9LC 3ZHDA 1TJIL 2NTSP 3D9AL 4PJEB 2E27L 2OCFD 3I3BA 1SEQH 3VFVB 3L3KB 3M17A 1R0AH 4K55A 5EU4A 3QFDA 3ECQA 5SWSD 1QVOA 3T2OA 1KNOA 3PWJB 3ARTA 3W11C 2HN7A 1S7TB 3BESR 3VWKA 4KV5F 4PJXF 4RAHA 3QI9C 4XMLL 3OJVC 1JL8A 5JW4R 3THCA 4MJID 3ARBB 3SDCA 1S7XB 4L3EB 5FIEA 4XBGA 4R8WH 3WMSA 5MI0C 1ZLVH 1P53A 3NPSC 1EVUA 5C09D 1RUPL 1MCDA 4XPGL 1A6TB 1M05B 4QRUB 1OF2A 4WO4B 5FO7B 5HHOD 2HMID 3RAJH 3G9VA 3BPOC 2VXUL 2JIXB 3M1BB 3EDFA 2HVKB 4D0CA 4U1GB 4NUJA 1WIPA 4J3XA 1N2RB 5CCKH 3JWDL 5E2JA 3WNMA 3AU1A 4S10A 4I1NB 4JKMA 3DETC 1F4XL 3NMEA 1G7LB 5L7XL 2Y23A 3LIZH 3RVWD 1JYWA 1JIBA 4NCDA 4F3FA 5CEZD 4HF5L 4MXQD 4MZ2A 5L2KB 5DEZA 1XGYL 1ZEAH 2EECA 2EO1A 4OTXL 2YWYA 4G80A 2SEBB 4G8FB 1TLKA 5GJSH 1WWWX 5DZLA 5E5MB 5F96L 2PXYB 5JDSB 2PO6B 3OR6A 5B3JE 1M71B 3KLAB 4LCCA 3AMLA 3FQXB 3QO1B 2BNQB 1IE5A 4HV8B 1EEYB 3TN0A 1Q72L 3V5DB 5IFHL 1UXWA 3DUSB 2QQOA 4QKXB 1W9TA 1D5IL 4FQCH 5E7BA 4P3CL 4LEOA 3K81A 2V2XB 2Z4QB 1OB1B 3BX7C 3EDEA 5BW7A 3SKJH 1QRNA 1P2CA 3L3HB 5JOEA 3GSQA 3RX8A 1ZANH 3BP5B 3UPRA 1GGIL 5D1XC 5DHVB 3O3DA 3VGEA 5DDHB 3IDIA 2ZWLT 4TPRL 1YEEL 2IMMA 4JFYA 3UZQA 2VXSH 4NHUA 4XC1L 3ARDC 4TNVK 4UOJA 5ETUA 3SKNA 1PD6A 2ZG1A 1ACYL 1UT9A 5I17B 1TJHH 3HZKB 3U37A 1A7OL 3U0WL 4P57A 5JPMA 1TTFA 3TF7C 2ZUQB 3TFKD 4GUPA 2G2RA 4G6AD 3KPPB 4JJHA 3O2WL 4NQDE 1T1WA 2QQNA 5F71A 5DEGB 4NIKB 3ELAT 5IB1B 1JWMB 3SDAD 3CFDA 2ZUQC 1ZHKB 3DMMB 1U6AL 4P2RB 5IKCA 9CGTA 1OSZB 5I1CL 5DQ0A 4AEHL 3SGEI 1LDPL 3CVHA 3VD3A 1A7OH 1D9KB 4GAFB 1YNTB 4HFWA 3U0WH 2R2CA 4PTTA 1TJGL 3LB6D 5E95B 5ESVB 3MBXL 5E8PB 1LGVA 1X5ZA 4JFDD 4KZEL 3JV6B 3RKPA 5D1XB 5EU3B 4P23C 1CQKA 2AEWA 5ANMB 3REVB 3TJHC 1EXUB 1UQSA 4M61B 4EDWH 1FSKC 2C3GA 4HJ0D 4J3SA 3BKJL 2IANA 2OKXA 3ESUF 4UTBL 4B41A 2VCCA 2AV1A 5IHZB 4DUXA 2X9YA 5FHBH 2YSSA 4KUZL 1MI5B 1BAFL 4H25B 1JZ6A 4WI4A 