2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
1NMCB 4NQXA 4MVBD 4NUGL 4R96B 4X6FA 3S37H 2XRAL 3HOBA 4WWKB 1U3HA 4D0CB 3B9VA 1CZ8L 1WTGT 4HH8A 3VJ6B 3U82B 2OZ4H 3IRPX 3MGAA 4XCCL 3NH7H 3HAEH 3T04D 1IQDC 2DYPA 4V1DA 1V3LA 2IGFH 4CU6A 1R5WA 2JELH 3L3DB 1UQSA 4RISH 1FG9C 4G7YL 3QH3B 1CFVH 4P2RE 4ZUWB 5D6CA 2AJ3A 4JG1L 3JWDL 4P46A 3SDDC 4UIKH 5FYJD 2RCSH 4YXLH 1TZGH 2NTSP 4YR6B 3MOAL 1AGEB 2G2RB 4MQSB 5ESVA 2DQCL 2VXQL 1JF6A 3NCCB 5E2TH 3JUYA 4OUOA 4ELME 1I85C 5J0BA 4L8BA 1RUML 3DBXA 2YPLE 5D1QC 2I07B 2ZUQB 4UIMA 1J87A 4MA8L 4GAGL 1JZ8A 2E7BA 4R9HA 2FYYA 2QHRH 3K3QA 1CI5A 4EQ2A 2IH1B 1N6VA 3ARGD 3PV6B 1X7QB 4FQIH 1UH4A 1JF5A 5C0BB 1X4ZA 5JW5A 5HHXH 2DDUA 4MNQB 3WFZA 1J18A 4M1DL 3SDAC 4RFNC 1MAKA 4QHMA 5CZXD 4IJ3B 1NC4A 3L3GB 4F7EA 1JNHB 3QULB 3U30C 4ETQA 1AE6H 2W1NA 5D7IB 3QIBB 1YEJL 3GJEB 2HVJA 1A2YB 1T2XA 2WUBH 2DF3A 4UI9L 1M71B 4P2CG 4ZAKD 2HT2D 3GFUA 3MRMA 1EHLH 3GHEH 5E8EA 3VXRE 3O4LE 2ITCB 4OD2A 2WM0A 4AY0A 3CK0H 2ZSWB 2NXZB 4GW4B 4HIJA 5DQ9A 3CFKB 4QGTA 2OP4L 4MJIB 3DGGA 4D9QD 2X4NA 4N8CL 5INDB 5FECB 4GUPA 1MREL 4HS6A 5DSCB 4EN3C 1ZT4A 2EYTB 3CH1B 3W5NA 1QSFB 3SDCB 1W9TA 4I13B 1JGEB 1YNLL 5DR5H 1IVLA 3CX5K 4KKAD 2IBGA 2F58H 1FVCB 4FXKA 4FZ8L 2HFFB 2Z93A 1EXUA 4OCMC 4OF7A 2YR3A 1QFWM 2ZCKL 3D18A 3TO4B 1DLHB 5GS0D 4NN6C 5F7KC 3OG6B 1XR8B 4EBQL 4PY8J 2W1UA 5AG8A 5HPMB 3G5VA 4MD4A 4AIXA 4CUCA 4F37F 1UYYA 3KYKL 4PP1C 4X7CC 3PWJA 5CGTA 1IL1B 1O8SA 4HJ0C 2JJWA 2AVGA 2XACC 3HMWH 3U0TB 2HJKB 2FHBA 3BHBA 4ZZ8A 2D31A 3HTLX 4LRNH 4D8MA 1WFTA 3O6ML 2A0LD 1RZIB 2YK1H 3P73B 4K8RD 4NQDA 4UILH 2DLHA 2EXWD 2EH8L 3NACL 4XMPH 4HHAB 1MOEA 1CD1B 1MFEL 5TE7L 3EJYC 5EU6E 1OF2B 5DD5L 2I9LB 4QRPE 3WFBL 1S78C 1KJ2L 4RWHA 4DZBA 4AG4L 5DVKA 5AZ2H 3PDDA 4D0QA 3LN5A 4HKXB 1RMFL 2PTTB 3QWRA 4WW2A 3DX7B 4XGZA 4EUPA 4IUGA 2LU7A 4GT7A 4MWFB 4Y2DD 5DQ0A 4JPVH 3WIHL 3D25A 2BP3A 2YD8A 3FFDB 4JJ5B 5IM7A 4QNPE 4XNXH 5TF1L 4N0YH 1JRHH 5LKNA 2HKHH 1F13A 1BF8A 5E2UL 1N64H 3V5HA 4MJ6B 4JFPB 4P57A 3VCLB 4V2BA 1KEGH 3CDCA 4IRSC 3BESR 1XIWD 4MDIA 2HT3C 3KPRE 1BQLH 1CR9L 3VFTA 2OM5A 3W11C 5E2VH 5JOEA 4OZHF 4YHLL 1KACB 2VIRB 4P2OD 3MV7B 1N7ML 2H1PL 1LK3H 1JYWA 4YHNB 1QFUH 3ULVD 4KK6D 1MCNA 5DUPL 1CE6A 5IHLB 1LEKA 2Y5EA 3O8XC 1KV3A 5C2BL 3QUML 4S1SL 1JPFA 5AAMA 5KVDL 4ZXEA 1UKSA 3I50L 5L2KE 3MUGB 4ONHA 3S88H 1LD9B 4OLVL 2QQOA 2GJJA 1WQVT 2NY5C 4X4ME 5LCVL 4HH9A 4NC1E 4PLJC 2BSTB 5C0DA 4YUEH 1BFVH 1RZFH 5C0AB 1JGDB 2XXMB 5CJ8A 4F7MA 2PXYC 4JFFA 3LEIA 2EC9U 4P59L 3GMRA 5I1KL 3C60B 3IDMB 1VFAB 4JM2F 2E9BA 5IVXF 5M95B 1ZA6B 4NGHL 5DS8A 3GNMH 2DQUL 2HFGL 2XTJD 3IJHA 1QO3B 4PRAA 3T2NL 3OKDA 3DTXB 1LWRA 4LLDB 4I2XB 5EZJB 1IAOB 1NCDH 1I3RA 4YHKL 1IGCH 2B5IB 3OAUL 4I77H 3L3JA 4YO0B 3VFPB 1UZ6F 3L3OB 4ZDHB 3O3AB 1NDGB 3GHBH 4WUUB 2R1YA 4QB1A 1HHGB 3LV3A 3ZDXE 2R0LL 4DGYL 4PGEA 2FO4A 4TVPH 4X7TA 3P9MB 3KPLB 3ISWA 1OGAD 4K55A 1U8IA 1DBAH 4HCRA 2O61A 5JHLH 5BRZA 5F8QC 4XCNA 3PNWB 4DXSA 4ZS7H 4WVRA 4HZAA 5JDJA 2IMMA 5H35B 2ZOLA 2X4PA 2ID4A 3RVWD 3UZQA 1JZ3A 3QQ9C 2W59A 4O02L 3DVGA 2ZEZA 3I85A 4K3DH 2NYYC 4YGVB 4BQCA 4Z7WF 4LDLB 3WJJA 4NN7B 3S96B 3FQNA 2Z31A 2DQDL 2VNCA 3IF1A 3QCTL 4G8GB 5HI5D 3DYOA 4FABL 1JPSL 4JZNB 3HPJA 3ARED 5HYSA 5LGHH 1U0QA 3QDJE 5DEFB 1WBZA 4LVOC 3I2KA 2AERT 2MCG1 1CS6A 4WWKA 4XNUH 3VXUD 1URLA 3QEQE 4LAQH 1FGNH 5BVJA 4PLJD 3O9WD 4WJ5B 2WW8A 1K12A 5DRNA 5IW6B 4LSQH 4I18A 4N90E 5HVFB 3ARDC 3UTSE 2W0FA 4PRPE 4QB6A 4I5BB 4LLQB 2IAMA 3V6OC 1IJ9A 4P9MH 1CDHA 1CGWA 3MCLH 2ZWLT 2APFA 4UT9L 1M7IB 1MRFH 1Q72H 1LO2H 4UOW1 4DQOH 5JDSA 3VFSA 4OZIB 3QSKB 4PJ9D 3UX9B 2G2RA 3OB0H 1MCJA 1L9MA 1P53A 2F54A 3KJ6L 4ZYKA 1P7QA 5L9DH 2J1SA 1JRHI 4RFOH 4PGJA 2NXYD 4JANB 1CLYH 5DJ2B 3T4AA 3FO1B 2BVYA 3MRCB 4D3CL 3QXDA 1OF3A 1NLBL 2NY6D 1FG2A 2WINB 3X14A 4LQFL 4N0RA 1OARL 3TZVA 1MCEA 5C0BA 1ZA3B 1T0MA 3UESA 5ID1A 3MJ7A 1LO4L 5DYOA 3X12B 4PLKD 1JWUA 1LMKA 4Z9KB 1HSBB 2NYYD 5C07B 1FNGA 1ZVSB 2DQHH 1J1XH 2MQ0A 3E2HB 2WN2A 5GJTL 2V9QA 1DE4A 1T89C 2VCCA 2CKBH 3HC4H 3RGVD 2VKXA 4I3RH 4QOKB 1LO5A 3DV6A 3SCMC 1PQZB 5KN5A 3MO1B 4JFDE 1MVFA 5JXED 5IQ7H 1C5CL 5J9PA 1HHJA 3VW3H 4P99A 3QWOB 2AK1L 3SE4A 2CDFB 4ODTL 3UYOD 5IUSA 3IFLH 1YEIH 2IH3A 4GW4A 5G05L 1C5BH 4OBSA 3PWPB 4QHNB 4UMGA 1A3LH 2XWJA 2YD4A 1MWAH 4KJQD 4P48A 4H25B 5DTFA 5J6HB 1JI1A 4IMKA 1G7QA 3T2PA 4O58L 5HDOA 1QSFA 3QQ3B 2YRLA 3ZE2E 1J1OL 1KPVA 3LKSB 2IQ9L 3JV6A 4Z76A 3QUKB 1I9JL 5IB4B 2FX8H 4L29A 3PL6A 2EDDA 2HFFA 2Y64A 4OFVA 5IMOA 2KUTA 4X7SL 3A6OA 5GS1C 4RMWA 3GKWL 4PRIE 4UQ2A 4OLWL 4WNQA 4HJJL 3HI5H 3MRGB 3GIZH 4KTEH 5EN2B 4HT1H 1Y0LB 4JRXB 2FSEA 3CU7A 1KCSL 4OV5A 4M5YH 3ARBB 1W72A 2PQSA 3FB5A 3NCEB 1UEYA 4XAWL 4LLUB 5INCB 3OR7B 5SX4I 4WI9A 2A9NL 5IESH 2ZOKA 2XZQL 5EFIB 4UQ3A 1A22B 3UBXG 2FJGB 1NC2B 5DUML 2R56L 4P3WA 4PJEE 4XVJL 1F2QA 1IC5H 2OKXA 4JREC 1Q9OA 5GRVL 4JHWL 5F7YC 5D7IF 2C3XA 3P73A 3C7HA 4J23A 5D1XC 1YPZE 3UDWA 2LVCA 1MCKA 3IFNL 1TZGL 3IXTA 3UMTA 2FL5A 1OF2A 4QRRA 1OH4A 3L95B 2G5BB 5B38B 3FFCA 4M61A 5DEZA 5F3BA 4GMSL 4GKOA 3G04A 3OJMB 1R0AH 5DMIH 4IRJB 