1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
3CLPA 4FHTA 3BB6A 3CO7C 1STZA 3M1EA 2IXHA 3K69A 2R7FA 5LGNA 3HSFA 4R1HA 5FLJA 2VT2A 3OOPA 4LMYA 1XE7A 3KEQA 3QACA 3DPTA 3FX3A 5BPIA 4KWKA 3K0LA 4Q0PA 5E1ZB 5BQTA 4OIPF 5FPZA 1VJ2A 2ADUA 3EHKA 2QUFA 4G94A 2A6EF 3WW2A 1SFNA 4K8FA 2KRFA 5CVRA 5HDNA 4KWJA 3QAHA 4MH0E 2XIGA 4RAZA 1MJAA 1ZN2A 4HOBA 1YW8A 5D6FA 4IPAA 6PAXA 3T8RA 2RV8A 2PMHA 1EYBA 2IXKA 3BALA 3DP7A 1CAWA 2ZBKA 5HDKA 1SAXA 2K0GA 3E5XA 3JZVA 2EV5A 3CDHA 4QM8A 4HX8A 1MDMB 2BNMA 2RN7A 1Y3TA 1U12A 2C0ZA 2ISZA 2EK5A 4LG0B 3FZ3A 4HF2A 4LK0F 3I71A 2XGXA 4XFAA 2HS5A 4M6YA 3D82A 5J7MA 1YFXA 1W7PD 1OD5A 5E18F 3M8EA 3H92A 5L3DA 4XFBA 1ON1A 2PTMA 2E9QA 3P9IA 3E6DA 4S05A 5I0UA 1L3JA 1X8MA 3GF2A 2IJLA 5AONA 2ZNZA 1HW2A 1HQCA 1YWKA 2BBYA 4BNCA 1RGSA 3VFZA 2JPBA 3AAFA 4HAMA 3HRMA 3QPTA 1ONVA 3JAMZ 1R7JA 3OCPA 3GBFA 4OU0A 4YIFA 1SD4A 2CW0F 4PZJA 4FX0A 3FJSA 1UIJA 1BJAA 4F7ZA 4IRIA 3M8FA 4YFNF 3QP5A 2M45A 4HF0A 4XF9A 4IEZA 4MQVA 5LHIA 4IEUA 3LA7A 2ESHA 5ICFA 4AVCA 4UNOA 4XLPF 3SCFA 4R79A 4WVZA 1SFEA 5C6CA 2KIUA 4HVRA 5CVIA 3V8JA 4MZUA 4ZYEA 1HKSA 2QBYB 1ZRCA 1QXJA 2P17A 3JSOA 3CO6C 1WRJA 1XCVA 3F6OA 1LDJA 3U1DA 3SQNA 4KNYA 3Q5FA 2STWA 2HQRA 4KIBA 2VBYA 4L9VA 4JBAA 4I0BA 5FLIA 2V9VA 1ZRDA 5E1RA 5BV6A 1EV7A 2QNKA 2E7WA 5DCMA 3H7YA 3I53A 2OZUA 4D0PA 2QQAA 1NYWA 1YUDA 1EH7A 4IRGA 5LEJA 3G7DA 1TQMA 1ZYRF 4HVOA 1UFMA 1FY7A 4OMYA 5ILUA 2K4JA 1BBYA 1GHCA 4QWQA 3W6KB 3SHRA 1Z05A 2WV0A 3EDPA 3ML6A 1BN5A 1KQ8A 4AIJA 2PI0A 4RB2C 3GFIA 2UYAA 3F23A 1GVJA 5FDBA 4HYEA 2L02A 4KT5C 4L9NA 3BU7A 2QQBA 2P7VB 2Q1ZB 3ZQ7A 3HRUA 3ZN1A 4HBNA 5IT3A 1RL3A 2Z69A 1DPRA 1OR7A 3T8TA 2IP2A 4LJZF 4ENKA 5LRRA 3EYYA 1BIAA 3NW4A 3SMHA 2EB7A 3ECOA 2DT5A 2VE9A 1W5SA 3FMQA 4M9SA 3ABTA 3TNQA 2E7XA 4LULA 1FZPB 3FHIB 4RGSA 4L0ZB 2A3SA 4U0YA 2LKPA 2XAGA 2CAUA 5L3BA 1O3QA 4GCVA 2FMLA 2FBIA 2VONA 1F9NA 1HSJA 1T0FA 5I0SA 3LAGA 1LDDA 4EJOA 3Q9VA 1CGPA 3GZ6A 4Q0QA 2W24A 2Z99A 4ESFA 4PJYA 2QM3A 4MGIE 4RGUA 2PAEA 3V8LA 2EJRA 5HLGA 3IRRA 2DPDA 4BHBA 1GXPA 2BV6A 2OU2A 3QU3A 3L2CA 1IN7A 4AWXB 2QLZA 3CUOA 4DQ2A 1YS7A 5ICGA 4NVPA 2ZXJA 5C8WA 4H7LA 1ZHFA 2HKOA 4HMZA 4OINF 4IEPA 4Q0UA 3K1MA 1U8RA 2HGCA 4L18B 2Z9OA 3U0ZA 3H1MA 2F5EA 1FP2A 3ZP5A 3K2ZA 2IXLA 4GULA 1ON2A 1KU2A 1FC3A 1X8EA 1FWZA 5ILVA 3RTRA 2NNNA 5CU1A 2VODA 2K27A 2Q30A 4LK1F 2DCTA 5TRDA 4BHPA 4ZYDA 1FBSA 2EVXA 4K2EA 2D1VA 1FXZA 1REPC 4KWLA 1K78A 1O3RA 3OTFA 2ET1A 1S6LA 3FF5A 5KHKA 1PM7A 2MD5A 3HTSB 2OZ6A 4MTEA 1NXMA 2E1NA 4I01A 2AS5F 2XROA 3GX4X 4HLTA 5HVQC 3ISPA 2QWWA 3MAJA 4Z82A 4ASNA 4DINB 3CF6E 2DK8A 2XRNA 4EWDA 1UCRA 4WWCA 1IN4A 2FQPA 3ZMZA 1H1IA 5JCTA 3GW2A 4RS8A 4GGGA 3M3IA 5HDGA 4IVNA 3IIAA 4NHJA 4UUVA 1XCBA 3L2HA 4BHCA 3MQ0A 2VBXA 3MYXA 5E8IA 3U11A 3M70A 1OPCA 2X4HA 4MGRA 2NRAC 1R1VA 2XV4S 2XKPA 3S2WA 3I59A 5A2QK 2XAFA 1WA4A 3KE2A 4HBLA 3GYHX 1PUEE 2R3SA 3WTYC 4META 2W84A 1YFYA 2X0LA 3I0TA 4MHGA 4S04A 1WWXA 4M71A 1V70A 3HHGA 1FSEA 1ZGJA 1O7FA 3LFKA 1J3RA 1BIBA 2Y0MA 5AIQA 3G73A 1UCXA 1D8JA 2WC2A 4Q29A 4OFGA 4ESJA 4IHTA 4UBGA 1FSHA 2ZFWA 1ZVFA 3JAMK 2XKOA 4I09A 4KMFA 4R8HA 2B5HA 3L9FA 3ZMTA 3M9AA 2K9ZA 5TJJA 3DL3A 3O2PE 3COAC 4WXHA 1J1LA 1QWRA 1JGSA 3HRTA 3V7SA 4MGZE 3NQOA 4HLXA 3DFGA 4EROA 4IESA 5F64A 3MDPA 1I1SA 3RIRA 3DEUA 4YIIA 2UWMA 1TQPA 3QP6A 1G4DA 4G7OF 1IXCA 4KN4X 5KHHA 5JR7B 4EQQA 4MEXF 3SCGA 1H9GA 4CICA 3I58A 1Z7UA 4HQEA 4IERA 2VXZA 1ZARA 3FXQA 1HW5A 3C18A 1I1GA 3LZZA 1ZZ7A 3DKWA 4IEVA 3KGZA 1P4AA 1J75A 2HDCA 1KQ9A 4HN0A 4H0EA 4R52A 5FO5A 2V09A 2PJPA 2PYTA 1TW3A 4UV9A 2HWVA 1BOAA 4YFXF 3GXOA 4OIOF 5KHJA 3RPQA 1H9TA 5DDGA 1XSXA 2ZO4A 3WG9A 4MTDA 2WFPA 4ZH4F 1IRFA 4G9YA 1PP8F 4QX5A 5FLXZ 1CAWB 2RC4A 2HYFA 3NRVA 1PDNC 2P6SA 3BY6A 3WTSC 2ZJ2A 1F1ZA 3ZMUA 5IT9K 1G3WA 2XAJA 4U0WA 1QPMA 2W57A 4WBBA 1UHWA 2PA7A 1S29A 3ZDSA 5FLHA 5JSRA 2GA1A 3RPUA 1Y9QA 4ENJA 2BE5F 2M30A 2FNPA 1IN5A 2QQ9A 1FYKA 4JQFA 5KVRA 1ZH5A 1ZZ9A 2EV0A 3OV8A 2OA2A 1Q5OA 3KP4A 1ZG1A 2HZTA 4CHUA 1X82A 3ECHA 2P5LC 3ELNA 4M72A 1J58A 1SMYF 4HSLA 1YFHA 1R5GA 1ZAOA 3D0JA 1IN6A 2GC0A 3FFQA 2QZ8A 3I54A 3T0YA 3KP5A 4CDGA 1Z91A 2DK5A 2FQ3A 3RI4A 4O5VA 3L09A 4Y17A 2GAUA 2DFIA 3ZMVA 2UZKA 4A6DA 2ESNA 3EBRA 3R6SA 3JTHA 3ES1A 4BH9A 2EA7A 3M7GA 5K5RA 2VECA 1WLTA 3F72A 3E6MA 1H0MA 1UPIA 1W4MA 2VBWA 1VTNC 1QQIA 5EEGA 3TO6A 1Z9CA 2EFPA 1D5VA 2PFWA 2IXIA 1DDNA 3MFKA 4CXFA 4HN1A 4LTAA 3TDUC 1EY2A 5CVUA 3WODF 3HSRA 5H6QA 3KCCA 3B73A 1LRHA 3J81K 1UIKA 3IRQA 4AVPA 4D7TA 5BPXA 2CAVA 1B1BA 3BCWA 4U7BA 1U5TC 3LAJA 4PIZA 1GQGA 4A0XA 2JRTA 3UKTA 5CVJA 3T1BA 1QXRA 2GA2A 2VT3A 1IPKA 2FOKA 2O8XA 2Y0OA 5K8SA 5JR3A 5KHGA 2PN6A 2EFOA 3BROA 2Q0AA 4I02A 4E2SA 2QENA 1HKTA 2Q4SA 4XFFA 2LNBA 3KFWX 1R22A 3LA3A 1W5TA 3C3VA 4OLLA 3WTZA 3PLQA 4A0YA 2QDRA 4D7SA 3H8UA 3CUQB 1SQ4A 3RNSA 4GXOA 2DAOA 1I6XA 4KN7X 2XASA 5LEKA 4XFGA 4FBFA 3KMHA 2ETEA 1O4TA 5D1IA 4HV5A 4EM0B 3PQJA 4P5OA 1RTVA 1O5LA 1B9NA 2Q8KA 4PGGA 1O57A 1CAXA 2EFNA 1NZCA 2TDXA 3FWEA 3T5XA 3OD0A 1DPUA 3ES4A 1Z1DA 2GC3A 2NAZA 2IA0A 4WZCA 5DEQA 2JTVA 4EWEA 3CUQC 1BI0A 