2RM23

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2300
1PVC3 1C8M2 1MQTC 3DPRB 1DDLA 1A6CA 2IZWA 2HWB1 5D8AC 1HRV3 4CEYA 4CDXC 1RMU1 2R042 1PIV2 3VBSB 2BFUS 1ASJ1 1ZBE1 1PGL2 1R1A1 2RS12 1MQTB 1BBT3 1MEC1 1VB2A 5D8AB 4N43C 4CDXB 2RS31 4WM8B 4WM7A 2ZAHA 1RHI2 4FTBA 1AR82 5ABJC 4N43A 4Q4V2 4YVWB 4PDWC 4Q4X1 1ZBA1 4QPIC 5ABJA 3VBOC 5AC91 3JB4C 1COV2 1QJU1 2RM21 1QQP1 4PDWA 5J98B 3JBG1 4PDWB 2HWC1 4CDQA 1V9U1 1RUG1 4QPIB 1R092 2HWE1 3VBOB 4Q4W3 4GH4A 1AYN3 3ZFEA 1RUH2 5BNNA 1VBB2 1HRI2 1QJY1 1FPN1 1AR72 2WZR3 4Q4Y1 2RR11 2HWF3 1VBC3 5DDJ2 4FTSA 1RUI3 4GB33 3VBFC 1NY72 1VBD1 2QQPA 1QJX3 1C8M1 1VRH2 1RUC3 2VQ0A 4EJRA 2RS52 1CJDA 3ZFGC 5BNOC 3JD72 4Y4YA 2R041 3VBFB 1OPOA 1PGL1 1H8TC 2RS11 3ZFGA 1BEV1 4AEDA 1F8VA 2MEV3 5BNOA 1D4M3 1VBA2 4CDUA 1AR63 1TMF3 5BNOB 1AYM3 3TN92 4JGYC 1RUE2 3VBRC 1NCQC 2BBVA 3VDDB 1H8TB 1W39A 1OOPA 2R071 2FZ1A 1Z7S2 1RUJ3 1RUD1 1PO12 4JGYA 1AR93 5C9AA 4JGZB 1ND3C 1PVC2 3VBRB 1NCQB 2R061 2GH8A 2HWB3 5J96B 1RVF3 2TBVA 1COV1 1B35B 1FMD1 1HRV2 1RMU3 1ASJ3 1QJZA 4IV1B 1ND3B 1MEC3 1BBT2 4N53C 2RS33 5A32B 1POV3 3ZFFC 1HXS1 1RUH1 1PGW2 3DPRA 1AL21 2XBO1 3FBMA 5BNPC 2WFF1 4Q4X3 4GMP0 1E57A 4N53B 3VBSA 2ZTNA 4WM8C 2Y26A 1MQTA 3ZFFB 1NY71 1R083 4CEWB 5D8AA 2RM23 1QQP3 2FZ2A 2HWD1 5BNPB 1C8NA 4LLFA 4YVWC 4CDXA 2RS51 4WM8A 2HWC3 1NA1C 1V9U3 1RUG3 3JD71 4RHV3 4YVWA 2ZZQA 2WS91 3M8LA 4Q4W2 5C4WC 1AYN2 3VBUC 1VBA1 5FMOL 4GMP1 4RFT0 1NA1B 3TN91 4Q4Y3 2RR13 2WZR2 1BMV1 2RMU2 5C4WB 2HWF2 1VBC2 1VBD3 4QPIA 1VAKA 3VBUB 1PO21 1RUI2 4GB32 5K0UC 3VBOA 1PVC1 1QJX2 3J8F3 2PLV2 1RUC2 1NOVA 3CJIB 5K0UA 1RB8G 5ACA1 4NWVA 1BEV3 5K0UB 1M06G 1EAH1 3LOBA 2MEV2 2RMU3 4CDWC 1BBT1 1AUYA 1D4M2 1HQNA 2WWSA 1AR62 1VBE3 1RUF1 1TMF2 1AYM2 1PGW1 2R073 4RS5C 2PLV3 4CDWA 1RUD3 1TME3 1EV13 1X36A 1RUJ2 3VBFA 4CDWB 1AR92 5CFCC 5JZGC 2R063 3VDDC 5FMOS 3S6PA 1PIV1 3HAGA 4RS5B 2HWB2 1FMD3 1RVF2 2GSYA 1RMU2 1VB4A 3VDDA 1K5MC 2WLPA 4JGZC 2BPA2 1ASJ2 1R1A2 1H8TA 5CFCB 5JZGB 1FOD3 1RHI1 4RR3C 1AL0G 1MEC2 4Z92B 1AR81 1B35C 4IV3C 4Q4W1 4JGZA 1HXS3 4Q4V1 5A33A 2RS32 1AL23 3VBRA 1NCQA 1K5MB 4IV1C 2XBO3 3ZXAC 5A33B 4RR3A 4RQPB 1B35A 4IV3A 2WFF3 5L7OB 4RR3B 4IV3B 4IV1A 4Q4X2 2BFUL 1ND3A 5LK7B 1IHMA 1ZBE3 1R1A3 1NCRC 1RUI1 4GB31 1R082 2HWD3 1R091 2RM22 4YVSC 1QQP2 5A32A 4FSJA 1RUC1 4NWWA 2HWC2 1NCRA 1V9U2 5C8CB 1RUG2 4SBVA 4CEWC 2X5IC 1NCRB 1VBB1 2WS93 1GFF2 1X33A 4RHV2 1HRI1 4N53A 4YVSB 1AR71 4GMP3 3ZFFA 3VBHC 1ZBA3 4QPGC 5DDJ1 4CEWA 1TMF1 3NAPC 5BNPA 5AC93 2X5IB 1QJU3 4Q4Y2 2XPJA 2RR12 2BUKA 1VRH1 3JBG3 1PO23 3VBHB 1VBD2 4QPGB 2HWE3 3NAPB 5GKAC 3J8F2 3JB8A 1ND2C 1NA1A 1RVF1 5ACA3 4CEYB 1QJY3 4FTEA 2DF7A 1RUE1 1FPN3 1BEV2 1ND2A 4WM7C 1EAH3 5C4WA 1CD3G 3VBUA 1ND2B 1NG0A 1RUF3 1Z7S1 3CJIC 1PO11 1POV1 1VBE2 1C8M3 1SMVA 2R072 4WM7B 1RUD2 3CJIA 1TME2 1EV12 1HRV1 4N43B 2R043 1PIV3 2R062 2RS13 4CDQC 1R081 1FMD2 5ABJB 4GH4C 3ZFEC 1RHI3 5BNNC 1AR83 1FOD2 4CDQB 4RHV1 4Q4V3 1HXS2 1HX6A 3IDEA 4GH4B 1AL22 3ZFEB 4RS5A 2XBO2 5BNNB 1COV3 2WFF2 5CFCA 5JZGA 1ZBE2 4RQPC 5CFDC 1R093 2HWD2 5L7OC 3J8F1 4BCUA 4AEDC 1K5MA 1RUH3 1AYN1 4RQPA 5CFDA 4CDUC 1VBB3 1F2NA 5L7OA 1HRI3 5CFDB 4Y5Z0 2WS92 1AR73 1OOPC 5DDJ3 3ZFGB 4AEDB 2WZR1 2RMU1 5C8CC 1ZBA2 2HWF1 1VBC1 1WCDJ 1VBE1 4CDUB 5C9AC 1VRH3 5AC92 1QJX1 1QJU2 1BMV2 2PLV1 2RS53 5C8CA 1TME1 1OOPB 1EV11 3JBG2 1PO22 3JD73 4JGYB 5C9AB 2HWE2 4YVSA 1VBA3 2MEV1 5ACA2 1D4M1 3TN93 5FOJB 1RUE3 1AR61 2X5IA 3DPRC 1AYM1 1QJY2 1FPN2 1EAH2 1FOD1 1Z7S3 3VBHA 1OHFA 1PO13 4QPGA 1RUF2 1RUJ1 1POV0 3NAPA 3VBSC 4CEYC 1AR91
chains in the Genus database with same CATH superfamily
1GNHA 1C8M2 1MQTC 2PAEA 4H7MA 3DPRB 3PNAA 1H1AA 2IWGB 4K40A 1DDLA 4AFCA 1A6CA 2IZWA 2WDBA 2HWB1 1HRV3 2JX9A 2D3SA 4AF9A 5FQ0A 2EXKA 4XFGA 1V6LA 3VBSB 1W8FA 3CO2A 1R1A1 1EP0A 5HV0A 1W6OB 2PXJA 1MQTB 1XSQA 1UPSA 4XAEA 2XJRA 1QNWA 4DRRA 4HPKA 4XQWA 3T4HB 3CF6E 3I4IA 4Y24A 5DZEA 4B29A 2LALA 4TXWA 1UMHA 2XH6A 3WQ7A 2E7QA 4WM8B 1Q43A 4RGKA 2XDVA 2G4IA 3I3DA 3Q8AA 4COZA 1O3RA 1P8JA 4LBMA 1JZ5A 1CONA 2H0BA 4Q4V2 1LGCA 1JU3A 5C7GA 4YVWB 5EIYB 2NP0A 4G9SB 2AENA 2ZPXA 2EF6A 3NW4A 4N9IA 1ZBA1 1SLAA 2ET7A 1UKGA 3JXSA 4NROA 5T5LA 1MS4A 1U12A 4QPIC 1S0DA 4CUGA 3WNPA 4R4XA 3O0VA 2HH9A 1QJU1 4YM3A 4Y1UA 4RFRB 4PLNA 4B1MA 1U5YA 5JVVA 4P14A 3PVBB 3K4ZA 5FZ9A 2FQPA 3WNKA 4QPIB 2VTXJ 1R092 4E9KA 3KV5A 2HWE1 1TNFA 2WQ4A 4XBQA 4F7ZA 1ZZCA 1DYKA 3KSCA 3RZLA 3WW1A 5B2GB 3WXPA 5C6CA 1AYN3 4COVA 3IIIA 3W5NA 1RUH2 1UO9A 3A7QA 4DIQA 2O1QA 1YWKA 1LOGA 5BNNA 2IFRA 5AVPA 4CXXA 1FPN1 5EYXA 1AR72 4YZ4A 4BK4A 4OHYA 3AMMA 5KBFA 2VTFA 2VR4A 4L2NA 3VB9A 2XL7A 3AKTA 3IPVB 3OPTA 4K8FA 1RUI3 1XE8A 3ACGA 1NY72 3AKRA 4YW2A 3VBFC 1VBD1 5FMDA 3MLKA 3RYPA 4CP9A 5A7WB 4XVHA 2QQUA 1WMFA 4Q26A 2W68A 3VDAA 2NPIA 4FPOB 3QCWA 2GP5A 2G9FA 4N7UA 3WNLA 1YRZA 5BNOC 4B1LA 4IEXA 2XJQA 5FXZA 4LBLA 3VBFB 5IYYA 3GCXA 1H8TC 4OLLA 3NV4A 1D0HA 5DUVA 1BKZA 4AEDA 4LHKA 3POEA 4QX8A 3WP3A 4B4RA 4LHNA 1NKGA 4COUA 5BNOA 2D6PA 1F8VA 5F8PA 2GNTA 2JDPA 1I5PA 5SV8A 3PIJA 3KT4A 1AR63 2BW8A 4OHXA 1TMF3 2A71A 