1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
1R1VA 1MGTA 3FM5A 2A68F 1UHWA 2EA2A 5BS6A 1EP0A 2JT1A 3V8JA 3ECHA 2CW0F 1SFXA 3MWMA 1TTYA 2YU3A 3J81Z 2ETHA 4QMAA 5JCTA 6PAXA 2VPVA 3EETA 3DFGA 4L9TA 2GC2A 1O5LA 3BPZA 2EWNA 2L4MA 5DUIA 2V79A 2A07F 3RNSA 1WWXA 4ZU7A 3E5UA 1CAXA 4HBNA 1XSDA 3GX4X 2V9VA 4AXOA 3KP7A 1MJBA 1I1SA 1YLLA 3T8TA 4M74A 2Q0OA 4FHTA 3IBMA 2GC3A 3MPBA 5HLIA 2FQPA 4KU7A 2LKPA 2PQ8A 4M72A 2OAZA 5K8SA 4IEQA 4R1HA 3EYIA 1EH7A 2HWVA 3PFIA 1O7FA 2ESNA 1KQ9A 4I7HA 3LQRA 4D0PA 2NAZA 2IP2A 1U5TC 3Q9SA 1ON2A 2C0ZA 4HYEA 4YG2F 4I09A 4FT8A 3KGZA 2CSOA 3G73A 5CVIA 1SD4A 1YHFA 4MGIE 4RGUA 2VXZA 2P6TA 4KNYA 5DYMA 4IEWA 4N9IA 2B9UA 4E2GA 4PZJA 1JE8A 4CO8A 5BY5A 5CVVA 4EJUA 4AD9A 5JR7B 4LEJA 2P17A 1KU7A 3O14A 1WQ2A 5EEHA 4UVAA 1U12A 1PP7U 5ED4A 4QXKA 2M87A 4PDKA 1QO0D 1XGMA 2HTSA 4HAMA 3I58A 3G7DA 2QWWA 3WW1A 3BJAA 4LGWA 3IL2A 1OFNA 4BHBA 2F2EA 3R0AA 5E8GA 3V8KA 1XSVA 5HDGA 5EEGA 4P9GA 4WVZA 3D5LA 4EJTA 3U11A 1WGPA 4Q0UA 5LLQA 5H20A 3U0ZA 5CVRA 4UXNA 4QLCU 4WF2A 4KFCA 1Z1DA 1OMIA 3RDIA 1GQGA 3F8FA 2VODA 4UVBA 3EHKA 2PLYA 2QQBA 2E7WA 2XIGA 3HHGA 1HKQA 3FZVA 3TO6A 3LA7A 3QOPA 1FYKA 4Q0SA 4IEZA 2XAQA 4HDVA 3QPTA 3FHIB 3RJPA 1EPZA 3RKYA 4ENNA 1Q3EA 1SD6A 1K6OA 3SZTA 3ZPLA 5AIPA 1ONVA 3D0SA 3MYXA 4O9EA 2FF4A 2KIFA 1U6GA 1QXJA 1YG2A 2L54A 2Y0MA 4WXHA 4RGRA 3LOIA 4QGMA 3WODF 1L3JA 2FBHA 4ENMA 2D40A 4MH0E 5IT3A 5FFXA 3SCHA 3REOA 3PNAA 1LB2A 3EJKA 4HX7A 2Q0AA 3CUQB 1BC8C 1O3RA 2IVMA 1SMYF 2F4PA 1H1IA 5KBFA 5F64A 2DCTA 2AS5F 4EJVA 4ZU5A 3IRQA 4KDPA 5I0UA 2DO7A 1R1UA 4CXFA 3S7IA 2O0YA 3VB2A 1U78A 2R7FA 4OMZA 5HVQC 3R61A 4LJZF 5J8CA 3V8LA 4MEYF 2PJPA 1KU2A 1ZNPA 1UB9A 3KP4A 2STTA 1YWKA 4ZYEA 4XF3A 3M8EA 5J7MA 1ZX5A 1YS7A 2FBKA 3FXRA 4HLYA 1FWZA 5FLIA 1HW5A 2B8MA 1BBYA 1YFUA 5ICEA 2GA1A 4P9UA 4Q0PA 1DUXC 5D4RA 4Z82A 4RGSA 3HRTA 4EM1A 2KRFA 3WTYC 2L02A 4HBLA 4XF1A 1UD1A 4ZYDA 3DV8A 4OFGA 5FD6A 5DD4A 3L09A 2IC1A 1S6LA 2PN6A 4PGGA 1B9MA 4HF2A 2CG4A 2ETEA 1ZRRA 4UHTA 1TNTA 3EQEA 4LTAA 1UPIA 1FY7A 5D4SA 5FLXZ 1CAWB 3WW2A 4WCGA 2GA2A 2V1XA 4ENKA 5FPZA 4ZYGA 2H94A 4NHJA 4RB0A 5ILUA 2XAHA 1ZRDA 2I45A 3WU0A 3OTFA 3GYHX 4Y15A 3HUGA 1T98A 4MX3A 1LKNA 3GWZA 2EA4A 4IEUA 3H50A 3LFKA 3BPVA 5JSRA 3H3UA 3K2ZA 3I53A 3TO7A 1CAVA 1LEAA 2DLLA 4YFKF 3J81K 1NZCA 2IXKA 1WKMA 1XE7A 4U0YA 4Q0VA 5FPXA 3D0JA 3HTSB 4HQEA 2O1QA 1J75A 1J0RA 4GYGA 2H6CA 4KIBA 4YIIA 4EVIA 5LEJA 3FE5A 4Q29A 1JGSA 5D6EA 3HRMA 3KZYA 4JQFA 1YW7A 3SCFA 4MHGA 3OD0A 2YR2A 4A0XA 3QAHA 2MHFA 1ZG3A 2OPKA 1J1LA 1J58A 2WV0A 4KU8A 2XLFA 1K78B 4KN4X 2IA2A 5DEQA 1Z7UA 1XMAA 3OCPA 4GGGA 3E3VA 3Q5FA 1J3QA 4OLLA 5ILVA 1XD7A 4XFFA 2MBFA 2P7VB 5D8KB 1HSTA 4HV5A 4G9YA 5D5VB 3H1YA 2Z99A 3IRRA 1BI2A 3CLOA 3C1DA 1YTYA 4UV9A 2XL7A 3FF5A 4L9NA 4ESBA 3WTZA 2ZBKA 2ADUA 5LHGA 4J1XA 2VE8A 1LDKB 2HS5A 1PM7A 4BHCA 3M3IA 1Z05A 4M9XA 1J3PA 1HW2A 1B59A 1QPMA 4IEVA 2VBZA 2IT0A 5J8FA 2W24A 4XEZA 4K2EA 1CX4A 1Z6RA 3C3WA 5L3BA 1D8JA 2AXLA 4BXUA 4AWXB 3LSTA 1NHAA 3QU3A 4L5JA 3CUQC 4GXOA 1LVAA 3H1MA 2ISYA 4MUVA 1O4TA 2UYAA 5AIQA 2F5CA 2DAOA 1XDUA 1EYBA 4WZCA 1OYYA 1ZHFA 4IETA 4JV4A 3BDDA 1KQ8A 2LF8A 3T1BA 4RAZA 2FU4A 1JHFA 5FLHA 3T8RA 3FXUA 5BV6A 1ZZBA 4IHSA 3QP6A 4EM2A 1FT9A 4HA8A 3CF6E 2QQAA 2OQGA 4H0EA 4PIXA 2IXJA 1YUDA 1ODDA 1ZG5A 4EMSA 1W4MA 5DUKA 3M70A 4AVBA 4BYYA 3I5UA 1XB4A 5FQ0A 2CV6A 2VECA 1YLFA 3IIAA 4L5IA 4YIFA 3ABTA 2XAGA 4EJWA 5ICCA 3OGJA 5CVUA 2OBPA 3NL1A 2FOKA 1OI6A 4ZZLA 3TDZC 4Y17A 4PJYA 1DPRA 3ST7A 4M73A 1ZYRF 1O5UA 2PG4A 2H6BA 2PAEA 2QLZA 4A12A 1E2XA 3SZPA 2DPDA 5IT9Z 4LFUA 3MFKA 2IXCA 5H6QA 4JTNA 2P5KA 2BYVE 4WXDA 4ZYHA 4META 3WG9A 5I8SA 3SMHA 4L18B 2UXNA 4XFGA 3R4KA 1JUHA 3OOPA 2PMHA 5E20A 4LLNA 1DGRA 1X8MA 1X8EA 3M7GA 1FOKA 3PVBB 5C6CA 1OR7A 2DI3A 1OD5A 2DK8A 3GLXA 2YPRA 2OZUA 2Q1ZB 2QDRA 3ABUA 4QM8A 3F21A 1IF1A 1ZLJA 3F6VA 4B8XA 2EAAA 1FBQA 3H1WA 4LMYA 5FO5A 2KIMA 2PMUA 4ORFA 3H3ZA 2CYYA 2D1VA 2HOEA 2W85A 2OU2A 4EQQA 2QYOA 3I0TA 2M30A 4IEYA 3RPUA 1X82A 2XUBA 3P9CA 4S05A 3ES1A 2CWEA 1QNTA 4HSJA 2PAKA 4QWQA 1R58A 4KA4A 4HDUA 2A5YB 4ENJA 1MDMB 1W7PD 3LAJA 4HVOA 1KA8A 3S2WA 2QNKA 2L4AA 4LB6B 1CAWA 4ASNA 1XE8A 2PHDA 3I7DA 1FSHA 1BN5A 3F22A 1SMTA 3O6BB 4RB1A 2ZMEA 3BU7A 4HN0A 4IEOA 3T0YA 3HRUA 4YARA 1JHHA 3PLQA 4M71A 2EFOA 1PUEE 2F5EA 1LRHA 4IESA 5JAXA 2OZ6A 3WTVC 3VHRA 1R22A 4P9FA 4KUMA 4IRGA 4XFBA 1LQ1A 5BXXA 1CAVB 2HR3A 5A2QZ 4K8FA 1MD0A 1HBXG 1Q5OA 5KVRA 1HKTA 3HSFA 2Y48A 5KHIA 2PEXA 2CAUA 3O2PE 1VP6A 3ES4A 4HX4A 1WRJA 3HRSA 1BC7C 5K1YA 3DP7A 1P4XA 5LBQA 4NVPA 5AONA 2OZJA 2X4HA 4TLFA 1K78A 4EM0B 3HQXA 3SHRA 1SAXA 5HDKA 4M6YA 1UIJA 4KYWA 2W25A 2JSCA 1MZBA 4CGZA 4N0BA 5FB2A 3OF1A 1CAUB 3JTGA 4U0WA 4CICA 2P4WA 4ZH4F 3E5QA 2ATFA 1XSXA 2FMLA 2KJBA 3ROUA 1O3QA 1E17A 4EGYA 3WTSC 1K7AA 2ISZA 3H92A 5L3CA 1FPQA 2CO5A 1NYWA 4A5MA 1ZH5A 1I27A 2HKOA 4OINF 1QQIA 1QY4A 2M45A 1UIKA 2BNNA 2WFPA 4XETA 3H7YA 2FEZA 3KP5A 1TQIA 2O03A 1SQ4A 5I0SA 4IVNA 3F3XA 4U7BA 4UXAA 4IJAA 4OIPF 3RI4A 2O3FA 5J48A 3MZYA 3L2CA 1GQHA 3F72A 4PGHA 3T5XA 4WBBA 3B73A 2VT3A 3QP5A 