2Z2SB 4EWAA 4OIQF 3WTXC 4L2NA 2O1QA 3KZYA 3O14A 5KBFA 1NE6A 2P8TA 3EQLF 4EJWA 4YSFA 2CQKA 4IJAA 1P2FA 3I64A 3BP8A 1SMTA 5J8CA 4UV8A 2GXGA 1D8KA 1QZZA 1YQAA 1J59A 3J80Z 4J1XA 1OYIA 2Y75A 5D5XB 4XF4A 5I0RA 1CF7A 4A0ZA 2F2EA 4P96A 2DW4A 5LHHA 3L00A 2XLAA 3JW4A 4AVBA 3O6BB 2W85A 1K7AA 1IPJA 4ENNA 3IWZA 3QRFF 3IDBB 3LAPA 2A68F 1U3EM 1T2KA 2RDPA 2OD5A 4BQAA 3IDCB 2B8MA 2NYXA 5F6FA 5LGUA 3K9TA 5ICCA 2P5VA 4LEJA 3F22A 1UD1A 4KA4A 1ZZBA 5ERIA 2DQLA 2F5DA 1IRGA 2XAQA 4HQMA 3MZYA 2O8QA 3LOIA 3H3UA 4IXAA 3WTWC 4QGLA 3ABUA 4WXCA 4PIYA 4ORFA 3ST7A 4JVAA 1IW7F 2VPVA 2XL9A 3H1WA 4UBHA 5CVVA 1T39A 4RB1A 2B0LA 2KIFA 1QBJA 3V4GA 1C0WA 4XLNF 2FXAA 2H94A 3E5QA 3G3ZA 1W7PA 3F3XA 3S7EA 1ZZ6A 3F8BA 2A6HF 3MCZA 1J0RA 3CJXA 3ULQB 2P6TA 2WTEA 3SXWA 5K1YA 3HTUA 5DD8A 3BDDA 1TLHB 1LR5A 1V4RA 4MGKE 3WGGA 4GYIA 4IEWA 4QM9A 5L3FA 2ETHA 3Q9SA 4IEQA 1Y0UA 1EP0A 2J5OA 2VOOA 1CAXB 2LSOA 2P7CB 4LA3A 3KGLA 3WU1B 5BOXA 1CAUB 4WX9A 4O3MA 3BPZA 3HRSA 4YYOA 3RKXA 3WTVC 4I7HA 2V1UA 1ZG3A 1YHFA 1QNTA 1ZNPA 1OMIA 5I8SA 1IXRC 3MWMA 4UXAA 1LQ1A 1KGSA 1CAVB 4LA2A 3UKNA 2H6BA 1RUNA 5FFXA 4KMUX 4ON0A 2VN2A 5LHGA 3PNAA 4RAYA 1XD7A 2BNOA 3OGJA 2I45A 4WF2A 4Q4ZF 3EQEA 1SFUA 1HBXG 4CGZA 5FLXK 4XETA 3KP2A 1BC8C 5FPXA 2QYOA 2CYYA 1ULYA 4G7HF 2HKXA 3HQXA 2OBPA 2Z5UA 5I91A 4IRHA 3H3ZA 4L0YB 2BEOA 2EA4A 3I59B 1T6SA 4JK1X 4ZU4A 1J7KA 4XSXF 3C3WA 4B8XA 4EJTA 2RVCA 4AXOA 4I98B 4BYYA 1RNLA 1XMKA 1A04A 3IC7A 3KEOA 3R61A 3CEWA 1QZYA 1LB2A 5HLHA 2O03A 2O0YA 3KP3A 4PGHA 4EGZA 4EVIA 4HX4A 4A6EA 2HYGD 2STTA 4N0BA 4RB0A 4Y13A 2RNJA 3IHUA 4KFCA 3S0MA 5A2QZ 4LB5A 2ZNYA 3H50A 3HOSA 1Q1HA 4L11A 5FQ0A 1EH6A 1KU7A 1FI2A 1YS6A 3FZVA 2EAAA 1U5TA 4CYDA 3TO9A 1ZGAA 2OZJA 4CZZA 4LD5A 4AVAA 1I5ZA 4IF4A 3E6BA 2RGVA 4Y15A 5I93A 1X3UA 3V8KA 3WU0A 3R0AA 2OPKA 5JSOA 2DO7A 2MLKA 4YNIA 1Q43A 1JXSA 4MV2A 4MEYF 3BWGA 3WGHA 3KETA 3R60A 1HSTA 1V3FA 3SHFA 2PEXA 2GXBA 1IZ1A 2FF4A 1ZZCA 3FMRA 5EEHA 1YTYA 4A12A 5FB2A 2UY8A 1ZLKA 1RI7A 2PG4A 2DPUA 2DBBA 3LQQA 2IC1A 1HKQA 1LNWA 2IVMA 3FM5A 3OF1A 1P6RA 1CAUA 1P92A 5D8KB 2A69F 4KYWA 4M9XA 3RYRA 5L3EA 2OQRA 1GXQA 4XF0A 3JTGA 3BPXA 4HLYA 2JPCA 3JSPA 3TOBA 5DUKA 1D3YA 1IN8A 3IL2A 2CG4A 1RC6A 5T3NA 3E5UA 3I4PA 4AD9A 4N9HA 2AXLA 3NKTA 4ONUA 5J8FA 1XGSA 2FA5A 2NS0A 2W25A 4XEZA 2L4AA 3F8MA 4OMZA 2IA1A 1IAWA 3FM3A 4MNUA 1R23A 3GLXA 1AWCA 5E17F 1ZX5A 3SCHA 1YFUA 2PHLA 5IT9Z 1HXDA 1KA8A 4TLFA 3K1NA 4P55A 3VOEA 4OIRF 3EETA 5L3CA 1XN7A 1UHMA 3DPLC 4IEXA 3E6CC 2VQAA 1DGWA 3C1DA 4G8XA 4ETSA 4P9FA 5K5QA 5JAXA 5I0TA 3LA2A 2P5KA 4IEYA 1B9MA 5HLIA 4HZFA 1XSDA 3QOPA 4I3PA 1RZ4A 4LB6B 2H09A 2Q2EA 3WTTC 4Z2YA 3F21A 3S7IA 1XDSA 1XMAA 2H6CA 1KQ0A 4WCGA 2ZKLA 4GO1A 1BI3A 4OOIA 3WW3A 4ZYGA 5I8YA 2R7DA 2H27A 1UB9A 3W6JB 2ACJA 4ESBA 1J3QA 5D4RA 4ZU5A 3NL1A 5J48A 2D2WA 2MBFA 2J5PA 1OYYA 3IWFA 1R1UA 4UVAA 3TGNA 3KP6A 2CGPA 3HT1A 2GU9A 1VP6A 4EJVA 2FMYA 5DCMB 3V7CA 3IBMA 3GFLA 2UXNA 3TKYA 2BGCA 2Z3YA 1U5TB 1X7NA 2HEOA 2YSRA 3QU6A 3RYPA 2ET7A 1S8NA 3LWFA 1MJ9A 2GIVA 3GFJA 4EV0A 2PLYA 4QGMA 2IXJA 4MX3A 2KJBA 4WXDA 5L3GA 2G7UA 3K1PA 4U0VA 5LGTA 5HS8A 3U2RA 3R0JA 3C7JA 2WWYA 1EH8A 1MGTA 2ZCWA 5FFZA 5EZWA 3P9KA 3VB2A 2MPFA 4IHSA 1PMIA 5E16A 2OQGA 3WW1A 4J1WA 2MNGA 1O3SA 2XLFA 1BI1A 5LBQA 5CADA 1ZREA 4EGYA 4U7DA 1LEAA 1YG2A 4PIXA 3L7WA 2K86A 1VR3A 3NJZA 1WSUA 1Z6RA 2XHKA 3B02A 4IETA 5DYMA 1G3YA 1ODDA 2V1DA 3NEUA 5D4SA 5H20A 2F4PA 5HOOA 2PBIA 1SD7A 4LFUA 3J7AO 2MLGA 4LLGF 3CLOA 1O5UA 5LRSA 4LLOA 2FE3A 5ICEA 2PMUA 2GZWA 3REOA 3TDZC 3BPVA 5FD5A 2FBKA 5CLSA 3GFMA 4XFCA 3O3KA 3CUQA 4AIHA 4UHTA 2Y48A 3TO7A 4L5IA 5BPDA 2DLLA 4E70A 3P7NA 2FNAA 2HTJA 2PQ8A 5JSPA 3RZZA 1MD0A 1JUHA 4B09A 4EMSA 1IF1A 4FT8A 1FPQA 2OYZA 3KZZA 3RKYA 1PP7U 3HUGA 5D5VB 2F5CA 3SFZA 2ATFA 1K6OA 3SZPA 4KU8A 2GC2A 2JSCA 2L3DA 3DXJF 3F6VA 4B29A 5ED4A 4Q47A 3D0SA 3F8CA 1FBQA 4PDKA 1S7OA 4HSJA 2HOEA 4CO8A 1R00A 4P9GA 1RIOH 1XSVA 1R58A 1CAVA 3GYDA 1IXSB 1NHAA 2QBYA 4UVCA 1L0OC 3D5LA 3WTUC 1ZRFA 3VEPA 4IEOA 1YLFA 2PAKA 3ZMDA 2MH2A 2N7GA 5FCCA 4ZZDA 3DV8A 4LLLA 2KJCA 3NSTA 1RUOA 2BNNA 4UXNA 2V79A 3BJ6A 1YW9A 4M9ZA 4LUMA 3LWCA 3UKVA 2YR2A 4HVQA 5HI0A 1TNTA 4ZZLA 5FD6A 4KICA 1P4XA 4HX7A 2K02A 3J81Z 3FMSA 3EJKA 2EWNA 2EA2A 5EFUA 4L9TA 1XE8A 3MPBA 2EV6A 1DP7P 2IRFG 2IA2A 1S7AA 3I7DA 3HIFA 3RKWA 3GUDA 5E8GA 3FXRA 5DD4A 1J9IA 3DQVC 4E2GA 2D5FA 2OAZA 2EFWA 3HT2A 4O6JA 1WI9A 1Z6TA 3H7JA 3FHZA 1LKNA 1MJBA 2ZMEB 1FP1D 1ZLJA 2CO5A 5E1XA 5FQ0B 1QGPA 3NVCA 2JZYA 2KIMA 2M8EA 1F4KA 1OKRA 2C6YA 3QPHA 4MQ9F 1CF7B 3IKTA 2E1CA 2G9WA 1FYMA 4XFIA 4YRDA 4M73A 1MZBA 4HDVA 3GZ5A 2A5YB 3KP7A 2GWRA 2VC1A 4KDPA 2KKOA 3RJPA 5HS9A 5DV5A 1WGPA 1MDMA 4RGRA 2D93A 3PFIA 4RGXA 5BMZA 3CJNA 1ZRRA 5AVPA 2HR3A 2L01A 2F5FA 1YO5C 2LF8A 2BYVE 2P4WA 4RD7A 1JHFA 5BXXA 1J5YA 2LDUA 2GH2A 4KU7A 4ENMA 3USSA 4PCQA 3ERED 1BI2A 4O9EA 1I27A 2YU3A 3MZHA 4LLNA 4I2OA 3PVBB 2YX7A 2D1HA 2PQQA 1B59A 4U88A 3LSTA 3DN7A 1SD6A 2A61A 2UY9A 2IXCA 2XL7A 1XDUA 2ZKZA 2FSWA 1JE8A 1TBXA 1YLLA 3HOTA 1G6NA 2V1XA 4RB3C 5J3UA 4KIGA 1XRUA 3HHHA 1OYWA 1XGMA 3ETQA 4KL1A 