5ACZA 2ZG3A 1RUKL 1L4IA 2W1SA 3U0PB 1WCBB 3P0VH 4Z7VE 2VMEA 3CFJA 2HVKA 4D9RD 5KVEH 2WUCL 5B4MC 4UT7H 3NRUA 3MXVH 3D69A 4OZ4B 2X4UB 15C8H 2X4RA 1T21A 4M48H 4X6BA 3WD5L 3MV8E 1ES0A 2E7CA 4WI5A 1QLEL 5JUVA 3LN4A 1N26A 2NY2B 5EOTB 2UZXB 2JCCE 4LP5A 3TBWB 3F12B 2GEEA 3E6FA 1LEGA 2CSPA 3IDYC 3V0VB 1GOHA 3FTGB 4UAPA 2I24N 3LKQB 4YZFE 2ZCLH 2JLLA 1A1OA 5FUOL 1N6QH 2VXTL 5CUSH 4IMLA 2K1MA 5ITBH 1AY1L 4OCXL 1SHMA 1NFKA 4I4WB 1UM5H 2FATL 3GMNB 3QXTA 4A4AA 4HKZB 1GUIA 1U8PA 2X1PA 4ZUSB 5I1GL 4ET7A 1J86A 3KLSA 1JTPA 3I97A 5LVEA 3GSWB 2I27N 2IBZY 5I1CL 4YHYC 3IB4A 2J8UB 5HYJD 2DI8A 4I9WD 2W87A 2P5WE 2B0SL 4JO2H 2RFXA 1EEYA 4ALAH 5CEZD 3VXPA 1CCZA 3T0EC 4WU5B 1JJUA 4BSVB 1CFQB 2JK5B 2Q7YB 2JJUA 4FP8L 2FWOB 4RWYH 4AAXA 1UM6H 4BQ6A 3A7QA 2WN3A 5FHBH 1R5IB 5FXCH 2YD1A 2UY6A 2OXGA 3WKML 2AK4A 3DTXA 3CCHA 2LTQC 1W0WA 4PR5A 1MHHB 5CIPH 4ZO9A 4P2RD 4PPTA 2JB6B 2MSPA 1KB5A 2XXCB 5C09B 4QT5B 2F5BL 1AD0A 4MDJB 4X5WA 2ATPA 1HHGA 1YNKL 1OAKH 4WTXA 5ILTL 5L2JA 1ZAGA 2VDML 1FNEB 3BGMA 1E6JH 1OTUD 2Y36H 3H3PL 4YDLC 5F7HA 3QRGH 4U1HB 4G6AD 1Q9LA 2YPLD 3JWOH 4M4PA 4OMDA 4DWHA 3EYSL 4O2EA 3LS4L 4U6HB 3HMXL 4ZFOL 2EDNA 5HHPA 3I2HA 3AVEA 4J8RA 3QBTB 4KHXL 3MNZB 3QUXB 3HG1B 4EDWH 2YS4A 5JW4Q 5D1ZB 4NKQB 3GUTA 4UB0H 4EI5C 4XUQA 2DM3A 4OLEA 3U4EB 5T3XL 5K9QG 1MCSA 3EO1A 1X44A 1S9YB 2PYEA 3RUGE 3CU1A 3UJTH 1DDHA 1EH9A 1M4KA 1WIOA 1SQ2N 4Y5XA 3CX2A 3RP1A 1ZSDB 2DOCA 3CD4A 5DRWB 2Q8AL 1ADQA 4JRYB 2AI0L 4AIOA 4NJAL 3OEBA 4JY6A 5JO5B 5TDPB 4U4BA 5I8OH 2VZRA 4WJ5A 4X83A 3UC0H 3VXRD 3O4LD 5I76A 1KTLB 2WYSA 3A6CH 3V52L 2HRLA 4YE4H 5SWQA 3IGAA 5JR1H 2XHNA 2C3VA 3MR9B 1EEZB 4HKBA 3MLTA 4N0FB 5E9DE 1QSVA 4JQXA 1FDLL 1KC5H 1NLDH 1NBQA 1BEYH 5FKAB 4G6JH 4IIQC 2MQCA 4Q9RH 1A1MB 4KI5E 4U1NB 1HINH 1X5AA 5GGTL 2V7HA 4NO3A 1DBJL 2G9HA 1IGTA 5DJDA 3LH2L 5TQ0H 3IFOA 3SJVA 3FQUA 2PR4H 5E2WL 1SMOA 4Y0GA 1OM3H 2HFTA 4LLWB 5GRWA 1SG3A 3J8F7 1J05B 4YBHA 2ZUSA 4M6NL 5IF0B 3V4UL 1OLZA 3NCYS 2K3TA 1AI1H 5EPMB 5F1NA 5J4MA 1UYWL 2YOCA 1IQDB 4A6YB 3ACHA 1CICA 1TZHA 4HFWB 1Z0MA 2W0PA 1CLOH 2ESVB 2HN7B 3BEVB 1ZKAA 3FO2B 3SDDB 1A4JB 4KU1A 4XVSH 2XN9A 5IB3B 5D2NE 2HH0L 4Z2AA 3KR3H 4HLZG 5JW4R 3TA3D 5GGRY 1GHFH 1RUAL 3KNBB 3CQOA 4XNQA 4M02A 2ICES 4YDVB 1S9WB 5EU6D 5D1QB 1MLBB 1QA9A 2ZJSL 1U3JA 3B9KD 4NNPL 4QRPD 1QFWL 3CSYA 5IR1A 4KDTC 2IANE 3KYMB 1TVGA 1ZHBA 5JHLL 3ZSSA 5FK9A 3TV3L 1RUQL 2ENYA 3WF4A 2RJMA 2F53E 2B1HH 3QZWA 2V5DA 3I6LE 2IPKA 5AD0B 2LU4A 1TETL 4XI5D 4OZIF 3IDNA 2FGZA 4PY7B 3IFPB 2I60L 1MEXL 1S9XB 3SDAB 4RFNB 3X13B 2Q8BH 2PYFA 1G6RA 4M1CC 2OJEB 4XVTL 3QPQC 1R3HB 4J1UA 1EA9C 3HNTH 1D9KA 5FDWB 3U30B 5KSAD 3P9WB 1C12A 4NQCA 4ZPTA 1MHCA 2NNAB 2KZWA 3NOIA 1R3IH 3KPRD 2W65A 3VA6A 1Y0LA 3BZ4A 2ADIB 4LHUA 4P4KD 4OZFA 3GMLA 3PG2A 1NCAL 1BZ7B 5INCA 2A83A 1F4XL 3EOBA 3PUHA 3OSKA 2HAZA 3G5XB 5BZWA 2I9TA 1BQUA 3RWJB 3RX7A 5ALBL 1J11A 4MJ5A 4NC2B 4EN3B 4CNIB 2GK0A 1FBIH 4PJAB 5F71A 4PP2B 1OCWL 3U6RB 4N0UB 5B3JE 4L3EA 5L2KD 2H2PC 3FT4A 4WENB 5E5MB 3GSVB 3FZUC 3MCLL 3QIUA 1FAIH 4ELKA 3GSOA 4AM0B 5H2BA 1ZOXA 4NN6B 4ZMAT 5B38A 3DX6A 3OKOA 1MIML 4DKFH 4GJTB 3DIFB 3T3PF 1MIEH 5C7XH 1YJDC 2NY1B 4XPGH 1QEWA 5K93A 4JY5H 4M5ZH 2P7TB 1LGVA 3FT3A 3MJ9L 3MMEB 3TCXA 3QFJA 3CVHB 4QRUB 1AO7E 2EDXA 5GGSA 4KTDH 1DP0A 5IB2B 5CHNA 5F8RC 5IFHH 1BGXL 3MBWA 1YYMH 1C08A 3FB8B 4L8CA 4R90H 3VD5A 1CN4A 2BBAA 2R4SH 5DJCA 2IPUK 3OL2A 5BOZG 5TF0A 4WHYG 1K8IA 1P4LB 3KWWA 5LWYH 1UYZA 5H94A 2OJZL 5LGKA 1OPGH 3BO8B 4Z8FH 2X5PA 2ZUXA 4KY1L 2E9WA 3P6BA 3C6LA 2GY5A 2VABB 1T4KA 5FO9A 4F9LC 1XFPA 1XNTA 2WBJC 4HC1H 3WS6C 7CGTA 1HYRC 2E26A 2BHUA 4HKZA 4ZUSA 2VOTA 3GM8A 3NGBC 5EOQH 3MRBA 3CLFH 3WDJA 5EO1A 1GC1H 3BKML 3T77B 4XCFH 2Q3ZA 5E8NB 2GITA 3LIZH 5TH2A 3MLPA 3M17B 5KG9A 3FL7A 4IRSB 2X1OA 4KMQA 4R4FH 5SWSA 3QDJD 3RPIB 2UY7A 2JIXD 3TYFA 2B4CC 5IFAL 2Z92B 3DROB 3BVNA 2PW1A 3ABZA 1VEOA 1X5GA 4HX1B 1VADB 3QEQD 3LB6D 1S9VA 1CBVL 3NZ8A 4OQTA 4F37K 3X11B 1X5IA 4O4YL 1KBGL 4N90D 1T5WB 4XH2B 1IAKB 1NEZA 3UTSD 4PRPD 3O8XB 1QSEB 1MHHA 3P4NA 5EBWA 4EEEA 3VD7A 3HAEG 3FN0H 5C0GA 5HHMB 4GRWE 5DK3A 3PABA 3T65A 2DTMH 3K74B 5GS2H 4NHUA 5J6GB 1FFPB 3P4OA 4OF5A 3AU1A 1PW3A 3DHJA 5FCSH 1KLUA 4HGKC 1S7VB 4YHOL 5CBEA 4HDIA 1MJUL 2V2TB 2PXYB 4Y4KD 2OQJA 5GHWH 3ILQC 4PUBH 4JZJA 5ALCL 3HZYB 2GAZB 2PCPA 2VLKE 3UZVB 1UENA 1VGKB 1XMWA 3I02A 2V17L 3MNZA 4YDKH 1Z5LA 1R0AL 1S5HB 3VWJC 5D1ZA 4ACPA 2HLFC 5DHYB 2J8UF 3U4EA 4OTXH 3WLWD 1DYOA 4DGIL 4JDTH 2VWEC 3GGWB 2YPKA 5EBLB 1GSMA 2GSIA 4KXZH 3KJ4C 5MEPA 4UI2A 5I16B 2WQ8A 15C8L 1DQTA 1R24B 2J5LC 4LCWB 8FABB 4E0RA 4L8SA 1WT5C 4JRYA 1U8QB 1ZLSL 2FEDD 3ARGA 2YKLH 5F6HJ 4X6CB 4JFDD 4NRXB 4DTGH 2PETA 3BW9A 1NUKA 2CJUH 4UV4H 4AYFA 3S36X 3T1FA 3ZDZE 2ZZUT 4P5TD 1DLCA 1NUFA 4HKJB 4KI1A 3ALWA 2LABA 5D93C 5CSZB 2EEDA 4HV8B 4HWBL 5CUSL 4TULH 4L0PA 3RVVC 4RNRB 5I17A 5FOBB 3ACIA 1UM5L 1EJOL 1LP9A 2W1QA 2R23A 1U8LB 5DD1H 3H2WA 4Z18A 1VFUA 2YSSB 4XP1L 2CLVB 3W9DB 3OGSA 3FONB 2R69H 1OHQA 4UTBL 3S5LA 2UWEA 2QSCL 1EO8L 5F9JB 2ZNWA 2VE6A 4LVOB 4JO2L 5AEAA 1YDPB 4PRID 