1S2BA 1VJ2A 3D0SA 3O0WA 5BNOB 4AAPA 1NCQC 1VALA 3POJA 1I1EA 4HSLA 1H8TB 1AJKA 1OOPA 1UU4A 4OUEA 2ZBJA 2B5HA 1SPPA 2FZ1A 1F35A 3I3BA 1CR7A 1JH5A 1EUTA 1JXNA 1W8ZA 2AGSA 1YNAA 4CCKA 2GP3A 1LR5A 1GZTA 5F2SA 3VD9A 4L8QA 1CPNA 4QXBA 1NCQB 1VMHA 2VH9A 4RYDA 5FY9A 3MV11 5T50A 2JD9A 3ZIWA 2A6YA 2W92A 3NNMA 1SQ4A 2XXZA 3ACFA 1IOAA 1GQHA 4JHZA 4D94A 2JWPA 3PTYA 1JZ6A 1JYIA 1UNBA 4HKWA 4MXWB 1E5IA 1GR3A 3NO8A 5DUWA 3WF2A 2BRTA 5HXVA 4HLTA 3WF3A 4Y3OA 5FZOB 4LKFA 4COYA 3ZFFC 1UY3A 1PGW2 5FYHA 4Y20A 5C3OA 1LKNA 2DVDA 1W2OA 1IQDC 3AP5A 1G9BA 3K4DA 4EWEA 2FDFA 3URFA 2D6NA 2ZZJA 2WFF1 3HEIA 3E5QA 1RC6A 3PL0A 3WINE 2YMZA 1QWRA 4Q4X3 5IVVA 5H9PA 2JJ6A 1UYZA 1QHDA 4W50A 2Y26A 3DN7A 3Q8FA 5FZFA 3VD3A 3ZFFB 2J1VA 4C1XA 1R083 2QQLA 3POGA 1WMDA 3J9SA 3BTZA 1QQP3 4K20A 4YGBA 3OUJA 1WD3A 1C8NA 1DBNA 3MIHA 4P9YA 2CY6A 2VW0A 2ZMLA 3N9OA 2VVFA 2VO5A 1V9U3 5J09A 1RUG3 2HEWF 3NKTA 1SEFA 2A6XA 3JD71 1W8TA 1IS5A 3PUIA 4AFDA 2YC0A 2C4XA 4RHV3 3RDIA 1XNKA 3I59B 3M8LA 3K75B 3C3VA 3N7MA 3O7OA 4FFGA 4KWUA 3KS7A 5F3EA 3VBUC 5FMOL 3PU8A 4GMP1 1FNYA 2HJIA 2V72A 4YGCA 1LOBA 2VOWA 2YY1A 5FBZA 1T2XA 2J42A 3T2QA 5JI9A 5LY1A 1H2KA 4XQ4A 1OQDA 1F5FA 2ZHLA 2XG3A 5LA2A 2YGMA 4HMZA 3J7MA 3PHMA 5KXBA 4XUOA 5DUXA 4IW3A 3SH4A 3VBUB 1PHMA 4Z82A 4PBOA 4A45A 3TEYA 4OVEA 2DUOA 4GB32 3TNQA 2YGLA 3WUCA 4L99A 3VBOA 1PVC1 1QJX2 5FY8A 2UY8A 2XWBB 5C8CC 1O7FA 5CB7A 4Y22A 4OUMA 1UY2A 3D5OA 5FYSA 4NO4A 3NJVA 2AC1A 4AI1A 4XILA 2YG0A 2PN5A 3AXDA 2FD8A 1HDKA 3OGVA 2RG4A 4GIQA 2P3YA 3E1F1 4ASMB 3RJRA 2MEV2 5FP9A 3TRSB 3BOPA 1BBT1 3O14A 2VOVA 2FMYA 4CP1A 2A73B 3ZSMA 2WSUA 5CKQA 1LCLA 4KGQA 1VBE3 5FUPA 4EYUA 1YEWA 1JYVA 1T6GC 1HKDA 5AFBA 1BJQA 3ZPOA 2E7TA 2R073 1SCSA 4PI0A 3UKTA 1DFQA 2VOTA 1CWPA 1RUD3 1EV13 2LROA 1C28A 3I2IA 1S0GA 1RUJ2 2VNRA 2XWJB 2VUCA 3PJYA 2EAKA 1AR92 1IKPA 2CWMA 3WDWA 5JZGC 2CWSA 3VDDC 1W90A 2ZGPA 3PVNA 1OQ1A 1RUNA 2VMDA 3D4KA 5HI0A 4P5HA 3WDUA 4JDOA 2HWB2 3LA2A 2E9QA 4HN0A 1VB4A 5FZ7A 3VDDA 2AACA 4JGZC 4BE3A 1R1A2 2R30A 4M00A 4PHZA 1LU1A 3CQOA 3RI8A 3DXUA 4JV4A 3DL3A 3SEPA 4KWLA 5JZGB 5IK7A 1HB4A 3UT0A 1ODNA 3H50A 4Q0SA 3OYWB 3C7FA 4R52A 2TEPA 1AR81 1CAXB 2DFBA 2JB8A 1RJ7A 3CEWA 4Q4W1 4JGZA 2K0GA 5FZ4A 4Y5TA 2VMIA 5CYYA 5A33A 5E88A 3ZN6A 2YU2A 4A3ZA 1WA4A 3ZXAC 5A33B 1PK6A 5L9VA 3MV01 5G05L 3VL8A 5A70A 2Z79A 3DUIA 1J84A 2PHTA 1PGSA 2DVFA 4GJYA 1S4CA 2WO3A 4NAOA 4IQPA 3FN9A 1ND3A 2RDRA 3T08A 3ZDSA 4AQ2A 5LK7B 3AYAA 3FMGA 4YZ2A 1UXXX 1ZNPA 4X8NA 1RYYA 2QVSB 3AJYA 2FBEA 4HT1T 4QGLA 4YVSC 3VV1A 1RUC1 1UY4A 4ES9A 3LQCA 1IPJA 3ILFA 2K9ZA 1C4RA 4J1XA 4Q1PA 2YDEA 3USSA 3WG4A 5FJHA 5GLTA 1GZCA 1YQ2A 2OX0A 5JPMB 1GP4A 4CEWC 4IE6A 1AXYA 1ZZ8A 2VBDA 2H0VA 1HRI1 1X50A 2FDJA 3GZTB 1SACA 1US3A 4YVSB 4L97A 3U11A 4XF0A 4YW3A 3JU9A 3R05A 4YW5A 5GLZA 2OT7A 3ZYIB 4CEWA 5DMYA 4O9EA 1LHWA 3HT1A 1A78A 1V0AA 1UOGA 2JDZA 4IEUA 4LBNA 4XDOA 2XPJA 2BUKA 1VRH1 1XQNA 4MHUA 3EBRA 5L19A 1UWWA 4Q0PA 3GXUA 1VBD2 4PI2A 2MPFA 2NN8A 1PNFA 4QMAA 1TQ5A 2EIDA 4PIZA 2WNUC 3AZZA 1XB9A 3UV9A 3H7JA 1AX1A 1YO8A 5DAWA 2RHPA 4TN7A 3WNXA 1SG3A 2LRPA 3K4AA 3WLUA 1JUIA 2VJXA 5GJ6A 3J7HA 1MVQA 5FR3A 5FZAA 2WNUA 2ZS6B 3GF6A 2PTMA 3ABZA 1W6PB 2R32A 2B4KA 4LHLA 1EAH3 4LO6B 5BPXA 5C4WA 2WNUB 5C71A 1BVVA 4R8HA 1J58A 2H6BA 1DLCA 4EN8B 1DQ6A 4PIXA 5EWSA 4CCEA 3MF6A 1W0OA 2HEYF 4MV2A 3S5QA 2K46A 4P08A 5FYZA 1C8M3 4MSVA 4AEKA 5A6XA 5FOBB 3DV8A 1YQ5A 2FDKA 2WSVA 4IGQA 2P6CA 4HZFA 5FREA 5LA9A 5JXIA 3HN3A 3WDTA 3ZXJA 3UL2A 2HLEA 5LW9A 4EN7B 1W9YA 4LPLA 4FT8A 3ILRA 3ZYRA 2I45A 4GAZA 2GNMA 3N35A 2UU8A 4XJ9A 1OFSA 3C7GA 2FCUA 2ZMKA 3HPNA 3NMBA 4UW5A 1O4TA 4IE5A 4BYYA 3ZOIA 1C5HA 3KMHA 4GH4C 1IPSA 2QCSB 2Y6GA 1J1LA 1VE0A 3CHXA 3E5UA 2XVLA 3NSTA 3DEMA 3OGGA 5EQUA 2QQJA 3AXEA 3WQBA 4XHBA 5F39A 3UKNA 3KHCA 4B4QA 2XJUA 1AX2A 3AYEA 4Q4V3 3FLTA 3LSDA 1LB2A 3VZNA 1UOJA 4XFCA 4NIAA 2OS2A 3MIEA 2F4PA 4TTGA 4GH4B 3B7MA 1URXA 1EY2A 1DCSA 3C2UA 2R0HA 1PMJX 4GWNA 4AWDA 3IKWA 4N9HA 3AZVA 1HN1A 4Q27A 1UZWA 4JRAA 1OQEA 2WFF2 4PBPA 1ULPA 5I0SA 4QX5A 4DUXA 2ADEA 5L36A 3H8XA 3RYKA 2GH2A 1W8HA 2VZSA 1ZZ7A 1NUKA 1ZBE2 3OJBA 3E97A 3H1WA 1R093 1JS9A 5IWFA 2JENA 2B46X 1PZ7A 3WV6A 1G9CA 2C0ZA 5F6KA 4A7KA 1YLLA 2OIIA 1ZREA 1RUH3 2P1BA 3AVSA 3FL7A 3I2DA 4CDUC 5FYCA 1F2NA 4FO9A 3OGRA 3ZIXA 3I2GA 3U0ZA 4OHWA 1OLME 4HFSA 2D43A 4LBQA 1AR73 2AEZA 1GMMA 4BZ4A 4KG0A 4EN0A 1BVP1 4LKSA 4MYEA 5HCAA 1ZZ9A 5J36A 3KHBA 2WZR1 2W3JA 1BYHA 3HWJA 3TWIA 4LO5B 1UU6A 1FNZA 2HWF1 3KM5A 4RSUA 1RGSA 1SLLA 1VBC1 3E5XA 4Y1YA 5E1RA 1Y9MA 1CAWB 1Q5OA 3T0BA 4CDUB 4BJ0A 3SISA 5C9AC 4FBFA 3H3LA 3OB8A 4FPHA 3RZHA 5AC92 2JKXA 5LZ6A 4BISA 2GC0A 1Y7BA 2GN7A 3OUHA 5L73A 5A3PA 5ISLA 3AP6A 1SLCA 2R1BA 4X6RB 4AHZA 4AR2A 5C8CA 3RRDA 1TME1 2VMGA 3JBG2 3VZKA 3VDBA 3A21A 4Y4RA 1H8VA 4E4ZA 2D97A 5E8AA 2B8MA 2YC4A 4JGYB 4R9DA 2WFPA 5FY5A 4KU7A 5DABA 5C9AB 2UWCA 1JU4A 3S5AA 4NUBA 2D5HA 3MEPA 4XURA 2D3RA 1VAMA 4YWAA 1O3TA 1SDWA 2Y0IA 2WT1A 3NWKA 1HLCA 2FDIA 2OPKA 1D4M1 2JE8A 3OBRA 1LGNA 1MVEA 3K77A 5A7NA 4CE8A 1DG6A 5IVFA 1KQRA 5FIXA 3VD5A 3DKQA 4BMBA 3ZMNA 