1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
3T5XA 5FLIA 3EJKA 2XL7A 3ZQ7A 1GQHA 1YUDA 1HBXG 3V7CA 1GQGA 1REPC 4PJYA 3TO7A 4GYIA 4EJUA 4GYGA 4UVAA 3ULQB 3KP6A 4NB5A 3JSOA 2BV6A 1DPUA 1TW3A 1ZVFA 4HW0A 2VXZA 2BEOA 3I71A 3ROUA 1FSEA 5AIQA 2G9WA 4EJWA 2O3FA 1J3QA 4LTAA 4IEUA 4UUVA 1XSDA 1B59A 4A6DA 1I1GA 3FMRA 1FP2A 2HR3A 4KWLA 3SZPA 3DPLC 3IKVA 1S7AA 3LAGA 5C6CA 3PFIA 1J5YA 4CO8A 2QUFA 3U11A 4R8HA 1FBSA 3H1WA 2LNBA 3C7JA 3BPVA 3KGZA 3H50A 2A61A 3ECHA 4HDVA 4RGRA 1IPJA 1O3QA 4IRGA 4P9UA 1UD1A 3C3VA 3RNSA 4AIHA 1YTYA 4DINB 2E1CA 2EV0A 1YWKA 4HZFA 3L9FA 5ILVA 2ZFWA 5J8FA 4TV7A 4ZYGA 4WXHA 2VONA 1TBXA 2ZBKA 1ZREA 2K02A 1R1UA 5CJ9A 4Y15A 3G73A 2GA1A 4A2UA 1OYYA 2MH9A 1UFMA 2XAFA 1EH8A 3TO6A 1FPQA 3HHHA 1RC6A 4HV5A 4L5IA 5DCMB 5ILSA 1FLIA 1XD7A 5JR7B 2C6YA 1H1IA 2PI0A 2DQRA 1ZN2A 1YFYA 4HF0A 4LGWA 1FYLA 5ERIA 1USSA 4RD7A 4M9ZA 4ESFA 2G7HA 5CVRA 1P4AA 1ZGAA 2B5HA 4UNOA 3RKYA 3I58A 2HTJA 4I3PA 1OKRA 2LSOA 2A6HF 1TNSA 4FAHA 3V7RA 4Y13A 3GFMA 5A2QZ 3QRFF 4YIFA 1UB9A 3GFLA 1XE8A 4MGIE 4NVPA 4ETSA 2QCSB 5ICFA 1WRJA 3T0YA 3BJOA 1VJ2A 5AVPA 4IEWA 4HYEA 5FDBA 4KL1A 5DCMA 3IRQA 1FBUA 1FY7A 2YU3A 3TQNA 4X6QB 4P55A 1D3YA 3Q5FA 1LEAA 1Q5OA 4L9JA 3FF5A 2M8EA 1TQPA 4KICA 4YRDA 4EMSA 3COAC 2DW4A 1IPKA 3P9IA 5BS6A 2OA4A 3I54A 2HZTA 2WFPA 2R7FA 5HLGA 1OFNA 4ONUA 4QM9A 3FJSA 4E2QA 4RB2C 1CAUB 1J0RA 5D5XB 2UYBA 3BJ6A 4R52A 2GIVA 2VPVA 4ZYHA 2E7WA 5FPXA 4IEXA 4U0YA 1EP0A 3FZ3A 2QBYB 1J58A 1LQ1A 2AXLA 2XRNA 4EJTA 1Q1HA 2R7DA 4AQ2A 3NSTA 3BP8A 2PAMA 4H0EA 4PIXA 2WC2A 2Z9OA 3MFKA 1DGRA 3JAMZ 3VODA 4Q4ZF 4HQEA 4Q0UA 1TQIA 4I01A 4LEJA 3DFGA 1LEBA 4Q29A 2K4JA 5L3EA 3IL2A 1X8MA 2YX4A 4G94A 5K1YA 3ZMUA 3QU3A 4PGGA 2EVXA 5E8GA 3WTZA 1H1MA 3FX3A 2VE9A 2LF8A 2FE3A 1WKMA 4IRHA 4PGHA 1AWCA 4FBFA 1FNNA 1XSXA 2G7UA 3QACA 4WX9A 4U7BA 2EA2A 3FE5A 3FXUA 2QBYA 2QVOA 4UXNA 3SXYA 2B8MA 3ABUA 3E5UA 1XRUA 4KMFA 4G7OF 2DO7A 3KLOA 4IHSA 1DP7P 4G7HF 4HA8A 2CO5A 1EH7A 4EROA 1XB4A 4LLOA 4HVRA 4OMZA 1O4TA 2LDUA 5LHGA 4YNIA 1KA8A 2XKOA 4Z07A 1RIOH 1ZZBA 1L3LA 2F4PA 4HAMA 2D1VA 2W84A 3B73A 4HBNA 4IEVA 2K7LA 4UHTA 3H3ZA 5ICCA 4LFUA 3TO9A 4DNCA 2PG4A 3BWGA 2RC4A 4KUMA 2IRFG 1IXSB 2O61A 1W7PB 2UXXA 2KJCA 3KP7A 3TGNA 3REOA 2IC1A 2RNJA 1SQ4A 1F4KA 5LHIA 2OA2A 3IWZA 2DI3A 5CVIA 3CL1A 2XVCA 4KWJA 1OPCA 4GCVA 3H8UA 5AIPA 4XBFA 1MD0A 5KHGA 1BC7C 3UKNA 4WXDA 1O3RA 2QDRA 3KCCA 5H6RA 3N97A 2M87A 1K7AA 3CUQB 4RGUA 4R1HA 3ST7A 2ESNA 2VC1A 4GO1A 1WSUA 3VB2A 1P92A 2HYFA 1STZA 3UKTA 4IEYA 5HDGA 4Q5SF 3DEUA 2XASA 2HKXA 3CEWA 3HRTA 4XF1A 1W7PA 1FBQA 4XF9A 2VECA 1I1SA 2WV0A 4ZZDA 1SFEA 4Q0SA 4Q47A 4UBGA 1EV7A 1KGSA 1QO0D 3MPBA 4META 5BV6A 5L3CA 2Z69A 2HWVA 2EA4A 2XAGA 5D8KB 2P7CB 2Y75A 1SMTA 4I09A 2ZKLA 1JHFA 2L01A 2QQBA 1RL3A 4FHTA 3BB6A 1YW7A 3MCZA 4XFAA 2QM3A 3CUQA 1X82A 5K5RA 1LRHA 5BXXA 1Q3EA 2CYYA 2VBXA 2ZNZA 4K2EA 2MD5A 1PP7U 4BNCA 1XDSA 4L0ZB 2NNYA 1S29A 4EQQA 2HQRA 2CWEA 4G8XA 2IXCA 2A6EF 5FLHA 3L7WA 1HSTA 4L9VA 4LG0B 1IZ1A 3IC7A 1YFXA 3IBMA 4EWEA 2PHDA 3TOBA 3BPXA 5I93A 3RDIA 4QM8A 2RN7A 2BBYA 4ON0A 5FD6A 3VEPA 2EAAA 1XDUA 4MQ9F 2MNGA 2W85A 4ESBA 1K6OA 4HSLA 3H7JA 3WTVC 4XFFA 4FX4A 3L2CA 1E17A 2MBFA 3GF2A 4YSFA 1Z05A 4KFCA 1SFNA 2HOEA 5HDNA 4Q0VA 2IXJA 2L02A 3QU6A 3GUDA 3ES4A 4B29A 3KP3A 2CQKA 3LA7A 1D8KA 3C18A 2COMA 5EFUA 4YARA 3F21A 1EH6A 1KQ0A 3M3IA 2XROA 2JT1A 1BI1A 4EJOA 4OU0A 4LG0A 2K9ZA 1YG2A 4N9HA 5L3BA 4ENKA 4YIIA 3CJXA 4HVQA 1QPMA 2HQNA 1YLLA 3IIAA 5IT9K 2YPRA 5DD4A 2CV6A 1FSHA 4EV0A 3W6KB 2J5PA 1SMYF 3U10A 1B4AA 1TQ5A 5D5VB 4ENJA 2FQ3A 3HOTA 3TDZC 2Q1ZB 3TKYA 3QAHA 4L11A 4HX4A 1CF7B 1O7LA 4RGXA 5FPZA 3U0ZA 3PVBB 3USSA 3SFZA 2NYXA 2ISYA 4XF0A 2W57A 5KHHA 5DCFA 2VODA 3GYHX 3LAPA 1HXDA 2XLGA 4IESA 5HI0A 2P6TA 3E6CC 2YX7A 1R22A 4WWCA 2Y48A 5E8IA 3ZMVA 2HDCA 4O6JA 1HKQA 2BE5F 2CW0F 4KIBA 3LWCA 4HLXA 5TRDA 3WTWC 4KT5C 3NEUA 1QWRA 1B9MA 1RUOA 2BNMA 2Z2SB 1WGPA 3WE2A 3WG9A 1L3JA 4ENNA 4PZJA 1CF7A 3IRRA 5LGUA 3RKWA 1HKTA 1SD7A 4OIOF 1J75A 5J6XA 1ODDA 4LK1F 3EQLF 3RYRA 2DT5A 4I02A 4RB3C 2ZMEB 2OD5A 3EO6A 4ZH4F 5DDGA 2QENA 2IA0A 4UXAA 3OCPA 3TDUC 4UVCA 4OOIA 2Y0MA 3ZMSA 1UW8A 4QWQA 1RGSA 4JTOA 3J81Z 4M72A 5CLSA 4M9SA 2OQRA 1F5TA 1BIBA 5F64A 3F22A 2XKPA 4JK1X 3ACLA 2E1NA 4H7LA 3SQNA 1XN7A 1KQ8A 2VBZA 2OQGA 5BMZA 1J3PA 5JSRA 5BPXA 5KVRA 2H6CA 4HX8A 2VOOA 2ELHA 2ZCWA 2Q0OA 4N9IA 1OR7A 4BYYA 2ZMEA 2V79A 1U12A 1R23A 4IEOA 1B9NA 2P5VA 3R0AA 1WQ2A 2V9VA 3KGLA 5E16A 5DUKA 2HTSA 1BC8C 3FMSA 3ES1A 2E7XA 1DPRA 2GU9A 1ZG1A 4L0YB 3G7DA 3RYKA 2M45A 3CO6C 2QJVA 3B02A 1ZZCA 3D0JA 1FC3A 3NQOA 1ZG5A 3UKVA 1S6LA 1KQ9A 4KYWA 4OFGA 3BDDA 2D93A 4LJZF 4UVBA 2P17A 5I8SA 1KYWA 5DV5A 2XV4S 1E2XA 2HS5A 4OIRF 2PHLA 5H20A 2Q8KA 1HKSA 2OU2A 2XGXA 2IA2A 3F72A 5KHJA 3DP7A 4BXUA 2L54A 3FMQA 3FM3A 1C0WA 4EM0B 3HT1A 4IPAA 1U3EM 1PDNC 4L9NA 2ZKZA 1FXZA 3J81K 1Z7UA 3NJZA 4U0WA 1OMIA 4WK8F 2PBIA 3ZP5A 4XFCA 2NRAC 2PAKA 3E5QA 1O5LA 3SCGA 3LA2A 3BCWA 1F9NA 1ZLJA 4AVPA 2F5EA 1TQMA 5HS7A 1QBJA 3H7YA 1D8JA 3ABTA 2OZ6A 2RDPA 5E1WA 3MAJA 1TLHB 3KFWX 4MGZE 3I4PA 3KZZA 