1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
3CUQB 4PDKA 2P8TA 4EJOA 5EZWA 2HOEA 2F5CA 4HLTA 3FMSA 5D5WB 4KA4A 3BWGA 2GWRA 4ASNA 4XF4A 1F5TA 5CJ9A 4HVOA 2FBKA 5F6FA 2LKPA 4JV4A 3FMQA 1G3TA 1T0FA 3EQEA 1BM9A 3WTUC 4KMFA 1J2XA 5JHUA 3FHZA 1XRUA 4IETA 4YARA 1RTVA 4E2GA 3GFJA 1EP0A 3EJKA 2XRNA 3BPZA 4XETA 5LLQA 4G6DA 4U7DA 3K1NA 3HYIA 2L4AA 3F72A 1LDKB 4P9GA 2M5WA 5BXXA 4IEVA 4WZCA 1CAUA 4P9UA 3LAJA 5LHHA 2STWA 3ZMTA 5FCCA 5FFXA 1FYMA 5K5OA 1OD5A 1I27A 3HUGA 5E1XA 4AD9A 5BOXA 1IXSB 2FEZA 3NJZA 4OIQF 2VBXA 2QNKA 1EV7A 4GCVA 3QACA 1ZZ7A 1HQCA 2B5HA 3LA2A 4UVCA 1RL3A 1Z1DA 4LUMA 1JXSA 1XD7A 3DXJF 1Z91A 4L9JA 1R1VA 1MDMB 2XLFA 2YX4A 3E5UA 3F6OA 1EY2A 3UKVA 1T2KA 2UY9A 2STTA 1QPMA 1O3SA 1O3QA 3KEOA 5FGMA 3J81Z 3MDPA 1W7PB 3M70A 2BV6A 5I0RA 1JHHA 1J75A 2E1NA 1WRJA 2Z9OA 5J48A 4EM1A 1ZGJA 1SMYF 3IC7A 5TJJA 4JK1X 1YUDA 4RS8A 4AIKA 1Y9QA 1SFUA 3MAJA 1BIBA 4EQQA 2LF7A 5FPZA 3F6VA 2Z5UA 5ILSA 2HTSA 2O1QA 5JFRA 2ACJA 5I8TA 2DBBA 1ZARA 2O0YA 5F64A 2MNGA 3I54A 2OD5A 2FXAA 4XFFA 3PFIA 3ELKA 2F5EA 5FO5A 1RNLA 5FLXK 4M72A 2QLZA 1P4AA 5DDGA 1IRFA 1PM7A 4XF1A 3CUQA 3KFWX 4MQVA 4OIPF 1SFXA 2ZFWA 4HW0A 1LDJA 1P6RA 1BN5A 3VODA 1H1IA 4Z07A 1YS7A 2QDRA 2L3DA 3KE2A 1BI1A 2P4WA 2O8QA 2KIFA 3U11A 1ZG1A 1OKRA 3KP2A 3QAHA 1XGNA 5LGTA 2A6EF 3D5LA 1LR5A 2PQ8A 3HHGA 1YQAA 1FPQA 2XKOA 4A12A 5CADA 4LD5A 4EM2A 2XAQA 1YFUA 3RPUA 1H9GA 4YIIA 4L5IA 3P7NA 1IUYA 4J1XA 2L01A 3KCCA 1ZHFA 4G7OF 1KYWA 3EYIA 4LB6B 2Y0MA 3EUHA 2BBYA 4MTEA 2M30A 3WODF 1FNNA 3GFLA 3FE5A 1J7KA 1K78B 1U78A 2K4BA 2A5YB 4HF0A 2ESNA 1KQ9A 2KIUA 3T8TA 1U5TA 4ESFA 3DPLC 1TLHB 2H6CA 4N0BA 4XBFA 5EEGA 1V70A 5E1RA 4TV7A 2GA1A 2PTMA 1I5ZA 2O03A 3HT2A 4MEYF 1QNTA 4I0AA 3WGHA 5LHGA 2KRFA 4BHPA 3GZ6A 4KWJA 3BALA 1OI6A 1U2WA 5DYMA 3DFGA 5HLIA 4HZFA 4WVZA 1W7PA 3QOPA 3CJNA 4CICA 4AIJA 3K2ZA 1YFYA 3ML6A 1MJAA 3M8FA 4Q48A 2EFOA 5BV6A 2YX7A 3USSA 3KGLA 4L11A 4M73A 5L3DA 4JTNA 5LRSA 4XEZA 5CYVA 4DQ2A 3E3VA 1UCXA 1ZNPA 2IRFG 1UPIA 5E8GA 2HR3A 3BROA 4ZYEA 4NVPA 2PHLA 6PAXA 5CU1A 4B09A 4BHCA 1L3JA 2UZKA 3WG9A 2NRAC 2DCTA 3U1DA 3NQOA 3J81K 1CGPA 3ZQ7A 5DCMB 1BBYA 3RTRA 2IXIA 1ZG3A 4LK1F 2DTRA 1WKMA 1D5VA 5AVPA 4HF2A 1ZLJA 3LA3A 4LLOA 1JGSA 1PP7U 5D5UB 2QBYB 3FZVA 1R7JA 1XE8A 1RUNA 3E6DA 3KP5A 2JPBA 2FBIA 1I6XA 3IRQA 3ZPLA 4LA3A 4UBHA 1SMTA 1GXPA 2YU3A 4D0PA 2VT3A 2EA4A 4AWXB 4QGLA 3BPXA 3TDZC 5JSRA 1ZAOA 1Q1HA 1BOAA 4Z82A 4LA2A 3SMHA 3KETA 1A04A 3CUOA 3SHRA 5BMZA 3GUDA 1D3YA 3KGZA 2IA0A 4ENJA 3HSFA 1X82A 3EO6A 3K69A 3BY6A 3WTTC 1DPUA 1O7FA 3R0AA 2P7CB 2IJLA 2EK5A 2Z99A 1ZZBA 2UWMA 2F4PA 2LDUA 3G7DA 4M6XA 3SCGA 3ERED 4PJYA 3HTSB 2XL9A 1EPZA 2CAUA 3WW3A 3H1MA 3LWCA 2I45A 4IJAA 5KHGA 4A0YA 1R22A 3WTWC 2DPDA 1IN7A 3DPTA 1PP8F 4L9TA 4O9EA 1X7NA 2P6TA 2XV4S 2EB7A 4RB1A 2VC1A 2ADUA 3HTUA 2BNNA 5I93A 4NB5A 3W6KB 1ZH5A 2PLYA 4XFBA 3PLQA 2QQAA 4LEJA 1CAWB 2OPKA 2ISYA 3IL2A 1IZ1A 1J3QA 3WW1A 1XGOA 1P2FA 1IPKA 4PZJA 1VP6A 3VEPA 4I02A 2X0LA 1R1UA 1FY7A 2BNOA 1H1MA 2XGXA 1H0MA 1YFXA 2D1VA 1BI3A 1SFNA 4M74A 2DLLA 2BGCA 5H6RA 5E18F 4HSLA 5KHHA 4HDVA 2CV6A 4WX9A 4LLNA 3O2PE 5JSOA 2ZXJA 3I7DA 5FD5A 3R4KA 2HEOA 1KGSA 3RYPA 3OD0A 3WU0A 3NL1A 5C8WA 4IEZA 2H0VA 3LQQA 3Q9VA 3LAGA 2Q0AA 3DQVC 3L09A 3FHIB 4JBAA 1XN7A 4IEXA 2HZTA 2LNBA 2VE9A 2JTVA 3DV8A 3FM3A 2PMUA 1I1SA 1SD5A 1CAUB 4A0XA 2DK8A 1OMIA 2XAJA 1J9IA 4FAHA 3R6SA 3S2WA 3HT1A 1LB2A 2ZMEA 5HDGA 3IRRA 2QJVA 3R60A 3U0ZA 1RUOA 2HJIA 1IN5A 1MJBA 1NYWA 2Z3YA 5L3CA 3U9GA 4BNCA 3BDDA 1YHFA 3OOPA 2K02A 3P9KA 4KIGA 2V1UA 5BPDA 2ET7A 2LF8A 3I5UA 4AIHA 5L3GA 2Q8KA 4A5MA 2VC0A 4UBGA 1IXCA 1NZCA 5JI6A 3BB6A 4P55A 3VHRA 5FLJA 2FF4A 3MWMA 5E1WA 4Y13A 2M87A 3V7SA 2V9VA 4MQ9F 2M45A 1ZN2A 4RAZA 4CXFA 5CLSA 5ILUA 1J0RA 2HQRA 2ZO4A 1J58A 1FC3A 2RKHA 2VECA 3WTSC 4AXOA 2P5LC 3GFIA 2EV6A 4HX7A 3BPVA 1FP2A 4LGWA 2E7WA 5L3BA 5BUVA 3OGJA 1S6LA 3M8EA 2J5OA 4XFCA 5J3UA 5CVIA 2VN2A 5E8IA 4Y17A 1FBUA 5BY5A 2ZKZA 4LMYA 4DNCA 4I01A 4OMZA 5LHIA 4EJUA 2VOPA 3G3ZA 2ETEA 1TQPA 4WK8F 3B73A 1UW8A 1VR3A 4R52A 1YFHA 1S8NA 5AIPA 1H9TA 2M8EA 4H0EA 1SD7A 2H6BA 5HS9A 5BS6A 3GBFA 4RGRA 3FM5A 4IVNA 4HLYA 3C3WA 4KU7A 1QWRA 3CO2A 1FP1D 3KZYA 1GHCA 4J1WA 1Z6RA 5HDKA 3H9AA 1X3UA 3TNPB 5HS8A 3V8LA 4EWAA 2P7VB 2PI0A 5D8KB 3I4PA 5HDNA 4HA8A 2O8XA 4HN0A 4F7ZA 5DUIA 4GO1A 4WXCA 1XMKA 2VQAA 1YW8A 2GC3A 4BXUA 3IDBB 3U2RA 5HLGA 5JSPA 1EH8A 1F1ZA 4XSZF 2JT1A 1YIOA 1U5TB 2EV0A 1DGRA 1FSEA 1TBXA 3S7IA 2VT2A 3CLOA 3QP5A 4YIFA 5FD6A 4QX5A 1ONVA 1QZZA 1JE8A 4L0YB 3Q5FA 4IRIA 2OBPA 2DI3A 1UIJA 3ZMVA 3ZDSA 3E97A 2DFIA 2CG4A 1DP7P 4KU8A 2D5FA 3PNAA 2Y0OA 4N9HA 2ESHA 4HBNA 2RDPA 3RZZA 2XUBA 4IRGA 3L7WA 4U7BA 3WTYC 3FXQA 2IXHA 2CO5A 5I8SA 4I3PA 3TQNA 1HW5A 4LTAA 4M9ZA 2KKOA 1CAXA 3K1MA 5IT3A 3FXRA 3PQKA 4UXAA 4X6RB 2WV0A 1Q3EA 3TNQA 3M3IA 4EJVA 3NRVA 1IN6A 1HKQA 1USTA 3REOA 2HKXA 3E6CC 2DT5A 2JPCA 4Q4ZF 1J59A 3LA7A 5E20A 1YO5C 2Q1ZB 1FWZA 4CZZA 4HOBA 5CVUA 4MV2A 3D0JA 3IBMA 4Q0SA 1T98A 2MLGA 3JTGA 2P6SA 1G6NA 2K86A 3F3XA 3SCFA 5LGNA 1WLTA 2W24A 1BIAA 4BH9A 4IHTA 2W25A 4KWKA 4TLFA 