1FOD1 4BQXA 5H9RA 1KEXA 3D82A 2W95A 1OHFA 4QPGA 4BK5A 2JE7A 4MGKE 4BH9A 1POV0 2UYBA 1AXKA 1S1AA 4IESA 2A3YA 3N9MA 4LA2A 1C5IA 4G3YC 4YPJA 2KM2A 3S7IA 4N8MA 1MR5A 5DXDA 4CUCA 4W65A 3K2OA 1F4AA 4FI9A 2GZWA 2WO2A 2XLFA 4HKLA 1TEIA 2NYYA 2Y0OA 4XFFA 5KHHA 1W9TA 1RMU1 5C3SA 1PGL2 2BFUS 3MLLA 1IGOA 4RA0A 2RS12 2H6CA 2YHJA 5DPNA 4AVAA 4JQRA 4DZGA 1SZBA 2WQZC 1XOYA 1CZTA 1NLQA 2VE1A 4YW6A 4IUGA 3BKZA 4KMQA 4OQ8A 2DBNA 1ZRFA 4RN5A 1QU0A 1WUVA 3ON7A 3MHZA 3RPQA 4HG6B 4AW7A 3I49A 1AR82 4XW3A 4MO3M 3ETQA 3C7HA 2PAKA 3I3EA 1W6NB 5FK8A 1GWMA 2AUYA 2XQXA 4U2AA 5FAXA 3W59A 3GCWA 3GZEA 2XLAA 3OEAA 2JDMA 2ZGMA 2NM1A 2WBKA 1CGPA 1OUSA 1HJGA 3KD4A 4AAXA 2V4VA 5F6LB 5LEKA 3JB4C 2A5ZA 4QKBA 1JZ8A 2RM21 4IGOA 3SH5A 1WCUA 1CJPA 1ULGA 3LEIA 1YUDA 2A3XA 3WNNA 4D6RA 1ZYBA 3T0DA 3IM0A 1H4HA 3POBA 1HW5A 4IEYA 5DG1A 2BDRA 3B93A 2BGCA 1HB3A 1EYBA 2OZ6A 2XMLA 5JR7B 5LWBA 1S55A 3DCQA 2AREA 4U36A 1Z78A 2V5DA 4LO7A 3ZFEA 1VIWB 3OBAA 3M1HA 1HV1A 4HKOA 3MUY1 5J37A 1HRI2 1C57A 1QJY1 4LMFA 1GQPA 1L7LA 1AZDA 4LQRA 3TB0A 1PMIA 4OZXA 4BXFA 5LBCA 4MGTA 4MUVA 4FTSA 4GB33 1SBDA 4NJ4A 3RWKX 2WT0A 4BA6A 4ET7A 5IVBA 2QQPA 1QJX3 4OYUA 4XUTA 4KWKA 4ISRA 1VRH2 2Y38A 5FY4A 3KWVA 2RS52 1XU2A 1JODA 3ZFGC 1NE4A 3UK9A 2OUJA 2JDUA 4M3CA 3R4UA 3KVBA 4JZRA 5CKMA 4EN9B 5J7MA 4XDPA 4Y4YA 5H9SA 4NR1A 2C9KA 4YGDA 2R041 1GU3A 3LA3A 4M3CB 1YFUA 4INDA 4Q0QA 4ASKA 4FFHA 5KXCA 3ZFGA 1BEV1 4YM1A 3BU0A 4QWNA 4MGQA 2VZ1A 2MEV3 5FZ3A 1UYYA 4KWJA 4D7YA 4NHMA 2ERFA 2YPJA 3PTRB 1QJEA 1QDOA 4QT6A 2WN3A 3IAQA 3MFCA 3TN92 5DN2A 3VBRC 2BBVA 5LK5A 1CZVA 2PHXA 3KGZA 4Z1VA 3OTFA 2A75A 1UOBA 4LKDA 3I2OA 1QIQA 1GZ9A 3F2ZA 3APBA 1RUJ3 1DQ0A 5KHGA 1GYKA 1WA6X 4XF1A 1AR93 2AYHA 4LE3A 5B4XA 3MIGA 1R1ZA 3LF7A 5IAVA 1WW4A 3VBRB 3SQOA 1PX3A 1KS4A 2HWB3 1K3IA 4FPLA 4I02A 4M3CE 4AZZA 5IVEA 5J96B 4V2WA 2TBVA 3KLSA 1COV1 1B35B 1JZ2A 4MGIE 5FXXA 4CUBA 4NIGA 1ACCA 4IV1B 3PJQA 3KV4A 1AVBA 4EN6B 4Q8KA 2VPVA 2X53S 3FBYA 3VZLA 2W2IA 4ISQA 4AHYA 3HD8B 1CESA 1YQ8A 4IEZA 4N53C 1GZWA 1XNTA 3JZVA 5FRAA 1POV3 3ZPYA 4BXSV 4LA3A 1HXS1 1N1VA 3DPRA 4N90A 5EYYA 3ZSKA 4ZY9A 4AE2A 1GZWB 3NL1A 5LRRA 4MHRA 2VNGA 3POWA 4QKDA 3SKJE 4AEMA 4B4PA 3AFKA 3S0MA 2XJTA 2VCBA 5BNPC 2WNEA 4ZONA 3MICA 1XNBA 3KGLA 3QOPA 4GMP0 5EP9A 2Q1MA 4N53B 3VBSA 3WUDA 3J7LA 2BBAA 1W6OA 4WM8C 1D0GA 1MQTA 3FJSA 3FX3A 3WDXA 1YHFA 1DQ2A 4XC9A 1OF3A 2E53A 2BU9A 2PELA 2PFWA 3LFIA 3MIBA 1MZ6A 3SH3A 4DUWA 5FUIA 2E33A 4NPRA 1LHNA 5BNPB 5EJ1B 2J1TA 4LLFA 4YVWC 4WM8A 1NA1C 3GGLA 4KGGA 3TEWA 2W46A 4ZS3A 1SFYA 1KS5A 1O4YA 2R16A 2Y8KA 3Q9OA 4HANA 1S0FA 5FP4A 4K7JA 1H2MA 3SCFA 2YFZA 4YVWA 2Q5TA 4KQ7A 1OLRA 1U5XA 4LBQD 5LRSA 1XJAA 2VQUA 4E2GA 1VBA1 4I3GA 4CUAA 3D3AA 4RFT0 1NA1B 3EQEA 1V6OA 4Y5SA 3JCIA 3DYOA 4MH0E 4LXLA 4OMCA 1CAUB 3RZKA 3NJZA 4MGZE 1DYOA 2F6BA 3OOXA 1CIWA 1QNYA 2WZR2 1GQGA 3MPPG 4HVOA 4LO8A 3TNPB 2HWF2 3W5MA 5FP7A 1VBC2 1OA2A 2C6SA 3O5SA 4AI2A 1VBD3 3ECQA 1W2NA 4QPIA 4L0PA 3SKVA 3ZYBA 4E4DX 4QU1A 4LITA 4TWTA 4W8JA 1LEDA 3WZ1A 2QZ3A 3MBWA 4QQ2A 4C91A 2D3PA 4SLIA 1NOVA 5BY5A 3HNMA 4YW7A 3O0XA 4FQZA 2W91A 5J1XA 2VZUA 3P6BA 2VZ3A 1OBNA 2BNNA 4QHOA 3MW2A 5FPVA 3L9JT 1KJRA 4UBHA 2D6LX 5A6ZA 3BYWA 1SDDB 2HEVF 2UWBA 1QGLA 4FCAA 3K3OA 1D2QA 4C8DA 3I2KA 4UBGA 4F83A 5F9TA 3IPVA 2N7GA 4D0QA 4FP2A 3THTA 2RMU3 3NNJA 4GA9A 2CYFA 4CDWC 1HQNA 1D4M2 1KDMA 4QX2A 1RUF1 4P9IA 5A7WA 1XNCA 4UFMA 3H8RA 1OPMA 1QH6A 4IETA 4CCDA 5C5UA 4W4ZA 4R9AA 4RGGA 4RS5C 1QY4A 1W06A 3UGFA 2Q4SA 2PLV3 1RL3A 4XEZA 4ARXA 4CDWA 1X36A 3KF3A 5FYYA 5FBJA 3G7DA 5EV7A 3VBFA 3C7OA 4CDWB 4QDQA 5C3QA 3OUIA 5CFCC 1XPWA 4FPGA 5FPZA 5FMOS 5T5JA 2W0XA 1PIV1 3J26N 1ZRCA 3HAGA 3HMYA 1UZ0A 4RS5B 4E8CA 2Y6HA 1KITA 3CKHA 4N7IA 1RVF2 3QBQA 3FFZA 3B5LB 3ROUA 3UESA 2GSYA 4IXLA 4OZOA 1RMU2 2ZHNA 4UWDA 5CKNA 4GZ9A 4V1PA 3HBZA 3KV9A 1H8TA 1NQDA 5CFCB 1M4WA 3WDYA 4IEQA 5I0UA 1YQ6A 1O4ZA 1SLIA 4RR3C 3RZGA 2WZPP 1HV0A 5FYUA 2YUEA 2ZA9A 5JOXA 1NQJA 1XYOA 2A6ZA 4O7XA 2ZAAA 1W8NA 1UF2C 1NCQA 3JUUA 2OA2A 4FFFA 3ZDVA 1DP0A 3ASIA 3BODA 4PJYA 3ZYPA 4RR3A 4RQPB 5H9QA 2GNBA 1J3PA 5A3OA 2CL2A 3VD7A 2WFF3 3T2PA 2XUEA 1W2AX 3BPZA 4RR3B 1UZZA 1W3VA 2RJ2A 1JN2P 3P1IA 3RGBA 4MXWA 1IHMA 1W0PA 1ZBE3 2CDPA 3P5BA 4NN0A 4NHLA 4S2DA 3ZKYA 4A4AA 2IXKA 1RUI1 5JOYA 1VRBA 2QQWA 1PX4A 2B42B 4XACA 4QX7A 2Q8DA 5A6QA 1XSRA 2RM22 4MADA 1OMIA 4XF4A 5FZOA 3ZXGA 1WZXA 4NWWA 1BHGA 1XE7A 3M3CA 5IFTA 3BUCA 4QDSA 1X7NA 3NVCA 3LD8A 3RFRA 4DNYA 3N9QA 5A80A 1MS9A 4XYXA 1CZSA 1EUUA 1S0BA 2X5IC 2PQQA 4AVVA 1CVNA 3AFGA 1V00A 1X33A 3THPA 3CJXA 4OI1A 1ODMA 1QOSA 4GMP3 3ZFFA 1RITA 5TSWA 3PURA 2P3IA 3AVRA 3HQRA 1OD3A 5DDJ1 1Y9GA 3UGHA 1TMF1 3NAPC 2VZRA 3WR0A 5AC93 2X5IB 4YZ1A 3HIFA 3ES4A 4OULA 2BP6A 4ASLA 3JBG3 4GD4A 2WWJA 4AFBA 5IVCA 3V0BB 3ZX7A 3I59A 1LOAA 2J1SA 3WEZA 1JZ4A 3POSA 3NAPB 3ZYFA 3J8F2 2AR6A 4XUQA 1O8PA 3IT8A 5IK4A 2DTYA 5A7QA 2I74A 5HCFA 4WVZA 4QQPA 5HPOA 3N9PA 1IKQA 4XETA 1W04A 4CEYB 4FTEA 4CPBA 1NYWA 1BEV2 3D8CA 4WM7C 4W6YA 1XBFA 1A8DA 1ZX5A 4AGVA 3VBUA 2LTNA 2QQKA 4ZPIA 1Z7S1 3MF9A 3N4MA 1V6NA 1PO11 5DZGA 2PHWA 