1I5ZA

Structure of crp-camp at 1.9 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR PROTEIN
publication title The effect of the D53H point mutation on the macroscopic motions of E. coli Cyclic AMP Receptor Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 56
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i5zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1i5zA01
1P4WA 5BUVA 5JHUA 3SQNA 3CUQA 3CEWA 3IKVA 4XBFA 1VJ2A 2OBPA 2GWRA 2XKOA 1T39A 2GAUA 4Y17A 1K78B 1S7AA 3HQXA 1OPCA 2ADUA 3F3XA 3T8TA 2UZKA 2HYGD 5D5VB 1JHFA 3BROA 4EWDA 3U9GA 4EROA 4Q5SF 1SFXA 4HF2A 1T0FA 3E6CC 2MH2A 1K79A 4G7OF 2WV0A 4S04A 1USSA 3WTZA 1O7LA 1O3TA 3LAGA 2EB7A 1S6LA 2F4PA 1XGNA 3HT1A 1X82A 2BYVE 3IRQA 4GXOA 3RNSA 2P4WA 3KZYA 1XGOA 2PLYA 1KGSA 2JZYA 2V1DA 2VOPA 3FXQA 4LLLA 2OZ6A 4UBGA 1R1TA 4UV9A 2QVOA 2VN2A 3F21A 3F8FA 1TNSA 2FA5A 4WZCA 3TNPB 3FWEA 2GA2A 2V9VA 2FRHA 4HF1A 4LGWA 2PAKA 4A5NA 3EHKA 1S8NA 3I71A 4ZYHA 3H3ZA 4IHTA 5D4RA 3L7WA 3ZDSA 4KN4X 4L0YB 5CJ9A 2O8XA 5HDKA 1WKMA 5BPXA 3F8MA 2BV6A 1KYZA 2G7HA 1T2KA 2A5YB 2QQAA 5BPIA 2PTMA 4HLXA 2IP2A 4HV5A 2WWYA 4LA3A 1UB9A 3LA3A 2IXJA 4QWQA 5ICFA 1J2XA 3QPHA 2QUFA 5KVRA 5E1WA 1DGRA 1TQPA 3OV8A 1R58A 1IN7A 3M1EA 1IRGA 2ISZA 1NYWA 4K8FA 4Z82A 4P5OA 2IXKA 4MTDA 3V7RA 3E5UA 3E97A 1RNLA 1RUNA 4A0ZA 4BHPA 2O61A 3NQOA 1LRHA 3SXYA 4ZZLA 5HS9A 3WW1A 3SHRA 3WTVC 2ESHA 2KIFA 4Q0PA 3SCFA 3LQQA 1EV7A 1LEBA 3DFGA 1CAUB 2D93A 4RB1A 1L3LA 3VB2A 2I45A 4KL1A 3CUOA 4GCVA 4MGYE 4ZU7A 1AOYA 2IXLA 3J80Z 4UXAA 1KU7A 4HLYA 4UVAA 1P92A 1X7NA 1KQ9A 3O14A 5EEGA 2IXIA 3WTTC 3J81Z 3IRRA 1I5ZA 4E2QA 1R7JA 1WA4A 3WW4A 2XIGA 2P17A 5J6XA 1F1ZA 3GZ5A 3I58A 5HLIA 3JZVA 4UXNA 1XGSA 2P5VA 3FX3A 2VC1A 5DUIA 2Z99A 4UUVA 2AXLA 3N4MA 5IT3A 2PFWA 3LFKA 3I59B 2A69F 5D5UB 3V8LA 1G4DA 2HJIA 2EFWA 3EO6A 4RGXA 3MFKA 4GYGA 2QBYB 3NRVA 3OD0A 4L5IA 4RB3C 3D0SA 4LG0B 1NHAA 5EEHA 3K0LA 2YU3A 2M45A 5FCCA 5A2QZ 2UYAA 5ERIA 1BOAA 1ODDA 4H7LA 2ZJ2A 2A6EF 5J48A 2D1VA 1UHWA 3PLQA 2EFOA 5K5QA 1EPZA 1Z91A 3DPTA 4KT5C 3VFZA 4JBAA 5D8KB 3NVCA 3NL1A 3K1PA 2B0LA 2C6YA 2Q2EA 2H6CA 5JI6A 2VQAA 3CJXA 3T1BA 2D5HA 1B9MA 3ULQB 3QOPA 3RJPA 3CLPA 4ENJA 4YIIA 4LJZF 4DINB 4A6EA 1YFUA 2QYOA 2XLGA 3ZN0A 1QGPA 4QMAA 1JUHA 2P6TA 3P9CA 3GFMA 2N7GA 4P9FA 5HS8A 2XL7A 3I4PA 3I59A 2EV5A 4O9GA 5D5WB 4EWAA 3LA7A 2HEOA 3R0JA 2KKOA 5BMZA 3M3IA 3P7NA 1HXDA 1UCXA 2CSOA 4ZYDA 4ETSA 2JSCA 2QDRA 2UY8A 5J7MA 3USSA 1BI0A 2FEZA 3C3WA 4QGMA 2BNOA 2GC0A 3FHIB 3BCWA 4HQMA 4XF9A 3K9TA 3MZHA 1JHHA 2PI0A 3H92A 5FLXK 2PAEA 4FHTA 1XSVA 1LDDA 4Q0UA 2QENA 4XFFA 3F6VA 2PMUA 3MYXA 2NS0A 3V8KA 3U0ZA 2PHDA 3OCPA 4EWEA 4LB6B 4AXOA 4LMYA 2UXNA 2FNAA 4YG2F 3G7DA 4EGZA 2M30A 2DW4A 1VP6A 2VT2A 1D3YA 2H27A 4BQAA 1Z6RA 4Q0VA 4XFCA 2IA1A 2CG4A 4WVZA 5KHHA 1KYWA 4BXUA 2P7VB 2KIMA 2E7WA 4N9IA 1YTYA 3ECHA 1SD4A 3BJ6A 3LSTA 1A04A 3TQNA 4KDPA 3EYIA 1ZYRF 3GO5A 3P9IA 1TTYA 1XMAA 1WQ2A 4KA4A 3IL2A 2ZNZA 1HW5A 3OTFA 2CWEA 2Z5UA 4YARA 4ZYEA 3FE5A 3IWZA 3HRUA 3WW2A 2Q0AA 2H0VA 5JSOA 1VR3A 5DYMA 3H3UA 4KWJA 5JVTA 4EJVA 1LDJA 1JXSA 5EZWA 1XGMA 3TDZC 1FP1D 5JFRA 3RKWA 1X8EA 1J0RA 4X6RB 1HKQA 4QM9A 3FHZA 1B1BA 3SFZA 2XAQA 5LRRA 2V1XA 5CU1A 4Y15A 4JTNA 3ES4A 4OMZA 3CLOA 5ILSA 1BIAA 4M72A 1YHFA 5DUKA 4TLFA 2D40A 3UKVA 3HHHA 3H1WA 4CICA 3WGIA 4J1WA 5DV5A 3EYYA 2Y48A 1NE6A 1YS6A 3EDPA 2V79A 3IDCB 2K0GA 1SQ4A 2EFPA 3RYKA 3D0JA 2VE8A 2A68F 2Z69A 4L9VA 3QPTA 2G9WA 1PP7U 4L18B 4IESA 1OKRA 3QP6A 3KE2A 2XUBA 5DCMA 3KP2A 1K7AA 1FYLA 4RB2C 5I8YA 3ZP5A 2GZWA 3C1DA 3VODA 4IEVA 3O3KA 1FBUA 2IA0A 2K27A 4Q48A 2ESNA 1RZ4A 4PIYA 1X8MA 4Q4ZF 4G7ZF 1KQ0A 1Z6TA 4WK8F 1ONVA 1ZRDA 1IF1A 4XEZA 2JTVA 2H94A 1O57A 2H09A 2ZBKA 5I8TA 4RB0A 3DXJF 5C6CA 3GFJA 2QNKA 4AQ2A 4KU7A 4HDVA 4A5MA 3ECOA 2EA4A 5D8LB 1J7KA 3ZMVA 2PMHA 1GHCA 3ZMSA 3U1DA 3ERED 1BN5A 4RS8A 4G94A 1V3FA 5I93A 1D8KA 5E16A 2PN6A 3WW3A 2HWVA 3ES1A 1VTNC 1IPKA 4ASNA 1GQGA 2O0YA 3WTWC 4AIKA 1DUXC 4MV2A 1U5TC 1OYYA 1O7FA 1Q1HA 4I02A 2GIVA 3ETQA 1L3JA 3F23A 1NE4A 2HOEA 1E2XA 4M9XA 4P9GA 4Z2YA 2K7LA 4JQFA 1ZG1A 5FPXA 1DZRA 4ORFA 1UW8A 2OQGA 4L0ZB 1LB2A 1YFHA 4KICA 3I7DA 4BIFA 2Z3YA 1HKTA 4UVBA 5I0SA 3FMSA 1I1SA 3BOQA 3KCCA 2X4HA 2HGCA 4U88A 2FSWA 5J3UA 1HSTA 4KWKA 2W85A 4XSXF 3H7YA 2DQRA 2ETHA 2OZJA 4IEOA 3ROUA 5I0TA 4KYWA 1CX4A 1YG2A 5DD4A 3C3VA 2IT0A 1S3JA 3KGZA 3I5UA 1IN6A 1FPQA 1YO5C 4ESFA 2QCSB 4XFGA 1J59A 2ET7A 5L3BA 2DK5A 2WFPA 2XLFA 1T6SA 3MQ0A 3TOBA 3B02A 3WU0A 5D1IA 3BB6A 3V8JA 4WXHA 3R0AA 1J1LA 2EK5A 1WRJA 3LAJA 2E1NA 5CADA 4HDUA 3KP5A 1QXRA 2A6HF 2COMA 2W25A 3K1NA 2G7UA 3VEPA 4MH0E 2GXGA 1CAWB 4WXDA 2OA4A 3DKWA 2VC0A 2NYXA 4YFNF 4CXFA 3PNAA 4IEUA 4GYIA 4HYEA 2P6SA 5C8WA 3WGHA 4U0WA 5LEJA 2B9UA 1RL3A 3GBFA 2F5CA 1BBYA 1ZGJA 5ICGA 3I0TA 2IXHA 1OYIA 3RKXA 2OU2A 2LNBA 3S0MA 2D2WA 5D6FA 2XHKA 5HDNA 4U0VA 2DLLA 4LK1F 3FMRA 3SHFA 1O3QA 3HRMA 5KHJA 3KP4A 1IUYA 4RGRA 1IXSB 3PVBB 2KJBA 5FO5A 4P55A 4RGSA 5BXXA 2YPRA 1WLTA 2R3SA 1HBXG 2IW5A 2WC2A 2STWA 1RGSA 1ZZ6A 3FXUA 3IKTA 2WTEA 1ZVFA 4HX8A 3B73A 5CVIA 4ENNA 1ON1A 2NAZA 3MWMA 4RAZA 3GX4X 4HN1A 5FB2A 1K78A 4I0AA 