2RM23

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2300
2FZ2A 1VBD2 2R071 3J8F1 1COV2 1VRH2 1EV13 5K0UC 3LOBA 4GB33 1HRI3 2WFF1 4Q4V3 1RUJ2 1RUH3 4CDWA 1AL0G 1W39A 1NOVA 1VBB3 4QPIA 1PVC3 1SMVA 4N43C 4GMP1 2HWD3 1QQP1 1RHI2 1RUC3 1FPN1 5JZGC 1NG0A 4N43B 1BEV1 1EV11 1AR81 4Q4Y2 2RS51 5CFCC 4GB31 1F8VA 4Q4V1 4NWVA 3VBOC 3ZFFC 1V9U2 4RS5A 1RUH1 1ND3C 2IZWA 2RM22 5CFCB 1VBB1 1AR73 1MQTC 2GH8A 4RHV2 2BFUS 3ZFFB 5BNOB 3VBFA 1ND3B 4IV1A 2BUKA 1RUC1 1ZBE1 1AL21 1C8M3 3VBUA 1MQTB 1VBA3 1EAH3 2R062 1VBE2 2HWE3 4IV3C 4YVSC 1C8NA 1B35A 1FPN2 5BNNC 4CDQC 4WM7C 4CDUC 1QJY2 4IV3B 1ZBA2 4NWWA 4YVSB 1AR82 5A33A 5BNNB 2BBVA 4CDQB 1AR71 1OOPA 1RVF2 4CDUB 1RMU3 2RS52 2FZ1A 5K0UA 3ZFGC 1BMV1 4QPGC 5C8CA 1COV3 1C8M1 1VRH3 1VBA1 2HWE1 4CDWC 1ZBE2 1AL22 4FTBA 1PO22 3VDDA 5C4WA 1DDLA 1HRV2 1ND2A 4QPIC 1TMF2 4CDWB 1F2NA 1RMU1 1VBD1 2WZR2 1RHI3 1MEC2 1RUD2 1RUI2 4WM8A 4CEYC 1COV1 3VBOA 1VRH1 1RUG2 5D8AB 1AYN2 1K5MA 4Q4Y3 4AEDB 1RB8G 4CDXA 2RS12 1NA1A 1RUJ1 1V9U3 4FTEA 5CFDA 1NCRA 4RS5B 3VBFC 4RQPA 1BBT2 4RHV3 4IV1C 2RMU2 2X5IA 3VBUC 4PDWA 1RHI1 5FMOL 5ABJB 5C9AC 4WM7A 3VBFB 4JGYA 4IV1B 1B35C 1TME2 1VBE3 3VBUB 4GMP3 4Q4Y1 1PGL2 1QQP3 3JB4C 1FPN3 3VBSA 1QJX2 3ZFGA 4QPGA 1V9U1 1B35B 1QJY3 1OOPC 1ZBA3 1BEV3 1AR83 3IDEA 2RM21 5A32A 4RHV1 2TBVA 2RS53 5A33B 5C8CC 1OOPB 1CD3G 5K0UB 1X33A 2RR12 5C8CB 2R061 1VBE1 2R042 3FBMA 3VDDC 5C4WC 1PIV2 1R082 3CJIA 1ZBE3 1AL23 1ND2C 2MEV1 1PO23 5L7OC 5FOJB 1HRV3 1QJY1 4CEYA 1ZBA1 1TMF3 3VDDB 1RUF2 1WCDJ 5C4WB 2BFUL 1NCQA 1ND2B 1RVF1 1VB4A 5JZGB 4WM8C 1A6CA 1ASJ2 2WZR3 1POV0 1MEC3 1RUD3 1RUI3 4Y5Z0 1R1A2 1RUG3 5J96B 1K5MC 4WM8B 3VBOB 4CDXC 4Z92B 1NA1C 4GH4A 1K5MB 2HWC1 1OPOA 1PO21 2RS13 1NCRC 3M8LA 5CFDC 1HRV1 4RQPC 4CDXB 5C9AA 1NA1B 1TMF1 2X5IC 1GFF2 3JD72 1BBT3 4PDWC 2HWF1 2RMU3 5CFDB 1NCRB 2MEV2 1Z7S2 4RQPB 2WZR1 4JGYC 1MEC1 1RUD1 1RUI1 2X5IB 5BNPA 1H8TA 4PDWB 1RUG1 1HX6A 1FMD2 1D4M2 1TME3 4WM7B 3VBSC 4JGYB 1AYN1 1X36A 1VBD3 3NAPA 3VBRA 2RS11 3VBSB 3ZFGB 4QPGB 4YVWA 3JBG2 1BBT1 3DPRA 2RMU1 2HWC2 1RUJ3 5L7OA 5AC91 1HRI2 2HWF2 1TME1 3CJIC 2R043 4JGZA 4LLFA 1PGL1 1PIV3 1R083 4QPIB 1QJX1 1HXS2 1NCQC 2HWD2 2PLV2 4CEYB 1QJU2 1ASJ3 4Y4YA 5J98B 2QQPA 1NCQB 3HAGA 5ACA2 2XPJA 1R1A3 2RR11 2RM23 1AYM2 1CJDA 2WS91 4GH4C 2R041 1PIV1 1R081 3ZFEA 1VB2A 5AC92 4GH4B 4Q4X2 2RS32 2R063 1RUF1 3JD73 2ZTNA 1AR92 5C9AB 1FOD2 5BNPC 1POV3 2MEV3 1ASJ1 1Z7S3 4RR3A 1AR62 1H8TC 4Q4W2 1R1A1 3NAPC 1D4M3 5BNPB 1RVF3 1H8TB 3VBRC 5DDJ1 4YVWC 1IHMA 2WS92 3DPRC 3VBRB 3JD71 1VBC1 3JBG3 2XBO2 5FMOS 1R091 2ZZQA 4YVWB 1POV1 2HWC3 1Z7S1 3DPRB 4JGZC 1FMD1 1D4M1 2Y26A 2HWF3 3TN92 5L7OB 5GKAC 4CEWA 1RUE2 4RFT0 2GSYA 4EJRA 1PO12 4JGZB 1HXS3 2DF7A 2WWSA 1AYN3 5D8AA 2PLV3 3JBG1 4N53A 1NY72 4SBVA 2HWB2 1QJU3 5DDJ2 4AEDA 3VBHA 4FSJA 5ACA3 2R072 4GMP0 3J8F2 1VBC2 1AYM3 1HRI1 1R092 5BNOC 3ZFEC 2ZAHA 2WLPA 1HXS1 1PVC1 5AC93 5ABJA 2WFF2 4Q4X3 1PGW1 3ZFEB 2RS33 2HWD1 1AR93 2PLV1 4RR3C 1FOD3 1QJX3 1QJU1 1AR63 5LK7B 5ACA1 4Q4W3 2BPA2 4BCUA 1QQP2 4RR3B 2VQ0A 3JB8A 1AYM1 1OHFA 5A32B 1BEV2 1EV12 4FTSA 2RR13 4GB32 4Q4X1 3S6PA 2WS93 2RS31 4Q4V2 1RUH2 1AR91 2XBO3 1FOD1 1VBB2 1AR61 1EAH1 1PVC2 3CJIB 1PGW2 4Q4W1 1RUF3 1RUC2 4CEWC 3ZXAC 4N43A 3TN93 1E57A 1RUE3 5JZGA 1PO13 4CEWB 5D8AC 1M06G 4N53C 4AEDC 5CFCA 2XBO1 3VBHC 3ZFFA 5BNOA 5DDJ3 2HWB3 1AR72 1ND3A 1VAKA 4N53B 1BMV2 2R073 1MQTA 3VBHB 3J8F3 1AUYA 1VBC3 4RS5C 1C8M2 1R093 3TN91 1VBA2 1RUE1 1EAH2 5ABJC 2HWE2 1QJZA 1PO11 1FMD3 2WFF3 4IV3A 4YVSA 1HQNA 5BNNA 4CDQA 4CDUA 1NY71 2HWB1 3NAPB 1RMU2
chains in the Genus database with same CATH superfamily
4HETA 4Z8BA 3D4KA 5J09A 2R071 2OPWA 2WQ8A 4OZXA 1DHKB 1G9CA 4TLGA 2Y60A 2YG0A 4LO6B 3ABZA 4HSLA 3NNFA 1Z0HA 3V64A 2XL7A 3IWZA 1MPXA 2XJTA 1CR7A 2W5FA 4LR4A 3TOJA 3U4SA 4YSFA 2PHDA 3L2YA 5FAXA 3THDA 3PVNA 2RDRA 5IVYA 2Z42A 3OJBA 5FBJA 3U07A 2BRTA 2VUDA 4PF1A 3ITQA 4K21A 1L7QA 2D6KA 1W39A 2XJSA 1NOVA 1WW4A 2A3XA 3U1XA 4A42A 2YZ4A 2VQUA 4INDA 5LWBA 2DYCA 1HQWA 3M70A 5JZGC 4LQRA 5EXOA 4H3WA 4BLIA 2BNNA 5F5AA 2F4LA 2JDKA 3DXUA 1BEV1 1XYNA 3O0XA 3OGSA 1U12A 1S55A 2JB4A 2VVDA 4R4ZA 5EPAA 1SBFA 1ZVFA 2VZVA 1SLIA 2WT2A 4FPCA 2WZPP 5CFCC 1HJGA 4Q4V1 4DRVA 3AX4A 1RUH1 3LIHA 4LEJA 4HLTA 5F2SA 2ENRA 1ENRA 1H1MA 5HCAA 3MDPA 3ZYIB 1SZBA 3H9AA 4JZRA 1V00A 2CDPA 1HIXA 1AR73 1YQCA 4XF0A 1EP0A 1S0DA 5F3EA 4HPKA 3Q8AA 2D40A 4KWKA 2ADEA 5BNOB 3JUUA 3VKLA 4QAWA 1A34A 1RUC1 1WA6X 1ZBE1 2JD9A 1IPKA 1W8ZA 2E31A 4YGDA 1UKRA 2QKDA 3VL8A 1DQ0A 1MQTB 2BGCA 1QJEA 4Y5SA 5F5CA 3U11A 3WF4A 3WVJA 5DZEA 4CP9B 1VBE2 3OUIA 3KT4A 4MXWB 3J7NA 5EIYB 2WR9A 2A6XA 2VNRA 1B35A 4U2AA 3OBZA 5FP3A 4CDUC 3WW3A 1STMA 3M3OA 4IE4A 1YFXA 4O7XA 4XPVA 5H9PA 3GF6A 3NV1A 1BMV2 3E97A 4LBJA 4LKFA 5A33A 2EVXA 4R8HA 1XE8A 4LULA 2E6VA 3WEZA 4CDQB 5BNNB 5ANNA 3T0BA 4IGOA 2QQWA 2WABA 5EYXA 3A4UA 1I5PA 2WN3A 1NQDA 3DECA 5C8CA 2OQ6A 1C8M1 1HB4A 4AVTA 1H1AA 3LZZA 3SITA 3HR9A 4B7EA 4PIZA 4OZOA 2D97A 3SLIA 3WDTA 3IN9A 2OA2A 4NUBA 2H6BA 4P9IA 4CUGA 4D6SA 1YRZA 4NIAA 2AH2A 3OY8B 4C1XA 4XDPA 3FLTA 2XB6C 