1Q5OA 3V8JA 2OZJA 2G7HA 2QM3A 3SQNA 2A69F 1IW7F 5J8FA 2F5DA 4X6QB 2XAHA 4UUVA 4EWEA 1HBXG 1LQ1A 1RC6A 1UCRA 2PJPA 2OQRA 4Q0VA 1YW7A 1ZX5A 1J5YA 3IKVA 4OLLA 4KFCA 2IPQX 2B9UA 2QCSB 4OIRF 1KA8A 1D8KA 4HX8A 2EJRA 1YFWA 4EM0B 4EWDA 1W7PD 2QENA 3ZN0A 3MZHA 1SQ4A 2O61A 1OYWA 2E7XA 1E2XA 1WWXA 4YFNF 2NS0A 3H8UA 2K4JA 3OCPA 2EFPA 1GVJA 2V1XA 3TGNA 3L2HA 3BOQA 3HRTA 5J7MA 2V6CA 4R8HA 5KHJA 1Z6TA 4MGRA 2OA2A 1HSTA 1I1GA 2DW4A 2ELHA 4ESBA 5L3EA 2Y75A 4LLGF 4KICA 4HYEA 4PCQA 1KU2A 1DUXC 2G9WA 2Z2SB 5CVRA 3OV8A 4LG0B 3QU6A 3S7EA 2UY8A 4M9SA 2KJBA 3KP4A 3F8CA 1G3WA 1XSVA 4BIFA 3JSPA 2HDCA 2NNNA 3WE3A 1YG2A 2XLAA 4FBFA 1YLFA 2H09A 3UKNA 5BPXA 2Q0OA 5FLIA 3FJSA 4L5JA 2IA2A 4NHJA 2EWNA 5E1ZB 4F8AA 3AAFA 4UNOA 4MZUA 4LUKA 4HBLA 3WGGA 1R36A 1DPRA 2K0GA 1QY4A 4EROA 4HDUA 4XFGA 1YS6A 3W6JB 2XL7A 1YW9A 3IIAA 4ONUA 3MZYA 4MGZE 1ZREA 3ISPA 2RV8A 2GIVA 3NKTA 4WWCA 3GYDA 2ZNYA 3TDUC 4EMSA 1DZTA 1JUHA 1HW2A 4IEYA 2FQPA 2XAGA 1FT9A 3LFKA 1NXMA 4IEQA 1MKMA 2C6YA 2MBFA 1QXRA 3ZN1A 2EA7A 2D2WA 2L4MA 2OA4A 3FX3A 4MGIE 1G3YA 5LEKA 1G4DA 2GC0A 1IAWA 3KLOA 2ZMEB 2EV5A 4Q0QA 3B02A 2DAOA 4G9YA 2LSOA 3RKYA 2Y48A 1HSJA 1R1TA 2MH9A 4YFXF 3RKXA 5DEQA 4EGYA 1FXZA 2L02A 4QXKA 1LJ9A 2VE8A 1WGPA 3WE2A 4BAYA 1FOKA 3BU7A 1S3JA 3ECHA 3CEWA 3RI4A 4IPAA 1IF1A 3F23A 4MX3A 3CF6E 1F4KA 1FI2A 4G7HF 3JSOA 3QRFF 3WTZA 1HW1A 2GC2A 1TQMA 1Z7UA 2NNYA 2RNJA 3TO9A 4RB2C 2KXLA 4YG2F 5FPXA 2H27A 4QMAA 5HLHA 2DO7A 4CHUA 4AQ6A 1JHFA 3FXUA 1TW2A 2EFQA 5DD8A 4YFKF 2GXGA 2UYAA 3I59A 1FBSA 1Q43A 4LG0A 4ORFA 2W57A 2IP2A 1LEAA 2QQ9A 4LB5A 1PMIA 1R58A 4IESA 2P5VA 1UB9A 5AIQA 2WC2A 2ETHA 2PMHA 4MH0E 5K5RA 4ZU4A 1K6OA 4XF9A 3DL3A 1FZPB 5KVRA 4PGHA 2A6HF 4KMUX 4ENMA 1E17A 4MTDA 2COMA 2MHFA 3JZVA 4WXDA 3R0JA 1SD4A 4GYGA 2R7DA 4KYWA 4CYDA 2IA1A 4A6EA 5DV5A 2CFXA 3F22A 2QVOA 2RQPA 5LGUA 1KU3A 2UXNA 2X4HA 2N7GA 1ZGAA 4EV0A 1CAVA 4ZYGA 4U0VA 4XFAA 4A6DA 2E1CA 3MFKA 3DP7A 3JW4A 1BJAA 3LSTA 1TQIA 1ZLKA 3MQ0A 3M1EA 3RYKA 3SXWA 3LWFA 1V4RA 5DUKA 1AOYA 2XASA 4META 3O3KA 1TNSA 3KMHA 3WGIA 2OQGA 3O6BB 4HMZA 3I71A 2ZKLA 3GWZA 5KK1A 2IXJA 3IWZA 3OTFA 4ZU5A 3LOIA 5ILVA 2ZCWA 4UV8A 4MUVA 3M7GA 4LJZF 4DINB 1ZZ8A 3J7AO 4NQWA 4RB3C 3EBRA 1G3SA 5KHKA 1R23A 4O5VA 4L9NA 1LNWA 2GXBA 4KIFA 4KN4X 1ZZCA 3ELNA 4PIYA 5TRDA 1O5UA 1O7LA 3HRSA 1PDNC 2PA7A 1XSXA 4L0ZB 5HVQC 4IEWA 1TNTA 5EEHA 1XDUA 4CDGA 2D45A 2Z69A 4KN7X 1O3TA 1STZA 4YNIA 1YLLA 2YR2A 4CGZA 5FLHA 2PEXA 2MA3A 1TTYA 4I09A 4Z2YA 4QLCU 4HX4A 1YTYA 4MHGA 5EFUA 2VBZA 3EDPA 4O9GA 2C0ZA 4AQ2A 5FB2A 4UVBA 5K1YA 4OMYA 2L54A 3CUQC 1V3FA 2XIGA 3P9CA 1CAXB 1ZRDA 2XKPA 4HQEA 4A2UA 2XHKA 3U10A 2V09A 3CL1A 1W5TA 3KP6A 3TO7A 4UXNA 1IXRC 2IXCA 3GO5A 4UHTA 3V7CA 1YWKA 4LLLA 3N97A 2QUFA 4OFGA 1Y3TA 1W4MA 3G73A 2GA2A 3CO7C 1XGSA 1L3LA 4RB0A 3ZMDA 3LZZA 1J3RA 4IERA 3RKWA 2IXLA 4R79A 4HVRA 4MGKE 4YRDA 1ZYRF 3WW4A 1O4TA 3HOTA 2VOOA 4M71A 4ETSA 1BC8C 1U3EM 1CF7B 1QO0D 4IRHA 5HI0A 3SZTA 3JAMZ 1T39A 4JTOA 2QYOA 2BEOA 2BE5F 2IC1A 1U5TC 1EH6A 5FDBA 2GC1A 4FHTA 5D8LB 2V1DA 2IXKA 1ZZ9A 1DGWA 1ZRRA 3ST7A 2FBHA 3M9AA 1F9NA 4Q5SF 2YPRA 1B4AA 3IWFA 1O57A 1ON2A 5LBQA 2MPFA 2P17A 4E2SA 3GLXA 4HV5A 2GU9A 1MD0A 1W5SA 5H6QA 2FE3A 4E2QA 3QPTA 1IN8A 1SD6A 3SZPA 2R7FA 2GZWA 2ZJ2A 4EGZA 1XCVA 2UYBA 1T38A 3J80Z 2VBYA 5L3FA 4OOIA 5D4SA 1K79A 4HN1A 1GQGA 4ZYDA 2FMLA 5K5QA 4H7LA 1P92A 1FYLA 3VOEA 3HRUA 4WXHA 3GW2A 2K9ZA 1Y0UA 5D5VB 2HFHA 1LDDA 1XE7A 1ZVFA 1ON1A 4MGYE 3KP7A 4WCGA 1NHAA 3D0SA 3HSEA 4AVAA 4JQFA 2DK5A 1BI2A 1NE4A 1XSDA 1YYVA 2K7LA 1RIOH 5ICCA 2CW0F 1WSUA 1S7AA 4XLPF 3FWEA 1KYZA 1XCBA 5D5XB 4G8XA 4HSJA 5ED4A 3FMRA 4ZYHA 2D1HA 2OZ6A 2IVMA 3BZ6A 2HTJA 2IW5A 2MD5A 3E6MA 3ABTA 4YYOA 4GGGA 2PG4A 2FNAA 2XLGA 2QZ8A 4IEUA 1B9NA 4LK0F 3COAC 2FMYA 2VXZA 3C3VA 1RZ4A 1RGSA 2B8MA 2QVSB 4U0WA 5FQ0A 4XF3A 3H7YA 3C18A 3LQRA 3H7JA 4QGNA 5I0UA 3HIFA 3I58A 3ZMSA 3BCWA 2RGVA 1IN4A 2V79A 3D82A 1CF7A 2DQLA 4FX4A 4KT5C 4OU0A 4XF0A 4AVPA 3WU1B 2AXLA 2F2EA 3ES1A 1SFEA 3ECOA 3S0MA 3WTVC 1BI0A 3V4GA 3ZP5A 2VODA 2F5FA 3VB2A 2VPVA 4D7SA 4HVQA 3K1PA 1OPCA 3BP8A 1B59A 4WBBA 1NE6A 3O14A 4Q29A 1KQ0A 3NVCA 5ICEA 3H3ZA 3T1BA 4FAGA 5LEJA 3K0LA 3ULQB 2CQKA 2QQBA 5BQTA 1T6SA 4IF4A 5D4RA 2Q2EA 1HKTA 4U88A 3EHKA 4ZZDA 3DN7A 3H92A 3I64A 3V7RA 3RYRA 3C1DA 1B1BA 4ZZLA 5JVTA 3QP6A 3PQJA 3JAMK 2RN7A 2EVXA 2CSOA 4XFHA 2MLKA 1P4WA 1GQHA 1UHWA 4GYIA 3RJPA 5CVJA 5JAXA 1U12A 4G94A 4JVAA 3QPHA 4MNUA 4RGSA 1C0WA 3BJAA 1Z9CA 1XMAA 1J1LA 1ULYA 2H94A 5IT9Z 2Q4SA 1XGMA 3EETA 2A07F 1R5GA 3I59B 4GULA 1MDMA 2PBIA 4P9FA 3F8FA 5JR3A 4O6JA 2O3FA 1DDNA 1REPC 3J80K 3I0TA 4UVAA 2FRHA 5E16A 1PUEE 1ZRFA 4L9VA 3I53A 1LKNA 2ZNZA 3VFZA 2OYZA 1XDSA 2HYGD 3KP3A 2OAZA 3KLNA 1XB4A 1LEBA 2HYFA 4QWQA 3HRMA 4A5NA 2B0LA 4QM9A 2CYYA 1UHMA 2MC3A 3H1WA 3L2CA 5A2QZ 2ET1A 5FFZA 4IEOA 2R3SA 1HKSA 4ON0A 3BJ6A 2PQQA 1IPJA 2PN6A 5ICGA 4RGXA 2CGPA 2PFWA 2D93A 1WA4A 3IHUA 4P96A 1WI9A 1ZZ6A 2WWYA 1IRGA 2XVCA 1TQ5A 4RD7A 5E17F 1CAVB 1UD1A 2YSRA 4HQMA 3H50A 3F8NA 5DD4A 4S04A 3NEUA 1B6AA 1WQ2A 4HF1A 4ENKA 4XSXF 4XLNF 4L2NA 4KNYA 5D6EA 