1OFNA 1FXZA 5FZCA 3ZMOA 2R6QA 4CP2A 1JOJA 2GNDA 2Z42A 3BTAA 2ARBA 4A2UA 4IEWA 4WM7B 1G7YA 2A1XA 5KWRA 4XJUA 1TG7A 3M4FA 1REFA 3ALQA 5FZIA 1F9KA 1MACA 2UWAA 4N43B 3MDPA 1JYCA 3E6BA 4IERA 3WD5A 2BWCA 4AQTA 2CNAA 2RS13 4GWJA 3U78A 4CDQC 1WBLA 4AHWA 2ZX2A 1E5HA 1R081 5GZFA 2RJKA 1CAVA 5ABJB 3GBFA 4DMIA 3B94A 3IBMA 1CAVB 4B7KA 2J7MA 3VN4A 2QZ2A 2GMMA 3KQ4B 5FXWA 2JECA 3O12A 4OUSA 5FZDA 1AR83 4OQ9A 1MPXA 2C1FA 4GULA 4CDQB 1OKOA 4RHV1 1W8WA 4LR4A 3RQ0A 4PLOA 1OSGA 4JRLA 5GLWA 2L9LA 4L9BA 1HXS2 4QHBA 4ARYA 5F1RA 2JG9C 2BJSA 4BWOA 2JKBA 5T3NA 1V70A 2NLRA 3GHMA 2WC2A 1KD7A 4DXSA 4UOJA 3MUZ1 5GLUA 2JG9A 2AH2A 4YZ5A 2HYXA 4XUNA 4M4RA 5KC6A 2IUWA 3DF0A 1O5LA 2W94A 3HNYM 3WG2A 5JZGA 3MI8A 3DYPA 2JG9B 2VL4A 2ZEYA 1XYPA 2WL1A 3OYWA 1JOPA 4XJZA 3OD4A 5A3TA 1CAXA 3AKPA 2DU0A 3ZXEA 3ZYGA 4H55A 2VUJA 3B9CA 4M01A 4XXPA 4BCUA 2FDGA 4DB5A 2X8KA 5LEJA 1NX9A 1YCIA 3AP4A 4EWAA 3U4SA 3ZSLA 4M0NA 5FFOC 1I9RA 3N7LA 3TEXA 3AZXA 4AI3A 2B9UA 1HRI3 4M3CF 1UZVA 2Y6FA 4QM9A 2EA7A 3H7YA 3HT2A 4XBNA 4KG8A 4YG0A 2W9XA 1S0CA 3VKOA 2BVVA 2NMOA 2VOKA 3WNOA 1ZBA2 1KRIA 3ITQA 3LA7A 3RZJA 1UCXA 1VBE1 1WD4A 4BB3A 2VQTA 2CV6A 4DEQA 1VRH3 4FOVA 5JWPA 5JCTA 1QJU2 2WABA 3NJXA 2VAUA 2RS53 3V64A 5JPNB 2ZABA 1EV11 4LUMA 3UKVA 3V0AB 4CCCA 2GALA 3IWZA 5CU1A 2HWE2 4YVSA 2X10A 3OY8B 1W9FA 3B3QE 2ZGTA 3VZMA 3H9AA 3I8TA 1NZCA 1F31A 3HBKA 4BQ1A 5FZ6A 5GLVA 3TN93 3VZJA 5FOJB 3DXTA 5A1FA 2DBIA 3WP4A 1FV2A 1NXMA 1AYM1 1G9DA 2QQNA 1FPN2 3AKQA 1XE0A 1WKYA 2FCTA 2W5FA 2Z69A 3NQHA 4ZHNA 2UURA 4Q1RA 3AKSA 2KD7A 4CXWA 1TE1B 2P3JA 4XJWA 2VUAA 1RUF2 4LE4A 1LEMA 3J4UH 5AFEA 4S2FA 2WQ8A 1BCXA 2R49A 1G9FA 3AMQA 4Z07A 2PHFA 1OVPA 2XUMA 1WW6A 1H9PA 1OH4A 2Y33A 5D8AC 1X82A 1HIXA 2UY9A 4GWMA 2OXBA 3GNEA 4OI4A 3BI3A 1VMFA 2YROA 4BQYA 2J1RA 2IC1A 4CDXC 5C70A 2V4AA 5C8WA 3LDRA 1W6PA 2VCMA 3IMMA 3ZYJB 1PIV2 2X05A 3O1SA 4FXKB 3SHRA 1ASJ1 4WBBA 2ZMNA 2EXIA 3VHRA 5I0RA 1VMJA 4FXGB 3L2HA 4UF0A 1MEC1 2W47A 1VB2A 5D8AB 3U1XA 1UX7A 1DQ4A 4D69A 4NIDA 3H3UA 4MGSA 4UYBA 2RS31 1W9WA 1O59A 4UF0B 4YGEA 2Q8EA 3SMHA 3X29B 4XOGA 2ZAHA 5FZMA 2VOXA 3I2HA 3T3YA 5T55A 3LSEA 1GKBA 2GMEA 1J59A 4YFZA 3VKMA 2QUOA 3CLPA 3BTXA 4YG6A 3TOJA 1Q8OA 2VM9A 3ZN4A 1U5ZA 4PDWC 3HR9A 2DCYA 3U75A 3BPSA 2WIIB 3L2YA 3TBDA 4BQ3A 2B39A 4DS0A 1H0BA 3DECA 2W1WA 1LULA 2VCCA 1CPMA 4PDWA 1S0IA 5J98B 1PNGA 3GZAA 4QX0A 4NIIA 4PDWB 2HWC1 2I07B 1FX5A 2XVKA 4Y1ZA 4DO0A 5IT6A 2QNKA 5CG8A 4GH4A 1JW6A 1K42A 4BIOA 1OLMA 2ARAA 2QQMA 1I5ZA 3AZWA 4Y33A 5A3NA 5FCCA 2EIEA 3CBNA 3U10A 4XCAA 2AZ5A 4KH9A 4M4PA 3BGAA 4D8MA 4D7SA 4YARA 2WZR3 4Q4Y1 2WR9A 2RR11 1MS8A 2HWF3 2ZHMA 2X09A 2OQ7A 1VBC3 5DDJ2 4DY5A 3QLQA 5FPAA 1EPZA 4NMIA 1YFXA 1D4VB 2FMDA 3OF1A 4DEVA 1C8M1 4OHVA 2V09A 3OG2A 4QM8A 4UAPA 5J48A 1XRUA 4MVTA 1LOEA 3VHPA 1RXFA 4CCJA 3VHOA 1CJDA 1ENQA 4HONA 4XFAA 5ERLA 2BTVC 4CSWA 4YM2A 2XHKA 2VW2A 3KV6A 5D21A 2D7FA 4UFJA 2WYSA 5FTTC 4FOWA 3JD72 3NRUA 2XONA 1OPOA 3WQ0A 1W2TA 1N1TA 4KU8A 2W1UA 3ST7A 4MXVA 4CPBD 1DGWA 5C3PA 1LTEA 2ZX4A 1GWKA 4JDMA 1D4M3 3WF1A 1CAWA 2XR4A 1MS1A 4CDUA 4ORFA 3MIDA 3UJOA 1UU5A 2C24A 4JGYC 4CCLA 1H1MA 3AYDA 3F95A 5A6YA 1N3OA 3LPFA 5GZDA 1OA3A 3H0OA 3O1OA 2VMHA 4NHXA 4FPYA 3S57A 2VU9A 4GALA 5I8YA 1X8EA 1Z7S2 5A7OA 1PO12 5FDBA 4JGYA 2WYFA 4BQ5A 3KT7A 5C9AA 5A7PA 1GICA 3WW2A 2R0FA 1L7QA 1PVC2 1ULOA 1ULEA 2R061 1UYXA 2GH8A 3T2TA 5LCWL 3UYJA 1ENSA 1OH3A 2VXJA 1RVF3 3MFAA 2EXHA 1FMD1 2ZGRA 1RMU3 5B4NA 4IEPA 3O1UA 2W1QA 4DXZA 1HB1A 4K8RB 1OLQA 4HBNA 5JIUA 2Y6JA 5F7UA 1GOHA 1X9TA 5FZKA 1N47A 2XKPA 4W6XA 3GBWA 1F15A 1RJ8A 4C0HA 2ZKLA 5APAA 2CHHA 2R7EB 1BBT2 2EICA 3ZXDA 1LU2A 5EFUA 3GBGA 1B09A 4JX0A 5A32B 5D1IA 2P5BA 4OI2A 5BXXA 1RUH1 4B7EA 4EE2A 1AL21 1D7PM 1DQ5A 4P9GA 2XBO1 3FBMA 1LHUA 5HXMA 3Q8BA 2JDKA 2WN2A 3RNSA 4PIYA 4Q8LA 5EXOA 3KF5A 3VLBB 2ZTNA 1NY71 2E6VA 5F3IA 4J6GA 4MOAA 2VZQA 5BYNA 3AM2A 2RM23 5FLIA 2FZ2A 2HWD1 3UNPA 2YBPA 1I3HA 5JSRA 3OGSA 5JIAA 1WCKA 3NV1A 5A1AA 2GN3A 2W52A 4G4FA 1F4HA 1W6NA 1WLWA 4E4SA 1O3QA 4YW4A 5KHIA 1DGWX 1ST8A 1FAYA 1YQCA 2VNVA 3AB0A 2WS91 1SHWB 3Q8CA 4NPMA 4PF5A 4Q4W2 2DV9A 2PYTA 2VZOA 3KCCA 4P02B 1CQ9A 4EZHA 4QB2A 3CZJA 4Y1VA 2K2SA 1W28A 1TZOA 4XZPA 4FQ4A 2O14A 3RZZA 3TEZA 1UYPA 1K5JA 3LB9A 4FPKA 4LT5A 1A8MA 2Q30A 4BU2A 3M70A 5JLVA 1BMV1 4LBKA 5JSPA 1C3HA 2DFCA 1YIPA 1BXHA 1ZZ6A 2TNFA 3OBTA 1PO21 3OBZA 5CZKA 2ZX1A 3AL6A 3G6JB 3ZN5A 2DUPA 5K0UC 1G9AA 3FLPA 3J8F3 2WZ8A 4H2AA 1SBEA 1RUC2 2WJSA 4NVPA 4HVQA 4JKLA 5FWJA 3CZUA 5AVAA 4QKNA 2BERA 1LGBA 2MNGA 4YNIA 1G8WA 3CJIB 4HOOA 2JG8C 5EJ3A 5GM0A 5K0UA 5HV4A 1LAJA 2XHNA 1RB8G 5ACA1 4NWVA 5CNAA 2VUDA 1BEV3 2WNOA 3AK0A 3H3ZA 2ORZA 3LDBA 4IEOA 2C9AA 5K0UB 1RTVA 4JDNA 4AK3A 4YYOA 1M06G 2CU5A 3EO6A 4UW6A 1GUIA 2O8OA 3EYPA 3M3OA 3LOBA 3ORJA 1JOBA 1YIFA 3PLQA 4I0WB 1DIWA 5LBEA 2VBBA 3AMPA 4FP3A 3VBSC 3O1TA 2JG8B 2QQVA 1AYM2 1PGW1 3A23A 3JQWA 3A4UA 1JHJA 4P5YA 1DZQA 1NAEA 2LM3A 2QJVA 1DLLA 2ZGLA 2ZKNA 3IAPA 3N7KA 4Q0VA 3BB6A 2ZGSA 2O0OA 4QB1A 5C5TA 4F3JA 2BNMA 5F2WA 3IB3A 5JOWA 5CADA 4QXHA 2HKXA 3WOGA 1Y43B 2FHRA 4I0AA 2OYZA 