4NIIA 3B7MA 1PO22 1U5ZA 4V2WA 3NWKA 5A3UA 2BZDA 1ND2A 1W2TA 2J42A 2VZUA 1TMF2 1XOYA 4LE3A 5EFUA 4KQ7A 1X7NA 1GQGA 1IGOA 4EWAA 5FWJA 2W68A 3ZR6A 1LHNA 4YZ4A 1RMU1 3WOGA 3VZLA 2R6QA 4IQPA 4XJUA 1UY0A 3WF2A 2XVKA 5HPOA 1NQJA 1S0FA 4U36A 1PK6C 4WM8A 5FPAA 3C2UA 5ANQA 4AI3A 3VBOA 1VRH1 1EPZA 4N7IA 4A7KA 2BGOA 1VPHA 3AZVA 5D8AB 5A3LA 5C6CA 2IXJA 4LHLA 4BK5A 1HB1A 4AQ6A 4BB3A 3BTXA 3WQ1A 3ZSJA 3DV8A 1KEXA 4FPJA 4CDXA 2CAUA 4FQ4A 1V9U3 1OQDA 1ZRIA 4P9YA 3IMMA 1C3HA 4HZFA 1NCRA 4NN0A 1NZCA 3A0NA 3FMGA 4DINB 1ZZ7A 1W06A 4RQPA 1J3RA 1H30A 3U0ZA 1VMJA 3KD4A 1AXZA 1Q8SA 4Q0VA 3WW1A 1XNAA 3POEA 4PDWA 2GNMA 1RHI1 4NPLA 5FY8A 3ZPYA 5FLJA 4D7TA 4AQ2A 5C9AC 3VBFB 4JGYA 1OLME 2XL9A 4LK6A 4S2FA 1UXXX 1TME2 1QOOA 2WC2A 4UF0A 5JIAA 3VBUB 5JOWA 1HV0A 4K3UA 1PGL2 3JB4C 1OMIA 2VMGA 4P5YA 1FPN3 2PHLA 2XLAA 3ZYPA 2E7QA 4MADA 3ES4A 1X8EA 1L3JA 1QXJA 5FYZA 2Y34A 2OZJA 3AVSA 1SCSA 3BIWE 4IEYA 4MV2A 1HV1A 4AHZA 4XUPA 2OKXA 4I0AA 2TBVA 4RHV1 2D44A 4H55A 1FNYA 1NT0A 3N4MA 3PJYA 1CD3G 2Y6KA 3AMHA 2XMLA 5CG8A 4ORFA 1PMIA 2JDMA 2R061 5AVPA 5GZDA 2ZGRA 4WVMB 3D0JA 4AVBA 1UZYA 2FDIA 3CJIA 3EQEA 3SEPA 1ZZCA 4NVPA 5FCCA 1J1TA 1CN1A 1K5JA 4PLMA 3BPSA 1HRV3 3GZUC 3I97A 1QJY1 3SCFA 3SKVA 3PJQA 4CEYA 2HEWF 4HANA 4QKNA 3ACFA 4DMIA 1AX2A 3O0WA 3K4ZA 1NCQA 5D1IA 1RVF1 2ZOEB 3ORJA 2W95A 5IVCA 5JZGB 4I30A 1A6CA 1ASJ2 4DY5A 4YG6A 1D2SA 4DEQA 4OHZA 1RUI3 2XJRA 1OD5A 4XJ9A 3I2JA 1R1A2 1W8UA 1RUG3 5J96B 2PYTA 1K5MC 2CV6A 3AP4A 4BQ3A 3BODA 3GYDA 3IIAA 3OPZA 3GDBA 3R05A 5HCHA 2YYOA 4PI0A 1HLCA 1NA1C 1RIRA 2SBAA 3FFZA 4FFIA 2WNVA 4LBQB 4E2GA 3LGRA 3MGUA 3PTRB 4NJ4A 2ZGKA 4LO7A 5F5QA 4Z2AA 1DYKA 1OPOA 2G4IA 1W8NA 3QD6A 1KXGA 4UBHA 4AGRA 1SFNA 1F5JA 3ZIXA 2Y64A 2X5IC 3USUA 1GFF2 4AK3A 2D93A 1BBT3 1UX6A 1ZZ8A 4P9XA 1OURA 3HJRA 5CFDB 2C24A 3VHPA 1Z7S2 4RSUA 4YG3A 2WZR1 2G1MA 1GANA 1YCIA 2XGXA 3BYWA 1MEC1 1S0IA 4PIXA 2NPIA 1HX6A 2WIIB 3OBAA 4ASLA 1FMD2 4DS0A 3T30A 1Q8VA 2VZ3A 3MLKA 3NNJA 3U4XA 3VZOA 2HYKA 3VBSC 3JQXA 2C26A 4M3CF 1AYN1 3J7MA 5DAQA 1VBD3 1FATA 4ASMB 2Q30A 5BNQA 5IVFA 3AK0A 1JW6A 5FYMA 2ZJCA 4OUSA 3KV4A 4GWNA 5T5OA 3HD8B 4K7JA 3EBRA 2IFWA 1RXFA 2PHXA 2VUCA 3FUQA 1W2OA 2PTMA 2NYYA 4MLOA 4YM1A 1GZTA 5DZFA 1KDKA 5FP4A 4DB5A 1QIQA 1QDOA 3JBG2 4S2HA 1NXMA 1YC61 4L0PA 3ZN6B 2JG9C 4ATFA 5JOZA 4MZUA 1CQ9A 4QB1A 3PTYA 3KVAA 4SLIA 3MIGA 3AMQA 5L7OA 2WWUA 5AC91 2PMWB 4HN1A 1GYKA 1HRI2 1H6XA 2IFRA 1S0CA 2B46X 1UWWA 5LASA 2HWF2 2WWJA 2ET7A 3THPA 5A3MA 4KH9A 3ZM8A 4N90A 4LIUA 5C5TA 3VD4A 4RS5A 4XF3A 2P37A 1S4CA 4M3CA 1Y9QA 1QJX1 2ADDA 4Y24A 1DF0A 2GNBA 2RVAA 3U10A 4Q26A 4Q0SA 2ZHLA 5E6HA 1D7PM 2P3YA 4I0BA 5KXCA 3NNMA 1O5UA 1GLHA 4L11A 5J98B 1PNFA 2OIIA 2F4PA 5ACA2 2XPJA 3CQOA 3HEIA 2VL4A 4IGQA 5FMBA 1CJDA 3AXEA 1KRIA 1QEXA 4FFGA 2WNOA 3OD4A 2ZHNA 3KWVA 4XHXA 1W6QB 2BYVE 1J1LA 1PIV1 1YHFA 3WT3A 1KGYA 2A6VA 4G9SB 4Q4X2 1AX1A 3WF3A 1OUXA 3LD8A 4EN8B 5M0TA 1J83A 2JDAA 2VNOA 2BJSA 3M1HA 4CXXA 5C9AB 5CG9A 5BNPC 4YM2A 1H1IA 1SDWA 4QDSA 4RR3A 1H8TC 4DXZA 2ZS6B 3ENRA 5FZLA 5C8WA 1KD7A 4Q4W2 1DBNA 1DCSA 2FDJA 3RMXA 4AGGA 3NJXA 3NAPC 1OLRA 5I8TA 1IPJA 5JLVA 5FP9A 1Z78A 2DWRA 3ZPOA 3DL3A 3MFAA 1W28A 1F9KA 1W2NA 2W3JA 1XC6A 2WLQA 5KXDA 1F4AA 1G9AA 4YVWC 1ULPA 1S0EA 1OQEA 3DPRC 4FO9A 3VBRB 3AXDA 3NSTA 2XVGA 1RJ8A 1VBC1 3O1MA 2XBO2 2CDOA 2ARBA 4Z07A 3ZDVA 1POV1 2HWC3 1XXNA 3AVRA 3IMNA 2PHRA 5FUNA 3RFRA 5A3PA 4HMZA 4LKDA 4RD7A 4MXVA 3W9AA 1RGSA 1LESA 4AEMA 3INAA 2YC4A 2XXZA 4CCOA 4JQTA 1D4M1 1XU2A 4UI9L 1DFQA 4B1MA 3W58A 2DV9A 2GMEA 1QGLA 1HXS3 4KMQA 3DXTA 4XMIA 2DF7A 4A6SA 2WWSA 5IFTA 1DIWA 4N9IA 3ASIA 4MHRA 1JZ5A 2VXRA 2XHKA 4N53A 4Z82A 5AVAA 2HWB2 1QJU3 4HT1T 3NKGA 3RMYA 3MLJA 4R4XA 4RYDA 3T0DA 2R072 3BTYA 1UZWA 1SHWB 5GLVA 3J9SA 4B4PA 1ZRCA 5I8SA 4AQSA 5FYSA 3EJKA 3P5BA 3GJAA 3VV1A 2WLPA 1IKQA 5IVEA 5ABJA 1N1YA 4UW6A 3ZFEB 1PGW1 2FBEA 4XACA 3VGIA 1DU3D 1YQ5A 5LA9A 2E33A 1AR93 2B9UA 2VW2A 1BVP1 2KA3A 4QX5A 5C7GA 4XBNA 2TNFA 3ZSMA 1XSQA 5LK7B 5T50A 3OUHA 3PL0A 1LTEA 1MZ5A 4BCUA 2VOXA 2A5ZA 2E51A 3POSA 2QBXA 2ZX2A 4K1YA 1AYM1 1EY2A 4OHXA 1IOAA 1EYBA 3DYMA 4GKXA 4KU8A 3BALA 5L36A 1BEV2 1FAYA 5FQ0A 1MS8A 4FTSA 1O3QA 4FAHA 3VZMA 2RR13 2ZMKA 4PQQA 2WS93 4DUWA 2WJSA 5FR3A 2XH6A 4Q4V2 3W5NA 1J3QA 4OMCA 5FXXA 1RUH2 4C90A 4NIHA 3ME2A 1CPNA 4QHOA 4E2SA 1FOD1 2KD7A 2V4VA 3CBNA 1AR61 4QGMA 1PVC2 4DXRA 5FPLA 4K20A 1TG7A 3AZZA 3OGGA 4ISQA 1RUF3 3HWJA 2X05A 3MUY1 1RUC2 4CPBD 3ZXAC 4H14A 4N43A 3WDVA 4BOWA 5LEJA 3AM2A 2GC1A 1RUE3 3D5OA 1UOGA 3MI8A 5FZFA 3AZXA 3RWNA 4XJAA 2ZX1A 1WW5A 5KHKA 3KGLA 3TB0A 2BV4A 1H2MA 1PMJX 4RL7A 1YXWA 5GZGA 2DFCA 3OYWA 5IK4A 5LW9A 4A7ZA 4K8FA 4AEDC 1LOCA 1O8SA 2R32A 3Q8EA 1AVBA 5DG1A 1OXCA 5DDJ3 5J3UA 5FK7A 3UYJA 2UYAA 4AGVA 5K8SA 1ND3A 3CEWA 3P1IA 1VAKA 1LODA 4H7MA 4QGLA 2RDSA 4BQ5A 1IQAA 1UY2A 5CNAA 2G9ZA 5APAA 2VW1A 1C8M2 3WD5A 1R093 1YO8A 2QZ2A 3HQRA 5H9QA 1GQPA 3I54A 1UU5A 3LB9A 5A1FA 1ZRRA 5FOBB 4ZHNA 1XNTA 3OPWA 5IVBA 3TEXA 2HYXA 2LRPA 3GM8A 3AKRA 2J1RA 3USSA 1JZ3A 3MW2A 2JIJA 3Q8FA 1ULOA 3VKOA 1F35A 3NNLA 2OUJA 4KGQA 3IKWA 1PHMA 