2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
4UUJB 3QXDA 1JGEA 1GCFA 3LV3A 4DZBA 1MQKH 4DAGH 4PRAA 4RMSA 3RWDA 4PLKD 2XN9E 1C7SA 1DJSA 4A6YA 1RU9L 1FLRH 2NY0D 3IFPB 3ZM8A 1R6VA 2E9IA 4KK5D 5IESL 4HIIB 4IJ3B 3DHJA 4UT7L 4E42A 4LVNC 2YEZA 4HDIB 1CU4H 1RUMH 4XAWL 4NO0B 4YX2H 5F9WB 5CEXB 1D5IL 5GSVB 1JF6A 3L3IB 2NY3D 4DN4L 4LHUG 5EUOF 1A1NA 4AEIH 3QQ9D 4GG6A 3HNTH 3CUPB 3S35X 1CFTA 1CTOA 1NLDH 2M1KA 4KK9C 3O6FD 4XPHH 1PZ5A 5D9SA 2AEPL 3LVEA 4X8JA 1WISA 5BJTA 5F3BB 1OTSD 3H9SD 3QEHA 5F96H 4JEGB 1RJLB 5ALCH 1A7NH 3DJ9A 1RULH 4OFIA 1RJCA 1T03L 1IGML 4J6RH 4OLYL 4YXHL 3GFUA 2W9EH 4NCC1 2ITDB 5JNYA 4FQQB 4IIQB 1W72L 1INDH 3VI3E 4CUCA 4JO1L 2NY6C 3Q6FA 4PJ5A 3EOAA 3WEXB 1SEQL 4XH2B 3T04D 3ZKQD 3OR7B 5KVFH 2HFFA 2D2OA 2PTVA 3TEUA 4NM8H 3FN0H 1F4AA 3HUJB 3UTOA 5LQBH 2XHNA 4JRWA 4C4KO 4OI8A 4HC1A 1R3IH 3UBXA 3MLZH 4K7FA 2IANB 5LAXA 3HRPA 3VWJB 3VW3H 5T1LD 1MCFA 4Z0XA 3RBSA 1CQYA 1LK2A 1LEIB 1U8JA 4TQEL 4YPGA 4GWJA 4QRSB 2FJFB 1N3NA 3TP4A 5FGBA 3SY0A 4AJ0A 1W72B 3B6SA 2OQJB 4NKOB 3U46B 4JG0H 3S36X 2BNQA 2Q8AL 1WGOA 5IVXF 3STZB 1MCBA 5I1AB 4OGZA 4GBXD 1OAXH 4D0QA 3FRUB 4L4VA 4Z7VF 4CL7A 2YC1B 3SKJL 4GXUN 3IDAA 3OKOA 3VMOA 4B41A 1OSPL 4DW2H 1KCUL 2V5RA 1HYSD 1DLCA 2WIMA 2CUIA 4L1DA 4ENEC 4UI9L 4PG2A 1LE5A 3WIIL 5F93C 3S88L 2JJUA 3KVQA 2JLLA 5FGSA 1NEUA 1TQBB 4HS6A 4JDVA 2XZAL 4KI5C 2XZQL 2AV7A 2VDOL 3S5LA 3KPSD 1QO3A 1YPZE 4FG6C 3WFHA 4Y8DC 5I1LA 4XP9L 1IGCH 1FORL 3S37X 2G2RB 1MFDL 3OGVA 5TE7L 3I6GB 4GKNB 3D39B 3DUUA 2YPLE 4YK4B 1DBAH 1X5FA 4TSAH 4K3EH 2AKRB 4YIQA 4QAWA 5LA2A 1R24B 1UQSA 3ARZA 4XPBH 2IJ0C 4H1LA 2O5ZH 3LY6A 2YD1A 1EMTH 1HEZA 2QR0A 3EJZD 3RDTA 4X6EB 4MADA 1F11A 3QULB 4NGHH 4F7EA 5B38A 5CBAA 1U8HB 4Z78B 3WLWD 4S1QL 3L5XH 1NFDE 2XN9D 1KIRA 1RVFL 4MAYB 4HHAA 4R8WH 2HYMA 4XUPA 2YPLA 3C6SB 4JQIL 3GRWA 5E2UH 2MKWA 1A9EB 2FSEB 3VXSD 3ME0A 4FZEH 5D5ME 4JE4B 5AWNL 1FNAA 1KT2B 2H6PA 2RJMA 2YUXA 1CE6B 4XNUH 5T3ZL 2OTWA 2IAMB 5IKCA 2YEZB 4HDIA 3FB5A 2FD6L 4MNQD 3CIHA 1AGCA 2C4FU 1TZGH 2AJVL 3ZYOA 4MQ7B 1MPXA 1G7IA 5BOZG 5I30L 2YPVL 2XTLA 4M8QB 2LAAA 3CXHK 2X4OA 4IRSD 5TE4H 1SG3A 5HGDB 5EB9A 2Y5TA 3JUYA 3MLRH 1KPVB 4ZTPL 1P1ZB 5T1KA 1MCJA 1T0NA 2NY5C 4GUPB 3S96B 1US2A 2GAZB 4MJ5A 5DHYB 1ADQH 1K8DB 2FH6A 3KPSE 3BIKA 1YMMA 3BPOB 1FRGL 1SM3L 3QZWB 1QACA 1FPTL 1FYHB 4CNIB 4NO0A 1K5NB 3I9GL 5IHBA 5FF6B 3O3BB 5IW6A 3DV4B 1YEKL 4D0CA 5B4NA 1ZVSB 3FT4A 4X6CA 3RY4A 1TXKA 1MFNA 3D39D 5L7XH 1JI1A 1YEDB 5HHOB 4K3GA 4QRPD 5JO5A 2V9QA 1MVFA 2CDGA 4I48A 3DYMA 1I1RA 4L29B 5C0JB 1INEL 3FT3A 1LE9B 2HJKA 5HVGB 1U3HB 1NAMB 4ALAL 5C07D 4H1LG 4JRXE 4GS7B 4PJDF 1N8ZA 3O2DA 3QNXB 1K42A 3VJ6A 3ZHKA 1TNNA 3SO3B 3EFFA 1A0QH 5ALBL 4HW6A 5HI4C 3MODH 5INCB 5DS8B 3FQRB 1JF1B 4K3JL 4GAYB 5D8JH 1FC1A 2F53B 5LCVL 4IRZL 3TO2B 5E6IB 2HMID 1JNNH 1WUNT 4NM4H 4NN7B 5FYKL 2FBOJ 3GMNB 4YDIL 2XPGA 4TNWF 3KLHC 1I3VA 4LFHG 5FKAB 1WWBX 4P46C 2NW3A 5D4QA 3ULUC 3MSPA 1QKZH 4Y2DB 4Z7QE 5C0CE 3RWFA 4PJGF 4CW1B 3B9EA 1JZ5A 2Q8BH 1VADB 4GLRI 5EN2A 2FEDC 3HG1E 3MRGB 3W11D 1A6TB 4NHUB 3C09C 3PGCA 1XH3B 4H1LB 3LRSA 1CCZA 2R2BA 3GJFK 4ZXBD 5IMKA 1Q8MA 4XVTH 4P57A 1U3JA 4P4KA 1RUQH 3MGOA 7FABL 1FZKA 1E6JL 1CIUA 1CXFA 1HSAB 3VGFA 1XNAA 3VFWB 2HFGL 3MRBB 4N0FB 1CX1A 2CKBL 3DX7B 5CJQL 4O2CB 3UMTA 3NJXA 2AJYL 3VXMB 4P2OD 1RAMA 4G8GA 2R39A 5A16A 3L1OL 4Q6YA 5J12B 5KTEL 3GUTB 3PV6B 1J0ZA 4ZFGL 1RZ8B 2FJGB 4YBLC 3UPCA 2O5YL 1HQRA 5JW4Q 4WV1A 3S5LG 4EI5D 1XGUB 4M6OH 5D70L 5HYQA 3C6LC 5MHSE 4HHAB 2EH7L 3A67H 1LVEA 5KZCB 4JRXD 4R4BA 4NQDE 4WUUE 4ZO8A 2ZEWA 4P02B 4E0RA 1FV1B 3BN9C 4NQUA 3NFNA 3MZTA 5TE6L 1IL1B 4XX1G 5FM5O 4JZOB 5J3HD 4BA8A 4X80L 4B5EA 3WO4C 2UYLB 4OKVB 1N7ML 4HWNA 4RAUA 3WE6A 3RWGA 5FOBA 4NWUL 3DTXB 1KN2H 4WVRA 1FAKT 2R56H 1EBAA 3QDMD 3V5HB 3MROA 5E6ID 5GSRA 5KJRH 1NAMH 3H9SB 3SY0B 4AL8L 4NZUL 4K71C 1PBYA 2NXYC 4J3VA 3ETPA 3Q2CA 2AABH 4HBQA 1NC2A 5EUOA 4PP2A 4J7RA 2NY2D 2IBZX 3D0LA 2JB6B 4X99A 1MI5A 3C5JB 3EYOB 3NA9L 4ETQA 2HT4C 3T4AB 1NMBL 4F57L 1TETH 5B39A 3HE7B 1R3IL 5F9OH 2OTWB 3HB3D 4EUPB 4XXDB 4ZNEE 1WQVT 3LKNB 3FQXA 1CZVA 3W9EA 3PHSA 4J4PC 4YHPB 4HBCL 5C7XL 4S1RL 3HMXA 2OL3H 2B9VA 3EIFA 3VFMA 3QG6B 5IW3A 1MJUL 3QHZL 1GGIL 5C0FA 4LBEA 2PQSA 2AJ3A 1FNHA 3BZDA 4I3SL 3I6LE 3IDYC 4KPHL 1GGCL 5EO0B 2FBJH 3SOBH 4JDZA 4M61A 3WXVL 2BNQB 3KPPB 5I1AA 4LAJH 4FOMA 1EXUB 4FMKA 4LKCB 3PUHA 1B0RA 1C1EL 4XMLL 1YUHB 1D6VH 2HJKB 1UXWA 1J18A 1M05A 4PFEA 1BIHA 3CVHB 5TF1H 3ILQC 2V9TA 3E3QC 1Q72L 3LZFL 3SGDI 1CD1A 5ITBH 1OTTC 3MV7B 4LL9A 3W5NA 5IK3B 3OKMB 2Q7YB 4X6CB 2QSCL 3EYQC 5JR1H 4YFLI 3EHBD 4HD9A 4KRMB 5BZDA 3CDGB 1KTLA 2DLEA 2I27N 5DURB 4HV8B 5C0IA 5C0JA 4HCRH 5F1NA 4NNPH 5K9QI 3UAJC 3LEKA 5TDNB 1FO0L 2DICA 4R4FL 3PDGA 3IAPA 3H9ZA 4WUUB 4XPAL 1BFOB 1RIVH 4QRUA 4KH2A 4KKAD 2HT4D 5HPOA 4MD4B 5E8DL 1J86A 1HEZB 2QR0B 4JFDA 2Y06H 4HKXB 5D7LE 4AY0A 1V8HA 3HE7D 1CG9B 4MA8H 4ERSL 3QCTL 4D9RD 3MRNB 1HQRB 1IRAY 3IKCA 1H3VA 3G5VB 4PIRF 5T1KB 3FO0H 4HFWA 4OT1L 1HSBA 5KSVA 1NGXA 4QF1B 4ZUTB 4K8RD 1P7QD 4PLNC 2YG0A 2Y4SA 5J6HB 5MHSD 3H0TB 