2WWYA 4UV8A 1KU3A 1RI7A 2FE3A 2FNPA 5F6FA 3NKTA 5JR3A 2H0VA 3SHFA 3Q9VA 2NS0A 3FM3A 4QGLA 1ZZ9A 3C3VA 1IPKA 1V70A 3K69A 5LGTA 4RS8A 1G6NA 4KWLA 1XN7A 1L3LA 4OIQF 2O8QA 1VJ2A 2EFQA 4A6DA 1EV7A 3KCCA 1YW9A 4A0ZA 1WSUA 2Z9OA 1Z9CA 1AOYA 3GVAA 1LJ9A 2HTJA 2GU9A 2BE5F 2XLGA 3GZ6A 4RGXA 3F8MA 3ZN1A 4DNCA 4EWAA 4XLNF 2XKPA 2OA4A 3USSA 4R79A 1PP8F 4JVAA 5LGUA 2BGCA 3JSOA 2HQRA 2QJVA 3N97A 3E6CC 1KYWA 3EQLF 3W6JB 3ZMTA 2K4BA 4KIGA 1WLTA 2VOOA 3EO6A 4XF0A 3M1EA 2DU9A 2Q4SA 4YRDA 3FWEA 3ZMVA 2XVCA 3WE2A 5E8IA 3BCWA 1XDSA 1YQAA 3NSTA 4GYIA 3M8FA 4U88A 2EA7A 4Q47A 1ON1A 3PQJA 2KIUA 3MZHA 2Q30A 1HW1A 3MQ0A 4AVPA 2BNMA 2QM3A 4Q48A 3HOSA 3TOAA 2JPCA 2A61A 2DPUA 1YO5C 5ICGA 2G7UA 1CF7A 1B9NA 4IERA 3TO9A 1ZG1A 2ZNZA 4Q0QA 4FX0A 2EJRA 1R23A 4S04A 4N9HA 2D5HA 1NE6A 3KGLA 5BPXA 1F4KA 2XASA 5BMZA 1FLIA 3LWCA 4BIFA 2Z5UA 1T39A 3E6MA 2F5FA 1PDNC 5DCMA 4G7HF 4LLLA 3SCGA 2H09A 5CJ9A 4JTOA 3DPTA 1IN8A 1H9GA 1F1ZA 4OIOF 3ZP5A 4DQ2A 4H7LA 1CF7B 3I54A 3FZ3A 4L9VA 2Z2SB 4CHUA 1R1TA 3SQNA 3ELNA 1IRFA 2ET1A 2LDUA 1MKMA 3CJNA 3P9IA 3E6DA 2EV5A 4BAYA 4I98B 1GXPA 4G6DA 1IXRC 2A69F 4M9ZA 5DD8A 4RAYA 5IT9K 2ZMEB 2A6HF 1J2XA 2QUFA 5ILSA 1XRUA 2XLAA 4ESJA 3L2HA 4PIZA 2HKXA 3WU1B 2N7GA 5D5XB 3CO2A 5CADA 3JW4A 2LNBA 2IA1A 4XF4A 4L11A 2G9WA 5KK1A 4QGNA 4QX5A 4XRFA 5JFRA 1A04A 1CAXB 3IKTA 2P5VA 3ULQB 1FBSA 3DQVC 3ZDSA 3GF2A 2NYXA 3K0LA 1HKSA 2NNYA 3VFZA 1H0MA 1Q43A 4BH9A 5BPIA 3GEZA 4IHTA 3KZZA 5D1IA 1S29A 1K79A 2QVSB 2YSRA 1SFEA 5FGMA 2ACJA 3DXJF 1ZVFA 5D5WB 4LK1F 5KHJA 3EYYA 5DDGA 4XFAA 4HVQA 1T38A 4YFXF 4F7ZA 3ZQ7A 1RNLA 3TQNA 4EWEA 1DGWA 2PTMA 2HZTA 3U1DA 2XV4S 4EWDA 3BALA 4Z2YA 2M5WA 4F8AA 2XGXA 3G3ZA 5EZWA 3K1NA 2RQPA 3FX3A 2RKHA 3LAPA 4MGKE 2VC1A 4HX8A 4AVCA 2K0GA 1UW8A 2P6SA 4ETSA 3SFZA 4L9JA 2RC4A 4I02A 3TNPB 4D7SA 2XAJA 3BJ6A 4WXCA 2IXLA 3FMRA 1FXZA 1YIOA 2EK5A 2MLGA 1IPJA 5D5UB 1YW8A 3KEQA 2VOPA 2MD5A 1FP1D 3C18A 1CGPA 2HDCA 4HV6A 2QVOA 4AQ2A 1BI1A 1LDJA 5TRDA 3ERED 4QM9A 3I59A 4GCVA 1F5TA 3KFWX 2M8EA 2MA3A 4KWKA 1HQCA 1RUOA 3KE2A 1DZRA 4HLTA 4EROA 5C8WA 1UHMA 5E17F 4G6QA 3ZMDA 2EV6A 3LAGA 1FZPB 3ECOA 1YFWA 1OYIA 2RV8A 2EFNA 3C7JA 1OKRA 4HVRA 2QBYA 1T6SA 2XHKA 5CYVA 3B02A 1S7AA 2D2WA 1SEFA 3J80K 2HJIA 3UKVA 5LHHA 4O5VA 2ZNYA 3WW3A 4TV7A 2UWMA 4IPAA 5J6XA 3DF8A 3S7EA 1S8NA 2Y75A 2FQ3A 3I64A 3CJXA 4I0AA 2E9QA 1G4DA 1W7PA 1R5HA 4M9SA 5CU1A 1VR3A 2Z33A 3GFMA 5E1WA 1FSEA 3UKNA 4KMFA 3FMQA 3F8NA 4LUKA 4B29A 3ZMZA 2QBYB 5LRSA 3FJSA 5HI0A 5L3GA 3M9AA 2BNOA 5A2QK 1W5TA 2L3DA 4Q4ZF 1SD7A 3IWZA 1AWCA 1MJAA 3RPQA 2DQLA 3V7CA 4AVAA 2UY9A 1Y0UA 2K7LA 3N4MA 1W7PB 3RTRA 1EH8A 3NVCA 1RTVA 4MQ9F 3NQOA 4RB3C 3NJZA 1B6AA 4M6XA 2UYBA 1J3RA 2OQRA 1X7NA 3IKVA 3KLOA 5D6FA 4YNIA 3K1PA 4X6RB 3TGNA 2ZKLA 2X0LA 2BEOA 3J80Z 3RZZA 2DFIA 3GO5A 1BI3A 3RYRA 1YFYA 4X6QB 1FX7A 3IC7A 4LD5A 3TDUC 5HOOA 3RYKA 3O3KA 2Q2EA 4WWCA 1RZ4A 2D93A 4PIYA 1ZRCA 1MDMA 4RD7A 2QQ9A 4O3MA 3FMSA 1TQMA 4L0ZB 4IRHA 3KP3A 5BQTA 3R0JA 1RGSA 2DK5A 2HFHA 3JTHA 1F9NA 4ONUA 2D45A 1R00A 1UCXA 1ZRFA 1SD5A 3GUDA 2PI0A 4BNCA 4UUVA 2C6YA 2ET7A 5CLSA 5HS8A 5K5QA 3H8UA 1B1BA 4O9GA 3K9TA 5LRRA 3MAJA 4EV0A 2QENA 3L7WA 2V1DA 5J3UA 2M1BA 5KHHA 1KGSA 4HLXA 1EH6A 1U8RA 1DP7P 5FD5A 3IWFA 1GHCA 4HZFA 2VQAA 2RGVA 4MGYE 5LEKA 4LA3A 1R36A 5EFUA 4YYOA 3ZMUA 3TNQA 1T2KA 4HSLA 4J1WA 5I93A 3ZMSA 2D5FA 1BM9A 4XF9A 3BJOA 1J59A 4OMYA 3K1MA 2PAMA 2R7DA 4LULA 4KMUX 5H6RA 3ZN0A 2VC0A 1C0WA 2V6CA 4MNUA 1G3WA 1BIBA 4KT5C 2O6GE 1H9TA 2IA0A 4P55A 3ML6A 1G3SA 3CTAA 1YYVA 1B4AA 1RUNA 1FYLA 1MJ9A 5FLXK 3RYPA 2VBYA 4ESFA 4B09A 5HS7A 1S3JA 3VEPA 1LR5A 4EJOA 4ZZDA 1IN4A 3JAMK 4LUMA 1REPC 5I91A 5E1XA 3FXQA 5L3DA 3BWGA 3WE3A 1YFXA 2UXXA 1UCRA 1SFUA 3VOEA 2FA5A 3FFQA 3QPHA 2NRAC 1KQ0A 2PHLA 4HMZA 5I0TA 3L00A 2IW5A 3GFIA 4GULA 3P7NA 1ZZ7A 2XAFA 4YFNF 2EFWA 3BROA 1BIAA 5D8LB 4XSZF 3HTUA 3U10A 5E18F 3WTTC 1IRGA 2VN2A 4CYDA 1SFNA 5I8TA 5JSPA 4LLOA 4AQ6A 2KKOA 5JSOA 2YX4A 4JK1X 3U2RA 2OYZA 3GZ5A 2P5LC 2XKOA 2GZWA 3WTXC 1BI0A 3LZZA 1V3FA 5KHGA 4UBGA 2PBIA 3QRFF 3S0MA 5FQ0B 3V4GA 1O57A 2DTRA 4BHPA 2OA2A 1ZARA 2P7CB 3BB6A 4D7TA 2XRNA 2E7XA 2L01A 1ZLKA 2CAVA 3HT1A 1DDNA 1L0OC 5JHUA 3BZ6A 1W5SA 5F1RA 3DL3A 2K02A 1LEBA 3MDPA 3U9GA 1P92A 2MC3A 1FBUA 3RKXA 5ERIA 1YS6A 4ON0A 1ZZCA 2E1NA 3GYDA 2ZJ2A 1EY2A 4KWJA 3HT2A 2MH2A 1HSJA 4A5NA 2FXAA 1Y3TA 1U5TA 2V1UA 4A6EA 3GBFA 2HEOA 3F23A 2KXLA 3EUHA 1OPCA 1O3SA 4MTEA 2EFPA 2EVXA 4Z07A 1IAWA 4IEPA 4MGZE 4PCQA 4XFHA 2Z3YA 3I4PA 5L3EA 1JXSA 1WA4A 3ACLA 1V4RA 1XCBA 1UFMA 5AVPA 5FDBA 2RN7A 2R3SA 1TW2A 5LHIA 2QCSB 4UBHA 3DPLC 2W57A 1U5TB 2GIVA 3HSRA 3RIRA 2YX7A 2LF7A 2PA7A 5T3NA 3WGGA 1USTA 4ZU4A 1Z91A 3CLPA 2O61A 4I0BA 2UY8A 1IW7F 2IPQX 4P5OA 1P2FA 4AIKA 3PQKA 3WTUC 5DCFA 2CGPA 2DT5A 4KN7X 4XLPF 3NW4A 3KMHA 5E16A 2DW4A 1X3UA 2J5OA 2K27A 3JAMZ 4E2QA 5JI6A 2GQQA 1QBJA 5I8YA 3COAC 2MPFA 3JZVA 1GXQA 2D1HA 3CEWA 1FI2A 1P6RA 1STZA 2QZ8A 3CO7C 2HYFA 4A0YA 2GC0A 2COMA 3LWFA 5CVJA 2ZCWA 2GAUA 1IUYA 5FLJA 3WGIA 3GFLA 1U2WA 5DCMB 4LLGF 1NXMA 4OOIA 4AIHA 4UNOA 4CDGA 3HHHA 1TQ5A 1I5ZA 1ZZ8A 