5I91A 3E6BA 1GXQA 2HWVA 1MGTA 4A0ZA 3DKWA 2JRTA 2BYVE 3EYYA 4ENNA 4Y15A 4KIBA 2PHDA 1DZRA 2FA5A 1KU7A 3MPBA 5ERIA 3T5XA 2IT0A 3H3UA 1OYYA 2M1BA 5J8CA 2AS5F 3FFQA 4L18B 2W84A 4YSFA 1Z05A 2EAAA 4AVCA 2RC4A 5D6FA 1OR7A 4KL1A 4B8XA 2DPUA 3F21A 4B29A 1U6GA 2RVCA 4KUMA 4XRFA 5BPIA 1RI7A 1QXJA 2D40A 2Q30A 1ZG5A 2EFNA 1HXDA 3ABUA 1R5HA 4EJTA 1VJ2A 3ACLA 4AVBA 3GZ5A 1KQ8A 3GFMA 2ZBKA 4PIXA 3UKTA 3T0YA 2WTEA 3CLPA 1UIKA 3ZMUA 3DEUA 1K78A 4QGMA 3MYXA 1X8MA 2VBWA 2CWEA 5JR7B 5ICFA 3IDCB 3CDHA 4LFUA 3T8RA 4OIOF 3MCZA 1S29A 4K2EA 3N4MA 3KSCA 1EH7A 2OZUA 3F8MA 3Q9SA 3F8BA 1P4XA 1KU9A 4U0YA 2FNPA 3HQXA 2NYXA 2FOKA 4G7ZF 4IXAA 3TO6A 2E9QA 5JCTA 2GQQA 4Q0UA 3ROUA 3TKYA 4ZH4F 1U8RA 2CAVA 2JZYA 3LAPA 5F1RA 4I7HA 3ES4A 2QWWA 4I98B 5H20A 3ETQA 3QU3A 3FZ3A 1FX7A 4I2OA 1L0OC 2FU4A 3OF1A 2D5HA 3WW2A 2P5KA 4WF2A 1X8EA 4D7TA 2W85A 4IEPA 2GH2A 1FSHA 3HOSA 1EYBA 1OFNA 2K27A 4BYYA 2G7UA 5IT9K 3FF5A 2A61A 1AWCA 2KJCA 2FSWA 5DCFA 4EVIA 1TW3A 3E5QA 3MEXA 3GYHX 2XROA 1QBJA 3GVAA 4OINF 4RGUA 3RPQA 1OYIA 2PAKA 3GX4X 4S05A 2JSCA 1SAXA 5DCMA 2DQRA 1CX4A 2DU9A 4BHBA 2PFBA 2GAUA 4GXOA 3SFZA 1O3RA 3GXOA 2QBYA 4M6YA 4PGGA 1J3PA 4MEXF 4EJWA 5A2QK 3HHHA 3L00A 4PIZA 2ISZA 1VTNC 1QQIA 4R1HA 1O5LA 4Q0PA 5LRRA 3E5XA 3R61A 2MH2A 4CO8A 5K8SA 3V8KA 1QGPA 1S7OA 3GF2A 3K9TA 5D1IA 3C7JA 2HGCA 2J5PA 4KWLA 3RDIA 3P9IA 5I0TA 3NW4A 2KIMA 3JTHA 2UXXA 2OU2A 2PAEA 4XFIA 2XAFA 1BC7C 1ZRCA 5HS7A 2PAMA 4KDPA 1FBQA 2A68F 3KEQA 3TOBA 1B9MA 5AONA 2BNMA 1K7AA 3TOAA 4P5OA 3SCHA 4G6QA 3WTXC 4Q47A 1USSA 3RNSA 2VONA 4ZU7A 3CTAA 2TDXA 4IHSA 5J6XA 5I0SA 3CJXA 1LVAA 4RAYA 3H1YA 3CO6C 2EA2A 4BQAA 4N9IA 2FQ3A 1ODDA 1QZYA 5FLXZ 3DF8A 2HQNA 4I0BA 5I8YA 3BJOA 1MJ9A 2WFPA 1D8JA 4E70A 4UV9A 1SEFA 3L9FA 2A3SA 4LULA 5CVVA 4FX0A 3NSTA 1MZBA 3KZZA 1UFMA 1FYKA 3HSRA 2EFWA 4K8FA 2PYTA 2NAZA 4O3MA 1R00A 4FT8A 1FLIA 1LRHA 4ESJA 5T3NA 5FQ0B 1CAWA 4M9XA 4QM8A 3EQLF 3SHFA 5HOOA 2HS5A 2ATFA 4HAMA 3RIRA 3GEZA 3ZMZA 2Z33A 3PVBB 2HKOA 2O6GE 5C6CA 4HV6A 3IKTA 5KHIA 5KBFA 4HLXA 3SXYA
chains in the Genus database with same CATH superfamily
4PDKA 1AR61 5EZWA 3ZQLA 1W6MA 5F5AA 3NWTA 4PQ9A 4NHMA 3WG3A 4ASNA 1AR71 3BU0A 4BIOA 2FBKA 5F6FA 4YZ3A 1JHJA 1IC8A 1JKRC 1IKQA 5FRAA 5C8CA 5JLWA 1IRZA 5IPAA 1U5YA 3EQEA 3WTUC 1QRYA 4DRRA 4YARA 3K75B 3VBRB 4E2GA 4RQPA 1EP0A 3B5LB 4W65A 2XRNA 4XETA 4G12A 1RHI2 1S2KA 3P6BA 3LDBA 2XJUA 3HYIA 2MEV1 3POEA 1W0UA 2M5WA 2DYCA 4WZCA 4ITCA 5HCFA 2QQVA 4JDOA 5FCCA 3CCLI 4R9CA 1I27A 3MIHA 3N9QA 1ZRIA 1QPIA 1OPOA 4YZ4A 4IV1B 1H4HA 4N53A 3V0AA 5F27A 4OIQF 4GCVA 3QACA 2C26A 4XCBA 3S3NA 3K4MA 4CPBA 4LUMA 1XD7A 3ZQIA 1CQTA 1R1VA 3E5UA 2PHTA 2X29A 5A6QA 2STTA 4QDQA 1O3QA 3KEOA 1CR7A 1N1VA 3POWA 2AREA 2E1NA 4FP3A 3UETA 1AHDP 4EM1A 3HM5A 4XJ8A 1W99A 2M3AA 1SMYF 2AZ5A 3GTMJ 1URXA 2F6CA 4N7IA 4BPZA 1MACA 1STMA 1W2NA 5DDJ3 3TP3A 4PSWA 1ZBE1 3S2HJ 2YPDA 3ZXGA 2W9XA 3WG7H 3KZIC 5I8TA 4EATA 4BQ5A 2RG4A 2MNGA 3OS2A 3JQXA 3MV11 4LMFA 3OBRA 3ELKA 2TEPA 4XIKA 2Y8KA 2VZSA 3H42B 4B3NA 1PVC3 3A0HC 5F5QA 3ZYBA 5DDGA 4UW3A 3JB4C 1BN5A 1H1IA 4Z07A 4BE0A 4BE1A 1IUFA 2O8QA 3KP2A 2YS9A 3OY9A 2A6EF 4AFCA 1LR5A 4GWMA 2PQ8A 3K48A 2JDMA 1YQAA 4EM2A 5C9AA 2XAQA 3ZDVA 1UAIA 1Z7S2 3GJAA 1ONAA 3AM2A 1VAMA 4JKLA 3K77A 4MTEA 2M30A 1K5JA 3TN92 1PGL1 4QKDA 1J7KA 2MABA 5A32A 1GOFA 5FKBA 2K4BA 2X09A 2KIUA 3T8TA 4ESFA 3DPLC 3FUOA 2IGOA 2EXKA 2VR4A 5EEGA 3B7MA 4TLGA 4EJRA 2JJ7A 1BK0A 3S5QA 2B4KA 3WCSA 2VCMA 4NIAA 4GB32 1YIFA 4BHPA 2JD4A 2HOTA 1W36D 5HLIA 3VBUA 2JVGA 1SFPA 4XUNA 2Y2ZA 4E4HA 1P9QC 1W7PA 3QOPA 2R1BA 4OUMA 4HG6B 2VMHA 4UF0B 5GLTA 1GMMA 1EAH2 2V5YA 3ML6A 3M8FA 2V1NA 3MIGA 3EB7A 3VKOA 4L11A 2RS53 5L3DA 1BA5A 1VQ6I 5CYVA 5KXDA 1UCXA 3PL0A 2I8DA 2ZSHB 2HR3A 3BROA 1S72I 4A3BJ 1N75A 4MVTA 5CU1A 2XQXA 3WG9A 3VN4A 4MO7A 3CCQI 4LJHA 2VAUA 5GTHC 4E7LA 5EWSA 4ZKTB 1QOTA 3ZQ7A 1SACA 2BOIA 5FY8A 5FP4A 3HVDA 3VYRB 3AMNA 1D5VA 5L7OC 2QSFX 2FUG2 5FPAA 2ZGMA 3HOYJ 2EICA 4FPHA 1XE8A 1RUNA 2X6YA 3HAGA 2B9SA 3IRQA 4UBHA 4LA3A 4LQRA 1LEMA 3CESA 2YU3A 2W52A 3BR6A 2JG9C 5C3PA 2DA7A 5DPNA 3TDZC 5IHRA 1YX3A 4B44A 2XONA 3MI8A 1BOAA 4B7EA 3ASOH 3SMHA 5FZOB 4MFEA 3V0BB 2A6VA 4Y26A 4DXRA 4FQZA 4GH4C 3O12A 3DKYA 2IA0A 4ENJA 1R1ZA 2IEKA 3VBHC 3EO6A 3K69A 2IZWA 3ZO0B 2IJLA 4LNVA 1ZZBA 5FJ8J 2XF7A 4AE2A 2XMLA 4GALA 4E4DX 2D6OX 1PO12 3A2KA 4EE2A 3HEFA 4MFDA 2VZ3A 4PK4A 3WW3A 1F43A 1A5JA 5EGOA 3H1MA 4BQXA 3TOJA 5IVYA 2OJED 3SH5A 3NMBA 3HNYM 5KHGA 4A0YA 2VBPA 2JDUA 4K8RB 4S0HB 1C57A 2BZTA 1W8OA 4FETA 4L9TA 3RZMA 2P6TA 1PK6B 1PNFA 2PLV2 1OQEA 1G8WA 4XOPA 4FOQA 2W0XA 2K9QA 4CUGA 1ETKA 3DTKA 4NB5A 3W6KB 4M0HA 2PLYA 5IYCJ 3PLQA 2CUZA 3MEPA 2CU5A 3H0OA 3RZOJ 1XGOA 3I2FA 4DO0A 3VEPA 1BK1A 2G9GA 1LE8A 2L7KA 1AVBA 1X9TA 5JVGF 3PL8A 1BJZA 3K7AJ 4KQ7A 1TNFA 1Q1VA 2XGXA 1H0MA 1A34A 1YFXA 3A23A 4CZSA 1SFNA 5HCAA 2CV6A 4OHVA 3CDIA 3KV6A 3FLTA 4JX6A 2QQLA 2RS33 3NNFA 3GGLA 3HB9A 3R4KA 3A4CA 1KGSA 2KD7A 3NL1A 2HWB3 2VJXA 1JGGA 3HR9A 3WF1A 3TN91 3WOGA 4RQPB 1MMAA 3L09A 2OUHA 4XAAA 2Y69H 2HZTA 2LNBA 4QU1A 3FM3A 3CQOA 3ACFA 