3Q9SA 2BNOA 2ZNYA 1UHWA 1VP6A 4AQ6A 3ML6A 2MLGA 1AOYA 4KA4A 4IEPA 3ZMZA 5E1ZB 5E18F 1MGTA 4EM2A 3GX4X 3IHUA 3EBRA 3RTRA 3WW1A 4OMYA 1YIOA 3M8EA 4P9GA 1SD4A 1FWZA 1RZ4A 2JPCA 2P4WA 1KU2A 4HBLA 5FCCA 4EWDA 1FZPB 1U78A 3Q9VA 4EGZA 3V8KA 4NQWA 3S7EA 2KRFA 4Z82A 4UV8A 3WGHA 2XLFA 4AVBA 2M5WA 2J5OA 5LHHA 3PNAA 2H0VA 3NVCA 5I0UA 4IXAA 4HSJA 2QZ8A 2K27A 4P96A 1H9TA 2E9QA 2FA5A 2Q30A 3ZMDA 1XCVA 4M9XA 1DGWA 2P5KA 1ZZ9A 4AVAA 3F6OA 2IXKA 3DN7A 3D82A 2UWMA 2FOKA 3T8TA 4GULA 5HDKA 3F8MA 2Y0OA 1IRFA 3DV8A 1YFHA 3WU0A 1IXCA 4MTDA 2DPUA 2BGCA 2PAEA 5BY5A 4ASNA 2Z99A 2DAOA 1I27A 1LDDA 1QGPA 1XE7A 3V8JA 1O3SA 3EYYA 3ZDSA 5A2QK 2Q2EA 5FQ0B 2A69F 2OZUA 3GLXA 3F8FA 4U7DA 2F5CA 4QGMA 3I64A 2P5LC 1U5TC 1EPZA 2IXIA 1O7FA 1IRGA 1BI0A 1P6RA 4B09A 2V09A 5I91A 1ON2A 1G3SA 2Z5UA 2PQ8A 1NYWA 2IXHA 1YO5C 1ZGJA 5D1IA 4D7TA 4RGSA 5DD8A 2DTRA 3HIFA 3SCHA 2O8QA 3EETA 4IERA 1ZAOA 1ZZ8A 2GA2A 3FHIB 4M74A 2GAUA 2ATFA 4S05A 4HVOA 2FBIA 4EVIA 4JQFA 1CAWB 1JGSA 4XFGA 5FQ0A 4Q48A 5JSOA 5KK1A 3MDPA 2UYAA 5T3NA 2EWNA 5J3UA 5LRRA 4LB5A 3RIRA 3WE3A 3V4GA 3DL3A 2MHFA 3FXQA 1ZX5A 3HTSB 3ISPA 4ZYEA 4EM1A 5JSPA 1SD5A 3GWZA 4NHJA 1WLTA 3JAMK 4MQVA 5JR3A 4FX0A 3KEQA 3BY6A 2ETEA 4AIJA 4J1WA 4D7SA 4LLGF 1YW9A 3KP4A 4QX5A 5DYMA 1SD6A 3VHRA 1VTNC 3G3ZA 5HLHA 3HT2A 2BYVE 1IUYA 1CAWA 5HVQC 3CO7C 1TW2A 2VT2A 3C1DA 3CF6E 4X6RB 1FYKA 4S04A 4MEYF 1YYVA 2H09A 2OAZA 5K8SA 1IW7F 3DQVC 5E20A 1Q43A 1S3JA 3WGGA 5K5QA 4HLTA 2PTMA 4PDKA 1JHHA 5ICEA 4XSZF 3H1MA 1Z6RA 1ZNPA 3ECOA 4M6YA 2X0LA 1KYZA 1G4DA 3CTAA 5JI6A 1GXQA 4A6EA 1R36A 3EDPA 4UV9A 1RUNA 4JTNA 2RVCA 3FXRA 5KHIA 3MWMA 3M1EA 2UY9A 2IA1A 2VT3A 4Y17A 2M1BA 3MQ0A 3K2ZA 3WW4A 1BOAA 4A0XA 3K1MA 2XLAA 1ZZ7A 1WA4A 2YSRA 3I7DA 4QXKA 1BI3A 1LB2A 1QNTA 3WU1B 4DQ2A 4K8FA 4CHUA 5FLXZ 1KU3A 1R58A 4RB1A 5JHUA 3QP5A 5KBFA 1GHCA 5J48A 2JRTA 1UCXA 3D5LA 4MNUA 1B1BA 2H27A 3ZN0A 1K78B 2VC0A 1SFUA 2RGVA 1W7PD 1TNTA 2ADUA 4A5MA 2XUBA 3JTGA 3RZZA 2FNPA 5CYVA 2K4BA 5EEHA 2A07F 5F1RA 1FP1D 5D5UB 4LLNA 2IT0A 5EZWA 5CVVA 5HS8A 1BN5A 2FMYA 4JVAA 5I0TA 3WODF 1U2WA 3F23A 1HQCA 3SMHA 1ZRCA 3ZPLA 1GVJA 3S7IA 5ILUA 2EFWA 1OI6A 5BOXA 5FFXA 1K78A 2GC1A 2XAJA 2MC3A 2QQ9A 3LSTA 3L09A 2HFHA 4BHPA 2QLZA 4BHBA 3GYDA 2IVMA 4O3MA 3NRVA 4EJVA 1DZTA 3J80Z 2PLYA 1R5GA 1DUXC 1RI7A 1X3UA 2WTEA 2PEXA 1QZYA 2BNNA 4WVZA 3WTXC 4HOBA 3AAFA 5CVJA 5J7MA 3BALA 3PQKA 3RPUA 5FLXK 4GXOA 2KIFA 3CO2A 3K1NA 2PA7A 1EY2A 5ICGA 2L4AA 2STWA 3EHKA 1G3YA 3KE2A 4IHTA 1F1ZA 3JTHA 1G3WA 3I0TA 4L18B 4LA3A 1MZBA 1YS7A 3WTTC 2L3DA 6PAXA 4L2NA 4ZZLA 1FI2A 2I45A 5D4SA 4BH9A 4OIQF 1P2FA 2RKHA 4P9FA 2ET1A 2EFOA 4MH0E 2DPDA 1T39A 4ZU4A 2JTVA 2VQAA 1USTA 3KP5A 5BPDA 2D45A 3S0MA 1MJBA 1ZRRA 3R4KA 1VR3A 5H6QA 5BPIA 1LDJA 2WWYA 1GXPA 1V4RA 3ETQA 1R5HA 4UBHA 3CJNA 3R60A 2Q4SA 4RB0A 2P7VB 3HRMA 1W4MA 2PMUA 2D40A 1B6AA 1QXRA 4KU8A 3KETA 2LF7A 1W5SA 2O8XA 2NNNA 2FXAA 1T0FA 4JV4A 4HDUA 5I8YA 1LR5A 4OLLA 4BAYA 4MTEA 4XF3A 2GXGA 2Z3YA 2NAZA 3WTUC 5LGNA 2QYOA 2DLLA 3SCFA 3J80K 2DCTA 2QNKA 3O6BB 4IJAA 4KIGA 1SFXA 1T2KA 4HN1A 3O2PE 3RYPA 4WBBA 4KMUX 3PLQA 3TOAA 5D5WB 4ENMA 3LOIA 3L00A 3D0SA 2GC3A 3SHFA 4E2GA 1LNWA 3OF1A 2STTA 4QGLA 3ZMTA 5FB2A 4KDPA 3LWFA 2W24A 3JW4A 3J7AO 2Q0AA 3SXWA 4LUMA 3I5UA 3MZHA 2JZYA 2LKPA 2V6CA 1IAWA 5JCTA 2PQQA 5TJJA 3MYXA 2GQQA 2K86A 3O3KA 3E6DA 5L3GA 4IETA 3GVAA 4XRFA 4HX7A 5HS9A 2FNAA 5D6EA 4O5VA 1FOKA 5LBQA 1QZZA 1ZHFA 4MEXF 5E1RA 3E6BA 4QLCU 4XFHA 1ZARA 4PCQA 4LD5A 2GWRA 1FX7A 1BIAA 1IXRC 3M7GA 2ESHA 3HSFA 1WWXA 2XAQA 3SHRA 4KN4X 2JPBA 2ZO4A 5CU1A 1R00A 2PFBA 4BIFA 1ULYA 2VN2A 2MH2A 2CAVA 4A12A 3CUQC 2K0GA 3IDCB 2A68F 4HMZA 1HW2A 1ZZ6A 1S8NA 1QXJA 3MEXA 4L9TA 3LFKA 3ZN1A 1W5TA 3OGJA 4HN0A 3DF8A 3KMHA 3OOPA 2F2EA 3LA3A 2EFQA 2DFIA 3T8RA 5BUVA 3R0JA 1HSJA 4AD9A 5DEQA 2PMHA 2M30A 1H0MA 3GBFA 1G3TA 2HEOA 1LJ9A 2ZXJA 4XLNF 2B9UA 4L5JA 5JVTA 2UXNA 4TLFA 4IRIA 4G6DA 3QPHA 3V8LA 4KIFA 2F5DA 2YR2A 3JZVA 4HQMA 3CLPA 4M71A 1X8EA 2V1DA 4CICA 2VOPA 1CAXB 1IN5A 4IEQA 2XAHA 1NE4A 2RV8A 3MZYA 3L2HA 4XF4A 2O1QA 4ZU7A 1XGNA 1H9GA 3GFJA 4KU7A 4XFBA 2FBKA 5FFZA 3M70A 2ACJA 3BJAA 1R1TA 2P8TA 2EV6A 2FSWA 4Z2YA 1UHMA 5D6FA 4YFXF 1IN8A 1XMAA 2CG4A 5JAXA 3HOSA 3FFQA 2GC2A 1OD5A 4ESJA 2X4HA 1CAXA 1MDMB 1O57A 1NXMA 1T38A 3E6MA 3FHZA 4O9GA 3F8BA 2W25A 4I0BA 3P9KA 4BHCA 5LEJA 4XFIA 4M6XA 3V7SA 4RAYA 3F8CA 2Z33A 3OV8A 2R3SA 3I59B 3H92A 5CADA 3EUHA 4IEZA 4E70A 4AIKA 1I5ZA 3S2WA 2A5YB 4KWKA 2A3SA 3WGIA 1DZRA 1XMKA 1Z91A 1HW5A 4F7ZA 2QWWA 1OYIA 5HLIA 4ZU5A 3BU7A 3OD0A 1Z9CA 2MLKA 1CAUA 4QMAA 2H94A 3HYIA 2GH2A 4EWAA 2FBHA 2ET7A 2HJIA 5J8CA 1R7JA 4KNYA 4CDGA 1LVAA 5K5OA 4Q0QA 1MDMA 3GW2A 1FYMA 1IN7A 2EJRA 4YFNF 4BQAA 1BM9A 1UCRA 3DXJF 3RKXA 2MPFA 2D5HA 1QQIA 4JBAA 3NL1A 3CUOA 4F8AA 1Y0UA 3I59A 1SEFA 2VBWA 4IVNA 1T98A 5FD5A 2ETHA 3LZZA 1TTYA 2PN6A 3HQXA 2OZJA 4WZCA 3JSPA 2FQPA 5AONA 4A0YA 4LA2A 3R6SA 5FGMA 1J1LA 4CGZA 4LMYA 1BI2A 1T6SA 1HW1A 4E2SA 2GZWA 2IW5A 1ZH5A 3QPTA 3LQRA 3I53A 4AWXB 3QP6A 1KU9A 4YFKF 2D2WA 4HLYA 2KIUA 2FRHA 1U6GA 3KSCA 4N0BA 3WW2A 5ED4A 3RPQA 3IDBB 