2MBFA 2HTSA 1D8JA 4HOBA 1P6RA 4FAGA 3IIAA 3GW2A 3WTXC 1R23A 1HQCA 2Y0MA 1CAWA 3RIRA 1UD1A 4MEXF 1ZHFA 2FMYA 1GQHA 4E2GA 2P8TA 4A0XA 3KETA 3LA2A 5F64A 2OQRA 4CZZA 5ILVA 1YFYA 1QBJA 1YQAA 4XFHA 3PQJA 4HBNA 2K02A 4ZH4F 3WG9A 2CV6A 1H9GA 4BNCA 3GFLA 2BBYA 4HVRA 1OI6A 5E1XA 3BDDA 3E3VA 3JW4A 2FMLA 2J5PA 3R61A 2V09A 5E17F 1Z05A 2JRTA 2GH2A 4YNIA 2FU4A 3BP8A 2LF8A 3IWFA 2F5DA 2FF4A 1TQIA 3GYHX 1O5LA 4A2UA 2FQPA 2HFHA 2GXBA 1R5GA 4AVPA 4MEYF 1G3WA 4UNOA 3QU6A 2ZKLA 1QZZA 3ELNA 4LLOA 2ZKZA 1YLFA 4EGYA 1OFNA 1ZNPA 1EY2A 2FBHA 3KZZA 1HKSA 2RN7A 2Q0OA 4I7HA 1XDUA 1S29A 1FXZA 1MZBA 4HLTA 1WWXA 3Q9SA 3J80K 3GWZA 3HYIA 1NZCA 2OPKA 2NRAC 4HN0A 1MJBA 3J81K 6PAXA 3HRTA 2L4MA 3GUDA 4HF0A 1KU3A 1FYMA 3ZPLA 1USTA 4MQVA 2DK8A 5E8IA 4F7ZA 1LJ9A 1FNNA 5IT9K 4WXCA 1CAVB 3RDIA 1ZX5A 1Z1DA 5HI0A 1W7PB 1FYKA 1BI1A 1ULYA 4I09A 5LBQA 3IC7A 1LQ1A 4L9JA 2QM3A 4KMUX 5TRDA 4EM2A 1CAUA 5H20A 1WI9A 1RUOA 3PFIA 4IEYA 4HZFA 5KHGA 4YSFA 2HKOA 1Z9CA 1FC3A 2RNJA 4OOIA 5L3DA 1QZYA 4EJUA 2A07F 1FP2A 5A2QK 5ICEA 1YW9A 2DPDA 2RKHA 3KSCA 4CO8A 3GF2A 2FBKA 1F4KA 2C0ZA 4OINF 5BV6A 1MGTA 1QPMA 1FOKA 1EH6A 1ZZ7A 4L11A 4PJYA 4WWCA 1BI3A 2D5FA 4CYDA 1O4TA 2O1QA 2KRFA 2DU9A 2GQQA 5CLSA 4QM8A 4HVOA 4EV0A 2YX7A 4PCQA 1KU2A 5CVUA 3S7EA 3JAMZ 2ZO4A 1UFMA 1UPIA 4O9EA 4XF0A 2ELHA 2QBYA 1CAVA 3SCGA 4LG0A 3BZ6A 1W7PA 2E7XA 2MC3A 4P9UA 4FBFA 5HLHA 1STZA 2MHFA 4IEPA 1LKNA 1YS7A 4OIRF 1ZG5A 4G6DA 2EWNA 2PHLA 4YRDA 3FXRA 1PUEE 4NB5A 2O3FA 2CAVA 1KA8A 2DPUA 4EJTA 1LEAA 4KU8A 1O3RA 5AONA 1FLIA 4M9ZA 1R00A 1QQIA 4MGKE 2TDXA 1EH7A 2VT3A 4IF4A 1FWZA 4PZJA 5JSPA 5LEKA 4IJAA 1S7OA 3WE2A 2FBIA 4M74A 1MJ9A 2GC3A 2CGPA 3GVAA 1IW7F 3RTRA 5BOXA 5K1YA 3LAPA 4XFIA 4FAHA 3EQEA 4IRHA 3UKNA 2XV4S 1XSDA 1REPC 2RQPA 4G9YA 2GC2A 1U78A 4MX3A 1HW1A 4Q0QA 5FFZA 2BEOA 2CFXA 2PQ8A 4MGZE 1TW3A 2GU9A 3ST7A 1YWKA 1R1UA 4J1XA 5FD6A 2W84A 4HSJA 5FQ0B 3TNQA 3L09A 4ENMA 4YFXF 1G3TA 5JR3A 2HQRA 3IBMA 1DPUA 3Q5FA 4XRFA 3KLNA 1U6GA 2EVXA 1ZAOA 4NVPA 2RGVA 3MAJA 2Z9OA 4XF4A 4R52A 3HHGA 5FLIA 4Z07A 5K5RA 4MZUA 5E1RA 4PDKA 2EFQA 3KLOA 1P4AA 4G7HF 2Z33A 1T38A 2QZ8A 1MDMB 1QXJA 2O8QA 2AS5F 2X0LA 4O5VA 1W7PD 1ZARA 4AVAA 2OZUA 1DP7P 3GFIA 3GLXA 1SMYF 2UWMA 1SD5A 3N97A 4M73A 4XLNF 3CO6C 4WBBA 4L9TA 3BPXA 3IHUA 1FX7A 3FZVA 1LR5A 1LNWA 3WTUC 4U0YA 3GXOA 3FJSA 4EQQA 4Q29A 4GGGA 1FBSA 1V4RA 3CUQC 2F5EA 2MLGA 1SFUA 1FY7A 2FQ3A 4BYYA 4EJWA 3TO9A 1H1MA 2GC1A 1K6OA 2PYTA 4OLLA 1LDKB 3HSFA 3LOIA 5ICCA 4KMFA 4KIFA 3V4GA 3AAFA 1XE8A 2V6CA 5I8SA 1YFXA 5CYVA 5FQ0A 1BIBA 5F1RA 1CAXB 3E5QA 1T98A 4JVAA 3REOA 3P9KA 3DP7A 1MKMA 2QVSB 2PFBA 3I54A 2FOKA 4F8AA 5I0RA 3FM3A 4YIFA 4UHTA 1J3RA 3L9FA 4LUMA 1QWRA 5L3CA 1BC7C 5FDBA 1IXRC 3HSRA 3HIFA 1SD6A 3R4KA 1X3UA 2DBBA 3BALA 4Y13A 2R7DA 3CUQB 5LGTA 4I2OA 4U7BA 4XF3A 3TDUC 2Q1ZB 4HBLA 1KQ8A 4MUVA 4UV8A 1XB4A 2VBXA 1RC6A 1IN4A 4RGUA 2IC1A 4HV6A 4CGZA 2VBWA 2M5WA 5JCTA 3SZPA 1G3SA 3Q9VA 2P5LC 1ZZCA 3KP7A 2L01A 5CVJA 3NJZA 1B59A 2HZTA 2PEXA 4WF2A 1RI7A 2YX4A 4BHBA 1FZPB 5E18F 3EQLF 3E6BA 3HT2A 4O3MA 3MDPA 2H6BA 3EETA 3RI4A 1ZLJA 1FSHA 2HKXA 1CAXA 3RYRA 2XL9A 2EV6A 2Q4SA 2K4BA 3FMQA 1HSJA 2OA2A 1U3EM 1ZZ9A 3H1MA 2UYBA 4OMYA 5L3EA 1IXCA 1WGPA 4B8XA 4BAYA 1XDSA 3HSEA 1DGWA 1EH8A 1O5UA 3K2ZA 3H1YA 2LDUA 4N9HA 4ZYGA 1P4XA 5LLQA 2J5OA 3BJAA 3WODF 4A6DA 5DDGA 2Y75A 3HRSA 1U5TB 1W4MA 2HS5A 4U7DA 3LZZA 2DO7A 3KEQA 2RV8A 1IAWA 3HOTA 1SAXA 5E1ZB 5D4SA 3PQKA 5DEQA 3BU7A 4EJOA 1Y3TA 4HX7A 1IZ1A 4M6YA 3SZTA 3KP6A 3OF1A 4XLPF 3RPQA 3NEUA 4I0BA 4O6JA 3LWFA 1TQ5A 1DZTA 2DT5A 3JSPA 2BNNA 5LGNA 3VOEA 1YW8A 3QAHA 1IRFA 2LF7A 1KU9A 2ZFWA 4QGNA 1D5VA 1J3QA 3L2HA 3BPZA 2ZCWA 4WX9A 2RC4A 4HMZA 1SFNA 4OFGA 4M6XA 1UIKA 4AD9A 4XETA 3L00A 2EV0A 1AWCA 1ON2A 2B8MA 1Y9QA 4ESJA 1TQMA 4IHSA 4A12A 3M7GA 1SFEA 5KBFA 5ED4A 4TV7A 3ZMTA 4LUKA 1YYVA 4ENKA 3GEZA 4AWXB 4Q0SA 1SD7A 4CHUA 1MD0A 4H0EA 1ZGAA 3DL3A 2ET1A 5HS7A 4R8HA 4CDGA 1OD5A 1O3SA 3FZ3A 2EJRA 1U5TA 2JPBA 2W24A 5AIQA 3G3ZA 4EM0B 2HQNA 3E5XA 2ATFA 1UIJA 2MA3A 2Q8KA 4KNYA 3UKTA 4K2EA 2IVMA 4L9NA 3W6JB 3M70A 2K86A 4I3PA 4QGLA 3KEOA 4YFKF 4I01A 3W6KB 3WTYC 1OMIA 3RKYA 4BH9A 4OIPF 3GYDA 5HLGA 5FLHA 4B29A 2CQKA 1B9NA 4RAYA 2K4JA 3SMHA 2BNMA 3M8FA 1R5HA 1H9TA 5LGUA 4EMSA 2IA2A 3DPLC 3DF8A 3EJKA 3QRFF 4MNUA 3F22A 4WCGA 1UCRA 2VBYA 5T3NA 2XLAA 3TKYA 5LHGA 2IXCA 1CF7B 2XKPA 3ELKA 4N0BA 1XE7A 4IEQA 1YFWA 1P2FA 3F8CA 4IVNA 4IETA 1L0OC 1JE8A 2VXZA 2PAMA 1ZLKA 1EP0A 1BI2A 1EYBA 5ILUA 2PJPA 3J7AO 3TO7A 4B09A 3I64A 1W5SA 1ZZ8A 4ON0A 1LVAA 1I27A 2A61A 3F8BA 4KN7X 1C0WA 5IT9Z 5DCFA 2QWWA 5HOOA 1G3YA 2EAAA 1XSXA 1UHMA 4KIBA 4ESBA 3FM5A 1J58A 2F5FA 3H50A 1V70A 4IPAA 4KUMA 2VE9A 3ABTA 4AIJA 2PBIA 3T5XA 5JAXA 2DI3A 2VECA 3ZMZA 4P96A 2VONA 1DPRA 5BS6A 4Q47A 3WU1B 5CVVA 1U12A 1Q3EA 2A3SA 4MGIE 1BM9A 5I91A 5BQTA 2RDPA 1XMKA 4EM1A 5LHIA 1ZG3A 4MHGA 1Z7UA 3CF6E 1HW2A 3F8NA 2L54A 1OR7A 2IRFG 3HUGA 4PIXA 4NHJA 3H9AA 2PQQA 3WGGA 3F72A 4MTEA 5HDGA 2XASA 3I53A 4FX0A 3MEXA 4L2NA 1CF7A 1MJAA 1R36A 3KP3A 3GZ6A 3E6DA 4MGRA 2ZNYA 5BY5A 2NNNA 1H0MA 4RD7A 3SCHA 4OIOF 3FFQA 1ZRCA 3TOAA 3TO6A 2O03A 3DV8A 