4XAAA

Crystal structure of avio1 from streptomyces viridochromogenes tue57
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
221
structure length
221
Chain Sequence
b'TATLDRAAAIERFRRDGFANAGPVLAPDAIARLKAGAERLITRFTDEGLRSDDYWNFPVEGDERPVLYRVHNLEKQDWAPERDLLHREELAQLAAAFVDGPVVPTAYALVLKEPYRAAEVPWHRDRVNVGPRTVCNLSICLDDAGPHNGCLEAVPGSHLLPDDAEVAKVRATGPVVPVPVSQGDVVVHDVRLVHGSGPNANGSWRRTIVIEYADPAAPPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxygenase
molecule tags Oxidoreductase
source organism Streptomyces viridochromogenes tue57
publication title Oxidative cyclizations in orthosomycin biosynthesis expand the known chemistry of an oxygenase superfamily.
pubmed doi rcsb
total genus 67
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4xaaA00
5LASA 4ZONA 5LB6A 3HQUA 4ZPIA 4MHUA 3GZEA 4UWDA 5EPAA 3OUHA 2Y34A 3BVCA 3NNLA 5HV0A 3OBZA 5C5TA 5LATA 4XCAA 4NHKA 2HBUA 4NHLA 5HV4A 2FCVA 4NMIA 4XAAA 5DAVA 5L9RA 3W21A 4NHMA 5LA9A 3PL0A 5IATA 2G19A 2JIJA 5DAQA 2RG4A 4XC9A 5A3UA 4MHRA 5DAWA 4Q5OA 2Y33A 3GJBA 3DKQA 3HQRA 3KT7A 4KBZA 5ERLA 5LBFA 5EP9A 4Y5TA 2RDRA 5DAPA 5M0TA 3KT4A 4JZRA 2RDNA 4XABA 3GJAA 4XCBA 2RDQA 2JIGA 3NNFA 3KT1A 4J25A 5EQUA 2OPWA 5L9VA 2FCTA 4IW3A 5LBEA 2A1XA 3EMRA 3MGUA 3NNMA 5IAXA 4BQXA 3OUJA 4NHYA 4XACA 5LBBA 5DAXA 3W20A 5IAVA 2FCUA 2RDSA 5C5UA 3OUIA 2HBTA 3NNJA 5L9BA 3ITQA 2V4AA 4NHXA 4BQYA 2G1MA 4BQWA 4Y5SA 5LBCA 4NAOA
chains in the Genus database with same CATH superfamily
3BIEA 2VQTA 1KDMA 1FYUA 1Q8VA 1SFNA 4GWMA 1PK6C 3VKLA 1LOFA 1QH6A 5A7NA 1UIJA 2QE3A 3AYDA 1PO22 2DVBA 4MHUA 4OCTA 5T5OA 2O8QA 5T55A 3JCIA 3U4XA 5I0RA 2QQIA 1B35A 1JXNA 2ZTNA 3E1F1 3POEA 4COZA 4Z8BA 2UY9A 2NP0A 2ZGRA 2R071 1OLMA 4CE8A 5LATA 2OUHA 1O59A 4WM7C 4L92A 4YVWA 1VBD1 4ZKTB 1ENSA 4KU7A 1W9FA 1DYKA 5FZHA 3TYJA 4F8AA 5B4NA 1RUH1 1AR92 5D8AC 2FCVA 1UO9A 5IFPA 2R062 5KHHA 2XUEA 1I5PA 1MEC2 1W2TA 4UW5A 2W08A 2YDEA 5FY5A 4FQZA 2A6ZA 1W8OA 2Z4FA 3WP3A 5F2WA 2RR12 4AYUA 1PGSA 2VQUA 5JSPA 4FXGB 3B94A 4QB2A 1LHUA 1PVC1 1FMD3 4BCUA 5IVFA 4XUPA 1VBE2 1JZ3A 1PO23 4CDUA 2BERA 5JI7A 2WNVB 1D4M2 5IHRA 2JECA 4XC9A 1FNYA 2JXAA 4HG6B 4ZXEA 4P14A 2EF6A 1JYIA 3LFMA 4MO3M 4RHV2 1JZ6A 4NPRA 3GJBA 1SG3A 2PHFA 4O9EA 5A33B 3LD8A 1TE1B 2GMMA 5I0DA 5IK5A 1NYWA 1ZREA 4EN8B 2ATFA 4NROA 2W3JA 1TMF2 5BNQA 2R073 5F3IA 3AL6A 4FPJA 5K9YA 4BDVB 2FBEA 1JZ4A 4CCEA 5GLTA 2VZ3A 1NCQC 1EPZA 2P2KA 4Z2AA 1EUTA 4CCNA 1U5YA 2AYHA 2VUCA 2BNMA 2X5IA 5D8AB 5T50A 1ASJ1 4QHOA 3FHIB 3LEMA 3HVDA 1CD3G 2WNOA 4AR2A 3NNFA 4EWDA 5JXHA 1O8SA 5HCBA 4AGRA 2PQQA 1IPSA 1HB1A 4Y1YA 4CCKA 3DN7A 5BNOB 1FMD2 4XHXA 3VDDA 2FDJA 1U12A 5E88A 3V0BB 1NUKA 5JR7B 3I2DA 1QIQA 1QJU3 1F2NA 5L7OA 1PVC3 2CAUA 2W91A 4FI9A 5IAXA 2X5IB 4U2AA 5FQ0B 4CYDA 4HPKA 5FCCA 1O5UA 2JDNA 5GM0A 5L36A 2A6WA 3AZWA 3LEGA 2JE8A 2X53S 5APAA 4D6RA 1HRI3 1GZTA 4K6BA 3U78A 1CONA 3N7LA 3NMBA 3OGJA 3UESA 4CCLA 1VBB3 4DOUA 1NT0A 5F9TA 3V0BA 2X09A 2YMZA 1HXS3 4LKDA 4OMCA 4LHKA 2P37A 3KV4A 4U36A 1WW4A 5CKQA 3O1RA 5L9BA 3ITQA 5FYHA 3V64A 2VZ1A 4FPHA 1S0FA 3GNEA 1SFPA 1N3PA 3WG1A 4YLZA 4CXXA 4AQ6A 1PMJX 3B00A 2ADDA 4CDWB 4MVTA 5H9PA 1FV2A 2KXLA 5FZ0A 4AQSA 4CXWA 3BUCA 1S0DA 2DV9A 1JHJA 2ZX4A 3PHMA 4XFCA 2DFCA 4FPFA 4CDXB 4RL7A 3S0MA 4YW2A 1ZRDA 2BGPA 2ZS6B 4XJUA 5DXDA 2OZ6A 4DQAA 2LRPA 2VZTA 4LORA 2YY1A 2UURA 5KWRA 2B4KA 1MS0A 1Z78A 4KU8A 2VGDA 3ZYBA 4RGKA 4QX3A 2VOXA 1AYM3 1Q3EA 2FHRA 4JTOA 1HRI1 1LOFC 3MFAA 3MDPA 4LBNA 5D2AA 1YI9A 3VKOA 3VBRA 3WSOA 1COV2 4YGEA 3MLLA 2JG9C 3HT2A 1OI6A 2VNRA 2WLPA 3M70A 4CDXC 4FT8A 2EIEA 2Y6FA 5FWJA 1J3PA 3ES1A 1O4ZA 4BB3A 2C5DA 3ILFA 3UKVA 1C5HA 2VMEA 1DQ1A 3AXDA 4AGGA 2OS2A 5LK7B 2Q8OA 5A3OA 2ZACA 2BFUS 4WVZA 4WZFA 5CKMA 3AKSA 4YZ4A 3IDCB 2ARBA 5FP7A 5I8TA 2CDPA 1YLLA 3LDKA 4JGZB 