2VZ3A 1RK0A 2DKUA 3TBSB 5C09E 4XP6H 4DKAA 2OJZL 3NCBB 1P69B 4AH2A 3MJ9L 4ZOBA 1W0WB 2WWMD 3Q6GH 1XGQB 3IB4A 3PWUA 4M6OL 5D70H 2GSGB 5BVPH 2BRQA 1C8PA 3PL6B 1IAKB 4MDJB 3REVB 1FL6A 1BREA 3PGFL 5IB4B 4D8PA 4GJTB 2IALB 3ZKXC 1BM3L 5EZIH 2X40A 4KK8C 1DLFL 1FDLH 3K74B 1O8PA 3U1SL 4U1SA 4AMKL 1M7DB 2E33A 4L4TD 4M5YH 2FJGA 1MCWM 1VEPA 2XWJB 3AREB 4PYHA 4UILL 5AZEL 1D5XB 3RI5F 4WV1B 5DMYA 4UNUA 4PLKC 1XZ0B 1S7XB 1V7NH 3OG6B 4Z0BL 3E6HA 3A6CH 4U6YA 4OBRA 1QLRA 1RHFA 3MNZA 1WIOA 2EECA 1QBLL 1F5WA 4LLDB 4M7LH 1CGSH 3F58L 3BFOA 1B9ZA 2EYSA 2P1YA 2ZJSL 1NLBL 1MLBB 2AXGB 3O8XA 1XIWD 5FOBB 5L6YH 2VQ1A 3P9MB 5DJ0A 1NKGA 5GGQH 4CW1A 3IXAB 3SJVB 4Z7WF 3HMWL 1DN0A 4OB5H 1T5XA 1G7QB 2Y9RT 4IRZH 5D7JC 2HVKA 5D8JL 1INQA 4OLVH 5FM4A 5J89A 2X6MA 4BFGA 3GB7A 1V3MA 5SWQB 4YR6B 1JMZA 3ZL4L 3Q5YA 5JMRA 2BNQD 2BSRA 4E5XB 3K8LA 3AS0A 5IBUG 1I7TA 4ALAH 3LIZL 3GMNA 5E08H 2VLRE 3MRFA 3C08H 2W60B 1Z5LB 4OCYH 5IHRA 4DJMA 1NUKA 3WJJC 2AK4D 4X9BA 4J3OC 2XFXB 4JY5L 4RFEA 4ZUWB 2OR9L 2J88H 4LCCB 1EO8H 3G5YB 3FQTB 5B4MC 1OTUC 5EFIB 1HXMB 1U36A 3CDGA 3V5KA 5IMLA 2AGJL 3PABB 1DANT 4MX7A 4P57B 3VFRA 3QG7L 4ZUSA 2PUQT 1U2HA 3BPNB 2XRAL 3ARFD 1NCWL 3OHXB 1FCCA 5H94B 1OLLA 1SM3H 5A43C 2LW8A 3QXDB 1NC4B 1EBPA 3O6KL 1KJ2A 3KWWB 3TV3L 1T7VA 3BUTA 2VO5A 4JVPA 3QFDA 5DRXB 1SDDB 3BYYA 4PJ5D 3QPQD 4BFIB 1KGYA 4U1NA 1JWUA 3VU2A 2Z93A 1CE1L 3FO9B 4UU9B 4X9HA 3STBA 1OAUL 4BZYA 2XQYG 1BMGA 2YPVH 2P8MB 1P7QA 1A3RH 5HYQB 2R4RH 3GNML 3ZDZF 5MENE 2X4RB 3ZKMD 4FRWA 4ZFOA 3D18A 3P4MA 2DMBA 5TJWK 5IVXA 3BGFB 5GS1C 3SKVA 5JDSA 1HWHB 4OF8A 4WNQB 3KR3H 5JPNA 2D7NA 1F4WH 1ZHNB 4NZTH 1L9MA 4PJFB 4M5ZH 1HHGA 4JFDD 4DFIA 1X6LA 4ZD3H 4ZG1A 3QXAB 4FZEL 5EO9B 4BJLA 4EI6A 4JZJA 2DAVA 2GFBA 4MAYC 3KR3L 5A2IH 5L2KB 1A6ZB 1L7IH 2WBJB 3WJLC 4YHKL 3UCRA 3MRQA 1FNGA 4IRJD 2DQJH 1A1OA 2E8ZA 3HC3L 3BAEH 1NC2B 1WFTA 8FABB 2IWGA 3MRLB 3TPUA 5I1HH 4XCFL 3OR7A 3OBAA 1K6QH 3LSOB 3NZ8A 4LLQA 3VFSB 2FL5A 4A6YB 1YECH 1KNOA 4PGJA 5I8CA 4U6YB 4EN3B 5LGHL 2EC8A 1VDGA 32C2B 1KB5H 3RI5K 1OPGH 2HYXA 4LSDA 2DCKA 4LKSA 3ARFC 1XGRB 4M3JA 1RFDL 2W65B 3T4YA 1OQXA 2AXFA 1S8DB 1LMKA 3BH8B 5DHXB 2I5YL 3GMMB 1C5DB 5ANMA 2YB7A 4N0YH 3NOIA 2ZP0T 4MWFA 3PWPB 5C09A 1CFVL 2X4UA 3QPQC 3HRZA 2ICEA 5FYKU 4I3RL 1EJOL 3JVGA 3JUZA 3PJSA 4R2GC 3S88H 4K23H 1ZGLA 1OP5H 4NIKB 4KRPD 1YZZA 1AXTH 1OP3H 1W9WA 4GWIA 4NQDB 1T83C 5H37H 4HWBL 3BN3B 3IFNH 4IRJC 2NY5H 1NFDA 4YLQT 3IDUA 1IGIH 3DXAB 1MCEA 2L4OA 3UC0L 4ZDHA 2BHZA 1J7VR 4NC0B 2NY2B 1G7MA 3TBYA 5HDQH 5D7LA 3PDOA 5DQ9A 5HY9B 1SYVB 3MR9B 2E6QA 3VI4F 4QRPB 3MYJA 1US3A 4X5WB 3QDMB 1LD9A 2F8VA 3BKMH 4I5BB 5D96B 5C0NC 5DJXA 5DJYB 1Q9KA 3MO1A 3WIHA 1K8IB 1VFAA 4AK1A 1NC2D 4MJIE 3C5ZC 1KCSH 3N85H 1HSBB 5KSVB 3ZDYE 4QB1A 2ZSWA 3CMGA 5L6YL 3MXVH 4L5FL 3B9DA 5I18L 5J7CC 3PNWB 4P2OB 1TVGA 3WUZA 2J1VA 3IDNA 4HUWA 1F8TH 2VZVA 4HZAA 3QAZB 1W72A 1R0AL 5ANME 4WTXA 1S5HA 4M7LL 1CLZL 4LHUA 2DBLH 3X14B 35C8H 4DEPC 2A2QT 1GJIA 5HVFB 4K2UL 3STZA 2XZCH 1MCDA 4DKDC 4UOW0 1FAIL 5JHDD 3ULUD 3VH8G 1BQHG 5L0QC 1VKXB 1IGMH 4BQ6A 3VFUB 4OGAC 5FA4B 1GGYA 4OGXH 5IFJB 4HWBH 3SDCB 4YAQB 1DE4A 4QHLB 4P5TD 1TVBB 3EUUA 3O45B 1IGYB 3JTSA 2AEPH 3BOVA 4IIQA 4N8PA 2G9HA 2V5MA 2CMRH 5IB2A 4PJ5B 3WEXA 4WU5A 4UTBH 1U8NA 4PJBA 1MJJA 2VLLB 4PRDB 1MI5D 2BOBB 5D1QD 2XIDA 3VRIB 2G75A 2HWZL 4P3DA 4YX2L 4WW2B 3I3BA 4KRLB 4TN9A 1YY9D 3D85D 4NC2B 1C5CH 4XP5H 4F9PC 1SEBA 4U3XA 1EPFA 5C0AD 3SBWC 3WO3B 4D8PB 1EHAA 4Z76A 5DZLA 4RBPH 3R4DA 4F7CA 1FLRL 1MUJB 1S9YB 3NAAH 2GT9A 5C2UB 1XT5A 4LVOB 3ZKXB 3DUSB 1LP9F 4U6HB 3DYPA 2C4FT 1KENH 1YDPA 3MRHB 5D7LD 2MTPA 3SHSA 4X7SH 4Y5XC 1D9KB 3AM8C 3BAEL 5DMIH 3S9DB 3WFCL 1EFXB 1ED3A 1D9KD 3NCCB 4ZFFB 2E6PA 4OFVA 4PRPD 3DV4A 4RGOL 4KK5C 5I8CB 4RGMB 3U7YH 1M71B 2HLFC 2HRPL 1T1ZA 3NTCH 1P4IL 2FGWL 1P5UA 3MRPB 1T89A 3QI9A 2DQGL 4Z8FH 4M5ZL 3H3PH 5D1ZA 3CSGA 1TENA 1N6QH 4EN3D 1VFUA 3PWLA 4P5KB 5HHOD 5GS0L 4NQDA 3LQAH 3GMMA 1F6AB 1U8QB 2RB8A 4OZGF 1AGFB 1YPZB 3PWJA 4ISVB 3P4LA 5K9OB 3LEYH 5EU6A 3MUGA 3DUHA 3ACFA 1CDJA 1OAUH 5F89B 2C3HA 4GOSA 2ZPKL 5GGRY 5GS2H 5IP4A 1CE1H 3PQYB 1GIGL 4ZUSB 4NQXA 4LCUA 4GKSA 4ZS6C 4D9RE 3SE4A 1D5ZB 4QTIL 3QWRA 1UJ3A 2F5BL 3O6KH 3QUZA 3IRPX 5MEQB 1MJ8H 1QUNA 1AI1L 2IAMD 4BKLA 4XNZC 1Q9KB 1QSFE 2AEQL 4JFZH 4RRPA 4Z7QF 2X05A 3L6FB 3BUYA 5IMMA 4JVUA 3KPRE 3OKEB 3OG2A 4MJ2A 2AGJH 2MMXA 2MQ0A 3KHOA 1CICD 4J4PD 1MF2L 4OCMC 5E1AB 5SX4I 3U30B 5I1LB 4EVNB 2DWDA 4GG8B 5CFHA 4AM0B 1HIML 2MFNA 4P4KB 4F58H 3TIDA 1X4XA 3ILQD 3VD7A 2VL4A 2NY3C 5DQJA 4C56A 2PYEB 5HYSG 1QFHA 3FB5B 2HVJA 2J1UA 1KCRL 5IB3B 1L4IA 4PB0H 2G5RA 4HK0A 1CVRA 3O3DB 4PJCB 1VFBA 3TH4T 4OFKA 4HJGA 5HTSA 4XMPL 1P9MC 5DDHB 5DQ9B 3WSQH 5HGAB 4JLRA 2H8PB 1URLA 4DCQA 4EN3C 1Z9OA 3P0YH 5CHNA 3NCJH 2VMDA 3V6FB 5IHUH 1UB5B 4CVXA 5B38G 5ADOL 3GSQB 4HWZA 3S96A 1MJ7H 2B0SL 5D7JD 1A22B 3WIFB 3UTQA 4QTIH 2ESVD 4X6DB 1LP9E 3LKOA 1AD0B 1M4KA 3CSBA 3IDGB 5ENWB 2YD2A 4GAGL 3DHMA 2FLRT 2A6JB 3HLAA 1N5AB 4G9FB 4X80H 4JAMB 2DI9A 3AMKA 5KBNC 1MJJB 2VLLA 4DZ8A 3I02A 5TE6H 4WFGE 2R2BB 