4DOUA 2DCJA 4QXCA 3S6PA 2G9ZA 3T30A 2DVAA 5FWEA 2BOJA 2WNVC 3V65A 5ANQA 1FV3A 5E16A 1LOFC 2Z4FA 1YC61 4FOYA 3KZ4C 3OSDA 3HOBA 3GM8A 1K5MC 2BQPA 2WLPA 5K8SA 1ASJ2 5I8TA 1NZIA 1UIJA 4QDRA 4I2OA 4DINB 3I97A 4IE4A 4NHKA 1UL9A 1RHI1 4KBZA 1S0EA 1LOFA 1UN1A 2WNVB 4S2HA 5F5AA 1MEC2 4XFHA 2BOIA 2WA4A 4Z92B 1B35C 4AHXA 2J1AA 1DYPA 3B02A 4L11A 1HXS3 5FYIA 1AXZA 3EJKA 2RS32 1KJLA 5SV5A 3VBRA 1K5MB 4IV1C 5LATA 4ZXEA 4QQLA 4FOQA 1VR3A 4CU7A 2YC2A 1B35A 1PM7A 5L7OB 3EB7A 1SLBA 5IW0A 3WCSA 1UIKA 4AQSA 2WAOA 3AMHA 4Q2FA 4XCBA 5I8SA 4IV1A 1DF0A 3SCHA 1VLNA 1XYNA 2BFUL 2PHUA 4QXKA 1R1A3 1NCRC 1NT0A 4GB31 2CGNA 3WVJA 1OKQA 4CVUA 2VCAA 3U07A 3OCPA 3N9LA 3BVCA 3WW3A 2ET1A 4GQ7A 2PMWB 4QAWA 4EROA 3UETA 3VGIA 2YB7A 2HWC2 1NCRA 1UW8A 5T54A 3CDZB 3O1PA 1NCRB 1VBB1 4OCTA 2Q1ZB 3K51A 3RSJA 3H1MA 3H42B 3MZHA 1H9WA 4N53A 2JD4A 3LFMA 2OPWA 1H1IA 1JTZX 1W0NA 2EIGA 2YPDA 2BEOA 3VBHC 1ZBA3 4YLZA 4FAGA 4XAAA 1GNYA 1LHVA 2VZTA 1KGYA 2VQAA 5IFPA 2OQ6A 1X8MA 3RZMA 5BNPA 1IQAA 1QJU3 4Q4Y2 3FWEA 4KBBA 4LULA 2RR12 1ZRIA 4QQHA 4HN1A 3WF0A 2E63A 4GJZA 4AI8A 2GU9A 5FJKA 3POFA 1U0AA 2WRAA 3BN6A 3VBHB 1UMIA 4ZU7A 2JICA 2QFEA 3FHQA 3USUB 1CN1A 1UXZA 2Y64A 3PUQA 1BK1A 2HWE3 2Q0AA 5FKBA 4H3WA 3KCYA 5GKAC 4AEJA 4AVCA 2CAUA 2V73A 2XVGA 3JB8A 1ND2C 2VULA 1R64A 4NHYA 3R6SA 3T0AA 1PMHX 4JC1A 1NA1A 4NOTA 5IHRA 2D40A 3KQRA 4BOWA 4DRVA 5CAZA 5IJRA 2BYVE 1CAUA 5C3RA 3MPBA 3T4VA 4LBOA 2W87A 2WKKA 3W20A 4QKFA 5FP8A 4LIUA 3IZOA 5FQ0B 1S2EA 1RUE1 1FPN3 2DF7A 4J1WA 2BWAA 1ND2A 2G9GA 5A1LA 4BIFA 5DAXA 4LK6A 5KC5A 2KA3A 2IXJA 3FHAA 3ILNA 4YW1A 1ND2B 2X29A 1NG0A 1RUF3 4HPKB 4HK8A 1POV1 4NRMA 3CNAA 1SMVA 4Q0UA 3WDVA 1A3KA 2OZJA 1QDCA 4H7LA 4X8PA 5FPLA 1UOFA 1HQLA 1TME2 4Q5OA 4BDVB 5JR2A 2A3WA 1Q8QA 1PVXA 4QB6A 5FLHA 4W6WA 1HRV1 2P3KA 2A7AA 3WP6A 1PIV3 2P34A 4HXCA 2R062 5DAQA 5JOZA 4F8AA 4K6BA 4XTMA 1GV9A 2RVAA 2I2SA 2Q1FA 1FMD2 1JUHA 3GJBA 1DZRA 3ZXKA 5M0TA 3ZVXA 1T6BX 2WUHA 3RMYA 2RDSA 1NLRA 1Q8VA 3W9AA 4K9SA 4DXRA 2DYCA 3S7EA 3WT3A 1LECA 2ETEA 2DCTA 2VMFA 3BIEA 5BNNC 1REEA 3ENRA 1FOD2 4UXAA 3RYRA 5T5OA 1N3QA 1O3SA 1XC6A 4KI5M 4FAHA 2WA3A 1HX6A 1UD1A 1AL22 2XL9A 1W8OA 2ZHKA 4AVTA 1DQ1A 2VW1A 3A0KA 4RS5A 3S30A 2XBO2 3AMNA 5HCBA 4CYDA 4A42A 1ZA7A 2DCZA 1JZ7A 3QH6A 5BNNB 2QBXA 4DUVA 1H6XA 3ZR5A 3PUHA 4NIHA 2Z2SB 3NV3A 5CFCA 1W05A 2ZGQA 2Q8OA 4ZU5A 4A3XA 3QH7A 2QE3A 4RQPC 3BU7A 3LEKA 1DU3D 1SFPA 2HWD2 2P4EA 4CP9B 1N1SA 4JAAA 4K1YA 3DYMA 4AEDC 3H8UA 1AYN1 4AL9A 2Y6KA 1K12A 3I3QA 4RQPA 1I6XA 2D6KA 2VTXA 3MGUA 1EPWA 3I2JA 4Y5Z0 2W39A 2WS92 5F32A 2ZGOA 5IK5A 1LENA 1YYNA 4P9LA 4P9XA 5T5PA 1GOFA 2ARCA 1OOPC 4ONUA 4XPVA 1IG3A 2QQOA 4TYSA 5DDJ3 4AEDB 2QQIA 4MX3A 2QKDA 2RMU1 5FZ0A 5JMOA 3ZSJA 3QD6A 1WCDJ 2ZEWA 1FATA 4LEJA 1MZ5A 1STMA 4CTEA 1ZRDA 5JXJA 2F4LA 1WLCA 1F5JA 1BMV2 2PLV1 3MO4A 4HK9A 1OOPB 3VDCA 1JYWA 1PO22 4AG4A 1SPPB 1Y9QA 3JD73 3M3IA 1CX4A 3MLJA 2QDNA 2W08A 2WO1A 5KHJA 4CCNA 3LIGA 1OT5A 3B01A 5FY7A 5FV3A 2ZACA 3ZLIA 5FZ1A 4GWIA 3RJ2X 3ME2A 1ULCA 1O91A 4KL1A 5IATA 4D7TA 5ACA2 5LBFA 2WAAA 1DGRN 3A22A 1JZ3A 1AR61 2HBUA 2X5IA 5GZEA 2CTVA 3ACHA 1HN0A 1QJY2 2VG9A 2AEYA 1H6YA 2MHFA 5GALA 3VL9A 3WW4A 1E5SA 1Z7S3 2YBSA 3R4SA 5EPAA 4BMEA 4I3PA 5FY1A 3V0BA 1PO13 4GKYA 3VUOA 2EIBA 3GYDA 4HETA 3SLIA 3NAPA 4CEYC 1PVC3 2VZVA 3OEBA 4BQ2A 2VNOA 2BGOA 5FMBA 4Y20B 3POYA 2GDFA 1C1FA 4Q29A 4CEYA 4NPLA 4TLFA 1RIRA 3R0RA 2WWUA 1ULDA 2R042 3UJQA 4IDZA 4EWDA 4E27A 1ZBE1 2JDNA 1J1TA 3LEMA 2QDRA 5CEHA 2JB4A 1WCSA 3JQXA 2JEMA 1BBT3 4FPJA 1W99A 3R4DB 2WINB 1XNDA 1IG0A 2C26A 5GZGA 1OF4A 4N43C 5A3UA 4AVBA 1HB2A 4NAMA 1QXJA 4QD2A 4K1ZA 1ENRA 4WM7A 1WW5A 4QQOA 1RHI2 4FTBA 4LTAA 3VKFC 5JAXA 5ABJC 4QU2A 4D3WA 1H4GA 4N43A 4GXLA 4YRDA 2ILMA 2ZEZA 5DG2A 3BTYA 3LGRA 3DKWA 4R4ZA 4D6QA 2R1DA 1UQXA 4Q4X1 5LBBA 1LOCA 1GBGA 4XF9A 3PMEA 3P3NA 1AX0A 3CL1A 3QACA 5ABJA 5CVRA 3VBOC 5AC91 4XZUG 1COV2 5CBLA 5L9BA 4TLGA 1QQP1 4QGNA 4XDQA 5I91A 1RUOA 2VZPA 1JYTA 3HQUA 4CXYA 2O8QA 2VMCA 2G1MA 3JBG1 1JHNA 1SBFA 3PVOA 2D93A 4JVAA 4CDQA 5KXEA 1V9U1 1WLTA 2XLGA 4MLOA 1RUG1 1RINA 2TUNA 4HVRA 5FPUA 3GJAA 2JIJA 2EALA 4Q4W3 3RWNA 3VBOB 5I93A 5JI7A 3LPGA 5L9RA 2F17A 1AHSA 4JTNA 5BNQA 4Y22B 4AXOA 4PQ9A 5E6HA 2ZOEB 2WT2A 1NXD1 2PA7A 3NNLA 1W03A 5EZWA 1VBB2 5FO7B 1WMEA 2FDHA 4OHZA 3PVEA 2E32A 5A3WA 1IS6A 4XFBA 4ZS2A 4XFIA 2VVDA 3Q8EA 1YI9A 3ETPA 2PHRA 1UKRA 2VECA 2VC9A 1ALYA 1MZFA 2GC2A 1SLTA 2YYOA 2ZX3A 1ONAA 3K46A 3A0NA 5F37A 1BLZA 3LOIA 1ENXA 2VQ0A 1RUC3 1ZVFA 4EJRA 4ATFA 4XBLA 4LJHA 4IGPA 2ENRA 2Y6LA 5I0DA 1FI2A 3H1YA 4C0BA 1CX1A 4EQVA 4RGAA 5FP3A 2XJSA 2D44A 3AX4A 1APNA 4WVWA 4P9WA 1PGL1 4ZXKA 5EHDA 2RS11 4XHXA 4AVSA 1H30A 4E4HA 1IS3A 2ZGKA 3IDCB 4UW4A 4V2VA 2WLQA 1VBA2 2E31A 3FUOA 3I2FA 4JCKA 4ZU4A 5G04L 3J7NA 1QH7A 2YV8A 2ES3A 1AYM3 1RUE2 2OUHA 2ZJCA 3VDDB 1ZRRA 2HBTA 4ATEA 5FZHA 3BIWE 1PK6C 3LEGA 4QX3A 4BQ4A 1W39A 2R071 4QHZA 5FXVA 3LWCA 5DZFA 5GZCA 3V0AA 2DU1A 2JDYA 2E26A 1AF9A 1RUD1 2YFUA 5F3CA 4WZCA 3WF4A 1W6QA 4YFWA 5FYTA 4JGZB 1L3JA 1ND3C 2ZGUA 3OY8A 5FZGA 1O8SA 4IE0A 3WY6A 3ZN6B 5LA0A 3O1MA 