2C4XA

Structural basis for the promiscuous specificity of the carbohydrate- binding modules from the beta-sandwich super family
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
250
structure length
250
Chain Sequence
PENQAPKAIFTFSPEDPVTDENVVFNASNSIDEDGTIAYYVWDFGDGYEGTSTTPTITYKYKNPGTYKVKLIVTDNQGASSSFTATIKVTSATGDNSKFNFEDGTLGGFTTSGTNATGVVVNTTEKAFKGERGLKWTVTSEGEGTAELKLDGGTIVVPGTTMTFRIWIPSGAPIAAIQPYIMPHTPDWSEVLWNSTWKGYTMVKTDDWNEITLTLPEDVDPTWPQQMGIQVQTIDEGEFTIYVDAIDWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xyloglucan is Recognized by Carbohydrate-Binding Modules that Interact with Beta-Glucan Chains.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 46
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4xA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2c4xA02
4JN1H 4P23B 5HHPA 4G42B 2EE2A 4GXVL 4PJ5B 4WJ5B 3NFSH 1PX3A 2O5ZH 3IDIB 2FLRT 5HYSA 1L9MA 3PUIA 1HCVA 4M00A 1IC7H 5EOCH 5BS0B 4RYDA 3GSNL 4JFZL 4OKVA 1MFBL 1VPOH 5CILL 1H3PH 2YD9A 5F6IC 3OG4B 4RAVB 1FFQA 1EO7A 3MZTA 5T3ZE 5H37G 1ZE3C 4PJEB 4KHTL 4QRRB 1BVLA 3ULSA 3QWOB 2W46A 3CLEH 1CX1A 2VJXA 2V2TB 1RSFA 4GRWB 4K7FA 3NGBB 2G2RA 2LE9A 2KD7A 1U9KA 5GIRB 5EZOH 3KYKL 5ERWB 1NLBH 4HUWA 2B4KA 4LFHG 3ARGA 4H0HB 4O51B 3WKNA 1S7QA 5DT1H 4AENB 4BQ9A 3BRFA 4P46C 1UZ0A 3QCUL 3UMTA 3G04A 1HH6B 3MRQA 1PKQB 5I0ZA 2HYMA 1UA6L 4ZUTB 1WIPA 5CIPB 3UPAA 3NA9L 4AEEA 1KYOJ 3MOQA 5FGRA 3QP3A 2EH8H 3QIBD 2IANA 3O41B 1SDDB 4R0LA 4OFKA 2YC1A 2PYFB 2HFGL 5I17A 5FYJD 4NYLA 4C55A 4GW1B 2X6MA 1BMGA 4BSJA 1EUTA 1LNUB 1R3LB 5L88H 4GXUN 3VW3L 3KPRB 3MBXL 1MY7A 2UUDH 3L3KB 2CGRH 5FYKU 2EIZB 2XN9B 3KS0J 5C0RH 1OF2B 3U7WL 5JXAH 2Z0BA 3BOVA 1LO3L 5HHOA 2Q6WB 3T65B 4X6DE 5GQBA 4MJ6B 4RWYL 1MQKL 4ONOA 3MV9D 2VDRL 3GMNA 4HJJH 5KVEL 5K9OA 2AK4A 4JHZA 1KJ2A 5C0EB 5CGTA 1P7QB 5GS2D 1QSFB 3OJDA 2PYED 2RR3A 3KAAA 3QEGH 1W99A 4PTTB 4CU8A 1INEL 5I9QC 4PRNB 3DETC 1P7KA 3RWCA 1KG0A 4EN3C 1OD3A 5E8NB 4J1UA 5HGDB 3REVA 3NABL 4MX7A 5LCVH 5I1GH 1FC1A 5ACMA 1P4LA 4KDVA 4Y89A 2UUDK 4Q7DA 4NWTL 3WHXA 2YB7A 5HDBE 1XGPB 2O61A 4YFLI 1GGCH 4W8JA 1A14H 4APQA 3VFRB 3FMGL 2C7UB 5D72L 5JPNB 3MLTB 1U93B 4HK0A 1A8JH 5D5MA 4JRXD 4OFVA 1NAMH 4NRYA 2QQOA 1B0RB 2C1OA 5I75B 1QLFA 1H9VA 1F4XL 4JO2H 2FCBA 1T1WB 4MAYB 3CAFA 4CVZA 2BVOA 2OTWB 3DGCR 4EQ2A 4QOKD 3RGVC 4Y5YC 4HD9A 1JI1A 1S7RA 1PMJX 3LKPB 5I1KH 5BW7A 1A7OH 3OKNB 3N85L 1XT5A 1TJHL 1KT2B 2K7PA 5HI5C 2YMXL 2HG5B 4CJ1A 4RDQG 1J5OH 1MHCA 3MRJA 2FEDD 1Z3GH 5CJQL 1JV5B 2W0FA 4IDJH 1YEDB 3ISWA 1A6TA 3BZ4B 5E9DB 3NN8B 3I75B 1JF5A 2NY2B 1M05A 5MP6H 1K2DA 5D7KE 2QSQA 5DVKA 5CEZE 4J8RA 3GSXA 3S36L 2VZPA 2Q1EA 4QXTB 1E27B 3BPCB 4I3SH 5F9OH 2XWBB 4CU6A 5EH1A 2FBJH 1LQSR 1YUHB 1KCVL 3AXLA 4DAGL 3GIVB 3NZHL 3FFCA 1PFCA 4L4TA 4UQ2B 2CK0H 2QQQA 3B3IA 5D2LA 4TSCL 1OARL 3G6AB 1NBVH 1JYVA 1CG9A 4XPGL 1OH4A 4M7KL 5EIYB 4EXPX 2YN3A 4U6TA 5HXMA 3SDXB 3GMOB 2P48B 1AXSB 3UAJD 2FHBA 4BZ2L 5JHDD 1RUAH 2AW2A 4N90E 2FX9L 3RVVD 3FT3A 2NX5A 4NFBA 4JO1H 2XWTB 3TPKA 5BRZE 1T03L 4PJEE 2J1TA 4D9RD 4IDLA 3MODH 3PL6D 2NY1C 1W9WA 3U7YL 2CKBA 1KCLA 1F4XH 2R1XB 1YPZF 1UMHA 2NW3A 1V7NL 3ARRA 1OF4A 1C5CH 1YNLL 5SWQA 3SDXE 4F8TA 1TITA 3MGOB 4HKZB 4WW2F 4ZOEA 4OZOA 1HIML 5EJ1B 4EI5A 2UZYB 2OL3L 3O3EA 3S97C 2CDGB 4LSQL 3VCLB 3R1GH 2BNQB 3IDNB 3ZMRA 5CP7A 3N1QC 4G6AD 2IH3A 1FZKA 3MGTA 5L2JB 2OI9B 1PZ5B 3NN8A 4JDTH 4PGEA 4EIZC 4LEXL 1E4KA 4HIJB 4NBYB 5ESVB 4AT6B 1VACB 2GQHA 3CLEL 3DPBA 3P4NA 4L4JA 4A6YB 2H6PA 4ZODA 3G6JF 5CWSA 2VC2H 3MRHA 4YFDB 2DQTL 1RUPH 5F3BB 1EHLH 2IALB 3JV0A 4LSPH 4EI5B 1BJ8A 3NH7L 1CXKA 3DSFH 5D93B 3SKJL 1A3RH 2W1NA 4R2GD 4F9LA 1IGYB 2VC9A 3VXUA 1JGUL 4S1RH 2AXGB 4HBCL 4YXKH 2F5AL 5DDHB 4RMRA 4JO3H 1C5BL 3D69B 5EO9A 5FA3B 1EEYB 4W4OA 1HHIB 4OD2A 1WFOA 3P30L 2E7CA 4LSDA 3GI9L 4POZC 1YDPA 2R0WH 4WGVB 4EI5D 5EORL 2IPTL 1NBZA 2JCCA 4Y1AD 1HEZB 5C0CB 1K8DA 2E9IA 2LVEA 4LVOC 1I7ZA 4YH6A 2WBJC 1I8LC 3V0WH 2IH1B 1JNLL 3HMXH 2DIAA 2JK5A 1D5IH 3OGVA 2ED9A 2F8OA 4G9DB 3ILQC 5TFSH 2F9BT 1FL3B 1EO8H 5E2TL 2DQTH 4L3CB 5A2IH 1UZ8B 2VDQL 4KUCF 4L3EB 4OZGA 3JV5A 4JPKL 1YYML 3K1DA 4Y16A 3IDAA 3HMWL 5J06A 1J0JA 3VD4A 1MIEL 3GMQA 4YFLF 1AI1H 4OIIH 4FN0A 3SDYH 5HI5D 1ZLWH 1I9RL 4K07A 1JZ7A 1FYTB 3CVHL 4CNIA 5KOVC 3QIWB 2JIXB 5E2TH 3DUSB 2CLZB 1FIEA 1HN1A 2FJHA 3RJQB 5FUZL 2MCPL 5JW5B 5SWZE 3NPZB 3O4LB 3ULUH 1N0XL 1MCHA 3LVEA 3QDJD 2BSSA 3U6RB 3RWCB 2XTJC 5DZNA 3RKDD 3X13B 2WUCH 2O5ZL 5FOBA 3RTQA 4NN7B 4OCSL 4OLEA 1FNGA 4MCYA 1CFSA 5I16B 3LEGA 2CO6B 1S7WA 3G9VA 4BH8A 3ZE2F 1UYZA 4KRMB 2Q86A 4K2UH 2Q76B 4UB0H 3VXOB 4YXLL 2FX7H 3IJSA 4Y4HA 5CZKA 5F21B 3MUY1 2PYFA 4YGAB 2R7EB 3DV6B 5EIIA 3ECBA 3MACL 3TNNB 4QNPF 2KQNA 3RI5F 1QRNB 3STBA 1MCOH 5DUMH 4D0CB 2CK0L 1YJDH 4LSPL 2CKBH 3M8OL 4EI6A 1IC4H 2UZIL 1RUPL 4P46B 1N4XH 4Z0XB 2VXTL 4NT6A 4PRBA 2JB6B 3B2VH 1JU4A 3GFUA 5C0EA 3LS4H 5J1AB 3TWCL 1K4DA 1ZLUH 5ACZB 1U8JA 3ZDXE 1MWAH 5JUVA 4LBEB 4PTTA 1UY2A 1MI5D 4OZHE 2HP4A 4UINL 2D7OA 5JUEL 1AY1H 3B9KD 4GRWH 1HIMH 3P0YH 4QDQA 5DR5H 3CCHA 4PJXA 2B4CH 5C0GA 1CE6B 4K55A 4MCZB 1GVIA 1J05B 1T7YA 1BWWA 1ZWIA 4PJ5A 1T5WB 1CXEA 2Z31B 4Y5VC 5EO1B 4LQFH 