4IF4A 1LNWA 3DEUA 4XFCA 3EBRA 1IXCA 5FFZA 1TQPA 4DINB 3FHZA 1R7JA 2EV0A 1GVJA 5LGNA 3V7RA 4OU0A 1P4WA 3ELKA 1IN5A 4BQAA 1DPUA 4LB5A 1QGPA 2J5PA 1RC6A 3E6BA 4I2OA 5HDNA 3BOQA 2ZXJA 2F5DA 1TLHB 2VE9A 3LA3A 1D3YA 3TOBA 4IRIA 2IXIA 3AAFA 1RIOH 5HLGA 1RL3A 3HOTA 2FNAA 1J9IA 2GXBA 4UVCA 2CQKA 3GXOA 4KIFA 1ZAOA 5HLHA 2EB7A 2VONA 5E1RA 4I01A 3VODA 2H27A 2K4JA 3WTWC 2XL9A 4FAGA 2OD5A 2K9ZA 4FX4A 2ZO4A 1Z6TA 2ZFWA 2Y0OA 1PMIA 3MCZA 1CAUA 3UKTA 3WGHA 1BOAA 3CUOA 4LG0B 4G7ZF 4E2SA 4XFIA 2Z69A 2JZYA 2PYTA 2PQQA 3HIFA 1USSA 5K5RA 3RKWA 1ZGAA 4AIJA 4HN1A 3DKWA 3KSCA 3WW4A 3QACA 4U7DA 2A3SA 4OIRF 4A2UA 4I3PA 3DN7A 2FSWA 2GC1A 1O7LA 2GWRA 1WI9A 2ZKZA 3KP2A 3GW2A 3HSEA 3KLNA 2FRHA 2HQNA 3HYIA 4HF0A 4KICA 4LG0A 1U3EM 2UZKA 2ELHA 1Y9QA 2JRTA 1TBXA 2IJLA 1FP2A 2B5HA 4Y13A 1XGOA 2GH2A 2VT2A 4L2NA 1I1GA 1XMKA 3D82A 1FYMA 2K86A 1Q1HA 3KEOA 1XCVA 1IXSB 3ISPA 3IDCB 3E97A 3ETQA 5FCCA 2IXHA 4O6JA 1BJAA 2FMYA 2RDPA 3I71A 3CO6C 2MNGA 4IEXA 4Q5SF 2V09A 4WK8F 3H7JA 3L9FA 2LSOA 5E1ZB 2RNJA 4GO1A 1H1MA 3OV8A 2WTEA 3I59B 2HYGD 3CDHA 4HW0A 4HOBA 4EGZA 1J7KA 2GXGA 5BPDA 2B0LA 1ZN2A 4P96A 3BP8A 1QXRA 2W84A 4E70A 2VBXA 2JTVA 2ESHA 3R60A 1OYWA 4JBAA 3GFJA 4G94A 4IXAA 5L3FA 3H9AA 1NE4A 3EDPA 4MEXF 5ICFA 3SXYA 4MQVA 3V7SA 1QZZA 1DZTA 1QWRA 4U0VA 1TW3A 1G3YA 1R5GA 2WC2A 3CUQA 4R52A 4WX9A 1QZYA 3BY6A 3IDBB 4R8HA 3P9KA 4NQWA 2BBYA 2STWA 1HXDA 2HGCA 4MV2A 1XGSA 2XROA 2G7HA 3TKYA 4KL1A 1IN7A 3F8BA 1T0FA 1J5YA 4XSXF 1S7OA 5I0RA 2BV6A 2P8TA 2IRFG 5TJJA 2CFXA 1ULYA 1P4AA 2JPBA 3E5XA 1KYZA 3JSPA 3LA2A 4LA2A 5BUVA 2E1CA 2VBWA 1ZZ6A 1LDDA 5JVTA 5DV5A 2DQRA 3SXWA 1G3TA 2KJCA 2PFBA 4MZUA 1FNNA 3KETA 2RVCA 5KHKA 3F6OA 2PFWA 4MTDA 3KP6A 3NEUA 3NRVA 3F8CA 1IZ1A 1YFHA 3IHUA 3W6KB 4RB2C 1XGNA 2MLKA 3J7AO 2NNNA 4MGRA 4G8XA 1VTNC 1D5VA 2Q8KA 4HF1A 4YSFA 1O3TA 2O8XA 4G7OF 4HQMA 4FAHA 4CZZA 2DBBA 1ZREA 3MEXA 1FC3A 4NB5A 4L0YB 3QU6A 2TDXA 1D8KA 3BPXA 1ZGJA 3LQQA 5HS9A 3CL1A 4XBFA 1KU9A 5BOXA 2A6EF 2FBIA 2MH9A 4LK0F 3R6SA 1IN6A 1TNSA 4FBFA 1I6XA 5K5OA
chains in the Genus database with same CATH superfamily
3K10A 4Y20B 5A3NA 1UHWA 1H8AC 5IATA 3VUOA 2ZC2A 3N7LA 1PGW1 3J81Z 5EJCA 2ETHA 4AL9A 1ITYA 2JQ7A 3DFGA 2GC2A 3LCPA 3FKIJ 1DYPA 2RS33 1AR61 2YXSA 4ZU7A 1WWXA 3VYTB 3ZYJB 1CAXA 1LU1A 1W3XA 4XKWA 1VAVA 2Q0OA 4FHTA 3A0HC 3JRCA 1RUD1 5C8CA 4N43A 3FBIB 2LKPA 2BPA2 4R1HA 4LO8A 1UKGA 2HWVA 3PFIA 1O7FA 1KQ9A 5B1AH 4NROA 2LRDA 3NV2A 5G04L 2VLAA 1U5TC 4XHXA 3LDBA 1ULOA 4IV3C 4HYEA 4YG2F 3I2IA 1W6QB 4MG2A 3FISA 1TT0A 2W1WA 5DYMA 2WY8Q 2C9AA 4E2GA 4MADA 5C5TA 5CVVA 4AGVA 5C8CB 1AKHB 3LSHA 1H8TB 4LEJA 1QA6A 3CMGA 2DN0A 5J47A 1IS3A 3PTRB 2DVBA 2JG8C 1PNFA 1OLTA 1C8NA 4JQTA 1FOD1 4MLOA 5JI9A 2NZ9A 3HN3A 1XGMA 3TN93 3VBHC 4I99C 3UGHA 2AUYA 3OPTA 1JT6A 1E57A 2ZJCA 1V54H 4FPYA 4M0NA 4K8RB 2HOAA 2WY7Q 4RHV2 3IDAA 4B1MA 5IK4A 1LHNA 1VBD1 2Y60A 4KMQA 4K7JA 3T0DA 4E6KG 4Q0UA 5LLQA 2VNRA 5H20A 4N53B 4E7SA 5EQUA 4KFCA 1Z1DA 5FBJA 3DPRA 2WYFA 3POFA 1GQGA 3LSGA 4UVBA 4COZA 1M06G 4A7YA 2XIGA 3CZUA 4PSXA 1AVBA 2DUPA 4Q0SA 2XQRA 4IEZA 3OS0A 3KT4A 3DLLF 1WKYA 4AI0A 2EXHA 3ZPLA 1BEV3 5AIPA 1WW4A 2E19A 2NVTJ 4IHYA 3MKWB 3Q9OA 1YG2A 2L54A 2Y0MA 1D1BA 2YBPA 4Q4X3 4E7ZA 5C7GA 1Y8QB 3LOIA 4QGMA 1DDLA 2LTPA 1HA8A 4ITVA 2PN5A 1R082 1NA1C 2CTVA 1TME3 1T2XA 5FFXA 1B09A 1GSLA 3REOA 3JBG2 1LB2A 4YVSB 3HNBM 2HYKA 3I4IA 3EMRA 5DDJ2 1RUC2 1H1IA 5KBFA 2DCTA 3UV9A 4FPOB 1SLIA 5FRAA 2AS5F 1AR83 4DXTA 3IRQA 3HB9A 5FIXA 1O4YA 4QPIC 2W1QA 1R1UA 3HXLA 1QJU3 2R7FA 2NOGA 4OMZA 2A3YA 2YBKA 2BW3B 3R61A 4BQNA 1PZ9A 4L99A 2PJPA 1JW6A 1KU2A 1IDYA 3B00A 1UB9A 3KP4A 2R7ZJ 1WLCA 4R9AA 4HLYA 2E1MC 2VZ1A 3H9JA 2OX0A 4XUQA 5ICEA 2XVLA 2TUNA 4LKSA 1Q8OA 1DUXC 5D4RA 1CN1A 4Z82A 4RGSA 5FRMA 2KRFA 1VBE3 2L02A 1WMXA 4DYRA 4JHZA 1IUFA 4A69C 4BMBA 4ISRA 1H6XA 3KVAA 3H1CA 4HF2A 5TISC 2CG4A 2L9SA 2ETEA 5A6YA 4D8MA 1D0GA 5EPAA 1HLVA 5DAPA 1TNTA 3NNGA 3T30A 3I2FA 1XYNA 1DYOA 4WCGA 4IGPA 3LDRA 4UFIA 1WH7A 3CCUI 1W3VA 3ZXJA 5A1FA 1RRJA 2PHFA 4RB0A 3QBQA 3RRDA 4Q4W3 2BOLA 1T98A 1QHGA 4X0GA 5FZMA 2O0OA 1SDWA 4AEDC 3JRHA 3A0BC 3K4AA 3ZR5A 1VRH2 3LFKA 5IFPA 3RZHA 3K2ZA 1JUIA 1CAVA 4XR6A 2KQRA 1PUFB 2X85A 4AW7A 5IY5H 1XE7A 3GDBA 1BR1A 4GJZA 4LITA 3OYDA 4PJMA 2BY3A 5B66C 5FPXA 3D0JA 5BNOB 1J75A 2I07B 4C8DA 3KCYA 1SZBA 3M3YJ 4AGGA 3P1IA 4U2AA 4BLIA 4A0XA 2WA4A 1ZG3A 2OPKA 1W8HA 3KZ4C 2WV0A 3G6EI 2XLFA 1K78B 3K46A 2HWD3 4UB8C 1VBA3 3E3VA 4JX4A 3Q5FA 3I2GA 3VBHB 3UESA 2IS1A 2VTFA 1PVC2 2LD5A 4XUNA 1HSTA 2LY2A 1AUYA 4P00B 1TWGJ 2YY1A 1A78A 4NN0A 1C5IA 3S6PA 2JJ6A 1X4PA 4DZJA 3GCMA 3FF5A 4L9NA 3WTZA 4GMP3 4LBQB 3SLIA 2F4MB 2ZBKA 3KT1A 1CD3G 4LO4B 5LHGA 2QSFX 5FZCA 3TYJA 3RPUD 4AFMA 2WA3A 4J1XA 2VE8A 1PM7A 3WQ0A 1LKXA 3ILRA 1RUJ2 2G19A 2OV7A 2D6MA 1W6PB 2VBZA 5IVJA 2I5UA 3PUIA 5DUXA 5JMCA 2O9LA 3THDA 1Z6RA 4YRVA 4CXWA 4QPIA 5FP9A 4BXUA 2VJIA 4AWXB 1OLME 4N53A 2C9KA 2V72A 4YELA 2W52A 4WV8A 2DAOA 5FWJA 1MBEA 3GXUA 4JV4A 2LF8A 4Z2AA 3PO3J 4RAZA 4E7JA 1W8OA 2VQLA 5LK5A 4L0PA 3T8RA 1ZZBA 1QZEA 1G7YA 3CHXA 4YZ3A 4UAPA 1S5LC 