5HBAA 3SC7X 1W6QB 3RVHA 3W58A 5A3MA 1PK6B 4LORA 1UX6A 4UFIA 2J1EA 3T2OA 1GNZA 1HRV2 4MG2A 1PZ8A 2ZEXA 4XJ8A 5A7SA 4PCRA 1ASJ3 4I01A 4BHPA 3HQXA 2JDAA 3IDBB 1QJZA 3M3EA 5DAPA 4AYUA 4ZZ8A 1KXGA 1ND3B 1U5IA 5LB6A 2VY0A 1MEC3 3FUQA 3NV2A 5JXHA 3PUAA 4K3UA 4URTA 4XJAA 2RJLA 2BV4A 3BCWA 2RS33 4GKXA 4A41A 5ANNA 1WMXA 4FPEA 5FUNA 5JDBA 3I7DA 1IS4A 5DQ0A 3HNBM 1SFNA 1L7RA 2BZDA 4X6QB 2IVIB 4CDXB 4LLOA 5IK8A 1S0JA 2YZ4A 1G86A 2J22A 1E57A 3AYCA 3SXWA 1UPIA 2KR2A 1GOGA 4XMIA 5IVYA 4UW3A 1G6NA 5JUVA 4CEWB 3ACLA 5D8AA 3M2MA 4META 4E2SA 3N7JA 1UY1A 2LUWA 4IEVA 4CDXA 5K7PA 2RS51 2ARXA 3WG1A 2D6MA 2HWC3 3KCXA 1H2LA 3MW3A 2OKXA 4A7ZA 2DVGA 5T52A 3C8XA 3SNMA 1IPKA 1REDA 1FT9A 4XABA 3O1VA 2CAVA 1OA4A 1OD5A 2ZZQA 2IFWA 4LOTA 1LJ7A 4XUPA 3OD0A 5C4WC 3H8OA 1AYN2 1BK0A 4MZUA 5JSOA 4WV8A 1GLHA 2ADDA 3TN91 1W8UA 1QMJA 1QXPA 4M0HA 1MS0A 3AP7A 1N3PA 4Q4Y3 2NZ9A 3AJZA 4CA9A 2RR13 3WHUA 2DUQA 3POIA 2RMU2 3LIHA 5C4WB 5FO8B 3ZSEA 4RD7A 2CDOA 4NRQA 4DFSA 1VAKA 1WCQA 2A70A 1FYUA 1RUI2 3NJYA 5KR7A 5F5IA 4URAA 5FZBA 1NE6A 4UI9L 2JDHA 3RMXA 3HN1A 3I54A 4EZ4A 4PQQA 2EXJA 2PLV2 3CU7A 1OXCA 4XXAA 4YG3A 1LODA 3B69A 4HSJA 4R9BA 1V6MA 1N1YA 3FZ3A 2B7YA 4LOSA 2ATFA 3THCA 5BV6A 3IN9A 4P9JA 2IXLA 5FPBA 4XMAA 2A6WA 3T09A 2ZXQA 3GALA 1J3QA 4LHSA 3WSOA 2PAMA 3THDA 5JXGA 1TVGA 1Q3EA 1EAH1 3FLRA 2XGXA 4CCOA 1AUYA 4C1WA 1Y4WA 2GAUA 2WWSA 1AJOA 1KFUL 2P17A 5LA1A 1AR62 1TMF2 1D2SA 3LCPA 5FYVA 3SCGA 4IL7A 3VKNA 4MGYE 4CU8A 2P2KA 1OVSA 2WO7A 5J3UA 3UGGA 5KXDA 4HL0A 4LKEA 2HYKA 1Q56A 1TME3 1QOTA 4RL7A 2GMPA 4R9CA 4AQ6A 1XU1A 2DDUA 3B00A 2R063 4COWA 4AI0A 5FKCA 3CIHA 3LDKA 4UFLA 1JBCA 4AFMA 1FMD3 2E51A 4XE9A 5IAXA 3N3HA 3D0JA 3AL5A 5D2AA 2DURA 3FC0A 4XF3A 2JE9A 3MYXA 3ZKUA 2BPA2 3EMRA 2CGOA 4Z2AA 2W1SA 2PQSA 3CMGA 1W6MA 4AGGA 1FOD3 3PMSA 5FY0A 1LHOA 3M7AA 1AL0G 2CSGA 2SBAA 1QOOA 1W6MB 4AFAA 4IV3C 1DGRA 4CU6A 3I3MA 4B8EA 2P37A 4Q4V1 3E6CC 1AL23 4Z8BA 4XIOA 4EV0A 2A6VA 2XBO3 5K9YA 4PLMA 5DUUA 2G19A 4IV3A 1J83A 1TNRA 3ZXFA 4CCMA 3LKJA 2QTWB 4Y26A 4LBQB 1HJFA 1PZ9A 2DWRA 4ITCA 4IV3B 4Q4X2 4S2GA 1JYXA 4ES8A 3O1RA 1KFXL 2IXHA 3OPZA 1X9PA 3WQ1A 4A6SA 1W3XA 4XIKA 1R082 2HWD3 5FLJA 1MS5A 4FPFA 5FK7A 1R091 4ZZ5A 5A32A 1QQP2 1WLDA 2ZGNA 4FSJA 3D6EA 3RI9A 2RDQA 4CRQA 1V6KA 1E5RA 3PU3A 1V9U2 1QEXA 5C8CB 3ZYHA 1RUG2 4AOCA 4UFKA 1O5UA 1MS3A 3PIGA 4SBVA 3OGJA 3LE0A 1ULFA 4DY3A 1YXWA 5IVJA 2WS93 3U4XA 5F3GA 1GFF2 4RHV2 4DPNA 1GSLA 4E2QA 1W9SA 2ZX0A 1QKQA 1C1LA 4BLIA 1AR71 1ZM1A 2EVXA 1WBFA 4QPWA 4BPZA 3FHIB 3VHNA 4QPGC 4YSFA 1LRHA 3OPWA 5CG9A 3DGTA 1OI6A 5LY2A 3WNMA 5CA6A 3WG3A 1YI7A 3KB5A 4I09A 1RXGA 2ZCWA 2Y34A 1Q8PA 1JMUB 3AP9A 1PO23 4LO4B 5DAVA 1XXNA 1BZWA 3PDQA 5FZLA 3MW4A 4JKMA 2IXCA 4QPGB 2Y60A 4C90A 3T1MA 5BUVA 2SLIA 1OC1A 5EJZB 5F5QA 2D6OX 2B9VA 3NNFA 3SITA 4BM8A 1QJFA 1QXRA 1RVF1 4A7YA 1K45A 2RDNA 5ACA3 3HJRA 4KNCA 3U14A 1UY0A 1YFYA 2BGPA 2ORXA 3T1LA 3VZOA 1QJY3 5IUQA 3TYJA 5FO9B 4JKKA 3N36A 3VD4A 5HCHA 2EAAA 4I0BA 5FYBA 1KDKA 1CD3G 2OW4A 3WP5A 3EXUA 3IDAA 4UT5A 2E7AA 4ZKTB 3V56A 3C7EA 4YZ3A 3CJIC 5I0TA 4WZFA 2PHDA 2UYAA 5FPXA 3HVDA 1VBE2 1GWLA 4XQDA 1H2NA 5A3LA 4IE7A 3FFQA 4JQTA 2R072 1Z0HA 4QPYA 3ZO0B 2NMNA 4PF1A 3ZXLA 4XTPA 1RUD2 3CJIA 4P00B 2YBKA 3AZYA 1EV12 1GP6A 3ACIA 3GZUC 1HQWA 3RG0A 4A44A 4O65A 4Z2WA 1YJKA 2R043 4CZSA 1WGPA 3FE5A 4Y1XA 1GANA 5JMCA 2DVBA 1BQPA 3ES1A 3LZZA 5FZEA 2D98A 2DCKA 3ELNA 3EHKA 1UMZA 2JG8A 2OVUA 4FPCA 1PM4A 2V5YA 3ZFEC 5E89A 1OUXA 4CP0A 4LNVA 5FZ8A 1RHI3 1UAIA 3BALA 3M3QA 3IIAA 1S2KA 3BOWA 2KXLA 2DTWA 3K3NA 3GDBA 2ID4A 3ZR6A 3IDEA 2J1UA 4LIVA 4FVVA 4OFGA 4OMDA 1ZA4A 2XOMA 3ZFEB 3P3PA 1J3RA 1DGLA 1UZYA 3TAYA 4D6SA 2D5FA 3RS6A 1COV3 5F5CA 5CISA 3E6DA 1W2UA 3GHNA 4I30A 1CIYA 2IXIA 3NKGA 1V6IA 2WNVA 2XQRA 5CFDC 1V6JA 1JI6A 5L7OC 2GC3A 1DZTA 3J8F1 2BNOA 2FCVA 4TSVA 4DQAA 1K5MA 4H14A 1US2A 1OURA 4QGMA 4BQWA 5CFDA 4AGRA 4UFHA 3AC0A 3VKLA 2Q8CA 1NLSA 2P6HA 1VBB3 2GC1A 1GP5A 2JIGA 3LAGA 3N9NA 4WVVA 3WX5A 4CU9A 5L7OA 1POQA 2IVJA 1IZ3A 2B45X 3NNGA 4K21A 5FYMA 5CFDB 2C5DA 4NE9A 3B9IA 2LW8A 2VVEA 4BLJA 2BVBA 3ZFGB 2Z5WA 2CGPA 3ATGA 4LK7A 3IMNA 2RV9A 2JXAA 3PUSA 2YU1A 2VBPA 4LUKA 4O9GA 2VMEA 2XJPA 3INAA 1YFWA 1WW7A 1QJX1 4L92A 4E8DA 4YM0A 3WCRA 4JTOA 1SCRA 4A6OA 4PT6A 2XB6C 4NRPA 2PHLA 3W21A 3KVAA 3K48A 1WWYA 2RE9A 1O6UA 4QX1A 5FMCA 3SEEA 5KHKA 2NQYA 2VXRA 1Y3TA 2XKOA 4WVMA 1ZZBA 4B3NA 4JHTA 4FFIA 1A34A 1LNSA 4WVMB 1DHKB 3ZM8A 1VBA3 4OI0A 1LESA 2MEV1 5CIRA 3KT1A 4DXTA 5LASA 1RUE3 1YJLA 3DPRC 3U37A 5C33A 2VD7A 4LBJA 4J25A 2VGDA 2YXSA 3MIFA 1VP6A 5K4LA 4AI9A 1EAH2 4O61A 3VBHA 1JYNA 4TZDA 1QF3A 3USUA 1XNAA 1VAVA 1RUJ1 1VPHA 2WZEA 1MZEA 2XJVA 2LS6A 1Q8SA 1AR91 3WHTA
chains in the Genus database with same CATH topology