3HUGA 4I7HA 3GXOA 3QOPA 4XSXF 1UPIA 2HKOA 1IN4A 3HSRA 4J1XA 3E3VA 5LLQA 1XGMA 1BJAA 2QQAA 3GEZA 4LUKA 2FF4A 1Z6TA 3H9AA 3M9AA 2OBPA 1FT9A 4EGYA 3F8NA 1J59A 4MZUA 3WTSC 3F6VA 3BOQA 2HYGD 4CXFA 3WTYC 4XETA 2DK5A 2KKOA 3DKWA 2GXBA 2EFNA 3DPTA 2O6GE 1ZG3A 1NE6A 3U1DA 1QY4A 2EFPA 3CDHA 3NW4A 4MUVA 2IJLA 1PMIA 3NKTA 4MHGA 1R1VA 3BROA 3TNPB 5L3DA 1CGPA 3P7NA 1Y3TA 4GGGA 4HF2A 4U0VA 4MGRA 2AS5F 5DUIA 3HHGA 3GO5A 1JUHA 1X7NA 2V1UA 5HOOA 1D5VA 4I0AA 2KJBA 1PP8F 2CSOA 1K79A 1KU7A 3CLOA 5EEGA 4KN7X 3K1PA 2IPQX 1L0OC 4I98B 3HSEA 2QVSB 2O03A 1IN6A 2XIGA 4R79A 3VOEA 1NZCA 5IT9Z 3K9TA 1YHFA 4RAZA 1I6XA 1JXSA 2XHKA 4MGYE 2MA3A 3O14A 1V70A 1OYWA 2FU4A 5I0SA 4PIZA 4AVCA 3WW3A 4MV2A 2DQLA 1J7KA 2O0YA 5FLJA 3KZYA 5E1XA 2IP2A 4CZZA 4PIYA 3VFZA 1MJAA 3BZ6A 3KP2A 1RTVA 1LDKB 3H1YA 3PQJA 1J9IA 3EQEA 1CAVB 1J3RA 2PFWA 4P5OA 4CYDA 2L4MA 4WCGA 2CFXA 2VE8A 1PUEE 4RS8A 3ELKA 5I0RA 3E5XA 1U8RA 2D1HA 1IF1A 1LKNA 2ISZA 5KHKA 3E97A 3KEOA 1DDNA 2KXLA 4G7ZF 1YFUA 1P4WA 2VBYA 1BBYA 4ZYDA 2DK8A 1S7OA 1P4XA 2P6SA 1MKMA 2B0LA 3HRSA 1Z1DA 3N4MA 4AXOA 2UZKA 4D0PA 3U9GA 1JE8A 1PM7A 4LK0F 3HTUA 1ZLKA 1Y9QA 4XEZA 5D8LB 3T1BA 1UIKA 1J2XA 4LB6B 1ZRDA 5D4RA 2XL9A 1O3TA 4G9YA 5IT3A 4WF2A 1CAVA 2EA7A 4Q0PA 2PJPA 3RJPA 3K0LA 1XCBA 5BQTA 4LLLA 3OTFA 3KLNA 5L3FA 5JFRA 1U5TB 4YG2F 5LGTA 3U2RA 2GC0A 4O9EA 1UIJA 3M8FA 2D5FA 3RI4A 2OYZA 3R61A 1XSVA 3FWEA 2C0ZA 3K69A 1XGSA 4HF1A 1V3FA 4I2OA 2F5FA 4MX3A 3IWFA 2OPKA 3W6JB 4LULA 3GZ5A 2EV5A 1YW8A 4YYOA 4OINF 3IKTA 1NHAA 2DBBA 2NS0A 3SZTA 3HRUA 3H3UA 3ERED 1O5UA 3GFIA 1ZYRF 3LQQA 3FZVA 2PYTA 1ZRFA 4FT8A 4WXCA 1ONVA 5E17F 2ZJ2A 5I8TA 2FEZA 1ON1A 4MGKE 4U88A 4IF4A 4OIPF 1U5TA 1YLFA 1MJ9A 2H6BA 2JSCA 3C3WA 2RQPA 2DU9A 2HGCA 3P9CA 1YFWA 4QGNA 1SAXA 4A0ZA 2N7GA 5FO5A 2CAUA 5CVUA 2KIMA 4M73A 1CX4A 3TNQA 2EB7A 4XLPF 2IXLA 3EYIA 1G6NA 1EYBA 2EK5A 1RNLA 5C8WA 3F3XA 5LEKA 3BPZA 1A04A 2CGPA 1YS6A 2V1XA 5F6FA 4A5NA 2UY8A 5LRSA 1WI9A 2TDXA 4G6QA 1YQAA 4ORFA 4HV6A 3FM5A 3GZ6A 3LAJA 4B8XA 3ELNA 1XGOA 4FAGA 2FMLA
chains in the Genus database with same CATH superfamily
3VBUA 2DA7A 3ZQ7A 1GQHA 1AXZA 1YUDA 3CCRI 4LO6B 1REPC 4PJYA 2ZGLA 4EJUA 4N8MA 4NIAA 3KP6A 3POFA 5IHRA 2EIJH 2ZEZA 3MLLA 1DPUA 2WV1A 4XMAA 2VXZA 1SDDB 3T1MA 3I71A 5AIQA 1S0GA 3HBLA 3CC4I 5JLVA 1G9CA 2JK3A 4IEUA 4UUVA 4PFOA 4A6DA 4K6BA 2HR3A 4KWLA 3BLYA 1NG7A 1J5YA 1WJDA 3U11A 4AVVA 3MVPA 4L97A 3ZCOA 2QQKA 4NROA 3OSFA 4HDVA 3POBA 4RGRA 3OL4A 4CDQB 5KAIC 4P9UA 1UD1A 4BM8A 4CCCA 1QJEA 1YTYA 2P81A 4DINB 5CG8A 2ZB9A 5ILVA 3L1PA 1TME1 2CMPA 1ZREA 3AK0A 3WNPA 3VBOB 3X2QH 1UZ0A 5CJ9A 4Y15A 1FX5A 4KITB 5FY7A 2MH9A 4Y4RA 4RR3A 1UFMA 4UFHA 1EH8A 1YQ6A 2UURA 1RC6A 2FCTA 4HV5A 1QJFA 3NNLA 5ILSA 2XWBB 3J7AY 3ZRGA 2HEVF 3RCOA 3CCVI 1IGOA 3DTKA 4F3QA 4MFEA 5CVRA 4N53C 1OVPA 4UNOA 4NIGA 3RKYA 4LO7A 5EF6A 4ASMB 1TNSA 2VZRA 3CLQA 1FYUA 5A7WB 2IBDA 3HEFA 2LKSA 1R093 5DAPA 4M3FA 3T0YA 1VJ2A 5AVPA 3MV11 1AXKA 3ALQA 5AFEA 4HFSA 4NWWA 4P55A 4MVTA 3MKLA 4M6VA 2GMEA 3PHMA 4XTMA 1Z67A 2X1DA 3BQZA 2ZGPA 3KT4A 3RWNA 5F39A 3PMSA 4EMSA 1IPKA 2HZTA 2WFPA 5F32A 2R7FA 3F9KA 2RS31 1OFNA 2W1QA 3FJSA 1CPNA 1Z3YA 1TWCJ 1K5JA 3T2TA 2UYBA 2R7QA 2GIVA 3S3OA 2VPVA 2Y9YA 3PSIA 5FZFA 2ZEYA 4U0YA 1SCSA 2XHNA 3IH3A 1R5ID 2L0KA 1LQ1A 2XRNA 3HVDA 4AQ2A 4CPBA 5EQUA 3MIFA 4H55A 3FBIB 3GJBA 3FIWA 4BDYA 2Z9OA 1D0HA 3VODA 4Q0UA 1VALA 4XL9A 4I01A 3MIDA 4Q29A 3AP9A 2VPLA 2YX4A 2F4IA 1WA6X 4JC1A 1IGNA 2JDAA 5K1YA 3ZMUA 3B93A 5E8GA 1H1MA 2XF5A 2RR11 1GMMA 1FNNA 1XSXA 2G7UA 3QACA 5DM7F 1S2BA 2C1FA 4YRVA 1UMZA 2QBYA 4UXNA 2B8MA 1AZDA 4LBMA 1XRUA 4G7OF 2O7OA 2VTXA 3MD2A 2B42B 2DO7A 5FO9B 3ORJA 5FXZA 4IHSA 4QAWA 4RS5B 2FDHA 2L9NA 3VDBA 2ZX2A 4D7MA 3WR0A 1BL0A 4AEMA 4HVRA 4A6SA 2G9GA 5K7HA 5JLXA 2UWAA 4XK4A 2W92A 5LBBA 2BZTA 1AHDP 2IGOA 2W84A 1WH5A 2K7LA 4JGZC 2I10A 2XJUA 2LTPA 1T2XA 1TZOA 3V65A 3U14A 3BYWA 1TT0A 3GTJJ 3FHNA 3CCEI 2O61A 4HKWA 2GOMA 2UXXA 3REOA 3BGAA 1V00A 1F4KA 5C8CB 4NE9A 3K4ZA 2JB8A 2RDSA 5FV3A 1IC8A 4AHYA 2IZWA 4Y1XA 2R7UA 4GCVA 3S5AA 1MD0A 1OC1A 2O0OA 1ZTRA 5E8AA 1QOSA 1CZVA 4BDZA 1BC7C 4WXDA 1QNWA 2QDRA 3KCCA 1R71A 1NY72 4XRSG 5H6RA 1IG7A 1PNFA 3BR5A 4GH4B 1URXA 3CUQB 4YZ3A 4DS0A 2ESNA 4GO1A 5DAQA 5FZCA 4OVEA 4CZSA 2HYFA 5JXHA 4CP1A 4IQJA 1LHNA 2OIIA 1X1AA 3AKQA 5FYHA 3MIEA 5HDGA 4Q5SF 4IUGA 3DEUA 2XASA 2HKXA 4P00B 5FZ0A 1IS5A 2PXJA 2QA4I 1JS9A 2WO3A 3OYDA 1I1SA 2NMNA 1F5FA 3DGTA 4UBGA 4WVMB 2G9FA 2W00A 4JKLA 1EV7A 1GZCA 2B9SA 1KONA 2ZKNA 4M0HA 2XAGA 2P7CB 3SLIA 2P6HA 1W39A 2W0XA 1W6NA 3WP3A 4NPMA 3U07A 3MCZA 1H30A 1BMV1 4NIDA 3SDGA 3OIOA 1C1FA 2LM3A 4K2EA 3ILFA 4P9XA 1PO21 4BNCA 2AUYA 3CCMI 3AB0A 1WUVA 5IOZA 3WZ1A 1R1A2 4G8XA 5BNPC 1NKGA 4KJZA 1Z0XA 1QH6A 1UKRA 1IZ1A 3G1OA 4EWEA 1JU4A 2Q8CA 1WW4A 4CXWA 5K4LA 1WJCA 2YFUA 4OHXA 1IQDC 2EAAA 3LDKA 2MNGA 1X3WB 1QHDA 2LY1A 2RM23 4FPKA 3DLAA 5DUXA 4XBLA 3WP5A 4FX4A 5FBJA 4IE6A 2JG8C 4JAAA 3T2OA 1OQDA 1TWGJ 3GF2A 3IP4B 4YSFA 1TL8A 4XLEA 5HDNA 4Q0VA 2L02A 1ZRIA 3GUDA 3ES4A 2CQXA 2CQKA 5IPAA 3C18A 1VQ8I 1RIRA 3F21A 1EH6A 2LKXA 