3MEXA 1TTYA 3P9CA 1USSA 1E2XA 1FX7A 3GO5A 3F8NA 4MGYE 3ZN0A 4ZU7A 1UW8A 2VE8A 1DZRA 1OFNA 1QY4A 1LVAA 2FU4A 2B9UA 1FYLA 5FGMA 1R5HA 4FX4A 1ZZ8A 1H1MA 1F5TA 4X6RB 2G7HA 3RDIA 1J2XA 2ELHA 1JHHA 5CYVA 3U9GA 4G6QA 2CSOA 4Q48A 4P9UA 5AIPA 2HJIA 1B4AA 1FNNA 1U6GA 2H0VA 3I5UA 2D40A 3ELKA 3TQNA 4XRFA 1FOKA 2MHFA 2M1BA 4LG0A 3VHRA 3RYKA 4NQWA 4HV6A 3PQKA 4BXUA 1SFXA 2O6GE 4HDUA 3EYIA 1NE4A 2IT0A 5E20A 1W7PB 3TOAA 1IUYA 1T98A 1YIOA 5KK1A 4KIFA 1B6AA 2RKHA 5JHUA 2MC3A 3HSEA 2Q0OA 2DQRA 1YYVA 1KYZA 2CWEA 4DNCA 3GEZA 2FBHA 3WE2A 3BZ6A 4YG2F 1GQHA 4Q0SA 1AOYA 4M6XA 2D45A 4LGWA 2K7LA 5LLQA 2XVCA 3U10A 4I0AA 1TNSA 4M74A 4QLCU 1T38A 4WK8F 1XGOA 3N97A 1SEFA 3N4MA 1K78B 4QMAA 1O3TA 4XBFA 4UVBA 2COMA 4HW0A 4EM1A 4AIKA 1WQ2A 3ACLA 5DUIA 2QJVA 3ZMSA 2VC0A 2QVOA 1Q3EA 4L5JA 4A2UA 1P4WA 4KUMA 4JTOA 4JV4A 3GWZA 2QCSB 4HA8A 2NNYA 5J6XA 4XF1A 4AQ2A 1KU9A 1KU3A 1MKMA 2MH9A 5ILSA 2PFBA 5D6EA 1U78A 1LJ9A 5BY5A 4O9GA 3ZPLA 1LEBA 4LUKA 4NB5A 5K5OA 2PHDA 1XB4A 2A07F 4FAGA 3FE5A 3CO2A 4L9JA 4G7ZF 2VOPA 4Z07A 2V6CA 1KYWA 3EUHA 5KHIA 3KLOA 2PAMA 1G3TA 2K4BA 3H9AA 4XSZF 2HQNA 1USTA 5HS7A 4AQ6A 1R1TA 1O7LA 5JI6A 4N9IA 3R4KA 4BIFA 5JVTA 2HTSA 4ZYHA 2FEZA 3CL1A 1L3LA 3F8FA 1DZTA 3E3VA 3BOQA 4XF3A 3J80K 4FAHA 3TNPB 4MUVA 3BJAA 1FBUA 4A5MA 2CFXA 3GVAA 1DUXC 1ZG5A 1TQ5A 4BAYA 1XGNA 3WW4A 3CTAA 2CV6A 1E17A 2FRHA 4QGNA 4YFKF 1CX4A 2IPQX 3BJOA 1R36A 3ROUA 4JTNA 2DTRA 1YFWA 2JT1A 1QO0D 2RQPA 5E1WA 2L54A 3WGIA 2XLGA 2DI3A 2UYBA 5H6RA 3SXYA 3V7RA 5D5UB 3KLNA 4GYGA 1LDKB 1FT9A 3H1YA 4Q5SF 1TW2A 1K79A 5I8TA 4A5NA 1DGRA 2GQQA 3VODA 2D5HA 5BUVA 2YX4A 2M5WA 2O3FA 4F8AA 2DU9A 3FXUA 5DCFA 3HYIA 1U2WA 2M87A 5CJ9A 3SZTA 1SD5A 3E97A 1WKMA 4G6DA 2UXXA 2L4MA 4Q0VA 4QXKA 2EFQA 3EO6A 2QVSB 2XUBA 2HFHA 1OI6A 1G3SA 5D8LB 2GC1A 2YPRA 4XFHA 3DF8A 2Z33A 2O61A 3IKVA 3LQRA 4E2QA 2KXLA 2IW5A 1BM9A 4EJUA 2LF7A 2ZMEA 5JFRA 2VBZA 4EM2A 2ISYA 4YARA 2XAHA 1HW1A 5D5WB 5BS6A 1BC7C 1YW7A 2MA3A 1J3PA 4TV7A 1TQIA 1S3JA 4HF1A 1FLIA 1EPZA 2OA4A 3KSCA 5F1RA 4X6QB 3WE3A
chains in the Genus database with same CATH superfamily
4XOTA 3GCMA 1Z7S3 3BB6A 1QJX3 3CO7C 3K69A 2RVAA 1BVP1 4CCEA 1W36C 5FOBB 2R061 4R1HA 5FLJA 1XE7A 3KEQA 2C9KA 5KWRA 3I55I 2A6XA 5BPIA 4CP9B 1VQPI 4AF9A 3BTJA 4CDWC 4Q0PA 4OIPF 3H42B 2DTZA 3A4CA 3H8XA 2RM21 4KNCA 3EHKA 4BK5A 4YW4A 1LOGA 1CJPA 4U36A 2F6BA 4PLNA 1QXPA 4QX8A 2R073 3M7AA 4RAZA 4HOBA 3U4SA 4IPAA 1DQ6A 2WZPP 4C8DA 2RV8A 2JUCA 2IXKA 2HWD1 4XUQA 2G9GA 5HDKA 5JLVA 4QX1A 1JODA 4XN0A 2WWSA 2DOEA 1LOAA 2RR11 1LPQA 4QM8A 3N9QA 3B3QE 1MDMB 4V19K 1V5FA 1XNDA 5EIYB 3WNMA 3WP4A 2VO5A 2IBDA 1Y3TA 1U12A 4AYBA 2LH9A 3JBG1 2C0ZA 4HK8A 4Q5OA 5FP9A 3I4MJ 1MIJA 1KITA 2VUJA 1W2NA 1HJGA 4NNJA 2WAOA 5IWFA 4XMYA 2ZX0A 4QU2A 2ZJCA 2YS9A 3J26N 3KZ4C 5E18F 3MIDA 3DCFA 3TP3A 3OUJA 1ON1A 2MYSA 2E9QA 4S05A 4DUVA 3RRDA 1DU0A 1YJLA 3LEIA 3OPTA 5A6XA 3B6AA 1ZBA1 5AONA 2ZNZA 2BY1A 2ZMKA 2IS2A 2JB4A 2F48A 4HAMA 1VALA 3J7LA 4JKLA 4HPKA 4IV1A 5IHRA 2R5ZA 3CBNA 4BLJA 1NLQA 2QQUA 4HKWA 4F7ZA 4IRIA 5BNNC 5TISC 4D9JA 2RV9A 3FDYA 2M45A 4B4PA 1KONA 4IEZA 3LEKA 1YJ9I 4DRVA 5ICFA 3WNLA 4LITA 3JD73 3VZLA 3SCFA 5C6CA 2VOWA 3ASIA 1UY4A 4HVRA 1MNEA 2E36A 5FK7A 4EN9B 4RMNA 5C3EJ 1HKSA 3OSGA 3HB9A 1POGA 2DBNA 2QBYB 5FUIA 3K70C 1ZRCA 3THPA 1TL8A 1LDJA 3U1DA 2DMPA 2WFF1 3MKYB 1GZCA 2LG4A 1ND3C 3DU5A 3G2BA 3DKYA 4KIBA 2TBVA 3GBGA 3NO8A 3P6BA 1EAH1 1JUPA 1WCQA 1EV7A 2IAIA 3LGRA 2QNKA 5FZFA 5A32B 4C3IJ 2E7WA 1D5YA 4XMIA 2HEYF 3HPNA 1OXCA 5DUVA 1ULEA 2OZUA 4D0PA 2QQAA 1C4RA 1EH7A 2KIQA 2Y0SN 3WSOA 2VOXA 1PYVA 4IRGA 3G7DA 3A0HC 5DUWA 4DFSA 1DG6A 2RQQA 2OX0A 1ZYRF 4OCTA 3W20A 1H4HA 5L9BA 1CQ9A 4RA0A 1FY7A 4ITVA 5ILUA 4XJZA 2K4JA 5FKBA 4OAYA 3WUCA 3ML6A 1SACA 4Z92B 3X2QH 4A3MJ 2L02A 1RUI2 3ZXLA 1ULPA 3F9KA 4KT5C 1IGNA 5FY4A 4L9NA 2WADA 2O5RA 4UYBA 1PNFA 3ZQ7A 3HRUA 3ZR6A 2Y2ZA 1OF3A 1W0OA 4OYUA 3AFHA 5J47A 2VE1A 1VB4A 3U4XA 5HBAA 2IP2A 3WNKA 3OY8A 4A44A 4AEJA 2DT5A 2FDHA 5FR3A 1UZYA 1TZLA 2DCYA 4CP9A 3ABTA 4QQLA 2VQUA 4BJ0A 2HOAA 4L0ZB 2VMFA 4EYUA 4JGZB 2VL8A 4GWJA 4RQPB 1Z7LA 4FCYA 2K9QA 3BTCA 3L2RA 2QQJA 1HXS1 5APAA 2BVMA 1T0FA 4QU1A 3LAGA 4EJOA 4COVA 2AEZA 3Q9VA 1CGPA 3CZJA 5HXVA 3BIEA 3AJZA 2Z99A 1EJ9A 4MGIE 1H8TB 2EJRA 3IRRA 2DPDA 1GXPA 2OU2A 3L2CA 1IN7A 3CUOA 5ICGA 2IEKA 3U75A 1ZHFA 2YZ4A 2NVUB 3O0XA 5IFPA 2HGCA 2HEVF 2FOWA 5LBFA 2A05A 2HWB1 1C5IA 3H1MA 3ZP5A 3PU3A 1AHSA 2IXLA 3NRUA 1FC3A 1X8EA 4NIDA 3C8XA 4DUWA 3SJMA 4BKXA 3JU9A 1FBSA 4GQ7A 4OHZA 2FDKA 3OTFA 2ET1A 4KBBA 1J09A 3G1OA 1S6LA 1DQ4A 2XH6A 2CUZA 1PM7A 4N90A 4FCAA 2MD5A 4MTEA 4FFHA 1NXMA 3WDYA 2L7ZA 3N7LA 4FFIA 2XROA 3GX4X 1QJY1 4ZXKA 1NQJA 1RUD1 4B8EA 3ISPA 1MSEC 2QWWA 4ASNA 3ZQGA 3T0AA 2NP0A 3OYLA 2VQGA 1POQA 1R082 1IN4A 3ZFGC 4K8RB 1HQWA 3OYGA 3IIAA 4NHJA 3CCQI 1XCBA 3Q9OA 4BHCA 1LESA 2ZC2A 3OPZA 1TME3 3HOWJ 5E8IA 1Y39A 3U11A 2HWE2 3QD6A 2JMWA 2PELA 5DZGA 3W3CA 1WA4A 5F5CA 3KE2A 1PUEE 2R3SA 5FUPA 1OKQA 2X0LA 4MHGA 3J7ZI 1Y7BA 3KCYA 2X5IB 3UK9A 3URFA 1APLC 2QGUA 1K6YA 1W6QB 1BIBA 4Q29A 5CG8A 4OFGA 4UUTA 1OA2A 