1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
4UVCA 4CXFA 1S7AA 2E7WA 1X7NA 2HKXA 1RI7A 4EM1A 3GFJA 4IRIA 1MZBA 5FLXK 1DGRA 3SHRA 4MNUA 3KP3A 2CWEA 3HT1A 4D0PA 3USSA 3EBRA 1ZLJA 2XVCA 4GXOA 4EMSA 1KA8A 2CV6A 1X8EA 1JHHA 1ZVFA 1UIKA 1XCVA 4FX4A 3T0YA 2O8QA 4ORFA 1XE8A 3FF5A 2DBBA 1PUEE 3WTVC 1LNWA 2BNNA 3CJXA 4U7BA 1LQ1A 1ZRRA 2FE3A 3TOBA 3RI4A 3H3UA 1KQ8A 1CAVA 2V9VA 2M1BA 4BIFA 3NW4A 4JTNA 1TQMA 4H0EA 3ZMTA 4EM2A 4HF1A 1W4MA 5CJ9A 5BS6A 3EETA 3E6CC 3HTUA 5I0RA 2HDCA 3E3VA 1QBJA 1FP1D 2XAQA 4O6JA 3BALA 1HW1A 1IXCA 2Z69A 4I0AA 4KT5C 2HTJA 3E5XA 2H6CA 4Z82A 2L54A 3PLQA 1DDNA 2X0LA 2QYOA 3ZQ7A 5KHJA 2EFNA 1UB9A 4B29A 1Y0UA 1K6OA 2IXKA 5D6FA 2HTSA 3M7GA 1CF7B 4H7LA 4IEZA 4EJOA 4M74A 1BI3A 2UYAA 3GZ6A 1DP7P 2Z33A 2UYBA 2DCTA 2EFOA 3KP7A 1PDNC 3HRUA 4D7TA 1QGPA 4JK1X 4YFNF 2Q1ZB 4HBLA 2FOKA 1L3LA 3BP8A 3H8UA 3I0TA 3ETQA 2L3DA 1V3FA 1D8JA 2DTRA 2C6YA 4MGKE 4NVPA 3DPLC 5LRRA 1YFXA 1U2WA 4LA2A 3KP6A 1TQIA 2QENA 3WU0A 1XD7A 5DUKA 3SXWA 1P4AA 1ZRDA 3GYDA 2DI3A 4N9HA 2FMLA 3I71A 1SMYF 2W57A 2VE8A 3BROA 5DD4A 3Q9VA 3O2PE 5J6XA 4UVBA 2EWNA 3GYHX 2GXGA 2XAGA 1TW3A 1O3TA 4ZYHA 4LB5A 5K8SA 5K1YA 3NKTA 4LTAA 2KKOA 5FLHA 1RGSA 5I93A 3CLPA 5HDNA 4LEJA 3N97A 1K7AA 4I01A 1ODDA 5ILSA 1TLHB 2K4BA 3H92A 5J8CA 2FBKA 3E5UA 4XSZF 5HI0A 1P4WA 4PIYA 4RGRA 4MUVA 2QQAA 4MEYF 1NE6A 5I8YA 3EHKA 2LKPA 1DPUA 1V4RA 4HLXA 5D8LB 1WWXA 4LLLA 4OINF 1G3WA 4EV0A 2M8EA 1J2XA 4L9NA 5H6RA 1XCBA 4I2OA 3LAJA 1SFUA 4QGLA 2XROA 1FNNA 2O61A 4UXAA 2NAZA 4G6QA 1EV7A 2B9UA 2O03A 5D8KB 3R61A 1G3TA 4AVAA 4CYDA 2EA2A 2PQ8A 2Z99A 3JZVA 1DZRA 4KUMA 2PHDA 4KN4X 3SQNA 3IBMA 4O9GA 3HUGA 2P5LC 2CO5A 1MDMA 3GFLA 1G3SA 3I5UA 1IRFA 2BBYA 3G7DA 4IEXA 2CSOA 4MHGA 2KIFA 4HLTA 2B8MA 1KQ9A 4XF1A 4IRGA 1FI2A 2OQRA 2F4PA 1K79A 3LA3A 4NQWA 3SCHA 2DAOA 2XGXA 2EJRA 3E6BA 2WWYA 4IPAA 2MLKA 4WWCA 1YG2A 3WTYC 3BY6A 4YIFA 4IRHA 1QZYA 2K27A 3MQ0A 1CAUB 2MBFA 4E2GA 1FXZA 4YFXF 4K2EA 1S29A 2PJPA 5EEHA 1FBSA 3BJOA 4U7DA 1C0WA 1YTYA 3FM5A 3RYKA 3H1YA 3E6DA 4OU0A 2HGCA 2QQ9A 3HOTA 4L2NA 3NVCA 1IN6A 3M8EA 2A07F 1YYVA 4LD5A 2BYVE 1K78A 4EJUA 2DT5A 2VT2A 2DK8A 1Z7UA 2Q0AA 4MGZE 3ELKA 5F64A 3ZMSA 1J3PA 3HSEA 3LAPA 2RC4A 2DPUA 5E1RA 2EV5A 2QJVA 4MH0E 2RKHA 3DL3A 2PI0A 3DF8A 5LHHA 1YO5C 1MDMB 2MH9A 1YHFA 3H7YA 3VHRA 2MHFA 2Q8KA 3QOPA 2FXAA 4ENKA 2IC1A 1XMAA 2YU3A 4WF2A 1BM9A 4EJVA 3GVAA 3DN7A 4DQ2A 4LB6B 1I1GA 2V1XA 2P7VB 3ULQB 4BYYA 4KA4A 1B9MA 1O3QA 4EGZA 1P2FA 5K5QA 1E17A 4AD9A 1JUHA 4WX9A 1JHFA 5HS8A 4F7ZA 4LULA 1XN7A 5ICFA 4G7ZF 4IHSA 5LRSA 1UW8A 2NNNA 4IXAA 3RIRA 1B4AA 2VBYA 2OQGA 5BQTA 4Y13A 2DQLA 3DV8A 2L02A 3KSCA 4HX8A 5FQ0A 1JGSA 1IN5A 3U9GA 2IPQX 5ICGA 4NB5A 1WI9A 3TGNA 3KFWX 1PMIA 4XRFA 4OIQF 1G3YA 4M9ZA 3WE2A 1J7KA 3COAC 2FA5A 3RPUA 2GC2A 1SFEA 1IN7A 2CW0F 4G7OF 4Q0VA 3VFZA 5LHIA 1XGSA 1PP7U 1ZZ8A 3D5LA 3ACLA 1H9GA 3L09A 1LB2A 3GWZA 5A2QK 3ERED 3BB6A 4M9SA 4D7SA 3FM3A 1QPMA 2RQPA 2FNPA 1ZNPA 2BEOA 4ZH4F 1J3QA 1W7PB 2XAFA 1JE8A 2ZNZA 5ICCA 3QP6A 3VEPA 2VBZA 3ZMUA 4XFCA 3SZTA 4HF2A 4AIJA 3F3XA 4G9YA 5KHIA 3MYXA 1Z6TA 1NXMA 4LG0A 4QX5A 3OV8A 3O14A 1H1IA 2W24A 1I6XA 1OYWA 1R23A 3F21A 3TDZC 3BU7A 4L9VA 4IETA 4ESBA 2ZKZA 4HQMA 1VJ2A 1MGTA 4U88A 1QO0D 1STZA 1U5TA 2OPKA 2DFIA 2PMUA 1QQIA 4M9XA 4FT8A 1O5LA 4HV6A 3ZPLA 5FQ0B 3IL2A 5CYVA 1XSVA 2OBPA 4FAGA 3U2RA 2GZWA 2LF8A 4BAYA 4X6QB 4Z2YA 2MA3A 5DDGA 4HMZA 3F22A 4LUMA 4IESA 3C3WA 3F6OA 2RDPA 2QUFA 3I4PA 4XF9A 1G6NA 1ZZ9A 5K5OA 4WVZA 3IC7A 3GEZA 3P9IA 3I64A 2GIVA 1WRJA 3F8BA 3I7DA 1BC7C 2Z9OA 2PFBA 4BNCA 2XLFA 1FY7A 5FGMA 3R0AA 4KWJA 2G7UA 2HJIA 4QGMA 4HVRA 1WLTA 4MGYE 2R7DA 2NYXA 3GLXA 4RGXA 5KHKA 4UUVA 1YWKA 1DPRA 4G7HF 1VP6A 1W7PA 4R79A 4LLNA 4Q5SF 2Z3YA 2EVXA 3F8FA 4A6EA 4ENNA 3K69A 4J1XA 3V7RA 2H0VA 5ERIA 4UHTA 2D1HA 5JFRA 4TV7A 4E70A 2HKOA 3IRQA 1YLFA 3F72A 4R8HA 1BI2A 2GC0A 2PAKA 4EWAA 4RB1A 3GFIA 5D1IA 3IWFA 1G4DA 4XBFA 4A12A 3OGJA 2W84A 5JSRA 4L9JA 1R22A 4EJWA 1FYKA 2IXHA 1OMIA 2CAVA 4YNIA 3V4GA 1HXDA 5FLIA 5L3DA 3RYPA 2IXIA 5IT9K 3WGHA 2JRTA 3MZHA 2HZTA 2XV4S 1FBQA 2YX7A 2OA4A 2IW5A 4L18B 2E1NA 3FMRA 2HFHA 1E2XA 4I09A 1TQPA 4FAHA 2K9ZA 4N9IA 3ML6A 4GCVA 4HDUA 4WXCA 2L01A 1ZX5A 4ENMA 5EEGA 3KCCA 1NYWA 4JBAA 1CX4A 4KU7A 2WFPA 2Y0MA 1KYZA 3QU6A 2QNKA 1YW7A 1SMTA 2B5HA 4E2QA 2XUBA 3ZMZA 5HLIA 2LNBA 1OYYA 1ZGJA 3ST7A 3UKTA 3S7IA 3KGZA 5JCTA 4M6YA 1ULYA 5LHGA 3KETA 3DFGA 4HVOA 3Q9SA 3TDUC 5D4SA 1CAWA 2Z2SB 1QNTA 1U5TC 4L0YB 1IAWA 2HYFA 1EH7A 1XGNA 3I54A 2CFXA 2EK5A 2VODA 1EYBA 5DUIA 4IEOA 4RD7A 5ICEA 3ROUA 3V8JA 2UY9A 3BDDA 2PEXA 5BPXA 4KU8A 4RAZA 1DUXC 3EO6A 4Q47A 1W5SA 5H20A 5IT3A 2OA2A 4ZYDA 1RTVA 3HQXA 3M70A 1T98A 1ZN2A 1TNSA 3V8LA 3C1DA 4U0WA 3CL1A 2LF7A 2HYGD 2MC3A 4BH9A 2ESHA 1FBUA 3WU1B 2E9QA 1FPQA 5K5RA 3CO2A 1D8KA 1S3JA 3H3ZA 2VE9A 1Y3TA 4META 4XFFA 4OIRF 4UV8A 2GWRA 1UCRA 4CICA 2IXJA 3R60A 2VQAA 2DU9A 3LSTA 1HSTA 2QBYB 3RZZA 1QY4A 3WW2A 2P6TA 2K7LA 1CAUA 1ZG1A 4E2SA 4BQAA 3W6KB 2A6EF 1ZAOA 1DZTA 3ISPA 4KMUX 2ZFWA 3CUQB 3M8FA 4HSLA 1I5ZA 4AIHA 3T8TA 2F5EA 3H9AA 5CVJA 2XL7A 5EZWA 