1W36C 2LVSA 1BI1A 5FZAA 3MO4A 4EJOA 2K9ZA 1YG2A 1E3HA 1UELB 1YRZA 4YIIA 3CJXA 1AYN2 4HONA 1QPMA 1F31A 1LU2A 4RDUA 3K3NA 4BQQA 4UI9L 1NOVA 3H0DA 2YPRA 5DD4A 4YM0A 1K4SA 3CU7A 1FSHA 4EV0A 2QSHX 1SMYF 2Q8EA 4QKNA 5EV7A 3DYOA 2E6VA 2YPJA 3TDZC 2HDWA 2VL8A 1BW6A 5JIUA 1SBEA 1T95A 1B8IB 5FMDA 4XF0A 4M3DA 4OAYA 3HOZJ 3K46A 2E51A 4BQNA 2VZTA 5A7OA 2W4SA 2MEV1 5FY0A 1QU0A 2RG4A 2J1SA 1KDMA 3ZMVA 2HDCA 4O7XA 2KDZA 5G05L 4ZONA 5JPNB 2L7ZA 1XBFA 2VG9A 4Y4YA 4XURA 2CW0F 1W5CC 3NEUA 1RUOA 3QBQA 5LBFA 2Z2SB 3WE2A 2ME0A 3MICA 3C2GA 4QXBA 2ID4A 2NN8A 1CF7A 1PK6A 1WZXA 1UG0A 4OIOF 2WA4A 1J75A 5J6XA 1ODDA 1UZVA 3EQLF 3WCSA 1COV3 1OVSA 3EO6A 3OSDA 1FOD3 2ZEXA 4LIVA 3TMOA 2JDPA 3GDBA 4M9SA 1N25A 3F22A 2XKPA 1R1ZA 4Q4Y1 3ACLA 2BGOA 4OI1A 3ZR5A 1HQWA 2IVJA 3I2FA 3BI3A 1XN7A 4DJAA 1KQ8A 2VBZA 2R071 5BMZA 4YEJA 3BIEA 3POYA 4CU9A 2DTWA 4UB6C 2H6CA 3MKYB 5FKOA 4JRLA 4N9IA 1E3PA 2HWD1 2ZMEA 1R23A 3ZGKA 3R0AA 4IE0A 2MC4A 5IOYA 3KGLA 5E16A 5DUKA 2HTSA 1BC8C 3ES1A 1BR1A 2DA2A 4HKOA 2GU9A 3OBTA 5C4JJ 1NLRA 3G7DA 4B1LA 1RHI2 2VZOA 3RYKA 3CO6C 2ZACA 2CQ7A 1G7YA 1FC3A 4KYWA 2BWCA 2OUHA 4OFGA 4QPIB 4MHRA 5BNOA 5I8SA 3S1MJ 3M3OA 1E2XA 1FPN3 5H20A 4E7IA 1W2UA 2OU2A 1W3VA 2E60A 3PTRB 3F72A 3DP7A 2L54A 5J98B 2J1TA 2LREA 1C0WA 3HKZN 2CQQA 2RAEA 3LFMA 2ARAA 1X9TA 2H1LA 1JKQC 3K4DA 2W82A 3HD8B 4E7JA 3NJZA 1UWWA 2ZSHB 3C7EA 3FXOA 1JZ3A 1O5LA 3UL2A 3H8XA 3I2IA 1ZLJA 3J26N 1JMUB 1TQMA 3ABTA 1GV5A 2OZ6A 4RAGA 5M3MJ 5K0UA 3DXUA 4MGZE 2R7OA 1H8TB 1QIQA 2LROA 3VLBB 1H8VA 1SLAA 5GZEA 4C30A 1UHWA 4AQ6A 1UXZA 3VKOA 4W50A 1VAVA 5E1ZB 4JKKA 3AKRA 1HF0A 1UN1A 1MS5A 1Y43B 3THCA 4OMYA 3M8EA 4P9GA 1SD4A 4EWDA 1RZ4A 3KT7A 1C1LA 3L2RA 1YRNB 1U78A 2Z1DA 4GRIA 1W6MB 4EGZA 1XNDA 3V8KA 5FY5A 1W03A 3VZLA 3O1PA 1BHGA 1YJWI 1NX9A 4Z82A 4UV8A 1K83J 1ND2A 2C24A 3CBNA 4YW1A 3IN9A 4CUGA 2HNHA 3OJBA 3BR2A 3NVCA 5B4NA 2PELA 4HEA2 4AAXA 2E9QA 1FOXA 4M9XA 2DFCA 1VBB3 4AVAA 4U2AA 3DN7A 2UWMA 2K40A 4GULA 5EJCA 5C9AC 1IRFA 3DV8A 3KPHA 1YFHA 3LSEA 2FMDA 2QUOA 4MTDA 5KC6A 2ECCA 4BE2A 2JXAA 3UJOA 5DAXA 2BGCA 3KYCB 2PAEA 3B69A 2Z99A 1JHJA 4UUTA 2EZKA 1IS6A 3AXDA 3V8JA 4NMIA 1NH3A 1JODA 1RMU3 3MPPG 3V0BB 2Q2EA 1HB2A 1OCCH 1ND3A 2OPTA 4CEYA 1QXPA 4PF1A 3GLXA 3N7LA 3GGLA 1VQMI 4FI9A 3I64A 2JA2A 4RGGA 1IRGA 3T3YA 3DU6A 3AL6A 1P6RA 2PLV3 1G3SA 4I6ZA 4YGCA 2Z5UA 3A0HC 2IXHA 2GN3A 5B1AH 1PMJX 2RDQA 1DP3A 5KAFC 4LKSA 3I2GA 2CV2A 1SCRA 3OPZA 1CR7A 1LHVA 4EYUA 3WD5A 4LQRA 2D6PA 2O8QA 3A23A 5JZGB 2W95A 4IERA 2E35A 2C4XA 3CJQB 4M74A 1M06G 1R091 3RZJA 2R0QC 1POGA 1OD3A 1VQNI 2ADDA 4Q48A 1A3KA 1POQA 2KM2A 4F55A 4BQOA 1JKPC 1W0NA 3MF6A 4OMDA 3VDDC 1CJPA 3RIRA 3Q0VA 3WE3A 2JVHA 3DL3A 3ERMA 4ZYEA 3GWZA 4NHJA 2NVUB 1LOEA 4ATEA 4EN6B 1YIFA 4DUVA 1KGYA 4FX0A 2R042 4J1WA 3HL2A 4WVVA 4K1YA 3D5OA 1VTNC 1SC7A 3P1IA 1IUYA 4FFIA 1WCSA 5HVQC 4QSHA 4OHYA 2OTJI 2VZUA 3K70C 5E88A 2VJ5A 1FOD2 2J22A 1T6BX 3S2DJ 5K8SA 1IW7F 4IV1B 1UHSA 3DQVC 4EN7B 1PYVA 3WGGA 3M1CA 2PTMA 3LDRA 3B9IA 4PDKA 2G9ZA 2DOFA 1VMFA 4XHBA 4Y52J 4XSZF 5FZ9A 4XBQA 1MIJA 4LXLA 1IDZA 5DG1A 1OFCX 5JI6A 1GXQA 2E26A 4XAAA 3VB9A 2HWC2 4DY5A 1DU0A 4JTNA 3MGUA 4HPKB 2A70A 2IA1A 2M1BA 4GJZA 3K2ZA 2GH8A 1VBE2 4NIIA 3HN3A 4A0XA 4C0BA 5B1BH 1RUI3 3NWSA 2WAQA 3LMMA 5ERLA 2YSRA 3I7DA 1YJLA 1XJAA 2G0EA 2VQHA 4RLQA 3WU1B 4CHUA 5FLXZ 2EXKA 1KU3A 2HPMA 1IG3A 5KBFA 2HBTA 5J48A 2AXTC 3D5LA 5FOBB 1JTZX 3ZXFA 2H27A 3ZN0A 3PURA 4GWNA 1XC5A 4X6AJ 1VBC1 1MEC3 1X1CA 1PX4A 2MSYA 4A5MA 2VTXJ 2JEMA 4N53A 3JTGA 3VBOC 2FNPA 4BL0B 3N36A 3WUCA 1LOCA 4NUBA 5EZWA 1GANA 4GA9A 2Y64A 2WO2A 4CXXA 1EV13 3S93A 4OI0A 4JVAA 3I3EA 1GNZA 4A7KA 4MIMA 3SMHA 1YIPA 1H0BA 1GVJA 2EFWA 5BOXA 2J7MA 3BTZA 2P0WA 2MC3A 2KZGA 2LW8A 4BHPA 3S3NA 2WUHA 3UNGC 4KMQA 2ZPXA 1RUE2 3B00A 2X53S 2D7FA 5JVGF 3J7LA 1DZTA 1R5GA 1DUXC 3GTOJ 5DN2A 1RI7A 2QQOA 3BCBA 2E63A 2PEXA 2BNNA 4WVZA 3LSJA 5IT6A 5J7MA 3PQKA 5F0CA 4GZ9A 3HR9A 3WNMA 2PMZN 5EHDA 1HOMA 1G3YA 3KE2A 3T0BA 3I0TA 1REDA 4W97A 2DMUA 4IEJA 5T54A 4YW7A 1BR4A 4L2NA 3H8OA 1GKBA 1HX6A 2I45A 5D4SA 2RKHA 2EFOA 4MH0E 4RA2A 2J1EA 2I8DA 1DBNA 3VBSB 1A34A 2D45A 1XG1A 1U5YA 1VBB2 5DG2A 1UQXA 1OLRA 3P3NA 4CYCA 1OCOH 2D40A 2EPFA 3OGVA 1QXRA 1JZ2A 2PJRA 4NPLA 2O8XA 3WT3A 2E7QA 5I8YA 3HQRA 5FMBA 1JYVA 2VZPA 1GOGA 3DYMA 1RMU2 3WTUC 3CJIA 2DLLA 4YIRX 3OUJA 3DCFA 4BWOA 3M07A 2PHTA 5FZ1A 4XUOA 4YG0A 1T2KA 4HN1A 1AR61 2EXHA 3C7GA 3TOAA 1AX2A 1W1WE 4ENMA 3LOIA 5IFPA 3D0SA 5LY2A 4XKCA 3OPWA 4E2GA 2WB1N 2D3SA 4OCTA 1HV1A 1E0EA 2PLV2 4RS5C 4QGLA 3TEXA 2XJQA 3ZMTA 2FJ1A 5IWFA 5FB2A 3LWFA 1S7EA 1XTAA 2DOAA 2LRDA 3MMYB 1W8UA 2CNAA 2LKPA 1PVC1 3NNMA 2J1AA 1ZBE3 4P9WA 5ANQA 3AP5A 4RMNA 4XRFA 1QQP2 3RZMA 1W6QA 1TG7A 1MVEA 1ZHFA 3J7YJ 4MEXF 2AR6A 5DAWA 1PZ8A 2F4OB 2XGDA 5C8CC 2GWRA 3M7GA 1N1VA 2ESHA 1B35B 4ITCA 1ULGA 2ZEWA 2ZGTA 1WWXA 5A7SA 5GPCA 1Y8QB 2AC1A 2JPBA 4CCLA 3OEBA 5CU1A 4N4OB 4BIFA 3THDA 4X1EA 1OPMA 1R6RA 4GH4C 3IPVA 4XDPA 3CUQC 4PJ0C 4D6QA 3ZMNA 5F37A 2A68F 4HMZA 2BXZA 1S8NA 3MEXA 4XKWA 3LFKA 1NLSA 3ZN1A 2GDFA 9ANTA 1W5TA 2WKKA 4QPGB 