3QOPA 3NAPB 4FQZA 1Y3TA 3RJRA 1RMU2 3C3VA 5IUQA 3UKTA 2DU0A 4I2OA 4HOOA 1UNBA 4LBKA 3J8F1 2Q8OA 3LDBA 5FP7A 1XE7A 4IXLA 5F37A 2XWBB 1IG3A 1VRH2 3E1F1 3HQUA 1WMXA 2YBSA 4LOSA 4Q27A 5DMYA 2W46A 1TZOA 5A3NA 3MICA 5FZMA 3FUOA 2WFF1 4F3JA 2WRAA 2GAUA 4QMAA 3GBGA 3I7DA 3FLRA 4X8NA 4CDWA 2YFZA 4XUOA 4BYYA 4EWEA 1AL0G 2BNMA 4UFLA 3IZOA 1VBB3 2QQUA 2JE7A 4QPIA 1Q3EA 1X82A 4Y1XA 5IW0A 2HWD3 4CP2A 1RHI2 3RI8A 1FPN1 1WA4A 3QH6A 5L9VA 1CESA 2WO2A 3P3NA 2VXJA 4E9KA 4AFAA 3VD9A 3ST7A 1DLLA 4NAOA 1EV11 2VCBA 4QGNA 4XFGA 1W8TA 4NRPA 3MBWA 1D4VB 2WAAA 1JHJA 4GIQA 4BJ0A 4GB31 4NHYA 2P4EA 4NWVA 3VBOC 2FQPA 4UFJA 3CO2A 2W0XA 1W0PA 4MSVA 1R64A 1YJLA 2V09A 3CU7A 1JI6A 5JSRA 2DUQA 1G86A 1JUIA 1CZSA 1A78A 1MQTC 2PXJA 4RHV2 1UAIA 4GWIA 4IEUA 4LJHA 3SISA 3ZFFB 4QPYA 1OPMA 4IV1A 1UU6A 2B4KA 1LOFC 2Q5TA 3KCCA 4MX3A 3BOPA 3I3DA 3KF3A 1EAH3 1XBFA 2GALA 2R062 4XFIA 2HWE3 3WP5A 5GZCA 3BI3A 2P2KA 1C8NA 3UNPA 1W6PA 4DUVA 1NX9A 4Q8KA 4CDQC 5BNNC 1O3RA 2XJQA 4A3XA 2L9LA 3WUCA 3ZYHA 2HLEA 4NMIA 4FI9A 4UFKA 4BHPA 1QJY2 2VJXA 2J1SA 2E9QA 3OPTA 4IV3B 4YVSB 3RYRA 3NMBA 4B4QA 1AR82 2BBVA 3ACGA 3T1MA 2VCCA 1OOPA 1OF4A 4DPNA 1RVF2 5JMOA 1RITA 2RS52 4N7UA 2EXKA 1OA2A 2ZGUA 3K3OA 2EAKA 5K0UA 1BMV1 1B09A 4F83A 1TE1B 3K4AA 4XOGA 1UU4A 2VZOA 3LE0A 2A71A 3RG0A 3AJZA 5A1LA 3ZDSA 5JI9A 5FUIA 1VBA1 2YU1A 3C7FA 2JDNA 2R1BA 2VTXA 3IBMA 2R16A 1JUHA 3T2QA 2F17A 1W03A 3IDAA 1DGLA 1W3VA 2VNGA 3FE5A 2WBKA 4OUEA 3CIHA 1AL22 1OVPA 3VDDA 5C4WA 1WMFA 4XJWA 2ZGSA 4Q0UA 5CKQA 2BBAA 3S57A 2B45X 2WNUA 1W8FA 2PHWA 5G05L 1F2NA 3H50A 1WMEA 4J1XA 4NROA 4YARA 3I2OA 1JYCA 4BU2A 1VBD1 2XLFA 2WZR2 1QXRA 1YQ8A 2Y6FA 4IUGA 5DUUA 1MEC2 4DFSA 4F7ZA 3E6BA 4CEYC 1COV1 1RC6A 1X9TA 2E26A 2VH9A 1CAVA 2VAUA 3PUSA 4EV0A 1PM7A 3LFMA 4C1WA 3AC0A 1AYN2 3CNAA 3T08A 5IAVA 3WP3A 4AEDB 2I07B 5J1XA 4XBQA 3CDZB 5FYIA 2ARXA 1RINA 3F95A 4BIFA 4FTEA 2V72A 3ZKYA 1V6LA 2J1AA 1SBEA 1UF2C 1QXPA 2J1UA 3N35A 2CGPA 3LEKA 1N3PA 3CL1A 3VBFC 1VMHA 4XE9A 2ZHMA 3D6EA 1O6UA 3WHTA 3VBUC 1OH3A 5FZ4A 5FZIA 4O9EA 1VIWB 4LE4A 4WM7A 4RGAA 5FP8A 1G9FA 5FZ0A 1Q5OA 3E6CC 2OW4A 4QXCA 1VBE3 5CKMA 3OGRA 5A70A 2LW8A 1OVSA 3FX3A 4Q4Y1 5FKBA 1QQP3 4X6RB 5LY2A 4AL9A 3LWCA 4EN7B 1QJX2 1LEMA 1QKQA 3M3CA 3QCWA 3ZFGA 3ZXLA 2UURA 2WAOA 4QPGA 1B35B 4KL1A 5GLUA 1ZRFA 2A3YA 1ODMA 1FV3A 4EYUA 1ZZBA 4FBFA 2KXLA 2WDBA 2ZEZA 2YXSA 2WZ8A 4LKSA 4QB2A 3ZXEA 3MIEA 1CVNA 2FHRA 5FZ9A 5CA6A 5A33B 1YWKA 2O0OA 3ECQA 5A7WA 1AX0A 4GWMA 2ETEA 4WZFA 1LOBA 1K42A 2XG3A 3WF0A 2E53A 3FJSA 5JXJA 4JDMA 3EHKA 5AFBA 3B69A 5GJ6A 5C8CB 4YW2A 4QXBA 4P9LA 4RA0A 1SPPA 3RZMA 3FBMA 5CBLA 4ES9A 1PIV2 2WSVA 1XNDA 4IEPA 3WX5A 1UOBA 1PO23 3I2GA 5L7OC 1W6OA 4XZUG 1ZBA1 5JAXA 3ZXGA 1TMF3 1WCDJ 4J6GA 2IWGB 1CIWA 2BFUL 1T2XA 2BWCA 4M4RA 1HW5A 2QQKA 1ND2B 1VB4A 2YHJA 4LKEA 5JDBA 3RYPA 3ROUA 5L19A 3N7KA 4CE8A 1ZREA 4QQPA 3WG4A 3I3MA 2VMHA 3T3YA 4Q5OA 3NO8A 4LHNA 4JVAA 4Y5Z0 4CUBA 1CGPA 1EUTA 3RDIA 4WM8B 5FYVA 5HBAA 1UOFA 3VBOB 2DCTA 5I8YA 2GN3A 3AFKA 1DGRA 2V5YA 2VO5A 2DBIA 3MLLA 1JOBA 4GH4A 4I01A 5D2AA 5F3IA 1JZ7A 2HWC1 3N7JA 3H3LA 4FPHA 4QX3A 5CVRA 2HKXA 5CFDC 5IWFA 3PURA 3SCGA 4FPKA 3J7LA 4CDXB 3A23A 1UCXA 5F2WA 4C0HA 1O59A 3CZUA 2P5BA 4XUNA 4JAAA 1NCRB 4MVTA 5DXDA 4AVAA 5JXIA 2MEV2 4KI5M 4RQPB 4OI1A 1LGCA 3I49A 4J25A 1RUD1 1JYXA 2VTXJ 5BXXA 5J7MA 2WNEA 1QU0A 5FY7A 1WW7A 2K0GA 4NHLA 5GLTA 4PDWB 4KWJA 1N1VA 2CWMA 4Y1ZA 1D4M2 2RJKA 2CWSA 1TME3 3NJZA 4JGYB 5LK5A 3DYPA 2J1TA 1Y7BA 2YDEA 1H9WA 4UF0B 4UBGA 2RS11 3HBKA 3JXSA 2WT0A 4NAMA 4AI2A 5F1RA 3GBFA 1KS5A 5F6LB 3DEMA 3SKJE 4ZY9A 2EXHA 3GCWA 2CY6A 1ZYBA 3I2FA 5H9SA 4AQTA 2RMU1 1LHWA 1JYTA 3ON7A 2VQAA 1RUJ3 2ZEYA 3O5SA 4KWUA 5CIRA 5EHDA 4OQ9A 3RQ0A 5FY5A 2JX9A 4UW3A 5IVVA 3FL7A 4EN9B 1UN1A 5KHGA 4FPLA 4JGZA 1HB3A 1PZ7A 5HXMA 1MR5A 4YW5A 2QQVA 3POIA 3WINE 2JDPA 4EZHA 2RJ2A 3WNXA 2C1FA 4DXTA 3UJQA 2GZWA 1W9SA 3EXUA 2JEMA 2O1QA 4HBNA 3LEGA 1QY4A 2XUMA 4WVWA 4XABA 3UT0A 3KM5A 3L2HA 1ALYA 1O91A 1H2KA 2VOVA 4P9JA 2PHUA 4CEYB 2BQPA 1C57A 1GMMA 1ZA7A 2R0FA 1GV9A 3WHUA 1ASJ3 4Y4YA 4XAAA 5CB7A 5KR7A 1D0GA 1NCQB 3A7QA 1N3OA 1YFYA 3LSDA 1JN2P 1IS5A 4AXOA 4ARYA 1R1A3 3PLQA 1A8DA 2RR11 2RM23 4QX1A 1AYM2 2D6PA 2JB8A 3HQXA 4ZU5A 2WS91 1SG3A 5LA1A 4LPLA 3DKWA 2R041 4YM0A 1LNSA 3CJXA 5A7QA 1R081 2D7FA 1LOEA 1VB2A 5A3OA 2WNVB 5FDBA 1UYYA 3PNAA 4CZSA 5T3NA 1RUF1 1W9WA 5F39A 5JUVA 4KG0A 5FZ7A 1MVEA 1LULA 2JDHA 2UU8A 3KGZA 4ONUA 3O1SA 1WLTA 1FOD2 3USUB 2Y6LA 2YB7A 4EN6B 1Z7S3 1OLQA 4PCRA 1AR62 4MGSA 2VZPA 2FMDA 3TBDA 2A7AA 2AREA 1VJ2A 2I45A 3PU3A 4UYBA 2WUHA 3ZKUA 1X8MA 3V0AA 4I0WB 3VBRC 1ULCA 5DDJ1 1KITA 4YGEA 5FFOC 2AEZA 1F4HA 2P17A 2LM3A 2MNGA 4CCDA 5E1RA 1GP5A 3AKPA 3VD5A 2D43A 3H0OA 2KR2A 3JD71 3MV11 5IK5A 3JBG3 5HXVA 4XILA 4QD2A 1UOJA 5FMOS 4P08A 1R091 2ZZQA 2ZGOA 3I2KA 1T6GC 5FPUA 4GZ9A 3OSDA 4CVUA 3R0RA 2P3JA 2XQRA 1QWRA 5LRSA 1U5YA 4XEZA 2HWF3 5L7OB 3PUHA 3POGA 5DAVA 5GKAC 4CEWA 2VZSA 4A45A 3WW2A 3NNGA 2GSYA 1PNGA 4DOUA 4Q29A 4D8MA 1LEDA 4M3CB 3MF6A 4CXWA 2Z4FA 5E88A 3QH7A 2FCUA 5D8AA 4B29A 5FPBA 3WQBA 4S2GA 1G9DA 