3LEKA 5T3XE 1AIFA 1IFHL 4HIHB 2Y72A 4M6OH 4Z0BL 1U95B 4BH7B 5CBAB 3TPUA 1MFDL 1V3JA 2AGJL 4M1GH 2GFBB 4ZXBD 3ARDB 3JVGA 1UFUA 2L7UA 1MJ8L 2X1WL 3HNVH 3OJVC 2Y07L 5EJ1B 1GIGL 4PS4H 1MFBH 3W0WE 2XA3A 4KVCH 4NYLA 2W38A 1A4JA 1QVOA 4PJGE 2ID5A 4ODVH 2J7LA 3K1DA 3GMOB 4HGMA 2ED8A 4OM1L 3T0XA 3EFDH 1XEDA 4YXKL 2C3GA 4WHTB 4BELD 3QQNA 1YQ2A 4NZTL 1JWSA 1DEDA 5D1QA 3V4PH 1AGBA 4TN9A 1XR9A 2ZP0T 1F6AA 2NY3D 4PJDB 5J8OA 2P5EB 1D7FA 1U8HA 3TBTB 1V5JA 4Q6IC 3H7LA 4PJ5B 5IKCB 1RZJC 1NBYA 3LQAH 4ISVB 5E6ID 2BGPA 4WY7H 2N1KA 4YFLF 4C4KT 5A2FA 1AXTL 1S7QA 3MV8D 4EOWL 1KLGB 2ICEB 2RQ8A 2J2ZA 3C5ZD 1QTYT 1J0IA 4X98A 5E99L 2BSRA 3G6JE 3AM8C 2JJSC 2YBRB 1MAML 4P2QB 4HAGA 5ESAA 1FZMB 3SCMB 2NNAA 5JHDE 3MUHL 4PJFE 4BSJA 4Y2DA 3GSXA 4MAUH 1JZ6A 2H3NB 1C16A 3L3KA 4P2YA 3VD4A 5KAQG 3EOTL 5C08B 3T1WA 4H20L 4MS8C 3G5XA 3CZUA 1RJYA 1RK1B 1JGLH 4FTVB 2FR4B 3K4DA 4MLSA 5CINH 3P30H 1ACYL 3KYOA 4U1KB 5K9OB 1MFAH 2D9QB 4JAMB 1DVFC 4TVPE 1N0XL 4U6TA 1FVDA 1G9MC 1U8OB 4A44A 1DFBH 1BLNB 3GSVA 4PV8A 3TBVA 5C0RH 1IMHC 1KTKE 1CLZH 4GG8B 1H3WM 3S3JA 5E1AA 5C8JB 2P5WD 2X41A 5DURB 5GISL 5GS1B 4P2OA 3ULUL 1BJ1J 1HIML 3FCTB 4XPAL 1IRAY 2DDQL 3I84A 1B0RA 1G7JB 4I3SL 2L9LA 5DJ6B 4MOAA 1S8DB 5IVZB 4MLIA 1CF8H 1I7RA 1OM3L 3GSNH 3HS0A 1FFOB 2VLRB 1V3KA 3UTZA 2RBLA 2VL5A 2NY7H 3EKCA 4U1MB 2OTUB 1E28A 4LVNC 2BNQB 3K7UA 4NQEB 4JREB 5C6TH 2HYXA 2WIIB 5C0FB 1DANU 4K2UH 4HZLB 2PTVA 1F3JB 4QCIA 3N85L 2VZOA 4X80L 5D1XB 3VXNA 4Y1AB 3DMMD 5T3ZH 2UZYB 2FNBA 4Q97A 3ZE0F 4K9EL 2W60B 3F7YB 1F2XK 4KGJA 1UY2A 2EC8A 1A7QL 3HE7D 1XNAA 3QO0A 3FQRB 4YC2C 5HI3C 1MHEB 4POUB 1W8OA 4HQQL 5KBNC 4LKCA 2X1XR 2BNRE 3QCVH 3P77A 4QRQA 5CD5D 5DK2A 2X4QB 3VXTB 4C55A 3UAJC 5JW4N 4YDIL 5I1DA 1RIHH 4U1LA 1L7IL 1OD9A 2H32A 5LJYH 3HB3D 4H8WH 3O3DB 4HGWB 4PJAF 5KSUB 1ULPA 5E8OA 3F5WA 5EWIH 5DD3H 3ZM8A 1AQKL 1WICA 4MS8D 1YUHB 4DXTA 3ZKMC 1JU3A 1OGAA 3PP4L 5T1MA 1FSKC 2MMXA 4WI7A 4Q2ZB 3BX7C 1A7PH 1D6EA 1DVFD 2BC4B 4IRSA 1KCRH 4U0QB 1G7PA 5D7JD 2D7TH 1I9IH 2DJ4A 2V5TA 3IDYB 3V5KB 3P0YL 1L7RA 1OAYH 3ROOB 2VDOL 5E4IA 3JXAA 3IDJA 1H5BC 5IV2B 4CU9A 1U2HA 3MRFB 5E9DD 2DQGL 3BDYH 3O8XA 4I1NB 4LARH 1KELH 1QSEA 5C0CB 3AREA 5F7DB 5I8EB 4EKXA 3RNQB 3KS0J 4KI5D 1VA9A 5FB8B 4YHYB 3O6FD 1ZEAH 4MD0A 1Q94B 4TUKH 4FHBD 3VXMB 4EXKA 1F3DJ 3VXUA 3GB7A 4NKDB 3AB0C 1HILA 3O9WA 4XHQA 1IE5A 3BQUC 3WFHA 4KZEH 3T0EB 1MI5B 1NL0H 2G60H 1FAIL 3G5ZB 2UUDH 4Z0XA 2Y4SA 1YN6B 2Y25A 3V9FA 4U1GC 4OCYL 4UINH 3P0GB 5HBBA 4G9FE 1M1SA 3IDAA 3DURA 5C7XL 4R7DA 4YQXH 3UAJD 2LTQB 3TNMA 2LE9A 3X3FL 2MQ3A 4PJ9A 4UV7L 5MEQB 1MPAH 3PGFH 3OR6A 4DVRL 4N8VG 5DHVB 4C83A 3LMJL 1K4CA 4NHCL 3BUYB 4PB0H 4CJ0A 1H3XA 1WIUA 5HGHA 4L1HA 4YDLB 3O2DA 4HEPG 5EU4A 1YYLH 5I8CA 2MKLC 4P9HL 1P4IH 2IPUG 3MRKB 1U36A 1DN0A 5ICXB 3X17A 2Z4QB 1HQRA 2IAND 1L7QA 4W4OA 3VDBA 2A1WL 4M7LL 3Q2CA 1JN6A 3SKNB 2F53D 4CMHB 4EI5B 3I6LD 3NFSL 2VR4A 4D9LL 4UDUA 3U4BL 3RGVA 3NPZB 2VDLH 1IAIM 3QAZC 1Z9MA 3EHBD 3VXSB 2OSLB 1KG0B 3Q5YA 5HGDB 5JXEA 4ODUA 3OKKB 2K7QA 4LBEB 5D5MA 1YC8A 3ZDYF 1U92B 5IROA 3ROLA 1QBBA 1CD8A 4ZTPL 1CVRA 1V3MA 3LKOA 2RB8A 3B5HA 1TNNA 4PREA 1UZ0A 2O5ZL 1IKNC 2E8YA 4UNVA 4NO0D 3QIWC 4WU7B 3NTCH 1KTDB 2CLZB 4MCYA 4FI9A 3GMOA 5GJSL 3C7GA 5GRXG 2OLDA 4ESKA 5CEYA 4YXHH 1ND0A 4X6CF 2EC9T 3HRZA 4OZHE 4MGXA 4Z95L 2Y9RT 3QI9D 4XPBL 4PJHA 4LASH 5TDNB 1F90L 5ITFA 2SEBB 2WWMD 5IWLC 5IJVB 4PJDA 2IADB 4HUXA 1E6OH 2P5EA 1FH5H 3TBTA 2YC2A 2GJZA 4KK5D 4NQDE 3EYVA 2XA8H 1FIGH 1P5UA 3DVFA 4DCQA 1AO7D 3FO9B 4RGMC 3DUHA 4YDKL 3MV9E 5J11C 4CBPA 4XP6H 3SKMA 1MY5A 4OB5H 3HE6C 3QNZA 4OFYD 1OP5H 2FB4H 1FGVL 5T5NF 5J06A 2YWZA 1L0YA 4M93C 1T89A 3LEXB 4K94C 2C1PB 3VMNA 3EUUA 2CIIB 1UB5A 5JOFA 1P2CA 1FZMA 2VZSA 3KPPA 1E27B 5IVXE 5MENE 3DVNA 4AQOA 4LRIA 4JO1H 2XZCH 1AGDA 4LGPB 2EZ0D 1QNZH 2VITB 2VKWA 5ID0A 4NNYA 5DZOA 2P24A 4TTDD 3OXRB 1AD9A 2BERA 1K9TA 5A2JH 2QQLH 2OS7A 5FV1L 1UZ6E 3MX0A 2BVPA 5B39B 3FRUA 4JAMA 5C0JA 2C1OB 1QRKA 2CUHA 4TULL 1KXTB 2P46B 1OSZA 3BDXA 3E6HB 1XF2B 2PN5A 2BY1A 4RZCA 1KB5L 5BV7H 3NCBB 3B8SA 4MX7A 2YN3A 2VSCA 2P1YA 1LE9A 1JI2A 1MF2L 3OZ9L 4PJDF 3BE1L 3ARFD 5GS1A 1C8PA 4LLVA 3LRSB 2CO6B 2GUOA 4GRLC 1OY3B 1FLRL 4Z7WE 4IRZH 1UY3A 4OCLC 3SGJC 5E6YA 4PBWD 2CDGB 3G6AB 1HI6A 4DKEL 2H26B 5HGBB 2QLVB 2ADJA 2D7MA 3V6ZA 2J4WH 2BNQA 3R06B 2A6JA 5HYJA 3BEWA 2PO6D 1NGPL 1TJGH 5F70A 5IB1A 4PTTA 1OAXH 5C0FA 2NLJA 2BK8A 1AHWC 4NCC1 2A73B 1MRCH 4E42A 3AUVA 2HLAA 1NFIA 2HRPL 1VEMA 4NZUH 4OLYH 3LKNA 1A7RH 1S5IH 1X4XA 1ADQL 1D6VL 3L7EB 2Q6WB 2VDQH 3B3IB 1KEML 5GGVH 1DL7L 4LLYA 3HZKB 1V7NL 1HHHB 2VLKD 3EJZD 3K2UH 3PGDA 1R3KA 1FN4A 1GPOH 3TEUA 2DM7A 4PJ8D 3CX5J 1U8KA 4P2RA 5F6IB 3RVXC 2OXHA 3N1GC 3PE9A 4OBRA 1ZGLA 3RAJL 3S8WA 1J84A 3HUJB 3LSOA 3CZFB 4TVSa 1FFQA 5DK0A 4U31A 2VB5A 1B2WH 1JUFA 3MZTA 5A16B 1U41A 2BRRH 4PF1A 3VE0A 1MCBA 4Z77B 4MMXC 4Z7UB 4FXGA 2IG2H 5KS9A 3G9AB 1B9ZA 5DA0B 3EO0B 4WTZG 3F7VA 1NMBH 4OIIL 5C0EA 2EDRA 1BAFL 3PHOB 1BJMA 1QFWI 3L5WA 3O2WH 3DVIA 1RJLA 1MVUB 4OFDA 2XONA 1YY9C 3KXFB 4JCLA 1FE8H 3F58L 4J4PD 4OI8A 1X5ZA 