1YIFA 1ZZ9A 4DIQA 1LOBA 3CO2A 4N43C 2BNOA 1XNKA 1YXWA 1JOPA 3P6BA 4YGBA 1BMV1 3ZVXA 5FR3A 1RUC2 1W03A 3HN3A 4QM9A 2VZOA 4W6WA 2VW2A 4JKLA 2VVEA 2Q8DA 4N9IA 3KSCA 3WG3A 3N9LA 4DUXA 3NKTA 1UY0A 5C70A 3WZ1A 1SPPB 2QQMA 2ZABA 4IEVA 1AR62 1GZWA 1S0CA 3ZXFA 1RC6A 5DN2A 1V6JA 1W9SA 3HT1A 3P3PA 1RUG1 5KHGA 1DBNA 2ZHNA 1AYM1 2KD7A 3DPRA 3OF1A 4AVTA 1WLCA 4ZZ5A 3TN91 2C26A 2DBNA 1BQPA 3MW4A 5F6KA 4EV0A 1GP4A 5DPNA 3C7EA 3VHRA 1OXCA 2A73B 2UYAA 2WAAA 3S7EA 1QJY2 2W1QA 3MPBA 4P08A 4FPKA 2ZHLA 5G05L 3ZN4A 3ZOIA 1JUIA 1G9AA 4XF4A 4XF1A 2EAKA 4QXCA 5BNPB 4LQRA 5JPNB 4KGQA 4HK8A 1OFSA 3S7IA 1TG7A 1F15A 3I59A 2HWB3 3UGHA 2XONA 4GJYA 3TEWA 4G3YC 1AZDA 4GH4C 4IGPA 2P3KA 2UWCA 4Q4V3 1PZ9A 2PLV3 4Q29A 5FREA 2XJPA 3FFQA 3MO4A 5FLHA 4E8CA 4QKBA 5JOXA 4KI5M 1AL21 4AWDA 4XJWA 2QQLA 5IAVA 3N9OA 5JUVA 1H6YA 1W05A 2HBTA 2RS51 2VZRA 4UAPA 4MGIE 3KD4A 4QGNA 1F35A 1U5IA 2VG9A 4E27A 3KGLA 2O8OA 1JYVA 4FP3A 5DDJ1 3LEKA 1MVQA 1TEIA 2A6XA 1A34A 2DBIA 5LBCA 5LCWL 2XVGA 3AP6A 5CFCC 1UMIA 1J59A 3Q8FA 5BNNA 1URXA 4YZ2A 1S2KA 4HSJA 1D7PM 1LOGA 1W6NA 4LTAA 5JOZA 5GLWA 3VDDB 2VMCA 5C71A 2XLGA 2QVSB 5L7OB 4O65A 4FOYA 5FYSA 2QZ2A 3R4UA 4G9SB 3DYPA 3ILNA 2HWB1 4Q4V2 4RR3A 3I3DA 3CDZB 3VZLA 1PHMA 1GOFA 1RB8G 5JPMB 4BXFA 4NUBA 4ARYA 2HYXA 2XJRA 4JGZA 3A4UA 3AMPA 2HBUA 3J7LA 3RWKX 1ND2C 4W4ZA 2GAUA 2ZEWA 2D93A 2ZGTA 2OYZA 3ZYRA 4A7YA 3C7GA 4XQ4A 4DY5A 3MLJA 1J83A 3FHAA 5ABJA 2VOKA 2RS53 2CSGA 3FJSA 4N43A 2Z69A 4QDSA 4IE4A 5DUVA 2VXRA 2VW1A 4RGAA 1FPN2 5C8CB 5KR7A 3VN4A 1QMJA 1MZFA 2GALA 3D3AA 4OULA 4CP2A 4NIDA 1KJLA 2QTWB 3VLBB 3VBRC 1A8DA 2XLFA 2JIJA 3VBSC 2VOWA 4N53C 3T4VA 4CDWA 3ILRA 1FT9A 5E6HA 2NZ9A 3ZSKA 4QGMA 4PQ9A 3ZXLA 4CUGA 1CAVA 4CA9A 5BNPA 3WNOA 3S5AA 3VDDC 4N43B 1ZBA1 2R042 4GXLA 4CEWC 3FLPA 2BVVA 1HQLA 4RQPC 3ZKUA 1ULDA 3J4UH 5JVVA 1NCRC 4OHYA 3H7JA 4BZ4A 4OI4A 3MUZ1 1CIYA 4N7UA 3VZNA 2WA3A 4DXSA 3E97A 2JDYA 5C8CC 1RINA 4Y5TA 2FDFA 4BMBA 5JWPA 3A22A 4COYA 5A1AA 3FUQA 5DZFA 2EAAA 1SBFA 1VBC2 5J7MA 3M3QA 1HRV2 2D5FA 4GZ9A 1S0JA 5I93A 1US3A 2OPKA 4EZHA 1UU4A 5J98B 1DYOA 3N7JA 4WVMA 3VBOB 1BCXA 4E2GA 3C7FA 3WVJA 1CPMA 2VMGA 2WSUA 1Y7BA 2A3XA 1HDKA 5GZEA 3PTRB 5F5IA 3ZN5A 1ZM1A 2OQ6A 4MGZE 4OUMA 1OOPA 3FE5A 4CVUA 4GULA 4Y1UA 1QY4A 2A3WA 3BI3A 4YM3A 1KJRA 1ZBA3 4JHZA 5ANNA 1V6NA 2G4IA 1UMZA 1DGWX 4OYUA 1SPPA 1JYTA 1EPWA 4OHXA 4RR3B 4JKKA 2P17A 2Q5TA 2D5HA 3WUCA 3H8UA 4CP0A 1ULEA 3AKRA 1GNZA 1CX4A 3DPRB 3LIHA 4I0AA 1HIXA 2XQRA 2ARCA 3POSA 2R1BA 3K3NA 1PIV2 1AR82 2FDIA 2JDMA 4BQWA 1WLTA 1Y4WA 1YO8A 5F37A 1UMHA 4D6QA 3THTA 2XG3A 4WZCA 2E9QA 2VOTA 2WN2A 4Q4X2 4LO8A 4MGQA 2GC1A 3J7NA 1JZ7A 5J48A 5AC91 4C8DA 2IXCA 4YARA 1HN1A 1LULA 2P6HA 3DXUA 4C91A 1Q8OA 4QPIB 3IAQA 5A70A 5KC5A 3H0OA 2G9GA 1BVP1 1V70A 4L0PA 4HETA 5EPAA 4BQ1A 1QJEA 2GN7A 1NCRA 3WF1A 3SHRA 5KHKA 4QX1A 1OQEA 5JZGA 4IEXA 1VJ2A 1UZZA 3OBZA 3ZSJA 3R4SA 5HBAA 4WBBA 1W2NA 1WCUA 4Y22A 3MV01 3WQBA 4W8JA 2PFWA 5FZOB 1F31A 3VBSB 4QPGB 4XJ9A 4A3ZA 1CN1A 1BKZA 2X29A 4NMIA 1LHNA 3TNPB 1F9KA 4S2HA 4XAAA 2ZKNA 4XFIA 4B7EA 2Y0IA 1WMEA 3HD8B 2ZX3A 4LBJA 2D97A 1IS4A 1C8M1 4OLLA 4D94A 5IUQA 5FO8B 4AEMA 2DVAA 2XGXA 4NIHA 4P9LA 3CU7A 2QFEA 3BOWA 3D0JA 4A7KA 2JD4A 3ACHA 4CDQC 5H9RA 3OEBA 4LITA 1B35B 4AHZA 1RL3A 4M3CE 4D3WA 4RD7A 1VMFA 3DKWA 4UW3A 1QQP1 2YPJA 3AC0A 4SLIA 2BU9A 4UXAA 4JGZC 3I4IA 1XC6A 4IV1A 4JDOA 3AYEA 3MIHA 5DAWA 2D43A 4Q5OA 2ZA9A 5A7QA 1H2MA 1NZIA 3USUB 3PURA 2W9XA 5C3OA 4WM8B 2GP3A 2PHWA 4JDMA 4LK7A 5ERLA 4LA2A 5EP9A 3GBWA 3IPVA 5DUWA 5JI9A 1VP6A 4MXVA 3WNMA 3MLKA 3WHUA 2VD7A 5JXIA 5I0SA 1GYKA 2I07B 1Y9MA 1UXZA 1QJY3 4QX5A 2CWSA 2ID4A 4UFHA 5FYYA 4XZPA 1SDDB 4ES8A 4RQPA 4A2UA 3PVNA 5JCTA 5C4WC 2GN3A 1G9DA 2QQPA 4GMP0 1XB9A 4BMEA 3U1XA 2D6LX 2PMWB 2VZUA 2XWJB 1UN1A 3RG0A 3RZGA 