4S05A 1WSUA 1TNTA 2DFIA 3EBRA 4G8XA 2CYYA 1QNTA 3V7SA 1ZREA 2BGCA 4LULA 3C7JA 4LLGF 4PGHA 3RZZA 3G73A 4LFUA 4KWLA 4ZZDA 2D1HA 2DCTA 3LQRA 1IN5A 2XAFA 2XAGA 4D7SA 1XCBA 2MPFA 4OIQF 3SXWA 5K8SA 5FLXZ 2MH9A 4AVBA 3DN7A 4IERA 2QQBA 2VODA 1R22A 1XN7A 4I98B 1I1GA 2LSOA 1J5YA 4PGGA 4HSLA 2HYFA 5LRSA 4AVCA 2CO5A 1YUDA 2ZMEB 3F6OA 3S7IA 3HTUA 4JTOA 3TGNA 1B6AA 2YR2A 3JTHA 5HVQC 4HVQA 3JAMK 1XCVA 3ABUA 3QP5A 3NW4A 1FT9A 4G6QA 3M8EA 3U10A 1GXPA 1B4AA 2D45A 4YYOA 5BPDA 3MPBA 2PG4A 2KXLA 4LLNA 4HW0A 3BY6A 2JPCA 3DQVC 1Y0UA 3BPVA 4LB5A 2OD5A 4JK1X 4HQEA 4D7TA 1FBQA 3K1MA 3BWGA 2ETEA 4GULA 2IJLA 1RIOH 3NSTA 5AIPA 3KGLA 3E6MA 3CTAA 2OAZA 5E20A 4KIGA 1ZH5A 2M1BA 1OYWA 5FGMA 3JTGA 4FT8A 2Z2SB 2XAHA 5KK1A 3ACLA 4IXAA 4LD5A 4JV4A 2HR3A 3CDHA 2QJVA 5LHHA 4XFAA 1Q43A 4DQ2A 1YLLA 2XRNA 4IRGA 2VBZA 1TLHB 2XAJA 2V1UA 4NQWA 5DCMB 1U2WA 4E2SA 2LKPA 2HTJA 5I0UA 4QXKA 2FXAA 5FLJA 1F9NA 2ZMEA 4PIZA 2FNPA 1GXQA 5CVRA 5FPZA 4LA2A 5H6QA 4KFCA 1ZZBA 3CL1A 5FD5A 3ZMDA 2Y0OA 2QLZA 2L4AA 4XFBA 4XF1A 3MZYA 4FX4A 2JT1A 2DQLA 4M9SA 2CAUA 3ML6A 3RPUA 5FFXA 2UXXA 3T0YA 3H8UA 4UBHA 4IEZA 2M87A 1SMTA 3M9AA 4E70A 1ZRFA 4MQ9F 2NNYA 3HOSA 2EFNA 3DEUA 2M8EA 2MD5A 3WTSC 4IRIA 3ZN1A 3RYPA 3CO2A 2B5HA 2Q30A 3LWCA 4ONUA 3OGJA 1R1VA 1IN8A 4IEXA 5J8CA 2R7FA 2ZXJA 1ZN2A 3MCZA 5DD8A 3K69A 2P7CB 4HA8A 1XD7A 1J75A 5F6FA 2DAOA 1PP8F 1SEFA 5EFUA 2QQ9A 3R6SA 5H6RA 1I6XA 5K5OA 1TW2A 3QACA 4GO1A 4DNCA 2L3DA 2MNGA 2VPVA 1YIOA 2KIUA 3O2PE 3HTSB 2STTA 3ZQ7A 2HDCA 1RTVA 4QLCU 2BE5F 5KHKA 3ZMUA 2K9ZA 5L3GA 2L02A 1DDNA 3S2WA 3QU3A 3D5LA 1J3PA 5E8GA 1F5TA 5KHIA 3T8RA 4D0PA 1MDMA 3H7JA 3CO7C 1J9IA 4ZU4A 2CW0F 1XRUA 2EA2A 1G6NA 1GVJA 5L3FA 2XGXA 3O6BB 4X6QB 3C18A 3NKTA 3BJOA 1QO0D 5JR7B 3ISPA 4HX4A 5D5XB 4LEJA 3EUHA 4IEWA 2E1CA 1ZRRA 4R1HA 2P5KA 2KJCA 4LTAA 3VHRA 3U11A 2PA7A 2UY9A 2O6GE 1PM7A 1H1IA 2XROA 5D6EA 2W57A 2MLKA 2FE3A 3OOPA 4R79A 1YW7A 4AQ6A 3L2CA 1FI2A 3D82A 4BHCA 2GA1A 1CGPA 2DTRA 2F2EA 4META 1E17A 3CJNA 4LK0F 4ZU5A 1BJAA 2RVCA 3U2RA 4HAMA 2YSRA 3FF5A 4XSZF 2IPQX 1IPJA 2EA7A 3KMHA 4L5JA 1PDNC 4OU0A 1JGSA 1FSEA 2ACJA 3IDBB 4EVIA 5J8FA 1Q5OA 2E9QA 1U8RA 1BC8C 3WE3A 1QY4A 4AIHA 2VOOA 3JSOA 2OYZA 4UVCA 4QX5A 2ISYA 2XVCA 5AVPA 1TBXA 1W5TA 4A0YA 3COAC 1PMIA 5JSRA 5TJJA 1NXMA 3KFWX 3R60A 4M71A 3V7CA
chains in the Genus database with same CATH superfamily
3AYCA 3DCFA 4D8MA 3SQNA 3OYDA 3GTLJ 2VL8A 1ZGWA 3UT0A 1CR7A 1VJ2A 2GNBA 2GAUA 1KJLA 4RBOA 1K78B 2L0KA 3N35A 1OPCA 3BPSA 3PSFA 4F52A 5D5VB 1JHFA 1UX6A 2ZGUA 2KZGA 3KV4A 1SFXA 1M06G 1C4RA 5C3SA 5J96B 3V64A 2R30A 1WJDA 5K9YA 3VPRA 1K79A 4G7OF 2DCYA 5GJ6A 2WV0A 5BNNC 2VB6A 4GXOA 4YVWB 2TRTA 2NS8A 5F0FA 3RNSA 1S4CA 2P4WA 1KGSA 2V1DA 4XLCA 1VQOI 1K6YA 3FXQA 4CP1A 4L9BA 3U07A 3K7AJ 2HDDA 2IAIA 3ASIA 4UV9A 5KC5A 1TNSA 2FA5A 4BEHB 5IOYA 2Y8KA 1JT0A 3RVHA 2P6HA 3EHKA 5AC91 2LRDA 1VQ5I 1P9QC 3I71A 4LT5A 4IHTA 2VZRA 1NX9A 3OEAA 3ZDSA 4L0YB 1WKMA 5BPXA 3F8MA 2BV6A 1KYZA 2VZSA 3KV9A 3T1MA 3BUCA 4HLXA 2WWYA 4LA3A 2RS53 3IV5A 2F48A 3ERMA 2IXJA 3J26N 1XYNA 2HVRA 5F37A 1J2XA 3IAS2 4KI5M 5KVRA 1V00A 4R9AA 1HXS3 4ZZ8A 2Q5TA 3OV8A 2Y34A 4DXRA 3MW2A 4D7NA 4Z82A 2IXKA 3VSLA 1GLNA 1PO21 2A73B 1A34A 3MD2A 1Y0NA 1C8NA 3E5UA 4OZOA 4A0ZA 4BHPA 1LULA 1VBE1 5A7OA 3NQOA 1LRHA 1X1PA 4Q27A 4W8JA 2XF6A 3CJQB 1WPKA 3PIPF 1NLRA 1SLTA 3WQBA 1EPWA 5T5OA 3SHRA 3VV1A 3WTVC 1FMD3 3LQQA 1ZR4A 1CAUB 4RB1A 2P37A 3A7QA 3O1RA 3BQZA 4GCVA 1URXA 3FDYA 2WWJA 4LOCA 2BZTA 1KQ9A 3O14A 5EEGA 2LKXA 4BDYA 4OCTA 1UNBA 4CSWA 1I5ZA 2AYHA 5FKMA 1R7JA 3WW4A 2P17A 3VD9A 1F1ZA 3V42A 1JI8A 2XPWA 2BOJA 1B72B 2BFUL 4QTRA 1OFCX 3FX3A 2VC1A 2GXAA 4FFFA 1W2UA 5T55A 2YROA 2AXLA 3I4NJ 3N4MA 2D6LX 1PMJX 2VH9A 2ZZJA 3VBHA 3IAM2 2A69F 1MBEA 2NYYA 4BQ4A 1W6QA 4B43A 1G4DA 4M4PA 2HJIA 5K0UA 1S0BA 2D7FA 1XYPA 3EO6A 5DG2A 2GALA 3HKZN 1H6YA 3FXOA 4RGXA 5FP7A 2FDGA 1NK3P 1QF3A 5J1YA 2BV4A 4X8PA 3I3EA 3NAPC 1GP6A 5EEHA 4SBVA 4NMIA 5EV7A 4W65A 1W05A 3OY8B 5FCCA 3VDCA 4BB3A 4I0WB 1ODDA 3HB9A 2A6EF 3RCOA 4LJHA 4LHNA 4QQOA 2EFOA 3W2WA 3DPTA 1UMQA 2VJJA 1D2QA 1BK1A 3FK7A 1MS0A 5JI6A 3LSEA 4GH4C 2D5HA 3I3QA 3ULQB 1APLC 4ENJA 3HWJA 1QXPA 3FC0A 3P9CA 3U78A 3VDDA 4II3A 1OOPB 2FCVA 3OYBA 4P9FA 4XXPA 3WHCA 4QKFA 5L7OC 5FZIA 4RM2A 1WZXA 4YFZA 3TN91 2OQ7A 2LY2A 2C5DA 5C33A 4QQHA 1HJGA 3P7NA 4BQ1A 2H8WA 1UCXA 2HWD1 2UY8A 2WSVA 5J7MA 4LBOA 3S15J 2CTVA 3C3WA 3MICA 4QGMA 1CESA 4ZJZA 1UU4A 3MZHA 3S6PA 1JHHA 4B4RA 1VBC1 3FUQA 1RESA 1LDDA 4Q0UA 5F1JA 1FV2A 3BTLA 3H0GJ 3V8KA 5H9QA 3NV4A 1Q56A 3RMYA 3WNXA 4AI1A 4EWEA 2WA3A 2UXNA 1SBFA 1QDOA 3NRUA 4QX1A 5KHHA 4LO4B 3NWTA 4DY5A 5EGOA 3URFA 2Z79A 4DXZA 1LAJA 4N9IA 1EV12 3A21A 2E2IJ 1YTYA 3EUHC 1SD4A 3GJBA 3LSTA 4L0PA 3TMOA 3H36A 4KDPA 5E3OA 1W99A 2ZS6B 2ZNZA 2X5IA 5B2GB 5C3RA 3G1MA 4ZYEA 3IWZA 2J1EA 5J4VA 2H0VA 4DO0A 2F5VA 3PHMA 4IL6C 1IGOA 3T09A 5JVTA 5CA6A 5KR7A 3CQZJ 2VBPA 5EZWA 4Y5TA 3CJRB 4JAAA 4X6RB 1AR71 5DS9A 4AEKA 2Y64A 1WW6A 4XCBA 3ON7A 1H9PA 2V1XA 3CLOA 3AFHA 1LOFA 1JZ6A 5FLMJ 1RHI1 4FCAA 1YHFA 2LYCA 2EQRA 2CQQA 3K4BA 1JYTA 3HHHA 1A35A 4CICA 1NE6A 5T50A 3PM1A 1O59A 