2OQ7A 3JAMK 2KHMA 3CIHA 4R8HA 1DLLA 2YXSA 3AJYA 1NLSA 2VQTA 3JRCA 5BNNA 1QWRA 3V7SA 4U87A 4O61A 2WINB 4ZDOA 2VVFA 2X6WA 3DFGA 1OVSA 2E7TA 4MGSA 4AI2A 3RIRA 4FASD 3ZYJB 4XUPA 1F31A 2UWMA 3MFCA 1D0XA 2GLOA 1IXCA 4KN4X 5JR7B 1SFKA 3VSKA 4MEXF 4CEYC 3JRBA 3MV11 2HVRA 4K40A 2VLAA 2H8RA 3I49A 2LBFB 1YRNA 2QQ8A 2RDNA 4NE9A 1AR91 4Q1RA 5IT6A 1HQLA 4IEVA 5JZGA 1JKPC 5FWEA 1J75A 2VPLA 4AHXA 4EQVA 4CH7A 2HWVA 4YFXF 4OIOF 2KM2A 3T1MA 4KT6A 4UW6A 3WG9A 3L2VA 5FRMA 3POFA 2R0HA 5FLXZ 2IS6A 1P7JA 2P6SA 2RS12 1F1ZA 2WT0A 2B63J 3OBRA 1EF4A 5FJKA 3T2TA 2XAJA 3DWLE 4ASKA 5A70A 1MBJA 1H2MA 2F17A 4LORA 4LBJA 3I56I 2G1MA 3QLQA 2R6QA 3EXUA 3QPLA 1Y9QA 3OYMA 2W48A 1VBE2 4Q4X2 4UW3A 4JQFA 2W4SA 5C9AC 1TWGJ 3GHMA 1ZZ9A 2ARAA 3OV8A 2OA2A 1XSQA 1ZG1A 1IPSA 1ONAA 5FP4A 5K7HA 3A03A 2P5LC 1UF2C 3ELNA 5CG9A 2R7TA 3IH4A 1ZAOA 4AI8A 3D0JA 2EF6A 2FCUA 2GC0A 3KP5A 4CDGA 4W6WA 1OCZH 3J8F2 5DZFA 4O5VA 2Y33A 1N1VA 3ZMVA 3EBRA 3JTHA 3ES1A 2HU9A 3M7GA 5K5RA 4IHXA 1HOMA 2DJNA 2VBWA 3PUSA 1QQIA 5EEGA 3TO6A 1Z9CA 5KXEA 2CQNA 1LU1A 5GTIC 4CXFA 5JXHA 4LTAA 3TDUC 1EY2A 3RZHA 4AYUA 3WODF 3KCCA 4AQSA 1U0JA 1X9PA 2DTYA 1MS0A 2CAVA 4E7KA 3LAJA 1H88C 1RMU1 4A0XA 2JRTA 1O91A 1PK6C 1PZ7A 2BZDA 5CVJA 1LHUA 4WVWA 2FOKA 3K4DA 2Y0OA 1D4M2 1OQEA 5SV5A 2D98A 4E2SA 1DP0A 1NA1B 3N9NA 4E7HA 1XS9A 4OLLA 1QQP2 2QDRA 3ZYFA 4Y5SA 3OPWA 1SLAA 3H8UA 1AJKA 3Q8FA 1HRV2 3CUQB 3I3MA 3RNSA 4GXOA 3WUDA 1H1AA 2ZGPA 3KMHA 2J22A 3FL7A 2CS3A 1S4CA 3CHXA 4A3DJ 4EM0B 4P9WA 2JE8A 4OI0A 2VNGA 4P5OA 4BS9A 1RTVA 4GZ9A 4IGPA 4P9YA 3POJA 2VCCA 2VKEA 1J1TA 2TDXA 1ND3A 4O7XA 4A3IJ 5LW9A 1VRH2 1WMXA 2NAZA 3A01B 5IVCA 3O1VA 4N7IA 3PUAA 2BVVA 2WT1A 3NV3A 5F3GA 1FNYA 4EWEA 2JA7J 4OIQF 4L2NA 4B1LA 3D5SC 5J40A 4Y26A 1VIWB 3HQRA 1JZ6A 4HKOA 1P2FA 1UMZA 2R5YB 1HN0A 5FUNA 5L7OB 2GXGA 4L0PA 1J59A 3J80Z 2Q8CA 1VBB3 1CF7A 1HLCA 1F5FA 3BGAA 1FV2A 4AVBA 3EB7A 1D0YA 4ZS2A 2XMLA 2OKXA 1PVC3 4ENNA 2HWC2 3IDBB 1SDWA 1XX5A 1T2KA 4CEWB 2RDPA 2E6VA 2W87A 3IDCB 1REEA 2B8MA 4MYEA 1MVQA 4JGYB 5FZOB 2NYXA 2XGEA 3BR1A 1VBA3 3K9TA 2ELJA 3T1LA 1UD1A 3M3EA 1V9U1 3OMYA 5C9AB 2WAEA 1IRGA 3VV1A 9ANTA 2JA5J 1W1WE 1HCRA 3U78A 1ULDA 4QGLA 1W9WA 5F3EA 3RZGA 3WG4A 3W2WA 1ETYA 4ORFA 5FKKA 4JVAA 2WQ8A 2VL4A 3HN3A 4YIRX 1ZBA2 3P3NA 5CVVA 4XACA 1ZYBA 1ODNA 4RB1A 1KJLA 4LHSA 1QBJA 4DEQA 4JRLA 3IMNA 5IVVA 4O65A 1RRJA 2BDRA 5BNOB 3MIFA 2I07B 4LBQA 4XLNF 1PX4A 2RREA 1W7PA 3F3XA 3S7EA 1ZZ6A 4LBNA 3SDGA 1ETXA 3ZGKA 5KCMA 2WTEA 1W8WA 3SXWA 4DRRA 2BU9A 3ZLIA 1W5CC 2MEV3 1AR82 1LR5A 2V26A 1NLRA 5A3WA 4RR3C 4GYIA 4QM9A 4SLIA 5DAVA 2ETHA 3ZN4A 3Q9SA 4IEQA 3BC8A 1XJAA 1WCKA 5F5QA 3HOBA 3HNBM 4RR3B 3DKQA 1Z7S1 4B4RA 1RUE2 1QOSA 1UMIA 3WU1B 3M8JA 2WZEA 1E5IA 2R16A 2RJLA 4A6SA 2VMCA 2ME0A 1E3OC 2R063 2YROA 1Q8OA 3AZXA 4BPZA 1LHOA 2VZUA 5EJ1B 3BPZA 4BGDA 5FMOL 3D5OA 1GZWA 1OPMA 2RM23 2V1UA 1YHFA 4LIVA 1QNTA 4M3DA 3HBLA 2ZGSA 3MW4A 5LBCA 1IXRC 3HOYJ 1WVRA 1KGSA 4ON0A 1JBCA 3CCLI 2VN2A 1OH4A 4GH4A 3RSJA 1JGGA 1AL21 4XC9A 2P2KA 3OGJA 3OSDA 2I45A 2XOMA 4CP2A 4WF2A 5M5YJ 2HWD3 1BC8C 5C3PA 4F3JA 5I91A 1W90A 2XAUA 4V1PA 3P1IA 5T5LA 4IRHA 3CKHA 5FYHA 4OZOA 2OUJA 1VBD1 4XRSA 4KISA 3I59B 1J7KA 2XPUA 1K3IA 4B8XA 4YG6A 4D7MA 4AXOA 4I98B 3TEYA 1A04A 3CCEI 3IC7A 3KEOA 1QZYA 1T95A 1AUYA 4COZA 1CIWA 2GNDA 5FZBA 1VQ9I 5EZGA 4EVIA 4DXRA 1XBFA 4RB0A 4WM8B 4KFCA 4AI3A 3H50A 1OQ1A 3K3NA 3HVDA 4A3CJ 3QH7A 1FI2A 3ZKUA 5GZCA 1LOFC 3ZDVA 3PO2J 4CZZA 4HG2A 3O5SA 1I5ZA 1ZBA3 3AZZA 3SFIA 1Y6IA 4KWUA 5LA1A 1G8WA 1X3UA 3MFAA 2PHTA 5JSOA 2ZGRA 4CEWA 3ORJA 1QOOA 4M3BA 4RAFA 1JXSA 1AX2A 3R60A 1V3FA 2AR6A 3WY6A 1C3HA 4YZ1A 4LOCA 3ZSEA 1TWHJ 2FF4A 4V2FA 1VBA2 1ZZCA 3N9LA 4FPKA 1YTYA 4A12A 5FB2A 4QHBA 1FPN2 4M0HA 1POV1 1HKQA 1B8IB 5IK8A 5FIXA 3FM5A 2NS8A 1P6RA 1CAUA 5A6QA 1JMUB 2R7UA 4M9XA 3RYRA 3TOJA 4XF0A 3JTGA 3BPXA 4N4NB 3BUCA 4HLYA 3JSPA 1RMU2 2J1TA 5IY5H 1DGRN 4BOWA 4N9HA 3CCJI 5A6YA 1XGSA 2W25A 4XUNA 2VQ0A 1IAWA 4MNUA 2BOJA 2HVSA 4S2GA 5E17F 1ZX5A 3G1MA 1U0AA 5IT9Z 3F0CA 4XNFA 3K1NA 1QNYA 1A5JA 3VOEA 4S2FA 4OIRF 2BOIA 2CH0A 1XN7A 1RUG2 2L0KA 2KP6A 2FDIA 4CPBD 1U9OA 4E27A 4KG0A 3C1DA 1H6XA 3CCRI 3RQ4A 5K5QA 4WV8A 2EXJA 2W1QA 4B7EA 1B9MA 3S5QA 4UUSB 1XSDA 4HZFA 3QOPA 1FATA 1MS3A 4TLGA 3I2JA 2H09A 3WTTC 2F4MB 3FXJA 3S7IA 2LD5A 1IV8A 1KQ0A 5LB6A 1WMDA 1GV5A 4E7IA 2SLIA 3RWKX 1SVOA 2R7DA 1QU3A 5CISA 2C4XA 1S0CA 1J3QA 4HPQA 3NL1A 1LGBA 5J48A 1JKQC 4XONA 3DLAA 1OYYA 2K40A 4JGYC 1JOPA 3IWFA 2JX9A 4UVAA 3TGNA 3HT1A 1JTXA 3PDQA 3UGGA 3FXLA 3V7CA 2AENA 2P34A 3WP3A 4GA9A 2Z3YA 2BFUS 1AL22 1X7NA 3DPRB 4PJLA 1HRV3 1G9DA 4JC1A 1UZWA 4Y24A 1X3ZB 2YSRA 4AHWA 3RYPA 1S8NA 2E7QA 2BXYA 4EV0A 1YQ6A 3U2RA 3R0JA 1Q56A 3BIWE 4CDUA 2QE3A 3MUY1 2DA1A 2ZCWA 2VUMJ 4WM7B 2AZ5A 4B3NA 5J09A 2VQHA 5FFZA 5F8PA 1DIWA 2C6SA 1TP4A 4RQPA 4IHSA 2JA6J 2DDAA 1BI1A 4IV3B 1SBEA 2ADEA 4P00B 5CADA 5CFDA 4EGYA 2XJQA 2ZXHA 3BG5A 1WSUA 3FBYA 4BE1A 1G3YA 3NEUA 2X05A 5BNNB 4NUBA 2F4PA 4KG8A 3KX2A 1AKHB 1SD7A 4LFUA 5J3LA 3J7AY 2E63A 2MLGA 1ASJ1 2P3JA 4UW4A 2CV2A 4LLOA 3ZQIA 2GZWA 3REOA 