1GNHA 1C8M2 1MQTC 2PAEA 4H7MA 3DPRB 3PNAA 1H1AA 2IWGB 4K40A 1DDLA 4AFCA 1A6CA 2IZWA 2HWB1 1HRV3 2JX9A 2D3SA 4AF9A 5FQ0A 2EXKA 4XFGA 1V6LA 3VBSB 3CO2A 1R1A1 1EP0A 1W6OB 1MQTB 1UPSA 2XJRA 1QNWA 4DRRA 4HPKA 4XQWA 3CF6E 3I4IA 4Y24A 5DZEA 4B29A 2LALA 2XH6A 2E7QA 4WM8B 1Q43A 2G4IA 1O3RA 4COZA 4LBMA 1CONA 2H0BA 4Q4V2 1LGCA 2NP0A 4YVWB 4G9SB 2AENA 2ZPXA 2EF6A 3NW4A 4N9IA 1ZBA1 1SLAA 2ET7A 1UKGA 5T5LA 1MS4A 1U12A 4QPIC 1S0DA 4R4XA 3O0VA 1QJU1 4YM3A 4Y1UA 4PLNA 1U5YA 5JVVA 4P14A 3PVBB 2FQPA 4QPIB 1R092 4E9KA 4F7ZA 2HWE1 1TNFA 2WQ4A 4XBQA 1ZZCA 1DYKA 3KSCA 3WW1A 5B2GB 3WXPA 5C6CA 1AYN3 4COVA 1RUH2 2O1QA 1YWKA 1LOGA 5BNNA 2IFRA 5AVPA 1FPN1 5EYXA 1AR72 4YZ4A 4OHYA 3AMMA 5KBFA 4L2NA 2XL7A 3AKTA 3IPVB 4K8FA 1RUI3 1XE8A 3VBFC 1NY72 3AKRA 4YW2A 1VBD1 3MLKA 3RYPA 1WMFA 4Q26A 2W68A 2NPIA 4FPOB 3QCWA 4N7UA 2G9FA 1YRZA 5BNOC 4IEXA 2XJQA 4LBLA 3VBFB 1H8TC 4OLLA 3NV4A 1D0HA 5DUVA 1BKZA 4AEDA 4LHKA 4B4RA 3WP3A 4COUA 1F8VA 4LHNA 5BNOA 2D6PA 2GNTA 5SV8A 3KT4A 1AR63 2BW8A 4OHXA 1TMF3 2A71A 1S2BA 1VJ2A 3D0SA 3O0WA 5BNOB 1NCQC 1VALA 1I1EA 4HSLA 1H8TB 1AJKA 1OOPA 1UU4A 2ZBJA 2B5HA 2FZ1A 1CR7A 1JH5A 1JXNA 1YNAA 2AGSA 1LR5A 4L8QA 1CPNA 1NCQB 2VH9A 5T50A 3ZIWA 2A6YA 1SQ4A 1IOAA 1GQHA 4D94A 3PTYA 1JYIA 4HKWA 4MXWB 1GR3A 3NO8A 5DUWA 5HXVA 4HLTA 4COYA 3ZFFC 1PGW2 4Y20A 1LKNA 2DVDA 3AP5A 1G9BA 4EWEA 3URFA 2D6NA 2ZZJA 2WFF1 3E5QA 1RC6A 3WINE 2YMZA 1QWRA 4Q4X3 5H9PA 2JJ6A 1QHDA 2Y26A 3DN7A 3ZFFB 4C1XA 1R083 1WMDA 3J9SA 1QQP3 4K20A 4YGBA 1WD3A 1C8NA 1DBNA 3MIHA 4P9YA 2CY6A 2VW0A 2ZMLA 2VVFA 1V9U3 5J09A 1RUG3 2HEWF 3NKTA 1SEFA 2A6XA 3JD71 1IS5A 4AFDA 2YC0A 4RHV3 3RDIA 1XNKA 3I59B 3M8LA 3C3VA 3N7MA 3O7OA 3VBUC 3KS7A 5FMOL 4GMP1 1FNYA 2HJIA 4YGCA 1LOBA 2VOWA 2YY1A 5FBZA 5JI9A 1H2KA 4XQ4A 1OQDA 1F5FA 2ZHLA 2XG3A 2YGMA 4HMZA 3PHMA 5KXBA 5DUXA 3SH4A 3VBUB 1PHMA 4Z82A 4PBOA 4OVEA 2DUOA 4GB32 3TNQA 2YGLA 3WUCA 4L99A 3VBOA 1PVC1 1QJX2 2UY8A 2XWBB 1O7FA 5CB7A 4Y22A 4OUMA 3D5OA 4NO4A 4AI1A 4XILA 2PN5A 3AXDA 1HDKA 4GIQA 4ASMB 3RJRA 2MEV2 3TRSB 3BOPA 1BBT1 3O14A 2VOVA 2FMYA 4CP1A 2A73B 3ZSMA 2WSUA 1LCLA 4KGQA 1VBE3 1T6GC 1HKDA 5AFBA 1BJQA 2E7TA 2R073 1SCSA 3UKTA 1DFQA 1RUD3 1EV13 1C28A 1S0GA 1RUJ2 2VNRA 2XWJB 3PJYA 2EAKA 1AR92 1IKPA 2CWMA 3WDWA 5JZGC 2CWSA 3VDDC 2ZGPA 3PVNA 1OQ1A 1RUNA 3D4KA 5HI0A 4P5HA 3WDUA 4JDOA 2HWB2 3LA2A 2E9QA 4HN0A 1VB4A 3VDDA 4JGZC 4BE3A 1R1A2 2R30A 4M00A 1LU1A 3RI8A 4JV4A 5JZGB 3DL3A 5IK7A 4KWLA 3H50A 4Q0SA 3OYWB 4R52A 2TEPA 1AR81 1CAXB 2DFBA 1RJ7A 3CEWA 4Q4W1 4JGZA 2K0GA 5A33A 2VMIA 3ZN6A 5E88A 1WA4A 3ZXAC 5A33B 1PK6A 3VL8A 2Z79A 3DUIA 2PHTA 1PGSA 2DVFA 3ZDSA 4IQPA 1ND3A 4AQ2A 5LK7B 3AYAA 3FMGA 4YZ2A 1ZNPA 4X8NA 3AJYA 2QVSB 2FBEA 4HT1T 4QGLA 4YVSC 3VV1A 1RUC1 4ES9A 1IPJA 3ILFA 2K9ZA 1C4RA 4J1XA 4Q1PA 2YDEA 3USSA 3WG4A 5GLTA 1GZCA 5JPMB 4CEWC 1AXYA 1ZZ8A 2H0VA 1HRI1 1X50A 3GZTB 1SACA 4YVSB 3U11A 4L97A 4XF0A 4YW3A 3JU9A 3R05A 4YW5A 5GLZA 3ZYIB 4CEWA 4O9EA 1LHWA 3HT1A 1A78A 2JDZA 2XPJA 4IEUA 4LBNA 2BUKA 1VRH1 1XQNA 5L19A 3EBRA 4Q0PA 1VBD2 2MPFA 2NN8A 1PNFA 4QMAA 1TQ5A 4PIZA 2WNUC 3AZZA 3UV9A 3H7JA 1AX1A 1YO8A 2RHPA 3WNXA 3WLUA 1JUIA 5GJ6A 1MVQA 2WNUA 2ZS6B 3GF6A 2PTMA 1W6PB 2R32A 4LHLA 1EAH3 4LO6B 5BPXA 5C4WA 2WNUB 1BVVA 4R8HA 1J58A 2H6BA 4EN8B 1DQ6A 4PIXA 5EWSA 3MF6A 1W0OA 2HEYF 4MV2A 4AEKA 5FOBB 1C8M3 4MSVA 3DV8A 2WSVA 4HZFA 5FREA 3WDTA 3ZXJA 3UL2A 4EN7B 4FT8A 3ILRA 3ZYRA 2I45A 2GNMA 3N35A 2UU8A 4XJ9A 1OFSA 2ZMKA 4UW5A 1O4TA 4BYYA 1C5HA 3KMHA 4GH4C 2QCSB 1J1LA 3E5UA 2XVLA 3NSTA 3OGGA 3AXEA 4XHBA 3UKNA 4B4QA 2XJUA 1AX2A 3AYEA 4Q4V3 3FLTA 3LSDA 1LB2A 3VZNA 4XFCA 3MIEA 2F4PA 4GH4B 3B7MA 1URXA 1EY2A 3C2UA 2R0HA 4AWDA 4GWNA 3IKWA 4N9HA 3AZVA 4Q27A 4JRAA 1OQEA 2WFF2 4PBPA 5I0SA 4QX5A 5L36A 3RYKA 2GH2A 1ZZ7A 1ZBE2 3OJBA 3E97A 3H1WA 1R093 2JENA 2B46X 1PZ7A 3WV6A 1G9CA 2C0ZA 5F6KA 4A7KA 1YLLA 2OIIA 1ZREA 1RUH3 3I2DA 4CDUC 1F2NA 4FO9A 3ZIXA 3U0ZA 4OHWA 4HFSA 2D43A 4LBQA 1AR73 4BZ4A 4KG0A 4EN0A 1BVP1 4MYEA 5HCAA 5J36A 1ZZ9A 2WZR1 3HWJA 1BYHA 3TWIA 5C8CC 4LO5B 1UU6A 1FNZA 2HWF1 3KM5A 4RSUA 1RGSA 1SLLA 1VBC1 3E5XA 4Y1YA 5E1RA 1CAWB 1Q5OA 4CDUB 5C9AC 3SISA 4FBFA 4FPHA 5AC92 2GC0A 1Y7BA 2GN7A 5L73A 3AP6A 1SLCA 2R1BA 4X6RB 4AHZA 5C8CA 3RRDA 1TME1 2VMGA 3JBG2 3VZKA 1H8VA 4E4ZA 2D97A 5E8AA 2B8MA 4R9DA 4JGYB 2WFPA 4KU7A 5C9AB 2UWCA 2D5HA 3MEPA 1O3TA 2D3RA 1VAMA 1SDWA 2Y0IA 2WT1A 3NWKA 1HLCA 2OPKA 1D4M1 3OBRA 1LGNA 1MVEA 1DG6A 1KQRA 4BMBA 3ZMNA 1FOD1 5H9RA 3D82A 1OHFA 4QPGA 2JE7A 4MGKE 4BH9A 1POV0 2UYBA 1AXKA 1S1AA 4IESA 2A3YA 4LA2A 1C5IA 4G3YC 2KM2A 3S7IA 1MR5A 5DXDA 4W65A 2GZWA 2XLFA 4HKLA 1TEIA 2NYYA 2Y0OA 4XFFA 5KHHA 1RMU1 1PGL2 2BFUS 3MLLA 1IGOA 4RA0A 2RS12 2H6CA 2YHJA 4AVAA 4JQRA 4DZGA 2WQZC 1ZRFA 1QU0A 1WUVA 3RPQA 4AW7A 1AR82 4XW3A 3ETQA 2PAKA 1W6NB 4U2AA 2AUYA 5FAXA 3W59A 2XLAA 2ZGMA 2NM1A 3KD4A 5LEKA 3JB4C 2A5ZA 2RM21 3SH5A 1CJPA 1ULGA 1YUDA 2A3XA 1ZYBA 3IM0A 1H4HA 1HW5A 4IEYA 5DG1A 3B93A 2BGCA 1EYBA 2OZ6A 5JR7B 1S55A 2AREA 4U36A 1Z78A 4LO7A 3ZFEA 1VIWB 3M1HA 1HV1A 4HKOA 5J37A 1HRI2 1C57A 1QJY1 1AZDA 3TB0A 1PMIA 4OZXA 4MUVA 4FTSA 4GB33 1SBDA 2WT0A 4BA6A 2QQPA 1QJX3 4KWKA 4ISRA 1VRH2 2Y38A 2RS52 1XU2A 3ZFGC 1NE4A 3UK9A 2OUJA 4M3CA 3R4UA 4EN9B 5J7MA 4Y4YA 5H9SA 4NR1A 4YGDA 2R041 4M3CB 3LA3A 1YFUA 4INDA 4Q0QA 5KXCA 3ZFGA 1BEV1 4YM1A 2MEV3 4KWJA 4D7YA 4NHMA 2ERFA 2YPJA 1QDOA 4QT6A 3TN92 3MFCA 2BBVA 3VBRC 5LK5A 3KGZA 2PHXA 