1OQ1A 3NO8A 4YW6A 1YI7A 5A32B 4ASKA 3WCSA 2ZGNA 1RUE3 4OZXA 1O91A 3JD72 4FO9A 4COUA 1MQTB 1IG3A 1AUYA 2C4XA 5A7WA 1X7NA 4IW3A 3ZO0B 4E9KA 5DQ0A 5CADA 2VBDA 4A45A 4LBQA 4GQ7A 1K3IA 1Y9QA 1SHWB 2BW8A 5LA0A 2QCSB 1E57A 5EFUA 5FZDA 3VHOA 4AFMA 4V2VA 3V0AB 3PIJA 4XDOA 4E4SA 4X8PA 1NZCA 3VBHB 3BGAA 2XHNA 4FPCA 5FZLA 2F4LA 4P9JA 5A1FA 5FZ3A 3URFA 2HWD1 2J1UA 5DAXA 1HX6A 4CSWA 1O3RA 5EJ1B 4SBVA 1UPSA 1RUOA 1AR73 4X6QB 3T0BA 1NLSA 2WO7A 2VW0A 4QQOA 1CGPA 3KV5A 4KWUA 1G9BA 3T1LA 1H4GA 4Q26A 3AP7A 2E32A 1WD4A 1TME3 2WL1A 2XL7A 4W6XA 1ULGA 4OZOA 1W6PB 2ZOEB 1E5RA 3WW2A 1OD5A 1FOD3 3DV8A 4JX0A 4KMQA 4ZONA 3MIDA 4JHTA 4PI2A 1RUE1 1R1A1 2GC3A 3EO6A 5FZFA 2O1QA 3VBUA 3FLTA 1LGCA 5CFDB 4BK5A 2WQ8A 2VE1A 3BVCA 4R9AA 1W8TA 5FPLA 1PIV3 1UU6A 1AF9A 3OJBA 5DZGA 1UOBA 2WRAA 2ZMNA 4L11A 3WUDA 4CEYB 3W5MA 1RVF2 2VU9A 3AKTA 3H3UA 4QGLA 4MGYE 2V72A 2EXHA 1ZRRA 2BGCA 1IG0A 1NE4A 3U4SA 2VJXA 4XFBA 1RUI2 2GH8A 2VMDA 1NOVA 2GMPA 3I3BA 3N7MA 5GJ6A 1HXS2 3APBA 1PM7A 1TME1 3GCWA 1W6OB 4YFWA 2W46A 4CCMA 2WBKA 1FATA 3K51A 1LHVA 3KCXA 2DURA 2PHXA 2WZR1 3ZSEA 1FOD1 5LWBA 4J1XA 4OUSA 1NY72 4Y3OA 5ABJC 3T2OA 2PXJA 1AR93 3ZR6A 2O0OA 4GH4A 4Y4YA 1CPNA 1UYYA 1X9PA 5DAQA 4XUTA 1W06A 4IV3B 1YFYA 5F32A 2QZ3A 2WLQA 3AM2A 4QKFA 2WZPP 4FAGA 5IK8A 2ZJCA 2VBPA 4JRAA 1IPJA 1WMXA 1WW5A 3N9MA 3OD4A 4QX7A 1UX7A 3VL8A 4EN6B 5GKAC 2RR13 4K3UA 5G04L 4RFT0 3ZXEA 1ZRIA 1YNAA 5A1LA 2YGMA 3OSDA 4AZZA 2BGOA 1WWYA 3VBHA 1IS6A 3POYA 2ZX1A 1HN0A 5FOBB 4CP9B 2E6VA 4LULA 3D0SA 3K4ZA 3J8F1 3NV4A 4DB5A 1DCSA 4AFCA 1W3VA 3M3OA 2IZWA 4BOWA 4LPLA 1BVVA 3JZVA 1UYPA 4PIYA 3BTXA 4CEWB 1OT5A 4B29A 3W9AA 2IXLA 4AI8A 4BXSV 1LJ7A 1TQ5A 3T3YA 3FMGA 4TXWA 2E7QA 5FXVA 2FCTA 1W2OA 2WZR3 1MVEA 4PJYA 1AX1A 4OQ8A 1XE0A 3ETPA 3VHPA 5IK4A 4RFRB 2JG8B 5EIYB 2BBVA 2WWUA 1VAVA 5A7PA 1UY1A 1GANA 3SQOA 1KRIA 1C8NA 3ZFFA 1UY3A 4TZDA 4YYOA 1MZ5A 2BJSA 4H2AA 1H0BA 5CB7A 2B46X 1HJFA 2Y6KA 2ET1A 3BB6A 4IV1B 2RM22 2EXJA 3FC0A 1AVBA 3GBFA 3BODA 1OF4A 1ST8A 2RVAA 3CQOA 3OUIA 3ES4A 3WT3A 1CJDA 2WT2A 3ZKYA 5DUXA 3KQ4B 1O5LA 1LR5A 2XJQA 1MS5A 2YXSA 1LEDA 2HEYF 3AKPA 3TBDA 1ND3C 1UXXX 2BYVE 3OY8B 2VNVA 1VAMA 4Y5SA 1EAH1 3A23A 1W9WA 3GBGA 4JTNA 2BQPA 4H55A 4I2OA 2QQKA 1HB2A 2TEPA 1I1EA 3MIFA 2YC2A 4AVSA 1ND2B 2Y0OA 5LASA 1VBB2 1VBA1 2Y6LA 1OH3A 4LLOA 4Y1XA 4AHWA 3OGGA 5KHIA 4BQ3A 1JS9A 3IIAA 2HWC1 3HJRA 3BPZA 3ZR5A 2P1BA 3OYWB 2Y60A 5EWSA 1S1AA 3B3QE 1QXRA 2D6NA 3IB3A 1W8WA 2AENA 1DZRA 2DU1A 4GJZA 1SLLA 4YW5A 4GH4B 5FYMA 1K5JA 4IEZA 4JQRA 5ABJB 3JB8A 2J1EA 1JU3A 3O1TA 4QWNA 1AX0A 3FX3A 4XQDA 3ACIA 3NV3A 4GMP1 4HPKB 3UJOA 5FZEA 5HCAA 1US2A 3MIEA 1XYNA 4BLIA 4HMZA 4LUMA 4P9IA 2D6KA 5ACA2 4XYXA 1GKBA 1CQ9A 2BNNA 3IM0A 4QQ2A 1A78A 4ZU7A 5J1XA 3USSA 1CWPA 4OVEA 3I2OA 2RS52 3O1SA 3AZYA 3PL0A 4UW6A 4TYSA 5FO9B 3CIHA 1G8WA 3WF3A 2PELA 3M8LA 4OQ9A 4RHV1 2HJIA 3ZXDA 3C8XA 4BISA 4IEOA 4BM8A 4LK6A 2IXHA 5A6XA 3P5BA 2HWC3 3PMEA 2RS13 2MHFA 1SZBA 3KT7A 1Q43A 1O4TA 2ZGLA 2WQZC 4D7TA 1QJX1 5IWFA 1UZVA 1V6MA 1AYN3 2OW4A 3LSEA 4JAAA 5FYTA 1Y43B 1NA1B 5DG1A 5CIRA 3JQXA 4XBNA 3CLPA 4UF0B 1RUD2 2ZBJA 4LOTA 3RWNA 2PN5A 2A5ZA 2OT7A 4P5HA 5T52A 1W8FA 4Q4W2 5F5AA 5FXZA 3I2KA 4JRLA 2NQYA 1DQ5A 4XABA 3VD7A 4IEYA 2BTVC 1JW6A 4QKDA 3ZPOA 4LT5A 1LOEA 1ZZCA 1LHWA 2VMFA 3AFKA 3LPFA 4ITCA 4IV1C 3I2FA 2IWGB 1L7LA 2BWAA 2XBO3 5FZCA 4M00A 4AEDA 3QLQA 4AI2A 4DXRA 1WZXA 1ZYBA 2V5DA 1GV9A 4L97A 2WFPA 5L9VA 1XE8A 1BXHA 4E4HA 1NCQB 1OLME 1G7YA 1NE6A 2ZGOA 4HKWA 2P5BA 3VZMA 1O7FA 3RI8A 1LECA 1H2LA 2OIIA 4ZY9A 1COV3 4O61A 3T08A 2RS11 1Q56A 3EQEA 3T4HB 2XQXA 1LODA 3LAGA 2MEV2 4R4ZA 5SV5A 2JG9B 5FZBA 2HKXA 1QJX3 3ECQA 3CJXA 1AYN1 4HZFA 4B8EA 1QKQA 2EIBA 3Q8BA 2RS31 1BBT1 1D0HA 4TWTA 2WQ4A 4G4FA 3UJQA 3T0DA 1CAXB 1GOHA 2V4AA 3ZXAC 2VM9A 4M01A 5FYCA 