2PN5A 1YEKL 3I2IA 5DHVH 4M9PA 3I02A 4PGDA 5HI4D 3CH1A 2HWZH 4ONGH 1WFTA 3NIFF 1YECH 5D6CB 5KSVB 1S9XA 2R0KH 1G6RH 1MCFA 3QG6B 5I1DB 3CCHB 2HKHH 4Y2DA 3VXQB 2W60A 3OAZH 1QBLL 3C9NB 1ZGLB 2PTTB 1ONQB 1EHAA 1GGIH 5D96B 4K2UL 2ZPKH 2NNAA 5F89B 1F13A 4KAQH 4XP9L 1OP9A 4OBRA 3BVNA 3VXUE 3WXWL 4PGJA 1ADQA 3MV7A 4XI5C 1ZSDA 5DD5H 1BFVH 3REVB 4QDSA 5IROC 1S7UA 1W2KT 1ZT1B 1L7TH 4M8QB 2ICWB 1KTLB 3F12A 5FYKH 1KLGA 3G04B 3MNVB 3AC0A 4S1SL 1I7TA 5L7XL 5C08A 3QDGB 1S7TB 3VXUD 4PB9H 5T1KA 1X3DA 4I1NB 1CE1L 1IGML 2LTQB 1TZIA 5J89A 3S88L 2JJVA 5I18H 1J7VR 1SYSA 1BFOB 5LBSL 4WWKB 4LSTL 2AVGA 1SEQL 1EIBA 4H1LB 1CL7I 1YYMH 5DQJA 5SV4A 4ZS7H 5ADOL 2OP4H 3MROB 1MUJA 1ZLSL 5MHSE 3S36X 4HH8A 3SDCC 5DJXB 4Y4KA 3VRIA 5L88L 2OJEB 5JIPA 3SQBA 2FBOJ 4Z0BH 1LE9B 1KB5B 1JF1A 3Q5YA 3QDHA 5FYLH 1D7FA 2EH8L 1U8IB 1ZWIB 4QX3A 1BQLH 3MLYL 3QDMA 5DJCA 3CIHA 3C5JA 3H7BB 1EZVX 3KPSD 3OXRB 4GLRI 1AE6L 2AV7A 4F2MA 5F9WB 1S9XB 2XZAL 3SGKC 1PG7H 4UNVA 1CD1B 4NP4H 1K5NA 1S9VA 4HMCA 3MRIA 5TE4L 3GI9H 2E9WA 1MI5E 3MZGB 4BYHA 3ARQA 1RUMH 4UU9B 2Y6LA 4FMFA 2FEEI 3QAZB 4PJCB 2J1EA 1I9IH 5DUPL 5IB2B 4PJ7F 2LTQC 3KR3L 1AGCB 4DVRH 3VDCA 2DM2A 3BD5A 5IGXH 4Z77B 1FNGB 4MCYB 5B3JE 4P3WA 4K3HA 3T3MF 2LS6A 2J7MA 4X9BA 3UTZB 4M3JA 2FIRT 3BPOB 4LL9A 43CAA 1EXUB 4PUBH 3HAEG 3BO8A 4PG9B 3TO4A 3SKMA 4I9WD 4L29B 1UM4L 2DCJA 4PR5B 4XNXH 2X89A 4HS8H 1AR2A 2V2WA 3G9AB 4V2BA 5TE4H 3PE9A 4HAFA 4L8BA 3EDJA 4JM2D 4UBDC 1BBJA 1XNTA 3CMGA 3VW3H 3EYQD 4L3EA 5MENE 4MA1C 3I50H 2YRLA 2P8PB 2WUBH 1OB1A 1PX4A 1MLBB 3U6RA 2APVA 4BFEA 5C71A 1DVFC 5FK9B 3BH8A 2HJFB 1U3YA 3NACL 4JO1L 3RTQB 5FOBB 1R0AH 2ZSWA 1T0PB 4HPOL 1QYGH 4YPGB 5I6XC 1K8DB 5GGTA 5ANME 4ZQKA 1WTLA 4YHML 4TNVF 5D93C 5ESVA 4C54A 3EAKA 3HRZB 4LPWA 4NUGH 5GGSA 3TCLA 3X11B 1I1RA 3PQYD 4JY5H 5D7JB 3MV01 1KJ3H 3PWUB 4ZOAA 4CU9A 1NFDB 4NNYA 5DEFA 3EGSA 5BRZB 1IGJA 4Y4HC 4FQXD 1ERNA 5DK0A 2YZ1A 3CVIL 4QWWD 2EEBA 1J1PL 4O4YH 4LAQH 4KHXL 3L5JA 5GRUL 2HLAA 1TCRA 4KJPC 1TPXB 1DBKH 1ZA3B 4MYWB 4QCIA 4X6EA 3BPNC 1NC2B 2ADFL 2B5IB 4RX4A 4X7TB 1NANH 5I1CH 1MEXH 3PWVB 4W6WB 5F93C 5KBNC 3QRGL 5DEZA 1HXMA 3GB7A 3L3DA 2BC4B 1GGIL 4YZFF 4OF3A 4O00A 5KS9B 3E3QC 4PRIB 4JR9L 1J1XL 1FRGH 2DMBA 3ESVF 4JQVC 1N5YL 3TT1H 4XVJH 4YO0B 1KPVA 1C5DA 1FDLH 4C4KT 5KVDH 4ORZC 3TP4A 1DEEB 5E2WL 2V5MA 1J5OL 2E33A 4UAOC 1UJ3A 5EOCJ 1NBYA 3MCKB 1RMFL 2X2YA 3TJEH 3CIQA 5C08D 3I2GA 4PGCB 2QBWA 4DUVA 1WBXA 5F1NB 1EVUA 2RCSL 1LO2L 3EO9H 4QNPE 1H8SA 3FZUD 1U58B 2P7TA 2YD7A 4L9LC 4K7PL 1R3KA 1CL7L 5D7LA 1WWWX 1HWHB 5HVGB 3RWEA 3AUVA 4OGAC 3MC0A 2YFZA 4PS4L 3IRZA 3BESR 3SDCB 1ES0B 3HC4L 1PBYA 3HNSL 1FNFA 2IAND 2VABA 5KSBA 3N0PB 4CADA 1KSRA 3M1BA 4HUMB 3H7LA 4WHDA 3SPVA 3W9EA 4WWKC 4JDVA 2DMKA 2E9JA 2ICWI 5E9DE 1KPRB 4WI3A 1UYXA 1KGCE 1S9YA 3BP6B 1QNZH 4C56E 3EB7A 3HR5B 1LDPL 3TN0D 3SE4A 4GT7A 4G7VH 5A2JH 3OB0H 1T1YB 2BNUB 1VB9A 4JFOA 1URLA 3CFIC 2VDLL 1IGCH 1S7VB 4JFHE 3D3VD 3U4BH 1I8KB 4HIHA 3THDA 3MUZ1 2VXUH 2ID4A 4I3RH 5HGAB 1G7LB 3D0LB 4N0CC 2QQJA 2VDRH 3OG6B 2H2PC 4HFUL 3RTQC 3TNMA 1X5XA 2VZQA 5FYLD 1I75A 4TSBL 1H15A 1DBJH 1KLUA 3FO9A 1MAKA 4PRIA 5D2NA 1IJ9A 2OL3A 1NGYB 1A6AA 4ZS6D 4HXAH 3DXAA 1J11A 4F7EA 3BEVA 2DQUH 4PJXE 1MI5B 3GHEH 4XNQA 1HOCA 4PS4H 4EBQH 3DETD 3QRFM 2VL5B 3DVIA 4JGMA 2DQFA 4X4ME 1TZGH 1AGFA 4LHUA 3LQAH 1BD2D 1XAUA 1JHLL 5C9KA 2N7AA 4XPTH 5KW9L 5CP3H 2V2WB 3U4AA 5EUKB 1I9RH 3EO0A 3QFJA 3HPJA 5GGQH 4QX2A 1ZKAA 1NEUA 2KPNA 1UWEH 4LCCB 4S0TD 5K9OB 1QLEH 2FATL 1N0LA 5FKAA 2W9EL 1AC6A 3UO1L 3MRRB 1UENA 4Y2DD 1AGDB 3OKMA 4QRUB 3FQTB 1T3FA 4HJGA 4P2OD 2HT2C 6FABH 4QXUL 2HJFA 2VMCA 3PHOA 1ZK9A 1TNMA 1JNLH 3HMXL 4OLVH 2NY1B 1BVKB 2EE3A 1RZIA 1A1NA 2PQSA 4EIGB 3BP7B 1ZXQA 4LAQL 1SBSL 2YWYA 2EZ0C 4PRHD 1EZVY 2ENYA 5I8EB 5E5MA 3ARDB 1R3IL 4G7VL 3MV8A 1IM3B 2OYPA 5JNYA 3U36A 5JPNA 4DKDC 4EVNA 3SDCD 1Z6JT 4G6KH 1OHQA 3VFMB 3C5JB 1HH9A 5LA0A 3BN6A 2WQRA 1YQ2A 1S9WB 1QLFB 4PY8J 4WVRA 5IVZA 3TBSB 3MLZL 4L4TB 5D5MB 2VWEC 5J1XA 3PL6B 1IT9L 4KJPD 3QNYA 1MPAH 1DL7L 1ETZA 1DVFA 2MMXA 5CUSL 1KCSH 1RY7B 1QSFA 1HK6A 2E27L 3IFLH 5J9PB 5MENA 1BFOA 5FYJH 5BJTA 2ICEA 1EO5A 3QI9D 3DV4A 3JVGC 4M6ML 4I2XA 3RP1A 4JCMA 4HKBB 5C7XH 3I75A 1NAKH 1BOGB 3S3PA 1P4LB 2JJSA 4N8CL 4QOKA 3WEXB 3LN5A 4TVPE 1XGPA 1JYNA 4X9IA 2Q8BH 2ATKA 2QSTA 2AJ3B 4ZFFB 2CKBB 4XH2A 1X4YA 3QEHB 4I13B 5DC0A 4MD0B 4QRPE 5E00A 1DANU 4CADB 4G6JL 3L3KA 5HYFA 2V4VA 3PWJB 5DRZB 2FWOA 2J8HA 3OWEA 4UT9H 2A6KA 1ZLUK 2I9TB 1WBZA 2VH5L 5IHRA 3F7YA 2WINA 5GRUH 3V5HA 3EYQC 1MJUH 3IXTB 2BC4A 4BZ2H 5SV3A 3B9EA 5K9QG 3VDAA 1JNHA 4PJ8C 3FTGA 2DWEB 1Q1JL 4OGXH 5AAWA 3NCCB 5IMOB 4MB4A 3KPQA 4I48B 4YE4H 1ZT7B 2MWCA 3DUUB 5D6DA 4YEEA 2DQDH 1KCVH 4PD4J 4GRLB 5TF1L 4Z78B 3GSOB 2J5LB 2FD6H 3GSXB 1RZ8A 3GJEB 1KGYA 3LKNA 3GBNL 5FYLE 4Z8FL 3ZM8A 3OAZK 3K46A 5E94A 4Z0BL 4BUHA 3OZ9L 3O6LL 4J4PD 2P8LB 2ATPA 5FO7B 3VWKA 4LU5L 1X9QA 2V7NB 3SGDI 5CZVL 3DWTA 3C7HA 1YN6A 1A7QL 1GGUA 1MLCA 3DHMA 4U33A 2OK0H 2X5PA 3V0VB 1P5UA 1J1XH 3W0WA 4NQCA 3RUGA 1C7TA 2RHEA 4D0QA 1Z5LA 3N85H 3VWKD 3D0VA 2X70B 1A02N 3MRLA 4PJCA 5F1IB 2XA8L 2HFTA 4FZEL 3SDDD 5EJZB 1HCFX 5EFIB 3ZYZA 1FG2B 2Z31A 4NO0A 