5C09B 1HSBB 3IXAA 3O2DA 4DN4H 4EUPG 2RAMA 3MGOB 3IJHB 5DSCA 3I3EA 1RURH 2C4FT 2E8YA 4Y16D 2CLZA 4IS6A 2W95A 5EOTA 3BJLA 5EBWA 4QDRA 3DSFH 3BP7A 2YSSB 5HYFA 5DK2B 2WWKO 1NMAL 3MLRH 1H3GA 4ODBD 4PRAB 1M6OB 4OZ4B 1UB6B 2X4SA 5KANI 2E5EA 3DXAB 4X4XB 1JWMA 2J8UA 1JPGA 3RL2A 5IMOB 4KROD 5EIVA 4JDTH 5GISL 5LBSH 1U58B 4LBEB 3HNMA 4KK5D 1IAMA 1I7ZA 3CFBA 4KKBC 3CFEA 2NY3B 3SDYL 3LEXA 3SQBA 4BQCA 4JM2C 7FABL 5DT1L 2JELL 4YUEL 3I75A 4GRWE 5SX4I 2D7NA 5J0BA 3FFCB 5SWZB 1NQBA 1CD8A 2V9RA 1T7XA 2Y5EA 5IV2A 5D72L 2Y6JA 3WFCL 3V5KB 1BD2B 3LVEA 1TXKA 4U6TA 2XIDA 1YUHA 1BOGB 1FFQA 2Z92B 2WN3A 4UINL 1MUJB 1OW0A 3GNMH 3NPSB 4RCAA 1AFVL 5BRZA 3SCMC 4L8SA 2D31B 4U6YA 1V3MA 4PGBB 4JHWL 2DLEA 3RPIA 5SWZA 1ZVHA 3SDDB 3V52H 1H15A 3EJJX 3V8CA 2YA1A 5GS0L 1WWBX 1K3ZA 3FT3B 3Q6GL 4PJIF 2DWDB 4B7IA 3QJHA 4DGYL 2XXCB 4YZFF 5MHSD 1CFQA 1U8OA 4F8TA 3OGCA 5IROA 3LS5L 4XAWH 3TO4B 1A9BA 5E5UB 5C0RH 4R3SB 1UXSB 4G42A 4WU5A 3BP6A 5IVXA 3S36H 5HHXH 5EORH 2CLRA 2ORBH 4JG1H 3V8OA 3HG1E 5JO5B 4JM2A 3LAFA 5EIIB 1KCSL 4NM4H 1KB5H 2ITCB 4U49A 1F2XK 1MWAH 4BK5A 2MHAB 2FJGB 1LQSR 5AAMA 4ODTL 5TPWH 5GRJL 5KVGH 3EZJB 5C0FA 5D7SL 2ICWJ 4AMKL 1HH9B 2X44D 5DVLA 1FNEA 4Y89A 5E6IC 4C83A 1FVEB 3MV9E 3T4YA 4LP4A 3CDFA 3MUGA 1BWMA 1IKFL 2P43B 3QZWB 4Y5XC 5GHWH 4NQEA 3HE7D 1PGRB 1FORL 1AE6L 5FECA 2E26A 2R9HD 3O9WC 3MLUL 1S7SB 1KPRB 3H0TA 5D7SH 3IYLW 2APFA 2BMKA 3WO4B 2AXFA 3KPSE 2HYXA 1UEMA 1FZJB 5IBLD 1LILA 3JV0A 3PNWB 5F7YC 4GWJA 3WF3A 2AXJA 2C5DC 2J1RA 3RFZC 3VXUB 2ZUYA 3QQ3A 4ELMA 1UCTA 3QBTB 1PZUB 3TBSB 1X4ZA 1GGCH 1CS6A 4H0GA 3QQNA 2NW3B 3I9GL 4AYFA 1ZOXA 5IB3B 3BD3A 2NYYC 3DX6B 4CAGA 1HN1A 4OCXL 3ULUD 2ICEA 4JZNA 3QUXA 4CJ1A 4W8JA 1XNAA 5MERB 1QFHA 5D1QA 5E0QA 1XIWC 1T1WB 2KBGA 3ZKQD 5FYKU 4OIIL 1WIUA 2F54E 1DUZB 4U6YB 1UB5A 1UXWB 3QRGH 4A6YA 1VFBB 3MOQA 