4CU8A 4NVPA 1UPIA 5D8AA 2XDVA 2PLV2 4P9XA 4QPIA 4EZ4A 1ZA7A 1N1VA 4UBGA 4XE9A 2NM1A 2W1WA 1WA6X 3OB8A 2WFF1 3NAPC 1S55A 3HQUA 3QACA 1QH7A 1R081 3AMNA 5FBZA 4ZPIA 4FPLA 2KA3A 2O14A 4D69A 3PTYA 4N53A 2DCYA 3VBSA 1VR3A 5IT6A 2PAKA 1N1YA 3WDYA 1FI2A 4R9CA 4XXAA 3F95A 3ZFFC 2GC2A 1DQ0A 2ZAHA 3HN1A 1COV1 3KCYA 1AHSA 5AFBA 1J3QA 2XJTA 3AP4A 4META 4AL9A 5DUUA 4XQWA 1JH5A 3LKJA 4JVAA 2K2SA 5CFDC 3NJXA 4WM8C 2QNKA 2RS33 5L9RA 3HBKA 3ZFEC 1NA1C 4OI2A 5F2SA 2F4PA 3NJYA 1WD3A 2D3SA 1LHOA 5CZKA 5IVYA 4ORFA 2IXJA 3CEWA 1RUC3 1AR81 2ZZJA 3ZFGA 3UL2A 4I0WB 3MW3A 3EHKA 1BEV1 4PF5A 3IPVB 4GKYA 4LO7A 5FZ8A 5FPUA 3VBHC 2MNGA 2J1VA 1UNBA 2YGLA 4QPWA 1GLHA 1R083 4Z2WA 2AUYA 1GBGA 1VBE3 2QBXA 5BNNB 5ACA3 1REDA 1YQCA 2WDBA 1RUG2 4UW4A 1XSRA 3H50A 3T09A 4ES9A 3WCRA 5CG8A 5FO7B 3SXWA 2RDRA 4AFAA 1GWKA 1GWMA 4F7ZA 5FYIA 1JZ2A 4IGQA 4XUNA 1NAEA 2FMYA 2W0XA 4IESA 3E5XA 3KZ4C 5K4LA 3VDAA 1WKYA 4P9YA 3TWIA 1OOPB 1ZRCA 4FTSA 3ATGA 3MI8A 2OZJA 1XU1A 1YRZA 3A21A 1RMU1 3WQ1A 3UNPA 5FLJA 3VBFA 4QPYA 3OGVA 3RJ2X 3ZMOA 1LCLA 4XBLA 2A75A 1LAJA 1JODA 4QD2A 4OFGA 3THPA 2J7MA 3KF5A 2EXKA 2WS93 3MYXA 5EQUA 4YM2A 3AJYA 1C57A 3EMRA 3K4AA 5D1IA 4D7SA 1DGRN 4IE5A 5IVBA 1AR83 2DF7A 3H3ZA 3U37A 1IQDC 3IDBB 3PUIA 3R4DB 1BEV3 1UIKA 2CAVA 2ETEA 3NAPA 1BLZA 2I45A 3K48A 4Y4RA 1IS3A 1PX4A 3ZDSA 4BJ0A 1D4VB 1VBE1 4I01A 4K1YA 4K21A 5CYYA 3WQ0A 4NWVA 2ZGUA 1M4WA 1RVF3 1XOYA 2PHLA 2R6QA 4PBOA 1VB2A 2LW8A 2WZEA 2D40A 1SBDA 5HI0A 3M4FA 1BJQA 4IERA 2IUWA 3LFIA 5K0UB 4ASLA 1E5SA 2XXZA 1TMF1 1W8UA 3D5OA 4BWOA 4YSFA 1DLLA 1VB4A 2CHHA 4XJAA 4LBOA 1UD1A 1UF2C 2E7AA 4Y1VA 1X8EA 4IXLA 3VD3A 3PLQA 1GNHA 1NG0A 5K0UC 1ASJ2 3U75A 2WS91 4JGYB 5A3MA 1X50A 5I0TA 3ZFEB 4RSUA 2E33A 1OC1A 3OUHA 2NYYA 3I7DA 4BE3A 3VKNA 4MGTA 5E1RA 5IK7A 1QOSA 1UYZA 1AJOA 2DVFA 1O4YA 2UU8A 4XF0A 1KITA 1REFA 4KG0A 4NHLA 1RTVA 1G6NA 3ZXKA 4LHNA 3H8XA 4FOVA 5E8AA 2JE7A 1S0EA 2X10A 2YBKA 1FPN1 3BYWA 4AFDA 1KD7A 2H0VA 1A6CA 1OA4A 2JDHA 2V4VA 4HBNA 3TB0A 1G86A 4ZHNA 3E6DA 2HWD2 3K77A 5CFCB 1K5MA 1AR72 4FPEA 2JDAA 1CZVA 4XUOA 4QB1A 4ZXKA 4CDUB 1TMF3 1CZTA 3E5UA 3VHNA 4E2SA 2DDUA 4QKNA 4URTA 1CAXA 4NHMA 5H9QA 3SH5A 2YG0A 3AK0A 3POJA 5JZGC 1RUF3 3IT8A 2P6CA 4M0HA 4CXYA 4LMFA 3VD9A 4E4DX 3SCHA 3GCXA 1H6XA 3I2JA 5K8SA 1PO11 3NV2A 4N90A 3RRDA 5LY1A 1UL9A 2VMHA 2XVLA 1R093 1VRH3 4Q27A 5IVVA 5C4WA 5BUVA 5EXOA 1PGW2 1RUE2 3I3QA 2AZ5A 3QOPA 1VBC3 2ADEA 2A71A 2ZMKA 3KF3A 2KM2A 4JCKA 1UAIA 4Q0UA 4Y33A 4Q4W3 1CAUA 4Q8KA 1OFNA 1PGL1 3D4KA 2B42B 2HWE3 1YUDA 3ACFA 1OA2A 1MQTA 4C90A 2CWMA 5F8PA 1CAWB 1GWLA 4M3CF 1Q8QA 3HNBM 4XMIA 3I2GA 1DFQA 1SLCA 3AB0A 3WF2A 1JU4A 4QQHA 2BP6A 5C4WB 3N9PA 4ET7A 5JMCA 1W9TA 2XUMA 3MW2A 1MACA 4JKMA 4EN0A 5FYZA 2JIGA 3JXSA 4BQ5A 2C0ZA 1FV3A 3C3VA 4LO5B 3B69A 4Z92B 2JG8A 2R1DA 5FMCA 1RUI3 2HYKA 4IV3A 1VE0A 1XNTA 2VR4A 3C2UA 2VZQA 3CNAA 1O3TA 3PIGA 2Q8EA 2D6PA 4GD4A 2A1XA 1C5IA 1RUF1 1UOFA 4BIOA 1Z7S1 2CDOA 1WCKA 3LA3A 4FVVA 1RJ7A 5IW0A 4YZ1A 3RZHA 3SMHA 1H4HA 1PO13 4NHYA 5T3NA 1EV11 4JGYA 3EBRA 2ZGQA 4Q0QA 5F5QA 3T2QA 4XDPA 1R091 1VRH1 3N9QA 3ROUA 4EN9B 4IQPA 1YC61 2B9UA 2Z42A 5GLUA 3SEPA 4RS5C 2RE9A 2FMDA 4NRQA 5FMOL 4I0BA 4YFZA 3PVBB 1YQ5A 3UKTA 2HWE1 1DYPA 1CIWA 4Q4X1 3SKVA 2HEWF 4BYYA 4BQYA 5FJKA 4YGDA 1OKQA 4PHZA 3OCPA 1EP0A 1SQ4A 4K9SA 1XRUA 1ZX5A 3NWKA 4I3GA 5A33A 4GWIA 3TN92 2VPVA 3WP6A 4BH9A 2A70A 2QDRA 1PO21 3WDXA 4L2NA 4XOGA 3O14A 3MEPA 3RYKA 5JIUA 1SMVA 1POV3 2XJSA 2ZGPA 3LSDA 4JGYC 1GZ9A 1W6NB 3AP5A 4K7JA 4P5YA 4RGGA 4WVMB 4Q1RA 4ASMB 5C3PA 3S57A 2XH6A 4L8QA 4A3XA 4Z1VA 5C3RA 4EWAA 5JXGA 2JEMA 5HV0A 2JX9A 4ZU5A 1FXZA 3HAGA 4NJ4A 4V2WA 1JHNA 1Z7S3 4MH0E 5HXVA 4AG4A 1K12A 4JDNA 3EXUA 1SLAA 4MZUA 3ACGA 4TLGA 3WNXA 2PQSA 1EV13 2LS6A 3SEEA 3AZZA 2BBAA 1JN2P 2YZ4A 2VVDA 4HT1T 3VUOA 