1UXXX 4YM3A 2IXJA 3SFIA 1YUDA 1Y9GA 4BOWA 4XACA 2D97A 5EGOB 4EMSA 3ILFA 3ASOH 2JDAA 1G9CA 4E4HA 3JRIA 1XYPA 5JVVA 5C5UA 4FOVA 2RS53 4LT5A 4EJRA 4MIMA 5FQ0A 1YLFA 4YIFA 5HODA 1YC61 3K4JA 5FR3A 1SBFA 4LHSA 2J1SA 2XVGA 1JHNA 2OBPA 3OS1A 3WX5A 4ZZLA 3AP5A 3TDZC 3O12A 5FZOB 4CUAA 3AL6A 2JUGA 3ST7A 5IVVA 4AYBN 5M5WJ 1N1VA 1O5UA 2PG4A 2QQLA 2H6BA 3OYNA 2JWTA 2PAEA 1W0UA 4A12A 1HRV3 3T4HB 5E6HA 2FBEA 3B3QE 5IT9Z 1PNGA 1W8ZA 3MFKA 2IXCA 1OF4A 4JTNA 3ZMOA 2P5KA 4MVTA 2X6YA 2AQEA 1QU3A 3KVBA 3BTLA 1FPN3 2UXNA 4DS0A 1PO12 3R4KA 1JUHA 4H14A 1H9WA 3OOPA 2J1TA 1LULA 1DGRA 4BA6A 4OI1A 4AQSA 4GQ7A 5FZAA 4CDUA 2DI3A 3GLXA 1RXFA 3S5AA 2MEV2 2QDRA 1VQ5I 2KD7A 1YI7A 4Q5OA 3J9SA 2F6CA 4AK3A 3F21A 4B8XA 1KJRA 1FBQA 5GAHJ 2EXKA 4LMYA 5FO5A 2NS7A 5F3GA 4ORFA 2E7TA 1E5SA 2D1VA 2HOEA 4EQQA 2PJRB 3FHNA 3FBYA 2M30A 1UY4A 1OFSA 4IEYA 5K0UA 3AMMA 1QNTA 4NHLA 1VQOI 1XNAA 3LSEA 4UFLA 2WWSA 3ABKH 1LODA 1MDMB 5C4XJ 2NMOA 4FFFA 3CF5F 1KA8A 5A3UA 3BTYA 5FZFA 1K83J 4XORA 2A1XA 2PHDA 2XJTA 5FY1A 4N7UA 1BN5A 3I3MA 4NHKA 3OY9A 1SMTA 3O6BB 3WDYA 4CU7A 3RVHA 1TZOA 3IAM2 3BU7A 4HN0A 4IEOA 3T0YA 1BBT1 4XAEA 4M71A 4FOWA 3WD5A 2KDZA 4GA9A 3T2TA 4XFBA 5J4YA 1LQ1A 3USUA 2WS92 5FMDA 1YE9A 2RREA 1GYKA 1HBXG 1RUH3 4Q4Y2 2DWRA 1HKTA 2WAAA 2JA2A 4D5CA 2D3PA 4CH7A 2AACA 5DXDA 2PEXA 1VP6A 1NCRA 3ES4A 5H2FC 3HRSA 5A7QA 5K1YA 4C0HA 4Y4RA 3DBLB 1WGXA 4CP9A 3RMXA 2Z4FA 4TLFA 1K78A 1RMU3 3SHRA 4AYUA 1D4M3 4GWIA 1MQTC 2LOOA 4XYXA 2VTXJ 2BY0A 1YCIA 3GZNB 1TEIA 1RUF3 3BZCA 3WV6A 1QNYA 4U0WA 3FXJA 5FMOS 3BOPA 1Q8VA 3J7NA 3CCYA 3E5QA 3O8HA 5A33A 5LFAA 4UW3A 2ZGLA 3BTZA 2E35A 3LFIA 4EGYA 5A7NA 1W8WA 2ZHKA 4QT6A 5FJKA 3ZOIA 5L3CA 1FPQA 3PUFA 2CO5A 4XQWA 1MEC2 3VBOC 3S15J 4IL6C 1I27A 4OINF 4ES9A 5EJZB 2M45A 1YJKA 5BNOC 3LL7A 3KP5A 4ZDOA 1TQIA 3FLRA 3PFYA 2WNVC 4CDXA 4IVNA 1OD3A 3RI4A 4FQZA 3VSKA 3F72A 1V6JA 2YC2A 3B73A 5JLVA 1X1AA 2WWYA 3H35A 4UV8A 1KU3A 3ITQA 2FE3A 1G9AA 5JR3A 4OYUA 3TEXA 1OCRH 2X9DA 3Q9VA 4QGLA 5A7WA 2F4OB 4GWJA 1ZZ9A 2DBNA 3C3VA 1LESA 1IPKA 1VMFA 3U75A 1JYNA 3VLBB 1G6NA 3BGAA 1OOPA 1XN7A 1N77A 4AEMA 4A6DA 4W4ZA 5H9RA 5E3MA 2Z9OA 4NHXA 5FKMA 3NV4A 1LJ9A 2HTJA 2GU9A 2QQNA 4KGQA 4RLQA 4E4DX 2BE5F 2XLGA 4NRPA 4OZOA 4HRIA 3ZN1A 1J09A 4EWAA 3IUOA 2IS4A 4ANJA 2OA4A 2LH9A 3GBGA 4JCKA 4XQFA 1SANA 1Z7S1 1VE0A 3N97A 5JZGA 3E6CC 4C91A 2O5RA 4NC8A 5EV7A 1N1YA 4JDNA 3ZMTA 2K4BA 4BK4A 1WJ5A 4XLAA 2VOOA 4PI2A 4OHVA 2VMDA 2W46A 3ZMVA 2W4SA 3WE2A 5E8IA 4QWNA 3W6VA 5FXZA 4QKFA 1R1ZA 1QOTA 1XDSA 2GALA 1UOJA 1ON1A 4RS5B 1IQAA 5C3SA 5JZGB 1HRV2 1LGNA 4XOGA 3MQ0A 5HPOA 1IS6A 5ACA3 1BVVA 4BGDA 2BNMA 1HJGA 5ICGA 1FIPA 1CF7A 3M4FA 1ZG1A 2C24A 4FX0A 1LJ7A 1RUI1 2UWBA 5AFBA 1IOAA 3KCXA 4KQ7A 4N9HA 1SLBA 1DU6A 3KS7A 1NE6A 5CBLA 3GCWA 2DTYA 1FLIA 1X1DA 1RITA 1T39A 2VBPA 2W91A 4CCJA 4G7HF 4FO9A 3SJMA 2AENA 3HOXJ 2DUQA 2VG9A 4LG3A 1ENRA 2A6YA 2EF6A 2JG8A 2BHZA 1CF7B 3L1PA 4L9VA 1AYM1 3HC7A 4CHUA 4OCTA 1A34A 2ET1A 1UU6A 4CYCA 2LK2A 2LDUA 2DCJA 1MKMA 2C5DA 3E6DA 1GXPA 2EZKA 2A69F 2ZABA 4RAYA 3H9QA 5IT9K 1VQ4I 2VMGA 5DM6F 3VN4A 4ESJA 5LATA 3LSIA 4MFEA 5D5XB 3CO2A 5IYYA 2R5YA 3JW4A 2IA1A 4XF4A 1JJ6C 1T6BX 4S2DA 3HOBA 4QX5A 4CDXC 1IDZA 5JFRA 1CAXB 1FOD2 2BP6A 2UU8A 1LOGA 1QJZA 5FZ7A 4UUSA 3UGGA 3U1KA 3ULQB 4JX6A 2RDQA 4FFIA 4Y26A 3DQVC 2NYXA 1HKSA 3D8CA 3I3LA 1SFYA 5BPIA 3BKZA 3LEKA 2YSRA 3EUKL 5FGMA 1LTEA 1D7PM 1I3HA 1SVMA 4HG6B 3OYGA 3SH3A 4QD2A 3EYYA 5A3WA 3WNPA 3TBIA 2DU1A 1NUKA 1T38A 3ZQ7A 3W58A 3LEMA 3MUY1 4UUSB 1X1PA 4Z2YA 1JZ7A 4XJ8A 2VQGA 5EZWA 1PVC3 3TL4X 1OVPA 4MGKE 2VC1A 1A31A 3S32A 2K0GA 3LSDA 1PO11 3SFZA 2OUJA 3K51A 2W47A 2X5IB 1YIOA 2MLGA 4RM3A 2QUOA 3CU7A 5D5UB 5CKQA 3KEQA 4N4NB 3C18A 4O7XA 2BJSA 1AYN2 2WO2A 4F92B 2HWE2 2ZX1A 2HDCA 2QVOA 2ME0A 1BI1A 4CDXB 3ZQFA 4YPJA 2XJSA 2DCZA 1AXKA 4GCVA 2M8EA 2MA3A 1WMFA 2NVXJ 4V19K 1H8VA 3C7GA 4EROA 2ARAA 2ZEZA 3WP3A 1K4SA 4C3IJ 2R1DA 3OUHA 1KFXL 3CP8A 4NWVA 3SZGA 2EFNA 3M3OA 4IEJA 4BBRJ 4RBOA 4DY5A 1D1CA 3N9OA 2HJIA 1RIRA 4CA9A 3QPLA 3VD7A 3PMEA 5J6XA 5F04A 4X6AJ 4I0AA 2R32A 1OKQA 2E9QA 1W7PA 4M9SA 2F6BA 1RUD3 1HB2A 1ND3A 3ZFGA 3AZYA 4KMFA 5EIYB 1R091 1VMHA 3Q0UA 3JQXA 5LRSA 1AXYA 4ZS2A 1VBE2 1RYYA 3OR1C 4H3WA 4E7IA 3AL0C 4YZ2A 1TVGA 1HRI1 1Y39A 2P34A 1W6OB 2XXZA 4BDYA 2UUZA 1DU3D 1PGSA 3MGUA 4XDPA 3NVCA 4HOOA 1RTVA 4RB3C 3AKQA 2UYBA 2V6EA 2JDHA 3K1PA 3TGNA 2X0LA 2BEOA 3RZZA 3PJYA 2YFUA 3VB9A 1BI3A 1V0AA 2YC0A 4RR3C 3TDUC 4LD5A 4K21A 2WDBA 1PMJX 1X9TA 4WWCA 3KEYA 2XPWA 3AZVA 1FJLA 2NVQJ 3PUBA 4O3MA 3FMSA 1TQMA 3KP3A 2VUCA 4HANA 5AC93 3RZMA 5E79C 1UCXA 3D1NI 3AYEA 5E8AA 2CQ7A 1RVF1 1QRYA 1A8DA 3H8UA 1B1BA 4B4RA 3K9TA 4EV0A 5HCBA 3L7WA 5KAIC 2OF7A 4YWAA 2M1BA 1KGSA 2ECCA 1IG7A 4DY3A 4OI0A 5LY2A 1JT0A 3IWFA 1R64A 2YGMA 2VQAA 4XJ9A 3ZMUA 1UY2A 3TNQA 1WJBA 1T2KA 2D5FA 3KF5A 3VBRC 4QKDA 2ME6A 2R5YB 4XW3A 3ZR8X 4OMYA 2PAMA 1AXZA 4LULA 3AG1H 5H6RA 1I5PA 2R072 1C0WA 4I3GA 2XR4A 3WNMA 4ZKTB 2LKSA 4RSUA 3HNYM 3CTAA 5FUIA 2WBMA 3CCEI 2E63A 5K7ZA 1RUNA 1FYLA 1MJ9A 3OD4A 4Q4Y1 2DYCA 1UX6A 4CVUA 4LBQD 5T5OA 