5IP9J 3KMHA 4CUCA 2X6YA 4D5FA 2F2EA 1AYM3 3EXUA 1WZ2A 1OCRH 4C3HJ 2KZVA 4S2FA 3NMBA 5F5CA 3KEYA 3HWJA 2L5QA 1F35A 2EZIA 4XHXA 4KT6A 1H6YA 3GBFA 5BNPA 2HEOA 3W5NA 1HIXA 1CJDA 4L5JA 2WA0A 3V8LA 3TN91 2JDKA 3CLPA 1I1EA 4RAFA 4AIDA 2V1DA 4CICA 1Z0HA 5A3MA 1GZWB 5F7UA 2VMEA 1AR83 4XF4A 2JG8A 1D7PM 5SV5A 1T08B 2R0HA 2OUJA 3DEWA 3A0KA 1H9GA 4FASD 1HA8A 4KU7A 5F5IA 3OIQA 3A21A 4AEJA 3DBRB 1MEC2 2ACJA 2YC0A 2FSWA 3Q8CA 1N3PA 4FFGA 1UHMA 3BG5A 2V4VA 1WW7A 5GAEJ 4C2MJ 2GC2A 2JDNA 3VBHB 4XXAA 1QRYA 2X4HA 4CUBA 1AF9A 1O57A 1KJRA 2WT0A 1T38A 4D8MA 4A45A 1PIV1 4L9BA 3F8BA 5LEJA 4A6OA 3V7SA 1RVF2 3WNNA 4NIHA 2JICA 2Z33A 4N43C 3OV8A 1FMVA 3H92A 1KEXA 2QZ3A 4IHXA 3GZNB 3S17J 1XX5A 5F3GA 5B3SH 2R16A 1W2TA 4DBQA 1X9PA 2IWGB 3A03A 3I3MA 3K7AJ 2K2SA 3ETPA 3K4JA 3KVAA 4QMAA 2H94A 3HYIA 4EWAA 1AJKA 3TL4X 2HJIA 1DQ2A 3I2DA 3G4SI 3NAPB 5IVCA 4KNYA 5EXOA 1LVAA 1TZLA 1WD4A 4XIKA 3AFGA 4Q0QA 3EB7A 2RE9A 3AVSA 1IN7A 3HUGB 4LKDA 5IK5A 5FYYA 4ZTJA 4OUEA 3CUOA 5FZMA 5K9YA 4UAPA 1N75A 2VBWA 4IVNA 1DU3D 2ETHA 3H5NA 4B48A 1ENXA 4H4KC 4FPHA 4JGYC 4XQWA 5A80A 4A0YA 4LA2A 3DPUA 2COBA 2DT7B 1T6SA 4CVUA 1AKHA 4ATFA 1AA7A 2KPMA 3ZQHA 2J1UA 1KU9A 2DDBA 2KIUA 4QTRA 2FRHA 1U6GA 5F27A 2RDRA 3LQCA 3IDAA 3WW2A 4XQDA 3RPQA 3IDBB 4AHXA 4QHZA 4I7HA 1R4MB 4ZDPA 4W6WA 3HSRA 3ACGA 3DU5A 4J1XA 3ESWB 5LLQA 5F8PA 1OR7C 5J37A 1XGMA 1V54H 3USUA 4LBOA 3H9AA 3M9AA 2OBPA 2VU9A 3CMYA 3F8NA 4ARYA 1WMXA 4LOSA 5JUVA 2VBBA 1MR5A 4CXFA 3DKWA 3RVHA 3KIOA 4DNYA 2EFNA 1ZG3A 1QY4A 4V2GA 1CD3G 3CCSI 1A6IA 3KS7A 1R1VA 2QDNA 4GGGA 3WDVA 4MGRA 2KISA 3HJEA 1UY2A 2FDJA 4GAZA 1DGWX 1JJ8C 3GO5A 1X7NA 3OOUA 1D5VA 4Q1RA 4FSJA 3O8GA 3J7MA 2QQLA 3AJYA 3J8F3 4KN7X 1L0OC 3Q8EA 4GWMA 4I98B 3T30A 2EIKH 2O03A 3GLLA 1JI6A 4JQTA 4AAPA 5FO7B 5J4VA 1L7QA 2QF7A 4R79A 3PVOA 4AFMA 1YHFA 2CUFA 2QKDA 1JXSA 4AVTA 1UJ8A 3RQ0A 3O14A 2RDNA 4UUSB 2FU4A 1GWMA 1X1BA 1CN1A 1BVVA 3WW3A 5L19A 1GYKA 1VQ6I 3KLSA 3WG7H 3I3QA 2XUEA 3KZYA 5SV8A 5E1XA 2BOJA 3VFZA 3VD7A 5C3RA 2AQEA 3PUQA 4K40A 2QQWA 1J9IA 1J3RA 1AL0G 5C7GA 5FZOB 1K5MB 3ZSLA 1N1TA 5FPUA 1HV0A 4OUMA 4LO4B 1U8RA 2D1HA 1XNTA 1X3ZB 1T8IA 1YX3A 5KHKA 1UL9A 3VBFB 2KXLA 4G7ZF 3T0AA 2Y6JA 3WP4A 1W6OA 4XE9A 1AR73 3HRSA 4YM3A 2DFFA 2WFF3 2HLEA 3MHZA 4D0PA 1AYM2 5FROA 2FX0A 3PIJA 1JE8A 3RQIA 5JHFA 1H8TC 2XPWA 2OXBA 3GZAA 1WCQA 3VSKA 2XL9A 4K1ZA 4Q4X2 3LD8A 1HLVA 5IT3A 1W9YA 3ZLIA 2EA7A 3OYFA 5FYZA 4Q0PA 3RJPA 1MH4A 3K0LA 2DVAA 1YXWA 2QQVA 4ITVA 4XMIA 1HC8A 3N7MA 4K8RB 1U5TB 2GC0A 4O9EA 2HWB3 1REFA 4PDWC 2OYZA 3RI4A 1HRI3 5FZ7A 2VBDA 1XSVA 1LUJB 3FWEA 2CJJA 2L9VA 1XGSA 1KS5A 2F4MB 1V3FA 5C9AA 4BEHB 2ES3A 4MX3A 3A2KA 1V6KA 2OPKA 1TNRA 4LULA 2WYFA 3GZ5A 4CDXB 4OINF 3IKTA 1NHAA 2DBBA 1H9PA 1UYYA 4OYUA 2J1RA 3SC7X 1PGL2 1LOBA 1LFBA 4IE7A 1PJRA 3GFIA 5KR7A 2VJ4A 4HK9A 1ZYRF 1ZRFA 2F5VA 4FT8A 2Z5WA 2WL1A 3I4MJ 3HOVJ 1E5HA 2ZJ2A 1SFKA 2FEZA 1VB4A 4U88A 5KCMA 4B4CA 1RUF2 2MGQA 4Y20A 3ZQQA 3LPFA 4A7ZA 1Y7BA 3GTKJ 3P9CA 2QQMA 1YFWA 4QGNA 4BXFA 3MIBA 1FOWA 4LBQB 5FOJB 4M73A 2JA8J 3AFKA 2EB7A 2B39A 2IXLA 5EEAA 3EYIA 1G6NA 1EYBA 3DKYA 1PGW2 2NP0A 1UZWA 1A04A 1WHUA 4UY8I 1YS6A 1EV11 1NCRB 3KHCA 2UY8A 1LGCA 1RUC3 2Z42A 1UYXA 2BDRA 2TDXA 1XU1A 3OPTA 2YUEA 3B94A 3GZ6A 3HOWJ 5HNHA 5DABA 3LAJA 2XJSA 4PT6A 3ELNA 1XGOA 4FAGA 3UGFA 3ZQIA 1LVKA 4X8NA 1MZEA 1G8WA 2WAEA 2WT2A 1GQGA 1V6JA 2QSFX 3TO7A 3RZOJ 2RS11 2YDEA 4UVAA 5CA6A 5JZGC 3GHNA 1ZVFA 2DU0A 4E6KG 3ROUA 1W2AX 3HQUA 3IMNA 1FSEA 2BTVC 4DFSA 4KNCA 2VQ0A 4EJWA 3JD71 2VD7A 2P3IA 3C7OA 1ASJ3 1I1GA 5FYIA 4B4QA 4G3YC 3DPLC 3LAGA 1TNFA 3A01A 4XCBA 5C6CA 3K3OA 3B7MA 1FBSA 1VRH3 1ZBA3 1JZ8A 2EF6A 3H1WA 2WY7Q 5F1JA 1QU3A 3H50A 1IPJA 1X2NA 1O3QA 4MHUA 4BK4A 2VKHA 1MZ5A 4D69A 3G6EI 2E1CA 1YWKA 1MQTB 5CBLA 4HZFA 1TMF3 4O65A 4EN8B 1JOJA 4TV7A 4ZYGA 3V56A 1BA5A 1LFUP 3SFIA 4XICA 1TBXA 4BZ4A 2WS92 2F6CA 2E5NA 3HOYJ 4A2UA 1OYYA 2AENA 2V1NA 2AGSA 2VMHA 4YWAA 5FY9A 1UOFA 3TO6A 4IV1C 3HHHA 2M4GA 1KS4A 3WQ7A 1PO13 2YBSA 1GU3A 2C6YA 1H1IA 1LE8B 3B6CA 1ZN2A 3I56I 4LGWA 2DA6A 1NY71 1FYLA 1ST8A 1DQUA 1QOOA 4CDQA 1D4VB 3ASOH 2B5HA 4ET7A 3BC8A 1W8FA 1OKRA 1LEDA 4D0QA 2LUWA 2XMLA 3IZOA 5IVJA 5IK8A 1RJ8A 3QRFF 1Y39A 4Y1YA 4NHYA 4YIFA 1K6YA 3GFLA 4EE2A 3VBOA 4NVPA 4FOWA 1F15A 3BJOA 2X10A 4IEWA 1HDDC 3NWKA 4HYEA 3QPLA 4KL1A 2YU3A 1WMFA 4ISRA 3TQNA 4X6QB 4FTHA 1D3YA 3MFAA 1DZQA 5EWSA 3ZYGA 5LZ6A 1VBD2 1LEAA 2A3YA 1E3OC 1K61A 2R5YB 3VDXA 2M8EA 4AQSA 4YRDA 3COAC 3P9IA 3AP7A 2X9DA 3I54A 5FJHA 4ONUA 3NJYA 1G8XA 2R32A 5A7WA 5CIRA 1V5GA 1CAUB 1J0RA 3BT9A 2WZR3 2P2KA 3OEAA 4H14A 1SZBA 5FTTC 5FPXA 4IEXA 3QOEA 1C8M3 2W1SA 3IAS2 2C9AA 2DVBA 2VIXA 4C1WA 5AFBA 1BEV3 3K51A 3LSMA 2A3WA 1Q1HA 2R7DA 4Q4V3 4G9SB 2PAMA 4Z1VA 4IHYA 1W9TA 2XF7A 1WCUA 3I4IA 3MFKA 2H8WA 4OHZA 1QHGA 4LG3A 3TBDA 2WFF2 1TQIA 4NRPA 3DFGA 1LEBA 2YB7A 1HQNA 4XC9A 1X8MA 1IDYA 4G94A 1LGNA 1VQOI 3QU3A 4KWUA 4LBLA 2FE3A 1WKMA 2XJRA 1BK0A 1AWCA 4FBFA 5FZ4A 4FFFA 3K75B 4LK6A 1H88C 2HVRA 4IL7A 1AYN1 4LE4A 4P1WA 2JWTA 4QT6A 3RWKX 5AC92 4KMFA 2HWB2 5J40A 1LFPA 2L9LA 3MF9A 2FD5A 