1S0GA 4KBZA 4A0XA 4XK4A 3U75A 3W2AA 2C1FA 4D6QA 1D4M2 3HT1A 2ZMEA 5HDGA 4OCTA 5JIAA 1MJBA 2AO9A 4CDXB 2Z3YA 2RJLA 1FMD3 5L3CA 3U9GA 4N53B 4NOTA 3IH2A 3OOPA 2OS2A 3P9KA 1XYNA 2WA3A 3P3NA 4UOJA 3U4SA 1Y9MA 2NOGA 3S1QJ 1HRV2 2ILMA 2KM2A 3I2OA 4CU7A 1QQP3 1I5PA 2Y31A 2Q8KA 3VDBA 1NZCA 2RMU3 4P55A 1X1BA 2FF4A 1KDMA 2IS2A 1NG6A 4RDUA 4BLIA 5C4WC 4CXFA 5CLSA 1J0RA 3VKNA 4RR3C 1J58A 3SITA 2X6OA 3ZN6A 1VBB1 1FP2A 5FWJA 2OC6A 5CKQA 4A69C 3BG7A 3DEEA 2BV4A 5KAFC 1U8BA 4JKKA 4WM8C 2ZKZA 4N8MA 4LMYA 4DNCA 4I01A 2EZLA 5CKTA 3ZYHA 3G3ZA 3E1SA 2ETEA 1SCSA 5JOWA 5J1XA 1UW8A 1VR3A 4IE6A 1YFHA 1S8NA 4IO9F 5AIPA 2M8EA 3CMEI 2IVJA 1D1BA 4HLYA 1KFUL 1FTZA 5A3PA 5G05L 5C9AB 4J1WA 2P3KA 3H9AA 4CCCA 4XQWA 4AFMA 5JI7A 2R4GA 3KLSA 4EWAA 2HZDA 1J83A 4Y22A 4HKLA 3WHTA 5HDNA 1NCRB 2WYSA 2WZR2 4F7ZA 1AR91 5DUIA 3LFIA 3O1UA 1ULEA 4YFWA 1FPN2 2VQAA 1PO11 5A32B 5B3SH 4NPLA 2GC3A 4A7YA 3K51A 5LB6A 2JK3A 3IDBB 1OA3A 3U2RA 1F31A 5HLGA 5JSPA 4C91A 1F1ZA 4XSZF 2JT1A 2O5RA 1JJ8C 4LO4B 4QX5A 1ONVA 5ACA1 4L0YB 5FJKA 3ZDSA 2BVVA 1S4CA 3I4NJ 1PZ9A 5FOJB 2XGDA 3PNAA 3FK7A 2M4KA 3VBUB 4HBNA 4ARXA 3CZUA 2R7OA 3WG2A 4CZCA 3HDDA 4U36A 3BGAA 1HXS3 1O8SA 3W5MA 3K4BA 4OMDA 1UZ0A 5I8SA 3TQNA 2D6PA 4ZDLA 4N7UA 4IE7A 4I3GA 1WLWA 3OYEA 2R0FA 2QE3A 4UXAA 4X6RB 4YRVA 2XJVA 1D0YA 4AI2A 1Q3EA 3TNQA 3U21A 4CCMA 4ZHNA 3BLYA 2QQNA 1JOBA 3L9JT 4N43A 3BTXA 3OMYA 2JPCA 4Q4ZF 1Y1WJ 2M0CA 1S9HA 1FWZA 5JI9A 4HOBA 1LEDA 4AAPA 3HPHA 3WLUA 2WFF3 1ZR2A 5FR3A 4Q0SA 2Z5WA 3AG3H 1T98A 2MLGA 2P6SA 4D9JA 1ASJ3 2VE1A 1AA7A 4DMIA 5LGNA 2HXIA 2R6QA 2W24A 1BIAA 2XF6A 4KWKA 2P3IA 4TLFA 4IX7A 3H5AA 4EEFG 2XGCA 1Y8RB 3BOWA 5FAXA 2G7HA 3WF3A 2QM3A 2PX9A 2E51A 1UOFA 2F5DA 2B45X 4B4QA 3WDVA 1EJ9A 4EWEA 1HBXG 2ZSIB 1UCRA 2PJPA 2P3JA 3J7LA 4Q0VA 5JXJA 1ZX5A 3WDUA 3ASIA 3IKVA 5EZGA 1VQMI 1FOD3 4KFCA 1GNHA 5BNOC 2EJRA 1OH3A 3ABZA 2RNGA 1S2BA 3VZNA 2O61A 2ZS6B 2E7XA 1HDDC 4XVHA 5EGOB 2BXZA 3I2DA 4AYBA 1B8IB 1PM4A 3LQCA 2V1XA 3TGNA 3L2HA 1I3QJ 2BWCA 4BISA 4JAAA 5JLVA 5KHJA 1Z6TA 3PJYA 1I1GA 5A7QA 2ELHA 4ESBA 2W95A 1ENXA 2NVYJ 4KICA 1MQTA 2G9WA 2ARAA 5CVRA 2XJQA 4ZXKA 4JRAA 2W7NA 1HB3A 3QU6A 4BGDA 5EJ1B 3GHNA 3PUAA 5FYCA 4XYXA 1LTEA 3MIEA 3TYJA 2M9HA 3VD5A 3J7HA 3WE3A 4FBFA 3U4XA 2DFBA 1YLFA 3OYLA 4GD4A 4AF9A 1SFKA 2EWNA 1H30A 5DZGA 2V26A 1COV1 4UNOA 1MSFC 1PGSA 5AC91 1UMIA 2VGDA 5GAEJ 4LUKA 1U0AA 4HBLA 1S0CA 2HEVF 4OVEA 3OYBA 1RUF2 3AKRA 3G6EI 4HDUA 1YS6A 3RZHA 2XL7A 1YW9A 3ABKH 2VMIA 3VYTB 2F17A 2RV8A 1XC5A 4A4AA 4UUSA 1QH6A 3NKTA 2WZR1 5CAZA 4QT6A 2ZAAA 2EIMH 5FXXA 3GYDA 2WO7A 2ZNYA 3MUY1 1DZTA 4EMSA 4Q4W2 2M7AA 1HW2A 3Q0WA 3HNBM 4IEYA 2XAGA 1FT9A 3LFKA 4C2TA 1GWKA 1MKMA 4R9DA 2C6YA 2EA7A 3ZN1A 1LOEA 3ZFFA 3N9NA 1W28A 2A5WA 4E6KG 4INDA 5LEKA 1G4DA 1IAWA 2J42A 2ZMEB 2RS13 4MXWA 1KZHA 4AEDC 4R9BA 3HL2A 3RKYA 1VALA 1QJU3 2MH9A 2D98A 2ME0A 3J8F2 3RKXA 5DEQA 3AL0B 2A3XA 1FNZA 1UZWA 2L02A 1LJ9A 2VE8A 4PLOA 1K61A 4XN3A 2DA6A 3ZN4A 2A6TA 3N36A 1F4KA 3UYJA 1W9SA 3NARA 2Y6KA 3SEZA 1Z7UA 2NNYA 2RNJA 4BDYA 4YG2F 3LEKA 3S16J 5FPXA 3TEDA 3O8GA 2Y6LA 4AQ6A 1JHFA 3H3VK 2VTFA 3FXUA 1TW2A 1MS1A 4JHZA 3AMMA 3I3QA 3ZN6B 3I49A 2H8WA 4LG0A 4A45A 3WD5A 3MF9A 4Q8KA 4OHWA 5J96B 5GLWA 4LHSA 1UYXA 5C8CC 3WP4A 4IESA 1S0DA 2ZXWH 1U5XA 3U78A 1B72A 3S1RJ 1CN1A 2GP3A 3B3QE 2VTXJ 3DL3A 5CFCA 5KVRA 2YHJA 1JBCA 3ZOBA 2UV1A 2DMQA 4ENMA 1E17A 4F52A 3O0XA 1PO21 3KVBA 4JX5A 4WXDA 1KFXL 4BY7J 1LODA 2R7DA 4KYWA 4CYDA 1SCRA 3F22A 2QVOA 2X4HA 5A7PA 2N7GA 3PUQA 4EV0A 4LITA 3W2VA 4YM3A 4A6DA 2X9DA 3MFKA 1L7LA 3DP7A 3PIOF 3I3LA 3LSTA 1TQIA 4N53C 1Y7BA 3BR5A 1W0NA 3LWFA 4Q26A 5DUKA 4META 1VB2A 2LTPA 1TNSA 3VBSA 2Z79A 3ZFGA 2OQGA 4J25A 3SEPA 3ZYFA 4ZU5A 5KK1A 4AVSA 5A1LA 4LE4A 4XQDA 4XXAA 5A3LA 2W1QA 2YXSA 3M7GA 4LJZF 4XOGA 1RMU3 2HOAA 4XTPA 1R23A 1W2AX 1RUG1 1ZZCA 4QX8A 4CDQA 1C4RA 2A6WA 4PIYA 5TRDA 2D3SA 1GR3A 3POJA 3KM5A 1XSXA 3OJBA 3KPHA 3OL3A 5HVQC 2YU9J 5JXHA 3L2WA 2D45A 2Z69A 4KN7X 3MGUA 3KYCB 1DU3D 1ZR4A 2M7BA 5FLHA 3VSLA 5JVVA 2NVUB 1UZYA 1TTYA 5FKKA 1PUFA 3NJYA 2VBZA 5EFUA 4EQVA 3K2OA 3IN9A 1Z77A 2C0ZA 1T33A 3ZXFA 1IDYA 4E7HA 4XUPA 5K1YA 4QIWN 1UJ8A 5JPNB 2XIGA 4Q4Y3 4HQEA 4D0QA 4QDSA 2ZTNA 3U10A 3CL1A 1W5TA 1JZ3A 5FMBA 3TO7A 3BT9A 3V7CA 5F0CA 4CDWA 5JWPA 2GA2A 1XGSA 4BBRJ 2XAUA 3NJXA 3OYFA 2IXLA 4ZPIA 1TNRA 5LCWL 5C71A 4R79A 4AEMA 4YRDA 1ZYRF 3GBGA 1O4TA 3HOTA 5GP9A 4YW3A 1NKGA 1UYYA 1OPMA 2JDPA 2Y33A 5FKLA 2X51A 2HPMA 4BQQA 3W21A 3BYWA 1LGCA 2LTNA 4YFZA 1RC9A 5D8LB 2IXKA 4CU8A 3VD4A 1UKRA 1W8TA 1HLVA 4BJ5C 3MLKA 1B4AA 3CCYA 4R4XA 3IWFA 1JT6A 1SG3A 3BODA 2ZHMA 3V56A 3DPRA 4E7IA 4HV5A 4JDMA 4ARYA 4DYRA 3MLJA 2FE3A 3VBUC 3SZPA 1Q8PA 2GZWA 1G86A 1XCVA 3WQ1A 4AZZA 4CDUA 1SLIA 3J80Z 1V6MA 1CJPA 3VD9A 2ZABA 2B46X 3CJQB 4LORA 4LHKA 4XXPA 1GQGA 3FISA 3MKLA 4ZYDA 2XBO1 1FYLA 4XUTA 2RR13 1NQJA 4WXHA 4TN7A 1RUI2 3NNLA 1VIWB 2HFHA 1XE7A 1U9OA 1HQWA 3D0SA 1ACCA 1KJRA 4D1QA 3O1PA 2K7LA 2XPVA 5ICCA 1WMDA 3PMSA 1RPWA 3LNQA 4E7SA 1YQ2A 4HPKB 4CTEA 2QQWA 1G9BA 4ZYHA 1XG1A 1CD3G 3KCYA 2VNRA 2OXBA 1NK3P 2IW5A 