1JGGA 3RYKA 3LF7A 3RS6A 3DBLB 2FHRA 1S0FA 3D0JA 2Y33A 2VE8A 2L9LA 2OCEA 3TW7A 5FAXA 3QPTA 5LATA 1F5FA 5DAXA 1U0JA 5L19A 4HL0A 1OKRA 5HCHA 1WLCA 2M0CA 4RB2C 3ZP5A 1H89C 2GZWA 2JKXA 4AI9A 5T54A 3POBA 3C7EA 4IEJA 1CZSA 1BA5A 5JR2A 1RZ4A 1X8MA 1R9TJ 1KQ0A 2XJTA 2BHZA 2TCTA 4DRRA 3LSPA 1ZRDA 4DFSA 1IF1A 2JG8A 2BVLA 2EPFA 4V2WA 2VUJA 2CL2A 3DXJF 1KS4A 3GFJA 2QNKA 3AP4A 4AQ2A 1LEMA 3S1RJ 3CBNA 1SEUA 4A5MA 4HPKB 3ECOA 3HQRA 1J7KA 3ZMVA 3IZOA 4BDZA 4COWA 4BE0A 3P5BA 3DTEA 3PDQA 5H9PA 2XF5A 3S8PA 4A3LJ 5I93A 2PN6A 2HWVA 1WCQA 4ASNA 1GQGA 2BERA 2QQUA 4AIKA 1MACA 4MV2A 1OYYA 2HWE1 4QPYA 4XABA 5KXCA 1YO8A 1MZ5A 2HOEA 5CFDA 4K21A 4W1UA 3K2AA 3H35A 1UN1A 2K9QA 1ZG1A 3D6EA 1DZRA 2OQGA 1YFHA 2J1AA 4YW6A 4KICA 4IDZA 3I7DA 4PLMA 4A3GJ 4UVBA 4K8RB 4XCAA 3BOQA 5J3UA 1HSTA 3PU8A 4KWKA 2W85A 3OYNA 5BYNA 3C7OA 1YG2A 5DD4A 3VBSB 4AUXA 2IT0A 1VAMA 4A4AA 3HJEA 1Q8QA 2O14A 1JUIA 2GP5A 4LLFA 4LBJA 2DFBA 2DK5A 3GTKJ 4YGDA 3MQ0A 4O65A 3TOBA 2ZC2A 1P8JA 5D1IA 3AG4H 3ZFEC 3VHPA 1OLRA 3BB6A 5FZ1A 3G1OA 2EK5A 3OIQA 3LEGA 2RR13 4MH0E 2JVHA 1LESA 1FMVA 2WDBA 1RUG3 5FJHA 4HYEA 4FOQA 4CP9A 3ACIA 1I1EA 4U0WA 5LEJA 1PO12 1RJ7A 3DPUA 1RL3A 1DHKB 4C8DA 2F5CA 3AVSA 4LOSA 2M4GA 2OU2A 2LNBA 5D6FA 4NHLA 5HDNA 3WG7H 3JRFA 4LK1F 3FMRA 1O3QA 4PT6A 2CQ7A 4IE0A 3OYKA 3CCSI 2F4MB 1JYWA 3USUA 2K3FA 2KJBA 5FO5A 4N7UA 2J1UA 3JREA 2CQXA 2P0WA 4CU8A 4E9KA 1WLTA 3IUOA 4DUVA 5HNFA 4CDWC 1KD7A 3CMMA 1OR7C 2V7FA 2STWA 3ZFEB 1QGLA 1M1EB 1NK2P 1QIQA 2MD0A 1RGSA 2W1UA 4C3HJ 5DAVA 1OA2A 3VDAA 4AI0A 3B01A 3IKTA 1GUIA 3G1LA 2QQLA 1ON1A 1XC5A 2NAZA 1FX5A 2ZX3A 1N75A 4EEFG 4OUMA 4HN1A 4EE2A 2BWAA 2MBFA 4IUGA 2J7MA 3WDTA 4HOBA 4FAGA 1GMMA 1UOGA 3IIAA 3GW2A 3WHTA 2R5ZB 3S2HJ 3OS0A 1CN1A 2WQ8A 1CAWA 4HT1T 5B4NA 1GQHA 4E2GA 4UW4A 2P8TA 4A0XA 4QSHA 3I55I 3I56I 1BXHA 3LA2A 2OQRA 3OYWB 5DZEA 2ZXWH 1JYNA 2NLRA 3OWTA 2L5QA 2ZX1A 5FZ6A 1VF9A 2RM22 5FYMA 4IHYA 1Z05A 3LGRA 5DUXA 2JD4A 1G8XA 2LREA 4RFRB 1AR61 3MKYB 1RUH2 4CYCA 2LF8A 4AE2A 2Z5WA 2F5DA 3ZFFC 4X1EA 5A33A 3AXDA 4BDVB 1O5LA 4D0QA 3O12A 1MBJA 5JLVA 3ABMH 5E79C 4AVPA 4MEYF 3C7HA 1G3WA 4IV3C 1QZZA 1RUE1 2RG4A 5FBJA 4ZS3A 2YC2A 1W36C 2OW4A 1K42A 5A3LA 1S29A 5GZDA 1MZBA 2BPA2 3J80K 4FOWA 3W21A 4S2FA 4GJYA 3QD6A 4AZZA 4HN0A 2B4KA 1KITA 4PI2A 3HRTA 4E6KG 4BACA 1VZ0A 4A6SA 3Q8EA 1NG7A 4F7ZA 4LR4A 4WXCA 2K5CA 4AQTA 1RPWA 5A1AA 5HI0A 3VYSB 3VUOA 1Z21A 1QZEA 1AJOA 3G6EI 1PVC3 4I09A 3ZQIA 2D43A 3IC7A 4L9JA 3HC7A 2QM3A 5FRNA 3ZFFB 3AZZA 3ZR8X 1QHDA 4EM2A 4JDOA 4XMIA 5KXEA 3CMAI 1JUSA 2YXSA 1RUOA 1HDPA 3CJIA 2IGMA 1RVF1 4IEYA 3FHQA 1FC3A 1U9OA 2XC7A 2ZMEC 2DU0A 2GNDA 2EZIA 2CGNA 1NT0A 1ASJ1 5A2QK 3KF5A 3AXEA 2MYSA 5CNAA 5ICEA 1S0DA 4G9SB 4B48A 1ZA7A 4YGEA 1BMV2 3KSCA 4CO8A 4YPJA 1V9U1 1MGTA 4UI9L 1QPMA 1UY3A 1FOKA 1EH6A 4OHVA 4PJYA 1PGW1 1JODA 1W2AX 5IP7J 1O4TA 1OFSA 1QJY1 2O1QA 1PO13 4QM8A 5C3QA 1VMJA 4ZS2A 4PLOA 2YX7A 3MF6A 1QVTA 1KU2A 2V72A 3U4XA 5A3UA 1UFMA 4O9EA 2PMZN 2ELHA 4XQFA 1CAVA 1YYNA 5IAVA 2DDUA 4NROA 4AVZA 1DGWY 2R92J 3WP6A 2GP3A 4QU1A 1ND3C 1OCTC 4RS5A 1LKNA 4GWIA 1H8TB 2DPUA 4HOOA 1IV8A 3UETA 4EJTA 1GANA 1F36A 4M9ZA 1D0GA 4BQXA 3DTIA 4MGKE 5FK7A 2X29A 2BWCA 2Y26A 2HYJA 1JHNA 1KXGA 1RINA 4C2MJ 5DDJ3 1COV1 3HM5A 1VMHA 2JDNA 3T4VA 2GC3A 1WZ2A 4CZCA 1JYIA 1U0AA 1ONAA 3RTRA 2RAEA 4XFIA 4FAHA 4DEVA 1JJ6C 1RUF2 1H1AA 2PHWA 2AEZA 4XRSG 4KMQA 1ETOA 2BEOA 1EUUA 2VUCA 2WO3A 3S5AA 2BY0A 2KL4A 2D97A 1ND3B 3TNQA 1XG1A 3VYTB 4YFXF 1RUD1 3IBMA 2ID6A 3ZYIB 1DF0A 1XNTA 3KX2A 4XRFA 4JGYC 3KLNA 3M3CA 4R9BA 2RM23 2E51A 4LK7A 1JUMA 1OQDA 1AU7A 1IS3A 3HHGA 4MLOA 3RZLA 4XW3A 2EFQA 5IVBA 1CONA 3ZCOA 2PLV3 1RUH3 4E7SA 5JWPA 4IX7A 3AP9A 4F92B 1H2KA 3V65A 2QZ3A 3RZKA 1QXJA 2O8QA 1OLMA 2R062 2AS5F 2X0LA 1W6NA 5F6LB 2EIJH 4QX3A 2BDRA 1N3QA 3GFIA 4XKBA 4KGQA 1HF0A 1W39A 3KWVA 3L2WA 4E4SA 4Z2AA 4JYKA 1FATA 4XLNF 4L9TA 3BPXA 3IHUA 1XC6A 3FZVA 3VZKA 1VBB2 3FJSA 4EQQA 1V6IA 3AK0A 4GGGA 2K2SA 5FMOS 2F5EA 1ULCA 3ZYHA 1TP4A 2DUQA 3VKOA 1OA3A 4KIFA 3JD73 1WWYA 1XE8A 1RMU1 3WUCA 1VQ7I 5FQ0A 2VO5A 2F4IA 5IK8A 5F1RA 1T98A 2DYSH 1S5LC 3REOA 2D6KA 1Y43B 4K9SA 5B1AH 4Q4W1 4E4DX 1MKMA 3ZXFA 3MHZA 2D6NA 1PZ8A 4Q8KA 3FM3A 2J1TA 4YIFA 4UHTA 1JI6A 4C3JJ 1X4OA 2UWAA 5DM6F 1QWRA 5L3CA 3DEEA 1BC7C 5FDBA 1UPSA 1MNDA 2COBA 3JRIA 3LOBA 5CKQA 1X3UA 4ET7A 3H42B 1J1TA 4NPMA 5LA0A 4G3YC 4OAYA 3QBQA 3TDUC 2FJ1A 5GTIC 2KD7A 3N7JA 4Q1PA 4HNVA 3RZMA 2DDAA 1RC6A 4XOTA 1YQ6A 5FZOB 2YYOA 2M5WA 3K4CA 1RUC1 1T08B 2G9GA 1G3SA 3KP7A 4XZUG 2L01A 1G9DA 5GAEJ 1S0CA 5IYYA 4WF2A 3FXJA 2P81A 1XNAA 1C28A 2BP6A 1RI7A 4Y5SA 3RFRA 5E18F 1WJFA 1UG0A 3E6BA 1V0AA 3MDPA 4BQ3A 2YGLA 5F3GA 1GBGA 3GMEA 5EYYA 2K4BA 4XN3A 2XR4A 1YI2I 2EILH 3Q3SA 2E31A 1ZZ9A 5DMYA 2X48A 2BRTA 1XS9A 3WDXA 4PF1A 4BGDA 4EYUA 4B8XA 5EQUA 1XDSA 1OPOA 3LDBA 1EH8A 3U1XA 1YRNA 1LHUA 4E7HA 4YW4A 5LLQA 1RXGA 2J5OA 3BJAA 2EXJA 3PURA 2VOKA 5C4WA 1W0PA 5LZ6A 1U5TB 2ZOEB 5IK7A 1RUJ1 4V2FA 2HYKA 4U7DA 3LZZA 4YZ2A 5DG1A 3KEQA 2RV8A 3HBLA 3HDDA 5D4SA 2V6EA 4B1MA 3HG9A 3BU7A 1Y3TA 3SZTA 1OH4A 2VQGA 3RPQA 1WBLA 3PMSA 1SACA 2X9DA 1IDYA 2BFUS 1NLSA 1PVEA 