2DVGA 3MIBA 3BALA 3LDBA 3M2MA 3ZYHA 5CAZA 1ASJ3 3W59A 4HOOA 2B45X 4NIGA 3TAYA 1RUH2 2P3IA 1AL22 2DTYA 4LA3A 2R061 1MEC1 1WBLA 1MQTC 1GFF2 2CYFA 2FZ1A 2BFUL 1R64A 3CZUA 2AGSA 5FUNA 3ZDVA 2BPA2 3J7MA 4AVBA 2VAUA 5LA9A 1QJU1 1D4M1 4TSVA 4AGVA 1UX6A 2XLAA 1GSLA 3KM5A 3OBRA 1W90A 2OUJA 3VKMA 1CAVB 3L2HA 3LCPA 4FQ4A 3IBMA 2WNUC 5J36A 2XVKA 1POV1 4XETA 5A32A 1W0OA 3BOPA 1O8PA 3H42B 4ATFA 4DFSA 5CKNA 1EY2A 1G9CA 1NCRB 4LKFA 1VBA2 1VBB1 3I8TA 2BWCA 2G9ZA 2GH2A 2HWC2 5EHDA 4IETA 4AVVA 3WOGA 1H1AA 4CDQB 1SDWA 2HWB2 5F3GA 3WEZA 5KXBA 5J3UA 1CX1A 4CUAA 3ASIA 4JC1A 1W04A 3WW4A 1RUH3 3OOXA 2IXKA 4Q2FA 2QQUA 3K3OA 2CNAA 5IVJA 2RDQA 2W1SA 3ST7A 5JOWA 1JOJA 2VUJA 3KT1A 4KGGA 4PLNA 1PMHX 1H9WA 3H3LA 3KS7A 3VD4A 4BQ4A 1MEC3 3RZKA 3IDEA 1W6QB 1O6UA 1ZZ7A 3VBOA 1DQ2A 4AEKA 1F8VA 1X82A 3AVRA 2YYOA 5AVPA 2D44A 2Y38A 3D82A 1ALYA 4A4AA 3MUY1 1J3RA 4IEUA 1MZEA 1ZBE1 1H30A 1FMD1 3D8CA 3NNMA 4O7XA 5FV3A 1UZ0A 4LBQD 4QU2A 1IPKA 4AEJA 4AW7A 5BV6A 1PZ8A 5F6LB 3OGSA 2ZX0A 1W6OA 5EZWA 5A3WA 4CUCA 2OVUA 3DXTA 5H9SA 4OI1A 3ZX7A 4CCCA 3UYJA 2PAEA 4FFGA 2J22A 5FOJB 1OLQA 3K46A 3LQCA 1W8HA 3OEAA 4MGSA 4QPIC 3WINE 2W95A 4RR3C 3I2IA 2X8KA 2DUPA 5JMOA 4Q4Y2 2WABA 3PJQA 5TSWA 2MPFA 2C9AA 3V56A 2W1UA 1YYNA 5FYBA 4DXZA 2WYSA 1GOGA 3E5QA 4QMAA 1H1MA 1PVXA 3O0VA 4XFHA 2UWAA 1KQRA 3OBTA 4M3CA 4YVSC 5T54A 5J37A 3CHXA 3VV1A 1DDLA 3NRUA 3ZFGC 1PZ7A 4Q0SA 4A7ZA 3RYPA 1ULPA 3GGLA 1OUSA 3M3IA 3BKZA 1OPMA 1QF3A 3X29B 3GZEA 3L9JT 2Z5WA 4TLFA 1RXGA 1LU2A 1UY2A 2ORXA 2PA7A 3S6PA 1ZBE3 1XQNA 2JG9A 4EN7B 3QCWA 1JMUB 1HB3A 2JDUA 3B02A 4GIQA 1IHMA 2WKKA 3U10A 1POV0 4NAMA 4FTEA 4YVSB 4ISRA 2WAOA 2RMU1 3SLIA 2BDRA 2QJVA 1OMIA 3G6JB 1HXS1 4F3JA 1HRI2 4FTBA 4DMIA 2BRTA 2CU5A 1AX2A 2RS12 3C7HA 5T5PA 5JDBA 4KNCA 3B01A 3LE0A 1SLBA 2GZWA 1SBEA 2WZR2 1DGRA 5A6YA 4ISQA 3RI9A 5AFEA 1OH4A 3P3NA 2AH2A 4ZS3A 5LW9A 3KVAA 3KWVA 4L99A 3E6BA 4TN7A 5HCFA 1BYHA 3W5NA 2Q1MA 4CEYC 1GU3A 3CBNA 5F3EA 3ZXGA 1NQDA 1V00A 2PLV1 3KLSA 3OY8A 2FDKA 1W6QA 3MV11 1LGNA 2DU0A 3LA2A 2AC1A 3ZXJA 2JKBA 3AMMA 5JSOA 1AL23 1HV0A 3KGZA 4KBZA 1W0NA 3IWZA 3PMSA 4I09A 2WNVA 3K4DA 4LUKA 1AYM2 1I3HA 4P02B 4YW7A 5FP9A 5IVEA 1ZNPA 2JENA 4AAXA 1BMV2 1STMA 4B1LA 4COWA 1MS9A 3WX5A 2XKPA 4IUGA 1K45A 4BHPA 2BV4A 1YIPA 3AP9A 5D21A 5A80A 5DDJ3 2JDZA 3A7QA 1W39A 3ZFFB 3SC7X 4AVAA 5A6QA 2PTMA 2RMU3 3QH7A 4A41A 2DWRA 2V5YA 4QXKA 4RN5A 4XCBA 2B8MA 3C7OA 1OF3A 4QHBA 4FSJA 5A3PA 5LZ6A 4CUBA 1L7QA 1H2NA 4C0BA 1PM4A 5BY5A 4W50A 4J25A 2R072 2HWF2 4MUVA 4QM8A 1C8M2 4UFJA 3HBZA 3O1PA 1JOBA 5CISA 4M3CB 2K9ZA 5FMBA 4DUWA 1HLCA 1QU0A 1SFYA 1UWWA 1VALA 1FNZA 1CESA 4H7MA 3S5QA 3HMYA 2VC9A 2C1FA 2Q8CA 4P9GA 3TEXA 3TNQA 5A3LA 2HH9A 4QB6A 1APNA 5EJZB 5C9AB 1MZ6A 3JBG2 4XURA 4BPZA 3Q9OA 4AE2A 3LPGA 2XBO2 1OQDA 4HL0A 3ZPYA 3H8RA 2ZZQA 4M4RA 2SLIA 1RUG3 3SITA 1U5XA 1PVC2 5LA1A 2UY8A 3LDRA 2JE9A 5JIAA 3TN93 2K46A 4LOSA 5A7OA 4S2FA 2D3PA 1BHGA 2R16A 4RA0A 1ODNA 5FXWA 5FRAA 4UBHA 2ZEXA 4BA6A 3MFCA 2PHRA 4AI9A 3IAPA 3BN6A 1W28A 3WDWA 3LWCA 4ZZ8A 5GZDA 1T2XA 3THDA 1OHFA 4PCRA 4UWDA 3V65A 2QDNA 4ZU4A 5FUIA 2IVJA 1ENQA 2FD8A 5JLVA 1YHFA 3BTAA 3GDBA 3JD71 5C5TA 1UCXA 1IGOA 2C24A 3T1MA 4Q4V1 1LB2A 1XBFA 4WM7B 1OPOA 1WCDJ 3PVOA 1D2QA 1JTZX 3JU9A 5KC6A 1UOGA 3J7HA 2LTNA 1W9YA 3GZUC 4AI1A 5LA2A 5IFTA 5F39A 3VZKA 4QX2A 1X33A 1DQ6A 1I5ZA 4XJ8A 2VUDA 1DHKB 3AMHA 1RHI2 1WW7A 4YM1A 5C3SA 3O1MA 3NJZA 2JDKA 3PU3A 4AHXA 2H0BA 3I3MA 1PK6A 4DY3A 3NKGA 3H7YA 2W52A 4YNIA 3RSJA 4C1WA 5FPVA 2X5IC 1NXMA 1Q5OA 3FN9A 2ZGMA 4XW3A 4PDWC 1TZOA 5FY4A 1WCSA 2YV8A 3BTZA 4NR1A 4CCOA 1J1TA 4IGOA 1NQJA 1WGPA 3I97A 3SCGA 2K0GA 1HJGA 3IIIA 1JZ5A 2Y33A 2B39A 4HANA 4AK3A 1H8VA 1F5FA 4RS5B 4HVRA 1H9PA 2AEYA 2HLEA 1R1A2 2BUKA 1VRBA 2N7GA 5GLVA 3BU7A 3ORJA 3VBFC 3JD73 1U5ZA 