1JHTB 1NCDH 4ZMAT 2IAMC 5AYQA 2P45B 4PJBE 1BAFH 4M1DL 3TZVA 4HXBH 2A9NH 3MREB 1ZWIA 4LPTA 5BV7C 3SDYL 2EH7H 3A67L 1NQBA 1Z0MA 3MRLA 1OSZB 4XCCH 4B53A 4PRBB 1GVIA 4QOKB 5LKNA 1F3DH 5KANI 3FB7B 2B4CL 4YBHA 3DX6A 3KPSA 2FZ3A 3B43A 5D7IB 4R7NB 5TQ2H 3LQZA 5FAAA 5GGSA 5MP6H 3EJZC 2DQGH 1CLYL 4Z8FL 1LE9A 3PUCA 5DMGC 2Y6SC 1REIA 3VXUD 5J9PA 4PJAF 2GJZA 1JZ7A 2QEJA 2EO1A 1F90H 3ULVF 1HINH 4KK9D 3HZMB 5E9DD 1A7PL 2APVA 1S7VA 3VFVA 4GG6F 1UKSA 3P40A 3QNZA 2NY1D 2EDQA 4G6AD 1FNSL 2NW2B 4I8DA 7FABH 4PGEA 1T0PB 4V1DB 1Y6MR 2D7OA 1I3GL 1U93A 1BLNB 3L95B 2CRIA 2P43B 4NFCA 1DYOA 2RFXB 2E7HA 4FTVB 1U8KB 4KTYA 1Q0XL 3V8OA 4OM0H 4FXGB 4XMKH 1V3KA 4GZ9A 3BX7C 3HPLB 5ISZD 4NQCE 2EDTA 3QIUD 3HNSL 1N26A 4NT6B 5D1XB 5E2WL 2P4AB 1BJ1H 4GW1A 5T3ZD 1AKJB 3BI9X 4HPOL 4WFEE 5A2KH 5CSBA 1I1YA 1D5MB 3BHBA 2Y25A 4NKIH 1YN6A 5EU3B 3EOBB 4J3XA 2W5FA 4U1HB 3NCFB 1CD1B 5MI0B 5SWZA 3EGSB 3OKEA 1FL5B 3QIBA 1G7HB 4HKJB 1UYXA 5JTWA 4YDKL 5I9QC 1S7QB 3H6JA 3GJFB 4QXWA 1CZ8L 4IDLA 1I3RB 1FGNH 5D93B 4P2RE 3IAGC 3G08A 1FFOA 3A6OA 3HR5B 1NFDF 4RMVA 5I1CL 2ZG3A 4AYFA 5JW4R 2B8OT 3REWA 5CIPB 4FP8H 3EKCA 5EO0A 4RSVA 1QD0A 2WBWB 2PYEE 3CSYA 4F15C 1TJGH 4Z7WB 1S9WA 1RURH 5AUMA 4LVHC 2G2RA 3CH1B 2WAHA 4MAUL 4WEMB 2V7HB 3ROOB 4FQIL 3O6FA 3U4BL 1YEKH 3EYFB 4ZNEA 1L7RA 1YNTA 5BXFA 2DKSA 3C8KA 4PRIE 1Z9SA 5DRWB 3BPCA 5FA4A 5DGQA 4LSSH 4MB5A 4WWKB 3O3DA 2X5PA 4LKXA 4D9LH 2Z92B 4QY8B 2DLGA 2CLZA 4XAKD 2VKXA 2BNUB 1ADQL 5IBTH 1OAQH 3OTTA 3LKOB 2LQRA 1HILB 3LS4H 4J3WA 3L3GA 3MLRL 3WXVH 1ZT7B 2ZUVA 2NMSA 2X9WA 3TBSA 4KPHH 4WW2C 2GEEA 5CMAB 3MLSL 1GGIH 3TT3L 5E24E 4RNRA 3NGBC 4NKDB 1MHHB 4PJEF 2BFVL 2VZSA 5E9DB 3LS4L 4BQCA 3MBEC 4S1RH 5JR2A 4X0KB 2W9XA 3DX8A 3H2WA 1ULVA 4JZOA 4X8JB 1DL7H 5EBGA 2VLKE 3W11C 2EIBA 1R3KA 2VN7A 3LN4B 1OF4A 3QQ4A 3LPWA 1TETL 4Z7UE 5CP3A 3WLWC 1VEMA 2DJSA 5FGCB 4QX1A 4NYLA 4QHNB 4HAGA 4L8DA 3FCTA 5H35B 1F6AA 1U8QA 3UO1H 4I3RH 2X9YA 5J9PB 5I74B 1X5JA 3TN0C 1AP2A 3JWNC 1S7XA 2D4DA 3FHQA 2VC2L 4PT6A 1HH6A 3ARED 5CSGA 2BVOA 1OPGL 4FP8L 3TO4D 3G6AB 4HMCA 1H9VA 4K7FB 2ADFH 3IJYA 4WI3A 4CVZA 1GU3A 1M05B 2ESVB 2BVYA 3WHE0 5J6HA 1ZLWK 4GAJH 1N4XH 5AAWA 5D2LB 1JPTH 1F02I 4ET7A 3HZVB 4JAMA 3OB0K 3HPLA 1NDMB 3BMVA 5IJRA 1K2DA 3H42L 4LHSA 2ED9A 1B2WL 3RNKB 1OAZH 3PWUB 5B39G 1P2CB 5HDBE 3M1BA 4WUKL 1E4KA 1SJVA 2H32B 4Y5XA 1RZ7L 4M61B 2VLME 1T80A 4PJ9B 1CL7L 4JHZA 1U8KA 3I97A 2ED7A 4JFPA 3IVKB 1MFCH 4EZMA 1MRFL 3NH7L 4O5LL 4XCEA 5BS0E 1YNKH 2DQUH 1CFQA 4NZTL 1ZT4A 5E2WH 1X5GA 4PJIF 4ODVL 5HSFA 3DRQA 4XBPB 2VAJA 2J8OA 1ZV5A 2W0LA 3Q5TA 2FLBT 2QHLA 3E1F1 4PV8B 5JIPA 1XGYH 3EDFA 2Q7YA 3OKMA 1CG9A 1MIMH 2LU3A 2FHFA 2XKNB 1EEYB 1BLNA 3JV5A 1ONQB 3RWHB 3BZEA 1A6UH 5CSZA 1BZ9A 4KI5F 3X12A 5GZNC 3RWJA 3WFBH 1IAII 4ZYKB 3O8XB 4X5XA 3HJRA 4WO4C 4PTUB 1UXSB 4XP1L 1CR9L 3LEGA 1KB5B 1KJ3L 3BVNB 2UZXB 2Y6JA 1QFPA 2VDPL 4Z7NF 2EDHA 4OF6A 5LA0A 2HLFD 1U2CA 3CSYB 4KKCD 4Z7WA 3U7WH 4L8BB 1H3TA 5JUEH 2R15A 5JMOC 1HNFA 1OQOA 4ZXBB 1UZ8B 3IDJB 3TA3A 4WW2F 2XWJA 5K59F 1I4FB 3T3PF 4NHCL 3RZCB 4HKJA 1NANI 4OZFH 1KIUA 1V7MH 3W9DB 5ACMA 1BAFL 2CIKA 1UB5A 3MQIA 4LMQE 3PHQA 1WV7T 2XN9B 1N0XH 3PV6A 2C4XA 1GL4B 5EPMB 1SBSH 4PJ7E 3LIZH 3O0RL 3SEEA 2VSDA 3UDWC 5ALCL 4OCWH 3KYKL 1WF5A 3DSFH 3AFLA 5HHPB 1FHGA 2R29H 4M02A 1TZIB 2RGSA 1FN4B 2F53D 4QHNA 1RMFH 4JM4L 4ORGA 3MV9A 3NCJL 4IOFD 4Z7UB 3FFCD 4PJXF 4RRPG 3HMWH 5FO8A 4L8CB 3I9GH 1RJZA 4MA1C 4DEVA 5E7FA 3BDBA 1ZHBB 3ZKSD 4Y4FD 2CIIA 1FPTH 1J05A 1JPFB 4GSDH 1SMOA 1KJ2B 1NLBH 4F33A 3FAWA 5FHAL 5CIPH 1IJ9A 4JREB 3HNVH 4GKZB 3H8NA 3QSKB 3WDIA 4KHTH 4AEEA 4ELKB 2ITDA 5HHVH 2BVQB 4Q6IC 4GW1B 3Q5OA 2P8PA 1AQDB 4BDVB 1G84A 1X9QA 3DBXA 3DRTB 5EH1A 1ZLUK 4PTTB 3VGEA 5FECA 4X4MA 3EFDH 1NDMA 5DA0B 5BW7C 4QT5A 2FRGP 2ARWA 5IM7B 4NC1E 5IT2L 2C1PA 4JFEE 1EHNA 4WV1C 4I18C 5JPNB 4HUVB 1L7TH 1W0VA 5JO5B 4ZNCD 3C5SB 3ALPA 1I7RA 4TULL 3EO1A 2VQ1B 3GSRB 5FO9A 2WW8A 4KZEL 2NX5D 2VDQH 4Y4HD 3KPMA 3DIFB 4Y89A 1RZJL 4LRNH 1DFBH 1Q0YL 1NAKL 1RVFH 4XGZB 1JRHH 5HDLA 3U7AA 1BJMA 2IPTH 1GIGH 5IMLB 3BP7A 4HIJB 3AB0C 1QR1A 3BRGC 4GRLB 5DJDA 1A7BA 5L8KB 3ILPA 3TBWB 3WDJA 3OAYH 3DSNA 1ZMYA 1ZGLM 3RJDA 1CLOH 1KXQE 4OZGA 4XPBL 5TGBA 4KZDL 1YNTB 4XZUG 4PYGA 2WINB 3BKCH 1G6RA 1M6OB 2JJSA 3QDGD 2CK0H 2E26A 4NRYA 4JFYA 3ZDYF 2ZUYA 4KU1A 2Z93B 4XP9H 3SE9H 2AW2A 3DECA 1IC7H 3D3VB 3T0EB 4ERSH 4QNPE 3A22A 2A73A 4U7MA 3T2NL 2CRMA 1KG0B 1DQLH 4AENB 4KWUA 1ZVYA 5EUKA 1JZ3A 3HMXH 5EWIL 3DWTA 4YUEH 2BXZA 1YYLL 4Z2AA 3WEZA 1NCTA 2AJSH 3V6BR 1QG3A 5HD8C 3BP6B 1JTPA 5DJ2B 1FO0H 4Y1AA 4DW2L 1FGVH 2YD9A 3QFDB 2YFZA 2D31A 2DQDH 4JZJB 1MHPL 2HH0H 4U05A 4U3HA 5MENA 5J1SC 1E27B 1EVUA 1EERB 1G7JB 4PRNB 4X6EA 1OAXL 1RPQA 4U1IB 3OGCA 4F3FB 32C2A 4OGYL 2J7LA 5ID0B 1YMMD 2UVEA 4OCRL 4R90H 5IVZA 3MRKA 1ZLWH 2DYPB 1BF8A 2EDFA 4LLQB 4PJDE 2ZCKL 3LKQB 1FVDB 4XVHA 4M8VA 1C5DA 5ANMB 4QF1A 3T0VA 1IGJA 2ICEB 3F7YB 1C08A 3ZE1F 4LIQE 3IF1B 2ZCHH 3IDNB 4P3CL 1LO5A 4MXVE 3MLZL 2QQLL 1KELL 2AJXL 1XF1A 4HLZH 2LTQB 1FN4A 1TCMA 1YA5A 1MRCH 5GRJH 4GLRH 1DZBA 1BEYH 3PL6A 