3VOEA 2YMZA 3QAHA 3VBHC 2LF7A 1GQPA 1NKGA 2BVMA 5ABJB 2ZFWA 4BLIA 3M4OJ 1S2BA 1E0EA 3JBG2 4QX8A 3CF2A 3L2HA 4WX9A 5A3WA 1LFUP 1HB1A 2ZEZA 5K0UC 1D0ZA 3S5QA 4OMCA 5KWRA 2WA4A 1SCSA 3DPRA 2E63A 1UIKA 3OB8A 3GXUA 5IP9J 2C9KA 2VZUA 2JD9A 5FK8A 2CFOA 4OHZA 2DA6A 1ON2A 3M7GA 2R063 4NHKA 1UL9A 3U21A 5FYTA 5ED4A 3OYAA 1YYVA 5BNPA 1GZWA 3KV6A 2QDNA 5GLVA 3AZVA 2VY0A 3O8HA 1MD0A 4JC1A 4FPFA 3VBOB 4AG4A 4H0EA 1ZGAA 2IBDA 4DJAA 2ET1A 5HS7A 2VG9A 3WXPA 4AEDB 2EJRA 3BR5A 3OSFA 3PUBA 4QX2A 5F5QA 1UIJA 2MA3A 2BW8A 4KNYA 1RITA 4K2EA 3CQOA 1HA8A 2VZPA 2DODA 3HOBA 1QPIA 1Y9GA 4I3PA 3VBHB 2I5UA 2W94A 1VE0A 3WUDA 3EPZA 4YFKF 1WJAA 2JE9A 2ZMNA 3WTYC 2EZKA 4BPZA 5JXJA 3VDDC 1X1CA 4LQRA 1HRV1 1UJ8A 2TEPA 3KB5A 1H2LA 3GYDA 2X6OA 2X1EA 3ZQGA 5FLHA 1HJFA 4XBNA 5M3FJ 3ZXLA 1DU3D 5EEAA 2K4JA 1VB4A 2BNMA 1R5HA 1H9TA 4Y33A 1MSFC 5F39A 5T5JA 4L5EA 1F9KA 2D3RA 3TBDA 5E88A 2IA2A 2WAQN 3DF8A 5EYXA 3QRFF 4RA0A 1YE9A 4WCGA 2VBYA 3TKYA 3HMYA 2XKPA 4IEQA 1LU2A 3P1IA 1YFWA 4IVNA 2IS6A 3CZJA 2G9FA 1L0OC 5CAZA 2VXZA 1K4SA 3BODA 3HL2A 4B4CA 3WD5A 3TO7A 4B09A 3I64A 1KS5A 1W5SA 3O1TA 2Y9ZA 2R7RA 2NS7A 5B1BH 1U5XA 1LVAA 1I27A 2R1BA 3F8BA 4RQPA 5FIXA 3WDYA 4BZ4A 1WA6X 5FZ8A 1ZQ3P 1CQ9A 1MMNA 5A3MA 5HOOA 3WNOA 4IV1B 1VRBA 5C44J 2EAAA 2YPDA 1D7PM 2DTWA 2F5FA 1V70A 2VE9A 2E19A 4AIJA 4B44A 2DI3A 5GLTA 2VONA 4XNFA 3AYDA 2FD5A 3WU1B 5EHDA 3ZFGA 5M5YJ 2BOLA 1X1DA 4FPGA 1XMKA 4DYRA 1ENRA 3H9QA 1BBT1 1GOFA 4LORA 2WZR1 1HW2A 2L54A 2DJNA 1PK6A 2X5IC 1F8VA 3HKZA 4XZPA 3GJAA 4RR3B 2XASA 1QJFA 4XDQA 2JWPA 2K9NA 1CIYA 1CF7A 4DQAA 5CKTA 5FP4A 4EATA 3N36A 1MJAA 4YM0A 2ZGQA 3E6DA 4XQWA 2ZGKA 3EUKL 2NNNA 1H0MA 2VASA 3HNMA 3GZUC 3TO6A 3ZKYA 2LFBA 1NUKA 2KFDA 4F55A 1WSUA 2DFIA 3ORJA 1LOFC 2WINB 2HOSA 1AUYA 4XDPA 3C7JA 5EGOB 2GSYA 4ZTJA 3KHBA 2XAFA 2XAGA 1OKQA 1OF4A 5FLXZ 2MH9A 2WQZC 5FP9A 4GQ7A 2WO2A 2WB1N 3JBG3 2EZHA 1R22A 4M3CA 2LSOA 2O8OA 2ORXA 4HSLA 1OXCA 5LA2A 5TISC 5FZFA 3MZ8A 2ZABA 3H8XA 3SC7X 4XDOA 3F6OA 5K4LA 3NNLA 4COUA 3TGNA 1B6AA 2WKKA 3HVDA 2YR2A 3FL7A 4M3FA 4A7YA 3ABUA 3NW4A 3M8EA 2M0MA 2KXLA 4LLNA 4DRVA 5EJZB 3RQ0A 3BY6A 2JPCA 1POV0 2W00A 2OD5A 1LCLA 5FPLA 5E3LA 4ZKTB 4UB6C 3VYUB 2VZTA 2IJLA 2BVVA 4CU7A 5AIPA 3E6MA 3LMMA 2JICA 1ZH5A 4JDMA 5IP6A 4IGPA 3V0BB 1WUVA 1JS9A 1QA6A 1AKHA 3BR1A 4LO5B 3O1MA 5FY9A 3OUHA 4AGGA 2DYCA 1Q43A 5KXDA 3BG6A 4IRGA 4CVUA 2VBZA 3K4LA 2CV2A 2VMFA 1MH4A 4MOAA 4NQWA 4BLJA 5CFDC 4E2SA 1FOXA 2HTJA 4QXKA 3CCQI 3IM0A 3ZIXA 5H6QA 4KFCA 1ZZBA 2RDQA 4LKDA 3CL1A 3BG3A 1R092 3OPTA 3POSA 3N7MA 2ID4A 2DQLA 2JG8B 3CC7I 1TNRA 3QCWA 4LBKA 2QSHX 1NZIA 2UXXA 1O91A 3M9AA 2XQRA 4D7YA 4E70A 1FOYA 2L9VA 5K7HA 5TGTA 4BQNA 1JOPA 3I3LA 2HLEA 4DY3A 2LY1A 3DEUA 2VJIA 5JI7A 2W39A 5D2AA 5AFBA 3ZN1A 1FNZA 3SZGA 3ZDVA 3TB0A 2HQAA 4ONUA 5FP8A 1DYOA 2A6VA 1HKDA 3WDUA 2R7FA 4HK9A 1ZN2A 4BY7J 4AW7A 2WV1A 4QDQA 3OL3A 3S16J 1PP8F 5CFDB 2L9SA 2AUYA 1SEFA 5F3EA 2WSUA 1I6XA 5K5OA 1X9TA 5DN2A 4GO1A 2VLAA 1MSEC 3I3MA 1YIOA 2KIUA 1O6UA 4PJJA 2BE5F 1P7JA 5KHKA 5A6XA 2L02A 1DDNA 3NWKA 2GNMA 4P9IA 3O5SA 3MV11 4CP0A 4IE5A 2WABA 3VKFC 3C2HA 3JRCA 2XGDA 2CW0F 1XRUA 1LEDA 2XGXA 3BJOA 5FYCA 3MUZ1 4HX4A 4IEWA 1ORKA 1LHWA 3UL2A 1ZRRA 4RGKA 4GWJA 2P5KA 2KJCA 2KDZA 2JN6A 1W9SA 2B7EA 2DV9A 4LOTA 4HNUA 5LCWL 5D6EA 2W57A 2FE3A 3GZNB 4R79A 1YW7A 1Q1VA 3LIHA 4DW6A 3K46A 1V6NA 1TMF1 4DEQA 1IOAA 4CP9B 5F0HA 4ZU5A 5EIYB 3BG9A 3ZOIA 3D8CA 4PHZA 4FPYA 3TEYA 3U2RA 3LFMA 1MBGA 5F08A 2IPQX 1YC61 1GICA 2EA7A 4GXLA 1IS5A 1UMIA 3FXMA 3GTMJ 3HOXJ 3VSKA 1YXWA 4AGRA 2GNTA 2HWC2 2E9QA 5B3SH 3WF3A 4AIHA 2OYZA 1JN2P 2C6SA 4MXWA 4QX5A 3USUB 3PTRB 3TEZA 1W5TA 4A0YA 5IWFA 1POGA 1NXMA 4EZHA 4W6WA 3R60A 1LE8A 4LNVA 1JZ4A 3HEFA 3GTQJ 5BUVA 2E7AA 4XC9A 1QJU2 4YZ5A 4GMP3 1PGSA 4L92A 3KZ4C 1GZ9A 1UZCA 2GWRA 3AL0B 2OCCH 1S7AA 3BR2A 2C26A 1N1SA 2ADUA 2DUPA 2VE1A 3F3XA 1JW6A 3RSJA 1RETA 4ARXA 3BROA 4EWDA 4RYDA 2DCEA 3U9GA 3VDXA 4Q5SF 1T0FA 4YIRX 2HPIA 3ZSKA 5T52A 1ODMA 3WTZA 5I0DA 3LAGA 1RJ8A 1TZOA 3LPGA 4IHXA 3I49A 4RAFA 1O8SA 3B7MA 1XGOA 3BI3A 3WT3A 1AYM2 1DU6A 4BQWA 1TEIA 1HLVA 1G8WA 4Q4Y1 2OZ6A 1R1TA 2QVOA 4D9JA 1R093 2Q8EA 1L7QA 3FWEA 2B9SA 4CYCB 5JIUA 2FRHA 2RMU1 4LGWA 3CD6I 4FQ4A 5CKMA 3L2QA 5A33B 3W2VA 2W1OA 3I9V2 1W5CC 5D4RA 3L7WA 2QQOA 1H4GA 1U9NA 3CJIC 5HDKA 5J4YA 1GNZA 2A70A 4YVSB 2A5YB 4QHBA 2HWF3 4IHWA 2AC1A 2IP2A 2QQIA 4Y1YA 1MEC3 4OHYA 3L2UA 3OBRA 3RKQA 5ICFA 3QPHA 5C3EJ 2RDRA 4LHSA 3DU5A 2IS4A 4XILA 3WHUA 1TQPA 3L2RA 1R58A 4BE3A 3M1EA 2V5YA 1Y8QB 4AIDA 2ISZA 1NYWA 4P5OA 2VU9A 1OCPA 2WT0A 1NXD1 1QJEA 3KYCB 2RVAA 4QDSA 1RUNA 2O61A 2JB8A 3OS1A 3SXYA 4CCNA 4FVVA 4FFIA 4HK8A 4CCKA 4YVWA 4LBQA 3WW1A 4MGTA 2PHTA 4EN6B 2VVEA 1UF2C 3THTA 4KL1A 1TC3C 4RS5C 2JECA 4LO6B 4BEHA 2IXLA 3GNEA 4XOPA 4HLYA 4CXYA 2QBXA 1X7NA 3J81Z 1AF9A 3N3HA 3ACHA 1CQTA 1WA4A 5FZKA 2XIGA 5J6XA 4CEWA 5HLIA 3JZVA 4UXNA 2B46X 4EZ4A 4V2VA 4H3WA 2JK3A 3B69A 4BJ5C 5IT3A 5FR3A 4HEA2 3BOWA 4M3BA 1W3XA 3P6BA 2TBVA 2EFWA 3M3YJ 1YQCA 2E53A 4BUPA 3ZSEA 4GYGA 3ONQA 5CISA 3FMGA 4F93B 3O1OA 3D0SA 1K61A 4CCDA 1MQTC 3M1HA 2HWC3 3H5AA 1FMWA 5LY2A 2OPTA 