4Z1VA 3OTFA 2A75A 1GZ9A 3APBA 1RUJ3 1DQ0A 5KHGA 1GYKA 4XF1A 1AR93 2AYHA 4LE3A 3MIGA 1R1ZA 1WW4A 3VBRB 1KS4A 2HWB3 4FPLA 4I02A 4M3CE 5J96B 2TBVA 3KLSA 1COV1 1B35B 4MGIE 4IV1B 3PJQA 1AVBA 4EN6B 4Q8KA 2VPVA 2X53S 3FBYA 3VZLA 4ISQA 4AHYA 3HD8B 1CESA 4IEZA 4N53C 1GZWA 3JZVA 5FRAA 1POV3 3ZPYA 4LA3A 1HXS1 1N1VA 3DPRA 4N90A 5EYYA 3ZSKA 4AE2A 1GZWB 3NL1A 5LRRA 2VNGA 3POWA 4AEMA 3S0MA 4B4PA 3AFKA 2XJTA 5BNPC 2WNEA 3MICA 1XNBA 3KGLA 3QOPA 4GMP0 2Q1MA 4N53B 3VBSA 3WUDA 1W6OA 4WM8C 1D0GA 1MQTA 3FJSA 3FX3A 3WDXA 1YHFA 1DQ2A 2E53A 2PELA 2PFWA 3MIBA 1MZ6A 3SH3A 4NPRA 1LHNA 5BNPB 4LLFA 4YVWC 4WM8A 1NA1C 4KGGA 1SFYA 1KS5A 1O4YA 2R16A 3Q9OA 4HANA 3SCFA 1S0FA 4K7JA 1H2MA 4YVWA 2Q5TA 4KQ7A 1OLRA 1U5XA 4LBQD 5LRSA 4E2GA 1VBA1 4I3GA 4RFT0 1NA1B 3EQEA 1V6OA 3JCIA 4MH0E 1CAUB 3NJZA 4MGZE 2F6BA 1CIWA 1QNYA 2WZR2 1GQGA 3MPPG 4HVOA 4LO8A 3TNPB 2HWF2 1VBC2 1OA2A 3O5SA 4AI2A 1VBD3 3ECQA 4QPIA 4E4DX 4TWTA 1LEDA 3WZ1A 2QZ3A 4QQ2A 4C91A 2D3PA 4SLIA 1NOVA 5BY5A 3O0XA 4FQZA 2BNNA 3MW2A 3L9JT 1KJRA 4UBHA 2D6LX 2UWBA 2HEVF 1QGLA 4FCAA 1D2QA 4UBGA 4F83A 5F9TA 3IPVA 2N7GA 4FP2A 3THTA 2RMU3 4GA9A 2CYFA 4CDWC 1HQNA 1KDMA 1D4M2 1RUF1 4P9IA 1XNCA 1OPMA 1QH6A 4IETA 4R9AA 4RGGA 4RS5C 1QY4A 2Q4SA 2PLV3 1RL3A 4XEZA 4CDWA 1X36A 3G7DA 5EV7A 3VBFA 4CDWB 5CFCC 4FPGA 5FPZA 5FMOS 5T5JA 2W0XA 1PIV1 3J26N 1ZRCA 3HAGA 3HMYA 4RS5B 1KITA 4N7IA 1RVF2 3QBQA 3FFZA 3B5LB 3ROUA 2GSYA 4IXLA 1RMU2 2ZHNA 4V1PA 3HBZA 1H8TA 1NQDA 5CFCB 1M4WA 3WDYA 4IEQA 5I0UA 1O4ZA 1SLIA 4RR3C 2WZPP 1HV0A 2YUEA 2ZA9A 5JOXA 1NQJA 1XYOA 2A6ZA 2ZAAA 1UF2C 1NCQA 3JUUA 2OA2A 3ASIA 3BODA 4PJYA 3ZYPA 4RR3A 4RQPB 5H9QA 2GNBA 1J3PA 2CL2A 2WFF3 3BPZA 4RR3B 1UZZA 1JN2P 4MXWA 1IHMA 1W0PA 1ZBE3 4NN0A 4S2DA 5JOYA 4NHLA 2IXKA 1RUI1 2B42B 2RM22 1OMIA 4XF4A 3ZXGA 4NWWA 1XE7A 3M3CA 1X7NA 3NVCA 4DNYA 1MS9A 4XYXA 1S0BA 2X5IC 2PQQA 4AVVA 1CVNA 3AFGA 1V00A 1X33A 3THPA 3CJXA 4OI1A 1QOSA 4GMP3 3ZFFA 1RITA 5TSWA 2P3IA 5DDJ1 1TMF1 3NAPC 3WR0A 5AC93 2X5IB 4YZ1A 3HIFA 3ES4A 4OULA 4ASLA 3JBG3 4AFBA 3V0BB 3ZX7A 3I59A 1LOAA 3POSA 3NAPB 3J8F2 2AR6A 3IT8A 5IK4A 2DTYA 2I74A 5HCFA 4WVZA 4QQPA 1IKQA 4XETA 4CEYB 4FTEA 1NYWA 1BEV2 3D8CA 4WM7C 4W6YA 1ZX5A 1A8DA 4AGVA 3VBUA 2LTNA 1Z7S1 3MF9A 3N4MA 1V6NA 1PO11 5DZGA 2PHWA 1OFNA 1FXZA 3ZMOA 2R6QA 4CP2A 1JOJA 2GNDA 2Z42A 3BTAA 2ARBA 4A2UA 4IEWA 4WM7B 1G7YA 5KWRA 4XJUA 3M4FA 1REFA 3ALQA 1F9KA 1MACA 2UWAA 4N43B 3MDPA 1JYCA 3E6BA 4IERA 3WD5A 2BWCA 4AQTA 2CNAA 2RS13 4CDQC 4LT5A 1WBLA 4AHWA 2ZX2A 1R081 5GZFA 2RJKA 1CAVA 5ABJB 3GBFA 4DMIA 3B94A 3IBMA 1CAVB 4B7KA 3VN4A 2QZ2A 2GMMA 2JECA 3O12A 4OUSA 1AR83 4CDQB 2C1FA 4GULA 4RHV1 4LR4A 3RQ0A 4PLOA 1OSGA 4JRLA 5GLWA 4L9BA 4QHBA 1HXS2 5F1RA 2JG9C 4BWOA 2JKBA 5T3NA 1V70A 2NLRA 3GHMA 2WC2A 1KD7A 5GLUA 2JG9A 2AH2A 4YZ5A 5KC6A 3DF0A 1O5LA 3WG2A 5JZGA 3MI8A 2JG9B 1XYPA 2WL1A 3OYWA 4XJZA 3OD4A 1CAXA 3AKPA 2DU0A 3ZXEA 3ZYGA 4H55A 2VUJA 3B9CA 4M01A 4XXPA 4BCUA 4DB5A 2X8KA 5LEJA 3AP4A 1YCIA 4EWAA 3ZSLA 4M0NA 5FFOC 1I9RA 3N7LA 3AZXA 4AI3A 2B9UA 1HRI3 4M3CF 4QM9A 2EA7A 3H7YA 3HT2A 4XBNA 4KG8A 4YG0A 1S0CA 3VKOA 2BVVA 2NMOA 2VOKA 1ZBA2 1KRIA 3LA7A 1UCXA 1VBE1 1WD4A 2CV6A 1VRH3 4FOVA 5JWPA 5JCTA 1QJU2 2RS53 3V64A 5JPNB 2ZABA 1EV11 4LUMA 3UKVA 3V0AB 2GALA 3IWZA 5CU1A 2HWE2 4YVSA 3OY8B 3B3QE 2ZGTA 3VZMA 3H9AA 3I8TA 1NZCA 1F31A 4BQ1A 5GLVA 3TN93 3VZJA 5FOJB 3WP4A 1FV2A 1NXMA 1AYM1 1G9DA 1FPN2 3AKQA 2Z69A 2UURA 4Q1RA 3AKSA 1TE1B 2P3JA 4XJWA 2VUAA 1RUF2 4LE4A 1LEMA 3J4UH 5AFEA 4S2FA 1BCXA 2R49A 1G9FA 3AMQA 4Z07A 2PHFA 2XUMA 1WW6A 1H9PA 5D8AC 1X82A 1HIXA 2UY9A 4GWMA 3GNEA 4OI4A 2YROA 2IC1A 4CDXC 5C8WA 1W6PA 1PIV2 4FXKB 3SHRA 1ASJ1 4WBBA 2ZMNA 2EXIA 3VHRA 5I0RA 4FXGB 3L2HA 1MEC1 1VB2A 5D8AB 1DQ4A 4D69A 3H3UA 3SMHA 4CDXB 2RS31 4YGEA 3X29B 4XOGA 2ZAHA 2VOXA 5T55A 3LSEA 1GKBA 2GMEA 1J59A 4YFZA 3VKMA 2QUOA 3CLPA 4YG6A 3TOJA 1Q8OA 3ZN4A 1U5ZA 4PDWC 3HR9A 2DCYA 2WIIB 3L2YA 3TBDA 2B39A 4DS0A 1H0BA 1LULA 1CPMA 4PDWA 1S0IA 5J98B 1PNGA 3GZAA 4PDWB 2HWC1 2I07B 1FX5A 2XVKA 4Y1ZA 5IT6A 2QNKA 5CG8A 4GH4A 1JW6A 4BIOA 1I5ZA 3AZWA 5FCCA 3U10A 2AZ5A 4KH9A 4D7SA 4YARA 2WZR3 4Q4Y1 2RR11 1MS8A 2HWF3 2ZHMA 1VBC3 5DDJ2 4DY5A 3QLQA 1EPZA 1YFXA 1D4VB 2FMDA 3OF1A 1C8M1 4OHVA 2V09A 4QM8A 5J48A 1XRUA 4MVTA 1LOEA 3VHPA 3VHOA 1CJDA 1ENQA 4XFAA 2BTVC 4YM2A 2XHKA 2VW2A 2D7FA 5FTTC 4FOWA 3JD72 1OPOA 3WQ0A 1N1TA 4KU8A 3ST7A 4MXVA 1DGWA 1LTEA 2ZX4A 4JDMA 1D4M3 1CAWA 1MS1A 4CDUA 4ORFA 3MIDA 3UJOA 1UU5A 4JGYC 1H1MA 3AYDA 1N3OA 5GZDA 1OA3A 3H0OA 2VMHA 4FPYA 2VU9A 4GALA 5I8YA 1X8EA 1Z7S2 1PO12 5FDBA 4JGYA 3KT7A 5C9AA 3WW2A 1GICA 2R0FA 1PVC2 1ULEA 2R061 2GH8A 3T2TA 1ENSA 1RVF3 3MFAA 2EXHA 1FMD1 2ZGRA 1RMU3 4IEPA 4DXZA 5JIUA 1OLQA 4HBNA 1N47A 2XKPA 4W6XA 3GBWA 1RJ8A 4C0HA 2ZKLA 1BBT2 3ZXDA 1LU2A 5EFUA 3GBGA 1B09A 5A32B 5D1IA 4OI2A 5BXXA 1RUH1 4B7EA 1AL21 1DQ5A 4P9GA 2XBO1 3FBMA 1LHUA 3RNSA 4PIYA 4Q8LA 5EXOA 3VLBB 2ZTNA 1NY71 2E6VA 4J6GA 5BYNA 3AM2A 2RM23 5FLIA 2FZ2A 2HWD1 1I3HA 5JSRA 5JIAA 1WCKA 3NV1A 2GN3A 2W52A 4G4FA 1W6NA 1WLWA 4E4SA 1O3QA 4YW4A 5KHIA 1DGWX 3AB0A 1FAYA 2