2F6BA 3CL1A 1MS4A 1UY4A 3KHBA 1LNSA 2R0HA 2VCCA 3U07A 1NKGA 1W6MA 1K5MC 2DCTA 2DYCA 2GSYA 5FP4A 4Z07A 3QBQA 2WYFA 3B93A 3RS6A 4N53B 1GZWB 3PUHA 2YPDA 1WCQA 3AVSA 4YVSA 1HKDA 3U11A 5C9AC 3O12A 3NAPB 4QDRA 5C7GA 1HRV1 1Y9GA 3M3EA 4EQVA 3N7KA 4GB31 4LBQB 1F5JA 1VAKA 2XL9A 1Q8SA 4B4PA 4DNYA 3DYMA 2OPWA 1JZ8A 1VMJA 3IMMA 5J09A 4ONUA 1C1FA 1PNFA 2JB4A 2A3YA 1WA4A 4DXTA 2VY0A 2ARAA 4W65A 3NNGA 1ND3B 5FTTC 4YPJA 2EA7A 2NPIA 4XDQA 4YVWC 4QU1A 5FQ0A 2GNMA 3EJKA 1NY71 1L7RA 2OXBA 1BK1A 3AYAA 4S2GA 4RYDA 4DPNA 5HPOA 1S2EA 1BBT2 1ULOA 4EJRA 1F4AA 1ACCA 3W20A 5FZKA 5A6ZA 2FCUA 3HWJA 5L19A 1IZ3A 3KCCA 4X6RB 4FOQA 5FP8A 2VL4A 3H1YA 3VKFC 2E53A 4WM7A 1RUNA 2PYTA 1HV1A 1V9U2 2YFUA 4NHXA 5DG2A 2G1MA 1NA1A 1C28A 2TBVA 5EYXA 5FY0A 1B35C 1KGYA 4INDA 5B2GB 1R082 4WM8A 5CFDA 4K20A 3GALA 3WQ7A 1HRV3 3W58A 2CGOA 4R8HA 4AEDB 4IEPA 2NN8A 4GB33 3T30A 1G9FA 2FDHA 3RZZA 1LKNA 4KBBA 5T5JA 3WNLA 4URAA 2VTFA 5JR2A 2XHKA 3KHCA 4YZ3A 2Y8KA 3FWEA 4LBKA 1YQ8A 4KWKA 4CCJA 2DCJA 3POGA 4FOWA 4CDUC 1H8TC 4XCAA 4XIKA 5LRRA 1QJY1 1S4CA 1ZA4A 4EROA 4CCDA 3LZZA 1JYNA 3I49A 3VBRB 1QDOA 4PDWB 5CVRA 3WD5A 1QXPA 3O7OA 1DGWA 3ZYIB 1MS3A 2Y26A 3AKQA 1J58A 2RHPA 3FBYA 4RS5A 4ARXA 4YW4A 5DAVA 1OVPA 4FFIA 1N1SA 1LGBA 1W99A 3RQ0A 2JB8A 3DPRC 4NOTA 2PAMA 2VNGA 1GUIA 1SCRA 3MF6A 4HONA 3A0NA 2ZPXA 4YZ5A 3VBUC 3H9AA 3MHZA 2VMIA 4Q0VA 5CBLA 2B5HA 5BNOA 2QQJA 5GZGA 1IKPA 5JOYA 1A3KA 4O9GA 2GMEA 3S30A 1LU1A 4BLJA 4WVVA 2Q1FA 3KQRA 5AC93 1J1LA 4DUVA 1DLCA 4UFLA 2GNBA 4V1PA 3ZIXA 5FKBA 3O1UA 1ZVFA 3DYOA 2JKXA 1D0GA 4IV3C 5T5LA 1VLNA 3WP4A 1QQP2 2P34A 3DUIA 4ZS2A 2P3YA 2Z79A 2XR4A 5LBFA 3Q8EA 4XXPA 4C1XA 4CDQA 5I8YA 2XOMA 1JYXA 5DDJ2 2R49A 1RUJ2 2ET7A 4E2QA 2YFZA 5FFOC 4CP1A 1K42A 5FK7A 3WW1A 3HIFA 1HW5A 2ZEYA 4NIIA 2E51A 1KXGA 2VOVA 3ZFEA 2W47A 4DZGA 2UWBA 4P00B 5FIXA 5FZGA 3KT4A 3N36A 2X05A 1XSQA 3VD5A 1ULCA 3GJAA 1XE7A 3JQWA 3VDBA 1C8M3 2QQWA 1AXZA 1MS1A 2ZCWA 4QPGA 5F5CA 4D8MA 4GAZA 1R1ZA 4Q1PA 5DZEA 1GZCA 1YQ6A 2J1AA 2Q0AA 4D7YA 1EUUA 3OBAA 2VTXA 3POIA 3B9CA 4QT6A 1ENXA 1LESA 2FZ2A 1DIWA 5FKCA 2VBBA 1C1LA 1QQP3 3RPQA 3OUJA 2VO5A 3FBMA 3NL1A 3ZFGB 4NRPA 4NO4A 1LOAA 1VMHA 4XACA 1UOJA 5FZ7A 2D3RA 2BOJA 2Y6HA 1ZZ8A 1YFUA 2RV9A 4B1MA 4X8NA 4IDZA 5FZ6A 2VZSA 1ZZBA 3PUSA 3WR0A 4AHYA 2JG8C 2WO2A 2ZEZA 5FPXA 2OA2A 4FPYA 5EYYA 1LENA 5EV7A 3ZYFA 2JDPA 5JAXA 4LNVA 3H1MA 3RZJA 1KEXA 3ZYJB 1W8NA 3HR9A 3DF0A 3Q8AA 1E5HA 2KR2A 3WF0A 2WS92 1I9RA 2XB6C 3WP5A 4D6SA 1UW8A 3R05A 2AACA 4AEDC 5CFCA 2Q4SA 2AREA 2R32A 3R0RA 1UZYA 1RYYA 3CKHA 2RJ2A 4MSVA 3I2HA 3MF9A 5E16A 5CA6A 1O3QA 3RJRA 3OD0A 4UOJA 3GHNA 2Y34A 4PLMA 3NNLA 5BYNA 5L7OC 1S2BA 1RXFA 3E6CC 2VCAA 2BVBA 1P8JA 4XPVA 1DZQA 1HQNA 1QNWA 2ZMLA 3D6EA 3NJVA 3UK9A 5DABA 5C3QA 4IE0A 4BIFA 1ZBE2 1AR63 2XWBB 4GWNA 3GZAA 2ENRA 4YGCA 1ND3A 5HV4A 1N1TA 2VZPA 3KVBA 3BPSA 2HWD3 4R4XA 4F83A 1RIRA 2Y64A 2WO3A 1AR71 1UYXA 3AJZA 3AX4A 3NVCA 5I8SA 3ELNA 1EYBA 3AFGA 3H1WA 4HFSA 4NN0A 3AXEA 1CAUB 3I59B 1QDCA 5LEJA 3CJIB 4Q4Y1 1V6LA 5FZAA 2OKXA 2RS32 1WW6A 3AYCA 4FAHA 4FFFA 2D7FA 1JI6A 3PNAA 3VB9A 4COVA 2G19A 3K2OA 4MV2A 5SV8A 2WNUB 1SACA 4R9DA 4HKOA 1FOD2 4PIXA 5K7PA 4WVWA 1CR7A 1R1A3 4MHRA 1XPWA 4E4ZA 2WNEA 2B7YA 1H1IA 2JICA 1UKGA 4Y24A 4MXWA 1KFXL 2VZVA 3ON7A 5FPZA 1Z0HA 1PIV1 2CY6A 4AI0A 3OTFA 1DQ4A 1REEA 3PUAA 4A42A 3ZYGA 4CZSA 3IZOA 4NIAA 3J8F2 2E7TA 4KG8A 2WT1A 4K8RB 4Y5Z0 4AAPA 2EXIA 5AC92 1AR61 4MG2A 1GQGA 4S2DA 1W2AX 5JSRA 2CTVA 5C33A 2RDNA 1EAH3 4IE7A 1WBFA 4CU9A 1XJAA 2XJUA 1S0IA 4MLOA 1AL0G 3ENRA 2ZXQA 2IFWA 4RQPB 1QXJA 3A0KA 1XXNA 4Q4Y3 1ZZ6A 4HXCA 4NWWA 5BNOC 5JXJA 1K5MB 2QQVA 2J42A 5CG9A 1VBD2 3DGTA 3HQXA 4EWEA 4XF9A 4QX0A 4YWAA 3ZN6B 4HLTA 3LEIA 2IXIA 1AR91 2P4EA 4BQXA 4H14A 3PVEA 1IKQA 4P9WA 2DCKA 1QOOA 1YQ2A 5L73A 4DEQA 2ES3A 