1A6QA 1VQLI 4H7LA 5FZCA 2VVDA 2D1VA 3P5JA 4AEJA 1EPZA 2WS92 3ME2A 3S3NA 4JBAA 3NVCA 1CIWA 3K1PA 5A1LA 2VQAA 3T1BA 2A6XA 2GMPA 3LSDA 1QJU3 3QOPA 2XQXA 4A3IJ 3CLPA 3ZXKA 2W92A 1DLLA 2QYOA 2WWUA 1QGPA 3ZPOA 1K3IA 5IVVA 2N7GA 1D4VB 5FJKA 1DLCA 4YW1A 3POYA 4O9GA 3BC8A 1LUJB 3LA7A 4NRMA 1MZFA 3QYEA 2HEOA 3R0JA 1CX1A 5IFTA 1EJ9A 5BMZA 2VQ0A 3M3IA 2ENRA 1D2SA 1HXDA 3B00A 5ACA1 2CSOA 4ZYDA 3RI8A 4C1WA 1MH3A 2JSCA 5GAGJ 3F9KA 2OTLI 1Y7BA 4TXWA 2QQWA 3MIEA 2GC0A 1OCZH 2PMZA 4J25A 4EN0A 4ZDPA 3FHIB 3BCWA 4HQMA 3D5SC 3OY8A 1W8HA 3K9TA 1HN1A 1VMFA 1X3ZB 5A3PA 4QPQA 4JKKA 1JU4A 1PVXA 4ZYAA 2VI6A 2XJVA 1CVNA 1SHWB 4A7ZA 2ID3A 2HBTA 2PMUA 3A01A 5F5AA 1W6NB 2PHDA 1R64A 4LIUA 3ZXEA 4CE8A 1SBDA 2GMEA 1MW7A 4YG2F 3G7DA 4XORA 5FJ8J 2DW4A 2VT2A 4BQAA 5DZGA 4XFCA 3ABKH 3DBRB 4AHZA 1KYWA 4BXUA 2P7VB 2KIMA 4BBSJ 3ECHA 3L2YA 3ACFA 3TQNA 3WG3A 1GWKA 4A41A 3P9IA 2W82A 2EIGA 4KA4A 3IL2A 5HNHA 4CUCA 1TME2 3T0AA 3CMGA 5FXXA 2CWEA 2P34A 4RSUA 3FE5A 2M7BA 1X36A 4GWMA 4UB8C 5JSOA 1PJRA 2J1VA 3H3UA 4KWJA 1UG2A 5FY0A 5LY1A 5F04A 3TDZC 1FP1D 3A03A 4NAMA 4P14A 5GM0A 3FUOA 1X8EA 1J0RA 1H8VA 1HKQA 4CU6A 4QM9A 2CWMA 2YDEA 1B1BA 1F5JA 2XAQA 2JRMA 3M3EA 3I4IA 2ZJQF 2JDYA 3ZQFA 4OMZA 1IGNA 4M72A 2CJJA 3THPA 3AG3H 5FYHA 3UKVA 1LGCA 2R93J 5DV5A 2OUHA 4CDXB 3EYYA 4P9LA 2Y48A 2ILMA 3UYJA 1EV11 3PUQA 4WM7A 2V79A 2ZXIA 2K0GA 2EFPA 1ZRIA 2DFFA 2R7ZJ 2DMNA 4HNTA 4L9VA 1ITYA 2R0QC 1ACIA 2MC4A 1R6RA 2P3IA 2XUBA 5DCMA 1YJWI 3AMNA 3ASOH 1FYLA 1RB8G 5I8YA 3CF5F 2XJPA 3O3KA 1VBA2 3NQHA 1FBUA 2IA0A 1OLTA 2KM2A 1ZM1A 4PIYA 4G7ZF 3HPHA 1Z6TA 3IKWA 1ONVA 2G0EA 5GZGA 2JTVA 5EZHA 2WS93 3DPRC 1O57A 2JWTA 1NLQA 4RB0A 1OC1A 1YRNB 4KU7A 4HDVA 1C5HA 2HWB2 2IGNA 4DOUA 5C4WB 1HC8A 3ERED 5BNPC 1BN5A 4MO7A 4W97A 3OMYA 4FOYA 1D8KA 2IEKA 4BJ6C 2YBKA 2ZA9A 2R6QA 5E3NA 2O0YA 1BHGA 5HCAA 3CCMI 2VQHA 2E7TA 4CH7A 5FZ3A 1L3JA 3VBRA 3O1UA 3LSGA 1FOD3 1MBHA 5A32A 1E2XA 4M9XA 1B09A 3IPVA 4XKVA 4FPJA 2JDAA 1UW8A 4L0ZB 1LB2A 5DAQA 2G19A 3KYLA 2Z3YA 3P3NA 3JB4C 2JA7J 2CHHA 1C57A 5I0SA 3KQ4B 3FMSA 4M4RA 1VNDA 4QXCA 2X4HA 2HGCA 1PNFA 4U88A 2FSWA 1S0GA 4XSXF 1T8IA 5LBBA 3ROUA 2HEWF 2WNVA 2LALA 3C3VA 1CPNA 3DYOA 2KR2A 2NVQJ 1NCRA 3KGZA 3I5UA 3MEPA 3AKSA 1IN6A 2X53S 4LG3A 5L3BA 2ET7A 3QOEA 1XSRA 5BNPB 3DTKA 1T6SA 2NM1A 4QB1A 1BEV2 1EF4A 2ZAAA 1OVSA 4D94A 2P6CA 1R083 4HPKA 1ZA4A 4IGOA 3TP0A 1RKTA 2A6TA 2E1OA 1XOYA 1OQYA 3LAJA 2E1NA 3PUAA 3H5RA 2G7UA 3VEPA 2GXGA 4ZDLA 4JQTA 3LIGA 4WXDA 4IKFA 2VC0A 2NYXA 5DQ0A 4YFNF 2IXSA 4CXFA 4IEUA 1QJX2 4ATEA 4OI4A 3S30A 4GYIA 4RQPC 2P6SA 1RC9A 4FE7A 3FFZA 4ZHNA 5GPCA 3AJZA 1GR3A 1LVKA 3KQRA 2IXHA 3RKXA 1TME3 3S0MA 2AXTC 4FSJA 2XHKA 3SEEA 4XHXA 1W6PB 3F2ZA 3SHFA 4M3DA 3WG2A 3ZFGC 1IUYA 4RGRA 4P55A 3CP8A 3F95A 5E89A 4RGSA 3DXTA 5BXXA 2IW5A 3VBSA 1JTYA 1REDA 4M3CF 4N43A 1PK6C 2XDVA 3AYEA 2HU9A 1W0TA 3TL4X 2GBYA 2WTEA 1ZVFA 2WAFA 3WVJA 3B73A 2LTPA 1XB9A 4XQDA 3GZAA 2G4IA 4RAZA 4ARYA 3AFGA 4B3XA 2VZQA 1D8JA 1V6OA 4SLIA 2Y0MA 1W2OA 1UD1A 2FDFA 2TNFA 2FMYA 4FCYA 1PO11 1GV2A 3GTGJ 4CZZA 1UZ0A 2AO9A 4ZXEA 2K02A 2E34A 3WG9A 4HG2A 4NJ4A 3KIOA 3ZFGB 2ZJRF 4CUBA 1Q8OA 1JTZX 1W0OA 2BBYA 1OI6A 1W2TA 3BDDA 2RS11 3JW4A 1VBA3 2ARCA 2FMLA 3R61A 2V09A 2W91A 3U75A 5E17F 1PK6B 2CYFA 1SPPB 4YNIA 3RQIA 1QOSA 1E3PA 3IWFA 2HFHA 4CCLA 4IE4A 1PGL2 3ZYBA 1DYKA 2JA2A 4HG6B 3ELNA 2HWB3 4LLOA 2ZKZA 2CQNA 1NCQA 3KZZA 4IL7A 5GP9A 1XNBA 2RN7A 3RWKX 5FLVA 4WZFA 5A6YA 2R0HA 4BM8A 1WWXA 3VN4A 3A4UA 2K9SA 3IH2A 3GWZA 1ULOA 3BR0A 3DKYA 2E71A 1CJPA 2R5ZA 3GUDA 1KU3A 5FUPA 3ZPLA 4MYEA 2DK8A 3WHBA 3BIWE 3OYWA 2H8RA 1IQDC 3Q0VA 3MFAA 3C2UA 1ULYA 3ZYPA 4CCOA 3IIIA 5LBQA 2HYXA 4M3CB 1G9FA 2RM21 3H5NA 1IJWC 2QKLB 5TRDA 4A6OA 1G86A 1MMDA 2VMGA 1RUH1 3R4UA 2LBFB 5F3CA 4COYA 2QF7A 4Y22B 5BNGA 1ETXA 3M3OA 4YSFA 2UURA 3BIEA 5FPVA 5L3DA 1QZYA 3K2OA 4EJUA 1YQ2A 3ZXSA 1ULEA 2KPMA 4YZ1A 3AVRA 5IVFA 3KT7A 3H9GA 2DYRH 3OIOA 4ASMB 4V2GA 1PMHX 2DPDA 1K4TA 3FLTA 2AGSA 2FBKA 4AU7A 1NG0A 4OINF 2ZX0A 4L11A 2LROA 2Y6LA 2X6WA 2D5FA 1QJX3 2FDKA 1MS4A 3NNJA 2DU9A 2GQQA 2YV8A 5CLSA 1AKHB 4BMBA 3AKZA 4PCQA 2ZGOA 4YZ4A 4XF0A 3SCGA 3ILNA 3L1PA 4DXTA 5C9AB 1A36A 1VAVA 3S17J 2MC3A 3DXUA 3KLSA 4FBFA 4F3JA 1STZA 1LJ7A 1ND2A 1WMDA 4IEPA 4NQWB 1YS7A 1WCSA 2PHLA 3FXRA 2WB1A 1E57A 4GD4A 1KA8A 3W5NA 1LEAA 1FLIA 3BZCA 1QQIA 4S2DA 1AL22 2VOXA 1JYCA 5KC6A 5LEKA 1F31A 2OV7A 1S7OA 2VCCA 1MJ9A 1IG0A 2WAOA 1AR92 3GVAA 1IW7F 2LY9A 5BOXA 5K1YA 1BMV1 1OURA 2PJRB 2XV4S 4MADA 4DXSA 5FYVA 1XSDA 3OGSA 4MX3A 4FQZA 1HW1A 5FFZA 3OR1C 2ZHMA 2CFXA 3MKLA 3CCYA 2GU9A 3OGVA 3ATGA 2I07B 1F4AA 5FD6A 2V9PA 2W84A 4ENMA 1G3TA 4NIDA 1WI3A 3R0RA 1U6GA 1K5MA 2XVGA 1SLIA 4R52A 5JZGA 4Y20A 3BTYA 5K5RA 1SFKA 3KLOA 1P4AA 3WLUA 1LOGA 3PIJA 3JRHA 2Z33A 1SLLA 5J3LA 2JJ7A 4CDUA 1SLBA 2DWRA 1ZARA 3N9MA 1WLWA 5FFOC 5LB6A 1Y1VJ 3POFA 1S0IA 3GLXA 2UWMA 3N97A 3S3MA 4M73A 2JIGA 1J09A 4XUOA 1FX7A 1WCUA 1Q8VA 1RUF1 2RS52 3AZWA 4U0YA 4QT6A 1FBSA 3ETPA 1V4RA 3OR2C 1FIPA 4BA6A 1SFUA 4BYYA 1AR82 2GC1A 1HXS2 3HSFA 2YFZA 4INDA 4COZA 2DVDA 2HWD3 3I97A 4AAPA 2L7FP 4RGAA 3RZDJ 1CAXB 3E5QA 3DKXA 