4G8EB 1OAZH 4K3EL 2HLAB 4FMKA 3SE8H 5I15H 4HX1A 4NBZB 3IB3A 2B1HH 2ZOKB 1WCQA 4XNUL 2X4OA 2C3VB 3AS2A 3OAZK 4GG8B 5E7FA 4A6OA 1CZ8L 2DQGH 3C8DA 3N1FC 3OKMA 2VWEE 5CGTA 4QB6A 3WNLA 3PDOB 3F58H 4UT9H 4C59B 1CXHA 2VDLH 3QIUB 1W72B 2OL3H 3BP5A 3UPRB 1XR8A 3ROOA 1J1PH 4MNHA 4I3GA 2X5PA 3PL6B 1CLYL 5HGAB 2DQUH 1W2KT 3NN8B 1WFNA 2HVJA 2NZ9C 4C58B 3BEWB 4D8PB 4P00B 4Z76B 2ID5A 3QFJB 4J3WA 5DJ2A 3RVUD 4MXVF 2Y6LA 2A0LC 4TUOB 4KZDL 2PR4H 4LVHB 1ZHBB 1ADQH 1CZSA 4ZYKA 1DDHA 1RZFH 4U33A 1U6AH 2EE2A 2IQ9L 1Y18B 2D7MA 4XXDA 1EMTH 1M7DA 4AEHH 4RMWA 1VFOA 3KJ6L 1J1PL 4PGZA 3DXAE 4EIZC 4K8RD 4ODUB 1JF1B 4GW5B 1SEBB 1K85A 1MVUA 3QEQE 1WBYA 1U8MB 2NY3D 5D6DA 3SE3C 1B88A 3H2WA 5FGBA 3X13B 3HFMH 5E2VL 3ARYA 2PR4L 2F8VA 4RGNC 5DVNA 4EI5D 1I1AC 4P2OB 1MCBA 1FFNB 5JNYA 5DPNA 1H8SA 4DFHA 3VMOA 4DK6A 4G7VH 4LFHG 1KIPA 2C3XA 2GFBA 4LRIC 3WL9B 4PP2B 1F6LL 1YEKL 3K2UH 1RPQA 1IEBB 5FDWB 2V72A 2UVEA 1G9NL 1QOKA 4Y2DA 3SN6N 1KULA 3A21A 2EYRB 4PJEF 3MOBH 3MSPA 2I07B 3MLWH 4JRYA 4EDXB 5KSBF 4UBDD 4S11A 3G5YB 2BP3A 4JJ5B 1G0XA 4X7FC 5E70A 3CDGB 4OCMC 3O9WD 4QTIH 5DMKB 5JNYB 3L3OA 2QQIA 5JIKA 3RTQC 3UYPA 4ZUTA 5JQ6L 2DQHL 5SWSE 2BNQE 1NGWA 4HG4K 2BNQD 1GOHA 4JN2A 1NBYB 1HSBA 1ERNA 4DKEH 4V2BA 2I5YL 2X4QA 4U2ZA 43CAB 2H2SD 3ABZA 4GW1B 1JV5A 4Y4FB 1EEZB 1A7RL 4NZRH 4CVZB 2IH3A 4YBHA 4Y19A 1W0NA 4C4KO 4OLXL 3MLTA 3IJSB 1S7XA 4L3EA 4BK4A 4UIKL 1B4JL 3KPTA 1BJ8A 3VFGH 5HTSA 4M7ZC 5JIPA 2H9GB 5JOFB 3DX9B 1CT8B 2OSLA 2G60H 1EHXA 4DEQA 2WWMD 2IADB 3HNSH 5ELIA 3LQAC 3WIHH 3RTQB 4MNHB 1EO8L 1Q94A 1AKJA 1JBJA 3BZFB 5DWUH 4S0TD 4WY7L 4NOBA 3PWUA 1BAFH 3GSVA 1UJ3C 2W87A 1EJ6A 5L0QC 2YXMA 5DUPH 4ZFZA 4HWEL 5DFVD 4LU5L 1ZLSH 2DM2A 2J2ZA 1U8NA 2XWBA 1KIQB 2Y06H 4WO4D 4JPVL 1X5XA 5CBEB 4ZXBB 2Y25A 4FQJH 1F13A 4JO2H 2WP3O 1FVDA 3D3VA 4I2XB 3Q1SH 5F7EH 4L3ED 