2Q8CA 3VEPA 2WZPP 4RMNA 3ZCOA 4GAZA 5EJ1B 2W95A 4ZZDA 3JAMK 4QPGC 1VBA1 4PQQA 4QX0A 1YFXA 3KWVA 4LBLA 2UXXA 2N8GA 5FLVA 3VOEA 4WM7B 1Z77A 2NRAC 3I2KA 3VL9A 2FZ1A 1ERDA 4HMZA 2R7OA 2WNUB 3OGGA 5I0TA 1LHWA 5BYNA 2B9VA 3P7NA 5EHDA 4BISA 1BL0A 2JK3A 3WTTC 3BR0A 5LASA 1SFNA 4CCOA 3OBRA 4LLOA 1MS3A 1P7JA 4PFPA 1DQUA 2YX4A 3JRAA 2DVAA 4IE7A 3I3EA 2GZWA 2CSGA 2W00A 2C4XA 2VTXA 1PO13 5M3FJ 3PMSA 3S0MA 3KM5A 3H5AA 4QDRA 2WNOA 4UF0B 3ZXLA 5AVAA 2DTRA 4C1WA 2PLV2 5LBBA 1ZARA 3ZFEC 3K4DA 1LUJB 2L01A 3PU8A 4Y5TA 1L0OC 4XLFA 9ANTA 3GGLA 2PHTA 1NG7A 2EICA 2X10A 2SLIA 1LEBA 4P14A 3POYA 3DYMA 3RKXA 4PUSA 5ERIA 1LEDA 1AYN3 4D7YA 2HPIA 2ZJ2A 4KWJA 2IGMA 3JD71 1JYWA 2W68A 2JVHA 2FXAA 4UF0A 1SLAA 4W6WA 2HEOA 3EUHA 1GUUA 1OPCA 1O3SA 2CWSA 4LNVA 2EVXA 4Z07A 1YRNB 4MGZE 2ZGPA 3D5SC 2Z3YA 1D0XA 1WA4A 1DQ4A 5EGOA 5FP4A 3AYDA 2RN7A 3D6EA 3ZSLA 1TW2A 2GIZA 1E3HA 1UOFA 4UBHA 1DQ5A 5AFEA 2P81A 2ZAAA 1U9NA 4CU6A 3ZKYA 5JOXA 2GXAA 4QB1A 2Y0SN 1ULGA 2PA7A 5T3NA 1USTA 4CCLA 4ZU4A 3ALQA 2X1DA 4HETA 2IPQX 2W3JA 3D3AA 3O0WA 2RMU1 1P2FA 2PHWA 3IT8A 4CZSA 2WWJA 1TG7A 2VL8A 5EP9A 2GQQA 1QBJA 1MNDA 2EH3A 1FOD3 2MPFA 5A32A 3Q8EA 3CEWA 1STZA 4PFOA 4A0YA 4Y22B 5HNFA 2ZCWA 2GAUA 1IUYA 4CDQC 3ZXEA 5L19A 4TLGA 1OBNA 4RGAA 3WLUA 3NV1A 2R7WA 4RR3B 3RSNA 1ZR2A 1ZYBA 3RSJA 4XFCA 5A6ZA 2D98A 1OCTC 4PDWB 3S3OA 3ZRGA 3NMBA 4IOAF 4YZ1A 3V7RA 4OU0A 3K3NA 5LD2C 4BQAA 5JXGA 2HNHA 3HM5A 4AUXA 2LREA 3E6BA 3LD8A 4OMCA 3Q8CA 5HDNA 3G1OA 2ZXJA 3OBAA 4N43C 2F5DA 1TLHB 1S55A 1G86A 3H0GJ 3TOBA 1PIV2 3ZSEA 2MD0A 2F17A 3RI9A 4LO6B 4BMEA 1G9DA 4YGCA 3VBOA 1H89C 2EB7A 4I01A 3VODA 4NDLA 2K9ZA 2DA2A 4FTSA 1HB3A 4LK6A 2WQ8A 2AXTC 3WGHA 4V2GA 3KF3A 4ZC3A 1D4VB 4XFIA 5KHDA 2PQQA 2LMDA 1JS9A 3MW4A 3A2KA 1USSA 2O8OA 2IGNA 4ZYAA 2E53A 1WCDJ 1TNRA 3DU5A 1C3HA 2A6XA 2PLV3 4A2UA 1VRH3 4YW2A 1W0TA 2J42A 2GC1A 1XSQA 4NUBA 3VZJA 2JA6J 4RN5A 3GW2A 2KM2A 3PJQA 1REFA 4A3DJ 3HYIA 2ZJQF 3OBTA 4OAYA 4DJAA 2ELHA 1G9FA 5C4WC 3VZLA 2IJLA 3A7QA 3BIEA 1DYKA 3FUOA 5K7HA 4AHWA 2FX0A 4OUMA 3SEPA 1X1CA 1ULPA 1XMKA 4F3QA 2GOMA 2VMFA 3ISPA 3DXTA 2VXJA 2IXHA 3K4MA 3I71A 2MNGA 1YQ8A 1O59A 3H7JA 5GPCA 4BQ4A 4QHBA 4TWTA 2B39A 2A05A 2RNJA 4GO1A 1H1MA 1W5CC 2HYGD 4NRMA 3JREA 2CMPA 1S0CA 1HCRA 3S3MA 5BPDA 4K3UA 5F2WA 1QXRA 1RETA 2VBXA 5A3PA 3R60A 2W82A 1SAUA 2BWAA 5L3FA 1LHOA 1TMF3 5A70A 1NE4A 3OY8A 5CFCC 5KR7A 5ICFA 4ARXA 1HDPA 2GH8A 4MQVA 1GLNA 4Q26A 1DZTA 3ZN4A 3ZYHA 4ZPIA 4PJ0C 5EG0A 5F9TA 5AC91 3QWLA 1EPWA 4J01A 5F39A 4LO5B 3CUQA 4QTRA 2XOMA 4WX9A 1B8IA 3IDBB 4NIGA 3P9KA 4NQWA 1HXDA 1FV2A 1CESA 2VQCA 1XGSA 5A7PA 3ACFA 5KNLA 3AP9A 2OPTA 4OWRB 1UJ8A 5A7WB 3A0NA 1Y1VJ 1MEC3 4XZUG 1MS5A 3PVNA 1S7OA 4W8JA 5TJJA 2CU5A 2CFXA 4QDSA 3FUQA 4YVWC 3GTMJ 1SG3A 3IH3A 1R083 3LA2A 3LFUA 2V9PA 5HCAA 3FBNB 3A1YA 2GMMA 5FKOA 1F4AA 3WT3A 2VBWA 1ZZ6A 4LE4A 5DV5A 3V42A 3SXWA 5FZ8A 1G3TA 4Q4X2 2W94A 3UYJA 2KJCA 2M8GX 2PFBA 1HLCA 3HD8B 5KHKA 1RUJ1 2PFWA 3KP6A 3DBRB 4P08A 3LGRA 3JBG1 2ZMLA 1RMU2 3W6KB 3J7AO 1HDKA 5IT6A 2Q8KA 3HEIA 2DFCA 5FK7A 1O3TA 2O8XA 5FZEA 5CEHA 4PBPA 3KB5A 2VBBA 3TW7A 4Q4V2 1ZREA 3MEXA 4NPLA 4NB5A 4L0YB 3QU6A 4GMP1 1JZ8A 4BJ0A 2TDXA 3WG1A 1D8KA 1ZGJA 5HS9A 3CL1A 1KU9A 5BOXA 4PDWC 2A6EF 2FBIA 2MH9A 1Y6IA 4FBFA 3B9IA 5BNPB 5FPBA 1MGTA 3PUAA 2G9GA 2CW0F 1ETQA 5JCTA 1GKBA 6PAXA 2XJRA 4L9TA 3BPZA 3ZYIB 5CG8A 3HZJA 2FDKA 1HDDC 3E5UA 3K70C 2IWGB 2VH9A 5A7OA 1W6MB 2RJKA 1WJEA 3HGYA 2R7UA 3U4SA 1MJBA 1YLLA 1QPIA 3T8TA 3HJEA 4Q27A 2GC3A 2YPDA 2LALA 5HLIA 2RMU2 1KITA 4KBBA 1UYZA 3S2HJ 2F4IA 4M72A 2AHQA 5CFDC 3NO8A 2ESNA 4AOCA 1WCMJ 3DTKA 5GP9A 1V5GA 2B42B 1W2AX 4FT8A 1BA5A 2MEV3 2QQOA 3KGZA 2CSOA 1LEMA 3G73A 3OPWA 1SD4A 5DMYA 1GZCA 4NC7A 4RGUA 4KNYA 2GLOA 4IEWA 4N9IA 3NNMA 2Y38A 3BVCA 5CKMA 4CO8A 4EN7B 5BY5A 1VPHA 4AD9A 1AR91 2BFUL 2J1UA 1KU7A 4NPRA 1C1LA 1UKRA 3IPVA 3O14A 1V6IA 1WQ2A 1C5HA 1UZ0A 5DS9A 4UVAA 1U12A 3E0JB 1PP7U 1XYOA 4ZY9A 4DUWA 4DEQA 4INDA 1GP5A 4JDMA 4CDQB 1RUD2 2F2EA 3Q0WA 3R0AA 1DZQA 1HN1A 3IKWA 2DURA 4BE2A 4A3LJ 2XUMA 4P9GA 3OYAA 3D5LA 1KDMA 1WGPA 2JENA 5CVRA 4WF2A 1WPKA 4CRQA 4YW4A 1OCCH 3SEEA 1OXCA 2JA5J 3CIHA 4AYBA 5K4LA 2QQBA 1PYVA 2Q8EA 3V0BB 3HHGA 1E0EA 1FYKA 2DA1A 1K5MC 4D1QA 3A23A 3DYOA 3SKVA 3DYPA 3FHIB 3RJPA 4L9BA 1EPZA 4ENNA 1Q3EA 1SD6A 4AU7A 1WBFA 4DBRA 1PIV1 2FF4A 2CJJA 2JDUA 2HVRA 2F48A 1FATA 4EE2A 4WXHA 3MICA 1X3ZB 1YJLA 2QA4I 5JPNB 1OJLA 1UMIA 4ENMA 1MMNA 4KGGA 1VQ7I 5FO8B 2Y9ZA 4GB33 2M34A 2Q0AA 2OCCH 4QPWA 1BC8C 1O3RA 4FPKA 3WNOA 4JQRA 5F64A 2RJLA 4RLFA 4HPKA 2VCCA 4KDPA 5I0UA 4XE9A 3ZFEB 1OPOA 2CV2A 4FXGB 1VBD3 3VB2A 4DEVA 2MFZA 3VBFC 1ZBA1 1W6NA 3WDWA 1FX5A 3WHTA 3TP3A 1OCOH 3V8LA 5J8CA 1ZNPA 1LGBA 1Q8PA 1K61A 1YWKA 1VBD2 3M8EA 2IUWA 1ZX5A 2XUEA 2EZHA 2FBKA 5FYMA 3BT9A 5FLIA 2XRLA 3AYAA 4DUXA 1HW5A 3MEPA 2Q2EB 5DM7F 3N3HA 2VZUA 2VOXA 1ZKGA 4DRRA 3AKSA 4WM8C 2HQAA 2NN8A 2R5ZA 1UD1A 2K9LA 4BJ5C 1GV5A 1VRBA 2YDEA 5A80A 1HRI3 1RUF1 2L9RA 4OFGA 2ZEYA 2KHMA 5GLTA 3L09A 5LA0A 5TSWA 5JOWA 2L7FP 4M3DA 2Y6JA 1ENSA 1NK3P 5ACA2 1R5ID 2BQPA 1YIPA 2XGDA 3GTQJ 