1Q5OA 1UHMA 4L0ZB 3J7AO 3CEWA 1YW9A 4RS8A 2FU4A 1B6AA 4HOBA 3S2WA 5TRDA 4N0BA 4PZJA 4LMYA 3BCWA 3OD0A 2DPDA 3SHFA 3EQEA 5HDGA 2Z5UA 3BJ6A 1H9TA 4HW0A 3FFQA 2MD5A 1O57A 2FBHA 4AQ2A 1QXRA 3P9KA 3OTFA 2BGCA 1T2KA 3E5QA 4BHPA 4U0VA 2HEOA 4HSJA 2I45A 1CAVB 4Q0QA 3NSTA 4AIKA 2B0LA 5HOOA 1T38A 3E97A 2D40A 1RZ4A 5KK1A 3WTXC 4LA3A 3KE2A 3IKTA 2G7HA 3SXYA 4OIPF 3R6SA 2AXLA 3R4KA 4MZUA 3K1MA 2UWMA 3OCPA 3FHIB 5F6FA 2PLYA 1X82A 5JI6A 3HSRA 4EJTA 4LLGF 3KP5A 1USSA 1WQ2A 4FBFA 1R7JA 4IEUA 2ET7A 1FT9A 3WGGA 2HQNA 1BI0A 4RGSA 1EPZA 1OYIA 3HHHA 2ZCWA 2GQQA 2JZYA 3ZMVA 2WV0A 2P17A 5JSOA 3J81K 5AVPA 2DO7A 2HR3A 1LEBA 2O6GE 5FB2A 2V1DA 4A5NA 1R5HA 1U8RA 2G9WA 4KFCA 1TBXA 3QP5A 1HKSA 2IXCA 1KYWA 1IXSB 3WE3A 1PP8F 4A6DA 5C6CA 1U6GA 4CGZA 3H50A 2VBWA 2CGPA 5KHHA 2PAEA 4KIFA 1Q3EA 2EA7A 2VONA 2A3SA 2VXZA 1O3SA 1U3EM 3WTZA 4G6DA 4A5MA 5E20A 5T3NA 1OI6A 4HYEA 4ETSA 4YARA 4KN7X 3SMHA 2HWVA 5E17F 3HHGA 1FWZA 3MEXA 1LJ9A 3IWZA 1WSUA 2QWWA 2X4HA 3FXRA 1QZZA 2VOOA 1RIOH 4YYOA 2JPCA 5D5VB 4ENJA 4JTOA 1YLLA 1KQ0A 3SZPA 3DKWA 4IF4A 3K9TA 2FF4A 2ISZA 3MFKA 2EV0A 4UVAA 3NL1A 4G8XA 2VN2A 3IDCB 3N4MA 3RKXA 4HX7A 3FZ3A 1IZ1A 2VC0A 3UKVA 4HF0A 4UNOA 1TW2A 1QWRA 3QACA 3V8KA 3T8RA 3PQJA 1HSJA 4M72A 1UIJA 3CJNA 1USTA 4K8FA 3RPQA 2HOEA 4GYIA 2XRNA 3MPBA 1UD1A 2VT3A 5IT9Z 4UXNA 4PDKA 1JXSA 2DQRA 2V79A 2ETHA 3WGIA 1B1BA 3FZVA 1TQ5A 2J5OA 2Q4SA 1LDKB 1VTNC 1J5YA 1FLIA 4PCQA 1YS7A 3S0MA 1Z1DA 1L0OC 2OZJA 2OU2A 3CUQA 3RTRA 2XLGA 2R7FA 1ZZCA 1MJ9A 2Q0OA 4L5JA 5I8TA 1XSDA 1X3UA 4KWLA 1YS6A 4M71A 2YX4A 1BOAA 3GZ5A 3TO6A 3L7WA 2P5KA 5LGTA 1IF1A 4RB3C 5J7MA 2L4AA 4XFHA 4IJAA 4I98B 1AOYA 5ILUA 3GFMA 5JVTA 2NRAC 2YR2A 4KYWA 2JSCA 3PFIA 1ON1A 2MPFA 5L3GA 1U5TB 1S7OA 1FP2A 2MLGA 2M45A 2PTMA 1F4KA 3E6MA 1O7LA 3TOAA 1GVJA 4Y15A 4CZZA 1O5UA 2K02A 4RB2C 1EY2A 1HW2A 4IHTA 3IHUA 4PGGA 4JV4A 2IA1A 4LFUA 1S8NA 4B8XA 3WG9A 1K78B 3KZZA 4MGRA 4EROA 5JR3A 5ED4A 2N7GA 1XSXA 3ABUA 2JPBA 3H1MA 1UCXA 1BIBA 1BC8C 2E7XA 2OZUA 3KP4A 2PMHA 3ECOA 1Z05A 4HX4A 3TQNA 5FLXZ 1P92A 4ZYGA 3D0SA 1IPKA 4JQFA 5AIPA 2NNYA 1YIOA 6PAXA 2MNGA 4YRDA 2ET1A 2V6CA 2M30A 4EVIA 2OZ6A 3NQOA 2PQQA 4HV5A 3ABTA 1FX7A 2CG4A 5D6EA 4WK8F 2P7CB 5LEKA 4OLLA 3GW2A 3HRSA 2BNMA 1J1LA 3DXJF 2J5PA 1O3RA 4XF0A 2KJBA 1UPIA 5CVRA 2D5HA 3DPTA 4MV2A 1R58A 4WZCA 1WGPA 1R00A 1TTYA 3C18A 1EH6A 2P5VA 2OAZA 4MQ9F 1MKMA 4R52A 1Z91A 4EWEA 5BUVA 5CLSA 2H27A 4BHBA 1P6RA 1RC6A 3G73A 3ZN1A 1BN5A 1R36A 3U10A 1RUNA 3HTSB 2WC2A 2QZ8A 5J3UA 3RYRA 1FSHA 1LKNA 3K2ZA 1OD5A 5CVVA 3FHZA 3BPVA 4CO8A 1OR7A 3H7JA 2HS5A 2QVSB 4DINB 4OIOF 2GC3A 1H0MA 5FFZA 2DK5A 4LLOA 4XETA 3JW4A 3L9FA 2QM3A 2M5WA 4P9GA 4Q0SA 4KIBA 4MTEA 1LRHA 1OKRA 4YIIA 3WODF 3NEUA 5BPIA 3GX4X 4ZU5A 5BPDA 1T6SA 2EB7A 3J81Z 4I3PA 1GXPA 3EYIA 1IRGA 1R1TA 1R1VA 2P4WA 3O3KA 1T39A 1FSEA 1SEFA 1XGOA 1KU9A 2R3SA 3J80Z 1BJAA 4M73A 2WTEA 1ZRCA 1FYLA 2F5CA 1XDUA 1CAXB 3RNSA 5FPXA 3D82A 4L9TA 5L3CA 4IEPA 4Q4ZF 4QM8A 1HW5A 1Q1HA 3EQLF 1BBYA 3ES4A 3IKVA 1TNTA 5DCMA 2OYZA 1REPC 4PGHA 1SQ4A 3O6BB 3SCFA 5DV5A 1MJAA 2L4MA 5FDBA 1SD6A 2QQBA 2K86A 2H6BA 4XLPF 4P96A 5TJJA 1OPCA 1J9IA 2UY8A 1Z6RA 2BNOA 2M87A 2ZMEB 3BWGA 3ECHA 1YFHA 5LLQA 3F6VA 3VODA 4Q48A 1BI1A 2A61A 2Y0OA 4KL1A 4XF3A 4RGUA 4OMZA 4IEQA 3LQQA 3UKNA 1NE4A 1D3YA 4A2UA 4HA8A 5FD6A 1CGPA 3CDHA 5HDKA 3K0LA 2ADUA 4PJYA 4I0BA 2GA1A 3REOA 2FSWA 5FD5A 1R5GA 3F8CA 4Q0UA 3HYIA 5FFXA 3K1NA 4GYGA 2KXLA 4HBNA 3KEOA 1XGMA 5H6QA 1KU2A 4UV9A 4Z07A 2GAUA 2PBIA 2TDXA 5I91A 2DLLA 1W5TA 4AXOA 4TLFA 4I7HA 5E8GA 1ZG3A 1SD5A 4KWKA 4ZU7A 4ZU4A 3KP2A 1T0FA 2W85A 3TNPB 3V7CA 1UHWA 5HVQC 4M6XA 1ZG5A 2ESNA 3PQKA 1WKMA 5J8FA 3BPZA 3I59A 3W6JB 3EDPA 3P9CA 2F5DA 3LFKA 2V09A 1YUDA 2XAJA 1ZRFA 4QGNA 4OOIA 1J0RA 1ZZBA 1HQCA 2A68F 3OOPA 3F8NA 5KHGA 5KVRA 2JTVA 1OFNA 3LWFA 3M1EA 1XMKA 2EV6A 3HOSA 1VR3A 3OF1A 1MJBA 3L2CA 4XFGA 4ZZDA 2ATFA 3MAJA 2MH2A 4FX0A 4P9UA 4GGGA 1ZARA 4P9FA 1U78A 4B09A 1SFXA 3I53A 1LDDA 3J80K 4DNCA 2ZO4A 3DEUA 4GO1A 1HBXG 4A0XA 3HRTA 5E8IA 2JT1A 1IN8A 5J48A 3GF2A 3B02A 4WCGA 2LDUA 3RJPA 2DW4A 3ELNA 3JAMZ 3CF6E 1YFYA 1AWCA 2P6SA 2VC1A 2O3FA 4ZYEA 4ZZLA 2PYTA 1IPJA 1KU7A 3KZYA 1HKTA 1LDJA 3H1WA 3KMHA 4WXDA 2EA4A 4U0YA 5E16A 3MZYA 5LGNA 2STWA 4HLYA 3U0ZA 4IERA 2VECA 5CU1A 2KRFA 3KLOA 3CO6C 2IRFG 1Y9QA 1W7PD 1RNLA 3GXOA 3TKYA 3L2HA 2FEZA 4LUKA 4PIXA 2H09A 4ESFA 5LBQA 4XFAA 4BHCA 3V7SA 2F5FA 1YW8A 1LR5A 2KJCA 3F23A 4CDGA 2IXLA 3L00A 4BXUA 5CVUA 3Q5FA 4LK0F 1F9NA 4QLCU 4AVBA 5AIQA 4O9EA 4OMYA 3IDBB 3LOIA 1P4XA 5EFUA 1ZH5A 3ES1A 1B9NA 2NS0A 2D1VA 3C3VA 3TO7A 5L3EA 4LJZF 5I0UA 3F8MA 2K0GA 5JHUA 2D45A 3R0JA 1V70A 2PAMA 2FQPA 2Q2EA 5E1XA 2ACJA 1GXQA 1IW7F 2RN7A 4ESJA 2COMA 1RL3A 2KIUA 3P7NA 5BXXA 2IT0A 3IRRA 4I02A 4Q29A 3SFZA 4YFKF 1ZREA 1XE7A 3LA2A 4IEWA 1IN4A 1KU3A 4KDPA 4JVAA 2UXXA 5BMZA 3MDPA 3CTAA 3FJSA 4MEXF 1ZGAA 4KIGA 3QPHA 5KBFA 2ZBKA 2OD5A 1U12A 1L3JA 5CVIA 4RB0A 2A5YB 1D5VA 1I27A 3B73A 2CAUA 3WW3A 4IEVA 2F2EA 5D4RA 4MQVA 4J1WA 3KEQA 5BV6A 2ZNYA 1J75A 3S7EA 2W25A 2ZKLA 2KIMA 3AAFA 3HIFA 1FYMA 2Y48A 4XFBA 2IVMA 