2WUBL 2VLJE 1T20A 1N3NB 2J12B 2VLJD 5F21B 1MWAB 3P2TA 4MDIB 2FB4H 5ESAB 1CICC 4TVSa 4KI5C 1JWSB 3VRIA 3KGRA 4UV4L 2ZJSH 3E3QC 1NCAH 1MCSA 2BNQA 2MCPL 2VDOL 4C55A 4P5MB 2XY1A 2NY7H 2DQTH 1A14H 4X98B 5ANME 3CXHJ 2GCYA 2JELH 4LVOC 3CX5J 4MOAA 3O3UN 1VKXA 5KVGL 4JJ5A 1IGYA 2ZSWB 2DS4A 1NGZB 4EI5B 4K8RC 3OHXA 4QCIA 3B2VH 3NPZB 3MA7B 4UNUA 3CSBA 3WYRA 2CKBB 1O59A 3QIWC 1TETH 2B5IB 1YYML 3OSKA 5BRZD 5B3NA 4EXPX 3S35H 3ULVC 4MQ7A 4F8QA 2IFFL 2FJHA 4YC2B 4R8WL 1EIBA 1T20B 1WT5C 4ZUVA 3CLEL 4XPGH 5D2NA 1PG7H 3CQOA 1CCZA 3C7OA 3CKHA 5DURD 1J05A 5C6TL 2VXUH 1FO0L 1S7VB 3GHBH 1JU4A 3LEGA 4PGBA 5F8RC 2W5FA 2W65A 3QFJD 4F7MB 5MHSE 4PV9B 4XRCB 1HEZB 2OR9H 3QFJE 3UBXI 4JKKA 5BS0D 4MNGA 1YDPB 3CDCA 4BZYA 3D6GA 3DNKA 2W60B 3TVMB 4NGHL 3BE1L 4NKOA 3MGAA 1QFOA 3RNKB 1FG9C 1ZHKA 5B3JF 2GSIB 1NBZA 3IDMB 1S9VA 2BOCB 2ADIA 3NN8A 1C5DB 1YQVL 3QWRA 3H9ZA 4KI5E 4AH2B 1X5GA 5IFJA 2NLJA 4LSVH 2CRYA 3LKPB 4TYUA 1IKFH 2JIXD 4PJCB 1OAYL 2PYFA 1K4DB 1MCWM 1JPGB 5JLZB 3H9HA 2FD6H 3G6AA 5K9QI 4MD4A 2FZ3B 5C0CA 4UTAH 1CI5A 3HI6L 5A3ID 4PT6A 5DC4B 1KEML 1FQ9C 1QQDB 1YEFH 3H7LA 3PHQB 3UTSA 3MXWH 4PRHD 4HJGA 3SGKA 3QZWA 4G8EA 3IFOA 4LKCA 3OTTA 3MNZA 1IC4L 3QQ4B 1NGQL 4TSCL 2JF1A 4XP6L 5IHUL 3S3SA 5EIQA 1IM3B 3OXSB 1FYTB 1KGCD 4ET7A 1ZSDA 5HDLA 1LP9A 3SE4A 4XPBH 5F97E 5ISZA 4YBLB 4OCSH 5C8JA 1PBYA 4ZUVB 1J0KA 4N5ED 3AB0C 1S9YA 1UZ8A 1RUKL 4TVPE 5HYJD 1UWEH 5FUOH 3HG1B 2NX5D 2BHZA 1OTSC 1ZVSA 3GMNA 1YEEH 4PJ5E 4PRPA 3P1IA 3TO2A 4WENB 1QP1A 4PJ7A 1V3KA 3U4EB 3IAPA 2ZG3A 1JUFB 3VXTA 4YFLF 3U4BL 2ARJB 1YEGL 4NQCD 1ES0A 4QWWD 1FLRL 1Q9KA 5B8CA 2WLYA 4F7TB 3VRLF 2XQBL 3NACH 1CZ8H 5D9SB 3LH2L 3FQNA 1G6RL 1LDSA 4KAQL 4HGMA 4U1NA 1YNLH 3T2QA 3C5ZB 4AG4A 1R3KA 5GS1B 2I24N 5JHDA 1YEKH 3K2UL 5DI8B 4HUWB 5FYKL 4PLJD 2BGOA 3DMMA 3TBWB 2O5XL 1K4DA 4C83B 3VXME 