4G7HF 1I39A 1K12A 4HA8A 2YU9J 2CO5A 2LRPA 1XB4A 2HZDA 4AVSA 4PFPA 4GD4A 3AG3H 1GZTA 3APBA 4AUXA 3AJZA 3NO8A 4Z07A 5JLWA 1V5EA 5APAA 2F4PA 2JN6A 3FUOA 3ZKYA 2DA4A 3VBSC 2ZX4A 3HKZA 1X1DA 3T0DA 4HBNA 1AR81 4IEVA 2K9SA 3CZUA 5FKNA 4FPLA 5ICCA 3ZN5A 3VZKA 1HXS3 2LD5A 1F2NA 3SKVA 5C71A 4RS5A 1VBA3 1W6PB 1JH5A 5L7OB 2OS2A 5LHIA 2OA2A 2DVDA 5JDBA 4KWJA 4GB32 3KQ4B 5LBEA 1OPCA 2WLPA 2BFUL 5KHGA 1RUD3 1O3RA 2DOEA 4AZZA 4ASKA 5CFDB 2FBEA 3GTLJ 1QZEA 2XF6A 1I3QJ 1K7AA 2ZTNA 4L0PA 1MS0A 4RA0A 4M00A 4OQ9A 3VUOA 4IEYA 5TSWA 4XNFA 5IATA 1UU6A 4MOAA 3CEWA 3UJQA 3HRTA 4XF1A 4XF9A 5A33B 1ZELA 2VECA 1S2EA 4ZZDA 2FDFA 5L3CA 2YU2A 2Z69A 2HWVA 2EA4A 5D8KB 5K7FA 2K9LA 2ZKLA 1JHFA 3LEKA 3LSDA 1JBCA 4GH4A 2PX9A 2VQUA 2QM3A 2PHFA 3CUQA 3GZEA 4MGSA 4EJRA 1LRHA 5BXXA 1Q3EA 2ZNZA 4XDQA 1PP7U 5B4XA 2NNYA 5HBAA 2V5YA 4EQQA 3FBYA 4CEWB 2A3XA 1B35C 1O4ZA 2CWEA 2DYCA 1Z7S3 3H36A 2A6EF 1RHI1 2LOOA 5IVFA 1XOYA 4LG0B 1RUG2 4M0NA 4O61A 1YFXA 4WVMA 4RYDA 5L9VA 2JMWA 3TB0A 2RN7A 2BBYA 4ON0A 5FD6A 2JENA 2L7KA 1IV6A 3KZIC 4BACA 4MQ9F 2W85A 1TEIA 4FXGB 1K6OA 4II2A 2HI3A 1V0AA 1V6IA 4QPGC 2QEXI 3HBZA 3AX4A 1PO12 3OS1A 2OV7A 4FFHA 1Z05A 4KFCA 3EPZA 2IXJA 3QU6A 2D3PA 1GV2A 4LBKA 4B29A 3KP3A 3LA7A 1JT6A 1Q8PA 2BW3B 5A1LA 1S5LC 2WY8Q 4W6YA 2Y6HA 3K2AA 1RITA 1DQ4A 4L5EA 2Y69H 1HDKA 3M3IA 2HBUA 4YW6A 4ENKA 1YYNA 3N05A 1CONA 2ADEA 4HVQA 4YZ4A 2W46A 2DA3A 3M4OJ 4DYRA 2HQNA 3LIGA 1MZFA 1YLLA 3IIAA 5IT9K 4PQQA 2HOTA 3K10A 2HQ5A 2J5PA 3U10A 1B4AA 4JX0A 4P08A 5D5VB 4ENJA 2KIQA 5FPZA 3U0ZA 2W91A 4ZHNA 1XYNA 4LO5B 3TEZA 2NYXA 1UZZA 1DQ0A 4IV3B 4G6TB 2W57A 1I6HJ 2VODA 3CMAI 5JMOA 3VYTB 4IESA 2E33A 1PX3A 2WZR2 2P6TA 5HI0A 1R22A 2JA5J 1OBNA 3VBHC 4COWA 3RPUD 3NV3A 3DYPA 2ZFUA 2B4KA 4Y22B 1TME3 3NV2A 4Y5TA 4O6JA 1BLZA 1D4M1 4HL0A 2X29A 4G12A 3VL9A 1O6UA 4B43A 1GDTA 4K7JA 1ZK8A 1OUSA 5DDJ2 2XJVA 5FZ6A 3W59A 1RKTA 1V6OA 1UOBA 4Q4V2 1B9MA 3U21A 5IP6A 1L3JA 4ENNA 3O1VA 1ULDA 5LGUA 3RKWA 3OYIA 5CKNA 2XB0X 2JX9A 2DVGA 2MG4A 1EPWA 1B8IA 3RYRA 1N3QA 2QENA 3PUIA 1MMGA 1NTCA 3NAPC 1PHMA 1UW8A 1RGSA 3J81Z 5JI7A 3H5AA 3LSHA 2E2JJ 2F4LA 2NXNB 4HNTA 1Y56A 1DGRN 2R49A 1O8PA 3ZKUA 1J3PA 5C33A 2DCJA 4B47A 1Q8OA 2VQGA 5BPXA 3LSGA 3R0RA 2ELHA 3M3CA 5A7PA 2ZCWA 2WAAA 3SZGA 4D5CA 1G9AA 1OR7A 3PIPF 4ZZ8A 1HRI1 2W5FA 2HYXA 2X09A 3VHPA 2I07B 1B9NA 2P5VA 1WQ2A 2GNDA 1FJLA 2RS33 3ASNH 3O8HA 3FXMA 1DPRA 1OXCA 4NWVA 4V1PA 1AXYA 4A4AA 3OYMA 1SG3A 4CDUA 1HXS2 1ZG5A 2WZ8A 5CEHA 1SLLA 2XBO2 3DXTA 2CWSA 2DTZA 4COZA 3JBG1 3VBRC 2PHLA 4FQZA 1H6XA 2Q8KA 3AXEA 1HKSA 2R041 3PUFA 2IA2A 3MEPA 5BYNA 4BXUA 2BY3A 3HPHA 1WW5A 5B2GB 2ZGRA 4PJLA 3QCWA 5GLUA 5DAVA 1O4YA 4JKMA 1Q8VA 4U0WA 2PMZA 2RREA 2SLIA 3ZP5A 5DQ0A 4X8PA 2V26A 2RR13 2VW2A 2VLAA 3C7HA 2BY0A 3OYAA 3E5QA 3SCGA 3LA2A 4A3FJ 1RUC1 1Z78A 4AVPA 2F5EA 1QBJA 3H7YA 1D8JA 4QPIA 5F3EA 2Y60A 2ID6A 3MAJA 1WCDJ 1TLHB 3KFWX 4XJ9A 2JIGA 3Q9SA 2QFEA 1AOYA 4KA4A 1HRV2 1L7LA 3ZMZA 1UO9A 3P5BA 4GXLA 3I3BA 5ACA2 3IHUA 3RTRA 1S72I 1W99A 1ENRA 1LU1A 2K85A 4BJ5C 1FWZA 2JPCA 4TWTA 3WDXA 1YNAA 3Q9VA 1W8WA 1MS1A 1U9NA 3PUHA 2XLFA 1ASJ1 1YHQI 2BOLA 1Z7S2 1RPWA 3MKWB 2H0VA 2NQYA 1K5MC 4LJHA 1W0OA 4C2UA 1WKYA 2K27A 1VRH1 1H8TA 4AEKA 1H1AA 5HODA 1QJY2 1PUFB 3MZ8A 2L7FP 3VBFC 1LHOA 2YHJA 5GALA 3RZLA 1OQEA 2WB1A 3T8TA 2R92J 1TMF1 2DPUA 5JIAA 3Q0UA 1RUJ1 1YRNA 1W6MA 3LKJA 3JB4C 3HNYM 1I27A 4MLOA 3AP4A 1BKZA 4FVVA 2A6ZA 5J1UA 1O3SA 3C8XA 5A2QK 1G2HA 2R061 2B46X 2JDMA 2WSUA 1JYXA 2A69F 2OZUA 4UFMA 3F8FA 4U7DA 4BDVB 1U5TC 1EPZA 2WRAA 4HETA 1BI0A 4B09A 2V09A 5I91A 1ON2A 2VBPA 1NYWA 3BQYA 1YO5C 5D1IA 4D7TA 4AG4A 4XOGA 4TSVA 4RGSA 3K4LA 4ASLA 4MXWB 5LD2C 5DD8A 4AI9A 4CDXC 3EETA 2Z4FA 2ZS6B 5C3EJ 5A6QA 3RS6A 2GAUA 3G2BA 4S05A 4HVOA 4JQFA 1CAWB 1JGSA 3V0BA 4NN0A 3FHQA 4LIUA 2KQRA 5K7ZA 3RSJA 2DJIA 4XUQA 2DBNA 5T3NA 2B7YA 4KQ7A 4RHV1 4AWDA 1JGGA 1RXGA 2CDOA 3J7HA 3FMGA 2VNOA 1YITI 3ISPA 2AO9A 2R7TA 2NMOA 1A31A 5HCHA 1SD5A 4K3UA 3JQXA 2ETEA 2YFZA 3AYDA 2WAOA 4D7SA 4LLGF 1YW9A 2X48A 3I8TA 5JZGA 1G9FA 4QX5A 1NCRC 1SD6A 2HPIA 4LHSA 5EIYB 2W1UA 2R0FA 2BPA2 3G3ZA 2BYVE 4S2GA 5L9RA 3W58A 3FKJA 4XR6A 2YXSA 1BEV1 2R7XA 2VW0A 2VT2A 4BMBA 2GP3A 4X6RB 4C3IJ 2Y34A 2VXDA 1MMSA 4MEYF 3TOJA 4AHZA 2OAZA 3F95A 2BY1A 5F6KA 2DMTA 3KV5A 4HLTA 3KQRA 5ICEA 5FFOC 4QDQA 5JXGA 3H1MA 1Z6RA 1YE9A 3ECOA 4BQ2A 2LBFB 4HNVA 4YVWB 1R36A 3EDPA 4UV9A 3X29B 4XJZA 5KHIA 5FWEA 2BU9A 2UY9A 2VT3A 1NG0A 3WW4A 5FK7A 1ZZ7A 1WA4A 3PTYA 2P3JA 4AFCA 5F2WA 1CVNA 3MLJA 1YJ9I 1LKXA 5E89A 2RMU3 2PN5A 4IV1A 4K9SA 4DXTA 1R58A 3QP5A 2ZHLA 3H1CA 5BNGA 1MQTC 1NXD1 2YGLA 2MEV3 1K78B 2VC0A 1V9U1 3GALA 2XC7A 1SFUA 3LDBA 2RGVA 2ZHKA 3WLUA 3WXPA 3HJRA 1R4NB 3PNYA 2CV0A 2DCYA 3LEGA 3RZZA 4HPKA 5CYVA 2ZXQA 2UU8A 2IT0A 2HXIA 5C3PA 4Y1ZA 4FPEA 1BN5A 2L2OA 2G4IA 4BA6A 3WODF 3F23A 2CYFA 1BJQA 1HQCA 2XOMA 4ZS3A 1ZRCA 1VBA1 1YC61 2C6SA 3J4UH 1OQYA 3AG4H 4CP0A 2GALA 5FFXA 1QJZA 2WNVB 4QX1A 1JUIA 2QQ9A 2A5ZA 3KM5A 3LSTA 2QKLB 4BHBA 3GYDA 1VB2A 4Q4Y3 1HB4A 2DMQA 3ZXLA 1SANA 2QE3A 5FUIA 1GOHA 5CFCA 2R073 1RR8C 2JIJA 