5FD5A 1F36A 3O3KA 2ZMNA 3OG2A 3J7YJ 4UHTA 2WQZC 3ERMA 4QDQA 3TO7A 4L5IA 1JYNA 2VUCA 1AYN1 4GXLA 2AQFA 3L2YA 3P3PA 5JSPA 5A7PA 5F6KA 2EXHA 1I6HJ 4BXFA 1DP3A 1B09A 5FY9A 1ZM1A 4DGWB 2DA7A 3DGTA 4XJUA 1NZIA 4JOMA 2VMDA 2RJKA 1GV2A 5D5VB 2GH8A 3SFZA 1TVGA 2ATFA 3TEXA 3N3HA 2R32A 1GICA 1HA8A 3A0BC 3ZXGA 1VRBA 4P08A 2BY2A 2M0CA 1HB4A 1FBQA 4P5YA 3BOWA 5C4WA 1S7OA 3UNGC 4QPQA 2D44A 4C0HA 4NRMA 1U9NA 2M0MA 1VBC3 5G04L 2Y6KA 5KXCA 1XSVA 2W1WA 4HRIA 4CDXA 1PUFB 3RZLA 1RPWA 4GDFA 4MXWB 4IEOA 1YLFA 3ZMDA 2Z79A 2MH2A 2N7GA 4ZZDA 2KJCA 2LTNA 2BNNA 4FE4A 4GKXA 4LUMA 1YW9A 3VDXA 4BQ2A 5IP6A 4KICA 1JZ5A 3FMSA 2JDZA 3EJKA 2R7RA 4UW5A 4A3LJ 2EA2A 3USUB 4XUTA 5A6ZA 2KISA 1UZZA 2IA2A 5F0CA 1BZWA 4AHYA 1Q8PA 3HIFA 1RUI3 1U5XA 3GUDA 5E8GA 3FXRA 3K4ZA 1VBC2 2O0OA 1C8M2 3DQVC 1LUJB 2OAZA 1HLVA 1CVNA 2EFWA 1UOBA 1KS4A 2OT7A 2DA4A 4A3GJ 1A31A 1H2LA 4ASLA 3VZNA 1UYYA 3E1SA 2JRMA 5FQ0B 4H7MA 3NVCA 2JZYA 1SCSA 1F4KA 4NR1A 3I3QA 1EV12 3IKTA 4I3GA 4M73A 2WO7A 1MZBA 3VN4A 4HDVA 3J4UH 1CZSA 1ENHA 1RUE1 2Z42A 2VC1A 4KDPA 4G4FA 3KD4A 1MDMA 3H9QA 1SAUA 2D93A 1RVF2 1ZRRA 4YW5A 2LF8A 4RD7A 4E7LA 4RDUA 1B35C 5H9PA 5BXXA 3V65A 3S16J 3JR9A 4OHWA 3ZQHA 4PCQA 3ERED 1YXWA 4O9EA 2WQ4A 2RS13 5CAZA 3AZYA 4TTGA 2DJIA 3NV4A 1SD6A 2UY9A 1YI7A 5JDBA 2QSHX 1XDUA 1WKYA 4OI2A 4BQOA 4NRQA 3HOTA 4BDVB 5JR2A 2Y34A 4FOYA 3WG1A 3ZVXA 4KL1A 3MEXA 3QYEA 3P9CA 3WF0A 1USSA 1OOPA 2XVKA 1H2KA 2R7OA 5IYCJ 4MGYE 3LSRA 4P02B 3VKFC 1AJOA 1UW8A 5GAEJ 1OFNA 3BQYA 4YWAA 2HPMA 2DA5A 2EIKH 5FGMA 1F5TA 4X6RB 1RETA 3RDIA 2ELHA 5CYVA 4JRAA 2RR13 3DXUA 4P9UA 5AIPA 3M4FA 2WYSA 2X10A 4PSXA 1JYTA 2X6XA 4IE5A 3RMXA 4M4PA 3KF3A 3B7MA 3TQNA 5J1UA 5EXOA 2BPA2 4HV6A 2JG9A 4K1ZA 4HDUA 2GN3A 3OBAA 2IT0A 2VCAA 3MW2A 3JREA 3THDA 2ZX2A 4KIFA 1B6AA 2RKHA 1K12A 2MC3A 1ULFA 4IXLA 3OYDA 2DVBA 4R9BA 1VFCA 4DNCA 3WE2A 3BZ6A 3SEZA 2C24A 2PHFA 1GYKA 5FPLA 2DUQA 5FMDA 3ZSKA 3JD71 3RJ2X 1PZ8A 4KI5M 4UOJA 1NCQA 4Q0SA 3BVCA 5C8CC 4UFJA 2YBPA 2BW8A 4AQTA 1S0IA 2DFFA 3N05A 5ABJA 1MEC3 4HSRA 4MG2A 1NCQC 4CUAA 3ZFEA 2DURA 2B7YA 4UVBA 1WFXA 4HEA2 4AIKA 2OTLI 2JJ7A 1WQ2A 4GWMA 1KEXA 3ZMSA 2VC0A 2QVOA 1Q3EA 1MVEA 1P4WA 2QQLA 4CEYA 3HL2A 1MBHA 3GWZA 1CPNA 4HA8A 4XF1A 1D1CA 2QQMA 1IKQA 4RHV1 4XIDA 5ILSA 1YOVB 2PFBA 3B00A 3VDDC 1GANA 4FTEA 1LJ9A 2W39A 1GR3A 1LEBA 2E2JJ 4D69A 2Q8OA 5HCHA 4Q8KA 4Q2FA 4LIUA 2PHDA 3VBSA 5F5AA 2V7FA 3RI8A 4CP0A 4UFKA 2V6CA 1PGSA 4LBQB 1KYWA 2PAMA 2V9PA 4A3JJ 4XSZF 5FZ6A 2K9MA 5HS7A 1R1TA 2F5VA 2VW0A 2A3XA 2DCJA 3VDCA 3R4KA 4BIFA 4XLFA 1GZTA 5JLWA 5JVTA 2HTSA 1G9AA 2OS2A 4JGZC 2XQXA 5A3TA 5FPUA 3BOQA 3R4SA 1VBD2 4FAHA 3TNPB 3TEWA 3BJAA 1FBUA 1FOWA 3AP5A 4A5MA 2CFXA 3GVAA 3I3DA 4BAYA 5GPAA 1K5MA 4V2VA 3CTAA 2XONA 2BRTA 3PNVA 5FZMA 3AXDA 1E17A 2FRHA 4KQ7A 4QGNA 1I3HA 2IPQX 3BJOA 1R36A 1QJY2 1LOFA 1AR81 3JD72 5T50A 2Y0SA 3BLYA 5E1WA 3S93A 5HPOA 3WGIA 1BVVA 3PJRA 2UYBA 3HNYM 3CDZB 4E4SA 4K1YA 5JXIA 5CKTA 3H1YA 2QKMB 1TW2A 1N78A 5I8TA 2K85A 1RUJ3 3PU8A 5BUVA 3ZSLA 3H0GJ 5FP8A 5A1FA 2VZQA 3LDRA 3LPGA 3OGGA 3FXUA 1U2WA 2M87A 1VQMI 3SZTA 2L4MA 3LSIA 5F6LB 4Y1XA 2J1EA 2HFHA 2NS7A 4CDUC 1G3SA 1D2QA 2UWAA 1GP6A 1JUSA 4BQ3A 4XFHA 2Z33A 3IKVA 4JDNA 1NKGA 5FWJA 1BM9A 5ISLA 3MV01 5A7QA 4LHKA 2ISYA 4YARA 2XAHA 4IOAF 1FNZA 4LO7A 4R9CA 4OMCA 3ABLH 1YW7A 4IO9F 2A5ZA 2ZZQA 1J3PA 4AEDB 1TQIA 1S3JA 4HF1A 1FLIA 1EPZA 4YM0A 2ZSHB 2OA4A 3KSCA 5F1RA 3DTKA 4M00A 3WE3A 4ARXA 1IO2A 3KZIC 1STZA 1LFUP 2QSGX 1VPHA 5F0FA 3POIA 4BDYA 3OYWA 5EQUA 2HYXA 3DPTA 4BA6A 1TG7A 3FX3A 4JZRA 4KWKA 3OWTA 3ZOIA 1AVBA 5BQTA 1MH4A 2XB0X 4BE0A 1H8AC 2QQOA 1SFNA 4K8FA 2X48A 2ZX3A 1P9QC 5HDNA 1QDCA 2WN3A 3LSMA 2XIGA 4CDQB 1RUG1 4E6KG 4HXCA 1V0AA 3WD5A 3JRHA 1W8OA 3WHBA 2PMHA 1CAWA 2ZBKA 2HWF2 2EZHA 2EIEA 4CRQA 2WZR3 3JZVA 4N43A 1K5JA 4QAWA 2JDNA 2FZ1A 5C3OA 3V56A 1BBT3 2BGPA 4D7YA 3ZR5A 3MLKA 3ZQLA 2RN7A 3RVHA 2ISZA 3NAPA 2CUJA 4HF2A 4XJ9A 3L9JT 2R7QA 4P9XA 4IV3C 4LK0F 1H4GA 2A73B 1QQP1 4LR4A 2HS5A 1PO11 3IAPA 5EYXA 1O59A 4N53A 4OUSA 2CUEA 1W7PD 1SANA 3M8EA 1LE8B 3MIBA 3OYJA 4XFBA 1L3JA 1X8MA 1S9HA 1HQCA 1YWKA 2BBYA 4BNCA 4Q4Y3 4C2TA 2WZ8A 1R1A3 3IKWA 3LDKA 1HB3A 1N3OA 3HRMA 1ONVA 2XR4A 5FY8A 1OLRA 4OU0A 2CW0F 2JA2A 5GADJ 4FX0A 1MR5A 3FJSA 1W6QA 4ATEA 3CLQA 1JTZX 2ID4A 4PLMA 5EP9A 4QD2A 4YFNF 1NQDA 2KZGA 3NV2A 4HF0A 2XBO1 3LEMA 3GTLJ 4XF9A 2HWB2 2Y64A 4MQVA 4NC8A 4ISQA 4IHVA 5LHIA 4IEUA 2L9VA 4A3FJ 3C7GA 4S0HB 5LZ6A 2KIUA 4PFOA 4GJZA 4AEMA 1PNGA 2YPJA 2YGMA 3K4CA 5L19A 3H8OA 1QXJA 1VQNI 2P17A 2VOTA 3M4OJ 3Q5FA 2DT6A 2IFRA 2M2EA 2STWA 3E1F1 1RXFA 2LBFA 4HNTA 3V42A 5H9RA 5F3IA 4JBAA 5BNPA 2JJ6A 1R081 2O8KA 2HI3A 2ZJPF 5BV6A 4R9DA 1Y43B 1F43A 2E26A 5ERLA 1YUDA 2E1OA 5FLVA 2DA2A 5FY7A 2FMDA 4HVOA 1Y8RB 1G86A 1GHCA 2Y9YA 2QBXA 4Y5Z0 1NK2P 3WNPA 5LA2A 1OJLA 4Q4V3 4GWIA 1Z05A 1D1BA 4Q4V2 1AX0A 5ACA3 5K7ZA 4RB2C 3WQ0A 3GFIA 3THTA 1RUC3 2DDBA 1GVJA 3K4BA 4HYEA 3OS0A 2NYYA 3A21A 1ZTRA 2P7VB 1HC8A 3BU0A 2CL2A 4MXWA 2R1DA 1PJRA 5IT3A 1X4OA 4DBRA 4D5FA 2A1XA 2Z69A 1SLCA 4FP2A 1DPRA 4JQRA 2JG8C 5IPAA 4DO0A 2CY6A 1R093 