4MGTA 2E34A 3DPUA 4SLIA 2JB8A 2QQ8A 3WW2A 3HOYJ 4JDOA 4H4KC 5FPZA 2CNAA 2ZKNA 2HVQA 2XAHA 1U9OA 1DCSA 3WU0A 3OTFA 5JOYA 3CC2I 3HUGA 4MX3A 3I3DA 2JJ7A 3MKZA 5LBFA 4KG0A 4RAFA 5F08A 3H50A 3EPZA 3BPVA 3H3UA 2ELJA 5FY0A 5FPAA 1F35A 2LLKA 2WYSA 1S0JA 4IXLA 1LEAA 4A44A 2DLLA 1DU0A 4L8QA 1BZWA 3RWKX 2ZEWA 5A6QA 4HQEA 4JKKA 3R4UA 1J0RA 2H6CA 1PGW2 3FE5A 4Q29A 1JGSA 1MZFA 3KZYA 1YW7A 1UELB 1QVTA 5C3EJ 5JVGF 1MS1A 3AJYA 1J1LA 3P5BA 4KU8A 1FIAA 4KN4X 3POSA 3VZMA 4LBNA 1Z7UA 1PVEA 1XMAA 3JD72 1J3QA 1NKGA 1XNDA 4OLLA 5H9QA 5ILVA 1XD7A 5K0UC 3VHOA 1ULCA 2X53S 5IFTA 4FTBA 2Z1DA 3INAA 5FTTC 1V6MA 4K1ZA 4G9YA 3AXEA 4PHZA 3VBUA 3ZQLA 1YTYA 3GALA 4UV9A 2DJNA 2QKLB 4ESBA 1VQMI 3ACHA 2ADUA 2XDVA 3RKQA 3U37A 2JXAA 1UU5A 4FOQA 1PK6A 2HS5A 3O8GA 4BHCA 1SFKA 3M3IA 1Z05A 3MFCA 4AC0A 4M9XA 2H8RA 4B4QA 4CDQA 1D2SA 1B59A 1QPMA 2JUCA 2RMU3 3JB8A 2DT7B 4LQRA 2LRPA 2B7EA 1CX4A 3VHPA 2X51A 1D8JA 2AXLA 5FUNA 4NWWA 3JBG3 4KJZA 4MUVA 3CUQC 4GXOA 3H1MA 2ISYA 1O4TA 1PK6B 1DIWA 4EQVA 1VZ0A 2XPUA 4Q1RA 1XDUA 1LE8A 2VMCA 2VW1A 3LFMA 5BNNA 3BDDA 3T1BA 1H9PA 1QQP2 2DMQA 3M8JA 2BTVC 1IS4A 5DDJ1 1DQ6A 3FXUA 5BV6A 3CMEI 5IK7A 4XJWA 1UX7A 1W28A 4EM2A 4HA8A 2X48A 2QQAA 4ARYA 4H0EA 2AQFA 4PIXA 4EN9B 4CTEA 3AP6A 1TE1B 4NOTA 2R041 2V4AA 1BOBA 1O4XA 4IQ4A 5EDNA 4IZZA 1X1BA 5ABJC 2PHXA 2A5ZA 1XB4A 3PNTA 2CV6A 1LOFC 3NNLA 2ZJPF 3BTJA 5F27A 4GWNA 4EZHA 2XAGA 3DCQA 5ICCA 3L2QA 3VDCA 1EF4A 4RHV3 3K4ZA 5L7OA 3POWA 1I6HJ 2WLQA 3LOBA 1DPRA 1ZYRF 2KDOA 1RUF2 2QLZA 1VMJA 2KL4A 4CEWC 4LFUA 2BZDA 2HBTA 3FXOA 5H6QA 3CCJI 5AC92 3VWBA 2BYVE 2OW4A 1ENXA 4Q4W1 2RJ2A 3BR1A 2JKBA 1QKQA 3O1UA 1UO9A 1H2NA 4LBJA 4FISA 4LLNA 5J1YA 2TBVA 1FOKA 3PVBB 3ZX7A 2OZUA 3RJRA 1HV0A 3B01A 4QM8A 1F4HA 4Q4Y3 3BCBA 1OA3A 2WO1A 4YW3A 5IPAA 1U5IA 1P7IA 4E4SA 2YC4A 2KIMA 4XAAA 4B48A 3Q8AA 3I0TA 3RPUA 3E7LA 1TMF2 1ZELA 5IWFA 3K4KA 3ZVXA 2ZGTA 2KMUA 1OLRA 4HDUA 1ST8A 4QQPA 2VZ3A 3LAJA 4HVOA 3DBHB 3S2WA 1GP6A 2L4AA 4CEYB 2JE7A 1XE8A 1ND2C 1Q56A 3VDDB 3I7DA 1LU2A 1T56A 1ZQ3P 4YARA 4N43B 5IJRA 2R7RA 1LRHA 3WTVC 1NY71 4QXHA 4MO3M 1PJRA 1AX1A 1BYHA 1TWHJ 3PTYA 2FOWA 1ENQA 4Z8BA 1CAVB 4XJUA 5F0FA 3MUZ1 4K8FA 1MD0A 1EKEA 3NJXA 4IL7A 5KVRA 1W6QA 3AJZA 5B4XA 2LBFB 3VDDA 5T5LA 5FZLA 2E2JJ 1KD7A 1WRJA 2PMWB 2E1MB 2AH2A 3DU6A 3IH4A 2OZJA 1VBB2 5KC5A 1ZK8A 2VUDA 2HWC2 1SAXA 4GXLA 4M6YA 1V6KA 2DOEA 2W25A 4CGZA 5C4JJ 4N0BA 1N78A 1MPXA 3OF1A 1NCQB 2RVAA 3JTGA 2X8KA 3VBUB 1DGWY 4CICA 1HQWA 5JLXA 2P4WA 5IVFA 5FYBA 2BDRA 1VLNA 2FCVA 4CEYC 4D69A 4A45A 3S2DJ 3LB9A 3ROUA 1XJAA 2V5DA 1W2TA 4EZ4A 1WLDA 5C9AB 2QE3A 1PIV3 5FZ6A 1MZ5A 2LYCA 4DIQA 2EXIA 3AL5A 4A5MA 1ZBE1 2RS52 1QQIA 2X6WA 2L5QA 2NQYA 4Y5Z0 2FEZA 1SQ4A 2O03A 5HCFA 4LOTA 5LBCA 5I0SA 2G9ZA 5M5YJ 4PLNA 2ZGKA 4OIPF 3KT7A 1EV13 3G6JB 5KCMA 2D5VA 4QHOA 3G2BA 5LA2A 4BQXA 2HEVF 3QP5A 2A70A 4BU2A 2WT2A 1RI7A 5F6FA 4XBNA 4MO7A 2BUKA 3RZJA 4P9WA 4BQ5A 5GLVA 3KYDB 3BZKA 4JGYB 2HWD2 4QXCA 4CCKA 1KQRA 1L3LA 5FKLA 2O8QA 4J6GA 1EV7A 4F3JA 1YW9A 5CKNA 2IVJA 4X8NA 1PVXA 5M0TA 4DOUA 5JXJA 2KA3A 3FXMA 1AOYA 3GZEA 3GVAA 3GZ6A 3BIWE 4RGXA 4A7ZA 4DNCA 2E32A 1VB2A 1BJQA 2Y9YA 2BGCA 2CL2A 4DPNA 2HQRA 2QJVA 5EG0B 4XM3A 1E5HA 1KYWA 1LVKA 1DP0A 1M4WA 1AU7A 2EIJH 1VALA 3KV5A 5C8CC 3VYUB 1Z21A 2YPJA 3FWEA 5IUQA 1W2NA 3BCWA 1FTTA 2QQIA 5L9RA 3OIQA 3ZN5A 4GYIA 3FLPA 4XMYA 3AP4A 5IVEA 3QODA 4EYUA 1BLZA 1V6LA 5T5PA 4XCAA 1HW1A 4BKXA 3RZGA 4WVMB 2K9SA 2QM3A 4XPVA 1MS8A 4Q48A 2A5WA 2DODA 1HQNA 2V4JC 4NIHA 3KV4A 2DPUA 4CDUB 1YO5C 2RS51 2E31A 2LM3A 3RGBA 3S57A 2EJRA 5BPXA 2Z5UA 2F5FA 4JP0A 3OYEA 1ETKA 1DLLA 2CW8A 4LLLA 2Y26A 4JTOA 2OC6A 1W8TA 1H9GA 5IYCJ 1F1ZA 2R042 1U8BA 4MGSA 4OIOF 1ENHA 3VBRB 1BR2A 2P5BA 1QH6A 4BY1J 2LG4A 3CBNA 1R1TA 4XN0A 1I50J 3S1QJ 3T1MA 1QJY1 1UG0A 4CEYA 2EV5A 1S2KA 4MXWB 1CZSA 2JG9A 4BEHA 1R081 2A6HF 2QUFA 5ILSA 3WF3A 3BTAA 4FPFA 4BS9A 2FDHA 1RUG1 3VBSB 4FFHA 5CADA 5DDJ3 2DDUA 4GKXA 4F83A 5KK1A 4QGNA 4IV3B 4XN3A 1R6RA 4GB31 3LSMA 3I56I 3PNVA 2LBFA 4A4AA 2ZFUA 1G8WA 2HWE1 5F7UA 4BEHB 1NCRB 3TWIA 2NNYA 3I3QA 3A01A 4LHKA 4CP9B 3CLQA 1RHI1 3ZQIA 2ZHMA 5FYSA 1XNKA 2XPVA 5D8AA 1WBLA 1LNSA 4NPMA 1JUMA 3LPGA 3CMMA 5DDGA 2W1OA 1QJU2 4G12A 3TQNA 3ZYBA 1YX3A 2XSJC 3MW2A 2PX9A 1MNEA 3C2BA 3U1DA 2XV4S 4EWDA 2I74A 4ZS3A 1ODNA 3I2OA 4HNTA 2RQPA 2HXOA 3CCVI 2VCBA 3FX3A 3LAPA 4A3JJ 5BNGA 4K6BA 4YM0A 1UZCA 5ERLA 3AZWA 1UW8A 1RUC3 4A3BJ 3NARA 3W2WA 3K48A 4B3XA 2GNMA 1O91A 2RC4A 4K1YA 2VJJA 2XAJA 3BJ6A 3FMRA 3ASNH 1IRZA 1UY3A 4OI4A 1LFBA 5F5CA 3A4UA 1KDKA 5J98B 4AQ2A 4KI5M 3TN92 3VBSC 4AI9A 3CCMI 2DMTA 1BEV2 4Q1PA 1JZ5A 2ECBA 3ZLIA 5FUPA 3RZLA 3I59A 1F5TA 3KFWX 4DXRA 5L9VA 3PSFA 4XUPA 4KWKA 2GNDA 3OSDA 1RUOA 1DZRA 3F95A 4X8PA 4PJNA 2C6SA 4GWMA 3I9V2 3UGFA 1QDOA 1JTYA 4WVWA 3A0KA 3GM8A 1BBT3 1FZPB 2J1EA 3PL8A 5HV4A 1R49A 3O1OA 4CCDA 1OKRA 1I3AA 2A3WA 4HVRA 1RUH2 3M1CA 3B02A 1SEFA 1JUSA 4TTGA 3UKVA 1KONA 3IP4B 2ZNYA 1NLQA 3WW3A 5JXHA 3HBLA 3S7EA 3THCA 1VBC3 1S8NA 2FQ3A 4AZZA 4XNFA 4UY8I 5FV3A 4DYQA 2Z33A 1ZGWA 1FSEA 1W39A 2XJQA 2ZAHA 5DZEA 3UKNA 3CCQI 