3U4XA 1S9HA 1QZYA 3B9CA 5DZEA 3WTXC 3BU0A 3B6AA 2X8KA 2VJJA 2QQUA 5IAXA 2ZZQA 3AAFA 5CISA 2ID3A 3ZFGB 3WDUA 2RS51 1ETOA 2HWD3 5FLXK 4YG6A 3MW3A 1POV1 1PK6B 1U0AA 3CO2A 1SLTA 2KLOA 1WPKA 3ZQFA 3VV1A 1D0ZA 5ICGA 2DBIA 1F1ZA 3JTHA 2HWF1 4L18B 1QOTA 1OUXA 1MZBA 2L3DA 1WLDA 4Z8BA 4ZZLA 5ABJB 4UW6A 2ET1A 1PGSA 1T39A 4JDOA 4ZU4A 2JTVA 4E4DX 3A4UA 5F3IA 3EYPA 3KP5A 3S0MA 4Q4W2 1ZRRA 5BPIA 2WWYA 4A3KJ 1GXPA 1V4RA 1PZ7A 5C3SA 3PUSA 3UNPA 4YW5A 4UBHA 3R60A 3VDDB 2P7VB 3WF2A 3VDAA 1W4MA 3JCUC 3KETA 1W5SA 1DGWY 2DYSH 2P4EA 1MBJA 3KCXA 4A3ZA 5FRAA 5C4XJ 3VD4A 1RVF1 2NAZA 3LB9A 5LGNA 2QYOA 3CF5F 2DCTA 3O6BB 4IJAA 4KIGA 1SFXA 1LOGA 3FL7A 3O2PE 3RYPA 2XUMA 2XAUA 5LBCA 3VBSA 3L00A 2WBKA 4LORA 2R6QA 4BLJA 1LNWA 4CTEA 3OF1A 2EZLA 1Y4WA 2DUQA 2CS3A 2VPRA 2Q0AA 1HLCA 2GNBA 4FCAA 4LUMA 2I5UA 1WCMJ 3I5UA 3MZHA 3GTGJ 2V6CA 1SVLA 1EF4A 3D8CA 4JQRA 5JCTA 3FXKA 5TJJA 3HBKA 2GQQA 2LLKA 2WWSA 1PO22 3UV9A 5GAHJ 3A22A 5IVBA 5HNFA 3SYTA 3E6DA 1Q56A 3ZX7A 4EZHA 4HX7A 4RFRB 3AZYA 4XN0A 3CHXA 3RQ4A 2FNAA 5D6EA 4RFT0 5FO8B 4O5VA 5LBQA 4FPOB 3PO2J 2W1OA 3SISA 2JB4A 2EZHA 2OQ7A 1SACA 2ZMNA 5J09A 4XRSA 3ZR6A 4D3WA 4QLCU 1JI8A 5L7OC 1ZARA 3DF0A 4PCQA 4XLHA 1VE0A 1BIAA 1IXRC 1R082 1PVXA 3ITQA 4KN4X 5F2SA 1GVDA 5FJKA 1YOVB 5CFDC 3CF2A 2MH2A 1GP4A 1HW2A 1MBGA 5A7NA 4R4ZA 3MW2A 1QJU1 3OGJA 4HN0A 1IV8A 2VZ3A 2XRLA 3OOPA 2EFQA 2CTVA 5BUVA 2Y6KA 5JMCA 2FUG2 4BJTA 2XB6C 1WLWA 1LTEA 3PVNA 1H0MA 1B35A 2VJIA 5FY8A 4QX2A 1K3IA 2ZXJA 1W06A 4XLNF 1AX1A 2UXNA 4TLFA 4W1UA 2PQSA 4HQMA 2A71A 3WEZA 4F3JA 5IVVA 3ME2A 3OYWB 4WM7B 1IN5A 2B7EA 1RXFA 4QKDA 3S14J 1BJZA 4DZJA 4CEWC 1XNCA 4QPGA 3MZYA 2QQJA 4MADA 1O4XA 3QYFA 2O1QA 4ZU7A 2QGUA 1OURA 4DRVA 1WLCA 4A3LJ 1P7JA 4QQHA 2FBKA 3S8PA 1QDCA 4A7YA 2E2HJ 3BJAA 3G1LA 2P8TA 2EV6A 3O0VA 1YQ5A 2VH9A 4D7NA 4Z2YA 1ENSA 2ZXHA 2HWE2 4YFXF 3CJRB 1C5IA 3BG9A 3DEEA 1AL23 3HOSA 1DYKA 1H89C 1OD5A 1E5SA 4ESJA 4QB6A 3IT8A 2JUGA 2VZ1A 1NXMA 3FHZA 2K5CA 1GZWA 1MMDA 4A44A 2CDPA 2R7VA 1G9DA 2ZX3A 1FTZA 4M6XA 3GMEA 4U87A 2CFOA 1QF3A 1R64A 4XVHA 3KWVA 3E1SA 1X4PA 4BQ5A 3OR2C 4OWRB 3DECA 3Q8FA 1UY1A 1I5ZA 4AI8A 2A5YB 2MYSA 4BOWA 3J7ZI 4Q4Y2 3WGIA 2JWPA 1Z91A 4B1RA 2QWWA 1OYIA 5HLIA 3OD0A 4CPBD 2LFBA 3PSFA 2R072 4SLIA 4Q4X1 2FBHA 3FDYA 1JYWA 2ET7A 5J8CA 5FMOL 1ZQ3P 3VBHA 3HOUJ 3GW2A 1FYMA 1VQPI 2EJRA 4ZJZA 2HWD2 3FHAA 2VUMJ 3NNJA 1UCRA 2OX0A 2MPFA 2EALA 3NL1A 2VKVA 2VQCA 3BKZA 4IV3C 4HXCA 4J6GA 1I9RA 3FK6A 1NQDA 1SEFA 4FE4A 5FD5A 3MIGA 2KDOA 3LZZA 4YG3A 1EAH2 1TTYA 1PM4A 1VIWB 1RUH2 1VBC3 3CC7I 3L2QA 2FQPA 5AONA 4AW7A 5EGOB 4CGZA 1GSLA 4LMYA 3VGIA 3SITA 1WJBA 1HW1A 3EMRA 4Y1VA 1ZH5A 3QPTA 3KYLA 3NAPA 2JDZA 2AZ5A 4GMP0 4N0BA 4JRAA 1W8TA 1WH7A 2YG0A 1XNAA 4Y5Z0 3HUGA 5FKMA 4XSXF 3PNVA 1RUF1 1F4AA 2VY0A 4DXRA 1BZWA 3WG2A 3OYHA 1BJAA 1AR92 1MBHA 1US2A 3GEZA 2FF4A 1FT9A 3PFYA 2H8RA 3BOQA 3CMEI 2HYGD 2QQ8A 4C9YA 1WJ5A 3VYRB 2KKOA 2BRTA 4MG2A 3KB5A 4MUVA 1PMIA 3NKTA 2IS6A 2WWJA 4ZDLA 3PIOF 2GM4A 5L3DA 1CGPA 1OA4A 3P7NA 1Y3TA 4ZTFA 4KISA 4HF2A 3WF3A 5FZIA 3SH5A 4Y26A 4AEDA 1U8BA 4ES8A 2VMFA 4AC0A 3MKZA 1AHSA 2GNMA 4RLFA 4ANJA 2YC4A 1PP8F 2CSOA 1KU7A 4DW6A 3BIWE 5EEGA 3L2YA 2QVSB 1D0YA 1WI3A 3VZMA 4P14A 2ELKA 1JYCA 3VOEA 3ZO0B 5IT9Z 1SVOA 4OHWA 4IGQA 3S57A 1JZ4A 1PVEA 2XHKA 1V70A 1WMDA 4J00A 3L2UA 5I0SA 3L9JT 4PIZA 1WGXA 4ZS2A 2VUJA 3AVRA 4CCKA 5FLJA 4I99C 4CZZA 4PIYA 3ZFEB 1OOPB 3BZ6A 3KP2A 1RTVA 2CUZA 4QDRA 1D2QA 3AMHA 5EZGA 1NG6A 4XUTA 1LDKB 3PQJA 3NARA 2Y0SA 2JDYA 2VCBA 4NPRA 4CCJA 4JP0A 4WCGA 3S6PA 2CFXA 3WY6A 2VE8A 4QKBA 4RS8A 3JQWA 2E2IJ 3DKXA 1XS9A 2WS91 1LKNA 2IGMA 3ECQA 2P34A 2CRGA 5FYVA 2VVDA 5FJ8J 1BBYA 4ZYDA 1XPXA 4UUSA 1IHMA 1P4XA 2B0LA 4RQPB 3N4MA 1AR63 4AXOA 2UZKA 3U9GA 3PL0A 4LK0F 4LMFA 3HTUA 1Y9QA 2J1VA 5DZGA 4XEZA 4LB6B 5D4RA 1UZYA 3UGHA 3OBAA 2XVKA 2M3AA 1O3TA 4N43B 1OA2A 4WF2A 5FZOA 1K5MA 2PJPA 5FKLA 4I30A 2ZZJA 1H4HA 1QJX3 3TBIA 4XABA 5L3FA 1PVC3 1UIJA 3M8FA 2R5ZB 2D5FA 1R092 1W05A 3VBFA 3R4SA 1S0IA 3L2WA 2BFUS 3URFA 1J09A 1KDKA 4Y24A 3K69A 4AFDA 5LK7B 1JTYA 2F5FA 2TCTA 3IWFA 4FPGA 4XLFA 3W6JB 1DLLA 2EV5A 2D5VA 1VBD1 5IYCJ 2YU1A 2M9HA 3GBWA 3CC2I 2CUEA 3HRUA 3ERED 2RMU1 2YMZA 2PYTA 1KJLA 3W2VA 1Q8QA 5E17F 2XWJB 2E53A 4JGYB 4G4FA 4E4SA 4BQWA 1U5TA 3GHMA 1MJ9A 3IH4A 3ON7A 4KG8A 3T4HB 4AI3A 3BG3A 4DBRA 1QNYA 2HGCA 2R1DA 5E6HA 2NPIA 1SAXA 4A0ZA 1OCTC 3BR3A 5CVUA 3PNTA 4BEHA 4GALA 4AFBA 5FYBA 1BBT1 2CL2A 1RNLA 3CQOA 5KC5A 4XCAA 4CDXA 3BPZA 2V1XA 1WI9A 2EXJA 4G6QA 4NBQA 1C3HA 3GCWA 3I2OA 3DEMA 1DYOA 4I3GA 2NVYJ 1HBXG 3V7CA 3KVBA 1JU3A 1JUPA 1AU7A 4ISQA 4GYIA 4GYGA 4LR4A 3ULQB 3TN93 4II3A 4NB5A 3N9NA 2BV6A 3HM5A 4GFBA 1TW3A 4HW0A 2CV1A 3T08A 2BEOA 4LBQA 1H2LA 5HPOA 3OYLA 5LA0A 1J3QA 4YZ5A 1IOAA 5DMYA 5JR2A 5M5YJ 1B59A 1A8DA 3ZOBA 1NCRA 3FMRA 1QA6A 1Y1VJ 3IIIA 5B66C 2HH9A 1S7AA 3PFIA 2KMUA 4CO8A 2QUFA 4R8HA 2XH6A 4E8CA 3C7JA 2BERA 4C8DA 3BPVA 3KGZA 2A61A 1WBFA 1MSEC 4IRGA 2Z16A 1W90A 4BB3A 4TN7A 2X5IB 1CIWA 4PBOA 4KGQA 1YQ8A 3FLRA 1RB8G 4WXHA 4QQLA 5DUUA 2VONA 1PIV3 3K4AA 4XN3A 1O8SA 1R1UA 3M3YJ 