1GQGA 4FHTA 1QXJA 3SCGA 4WBBA 3VB2A 1SD7A 3LQRA 2VOPA 5JSPA 3JAMK 2IP2A 4QWQA 2VBXA 4F8AA 3GBFA 3CUOA 1XDSA 4XFIA 1GHCA 5I0TA 4XSXF 5I0SA 2XHKA 5DCFA 2YSRA 2E1CA 1A04A 5FLJA 4LK1F 4YG2F 1I1SA 5D5UB 3IIAA 3EUHA 5HLHA 1UFMA 2ZXJA 2PFWA 4HQEA 5DD8A 3U11A 3MWMA 1XB4A 3EJKA 3BOQA 4QMAA 1Z9CA 5D5WB 2O0YA 4MTDA 1ONVA 2QVOA 4WXHA 1ZYRF 4XLNF 2EFQA 2CQKA 5D5XB 3KGLA 4HZFA 3ZP5A 2ISYA 4L5IA 2XKPA 3EYYA 3BZ6A 4HAMA 2H94A 4EM0B 2XIGA 5ILVA 5DEQA 2XL9A 1FC3A 3NJZA 3WTUC 4KMFA 2XLAA 4AQ6A 2P8TA 2BE5F 2IA2A 4ON0A 1KGSA 4P5OA 3QRFF 2EFPA 2FQ3A 4A0ZA 1J3RA 4Y17A 2ZJ2A 5E1WA 2O1QA 1HKQA 2C0ZA 2RV8A 1RUOA 1J58A 2V1UA 3CUQC 2FNAA 1CAXA 4XEZA 3JSOA 4HN1A 2ELHA 4S04A 3D0JA 2GC1A 1NHAA 4ASNA 4AVCA 3CLOA 2ZMEA 3JTHA 1O4TA 5JAXA 3TNQA 4O5VA 3LA7A 3GUDA 1WA4A 5DCMB 4IEYA 3KLNA 3JSPA 4L11A 2GXBA 2PG4A 2BV6A 3MCZA 4HN0A 4QM9A 4XF4A 3WTWC 3FMSA 1LEAA 1B59A 2RVCA 3FMQA 5CADA 3PVBB 4IVNA 4UBGA 4GULA 2PN6A 1FZPB 3T5XA 3WW1A 2QCSB 3HRMA 2O8XA 4AWXB 4HDVA 1EP0A 1ZZ6A 2UXNA 5AONA 3QU3A 5L3FA 2YPRA 1CF7A 3PNAA 2XASA 2AS5F 2HQRA 4NHJA 3ZDSA 3T1BA 4RAYA 5L3BA 4LG0B 3RKYA 3QAHA 3DP7A 4KNYA 2VPVA 3GO5A 1J59A 2IJLA 4Q0PA 1CAWB 1S6LA 1PM7A 4OFGA 2EAAA 1XRUA 3JTGA 2PHLA 1YFUA 4S05A 5BOXA 3LWCA 1F5TA 4CHUA 5C8WA 4P55A 5F1RA 3FXQA 1BIAA 1SFNA 1ZZ7A 2FRHA 2Y75A 3I59B 1LVAA 1Q43A 5I8SA 1IUYA 1H1MA 3TO9A 4O3MA 3BJAA 4MGIE 1YFWA 3VOEA 2XKOA 3FE5A 2XAHA 3BPXA 2QDRA 2RGVA 5FPZA 3K1PA 1NZCA 4R1HA 4MX3A 2RNJA 3NRVA 2PA7A 5A2QZ 2D2WA 3FX3A 1SAXA 1IXRC 3FWEA 3RKWA 5HS7A 3WW4A 1ZHFA 3FXUA 3CO7C 2A6HF 1X8MA 1R1UA 3M3IA 4UBHA 3QPTA 2K4JA 2D5FA 2FBIA 2GA2A 3C7JA 4PIZA 1EH8A 5LGUA 2ETEA 4EQQA 4AVPA 3ZMDA 2UZKA 5JR7B 3U1DA 4YSFA 4G94A 1GQHA 4HVQA 1DGWA 2QLZA 4LGWA 3WTTC 2EFWA 4KICA 5FCCA 2FMYA 1YQAA 3I58A 4EWDA 1F1ZA 2D93A 5LEJA 4A0YA 3WTSC 2GU9A 2QBYA 5HLGA 3HSFA 3RDIA 1SD4A 4EGYA 1ZLKA 5BY5A 4X6RB 2IA0A 2Q30A 5HS9A 3ZN0A 2STTA 3M9AA 2CYYA 3HT2A 1MD0A 5E1ZB 4QXKA 5DYMA 1FOKA 2LSOA 5FO5A 3G3ZA 2GH2A 3DQVC 3LZZA 4ONUA 3LAGA 1O7FA 5E18F 1ON2A 2A69F
chains in the Genus database with same CATH superfamily
2Q8CA 3QQAA 1AA7A 4FXGB 4KNCA 1JGGA 2RG4A 2E7WA 5C71A 1B72A 4IRIA 5EP9A 4FFIA 3VSKA 3SHRA 4P1WA 1VQ9I 2QEXI 2QCOA 4YFWA 5FZKA 5DTDA 4D0PA 3RKQA 2F17A 1X1PA 2EZLA 5FKOA 1X3WB 3HR9A 3AMPA 2XVCA 4GXOA 4A3DJ 1KA8A 1OA4A 4FX4A 1S55A 1W2OA 4AHWA 4DXZA 3FF5A 2DBBA 4XW3A 1LNWA 2Q1FA 2X05A 1HOMA 1W9FA 4U7BA 1LQ1A 1ZRRA 1ST8A 5H9QA 1QJX1 3ZN5A 2M1BA 1IV8A 1WWYA 4ZKTB 4JRLA 5CG8A 5CYYA 4UW5A 4H0EA 2B7EA 3ZMTA 5DZGA 2F4IA 3WP6A 1ZBA1 3ESWB 5I0RA 2HDCA 1UYYA 1QBJA 2H0BA 1FP1D 3KD4A 3AKPA 4I0AA 1BA5A 1OUXA 3E5XA 3GMEA 3PLQA 3W58A 3AKSA 4B29A 4RMNA 3KZ4C 4S2HA 5D6FA 1LOGA 3M7GA 4IEZA 2YBSA 1YITI 1BI3A 2Q8EA 2NM1A 3GZ6A 3WD5A 1PNFA 1DP7P 2Z33A 2DA1A 1Q1VA 4FOWA 3KQRA 4NHYA 3AL6A 1W6PA 1QGPA 5HNHA 4YFNF 1S0FA 3AP7A 1YX5A 3FXMA 2ADEA 3BOWA 1L3LA 2WZ8A 2NQYA 2ZX4A 1V3FA 1W8UA 3ZSKA 1EAH3 3OGVA 3G71I 3KT1A 5FFOC 1XYPA 2OF7A 1A78A 4AOCA 1TQIA 2VE1A 2QENA 3MI8A 3NAPC 1Y1WJ 1XD7A 3GZUC 3ZXKA 5DUKA 4GKYA 1OKQA 2KZVA 1ZRDA 2QQNA 4UFMA 2FMLA 3I97A 3I71A 2G1MA 2YC4A 2GLOA 5E3LA 3OBRA 5FKKA 4A7YA 3VLBB 3DLAA 3Q9VA 3O2PE 1LEDA 5FYYA 4UVBA 3S1QJ 3GYHX 1S0CA 2GXGA 1TW3A 5J37A 1O3TA 3OJBA 2LD5A 5FZ1A 1RGSA 5IAVA 2CQ7A 2E1OA 3CLPA 1F36A 3WG7H 4LEJA 3T2OA 1H2LA 1ODDA 3GCXA 1TLHB 1IKQA 4ZS3A 2B9VA 5HCFA 3DECA 4B1MA 4M3CF 4MUVA 5IVFA 1DZQA 3EHKA 2LKPA 4HLXA 3IAM2 1PO12 2M8EA 5M0TA 3A0KA 4H7MA 2GN3A 4I2OA 2GNTA 1FNNA 1RVF3 2KT0A 2E1MB 3CDZB 1EV7A 2QQOA 1N25A 2R061 4G3YC 4RR3A 3WNMA 4JGYB 2EAKA 2D6NA 3RGBA 3OOUA 2VC9A 2P5LC 2X51A 4ZPIA 1V00A 2VUJA 1RJ8A 3GZAA 2AXTC 1G3SA 1L7QA 3I5UA 1MNEA 4N43C 1VAKA 1OSGA 2YGLA 1IRFA 3PIJA 1OFSA 3C7EA 4IGOA 4IRGA 2RMU1 5B1BH 3MO4A 3GTOJ 4NQWA 2DAOA 2XGXA 4YW3A 4E7JA 3E6BA 1VRH1 3UNPA 1ENHA 4WM8A 1OLMA 5ANQA 3WTYC 1OVSA 5EWSA 4YIFA 2K27A 4OUEA 3WF4A 1G8XA 1TMF2 4K2EA 4DRRA 1QOTA 2V73A 2PJPA 3S93A 3BJOA 4U7DA 2E7TA 3HEFA 3NO8A 4YVWB 1KFXL 4AYUA 1VBC3 3H1YA 1A35A 3O1SA 2IAIA 1LESA 4MO3M 2C1FA 3NVCA 3I3BA 1UU4A 4IV3A 1HRV3 2W7NA 3NQHA 4W6XA 1ND3B 2A07F 4LD5A 4UOJA 1K78A 3C2BA 3JQWA 1IPSA 2Y38A 1J3PA 3ZMSA 4AEDA 3LAPA 2RC4A 2DOFA 1ERDA 1MMGA 1QJFA 2QJVA 3A4CA 2E7AA 1OOPB 1ULPA 4C8DA 3SH4A 2BZTA 1FPN1 1MDMB 2X6OA 4AM3A 1WJ5A 3M4FA 3H7YA 1GWMA 5EJ3A 2QQKA 2IC1A 2F6BA 2YU3A 2RQQA 1F43A 1VQKI 3JD71 1QGLA 4XKWA 4DQ2A 1HCRA 2R073 2W9XA 4GDFA 2MGQA 1AR92 2EIJH 2HWB1 1S0BA 4KA4A 3AC0A 5IYDJ 2RM22 1UX7A 1P2FA 3U37A 2VBPA 1JHFA 1WD3A 4ITVA 3NMBA 1L7LA 1C5HA 4IXAA 3RIRA 1MS0A 2OQGA 4Y13A 3VL9A 3W21A 2DQLA 1H2MA 2L02A 4BOWA 2VD7A 3WNPA 3JRFA 3S1MJ 5ICGA 2IGMA 4M9ZA 5T52A 1EAH1 1QVUA 3BTZA 2QA4I 2MSYA 4YW4A 2R063 3URFA 2J1TA 3ZKUA 2Y9ZA 5LHIA 1SHWB 4NPMA 3GLLA 4CCMA 3ACLA 2RR13 1PGL2 1LB2A 2WY7Q 4DZPA 1Y9MA 1QJY2 2RQPA 2FNPA 5C9AC 3RRDA 1J3QA 2D98A 1HKDA 1I3HA 4DO0A 1YQ5A 2BY1A 1OCRH 2PJRA 3QP6A 3M8LA 4IOCF 3ZO0B 4ATEA 3SZTA 3FL7A 4HF2A 4UI9L 1KS5A 4FPOB 4G9YA 3MYXA 1BZWA 1H6YA 2FMDA 3S30A 2M7BA 1RUI1 1NXMA 4LG0A 1W8WA 3M3OA 2J1EA 3PNYA 1JZ8A 2RJLA 