3L7EA 3MYJA 3L3GA 1A6WL 1QSFD 4P9ML 4WTZG 2HMID 1IKFL 3B4NA 4OM1L 3UBXA 3MO1A 3SE9H 1DUZA 5ERWA 1A3QA 2JDAA 1A3LH 3Q1SH 4X6DF 4A42A 4WCYL 3PHSA 4Z76B 3W2DL 4FQQB 1T4KA 4HWZA 4U6XB 2DQJH 3MO4A 2GSGB 3N1PC 3V9FA 3RU8H 2YOCA 2ITDB 1UH2A 1PKQE 3FJTA 3O6FA 5CIPA 3HI1B 4JN2B 4LPXA 2X4QB 3EJYC 3IT8D 1HNGA 4PYHA 4WDIB 4NUGL 4XCYA 4RGNC 3P77B 3BW9A 5DHYB 3KPRE 2XG5A 5C92A 4FQCH 4XVTH 1CFVL 3SJVE 3MNWA 5BS0A 5TF0A 3H0TB 2R2EB 1TETH 4M8QA 3I97A 4LKCB 2J88L 3TPUB 3CPLB 1H3XA 3QYCA 2FLBT 2G9HB 3FQUB 4KVCH 3QWOA 2EDBA 2X4QA 3A67L 2NY3D 1BVZA 2WUBL 1UB6B 2DQHH 2B4CL 5KVEH 3OF6D 2WBKA 2VZTA 3P0VL 3C5SB 1D6VH 3VG0H 3CK0L 1YJDC 2ZP0T 3UDWC 2CIKB 1K9TA 3QDGD 2OP4L 4PRPA 2WZ8A 5EZJA 5E08H 3V4VL 4D0CA 3TJHC 1A7BA 1XF5A 3C8KB 1A4KA 2AK4E 2H3NB 1QKZL 5EU6A 4P46A 1DP0A 1D5BB 1FL5A 4X5LA 1K6QL 4XP6H 4A45A 3B2VL 1XGRA 2AI0L 5EC2B 3ALPA 1UA6H 1F6FB 4ZFGH 3HMXA 4LLVA 3BP4B 5D71L 1DBAH 4P00B 1MPAL 2DI9A 5JQ6L 5E6YA 5FDYA 5I1HL 5L2KE 1IGFL 1UEYA 3QIBC 2NXYD 4S1DD 1DQLL 3EYSH 3MOBL 3NFNA 4F8QA 4YUEH 4OM0L 5ESAB 4XMLH 1FNSL 1MJ8L 1ZV5A 1KCRL 1GPOH 2Y06L 4NRZB 2Y5TA 1CN4A 1I7TB 5C07A 5ELIA 4KRLB 3IXAB 1OF3A 4I77L 2EDHA 5DMYA 1T5XB 3WLWC 3WS3A 1PG7L 2CD0A 1CFNA 3OV6A 3O81A 4EQ3A 1H3PL 2F53E 4ONFL 1SYSB 4GKSA 1SBSH 2DOCA 4U4BA 3B83A 1FZMB 4P9MH 1TVGA 4PBVC 4BH7A 1N0XH 5FYKD 1YEKH 1ONQA 3UCRA 3WE6B 5C0AA 2QHLA 4UOW0 2JB6A 2PXYD 3RRQA 4M5YH 3ARBC 2W65B 5IT2H 4JAMA 4QWWC 4XP1L 2AEQL 3MRCA 5BVJA 3GIZH 4P2QA 1RFDL 2H1PL 2VLMD 2XPGB 3PP3H 1UYWL 1W0WA 4N8VB 4JFYB 1A2YB 2E7LA 1FVCA 4DXRA 2A9NH 4GRLC 4I18C 1XF5B 1V3MA 3C8KA 3THMH 3OZ9H 3IB3A 4FI9A 3IJYB 5JOEA 1I5PA 3LQAL 2AJ3A 4Z7WF 2D2OA 3DYOA 4FQJL 4ZFFA 3OB8A 5FCUL 5FXCH 4JJ5A 1BX2B 1KJVA 4JPIB 4JZNB 4PY7B 3TN0A 1ZANL 4G5ZH 4FXGB 1AKJA 4NKQB 4F37F 3WXWH 2ITCA 3UTPE 5LGHH 4ARXA 2DIJA 1PDKA 1NGQL 1QFUL 3ES6B 4LARH 4BSVA 1FN4A 1G7QA 4U1NB 3TH4T 3OGCA 1W0VB 2FX7L 4LCWD 4B50A 3QI9B 3KDMB 5JHLH 1JNHB 4F7CB 1OP3H 5HDQH 2YPLE 1JGUH 4S1RL 4FHBD 3RVWC 3GI8L 2MHAA 3VJ6A 2YXMA 4ZNCD 2HMIC 1CVSC 1FZJB 3IFOA 5ICYA 3FO0L 4XCEA 3GSNA 2BDNL 4NQDB 4XAKD 5TDPB 1T4KB 2XICA 4YHOH 3T0ED 4HIJA 5IIEB 2HN7A 1I8MA 1JPSH 4PJ8B 2PNDA 3G6JB 1LEKA 2DQGL 5IFHL 3SJVB 1SEBB 2EC9T 2PKDA 4U49A 2H9GA 5C3TA 3PUHA 1X5FA 3MV9A 7FABH 4H26B 2EO1A 2FGWL 2R2CA 2VLLB 3HRPA 3K4ZA 3O9WB 4H8WC 2VZVA 3MMEB 2WO1A 3RY6C 1NAMB 1MCNA 1B0WA 3T0AA 2Y6SC 2Q8AH 1F90H 4MQXD 4WI9A 1IQDA 3TWCH 1N6QH 3QEUB 5DFWH 3T04D 1CD0A 4KXZH 5D70H 4HCRL 1KCSL 5LG1A 3D9AL 3HZKB 2GI7A 3O6ML 3LEVH 4NC2B 3F7VA 4HIXH 1K8IA 5DJ6B 3L3IA 1XFPA 1BJMA 4LDOB 1T03H 2X09A 3BGMA 4TQEH 3WFBL 2V7HA 1IMHC 4MJIA 3DVGA 1BZQK 3PWPE 4MNGB 3RIAF 4JFHD 3U9UB 3B9AA 2L0DA 4MNQB 4PV9A 3HCVB 2GTWA 2B4CC 1MFAL 1IAIL 1UX7A 1C8PA 3U0WL 4U1SB 3JWDH 4GOSA 2YK1L 4IOFD 5D5ME 5HGHB 4JFQA 4P08A 4L4TE 4XTRD 1JN6A 4M48H 5LA2A 3IDJA 4ODWB 3DSFL 1G7PA 1SY6H 3ULUL 1JGVH 3LY6A 5TDPA 1VEPA 4XMPL 5IQ7L 2VXSL 1EHLL 3MLTA 3OG2A 1UXSB 1AO7A 3DHJA 3H42L 1QQDA 3ARXA 2YPLD 3KJ6H 2E26A 1CZ8H 1PY9A 5DQDL 4CMHC 4N8PA 1IILE 2QKIA 3KYNB 1BIIA 4IDJL 1WKYA 2Z93B 1TLKA 4P2QE 5T3XH 3SDDA 4ODWA 4UTBH 4ENEC 4R4ND 3HE7C 2NW2A 43C9A 4F9PC 1FL6B 2B2XH 4WU7A 3BDYL 4WUUB 5IT2L 4GLRH 1T1WA 4MZ2A 5JORB 4LP4A 4A6YA 3P6BA 3V4PH 3L3DB 4XBPA 3H3PH 2VNCA 4PFEA 5C0AB 5ID0B 2EH7L 5E2UL 3SCMA 3V52L 1KJ2B 1RK1B 1ZT4B 3MLXH 1DZBA 5DGQA 4LNRA 5H2BA 1LEIA 3TCLB 4LRIA 1PLGH 5IK3A 3WHXB 1G7IA 2BNUA 4JQIL 4LNVA 5JXGA 3DMMB 5DJ2B 4PJGF 4JFXB 1MELA 2UVFA 2O5YH 3LRSA 4WFGD 2QV2A 1U41A 3WJLC 3WLWD 4ETQA 1AGDA 1BQHG 4M6AA 1TXKA 3H9SA 2W59A 4EUPH 3HUJE 3SDAD 3M45A 1P7HL 1KIUA 2JIXD 2YD2A 1AKJD 4XNXL 2X89D 4NWTH 3S98A 5E2JA 1Q9LB 3MRPB 4WI4A 5FDWB 2AV1A 2C1OB 3EYSL 4FQ2H 3KYMB 5JHDE 3HI6L 4ZAKD 4WIQA 4KGJA 4IUGA 3MR9A 2M8XA 5H94A 4MQXC 5IB1A 25C8L 1VHPA 3CC5A 1QNZL 1JHKL 1NCUA 4P49A 1VEMA 4WRLA 2G75B 4HJJL 3E2HB 5I8KL 1WCBB 1NKRA 4MXVE 3Q6GH 3MCKA 4PRPE 1B4RA 3AY4C 1XF2B 5CMAA 1OWWA 4UIKH 1C5DB 1KB9J 2WV3A 3N1MC 2YC2A 2DYPD 3HZVB 2XPGA 2Q7YB 4Y1AE 5BOPA 4BFIB 2W92A 3PDOA 3IJHA 2EECA 2J1VA 5D8JH 1C5CL 4AEHL 3ULUD 1N59A 4CVXA 3SEEA 1A22B 3JWDC 4APQB 3T0EE 5I1LA 4XPBH 2ZUQC 2ARJA 32C2A 1AR1D 3LQAC 4ZUSB 3UJIH 1GSMA 4XBEH 4JQVA 5F71A 4F9PA 2CXGA 3AVEA 4UTBL 3LKQA 3ROOB 3WYRA 5CSZA 1FL5B 4H25A 2ZEWA 2D03L 1F3RB 4RBPK 1CZ8L 3MCLH 1ULPA 2ADGA 3U46A 2CLVB 5I76B 4ZPVB 1AGCA 3PWPA 2C4XA 3FO2B 4WDIA 4XNMB 5BVJB 2AKRB 3VGDA 2J6EA 3G5ZB 1P7QD 4M6OL 4NCC2 5ESQA 3W2DH 1CIDA 3F6LA 2UYLA 4AENA 5LCVL 5I1GL 2XXCB 5D1ZA 4QB6A 3DMMC 3ILQD 4ISVB 2A83A 3UYRH 4OLXH 4W4NA 2OKXA 1HHGB 1MJ7H 3I84A 1RIUL 4KKLD 3MLSH 2CDPA 4KWUA 3PJSA 1KJ3L 1C16A 1NCWH 2VITB 2P44B 5IHUL 1HHKB 3QNZB 4JZJC 2OK0L 4CL7A 5C0JB 5AD0B 3VE0B 2X1QA 3TBVB 4Q97A 4U1IB 4LU5H 2WUHA 1R5VB 4KI1A 2C4FU 3LEXB 3LPGA 4IS6A 5IV2B 3CFKA 2NY6B 4GAYA 3KGRA 4P9HH 2OTUA 2V5RA 4M7JH 4UDTA 1LK3L 3UC0L 1U8QB 4MDIB 1RUKH 2BGOA 1HYSC 1OTTD 1UCTA 3UBXG 1U8PA 5JW3H 3SOBL 2P5EB 3GMRB 2AEPL 4N0UA 2E32A 1KEML 1H3TA 1HKFA 4X98A 4WNQB 4N5UA 1R5VA 1RZKL 4OZIB 3MA7B 4FTVB 5JPMA 1Q1JH 1LDSA 1OLZA 3HNTL 5DD1H 4BQCA 3BUYA 4MJ2A 4Z6AT 1UM4H 4G43A 5CHNB 1BX2A 1KJVB 4JPIA 5LWYL 1NCAL 4ZXBC 