2B2XL 4PLNC 4J3XA 5A43C 5IEKB 5JA8B 2YPVH 3OF6A 3AMKA 4GAFB 1T66C 3C5JA 1T04B 1YQVL 1JHKL 2WBJB 1T83A 4IOFC 4RQQA 4OGXH 5JXAL 5I30L 4NJ9L 1EBAA 2OL3A 4X99B 1XGPB 5HYIA 4RAVA 3CMOL 4G42A 4D0DA 1JGLL 3RBGA 3ARQA 3WFCH 5FB8A 3QYCA 5DRXA 4JRWA 4OGYH 4CW1A 1UG9A 4P5MA 2BNUA 4FNLH 3VXMA 4NOBA 5J3HD 3GGLA 5GGRA 3RNKA 1DFBL 1GZQB 5CZKA 5IW1B 1PZ5B 1PLGH 5D9SA 3VXRA 3O4LA 2YA0A 4JFYA 1CLZL 4X8XA 3MUY1 3GM0A 2CD0A 3BKCL 5T3XD 3TVMD 3U7WL 1MH5B 3MRHB 4P5KB 4TUJB 3MLRH 4P3DA 3I6GB 4TRPH 1XCQA 1T0NB 2XKNB 1TFHA 1K5NB 4OM0L 4N9GB 5EO0A 4FQXC 4BQBA 3MGTA 4M6ML 4XMLL 3JV4A 1G7HB 3W0WD 4XVHA 4M7LT 4TPRL 4PBVC 4ZUTB 1F45A 4KDWA 1F4WH 1G6RL 1KN4H 4LNRB 1NFDB 2BSSB 5HHQB 4YHMH 4G5ZH 1EFQA 1DLFH 2F9BT 1EHNA 5F21B 4AIZB 3BKJH 1WLHA 4WW1A 5C0BE 1CGSL 1A6WH 4TTGA 1QRNB 4MNQE 4PG9B 1HOCA 3VWKC 3ZT7A 1EHXA 4FFWD 4U3HA 5ISZB 3D3AA 1ZLUH 3SGKA 4BQ8A 3OKMB 1SY6H 3PWNB 1MUJA 1C7TA 3TN0C 2FIKA 4Y4HC 1UXWB 3VWJB 3Q6GH 1SJHB 5D7IE 4O2FB 4R3SA 3TA3A 3TWCL 4O5LL 1I1FB 5HDQL 1TQCC 1UB6B 3KJ4B 2NY5H 5DJ0A 4HXBH 5EU6A 1EK3A 3MBXH 3GBNH 1DQMH 2J5LB 4IHOB 5E70A 4QRPA 1BD2B 1PDKA 5CJ5A 3TO2B 4MJIE 4NQUA 3UTTB 1CGVA 4GBXD 1WZMA 3C2AH 3KPSB 5JHDD 2GCYA 5EUKB 4E41B 2AV1B 1OAUH 1IM3A 3QNYB 1QSFE 3NCYP 1IGFH 2R2CA 3VFVB 1WWAX 5E5UB 5BQ7A 2X09A 2W95A 1T2QL 1XGYH 5D93B 1OTSC 3OGVA 3O6LH 4ZD3L 3OHXB 1OAYL 1MCOH 4IIQA 3HI1A 1IKFL 1OGTA 3O41B 4HUVB 5KSAA 1BBDL 1T2JA 1JV5A 5I19H 1GGYA 4LARL 4TVPD 5AZEH 3KLAA 3D85D 4K7PH 2V2WB 4Y19B 5GRUH 1XF5A 4JY4A 4GSDH 2OYPA 3KPRA 3DO7B 1I8LC 1R3LA 5IK3A 4HBCL 2UUDK 5HVGB 5DQJB 4ZOAA 4JPIB 4U3CA 4Z7QF 1H3UA 4IOIB 4DJMA 5IJVA 2P49B 3DGCR 5FGCB 4HK0A 4AMKH 1D5MB 2MCPH 3VFWA 5DMYA 2X40A 5KTEL 5AWNH 5ETUB 5IBLC 1RJCA 2AJYH 3MCKB 3OTTA 4MZ2A 2V7NA 3GJFB 1T1YA 1PKOA 5L2KA 1CZSA 1VERA 3BP4B 1NAMB 2QQKH 1JP5A 4YQXL 2EYSA 4TSBL 1JYXA 3TN0D 2IC2A 4X4MA 4NKIL 2XZAH 2R15A 5DVLA 5DRZA 5E8PB 4PFEA 5CP7B 1ZXQA 5D96C 3SOBL 2BVQA 4PQQA 1CDUA 5FAAA 5T1KD 2DMKA 1X6NA 2D9CA 2Y7QB 3H9HB 3NQHA 5C71A 3GRWA 4WTWA 3QDMB 5HGGS 4MA7L 1BZ9A 1U93B 1B6UA 3PWVB 5KW9L 4QXTA 2BNRD 1TQBB 3PGCA 1FORL 1UWGH 4OQTL 4NNXA 5DMJB 1DQDH 4KAQL 1RY7B 4MQXD 4ZAKB 5JMOC 4Q6IB 5GGQL 2AXGB 3Q0HA 4OGAD 1ZGLM 5FM4A 5BJTA 2A9MH 3OKLA 4NPYA 4Y16D 4HCRH 5IT2H 2EO9A 3BXNB 3EDJA 1G9NL 2C1OA 2ITDB 1G7MB 3UJIH 4JN2A 4JX0A 3F65A 3I2CL 1XF2A 1RD6A 2H2SC 5L88H 4Y4FD 5JOPE 1I8MB 3MV7E 1RZKL 3RDTC 3B6SB 4R2GD 4FQHA 1QBAA 4NBXB 1T0PB 3WS3B 3NA9H 1PG7H 1OAQH 2B8OT 3BIAX 4M62H 3FKUS 2HTLD 5HHNB 4HEME 4A2LA 1I3GH 5E94B 4QTHB 3C6SB 4JDZA 3MLWL 3MACL 1FO0H 2H26A 2UV3A 3WHXA 3QEHB 4NFBA 4RGOH 5LGJA 5FYJL 5C0AE 3R06A 1VFBB 3I75A 4WUKH 4YHIB 1I3UA 4KMTL 1JPTL 1NGWB 3OGOE 4KROD 5JPNA 1UH2A 5F1IB 3QDJA 2JIXA 2ICWB 5EO9B 3RWEB 1J10A 3JTSB 4TNVF 5DLMH 4M3KB 4X9BA 5CJQL 5DGQA 3QEQA 3N1PC 1AGCA 4DEPC 2R2EA 3WN5A 5CWSB 3BZEB 4LIQH 1UADC 3L5XL 5GZOC 5I1EH 4OD3L 5SV3A 4PRPA 5E24E 1XF4B 5B4XA 5ICZB 4G9FD 4YWGH 2C9KA 4G6FD 4XCYA 2A6DB 4LSTH 4WUUE 1PMHX 1QUNA 4R8WL 4M00A 4LVNB 2UYLB 2GT9A 5JZ7C 3CZFA 4XVUD 1E4KC 5FEBA 2DLFL 1OP5K 5I1IL 3BYYA 1FPTL 4TQEL 1IQWH 4ZOBA 5DJXA 3ZYJA 5DPNA 1OF4A 4Y4KA 4XP6L 5DC0A 4GG6B 3K2MC 5DVOA 2EKJA 2PNDA 1YMHB 2VDRL 1N8ZA 3S4SG 4JG0H 1QLFA 2FO1A 4PJXB 1I8IB 1U58A 5K9KB 1A9BB 4YC2B 4NKMA 1GAFH 2OMNA 3DRTB 4B50A 2R29L 1Z9SA 3LKRB 5KSVB 4JKPL 4MXWH 2FBJH 4G8GE 4KHTL 5GSRA 2XTLA 4OLZH 3IS1X 3MOBL 3W82A 1HH6A 4PG2A 2APTA 4A6YL 1AJ7L 2L7JA 1MJ7H 2J6EH 5IVOA 4ENED 2CGRL 5F93C 5D8JL 5C0ND 3O2VH 3WSQL 2HKFL 3UBXA 2F5AL 4JM2C 1DEEB 1LDPH 3PHQB 3G6DH 1FSKB 4JFDA 32C2B 1AKJB 3STZA 4TSAL 4LSRL 5FO7B 3MLYL 1FIEA 4P5TA 3MLZL 2FX7H 1KPUB 5C0IB 4BZ2H 4PGCB 4ZG1A 4NO2A 1R3JB 1HZHH 1MH5A 1SEBA 2V9RA 4L3CB 3MRJB 5CILL 1KIQA 4OD1H 3FRPG 4OZIE 3HUJF 3IDGB 4ODSL 1H5BB 5FHAL 3DETD 4GW1A 3RWIB 2FD6H 4CN4A 4X5XA 2VDPH 4XTRD 4Z7UF 4K8RL 1W72H 2XTJB 3JWOC 2W07A 2KZ1B 1ZHNB 2L0DA 5B3NA 3RWGB 4HFUL 5EC2B 3SE3A 4PRIA 3ZYOA 3AB0B 2HA1A 4F2MB 4JB9H 3BQUB 1KIRB 5LXGH 3GSQB 1G6VK 1XGRB 1ZWIB 4NZUL 4ZXBA 2VYRE 1QBLL 3MREA 3I2JA 3MO4A 2YMXH 3GMPB 1I1AD 4U1GB 4XPFH 1SMAA 1MCPL 5C07E 1DQLL 2VDQL 4Q0XH 3TT1H 2QKIA 4AZ8A 4PJEA 2AJVL 3BT2H 4U6VL 3GMQB 5CGMA 4NQDD 5F9WC 3V8CA 4QOKE 2CK2A 4HPYL 5AG9A 5CD3B 3V5DB 3EO9L 1NUDA 3MV9D 5FA3B 1NGZA 4OKVA 5D70H 1KCLA 1YPZA 5E7BA 1A9EB 2H8PB 5BW7A 4FFYL 4ZSOB 1PKQB 4IHOA 7FABH 5K9JH 3T0WA 3N1QC 5I8KL 3T3PE 4Y8DC 3PWPE 4XRCB 4JM2D 4K23L 3EDDA 5MEND 3KPSA 3MFGB 3VFNA 1T1XB 4R4ND 1OWWA 1SHWB 3LEYH 2DI7A 2JTDA 1KYOK 5T5FL 5CJXC 2VN7A 5F7MC 1AGFA 3SDXB 3LPGA 4LU5H 3FOMB 3H42H 4L9LC 1QBML 2QR0A 4NQSA 3KPOA 5FCUL 4L5FH 3WJLC 3MV8A 1EMTH 3CVHL 4NQCE 5SWZB 4YHPB 2HTKD 2HT4D 1NFDF 1FZKB 3LS5L 1UA6L 3P11L 2JCCA 4TXWA 1J8HB 1FRGH 1WUNT 4JQIL 4JRXE 3QAZB 1UY4A 4BYHA 4G8EA 2CXGA 4RRPG 3WFCL 1TZIB 3TIDA 4QHLB 2VUYA 4CVXB 3QO1B 3WQBA 3IAPA 4WFHE 2X44D 4KRPD 4IOIA 4JO3L 3HR5A 4GAYB 5DI8A 3UYRH 1S7TA 5AYUL 4LSVH 1TVBB 3NABL 2R7EB 4NUJB 2I25N 4QYOA 5IBTL 1WBYA 3SPVB 2R4RL 2J1EA 3RTQB 1P7KB 2HFEA 2A6KA 3C5SB 5E4EB 2P5WA 3HPLA 4C4KO 5A2KH 5DHXB 5J1AA 