1I9RA 1KFUL 2BOJA 3VBHA 2IC1A 4X6QB 5FZKA 4FSJA 4ARXA 1ZA4A 4Y26A 5ACA3 3O1PA 3O1UA 1O8PA 2JJ6A 2A73B 3H1MA 3HN3A 1DGRN 2UWCA 2Y6GA 3AYDA 3J8F2 4GMP0 4QDQA 4M3CE 3ZFEC 5EYYA 2ZGPA 2F6BA 2ZGNA 1MS3A 5BY5A 2OX0A 5A6ZA 3GALA 4XC9A 4A2UA 4FPOB 2Q1MA 2WFF2 4Q4X3 5EJ1B 5FZEA 2HWD1 3MPPG 2ILMA 2D6MA 2QQJA 4PT6A 2PLV1 3ALQA 3UKNA 3PHMA 4AFCA 2JIGA 4UAPA 4XW3A 2DVFA 1AF9A 1E5HA 4XQDA 5I93A 1H4HA 2P6HA 2YV8A 4Q4W3 5LZ6A 4RR3B 1QNWA 4RGGA 3OOXA 4BK4A 2JICA 3N9QA 5KC5A 2QQIA 2KM2A 2W47A 1BK1A 5FLHA 3KS7A 5A32B 1LJ7A 1EV12 4KG8A 1QOTA 4LNVA 3HT1A 4JV4A 4QDRA 1VMFA 3H3ZA 3VKMA 1KS4A 3W5MA 2Y0OA 1UY4A 4GB32 3K2OA 2RS31 3VZKA 1I6XA 1XNBA 4LIVA 3TRSB 3U78A 2XBO3 4BE3A 3NJYA 1G7YA 4WVMA 5KXEA 1GZ9A 3MZHA 5B2GB 1EAH1 4KBBA 2VOTA 3H8XA 4YPJA 1IS6A 4PJYA 5C5UA 1NLRA 1DZRA 5JZGA 2ZXQA 3AZYA 2YPJA 4W8JA 2ZKLA 3ZN4A 5E16A 3VDCA 1PMHX 2FCTA 3QBQA 1H8VA 2YU2A 5BV6A 5CFCA 1J84A 3KSCA 5FYHA 4B8EA 2IXLA 2W9XA 1US3A 2BTVC 2HWB3 2WT1A 1AHSA 2DCZA 3AMMA 4XDOA 2GNDA 5FKCA 4L8QA 5FY0A 4N53B 3SCHA 1G8WA 1OBNA 3S5QA 4AZZA 3N9NA 4HK9A 2R073 2XKPA 1BKZA 3MUZ1 5FZCA 1UW8A 2JDZA 3UV9A 2YMZA 5LA2A 1LGNA 2SLIA 4FOYA 1O3TA 1XYPA 3TN91 1S2EA 1VBA2 1FT9A 5LY1A 1BJQA 2WSUA 5JVVA 5F3GA 1PO11 3SQOA 2JE9A 4TSVA 3SC7X 2ID4A 4E2QA 4GULA 4NHKA 3KCYA 3MIFA 4UT5A 3T09A 4BZ4A 3TAYA 2GH2A 4BQYA 4CDUA 4YZ5A 1NY71 4URTA 5DG2A 3ZXKA 1YEWA 4E8CA 4ZPIA 4AHYA 2FZ2A 5T5PA 1VBD2 3BU0A 2D3RA 2VC9A 4F8AA 1COV2 3TYJA 1PZ8A 2HH9A 3I2IA 2BWAA 2GC0A 3D3AA 2VY0A 2RJLA 5FPZA 4B7KA 4CCJA 3ELNA 3KHBA 1UIJA 4PLOA 4A4AA 2D3PA 1PX3A 3IB3A 4Y1YA 5K0UC 1SLBA 1CPMA 4HK8A 2QDRA 4UWDA 3AB0A 4W65A 4BXFA 4ZU7A 1N3QA 4Q4V3 2G9FA 3SH5A 3BPZA 4A3ZA 2BW8A 1RUH3 1ZZ6A 2OXBA 2ZMLA 1VE0A 2VBDA 2EA7A 4FPFA 3RI9A 4JX0A 4K1ZA 4YGBA 3E6DA 5H9RA 4LMFA 1RUNA 4GA9A 1PVC3 1XJAA 2VM9A 4Y22A 3KQRA 3Q8CA 1UPIA 2UY9A 1MZFA 4QHBA 2EXIA 2ZGMA 1QQP1 1RUC3 5J36A 1SLTA 1S0BA 1O4YA 3ZSLA 4P14A 1NG0A 1OI6A 3BTZA 1KJRA 1PK6A 1XPWA 3N3HA 2D6LX 4N43B 3HOBA 5B4XA 4QB6A 4AFMA 4K9SA 2YPDA 1KDMA 1W8HA 4Q4Y2 3POFA 3WDYA 1IQDC 3ZFFC 4COWA 4MGQA 1V6JA 4AEKA 1NXD1 2ZEXA 1LECA 1MVQA 1MS4A 3IPVA 2WN2A 4M0HA 2LALA 3OYWB 3WV6A 2IZWA 5ISLA 4JTNA 3RPQA 4BQ1A 1J59A 1AZDA 3AP6A 2BFUS 1JODA 4ASKA 5A80A 1ND3B 2JXAA 1YI9A 4XIKA 2VUAA 1S1AA 1C8M3 2E32A 2WFPA 4S2DA 4L9BA 1GP6A 2DU1A 3KF5A 1GWLA 4LO4B 5I0RA 4IV3C 3FZ3A 3C7HA 1DGWA 3DYOA 4YVSC 4L92A 4UFMA 1W8WA 2RV9A 3MIHA 3O14A 2EIDA 3RZLA 1BVVA 4WM7C 1JBCA 1YFWA 1NLSA 4E4ZA 1ZBA2 4NWWA 5B4NA 1UYZA 3DUIA 3WSOA 4CP0A 1S2BA 4NIGA 2X53S 1AR71 4B1LA 2XONA 1RMU3 3R4UA 5L73A 4OHYA 1LKNA 2GC3A 3ZFGC 4EROA 4QPGC 3I2DA 4YFWA 1E5SA 4IE7A 4KGGA 4YFZA 4M0NA 3UKVA 4AFDA 2FDGA 1NKGA 3OD0A 4CCCA 1VRH3 1F5FA 1WKYA 2VW0A 3VKNA 3VL9A 3SH4A 5EV7A 3WP4A 2D5FA 3NVCA 4A41A 3TEZA 4TXWA 5FYTA 2YY1A 1H0BA 1Y9GA 2A1XA 3FLPA 3B5LB 4OI0A 1ZBE2 4JRAA 1JXNA 2QFEA 3POBA 3NV2A 5CZKA 3K46A 4KU7A 4LBOA 4L99A 5G04L 2IUWA 3FBYA 4LLOA 4ES8A 2W91A 3H42B 4CDWB 3H8OA 4YG0A 3I59B 1PM4A 3RGBA 1WD4A 1YI7A 4QQLA 4CU8A 2XHNA 1MS1A 1RHI3 4FPYA 3A21A 1RUD2 2GP3A 2XKOA 2EF6A 1N1SA 1HN1A 4CRQA 4E4SA 3KQ4B 1W8OA 2FDHA 5FPVA 5FZOA 5T5JA 1K5MA 4HL0A 1UKGA 4TN7A 5DAXA 3J4UH 3NKTA 2HBTA 5A7NA 3ZMOA 3ZYGA 1C1FA 3RWKX 2GMMA 2RS12 1NA1A 4DIQA 1RUJ1 5A6YA 3TWIA 2AEYA 1NLQA 1W2AX 5FPXA 5K9YA 2ORZA 2FMYA 1N47A 1NUKA 4HN0A 4A44A 2VZRA 4RHV3 2RMU2 1UX7A 2X5IA 3RZKA 2R7EB 3MW3A 3IT8A 4AHWA 4PIYA 5FMOL 2VOWA 4V2VA 4AEJA 4XFCA 2H0VA 4AAPA 4IV1B 4MG2A 1OKOA 3N9MA 4NR1A 2VQTA 1B35C 2PFWA 4LK7A 3JCIA 3OEAA 4GMP3 1ONAA 1SEFA 3QLQA 2Y33A 3N7LA 2ARAA 2PHFA 4EN0A 5KHJA 1JYVA 3VBSA 1WMDA 4XF4A 2D6NA 3T0AA 1V9U1 1XSRA 4QQ2A 1W6PB 1QJY3 4YW6A 3IAQA 1V6OA 1AR83 3IDEA 4YYOA 3LDKA 4RGKA 2RM21 5KC6A 3AFGA 2XQXA 3ACLA 2DTWA 2JECA 2C5DA 4PF5A 2RS53 5FIXA 4YW4A 3ZOIA 1JZ6A 5C8CC 4IGPA 4OI2A 1OOPB 1FNZA 5A3TA 1ENSA 3BCWA 2JG9A 3BTAA 3POJA 3OBRA 5K0UB 1BK0A 3I3QA 2RR12 3JU9A 4O61A 5JWPA 4HVQA 3HMYA 4JDNA 4HVOA 2Z69A 4AVSA 3UETA 3KHCA 1LU2A 2R042 2VVEA 1GNZA 1UMIA 2OUHA 3AMPA 4LUKA 4E4DX 1R082 2VU9A 1AL23 1ND2C 1T6BX 5LBCA 2ZKNA 3LEIA 5IJRA 2VD7A 2VMFA 3DKQA 3WDUA 1V6NA 3AL5A 3UL2A 4BISA 2DURA 3AKSA 3VDDB 3VD3A 1RUF2 4JC1A 3RVHA 3KV6A 5C4WB 4YZ2A 1VALA 5FZBA 3WNPA 2WA4A 2DVGA 3O12A 2WNUB 1SFYA 1UY1A 3EB7A 4WM8C 5SV5A 2WZR3 3ZXJA 5LATA 3B02A 4E8DA 1MEC3 2OYZA 2YROA 4BQXA 4IEVA 3K75B 1HKDA 1LHOA 2YGLA 4D69A 2FDKA 1YUDA 5FZHA 3UK9A 2TUNA 2W1WA 4OMDA 4TYSA 4BA6A 1CAVB 2J1EA 4CDXC 4DEVA 1ENXA 4QXHA 1AJKA 4ZZ5A 5IK8A 3M3QA 2BVVA 1GKBA 2W87A 5FZ1A 2Q4SA 2ZX3A 3LCPA 1NCRC 2OQ7A 1U5XA 1HRV1 4R52A 4RQPC 1CAXA 3HNYM 4JRLA 4D7SA 1URXA 2E63A 1UL9A 3JD72 4IERA 4PDWC 4COVA 2HWF1 3WY6A 2VCAA 5KBFA 1CAUA 3WZ1A 1W6MA 3RZHA 4BLJA 2MHFA 4H2AA 4JGYC 1AXKA 3HPNA 4W6XA 1RUI1 3MYXA 3BUCA 5BNPA 3ZXDA 5JPMB 4HSJA 3N36A 3R4SA 2BGPA 1H8TA 4D6QA 1RUG1 2VNVA 2GC2A 5KHIA 2E7AA 3VDAA 2EAAA 2PAEA 4WM7B 5FRAA 3D0SA 4YGCA 5E8AA 1X36A 3NAPA 4GAZA 2CTVA 4MO3M 5LBFA 1O5LA 4LO5B 5IAXA 4ZS3A 5IATA 2JDUA 2VECA 3D8CA 2X8KA 1E5RA 3MPBA 4A7YA 3ZFGB 4COYA 1W9YA 4QPGB 4YVWA 3RS6A 1BYHA 