1MCDA 4U6VL 3G5ZA 1KULA 3VXOA 4H8WL 1EEZB 3PGFL 5DLML 1ZS8A 1CFTA 2UYLB 4FQ2L 1G6RB 3PL6C 4I9WE 4GG8A 4DOHB 3WFEL 4BH7B 1P6FA 4PJ7B 1FO0L 3S35X 4GXVH 1UJTA 2D9QB 4AEFA 5IMMB 1LO4H 2IFFH 3QFDA 5DPNA 5DA4A 1IFHH 1ZHBB 3ESUF 2R4SH 1G9EA 2XZAH 2WIMA 3WS6A 3NZ8A 2CQVA 5C70A 1GHFH 3VWKB 4ODVH 1NAKL 3SN6N 2BCKA 3FHAA 1L9NA 4FFZL 4WTZA 2HFGH 4M6MH 4RFEA 2BSED 4E0RA 1INDL 2XTJD 3CFKB 4MD4B 4W70A 1Q0YH 1KACB 3EDDA 1MFEH 4XZUA 1GZQB 1MHEB 2QJDA 3IAQA 3NFPA 1F11B 4NNPH 3HI5L 4KV5F 3V4PL 3VFTA 4D0BA 3CMOL 5E8PB 5EFIA 5BVPH 1LNUA 1EHXA 4NPYA 1ZLSH 4OZFB 3KPPB 4ZS7L 5T3XL 5F44A 1I1FB 2AABH 5INCA 4JY6B 5F9WC 5CMAB 5TDOB 3TJHD 2DB8A 2JD9A 2WSKA 1J8KA 5EO1A 1DN0B 2H41A 1XF1A 5LGKA 4O2FB 4JKWA 4YDJA 3VXMB 5IG7B 4MCZA 3P4OB 4Q9RL 4F33A 3BUYB 1U36A 1NGWA 3HI5H 3MBWA 3PXHA 3V5DA 3P3YA 2VQ1A 3IS0X 1A5FL 3BKMH 1MFEL 3DX7A 4M48L 1CGTA 1QSFE 4K94L 4J6RH 1N3NA 3H0TA 2PO6B 4KZEL 2A1WH 4M8VA 3P9MB 3TCXA 4AG4L 3TO4B 2OMBA 2YK1H 3QUKB 5JW4M 4OZHF 4BUGA 4NQVB 3TVMD 5MENB 1G0YR 3MRKB 2OMNA 4HLZG 3U37A 4NT6B 3O2DL 4LLMB 5HPMA 3V2AR 3SKOA 4HF5H 2G5BA 4YNYB 1CYGA 1OP5K 2DWEA 4X5WB 1FCCA 3VFWB 3JWNC 2DD8L 1VESA 2JK5B 3DMMA 1XF3B 1CDYA 4RFOL 5IB5A 2H2PD 3MGTB 5F1SA 4ELMA 5IHZA 4PB0H 3DUUA 4YHZL 3JV4B 2E8ZA 4ZZ5A 4HK3N 3FN0L 5I1LB 2XZZA 5IEHA 3MNVA 4U6VH 1JFQL 2HH0L 1GAFH 5AZ2L 3WNPA 3PWJA 5DRZA 3SHSA 4P4KD 4JG0H 1BBDL 4OUUA 5DR5L 5D6CA 5EOQL 3H3BC 4K8RH 2WIIB 3RWGA 4UV4H 5EU7C 2EKSB 3OKOB 1IC5H 5KSUB 1G9NL 3OKYA 2AXGA 5F88A 2WYSA 1JP5A 4JRYB 4ODHL 5H94B 5CEYA 3TESA 3C5ZD 3EDEA 3GJFK 4PV9B 3O4LA 3QG6A 3MUHL 4XMKL 3RZCC 2AEPH 5GGRA 5IBUB 3PHQB 2DTMH 4HKBA 1Q9WB 4F57H 3EDKA 5F1OB 1KYOK 5TDNA 3RDTC 1M6OA 3FB6A 2DYPB 2ADGB 2SEBB 4L9LA 3HNBM 3LHPL 2X1XR 3W11C 3U4BL 1JGEB 1FFPA 4ZAKC 5T3XD 4YX2L 4ETQB 1T0NB 2X4PB 4XUTA 3AY4A 3HUJB 3I6KB 3MFFB 3QEHA 4HMDA 3IDUA 2ZEYA 3E6HB 1OAKL 2ENSA 3SDAA 4WUKL 4Q6YA 4HUKB 5F3BA 2GK0B 5FV2A 32C2B 4R97B 4W4ZA 4YQXL 5JHDA 4HXBH 3V79C 2ZUSA 3QUXA 3WIFB 4F7TA 3MBEC 4X6CB 4C58B 3KLAB 5T1LB 4O5LH 1C12A 4U7KA 4PGBB 2OJZL 3UYRL 3TEUA 5C9JA 5D1QD 1U8LB 2XOMA 3SEPA 4O02L 1WEJL 2VSCA 1DLFH 5FUOH 4S1DC 5CJBA 2FEEL 2V9RA 1BM3L 1Y18A 4IRJB 4X99B 4G6ML 4UAPA 2VAJA 3H9HA 4L9DA 1CLYH 1KV3A 1F3DH 2GJJA 3DRQB 3FT2B 4ZXEA 4WEBH 1GIGL 2VR5A 3QHTC 3HE6D 5CJOL 1I7ZB 1WC7B 1GH7A 1BD2B 3SDYL 2P1YA 4Y88A 2UWEA 3S9DB 1EH9A 4CAGA 4NN7C 4QO1A 2NY5L 1F45A 3VMPA 5KVDL 4DVBA 1B0RA 4KZDL 1R64A 5GRJH 4WWID 3EYFA 2Q76A 4OAWA 1J10A 1QSED 3SE3C 1NFIB 1KPRA 5I1CL 5T1MA 5I30L 1QACA 4E41A 4P5TA 4IMLB 4R4FH 2EDXA 2VZ3A 1ZGLP 2YS4A 1AJ7L 1BQHB 4ONFH 3V6ZB 4P2RD 5GJTH 1FO0A 3HUJA 2R0WL 4LSVL 5GS0H 1EDQA 5IW1A 1RIVH 4KRPB 3U48A 5KAQG 3MRNA 2HVJA 5GGUA 2IADA 3EYOA 4M1GL 1HI6B 1HQ4B 1N64H 4ZTOH 2NX5E 2VQ1B 4NO5A 1AO7D 3DXAB 3RKDC 3MBEA 3VXPA 3R8QA 3QUXC 1TMCB 3TA3C 4JFDB 4XNUH 3WF3A 3QQ4A 4YHLL 3VD7A 1D9KD 4HUXA 3MV8B 5L2KD 2DLFL 1UXWB 3MJGX 3V7AG 1GOHA 1KT2A 3LHPH 5JQHC 4XZUG 1B0GA 2PYEA 4H88H 4DZBA 1BGXH 3WLBB 2YKLH 4P2QD 4KKBC 3QI9A 2H26B 4FFYL 3ROLA 5T1KD 2A74B 1AD0A 3MRCB 4TNWF 2B1AL 3R1GL 2JJSC 3GMLA 1UCBL 3QG7H 1W0WB 3QXAA 3T4YB 1XR8B 1R6VA 1IEBB 1A6ZA 3C6SA 3X14B 4NGHL 5C2BL 1BEYH 4ZO6A 3VWJC 4NQXB 2ZXQA 2FB4L 4OFYD 4HUUA 5CGMA 4XC3L 1GAFL 4LSSL 3M1BB 1MF2H 3FCTA 2NCMA 1CDUA 3EOTH 2J8UE 2HRPH 1FZMA 3SDCA 4QRQB 1TETL 3EYVA 3O45A 1FJ1A 4JFFA 1NUFA 5IYYA 3SJVD 1CFQA 3GDBA 2LV4A 3N9GL 1CU4H 4OQTH 1KGCD 4RNRB 4U6HB 5DURD 3OGSA 3BE1L 3SGEI 4WO4A 4DVRL 3Q48A 1NGXA 2DQIH 5GS0D 2ADJB 1XGTA 3HFMH 1JZ4A 3OKDA 4RIRA 4N90D 4M7ZB 3WSOA 4FXLA 5MEQB 2J5LC 4JDZB 3UJJL 3GKZA 3B9DA 1YYLH 4IRZL 4EZMA 3NZHH 2XOTA 1UXZA 1C08B 1LO0L 2NW3B 2Y36L 4HWNA 5TE7H 5E8EB 2VIRA 4LGRB 1XF3A 2C7UA 4JRXB 4YGVB 2H9GB 4ZNEE 2YUWA 4IOFC 4V2CB 3GSQA 3P40A 4OUUB 2EDOA 3C5ZB 2YD3A 4HJ0C 1FLRL 4QAWA 1I9JH 1P6AB 1IAIH 2CO7B 3FQRB 4R26L 4ZUWA 2YPVL 1H15B 3FO9B 4P4KA 4U3CA 3STLA 3VFSA 5C9JB 5C0FB 5ADOH 1D5MA 4PJGA 2O5XL 4AJ0A 1QLEL 4X6EB 3MREA 2VO5A 4MZ3A 3WFCH 2EIDA 3ZKND 3KLDA 3NIDE 3B5GA 1FGVH 5TDNB 5JO5A 4PB9L 5C6WH 4OLUH 2W1UA 3OGOE 4LLMA 3O3AA 5FB8B 5EIQA 4LGPB 1YEDA 3U0TB 4GBXB 4RMWA 2Z8WC 5FUOL 1ODAA 3QXVA 3CFCH 5E8NA 5HGDA 1T0NA 3RWDB 4LHSA 1K3ZA 5GGSB 3LH2L 2R2EA 4MGSA 2ZOLB 5BZWB 1NEZB 1T2XA 3HZYA 1X5GA 4CN6A 4GG8B 1EFQA 3JUZA 2AK1H 4QY8A 1U8IA 4Z7OF 1BHGA 2WWMD 1J1OL 4P2RA 3RZWA 3RFZC 5C09A 1DN2A 5J3HC 1F97A 1UWGL 1R5IA 5HDLA 3WN5C 5HYQB 4G9FD 1G7MA 3WIHA 4K71C 3QT2A 4NKDA 4OCMC 4RFEB 3WXVH 2D9CA 4LQFL 1T7XA 3C87A 4MHHG 5I73B 1V05A 1A4JB 4X4XB 4CUAA 3DGGA 3GJEA 4Y4KD 3UYPA 1D5BA 4ZXBA 5HPMB 1OWRM 4WW2C 4C56D 2VDPH 5EULV 4D0BB 2RBLA 1B4JH 3OEAA 1ITCA 4Y19A 4MA7L 4XWOC 5DD3H 2PYEE 5HJ3A 4D3CH 2P8LA 5IB5B 2VLJB 1P84K 1CTNA 4JFEE 4PJDB 3CPLA 3D3AA 4HSQA 3GSUA 3ALWA 1B2WL 4X4MA 1L7IH 4D8PA 3BDXA 1OW0A 4LLYA 3CFCL 5EZLB 2P43B 3GJFB 3P4OA 3ARUA 2OTPA 2R29H 3NA9H 2XTJB 4DN3H 5CUSH 5GJSH 4Y19B 5DJCB 3U30C 1H6YA 5TPWH 5CINL 3KVQA 4EOWL 1MJJA 2R9HC 4MA8H 5DD6B 2P8MA 4QHMB 4X7SH 4ZS6C 2Y07H 2DBLH 3NPSB 3SDDC 5F6IB 4X6DB 5EOTA 1E6JH 2P5WE 5GHWH 4E5XA 4QXGL 1U3JA 4QRPB 4WEMB 3S4SA 4PV8B 4XGZA 4QHLB 5EIIB 4NC1E 1N5YH 1RJCA 1XZ0A 5EC2A 3DX8A 5HHMD 