3NN8B 1YEHL 2A74B 3VGAC 1KN2H 2DM2A 2J3SA 4LCUA 5DQDL 4PTUA 3TH4T 3L6FB 4EDXB 1ZLUK 2DBLL 1I1CA 4PV9A 2XWBB 3REVA 4G3YL 2WQRA 1RVFH 1YMMB 3BSZH 4K3EL 5JIHA 1ORQA 3B2VH 1QPXA 2QHLA 5CJOL 4D0BA 1KEXA 2BHYA 1RZ8B 1I4FA 4KK8D 1ORSB 4HIIA 5J11B 3CDYA 3B4NA 1KGCE 1A1NB 2X4TB 4XWOD 3HE6B 25C8L 5A1AA 2OTWB 1UJ3C 3TCLB 4S1DC 3CPLA 4KQ4L 3HE7A 2ORXA 3OX8B 4M93B 4NZRL 3ZTNL 2NY0D 2ZUTA 4X6EB 4BDVB 1CU4H 4MNGB 3RHWF 1SBBA 1B4JL 4R6UA 4TSCH 4JVUA 1A6TA 1RK0A 3U9PH 4H0IA 2EDJA 2ZKHH 1B6DA 4E5XB 3EOAA 4S1QH 3H9SB 4BK5A 5LBSL 4QXGH 2EYRA 1DUYB 2J8UE 4QLRA 4R0LC 2GK2A 3CUPB 3T8XA 2X7LA 1N2RA 4X0KB 3RUGA 5L0QC 2VISA 5EDXA 1XGYL 3LQZB 2P8PB 1TVHA 4CVWA 1DVFA 2XG5A 4JO4H 3EJJX 5DJ8A 4WWKD 5D7JA 5JXIA 2E5EA 2R1XB 2R1WA 4K7PL 2R0KH 3VFRA 1J0YA 3AC0A 3QUZB 2PW2A 3AFLA 4QXWA 4RAUB 3O2DL 2IAMD 2NW2B 3OBAA 2Z4FA 1D5IL 3C7FA 4GRLB 3MUZ1 4W70A 3BP5B 5E9DA 4KVNH 3S37X 4LHJB 3FT2B 3LPFA 2A6DA 5C09E 4L4VB 3BP6B 1MCCA 2VAJA 5I66B 1HXMB 2AJYL 3H0TB 2OI9C 5D6DC 3SN6N 4WI8A 5I15L 5KVFL 3LEVH 1DBKH 2E6QA 2UVFA 4RGNC 1AHWB 2J8OA 2XPGB 3C9NB 4ZUUA 4ZTOL 4RN5A 2FZ3B 3STLB 1UM4H 4LPUA 3HG1E 3VFGH 1ZANH 5FGSA 5DA4A 5C0BD 3WIIL 1ACZA 1BWWA 4UNTA 4MNQD 3DUSA 5CLWA 4XPTL 1GC1C 4GXVH 4U6XB 3U79A 5B22A 1L6XA 2AXFB 1GVIA 1IGJB 4JFZL 5K33A 1A47A 3GKZA 1VCAA 4HXAH 5DDHA 4XT1C 4G8FA 5FYKL 3WUZA 1EHAA 1J1PH 4J6RH 5TGBA 1IBGH 2EDLA 5D2NA 3QIBD 4JRYE 1BP3B 4PJBB 3N9GH 3FQWA 4AENB 3U2SB 4K7FB 3D9AH 3PIQA 3PWLB 4NN5C 2V2XA 4XHJC 2R2BB 4X4YA 4DN3H 1KFAH 4HSQA 5L8JB 3WBDA 5HHVH 2NW3A 3BPNC 1MFCH 2R9HD 5FA4B 4QXUL 1AKJA 2NXZD 1ZE3C 4MJID 4PGBB 1Q9WA 5BMFL 4YBLC 3INUH 3ARYA 1KPUA 1JVKA 4IDJL 2C7UA 4H1LB 2F53A 4L3CA 3EYFB 4TNWF 1QSFD 3SDCD 4HWEH 1NMAH 3H7BB 1V8HA 2H6PA 1UACH 5DEGA 1JZ5A 1H5BA 4XP9L 4OZGB 5GGUB 1GZPB 3AS0A 5CEXA 4GG6F 3IAGC 3TH2T 3TO4D 1IAMA 3IVKB 3RWGA 4G80A 4C59B 2CMRL 3W39B 1IM9B 4OCWH 4PJXF 1QKZL 5JUEH 1PFCA 2WANA 1RIVH 3GSQA 4PJCB 2YUVA 4PY8I 3UPRB 5EU3B 2QSQA 3EBAA 1W0VA 2ESVE 1SVZA 3EYOA 1KGYA 1DZBA 4GS7C 2CK0H 4ELMB 2ZUVA 2M26A 4NO0A 3TNNB 3FB6B 4D2NA 2YPLB 3PWUB 4GFTB 4LSSH 4FQXB 3V4VH 2FJHB 1BBJA 3T4YA 1S7UA 3QA3A 3R1GL 3C60C 3V5DA 2W3JA 1TCRB 4FQLH 3ACGA 2XQBH 4DFIA 2VDNH 3AMLA 1LE5A 3IXAA 5KJRH 1I75A 4NWUL 5B8CA 5BZDA 3T0DA 2APBA 1M05B 5E56A 1N59B 1P9MC 5T1DH 3QDGB 3MBEC 2B4CH 2IPTH 4MA3B 3DX8B 5JQHC 1B0GB 4BZ1L 1JZ7A 1HSAB 1DBBH 1A6VH 1EAPA 2XI9A 3DX9A 4GW5A 3RIAF 1T1XA 3VWKB 2GIYA 4AH2A 3GMMA 3PJSA 3U36B 1AO7A 4YJZL 1CK0H 5DZNA 2P8LA 4G7VH 2DQJL 3BFOA 3I3DA 2DLIA 4BUHA 4Y89A 5LQBL 3MROB 4Y4HB 3O45B 1LO3L 4OFYA 4LSPH 5GS2D 1KENL 4HWZA 1CE1H 2DD8H 5IFJB 4CVUA 5DD0H 4U33A 1O7VA 2E27L 3ZE0E 3C8KB 4OJFL 2J6EL 3QRFM 5BVPL 2EDEA 1A5FH 4U05A 2OZ4A 4P00B 1H8SA 5JOPD 3HAEA 3MV7D 3L1OH 3FHQA 4YHZH 3SO3C 2F74A 4UUJA 4MHHG 4F7TA 3WO4B 3BRGC 1ZT7A 2VDKH 4LEOB 1AXSA 1U42A 4C54A 4JEGB 2BY2A 4MSWA 2DQTH 4P23C 4PJAE 4DZ8B 1MQKL 2X6MA 1K8DB 2DQIH 1JPGA 5TPWH 2VMCA 4ODWB 5I2IB 2EH7H 3L9RA 4KJYB 2GW5A 5F3HB 2KKQA 2WBKA 3SQOH 4GAJL 5H8DA 2WO2A 1WAAF 1MCDA 3AS3A 3W9EB 2XFXA 5C0AD 3QIWA 2X05A 1MRDH 1J12A 1FVEA 1SEQH 3TT3L 1EO5A 4I0PC 1IC4L 1US3A 2D4FA 3ARFA 4GMTH 4KKLC 1T1WA 5EC1A 1P1ZB 2RIKA 2VXSL 4L8DB 3UXFA 3RZCB 1KCVL 4WO4C 3BD4A 3GSRB 3LQAC 4OUUB 1OP3H 4Z7OF 3U0WH 3FB7A 4DGVL 1Z9OA 4Y88A 2ICCA 2XT1B 3SDXF 4JR9L 1RSFA 2ZG2A 2DICA 3UPAA 1A0QH 5FUIA 1X5JA 3WF1A 2DKMA 2PUQT 2PO6A 4Z78A 4KI5M 2CKBB 1ZLWH 2ATKA 1WF5A 4WUUD 3GK8L 4M43H 1S3KH 1OAZL 3MYZA 3NCJL 4I48A 4XNMB 4XUOA 2E7MA 2FX9L 2YN5A 3C2SA 2OL3L 1A1NA 3L7FA 5F9AC 2AJXH 5F7EL 2WK2A 2VJXA 4KZDH 1JHLL 5D96B 5IOPA 5IGXL 1JNLH 5FYLH 3D0VB 1Q9KA 3CFBA 1SDDB 1W2KT 2PF6A 2BOBB 4FQQA 4RDQF 3MRQA 5EU5B 4PJ8A 3KHQA 4FFZH 1TJIH 4UT6H 5ADOL 1PEWA 1EVTC 6CGTA 4KJPD 1RULL 3GJFH 1DUYA 4G8GD 2MWCA 4MAYB 1C1EH 3UTQA 4AT6A 5IG7A 3I3EA 1CFSA 4P4KB 3LPWA 5ICYB 4ZPVB 1HHIA 3G08A 4X9HA 4NRYB 4U1IA 6FABH 2DN7A 1UWXH 4KDVA 3HC0B 1XPWA 3RVUC 2VQ1A 3OJ2C 5EZOH 2LVEA 3NFPB 4KUZH 3RDTB 4J4PA 1S9KC 1P4BH 1X3DA 3PV7A 1U3YA 3CNKA 1H9VA 2HG5A 2QJDA 3IKKA 3V0WL 4RYDA 3S35L 4R26L 3FOLB 5HHOB 4WIQA 1AR2A 3KG5A 1QSEE 4LSUH 1X9QA 3H9ZA 4GRLA 2CUMA 3JUZA 5HHME 5DT1L 2P43B 3LN9A 3MA7A 4HMCA 4DUVA 1E4XH 3FT2A 3C8XA 4XPHH 1RZJH 1PX3A 2Z35B 3V95A 4X4XA 1HXMA 2ZPKH 1NDMB 1TJHL 1N3NA 1X4YA 4JQVA 1INQA 4J3UA 5E08L 3ZDYE 4LOUD 2DB8A 5HD8C 1BX2A 5JPMA 3CXHK 3C9NA 3BZFA 1R5VB 3LKPB 1ZS8B 4XXCC 4BFIB 1I7TB 1HYSD 4JFQA 5J89A 3EFFA 4GXUM 1TVDA 1KN2L 1T5XB 1TTUA 4YEFA 2ARJB 4G9DB 1LK2A 1TTFA 2QV2A 3LRHA 3ULSA 2B1AL 2MNUA 4LF3A 4JN1L 5C07D 1FV1B 1T3FB 3VG0L 3W0WA 1H6XA 3RZWA 2CLRB 4LCWE 1A14H 1M7DB 1NCNA 4OF6A 4EI6B 1FZOA 3PXJA 1NBZB 3A21A 3HCVB 4QOKD 2BX5A 4XBGB 5F1KC 1I7UB 4X6CE 2O5XH 4AK1A 4S2SA 3QJHB 1BVLA 5DO2D 4KQ3L 4HPOL 3SY0A 5JW4M 3IU4L 2NX5B 3LZFH 1FLTX 1XF3B 1IT9H 4FQPA 1WCQA 1NBVH 4U7SA 3O3BB 4HF5L 3PWPD 4O2CB 1ZHLB 4NFDA 5TE6H 4MCZA 2AABL 1RJZA 1IAIH 1GMMA 1OL0A 5T33H 4N1EA 3H7BA 1T7YA 3T09A 1K3IA 3B2UC 2YEZA 3KYNA 1IC7L 2YRZA 3CIHA 4XBEH 3RA7H 2VLJB 2VXUH 4NQCD 1FFNA 4FG6D 3D39A 4S1RL 5JW3H 3K75B 