2VMGA 2JKBA 5FLMJ 4YGCA 4YYOA 2PG4A 3IDAA 4WM7A 2BTVC 2XLGA 2GALA 1SBFA 5A7SA 3KT1A 2R1DA 5LK5A 1UU6A 1B9NA 2VXZA 4FFHA 1S2EA 4QPGA 1JOJA 1QJZA 1ETQA 3S14J 3C18A 3D5SC 3LQRA 4W1UA 2DOEA 4QGNA 2BY0A 4UI9L 3HOXJ 1K12A 3GTJJ 1C8NA 1PX4A 5F8PA 2DQLA 4UUSB 4FX4A 2Q8EA 1RUE3 3IAS2 2F2EA 3WTVC 3V4GA 3AKSA 5FZDA 4H3WA 1BBT3 1B59A 3HC7A 1RUJ3 1GP4A 1GUUA 4Q29A 3QH6A 4UT5A 1KQ0A 1X4PA 3ZFFB 2DODA 3H3ZA 3ULQB 5IY5H 1LHOA 2QQBA 4DYQA 4XUQA 1T6SA 4MXWB 3MMYB 2GDFA 2X05A 2F4IA 3EHKA 4ZZDA 1FX5A 1V6NA 3C1DA 4EYUA 4ZZLA 5JVTA 3JRIA 1U0JA 4KG0A 1LHUA 2FBEA 3WHCA 3JAMK 3L2QA 5LA0A 1PNGA 1YI7A 4YELA 4U87A 1GQHA 4GYIA 3OOXA 4MNUA 1DQ1A 5DABA 1Z9CA 1XMAA 3H0GJ 2Q8OA 4NJ4A 1R092 2FZ2A 4KISA 2DA3A 4A44A 3HOWJ 3ZSKA 5BNPA 1MDMA 2PBIA 1FOWA 3HBZA 1X3WB 1B09A 2B63J 1F35A 4UVAA 5K7ZA 2RREA 1AYM1 1PUEE 1P7JA 3PUBA 4L9VA 3WHBA 5A33A 1LKNA 5D21A 2ZNZA 4M3GA 2JB4A 3BG9A 2AXTC 4LO5B 4QWQA 4A5NA 2UWBA 4QM9A 4FFFA 5FYUA 4GDFA 4IQPA 3ONQA 1OURA 5FZ4A 3GCXA 2E1MB 3B6CA 5E6HA 1NK2P 3ZXSA 3BJ6A 1FIAA 3PMEA 1D7PM 5FYYA 1IPJA 1RUC2 4RGXA 4P9YA 4XN0A 3IHUA 1ZZ6A 2XVCA 5DDJ2 3TB0A 4Q5OA 1VAVA 2YSRA 1UY3A 1VFCA 4S04A 2X5IA 1UOBA 1DP3A 2R7SA 4HF1A 4XLNF 5GZGA 3NAUA 3VBSB 4LE3A 4KNYA 1RUD3 3E6BA 1GXQA 5FZ3A 1QJY1 5HLTA 1R4NB 1H4GA 5FJHA 2HWC1 1OA2A 4NHXA 1PMHX 1PVC2 1KU7A 1J09A 4DIQA 2CU7A 2XPJA 1H1AA 3EMRA 4AGVA 2E7TA 2HWF3 3DGTA 3OYAA 4AVCA 1OR7A 1QEXA 1LKXA 2RVCA 4KUMA 1DBNA 4OZOA 1HXDA 3VPRA 2O7OA 1VJ2A 3ACLA 3BI3A 2Q1FA 1KQ8A 4AHWA 3DCQA 3GFMA 3UKTA 3HOVJ 2WTEA 2Y0SN 3DEUA 3GALA 3MYXA 1D1CA 3IDCB 1M1EB 4D7MA 3A1YA 4OIOF 3B00A 4PJNA 3W20A 4IE5A 3Q9SA 3N9LA 2DTWA 3LIGA 4IXAA 2E26A 2PHUA 3TKYA 3KD4A 4CUCA 2JZYA 1OD3A 4I7HA 3VKLA 3ZXJA 3ES4A 4BACA 1VBA3 1GKBA 2DYSH 5C3QA 3FZ3A 1FX7A 1UOJA 1V0AA 4FFIA 5F0HA 3J9SA 4L99A 1K83J 2NXNB 1AYN1 4EN9B 2TBVA 3OL4A 3ZMOA 3LE0A 4IEPA 2GH2A 2JIJA 4AAXA 4M0NA 2DDAA 2ZEWA 2KQRA 2Z4FA 2RE9A 4BYYA 4FQ4A 5IT9K 2P0WA 1BHGA 4ET7A 4AWDA 1WUVA 1IS5A 1QBJA 3J7YJ 3WINE 1DGRM 2RS52 4OINF 1GP5A 1OYIA 1S0BA 3UGGA 2KL4A 1VNDA 1XNCA 2PAKA 3GF6A 2YV8A 1CPMA 1CX4A 1R6RA 3DPRB 4HT1T 4X8NA 2V9PA 1S55A 1FOXA 3GXOA 3S1MJ 4QB6A 1E5SA 3IAM2 3L00A 5FKMA 4PIZA 4B1LA 4R1HA 1ZELA 3BIEA 4Q0PA 3R61A 2MH2A 2JXAA 2ZKNA 4QX7A 4WV8A 3NW4A 3X29B 2KIMA 2JA6J 3KYDB 2DA2A 2R7RA 5B66C 5FKOA 3DKXA 1IV8A 1R091 4QQHA 2XAFA 1ZRCA 4KDPA 5FZ8A 2COBA 3BR3A 1OCOH 4HL0A 4FOYA 1NCQA 3HUGB 3RNSA 1X2NA 3M3CA 2BHZA 4ZU7A 1C5HA 2R7WA 4N43C 4L8QA 2D3RA 3HXLA 4RAYA 3RZGA 5J3LA 2QFEA 2E31A 4Y5TA 1MH4A 1QZYA 3M4OJ 4Y4RA 4IL7A 4DB5A 5FIXA 2HQNA 3BJOA 1ZYBA 3N7LA 2W39A 4C1WA 2WFPA 5FPVA 3QPSA 3FHQA 4E70A 3PNTA 1SEFA 1G7YA 2A3SA 3AVSA 1RRJA 1N3QA 2GH8A 5HCBA 4FE4A 1MZBA 5GZDA 3HSRA 1RUC1 4K8FA 2PYTA 3BC8A 2JA7J 4RN5A 1LRHA 3ZXDA 4LKEA 5HNHA 4QM8A 3RQ0A 2HS5A 1JT0A 5CFDB 1V9U1 2E5NA 3GEZA 4QHZA 4GRIA 5A6YA 2YPJA 4RAGA 2O6GE 5DQ0A 4FXGB 3LCPA 1JW6A 1AZDA 4GMP1 3SXYA 4JOMA 5FRMA 2P8TA 5IYYA 2I07B 2F5CA 5IUQA 5FP8A 5FFOC 4KA4A 4P08A 2WBMA 3BWGA 4CYCA 3KYLA 4PCRA 4XKVA 4Y3OA 1QJX3 3KVAA 3FMQA 1T0FA 2CJJA 4LO7A 5JMCA 2RS32 1BM9A 3FXLA 1PYVA 1J2XA 3FHZA 1XRUA 4IETA 1V6OA 4GZ9A 3GFJA 1MQTC 1TWGJ 2C9KA 3BPZA 1N47A 2HWB2 4MHUA 1IO2A 3BCAA 5IP7J 4P9IA 1RUH1 3F72A 3T0DA 3WUDA 1IDZA 2X8KA 3H5RA 1JYWA 5BXXA 1CAUA 3LAJA 2WV1A 3A4UA 3WNXA 2VZVA 5K5OA 5APAA 1POQA 2CW7A 1R71A 2XGEA 4RS5B 1QH7A 3G6JB 5C3SA 4AD9A 1BW6A 1UMZA 1OOPB 5IFPA 1W2OA 1MS3A 2QNKA 1QHHD 1K42A 2B5HA 1Y43B 1RL3A 5FUNA 3DXJF 5BNPB 1MDMB 4DY3A 1H8AC 1CJDA 1OVPA 3UKVA 1POV3 1FMD2 4I99C 2PMZA 1QPMA 1PIV3 2MD0A 3M70A 5I0RA 1J75A 4UB8C 2NMOA 2Z9OA 1OUXA 1LENA 1XTAA 1X1PA 1O4ZA 5JDBA 3IC7A 1H6XA 4RS8A 3ACHA 4AIKA 5FZ0A 1CPNA 1AHSA 2RMU2 2ZX1A 4NIGA 5FPZA 4Q8LA 5F6KA 2NS8A 2VXRA 3WXPA 1S0FA 5JFRA 4F92B 4XABA 1ZARA 4K21A 1YC61 4IW3A 1GNYA 2EH3A 2R061 3PFIA 1D0HA 2WAAA 3CJIA 2X5IB 4XACA 3LIHA 4B8EA 1P4AA 4ES8A 4XNFA 3CUQA 3KFWX 4OIPF 5BNNA 5HXVA 4I0WB 3NNMA 4FPCA 4HG2A 3KE2A 1BI1A 4NC6A 4URTA 2W46A 2OTLI 1SFYA 1QOSA 2XOMA 1WW5A 1XGNA 5JZGA 2BVMA 3BR0A 5CG9A 1W39A 4S2HA 4WVMA 4JP0A 3WY6A 5CYYA 1BXHA 1YFUA 4OI1A 3RPUA 1H9GA 5L19A 4TZDA 1IUYA 1E3OC 1UX7A 4PJMA 1MZFA 1OCTC 1NY71 4DZJA 3EYIA 2BWAA 4LB6B 2XVGA 4XJAA 3RRDA 3C7OA 2R49A 4BS9A 1RVF3 3CKHA 1FNNA 1WD3A 2LD5A 4QB1A 1UY0A 3GDBA 4UAPA 2WY7Q 2JKXA 2OPWA 2RQQA 2ESNA 4B3XA 3M07A 1U5TA 5DG1A 1TLHB 5CFCC 1QXPA 4IV3B 2GA1A 2VZ1A 1YRZA 2AENA 4DGWB 1QNTA 3KF3A 3M3QA 1VRH3 3O1VA 1BR1A 5F7UA 1PVEA 3BG6A 5LHGA 1F5JA 4YVWB 2X48A 3ZLIA 1ZA7A 3BALA 3EUAA 1OI6A 1U2WA 3ZQHA 1XXNA 2ELJA 3DFGA 1DGRN 1NA1A 4UFHA 4HZFA 3CJNA 5L36A 4Z8BA 4CICA 2A73B 1F4AA 4XPVA 1W5CC 4AIJA 3K2ZA 1MJAA 4NDLA 3ZFGC 4Q48A 1CWPA 1MBGA 2ZGKA 2YX7A 3HBKA 1Y4WA 1TC3C 4PDWB 3USSA 4CU6A 1UU5A 1HXS2 1QVUA 3ETPA 3JBG3 3SQOA 4ZZ5A 5GZFA 2FX0A 4PF1A 4BEHA 1D0GA 3WSOA 3PNYA 2GLOA 3PUHA 2DA1A 2NLRA 4CDQC 1L3JA 2NRAC 3U1DA 4NRQA 3MV01 2I2SA 3CCMI 3FBNB 3J81K 1AX1A 3RTRA 4LK1F 1IS3A 4ASLA 3W6VA 1R1A3 1WGXA 1CONA 5DM7F 1JGSA 1AXZA 1R7JA 1NLQA 2WNVA 1PJRA 2R7ZJ 2FBIA 3ZPLA 2O14A 1GXPA 4BWOA 2VT3A 