3DBXB 5DA4A 5SWQB 3VDBA 1OTUD 2R56H 3E1F1 5BV7C 3THDA 1V3LA 3F7PC 4KROC 4PTUA 3C87A 2A83A 5DUML 4JFFD 3PIQB 4ZQKA 2XQBH 5KSUB 1JFQL 2ADIB 2ITCA 1K6QL 1G7IA 3BIBX 4IMKC 4E8CA 2NY3C 1WK0A 3P0YH 4J4PD 5EA0L 4XZUG 1ADQL 5IHBA 1T7VA 2GI7A 2R2BA 3OXRB 3SDDD 5DQJA 4YHOL 1ZTXH 5CIPA 5J1XA 3HC3L 2JJSA 2PYFB 5DMGC 1IGFL 3PGCA 3VMNA 3AUVA 4MQXC 4HPOH 4EVNB 1NCDL 1INQB 4RX4D 5F1NB 3TN0D 4GBXD 4JG0L 3V7AE 3BW9A 3UBXB 3LRSA 3MOAH 1T22B 3BAEL 1DUYB 3UNPA 1B4JH 4YNYA 3RPIB 3V6BR 3RVUC 4HPYH 3JSSA 3DROA 1BFOB 5TQ2L 2NR6C 3QUZA 4JY6A 4L5FL 3KAAA 1PYWB 1BIIA 1U8KA 3OGOE 2Z8RA 4ZFGL 1E6JL 3U36A 1JGVL 1K3IA 5FM5M 1NC4D 4H5SA 2FLBT 4MA3A 3D39A 1FAIL 3O4LB 1KTDB 3U9PH 2MMXA 2JJVA 3VGFA 2PQSA 3R1GH 3V95A 5D1XA 1AO7E 2FDBP 3CLFH 1V7NH 5B38G 4DXRA 1XCTA 3S4SA 2W9LA 4FQLH 5F7EL 1ZT4B 2DQJL 3ARDA 4EI5C 2V5YA 4GMTH 5IEHA 3KYOB 4HEME 3JWOC 5CZVL 3SJVD 3RIFF 1MSPA 1BBJA 4NQXB 5IBUB 4U1HB 3LCYA 1NEZB 5I8EB 5LGHH 4JFOB 4WI6A 1H8OA 1KLUB 4LLYA 4Z95L 5J6GB 2W3JA 1MI5D 1HQ4A 5I8OL 5E00A 3GNML 4FQ1L 5D7IA 4PP1C 2Q7YB 2PN5A 5C0AE 4Y4HC 2A6KA 4JFDA 1INQA 3CZFA 1CXLA 3U36B 1YDPA 1EHLL 4NP4L 4XVSH 1LNUA 1LEKB 1NMBH 1PQZA 2YD9A 3EIFA 5EC1B 5D1XD 2D7PA 4HMCA 1H3XA 4PIRF 4I18C 2OK0H 4F9LC 1C16A 3D85D 4HEPG 4QYOA 5AWNH 3TCXA 4QXTB 5D5ME 2IANE 5I74B 5HYQA 1YC8A 1U3HC 1CDUA 3DI2B 3JUYA 4S1DD 3I3DA 3P4MA 4APQB 2R8SL 1MWAL 4NQSA 3CLEH 2FHFA 3RJQB 1FL5B 2OLDA 3LRSB 2EH7H 1T2JA 1W72A 2NXYC 1IL1B 4XBPB 4HFUL 1C16B 4H1LH 5IT2H 2EDEA 1CGTA 4XPTH 4S1RL 3DRQB 1KXQE 4JB9L 2ENYA 1XIWA 3VW3H 4XC3H 1U8JA 3FRPA 3DVGA 1GZQB 3CZUA 2B0SL 5FM5O 3ULUC 3B9KB 4L29A 3PV6A 3NCYS 1T0PB 3QNZB 3TPUB 3GI9H 3VDCA 3N1GC 2FH8A 1K4CA 4O2FB 1KT2B 4KMTL 4IRSA 1AGFB 5KG9A 4L4TD 1SBSL 2OR7A 2HFFB 1NEZA 4LSRL 4L4JA 4OZHA 4QOKE 1JK8B 3QEUA 5HYJB 2BVQB 3HMXH 2P5EA 4DVRL 25C8H 1SM3H 2WBJD 