1NK3P 3G73A 4RBOA 2GA1A 2B45X 2HU9A 1QH7A 1W8OA 1F8VA 1FAYA 2XAFA 1FPQA 3O1SA 4GB31 4L5IA 5DCMB 1FLIA 1XD7A 1RJ7A 3V0AB 2VNGA 1LULA 1MPXA 1YFYA 2BW8A 4HF0A 4BBRJ 3QQAA 3DTEA 3QD6A 4M9ZA 4ESFA 3G1MA 2OCEA 1P4AA 4YVWC 2HTJA 4I3PA 2ZA9A 2VQTA 2LSOA 1MQTA 5GZDA 3DLLF 1LJ7A 4B4PA 2ZXIA 3V7RA 4Y13A 3GFMA 1F43A 3JREA 1L7RA 5A2QZ 1XNKA 2DURA 1XE8A 5A70A 4YELA 2EQRA 2QCSB 5H9SA 2OC6A 2X1CA 3FLTA 2D6OX 2YS9A 5FDBA 3IRQA 3RZKA 1FY7A 1LE8A 1VQ7I 3AMMA 1DFQA 2FOWA 3ZM8A 3TRSB 1Q5OA 3FF5A 4PDWB 3GJAA 4KICA 4A3EJ 3TP3A 1QDOA 2DW4A 5A3WA 5FYSA 2GIZA 4PF5A 2CW8A 4E2QA 4RB2C 3E0JB 5D5XB 1OJLA 3FFZA 3BJ6A 3ZFFB 4R52A 4UFJA 4ZYHA 1NZIA 4CXYA 1EP0A 2VB6A 3FZ3A 1IS4A 4FTEA 2GSYA 2AXLA 2X05A 1KD7A 2RM22 3R4UA 3N35A 3BP8A 4CP9A 3FXJA 4AVZA 4H0EA 2WNVC 3JR9A 2NS7A 1DGRA 2JECA 3VDCA 2R5YA 5CNAA 2WO7A 4PJNA 1AR62 4Q4ZF 3ZXJA 3OUIA 4LEJA 1H2MA 4ARXA 2K4JA 5L3EA 3IL2A 3WF4A 2EVXA 3LSKA 2W47A 2VE9A 2LF8A 4IRHA 4XDOA 3SKJE 4PGHA 5GZGA 5T52A 4IGPA 4WX9A 4F91B 1OF3A 4U7BA 2EA2A 3ZFGC 3FE5A 3FXUA 2QVOA 4CSWA 1PK6C 3SXYA 1T56A 4AYUA 1PVC2 3KLOA 3WNKA 1Q1VA 3B01A 4K21A 1OLQA 3VN4A 4XOPA 3LGRA 1DG6A 4EROA 2LP0A 2AEZA 1O4TA 5LHGA 5ABJC 5FYUA 3UK9A 1OF4A 3DCQA 2Y38A 1T6GC 5FYTA 4IQPA 3GF6A 5JPMB 4DUXA 2CGOA 4M3BA 4CCMA 2WA3A 2BUKA 4HT1T 5FIXA 1MS8A 2M2EA 3KF5A 1ULFA 3H3ZA 3TO9A 2PG4A 4XBNA 2IRFG 2BY2A 3PJYA 5DUVA 1W7PB 2KJCA 3TGNA 1DF0A 5C4WB 4UFIA 4JX5A 3AYAA 1SQ4A 4CCNA 1JT0A 4IOAF 4QDSA 3HGGA 3BTJA 1U5ZA 5F04A 3CL1A 2XVCA 5LA9A 3H8UA 1AL21 4XBFA 4BJ0A 4ZC3A 4UW3A 4BPZA 1D5YA 3A02A 1Z3XA 2E7TA 3N97A 2M87A 1JOBA 1COV2 4R1HA 3OY8B 2VC1A 2LY9A 4AI2A 2GOXB 1WSUA 1F5JA 1D1BA 3VB2A 4B7EA 1P92A 2J42A 1STZA 4FPYA 3Q3SA 5IK7A 2ENRA 1U9OA 3UKTA 3ASIA 3FN9A 3KZ4C 3CMMA 4CRQA 2RJ2A 5FZ3A 3ACHA 3ZDVA 3BOWA 2L7MP 1W6PA 5L7OA 2WV0A 4Q0SA 5D8AB 2JD4A 1KGSA 1QO0D 3MPBA 2X6OA 4M4PA 4META 5BV6A 4XOTA 1SMTA 4I09A 3O1OA 4KI5M 2ILMA 2QQBA 1US3A 3LL7A 4FHTA 3BB6A 3W5MA 1LOFC 4URTA 5CFDA 1YW7A 4HG6B 5FY4A 1X82A 3HOXJ 1FMD1 3DWLE 2EAKA 1NLQA 1XDSA 4LOTA 2R7EB 1S29A 1H9WA 2V5DA 5HV0A 2HQRA 4RM3A 2C9KA 5FLHA 3ZYIB 3L7WA 1HSTA 4L9VA 1CQ9A 2VUCA 5A33A 1J83A 4D6SA 3W21A 2NVXJ 2PHDA 3TOBA 3BPXA 2UWBA 3RDIA 4QM8A 3VEPA 1AJOA 1UMHA 4ESBA 4HK8A 3OBZA 4HSLA 1FPN2 3UESA 4H7MA 4XFFA 3VZJA 1PZ9A 2MBFA 2ZJCA 4M3EA 4YFZA 2V9KA 1SFNA 2HOEA 1WJEA 3NRUA 3CP8A 5IYDJ 4CU7A 4A69C 3JRAA 4CEWA 3W9AA 3GCXA 1ONAA 1W2OA 2ZBJA 2XROA 4QXCA 2JT1A 2W39A 3GTQJ 3EUKL 4LG0A 4F83A 4N9HA 5L3BA 1JJ6C 4OUSA 3NAUA 4Q8KA 1S55A 2RS13 2X6XA 2K46A 3W3CA 2TBVA 5BNQA 5FZEA 3PVEA 3MN2A 4WM7C 4Y20B 4XORA 1N78A 2VVFA 3H0GJ 2CV6A 4P5YA 4E9KA 5T5OA 2A7AA 3JD73 4RGAA 3SEEA 1IUFA 1HRV1 1TQ5A 4AFAA 2FQ3A 3HOTA 2Q1ZB 3IAM2 1LOAA 2ZAAA 5ACA1 1OT5A 1O7LA 4RGXA 3PVBB 3USSA 2BW3A 2YGMA 3SFZA 4P9LA 3RSNA 5GJ6A 1G9BA 1WFXA 4Q1PA 2ZGMA 2GN7A 2KFDA 2XLGA 4CCEA 2EIEA 4FQ4A 3E6CC 2YX7A 5T5PA 4WWCA 2Y48A 4BMEA 2B9VA 1GZ9A 1QJY1 2Y8KA 4KIBA 4CU6A 4HLXA 3WTWC 5T5JA 5LW9A 4KT5C 1QWRA 1C4RA 1WGPA 3W2AA 4C0HA 4H3WA 3OYCA 3WG9A 5DXDA 3ZOIA 4PZJA 3IRRA 2LTNA 4DYCA 4PBPA 1ZR4A 1YI7A 2A6YA 3BTXA 2W2IA 4Q27A 3A01B 4IV3A 4WM8B 4IHVA 2OD5A 3AZWA 4ZH4F 4IW3A 3I2KA 3JRIA 4UXAA 3OCPA 2M0CA 4OOIA 2WSVA 4QWQA 4XACA 4Y22A 5C5TA 1RYYA 3BG7A 2OQRA 1F5TA 1BIBA 1FEXA 5F64A 3POJA 4JK1X 1BVP1 2E1NA 2AH2A 2PHRA 1AX0A 1EA3A 1TC3C 4P02B 3SQNA 3KV4A 1OPOA 4JGZA 3CZ6A 3IM0A 4BIOA 1WJAA 4J19A 4V2VA 5M0TA 4CE8A 3AKTA 5KVRA 2OCCH 3VKFC 1QJX1 3KT1A 1IPSA 2XGEA 3POSA 4EN9B 1U12A 2V79A 1OHFA 1X58A 4A3JJ 2GBYA 1XSRA 1R9TJ 2Q8DA 4BY1J 2PHWA 4H2AA 1R1A3 2P3KA 1ZG1A 4L0YB 2ARBA 1W8ZA 3K4NA 2M45A 3B02A 4QX0A 1D1CA 1ZZCA 3HMYA 1ACIA 3D0JA 5CQGA 3UKVA 1S6LA 1IJWC 5TGTA 3W6VA 4L8QA 2VMGA 1CIYA 3BDDA 3OGSA 5FMCA 2D93A 4JCKA 4LJZF 4UVBA 1ULPA 2P17A 1FMWA 1ZKGA 2XGXA 5B5EC 5KHJA 3FLPA 3CDZB 2MW8A 3JRBA 3FMQA 5FPVA 4EM0B 3TEYA 1PDNC 2ZKZA 1FXZA 1HQLA 3J81K 3WOGA 1Z7UA 2TEPA 4LHKA 1GICA 1OMIA 5FP3A 4WK8F 2PBIA 1MNDA 2ZAHA 4XFCA 1HB1A 4NQWB 4YGBA 5A6ZA 2PAKA 2I2SA 2DFEA 4UOJA 3BCWA 3OD4A 5LB6A 1F9NA 5J4YA 4IL6C 5HS7A 1AYN3 4QPYA 1LODA 1KXGA 5LCWL 2R7SA 1U5XA 1GOFA 5F5AA 3HN1A 5E1WA 1UOGA 2NM1A 3I4PA 2G19A 2DYRH 3IUOA 1Q8SA 2BBAA 2BNOA 2ZNYA 1VP6A 4E4ZA 1MNMC 4INDA 3UGGA 4IEPA 4NC7A 4FPFA 4GWJA 5E18F 3IAPA 4EM2A 3GX4X 1RUI2 3EBRA 5I0DA 3WW1A 2YV8A 2QTWB 4HSRA 2IGKA 1FTTA 3O5SA 1A36A 3ZXSA 2FQ4A 5FCCA 1KQRA 4PCRA 3S7EA 2KRFA 1N1SA 3ZFEC 1OOPC 2VMIA 5FUPA 4JYKA 4A41A 1OCZH 3QPSA 1JZ7A 3MV01 1XXNA 4ZPIA 1RC9A 1FV2A 4HPQA 4IX7A 1W3XA 5FRNA 4HSJA 2QZ8A 1H9TA 1JUSA 1CQTA 4BXSV 2Q30A 5GLTA 5A1FA 1XCVA 4DEQA 1DGWA 3WHBA 2P5KA 2W48A 4FP3A 4FPCA 3E1F1 3D82A 1QHHD 3RJRA 2RV9A 2FOKA 1ZA7A 3F8MA 1POV0 4RQPC 3N9OA 1HN1A 1EV12 2Y26A 3V64A 4XMYA 3PJRA 2DCEA 3OY9A 2ZGQA 3HXLA 1YEWA 1DLCA 2DAOA 1LDDA 2X85A 2VJXA 2ZJPF 1XE7A 1W36D 4V2FA 3FC0A 3VL8A 3EYYA 3ZDSA 4XILA 2LALA 4LO8A 5BNNB 5FQ0B 4YVSB 3CCQI 2WAFA 2RS12 4ZY9A 2BHZA 2P5LC 4LKEA 3JUUA 1PUFA 1O7FA 4XLAA 3NWTA 2CY6A 2YBPA 1S0BA 2P1BA 2WR9A 1ZGJA 3JD72 2LMDA 2UV1A 4HNUA 2LK2A 4DIQA 2DTRA 1VQKI 3HIFA 3SCHA