3BU7A 4YW7A 4HQMA 3RZDJ 1STZA 1U5TA 1XPXA 3E1F1 2E26A 2E60A 3ZPLA 3IL2A 3OY8B 1O59A 5J1UA 2VZ1A 4FAGA 3IV5A 5IK5A 5IT6A 5FK8A 2P3KA 3ZFGB 2JUGA 5L36A 4FOVA 4MSVA 4Z2YA 4MXWA 5G05L 4I30A 1IZ3A 2ZXQA 3KVAA 4CCNA 3KCXA 3U4XA 2RDPA 1KD7A 1WJCA 4XF9A 1G6NA 4Y7NJ 2DDAA 4WVZA 4AEKA 5F2WA 2GIVA 2JIGA 2PFBA 4COZA 2XLFA 3OYBA 1GZWA 1FY7A 5FGMA 2YU1A 3BIEA 3ABZA 2DFHA 4YZ4A 4XN0A 4E7KA 4DFSA 4QGMA 4HVRA 2R7DA 3GLXA 1OCPA 5KHKA 1IGOA 1HX6A 4DOUA 2AQFA 4G7HF 1BOBA 4RDUA 4CCLA 4Q5SF 2FX0A 3A0BC 2Z3YA 4J1XA 3V7RA 4BQ2A 2R071 5JFRA 2RS53 4PBPA 1CZVA 1YLFA 1HXS1 3OSDA 3LSEA 2ZGKA 1QMJA 1U0AA 5JZGC 5FRNA 4UUSA 1CZSA 2DT7B 2DYRH 4B3NA 1AYN3 3O0XA 5JSRA 3WHUA 4GH4A 3TEWA 1C8M1 2IXHA 1OMIA 4IGPA 1V5FA 1U0JA 4GH4C 5A7SA 1HXDA 2CNAA 4NRMA 3RYPA 2VBBA 3LDRA 3AB0A 1AYM3 4L18B 2JG8B 2ID6A 4XBLA 4E4DX 3UR3C 4CP1A 4HDUA 3FK6A 3D6EA 3DKXA 4CA0A 2HYKA 4HONA 4WM8B 5IK8A 5C70A 1KYZA 4AFBA 2DCKA 4AVZA 3NV4A 3ZSLA 5IOZA 1OLRA 2DUQA 1WMEA 2B5HA 2R0HA 2CQQA 4E2QA 2LNBA 2BWAA 2VNGA 3KHBA 3UKTA 1VQNI 3POSA 3S7IA 1TNRA 4M6YA 5LHGA 5DDJ2 4YPJA 2AR6A 3Q9SA 4IQ4A 1QNTA 2R5ZB 1X1AA 3ONQA 1TE1B 1LOAA 2X85A 2GM4A 4YM1A 1QJU1 1RETA 4IEOA 3JR9A 5IVYA 1IC8A 3C7GA 4Q47A 1W5SA 5H20A 5FBJA 4SBVA 1ZN2A 3ILFA 4U0WA 1ODNA 3GM8A 4BY1J 3WU1B 1B35C 3P3NA 3CO2A 3AG2H 1GZTA 4LKFA 4IX7A 1Y3TA 4OULA 2F48A 2GWRA 4CICA 1UYXA 3ZXAC 5FPBA 1BQPA 4BISA 3UNGC 1OQ1A 2VUDA 1ZG1A 4RHV3 4E2SA 3NAPA 3RZJA 1QQP1 1QJEA 3OPZA 2A6EF 2PMZA 4ZC3A 1H8TB 2WYSA 1I5ZA 3BQYA 3T8TA 2F5EA 4L0PA 1AR62 4K9SA 3ZYRA 4FASD 3J7AO 1UY3A 4RS8A 2FU4A 2C26A 2XC7A 1QHHD 4GB31 4Y4YA 5TRDA 1K4TA 1PM4A 3G1LA 3EQEA 4BE0A 2BDRA 1SANA 1H9TA 1PO21 5TISC 1H1AA 2XJTA 2ZACA 5JOZA 1UQXA 3WHCA 3P9KA 3E5QA 4BHPA 2HEOA 3B69A 2P0WA 2I45A 2ZAAA 4AIKA 1XQNA 1MVEA 3OYNA 2AZ5A 2G7HA 1C3HA 4IEJA 2UWMA 1WCDJ 2I07B 2VMIA 3V42A 3NNFA 1H2NA 1X82A 4U87A 3O0WA 3HSRA 3AK0A 4KG8A 2D7FA 4JGZB 1AHDP 4FBFA 1W90A 2HQNA 1BI0A 1OCTC 5DM6F 2EXKA 2GQQA 2JZYA 2D44A 2DO7A 5DAPA 3WX5A 4COYA 1JZ4A 4MOAA 1RUH1 1BVVA 3T4HB 3WF1A 2IXCA 4AI3A 1KYWA 4BB3A 4LNVA 3WE3A 4PDWB 2SBAA 2JE8A 1TMF1 2VBWA 1MNDA 4XURA 1AYN2 2JK3A 2R7VA 3ZVXA 3FHAA 1GUIA 2VONA 4XILA 2XJVA 1POQA 2L9LA 3PVOA 2ZAHA 2X8KA 1K3IA 5E20A 1AKHB 5FZGA 4HYEA 5FYIA 5ABJB 4HPKB 4OQ8A 1OISA 1XYOA 2K3FA 1FWZA 3IWZA 1WSUA 3F0CA 2X4HA 4A41A 3FXRA 3CKHA 3MW2A 2VOOA 1HC8A 3T4VA 2HOAA 3ZYBA 1RIOH 4YIRX 5FZAA 2XHNA 5D5VB 4KISA 3ZR8X 1QEXA 5IP7J 5FZEA 5BNNB 5T55A 5CFDA 5A80A 3IKWA 4IF4A 4Q4Y3 4PBOA 1DIWA 4QX3A 4AEJA 3B94A 1JYXA 4G8XA 4YZ3A 2EXIA 2O9LA 1OBNA 3IDCB 2C6SA 4BJ6C 4KBZA 1NX9A 1QA6A 1F15A 5FZOA 1IZ1A 4LO8A 4HF0A 4UNOA 1QWRA 5FY4A 1WJEA 3OG2A 3PQJA 1HSJA 2GP3A 4Q5OA 2FHRA 1RHI3 2DYCA 2XQXA 2Y60A 1QOSA 4NC6A 4OHZA 2VT3A 4OWRB 5IT9Z 1BXHA 1UY2A 1JUSA 1CONA 1UO9A 3WGIA 1TQ5A 2J5OA 1OUSA 2BW8A 2E34A 1GP4A 3JRBA 2W2IA 2X6YA 3A0HC 1CPMA 3CUQA 3RTRA 2XLGA 1MJ9A 2Q0OA 5I8TA 1N1YA 1K45A 1XSDA 1X3UA 1ETWA 1AR91 5KAIC 1AYN1 4Q8KA 1IF1A 2LW8A 2BVLA 2YYOA 3ASOH 4XLAA 4IJAA 4I98B 2J7MA 3A21A 5EHDA 5JVTA 2YR2A 2X5IA 3KWVA 5C3PA 1WFXA 3AL5A 2KHMA 2G0EA 2F6CA 3OYWA 5G04L 1F4KA 1OKOA 4N7UA 3TOAA 1GVJA 3HQRA 4JGYA 4BK4A 4Y15A 2OW4A 1O5UA 4BEHB 5FY1A 2MW8A 4IHTA 4PFOA 1P9QC 2X29A 3IAS2 4Y22A 2XJQA 2IZWA 4JV4A 2IA1A 1ND2C 1W6NB 2YROA 4B8XA 3H0GJ 2OX0A 4GWNA 2MEV2 1FOD3 3BIWE 2K9QA 3NWKA 2N7GA 3H1MA 1BC8C 5HCHA 2OZUA 3KP4A 5KXBA 3OBZA 2Y2ZA 3POFA 2WZR2 2EZIA 4HX4A 3TQNA 2B42B 4JOMA 4F92B 5LZ6A 4TSVA 2MNGA 4YRDA 1D0XA 1M1EB 3TBDA 4XUOA 4EVIA 2HXOA 2OZ6A 2PQQA 4WM7B 1FX7A 1JHJA 3IMMA 4OLLA 3KVBA 3GW2A 1K12A 2BNMA 2JDUA 3ABMH 4Y1UA 3WVJA 5A3NA 1E0EA 1TMF3 2EIGA 5F7UA 4BQNA 3K4NA 2KJBA 3VKOA 3DPTA 2BVVA 1R58A 3CCJI 4CDXC 1OA2A 4OHYA 3RWKX 5FTTC 4I99C 4AC0A 1R00A 2BOIA 1S5LC 2DOAA 2P5VA 1HB1A 2OAZA 2KD7A 1MKMA 1Z91A 1A34A 1B35B 5CLSA 3RQ0A 1HQNA 4LJHA 2H27A 4QB2A 1RUH2 1YQCA 3G73A 3OEBA 1VE0A 1BN5A 1R36A 3OGRA 4NIAA 4AFCA 4D6QA 5EEAA 1LKNA 3K2ZA 1LUJB 2AC1A 3ZLIA 5K0UB 2ECBA 2OKXA 3CCLI 3H7JA 2R7EB 3PMEA 3S5AA 2GC3A 5KWRA 4LLOA 3ZQLA 2ARCA 4XETA 1KONA 2RS52 3NNJA 2NXNB 3BTAA 3WODF 1GDTA 4HRIA 4LR4A 1QPIA 4OHWA 3J81Z 2YUEA 5C3SA 1EF4A 4A3BJ 1R1VA 2P4WA 2EIKH 1RVF1 1SEFA 1XGOA 2D5VA 4E7ZA 1FV3A 2Z4FA 5T50A 2WTEA 2XMLA 2Z42A 4DZGA 2LKXA 1FYLA 3QH7A 1XDUA 1CAXB 3RNSA 3BG9A 1RUI3 4LOTA 2VMEA 3PO3J 3FXLA 3W5MA 1JT0A 1RHI2 5C5TA 5DCMA 4PGHA 2L9VA 3KS7A 3O6BB 4NQWB 3CD6I 1NTCA 5JZGB 1PUFA 5DV5A 1SD6A 2QQBA 3CQOA 4QPGB 5B66C 3VDDC 2ZEZA 1LGCA 1X19A 1E57A 3MIDA 5J1RA 3BWGA 3ECHA 3FLTA 2Y34A 4FPYA 3VDAA 5LLQA 1MEC3 4HG6B 1J1TA 1HRV1 3SLIA 1RUF3 5EJCA 1BI1A 1EAH2 1QXPA 1XNKA 4KL1A 2Y0OA 4XF3A 3L2VA 4RGUA 2BXYA 5FZHA 5K7HA 4YRVA 4IV3B 5M5XJ 3OBTA 5FD6A 4RN5A 1CGPA 5HDKA 4PJYA 2VNRA 2CDOA 5EG0B 2JA5J 4AE2A 2BP6A 3F8CA 4Q0UA 3NARA 3HYIA 5FFXA 1A3KA 3K1NA 4GYGA 3C7OA 2KXLA 2F4OB 1XGMA 1KU2A 4UV9A 3FMGA 5AC92 2GAUA 5I91A 2DLLA 1W5TA 3DTEA 1ZG3A 3RZLA 4OHXA 3VPRA 1CR7A 1LKXA 3V7CA 2HWF3 2BW3A 4EN8B 1UHWA 5EJ1B 1NZIA 1ZG5A 4BEHA 3PIPF 3PQKA 2DFBA 3BPZA 3JXSA 5DDJ1 3I59A 1G2HA 1UPSA 3B01A 