4BPZA 1BBT1 3DPRA 4PQ9A 1RYYA 4URAA 1DQ6A 2DVDA 3LQCA 4AWDA 1XNKA 5KWRA 3VB9A 5JXHA 3PVOA 4IE0A 2R1DA 4Z1VA 3T2TA 1L7RA 3FHQA 5HCFA 4L2NA 4QXKA 3I8TA 4FVVA 1SQ4A 5A7WB 5A7PA 4FOWA 3CJIC 4BDVB 1SACA 4CCLA 4MHUA 4LLFA 2UWAA 4QHZA 5DUWA 5C3RA 1PIV3 1OFSA 4FOQA 5IK7A 3HBZA 4XETA 1SPPB 1WLCA 4HVRA 5AFEA 1NCQC 2VGDA 5L9RA 2HWD2 4OUMA 1J3PA 1W6OB 2JG8A 1W04A 3O1VA 2PLV2 2D98A 1PZ9A 4AR2A 1US2A 1CZVA 3AP9A 5LB6A 2ZEWA 1OSGA 3HAGA 2EXJA 3WCRA 1AJOA 2A75A 4O9GA 1LCLA 3T2OA 1K45A 5DPNA 3VDBA 1DG6A 2VULA 2WNVC 2I74A 5FTTC 2QCSB 4TTGA 4YWAA 2WO3A 2GU9A 2GDFA 2ZZJA 4CP1A 1UXZA 3DCQA 5FZGA 4HPKB 5C3QA 4QQOA 5FO7B 1WGPA 5LA0A 4UFHA 2B9VA 2OPKA 4BMEA 5AC92 1JYWA 2QQMA 4GH4B 4CSWA 5JPNB 3VLBB 2RS32 4AI8A 1UMHA 2YGMA 2ZTNA 3AP7A 3C7OA 5FREA 1LOAA 4FP2A 3ZMNA 1JU3A 2W94A 1GNHA 1ULFA 1YQ6A 3NV3A 3OF1A 1POV3 2MEV3 1POQA 2X10A 4FCAA 2WKKA 1UD1A 5EWSA 5HV4A 1DLCA 3NL1A 1ZM1A 3T1LA 5DQ0A 2O8QA 1D4M3 2Q1FA 3B93A 2A70A 2WA3A 3BIEA 2NMOA 5HCBA 3PIJA 4GQ7A 4QM8A 2QNKA 2VCMA 3V0BA 3MO4A 4LHSA 2W1SA 1CAWA 4JHTA 4ISRA 5FUPA 2OT7A 1W0OA 5FJKA 3BN6A 4DQAA 3OCPA 5T54A 2RG4A 1OUSA 4IEOA 5GLWA 1W3XA 1JHNA 2HEYF 3H8UA 3LA2A 3DGTA 3RZZA 3WG1A 4LBNA 1LHUA 3H3UA 3IIIA 2C4XA 3M4FA 4OHVA 4PLNA 4NHMA 1ZNPA 3RJ2X 3POYA 2Y26A 3VUOA 4COZA 3TN92 4AYUA 5KXBA 1V70A 1J58A 4N8MA 3V56A 4RFT0 4BXSV 1OKQA 3B3QE 4LBMA 4EJRA 2V73A 1PO12 3NRUA 2WYFA 4JGZB 1WD3A 2TEPA 2IVIB 5A6XA 3X29B 1GZWA 5FO8B 3IM0A 4MGIE 3LPGA 4QX2A 4QKFA 3FHAA 3WNNA 1U5IA 2JWPA 1O3SA 3NJVA 3WDXA 1D2QA 1NY72 4ITCA 4CA9A 4AEDA 1ST8A 2XLGA 2UY8A 2CNAA 4FP3A 5FZ8A 4LOTA 4RFRB 4W50A 1XE0A 3ZYJB 1D0HA 2VPVA 4NHXA 1SDDB 4Y20A 1KQRA 2JKBA 1VBC2 1AYM3 2A3WA 4WVZA 1DQ4A 1MZ6A 3TNQA 3MF9A 4LBLA 5FY1A 1W6NA 1QF3A 2FCVA 5F9TA 2ZAHA 3AKTA 5FJHA 1V6KA 1SCRA 1WW6A 1P8JA 1HXS1 1PVC1 2NM1A 5DAWA 2HBUA 1BZWA 2AC1A 3N7MA 3W20A 2ZABA 3ZIWA 5I0DA 4I3PA 4FOVA 4K40A 4AW7A 1C1LA 4RR3C 5C3OA 4NIDA 1FOD3 2C9AA 2PHTA 1QJU1 1TVGA 1W99A 3N9LA 4WVVA 4DO0A 1AR63 2DFBA 2Y6JA 5FO9B 2VUJA 2JDYA 4JCKA 4AE2A 1GOHA 4MOAA 4B4RA 1QQP2 3O0VA 2VQ0A 4Y1VA 3JB8A 3KLSA 4XJ8A 2DTYA 3LDRA 1LHVA 1OHFA 2PAKA 3LOIA 2AYHA 4UXAA 4XTMA 1FXZA 2QQOA 2B7YA 3LPFA 3V0AB 1C28A 1V6IA 4UW4A 1YNAA 4E27A 5IVJA 2VG9A 1XNCA 3CKHA 3ATGA 3OG2A 1Y9MA 2V4AA 2OS2A 3SNMA 5I0TA 3K51A 3FFQA 1AR91 5FYCA 1WBFA 1JOJA 1MACA 3Q9OA 4W4ZA 3LIGA 3N9OA 1Q56A 3CJIB 1U0AA 1QMJA 1EUUA 1PGW2 1SLLA 5E89A 1DQ1A 1VLNA 3KCXA 1K3IA 2RE9A 5FYUA 3MIDA 3THCA 3WQ0A 2RDQA 4IDZA 2WZEA 4CEWB 5GZEA 4QWNA 4FFFA 1S0JA 2QQNA 1RTVA 3LKJA 3T2PA 4M00A 1M06G 3NV4A 2QUOA 4N53C 4ZXKA 3W59A 3O1OA 1KJLA 2AENA 3M7AA 1QHDA 1ZRDA 4HONA 3VKFC 5BNOA 5EJZB 3CLPA 4Y1UA 1AR72 4MGYE 3KT1A 3JZVA 5C3SA 2R0HA 5JSPA 1M4WA 5FY9A 1BCXA 1MQTA 3VBHB 3J8F3 1AUYA 4RS5C 5JMCA 1L7LA 2CAVA 3VZNA 4CP9A 5CKNA 3ZVXA 4MXWA 1A8MA 2C6SA 1RUE1 2P6CA 3CHXA 4FPEA 4FXGB 1LOFA 5CADA 5JR2A 5ABJC 4Q0QA 2X29A 2CU5A 1JTZX 4P00B 3OGJA 5F5IA 4BQ2A 1Q8QA 2VZTA 1FMD3 1OA4A 2WFF3 1A3KA 3ILRA 3NW4A 5BPXA 1HQNA 3C7GA 3AJYA 5CEHA 4JTOA 5BNNA 4CDQA 3P6BA 1ODNA 1GWMA 1QNYA 2ZHKA 4XCAA 3ZYRA 4E4HA 2C0ZA 3Q8BA 4MUVA 1BHGA 4GKYA 2B39A 4OQ8A 1AXYA 4WV8A 2CHHA 3FN9A 2BPA2 1CZTA 4FT8A 4CCKA 1WLWA 5T52A 5A3WA 5FZDA 3DN7A 3I3EA 3ZR5A 4PBOA 3UGGA 4AF9A 1WBLA 1SLAA 3OY8A 1QDCA 4P9GA 3KB5A 1EV13 2BOIA 3K77A 3QACA 1JU4A 3OTFA 2QDNA 4GB33 1HRI3 1I1EA 5C3PA 3LOBA 2BDRA 3APBA 1RUJ2 2VBPA 3PUQA 2W1QA 3S5AA 2X09A 4P5HA 1Y4WA 2WQZC 1IG0A 4Q1RA 5FYYA 5C70A 3ACIA 1H9PA 1SMVA 4N43C 3URFA 2K2SA 4GMP1 1SLCA 3LF7A 4CUAA 1ULGA 3AKQA 4RN5A 4NOTA 5HV0A 3CZJA 1LENA 3WG3A 2IVJA 1GICA 3ZLIA 3EMRA 5FXVA 3K48A 1O4TA 3LFIA 4NPMA 1LOGA 2VBBA 1AR81 1UY3A 2GN7A 4EQVA 1OLMA 3WCSA 3SEEA 4QX0A 2RS51 3U14A 2Y6HA 1WCQA 3BGAA 1XQNA 1F8VA 3GZTB 3I3BA 4G4FA 1V9U2 3IDBB 3KZ4C 3ZSEA 4CCNA 4IL7A 1Q8PA 4K6BA 1ND3C 4GXLA 3U37A 5JSOA 1LRHA 4QQHA 4OI4A 1WCKA 2Q1ZB 2RM22 4XTPA 1VBB1 5CFCB 1GZCA 2GH8A 4IW3A 2W2IA 2Q8DA 1OFNA 5I0SA 3VBFA 5A1AA 5A7OA 2W08A 4DXSA 1CWPA 2BUKA 3GGLA 1REEA 4MYEA 3PMEA 1AL21 3VBUA 2E7TA 3GZEA 1F31A 1VBA3 4YNIA 1JZ2A 4R9DA 4B3NA 4GJZA 4XXPA 3J7HA 5EP9A 4C8DA 3H7YA 4C91A 5BYNA 1R1ZA 5FMCA 2P1BA 1FPN2 2PN5A 1H2LA 4I09A 4CPBA 1SFPA 2YBPA 4OULA 2W39A 4KWLA 1QH7A 4YRDA 5CYYA 5FY4A 1V0AA 4KNCA 2EICA 1FV2A 3S0MA 1Y43B 3B94A 2P3KA 2XOMA 5FZAA 1S2KA 2PQQA 2RDNA 3IAPA 4CDUB 2EIBA 2FZ1A 2K9ZA 1V6MA 1VRBA 3WNMA 5F32A 3PUAA 4BH9A 2R30A 4P9WA 1COV3 1K12A 1GP4A 1REFA 3L9JT 4XXAA 4XFFA 2HWE1 3THTA 2WQ4A 3ZN5A 4META 1TEIA 2HEVF 4Y33A 5FZ3A 5EJ3A 2BU9A 4UW5A 2QJVA 4CDWC 1VP6A 4FTBA 4K8RB 1FI2A 3HT2A 1DDLA 2CGNA 1HRV2 3ZYBA 2DCKA 4CYDA 3MFCA 1BQPA 4QPIC 1JZ8A 4TLFA 2XUEA 5EQUA 4EWDA 1ULEA 2VTFA 4FFHA 4BWOA 5F7UA 2VMCA 4ZU4A 4X8PA 4JKLA 4D94A 4I02A 3KVBA 2NMNA 3LA3A 3WQ7A 1JOPA 2I2SA 3C7EA 2VZQA 4Y22B 1RUI2 3GHNA 3ZSKA 1RUG2 2XJUA 3TNPB 1DYPA 1KFXL 2ZGTA 4LBQA 1DQ5A 4M4PA 5FZ6A 5K4LA 4PI2A 2Q8CA 1BXHA 3RSJA 1IS3A 4R9CA 4Q4Y3 1RB8G 4DZGA 2Q8EA 1PK6B 4IEZA 4YW7A 5JOXA 4ZS2A 4XJZA 2DVBA 1N1TA 2R49A 4I3GA 1C5HA 1GSLA 1RJ7A 2ZX4A 4XZPA 5DAPA 2DUPA 2YFUA 3I2HA 3PMSA 