4LO6B 4PT6A 4AXOA 3HNYM 2VUAA 4LBLA 2RR11 3DCQA 5C8CA 4HVQA 1CZSA 5FZIA 2Y6JA 3ZN6A 4KWJA 4C0HA 3NNJA 2E26A 1EAH2 2Z2SB 5LY2A 2GP5A 2GNDA 2YROA 2W5FA 3IMNA 4WV8A 5FY1A 1ODMA 2W2IA 1VIWB 2W94A 2YBSA 3SH4A 2YBPA 3AMQA 3J8F3 4CPBA 5FDBA 4AQ2A 4OHWA 1MPXA 2WT0A 4PF1A 1E5IA 1RITA 4CU7A 2QKDA 1WLDA 4HN1A 3SCFA 4D0QA 1OA3A 3ZLIA 4NPLA 5LB6A 1FAYA 2ORZA 5FZ9A 1DG6A 1XNDA 2PHDA 4MX3A 1RMU2 5AVAA 2Y6GA 4LIVA 4UF0A 4FCAA 4XBQA 4FBFA 1OBNA 4OUEA 3MBWA 1JBCA 3TEZA 2DFBA 3N35A 4UFKA 5FMDA 4CU6A 2J1SA 2WNUA 2WWSA 4QQPA 4E8DA 2CGPA 4PI0A 3MICA 1S0GA 2DTWA 1MR5A 4CPBD 2B9VA 2R0FA 1IOAA 1YEWA 3P1IA 1YJKA 4K1ZA 3RDIA 2XKOA 4CEYA 3O1OA 3VZOA 2WIIB 3ME2A 4A6OA 3AZVA 3JBG1 1QJU2 3L2YA 3CJIC 2GNTA 3GM8A 5LRSA 3RMXA 2XBO1 1QJZA 3VGIA 4JV4A 3INAA 1TNRA 1Q8PA 1RHI3 4LKEA 3N9NA 1DZTA 2YC0A 3JB4C 1V6OA 2AEZA 3WV6A 1PMIA 2XPJA 4R9BA 3RYRA 2L9LA 3DL3A 4N9HA 4AOCA 4NRMA 1VBA3 2RG4A 4QPGC 4PQQA 4DINB 1QJX2 3I54A 2G9FA 3RNSA 1N3OA 2CGNA 2EVXA 3M7AA 5BNPC 5ISLA 3DKQA 5FZMA 2VTXJ 3POFA 4YG6A 1T6GC 5HCHA 2BZDA 5FUPA 2GU9A 4BU2A 4QAWA 1QJFA 1RUD1 2WR9A 3J26N 3RGBA 1OURA 1CJPA 3ZM8A 3O0XA 2FQPA 4Y1ZA 4GWJA 4DO0A 1W0PA 4Q0PA 5FXXA 3ALQA 1KS4A 3GXUA 2NMOA 3AL5A 3POWA 1O3SA 4A44A 4FPGA 5FY7A 2J1RA 3Q8CA 3FLRA 1UKRA 1TVGA 1CAWA 3I3EA 4GMP3 5FK8A 3UT0A 3QD6A 1X36A 2CL2A 2V09A 1ENRA 2WUHA 3B7MA 2WFF3 4K40A 5FZ1A 3JBG3 3CJIA 4LE3A 1AXYA 2OX0A 5FLIA 5FZ4A 3RMYA 4CRQA 5GALA 2R7EB 3VZJA 1RHI1 5FY8A 2LROA 5LBEA 3MGUA 4MOAA 3M1HA 4XEZA 5IJRA 3SNMA 3POBA 2BOIA 1FX5A 4FP2A 4RHV3 5C8WA 3V0AA 2IVIB 2ZGSA 2VCMA 4XUQA 2W39A 2E63A 2MEV1 3WNPA 5EJ3A 4MADA 2GDFA 3FHQA 3LOBA 2V73A 4I30A 1N47A 5LBBA 5CU1A 3ZYPA 5FBJA 1XNCA 2SBAA 5J96B 4IEQA 4J1WA 1RUD3 2RDSA 4KWLA 4XIOA 4UI9L 1OKOA 2XJVA 3SISA 4GA9A 4TTGA 3BU0A 2TUNA 2YU2A 1W6PA 1AYN2 4PIZA 4I02A 2Q1ZB 3FZ3A 3CF6E 3KB5A 5F3CA 4Y20B 4Q8LA 2J1TA 3PUQA 1J84A 1V9U3 2LUWA 1RUC1 3GYDA 4A6SA 2C9KA 4BQ2A 5A3TA 3RVHA 2EICA 2D6MA 3LB9A 3OGRA 1UZWA 1Y3TA 4HKLA 1YFXA 2VCBA 3WF4A 4PLOA 2WINB 4XAEA 3O5SA 1XNAA 1F4HA 3BIWE 3USUA 3VBUB 3WG2A 1U0AA 3O0WA 4IEWA 4Y20A 1XYPA 4PDWA 4CDXA 3LF7A 5IYYA 2CV6A 1D2SA 2VECA 3VL9A 4LBMA 2RMU2 3ACLA 3UGFA 4EYUA 2MEV3 2W87A 3JUUA 5FAXA 3BCWA 3LA7A 1NXD1 4LR4A 4XVHA 1DP0A 1RUF2 2QUOA 1DGLA 3KV6A 1Z7S2 4LEJA 4N8MA 1OUXA 4NPMA 2VQ0A 4H3WA 4XJZA 1GP5A 5LEKA 3R6SA 2ILMA 2LALA 1WLWA 3U14A 3UGGA 1BBT3 3OPZA 2VXJA 3BTYA 2H6BA 1X8MA 1QNYA 2VH9A 4Y26A 2A6VA 4UYBA 4YRDA 3W21A 5GZCA 2R30A 2ARXA 4KQ7A 2HEVF 1M06G 2DUOA 5JZGB 2RJKA 1V9U1 5A7WB 3LGRA 1ZRFA 3PU8A 4AI3A 4Y22B 3ZIWA 4KH9A 3UETA 1KS5A 1GMMA 1XNBA 1N3QA 3OG2A 4JQTA 2W68A 4LO4B 4XMAA 5FZOA 3U0ZA 4L9BA 4QDQA 4B3NA 4UT5A 2VVFA 2XMLA 3PJYA 4M0NA 3IDAA 4QQLA 4UFMA 4FXKB 4QXHA 4GKXA 3GHMA 4UFIA 1SEFA 4I3PA 4XF3A 4IE6A 4YG3A 2BEOA 5DAPA 5M0TA 1W2UA 1CVNA 1RUJ3 3B9IA 3T0AA 4EE2A 4DRRA 3RZLA 4M4PA 3WW3A 2VNOA 2IC1A 4XTMA 3G7DA 2HWF1 3T2PA 4LJHA 4B4RA 2YC4A 3H8OA 4GALA 1RJ8A 2TNFA 1LRHA 3NQHA 3OPWA 2IFRA 2Q30A 4NE9A 5LK5A 4LXLA 1WMFA 3WNNA 1SCSA 1X9TA 2I2SA 2LM3A 3NV1A 4B7KA 4CEWA 1L3JA 4B4QA 5A3NA 4OI0A 5CEHA 3J9SA 3IKWA 2PHTA 3DEMA 1KDKA 4CDWC 1BZWA 3WXPA 1NLQA 2WC2A 5BPXA 2VQAA 3HNMA 3WLUA 1LOCA 2D98A 4YVWB 1NCQA 2RJLA 1YWKA 3QH6A 2H6CA 1S0BA 2E31A 3UKNA 5ACA1 5DMYA 1JYCA 3CZJA 3HPNA 4MGKE 1OD3A 5I91A 5ANQA 5FYVA 1JUHA 5C5UA 3PDQA 4K8FA 4XFGA 4HK9A 3EYPA 5FPBA 3WG4A 1AJKA 1RUJ1 3MIGA 5FP3A 1GQHA 1ULFA 2ERFA 3TOJA 2DVDA 4N7IA 1OOPC 1LEMA 1RMU3 1ZBA2 2R041 4YG0A 1W6MB 4LLFA 2HWF3 2ZGKA 5KHJA 3IN9A 5GLZA 3VDCA 2AR6A 3OYWA 2EALA 4HN0A 2ZKLA 4XTPA 1GQPA 2WN3A 1ND2A 4ATEA 4MYEA 3ABZA 4OHVA 4KL1A 4CTEA 3F2ZA 4IL7A 3THCA 4YM0A 1GP6A 1A8MA 4LHLA 5E89A 2FDGA 1VBC1 3N4MA 1SLIA 4Q4W1 1XU2A 5FWEA 1KFUL 1HQWA 4NHKA 2WWJA 5B4XA 1H8TB 1V6KA 1ONAA 4QXBA 2UYBA 