3UJTH 5LG1A 3BRDA 4MJ6B 3GRWL 4QXTB 5F7WC 1NBVL 4EBQL 2GHWB 3C7OA 3GIZH 3TN0A 1UWGH 2V17L 5E2TH 4K2UH 1T1WA 4JFXA 4WHCA 1B0GB 1W72H 1I85C 3VFSA 3PP4H 1CDCA 2COQA 2YR3A 4ZFFA 4BK4A 1CLZH 2XN9A 3ECQA 2RBLA 5SWSB 4NDMB 1OP3K 4CJ0A 3BGFC 2H26A 5GS1B 3O2DH 2A6KA 3Q1SH 1YY8B 5T1LB 2X4PB 5IBLD 4FG6D 1U6AH 3QNYA 3BZ4B 1K2DB 1GPOH 1Z3GL 4NFBA 1I8LA 1I8IB 1BF2A 4QCIA 3LDBB 5I1GH 1K45A 2ZNWA 5EU6E 4P2QB 4LBEB 1Y18B 2R0ZL 5CAYB 3I2IA 1AIFA 5I16A 1CXHA 1IEAB 3DROB 3ARWA 1IKNA 2VIRA 4JHAL 1I1FB 1KN2L 3F7VA 4Z7NE 5D7SL 1I5PA 5B4MD 3X12B 3BIAX 3E3QE 3VFNB 2ED8A 1S9YA 4GKZA 2Z4QA 1JWMB 4FQ2H 4GKSB 3IFNL 1LILA 3QQ9C 5GGVL 1NCNA 2P8PB 2BHYA 4JM2A 1PYWB 3UTTA 3O6FC 2VDLH 1C5BL 5AG9A 3B9VA 2QL1A 5DPNA 5DYOB 1G0YR 2LU7A 6FABL 1OCWH 5D6DC 3O6LH 5IFHH 3BMWA 1FP5A 3SGKC 5C71A 5JOFA 2CQVA 1Z0NA 3GMQA 4TYUA 4MCZA 3HS0B 3G9AB 2Z8RA 2O61B 2AI0L 1GHFL 2X2YA 2X89A 2X89D 3IJSB 3SDCA 1GYAA 1MCHA 5JIIA 5GS0D 4M7KH 5DJ6B 2HFGH 5MI0C 1IM3A 4JKKA 4R7DA 3NPSC 5GSVA 2OI9C 3VCLB 2CKBB 3S34L 1BGXL 3QHFH 1FVCB 1CLOL 1FNFA 3OAUL 1VFBB 3CX5J 1SY6A 4ORGB 5FIEA 5E8OB 5DRNB 3FL7A 4NJ9H 5JQ6L 4HUXB 3L3OB 4YHKH 5ESQA 3ULVH 2ZCLH 3L7FA 1QHOA 4G8GB 4JHBA 4PGCB 3KYAA 1B4RA 3D69B 3IDMA 3BE1L 3PQYE 3GUTA 3NIDE 3B3IA 2DB8A 1MHCB 1ETZA 1DN2A 3WS3B 2W07A 5I75C 5EOCL 1L7TL 1QBML 1MELA 1K4DA 3QYCA 3VXNA 4K3JH 2VISA 1GC1H 4PRDA 2Y5EA 2JCCF 3PWLB 3MLWL 4P5KA 5BS0A 3MJ7B 3NN8B 2G75B 1AY1L 1FVDA 4AH2B 4HLJA 1MCKA 4C56D 5GIRB 2JIXD 1BJ8A 3EFDL 1H0DA 3SGKA 4L1HA 3FTGA 2VITA 5F8RC 4YWGH 1WAAE 4Q0XL 3U30C 2RHEA 4IOIA 4TPRH 5F3BA 2XONA 1P9MA 2UUDH 2ZNXA 2WQRA 3C60C 3TV3H 4N90E 5IF0B 4U0RC 5IW1B 3TCLA 3WIHL 5JLZA 1X7QB 4KHXL 1O5DT 4PBWD 3UYRL 1RK1A 1QBBA 3BQUB 4ELMA 3TYFB 3FRPG 3SKUD 4NOBA 5K9OA 3GKWH 4F37F 5E5MB 4X4ME 3KDMB 2BC4A 1KULA 3N06B 3DOSA 5KS9E 1UY3A 2UVFA 5D2NB 4DGVH 3QUZD 2NY3B 2AXHA 1IKNC 3C5JA 3EYOA 5E4IA 1DQQB 1NMAH 4BQ8A 1LK3L 1HHHA 1F45A 3WSOA 5I1IH 3ARBC 5DD5H 3VG9C 5JXED 3IDXL 3BGMA 2DWDB 1I8LC 1IVLA 5F88A 1BQHA 4OLWL 3RX8A 1MLBA 2ZKHL 1N0XL 1TTUA 3CPLA 5BO1L 2AV7B 4NUJA 5DJCA 3W0WD 2VMCA 2WUBH 2VLKD 5I30H 3ZL4H 3KYOB 5DO2C 3WS6A 3HG1D 2OQJA 4NKOA 3U46A 4ZZ8A 1YPZF 5MEND 1JGLH 5DXWA 2H41A 3WN5A 3S4SA 4JR9H 3VDBA 4MJ4A 2VE6B 3PWNA 3NPSB 4E41D 4F80A 4Y1AB 3HC4H 1FC2D 1LDPH 4UB0H 1W8NA 3RWDB 1I7UA 1OB1B 4HWZB 1QVOB 3BW9B 4NO2B 4HS3A 4U1KB 4YXKH 5J13C 3S3PA 4OZHE 2DL9A 3WHE1 2EC9U 4FQXA 2HMIC 3QIWA 1G9NL 1T20B 2H8PA 4DCQB 1F4YH 5T3ZE 4ONFH 3NNGA 4O2FA 5KSUB 2DQHL 2NY4B 4HH9B 1CF8H 1P7KA 2QADD 4GMSL 1F13A 3BT2H 2OMNA 3PABA 2V72A 3KPNB 2Q6WB 1UZ6F 5E8OA 1QOKA 1WWAX 3DMMD 2A0LC 5CJBA 5F7YC 1N59B 2VXTL 1HDMB 1A9BA 4FABL 3CXDH 2V7NA 2VLMD 3RVTC 3TJEH 1J0KA 4QRPE 3QEHB 1CZTA 4K8RL 3RPIA 3T65A 1YY9C 3VCLA 2W95A 4QGTA 3ARDA 2J8UE 4JKWA 4ZS7L 2DJUA 3O3EB 2DLHA 1Y0LB 2YXMA 4OZFA 5ESAA 4NBXB 2UWEA 1OAKH 3QO0A 3HB3C 4FXKB 1YEFL 2B1HH 1QLEH 1RZ7H 1ZLVK 3Q6GL 3FFCB 1UYWH 1FFPA 5D5MF 3I75B 3BEVA 3CLFL 5T1DH 3V52H 1JNJA 5JXJA 4LGSB 2FZ3B 2EZ0C 3AS2A 3SO5A 1B6UA 1I1AA 2MJWA 1FYTA 1CE6A 4YHIA 4LOUD 3S34H 4WFFD 3MA9L 3QXVA 1VFOA 4OT1H 3C7FA 1YEEH 4LDOB 1EUUA 2J8UF 4MNHA 4DVBB 4I0PC 2H2SD 1T5WA 2HN7A 4X6DF 4ZSOA 4JG0L 1YMHB 2KH2B 2BY3A 3R8QA 4O9HL 2G5BB 2VZQA 1N3NB 4EDWH 4NSKA 3SJVA 1KC5L 5DK2A 4JANA 4GXVH 4ZXEA 2HVKB 3GDBA 1D5MA 1NUNB 2VXUH 5D1ZD 4PJIE 4L29A 2VITB 1I1FA 4TQEH 4PBXA 3RUGF 5A40E 1RZIA 3WFZA 2NLJA 2XTJB 1UCBL 3DTXA 5SWZB 1SHMA 1MY7A 5L88H 3QNXA 2YD4A 5IW1A 1AR1D 1YY8A 4Y4KA 5IROC 1I9RH 2NXYD 5J1AB 1ETZB 4NNXA 1AKJA 1IEBA 4KJWC 1UXXX 4R4FH 4DEPB 4WDIA 3FN0L 1T7ZA 2N4IA 4NNPL 4PG9A 1A4JB 4HCRL 1IKFL 2ZUSA 3I85A 3CFDB 3R06B 3P9LA 2J1AA 4HFUH 3BH8A 4GS7C 4P2OC 1SEQH 1NBQA 2OTUB 5GIRA 3SDAD 1FNEA 3V4UH 2NY0C 4PJHB 3I2CL 2W9EL 3SDAB 3CDZB 3T0WA 4FTVA 1PG7W 1T03H 4LCYB 1S7QA 2AS5M 1JUFB 4X83A 3G5ZA 4DTGL 4PY7A 3C6LD 1WC7B 1SMAA 5JLZB 3JTTB 2F58H 2G60L 1FJ1B 3B8SA 2V2XB 3H7LA 3GK8H 4U6XB 4WW1A 1OGAE 4OZOA 1KCKA 3HNTL 3HZKA 4DTGH 5BQ7A 3UTPD 3C2SA 3EYVB 3O41B 4HUUA 1B6DA 4CDGC 5IR1A 1BVZA 2B39A 2CJUL 4RIRB 1X4ZA 3L7EA 3UTSD 5JOFB 2AJZB 1RURL 3JVGC 4I3SH 2EXYD 1UJ3B 3QUZB 4CMMA 4XP4L 4MD0A 1MJUH 3RX7A 3VFTA 3IJYB 2KZ1B 2X4SA 3WL9B 3L9RA 1JE6A 2OL3L 4NNYB 4U1LA 3C5ZA 4HBCH 3U83A 2J1TA 4J2XA 1MQKL 2VR4A 4YE4L 3MV7A 1WEJH 1RUAH 4XUOA 3N9GL 3F12A 4YO0A 5F9OL 1NMBH 4F57H 2NTSP 2ZCHL 4LCWB 5DVNA 5DUBB 1WCBB 4PJAA 3DVGA 43CAA 4E9LA 2HP4A 4K3DL 5KVGL 1CYGA 1LNUA 3ARDB 4LCWD 4E0RB 4LHUB 2D9QB 3WQBA 3D1MC 2CGRL 1LEKA 3U2SB 2ADGA 2Y6KA 1UZ0A 2HJFB 1PVHA 3VXRD 3NACH 1T3FA 5KSBB 3BSZL 4LQ1A 1H5BB 5H94A 4RISH 4AAXA 1MH5B 1PKOA 2ICWB 3QUXB 2FL5B 2QQKH 1QFOA 5A2JH 1G1YA 1N7MH 3O9WC 5BV7L 1E4XH 4WHTB 1UA6L 5FUZH 3UTSB 1MHCA 4Z77B 4XMKL 5DJAB 2DI7A 2EXYC 4MNQA 4AIZA 4DVRH 4P59L 3GM0A 3GJFH 2PTTB 5E2JA 1ZEAH 3MUZ1 5DQDL 4NBZB 3LV3B 4G7YH 1AP2B 4DZBB 3RWHA 2VLRB 3RAJL 2WV3A 4KKLD 4KXZH 2D7TH 4DGIL 1NUGA 3RA7L 5HHXH 3V52L 3OKKA 4UNVA 2EE3A 5EWIH 1AFVH 1OOAA 4NO3B 2UWEF 4KDWA 4E42B 3ARFA 3GSNB 4XHJD 3MLVH 3CSPA 1OM3H 2FR4B 2IANA 3QEQD 5LAXB 5CWSB 5HYFA 