4UBDC 1MAJA 4NDMB 3G6JA 4NQVA 1T03L 4GBXA 4JRXD 4ORGB 1IM9A 3AGVA 3ARBD 5JHDA 1JNJA 3BMWA 3QEUB 4PJFA 5DMGC 3TJHD 3D0LA 1OB1B 1HHKB 3MGOA 5FYKE 3U83A 4JHAH 2D0FA 1K2DA 3V6OE 3GRWL 4U2YA 5CMAB 3VI4F 1NC2D 4WFHD 4POZD 1NCWH 3FMGH 1JK8A 1B88A 5E8DL 4F57H 1XGUA 1PVHA 4GOSA 4APQC 3V7AE 4FN0A 5CSBA 2NZ9C 1YEGH 4LMQE 4PJBF 3M1BA 1CQKA 5GRJL 5IMMA 3PUIA 3BWAA 1O7SA 2VLLB 4UDTB 2I5YL 1ONQB 2BVOA 1IEAA 3O11B 1GGCL 4N0CD 2VMFA 3O6KL 4OLUH 3RL1A 4F58L 5F88B 3VG9C 5IMKB 5KSBB 4Y5YA 2VXVH 4PJDE 2Y5TA 3MRLA 2P5EE 5A3IC 3NNGA 1D5XB 1JGUL 4IRJD 2AKRA 2YC1A 3AY4C 4QY8B 3S36H 4JZOA 1DCLA 4CMMB 4PJ5E 1Y18A 1X5HA 3LE0A 1K4DB 3BKYH 5T5NG 3WXVL 1M7XA 4DOHE 1YEFH 1D7PM 2GJ6B 1A6ZA 3VWKA 5KVGH 3KVQA 3VFGL 4F7PA 1JHJA 1PG7W 4YNYB 1IEBB 3FHAA 4OZGF 3MROA 4WI3A 2DBJA 4AEHL 2BGOA 1I1YB 2BJML 3TN0A 3O45A 4G43A 1HXYB 2NY2D 4FXLA 5F9WB 2R0ZL 4P2QE 1GCFA 1WBXA 4LCYA 2QQNL 4KKCD 2F8VA 1KGCD 3MV11 5T1KA 3GZKA 3LHPL 1EZVY 4ZFFA 4CDHA 3F62A 4OCSL 4LIQE 4PJCF 3V7AG 4ZUVB 2VZVA 1EAJA 1U6AL 4PRHB 1MHPL 1WSST 1NGXA 3KLHC 3UJJH 4FTVE 4ELMF 3SHSA 4EIZC 5JLZA 4O9HL 4RIRB 4Y16A 4AL8H 4HJGA 4KKBC 4MNHB 3QJFA 1YJDL 4G6ML 5IB5B 5CP3H 4TOYH 2D03L 4L9LB 1H6YA 3SKJH 3VFUB 2CDPA 4XP5H 3SE9L 1HDMA 2FHFA 4Y4FA 1KB9K 1FL6B 4LHQB 1FL3B 5I1LB 3KHOA 4ZQKB 3MJ9A 3F2ZA 4AEIH 3G5YB 1SM3L 1U8NB 5GGSY 1RIUH 4OMCA 1I8LA 2VLRE 5DJZB 4HUWB 1YEKH 3A67L 2QL1A 2X4OA 3PDOB 5HVWA 3F8UB 2DL2A 3TFKC 2MKWA 2ICWI 4N8VA 2BNQE 3RWCA 4NQEE 3I6KB 4HUKB 1MCRA 3BH9B 3IETA 3RY6C 1V7ML 5ANMB 1S7RB 1L7TH 3EYQD 2CKBA 3MLUL 1KIPA 1IC1A 4MJ2A 1NGYA 4Y1AE 2CK0L 5C09D 2GTZA 3WIFB 4XCEA 3SEPA 1SYVA 1PEZA 5H37H 3HRPA 3ECBB 3O0RL 1IAII 4LPWA 4F3FB 4M7KL 3KPMA 2BDNH 4WV1A 4AEEA 3VGAB 5E6IB 3QHFH 3CFDB 1MWAA 1Q0XH 4Y7MA 3QUXD 3HG1D 5IJKC 1XH3B 2BOBA 4G9FA 5M7QA 1FJ1A 1A3RL 2B4CL 3C5ZB 1FZJA 5D1ZD 5D71H 5LAXB 2DQEH 1BOGA 3S97C 1WEJH 2H9GB 1DUZB 1L6ZA 4UTAL 1CXEA 3SKOB 4D8PB 3TPKA 4CGTA 2IALB 2LW8A 3CJJA 1T6VN 5BV7C 1X5LA 5KS9E 2AJZB 3NIDF 4WDIA 2JDAA 1CK0L 5L7XH 3HKFA 1M6OA 1IZKA 4DW2H 5ICYA 4NP4L 3IDUA 1D5BB 3WEXB 4JRYD 4OF0A 3DXAB 4FQJH 4X7EC 5EZIH 1UJ3B 3EDEA 3DV4A 4YPGB 1WIPA 5EOCH 1EGJH 1KJMA 1KJ2B 1MJJA 3BD3A 1J5OH 5ADPL 4HUUB 3MRNA 1U3HC 3CKHA 4LHSA 2AQ1A 1RU9H 5C0CE 3M8OL 2FEEI 2IF7A 3KPQB 1JNNL 5I74C 5DD6B 2HLEA 4JFEB 4PRDB 1XZ0B 4R0LB 3VXME 4ZFGH 3MRDB 4FQ2H 2AJSH 2HJLA 1CX1A 3JSSA 3MXWH 5L0QB 3QPXL 4P46C 1KPRA 3IJSB 3RBSA 3T0EE 4PRBB 1MI5E 4UZGA 1GGTA 1U8JA 4P3CL 3NMEA 3S6CA 4K94H 2VR5A 3LKPA 1R5VA 1XGTA 4PD4K 4DAGL 1YY8B 1JHTB 1SBSL 1I7TA 1OP3K 4HS3A 4BFIA 3SDYL 4LKXB 3TBSB 1JMZA 1I8KB 3DSFH 2P8MB 1VGEL 3MODH 2VZQA 2ARJA 3OKEA 1KJ3H 5IP4A 1JGVL 2F19L 3DMMB 3V6FA 1FL5B 5CCKL 2XWTA 4NM4L 1ROWA 1ZMYA 2ESVD 5I1JH 1DBML 1ZLWK 2EKSA 3U0WL 4I3GA 2P48B 3SDDD 2X70A 3GI9H 5TFSH 1FV1A 5FKPB 2EXYC 1YEDA 1BQHB 4HIXL 2GTWB 3QUMB 5IHUL 2R8SH 1DQJA 1RFDH 1NBZA 2E9JA 3HCVA 2OI9B 3JTTB 1RURL 2NY1C 2ORZA 1U91B 2Y06H 4OAWB 3ET9F 3RX8A 5D1QD 3OB8A 4RGNB 4W68A 4Z5RB 4OZHA 2BSED 4HWBA 2CDEA 4Z7QE 3FQTB 4KPHL 3RHWK 4NM8H 1I1AA 5MEOA 4X7DC 1FCGA 4F80A 5TDOA 2DWEB 5C1MB 3Q1SL 3QEGH 1RUPL 1IZJA 2XNAB 2ZSVA 5FYLL 3HPNA 2IFFH 1O8PA 2NTFB 3GJFK 1AR1C 1FHGA 4HBQA 4QHUA 4PB9H 4XAKE 1LO0H 2FGWL 3SDAD 4PJ7B 2ADFH 3QHZL 1BFOB 3MV9A 1BIIB 3I9GL 3VXSE 4RA0C 9CGTA 4LLMB 3BMVA 3TH3T 1TNMA 1UWXK 2E33A 1NAML 2GSGB 3KYAA 1N5YH 5E00B 1FYTB 1JWMA 1J0KA 3B9EA 4JM4H 4NN5B 3MRIB 4JM2A 4QRSA 4P4RB 3CVIL 4XC3H 3BPNB 5IVXA 5MENA 5EORL 3T0AA 1C7SA 1YN7B 3CLEH 5MP6H 2ZEXA 1PSKL 1Q1JH 2J8HA 4B0MM 4YBLB 4X6DB 5CIPA 4MD5B 5CMAA 1CYGA 3QNXA 1A02N 4EN3D 3DRQA 1LEIB 4TUOA 4HUNB 1CFNB 2W9EH 4OT1H 3F7QA 4XX1E 3OGCB 3ILPA 3MJGX 1G7LB 5GIRA 3OPZH 5I0DA 1JFQL 1RZJL 4QRTB 3L3IB 3RQ3A 1DSFL 1WC7B 2AJUH 1KNOB 4PJIB 3QXAB 3WLBA 5CGYC 3WUWB 3VFMA 4JDVB 3AAZB 3L5IA 2W1WA 1K6QH 4IS6B 1NCBL 4H1LH 4PP1D 3HFMH 4Z7WA 5CEZH 4PLOB 3WO3B 4WTZA 1BM3L 1HKLH 5HYQB 4HJ0D 1CZTA 3T0VA 1F8TH 4ODXA 4GS7B 3T3MF 1IEBA 1JF1B 1MLCB 2VZTA 1INEL 1BVKA 4HK3N 3GDBA 3BP7A 3D2UB 5GS3A 2QBWA 3RU8L 1HCFX 2JB5H 1H0DB 3ARWA 3MYJB 3EJYD 5GGVY 3STBA 4RFEA 2VMDA 1ETZA 1S78D 3UPCA 3VH8G 1G9ML 5D7SH 4DN4H 3AXLB 5EG6C 2FBOJ 3CXDL 1VPOH 2OK0H 4X9GA 3WXWH 5I18H 3P4MA 4XX1G 3MBEB 5IQ9A 3OJDB 5FO8B 1WWCA 3NAAH 4X5LA 5FF6A 3Q3GB 1OTTC 1A7OL 3QQ4A 5T1LB 5DN2A 3QG7L 3QWQB 1FNSH 1F4YL 4LCIH 4U6YB 4LKSA 4TNWK 4WEBL 5SX4H 1NAKH 3BGAA 4XBPA 3U9UB 1HEZB 5KANI 3QXWA 3GSUA 3ZTJH 1A6AA 1HN1A 3SBWA 1OW0A 4ODHL 4TYUA 5KSBF 1NSNH 4QDRA 4XNYH 4IRSD 1CL7H 4QHKJ 5E95B 5I1HL 1FL6A 5GSVB 2HT3D 3RVTC 1BJ8A 2I26N 3LRGA 4L1DA 2C4XA 1XCTB 3RA7L 3W11D 1CT8B 1KCUL 4NRZA 1PYWB 3DNKA 5LA1A 1OT1A 5DJYB 1A4KB 3WE6A 4EXPX 2Q86A 4LGRB 3SO3B 1VKXA 4BKLB 2E31A 4GKSA 1AP2B 3O8XD 4LL9A 2JKXA 1UVQA 1QSED 4P23B 4PGDB 4IEFB 4XXDA 5JORA 2Z0BA 3C08H 5HHMD 3PF2A 1R6VA 3U1SH 2FCBA 4R96A 4ZZ5A 5L8KB 3WIFA 1RZ7H 3U7YH 3QUYC 3X3GL 4D0CA 3QG6B 5B39G 1D5ZB 2PXYD 4I0PB 2AEPL 3VJ6A 3FAXA 3TYGL 3MRRB 2VTFA 12E8L 2VL4A 3ULUC 3L3DA 4FQCL 1QYGH 3QH3A 4YBQC 4ZUWA 1DTUA 5F9OH 1A7NH 3DPBA 3GI8L 2ADGB 4WO4B 