4G9SB 4ENKA 5JOWA 4BMBA 3KCXA 1MS8A 2EB7A 2RM22 4FISA 3AL0C 2WUHA 3DKXA 3FMQA 3C7FA 4AYBN 1BEV2 2DVGA 4LULA 3A1YA 2VTFA 3H3LA 2J42A 3FFZA 4EZHA 1SBFA 5L3BA 1O3QA 3WQBA 1F4HA 3AL0B 3WLUA 3S1QJ 1F9NA 1HSJA 2ZGMA 4PSWA 3TWIA 1W06A 1S0JA 3FKJA 1BOBA 1DCSA 4YELA 2AUYA 1FOD3 1N3QA 2CU7A 1BJQA 4Q0QA 2W24A 2D7FA 4PJYA 2QM3A 2EZKA 4MGTA 2IUWA 1R091 5DXDA 2KA3A 1YS7A 4N43B 3OB8A 1LJ7A 5M0TA 5E6HA 4IEPA 4C2UA 3CCVI 4YW7A 2Z9OA 1GZ9A 4XICA 2F5EA 5AFEA 5FY0A 4GULA 1ON2A 2A6VA 5J4VA 5EG0B 1W8HA 3RTRA 2KMUA 4XKCA 5CU1A 4PQ9A 4XJ8A 3DBRB 4BHPA 1OT5A 1K78A 5T52A 1ZGWA 5FP7A 5KHKA 2DCKA 3R4UA 3HTSB 3HBZA 5C9AA 2OZ6A 2VM9A 1VBB2 2RAEA 3WOGA 2Q1MA 5C4WB 2UV1A 3DTEA 4PJJA 4CCLA 1NG7A 4ZYAA 1UXZA 2VCBA 4AIDA 3CF6E 2DK8A 2XRNA 3OD4A 1PO23 2VAUA 1PGL2 3D3AA 4EWDA 1UCRA 2DA6A 2VVDA 1HKDA 3B6CA 4RS8A 4UI9L 4CP1A 3L2HA 3L1PA 3CMYA 5A1AA 2B45X 4MFDA 3AKTA 2NM1A 4DYQA 1MQTC 3T0BA 3K4JA 1WBLA 3PUBA 5JVGF 2K3PA 1VAMA 1V00A 4PJ0C 3SKJE 2FDFA 4S04A 4WZFA 1V70A 1ZA7A 5FY5A 4ISRA 3NWKA 4RLQA 4FPGA 4E7SA 1QVTA 1JT6A 3O1RA 5IYYA 4MHUA 1US2A 2CJJA 1KRIA 1UCXA 2WC2A 5IYBJ 4ESJA 1TWAJ 5FBZA 1ZVFA 3I2IA 3PJYA 1XPXA 4KMFA 3MBWA 3DL3A 3O2PE 4RFT0 1JN2P 4WXHA 1J1LA 1GUIA 4MGZE 4AC0A 5FMOS 4HLXA 1DDLA 1UYXA 4EROA 4IESA 3VYTB 3MDPA 1I1SA 3K4KA 1VRH1 1TQPA 3ZXSA 2JK3A 2PMZN 4XQDA 5KHHA 4EQQA 1AR61 1XNAA 4EEFG 1H9GA 3K4MA 4Y20A 3I58A 4TXWA 1SCRA 2WNUC 1SVMA 2GBYA 4D3WA 3LMMA 2XPWA 4JKKA 3GBWA 2VI6A 2XF5A 3M3OA 2X1EA 2HDCA 3FC0A 4HN0A 1POV0 5DMYA 4R52A 3VHOA 3I9V2 4BB3A 2FCTA 2V09A 4UV9A 3CMEI 2WZR1 1BOAA 3T09A 3EUHC 2XPVA 5JWPA 1LVKA 3H5RA 3NMBA 5DDGA 4WVVA 1YE9A 4MTDA 3I97A 4ZH4F 2VZVA 2E19A 1LHWA 1IRFA 4G9YA 1PP8F 3WF3A 5FZGA 4XDOA 3ZFGA 1UMQA 3NRVA 4BXXJ 3BY6A 4LKEA 3ONQA 2JVHA 4KH9A 5C4WC 1XYOA 3ZQCA 4X1EA 2JB8A 4U0WA 1X1CA 3UJOA 2XHNA 3OUHA 2W57A 2BJSA 3ZDSA 1MMSA 5LY1A 1UNBA 1S0EA 3M8LA 1HXS2 2ARCA 5FYMA 2BE5F 2M30A 2Y30A 4YM2A 1YIJI 1FYKA 1XOYA 2EINH 3T2PA 1ZH5A 1ENQA 4AFAA 5C5UA 5AC91 4R9AA 3O1MA 3OEBA 3KP4A 2HZTA 1ETOA 4CHUA 3X29B 3ECHA 3WQ7A 4IKFA 2Y8KA 4M72A 2JDPA 1J58A 3K46A 4HOOA 1AXKA 3KT1A 1R5GA 2D5VA 4D0QA 2FCVA 2RR12 3I54A 2KQRA 1PVC2 2FQ3A 1XC6A 3L09A 4MO7A 4Y17A 2GAUA 2DFIA 4FQZA 2ESNA 4G6TB 5FKOA 1SLLA 3KQ4B 1AYM1 4E4HA 3WP5A 1MPXA 2IXIA 1DDNA 3MFKA 3HXLA 3HSRA 2L7FP 2IGKA 4XOPA 3J81K 1LRHA 3Q3SA 1UIKA 4AVPA 4D7TA 4F52A 4U7BA 4PIZA 1GQGA 2W0XA 2VUDA 2DOFA 4QT6A 2R042 1T0FC 1JOJA 2LKSA 2HDWA 5JIAA 2XPJA 4QWNA 5K8SA 5KHGA 2PN6A 3TN92 2QENA 2RS52 2Q4SA 4XFFA 3KFWX 2J1VA 1WW6A 1EAH3 1W5TA 2LOOA 1ACIA 2JDUA 1HDKA 4A0YA 5B2GB 1GMMA 3WHTA 3WHUA 3DYOA 2DAOA 2XASA 4XFGA 2DT7B 2DVAA 1V6LA 4RS5C 5D1IA 4HV5A 2P4EA 5CQEA 3INAA 4GWNA 4M0NA 3WDXA 4XBLA 3U1XA 2Q8KA 2WAQA 4QPGA 4YGBA 2EFNA 2A5WA 1OOPC 1RITA 4LBOA 4DXSA 4B1MA 1DPUA 5A33B 3ES4A 1Y1WJ 2VZPA 1Z1DA 4Y1YA 2GC3A 2EICA 2IA0A 3DYPA 3LCPA 3SH3A 2GNMA 1FJLA 3LKJA 1MS1A 1OVPA 1ODMA 1BI0A 2Z2SB 4F91B 2WY7Q 2O1QA 3KZYA 5HNFA 5HLTA 2P8TA 2QDNA 3EQLF 1B35A 4YSFA 2CQKA 3I64A 1BK1A 3OJBA 3TN93 4LNVA 1SMTA 1D8KA 1FEXA 5M3MJ 2LREA 1O6UA 3MN2A 4OHXA 4FQGA 2R7ZJ 4AFCA 4IQJA 5I0RA 1WCUA 3O1OA 4Y4RA 2CV0A 2X29A 5LHHA 3L00A 5FMCA 2WO3A 1W05A 2D6KA 4MIMA 3VBSB 5AVAA 1RUJ1 5FYVA 3QRFF 2ZHLA 3LAPA 1YQCA 1U5ZA 1JKOC 4BQAA 5IVYA 4D94A 5F6FA 3TBDA 2XSDC 1CZTA 5ICCA 1S0BA 2P5VA 3IAS2 5ANNA 3KPHA 2JDMA 4NDLA 5ERIA 4HQMA 4AI1A 3H3UA 2WNVB 3DF0A 2HOTA 1HB1A 4CU9A 2ZFUA 4NIIA 1V6MA 4UWDA 3TW6A 2X53S 2P37A 1Q1VA 2IFWA 1IW7F 4FXKB 4QKDA 2ZACA 2VPVA 3SYTA 4UBHA 2LP0A 4QSHA 3UJQA 1YJKA 1T39A 2YGLA 2B0LA 3VBHA 1PIV3 1YJNI 1PVC1 1C0WA 3KV5A 4JHZA 1SDDB 2FXAA 2H94A 1ZR2A 5K4LA 2YPDA 3ZFFA 3BR2A 2BY0A 3F8BA 3S2DJ 4QX7A 3ULQB 2L9SA 4UF0A 2P6TA 4KJZA 3KHCA 2BWCA 3HTUA 2RMU2 4E7ZA 2CNAA 1V4RA 4AL9A 1N25A 4P5HA 2BY3A 1GU3A 5L3FA 4QPYA 3M2MA 1EP0A 1UY1A 2VOOA 2LSOA 3IN9A 4Z2WA 1WZ2A 2P7CB 2XG3A 4II3A 3VL9A 4IL6C 3MPPG 3BKZA 1IRZA 2EAKA 2RMU1 5FYTA 4WX9A 1KFXL 3RKXA 1Q8SA 2WNVC 3WTVC 1ZK8A 2OTJI 3FUQA 1ZG3A 1OMIA 5I8SA 4QB6A 3S32A 3G4SI 1TME1 3HC7A 4LOSA 4LG3A 4OWRB 5IW0A 1KQRA 3GALA 2GMPA 1CAVB 3UKNA 4E8DA 2W08A 1OLQA 4Y22B 4QXCA 3V0BB 2BERA 3PNAA 2VMEA 4RAYA 3AL5A 1XD7A 2OIIA 2BNOA 1OA4A 2E5NA 5CFCC 3HG9A 4Q4ZF 4BQ5A 1RB8G 3K77A 2QYOA 3D5RC 4G7HF 4B43A 4N53B 2Z5UA 2KD7A 1W2AX 3OIOA 4L0YB 2EA4A 2DA3A 1MBKA 4RM2A 4XSXF 3C3WA 5E89A 3VDAA 4CU8A 1GP4A 3T4VA 3ZKYA 3R61A 4XVHA 4ZHNA 1LB2A 4BLIA 3R05A 3KF5A 2O0YA 4EGZA 2JWTA 4HX4A 5JOXA 1ZELA 4DOUA 4N0BA 1D0ZA 2AACA 1A34A 5BNGA 3Q8AA 3S0MA 2K3FA 3VZJA 5FOJB 3FBNB 1RHI1 5F32A 4L11A 5FQ0A 5FYIA 1EH6A 1JOBA 1ST8A 3FZVA 2EAAA 3JBG3 2FX0A 1U5TA 2BVLA 3TO9A 2P81A 3T30A 1ZGAA 2P3KA 3HBKA 4AVAA 5BNOA 2R043 1U5YA 3OY8B 4QXHA 3E6BA 2O7OA 4FPOB 3AKSA 5I93A 4XQWA 1W39A 4JGYA 4K21A 3R0AA 1RUJ2 4GB33 2FBEA 4YNIA 5FRNA 3VUOA 5L36A 1Q43A 1A6QA 2L9NA 4B44A 3BWGA 2VY0A 4PFPA 3SHFA 3P5BA 2PEXA 1BK0A 2PLV3 2R93J 1X1DA 3HN1A 2C9AA 4Y1VA 5D8AC 2UY8A 2JG9C 1ZLKA 5FXZA 3S57A 2PG4A 3HNMA 2DPUA 4DJAA 4W6XA 1LNWA 2IVMA 3OF1A 1W8FA 1VQOI 4Q4W1 4BJ6C 1OFSA 4QX3A 1GXQA 4MOAA 