5MERB 2WZEA 1DQLL 3HC0A 1J1PL 2VDRH 1MQ8A 3KYNA 1QRNA 4B7LA 3HG1A 3UTZB 4LLVA 3VFPB 3HAEH 5HYJD 4KI5D 4ZZ5A 1MUJA 5FDWA 5C0CA 4XCEB 2AK1H 2V5YA 2CK2A 2QSVA 4L8BA 5J1XA 4ZSOE 2I26N 2Q76A 4DK3A 1CFTB 2B4CH 4PBVC 5I1DA 4PP1C 4KQ4L 4OV5B 5FCUL 3BKCL 4ONGL 4RAVA 4XCNB 3BQUC 5E7BA 3KDMA 3VG0L 5ACZA 2IG2L 4U0RB 2CIKB 4W81A 3BJLA 3RY6A 4M1DH 3FMGH 2ATKA 4XC1H 2VXVH 1WWCA 1NGQH 2VAAA 1QKZL 3PHOB 3MRPA 3NCMA 4Y5VA 1ZA6A 4KKLC 4F2MA 1KCLA 2VDQL 3FAXA 2HFFB 2CLVB 1MAKA 3SDDC 1LDPL 3CFBA 1U8MB 4UB0L 3MACH 1I9IL 4NUJB 2APWA 4OCSL 4Y1AE 1JNNL 4NM4L 5EULV 2Y8KA 5I17B 3G6JF 3LB6D 1ZKAA 4ONHA 4G6FD 3CLEL 2P5EA 3LPGA 3QEUB 3OGSA 2R2EA 4K8RC 2CIIB 1JIBA 1GGBH 5KVGH 3WSQL 1Q1JL 1XIWC 2IFFL 5AYUL 3VRLF 1A0QL 4RX4D 5ALBH 3CQOA 3IGAA 3PWNB 1TNMA 2J1RA 4F7MB 9CGTA 5ERWB 3SE3C 2ZKHH 3QQ3A 4UT9H 5D1XD 3OAZK 2WAAA 1QSEB 3ORJA 4U1KA 4PGBB 5EUOE 4IRSC 4YHZH 3THDA 4XP4H 4A41A 1NGWB 3Q48A 1OD9A 5SWSD 3F12B 4YO0B 5DEGB 5TH2A 4CBPA 4CJ1A 3ULSB 3JWOL 1JZ4A 4DGVL 4MVBD 1TPXB 4HFWB 1LE5B 3JV6B 4M7JH 1TPXC 3T1WA 1G9MH 5KG9A 3I2JA 3D5OF 1EK3A 3TIEA 3DVNB 1KEGL 4ZPTA 2PYEA 5T5FL 2EDRA 1F4XL 3TVMB 3WE6B 4W4OC 3L3JB 1UADC 4MD4A 1PLGL 5JZ7D 4M6MH 1UB6B 4ODHL 4Y88A 3UJIL 3V0AC 3CFCH 4C4KT 1BQLL 4YDVB 2HJFA 2PTTA 1CFBA 3BPCB 3LQMA 1H5BA 4CMMB 4RWYL 1UWXK 3MRKB 3NFPA 1WTGT 2C3GA 3P4NB 3QUXA 1AGBB 1X5LA 1GC1L 5T5NF 1GAFH 4Y8AA 1OF2B 2HG5B 1MPAH 4JB9L 1JMXA 1I9RL 1DDHB 1RHHB 4U6VL 3P4OA 1C08B 4WI7A 5DJ8B 3QT2A 4OQTL 1XZ0A 2IAND 4WJ5A 1J0YA 2J6EH 1JNLL 1K85A 4LLVB 4PJHF 3CFDA 4JQIH 5E2UL 1WIUA 3HNMA 2XWTA 2Q86B 3ISWA 4YHNB 5E9DA 2P24B 3H9YA 5GS0C 5JHLL 2Z4FA 2DLIA 4FFZH 1TTFA 2HA1A 3IETB 4KFZC 1WAAA 4O9HH 2F9BT 3QIBC 4H1LH 4PJCF 4ZUUA 4HQQL 4D3CH 3O2VL 2W46A 4YDJB 1QBAA 1MIML 3T1FB 4M43H 1JHLH 2PKDA 4NC1C 8CGTA 4K3EL 3LQZB 3HE6B 5BVJA 4ELKA 2YKLL 2M8XA 3NIFE 3SE3A 4XXCC 5DJAA 3DV6B 3SKNA 1PKQE 4OM1L 8FABA 3WFDH 2GTZB 3OL2A 4RAVB 5DK0B 1EFXA 2YMXL 3R06A 5T1DL 1C5CL 2DTML 2LFGA 1DUZB 2NW2A 1O8SA 2WZ8A 4QDQA 3GMPA 2ADIA 4IJ3C 4U1GB 5E8PB 4UTBL 43C9A 4OI7A 5T5NG 4U1MA 5EU4B 3A6BL 1GUIA 4OIIL 3GHBH 3WIIH 2NW3B 5BRZE 5C0IB 1B2WH 4TXWA 2NY0B 2VERN 3HAEB 1OSPH 1WFOA 1Q9OA 4K7PY 3ULVE 4YC2B 3GMLB 1KXTB 1F3JB 4EXPX 3MUGB 1RIHH 2DQIH 3CK0H 1BX2B 5GJSL 4MZ2A 4L4TE 2BJMH 1CF8L 5D7SH 5DRZA 1Y6KR 1JPST 4H25A 3KXFE 1XF5B 4PF1A 1IAIM 1MY5A 1ZTXH 3HFML 3VXME 5IHZA 2ZUQB 1X5XA 1FFNB 3MFFB 4NDMA 4UAPA 3VJ6B 5CJ5A 1T1YB 2VZRA 3BD3A 2QSQA 3TZVC 5L9DL 4LFHD 1NJ9B 4JKLA 4PJ5E 1A3LL 2K1MA 2ENSA 4F2MB 1JHJA 1NUFA 4OD3H 4JJHA 4QHMA 3RVWD 2KKQA 1KJVA 4J4PA 4OD3L 3JWDH 5IQ9B 5HVWA 3UTTE 1XC6A 4F8TA 3ACHA 1DL7L 3L3KB 4FFWD 2EKJA 1AR1C 5LXGL 4KV5F 4LQFH 4Y16A 5E2TL 4OUUA 4UBDC 3TT3H 3UPRB 2V7HA 1INDL 4Y4HC 2CDFB 1GZQA 1CDYA 1J0IA 1L0QA 2VABA 4Q6IA 2AJXH 2MCG1 3NIGE 4AT6A 2VR9A 5D7KE 2NXZD 1DVFA 1E4JA 3MRCB 3V7AG 1LK3H 2XACC 2BNUA 5ID0A 4QDSA 4MJ6A 4QXTA 2ZWLT 4PJ7F 2D03L 3GHBL 2A6IA 3E8UH 4YDVA 1D6EA 1EJOH 5B8CC 1I3UA 2EKSB 4ZAKC 1CDUA 3T2QA 1H6XA 3FFDB 2BNRD 2W3JA 5SWSE 3DX9A 3B83A 3ZE2E 3RUGB 2NX5E 4X98A 5IFAH 5DHYA 1FCGA 2X1QA 4TNVK 3S37L 4X99B 2X41A 2HFEB 2FHCA 2RQ8A 1ZSDA 3WFEL 3P30H 2DDQL 4YFDB 4KHXH 4N8VA 1BBJA 5BZWA 3IETA 1XGRA 4UOW1 1E4WH 4YHOL 2NYYD 3QDJD 3ARPA 5GRUH 4H26B 3T3ME 1KB5L 3FOMB 4BXSV 1LNSA 2EYRA 4XBGA 4D0CB 3VH8A 4HCRA 1MAMH 2J8UA 4K71B 4OZHF 5G05L 3V5DB 3LEVL 1JHLL 2ZUUA 3LN9A 2M26A 2PXYD 1YECL 3HE6C 4KKNA 4C59B 1ZT1A 4N5EC 4NQEB 1KUMA 5DC9B 4XCFH 1P6FA 1SEBB 4ONHB 2W87A 4YDKH 4R6UA 2DQJL 3MLWH 3BJ91 4UT6L 4J1UB 3VE0B 2OKXA 2FX7H 4LKCA 5JHLH 4MXVF 4O2EA 3DUSA 3T2NH 1FL5A 2JB5H 4U31A 1LO4H 2R4SH 4L4JA 2OI9B 2L9LA 1A7OH 2VAAB 3IXTB 1JNLH 4JPIB 1GNYA 5F7NC 1R3LA 4ZD3L 1IBGL 4PS4H 1KJMA 3BEWB 3VXQA 1RUKH 5GGVY 2HLAB 4WO4A 3QUMH 2BY1A 3RIFF 2ZCLL 2CK0L 5HY9A 2BNQE 4CU6A 4A42A 2PR4H 3M8OL 1IM3B 5JORB 2W0FB 2R8SL 2AV1A 4XXDA 1HHJA 1U92A 3QI9B 2HRLA 2X9XA 4Q97A 1S9VB 1SJHA 1XCQB 3QHFL 4PJ9D 3SPVA 3TCXA 5F1NB 3ARBB 3ROOA 1CFNB 1T21B 5EORH 3X3GH 4M7KL 1DFBL 4KJPC 4DKFL 4E41A 1X7QA 3FRPA 1BFOA 1YYML 5ERWA 2NY6D 3PGCB 2W9LA 4Y4KC 5IROA 3MUHL 4RWHA 3HAEG 3TH2T 3D2UA 3VA6A 5F97E 5KVEH 3DRQB 4J8RB 1NCWH 2E8YA 2NTFB 3B2VH 4NQTA 4P2RA 2XRAH 3IDMB 1W0YT 2FWOB 3N1PC 4YBLB 4LPLA 2XG5A 2PF6A 3ARDD 1MFAH 1KFAL 2FX8L 3TBTA 1TITA 3C87A 5C1MB 4KDTA 5EO1A 2K7PA 4Z7VB 3U48A 43C9B 2P46B 3PWPD 1F42A 4N5ED 3SQOL 4BFEA 4I9WD 2VDLL 4Z7OE 4M6AA 4HIXL 1OF2A 2QQNA 3EO9H 4ZYKA 2XKSA 4FQ2L 3D0VB 4OCYL 4PTUA 4NCC2 1CICC 3V95A 1EHXA 3BKJH 2YA1A 4F7PB 5CBEB 4WRLA 4DQOL 3QQ4B 4Y19A 2RAMA 4PJ9C 5B3NA 1O59A 1FVCA 4EVNA 3MJ7A 5KS9F 1XGQA 1A6ZA 2WBJA 3NQHA 1SYSA 3MV8E 5I8OL 4O02L 3O4OB 2A74B 1GGBL 2R23B 4L8SC 3QO0B 4FXKA 4ZUUB 3MLXH 4OLUH 3V0WH 3O4OC 2IALA 3ABZA 1RJLA 3ZZ1A 2XQXA 2YK1L 4JFED 4APQB 4PGCA 2MNUA 1WKYA 4W4ZA 1WFUA 4N0UE 3ARDC 4W6WB 1DDHA 3DSFL 3SGJC 1VPOH 1RK1B 4ELMB 5E5RB 1PSKL 4YHIB 3D25A 1H3GA 2AXJA 4KVNL 3HUJF 4WJ5B 3I6KA 3ZE1E 2YC2A 4LVHB 4CNIA 2JIXA 3OEAA 1EJ6A 2QLVB 1BD2B 1QBLH 3V0VB 4PGDA 2ZSVA 3D0LB 2C1OB 1XMWA 5FB8B 4GH7B 1HIMH 4LSQH 3GMPB 