4XCBA 5CFDA 2XR4A 3TEWA 3G7DA 3IPVB 4RS5B 1JZ4A 1BBT2 1WZXA 4IV1C 4JDOA 4LTAA 4BMBA 1REDA 1UZ0A 3GXUA 4FPGA 1GOFA 1TNFA 5FYBA 4BIOA 3OBTA 4HKOA 5ABJB 1DP0A 2B5HA 1OC1A 2VMIA 4XVHA 1TNRA 4CXYA 1OA3A 1XRUA 2VE1A 4AI0A 4Q8LA 4XDQA 5CAZA 1MS9A 3LA7A 4QPWA 3EYPA 5FMDA 5LBEA 1O7FA 1ZX5A 4Q2FA 4MH0E 1OOPC 3DF0A 1ZBA3 4YW3A 1BEV3 3R4DB 3S30A 3ZN6A 1PX4A 1UYXA 2VR4A 5T55A 2J1VA 2XDVA 4MGTA 5A32A 4Y4RA 5J48A 3AL6A 2EALA 2J7MA 5FQ0B 2Z2SB 2D6OX 4QU2A 1YJKA 4N9HA 3S7IA 3ILFA 2W92A 1IPSA 1X33A 3ILNA 3V65A 4D0QA 1DQ2A 1TQ5A 3T4HB 1VBE1 2XJPA 5L9BA 2Q0AA 3VDDC 1O4ZA 5C4WC 4YZ1A 2W52A 1ZBE3 3BVCA 2YC0A 2Y8KA 4CU7A 2MEV1 3MEPA 3AMNA 3AYCA 2WNUC 5FOJB 4WBBA 1HJFA 4GD4A 3HVDA 4LO8A 4DY3A 2PQSA 5LBBA 4LT5A 1C5IA 2WYSA 5JXGA 2JKXA 1MS5A 1YIFA 5FWEA 4CU9A 1JYIA 4IESA 4D3WA 3D82A 1POV0 3HNBM 1RUD3 1BLZA 3O1RA 4NE9A 3B01A 2H6CA 3VZJA 1UPSA 2JG8C 2VZ1A 4J1WA 1W6QA 1YFUA 1SBDA 3MV01 3WDWA 1GQHA 1WCSA 1YIPA 4QX7A 4Z92B 1UIKA 1CX1A 5GLZA 3RZGA 1H4GA 5I0UA 5IT6A 5DUVA 5FZOB 1K5MB 2RS13 1PO21 3M8LA 4XF1A 1JYNA 3OEBA 1YYNA 4CCMA 1VR3A 2BNOA 3VHNA 2CL2A 5C9AA 3FWEA 3E5UA 1NA1B 1TMF1 5T5LA 3RNSA 3ES1A 3UGHA 4IEXA 4XFBA 1E5IA 2RMU3 4QX8A 3M3IA 2ERFA 1W90A 2Z79A 4R9AA 4P02B 1IS4A 3ACHA 3MHZA 5KHHA 2X5IB 4UOJA 4L97A 3SH3A 2H0BA 4LXLA 4WZCA 2O8OA 1S0GA 2XJVA 2WO1A 4CU6A 1GWKA 4XFHA 2DBNA 1GU3A 4LUMA 1MZEA 1FYUA 2QZ3A 4PHZA 2AGSA 1QH6A 2C9KA 2ZX0A 2VVFA 5JOYA 3VBRA 1MS0A 2PELA 5JCTA 3K3NA 1LGBA 4FXKB 3VBSB 4CCEA 2IXKA 3E5XA 3WP6A 1OF3A 2DCJA 2NZ9A 4YLZA 1I3HA 4TWTA 4LA2A 1NE6A 2HWC2 2JENA 2ZMNA 2RHPA 3PU8A 1OH4A 4G3YC 4BQWA 3JQWA 4CTEA 3ZXFA 1WUVA 4AI1A 5IHRA 4IETA 2MPFA 3E5QA 5GM0A 5K7PA 2JG9B 4JQRA 4LHKA 2ES3A 1TME1 4UFIA 4W6WA 1RXGA 2R043 1GR3A 4XBLA 5LRRA 3ZO0B 4AFBA 1PGL1 1W9FA 2HJIA 2GP5A 1R083 4QPIB 5C71A 3PDQA 3RYKA 5HI0A 4KBZA 3T4VA 1HXS2 3GHMA 3VD7A 1W9TA 4AI9A 3PVEA 2ZA9A 3WNLA 4BM8A 3UJOA 3H7JA 4XIOA 4XAEA 4HKLA 2UWBA 4D6RA 1QJU2 1G6NA 2A6YA 2QQPA 3F2ZA 2K46A 2WINB 4NRQA 3SMHA 5FXZA 3BOWA 3ETPA 4NO4A 1DZTA 2B8MA 3A0KA 5DUXA 3B9CA 1W0NA 4FAGA 4GH4C 2QE3A 2QQLA 4AOCA 2ZAAA 1ZZ9A 1WCUA 1VAMA 3IDCB 3C8XA 1HDKA 2DUOA 4YW1A 1X50A 3ZFEA 4Y3OA 3M3EA 4HKWA 3S7EA 5LCWL 3P3PA 2YBKA 4AAXA 3EO6A 5TSWA 1GOGA 2R063 3OB8A 5DZGA 4XUQA 3JD73 1AR92 2BVBA 1CAXB 1HQLA 1DGWX 5DABA 5FV3A 1ASJ1 1H2NA 4O65A 3HNMA 4QKBA 3CMGA 3GZAA 3BU7A 3VHRA 3RZJA 4JKKA 4AHXA 1CAUB 1R1A1 1W6MB 3GCXA 3UESA 3I4IA 3KT7A 4EZ4A 1XYOA 1OD3A 1X9PA 2VMDA 2GMPA 3M2MA 1RVF3 4JKMA 4AVCA 5BNPB 1H8TB 2OVUA 3G6JB 4GALA 3UGFA 3LEMA 5LEKA 2IXHA 2O14A 2YC2A 3GNEA 4LBQD 4Q1PA 1APNA 1QOSA 1IHMA 2QVSB 2DVAA 2WS92 2A6WA 2PAMA 3PIGA 1FX5A 1LR5A 3KV9A 4ZZ8A 1VAVA 4XYXA 1ULDA 3LAGA 5F3CA 4ZONA 1OT5A 1XB9A 1HB2A 4YVWB 2FD8A 1Z7S1 1UQXA 1JS9A 3DPRB 4IEWA 4YM3A 4Y5TA 5FXWA 3MIBA 4ZKTB 4JGZC 2AACA 4AG4A 1FMD1 3H8RA 4XMAA 1ACCA 1LU1A 5F8PA 3LSEA 3AZWA 5JI7A 1IZ3A 3B00A 1YQ2A 2EIEA 1RUE2 2ZACA 3I59A 4XF9A 1H6YA 4OYUA 2BERA 5I91A 2FDFA 4XHBA 1JH5A 1ENQA 3O7OA 4LORA 1GNYA 2ZPXA 4QU1A 5FLIA 4IEQA 4OFGA 3ZYFA 4BQ4A 3H1YA 1AYN3 5FBZA 4Z2WA 2D5HA 2PLV3 2NN8A 3JBG1 5JIUA 2NQYA 5EZWA 2LROA 5DDJ2 4SBVA 2WO7A 2JG8B 3ETQA 1DZQA 4H7LA 4LITA 4D7YA 4MGZE 2IXIA 2UYBA 4QT6A 2J22A 1NE4A 3WUDA 3BKZA 4OHWA 4XQWA 2ARCA 4CUCA 5GZFA 4EE2A 1HRI1 2QTWB 4ATEA 1W05A 3J26N 1R092 2JD4A 5BNOC 4M01A 3WNOA 4W6YA 5GALA 3O1TA 2WL1A 1IKPA 2BP6A 2G9GA 2IXCA 3H1WA 4XFAA 5FK8A 4XQ4A 5AC93 2A6ZA 2YUEA 2P34A 2RS33 1UYPA 1Q8OA 3KV5A 1LB2A 3VHOA 4ET7A 2V5DA 3FC0A 2CYFA 2LS6A 2ET1A 2ORXA 1QJX3 2AZ5A 1NAEA 5F6KA 3GJBA 2PA7A 3B9IA 2P3IA 5CISA 2OZ6A 3HIFA 3OUJA 4COUA 5ACA1 4XUTA 3CF6E 1EPWA 1OQ1A 3WF1A 1JMUB 3N9PA 3U75A 1I5ZA 4GWJA 4XURA 5CU1A 1CIYA 4HFSA 5C33A 1CJPA 5A7SA 1UZZA 3A22A 3HN1A 4MGKE 3V0BB 2VOKA 3OGVA 2B42B 3AYAA 2LUWA 3FHIB 4NRMA 1CAWB 4Q4X1 3S6PA 4AVVA 3AYEA 4C0BA 1WWYA 4IE5A 1F15A 1CX4A 2Z5WA 1RL3A 3POWA 4V1PA 5D21A 5IYYA 2G19A 3WNKA 2W1UA 1VBB2 3AP5A 2Y0IA 4GJYA 5SV8A 3WXPA 2EIGA 3MW4A 1Q43A 4Q4W1 5JR7B 2CSGA 3WR0A 4DRRA 4CEWC 2CGOA 4LA3A 1GUIA 3W21A 3TN93 5BUVA 3KMHA 4DUXA 4HG6B 1E57A 4PBPA 3SHRA 3WG2A 1PO13 2N7GA 1G9BA 1PGSA 1PVXA 4R9BA 1UO9A 5D8AC 5A6QA 1NZIA 1WLDA 4YZ3A 1YLLA 3SXWA 3WW4A 4ZXEA 3VN4A 1DYOA 1GZWB 2XBO1 3TEYA 4JHZA 3VBHC 3ZFFA 4NPRA 2ZGLA 2Y38A 2ZBJA 3PUIA 2XWJB 4OCTA 4IE6A 1C4RA 4DNYA 2DCYA 1UMZA 2XVLA 1VBC3 3R6SA 1QJFA 2AR6A 3RRDA 2ZGQA 2GNTA 4Y20B 1XU1A 2VMEA 1W2UA 5DN2A 1EAH2 4HXCA 3K4DA 4TZDA 1RUOA 2HWE2 2ATFA 4OVEA 4A6OA 2ZCWA 1QJZA 3BB6A 4Q0PA 1W6NB 1HN0A 4QM9A 1UZVA 4IV3A 3WLUA 5IFPA 2LTNA 4YVSA 5J37A 1GBGA 1CONA 2NP0A 3NQHA 3ZX7A 2AUYA 2DDUA 3PVBB 5ERLA 2D3SA 4OLLA 2NLRA 2HWB1 3GBWA 1LAJA 2BEOA 1NYWA 2JE8A 4QKDA
chains in the Genus database with same CATH topology