2M7AA 1D4M3 3P9CA 4W8JA 3LFKA 2PLV3 2XAJA 2QQ8A 1ZRFA 1J0RA 2YMZA 3BR1A 1VQPI 5C4XJ 5KHGA 5FYSA 1AHSA 1OFNA 3LWFA 3M1EA 1XMKA 3FN9A 3ABKH 1W6MB 4Y26A 1VR3A 3VL8A 3J9SA 1MJBA 3DTIA 2BU9A 4AQSA 3L2CA 1H9PA 2UWBA 3OIQA 1FNZA 1APNA 2ATFA 3MAJA 2CGOA 3INAA 4GGGA 3TAYA 1U78A 3UESA 4B09A 3T2QA 3J80K 2RE9A 5CKTA 2ZO4A 4DNCA 2DDBA 3HRTA 3OYIA 3KZIC 4NIGA 5J48A 3CZ6A 2LDUA 1QZEA 2WQZC 2DV9A 4PJMA 2VQ0A 2VC1A 2ZJPF 3M3YJ 3PSFA 2ZB9A 5DAWA 4QPQA 1HKTA 3SJMA 3ZN4A 2HEYF 3IAPA 3KMHA 2EA4A 5F32A 4U0YA 5CFDC 5E89A 2UV1A 1UZCA 4QPWA 2DN0A 1FX5A 1S0IA 2WINB 2XOMA 2R6QA 1XYNA 2FEZA 4QPIB 4PIXA 4XFAA 5LBQA 2QQPA 2F5FA 1YW8A 3DEEA 1PIV1 3WP3A 2IXLA 3WDXA 3Q5FA 2QQWA 3VYTB 2WZEA 4LK0F 1YRNA 5F1JA 1SMVA 4O9EA 3IDBB 4F3JA 5HNFA 4RS5A 2VQHA 4LBLA 4ZDOA 1G9BA 1H0BA 1GBGA 2RDQA 2DVGA 4P5YA 1V70A 4Q4V3 3R4UA 1IOAA 3N7KA 3BI3A 5FYHA 1QJU3 1VLNA 4MADA 4KMQA 1NQDA 3PFYA 2ACJA 1BK0A 1WA6X 1NY72 4ESJA 2L9RA 2COMA 4XLEA 1RL3A 3ZMNA 4FPJA 1IN4A 4JVAA 5K0UA 2AYHA 3HOZJ 2CV2A 1D5YA 1HB4A 1ZGAA 2HWE3 4PSXA 1UMIA 3CC7I 2OD5A 3LFUA 2KZGA 4GQ7A 2WRAA 5AC91 3CQZJ 2HBUA 2CAUA 5F3IA 2F2EA 4UAPA 4MQVA 2XUMA 1BW6A 3VBHC 5BV6A 1J75A 3VBHA 2W25A 1FYMA 1N1SA 4ASLA 1JUIA 4P00B 4GWIA 2RDNA 4ISQA 3ZSJA 4WBBA 3G4SI 4G9SB 4LK7A 1W0PA 4KQ7A 3LQRA 3AFKA 5JSPA 2VBXA 4CCOA 2J22A 5I0SA 5DCFA 2YSRA 1JN2P 5GP9A 2E1CA 5IHRA 1S7EA 3M1CA 4LK1F 2WWUA 2EIDA 5D5UB 3IIAA 3EUHA 5KAFC 3D1NI 2XGDA 3JRAA 3C2GA 2IEKA 1V9U3 4OI0A 4C1WA 1IO2A 2QUOA 3EJKA 3BOQA 1Z9CA 5D5WB 4N43B 4MTDA 1T6BX 4CEYA 1X2NA 1ZYRF 2W47A 5FZ3A 5FK7A 5FOJB 3ZP5A 3H5RA 3VD5A 2L7FP 3K3OA 1QJX3 5F8PA 1MBGA 4JZRA 3C2HA 4CDWA 1GWLA 3RZMA 4RAGA 5DEQA 4XBQA 1ZBE2 5DQ0A 2ZMLA 3NJZA 1XX5A 2WN2A 1WLCA 5LFAA 2BE5F 2E51A 4YM3A 1KGSA 3ZFGC 4P5OA 4NR1A 1F4HA 1X1DA 3TL4X 3MFCA 5JPNB 2L7ZA 3N36A 2SLIA 1H6XA 3VZMA 1PGW1 3BKZA 3RMXA 2FNAA 2BW3B 3J8F1 3AFGA 1R1A1 3JSOA 4NRPA 3TEYA 4D5CA 3MV01 2YU9J 4S04A 2HI3A 1N78A 2NS8A 3VBSC 3D0JA 2WWJA 4GMP0 2WB1A 3WP4A 2VUMJ 4V1PA 5JAXA 2FDIA 3GUDA 5FZFA 2W1QA 4C3IJ 5FZ6A 2PMWB 3QWLA 1KDMA 3LIGA 3JSPA 4L11A 1FIPA 5H9PA 2DBIA 4HN0A 3MCZA 2ZGSA 4XF4A 3LEMA 2LROA 2RVCA 3CP8A 5HXMA 3PVBB 4UBGA 2V4JC 3O0VA 2PN6A 2IUWA 2E71A 1FZPB 1H8TA 3ZOBA 3T5XA 4D7YA 4K1YA 1NCRA 3BR2A 1DQ5A 4AWXB 1XNAA 4XBNA 3HL2A 2VCMA 3VZNA 5I0DA 3QU3A 5L3FA 1O8SA 1JYTA 2ZX1A 4EN9B 3PNAA 2L7KA 3LSPA 3K70D 1VBC2 1JTZX 3RKYA 3ETPA 4KNYA 2ID3A 2IJLA 2JXAA 5GKAC 1CAWB 1S6LA 3BYWA 4S2DA 1KXGA 5C44J 1UN1A 1JT6A 1YFUA 1GLNA 5BOXA 3PTYA 4Q4W2 4CHUA 5C8WA 5F1RA 4DUWA 1WCSA 5F0FA 1ZM1A 1IUYA 2ZJQF 3A0NA 3TO9A 1NKGA 3PURA 1GOGA 1PK6C 1S0GA 4MGIE 1X4PA 2XKOA 3S3NA 4LBJA 4LIVA 5C3RA 1W28A 2VU9A 1NZCA 5GLTA 1H9WA 2UUZA 3ATGA 2D2WA 1XMXA 1QOOA 3RKWA 4CZSA 1ZHFA 3GCMA 3G1MA 4NPRA 4XIOA 3N9NA 1MS3A 2A6HF 1HRI3 2ID4A 3HD8B 3M3IA 3QPTA 3WNNA 1GFF2 4XC9A 4YVWC 4AL9A 3QD6A 4ZXKA 3ECQA 2GNDA 4EQQA 3ZMDA 4YSFA 1GQHA 1J83A 1RMU1 3MIHA 4KICA 3KV6A 4RLFA 2FMYA 1PX3A 1UZYA 4ATFA 3K48A 1BJZA 5H2FC 2D93A 5LEJA 2VXRA 3LSKA 2RHPA 1V5GA 4EGYA 3HSFA 5BY5A 3ZDVA 4X6RB 3V0BB 2IA0A 1DLCA 3O1UA 3ZR5A 2LS6A 2CYYA 5B5EC 2DURA 4M4PA 4BGDA 5FLMJ 2B4KA 4MLOA 3LAGA 1IRXA 1U9NA 3DPRC 4M3CA 3CP2A 3IN9A 1RKTA 4CXFA 3JCUC 4OMDA 2HKXA 1RI7A 2HNHA 1RUG2 4MNUA 1SBFA 3BTYA 1XTAA 1ZBE3 2Q2EB 2DF7A 2CW7A 3USSA 3EBRA 4QX1A 5ERLA 3CCVI 2ZGMA 4Q2FA 4E4SA 4NPLA 1POV0 1T33A 3T0YA 2O8QA 3L2YA 4ORFA 1D4M2 4RGAA 2W48A 1UHSA 5FMDA 1X9TA 2A6XA 1UOBA 4XLCA 4LKSA 4Y24A 2FE3A 3KHCA 4N7IA 3T0DA 3H3UA 1CAVA 3H3VK 4BQ4A 3NW4A 1SLCA 1LECA 4RGKA 4QB1A 4RA0A 4D7MA 4COVA 1WVRA 5CJ9A 5BS6A 3M2MA 1VQ6I 3E6CC 3UL2A 1W6QB 5CKQA 1NUKA 2IFWA 4CXXA 3BALA 3T0AA 3RJ2X 1IXCA 4LORA 3L2QA 4YM0A 1MH4A 2X0LA 2RS13 5K4LA 4JP0A 1K6OA 2IXKA 2HTSA 1MBFA 1CF7B 5GPCA 1AJOA 4NIIA 2DODA 1ULEA 3MZ8A 4JK1X 4HBLA 4W4ZA 4Z2AA 2FOKA 2Y30A 1CZTA 4M00A 3I0TA 4D69A 2W0XA 4O65A 4V2WA 3PHMA 1OXCA 2Y31A 5LRRA 3I49A 1VAVA 1YFXA 2ZEYA 1U2WA 4LA2A 3WEZA 1LNSA 1ULOA 3KP6A 5EG0A 2RREA 4B4RA 3WU0A 4IV3C 2P3YA 1GQPA 4ANJA 4MFEA 3WG4A 3GYDA 1BCXA 2O8KA 2DI3A 3BN6A 4ZJZA 2W57A 5JPMB 4I76A 2VE8A 4AEDC 3M8JA 2DMPA 2WO1A 1ZELA 3CF5F 1ENSA 4OUMA 2HVQA 4XMYA 4LXLA 2JA7J 2JG8A 5K1YA 3AJYA 5FZLA 2VOWA 2P1BA 5LASA 1PO22 5I93A 1DP0A 2IS1A 4Q4X2 5SV5A 2YPDA 4LO6B 5K7PA 2E5NA 4RYDA 3J8F2 4XSZF 2VQTA 1R1A3 3J7MA 4BM8A 3H8RA 1P4WA 4RGRA 1NE6A 5JXIA 4OI4A 1DPUA 1V4RA 5CEHA 1MW7A 3N9LA 2VUAA 4L92A 3FXKA 4UUSB 1XCBA 5J96B 3LAJA 1SFUA 3WUCA 4QGLA 2A6WA 3LSJA 3W20A 2JKBA 4G6QA 1DGLA 2X1DA 3R61A 1G3TA 1UXZA 4FE7A 2Z99A 1REEA 3X2QH 3ZFFA 3SQNA 4DYRA 3IBMA 4GWJA 4DYQA 3HUGA 1BL0A 1A6IA 3I2OA 1RUF1 3GALA 3U07A 3OD4A 3AZVA 4PJNA 4OZOA 1VFCA 4FXKB 4URAA 3H8XA 1SPPB 3G7DA 3DU5A 2DJNA 2VW0A 4J19A 2H1LA 3QYFA 4XF1A 1FI2A 2L0KA 2OQRA 2B45X 4D1QA 1R1ZA 5FMOL 3SCHA 1AR72 1YJKA 5A33B 2Y0SA 1Y8QB 1RMU2 4HPKA 3R0RA 2RMU3 3BY6A 4BQOA 4IRHA 1QZYA 1W39A 3MQ0A 1VBB2 2FD5A 2MBFA 2CDPA 3KV5A 2R1BA 4YFXF 1S29A 1HJGA 3PUFA 1FBSA 1SEUA 5D21A 1C0WA 3ZGKA 2WJSA 4RLQA 5FOBB 4BJ0A 1PMHX 2JA8J 3FKJA 4ET7A 3PL0A 2QQ9A 1SCRA 1KDKA 4LBQD 2RS32 