1NBZA 4Z0BH 1V7ML 4WW2A 3CFIC 2YZ8A 1TJIL 1BEYL 1MCWW 1X6NA 3FTGB 5BOPA 5EJZB 5JUEL 4HX1A 1AJ7H 2APXA 4JFPB 2Y36H 3RPIB 3T65B 5CP7A 3KJ4B 1FDLL 4O2EB 3UESA 4H5SB 2J8UB 4LU5H 3HAEA 1KJ3H 4X6FB 3GMLA 2GJJA 4ZDHB 4WI5A 2F5BH 3CCHB 4XHJC 4TSCH 5HBBA 4B0MM 4PJ7A 2DWEA 5F70A 4KI5M 1A21A 2HFTA 2ADIB 1CK0L 4KY1L 5T1MB 3P3YA 1ZHLB 4L4VD 4ACPA 1KTDA 1QSZA 1CN4A 3AREA 5DHVH 2FYYA 2UUDK 3WUWA 1JI2A 3QWQB 5F7FA 1S7VB 1XR9B 3U36B 5FYLH 3BQUD 1UA6H 2WP3O 5L2JB 2ZSWB 3FO0L 3RBGA 1N6QL 1G9EA 3OJMB 2J8HA 5CILL 4WEBL 5F1KC 1YYLH 2J12B 2X42A 1AIFB 2D4FA 4S0SD 4APQC 1U8PB 4JANB 2AV1B 2EDNA 3B9KA 3NH7H 4GG8A 4HS8L 2X4QB 1SJHB 4N68A 3UJJH 1UXZA 2QBXA 2E7MA 1QTYT 2JB5L 2YN3A 3LHPL 3HZYA 4YK4C 2CXGA 2PN5A 2R1XB 2Y06L 4LSRL 1ZXQA 4Z9KB 3G04A 4LSUL 3PP3K 3OKOB 1XGTA 2DQCL 1UY0A 4OZGB 2GJ6B 3WFCH 1Z2KA 2VNCA 1JTOA 5JQHC 5DVLA 4FQCL 4XNYL 1E4XI 4C58B 3TT1L 2ITCB 1MAML 5T3XE 1CT8A 3GMQB 3CX2A 1R5WB 4JFDE 4NN6B 2EYTA 3AXLA 3DI2B 3VWKA 2DLTA 3WIFA 1FE8H 4PG2C 1X5YA 5I73C 2XFXA 1JYVA 3TH3T 5EJ1B 1FFOB 4LRNL 4PY7B 3NCEB 3BPLB 3ZDZE 2R23A 3SO3C 4TTDC 5F7EH 4PJIA 2N56A 4NKMA 5E5UB 5FM8A 3UO1L 5CEXA 1MH5A 2GW5A 2D03H 4H88L 5DD1L 5TDPA 4JG1L 4BSWA 3DPBA 1NMCC 5D72H 2X44D 3ARXA 5MENB 5F9JB 5F1IB 3A23A 1R5IB 3FQNB 5GSRB 1FFQA 4QOKD 5FYJE 4M48L 2GCYA 1F58L 4PG9B 3IU3A 5D1XC 3WLBB 4X7CC 4JPKL 2VLRA 1BBDL 1BZQK 4Z95H 4YQXL 1JBJA 5HHNB 5C6PB 1FAIH 2GQHA 5EBWB 3O4LB 4M1CC 1E6OL 3F5WA 4OZFG 5EPMA 4Q9RL 4CVWA 1D5XA 1I9JH 5FA3B 3E6FA 4S10A 1FG9C 1P7QB 4LVEA 5FKPA 3NJVA 4PRPE 4R3SA 5CINL 3DURA 3SDCC 3EO1B 1WC7A 3TNNA 2IH3A 1NGYA 3DIFA 4FXLA 1A3LH 1U95A 2X4OB 4TUOB 2VXUL 1S7UB 4ZFZA 5I19H 3O6ML 4FXGA 3I2GA 1WT5A 3SPVB 3V7AE 2DN7A 1NAML 4Q74A 5CEZD 2ATPB 3P2TA 3GEWB 4HJ0D 4QRQA 1E28A 4XNQB 1F00I 5H2BA 1D7FA 3GSVA 4M00A 1A6VL 4JN1H 5L8LB 4NN5C 4WUUD 2ZUWA 1FGNL 2JF1A 1Q94A 2NY5L 3O8XC 4GKOA 4MGSA 5I15L 3LSOA 2RCSH 4KV5E 1JFQH 1AGEA 1KB9J 1G7PB 3VG9B 1FSKC 5CKGA 3JBG7 2YPLB 1NPUA 4P2QD 1UWXH 5EA0L 2YFUA 2F5AL 3WUWB 4LF3B 1BQHB 3OX8A 5D71H 4L8SA 2UZYB 5ETUA 2DTMH 1MCRA 5I6XB 1A7QL 4O51B 4LASL 5A2LH 4RMRA 4OM1H 3SE4C 3ARTA 4HK0B 3CXDL 4FABH 4M6NH 2L7JA 4NQCB 1QR4A 1YN6B 1J9CT 1IM9A 1RUQL 3I6GA 4QHKJ 2QKIA 1FIGL 4XUNA 5C92A 3DGGB 1WIPA 4RQQB 1K6QL 1XGYL 2Y5TB 4K94H 3ULUF 1MOEA 4HEME 4P5MA 2IMNA 2GTWB 5EOTB 4BFIA 1FNLA 5I71B 4XRCA 1YN7B 2NY7H 3AS1A 4Q7DA 5JOPE 4HIHB 1YMMB 4O58H 1VACA 2AVGA 4Y2DA 2APBA 3JV6A 4ODVH 4PJXB 4FZ8L 1G0DA 3O45A 5L2JA 3MNWA 5JPMA 3IF1A 2OP4H 5KSAA 3NABH 5AAMA 2Y07H 3LS5H 1FO0B 3O3BA 4LLWB 4KTDH 3TO4C 3B9KB 3IFOB 2W38A 4KRPC 2EYTB 5GZND 5LCVH 2QJDA 4DUVA 1YEIL 1GAFL 1NBZB 2DQEL 2P42B 5ACZB 4G3YH 4HMDA 1BHGA 1F2QA 4IMKA 5EC2A 3MV9E 4A4AA 1S5HB 3RWCB 5FYJL 1QLFB 4LPCA 1U3HA 3FN9A 4WHTA 1A6VH 3RTQB 2BY2A 3VMNA 4GAGH 4LARH 5MEOA 4ZXBC 4P5TB 3LRGA 5FUOL 1ZLVH 2ZEXA 3U6RA 4F7TB 3SBWA 3CMOL 3ALXA 2WUCL 3I75A 1MJ7L 2C3XA 7CGTA 4XVSL 2YA2A 1XCTB 5BS0B 5A16B 2QSTA 1TVBA 3INUL 2VUOA 5MERA 1KPUA 3CAFA 5ADPH 3O3UN 4JO2L 4ZPTB 1U8NB 5C08B 3KYMA 5SX4H 3OKDB 4EOWL 5B4XA 1T1XB 1P53A 1JN6B 2J88L 4PJDB 4EUPG 3QDGB 3GMOA 3ZE2F 4ISVA 2F8XC 2EZ0D 4UIKL 5CD5D 4X6CE 3U0TB 4Y4FC 1A02N 3C08L 5JHDB 3RWEB 4OGAD 1DBML 4N5UA 5E8NA 4N0UB 3NVQA 5DWUH 5KOVC 1B0RB 3WCYA 1MF2H 4JRYD 3IRZA 3U4EB 3M17A 3SDXE 3F6IA 2E9WA 1II4E 2FB4L 5FA3A 1T0MA 2R1YA 3W9EB 3C7EA 3ULUL 3TBYB 1A4JA 1HH9A 1YEJL 4Y4FA 3TPKA 1CZSA 3MV9D 1HK6A 1I9IH 4Q9BA 5E03A 4GAYA 2J5LC 5AWNH 5DZOA 4YHNA 1LD9B 2ZJSH 5I66B 1N64L 4AEHH 4G42B 4I18A 3OWEA 4R8WL 2WUHA 1K8IA 1TJGL 2OSLB 4X5LA 1CWVA 1X5AA 4WGVB 1N2RA 1BVLA 5C3LD 1VB9A 4NRZA 2XQYK 5CD5C 3LD8C 2IG2H 2PO6C 4POUB 2JKXA 4LDEB 4GRMB 4V2BA 3RY5A 1UT9A 1A1MB 4X7FC 5M94B 4PV9A 1MLCB 4BH7A 3WF0A 5DTFA 3TA3B 4ZXBA 2MHAA 3EW3B 1G7LA 1S9XA 4JHWL 2FJHA 3AVEA 4A6YL 1YUHA 5D5MB 2C7UA 1GHFH 3MRNA 3MLUL 3OMZA 4XT1C 1RZFH 4PJFF 4G8GE 1EEYA 3OF6D 3KG5A 3NZHH 1U8LA 4RDQF 4WTZA 4HV8A 2X4RA 1KYOK 2X70B 3NFPB 2CRYA 1IC5L 3D39E 4P0DA 3RIAK 5K9JH 2IBGA 1MI5B 4IEFB 1OCWL 4YPJA 3RWJB 1KIPB 2ICWJ 3OJDB 4O4YL 5DUPL 2OJZH 4X0KA 3MNWB 2EDXA 1AGDB 5EU5A 4GAFB 5CZVL 3QEGL 3TO4A 1DBBH 4OM0L 3EYQD 1RIUL 3QXAA 2P5WA 3OPZH 4M9OA 1DBBL 2B4KA 4Z7UA 5TQ0L 2ID5A 3K81A 1Q38A 3VFGH 3WNMA 2VLKA 3CDYA 3I50L 3V4VL 3RZCA 3G5VA 3FB6A 3BSZH 4PJBF 3FB7A 2ZEZA 2GTWA 5EOTA 5GS3A 3QJHB 4X9IA 3N1GC 1F90L 4HIHA 4FNLH 4OV6F 4OCXH 2OJEA 4OLXH 1ULPA 3IU4H 4OUOA 5JOPD 5JHDE 4HWEH 5EU4A 3FQUA 4Z18A 2N1KA 5CUSL 3BH9B 3EOTH 3BGMB 1UC6A 1T04B 2CDEB 4Y16D 4OGXL 2F74A 1NC4D 1PX3A 2EXWC 4P2CG 3LD8B 3RIFK 1XR8B 3LRHA 2VLRD 3T4AA 1TJIH 5HXMA 1T2QL 2ILLA 5HI3D 2A9NL 3M07A 2R69H 2DOCA 2DRUA 3WNNA 5IB4A 1UWGL 3MX0A 2R69L 1OF3A 3VDAA 1BZ7A 1QZ1A 3GSRA 1AD9A 3W0WB 3QEQB 4MD5A 4D0BA 3MA7A 3RUGE 4G80B 4LPUA 3BZFA 5ITBL 3ZHLA 1S7RA 1VPOL 3DXAD 1A5FH 1ZWIB 2QQLH 4O51A 4HPYH 4WI8A 3QDJE 1INQB 1NJ9A 5GS2D 3MNVB 4U1HA 1G7MB 1FIEA 2AP2A 2R2HB 5EOCJ 4W6XB 2O5XH 4PJ8B 2ZCKH 2XKNA 5JORA 5IHZB 3EZJB 1D5IH 2XY2A 1VEOA 1CXLA 3AB0B 12E8L 4HH9A 5DLML 3MCKB 1RUML 1LDSA 4JO3L 1DBKH 5DHVA 4BH8B 