5JXHA 2YUWA 3RIAK 3WFEH 3CSPA 3HUJE 5CZVL 5JNYB 4YR6A 4LVHC 4LP4A 1DUZA 1AGEA 3P9LB 4D8PA 1CZVA 5KVGL 4Z7UE 3WFDL 3TLRA 2HJFB 1NCTA 5F89B 4GQ9H 3WJJC 3RWFB 1GGBH 2I07A 4HWNA 4LCWD 2NY4C 2Z31C 4LAJH 4NQTA 3ZKXC 1D5BA 5EZLB 4QPWA 2IH1A 1FNLA 1SYSB 3PV6A 1X7QA 1U9KA 2CRIA 4K9EC 2J1KA 4YPGA 4OCRL 4L4JA 3S34L 3HNMA 4MNQA 5EA0L 3QQ9D 2DAVA 2AEIT 4YX2H 2B9VA 5F6HI 5IIEB 1YECL 2DQFB 3CFCH 4OSUL 43CAB 3M45A 4QF1B 4F8TA 3W2DL 1F58H 1HH9B 4XMKL 3L3GA 5FFLA 4I18C 1DQQB 1JNHA 3QULA 3KPQA 3L3HB 5D7IA 3QIBA 3ZT6A 3GJEA 1A2YA 1XZ0A 1MNUL 4R0LA 1M71A 4QX2A 3GBMH 4WCYL 3MRDA 3Q5OA 35C8H 1XC6A 2ORBL 4QTIL 4LEXL 3QFDB 5DJAB 2C5DC 2ITCA 4Y8AA 1EFXB 1X5KA 1PAMA 1IGMH 2ZSWA 4MGQA 3CFKA 2OR9H 3GSNB 4MJIA 2FJFB 4PBXA 5INDA 4CDGC 5FECA 3DO3A 5TQ2H 4M7JH 2E7LA 5DSCA 2EYTA 3CH1A 3ARDD 5FYKD 3SDCA 2D3VA 1JGEA 3IDIB 4XZUB 4YAQB 2VH5L 3VXQB 4DKAA 4QWWC 4X8JB 4K7PY 1FVCA 2AXJA 5EJZB 2AEQH 1VSCA 2BFVH 4H88L 5BXFB 4F8QA 1C5DB 3TZVC 5GZNC 1NFDE 3BAEH 3TO4A 1DLHA 2N7BA 3IDXH 4XC1L 1IARB 1XR8A 1RZGB 5HI4C 2BVEA 1EUTA 5D6DA 3S37L 4XWGH 5HPMA 4AEFA 1QRNE 4ONFH 5CS7A 3O81A 5TE4H 4NIKB 2KQMA 5ISZE 2UZIH 5I1AB 2IEPA 1IL1A 2P5ED 3WHE0 3Q6FB 4HC1A 2OZ4L 3U0TA 2HJKA 3NH7L 4KJWC 1VDGA 1CG9B 2IGFL 3U46B 1CL7I 3H3KA 2JELL 4PJ5D 4RISL 4NSKB 1RZIA 1CFVL 3SE4C 4MXQC 5HXMA 4WEUD 2VWEE 4UIKL 1P6AB 2RCSL 4HHAA 4YXLL 1CD1A 3VRIB 4PJ7A 3EIFA 2I9LA 4Q74A 4YGAB 1U3ZA 4IMKC 1BD2E 3PQYB 5E2TL 1CDJA 1S7XB 4P2QD 4JLRB 3UTTE 3SCMD 4JPWH 3VXOB 4HKXA 3KPSE 2PTTA 4E41E 3DX7A 5DXWA 4MWFA 3SGEI 2QHRL 2M1KA 4YDJB 4Q9QH 3PL6C 4BFGA 4NWTH 1WISA 3FFDA 1I9RH 4JJ5A 5EIIB 4FQIL 5DVMA 1CXHA 3THMH 2ZCHH 1AQDB 5D72H 2ED7A 4FRWA 2KQNA 5HHXL 1OT2A 3OXSB 4ZFOB 4FTVD 1Z3GH 3MRPB 1F11B 4LDEB 4J3VA 3WF0A 5EBMB 4MJ6A 4JFPA 3VCLA 3EYUH 1CFNA 3QB7C 4Y19E 4G6KH 2EDYA 1ZT1B 1AE6L 1G7LA 1QQDB 1P7HL 3EGSB 2WUBL 5EU7E 5DURD 2LV4A 2VIRA 5FYLE 2AJSL 3MV7A 3NA4A 1EHLL 3FN3A 3GHEL 1NCCH 4YHNA 2LU3A 5FGCE 1INDH 3WNKA 3CK0L 1QFOA 2EEAA 3V8OA 5FUZH 2VLRD 2RVAA 4M3JA 4PJGB 1T7ZA 5JQ6H 2DMCA 3MUGA 4PJ7F 5L6YH 1IGIH 1LD9A 5HYQA 2BNQD 4MJ4A 43C9B 5HY9B 4NQED 3S4SA 4H26B 2BSTA 5DR5L 1ZHKB 5C0AA 1JGDA 4APQB 3TJEH 5J13C 2DMBA 2F58L 1UZ8B 3D2UA 5D1XD 2A77H 5EH1A 4Y1AD 4B7LA 3GI9L 5ESQB 1HQ4B 1L0QA 3C60A 3IDMA 1VFAA 1H15B 3QDME 5F96H 1ZA6A 5ENWB 3VG9B 2W9DH 2G5RA 2Y6SC 1QO3A 2COQA 5HJ3B 1CDYA 1X6LA 4ONGH 4X6DF 1P9MA 4LLDA 3NZHH 4I2XA 5EZJA 1IAOA 4HIEB 1UCBH 4GRMB 4YO0A 3HMWL 5B4MD 4JPKH 3VFPA 2W92A 3WSOA 2BOCB 1MELA 3L3OA 4ZDHA 1K85A 1TLKA 1NDGA 3O3AA 4WUUA 1J0ZA 4LRNL 2Z91B 1LNUB 4M7ZC 2O5YH 2BY0A 2YK1L 3D87B 1KIUA 3HA0A 4CADB 3P9MA 2VZ3A 3KPLA 4UILL 2ILLA 4XMPL 3VRJB 1IGYB 1WZ1H 1EZVX 3PNWA 2J88H 4M8QB 2DWDB 5H35A 4PJIF 1A6PA 5ELIA 4DVBB 3FRPA 3HLAB 1YEEH 4W6YB 4NO5B 4NUGH 3TBYB 2XRAH 5AZ2L 2Q76B 2C26A 2D7NA 4YGVA 2EIZB 3OF6D 4CMHC 4PT6A 3S96A 4JPVL 1CZ8H 1QR1B 4XC3L 3D85B 5E1HB 2Z8RA 2UVEA 3NJXA 4U1SB 2IQAB 4G8GA 4PRNB 4XCCH 4XNXL 4JZNA 3V2AR 4N0YL 5C0CD 1JRHL 3ETPA 4G7YH 2HKHL 5HGAB 4MYWB 2GHWB 4F9PA 5DEFA 1N64L 4JG1H 4JFOB 3JWDH 3BRFA 5EUOB 1KEGL 5IHZB 4MQ7B 4NCC2 3VXMD 1N5AB 2FECI 3MOAH 1BQLL 2DQCH 2VXQH 5HTSA 5IW6A 3BN9C 5E2VL 3T0ED 1MI5D 5D7KE 1XF1A 4F7CB 1RUMH 3IKCB 4BH8B 1XGQB 4I5BA 4LLQA 1G84A 5DVNA 1KYOJ 4GAGH 4MA8H 2J1VA 1LK3L 1VEPA 1QFUL 2BMKB 3ES6B 4POYA 5ERWB 5KZCB 1M7IA 4OZIA 2WZEA 3P9LA 2CUIA 3S88L 4M1DH 5IVNA 4N5EC 4GG6E 5IMLB 4KWUA 5FGBA 4YUEL 1BFVL 1RZFL 5A2LH 4JANA 5DJ2A 3FO1A 4PJXE 1KOAA 2XYCA 5D2LB 3MRCA 1YEJH 2CDOA 1DN2A 2WINA 4YK4C 4Y5XC 1QFHA 1NJ9B 1ZA3A 3Q48A 1QOKA 3GNML 4U0RC 5GQBA 4IBLT 3RWHB 1RPQA 2EDKA 5J7CC 3X12A 1HSBA 3OKYA 5C07A 1P5VA 1ZVSA 4RRPA 2D4DA 2OP4H 1NCDL 4EI5D 4N8CH 3BPLB 1VENA 1IGCL 3D3VB 5BS0B 1MREH 4I77L 1U8MB 4B41A 4XAKD 1B4RA 4QOKA 5FOJA 5BV7B 3GHBL 3MOQA 3P2TA 4JQXC 5IYYA 1I7ZB 1PQZA 3MO1A 3VXSD 4MB3A 1YNLH 1KJVB 3CFEB 4TVPL 3QWOA 4GO6B 1DBAL 2CDFA 4G8IB 4FZ8H 1F97A 4JGUA 3CC5B 2ZCKH 4ZS7L 4OF3A 3ETBF 3PWPA 4ONOA 4QHNA 1OOAA 5IBUB 4NQXB 4EBQH 2YHGA 4H25A 4X6FB 5J6HA 4K3DL 1H3TA 3QQ3A 1U3HB 5I75C 3LKSA 1UWWA 1P84K 3KYKH 3QUKA 5ACMA 3ALXA 2AS5M 5IB4A 2V9TA 3CDGB 3WCYA 2DYPB 5I74B 4J3SA 4V1DB 1CICC 1R5WB 4LDOB 5LGHL 3O6MH 1UQSB 3MRGA 3WKNA 5D6CB 2AJ3B 5EN2A 3U1SL 4JRXA 4J3OC 4EQ3A 4P46B 3NACH 2EH8H 3ARBA 1MFEH 2NR6C 5TE7H 4B7IA 4XNUL 4LLUA 4LAQL 5KOVC 1FGNL 3OR7A 3F6LA 2EDBA 5DD5H 5ESVB 4O51B 5EFIA 4ZS6C 3WFBH 1KJ2H 3ZO0A 2FJGA 4LSQL 1NC2A 4XXCA 5J12C 4L8BB 4B53A 4AG4H 3DBXB 2VQTA 4MZ3A 3U46A 1RMFH 2WP3T 4P9ML 4KRMB 2FYYB 3WIHH 2YB7A 3MFFB 3K8KA 4MMZC 1WAAE 1MRFL 1Q72L 1LO2L 2VC2H 4U7KA 4DQOL 3REWB 4ZSOE 5JW5B 1PKQE 3L95A 2G5BA 2YD5A 3VGGA 4U1JB 3ARTA 3ZHLA 5L9DL 4QHMB 4IRJA 4RFOL 2EICA 1CLYL 1NC4B 1WCBA 2LFGA 3U0PA 5F6IC 1CR9H 1D9KC 4ETQB 4Z7OE 1OVZA 5EIIA 4YHLH 4OZ4A 3SDXE 2Q20A 4F33B 2X4UA 2F8XC 5JXJA 1N7MH 1PY9A 2H1PH 3MRMB 5E8EB 5SWZE 4OD2B 2AQ2A 5DUPH 5EBMA 5EOTA 3WDHA 4HIJB 5DQ9B 1J8HE 2DQHL 3TBWA 1J1XL 3F12A 4CN6A 5C2BH 3DGGB 3QUMH 4S1SH 2X4NB 5KVDH 4M1CD 3I50H 5HSFA 3QPQD 4HS6B 3K0WA 1ZT1A 2CKBL 3HC4L 3V0VA 