1S9XB 3S35L 3PJSA 3MRBA 4PY8I 2GT9B 3RIAF 4PJFE 3N50A 4ETQB 1W99A 1EGJL 3P11H 1J87A 3F6IA 1UADC 5HPMA 3OAZH 3TJEL 3WF4A 1BFVH 3WS6A 1S9WA 4M9PA 4ELMB 3QDAA 4Q6IB 3EZ8A 2Y9RT 4JZJC 4NN7B 1HINL 4LLUB 5I16A 2JJSC 5DD1L 4FQQA 1IAOB 4PBVC 5HHPB 5DHXB 4GG6E 1QR4A 5B4MC 4KJPD 2AJUH 4DVRH 1NFIB 5IWLC 1C7TA 4JZOB 2E3VA 3T08A 4O4YH 3AROA 1S3KL 1Q0YH 2XKSA 3HNBM 4YAQB 1G7LA 1QZ1A 4OCSL 5I15L 1Q8MA 2X4PA 4A41A 3HB3D 1MCWW 2AV7B 3GMQA 4LDEB 3OZ9L 1RUKH 2DIAA 1MHCA 2P5WD 2F53D 2XZZA 4HBCL 2UYLB 5TF0A 2B2XL 1UM5H 3FMGH 3S88L 3U82B 4Q6YA 1ULVA 3W5MA 1L4IA 1I3UA 2Q6WA 2P8PA 2BJML 5CKAA 4TUKL 2W1QA 1KIQA 2QADD 1DP0A 2R1XB 3QIUA 2D3VA 1RZJH 3RWEA 4XP4L 3MZTA 5TF1L 1D9KD 4UIMB 5C0DB 2HTLD 1QLEH 3VG9B 3MV8A 3EOBB 4BM7A 1G6RH 4JN1L 1KCRL 4K7PX 2YMXH 4YC2C 1AKJD 4ZFFB 4KK9C 4KQ3H 4P3DA 3KPLB 1D5XB 4NWUL 1IARB 3QI9D 4IDLA 4P9MH 3ZTNL 3OKKA 1P7QA 3NA9H 1QBML 3WHE0 1MF2L 1TZIB 3PE9A 4RWYH 3O4LE 4P4RB 2V5TA 1MLCA 3LV3A 3RWDA 1T5XA 1BZ7A 1NAMA 1KT2A 5HGGS 5JW4N 4HUVB 1TZGL 5LQBL 2N7BA 4EJ1C 5FECB 4XTRC 1F58L 3ULVL 1P7KB 3O11B 4K3GA 1QFUL 5I74C 4YXKH 5DC0A 2XN9B 3NCBB 3QB7C 3LB6C 3OHXB 3O2DL 4XNZB 1FCCA 5DK2A 3MCLH 2HT2C 4YPGA 1KIRB 4MWFA 4J23A 1NGYA 1X7QB 1J0JA 2YPLB 1JWUA 3K7UA 5C0IB 3VGAC 5LJYH 1OTTC 2I26N 4U6HB 4JRYB 2XZAH 4W4OC 4YGVB 3IJHA 5DSCB 4YWGL 1XAUA 1TIUA 4Y19E 3INUH 4LLUA 1DEEB 5IEHB 3G6JE 4K2UH 5JMRA 4OLVH 5EPMA 3C8XA 1KCVL 5BVJA 4KHXL 3O2DH 3O4OC 1A6AB 3T1WA 4K94L 3VFWA 2OJEB 4P4RA 4UILH 4JREB 4GRLD 4ZFGH 1AJ7L 2V7NB 4HLZH 4YHPA 2CPCA 3NVQA 3NCFB 4GH7B 3ROLA 4MA8L 4ZXBD 4Z0XB 1HQRA 3P73B 3QPQD 4PJHB 3RL1B 5IHRA 4ONOA 5EU3A 4D9RE 2F5BL 1B0RA 4ZODA 1XF2A 2BRRH 3QXAB 4PV8A 4QXGL 3WXWH 1F4XH 3IDUA 5D6CA 1G0DA 4Z7UA 2FO1A 3QUKB 2G5RA 3TYGH 1CLZH 3BWUC 3BIKA 2YPLA 4EN3D 4HS3A 4UILL 5IVZB 5I1DB 3LDBC 3RBGA 2OTWA 2W65B 3MRIB 