1YNAA 2EA4A 2GXAA 4QGLA 3BPXA 1ASJ2 1C5IA 4OAZA 4XKCA 1PVXA 1ZAOA 1Q1HA 1LULA 4BK5A 3IB3A 4CE8A 4Z82A 3VGIA 4LA2A 2GOXB 4HXCA 1Z3YA 1A04A 3CUOA 1MW7A 4NAMA 3KGZA 1LHVA 4XURA 3P1IA 3AG4H 1T56A 2H0BA 4CDWC 3JRCA 2AH2A 2G0EA 1DPUA 1F36A 3TEZA 4Z1VA 1Q8OA 2EK5A 2UWMA 2F4PA 3OS1A 5HNFA 3ERED 1KQRA 1SPPB 3LWCA 2YGLA 2CTVA 1FOD2 4NMIA 5D8AA 5ANQA 3WTWC 3OYDA 3OBAA 4Y7NJ 1X7NA 1QNYA 2VC1A 2ADUA 1OT5A 3HTUA 1WFXA 4PBPA 1JZ5A 5JOYA 4AFDA 5I93A 2FD8A 2CH0A 3K4NA 4QPIC 1ZH5A 3NV1A 3OD4A 2ZX0A 2QQAA 1BEV2 1MR5A 1W8HA 2VUJA 3M1HA 3DPRC 3TEXA 4PZJA 3CCUI 2YC4A 3NRUA 1FY7A 4LBOA 2BNOA 1ZGWA 2XVKA 4CDUC 1VBC3 1H1MA 2QUOA 3IT8A 4MGSA 4YZ1A 4Q4V1 1VZ0A 2DA4A 2DLLA 4HSLA 3GBWA 5KHHA 4HDVA 1MMSA 4ZTFA 3O5SA 3TBIA 5GTIC 3ZR8X 4CCEA 3I7DA 3OPZA 5FD5A 4YVSB 3ZYJB 1YHQI 3D8CA 4CYCB 3RYPA 4XJUA 4E4SA 3WU0A 1BR2A 5C8WA 1HRI3 5F3EA 4IEZA 2H0VA 4Y4YA 1FNYA 4YLZA 2ZFUA 3LAGA 2IFWA 3FHIB 4JBAA 2R041 4SLIA 4QQPA 1UU4A 3T0BA 2VLAA 3D5RC 1G9AA 5LBEA 1I9RA 2YG0A 1TMF3 2QQPA 2D3PA 2LOOA 3RKQA 2RM23 5C5UA 1I1SA 1TWHJ 1TL8A 3AP9A 2KRCA 1SD5A 1CAUB 5M3MJ 4COVA 2DK8A 4WM7C 1JI6A 1ENQA 2DN0A 5CIRA 5J98B 3K4CA 4K3UA 3CCRI 4Q1PA 3R60A 3U0ZA 1NYWA 2VUMJ 2HWD3 3BDDA 4RHV3 5FYMA 5HXMA 1MZ6A 4QPGC 2ZJRF 2OCEA 2K02A 4A3IJ 1QNWA 4DRVA 3CJTB 4UWDA 1LJ7A 3VBOA 2ET7A 4V19K 2XG3A 3WF0A 2CDPA 5GKAC 3ZPYA 4LR4A 3I5UA 3ZXAC 1QJU2 3TL4X 2XWBB 1IXCA 4YW1A 1APLC 5JI6A 1SMVA 1W9YA 3BB6A 5FPUA 5DZEA 5FLJA 4Y13A 4LO6B 1RINA 2M45A 3ZIXA 2YU2A 2HQRA 5A1AA 2WO2A 2Y34A 1B35C 4K20A 4L92A 3GFIA 1ZBA3 5L3BA 4LGWA 1LOFA 3ABMH 1WMFA 4JHTA 1YQCA 3ZX7A 3M8EA 3LPGA 2J5OA 1ULDA 4D69A 5CVIA 4BQNA 1FBUA 3CJIB 1RETA 5LHIA 1PZ8A 4LBNA 4EJUA 1QHDA 3J26N 5LA9A 1TQPA 3B73A 1OH4A 3POSA 3BTAA 5BNNB 4OZXA 3ZM8A 1H9TA 5M0TA 3GTLJ 4NPMA 4QHOA 1SD7A 2H6BA 1AL22 3MFCA 3O1SA 5BS6A 3GBFA 4RGRA 1GOGA 3FM5A 4IVNA 2WT2A 5JZGB 2VOVA 4AVZA 1HF0A 4KU7A 4WVMB 3CO2A 1FP1D 5HV0A 1GHCA 1MVQA 1Z6RA 5HDKA 2VC9A 2R32A 5HS8A 1C3HA 3V8LA 2NPIA 5FK7A 5K7PA 4ZC3A 2A5ZA 5BNPC 3THDA 1Z67A 3DBRB 1N1SA 1MZ5A 5FMCA 4GO1A 1OHFA 1GNZA 4HK9A 4BXUA 1EH8A 1YIOA 1U5TB 2EV0A 1FSEA 4FPEA 1SHWB 1TBXA 3S7IA 2VT2A 3CLOA 2AR6A 2Z42A 3LF7A 5FD6A 2VUDA 2VQCA 4QAWA 1JE8A 2UWCA 4IRIA 2DI3A 1D1AA 1RMU2 1UIJA 5E89A 5FY0A 4FCAA 3S2DJ 4G4FA 4NO4A 4WZFA 4MIMA 1REDA 1OKQA 2Y0OA 3VZLA 3QLQA 4V2VA 1BEV1 4NR1A 5IYBJ 3S93A 3RZZA 2K3FA 4IRGA 4U7BA 1T8IA 4QPQA 3WTYC 2X5IC 3T1LA 1K3IA 3CC4I 3BUCA 4AHYA 2R072 1CAXA 5IT3A 3FXRA 1SANA 1WJFA 3S3MA 4FO9A 1VQLI 4NUBA 4XTMA 2Y6GA 3MUZ1 4XZUG 3M3IA 1A8DA 1AL0G 4Q4Y2 4BEHB 1IN6A 4DUVA 1USTA 1Y6IA 3E6CC 3LSHA 2JVHA 4FI9A 1J59A 1MMDA 1HB2A 2WINB 4IL6C 3DYOA 2VULA 4CZZA 2AACA 1AR63 2R7EB 1BMV1 4COWA 1XB9A 3IBMA 5AFEA 1BOBA 2WQ4A 1AR73 1JZ6A 1WLDA 2NOJB 3F3XA 2XRLA 4IHTA 1YQ8A 2W25A 5C4WA 4Y20A 5GZEA 2XWJB 3BQZA 5FZCA 2E36A 3V8JA 1W8NA 2ZZQA 5A3OA 3T4HB 2MEV3 4UUVA 1XSRA 1X50A 5C4JJ 1ETOA 3AKZA 2G9FA 2W1WA 3CDLA 4XCAA 3LFMA 1W6OB 4NIHA 1ETYA 4NN0A 2BFUS 1AU7A 2IPQX 1L7RA 1N3PA 1V6LA 2YFZA 1D8KA 2P3YA 2QENA 3MZHA 2JIGA 2WADA 1LNSA 4YFNF 2VU9A 5CZKA 4AG4A 1GVJA 1Q56A 2R7VA 3CDZB 2R7TA 4OQ9A 1SLAA 1GUIA 3DYPA 2ZHNA 2KA3A 4RFRB 1HSTA 2RR12 4XDOA 4DNYA 3W2WA 2WS92 4DBRA 3M3YJ 1R082 1HQLA 1H2MA 3D5OA 3ACGA 3THPA 4LK7A 5KXEA 1ZBE3 2QEXI 3KP4A 2CQXA 1XSVA 5FO9B 3JSPA 1E5HA 3VB9A 1YG2A 2H09A 2M8GX 5BPXA 3FJSA 1AL21 2B7YA 4F8AA 1Y56A 3OYKA 1IV6A 2W3JA 4A6SA 5A70A 1R36A 2ZGUA 1DPRA 1QY4A 4EROA 1X3ZB 3N05A 1XC6A 3IIAA 4YWAA 3PTRB 2E6VA 1K5MA 4MGZE 3UGHA 5J47A 2ZA9A 3RZDJ 3FXJA 2JUCA 2K5CA 5EV7A 3ITQA 5EPAA 1NCQC 4CXWA 4BK4A 3RSNA 3PSIA 4WWCA 3OOUA 3G4SI 1ETXA 1VBE1 2JJ6A 1UNBA 3TDUC 1MBHA 3A21A 2Y60A 1TME1 2ECCA 2E7QA 4KT6A 2GSYA 2WWSA 1NXMA 5C3EJ 1RUE2 4QPWA 3K4KA 3WDWA 1VBD1 5EIYB 4XICA 1WVRA 4G9SB 3FX3A 1QKQA 2NM1A 4MGIE 1BBT2 1WJCA 1AR82 4W4ZA 2FDJA 3PO3J 1RUJ2 2XF5A 4D5CA 1I6HJ 2Y6JA 3LKJA 1X9PA 4YFXF 4NE9A 4FSJA 4QXKA 4JRLA 3KB5A 4ASMB 5L7OB 3WE2A 4EN6B 4BAYA 1EUUA 5GM0A 3BU7A 2R7XA 3ECHA 5T50A 3RI4A 3FLRA 1DIWA 2B42B 2R071 2CHHA 4MX3A 1IPSA 3CF6E 1KDKA 4GXLA 4LOTA 1KRIA 1US3A 3GJBA 1E5IA 2Q1MA 1Z78A 2JG9B 2H27A 1A3KA 4QMAA 3T2OA 4CHUA 5FO7B 2BW3A 3S17J 5DD8A 2VCBA 2F6BA 2DBNA 4P9LA 3OGGA 1W3XA 2CDOA 2QSGX 1J84A 5HBAA 1SLCA 4LB5A 1T0FC 3VBHB 3GMEA 1UB9A 2DTZA 2ETHA 4MH0E 3C7GA 5K5RA 4ZU4A 5BNOA 4HONA 5E3NA 1UQXA 4FCYA 4XF9A 4KMUX 4RLQA 1UMQA 5EJ3A 5A7NA 4FPLA 4I76A 3AFGA 5A1FA 1YIJI 3DBLB 2WAQN 5C4XJ 4B3AA 2IA1A 4A6EA 5DV5A 2CFXA 3AKPA 5LGUA 3HQUA 2LBFA 3KIOA 4XFAA 2VO5A 3MBWA 1KD7A 3SXWA 1C1LA 1AOYA 2KR2A 4CCNA 3KMHA 2XB0X 3WGIA 3BQYA 4NIIA 4HMZA 2ZKLA 2IXJA 3LSEA 3O1TA 4YG0A 2ZCWA 1EA3A 2KDZA 3C7FA 4MUVA 2QBXA 4DINB 1ZZ8A 3J7AO 4RB3C 1RUD2 1EV11 1G3SA 3I2JA 4V2WA 1I1EA 1LNWA 2GXBA 2QZ2A 4KIFA 1R64A 3ELNA 3HRSA 2HWF2 1AJKA 5TSWA 2WS91 5DMYA 2HDWA 1R081 1O3TA 1HCRA 4KMQA 1O91A 2WZ8A 4I09A 4HX4A 3CJRB 3L2UA 1XX5A 2CWMA 3AMHA 3CJIC 2IS4A 2JDNA 3DECA 4XORA 4F91B 4D6SA 2L54A 3CUQC 1ULPA 1CAXB 2EXJA 5EEAA 5EG0A 4I30A 2DA5A 2V09A 3PFYA 3T08A 4GJZA 3OY8A 2VL8A 3KP6A 4HNVA 5JZGC 