1J8HA 3KNBA 1OWWA 4M4RA 5J12C 3QHZH 5CJOH 1UVQA 5TQ0H 4XUTA 4UIKH 3GSNH 3SDXF 4YGAB 3MCG1 2A73B 1Q9OB 1F3DJ 3L95A 2VZPA 2CO7B 1U41A 5D1QB 3QEGH 1QO3B 4XPTH 4Y5VC 1GOHA 4XCYB 3CH1A 3VXTB 4JO2H 5TDNA 1KBGH 4GRLA 3VFNA 2WIIA 1TZHB 1I7ZB 4RMQA 1EAPA 5GGUB 2D7QA 3P9MA 4UIMB 5HHQB 4P5YA 2W1WA 3CNKA 3HHRB 1FZMA 3EDJA 3LOWA 3NZHL 4N0YL 4MB3A 4M7LT 4Z7OF 4TNVF 2D0HA 3MJ9A 5KVEL 2ICWI 2JJWA 1MLCA 1UG9A 3TLRA 1PZUB 4GW4B 1MFEH 4L4TB 5HYJE 1IAIL 1PQZA 2DKMA 4MNQE 5FHBL 5EIIA 4EJ1C 2IPUG 3GSQA 3S7GA 1WCBA 2UZIL 2FX9L 1X5IA 3EYUL 43CAB 3PGDA 5J6GB 5F1OB 1DQDL 4U3CA 2DTSA 3UPRA 5KG9B 2XA8H 4JM2D 2Q3AA 3OHXA 3O8XD 3CLFH 1UWEL 1KIPA 5ENWA 1I8KA 4GRLC 4DGYH 1JRHL 2VTFA 4IOSD 4YHLL 2R0LH 5AG8A 1G1CA 5GRVK 4MOAA 1FZOA 1MEXL 3GHEH 3RDTB 2OJEB 3U0WL 5T3XL 3QR2A 5C0RL 1A7OL 4JFFB 3QULA 4F7EB 1FL6B 3MRQB 3MRHA 4JVWA 5DC4B 3UTPE 1C16A 4K8RH 1V3JA 1YEJH 2EICA 4WU7A 4RDQG 5JW4M 3S35H 2FX7L 1Z9LA 4ODSH 5BRZD 1MI5E 3TFKD 5HYEA 1IQDA 1MCLA 3QFJA 1KT2A 4ODUA 3MBWA 2B2XL 1I7TB 2BMKB 2FATH 2IPKB 5DWUL 2ZOLA 1S7TA 3IXTA 4KRPB 4D0DB 3KPRD 2P48B 4QTHB 3WNOA 3TO4B 4FFWC 1H6YA 1T66D 4L3EB 4ZAKB 5I8KH 5CBEA 4F7PA 4X4XB 4HX1B 4M6NL 5JW5A 4GO6B 5HHVL 1JN6A 3U37A 3NN8A 4YC2C 1QNZH 2VMFA 4Z7WE 3HNVL 3MNZB 3TWCL 2ORZA 4IS6B 4BZ1L 1NEZA 2DDQH 3PWJB 3HOBA 4GSDL 1CFSA 4XNXH 4PJFA 5CZKA 4M1CD 4XCNA 4G43A 5ICYA 4I48B 2B1AL 4JFOA 4X6BB 3IJHB 4QWWD 2ARJB 2VJXA 3C60D 5IJKC 3QJHA 1O7VA 5IIEB 5IVXE 1AD9B 1NDGA 4JM4H 1JGLL 1WVZA 3GGWA 3DV6A 3MODL 2VH5L 2D7PA 2NY1B 2J2ZA 1EO8L 1ES0A 4I0PB 1GZPA 4RX4A 4MCYA 3GBML 4LEXL 1S9KC 3RRQA 1G6RB 3AY4C 3OJVC 4OCWL 3TFKC 4U1NB 4LARL 1J0JA 1XGPB 2VDNH 1JJUA 2JD9A 3GSUA 1RY7B 4ORZC 5IVOA 3K4ZA 1MWAL 4G42A 3MRIA 4MDIA 3QO1B 3GBMH 4LEXH 4LCWA 4P48A 2XZCL 5EC1B 2WO3A 3WFHB 5I16B 4V1DD 1A2YA 3AUVA 3TBVA 3DETC 35C8L 1VFAB 1ND0B 1BZ9B 5EBMB 5C08E 5I19L 1R0AH 2DMKA 3E0GA 4XWOD 3QEQA 4D0BB 1VCAA 1GRWA 3D2UD 2VL5B 5GGUA 5H8DA 3SE8H 4QRRA 5IEHA 4GG6E 4E41B 3G04B 3UBXG 3GI9L 1MCPL 4X9FA 2GJ6A 2JJVA 1W0NA 2XNAB 3H9HA 4JY4A 3SJVE 1VGKB 3B9KC 1KCSL 5DO2D 3STLA 4OIAA 4IOFC 5GPRA 3PJSB 3ALWA 1CR9H 3BPOC 4K9EH 4QWWC 4XP1H 4APQA 5L2KA 1NANH 1NFKA 4ZO9A 5L9DH 4M93C 3VRJA 3F58H 4OI9A 3ARUA 5C0AE 4HUNB 2VLJB 3QQNA 3DUUB 3QP3A 1FZKB 4Z78A 4JDTL 1XF4B 1L0XA 3RHWF 2A74A 4ZTPH 15C8H 3OG4B 1U8LB 5DD3L 1P1ZA 4HKBA 5IV2A 5DI8B 2DYPA 2BERA 2CLZB 1RIHL 3IJSA 3ZSTA 1IGIL 3GSNA 2FR4A 1SJEB 2BGPA 4M5YL 3OR6B 5HHPA 1KTKE 1LO5B 1AXTL 4PRID 4P2QE 3MRRA 3HG1B 5EOCH 3HPJB 2HAZA 4BZ2L 1J5OL 3RVUC 5CP7B 4H88H 4RNRB 5DD1H 1YNKL 2DQUL 5F7DB 4BSWB 3K2MC 4XNUL 3RPKA 4L0PA 2YHGA 2W1NA 2V5DA 1H0DB 3QXWA 2Q76B 4I0CC 4P3WA 1P5VA 1UEYA 4MA3B 4Y7MA 2JTDA 3MREA 5CCKL 1OT2A 4K9EC 2XICA 1LP9B 1XGTB 2CDGB 4N90D 4UDTA 2R0WH 1WJ3A 3VGHA 4I0KA 4Y4KD 5EO9A 3L3OA 3CGTA 2BSSA 5JQ6H 2ICWA 3MJ9H 3B9AA 3QIUB 4RAUB 2XA8L 4L8DB 2ARJQ 4K94C 4QYOA 2FO4A 2VDMH 1K9TA 4XWGH 3UTSA 3V5HA 4TNWK 1IT9H 2B20A 2R2CA 2YPKA 4RFOH 2FX9H 3EYUH 5GJTL 3SKMA 3TT1H 4M1GH 4FHBD 4TSAL 1JGVL 1OW0A 1T04A 2M2DA 2YWYA 1ULOA 4OZHA 4HKZA 1YMME 5CJ8A 2VCCA 5I1HL 3VRIA 2OXGA 4M03A 3I3DA 2ZUXA 3SJVD 1FORH 5E6IA 3KS0H 3QDMA 3S97C 1RZKL 2XZZA 1M7IA 1XIWB 4CMHB 4P5TC 5DR5H 1KGCD 3MV7D 2R2EB 4JFOB 3UJJL 4Y0GA 2J3SA 4PJBB 4PJGE 2HTKC 3RJQB 1OD7A 1QPXA 3FQNA 5CLWA 4PJ9A 1XEDA 3GIVB 5IG7B 3S4SG 1UY1A 1J05B 4MSWA 1G9NC 2R2HA 4Q9RH 4RWYH 5H37G 3GSUB 3TO2A 1HSAA 5AD0A 3WN5C 1DBKL 1BBDH 4YQXH 4MLIA 1PLGH 4G8GD 1A2YB 3TBVB 3DRTA 1U9KA 4ZPVA 4TSCL 3LZFH 5E00B 5IBTL 2VCBA 2OR7A 5L0QB 1UACL 5TDOB 5TF1L 1BWMA 2DIBA 1JNHA 5ETUB 2WDBA 2OTUA 5FXCH 4JG1H 1T89C 3QI9C 4YXLL 1JGUH 3FZUD 3E2HC 2J1KA 4XMLH 4KQ3H 3C09B 4S1DC 4Q2ZA 4PRPB 3ARBA 2XXCB 4EDXA 4HULB 2OCFD 4ZOAA 1TMCB 5C0DA 4OD2B 2VLJA 4OD1H 3S3SA 4NUGH 2H2SC 3AM8A 1AGFA 1YPZA 5CYYA 2PYFA 5DFVD 2FEEI 3L7FB 5GGTL 4WTZG 1JWSA 2XYCA 1VGKA 4MCYB 1U3HD 1T2QH 5F6IC 3WHXA 3KPQA 2FWOA 2XTJC 2Z8VC 4GW4A 1AC6A 1OTTD 3QIWC 1NUDA 4FQXC 5J56B 2A83A 2H9GA 4QNPF 3QAZC 2X4NB 4JFQB 2YS4A 5TH2B 1WSST 3UETA 2WINA 1ZT7A 2BSTA 2A77H 1S3KL 4ZOEA 4MHHG 1ZS8B 4XPHL 3IU4L 5KZCD 3UAJD 3LHPH 1OARH 3F7QA 3GI8H 4IRJB 4OB5L 3VRLE 2VXQH 1EEQA 2XXMB 1P8JA 4POYA 2NNAB 5G04L 2CPCA 1A3QA 5L2KD 4MNHB 2DBJA 4DVBA 5ICZB 2X4TA 3I2KA 3DVGB 3LN4A 4RBPK 4OCRH 3T1FA 2VOTA 5CILH 5DF0A 1CICB 4JFDB 3VFGL 4Y2OA 4OFDA 4PB9H 2L0DA 3C2AH 4YZFF 4UI2A 1MHPH 2HH0L 3TYFA 1L9NA 3VGAB 5DMKA 4JQXC 4OF0A 1V5JA 1MWAA 1LP9A 5ICYB 5GISH 4HC1H 1AO7B 2DM4A 2JCCA 3CC5A 1QFWM 2V2TA 4M93B 5D7IA 4X98B 3PP3H 4ODUB 4U49A 4HUMB 5FV1L 5HI5C 3V6OE 3IYLW 3OGCB 4F3FA 1I1AB 2FX8H 5K9JL 1HHKA 1WAAF 1RHHA 1ZSDB 1MFAL 2O5YH 3G6JB 4MNQB 4AIZB 4QXUL 3MXWL 3IDGA 1GH7A 4TOYH 5DK3A 5BZWB 3DMMA 1OP5K 4L3EA 4ZAKA 2J4WL 1OW0C 3OXRA 2ZSVB 3B2VL 1EHLL 3I02B 4I4WB 1ZE3C 4YFEA 1J1PH 3LEXA 3UX9B 4TOYL 4DKFH 5HD8D 4NSKB 4TUOA 2HTLC 1AD0A 3QIWD 1AFVL 1U8OA 1S7UA 4C56E 4X6BA 1WT5C 1JUFA 2D7TL 4DGIH 4GW5B 2C26A 4WUUA 5GRVL 4HG4K 3U4AA 1EVTC 1T5XB 2J1SA 3MJ6A 3AY4A 5IB1A 4ODXB 3KPRA 4QHMB 1NBYA 4Y5YB 4PGEB 5JPMB 1PFCA 5FYKH 3EGSA 1A6PA 