2ZKHH 5J89A 4OTXH 1VENA 4OFPA 1FNFA 4W4OA 5HDOA 2AK4E 4XH2A 2RCSL 3BFOA 2MKWA 2ZEWA 2B8OT 2Q8BH 5DD6A 4YBQD 35C8H 1GGBL 4Q9RL 2VCAA 4LHSA 5DEFB 5KTEH 5JO5A 1T0MA 5J6HA 5F93C 2EIEA 1F42A 1P4LA 4FFYH 3V6FA 2CIKB 3S37L 1JI1A 5JUEH 5DQDL 1I3GL 2ZCLH 1C1EL 3VG0L 3H9SE 4LNRB 5D8JH 2A9NH 5EO1A 3RI5K 2ITDB 3U0TB 4OV5A 1E6JH 2LU3A 1HHHA 1KENH 1JZ5A 3OEBA 1L7IH 2MTPA 5GQBA 3CSYB 5C0EB 1EHAA 2OTPA 5MP6H 3AAZA 3RVWC 3WXVH 3T0EC 5J56B 3OB8A 3V0VA 4ENED 2R29H 3CFEB 4WEMB 4Q0XL 4P5MA 4L4VD 1B6DA 1EO7A 5IYYA 5IBUG 1QSFE 4HZLA 1FIGL 2XPGA 3VRLE 2BCKB 5KSBE 2FEDC 3K75B 4LVEA 4V1DA 2GT9A 2GY7B 3ARSA 4UQ3A 4ETQA 5C86A 3GJFH 4R97B 4MA1B 3ZYOA 1OP3K 2YN3A 5C0EA 4M6AA 1P4BH 5T1LA 3VCLA 3VFRA 3LKQA 5BZWB 2E7BA 5AG8A 4YDKL 1BMGA 2I9TA 4TQEL 3EO1A 3U30B 3HAEB 2UY7A 4Z7WB 3ARDB 5C0BD 1NKRA 4ZSOE 4N90E 4NN7C 3A0OA 1KN2H 3DOSA 4JFEE 5H8DA 3ECBA 1FFOA 3IU4L 5F6HI 4LVHC 3HS0A 1RIVH 1O0VA 4OLZL 1MEXH 4KKLD 2A74B 3L3JA 5CAYB 5FEBA 4XWGH 3TT3L 1RK0A 3MREB 1VHPA 3HR5B 4ODXB 1UXZA 3SEPA 5I76A 1HWGB 2HJFB 2HT2D 1MVFA 3SY0A 5CWSA 4IRSC 1W0WA 4NC1C 1UYXA 1MLBB 1IFHL 1KN2L 4M1DH 1JZ4A 5HYSA 2CD0A 2J1EA 2R8SH 1GCFA 3ZE1E 1UEYA 1VACB 4YHLH 1AO7B 1CR9L 4NO0B 3REVA 2Z92A 4NQTA 1HHJB 4P2QB 1XGTA 3PDOA 3HI1A 1GRWA 2EC8A 1LEIB 4QB1A 4JPIA 4UTBH 3RIAK 2E7LA 3N85L 1AGBB 3HB3C 2Q3AA 1CGUA 3FFCA 4HS6B 1T1ZA 3N1MC 3THML 4IRJD 2ZOKA 2X89A 4Z78B 4YHZH 4KDWA 4RAUB 2XTJB 3LOWA 2CRZA 2NY5L 2HMIC 4HXBH 4WTWA 2IQAB 4MQXD 5BO1L 4TOYH 1CE6B 2DWEA 3D48R 3HTLX 3SKVA 3PV7A 1IC4H 4CU8A 1BBJB 1NMAH 1QFPA 1X5YA 3IDYC 3QCVH 4OM1L 3QEQD 25C8L 5IFAH 4R97C 4Y19B 1XF4A 2H6PB 2DKMA 5KVMC 4P5TA 1ZGLB 1HI6A 3IXTA 5FYKE 1IBGH 2YD7A 1MHEB 1XCTB 2CLVB 3AREB 4MNQB 5LXGL 5L88L 1HHKB 5LGJB 3BVNA 1YPZB 3P0VL 3K77A 2DDQH 2R1XA 2IEPA 3VXSA 4YX2H 1NC4B 2H3NB 5ID0A 1LEKA 4I48A 5J57B 3IB4A