3FISA 4JVAA 2ARAA 2AQFA 1WMXA 1WJ5A 2XUMA 1RXFA 3AMHA 4WM8C 1PYVA 1FMD2 2PFBA 4M0HA 4F8AA 5I0RA 3S1MJ 4MXWB 4GZ9A 1WVRA 1Z3XA 2R061 4J6GA 4LUMA 4I3GA 3CCVI 5F3IA 2P4EA 3N9OA 2YC4A 2CH0A 2DU1A 1SD6A 3R4KA 2DBBA 3LSKA 1KONA 3BALA 3BYWA 2R7DA 3KPHA 4GWNA 2JA8J 3CU7A 2Q1ZB 4HBLA 4JX4A 2IGOA 1VBB1 3N7KA 3J7AY 2VBWA 3Q9VA 1ZZCA 1NAEA 5FO7B 2VXJA 2WR9A 3IDEA 4XHBA 1TVGA 1B59A 4BHBA 4JQRA 4L97A 1HOMA 3D1NI 2H6BA 3EETA 1WW5A 4DB5A 1ZLJA 5FZ7A 2IVIB 3RYRA 1BQPA 3FMQA 3MV01 5ERLA 5A3NA 5LD2C 3H1MA 4DZJA 2ZMKA 1IXCA 4YVWC 4E4ZA 1GSLA 1WGPA 4JX0A 2WNOA 1X33A 2B42B 3UGHA 3WP3A 1DQ2A 4E7JA 3HSEA 1AL23 2KRCA 3H1YA 3M7AA 4V19K 4ZYGA 5FBZA 4BQQA 3LSRA 4UFMA 1SDDB 3OPWA 1AR93 4XJUA 2EIMH 4ES8A 1GFF2 1W4MA 4AHWA 4TN7A 5J98B 4AI8A 3HOTA 1NA1A 4CEWC 1YI9A 4M6YA 3GF6A 1QNWA 5FZOA 3KP6A 3BT9A 1GOHA 3OF1A 4XLPF 4CA0A 1AHDP 2NOJB 1DZTA 4QPOA 5JMCA 2BNNA 5LGNA 2LR8A 2LTNA 3K75B 4I6ZA 1Z7S2 4EN7B 4C2TA 3T0DA 1OLQA 1KU9A 4E7LA 4QGNA 2BGPA 1OF3A 2RC4A 2UU8A 1I39A 4MGQA 3OYIA 4EJRA 2PQSA 5HBAA 1M4WA 4RHV1 5LA9A 4LBQB 1SFNA 2BVBA 1IDZA 2DT7B 5M0TA 4WVMA 4MG2A 4GB32 4FTSA 5C8CB 2EICA 4CPBA 2B8MA 4ESJA 1TQMA 4IHSA 4FPKA 1SFEA 2E33A 5AFEA 4E7ZA 4KBZA 2W47A 4LUKA 1S7EA 3GEZA 3FHNA 1W6OB 4CHUA 3MLJA 1UAAA 2VW0A 3MLKA 1JBCA 3LNQA 5FWJA 4R8HA 1YJKA 4AFMA 3A0BC 1U5TA 1QKQA 4CEWB 2D3SA 2WLPA 3OUJA 5AIQA 2JDZA 4EM0B 1K83J 3ZMNA 2X1DA 3UKTA 3CKHA 2HWE3 4L9NA 1DQ1A 3WG4A 3W6JB 1DG6A 4A3EJ 1AR83 1IUFA 1YX5A 2VAUA 1JMUB 2HVSA 3O1VA 2R7VA 3A4CA 4BH9A 3BTZA 5GZEA 3JBG1 3GHMA 5ABJA 1UYPA 5IYCJ 1IRZA 2ARXA 2GM4A 2NP0A 2XVLA 3M8FA 3H3LA 5CQEA 3EJKA 3F22A 3HZJA 4FP2A 1UCRA 5T3NA 5FZ0A 1YIJI 4N0BA 1XE7A 3F8CA 1SFPA 1JE8A 2YFUA 3M1CA 1DP0A 3OYLA 3J7AO 1E5HA 1CWPA 3VBOA 3DGTA 2LK2A 4ON0A 4AEDA 4KN7X 3AC0A 1AXYA 3WQ0A 2WUHA 5BNNA 2VZ3A 1C0WA 3MIDA 1XSXA 1UHMA 4XE9A 3H50A 3WEZA 3I4MJ 4KNCA 3FBYA 2PBIA 3T5XA 3VBUB 4P96A 2HBUA 3M2MA 4Q47A 1OOPC 5T5PA 2CS3A 3VLBB 5A7QA 4OI0A 3AM2A 2BUKA 5LHIA 2R7EB 4MHGA 1Z7UA 3KHCA 2IRFG 3HUGA 3HBKA 4FFHA 3F72A 4P5HA 5HDGA 4FX0A 4L2NA 1R36A 3GZ6A 3I2OA 3A01B 4IQJA 3SNMA 3S1QJ 2R5YB 2VD7A 3LCPA 2XRLA 3GHNA 4HXCA 4K7JA 3FFQA 3TOAA 2XSDC 3M3QA 3PUHA 2ZHNA 4QB2A 2ZB9A 2KMUA 5FMDA 2MEV2 1JKRC 2WY7Q 2W87A 4HANA 1V5FA 2DA3A 3S32A 4GRIA 4G8XA 2W9XA 2IGKA 3TW6A 1X4PA 1ZREA 1QU0A 1HQLA 4IV1A 3RSNA 4LFUA 1E5IA 4ZZDA 5JOZA 2DCTA 2FQ4A 2XPJA 1UQXA 2ZAHA 4D7SA 2PMWB 1MNEA 2PN5A 1XCBA 1Z7S3 1ACCA 3VD5A 4WM7C 3SXWA 1DBNA 2RDSA 4AVBA 2OXBA 3WNNA 3DN7A 2VODA 1J5YA 4Y4YA 3SFIA 2EXHA 3RZJA 4QQPA 2HI3A 2Z16A 4JTOA 1AR63 2V4AA 3MFCA 1W1WE 4GB33 3JAMK 4HVQA 4AVTA 5FZDA 3VD3A 2A75A 3Q0UA 3CDLA 1FT9A 3J8F2 4QPIA 4X0GA 4RR3A 1B4AA 5BPDA 4NPRA 1A31A 4HSTA 1RUE3 4B3AA 1HB4A 1CZVA 4LB5A 4LKFA 4HQEA 4D7TA 3LSJA 1FBQA 3K1MA 3RRDA 1KEXA 1RIOH 2BZDA 3KGLA 1KFUL 4YM3A 3ZMOA 4XTPA 1S55A 2OAZA 5E20A 2VMDA 4KIGA 1FYUA 4O61A 1OYWA 1QHHD 2R16A 5FGMA 4FT8A 2Z2SB 4GKYA 1REEA 3SYTA 2RR12 3BKZA 4WM7B 4C2UA 4IXAA 1RUG2 4JV4A 2HR3A 1BLZA 4URAA 5LHHA 1POV3 4XAEA 5DUWA 2GOMA 2ZGPA 1TLHB 3HPNA 2B63J 5ISLA 1HB3A 3ZSMA 2V1UA 3VBRC 1MPXA 5DCMB 1U2WA 5JVGF 2KZVA 2LKPA 4D6SA 3O0XA 5I0UA 5IVEA 1FNYA 5FPZA 2R7UA 4J19A 4AI2A 1ENHA 5IVJA 2E5ZA 3ZMDA 2QLZA 2WNUA 3PMEA 1V5EA 1ASJ3 3ML6A 2O5RA 1MS5A 3T0YA 4UBHA 3B94A 3H8UA 4IEZA 2M87A 1SMTA 2FMDA 2WNVC 4AVSA 4W4ZA 3WCRA 1WH7A 2KT0A 1NCRC 1OLME 2ME0A 4A3MJ 3HOSA 2EFNA 1QU3A 5FPBA 2X85A 1FV3A 2MD5A 1ZK8A 1IO2A 4QKBA 3I8TA 2XG3A 3RYPA 1YOVB 2A3WA 3BZKA 1U8BA 3CO2A 2Q30A 5J09A 2E26A 1IN8A 2HZDA 1DZQA 4P9JA 2DVBA 3V0BA 4XIKA 2ZGNA 5DD8A 2P7CB 1XD7A 4KQ7A 3VBRB 3GCMA 5F6FA 5A32B 2DUOA 1YJNI 3IPVB 5EFUA 4Q4X2 1H0BA 1XPXA 3U14A 3ZQCA 3NNGA 3JXSA 3WG1A 4XIDA 2L3DA 2MNGA 2VPVA 2E32A 2VR4A 4AL9A 2XMLA 3O2PE 3HTSB 3EYPA 1RTVA 3ZMUA 2QQNA 2DCZA 3D5LA 1XPWA 3U4SA 4LO8A 4MIMA 1R091 1CZTA 1WHUA 2K9LA 2Y6GA 3T8RA 1MDMA 1S2KA 2WNVB 2YG0A 1IQAA 5A6QA 3H7JA 1J9IA 1NCRB 1I6HJ 5L3FA 1JKPC 2PHUA 4X6QB 3C18A 2W5FA 2ZBJA 4MSVA 4UF0A 1QO0D 3AKRA 5DUVA 3EUHA 3MN2A 5K7FA 4A3KJ 4NC6A 2K46A 3VBSC 1QDCA 4N43C 4LTAA 1IG7A 1TWHJ 3WU2C 2UY9A 3FLRA 5JXGA 1RRJA 2MEV3 2O6GE 1PX4A 3AYAA 5FREA 1PM7A 1H1IA 2XROA 2EIBA 2MLKA 1ETQA 3TEWA 3L2CA 1FI2A 4BHCA 2WY8Q 4C90A 1T6GC 1E17A 3CJNA 2VOWA 2RVCA 1QH6A 2IFWA 5LASA 2YSRA 3FF5A 4XSZF 3APBA 1GZCA 1WW7A 1ETVA 3KMHA 1PDNC 3I2GA 2BY2A 1FSEA 5BNOB 2D3PA 4EVIA 3IAPA 2W08A 3LSIA 1Q5OA 3VGIA 1MVQA 1PVC2 3R05A 3RGBA 4UVCA 2QSGX 1A78A 3J8F3 3COAC 3ZN5A 1MVEA 2GIZA 2ZX2A 4N43B 4PJNA 2PXJA 2JDKA 3V7CA 1P4WA 3K4ZA 5C71A 4BQ5A 1JH5A 5FKBA 1X58A 4C3IJ 1ODNA 2L7MP 2R042 1D1BA 2W46A 1WLDA 3CEWA 3GBWA 4XBFA 2XH6A 1YJ9I 4Y5Z0 2OBPA 4I99C 1LODA 4H7MA 4Z1VA 1NCQC 2HYGD 2ICWG 1GP5A 5CG9A 4FPLA 4ANJA 4BY1J 2Y38A 2DCKA 3E6CC 3X2QH 4S04A 1O7LA 1O3TA 1FPN2 1S6LA 1T33A 3HT1A 1B8IA 3VBFB 2BYVE 1WJBA 1BVVA 4UWDA 3BR3A 1OVPA 2ZEYA 3IRQA 3CDIA 5TSWA 1AXZA 2OF7A 1U5ZA 5IY5H 3KZYA 1LU1A 2OC6A 2HWC1 4MHUA 2VOPA 3VZOA 3R4SA 4LLLA 3GBGA 5F27A 3ZQLA 4KISA 3NJXA 4K1ZA 4WZCA 1HLCA 2BXZA 2GA2A 2V9VA 4QHZA 4HF1A 4ZTFA 1SAUA 1S8NA 4DS0A 4KN4X 5CJ9A 2Q1MA 4X8NA 5FOBB 5DZFA 4QPGA 