5I1IL 3T2PA 1US3A 3IJSB 1XH3B 5E8OB 3ULVD 2BGPA 1ZAGA 3CXHJ 4F37K 1JNNL 2JELH 4HMEA 4OLYH 1FNHA 3DO3A 3ACGA 5JA8B 1JI2A 1T04A 5MI0C 1XGTB 4CN4A 3B43A 4H25B 4IS6B 3NGBC 1A6VL 3BZFB 1ZHNA 4JFDE 4TVSa 5L9DL 4QT5A 4Y4KB 3VRIB 4ZUVB 4ZPVA 5AG8A 2F53A 1EVTC 2LFGA 4DGYH 1MCCA 3T0VA 5FM4A 4OIBA 2AK1L 1AH1A 5H2BB 4JY5L 3C5SA 3L3OB 1EJ6A 3QNXA 1A7NL 3ZT7A 3PWLB 3CUPA 2WN3A 2ARWA 2D0GA 4NQDE 2P5ED 3N9GH 2XQBH 1V5JA 1AO7E 5GS1B 2NX5D 2YFUA 3GGWB 1IM3A 5JNYB 1I1AA 2DLGA 1I3GH 3GSVA 3T4YA 1BIHA 2EXYC 1HYSD 3MXWL 1IL1B 1BREA 1Y0LA 4CJ0A 5GISH 2IQAA 1C16B 1PQZB 4J3XA 2APFA 4XPBL 2CRMA 3L6FB 4PP2B 4RFNB 4XHJD 1W72L 4MHHI 1L7IL 1Z5LB 1MCKA 2L4OA 4PGDB 4TUOB 4NZTL 5G04L 3IXTA 2I9TA 1YA5A 4KQ3H 1NANI 3C08H 4HXAL 1PKQA 4TVPD 4DXSA 4ODUA 1G7HA 3FTGB 4PF1A 3R8BB 3CD4A 3L3GB 2R56L 4OF8A 4HLJA 4DOHE 2XQYK 1DUZB 1DJSA 1W8OA 2ARJQ 2F5AH 1CFSB 5I16A 3L7EB 1UZ6E 2VDOH 1RJLA 3MYJB 3GK8L 4NM4H 1NCBL 1A3RL 1F2QA 1JRHL 3D3VE 1NUNB 2J4WL 3BQUB 4LVOB 3PDOB 2WZPD 1DQTA 3MLUH 3MUGB 2DBJA 4HUNB 2FL5A 4G9DA 3FT4A 3BW9B 3WHE1 1I3RA 2VC2L 1NCAH 5F8RC 4ZXBD 1N64L 4OMDA 3NCJH 3KR3H 3N06B 3GHBL 2FJFA 3PNWB 3ABZA 4HX1B 3L3HB 3F7PC 4UT6L 2OZ4A 5FO8B 1Y6KR 1SMOA 5J11B 1QHPA 4DQOL 1GYAA 1J0HA 3RU8L 3UAJC 4LCCA 1CBVH 5GS0C 5AD0A 3HZMA 4MJ4A 5ID1B 4P0DA 1UXWA 3CH8A 3Q5OA 3O0RL 3P2TA 4PRHE 2KQMA 1KIPB 4ZYKA 1D7PM 3D69A 1PVHA 1QFHA 3OJ2C 3VGAC 1HXYA 2B1HH 4XPAL 4HKZA 5GGVL 3N50A 5EWIH 1FE8H 3FO1B 3D0VB 3MV7B 4DN4L 1A1OA 4CMMB 2VXQH 1MFNA 4N0FA 4MQ7A 3WKML 3D18A 1JYWA 5FB8A 5D1ZB 3GKWL 3S5LB 1RZIB 3EJYD 1D3CA 3W0WE 5E5MB 3QEQB 3V5KA 1G7JA 3SKNB 4E42B 4AT6A 1IBGH 3O3DA 3RGHA 2FX8L 5DJ8B 3S37X 1RUQL 3CFJA 5DQDH 3MV8D 2F54E 4Y5XC 5L2KB 3LS5H 1OD7A 3DI3B 3C7FA 5KN5A 5EU6D 1FORL 4UT7L 3EW3B 5EUKA 1IM9A 2X9XA 4Z7WA 2ZOKB 1NBVL 4Z7QF 3T0DA 3RPKA 4L4TD 5DGRA 4XURA 2HVKB 3GBML 5ECJE 3EHBD 4ELMF 2VN7A 1DLFL 4GH7B 5CEXB 4F9LC 2Y36H 1CD8A 3MRRA 4KJQC 5ENWB 1MRFL 5EN2A 4F7PB 1T1ZB 1T7WA 2R69H 2W0KA 3L95A 4I3SL 5DD5L 2XNAB 3KWWA 3QIWA 2X40A 3SDAC 4N8VG 3NIFE 4QXTA 2YSSA 1N6UA 4XBPB 1P53A 5ADPL 5MP6L 4YHNA 1MCQA 3QIBA 1BZ9A 1FSKB 1T2QH 3L5XL 1CF8H 2GITB 3VCLA 1I1CA 4GMSL 1QSEE 1EHNA 4DCQB 3WFBH 2WWKO 2DLIA 2R9HD 5CEYB 3MTRA 4MWFB 3BZEA 3MJ9L 2R1WB 3QWRD 2BMKB 3U83A 1A2YA 3KPLA 4HCRH 2XKSA 2AJSL 2GIYA 5DMIL 1WT5A 2NZ9D 4KK6C 5GSVA 5I15H 2NX5B 5TGBB 5ETUA 4QRQA 3ZL4H 1AY1L 1WT5C 1JYXA 1Z9OA 3QWRA 1GMMA 2BRRH 4IOIA 4NNYB 1YEIH 3I6LE 3OAYK 5D72H 5JO5B 1MIML 5J9PA 4GKNA 1HSBB 4MVBC 5G05L 1YEHH 4XRCB 3QI9C 1I3UA 3AFLA 4HT1L 4Q6IB 1EMTH 2ED8A 1T22B 3ZYOA 2YUVA 2YD5A 3W0WD 4JHAH 5AWNH 4KDTA 4U2YA 5HGGS 5JHDB 1OM3L 2IC2A 1OW0C 4H0GA 1NC2A 1QLRA 1F4WL 2X4OB 2HKFL 1AQKL 3BFOA 5F7NC 3EDFA 1UH4A 2R2BB 2J4WH 2YD1A 4M5ZL 2ITCB 4H1LG 4JRXA 5EBMB 3BJ91 3UTPD 3TLRA 4KTEL 1RUML 4PY8I 3OX8B 3K77A 3RA7H 3QIUA 5HHME 3U1SL 3KYMA 4QHUA 4BQ6A 1OQOA 2O5YL 3DX6A 4I18B 2HN7B 4ZD3L 2DMCA 2BVPA 1BIIB 2BVTA 15C8H 4ODXA 4HIHB 2R0ZL 2GY7B 4D9LL 1OT5A 5EO9B 4DEQA 2X4SB 2LQRA 4ELMB 2APTA 4OLVL 3MSPA 1HILB 1EJOL 5M7QA 1YQVH 4HJGB 3GRWL 2MCPH 5FUZH 2PW1B 5KS9F 4P2OC 3O3UN 4Y5YA 3VMOA 2IAMD 3QUYC 1EGJL 1NGYA 4U1MB 5MHSD 3RDTD 3LE0A 1TCRB 1KIPA 4ZYKB 3KPOB 5DJDB 3W9EB 3ULUF 4LRNL 1FP5A 1BLNB 5LBSH 3FOLB 4G6AC 2EE6A 3I6GB 4WGWB 1BBDH 4LAJH 2Z91A 1EFXB 3KJ6L 3ALXA 1IGTB 2G5BB 4LSRL 1EGJH 2P24B 3QFJE 4JRYD 3UZVB 5DS8A 2D3VA 1OAZL 2IALA 2A9MH 5ISZB 1D9KC 1CXHA 2VDML 3I2FA 4WI8A 4NZRH 1SY6L 4PB0L 1QEWA 1WEJH 3DJ9A 4EBQL 1L7TL 1Q0YL 1DDHB 2Y25A 5B3NA 4D9LH 2XG4A 1WAAF 2Z8VC 3BGFC 2N1KA 4O5LL 5MEND 1MFCH 1GHFL 1IM9B 4QTIH 1G7JB 5E6IC 4K3DH 3I2HA 5L6YL 4G9FE 2CR3A 1UY3A 4WJ5A 3CFJB 4Q58C 2ZPKL 1WICA 4X6CA 1YMHB 1ES0A 2B7DT 2WP3T 3TFKC 1ZTXH 4N0CD 3QUXB 4FQLL 5CLTA 5EBWB 2EIZA 5CSBA 5JXIA 4JRYA 4JLRA 3RVXD 4K94H 1N6VA 3MV9B 5GGSY 1P9MA 5F7MC 5TE6L 2KDGA 5T3ZD 5J6GA 1ZHKA 5FA4B 5GZOC 4NHUB 4YNYA 1DBAL 4GRWF 4NN6C 3KPMA 4Z7OE 1AIFA 4OZ4A 5C0BB 3ARGD 3EYUH 3QHFH 5JR2A 5F7LB 1S7QB 3E0GA 3PIQA 3QIBB 3WF1A 1B2WH 2J12B 5F7EH 3J7HA 2BXYA 2MOVA 5CD5C 5IW6A 5JUEH 4M1CC 5DJZB 1KLFA 3LZFL 4G8IA 4KVNL 4PGZA 1IC5L 3OTTA 2NY4B 3RL2A 5BV7H 3QUYD 2FO4A 3BRDA 4PG2A 4A6YL 4FQHA 5DVNA 3LD8C 1YNLH 1IVLA 2Y64A 1XH3A 5D1XA 8FABA 1NFKA 3CSBA 3LKOA 4IHOB 3ZKQD 3UESA 2UZIH 4PLKD 5IJRA 2XN9A 2HFEA 2HT3C 4QEGA 5FUCC 4KY1L 3VFUB 5F7YC 1ZT1A 4P3CH 4KTDH 4QX1A 2R2HA 3SKUD 3OF6A 1CICA 2GSGA 2BVOB 1Y18B 1Z0MA 2IMNA 1TVBB 1V7ML 2DDUA 5E95B 5E1HB 1X6NA 2V17H 2G2RB 4G3YH 2VZ1A 1FZOA 3OHXB 2ZSWB 3L3OA 4FQ1H 5AZEH 1WBZB 2HAZA 3FN3A 1Y6MR 1MEXL 1U6AH 4XC1L 4NCC1 4BK5A 5J11C 3GNML 3LH2H 4QRSA 3ILPA 3OR7A 4YJZL 4JREC 2HJKA 3SE9L 1A0QL 1JBJA 4OGZA 1VGKA 3FOMA 3OXSB 1CZTA 1IKFH 4PRPD 1NUDA 4FQPA 1IGIH 1BP3B 1P1ZA 1QSEA 2ICCA 4Q0XL 5A16A 1HZHH 4QYOB 3MBED 4YEFA 4HDIA 5BV7L 1U8MB 2QSCH 4J2XA 3ARFC 5ICZB 2BCKB 4MJ5A 2IEPA 4EXKA 3ULVF 4NQSA 3I2JA 5AYUL 1RJYA 2FZ3A 4OKVB 3T09A 4JM4L 2AABL 3GSOA 4NM8L 1VGKB 3FOMB 3OXSA 4IIQB 4J3UA 1FIGH 4R7DA 4P4KC 5T1KB 1QVOA 4KKAD 2R4RH 4PJ7E 5BVPL 1WZLA 3F58H 3RVUC 4UILL 4GW5A 3A6BH 4KROB 1FVDA 2ZG2A 1E4WL 4QOKE 1JPST 4XTRC 1D5IL 4JFYA 2A77H 4Y4HD 2WAAA 4Y16D 4XPAH 3TZVD 3L5WA 