4W50A 1K3IA 4BZ4A 4UFHA 2QBYB 1AHSA 5ANNA 3FJSA 2WO3A 5IAVA 3SH5A 4RHV1 2VQ0A 1AWCA 4DFSA 3RPQA 1GOFA 2F5VA 2A73B 1A6IA 3LSKA 4AVAA 2ZPXA 5LB6A 3VD3A 1V9U2 3WP4A 3LQCA 4G3YC 1W04A 3HMYA 4FPHA 2EPFA 3RTRA 3AC0A 3CKHA 2VOKA 3W2AA 4CU9A 1MBFA 4JRAA 4HKWA 3NQOA 1FOYA 4C2TA 2R92J 1HXS3 4HSRA 4N4OB 5TGTA 1J3RA 1K5MB 2RS13 2ZHLA 1JKPC 3IKVA 5EYRA 3KLOA 4RS5A 4YNIA 5SV8A 2ZGSA 2ZKLA 2MGQA 2DT6A 2VO5A 4FP2A 1PGL1 3DKYA 1W2UA 4IQJA 3B94A 2Q2EA 3U14A 3WVJA 4I76A 1W9TA 2OT7A 1MDMA 1CQ9A 2YHJA 1CPMA 3FXLA 2ZZQA 1FPN2 2AEYA 1XOYA 4L0ZB 3DKQA 4M4PA 1RGSA 5EEAA 2DA3A 3SDGA 2R5ZB 5FAXA 2RS32 1F9NA 3W9AA 3S8PA 2D45A 5J1UA 3AM2A 1GR3A 3PUHA 4BNCA 4UUVA 1GVDA 5CLSA 3JUUA 5K5QA 3A4CA 4O9GA 4AWDA 3MAJA 1OH4A 4XBQA 4W6XA 5EJ3A 3VBRA 3TMOA 4COYA 3OYIA 2K2SA 2VPRA 4HLXA 2OQ6A 5FD5A 1YHQI 4M3CA 3M4OJ 1V6OA 1X50A 1S7EA 1AHDP 3GHMA 2TNFA 3LE0A 4MGYE 2JA7J 3RZDJ 1H6YA 1JYXA 2JDPA 3ZMSA 1N3QA 1ODMA 1BM9A 1Z7LA 2DMNA 3ZYRA 2R7DA 2ZGOA 2XONA 1OPMA 3ZN0A 1PUFA 2COBA 2DCYA 2V6CA 1KRIA 2HPMA 1BIBA 4KT5C 1H9TA 2IA0A 4P55A 3CP2A 2Y6KA 4XABA 4XKVA 3GZTB 2K9NA 3A01B 4CP1A 2FDIA 2ELKA 4YM2A 3FFZA 2XAUA 1VQKI 5FLXK 2VBYA 4RQPC 4AIDA 1MMDA 1HQLA 1IN4A 5L3DA 5FMBA 5JZGC 2B63J 3I8TA 2BGPA 3BWGA 4AVSA 4Y1VA 1ETVA 4R9DA 2VMEA 2XBO2 3BQYA 4HL0A 1U0AA 2FA5A 3POBA 2IAIA 3QPHA 2YV8A 2FJ1A 4XOTA 2ZGUA 1NG0A 3GFIA 4GULA 1UNBA 5JPMB 1BIAA 2YU2A 4XSZF 4LBQA 3MIEA 3U10A 5BNQA 1QMJA 3SITA 5JOZA 2VN2A 3WF0A 4AQ6A 4C3HJ 1CX1A 2QSHX 3WG2A 1F2NA 4JK1X 4OI2A 4S2FA 3N05A 2P5LC 1IGNA 3WTXC 2K85A 1BI0A 3LZZA 5KHGA 4BCUA 1T95A 4UBGA 1MSFC 1SVLA 3H0OA 3V4GA 2ZJRF 3BB6A 4D7TA 4QPIB 2E7XA 3HT1A 1DDNA 5JHUA 3BZ6A 1RKTA 5J3LA 1OUXA 2HLEA 2B45X 5F1RA 1URXA 3DL3A 3AX4A 2MC3A 1FBUA 4ON0A 2W92A 3CESA 3GJBA 4BB3A 3AVSA 2MH2A 4XURA 3C7EA 4A5NA 2VQHA 1ONAA 3OJBA 1ETWA 4B44A 3HKZN 4PI0A 4XFHA 3MIBA 3ZSKA 2HWF2 1S9HA 1MQTA 2DTWA 4AEKA 1JXSA 1V4RA 1XCBA 2EBIA 1BW5A 4Z92B 5FDBA 5EWSA 2XBO1 4XKBA 5LHIA 3JRGA 4QX2A 2W57A 1U5TB 3LOCA 3SNMA 1X33A 2XGEA 3RIRA 1AJOA 3WGGA 1Z91A 3CLPA 4R4ZA 1YOVB 4I0BA 1IW7F 2Y0SA 4P5OA 5JIUA 1JTXA 5FZOA 3WTUC 5DCFA 3AVRA 5GPAA 2CGPA 4KN7X 1W6OA 4JZRA 2J5OA 3I4NJ 2K27A 4FETA 4G4FA 2R49A 4E2QA 3OIPA 1FNYA 3COAC 1C1FA 1F43A 1FI2A 5KXBA 1XMXA 3CO7C 1YQ5A 2COMA 3LWFA 4ATFA 2KRCA 5KXEA 4HEA2 3P5JA 5DCMB 1NXMA 3B6CA 4BXSV 4UNOA 2R30A 2VE1A 2DFBA 2JG8B 2BXZA 1WCUA 1LNWA 2FCUA 3EBRA 1IXCA 1TQPA 3FHZA 2R073 2YU1A 3QOEA 5LGNA 1AL0G 4IE5A 2A6TA 1A3KA 5GAEJ 1IN5A 4MHRA 2MABA 1VI0A 4Q8LA 4LB5A 4DO0A 1QGPA 2J5PA 4XICA 4FPGA 5GZCA 1RJ8A 3JQWA 1IZ3A 5CNAA 1IS5A 3PM1A 4YW6A 3OIOA 2IXIA 3AAFA 2VASA 1RIOH 5HLGA 1JI8A 3HOZJ 3O1VA 2FNAA 2GXBA 1H88C 4UVCA 2CH0A 3JB4C 3GXOA 4KIFA 1BK0A 4CUBA 1TME2 1T6GC 4J25A 3WTWC 2XL9A 4FX4A 2ZO4A 2EZIA 1EUTA 1H2KA 2Y0OA 3MCZA 1CAUA 3UKTA 3CUOA 2R16A 2CQNA 4QQLA 4CDUC 2Z69A 4AVVA 2JZYA 3OSFA 1BQPA 3OYWB 1UPSA 4PT6A 5C4WA 1SVOA 1JOJA 1QJY2 3GZAA 1D4M2 2JKXA 4HN1A 5DAVA 3USUB 1WJDA 3WW4A 2A3SA 4D9JA 3RQ0A 2GWRA 2WB1A 4YG6A 1X4OA 1WW7A 1EA3A 3KLNA 2JEMA 2FRHA 2HQNA 4HF0A 4KITB 1U5XA 2VI6A 1XXNA 1AR63 1JBCA 5D8AC 1TBXA 4C9YA 3I49A 3LF7A 4L2NA 5K7FA 3F2ZA 1Y4WA 3ZPYA 2WS93 3KYLA 3EUHC 4MGQA 2X5IA 4Y4YA 4CSWA 2LUWA 3WNNA 4UT5A 2Z79A 3E97A 1QOSA 3CNAA 2FMYA 2RDPA 1NCQA 5EF6A 4Y3OA 2V09A 4WK8F 3L9FA 3VBFB 2LSOA 5E1ZB 2P4EA 5A33B 5IVCA 4KH9A 1X2NA 1POV0 4HW0A 1SLTA 1K6YA 4EGZA 1J7KA 3V64A 2GXGA 2DDAA 3ONQA 3BP8A 1VBC1 3C8XA 4GDFA 2JTVA 2JRMA 2WN2A 1QEXA 3NQHA 4XVHA 3PUSA 1W90A 1YQCA 2GNBA 2EIEA 3VHNA 4XTPA 5J37A 4IX7A 5GLZA 1TT5B 1QZZA 1M1EB 1RINA 1TW3A 2DDBA 2KP6A 3PVOA 2WC2A 1Z67A 4KISA 1UN1A 4R52A 1MBGA 4R8HA 3V65A 2BBYA 2STWA 2VQUA 5F37A 1JOBA 4KG8A 2XROA 1S0FA 1Z0HA 2L2OA 2E60A 1ND3B 3ZFGB 2VB6A 4RFRB 1TME1 1O8SA 1UU4A 2BV6A 3OYLA 5GZGA 3DEEA 1OOPB 1W99A 2OPWA 1ULYA 2JPBA 4JX0A 5M5XJ 1OQDA 2TEPA 3WOGA 3BODA 2DOAA 1X36A 1IPSA 3LEIA 2BRTA 3DLAA 1MQTB 4FE7A 1LDDA 2DQRA 1C8M2 1JGGA 3CJTB 3TEDA 2A75A 2NP0A 4GH4B 2HWE3 2K3FA 2Y0IA 4ZXEA 2RVCA 1IJWC 1DGLA 4D6QA 1ETYA 4MTDA 5FYTA 2GDFA 2WZR2 1AR71 3AK0A 2VZPA 2RG4A 4RB2C 1XGNA 3KV9A 1HKDA 3NJVA 5J09A 4HF1A 4YSFA 3AZXA 5FLMJ 3KLSA 4HQMA 3VD4A 2CDOA 2VZSA 4FAHA 2WNUC 5IK5A 4CZZA 5FZ3A 1FC3A 1QJX3 2D3SA 4DOZA 4BPZA 2WV1A 3OPZA 5FROA 2VMHA 3HR9A 4BQYA 5C70A 3BPXA 2A6ZA 4XBFA 4XL9A 2FD5A 3QPSA 4Y1ZA 1MNMC 1CIWA 3FM5A 3ZPOA 4HK8A 1D0ZA 4M3BA 2EA2A 5BS6A 2JT1A 2DTZA 3ECHA 1MS0A 1SFXA 3MWMA 2YU3A 3KQRA 4MSVA 3CCSI 1HV1A 4YEJA 1V9U1 1GV9A 5F0HA 3WCSA 4ZXKA 4JX5A 3CJQB 3B9CA 2QTWB 1O5LA 2L4MA 3IAPA 1U5ZA 4PDWA 2A07F 3RNSA 1A6CA 1K5JA 2BVBA 1ULDA 3GX4X 2V9VA 3ZSJA 4AXOA 5J40A 3KP7A 2ZGMA 4D3WA 1A8MA 4HSTA 2C26A 1FYUA 3ORJA 1JZ3A 3MPBA 1DGRN 2KISA 3FIWA 2FQPA 1W1WE 4KU7A 4AR2A 5ACA1 3IAS2 3OOUA 2PQ8A 1RUJ3 4IEQA 3EYIA 2R93J 1JOPA 4I7HA 2LKXA 2ADDA 3LQRA 4D0PA 2NAZA 2Y69H 2XB0X 3Q9SA 5M3MJ 3VSLA 2E26A 4CYCB 2GP3A 5FYUA 4I09A 2RM23 1S72I 1YHFA 2VXZA 2Z16A 2P6TA 2B9UA 4NRQA 2Q8DA 4PZJA 2PMZN 3RZOJ 4EJUA 3DF0A 2P2KA 3H42B 5A3TA 2P17A 4AI1A 3EUAA 3NNFA 4J19A 4Y1UA 5EEHA 2MC4A 2HI3A 