1RXGA 3H36A 4EN7B 4BQ3A 4EJUA 2DT5A 1FTZA 2VT2A 1M4WA 1DQ4A 2NN8A 2HWC2 1AJKA 3MKLA 2BZDA 4Q4X1 3DL3A 4DY3A 5LHHA 2IS6A 4DMIA 2EIMH 1J84A 3IIIA 4CDWB 3THDA 2MH9A 3TBIA 3QOPA 2FXAA 4DJAA 3HBKA 4ENKA 3PVEA 1XMAA 1D0YA 4WF2A 1W03A 4EJVA 1ENQA 4HK8A 5EV7A 5HLTA 1U5YA 4Q27A 3QPSA 1ETVA 3NV2A 2R7QA 5LA1A 4LB6B 1HXS2 1ETKA 1I1EA 5JWPA 2YB7A 4IDZA 4BYYA 2V5YA 3FXJA 3OUIA 1DFQA 2VG9A 4QX2A 4RBOA 4DUXA 1LAJA 4OZXA 4DEVA 2ZGUA 4IHSA 2LY2A 1UW8A 1RR8C 3PSIA 2NNNA 3VBHB 4A3IJ 2VBYA 4ZTJA 3NKGA 3EPZA 3VBRB 2R32A 2VNVA 3CZJA 5A1LA 5FRMA 2O14A 3KSCA 4RFRB 5A7QA 4HX8A 3U9GA 2IPQX 1VBE3 4NB5A 3MLJA 1PMIA 4OIQF 4QU2A 1J7KA 3RPUA 2GC2A 1Q8OA 3U1XA 4M3CB 2CW8A 1FTTA 4G7OF 3P1IA 4Q0VA 1PP7U 3RZHA 3HUGB 4WVMA 1UU5A 4K20A 2CUEA 4XCBA 1VQ7I 3ERED 4M9SA 3FM3A 1DGRM 4X1EA 1PO23 3GTMJ 3OPWA 1XC5A 2XAFA 2CUFA 1GT0C 2BFUL 3W59A 4BXXJ 3POBA 4CUBA 4FPLA 4AHZA 4B7EA 5KHIA 1S1AA 4CU8A 2WA3A 4FISA 4QX5A 3OV8A 1QH7A 2QZ2A 4XICA 3O14A 5T5PA 1I6XA 1OYWA 3KX2A 3F21A 1YIFA 4L9VA 1JYNA 2DFCA 3BT9A 3A03A 3WCRA 1FEXA 4GWMA 4U88A 3HOXJ 1QO0D 1XNBA 1VQ8I 2OPKA 2DFIA 2PMUA 4M9XA 3ZM8A 2HU9A 4HV6A 2KA3A 2Y6KA 1IS4A 5FQ0B 1RRJA 4TYSA 4QKFA 3N9OA 3TEXA 3PU3A 3KPHA 4BAYA 1PK6A 2D6KA 1MH3A 4XVHA 2FUG2 3F22A 3S17J 3H0OA 5GZEA 4DB5A 3F6OA 3LB9A 3LDKA 1BEV2 3I4PA 4H4KC 4GH4B 1YJNI 2W87A 2NPIA 5K5OA 4XKVA 2A7AA 2E19A 3I64A 5F0HA 4FETA 1WRJA 3F8BA 4F91B 2JB4A 2DA3A 1QU3A 3R0AA 1D2SA 9ANTA 4DBRA 2WNOA 4KITB 1VNDA 1VBB1 2JECA 3ZXGA 3ZXJA 3RI8A 1WLTA 4YGEA 4RGXA 5BNNA 5IFTA 4UUVA 1YWKA 3KYLA 3WY6A 2VL4A 2GH8A 4GJZA 1VP6A 4FQGA 4R79A 3F8FA 3PO2J 4ENNA 2YFUA 1AX2A 2H0VA 2JDAA 5F04A 2XB5A 1LHVA 3F72A 1BI2A 1RXFA 2GC0A 1A8MA 4EWAA 3GFIA 2NVUB 3TB0A 1GYKA 3IWFA 3FC0A 4A12A 2W84A 1R4NB 4YNIA 4ITCA 5DZEA 5L3DA 3NV1A 3ORJA 3MUY1 2IXIA 1Y39A 1LE8B 2LM3A 4C90A 4BIOA 1JYVA 2E1NA 3FMRA 1H88C 4QQOA 2HFHA 3ASIA 1QDCA 3P6BA 3WLUA 1YHQI 3BTXA 4P9JA 1PGW2 1Z67A 4YVSB 5EEGA 4QIWN 4NE9A 1CX4A 1JS9A 2K9NA 2WFPA 2Y0MA 2QNKA 4S2GA 2OQ6A 5KC5A 3N9MA 2ZHLA 5C8CA 2I10A 1RHI1 4WZFA 1SMTA 2FDJA 1JI8A 4MVTA 1HXS3 1XE0A 4Z1VA 3VKFC 2OT7A 3AZZA 3J7AY 4XYXA 4XJ9A 3DLLF 1VMFA 1TZLA 3KETA 5D8AA 4HVOA 1B8IA 3TDUC 5D4SA 4A3FJ 3DUIA 2ARBA 4YG6A 4S0HB 2EK5A 4Q4W1 4B4QA 1MZEA 1WHUA 5DUIA 5FWJA 1UMQA 3MPPG 4UFJA 2VZVA 3V8JA 2OV7A 5BPXA 1DUXC 3FXOA 3T30A 4A7ZA 2ZXHA 3VD4A 1VBE2 1RTVA 4XJZA 1WD4A 3M70A 1S9HA 3OY9A 1VBA3 2OXBA 4RSUA 3V8LA 3RZGA 4BH9A 2E9QA 1FPQA 1NCQA 5K5RA 2LC2A 3L9JT 1S3JA 1PK6B 3VYRB 3LD8A 4XFFA 4OIRF 5DM7F 4A6SA 2IXJA 3R60A 1DGRN 5KXCA 2DU9A 3LSTA 3A23A 2M0CA 1QY4A 3CMMA 1H4HA 1Z3YA 3ZFEB 1D4VB 3TMOA 1S0EA 3G2BA 5A6ZA 4I3GA 3NAPB 2ZFWA 1MMDA 3M8FA 5GZDA 1BMV1 5FZOB 1YQ6A 1NXD1 3GNEA 1Q5OA 4L0ZB 1AZDA 2GNMA 3WXPA 1YW9A 1B6AA 3S2WA 2Z5WA 2Z1DA 4PZJA 1E3OC 2XJSA 1Q8PA 3S14J 3K3NA 4HW0A 4YLZA 2Y0IA 2WNEA 3SNMA 1O57A 4P9YA 4CDUB 4XHBA 4KWUA 4BE2A 3VBUB 1UELB 1KEXA 5TGTA 1AXYA 1JH5A 2BGCA 3KT7A 2DA7A 4X6AJ 1WKYA 4U0VA 4HSJA 2JJ6A 3QOEA 5IVJA 2W68A 5HOOA 1T38A 3E97A 4LKDA 2D40A 4XUNA 5EIYB 3WTXC 3SISA 3IKTA 2GSYA 4OIPF 3R6SA 4MZUA 3I2HA 5JXHA 4E6KG 3VDCA 3I8TA 3FHIB 1S72I 4EJTA 1WZXA 3KP5A 2NVXJ 4HNTA 4IEUA 2WNUC 2ET7A 2PLV1 3WGGA 2E5ZA 3I2JA 2PXJA 1OYIA 2ZCWA 2WV0A 2P17A 5JSOA 2JG9C 5AVPA 3VBFA 2VJXA 4BY7J 3JCIA 5FB2A 3I2FA 1R5HA 2G9WA 4KFCA 3QP5A 1OFCX 5JMCA 3GXUA 2MD0A 2A6YA 4A6DA 5C6CA 4CPBA 4LE4A 1V9U2 3B7MA 2XVKA 3ACHA 4NWVA 1C8NA 4KIFA 2PAEA 2DCYA 1LU1A 5DMYA 4YELA 1AL23 2VXZA 1O3SA 4OAYA 3CJIB 3K4BA 3CJQB 1RMU3 1OI6A 2RMU2 2GIZA 4PLMA 1JW6A 1N3OA 5FZBA 5E17F 1VBA1 3BOPA 4BQYA 4D6SA 4A3MJ 2LOOA 4GD4A 5JLWA 1SFOJ 2VZ3A 2P4EA 4RQPA 1Y6IA 2JPCA 1ZBE1 2M3AA 1Y8RB 3MFAA 3L1PA 2GALA 4JTOA 1ZR4A 4AYBN 2P81A 2FF4A 2E2JJ 4JGZA 3WG2A 3EUAA 3NJVA 2AEZA 2EV0A 4UVAA 3HQUA 1A8DA 5FY5A 2VN2A 4ZDLA 3QODA 2TCTA 3LSGA 3AMQA 4HX7A 5D8AB 1PGL1 1R71A 4GB32 3UKVA 1LOEA 5BNPB 3QACA 3V8KA 1AR61 1UIJA 3CJNA 1USTA 4K8FA 2HWF1 3RPQA 1R9TJ 3BVCA 3AVRA 4NDLA 4GZ9A 1CIYA 3O1MA 1UKRA 2LR8A 4P9WA 3H1CA 4C2MJ 5ANNA 4PDKA 5A7PA 5JXJA 4C3JJ 2DQRA 4CEWB 2BBAA 4LG3A 3HKZN 1NA1C 1FLIA 3S0MA 4JX0A 2KRCA 1LPQA 2WFF3 1E3PA 2V7FA 1ZZCA 3SITA 4YVSA 3VGIA 1V0AA 2YBKA 4KWLA 4XZPA 2EH3A 4Y1ZA 5FJHA 2IS2A 3HB9A 4PHZA 4RB3C 4C0HA 5J7MA 4AIDA 2L4AA 1MNMC 2PJRB 2GOMA 5GAEJ 3NNMA 5ILUA 1GR3A 5J1XA 1OH3A 3GFMA 4C9YA 3K4CA 3OYLA 1ON1A 2MPFA 3B3QE 3WF0A 2A6VA 2ORXA 1WH5A 2Y26A 3TN92 1WJAA 2R0QC 2MLGA 3QYBA 2DCZA 4JDMA 4Y5Z0 1OVPA 3V0AA 2LY1A 3E6MA 4LKEA 1O7LA 3NJXA 3S32A 3DKQA 4CZZA 4Q8LA 1SBEA 1UKGA 4Y52J 2HWC1 4RB2C 1EY2A 1HW2A 1XNDA 1Q8VA 2VAUA 3GJAA 4LFUA 4P14A 2ZEXA 2B63J 4RAFA 2K85A 2JUCA 4AI9A 1SAUA 3KZZA 4EROA 5JR3A 2WS93 5ED4A 5ACA1 4PFPA 3TRSB 5GLZA 3TOJA 5A1FA 2E7XA 2W91A 1LFPA 5B3SH 3BG6A 4ZYGA 1P92A 5FLXZ 2COBA 3HWJA 1WBFA 2DCJA 3VBOB 5AIPA 2NNYA 4O61A 1YIOA 6PAXA 1ETXA 2ET1A 2XPJA 4HV5A 2CG4A 4WK8F 4XR6A 1VRH2 4E8DA 2P7CB 5LEKA 3CCMI 3K4MA 1J1LA 3DXJF 2Y8KA 1NLQA 4XDOA 1OR7C 3LSMA 3BR5A 5CVRA 2XPVA 4MV2A 2W4SA 4WZCA 5JOWA 4H14A 4YW6A 5CG9A 2DA2A 1TTYA 4GRIA 1EH6A 2A71A 2BVBA 2Y6HA 