4JY6A 1INDH 3U46B 5EPMA 3LAFA 4GRMB 2HJLB 4IRZH 5TQ2H 2MSPA 2FJGA 4HBQA 5IBTL 1KEGH 2JB5L 3C6LA 1T6WA 4LIQH 3C9NA 1ZGLA 4PYGA 3D3VA 3WSQL 3LPWA 3TVMC 2EC8A 3DROA 5AG9A 4XNMA 1QFOA 5I17B 2A38A 1B88A 2Y7QA 3IB4A 3WFEH 4NJ9L 2CIKA 4KDTC 1BPVA 3DVNB 2GFBA 2RJMA 1U91A 3MLUL 1KIRB 3ILPB 1OTTC 3UZEA 1C1EL 3O6KH 4WO4C 3RX5A 3NIGE 1MHEA 1TQBB 2BSTB 1T83A 4NRXB 3STLB 3SGDH 4D8PB 3P4MA 1QFPA 3PJSB 1JWSA 4P5MA 3GMQB 3O11A 4Z7NE 3C5ZA 3ARYA 1ZVSA 3LEIA 1J0IA 4DGVH 1MQKH 2JLLA 2F5BH 1X5AA 4J12A 3VXQA 3QJFA 1MWAA 1G7MB 5DZLA 3L1OH 4U1IA 4MNQE 2APBA 1A9BB 4GAJL 1VKXB 3BT2L 3WFZA 1HHIA 4X83A 4QHNB 1QZ1A 4NBZB 4HGKC 5DHVB 3S4SB 5FYJL 4HCRA 2YKLL 3X3FL 2Z9TA 2A74A 5MEQA 5SX4I 2E7BA 2VLKB 4H88L 3ZSSA 2AJVH 3TBWB 3QHZH 1OAXL 2NY2C 5JA9A 2D7QA 3BVNB 4L5FL 4LK4A 5T5FH 5DS8B 3UBXB 4KUCD 3HJRA 4JANB 1NLBL 3WUZA 2KZ1B 3GSUB 4X0KA 4CRPA 1TZHA 8FABB 2XZQL 1TJIH 7CGTA 3CX5J 2YXFA 1FC2D 3VI4F 2FO4B 1A7NH 5DTFA 1I1AC 3QDGA 3C8DA 1HI6A 4GQPH 3QQ3A 3UTOA 4JG1L 1WJ3A 1X5JA 1RULH 4C83B 4U6HA 4BXSV 3LKQB 3HI6H 5I74B 1NH6A 1DSFL 3QCVL 5C0JA 5DQ9B 1IC7L 5EOCL 5IMMA 4WU7B 4XHQA 5A3ID 3DUSA 5AWNL 3LEYL 4OZFG 3NFSL 5ACZA 1WCBA 4X4XA 4UDTB 1UACL 1VFBB 1YEHL 5IWLC 1ZHKB 3MV7D 5C0CA 5FGCB 2PUQT 3AM8A 5ESQB 3DX6B 4I18A 3VH8B 3WJLA 3KPMB 2WLYA 4GRLA 2IGFL 5HHQB 4DGIH 1G9ML 4P5TC 2Q7YA 4RN5A 5IBTH 1S9KC 5CP7B 3SQOL 5E8DH 1ORQB 3WN5B 2FATH 4IOIB 2VL5A 3ETBF 3IDYB 4L1HA 2LU4A 3K75B 1I7RB 4NQEB 3HOBA 2R23A 1FAIH 4I0CC 5J13B 4LHUB 4Z95L 3LN9A 3QUYA 1SG3A 5T3ZH 1NGZB 5BQ7B 3LKOB 5CJXA 5KW9H 2XONA 1NEZG 3MLWH 4MSWA 4B7LA 4PJHF 5GJSL 4DKFH 5C0CE 3STZA 3DX9B 4JPWL 3ROOA 5CZXD 4H5SB 4PJ5E 4ELKA 5FO9B 5ALBL 4P5KA 3LQZA 4GO6B 3MQIA 5AYUH 2L7UA 1QO3B 4KRPD 4MDIA 4NQDA 2I9LA 3LCYA 1CXLA 5L2KA 3AMKA 2DDQH 1KN4H 1DBJL 2XY2A 3ARED 5F7EL 4QRTB 4AQOA 2KKQA 5ISZA 3O2VH 2BOCB 2YA0A 2BHZA 3NCJL 3GMPA 4FFWD 4X80H 3CDGB 5FHAL 4TRPH 5F7DA 2H8PA 1NGPL 4FA8A 4UNTA 5ENWA 3LKPA 3SPVB 1HOCB 4FG6D 2CLRA 3Q3GA 3TIEB 3TZVB 3OKEA 1Y6NR 4Y5VA 3FB5A 2I9LB 3PDGA 1L0QA 4BA8A 2Y6JA 4MAYA 4MNQD 4Q74A 1JRHI 1PY4A 3CZUA 1UJ3B 1NDMB 2W47A 1JMXA 3FT2A 5DVMA 1F00I 3MPCA 1T1XB 5DUBA 1U8KA 1O7SA 2K3TA 4N8CH 3MBXH 2P5WA 1IGYA 3ARZA 1TDQA 4NZTH 3ARSA 1HNFA 3AREA 3BPLB 2R1XA 1NLDL 4ZUUB 4GFTB 4U1JB 5JW5A 4IRJC 4JG0L 2VMFA 3AXLB 4QHKJ 2P24A 3QCTL 1NAEA 4MGQA 2VZRA 1N6QL 4HC1A 4JKPH 5CBAB 2XIDA 3AU1A 4LPUA 3UJTH 2UWEF 3MLVH 5HSFA 1WV7T 4DQOH 5EZOL 2AAVA 2ZCHH 4QF1A 1XIWB 1FO0B 1T89C 1QG3A 2FO1A 1QO3A 3FB7B 3RNQB 3H9SB 1CZVA 1MHPH 1UY0A 4XRCA 4KMQA 3MRHB 1FL3A 1J9CT 1CDHA 4KROC 2EDEA 5IM7B 3GIZL 1UYYA 4XUOA 1KG0B 4RA3A 1IEHA 4QLRA 1Q9WA 4UOJA 43CAB 4ALAL 4LPVA 1R3IH 3EIFA 4KI5M 4XXCC 4TVPH 3I9GL 1CLCA 2XWTA 4M6NH 3G5XB 5HD8D 2HT3D 3HG1B 1S7SB 5KSBE 3KJ4C 4GKZB 2I25N 3O3DB 1VDGA 2WAOA 4X9FA 3UBXI 4LLDB 5CEZH 2HT2D 1U93A 1C12B 3GSWA 1BBJB 1OVZA 3KPRA 5HHXH 2B39A 3DYMA 2GW5A 4F2MB 1MWAB 2XT1B 2WWKT 2QR0A 3C08L 4MNHB 1KCKA 3FAWA 4K23H 1PSKH 1CG9B 5GHWL 4M1CD 4ODUB 4ZNEA 4R2GC 3M17A 3OKOA 1U8LA 2XKUA 3BH8B 1A7RL 2JE8A 4EOWH 2A9ML 1JZ5A 3RWJB 4XPFH 4NZUH 4WHTB 1XGUA 1JGEA 4H1LA 3THML 1MCPL 5DJ6A 4NQSB 1NMBH 4L4VA 2DYPA 2SEBA 5SX4H 3HPJB 1NLDH 3GGWA 4OKDA 1BEYL 2NY6D 3PUCA 5T1DH 4PRID 4OZGF 3BKCL 7FABL 1F58H 2X4PA 4WFHE 5EB9A 3B8YA 1S8DB 3NQHA 1KJ2L 3DX9A 1BZ7A 2VB5A 1D6VL 1QD0A 4HS8L 2AV7B 1ZHBA 1YQVL 2ICES 3NJXA 2Y4SA 3DO7A 2ED7A 3EO1A 5ISZE 4IMLA 5F88B 1A6AB 1KOAA 1IGCL 1MVUB 2NR6C 3GGLA 4H8WH 4JRWA 1A4KB 5FFLA 3TVMA 4TUKL 4EDXA 4K3JH 2W1SA 3CXDH 1ZVHA 3BN9D 4TPRH 3OKNA 2MQCA 4LLYB 1F8TL 5FHAH 4OBSA 3VH8A 1S5IL 3LOWA 4NN6B 3O2VL 1GPOL 4OGYL 3IDXL 2F8VA 3CUPB 4OFIA 3BSZH 3TA3A 2LAGB 4LKSA 3TIEA 3I02B 1NJ9A 2OXGA 2Q20A 1DQLH 1E0OB 3CVHB 4OFYA 5I8CA 2J22A 5GZND 2CDOA 2G9HA 3FQUA 2R8SH 4LCUA 3QXDA 4J3OC 1J8HD 3IGAB 5ITBH 4Z7WB 2EDDA 1GC1H 3HC0A 3ZTNL 5IVXA 5HDBF 3IDIA 1FNEB 1AGBA 3W11D 5D1QC 3B6SA 2MTPA 1O7VA 1EFXD 4YHPA 1MIMH 1N8ZA 2Z92A 2NYYD 4F3FA 2Q6WA 4YBHA 5DQ9A 1TJGL 3ULUE 3QO0B 1VFAB 5FO9A 3ZL4L 4HWZB 4U6XA 3T0EA 3F12B 3CK0H 1OGAE 4OLZH 3JWOL 1B4JL 4PJEA 3CZJA 5CD3B 2FHFA 3CFDB 2F53B 2DI7A 3GKWH 1DFBL 2VRAA 1KBGL 1CE1H 2QQNL 1P4IH 3PABB 4KJQD 2YD8A 2F54B 4YXHH 4OFDA 2DJSA 1XIWD 4JO2L 1ORQA 1G0DA 4G8GE 4RZCA 3HE7A 3C09C 4F58L 4GMSH 5BCAA 1HHJA 4NJAH 4PJ8A 4G8GB 4OFPA 3BH9A 1J1OH 1ULVA 4IEFB 1RULL 1TVDA 5IMLA 4KAQL 4XP9H 3ZLQC 4OGXL 5K9KA 1CK0H 3RIFF 1A14L 2VZUA 3CGTA 4N0YH 4YQXH 3HN3A 4P5TD 3UXFA 2ZUXA 2ADIB 3CX2A 1WIUA 1CE6A 4RAVA 2QEJA 4WEUD 4OZIA 3IIIA 1UM5L 3UX9B 4K3JL 3FQRA 4ZUWB 1A6WH 1OCWL 5IB4A 2YR3A 1N26A 5B4NA 1P69B 1NCBH 1WAAE 2QQNH 4YK4C 2DQCL 3F7RA 1U8MA 3IDYC 2WM0A 4PJBF 1SMAA 4RQQB 4FQXA 3KPNB 3OR6A 5HVHB 1NX9A 4HUVB 4MNGE 1NMAL 4ODBD 1WGOA 4OLZL 3HTLX 2CJUH 1A7QH 2X4UB 1LO3H 2Q8BL 2FECL 2O5XH 4Z0XA 1S7XA 2BVQB 3W9DB 4R3SA 4X6DA 5D2NC 4AIXA 3OKDB 5FA4A 3UDWA 2N4IA 4GW4A 4NRZA 4GAFB 5IMOA 4P23A 2Y6KA 3ZE0F 5DN2A 3NPSC 5L8JB 1TQBC 4JFFD 4FQIH 2DQCH 2Z4FA 5I9QB 1LO0H 3FRPG 1H3VA 2VIRB 4UUJA 1QOKA 4YDVB 2QBXA 3L3JB 3O4LE 4ZTPH 3QXTA 2KL6A 3LB6C 4R90L 3ARBB 1KTRL 3RL2B 4RFOH 4R6UA 4NQCE 3RUGE 4GKZA 1I9IL 5DUPH 4FFVC 3VA2C 2BNQE 2VLKE 1M71B 1ITBB 