2JPCA 4XILA 1OBNA 1IN8A 1REDA 4DB5A 2K46A 5T3NA 3I4PA 4ONUA 2GALA 5DPNA 3VDDA 2FA5A 2EIJH 1OKOA 3U14A 5JXGA 2E2HJ 4S2HA 1PO13 1Z67A 1W0NA 5CFDC 5FZ7A 4OMZA 4AW7A 3KM5A 2IA1A 3TN91 4C0BA 1R23A 3S15J 3GLXA 2VZOA 1YFUA 2PHLA 5IVFA 3APBA 1OCTC 2RS11 3AMMA 2TCTA 1WLCA 3WXPA 1O4XA 4RYDA 4X8NA 1DGWA 2P0WA 5GLUA 4ETSA 2ZGOA 4IEYA 2VJ5A 1NOVA 4ARYA 4JX6A 4Z2YA 3F21A 1XDSA 1XMAA 3BTYA 2CGOA 4WCGA 5K0UB 4ANJA 2ZEWA 2C5DA 4EE2A 4ZYGA 1N1YA 2ZPXA 5I8YA 3AYEA 4B1RA 5DUXA 1UZVA 2DMUA 3S17J 2F4IA 4AUXA 4XTPA 2MBFA 5CKNA 4RLFA 1NY72 2HBUA 1R1UA 2VU9A 3ALQA 2CGPA 1UY3A 4DUXA 2E60A 5DCMB 3GTKJ 3IBMA 3GFLA 4BJTA 1XQNA 1U5TB 2RG4A 3MICA 2QQNA 1A6IA 1XNCA 2V4VA 5KXBA 4Y5TA 4ZTJA 2HEOA 2ARBA 5F27A 1LEMA 1ASJ3 3HQUA 5K7PA 2WBMA 2VKVA 2R30A 1YRNB 1HRI1 3K1PA 4U0VA 5LGTA 2VXDA 5HS8A 2FDGA 1MMDA 4XUOA 4P9JA 4PI2A 3C7JA 3MKZA 1MGTA 1Z3YA 3IZOA 2J1UA 2DDUA 3PM1A 3UETA 1CD3G 2Y60A 1AYN3 3ZYPA 3P9KA 4AHZA 2W68A 2MPFA 1UZCA 1PMIA 2VZSA 5E16A 2BP6A 2OQGA 2R062 4W6YA 3LNQA 1UKGA 4CCCA 1JZ8A 3HUGB 1CONA 2MNGA 3NARA 4Q4V1 3H0DA 3VGIA 5JHFA 5CKMA 2QQWA 5DAXA 1ZREA 2MC4A 2M7BA 3L7WA 1VMFA 5D8AB 1RUF2 4KBZA 4CDQA 4AAPA 2CMPA 4QX2A 1ODDA 2PLV2 5D4SA 5H20A 5EJZB 2PBIA 4BK4A 1VB2A 3J7AO 1WD3A 2P3IA 3RGBA 3CLOA 1FOYA 2GMMA 2FE3A 5ICEA 3TDZC 5JIUA 3BPVA 4BY7J 4QKNA 2W1OA 1ZR4A 4AIHA 2JKBA 2QKLB 2Y48A 1BEV3 2W95A 4G12A 2LFBA 2ZGTA 1QJFA 2DLLA 3P7NA 2K5CA 2FNAA 2PQ8A 3RZZA 3FUOA 5FBJA 1JUHA 1IS5A 3AG2H 4QQPA 4EMSA 3WNXA 4UFHA 5JZGB 5F3CA 4DW6A 1FPQA 5A7OA 3KZZA 3LOBA 4HG6B 3VWBA 2ZJRF 2CQXA 2XGDA 2YHJA 1EUTA 2JSCA 3KYLA 3F6VA 3I2HA 1AXZA 1FIPA 2LR8A 3ZPOA 1MS4A 2WNEA 1IJWC 1DGRM 1XE0A 2QKDA 1G2HA 4FSJA 2DVDA 2VW1A 1YNAA 1UKRA 1VAVA 3ITQA 1CAVA 4FOWA 5FMBA 3GYDA 4N53C 4Y4YA 4YW2A 1I3AA 4UVCA 2WR9A 3VBOC 1HF0A 4GD4A 3VEPA 1JUMA 4FPLA 5KNLA 2VJIA 4Z1VA 4NN0A 3DV8A 4LLLA 1WD4A 2FJ1A 4CDXC 3LWCA 3UKVA 5B1AH 2YR2A 1EA3A 5HI0A 1TNTA 4ZZLA 5JMCA 2LM3A 4ZC3A 4F3QA 3J81Z 2BZTA 1R71A 2PHXA 2I10A 1K4SA 3MPBA 3U37A 5FAXA 2YMZA 4FTSA 2WFF2 1W6NB 1S7AA 1N75A 4UFLA 3I7DA 2X6OA 3RZMA 3HWJA 1UWWA 3OGRA 4FPEA 4E2GA 1NY71 4A7ZA 1UOFA 3A7QA 5CA6A 1RVF1 1Z6TA 2VBPA 1VRH3 3FHZA 1POV3 1VMJA 3B94A 2ZMEC 5M5WJ 1FP1D 1XU1A 5E1XA 3M07A 2KIMA 1OKRA 4GB31 4XIKA 2VG9A 4QKFA 3I2DA 4BQWA 4MQ9F 5TSWA 5FZLA 2E1CA 2G9WA 4XFIA 2G19A 3VBOB 5T5JA 1E3PA 3JRDA 3GZ5A 2GWRA 1WGPA 5DV5A 4FPHA 3A23A 4RGRA 3L2WA 4IV1C 3CJNA 1FPN3 2HR3A 3O8HA 4FOQA 1JHFA 4IQ4A 1QDOA 1J5YA 2LDUA 2GH2A 2OJED 4ENMA 4KU7A 3CZUA 3KT4A 2CQ7A 2YC0A 1I27A 5DQ0A 4LLNA 3K4AA 3T08A 1LEDA 2ZTNA 1B59A 2W47A 2O14A 2VZTA 5LFAA 4CCOA 3PVOA 4GH4C 2IXCA 3WP6A 1YI9A 2VQCA 4A4AA 1YLLA 2YY1A 2V1XA 2IWGB 5J3UA 1XRUA 5C3RA 2OUHA 1T08B 4BISA 5D8AA 1XGMA 1TMF3 5DG1A 4LBMA 5F5IA 3OOUA 1FX7A 4J19A 1DGWY 2LY2A 1C8NA 1W9SA 2VE8A 3KLSA 1LVAA 2FU4A 4RGGA 4MVTA 1WMEA 1YC61 1R5HA 4FX4A 1B72B 1ZZ8A 3AYCA 1DQ1A 2EPFA 4XCAA 1JTYA 1A6CA 2CSOA 2A71A 1W2OA 1F15A 2HJIA 2H0VA 3I5UA 2D6MA 3BG6A 3ELKA 3LIHA 4NRPA 4XRFA 1FOKA 2MHFA 1IG0A 3FMGA 2HEWF 3OR1C 1FMD1 4BEHA 2NMNA 1SLIA 1Z0XA 3ZQQA 2A3YA 2O6GE 3EYIA 1NE4A 5E20A 1W7PB 1IUYA 1T98A 1YIOA 1W6OB 1UO9A 3IP4B 4OUMA 3KB5A 4YM1A 4XHXA 2WNOA 2CWEA 1AYM2 4BL0B 3GEZA 1AYN2 1QJEA 1LOEA 4XQ4A 4DEVA 1RUC2 2HOSA 5T5PA 4AFMA 5ACA1 3GCWA 4LGWA 2K7LA 5LLQA 4B48A 2XVCA 5FJ8J 3U10A 1GWMA 2C1FA 4B7KA 1TNSA 4M74A 1OOPB 4NBQA 3N97A 1WJ5A 5GZDA 3VKOA 1HIXA 1SEFA 4CCNA 3UGHA 1T2XA 2DUPA 4U2AA 4XBFA 1PGW1 2COMA 2CQQA 2KRHA 3GTGJ 1IC8A 2B9VA 3PUIA 1DQ0A 4ZS3A 5FZ4A 3DXTA 4JV4A 5L7OC 4AQ2A 3ME2A 4DIQA 5EEAA 3S30A 1RR7A 1QGLA 3DLLF 5BY5A 4MXVA 3IM0A 1PGW2 3AKZA 1AR83 1GWKA 1K83J 2XJUA 4XOGA 2WJSA 1V55H 2P5BA 1WWYA 4FAGA 3FE5A 1CPMA 4M3CB 4L9JA 1PO22 3WR0A 5C33A 2UWBA 2GSYA 2HQNA 4FXGB 2WA3A 1NT0A 1L7RA 3AK0A 5M5XJ 5K9YA 2FEZA 1L3LA 3F8FA 5A3MA 4OMDA 1UG2A 3E3VA 2W46A 3OYCA 4DY3A 4MUVA 4YVSB 1TQ5A 5LK5A 1XGNA 1PO12 2ID3A 3BT9A 4BY1J 2WAQN 1LCLA 1HQNA 3OEAA 4GH4B 3C7OA 4YFKF 4NWVA 2AQEA 2DTRA 2JT1A 3CC4I 1RIRA 3SH5A 1IDZA 3ZXJA 2XLGA 2JG8A 2XJTA 1UQXA 5D5UB 3OUIA 4OVEA 5FKNA 3RG0A 1FT9A 4I76A 2GNTA 1MH3A 4Q5SF 4PDWA 1K79A 3KHBA 5C44J 4DYRA 1DGRA 2JDKA 4AOCA 2GQQA 2D5HA 3NJVA 1TT0A 1LHNA 1BHGA 2M5WA 3HD8B 2AREA 2X5IA 2WIIB 4F8AA 1X2MA 1E5HA 2DU9A 2ERFA 1BQPA 3W5MA 1UELB 2BWAA 3B9CA 4G6DA 3SZGA 4QXKA 2QVSB 5GAGJ 3IPVB 5D8LB 4KGGA 1PMJX 3J8F1 4A3ZA 2CDOA 1MMGA 2GC1A 1UX7A 5HNHA 2O61A 1JXNA 4IV3A 3LQRA 3QPSA 2I5UA 1IKPA 4YW6A 2SBAA 2VBZA 1YITI 5HV0A 1BEV1 1HW1A 2A6ZA 5D5WB 4WM8A 1BW5A 2VTXJ 4W50A 1ETWA 3O0WA 2QQVA 2ZS6B 4X6QB 4BQ4A 1J83A 1APNA 4E8CA 3M1EA 2IXHA 2B42B 2L9LA 4K9SA 5LGNA 4MHRA 2QUOA 3HSFA 2LW8A 3ZXEA 1BBT1 2VT2A 4A7KA 3RZJA 2Q5TA 2Y38A 3LF7A 3HEIA 4JHTA 3VD4A 4J01A 4NOTA 3OS1A 2JDHA 1AR62 4PBPA 2QUFA 4G94A 2VJ4A 1BKZA 1M1EB 2A6EF 3WW2A 2KRFA 1AR63 4YZ4A 3QAHA 1OH3A 3TMOA 1RXGA 4LKDA 5D6FA 6PAXA 2NVXJ 1XMXA 5F39A 3T8RA 3BR6A 2J7MA 3K48A 1WJDA 3VLBB 3BR3A 3BALA 3DP7A 2WB1A 1SAXA 3E5XA 3H0OA 1K5MB 1X9TA 2LKXA 3LPFA 2BNMA 2E2IJ 2EK5A 4LG0B 2WWUA 4LBKA 1SLTA 3OYFA 5JOZA 3KV6A 5LCWL 