4BHBA 3CMYA 4AHYA 1RC6A 3P3PA 3ZN1A 4LT5A 2W82A 2HWD3 3U10A 2VIXA 3WV6A 3HTSB 2BWCA 5HBAA 2WC2A 3BR3A 5J3UA 3RYRA 1X50A 2HEWF 5A3OA 5CVVA 2JDYA 1YO8A 1XC6A 1GKBA 1OR7A 4OIOF 5FFZA 2OTJI 3VD3A 3JW4A 5T5JA 3K4DA 2M5WA 1S0DA 4P9GA 1GMMA 4NIHA 4KIBA 1LRHA 2VZRA 2ME6A 1OKRA 5KNLA 4IV1B 1KFUL 2DOEA 3NEUA 1C4RA 3H9QA 3GX4X 4ZU5A 5KXDA 2J1UA 1T6SA 4ZS2A 3EYIA 1IRGA 1R1TA 1XSRA 3RVHA 5J36A 2N8GA 3M4OJ 2AREA 1C8M3 3J80Z 3PMSA 2WQ4A 4FPFA 3R4SA 3VHNA 2F5CA 4E7HA 3OUJA 2EALA 2R93J 4IEPA 1VB4A 4PLOA 5C8CC 3ZQFA 3SKVA 1K83J 2ZX2A 3EQLF 4CA9A 2ICWG 3HEIA 3E0JB 4QKDA 4BLIA 2B39A 2DMQA 3AP9A 1REPC 2CUZA 1ETOA 4M3BA 2E1MC 1OJLA 3A4UA 4PUSA 1G7YA 4FPGA 3FHQA 1MJAA 2L4MA 5LATA 1TT0A 2J1VA 2H6BA 2KL4A 4HT1T 1OPCA 1J9IA 2UY8A 4ZTFA 5FZ9A 3JRIA 3VBSB 1I3AA 2ZMEB 1YFHA 2LTNA 5A3MA 1BMV2 5IATA 4DOZA 1T2XA 3F6VA 2LALA 5FYUA 4Q48A 4MXVA 1PIV2 5CNAA 2A61A 1VQLI 3FFZA 4IEQA 3OIOA 3JRGA 3UKNA 5CQEA 2BGOA 2LMDA 2EBIA 3CDHA 2XJUA 4BZ4A 4F3QA 4Y33A 4I0BA 1HJFA 2GA1A 3VHPA 2VULA 1XJAA 4AI8A 4CCEA 5GTIC 4ES8A 1D0ZA 1MBKA 2R5ZA 4Y22B 5BNGA 4A3CJ 4HBNA 2BV4A 5H6QA 4Z07A 2TDXA 3MN2A 2P6HA 1V6KA 2VOTA 2L2OA 4AXOA 3OYFA 1JMUB 2RAEA 4I7HA 5E8GA 4FE4A 4KWKA 5L19A 3KP2A 1T0FA 4UFKA 2WAQN 3O1RA 3TNPB 2R043 4JDNA 2VPLA 5HVQC 2ZHKA 4E8CA 4GALA 3W6JB 2IVIB 1KRIA 2F5DA 2XBO3 1JJ8C 2V09A 3ZPOA 1YUDA 4QGNA 1HQCA 1ZK8A 2A68F 2BXZA 3CZUA 3F8NA 3F2ZA 5L9RA 2JTVA 1HDDC 5GZFA 3V64A 3S15J 3LSDA 1UXXX 3H5NA 1AUYA 4Y1YA 3PIOF 2WO2A 2R4GA 5C3OA 1VI0A 3NAUA 1IDYA 2NOGA 4JDOA 2MH2A 5GLVA 5JI9A 4P9UA 2VZPA 2XWJB 1ZARA 1MS9A 2FCTA 3RFRA 2YG0A 1SFXA 3I53A 5EPAA 3H9GA 1JZ3A 2BQPA 3DEUA 4A3KJ 4A0XA 3RQIA 5E8IA 2M34A 5FV3A 2Y64A 1P7IA 4LHSA 4KG0A 2DUPA 4M6VA 4NJ4A 3MGUA 3AX4A 3D8CA 1AWCA 3VSLA 5LWBA 4ZZLA 4CEWC 2PYTA 3TN91 2O5RA 2VUCA 4LBKA 4JHZA 1SVLA 5C4JJ 3OYAA 1LDJA 1DGWY 5FPVA 3NJYA 5A32A 1UZZA 4F52A 2RM23 1H2KA 2E7QA 5LGNA 3VZLA 4HLYA 2I8DA 2VECA 1RESA 2A70A 4CVUA 1W36C 2LH9A 5K0UC 4XRMA 2ZFUA 4HKWA 1VBB3 3CO6C 3J4UH 1RNLA 3GXOA 1K5MC 3L2HA 5JMOA 1V6LA 2CUJA 4BHCA 1WCUA 1LR5A 1JOPA 1MQTB 4BXUA 5GM0A 3U1KA 1UWWA 4YZ1A 4XCAA 5IOYA 2ZMNA 4OMYA 1V5EA 4JCKA 1KZHA 2WN3A 4QDQA 2W1OA 2R062 3CMEI 2XR4A 5FLVA 3ZSEA 4XQDA 3M3CA 5EFUA 1ZH5A 3FBNB 3DPRB 1B9NA 5F6LB 2D1VA 3C3VA 3ZFGA 5IP9J 4B4CA 4NHMA 3KV9A 1XPWA 1NA1A 3F8MA 2K0GA 2W5FA 2PAMA 3U78A 4QDSA 4PDWA 1W05A 2VL8A 2RN7A 2EINH 5BXXA 3VB9A 2BTVC 1GZWB 4I02A 3GTQJ 4YFKF 4OYUA 4QQLA 4KDPA 5BMZA 3CTAA 4DW6A 1QQP3 2WR9A 3LPFA 3QPHA 1YIPA 4K6BA 2R16A 4YM2A 5CVIA 4RB0A 1D5VA 4BDYA 2QE3A 5D4RA 5F37A 3PUIA 4JGZC 2ZOEB 1ETQA 3S7EA 3AAFA 2EPFA 2IVMA 2WNUB 2MEV3 1H89C 1QXJA 5IYBJ 2JKXA 2AQEA 4DGWB 1WLDA 5FPLA 5IYCJ 2LP0A 1FYUA 2OJED 4UFLA 5EQUA 1U5IA 4UUTA 3JAMK 2IP2A 1R64A 1XDSA 5I0TA 3Q8FA 2D3SA 3FK7A 5LK5A 4R9DA 3RMYA 3P5JA 4IE5A 2KRHA 3WNLA 5IPAA 4FP3A 1ODMA 2R5YA 2VOXA 2DU0A 3CCUI 1UFMA 5DD8A 3WSOA 3I3MA 3GHNA 3S1RJ 4C2UA 1ULDA 3MWMA 2YU2A 5A32B 4W50A 5LK7B 2CQKA 4EE2A 3GTLJ 4AVTA 2D6LX 1PYVA 4L5IA 4GKXA 1JHNA 2JA6J 4EM0B 1UAIA 2XIGA 2LG4A 5ILVA 3J8F3 5EDNA 4XPVA 4FSJA 2C4XA 5FR3A 2XL9A 4JKLA 1OQYA 4Q4V2 4AQ6A 5FKMA 2P8TA 2VQGA 2IA2A 3K4KA 1TP4A 3QRFF 1GV5A 2EFPA 3B93A 1D7PM 3JBG1 1W9WA 4KGQA 3IH4A 1DP3A 1W0NA 4Y17A 3VD9A 3POEA 2ZJ2A 5E1WA 2C0ZA 3VZKA 1QKQA 1SDDB 5F5AA 3MIGA 1J58A 1FOD1 1X4OA 4PK4A 1REDA 4OMCA 4FPHA 3GBGA 5FUPA 4HN1A 4CE8A 1NHAA 4HPQA 2QZ3A 4AVCA 2ZMEA 3JTHA 1JZ7A 3O1OA 3ILRA 4O5VA 3LA7A 3VBRA 1WA4A 4XKCA 2WIIB 4IEYA 4NWWA 2BGPA 1FOYA 5A6XA 4BQ1A 3CLQA 2GXBA 3C7HA 2BV6A 5IP6A 2ZEWA 1OPOA 4W65A 4QM9A 3WTWC 4CDQA 3IPVB 1LEAA 5CFDB 1HV1A 1GP5A 2QQJA 3GTPJ 4H2AA 3WW1A 2QCSB 3HRMA 4HDVA 5EGOB 1T6GC 2UXNA 1ACCA 1FNYA 2A73B 2VJ4A 1B72B 2YGMA 5IK4A 3CBNA 4AGVA 1BKZA 4Q26A 5F0CA 4XNFA 4NHJA 3ZDSA 2W1SA 1YC61 4PI2A 3ZFEC 4LG0B 4K3UA 4DUVA 3DP7A 4H55A 4AYBA 1AVBA 3GO5A 2QFEA 5GJ6A 4Q0PA 2RS33 3GTGJ 3ZSMA 1UJ8A 4QXHA 5LA2A 2PHLA 4MO7A 4C91A 4S05A 2TBVA 2ZGLA 3LWCA 3DYMA 1F5TA 1VZ0A 1ZZ7A 2Y75A 1B35A 1H1MA 3GTKJ 3FBYA 2WB1N 2XAHA 1JZ6A 2DXIA 4CEYB 4CDXB 2RGVA 3K1PA 4PSWA 1W1WE 3HMYA 4XL9A 3VZJA 2XG3A 1W2NA 4A3ZA 3FX3A 2MABA 3K75B 3FWEA 3WW4A 4CYCA 4JKKA 1E5IA 1JYCA 2X5IB 1LENA 5LCWL 3JBG2 3JUUA 1R1UA 3N7MA 3SDGA 2A3YA 2D5FA 4URTA 2FBIA 5FWEA 4YGBA 2LY9A 2NZ9A 1HQLA 3IH3A 2V26A 2DMUA 4OQ9A 3RWNA 1UZ0A 3I4IA 5JR7B 3U1DA 1RUE2 3O8HA 2QSFX 3K4AA 2ZS6B 5FCCA 3B9CA 1PZ8A 3S16J 2LKSA 5APAA 4AWDA 4EWDA 1BBT2 1NCQC 2RS51 4A0YA 4RM3A 3WTSC 2ME0A 2GU9A 1ZLKA 3RDIA 1SD4A 3CCSI 4BACA 3QCWA 4B4PA 1TVGA 5HS9A 2BRTA 4EZ4A 3M9AA 1NG6A 3OYJA 1OF3A 3AYEA 4AFMA 5E1ZB 2K3PA 2G9ZA 5DYMA 2XONA 4OHVA 2LSOA 2ZJRF 3KIOA 3G3ZA 4ONUA 5E18F 1ON2A 2A69F 2VM9A 3O1PA 2VB6A 1KJLA 2YFZA 2FQ4A 5C4WB 4MIMA 4IQJA 1S7AA 4IE6A 3UKGA 4EM1A 3GFJA 5FLXK 1MZBA 4UFHA 4CDQB 2QQVA 2WWSA 2QKLB 2XVLA 1CN1A 3HT1A 4LOSA 5IW0A 3QPLA 3T3YA 2MEV1 3OB8A 4M3CE 4UB8C 4WVWA 1IS6A 1BYHA 4EMSA 2K40A 2WA4A 3O1VA 2W00A 1UIKA 1XE8A 3WTVC 2BNNA 4YW5A 3T1LA 3CJXA 4XOGA 2KM2A 1XS9A 1MACA 2JD9A 1BJQA 1FMVA 1MMSA 2OUHA 3TOBA 4IKFA 1KQ8A 3PJQA 1UY1A 