5A16B 2E9BA 5HHXL 1LK2B 5JIKA 3FB8A 4QDRA 4JZOB 4NQED 3CXDL 2MKLC 1X5IA 1X7QB 4CNIB 4NJAL 3PWPD 4ZDHB 3Q5TA 1JRHH 2Z91B 2Y5TB 3KYOB 4M6NL 3WLBA 4CVWA 4YR6B 1U8QA 3PIQB 1RK1A 3LKSB 1UG9A 5E7BA 1P4IL 5FGCE 2MPAL 1UMIA 1FG2A 3JSSA 1ND0B 2XRAL 3UTTE 3OXRA 4LEOB 2XWJA 4IRSB 1IEBA 4PJHA 4X5XA 5D1QB 4PBXA 4RCAA 1MHPL 3PQYA 5HTSA 3CVHA 5I8CB 1CFBA 5DJAB 1ZMYA 1NEZA 3HZYB 1P5VA 5E7FA 5FF6B 3HPNA 1MCWM 4Y5XA 1Z9MA 5F6HI 3ACIA 3UJTL 3WO3B 5AUMB 3DMMD 3D1MC 5HHOD 3PGCB 2CRYA 5IBLC 2C3VB 5HHVL 1JGVL 4Y16C 3BHBA 3V5HB 4E8DA 1F4AA 4M03A 2GITA 3H3KA 4LHQB 3QQ4B 1EFXA 4HAGA 5FV1L 3RVUD 1T0MA 4OF6A 4U1HA 5DI8B 5DJYB 5CBEB 3G5YB 3QIWD 1NCDH 2ORXA 3VFOB 4NO3A 3JWDL 4P4RB 3PHOB 4TSAH 4ETYA 5E5UB 5CD3A 3KPQB 2QTEA 5HGHA 5T5NF 5MEPB 3JTTB 4EDWL 2W91A 4OIAA 4LHJB 1R5WA 2HKHL 3OR7B 3CLFL 1MJUL 5CEXA 4ZSOE 1XF4B 4M7LH 4JFEA 2V5TA 4RMQA 1HHHA 4ZO7A 5I8OH 2B20A 1PZ5A 1N2RB 1IQWL 4TUJA 4QXUH 1WUNT 2H6PB 2V5SA 3QBTB 2BP3A 1HH9B 4HUUB 1KBGH 4P4KB 5DK2B 3JWOC 4L8SB 1UWGH 4U1MA 1NSNL 1JGLL 1KPUA 2PCPA 5C0DA 4O58L 4M7LT 1IQDC 4LF3B 4PJ9A 3F7YB 2OSLA 1Q38A 4K9EL 5C8JA 2COQA 4KU1A 3NCBB 2X4TA 4BJ0A 4WI5A 1W0YT 2FGWH 4OLWL 3PWPB 2ICWJ 4UV4L 1CLYL 5ICXB 5TPWL 4M1DL 3U0TA 2BMKA 3O4OC 5BRZD 2ESVD 4HG6B 4WHCA 5GRYA 4Y4FA 1J0ZA 2BOBB 2WBJD 5EG6C 3ZE1F 3MODL 5A40E 1IKNC 1RUKL 5EUOE 4PLKC 1GGTA 4DK6A 2CDEB 5T3ZL 1UC6A 3FO0H 1RMFH 2CPCA 4NC0B 3LDBC 5E24E 4X8JB 3QJHB 5B4MD 3V4UL 1KF9B 2VR9A 1FDLL 2UVEA 1JUFA 1DQDL 2YSSB 1PD6A 1JV5A 3HR5A 1DE4B 4POYA 2YRZA 2R1YA 3CDGA 3EYVB 3O45B 3E3QE 3T3ME 5GS1C 3MRGB 1JPTL 1YNKH 1PEWA 3WUWB 3DVGB 4DUWA 4OCXH 3X17A 1LP9F 1VEOA 1FL6A 1NGPH 2K7QA 1TCMA 2IBGA 3NCYS 1XCQB 5SX5K 2A6DA 3MV8E 2ESVA 3SE8L 1B0GB 4NQDD 4AM0B 5EU3A 4AQ1B 3UJJH 4ENED 1NUGA 3SJVA 4RGOH 3O9WD 1KPUB 5F6HJ 2IPKA 1I9EA 3DBXA 1HINL 1K4CB 3MCLL 1MI5A 4LCWB 5JTWA 1CQYA 2DJUA 1DDHA 1AI1L 4KK5D 3TO2A 1LE5B 4PJAA 3VRJB 1YC8A 4J4PA 5C08E 4XH2B 3CFBA 3BP5B 2H1PH 2P42B 1DANT 1UXSA 4J3TA 1S5HB 3BPLC 4NN5B 1Q9OB 2VM9A 4XWGH 3NACH 5M95B 1AHWB 4L5FH 4IRSA 4NZUL 5DDHA 4Z7VE 5GIRA 3I2KA 1XCTA 2NY7H 2OQJB 2AJVL 5CKGA 1KENL 5DZOA 1RZKC 1HQ4A 4KPHH 4NO0D 1RHFA 3D39A 3HCVA 4FFZH 1C7SA 5IKCB 2EYRA 3NVQA 2Z4QA 2G60L 4MNGA 3BP5A 1RD6A 1JJUA 1OSPL 3AB0B 3IFNL 2GJ6A 3CJJA 3O2DH 4CDHA 1CLOL 2IGFH 1UVQB 2GK0A 4BDVB 1FFOA 5I75C 2VLLA 4UI9L 5I8KH 4C56B 1UACH 3RWHA 1KLUB 2IH3B 4WI7A 2Z35A 4V1DA 1MCIA 3D39B 4J6RL 2AGJH 3P9LA 5FHBH 3O3EB 2WBJA 2PXYB 1A5FH 1S78C 4RWHA 5BO1H 3WNNA 4TVPL 4W81A 2X1WL 1RYYA 1WISA 5I1HH 2GUOB 1KPVB 4OUOA 3ZDYE 4AM0A 3D18B 3SDDB 4JFOB 1ND0A 5GRXG 4DVBB 4KKAC 3VXUB 1EMTL 4PGCA 3ZZ1A 1QKZH 3OKKB 2WNGA 2VLRE 1WC7A 4TUJB 1G0XA 2ZCHL 2B8OT 4Z9KB 1YEIL 4Z7VF 4JB9L 3MLVL 3T8XA 4R0LB 1VADB 1YN7B 2XWBA 3OKMB 5CJXC 4XVHA 4MAYD 4MNQA 3WCYA 5BV7B 2AJSH 1B6UA 4JPWH 1T5XA 4NFCA 2BY2A 4XC3H 4K7PH 5DHXB 4Q9BA 4KMTL 1JN6B 1YEEL 4P3DA 2NXYB 4NNXA 3DX7B 3X3FH 3D2UB 3T0BA 3IETA 3S96A 1ZA3A 4OI9A 5EN2B 4F7PA 1H6XA 4GG6A 4G7YL 4Y1AA 1D5ZB 1X4ZA 1CIYA 1OGAA 4GAJH 2DQEL 5CFHA 4ZDHA 5FGSA 5EA0H 3EKCA 3BP6A 2VCCA 4BZ1H 2VQTA 1W0VA 2Y6SD 1NMCB 4E41E 1I4FB 4G8FB 3VFVA 3JTTA 4CUCA 3BKYH 1U3ZA 5ACLA 5ICXA 4DGIL 4CMMA 4HS3B 1YMMA 5SWZA 1CLZL 3ORJA 3VFOA 4KHTH 1QA9B 4AZ8A 4OZFA 2RIKA 4Y2OA 3FFCD 5HYQA 5JOFA 1OARH 2O93L 4NKIH 3QEQA 1NCCH 1MAMH 3V5KB 1G9NC 1J0YA 1A3LL 5H35B 5C07D 5I1EH 4DAGH 2RJ2A 1I1AB 1DVFD 2I26N 1NDMA 1VFOA 1A9EA 3O8XD 1U3HB 4LSUL 5E8OA 5E6IA 3L3HA 1U6AL 2EIBA 2DDQL 2DLTA 5GS0L 4IMKC 4GSDL 2EDLA 4NP4L 3ZKMD 5EUOF 1J84A 1QBLH 2H32B 1CGWA 1J05A 3BXNB 3W9DA 3V6FA 4BZ1L 3Q2CA 4XP4H 3V6OE 2EEDA 3PV7A 4LQ1A 1EX0A 3VRLE 3LKSA 5HHNB 1I8IA 4UDUA 1I1YA 3MV9E 3NJVA 4YPGA 3SKOB 3UC0H 3Q0HA 3ZTJG 2MHAB 3VJ6B 4WI6A 2VUYA 4ZQKB 1V8HA 4MX7B 1XF4A 3I50L 4XT1C 5HYSG 2V2XA 2E7LC 5D6DC 4YPJA 3AREC 3B8SA 5IQ9B 2GFBB 1TENA 5E8DL 3T77A 1JK8A 1CQKA 1TJGH 4UINH 1NFDA 1QSZA 1H5BA 1UQSB 2EIEA 4KVNH 5B39B 3BWAB 3TFKD 1ZHLA 2XFXA 3LV3B 1IGMH 5DSCB 2F5BL 3IKKA 3V5DB 4NO0B 1VGEH 4HGWA 3K4AA 1U92A 1XR9B 5BS0D 4OV5A 3QFJD 4X98B 3MOAL 2M1KA 5IJKC 2OSLB 5FYKL 3UTTD 2AJXH 3GJFH 3HZMB 5C0GB 2Y23A 3O6KL 3T0WA 3K81A 3TYGL 4NOFA 2X4RB 1HHJB 3TT3H 1U8OA 4XC1H 5F72S 3NNGA 1EBPA 3B5HA 4QY8B 2WLZA 5D7SH 4WWKA 5BO1L 3ZKNC 3EOAB 4W50A 3OB0K 4KK9D 4L0PA 1MSPA 2V2TA 3J8F7 2DLEA 1SVZA 5IVXE 4HGWB 3LEXA 4G3YL 3ZDYF 5IV2A 4NHCL 3RKPA 2QQKH 1EAPB 1I85A 4RAUA 2CMRL 3MUGA 4LEOA 4OTXL 4HJ0D 5C0FA 3C2AH 3U7WH 3ARDD 2Z31D 1DLCA 1OPGH 1J18A 4PREB 3WFDH 2WP3O 3WO4B 3FQXB 4ERSL 3IAPA 5T5FL 5J57B 3EOAA 3HE6C 5DC4B 2NY1D 5D7JA 4TOYH 3P4MB 4WENB 1BOGA 4YIQB 1EK3A 1T66C 2LU7A 4U2ZA 3FRPA 1OTUC 4DW2H 3MRIB 4G8EA 5TQ0H 3I85A 3QXAB 1CCZA 3D85D 4LOUD 3LKRA 3A6BL 5F7FA 3HAEH 1KJ2H 3DTXA 1QBML 1JCKA 4Z78A 1F58L 5K33A 3FL7A 3RL1B 4FFWC 2B0SL 1T04B 3MLZH 5T1LD 2A9NL 1BQSA 4APQD 1HILA 1AGEB 4LLQA 2VITA 4LRIC 4LRNH 4GUPB 4KKCC 4U1GC 1UYWH 1JPFB 4JREB 2VDQH 3UETA 5DSCA 1ZLWK 1G6RA 3HC3H 1TQCC 4IJ3B 1MUJB 1XR9A 1ZOXA 1IAKB 4HV8A 3BRGC 3V0VA 4Y0GA 1L7QA 1AD9B 1MCOL 4NNPL 5DUML 5IB1B 4YHZH 3GSNH 4JFZH 4XBGA 3O2WH 1P4BH 2W1WA 1FNLA 4OD2B 2DM3A 4UQ3B 1MVUA 3REWB 3K0WA 4OCXL 4PQQA 4L29A 2PXYA 