4R4ZA 4MGQA 3VL8A 4YZ5A 1T6BX 2XGXA 4URAA 4XFAA 4XDPA 5JLXA 1VBE1 4M6YA 5J7MA 3ZFFC 2CYFA 4XKBA 1G59A 3H92A 5L3DA 2PMWB 4YGEA 3GZTB 5CKQA 4LBLA 4Y20B 2PTMA 3P9IA 5I0UA 4QQHA 4XAAA 2XBO2 3GF2A 1DYPA 2IJLA 3EPZA 2RMU3 1RGSA 3AAFA 5EDNA 1MS5A 2YU1A 1IQAA 3JAMZ 4LO4B 3OCPA 1LGNA 3GBFA 1W2UA 1ULGA 1SD4A 4QPGB 1S0GA 2Z16A 1UY2A 1C1LA 2CRGA 1UIJA 4QX0A 3B01A 5L9VA 2CSGA 3PNYA 5EYRA 5FYBA 4CXWA 1JZ2A 3VZMA 2ESHA 1RUF1 4HKLA 4AVCA 4XLPF 4R79A 3Q0WA 2ZMLA 1LNSA 5CVIA 3V8JA 4MZUA 4ZYEA 2IVIB 2COBA 1G9CA 4EN6B 4NJ4A 5K7FA 5L7OA 5A1LA 3JSOA 2OXBA 3POEA 3F6OA 4M3GA 4Q4W3 3Q8CA 3CMGA 1E0EA 3BTAA 1IHMA 2HQRA 2VBYA 3VKMA 4L9VA 1XNKA 1UXXX 2MFZA 4I0BA 3H1CA 2V9VA 2YC4A 1ZRDA 5E1RA 1UN1A 3H7YA 3VBSC 3I53A 2L5QA 4XLAA 1NYWA 2O8OA 1MZFA 3MHZA 2BBVA 2JD9A 1JKRC 5LEJA 2VB6A 1TQMA 1YQ2A 3PL8A 3GZNB 3J7HA 2KRCA 5GJ6A 1UFMA 3GTPJ 3SC7X 4K20A 3POGA 3ON7A 1V6IA 3W6KB 3VBFA 2WV0A 3EDPA 4XXAA 1BN5A 4CTEA 2DCZA 5FDBA 1MEC1 4B3XA 2VMHA 2CUFA 4B3AA 2JG8B 2LMDA 2QQBA 4X0GA 2Q1ZB 1H0BA 5DAQA 3HM5A 1Z0HA 1KZHA 4GALA 4FFGA 1E57A 1XNTA 3T8TA 4Z6YA 1O8PA 3GNEA 4BCUA 5CFDB 3CJTB 1GOGA 2X1DA 5F1JA 4LJZF 2BGOA 5LRRA 4QB1A 2RS31 2VC9A 3NW4A 3SMHA 3LFUA 3ECOA 2DYRH 3C2BA 2A6WA 3TNQA 1BR4A 2A3SA 2KFDA 3V0AA 3ILRA 3LSPA 1BW6A 2Q8EA 2LKPA 1MZ6A 2FMLA 4DY5A 3VBHC 1QA6A 4AAXA 1EAH2 2BW3B 1TZOA 3NAPB 3O12A 1XG1A 4NC6A 3LFMA 4MO3M 5FZ1A 1H9PA 4XQFA 1RKTA 1UYPA 3V8LA 3GJBA 1Y8QB 1WJFA 5GKAC 2BXZA 3WF1A 2BV6A 3GLLA 3QU3A 2QLZA 3A0NA 1REFA 5EPAA 1AU7A 1PM4A 4NVPA 1F9KA 3HKZA 2HKOA 3IH3A 1H8VA 3G6EI 2LALA 2ZGUA 2LRPA 4OINF 4Q0UA 5FZ0A 3VZOA 1U8RA 2R7EB 2JICA 2JKXA 3U0ZA 2ZGQA 3K2ZA 3PJQA 2PHWA 1S0DA 3MEPA 3OL3A 2NNNA 2QZ3A 3LSGA 2VODA 1KDMA 3BN6A 2ZHKA 2Q30A 2DCTA 5TRDA 4Q4X3 5E3OA 2EVXA 2JECA 3B93A 4K2EA 2D1VA 1REPC 1VF9A 3DEMA 2V1NA 3RCOA 2ZX4A 4IE7A 2BQPA 2VMGA 3HZJA 3FXKA 4I01A 2AS5F 3VYUB 3CCMI 1OHFA 1HV1A 4XKVA 3ZIXA 4IE6A 3RKQA 5GZEA 3MAJA 3OYIA 5FP3A 2J1RA 2D6OX 2WT2A 4Z2AA 2OUMA 2A3WA 1ASJ2 1FTZA 1C8M3 1VLNA 2VBDA 2FQPA 5KAIC 2AXTC 1QKQA 3ZMZA 2GMEA 4GGGA 3M3IA 4E4DX 4H2AA 1DHKB 4UUVA 1BJZA 2I8DA 4IE4A 3J7NA 2R7XA 1LOBA 2VBXA 3M70A 1OPCA 2X4HA 4CEYB 2XV4S 3I59A 5A2QK 1AHDP 3V64A 4META 2W84A 1OQDA 1LULA 3I0TA 3IH2A 1WWXA 4M71A 3HHGA 1V9U3 1O7FA 4N7UA 3W9AA 3OYEA 4XKWA 3WDUA 2YB7A 5AIQA 5EGOB 3G73A 4BUPA 1JW6A 3ETPA 4CDQC 1D8JA 2O9LA 4DMIA 4IHTA 2G0EA 1FSHA 4UBGA 2ZFWA 4XRSG 2XKOA 3L9FA 2UWCA 1N77A 1WLDA 4ATFA 1QJU3 4PQQA 2JENA 4C3JJ 3NQOA 4L92A 2LK2A 5F64A 3RQ0A 4Y3OA 1JZ3A 1W8ZA 1Z7S2 5KXDA 3DEUA 4XLHA 4OUEA 4YIIA 3QP6A 2WLPA 1G4DA 4G7OF 1NK3P 1OCRH 3IUOA 5CYYA 4LK7A 4CICA 3IAM2 3ZFFB 2VXZA 1ZARA 4QQ2A 3EUKL 4IL7A 4W4ZA 1HW5A 2K9NA 1I1GA 3LZZA 1JJ6C 2R041 1ZZ7A 1V6NA 2ZB9A 3KGZA 2EILH 1I3QJ 3G1LA 1KQ9A 4COWA 5FO5A 1B8IA 3ZRGA 2PJPA 1TW3A 1W2TA 1TT5B 4X6AJ 1RUE3 3DPRC 5KHJA 5FROA 1SBDA 2NN8A 2ZO4A 2WFPA 3W58A 3PMSA 1VBC1 4QX5A 2RS53 4NROA 4M4RA 2RC4A 2HYFA 4AM3A 3WTSC 3UNPA 1FMD2 2VKHA 3ZMUA 5IT9K 1YI2I 1G3WA 4M3FA 3OBZA 3AP9A 4WBBA 2PA7A 2FZ2A 2DODA 5FLHA 5JSRA 2GA1A 4RHV2 5T55A 4SBVA 3RPUA 3WV6A 2FNPA 1XYPA 1IN5A 2QQ9A 4ZONA 5A80A 5F04A 1QVUA 5KVRA 4Y22A 5EZHA 2LUWA 2EV0A 1YIFA 4XABA 2LY9A 3O1TA 1LTEA 1UAIA 5CEHA 2YC2A 2WL1A 3WT3A 4AU7A 5J1RA 3AM2A 3ZCOA 2R7VA 2G4IA 5FFOC 5EG0A 4HSLA 3NAPC 1JT0A 3POWA 1SEUA 4LK6A 2YU9J 3CMAI 1MS9A 3M3YJ 2WV1A 1Z91A 2DK5A 5JI9A 5IK5A 1FV3A 3RI4A 1IUFA 2UZKA 2Z4FA 4LKFA 1VNDA 3E6MA 2Y6LA 1HDPA 4J00A 1H0MA 4I6ZA 1VTNC 1E5SA 3ZX7A 4YGCA 2EFPA 1G8XA 1D5VA 1EUUA 5J1XA 1WW7A 4HN1A 3HOUJ 2D6NA 2HWC3 2XC7A 5H6QA 2YG0A 2VNOA 3B73A 1US3A 5BPXA 1B1BA 3BCWA 3T3YA 1U5TC 1SPPB 1RHI3 2Y6JA 5KC5A 3T1BA 4BWOA 2VT3A 2Y26A 4DZJA 1IPKA 4IOCF 2LTPA 5JR3A 3BROA 2Q0AA 3CP2A 2Y6FA 3DPRA 1R22A 2QA4I 3C3VA 2B39A 1YX3A 2Y0IA 4D6SA 4RA2A 4A7YA 2ZHNA 3RQIA 1SQ4A 3IIIA 4R4XA 1O4ZA 4KN7X 1OQYA 5LEKA 4QB2A 4FBFA 4JDMA 5IK4A 2WAAA 4IGOA 4DYCA 1HRV1 3HOXJ 3H36A 4IHWA 4YVWB 3FISA 3PQJA 5FZ8A 1E3HA 1O57A 3KVAA 1CAXA 4QPIB 3Q0UA 3FWEA 3NNLA 1QJX2 5FZOA 4A45A 3I8TA 1JHJA 1DQUA 3WNOA 1LE8A 5BNQA 4OQ8A 5A32A 4WM8C 4WZCA 1V6OA 4BM8A 3ZSJA 4BE2A 3CUQC 2M4KA 2W9XA 5JPNB 4RN5A 4HONA 2ORXA 5KBFA 1NE6A 1W8NA 1QRYA 1Z3XA 2R49A 1L7LA 3CMMA 1LECA 3BP8A 2VZ3A 1BLZA 4UV8A 1SLBA 2R5YA 1W0UA 1VQ4I 2DN0A 3BG9A 4A3BJ 4CYCA 4J1XA 1OYIA 2Y75A 2EZIA 3CJRB 1FTTA 4A0ZA 1HJFA 4UAPA 2EQRA 4LE4A 2F2EA 4P96A 2DW4A 1G9FA 3OYKA 2XLAA 3JW4A 3O6BB 2DFCA 4EN8B 2RE9A 1K7AA 4TYSA 1QNWA 2D97A 1GT0C 2IZWA 1U3EM 2YUEA 3F95A 1R4MB 5A3PA 2X9DA 4OZXA 3N35A 3QWLA 5LGUA 3RMYA 4NPRA 5E79C 3F22A 1LOCA 3AX4A 1FOD2 3MD2A 4KA4A 1QJZA 2DQLA 2F5DA 2XAQA 3MZYA 2WAFA 3OS2A 3B5LB 5J36A 2W1UA 5EF6A 4IXAA 1Z21A 3WTWC 4NO4A 3ABUA 4WXCA 2OF7A 1RESA 4YVSA 4NIGA 2R1BA 4TN7A 3ST7A 4EJRA 2OPTA 1M4WA 3AMPA 2XL9A 2VGDA 2HWB3 3H1WA 3H35A 4ZPIA 4URTA 2QEXI 3V4GA 5DS9A 1XB9A 4XIOA 4J25A 1B35B 1M06G 3E5QA 3G3ZA 1RR8C 3CP8A 4OQ9A 1D7PM 3FIWA 5J98B 5A7SA 2PJRA 3T2OA 1SG3A 5K1YA 2WNUA 3BDDA 3PIPF 1TE1B 2L7KA 5C4XJ 2KDOA 2WSVA 5LA0A 2EIGA 1JU4A 5FZCA 4XHBA 4IEWA 5BNPB 1QMJA 2BUKA 3CESA