1FPN2 4BIFA 4JTNA 4D5FA 1TQMA 3VHOA 2CTVA 1BVP1 3VBFC 5F5CA 3Q8EA 2HWD2 1NLSA 3E3VA 3GZEA 4CRQA 5FYZA 4EYUA 4XXAA 2XAQA 4O6JA 4KI5M 1F8VA 1HW1A 1XXNA 2GMMA 2Y33A 2Z69A 4KT5C 5FO7B 4ZDPA 4Z82A 2L54A 2JG8C 3JRHA 5DDJ3 2EILH 5KHJA 1XBFA 2RJ2A 4RGGA 5DXDA 3WHBA 2X53S 4D7NA 1WJFA 4H7LA 1ND3C 3PUHA 5L9BA 3KEYA 4EJOA 4M74A 1G9AA 4RHV1 2Z79A 2UYBA 2EFOA 3KP7A 1PDNC 4AI1A 4D7TA 2Q1ZB 3W9AA 5CPRB 3V0AB 2JG9A 3BP8A 4OUSA 2L3DA 4RA2A 4E27A 1DCSA 2UWAA 1D8JA 2DTRA 4NVPA 5FZMA 2JWTA 3H42B 4F55A 3SXWA 2CJJA 1P4AA 4QXCA 1ND3A 4N9HA 3ZFFC 5KR7A 4II2A 2JD4A 4QPIC 2NVYJ 3OOXA 4NOTA 3ZMOA 3ITQA 2ZZJA 2JEMA 5J6XA 1US2A 4IE0A 1IGNA 2EWNA 5DAQA 5L73A 1Y0NA 2HEVF 2XAGA 4BJ5C 2XSDC 4CZCA 2VLAA 5FLHA 1AX1A 4Z8BA 3MIBA 1RB8G 4AQTA 3KYDB 4BMEA 5IJRA 3DU6A 1K7AA 4L8QA 3H92A 2FBKA 3E5UA 4PIYA 3R4DB 1CESA 3T0BA 2PELA 1F9KA 2ZX0A 5BNPA 5D8LB 1WWXA 4LLLA 1G3WA 4EV0A 4A3JJ 1PVXA 3HN3A 3PTRB 3ME2A 2ERFA 4QTRA 2WNVC 4IHVA 2QQMA 4L9NA 5H6RA 1GSLA 4YW1A 2XROA 2A1XA 3A22A 2O61A 2NAZA 2Y69H 3BUCA 2WZR3 4AVAA 4CYDA 2EA2A 2PQ8A 3JZVA 4QT6A 3WNOA 1DZRA 4KUMA 2PHDA 4KN4X 4RR3B 5FP4A 5F3CA 1N77A 3BG5A 4O9GA 1IQDC 2CO5A 2RJKA 1JBCA 2W3JA 4J01A 3ACFA 3OBAA 4ISRA 3VD7A 1AR71 1WCQA 3H3LA 4M01A 2XPWA 4HLTA 1Y9GA 1JKQC 4BBSJ 3OR2C 3ZKYA 4CDXA 2XBO1 2DU1A 2XBO2 5A6QA 1W6NA 2F4PA 1ZA4A 4JKMA 3ZN6B 3ON7A 1K79A 5FPAA 3CJTB 3LA3A 4UY8I 2EJRA 2WWYA 3BCBA 4CDWC 2MLKA 3OS2A 5AFBA 5CA6A 1RUD1 3TN93 1GZ9A 1YG2A 3S5QA 2WKKA 1DDLA 1CAUB 5KCMA 4LHKA 4IL6C 4AI0A 2NMOA 2M4KA 5C3EJ 3UT0A 4EN0A 3HJRA 3ZYJB 5LW9A 1YTYA 2PHUA 3BTJA 4OU0A 4P02B 2HGCA 4CH7A 3HOTA 2AGSA 5A70A 1IN6A 4FPCA 2WZPP 1WW5A 2K2SA 1IHMA 5BNOB 1ENRA 1YYVA 2ELKA 2JVHA 1IUFA 2CS3A 2DK8A 2Q0AA 1GOHA 4MGZE 3V0BA 4FTEA 1FMD3 1CJPA 5FBZA 3TWIA 3HSEA 5E1RA 1OOPA 4ARYA 3GGLA 2EV5A 1R091 4LO7A 3GZNB 1GVDA 2RKHA 4AEMA 3CCQI 2VCCA 4H3WA 4XIDA 3OSGA 1YO5C 3WDTA 1W0TA 4CDUC 2MHFA 2Q8KA 1WCKA 2YV8A 1COV1 3QH6A 3F9KA 2JDZA 1BM9A 3TYJA 2VKDA 1I1GA 2E2IJ 4JYKA 1QRYA 2V1NA 4II3A 2E63A 4XRSA 3ULQB 4LITA 1SBDA 1B9MA 1NLRA 5K5QA 3DXUA 1E17A 4AD9A 4WX9A 5HS8A 2ZMEC 1W0UA 4LULA 1XN7A 5ICFA 4G7ZF 2QF7A 2EZKA 4BUPA 5LRSA 5C33A 1AR93 3PUSA 1BW5A 1VBD3 3SKJE 2M4GA 1OQDA 2VI6A 3H5AA 4OI1A 2F4MB 4TWTA 1QJZA 1T8IA 1XNCA 5IK7A 1HRI2 3TGNA 4FOQA 3KFWX 4MXWB 1O6UA 3WE2A 3JQXA 3COAC 4D8MA 2AHQA 4C1XA 2HPIA 1F35A 1PHMA 2CW0F 4M3EA 1XGSA 1X1BA 1ZZ8A 3D5LA 4AF9A 5LA0A 1OLTA 1JTXA 1H9GA 3L09A 2JX9A 2O7OA 3K7AJ 5A2QK 3BB6A 2LBFA 3BG7A 5C5UA 4D7SA 1QPMA 1TG7A 4B1LA 2BEOA 4YZ2A 3G6JB 1W7PB 4XAAA 1ND2B 2ZNZA 2BOJA 4BDZA 1D1BA 2FDFA 3VEPA 3MV11 4FPEA 2VBZA 3ZMUA 4B43A 4AIJA 3FKIJ 3F3XA 2OIIA 2VXDA 2YXSA 1NCRB 4R9BA 4YZ5A 2MG4A 1R23A 3TDZC 4ESBA 2WAFA 2VMDA 1SCSA 2WNVB 3HM5A 1O5LA 1MMAA 4FCYA 4CCKA 1NAEA 5FZ0A 3CJRB 2BHYA 5CYVA 1XSVA 4WM7C 1X2MA 2WZR1 2OBPA 3BLYA 1TWCJ 1FMD1 5B1AH 1RUJ2 4X6QB 1ORKA 2MA3A 5ACA3 3IDAA 5DDGA 4LUMA 1MR5A 3C3WA 2LREA 1TEIA 1TWGJ 2QUFA 1ZZ9A 3W6VA 3AL0B 3GEZA 2WV1A 2I5UA 3QLQA 3MHZA 3I7DA 1BC7C 2Z9OA 4XXPA 3APBA 2GBYA 1CQTA 3VZOA 3HBZA 1BLZA 1GNYA 4RL7A 1AR82 2ZBJA 4KWJA 2VTFA 4N8MA 2HJIA 1EUUA 2XB6C 4MGYE 1H4GA 2JDNA 1W7PA 2D3RA 3VBOC 1YE9A 3OYWB 2EVXA 5IWFA 3K69A 2ZA9A 3JRDA 1RUE1 3RG0A 2D1HA 4TV7A 1YOVB 4R8HA 1RITA 3JD72 3U4SA 2PAKA 1C5IA 1W99A 2AEYA 4RB1A 1Z7S1 4DIQA 4BDVB 4UW4A 3HXLA 1TC3C 1Z7LA 1N1TA 3MLKA 5DAVA 4XBFA 5HCBA 4UW6A 4L9JA 1R22A 1W8ZA 3V4GA 3WDUA 3MZHA 2OA4A 3HOBA 3QBQA 3ASNH 4I09A 1ACIA 4FAHA 4ZXEA 3ML6A 4Y1VA 3RSJA 4GCVA 1ULGA 2HYJA 3JREA 2YC0A 2EQRA 4ENMA 1NYWA 3OR1C 4AVVA 4JBAA 4KU7A 2ZGRA 3QU6A 2WL1A 2E32A 2DJIA 1AU7A 2XUBA 3DYOA 2CYFA 1ZGJA 3SEPA 2GOXB 3ST7A 4I6ZA 5K7ZA 1S4CA 2KFDA 2ZGTA 2YBPA 3SC7X 3DFGA 5HPOA 1D1CA 2Z2SB 1CAWA 5T5LA 4L0YB 1IAWA 2NVQJ 2HYFA 1XGNA 1RUC1 2PQSA 3HAGA 4FP2A 4AR2A 2VODA 2EF6A 3JB4C 4QAWA 1VBD2 4RD7A 3ROUA 4Q4X3 2FZ1A 3BDDA 2PEXA 3KCYA 3POWA 4RAZA 3LFMA 3EO6A 1SFKA 2CU7A 4D9JA 3GTJJ 5EJZB 4ZYDA 2WA0A 3OWTA 2HQ5A 3HQXA 4IHXA 5FXXA 1S2BA 3K70C 1VAMA 2HYGD 3IP4B 1FBUA 3FBMA 1OLME 1MBHA 3TEDA 5EZHA 2CRGA 4IHWA 4BK5A 4XDQA 2VE9A 4META 3NRUA 3RJRA 4UV8A 1UCRA 2VQAA 2R7XA 3FIWA 1F4AA 3WW2A 2P6TA 3CU7A 2K7LA 1CAUA 2EIBA 5EZGA 2XSJC 1AL0G 2W95A 3ISPA 2BUKA 4AIHA 1TME3 3H9AA 4GMP1 2CV1A 1FOD2 3LCPA 4XRSG 3ZYIB 4TLGA 2V9KA 3CEWA 3DWLE 1R092 2V9PA 4N0BA 1W8OA 3OD0A 4A4AA 5EF6A 1O91A 5HDGA 4EN6B 2Z5UA 3BJ6A 4BE1A 3B9IA 3FFQA 4TXWA 1OHFA 4P5HA 3OPTA 4CEWA 2FBHA 1T2KA 4HK9A 2ECCA 4WVVA 1CAVB 2B0LA 3ZOIA 1OCCH 2W1WA 2VBDA 1RZ4A 4LA3A 2QSGX 3SXYA 3CIHA 3R4KA 3K1MA 2B46X 2DA5A 3M3QA 2G9GA 2VKEA 1MSFC 1ZA7A 3LPGA 3DCFA 5F6FA 5EGOA 1OT5A 2PLYA 4DS0A 5CKMA 2HXIA 4CP2A 2QKMB 1USSA 1R7JA 1PIV3 1W6PB 3AMMA 1FT9A 3ZCOA 2KDOA 4RGSA 1EPZA 4XQ4A 3ZMVA 2C5DA 3Q0WA 4CCCA 3J81K 1AR81 1X9PA 1OQEA 5A7WA 2V4VA 3CDLA 2O6GE 4Q4W3 1U8RA 3KF5A 4YW2A 4AFAA 3LFIA 2K9SA 1HKSA 3AKTA 5LBBA 1MZ5A 1IXSB 1PP8F 3THCA 3OSFA 1Z78A 3H50A 3FHNA 4QPYA 1Q3EA 3T2PA 1RUD2 3ZFFB 2A3SA 4P08A 5FXZA 1U3EM 3WTZA 4G6DA 4A5MA 2W39A 3IM0A 3Q0VA 1CWPA 3LSHA 3DBRB 4XUQA 3J7HA 1BK1A 3LOCA 4ETSA