4HETA 4Z8BA 3D4KA 5J09A 2R071 4OZXA 1DHKB 1G9CA 4LO6B 4HSLA 1Z0HA 3V64A 2XL7A 3IWZA 2XJTA 1CR7A 4LR4A 3TOJA 4YSFA 2PHDA 3L2YA 5FAXA 3PVNA 2Z42A 3OJBA 3U07A 4K21A 2D6KA 1W39A 2XJSA 1NOVA 1WW4A 2A3XA 2YZ4A 4INDA 2DYCA 1HQWA 3M70A 5JZGC 5EXOA 4H3WA 4BLIA 2BNNA 1BEV1 1XYNA 3O0XA 1U12A 1S55A 2VVDA 4R4ZA 1SBFA 1ZVFA 2WT2A 1SLIA 4FPCA 5CFCC 2WZPP 4Q4V1 4DRVA 3AX4A 1RUH1 4LEJA 4HLTA 2ENRA 1ENRA 1H1MA 5HCAA 3MDPA 3ZYIB 3H9AA 1V00A 1HIXA 1AR73 4XF0A 3VKFC 1EP0A 1S0DA 4HPKA 2D40A 4KWKA 5BNOB 3JUUA 3VKLA 1RUC1 1ZBE1 1IPKA 4YGDA 3VL8A 1UKRA 2QKDA 1DQ0A 1MQTB 2BGCA 3U11A 3WVJA 5DZEA 1VBE2 3KT4A 4MXWB 2A6XA 2VNRA 1B35A 4U2AA 4CDUC 3WW3A 3M3OA 1YFXA 4XPVA 5H9PA 3GF6A 3NV1A 3E97A 4LBJA 5A33A 2EVXA 4R8HA 1XE8A 4LULA 2E6VA 4CDQB 5BNNB 5EYXA 3A4UA 1NQDA 5C8CA 1C8M1 4AVTA 1H1AA 3LZZA 3SITA 3HR9A 4B7EA 4PIZA 3SLIA 2D97A 3ZSEA 3WDTA 3IN9A 2OA2A 4P9IA 2H6BA 1YRZA 2AH2A 3OY8B 4C1XA 3FLTA 2XB6C 3B7MA 1PO22 1U5ZA 3NWKA 1ND2A 5EFUA 4LE3A 1TMF2 4KQ7A 1X7NA 1GQGA 1IGOA 4EWAA 2W68A 1LHNA 4YZ4A 1RMU1 3WOGA 3VZLA 2R6QA 4IQPA 4XJUA 2XVKA 1NQJA 1S0FA 4U36A 1PK6C 4WM8A 3C2UA 4AI3A 3VBOA 1VRH1 1EPZA 4N7IA 4A7KA 3AZVA 5A3LA 5D8AB 5C6CA 2IXJA 4LHLA 4AQ6A 3WQ1A 3ZSJA 3DV8A 4FPJA 4CDXA 2CAUA 4FQ4A 1V9U3 1OQDA 4P9YA 4HZFA 1C3HA 1NCRA 4NN0A 1NZCA 3A0NA 3FMGA 4DINB 1ZZ7A 4RQPA 1J3RA 1H30A 3U0ZA 3KD4A 1AXZA 1Q8SA 4Q0VA 3WW1A 4PDWA 2GNMA 1RHI1 3ZPYA 5FLJA 4D7TA 4AQ2A 5C9AC 3VBFB 4JGYA 2XL9A 4S2FA 1TME2 1QOOA 2WC2A 5JIAA 3VBUB 5JOWA 1HV0A 4K3UA 1PGL2 3JB4C 1OMIA 2VMGA 1FPN3 2PHLA 2XLAA 3ZYPA 2E7QA 3ES4A 1X8EA 1L3JA 1QXJA 2OZJA 1SCSA 3BIWE 4IEYA 4MV2A 1HV1A 4AHZA 4I0AA 2TBVA 4RHV1 2D44A 4H55A 1FNYA 3N4MA 3PJYA 1CD3G 3AMHA 5CG8A 4ORFA 1PMIA 2R061 5AVPA 5GZDA 2ZGRA 4WVMB 3D0JA 4AVBA 1UZYA 3CJIA 3EQEA 1ZZCA 4NVPA 5FCCA 1J1TA 1CN1A 4PLMA 1HRV3 3GZUC 3SCFA 1QJY1 3PJQA 4CEYA 2HEWF 4HANA 4DMIA 1AX2A 3O0WA 1NCQA 5D1IA 1RVF1 2ZOEB 5JZGB 4I30A 1A6CA 1ASJ2 4DY5A 4YG6A 1D2SA 4OHZA 1RUI3 2XJRA 1OD5A 4XJ9A 1R1A2 1RUG3 5J96B 2PYTA 1K5MC 2CV6A 3AP4A 3BODA 3GYDA 3IIAA 3OPZA 3R05A 2YYOA 1HLCA 1NA1C 1RIRA 2SBAA 3FFZA 4LBQB 2WNVA 4E2GA 5KXCA 3LGRA 3MGUA 5F5QA 2ZGKA 4LO7A 1DYKA 1OPOA 2G4IA 3QD6A 4UBHA 1KXGA 4AGRA 1SFNA 1F5JA 3ZIXA 2X5IC 3USUA 1GFF2 4AK3A 2D93A 1BBT3 1UX6A 1ZZ8A 4P9XA 5CFDB 3VHPA 1Z7S2 4RSUA 4YG3A 2WZR1 2XGXA 1GANA 1YCIA 1MEC1 1S0IA 4PIXA 2NPIA 1HX6A 2WIIB 4ASLA 4DS0A 1FMD2 1Q8VA 3MLKA 3U4XA 3VZOA 2HYKA 3VBSC 3JQXA 4M3CF 1AYN1 4ASMB 1VBD3 1FATA 5BNQA 2Q30A 3AK0A 1JW6A 2ZJCA 4OUSA 4GWNA 5T5OA 3HD8B 4K7JA 3EBRA 2IFWA 2PHXA 3FUQA 2PTMA 2NYYA 4MLOA 4YM1A 5DZFA 1KDKA 4DB5A 3JBG2 1QDOA 4S2HA 1NXMA 3ZN6B 2JG9C 4ATFA 5JOZA 4MZUA 1CQ9A 3PTYA 4SLIA 3MIGA 3AMQA 5L7OA 5AC91 4HN1A 1GYKA 1HRI2 2IFRA 3THPA 1S0CA 2B46X 5A3MA 2HWF2 2ET7A 4KH9A 4N90A 4XF3A 2P37A 4M3CA 1Y9QA 1QJX1 4Y24A 1DF0A 2GNBA 3U10A 4Q26A 4Q0SA 2ZHLA 4I0BA 1O5UA 1GLHA 4L11A 5J98B 1PNFA 2OIIA 2F4PA 5ACA2 2XPJA 1CJDA 3AXEA 1KRIA 3OD4A 2ZHNA 4XHXA 1W6QB 2BYVE 1J1LA 1PIV1 1YHFA 3WT3A 2A6VA 4G9SB 4Q4X2 1AX1A 4EN8B 2VNOA 5C9AB 3M1HA 5CG9A 5BNPC 4YM2A 1H1IA 1SDWA 4RR3A 1H8TC 4DXZA 2ZS6B 3ENRA 5C8WA 1KD7A 4Q4W2 1DBNA 3RMXA 4AGGA 3NAPC 1OLRA 5I8TA 1IPJA 5JLVA 1Z78A 2DWRA 3DL3A 3MFAA 1F9KA 5KXDA 2WLQA 1G9AA 4YVWC 1S0EA 1OQEA 3DPRC 4FO9A 3VBRB 3AXDA 3NSTA 2XVGA 1RJ8A 1VBC1 2XBO2 2ARBA 4Z07A 1POV1 2HWC3 1XXNA 3IMNA 2PHRA 4HMZA 4RD7A 4MXVA 3W9AA 1RGSA 1LESA 4AEMA 3INAA 1D4M1 1XU2A 1DFQA 3W58A 2DV9A 2GMEA 1QGLA 1HXS3 4XMIA 2DF7A 2WWSA 1DIWA 4N9IA 3ASIA 2VXRA 2XHKA 4N53A 4Z82A 5AVAA 2HWB2 1QJU3 4HT1T 3NKGA 3RMYA 3MLJA 4R4XA 2R072 5GLVA 3J9SA 4B4PA 1ZRCA 5I8SA 4AQSA 3EJKA 3VV1A 2WLPA 1IKQA 5ABJA 1N1YA 4UW6A 3ZFEB 1PGW1 2FBEA 3VGIA 1DU3D 1AR93 2B9UA 2VW2A 1BVP1 2KA3A 4QX5A 4XBNA 2TNFA 3ZSMA 5LK7B 5T50A 1LTEA 1MZ5A 4BCUA 2VOXA 2A5ZA 2E51A 3POSA 2ZX2A 4K1YA 1AYM1 1EY2A 4OHXA 1IOAA 1EYBA 4GKXA 4KU8A 3BALA 5L36A 1BEV2 1FAYA 5FQ0A 1MS8A 4FTSA 1O3QA 4FAHA 3VZMA 2RR13 2ZMKA 2WS93 2WJSA 2XH6A 4Q4V2 1J3QA 1RUH2 4C90A 3ME2A 1CPNA 4E2SA 1FOD1 1AR61 4QGMA 1PVC2 4K20A 3AZZA 3OGGA 4ISQA 1RUF3 3HWJA 1RUC2 3ZXAC 4H14A 4N43A 3WDVA 4BOWA 5LEJA 3AM2A 2GC1A 1RUE3 3D5OA 3MI8A 3AZXA 3RWNA 4XJAA 2ZX1A 1WW5A 5KHKA 3KGLA 3TB0A 1H2MA 4RL7A 5GZGA 1YXWA 5IK4A 2DFCA 3OYWA 4A7ZA 4K8FA 4AEDC 1LOCA 2R32A 1AVBA 5DG1A 5DDJ3 5J3UA 2UYAA 4AGVA 5K8SA 1ND3A 3CEWA 1VAKA 1LODA 4H7MA 4QGLA 1IQAA 5CNAA 2VW1A 1C8M2 3WD5A 1R093 1YO8A 2QZ2A 5H9QA 3I54A 1UU5A 3LB9A 5FOBB 1ZRRA 3AKRA 3USSA 3MW2A 3VKOA 2OUJA 4KGQA 3IKWA 1PHMA 3QOPA 3NAPB 4FQZA 1Y3TA 3RJRA 1RMU2 3C3VA 5IUQA 3UKTA 2DU0A 4I2OA 4LBKA 3J8F1 2Q8OA 1XE7A 4IXLA 2XWBB 1VRH2 4Q27A 3MICA 3FUOA 2WFF1 4F3JA 2GAUA 4QMAA 3GBGA 3I7DA 3FLRA 4X8NA 4CDWA 4BYYA 4EWEA 1AL0G 2BNMA 1VBB3 2JE7A 4QPIA 1Q3EA 1X82A 4Y1XA 2HWD3 4CP2A 1RHI2 3RI8A 1FPN1 1WA4A 3QH6A 1CESA 3P3NA 4E9KA 4AFAA 3ST7A 1DLLA 1EV11 4QGNA 4XFGA 1D4VB 4GIQA 4GB31 4NWVA 3VBOC 2FQPA 3CO2A 2W0XA 1W0PA 4MSVA 1YJLA 2V09A 3CU7A 5JSRA 2DUQA 1G86A 1JUIA 1MQTC 1A78A 4RHV2 5KC5A 1UAIA 4IEUA 3SISA 3ZFFB 4QPYA 1OPMA 4IV1A 1UU6A 1LOFC 2Q5TA 3KCCA 4MX3A 3BOPA 1EAH3 2GALA 4XFIA 2R062 3WP5A 2HWE3 5GZCA 2P2KA 1C8NA 1W6PA 5BNNC 4Q8KA 1O3RA 4CDQC 2XJQA 4A3XA 3WUCA 4BHPA 1QJY2 4IV3B 2E9QA 3RYRA 4YVSB 4B4QA 1AR82 2BBVA 3T1MA 1OOPA 4DPNA 1RVF2 1RITA 2RS52 4N7UA 2EXKA 1OA2A 2ZGUA 2EAKA 5K0UA 1BMV1 1B09A 4F83A 1TE1B 4XOGA 1UU4A 2A71A 3RG0A 3AJZA 3ZDSA 5JI9A 