1ZT4B 3FTGA 4I3RL 4OLVH 2M2DA 4F15B 3LKQA 2CR3A 5LCVH 4FS0A 5IQ7L 3VW3L 4FXKB 5F97E 3QIUC 4I4WA 2Z93B 1EXUB 1EEUA 3GMNA 3IFLL 4P59H 1YEIL 5I1KH 5F7UA 2NR6D 3D18B 4HK3J 3W5MA 1C5BL 4LPVA 2R2HB 1A3LL 4A45A 4D94A 3GSWA 1MWAL 3OQ3B 2DQUH 2HFGH 2KL6A 3T2NH 2J8UA 3G5VB 3C8DA 4H26A 4YHKH 2BRQA 5DFVC 3PWJB 2H2PD 1UZ8A 4QX0A 2FX8L 3FZUD 4WU5A 3BHBB 1Y6NR 2E8ZA 4BSVA 1CFQA 2JK5A 2D31B 1JU4A 2Q7YA 2AQ3A 3VDAA 4DGYH 2FWOA 2R0LH 3HI5L 2FLBT 3BGFC 1GNYA 3GIZL 4KTEL 1NANH 4HT1L 4NQDB 4M5YL 5H37G 2QQIA 1R5IA 5F9DC 1YMME 2O93L 5EB9A 1F42A 5IESL 3N50A 2QADC 2JB6A 4DZBB 4O02H 3GIVB 1IC5L 2Z9TA 3LN5B 5C09A 4QT5A 3VD3A 4MDJA 1GXEA 4WW2B 4XGZB 4EUPB 4RDQG 1FNEA 3D25B 2VQUA 2DQDH 2C9AA 4U1HA 3S4SB 3QCTH 4A2MA 5IM7B 4FABH 1JPSH 4KK9C 4MNGE 3OKNB 1FC2D 4U6HA 5J57B 3KGRA 4QGYA 3V5HB 4J2XA 4P57B 3QUXA 3HG1A 5DMIL 2Q76A 4PJGF 3H9SE 1E4JA 2EIZA 3P0VL 4MDIB 3JXSA 3VFTB 2WBJD 5KVEL 4UT7L 1S9YA 1NQBA 2EIEA 3MXVL 5D72L 4M48L 2WZPD 1ZSDA 5DRWA 4ZNCD 2HMIC 4XB8A 3TESA 1CE6B 2X10A 1LEKB 4JFOA 5DC9B 4OV6F 4MQ7A 1G9NC 5JO5A 1JPFB 5DF0A 5TDPA 1EPFA 4ONHB 3KJ6H 4MVBC 1O0VA 1KTLA 1G7IB 1RZKC 5AAWA 1UY1A 5K9QI 4BH8A 3MR9A 5D7LB 1EEZA 2ZCLL 4HH9B 5C0DB 4N0FA 3H9YA 4JGMA 1W0YT 1N6QL 2D7OA 4F7MB 3B5GA 1HWHB 5ITBL 4JFFB 5FKAA 4L4VE 1ED3B 4GKZB 4JZJC 1A1MA 3GMRB 4U1NA 1NLBH 4LQFH 1OARH 5F7WC 3SQBA 5DS8B 2HWZH 4PRAB 5L6YL 3OKDB 4I0KA 3LQCA 3WEZA 5EU7C 3UP1A 1A6UH 4ALAL 4LLWA 1I3RB 5GJTH 1J05A 2WNGA 3QUYB 5IF0A 1E0OB 3ZLQC 2YXFA 2WDBA 5EPMA 3ILQD 1QRND 2R1YB 4WHDA 1IQDA 3I2IA 3B9AA 3LV3B 4A6YA 4RWYL 1C5CH 1UM6L 2FO4B 5ISZD 1W0NA 4L8SC 4HFWA 4X7TB 3VI4E 3OMZA 5FHBL 1U8IB 2AK1H 4ODTH 3ARGC 2ESVA 2HN7A 3BEVA 3FO2A 5BRZB 4L4TB 4XCNB 3SDDA 1EBPA 3NZHL 5IFPA 3VWJD 2ZG1A 5IB3A 2ZOLB 4ZO7A 2X4PB 2HLFD 1UCBL 1O5DT 4LVHB 4PJBE 3QR2A 5EBGA 3ZKSD 5EUOF 1ITBB 3DVGB 1T7VA 4JPKL 4W50A 3KNBA 1I85A 4O58H 4YDVA 4Z7NF 4J7RA 5CZXC 1S9WA 3VGBA 1J1OH 1OAKL 3A0OA 1MLBA 2IQ9H 4X9IA 3FQNB 1E6JL 1BD2D 2NY4B 2Y36L 2Z31B 4WFFE 2HMID 2V5MA 1TQBC 3QRGL 3ZKXB 3KYMA 3LOWA 3UTTD 5HVHC 4KH2A 3JWOL 4ZAKC 3HPJB 3KPSD 2HT2C 4X7SH 5HYSB 2KPNA 3GKWH 4E41D 4OLWH 3NIFF 1FO0B 2VSDA 1WBZB 5AD0A 1KCSH 2DKSA 4OIAA 4EDWL 4FOMA 4PY7A 3IFPA 4XAWH 1S9XA 3SDAA 3X13A 4OZGE 4UB0L 5BVJB 1ODAA 2A9NH 3RVVD 2XZQH 1NANI 2OJEA 4KV5F 5DRNB 3D39E 1R3HA 4JFXB 4I18B 5DUMH 3CDGA 3JVGC 5FDWA 2R56H 3VGHA 4XVJH 3UJTL 1UC6A 2W0FB 2DLEA 4O00A 2IAMB 1KULA 4Y19D 4JHWH 4YPJA 5D2LF 2BHZA 4KKAC 4BFBD 2ADIA 3BIKB 3G9VA 4PJCE 3IFNH 1K3ZA 1TITA 1RQ5A 5I8OL 1BZ7A 5FYLD 3VFSB 4C56B 5JDSB 5GS0C 4O51A 2F54B 3UC0L 3A6CL 3RWJA 3UEZA 4YE4L 4GMSH 4GZ9A 2AP2A 4ZYKB 1P7QB 4CNIA 4EN3A 5JR1L 3BUTA 2P4AB 1RUKH 4K7PX 4LPCA 4PJAA 5B4NA 1KC5L 4PP2A 1NLDL 3T4AB 1BEYL 3U6RA 4N0UA 2WWKT 4G6JL 4QX3A 2CKNA 3NFNB 5E5MA 4OI7A 3FO0H 4Q9RL 2WUCH 3MFFA 4S0TD 4OLXH 4H1LG 3QXDB 1T6WA 1OWRM 1FG2B 1RI8A 1HINL 3X14B 1QSZA 2BCKB 3MNWB 3TZVB 2A0LC 4AM0A 5EIVA 1T0MB 3REWA 3WD5H 5ID1B 3NPSB 3MJ7B 4K8RC 5DYOB 3BN3B 4U1JA 3QDGE 1II4E 5TQ0L 2EXWC 1QLEH 1JWUB 5CJBA 2PR4L 3DIFA 1UYXA 1FNGB 1V05A 3QDMD 5J56B 3HEIA 4GXUN 4HS8H 2P7TA 1DE4B 2AXHA 3MMEA 3CVHA 4QRUA 4ERSH 1AI1L 1LO5B 4GRWH 3DV6B 5KN5B 5MERB 5IB2A 4F33A 5FUOH 2ARJQ 2VXTH 4Y2DC 5J9PB 1HHJB 5LG1A 1I9EA 1UJTA 1AY1H 3FB8A 2X9YA 4OCXH 1CLOL 2FATH 5JIKA 4RSVA 2IH3B 4XVSL 5I1GH 4LPTA 3KR3L 1UT9A 3CXHJ 2XWJB 1P4LA 2XG4A 5I1CH 1GHFL 5DTFB 3ESVF 3BO8A 1G7QB 3O4OB 4MB4A 2NZIA 2FDBP 1KPVB 2B0SH 1UCTA 3ZTJG 1XIWC 3SE8H 4DFHA 3JV6B 2VABA 4Z76B 4BXSV 4KTYA 5EULV 1WITA 2CO7B 4N68A 4L29B 3PL6B 1GGIH 5IMOB 1QLRB 3M07A 4P2OC 4UQ2B 4FP8H 4WNQB 4HMEA 2R2HA 2B1HL 2FSEB 3ULVC 4OV5B 3T77A 1W72B 1ZVYA 4KK6C 3FB5B 2EDFA 3WNMA 5E8NA 3GBLA 3NIDE 3WKMH 2Q8BL 2ZOKB 4CVZB 3M17A 4UQ3B 2XQXA 1PG7X 3RPIA 1BFTA 3HNTL 2YXMA 2QQQA 1UEMA 2Z92A 3DROA 4A6OA 4HX1A 2LAAA 2F5BH 1Q9OB 1VADA 4M6AA 1YNKH 1R3IL 4ZOEA 5ILTH 2C3HA 4I8DA 2VDMH 3X11A 3H3PH 5SX5H 5D7KD 4RMUA 1T5WA 1SY6A 4XH2A 1IAKA 3IXTB 4H5SB 2BVUA 2FL5B 3MTRA 4QRRB 3IAQA 3EYSH 4HWUA 3ALPA 3LS4H 3HMXH 4WI2A 1YNTB 2XTJC 3FFCB 3D1MC 4M61B 5F3BB 1FQ9C 4ZO6A 3G04B 4KHXH 3GIVA 2RGSA 5ACZB 1FBIL 1Q38A 1FFPA 5J6GA 1S7VA 3VFOB 4NBYB 3CFJB 2HVKB 5T3XH 3KPTA 5J13B 2V2TA 2PXYA 3PXHA 3MLXH 1PX4A 3D69B 2VC2L 3HZYA 2X4RB 2GAZA 1T21B 4X6BB 3OKNA 2DIJA 1ES0B 1NH6A 5HI3D 2Q8AH 1VGKA 3LN4B 4MA1C 2AI0H 4DKFL 1MIEL 4NJAH 4XPGL 3WF3A 1S5HA 4JY5L 3RVWC 4M5ZL 5DHYA 3E6FB 1G1CA 1LEGB 1XAUA 3V52H 3GGWA 4KTDL 5EBLA 5IFHL 5I16A 1A1OB 4DXRA 4OFPA 4IMLB 1R24A 1FDLH 1YYML 4LCWA 8FABA 3ZKMD 4M7ZB 1UXSB 4R90L 1BMGA 5HDBF 3DUUB 5HI5C 2R4SL 1U8QA 1U8PB 2Q3AA 3N0PB 4X6CA 3AREC 4NRXA 5GGTH 1DBJH 3Q5TA 5LWYL 1AKJD 5HHOE 3LH2H 1OPGL 1G7IA 2W47A 4Z8FL 5BO1H 4HKJA 5E2WH 3IRZA 4LPYA 5D7LA 2RFXB 1EEYB 5CSZA 3O9WC 3VXPB 4HV8A 4RNRA 4KFZC 4M6NH 3V4UH 1U2CA 4HC1L 5FOBA 3A22A 4YFEA 1ED3A 1KCKA 4GKZA 3D6GA 3MV01 1U8LA 4WW2F 1QHPA 2QQKA 1UYWH 5EOQL 2YSSA 3W9DA 2CLVA 3FONA 3CLFL 1GC1L 4FFVC 4XCFL 5F9JA 2AK4B 3LIZL 3CCHB 4PR5B 1W0WB 2WLYA 5D4QA 2W46A 1YDPA 4PJ9C 1Y6KR 2HH0H 2AW2A 4IOSD 5KOMC 4EVNB</