1QJU1 1AA7A 2G7HA 2QQAA 5C4JJ 3M4FA 5DDJ2 1AJKA 1NCQB 2JX9A 3LA3A 2ZXHA 4E8CA 3O0VA 3MW4A 3PL0A 2LW8A 1DIWA 1MS3A 3B5LB 1IN7A 4OWRB 2Y60A 3AFKA 3A0NA 2XJSA 4BJ0A 3WF1A 2VVFA 3LDKA 3IP4B 5F32A 3E97A 3FXKA 1RNLA 4Q4X3 4IQPA 2WAEA 3MGUA 3RG0A 1GNYA 3AMQA 4ZZ5A 2JSPA 4RA2A 1UMZA 5A6ZA 3BTXA 4ZZLA 5JPNB 1DGLA 3HJRA 4U36A 3NNFA 1AYM1 4CEYB 2ESHA 3SCFA 3ZXJA 1EV7A 4XUPA 3G4SI 3DFGA 2D93A 1L3LA 3VB2A 1ND2C 2I45A 4JCKA 2VW2A 2M7AA 4MGYE 1AOYA 3J80Z 4UXAA 2PLV2 5FZ9A 1KU7A 4UVAA 1W8TA 1P92A 1UY4A 1XBFA 3MUY1 4NIAA 4UW6A 2IXIA 2VQUA 3W20A 1RUJ3 2VTFA 4AFCA 3VL8A 5FKKA 3S1NJ 2NPIA 1UY2A 4YVSA 3O1PA 3NMBA 2NOGA 4K40A 2Z99A 2K40A 2QQKA 2H1LA 2CUFA 2C1FA 3FLPA 3QYFA 2FZ2A 3I59B 2CUZA 2VNRA 3VZJA 4HETA 2AENA 4YZ3A 5D5UB 3V8LA 4FPEA 3B9IA 2JUGA 4RDUA 3GTJJ 4BE2A 2XUEA 4CCMA 1A8DA 2KDOA 3MFKA 3JD72 4Q4V2 3NRVA 3OGRA 1N78A 4RB3C 1BCXA 5CYYA 5EG0A 1DFQA 4JDNA 1ND2B 2OTJI 2M45A 1W8OA 1LOCA 5A2QZ 1LOEA 1UKRA 2V4JC 2YS9A 5ERIA 1BOAA 2QGUA 2ZJ2A 1BKZA 5DAWA 1K5MC 3T3YA 1N25A 3PLQA 4TZDA 5K5QA 1Z91A 5JZGC 1H8TC 3NL1A 2B0LA 2C6YA 3VWBA 1VQ8I 2NZ9A 2H6CA 1UXZA 3CJXA 4XJAA 4HPQA 3TOJA 1H88C 2R043 3RJPA 5EWSA 4CDUC 1WD4A 3BCAA 5GTHC 5FY8A 3BLYA 4DINB 4UY8I 4A6EA 1YFUA 3G6JB 2X09A 4N90A 2P6TA 3ZSJA 4ABZA 4FXKB 5BNQA 3LEMA 1GYKA 3C7GA 4Q5OA 4UFJA 2CY6A 1GUUA 2E2JJ 2VOTA 4P1WA 5IK5A 2EV5A 1YEWA 5D5WB 2DTYA 3JB8A 4EWAA 2ECBA 3MI8A 1FPN3 2KKOA 1E3OC 4NHMA 4CXWA 3PSIA 1RR7A 3JRBA 4ETSA 3NJYA 5F0CA 1AX2A 3USSA 5JOXA 1BI0A 2QEXI 2FEZA 3Q0WA 4RLQA 2OVUA 1AX0A 1K5MB 1U5YA 3WR0A 4YGBA 2Z1DA 3OEBA 5JZGB 4Y20B 4XF9A 3JRAA 4NE9A 4XR6A 4DGWB 1SCRA 2RS31 2DF7A 2FDHA 2E5NA 2WS91 1ZTRA 3CCEI 4LITA 3ZR5A 4RAGA 4XFFA 3F6VA 2AREA 4AEMA 4CDUB 2ORZA 2NS0A 4BCUA 3U0ZA 3OYJA 3OCPA 4ITVA 3CP2A 3JCIA 3POEA 4LB6B 5FRMA 4AXOA 2FNAA 1C8M2 4BBRJ 4CCJA 4EGZA 2M30A 1D3YA 2H27A 3WV6A 3ZYRA 1Z6RA 2AR6A 2W1QA 2E7WA 1A04A 2V26A 3EYIA 5IPAA 2FDJA 1ZYRF 3GO5A 1BR4A 3FHAA 1YIPA 1TTYA 3DYMA 4W6XA 2ZSHB 1HW5A 3OTFA 3CC4I 1ZBA2 3HRUA 3WW2A 2Q0AA 1MBFA 3A02A 2VZOA 3SISA 1VR3A 2QQPA 4EJVA 1LDJA 1PZ7A 3LEIA 4PF5A 2LM3A 4XUTA 5JUVA 3FHZA 2JG9A 1W2NA 4KITB 4JTNA 2F4OB 5ILSA 4XUQA 1BIAA 2VMCA 3WNLA 1EKEA 4D69A 4PLNA 2D40A 2UWCA 1XU2A 4YLZA 1H2MA 1A3KA 2BXYA 1R1A2 3EDPA 1O4XA 3RJRA 3IDCB 3K70D 1F15A 1SQ4A 2QKMB 1OISA 1NA1C 1LGNA 4QXBA 4A42A 2G9WA 4L18B 2E2HJ 1TME1 4Q4V3 4IESA 4AQSA 3KE2A 2YHJA 2LG4A 2KA3A 3K4AA 3C1DA 3VODA 2QQVA 3UKGA 2B9VA 3M8LA 2ADDA 4Q48A 1G9CA 4Q4ZF 2LD5A 4WK8F 2ZHLA 3GDBA 2ZEXA 2MABA 2H94A 4KGGA 5DXDA 2LRPA 5J40A 5C6CA 2EA4A 5D8LB 2BJSA 1I50J 2PMHA 1GHCA 2QA4I 3ZMSA 4RS8A 3OY9A 1V3FA 2BBVA 1VTNC 1NA1B 4CDXA 3BTIA 4XIOA 2QUOA 1U5TC 5FYIA 3RJ2X 1O7FA 1Q1HA 1Z0HA 4EQVA 2GIVA 1GWMA 1NE4A 2FD8A 4DUWA 4YELA 3CCUI 1ZBE2 4P9GA 2VC9A 4ZXKA 2WZPP 1TNFA 5JOWA 5FPXA 4UOJA 1I3AA 4ORFA 1LENA 2JENA 4MFDA 3J7HA 3K10A 4P9WA 1DQ5A 5EJ1B 1HKTA 4NWVA 1VBA1 3SKJE 1I1SA 4QDRA 4C9YA 1XNDA 4DPNA 3KCCA 4UUSA 4QQ2A 5ABJC 3H7YA 2DQRA 2ETHA 2OZJA 4HSRA 4WVMB 5I0TA 4KYWA 2EIDA 2V9KA 2IFRA 2Y6HA 1S3JA 4BJTA 2JDPA 1Y9MA 3D5RC 3BG7A 3ZQQA 4PBPA 4ESFA 2QCSB 1JXNA 2ERFA 2WFPA 4JRLA 2IUWA 2HWB1 3WU0A 3E1SA 5A3OA 1EA3A 1C8M3 1FAYA 1Y56A 1BOBA 3V8JA 3R0AA 4A3FJ 1J1LA 1UKGA 1WRJA 4HDUA 3DBHB 4TWTA 1QXRA 2W25A 3ILFA 2X6YA 2XBO1 3VBOC 3PNAA 2XOMA 5C8WA 3WGHA 4AEDC 4A44A 3JU9A 1HCRA 1UOJA 5C4XJ 1BBYA 5ICGA 3I0TA 3K4DA 5B66C 2XXZA 2J1RA 1ZBA3 4LXLA 2DLLA 1OD3A 2K85A 3WOGA 5IJRA 3KP4A 3LL7A 4IXLA 1UAIA 5IFPA 1DU0A 1AXKA 2YPRA 3R4DB 2R3SA 4J00A 1HBXG 1SFYA 4H14A 3PO2J 5EZGA 3POJA 2FBEA 4XLEA 1GU3A 2L7ZA 3EMRA 2RHPA 2A3XA 3J7YJ 1NY72 1BEV1 3LEKA 3FXUA 4PK4A 5IK4A 1ULPA 2WL1A 3AKTA 1DGRN 4HX8A 5FZ4A 2RREA 4ENNA 4ZDOA 2Y31A 2R4GA 3JCUC 3MWMA 5DAPA 1G9BA 3GX4X 4I0AA 2WADA 2HTSA 1R1A3 5BNNB 3WTXC 1R23A 1HQCA 1TMF3 4CCEA 1QJX1 2WN2A 3RIRA 4MEXF 4WV8A 4HKOA 2XGCA 1MS9A 2EXIA 3KETA 1NQJA 1LHNA 1XNKA 3A0HC 1W0NA 4BS9A 1QBJA 2VPLA 3PQJA 4HBNA 4IV1C 1QQP2 4AVVA 5E1XA 3E3VA 4GDFA 2J5PA 2L2OA 1W6PA 3HUGB 4IE7A 2JRTA 3IMNA 1DGRM 4M0NA 3BP8A 3OYHA 2JMWA 2XJQA 3GYHX 1OCRH 2FQPA 4UYBA 4DNYA 1R5GA 2E7QA 3BN6A 2OX0A 4UNOA 1F43A 4DZPA 3K4JA 4QPIC 4RR3C 1EY2A 1HKSA 5FXVA 3T2TA 3PTYA 4S2GA 2WBMA 3J4UH 2ZXQA 2NMNA 1OUSA 4HLTA 5IOZA 3Q9SA 4YEJA 4BWOA 1GP4A 2CUJA 2DOEA 3HYIA 2VPRA 2OPKA 2NRAC 2WFF2 2X8KA 2ZHKA 4ZPIA 2ES3A 2L4MA 4HF0A 4XUNA 1FYMA 4JKLA 1Z7LA 2O8KA 4MQVA 2XWJB 5E8IA 1ZBE3 2VTXJ 1LJ9A 1SBEA 5ACA2 3RDIA 1Z1DA 2VTXA 4Y52J 1W7PB 2CUEA 1BI1A 4Q4Y3 1BW6A 1KDKA 2LMDA 2I8DA 1D4M2 4XJZA 5H20A 1D0HA 1LHOA 1WI9A 2RMU3 4X6AJ 4FQGA 1L7RA 1SPPA 3HOWJ 5KHGA 4NN0A 1Z9CA 4NHXA 4QPIB 4LKSA 2RNJA 1Z78A 1PM4A 4E7IA 1PGL1 4PUSA 4JP0A 2FCUA 2VBDA 5G05L 4Y24A 2ZTNA 1FP2A 2X10A 4XBLA 4E4HA 2WNUC 4QB6A 3OBZA 5FZHA 4BKXA 1C3HA 4QX7A 4II2A 1YW9A 4HFSA 4GJZA 2RKHA 3HOUJ 1G59A 2DOFA 3GF2A 2LOOA 3O0WA 5LWBA 2C0ZA 5BV6A 1ZZ7A 1O4YA 5D8AA 1BI3A 4DMIA 4KG0A 2CRGA 3NAPB 3KM5A 2QE3A 5CVUA 3S7EA 1US2A 4LBLA 2QBYA 2ZKNA 2F4LA 1C1FA 1IRXA 4LG0A 4QKDA 2B7YA 2DA7A 4P9UA 1EAH2 1XSQA 3OYGA 4OIRF 1ZG5A 3FKJA 4G6DA 5GZCA 4YWAA 1X2MA 5JLWA 4YRDA 3ZM8A 4RLFA