1VBA1 2R1BA 3IBMA 2R16A 1JUHA 1DGLA 2VNGA 3FE5A 1AL22 3VDDA 5C4WA 1WMFA 4XJWA 2ZGSA 4Q0UA 2B45X 2WNUA 2PHWA 1F2NA 3H50A 1WMEA 4J1XA 4YARA 1JYCA 1VBD1 2XLFA 2WZR2 1QXRA 5DUUA 1MEC2 4DFSA 4F7ZA 3E6BA 4CEYC 1COV1 1RC6A 2VH9A 1CAVA 4EV0A 1PM7A 4C1WA 3CNAA 1AYN2 3WP3A 4AEDB 2I07B 4XBQA 2ARXA 1RINA 4BIFA 4FTEA 1V6LA 1SBEA 1UF2C 1QXPA 3N35A 2CGPA 1N3PA 3CL1A 3VBFC 4XE9A 2ZHMA 3D6EA 3WHTA 3VBUC 4O9EA 1VIWB 4LE4A 4WM7A 4RGAA 1G9FA 1Q5OA 3E6CC 2OW4A 1VBE3 3FX3A 4Q4Y1 1QQP3 4X6RB 3LWCA 4EN7B 1QJX2 1LEMA 1QKQA 3M3CA 3QCWA 3ZFGA 3ZXLA 2UURA 4QPGA 1B35B 4KL1A 5GLUA 1ZRFA 2A3YA 1FV3A 4FBFA 1ZZBA 2KXLA 2YXSA 3ZXEA 3MIEA 1CVNA 2FHRA 5CA6A 5A33B 1YWKA 2O0OA 3ECQA 1AX0A 4GWMA 2ETEA 4WZFA 1LOBA 2XG3A 2E53A 3FJSA 4JDMA 3EHKA 5AFBA 3B69A 5GJ6A 5C8CB 4YW2A 4RA0A 4P9LA 3FBMA 5CBLA 4ES9A 1PIV2 2WSVA 1XNDA 4IEPA 3WX5A 1PO23 5L7OC 1W6OA 1ZBA1 5JAXA 3ZXGA 1TMF3 1WCDJ 4J6GA 2IWGB 1CIWA 2BFUL 2BWCA 1HW5A 2YHJA 1ND2B 1VB4A 5JDBA 3RYPA 3ROUA 5L19A 3N7KA 1ZREA 4QQPA 3WG4A 2VMHA 3NO8A 4LHNA 4JVAA 4Y5Z0 1CGPA 3RDIA 4WM8B 5HBAA 3VBOB 2DCTA 5I8YA 2GN3A 3AFKA 1DGRA 2V5YA 3MLLA 4GH4A 4I01A 2HWC1 3N7JA 5CVRA 4FPHA 5CFDC 2HKXA 3SCGA 4FPKA 4CDXB 1UCXA 4C0HA 4JAAA 1NCRB 4MVTA 5DXDA 4AVAA 2MEV2 4OI1A 4RQPB 1LGCA 1RUD1 5BXXA 5J7MA 2WNEA 1QU0A 5GLTA 1WW7A 2K0GA 4NHLA 4PDWB 4KWJA 1N1VA 2CWMA 4Y1ZA 1D4M2 2RJKA 2CWSA 1TME3 3NJZA 4JGYB 5LK5A 2YDEA 1Y7BA 1H9WA 4UBGA 2RS11 4AI2A 2WT0A 5F1RA 3GBFA 1KS5A 5F6LB 2EXHA 2CY6A 1ZYBA 5H9SA 4AQTA 2RMU1 1LHWA 2VQAA 1RUJ3 3O5SA 5CIRA 3RQ0A 2JX9A 4UW3A 4EN9B 1UN1A 5KHGA 4FPLA 4JGZA 1PZ7A 1MR5A 4YW5A 3WINE 3WNXA 2C1FA 3UJQA 2GZWA 3EXUA 2JEMA 2O1QA 4HBNA 4WVWA 1QY4A 2XUMA 3KM5A 3L2HA 1ALYA 1O91A 1H2KA 2VOVA 4P9JA 2PHUA 4CEYB 1C57A 2BQPA 2R0FA 1GV9A 3WHUA 1ASJ3 4Y4YA 5CB7A 1D0GA 1NCQB 1N3OA 1YFYA 3LSDA 1JN2P 1IS5A 4AXOA 1R1A3 3PLQA 1A8DA 2RR11 2RM23 1AYM2 2D6PA 4ZU5A 3HQXA 2WS91 3DKWA 2R041 4YM0A 3CJXA 1R081 2D7FA 1LOEA 1VB2A 2WNVB 5FDBA 3PNAA 4CZSA 5T3NA 1RUF1 4KG0A 1MVEA 1LULA 3KGZA 2UU8A 4ONUA 1WLTA 1FOD2 3USUB 4EN6B 1Z7S3 1OLQA 4PCRA 1AR62 2FMDA 3TBDA 2A7AA 2AREA 1VJ2A 2I45A 1X8MA 3V0AA 4I0WB 3VBRC 1ULCA 5DDJ1 1KITA 4YGEA 5FFOC 2P17A 2LM3A 2MNGA 5E1RA 3AKPA 2D43A 3H0OA 5IK5A 3JD71 3JBG3 5HXVA 4XILA 4QD2A 5FMOS 1R091 2ZZQA 2ZGOA 1T6GC 3R0RA 2P3JA 1QWRA 5LRSA 1U5YA 4XEZA 2HWF3 5L7OB 5GKAC 4CEWA 3WW2A 2GSYA 1PNGA 4DOUA 4Q29A 1LEDA 4M3CB 3MF6A 5E88A 3QH7A 4B29A 5D8AA 1G9DA 4S2GA 1I9RA 1KFUL 3VBHA 2IC1A 4X6QB 4FSJA 1ZA4A 4Y26A 5ACA3 2JJ6A 2A73B 3H1MA 1DGRN 2UWCA 3AYDA 3J8F2 4GMP0 4M3CE 3ZFEC 5EYYA 2ZGPA 2F6BA 2ZGNA 1MS3A 5BY5A 3GALA 4A2UA 4FPOB 2Q1MA 2WFF2 4Q4X3 2HWD1 3MPPG 2ILMA 2D6MA 2PLV1 3ALQA 3UKNA 3PHMA 4AFCA 4XW3A 2DVFA 1AF9A 5I93A 4XQDA 1H4HA 2YV8A 4Q4W3 4RR3B 1QNWA 4RGGA 2JICA 2KM2A 1BK1A 5FLHA 3KS7A 5A32B 1LJ7A 1EV12 4KG8A 1QOTA 4LNVA 3HT1A 4JV4A 3VKMA 3H3ZA 1KS4A 2Y0OA 4GB32 2RS31 3VZKA 1I6XA 1XNBA 3TRSB 2XBO3 4BE3A 1G7YA 4WVMA 5KXEA 1GZ9A 3MZHA 5B2GB 1EAH1 4KBBA 1IS6A 4PJYA 1NLRA 1DZRA 5JZGA 3AZYA 2YPJA 2ZKLA 3ZN4A 5E16A 3QBQA 1H8VA 5BV6A 5CFCA 3KSCA 4B8EA 2IXLA 3AMMA 2BTVC 2HWB3 2WT1A 1AHSA 2DCZA 2GNDA 4L8QA 4N53B 3SCHA 1G8WA 4HK9A 2R073 2XKPA 1BKZA 1BMV2 1UW8A 2JDZA 3UV9A 2YMZA 1LGNA 2SLIA 4FOYA 1O3TA 1XYPA 3TN91 1VBA2 1FT9A 1BJQA 2WSUA 5JVVA 1PO11 2JE9A 4TSVA 4E2QA 4GULA 4NHKA 3KCYA 3MIFA 4BZ4A 3TAYA 2GH2A 4CDUA 4YZ5A 1NY71 4URTA 5DG2A 3ZXKA 4AHYA 2FZ2A 5T5PA 1VBD2 2D3RA 4F8AA 1COV2 3TYJA 1PZ8A 5FPZA 2BWAA 2GC0A 2VY0A 2RJLA 4B7KA 3ELNA 1UIJA 4PLOA 2D3PA 4Y1YA 5K0UC 1SLBA 1CPMA 4HK8A 2QDRA 4W65A 3AB0A 4ZU7A 1N3QA 4Q4V3 2G9FA 3SH5A 3BPZA 2BW8A 1RUH3 1ZZ6A 2ZMLA 4FPFA 2EA7A 3RI9A 4K1ZA 4YGBA 3E6DA 5H9RA 1RUNA 4GA9A 1PVC3 4Y22A 3KQRA 1UPIA 2UY9A 1MZFA 4QHBA 2EXIA 2ZGMA 1QQP1 1RUC3 5J36A 1SLTA 1S0BA 1O4YA 3ZSLA 4P14A 1NG0A 1OI6A 1KJRA 1PK6A 3N3HA 4N43B 2D6LX 4AFMA 4K9SA 4Q4Y2 1KDMA 3WDYA 3ZFFC 4COWA 1V6JA 4AEKA 1NXD1 3IPVA 1LECA 1MVQA 1MS4A 4M0HA 4NPRA 4RS5A 2LALA 3OYWB 3WV6A 2IZWA 4JTNA 3RPQA 4BQ1A 1J59A 1AZDA 3AP6A 2BFUS 1ND3B 2JXAA 1YI9A 4XIKA 2VUAA 1S1AA 1C8M3 2WFPA 4S2DA 4L9BA 2DU1A 4LO4B 5I0RA 4IV3C 3FZ3A 4YVSC 1DGWA 4L92A 3MIHA 3O14A 1BVVA 4WM7C 1JBCA 1YFWA 1NLSA 4E4ZA 1ZBA2 4NWWA 3DUIA 4CP0A 1S2BA 2X53S 1AR71 1RMU3 3R4UA 5L73A 4OHYA 1LKNA 2GC3A 3ZFGC 4EROA 4QPGC 3I2DA 4YFWA 4YFZA 4KGGA 4M0NA 3UKVA 4AFDA 3OD0A 1VRH3 1F5FA 2VW0A 3VKNA 3VL9A 3WP4A 3SH4A 5EV7A 2D5FA 3NVCA 2YY1A 1H0BA 3FLPA 3B5LB 4OI0A 1ZBE2 4JRAA 1JXNA 2QFEA 3NV2A 4KU7A 4LBOA 4L99A 3FBYA 4LLOA 4ES8A 4CDWB 4YG0A 3I59B 1WD4A 1YI7A 4QQLA 1MS1A 1RHI3 4FPYA 1RUD2 2XKOA 2EF6A 1N1SA 4CRQA 4E4SA 5T5JA 1K5MA 4HL0A 1UKGA 3J4UH 3NKTA 3ZMOA 3ZYGA 1C1FA 2GMMA 2RS12 1NA1A 1RUJ1 3TWIA 5FPXA 5K9YA 2FMYA 1N47A 4HN0A 4RHV3 2RMU2 2X5IA 3MW3A 3IT8A 4AHWA 4PIYA 5FMOL 2VOWA 4AEJA 4XFCA 2H0VA 4IV1B 4NR1A 1B35C 2PFWA 3JCIA 4LA2A 4GMP3 1ONAA 1SEFA 3QLQA 5KHJA 3N7LA 4EN0A 2PHFA 3VBSA 1WMDA 4XF4A 2D6NA 1V9U1 4QQ2A 1W6PB 1QJY3 1V6OA 1AR83 3IDEA 4YYOA 5KC6A 2RM21 3AFGA 3ACLA 2DTWA 2JECA 2C5DA 4PF5A 2RS53 4YW4A 5C8CC 4OI2A 1OOPB 1FNZA 1ENSA