4YH6A 5E2VH 5IQ7L 2PTUA 2H26B 1J8KA 4MA8L 3QJFB 1UH4A 3V0WL 1EV2E 4ZQKB 3VWJA 3BZEB 3KLDA 4DFHA 1IGTA 1YJDC 2GIYA 1S3KH 3FHAA 4AG4H 4PR5A 4O02H 3L6FA 3SDCD 1T1XA 5K9KB 3GBNL 1VERA 4NP4H 5ILTH 5JZ7C 2JE8A 2FJFA 4MMZC 4MXQC 5ID1A 4G6AC 1WEJL 1DBMH 1CTNA 4JRXB 4PUBL 1EH9A 1H3PL 1LO3L 3OEBA 3JV0A 1BX2A 3W0WE 5EDXA 5F6IB 5DRZB 4EI5B 1C12B 4GBXB 5GRUL 3AREC 1KJ2L 5ELIA 3SKOA 4HK3J 4MA3A 3IDJA 4GKNA 1KN4H 4WI2A 4HG6B 2ID4A 2J22A 2CJUH 3CVIH 3B2UD 3RL2B 3MOAL 2V6HA 1FFPB 4XTRC 4OBSA 2DLFH 1QLFA 1R3JB 1AO7E 5DDHA 1X5HA 2ITCA 5IVNA 3OJ2C 2BP3A 2EC9T 3N0PB 3RWIB 1OTUD 2JK5A 2XWBA 3CX5K 1HILA 1JK8B 1C1EH 1FRGH 4H26A 1MJ8L 2GKIA 3O2WH 3QIBD 2PW1B 2VWEE 4G6MH 3R1GH 1YEGH 2HKHL 4K7PL 3QEQE 5FUOH 4LSVH 1CS6A 1IAOA 3O0RH 4LLYB 3E6HB 5BS0D 2PO6B 3GGLA 2Z35B 3D18B 4MA1B 1MHHA 3O6FB 4HF5L 3V4UL 5FYJH 1MFBH 1TCRB 3SDDD 1YQVH 1KIQA 2GUOB 4LQFL 4H0IA 2VRAA 1A7RH 2R8SH 4NWTH 3VE0A 2ZXQA 5ISZA 3B5GA 4M3KB 3S6CA 3D3VE 3T0EE 3O3AB 3PF2A 1MCOH 2PNDA 5E70A 3JWDL 4EIGB 2H9GB 2KQMA 4Q9QL 4ZUVA 3WLBA 3FQUB 2Y07L 3LS5L 4W4NA 3C8KB 1NAEA 2WABA 2FGWH 3NABL 2YUZA 1VA9A 2Y72A 4KMTH 1FL3B 2DQFA 2R4SL 3C7GA 4P00B 4GUPA 5DR5L 1EO7A 3B9KD 3B3IB 4C55A 2E32A 4GQ9H 3VXRE 3DARA 3KJ6L 1MIEL 4KMLB 3L3GB 3IAQA 3QDHA 2CLVA 2K9UA 1LK2B 3T0XA 5E00A 4I2XB 1LEIA 2W65A 4LP5A 2IC2A 3G08B 3HR5A 3V8CA 5H35A 2KD7A 1B3JA 3CPLB 3OAZH 2HJLB 4G80A 4N1EA 1YEHL 1IT9L 5DJCB 1EDQA 4LASH 3TZVD 1A7QH 4P23C 4MSWB 3NZ8B 3MNVA 2LTQC 3HI1B 5C0CD 2V2TB 2J7MA 3FT3B 2E31A 5E4EC 5D5MA 3S37H 4MXWL 4RIRA 1ACYH 3JWOC 5D71L 5LGKA 5DRWA 1RD6A 5E4EB 5EO1B 1G7QA 4MXWH 4PREB 4QEGA 4YDLB 2BRRH 1P84J 3L1OH 5KTEH 2CDOA 4JFEA 5FKAA 1RZGA 4MJID 4NNYA 5DHVB 1D5BB 4BH8A 2WBKA 3TJEL 3WFDL 2MHAB 1UVQB 5LWYH 2VXTH 2RCSL 5EG6C 3SKJH 2BVTA 1AHWC 3K2UL 3U9PL 1U8IB 3D48R 4RGNB 1NGZA 1I3RA 1IFHH 2EDEA 4HQQH 2D9CA 2QQOA 5J11B 4JPWH 1XFPA 15C8L 5K9KA 3RNKA 2DBLL 5B3JF 2BVEA 1KOAA 1P4LA 4HK3N 3DXAA 4JGJA 2XY1A 3PIQB 3QWOB 4G9FD 3K1DA 4L3ED 4ZAKD 4I9WE 4JQVA 1UYZA 4KMTL 5EIQA 4TVPD 4ODXA 1XH3A 1G7IB 3MXVL 4L5FH 3NIGF 1B0WA 2A83B 1UZ8A 3DETD 3GI9H 4D2NA 4YGVA 5DD6B 5D7IF 5JW4N 3DX7A 3PL6D 3ACGA 1TFHA 5EIIB 5FGRA 3TYGH 3EDDA 1OVZA 1IGTB 4L4VE 3OKKB 2OZ4L 1XF2A 4KDTC 4UQ2B 1DE4B 3MLSH 3WS3A 2Y7QA 2YBRA 4FQPA 1Q9LA 3D87B 4KUCD 4Z95L 4C57C 5JDJA 4IUGA 3GSOB 4RGMC 2ADJB 5I2IA 1A14H 2E9BA 3O4LD 3RX5A 4K7PH 1CGYA 2YWZA 5EZJB 5D72L 2LS6A 4D9LL 5FUCE 4O00A 1GZQB 4K23L 1NLDL 2PO6D 2JELH 4X6DE 1VKXA 3EJJX 1OHQA 1W9SA 3KPTA 4AEIL 2X7LB 3D6GA 3HUJE 3EBAA 4PJ8A 5ISZB 4QHUA 4XC3L 5AEAA 3WIHH 2XWBB 4WU5B 1FG2A 2C3VA 3CJJA 4YEEA 2E3VA 4XVUD 3BEVB 5IFTA 3CU1A 4PRHB 1KSRA 4G6JH 1IAOB 4Q0XH 4R4BB 4HXAH 2A0LD 5SV4A 4OFYD 1ZGLP 4FQCH 4JO4H 4U1MB 1D3CA 3DO3A 2FDBP 5CD3B 3B8YA 4J12A 2IFFH 3KLHD 5D2LA 1R5VB 4NN6C 4JCMA 3V6ZB 3RWGB 3VFMB 4NN7C 4PY8J 4RGNE 3PNWA 4P2OA 5CKAA 1NDGB 4U6HA 3S36L 1P2CA 3LN5B 1F3JA 1NFIA 2EEDA 3EFFB 2J6EL 3U0WH 3BWAB 4YHYC 3UXFA 5D2NE 3KAAA 2LV4A 3P73B 3H7BA 3FQRA 5E8NB 4WEBH 1RZIB 2DWEB 4YHLH 4U33A 3UDWA 2VN4A 1PQZB 4ETYA 3G6JE 2E27L 1NCCL 1EAPB 1NGPH 3VFWA 1T1YA 1T1ZB 1IEBB 3WV0A 3O9WD 2DM2A 2IQAB 2WP3T 3QXUA 4L3CA 3PGDB 3VGDA 4YHMH 4N0CD 1BQLH 4UZGA 1S78D 1I3GH 5D7LB 4ONGH 1IGYA 3MLTB 1B90A 3WF1A 1NEZB 3MRGA 1A7PH 1NMCB 3NCYP 5FEBA 4R4NC 2YD7A 1SQ2N 1U8PA 4JRYA 4AENA 1A6WH 1W0VB 1CGVA 3CZFB 3ZYJA 3RKDC 4PJ8D 3GJEB 1U8IA 2PO6A 4EI5A 3C5SA 2BHUA 5BRZB 1F2XK 1G9ML 2ARJA 4NQXB 4M7JL 4PLJD 1TVDA 4NZRH 2QKIB 2XZAH 5EZLB 4ZS6D 1NSNH 4UIMA 1PDKA 5HHME 2AK4B 4MZ3A 4CGTA 1D5ZA 3QCUH 5C86A 3MFFA 4RZCB 2HVJB 2Z91B 1M6OA 4HKBB 3SDYH 5IV2B 1RZGB 1X3DA 4P4KD 4XPTL 3C8DA 4HUUB 3O4LA 1NCDL 2BVQA 3FO2A 3EYSL 1I1AD 4S2SB 5GGVH 2YBRB 5FYLD 2Y64A 3SDDB 2WSKA 1E4XL 2PW1A 4LSPL 1IC1A 4PTTA 4KAQH 4KVNH 2PXYA 5EUKB 4OLEA 2NZ9C 2CLRA 5IFJA 5CP3H 3QB7C 1TLKA 1Q1JH 3MJGX 2R0ZH 3NACL 4PRIA 1YJDH 2UYLA 3P0VL 1GPOL 2FO1A 4G9FA 1VFMA 2D31B 4I2XA 3FOLA 2ZEYA 3O81A 5JIKA 2P47B 1E4KC 2IH1B 1EO5A 3PQYD 1ZT1B 4NQEA 4XMPH 1A8JH 1OAYL 4U1JB 4N0CC 3TZVB 2IPUK 3O2DL 3N9GH 1CL7I 3SKNB 3ZSSA 2GY5A 4DQOH 5EIYB 4KUCF 2Y6HA 5JIHA 5DJDB 1FL3A 2DQFB 3PP4L 4KJPD 3LKQA 5DEFA 2GT9B 1ORQA 4R4ND 1H5BC 1JYNA 1XPWA 3ARGC 4RGNC 3ZMRA 1BFVH 1OGTA 1H15B 4PREA 1Q9LB 4ONOA 3W39A 1MRCL 3GMRA 4POZC 5GRJL 1A64A 4W4OA 2VQTA 5FKPB 1A7NL 4A3ZA 3PUIA 4Y2DD 2F74B 2E7BA 4PJEE 3V9FA 2OBGA 1KCVL 5K93A 1AH1A 4P3CH 4G6KH 4XXCA 3VXSE 1UM6L 2XTJE 4V1DA 4XTRD 1YC7A 1VSCA 1HHJB 1U92B 3FB8A 3IFLH 3EHBC 4KK6C 3TN0B 3L3HB 2QBWA 4OLXL 2FIKB 5D7KD 4CN4A 1KYOJ 2E6JA 5CD3A 1MCSA 2WN3A 4NQCA 3ZT5A 4LAQL 1K4CA 3V6ZA 1J83A 2YXFA 5HPMA 3RGVC 5DMGD 3KPMB 4G5ZL 3I50H 1J87A 3RA7H 2X09A 4OGYH 3MYZA 3A7QA 1ZANH 4IRSA 4MQXD 4U6XA 3W5MA 5FUIA 1HN1A 3X3FL 5B3JE 2F19L 5DQDH 3HPNA 2CKNA 2X1PA 5C3TA 4OJFH 2BCKB 3EO0B 2R0KH 1DEEB 1DSFH 4HKXA 4OZHB 3BW9A 5EIVA 4DOHE 4WY7L 5BV7H 5CZVH 1KJVB 2CR6A 3OV6A 5TGBB 3QIWB 1VHPA 5IVZB 3K46A 4IBLT 3CXHJ 2P44B 3OXSB 3QUXC 4KVCL 4U1LB 1J8HB 5F71A 5SX5K 2BBAA 1ZA3B 2PYED 4UQ2A 4UNTA 2D0GA 1J12A 1RZFL 2I60L 2VL5A 2WO2A 1KC5H