2VZPA 4HNUA 1DGLA 1GANA 4LBJA 2PXJA 3NNJA 4AEDA 1YWKA 4LLLA 3N97A 2OW4A 1OJLA 3I3BA 1UPSA 2YUSA 5IK5A 3GTPJ 1LGBA 1L3LA 4RB0A 1XNDA 3V65A 3RKWA 4XLCA 4YIRX 3DWLE 2R93J 1ZA4A 5FZ6A 5A3UA 2YBSA 4HVRA 4QKBA 4DOZA 2WQ8A 1H6YA 1VBA2 3B9CA 4M71A 3ZOIA 3AYDA 2RAEA 1XS9A 1H2KA 2A75A 1V55H 4BQWA 3PIJA 3ZFEC 2ZC2A 4NBQA 3U14A 3EYPA 2QYOA 3H8RA 2BE5F 3E7LA 1W03A 2HYXA 5FZEA 2IC1A 2JD9A 1U5TC 1A8MA 5C4WB 4Y20B 3KEYA 1JU3A 1WZXA 1ZZ9A 3VWBA 1ND3A 2EXHA 4RR3B 3FKJA 2JDKA 3M9AA 1O6UA 1F9NA 1AR81 2DCJA 5EJCA 5A3NA 3V42A 4GMP0 3WQ0A 4FTSA 2MPFA 2YC2A 4EZ4A 3OBTA 2R16A 5CKMA 2ZGNA 5H6QA 5DUVA 2R7FA 1NA1C 4WM8B 3GCMA 2Q2EB 4EGZA 2UYBA 3T1MA 2VBYA 4XDPA 1MBEA 3W58A 1K79A 5FLVA 4HN1A 1I50J 2JSPA 2FMLA 3MLLA 5C5TA 1P92A 4XRSG 1GZWA 3GW2A 1QJFA 1W9WA 1LDDA 1AUYA 1ON1A 3JRAA 4MGYE 3KP7A 4BLJA 3DBHB 2V72A 3THTA 3HSEA 4AVAA 4JQFA 2GNBA 4RGKA 2X1EA 1WHUA 1NE4A 5FP7A 2ID6A 5FXZA 3IV5A 3B69A 1RIOH 4H14A 5JMOA 5E3MA 1GVDA 2BGOA 2XJRA 4HANA 1KYZA 1XCBA 3VL9A 2CS3A 1W0OA 2QA4I 3N7KA 2HTJA 4JGZC 1VBB3 4Q2FA 4TTGA 2WNVC 1WCQA 3PDQA 3ZXKA 4IEUA 1C8M1 4CCOA 1XNAA 3KCXA 5ABJC 4Q4X1 3P5BA 5F04A 3JD71 3VV1A 5FUIA 3C3VA 2YBKA 1R9TJ 2QVSB 4BZ4A 1E5RA 5DM6F 3RPUD 3H7JA 1NX9A 5I0UA 3HIFA 3ZMSA 5F1JA 1DYOA 2ZGQA 2VPRA 2RGVA 5J1YA 3D82A 1CF7A 4CXXA 1W0PA 1U9NA 3JCUC 5JHFA 4BQYA 4F83A 1WH5A 5DUUA 3WU1B 3ES1A 2D44A 1BI0A 3ZP5A 2VODA 3Q0VA 3PVOA 3TP0A 2VXJA 3VZOA 3K1PA 3BP8A 4IDZA 4OHZA 2DU0A 1MSEC 1W8FA 1W6QA 3NVCA 4LOCA 5D8AC 5H9QA 2BBAA 5LEJA 1AR93 1MEC1 4N4OB 2WZEA 1KJLA 5D4RA 4YGEA 4NHYA 3BIWE 3RQIA 3ZMNA 2VBDA 1G9CA 1QJX2 3PQJA 2E60A 5ACA3 1LCLA 1VMHA 2RN7A 3HEIA 2AEYA 2EVXA 3ZGKA 2CSOA 5K7FA 4XFHA 4AI0A 1P4WA 1UHWA 4XL9A 5CVJA 5JAXA 4C8DA 3ZRGA 1U12A 1QJEA 3LL7A 4X8PA 4G94A 2CSGA 2DUOA 1VQ8I 3BJAA 4AOCA 4CH7A 1RKTA 4KITB 3OUJA 2DFCA 1OUSA 4XJZA 1XGMA 4A3MJ 2A07F 4P9FA 3F8FA 4C0BA 2CRGA 2O3FA 1DDNA 3S57A 3BTIA 5E16A 3I53A 2LH9A 2K46A 2BXYA 1XDSA 4MO3M 4DJAA 2OAZA 3KLNA 1XB4A 1LEBA 3HRMA 1CIWA 5BNOB 5CKNA 1PIV2 2ET1A 2GNMA 1K4SA 4E27A 3PURA 3OSGA 3RS6A 5IATA 4ON0A 2O8KA 2JICA 5ICGA 2OIIA 3QYEA 1ND2C 4V1PA 3RJ2X 2A1XA 5A3WA 3D6EA 2PJRA 2LBFB 3HMYA 1DLCA 2YBPA 4CUAA 2WT0A 4HQMA 3F8NA 1TWAJ 1QDCA 4ZTJA 1B6AA 1IG3A 4L2NA 1HV0A 1RITA 3ZIWA 5D6EA 3ZXLA 1ETVA 4XLFA 3VBOC 4A0ZA 3DKWA 2O9LA 4Q1RA 2RV9A 1RHI1 1UYPA 4QKFA 2JDYA 5JXIA 2DV9A 2PHDA 4YGDA 1DZRA 5ANNA 3MPBA 3K70C 5ERIA 2FDHA 5ERLA 2QSHX 5CPRB 2LK2A 1A31A 3F21A 1U6GA 2Q30A 4XRFA 5BPIA 1QXJA 1RI7A 2D40A 3RFRA 3ZXEA 5B4NA 4NNJA 3GZTB 1ZG5A 1YEWA 1YRNB 1LOFC 2ZBKA 1GWLA 4M3CF 3CLPA 3SNMA 3ZMUA 1UY2A 2VBWA 2CWEA 1WW7A 2K3PA 3LSPA 4LXLA 3CDHA 2C4XA 2L9LA 4AI8A 1S29A 2HEYF 1BQPA 1RVF2 3N4MA 1GV2A 3IDEA 3KSCA 2OZUA 3M8JA 5EG0B 1JYIA 3F8BA 1KU9A 3S1NJ 1LOCA 2FOKA 3WV6A 2E9QA 1MMGA 1V5FA 2DMPA 5F3IA 2GQQA 3OY8B 5JCTA 1IQDC 4ZH4F 1WW6A 4AW7A 1VRH2 5LBBA 4AEDB 5H20A 3ETQA 4QKNA 4QTRA 2CNAA 4I2OA 1COV3 3L2RA 3WW2A 2P5KA 5AC93 4RYDA 1FSHA 1VE0A 3HOSA 2ZEXA 2VMCA 2IGNA 4QD2A 2QQKA 5LK7B 2A61A 4YZ5A 2KJCA 2FSWA 4OHYA 4D3WA 3MEXA 2WZR3 3RPQA 3JBG2 1ZM1A 4YW5A 4QB2A 3GX4X 5DZFA 1W6MB 4OI2A 3A01A 5DCMA 2F4LA 2DQRA 4FASD 2PFBA 1Z7S1 2WSUA 2GAUA 4GXOA 1YJLA 3SFZA 4BJ0A 1UXZA 5C8CB 4CP0A 2RHPA 2WNEA 1OA4A 1NQDA 4MEXF 1MH3A 4EJWA 2KPMA 5A2QK 4DW6A 3HHHA 3DLLF 4XRSA 3U07A 2ISZA 3PU8A 2HXOA 1HDPA 1O5LA 2M34A 1JZ7A 5CG8A 3WNOA 1R1A2 2P6HA 3V8KA 2D7FA 1S7OA 1X2MA 3GF2A 1S5LC 5T55A 1PGW2 3RDIA 5AFBA 3WX5A 2L9NA 1W90A 5FZ1A 2BJSA 1GZWB 2KT0A 3M3OA 1VMFA 1BC7C 2PAMA 2QQ8A 1P8JA 2XQRA 4YW2A 5AONA 4GB31 3N9PA 3A0KA 3TOAA 4G6QA 3WTXC 3C7HA 1MBKA 1JTXA 3ZQQA 3CTAA 3V0AB 5J6XA 5I0SA 4XBNA 2OCCH 2VMEA 4XJWA 5EQUA 3H1YA 4PLMA 2YY1A 3CO6C 1NAEA 3AXDA 1ODDA 4KI5M 3AJYA 1Y1VJ 1EAH1 2D43A 1W8WA 1X36A 5FRNA 2ZPXA 3T30A 3UNPA 3DF8A 4YPJA 1XYOA 2QTWB 4LBKA 1GLNA 4UFMA 1UFMA 1FYKA 3NWKA 1ULFA 2NAZA 1QDOA 2Y9ZA 4P5HA 2X53S 3WP3A 4O3MA 1UY4A 4FT8A 4IQJA 1LUJB 4ESJA 5T3NA 1CAWA 2P1BA 3S30A 5HOOA 2GOMA 1EKEA 1PO23 2CL2A 4JQTA 3RIRA 3QPLA 5J4VA 2VQLA 3ZMZA 3UKGA 1OF3A 3AYAA 2Z33A 1A35A 5LFAA 4IEJA 3I9V2 3FL7A 2HKOA 1UYZA 3IKTA 3CQZJ 5KHIA 1LHWA 4QXCA 2VQ0A 3H9GA 2HOEA 1S0JA 5J37A 2VJJA 1VBC2 3PU3A 5D5WB 2DFFA 1W6QB 3JRHA 4XF4A 4BXSV 2FHRA 5CJ9A 1VMJA 4HVOA 3BTLA 2LKPA 1G3TA 4M3CA 4A3KJ 2BP6A 4KMFA 3VKMA 5JHUA 3JCIA 5F32A 2ZHKA 2HH9A 3EJKA 1YJNI 1HRI2 3MKZA 4FTBA 1RUG3 5LLQA 3K1NA 3AZXA 1GBGA 3K6GA 3BCBA 4BQ1A 1LDKB 4BB3A 5F08A 2DVDA 1FYMA 1OD5A 3NV4A 1TMF2 2XHNA 4QU2A 5E1XA 3S3OA 2RM22 1IXSB 2FEZA 5GZCA 4B4RA 3NJZA 2VBXA 1EV7A 1VLNA 1HQCA 2PLV1 1MS4A 3HN1A 2B39A 1Z1DA 3HOZJ 2XLFA 2YX4A 1EY2A 1GYKA 1K5MC 1T2KA 2HWD2 3FDYA 2VI6A 1O3SA 4RHV2 5FGMA 1EF4A 3MDPA 4XHBA 1W7PB 2BV6A 1JHHA 4QQOA 1JI8A 1WRJA 5J48A 2V4JC 1ZGJA 2EIKH 3CMAI 4JK1X 1YUDA 3LMMA 3JUUA 3BPSA 1Y9QA 4ISRA 1SFUA 2X6XA 4K1ZA 3MAJA 1BIBA 4EQQA 2LY2A 2J1AA 3AP5A 2O1QA 3WUCA 1M06G 5J36A 5LWBA 4A3LJ 2VXDA 2ACJA 2BU9A 3FFZA 1WJDA 2O0YA 2PJRB 2PMWB 3AP4A 1Z0XA 4C3HJ 4XFFA 1SVLA 1ZBA2 5FLXK 5FBZA 5D2AA 1W9TA 4M72A 1XSQA 4YM1A 1IRFA 1PM7A 4MQVA 2GN7A 