5ED4A 2HWB1 2DYRH 4PDKA 1DGWX 4FOYA 2QKDA 2XF5A 2HTSA 4HAMA 3VV1A 3I58A 2QWWA 3EXUA 3T2PA 3IL2A 1TMF1 2VGDA 5E8GA 2WAOA 1LPQA 2OCEA 1WVRA 2W9XA 4IV1B 4HPQA 4XHBA 4EJTA 2NOJB 5D8AB 5FMOL 2D43A 3U0ZA 1VNDA 2QKMB 4QLCU 4BXFA 2Y31A 3K2OA 1OMIA 3CJIB 3BTXA 3RDIA 4QIWN 4XDQA 1CONA 3F8FA 1GQPA 1D0YA 5F3EA 3EHKA 2PLYA 3QQAA 5GTIC 2V73A 1Y1WJ 5DABA 3CQOA 5ABJB 2HOTA 3WEZA 3QOPA 3GTOJ 1NQJA 1ZA4A 2XAQA 4HDVA 1QJU1 1F31A 3QPTA 4AM3A 3RKYA 2Y6FA 3H8OA 1K6OA 4QPGA 3SZTA 2VW2A 3MBWA 1ONVA 5IP6A 4YVSC 2EIKH 4O9EA 1U6GA 4FP3A 1QXJA 1DFQA 1SLLA 4RA0A 4QDQA 4RGRA 1QDCA 5GZEA 5ABJA 3A02A 1SHWB 2XGCA 4F93B 2ZMNA 3FMGA 4MH0E 2D40A 2YB7A 5IT3A 3PNAA 3OSGA 3OOXA 3CUQB 2IVMA 1B8IB 2EALA 2VJ4A 3BN6A 1NTCA 4ZU5A 4BE3A 3HDDA 2DO7A 1KFUL 5FY7A 3SKJE 4CXFA 3D5RC 4XK4A 3FBMA 5F6KA 1U78A 3BG3A 3CD6I 1RHI2 3ZN6B 3LSJA 4LJZF 2AREA 5C3OA 4XC9A 4RYDA 3EYPA 5J7MA 2E36A 1A5JA 1X2MA 1FWZA 1CJDA 4KBZA 2DOFA 4GH4A 4QQ2A 1BBYA 4LIVA 3I4MJ 3OEAA 2M0MA 5FYIA 4YZ5A 4OHYA 4OULA 4Q0PA 1OR7C 3MKYB 3WTYC 3T09A 1YJNI 4A42A 5LY1A 3THPA 4XF1A 4ZYDA 2JG9C 5FD6A 2IC1A 2M0CA 1S6LA 4PGGA 1ZRIA 4PJLA 1W8NA 3KPHA 4IO9F 1AR73 1H8TC 2VZRA 3FL7A 3VYSB 4AE2A 2E5ZA 2ADEA 3D4KA 3ZQCA 3EQEA 5KXCA 3VKFC 4LTAA 3J8F3 1UPIA 1FY7A 1P9QC 3AG4H 3ABZA 4DYCA 2A7AA 4RQPB 5D4SA 1CAWB 1XQNA 5EZGA 4ENKA 2G1MA 3UT0A 2V26A 4ZTFA 1US3A 4ZYGA 1QVUA 4DB5A 2I45A 4Y15A 1W05A 3H3VK 1WD3A 3HNMA 3RJ2X 1LKNA 2ID6A 5GLWA 2EA4A 1OISA 2XSDC 5CB7A 1GNYA 4WZFA 3OWTA 3TO7A 4YFKF 3J81K 2ZSHB 3CJIC 1NZCA 1NX9A 3CCLI 1XTAA 1GANA 2HYJA 4YGBA 5LEJA 5D6EA 3HRMA 5B4NA 4MHGA 1OURA 3OD0A 4ZDPA 5FO9B 4LPLA 1KS5A 4XRSA 1J58A 3OUJA 4ZHNA 3QH6A 1GICA 1XPWA 2P7VB 4HV5A 5D8KB 3ZYGA 5FZ9A 5L36A 5D5VB 3H1YA 2Z99A 3C1DA 3BG5A 2XL7A 4B3AA 2NVYJ 1WA6X 2WNEA 3OB8A 2HVSA 4BL0B 2WL1A 3V0AB 3L2WA 4XZPA 2VULA 3QH7A 2NVUB 2L9LA 4S2HA 4E7KA 1L7RA 1REEA 1O8PA 2IS6A 1HW2A 4IEVA 1BMV2 2TCTA 1FMWA 5J8FA 4XEZA 1S4CA 4IV1A 2HDWA 3C3WA 5L3BA 1PZ7A 1BW6A 3LSTA 2HWD1 1NHAA 1RKWA 1UYXA 3QU3A 4L5JA 1LVAA 2XF6A 2RHPA 4M6VA 5AIQA 1S2BA 1V5EA 1ZHFA 2CV0A 4UW6A 1OVSA 2BVVA 5FXVA 2C1FA 1U5YA 3WQ7A 1Y56A 4XUTA 1JHFA 3OY8B 2L0KA 1LOAA 1G2HA 2G0EA 3QP6A 3LNQA 1ZBA2 2JDMA 1OQ1A 4P02B 1FT9A 3H5RA 3TEZA 3O1PA 2RQQA 3CF6E 1OKOA 4PQ9A 1OCZH 4TN7A 4V2FA 1SDDB 3SDBA 2P1BA 1ODDA 4AHZA 1W4MA 5DUKA 3ZQGA 3HOUJ 3M70A 4AVBA 4BYYA 5FJ8J 1BCXA 2D6KA 2ARBA 2WFF3 3J7LA 1HB1A 2ID4A 3G1MA 1RUE3 2JMWA 2HH9A 4L5IA 2KZVA 3ABTA 2OTJI 4CPBA 4EJWA 1RUI2 2FDGA 4HKOA 5CVUA 3NAPB 3NL1A 3W3CA 3GBWA 1OI6A 4DNYA 1JU4A 4M3CF 2ZGQA 4M73A 1K4TA 1MMSA 5B5EC 3BUCA 3O7OA 1TNFA 1PZ8A 2VAUA 3HJRA 1UXZA 1I3QJ 3SZPA 2DPDA 4NHYA 3B7MA 1IG3A 3M7AA 2RV9A 3WDXA 2XJPA 3MW3A 4XFGA 3WUDA 4QKNA 3C2UA 5E20A 3RI8A 1X8EA 2DVDA 3POEA 5J96B 3M7GA 4XBLA 1OR7A 1OD5A 2DK8A 3H8XA 2BXYA 4A93J 2V5YA 2Q1ZB 3ABUA 5CISA 3N7MA 4CZCA 1Z7S2 2LFBA 5FXXA 2W0XA 2E5NA 4JGZB 1UHSA 2EAAA 3BYWA 5C33A 3H3ZA 3UKGA 5LZ6A 1L7LA 2W85A 1G9BA 2XUBA 4S05A 3ES1A 4YGDA 3EB7A 3OGSA 2L7MP 4KA4A 2FMDA 2ZXQA 4PLOA 2QQKA 2A5YB 3WG7H 4ENJA 2FHRA 1GV2A 1W7PD 2VZOA 1VBA2 3KIOA 2W48A 3CZ6A 3HKZA 2DVGA 4COVA 3RMYA 5J36A 4ASNA 1Q8SA 5E3OA 4FI9A 2UV1A 1FOXA 1FSHA 4QU1A 3F9KA 5FKBA 3SISA 2FQ4A 3TN91 3J7HA 5HBAA 1O6UA 1HIXA 1JHHA 4EATA 3L2UA 3PLQA 4AFCA 2EFOA 1PUEE 2F5EA 4IESA 5JAXA 2OZ6A 3P3NA 1G59A 4BE0A 2VNVA 5J4VA 3DTEA 3NV3A 1V55H 2VBDA 3OS2A 2HR3A 5A2QZ 3MLKA 1R4NB 2X05A 1UZVA 3HSFA 2Y48A 1UMHA 4GALA 3O0VA 4O65A 3OYKA 3JU9A 4D6RA 3RQ4A 1BC7C 3HQUA 3DP7A 4DXZA 1YO8A 4Q4W2 2VJ5A 5LBQA 2E2HJ 1LECA 5FRNA 4C30A 1CIYA 2K5CA 3K6GA 3HQXA 3IPVB 5JUVA 5HDKA 4G6TB 1UIJA 2BBVA 4QPQA 3FKJA 3HG9A 1LHVA 1OSGA 4KYWA 3SQOA 3PIJA 2B7YA 5FB2A 5CZKA 1CPNA 2R7SA 3GLLA 1ND3C 5T52A 3ZFGC 3HGGA 5FMCA 3OYWA 2ATFA 3QCWA 2OS2A 2FMLA 1G8XA 1O3QA 2UWAA 2JICA 3WTSC 4URAA 1K7AA 2ISZA 3DPRB 2WZ8A 1SC7A 2O7OA 2MG4A 1HOMA 1ZH5A 1W9WA 2RDRA 1MBHA 2D3RA 1UZYA 2WFPA 3V0BA 4XETA 2GN3A 3H7YA 4B7EA 2DA5A 4IQPA 1WUVA 1OH3A 4UXAA 2O3FA 5J48A 3L2CA 1GQHA 2WS91 4PGHA 3T5XA 2R7EB 2HWC1 4WBBA 1P8JA 2A6VA 1H2MA 2CDPA 2CFOA 3NKTA 2NMNA 2H0VA 4HK9A 2Q1FA 3K2AA 4QXBA 3SHFA 4FXKB 1AR82 2NS0A 4CA0A 3AZZA 3KZIC 5CFCB 2DFFA 3OYJA 1V00A 1BKZA 3RS6A 3ZFFB 5HLTA 1V70A 3VBFA 2WJSA 3K69A 3K4NA 5LGTA 3ZR6A 5IP7J 4A3KJ 2XB5A 1X9PA 4OIQF 3CJRB 1VJ2A 4XOPA 1AL23 4ITCA 4IHXA 4P9IA 1KZHA 4HNUA 3KCCA 5DQ0A 5C71A 3QYEA 4UWDA 2VUAA 3DXUA 2LR8A 1GBGA 1NY72 3OBZA 3G4SI 3FHQA 2AGSA 3F8MA 5L73A 3UL2A 2QFEA 4XLNF 5FYVA 5T50A 1W06A 2VKVA 4R79A 3IMMA 2P37A 1X58A 5FOBB 2MEV1 4K20A 4TYSA 4Y33A 4ASMB 3W6JB 4KIGA 3S17J 3J26N 1WLTA 2QQJA 3PL0A 3EO6A 4XF0A 1POGA 2PXJA 2Q4SA 4YRDA 4AGRA 4CE8A 2HOSA 2Y30A 3K70D 2XVCA 4DUVA 3PVEA 4M00A 2ZB9A 2HEYF 3NSTA 3M8FA 1OFCX 1UYYA 4U88A 2EA7A 1POV1 3PQJA 2XVKA 2KIUA 1B35B 2GNTA 3TOAA 1WLWA 4FE4A 2A61A 4D7MA 2G7UA 4IERA 3TO9A 4XRSG 2ZNZA 4Q0QA 1FMD2 5DUWA 4UFKA 4S04A 4QHZA 4JGZA 1BHGA 1RUE2 2D5HA 1ZBE3 2XASA 3E6MA 2ZACA 2J1VA 1B35A 3I55I 1NCQC 1B72B 3HUGB 4XQDA 3SCGA 2H09A 5CJ9A 1QGLA 3VBSA 3MF6A 1GDTA 4XJAA 4H7LA 1UYPA 1WJAA 3KX2A 1HC8A