4A41A 1MCLA 1IARB 1QA9A 4LBEA 4NOBA 3FRUB 5JXEA 4A4AA 4I2XB 1YNKL 3ZKSD 5JMOA 4R7NB 5EORH 3TBYB 2ORZA 3EJJX 2IMMA 5FEBA 1IFHL 4I0PC 3MA7A 4NC1C 1WWBX 3QDJE 4TN9A 4OZ4B 5C6TH 2ZOLA 2W9EH 2Y06H 2K1MA 4YDIH 1C5BH 4QXGH 1PLGL 5E56A 3NTCH 2HTKC 4OB5L 1UWEL 2RVAA 3W5MA 1E4JA 2BJMH 2EH7H 1OTSC 3S35L 1AGBB 3U30B 1E4KC 2VAAA 3DV6A 3MX0A 3GO1L 5E6IB 1L6ZA 4YC2B 1RVFH 1OM3H 5B8CB 3MREB 5FDWA 5EOTB 5FM8A 2ADIA 4NM8H 4WUUA 4LEXH 1OY3B 3FONA 2Q8AL 2H32A 2IAMA 3ARVA 4RRPA 5C0AD 1A1MB 1A47A 1SVCP 3VFVB 1DBBH 3V4VH 1HINH 3LZFH 3PABA 1AXTL 1L0YA 2QSCL 4TSBH 3UNPA 5ALCH 5T3XE 4JDZA 4LQRA 5D2NB 4DEPB 3QCTH 2VDPL 3P4LA 2EDQA 4HS3A 2W9DL 3QH3B 2NY2D 4G8IB 1OSZB 3KXFA 1G7PB 5CJ8A 2BNRE 2R0ZH 1R24B 2J3SA 4P2OB 2J88H 4ERSH 4X7FC 2FX9H 4AIZA 4WHYG 3MACH 4XVTL 1HHKA 3TNNA 1LO4L 1QLRB 1TVHB 4ONHB 1S9WA 1V7MH 3VXMD 4EUPA 5EBLA 1MHHB 3RAJH 4NHCH 3KS0H 3WBDA 2EO9A 5J6GB 1QBBA 4Y1AB 4F80A 3ZO0A 1MY5A 2BVEA 2PR4L 3AAZA 4HS6A 4KY1H 4OLXL 5J1AA 3TT3L 5HHNA 2WUCL 2G75A 4HC1H 2CDGA 4Z7VB 4N9OB 4X7DC 5ITFA 5DRNA 2MQ3A 4WV1B 2VDMH 5LAXB 3A23A 1NCCL 3ROLB 1R3HB 4FXKA 1U95B 1EGJA 1VGEL 5I74C 4JGUA 5ALCL 3HNTH 1E6OH 4Y4FC 3SDXA 5GZNC 1RJZB 3ZE0E 2ATKB 5C0IB 3HR6A 2OL3H 4Y4FD 3BKYL 2Z31C 4K9EH 1LP9B 1IBGL 1MRDH 1GJIA 3N1FC 1IZJA 4ZPTA 2P45B 5T5NG 4O58H 1WFUA 3CSYB 5JZ7D 4U7MA 4Z7QE 2MJWA 4TULH 5I73C 2XRAH 4GS7C 1FLRH 3QFJB 3EYOB 2IANE 5J4MA 3KPSA 1G7LA 3D0LA 1LK3H 3AS2A 1BLNA 1DLHA 1CFQB 5C0ND 1V3KA 3C60B 3CU7A 4LDEB 1H8NA 5TE6H 2QQIA 3PGDA 4XB7A 4CVUA 4QB2A 5DWUH 3PDDA 3RWJA 1G9MH 4GSDH 3S37L 4P5TB 1J0KA 1R3KB 1OGAD 2DQIL 1PW3A 4FTVD 2WIIA 3F8UB 4G5ZL 5F3HA 4WU5B 3MMEA 4JAMB 2JKXA 4NZRL 1W8NA 4YZFE 2A6DB 4EVNB 2VH5H 5F9OL 1RU9H 4L9LB 4NKIL 4Z7VA 1MHCB 4RISH 1M7IA 4HHAB 5IVOA 4A3ZA 3WMSA 4L4VE 5LAXA 4YHNB 3RWIB 1CICC 5IVZB 4B53A 1A1OB 5DFTA 5SWSB 5KS9E 3SY0B 1T3FB 4JDTL 3VWJD 5JW4N 3RWFB 4LCWA 1NFDE 5JIHA 5B4MC 3CDZB 5E2VL 1I8MB 4JKMA 2B0SH 2I60H 1A7PL 3CFEA 4HKXB 1TG7A 3PQYB 4XCCL 5C07B 3MFFA 3I6KA 3F2ZA 1SEBA 4L8SC 4MQTB 4JO4H 3PP4L 5TQ0L 4L8SA 1JUFB 2AJYH 4KKBD 1VFUA 1W72H 1EJOH 2F8XC 3IFLL 4KMTH 5DRWB 1TPXC 5DQ0A 5D8JL 4AEHH 1X6LA 2XNAA 12E8H 3KWWB 4HWEL 3KLHC 2DQFB 1QR1A 3G5YA 1KCUL 3ES6A 3QCUH 4A2MA 2HT4D 4XCCH 5INDB 2X05A 4ZD3H 3MRBA 2J2ZA 2J8UB 5F7UA 2GJ6B 4WWKD 2F19L 4ZTOL 3QISA 1CXIA 3FMGH 4GBXD 5DJYA 5I66A 1CGYA 3HKFA 3UPRB 2J1KA 4MB5A 4KTEH 4QRTA 3G5VB 1DEEA 4Z7WE 4N8VA 3H9HB 3AS1A 3DSNA 3K74B 4Y4FB 4KXZI 5A2LH 5CP3A 3SGKA 3C8HA 3NABH 3RTQD 4UIMA 4LCIL 3IJYA 5EUOA 1CXFA 2HKFH 4BFGA 4YDJB 1VCAA 2VAAB 3VXMA 4Y5XB 3OKEB 4Y5VB 3ZE2E 3A6CH 4ZFGL 4QHLA 1LEGA 4HGMA 4N1HB 3CFBB 1SJHA 3RWGB 3EJZD 1B90A 5I30H 1NKGA 1NAMA 4FZEH 5C0BE 2V72A 3CZFB 3KG5A 2VMEA 1BOYA 5FECB 1VSCA 1X7QA 3AROA 5J56B 2HTKD 3MRDA 1T1XA 4JDVB 5C0RL 3IU3B 3IDMB 3IFNH 4GRLD 1RUQH 5CWSB 1YY9D 3NFPB 4XPHH 1ZA6A 4HS6B 5KTEH 2HA1A 4LSTH 3BN9C 2AQ2A 2BOCA 3MLXL 3NAAH 3BDBA 1QFWM 4GKNB 3O3BB 4F7CA 1NFDF 2OI9C 4X5WA 5ICZA 5MEOB 1Q94A 1FZJA 3IFOB 4UUJB 3AU1B 3JV6A 5AYQA 1TZHB 3QPQD 2EDFA 5TF1H 1CFVH 5F1NA 3RX8A 1K85A 5C0IA 4QRRD 1BFVL 1FAKT 3KXFB 5F96L 4UZGA 3RGVA 4AEIL 4R8WL 2CKNA 3VD5A 2YC1B 4DGYL 4APQC 4ODSL 4PP2A 2FIKB 5JMRA 4ZFOL 3SGEH 5KSAB 3GHBH 1S5IH 3UTSA 3EJZC 4NUJA 1OF2A 8CGTA 1MRFH 1A6VH 4NO2B 1A9BA 1O5DT 4OM1H 4OD3L 4ZAKB 4TUKH 4ET7A 1CIUA 5JMOC 3WDHA 2NXZC 2XN9E 1IEAB 4RMVA 3VXSB 1BD2E 4GW4B 3MA9L 3ECQA 3LEKA 4P2QB 1R5WB 5E99H 2C26A 2QQLH 1MFAH 2A73A 4F57L 3EBAA 2A0LD 4MOAA 4GG6F 5F7DB 3VE0A 5C0AE 1I1FA 3P9WB 4J1UB 3JV4A 4MVBD 3QDMD 4RFNC 4AK1A 1KIRA 3RL1A 5GS1A 1DYOA 2IBBA 2E5EA 4KTDL 1ADQL 1FHGA 2IQ9L 2NY0D 4MA8L 2YPLB 4QTHA 3E6FA 1ZANH 1DBML 4JVPA 4MA3B 3SKJE 1YMME 4G42A 5B3JF 1GC1L 5I1JL 3UROR 1DCLA 2YPKB 3GBNH 4OT1L 2E27H 4Z8FH 2VXTH 4C4KO 5J1SC 3HZVA 3CQOA 3RVWD 3I2CH 3MXWH 1K3IA 4OZGE 5IB3A 1FYTD 2PO6A 1IAIM 5JOFB 4GS7B 4P99A 4WFED 2MKWA 4OLWH 1G6VK 2GYSA 4BSWB 5D4QA 3SCMC 3TJEL 4OZFH 2C1PB 1F4HA 1U3HC 2CSPA 1HHGA 3BWAA 4ZG1A 1M7XA 2VLKA 2WMPA 1EAJA 3RGVB 5ABDE 1VENA 4H20L 2E6QA 2W65A 4LVHC 2LVCA 4HWUA 3TT1L 2ZKHL 2F74B 3ARGC 3GBLA 1OAYL 1P9MC 2YPVH 5C09B 4UB0L 1WLHA 1RVFL 3TO4C 3W0WB 1EEZA 4YHOL 5KSAA 4Y2DB 4YDVA 5CEZL 4AG4H 2BVUA 3WXVL 3LRGA 4WI2A 3IU4L 4X8XA 3EZJB 3GK8H 1FFRA 2DF3A 3RVXC 1K45A 5C0CD 3VI4E 1UADC 3HE6B 1JF1B 1Y0LB 4MXQD 5H37H 5I66B 5IW6B 2X70A 1NDGA 1S7UB 5KZCB 3QUMA 1YMMB 2AEIT 1QEWB 4J3SA 4F7MA 3V95A 3PF2A 3DURA 2IBZX 4GQ9H 1KTLA 1OAYH 2ERJC 1HDMA 4EN3B 4UU9A 2PETA 3HFML 1NCDL 1P7QA 2V2XB 3ARPA 2BNRD 4KTYA 1EEQA 5JXEC 4OZIF 4OUEA 4YHMH 1CU4L 4WHYH 1NMBL 2DBLL 4NWUH 5LXGH 1U3HA 3MRFB 1RPQA 3ECBB 3IETB 2ITDA 4TNWK 5FCUH 2YD6A 5HHVH 2BHYA 3CMOH 3IDMA 1KFAH 3QUZC 4LKCA 2R2HB 4PJGE 1CDJA 5JOPD 5DJ0A 1IT9H 4QRPA 4FZ8L 3BIKA 1A4JA 2N56A 2OJEA 4XX1G 3EO1B 4WFEE 3NAAL 1DBMH 1CFTB 2IANB 1J12A 4XPHL 2VISB 3LPFA 4OMCA 2EDTA 4ACPA 1M7IB 4HHAA 1KTDA 3U7AA 3GMRA 3DX8B 1HEZA 1UB6A 4MA7H 4PJ8D 4M4RA 4MD4A 4DFHA 2YRPA 3S34L 1Q94B 4L3ED 5C08B 4YC2C 4O2CA 4RA0C 4PJXB 1JK8B 2K9UA 3NH7H 4P2YA 2HJKB 4MD0A 1BFTA 1JWMB 2Z35B 3PWNB 4ZSOA 4OTXH 3QQ9C 3VXSD 4BFBD 5TH2B 3IGAA 3RA7L 3TBSA 4HULB 3BEWB 1OAUL 3I3EA 2D4FA