2ZFWA 4YM0A 5FBJA 1NZIA 1LDJA 1P6RA 5FYVA 3T3YA 4OULA 2A05A 4M3DA 2QDRA 2L3DA 1JKOC 2TNFA 2P4WA 4A7ZA 4B48A 2JG8C 3LD8A 4FE7A 3QAHA 5C44J 2DMTA 5EYYA 4XOTA 5A6XA 1MVEA 3M3EA 5GJ6A 3HHGA 4A12A 5CADA 1MS5A 3RMYA 4LD5A 3CMYA 3T0AA 2EIBA 5B2GB 2J1RA 4YIIA 4J1XA 4UY8I 3VBRA 1D4M1 3KCCA 1ZHFA 2D6MA 4G7OF 2LLKA 2KZVA 3EUHA 2BBYA 2XBO3 4BOWA 2M0MA 4IKFA 3ZVXA 1T6GC 3MIFA 1HRV1 2A5YB 3MZ8A 1KQ9A 2A6ZA 4KGGA 3ZQFA 4S2FA 1V70A 3G1LA 4XLHA 1DCSA 1ORKA 5EXOA 1I5ZA 3NJVA 4IV1A 1P7IA 3HT2A 1YJ9I 4MEYF 4A41A 3O0VA 3WGHA 2KRFA 2CYFA 1LESA 3GZ6A 4KWJA 3CF5F 1VRBA 5DYMA 5DAPA 3W9AA 4WVZA 2WAQA 1PMJX 4R4ZA 2NVXJ 3KQ4B 4IHVA 3ZSEA 1ZKGA 2EILH 5FUPA 1X33A 2EFOA 5BV6A 3K3OA 4KG8A 2MW8A 4XE9A 2QKMB 4OMCA 2KIQA 3K4DA 4AFAA 1LE8B 2ZGRA 1PHMA 4JTNA 2LY9A 4DQ2A 3S32A 3E3VA 1TWFJ 4UFJA 3I2IA 1ZNPA 5E8GA 4DXZA 4NVPA 6PAXA 3CMGA 3DTEA 2DCTA 4XC9A 2DVBA 3NQOA 5K7HA 1CGPA 3A01B 4BM8A 2BPA2 5DCMB 3FLPA 4J01A 1POGA 2IXIA 4RFT0 4P14A 3RG0A 4XMYA 1JYTA 1WKMA 5AVPA 2D6KA 4HF2A 3LA3A 2SLIA 5C7GA 5FV3A 3T4VA 3FZVA 2JE7A 4JX0A 3E6DA 4MSVA 1AR62 3KP5A 1H9PA 3K3NA 1I6XA 2XDVA 1SMTA 3AK0A 1FPN1 1SC7A 1XNTA 2JMWA 5GPCA 3GTKJ 1H0BA 2W00A 1AR72 3I56I 3ZSLA 1O8PA 2OX0A 4A6OA 2C9AA 5HCHA 2QF7A 5BMZA 1QU0A 4M01A 5E88A 4UUTA 4RGGA 3G1OA 3HBLA 5CBLA 3WTTC 1BJQA 2P7CB 2MEV2 3AXEA 3I2KA 2VIXA 4A3XA 2R5YA 4SBVA 2LDUA 3SCGA 5IVVA 4PJYA 2XL9A 4OI0A 4RMNA 2CAUA 3GCWA 2QQMA 3WP5A 2IGMA 5TISC 2I45A 5DN2A 1R22A 5IP6A 2Y30A 2RDQA 3IMNA 1IN7A 2LMDA 1AYM3 1PP8F 4O9EA 4BUPA 1WWYA 5F2WA 2XV4S 4RB1A 2FCUA 5T5JA 3ZSJA 1LFUP 2BNNA 4YW7A 4N4NB 1ND3C 2OVUA 4AL9A 5FYZA 5FYBA 4LEJA 4LLFA 2P34A 1CAWB 2M4GA 2OPKA 3GLLA 2ISYA 3TBDA 1J3QA 1HIXA 1UY1A 1OLMA 3EXUA 2WL1A 1VP6A 1F4HA 2K9SA 2X0LA 1R1UA 3A02A 3VHOA 3NV3A 5GLZA 1YI9A 3C2BA 2HNHA 3AX4A 1MIJA 1ZBE2 4A7KA 4DUWA 2D1VA 1DLLA 1BI3A 3JRFA 4M74A 2JA2A 2BGCA 5H6RA 4FPGA 4WX9A 4IUGA 3O2PE 4NC7A 3OYCA 5JSOA 2X85A 2ZXJA 2NYYA 2HEOA 3O1OA 3AZZA 3OD0A 1QJY3 2KP6A 2HWC3 2MG4A 3CBNA 1OVSA 2LALA 2Q0AA 5GLUA 3DQVC 1JKQC 4OUEA 3CP2A 5F37A 4RM2A 1XN7A 4Y22B 1V5EA 3QH7A 4IXLA 1JXNA 4G6TB 3ILFA 4JKMA 2PMUA 2XVLA 4KJZA 4LK6A 5FZOA 3POIA 3PUIA 1J9IA 5FZ9A 3R6SA 3S2WA 1LB2A 5JOXA 3B9IA 4YW6A 3MPPG 2WSVA 3QD6A 4TSVA 1DYKA 2C6SA 1YHFA 1ULCA 2EXIA 1PGL2 1WI3A 4KIGA 2V1UA 2RDNA 2LF8A 4FOWA 5JLXA 4P00B 1G59A 5L3GA 4A5MA 1UG0A 3K4JA 2WR9A 1HX6A 3WHUA 1CZSA 1MBFA 3VHRA 3DKQA 2ZOEB 1XYPA 1N1YA 1PK6A 2M87A 1NLSA 3V7SA 1UF2C 2BOJA 2V9VA 1CIYA 3VUOA 1WKYA 4MQ9F 3W3CA 2BY3A 4RAZA 3FHAA 5ILUA 2CWSA 3HOBA 5KC6A 2ZO4A 2C5DA 1R49A 1FC3A 2RKHA 1LU1A 3FKIJ 2VECA 3WTSC 4AXOA 1AYN3 2P5LC 4HX7A 2E7WA 2VZUA 4LIUA 3LSRA 5BUVA 4Z92B 3OGJA 1RUF1 2W1OA 4XFCA 2L9RA 5J3UA 5HV4A 5E8IA 4N43B 4Y17A 5BY5A 1UO9A 4NRPA 2OUJA 4OMZA 2W94A 2ZGLA 3IAQA 4YGBA 4WK8F 2WT1A 3IM0A 1S0IA 2HWE2 3KS7A 4HK8A 2Q8DA 4Q4W1 4FTHA 3IUOA 3SISA 2R0HA 1JYNA 5JOZA 1QGLA 1QWRA 2Y0IA 2KRHA 3KZYA 4QPIA 1JJ6C 3MKYB 4PJLA 2PI0A 2G1MA 4U2AA 3MW3A 5C33A 2WN3A 3I4PA 1TWCJ 2O8XA 4HN0A 4YEJA 3J8F1 3CCJI 2J7MA 4CPBD 3H5NA 1MS9A 1XMKA 1R093 4XONA 2HOSA 1YW8A 4DXSA 3S15J 2CQNA 1F15A 2OT7A 3VLBB 2VKVA 3Q8AA 1RYYA 1H9WA 3OYJA 5IAXA 4E8CA 1REFA 4COZA 4YIFA 4CDXA 1KEXA 1QZZA 2WNUA 3ZMVA 3MFAA 1OQYA 1W36C 2ME6A 3FBMA 1DGWX 4ZDPA 2D5FA 3ZKYA 3RQ4A 3JRBA 5IFTA 2K9MA 3IMMA 4Y52J 5A80A 2QZ3A 2ESHA 2RDPA 1ENRA 4RL7A 2XUBA 3PNVA 4W50A 3L7WA 1MQTB 2XPUA 5T52A 3FXQA 2CO5A 1RUC3 5G04L 4I3PA 2G4IA 1HW5A 4LTAA 4M9ZA 2KKOA 2LW8A 2WA4A 3PQKA 4B43A 2QKDA 3KT7A 5GADJ 1V9U3 5FO8B 2WV0A 4H7MA 1DFQA 2HDDA 3NRVA 4PF5A 1AXYA 4QWNA 5DTDA 2FDIA 2HKXA 1UXXX 3TAYA 2A70A 4GMP3 3AG2H 4MV2A 3LSIA 3D0JA 1IRXA 1WCSA 2EINH 1LOAA 1RR7A 2DURA 4J00A 2EPFA 2KISA 3C8XA 1G6NA 3V64A 1E3PA 4BY1J 1DP0A 5M5XJ 1EPWA 5FMOL 3DF0A 3OSDA 4M3CE 4CP1A 4BH9A 2XH6A 1Q5OA 1L7QA 2W91A 2GBYA 3SKJE 3OYMA 5DXDA 2ELKA 4IHWA 1B35A 1E0EA 3SQNA 3FUQA 3QWLA 3RCOA 1DHKB 3POGA 3PUSA 1IW7F 5J8FA 2F5VA 5FZAA 4IHXA 3H8XA 2XAHA 1NCRA 1RUH3 2WJSA 1LQ1A 4OQ8A 3DLAA 2OQRA 1IS4A 1YW7A 5FTTC 2GP5A 1J5YA 2XR4A 1C28A 2RDSA 4PLNA 5TGTA 1BW5A 2B9UA 2DF7A 4KGQA 3ECQA 1W7PD 1SQ4A 4QHBA 3W5NA 2R5YB 3UT0A 5C3RA 1UG2A 1FMVA 2H1KA 3WF2A 3H8UA 3ME2A 3OCPA 2DOAA 1D0XA 5J7MA 1RKWA 2V6CA 2SBAA 4CCDA 4MGRA 4NHLA 4P5YA 3SFIA 2DW4A 2L7MP 3H36A 2Y75A 2IBDA 2DJIA 4PCQA 1KU2A 1DUXC 2Z2SB 4JGYA 3OV8A 4UW5A 2VQTA 1EUTA 4LG0B 3S7EA 1VQ4I 2UY8A 4H2AA 3HGGA 5JXGA 1SVMA 1MNMC 1G3WA 1Z0HA 3E1F1 1E3HA 3B94A 2HDCA 1JYXA 1ODMA 3WF4A 2O0OA 3VZJA 2NNNA 2HWE1 1CZVA 1SLLA 3UKNA 4CA0A 3ILNA 1B72B 1LGNA 4UB6C 4L5JA 2QQJA 4NHJA 5E1ZB 4CP9A 3HPNA 4A42A 5CFCB 1A6CA 1ERDA 3AZVA 3AAFA 2R063 2QQUA 1VBB2 5GAHJ 1TVGA 3K4ZA 4ES9A 5DUWA 3CC2I 2W48A 4DY5A 2WYFA 4C3IJ 2J1UA 1XPWA 3W6JB 2W08A 3KHCA 4ONUA 1HDKA 1F8VA 2VOKA 4L9BA 3ISPA 2LUWA 3CHXA 4W8JA 2GIVA 2AGSA 4NROA 1O59A 3CF2A 1FJLA 1YXWA 3VHNA 5JUVA 2JRMA 3AP7A 3ZFGB 1JUHA 5CEHA 2R5ZA 3WU2C 3SZGA 2VJ4A 2MBFA 1BKZA 1QXRA 4FPFA 5DAVA 2D2WA 3AVRA 2L4MA 4NHKA 3UR3C 2E1OA 2OA4A 1TZOA 4AVTA 2GC0A 1RUI1 3KLOA 2KDOA 3CC7I 2EV5A 4Q0QA 2DAOA 3TWIA 4CDQB