3SKJE 1HB4A 4Z82A 2ZAAA 1WMDA 4CP9A 2NLRA 1PNGA 1RVF1 4FFHA 2P3JA 2WA4A 1QGLA 2WZ8A 5BNNC 5C9AA 4FPOB 1QHDA 2WSVA 4LHSA 2C6SA 5C6CA 1YCIA 2DUQA 1RUI1 5KXEA 4OMDA 1YJLA 5I0UA 5FMOS 4YW1A 4XHBA 1C3HA 5IVCA 2JJ6A 4W6YA 5IATA 4R52A 1TME2 1PO12 4YW3A 1QEXA 2OQ7A 2R043 4DRVA 5KXCA 4HSLA 3EB7A 5CNAA 1IQAA 5K0UA 4MXWB 3ZSLA 2QQOA 4DS0A 3GF6A 5A3UA 1IS5A 2EIDA 1GNYA 1PX3A 1PGW1 3OPTA 5FPAA 1AXKA 3UV9A 2QQNA 5F1RA 3HQRA 1PGL2 3FL7A 1H2KA 3AZXA 3NW4A 4H7LA 1GR3A 4LKSA 3SH3A 3ZMNA 5KBFA 2YU1A 2ZX2A 3NSTA 5KXDA 3WHTA 4XFAA 2VULA 2RM23 4Q4X3 3HEIA 3MPPG 1MS8A 4BK4A 1VPHA 3WDVA 1RGSA 1LTEA 1TNFA 3LOIA 5GZFA 2WFF2 4JZRA 3LIGA 2WNVC 4GB32 4XFFA 1FPN3 2DCZA 4XILA 2YB7A 2A7AA 2YUEA 3WY6A 1OSGA 1SLTA 2WJSA 2JWPA 5FY9A 4HVOA 1PK6B 3WDTA 3RZMA 4AVCA 3MZHA 3FUOA 3RFRA 1POQA 2EIGA 3O1VA 4AQTA 1QOTA 3VBFB 2ZHKA 3WNKA 3TEYA 2ZHMA 1UU5A 2YHJA 1DF0A 1EV12 1XYOA 1YFWA 2D6OX 1NX9A 2WO1A 3FFZA 4AF9A 1JYWA 1R092 1VRH2 2JD9A 2NMNA 1VBD3 1T6BX 1OVSA 2PHUA 3K75B 4DEVA 3DECA 1DU3D 3CMGA 3VBOC 1V0AA 1V6IA 5FJHA 4QX8A 1GICA 2I74A 3N3HA 1OLRA 3WDUA 3ZSMA 3KV9A 3M3CA 1W3XA 1WUVA 1C4RA 1W8ZA 4LE4A 3HOBA 4PBPA 4XZUG 1BK0A 2RM21 1H8TA 2R063 5A7SA 4OHZA 3T2TA 4AFBA 2GC0A 4J6GA 3B5LB 3TRSB 5HXMA 5BXXA 1UQXA 1NLRA 2A6YA 1BEV2 2F17A 2W92A 5F7UA 2HWE2 4QHZA 1D4M3 3ETQA 4LIUA 5FYUA 3KMHA 1I6XA 3GZTB 1B09A 4NAOA 1QWRA
chains in the Genus database with same CATH topology
5LASA 4ZONA 5LB6A 3HQUA 4ZPIA 4MHUA 3GZEA 4UWDA 5EPAA 3OUHA 2Y34A 3BVCA 3NNLA 5HV0A 3OBZA 5C5TA 5LATA 4XCAA 4NHKA 2HBUA 4NHLA 5HV4A 2FCVA 4NMIA 4XAAA 5DAVA 5L9RA 3W21A 4NHMA 5LA9A 3PL0A 5IATA 2G19A 2JIJA 5DAQA 2RG4A 4XC9A 5A3UA 4MHRA 5DAWA 4Q5OA 2Y33A 3GJBA 3DKQA 3HQRA 3KT7A 4KBZA 5ERLA 5LBFA 5EP9A 4Y5TA 2RDRA 5DAPA 5M0TA 3KT4A 4JZRA 2RDNA 4XABA 3GJAA 4XCBA 2RDQA 2JIGA 3NNFA 3KT1A 4J25A 5EQUA 2OPWA 5L9VA 2FCTA 4IW3A 5LBEA 2A1XA 3EMRA 3MGUA 3NNMA 5IAXA 4BQXA 3OUJA 4NHYA 4XACA 5LBBA 5DAXA 3W20A 5IAVA 2FCUA 2RDSA 5C5UA 3OUIA 2HBTA 3NNJA 5L9BA 3ITQA 2V4AA 4NHXA 4BQYA 2G1MA 4BQWA 4Y5SA 5LBCA 4NAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LAS A;  4ZON A;  5LB6 A;  3HQU A;  4ZPI A;  4MHU A;  3GZE A;  4UWD A;  5EPA A;  3OUH A;  2Y34 A;  3BVC A;  3NNL A;  5HV0 A;  3OBZ A;  5C5T A;  5LAT A;  4XCA A;  4NHK A;  2HBU A;  4NHL A;  5HV4 A;  2FCV A;  4NMI A;  4XAA A;  5DAV A;  5L9R A;  3W21 A;  4NHM A;  5LA9 A;  3PL0 A;  5IAT A;  2G19 A;  2JIJ A;  5DAQ A;  2RG4 A;  4XC9 A;  5A3U A;  4MHR A;  5DAW A;  4Q5O A;  2Y33 A;  3GJB A;  3DKQ A;  3HQR A;  3KT7 A;  4KBZ A;  5ERL A;  5LBF A;  5EP9 A;  4Y5T A;  2RDR A;  5DAP A;  5M0T A;  3KT4 A;  4JZR A;  2RDN A;  4XAB A;  3GJA A;  4XCB A;  2RDQ A;  2JIG A;  3NNF A;  3KT1 A;  4J25 A;  5EQU A;  2OPW A;  5L9V A;  2FCT A;  4IW3 A;  5LBE A;  2A1X A;  3EMR A;  3MGU A;  3NNM A;  5IAX A;  4BQX A;  3OUJ A;  4NHY A;  4XAC A;  5LBB A;  5DAX A;  3W20 A;  5IAV A;  2FCU A;  2RDS A;  5C5U A;  3OUI A;  2HBT A;  3NNJ A;  5L9B A;  3ITQ A;  2V4A A;  4NHX A;  4BQY A;  2G1M A;  4BQW A;  4Y5S A;  5LBC A;  4NAO A; 
#chains in the Genus database with same CATH topology
 3BIE A;  2VQT A;  1KDM A;  1FYU A;  1Q8V A;  1SFN A;  4GWM A;  1PK6 C;  3VKL A;  1LOF A;  1QH6 A;  5A7N A;  1UIJ A;  2QE3 A;  3AYD A;  1PO2 2;  2DVB A;  4MHU A;  4OCT A;  5T5O A;  2O8Q A;  5T55 A;  3JCI A;  3U4X A;  5I0R A;  2QQI A;  1B35 A;  1JXN A;  2ZTN A;  3E1F 1;  3POE A;  4COZ A;  4Z8B A;  2UY9 A;  2NP0 A;  2ZGR A;  2R07 1;  1OLM A;  4CE8 A;  5LAT A;  2OUH A;  1O59 A;  4WM7 C;  4L92 A;  4YVW A;  1VBD 1;  4ZKT B;  1ENS A;  4KU7 A;  1W9F A;  1DYK A;  5FZH A;  3TYJ A;  4F8A A;  5B4N A;  1RUH 1;  1AR9 2;  5D8A C;  2FCV A;  1UO9 A;  5IFP A;  2R06 2;  5KHH A;  2XUE A;  1I5P A;  1MEC 2;  1W2T A;  4UW5 A;  2W08 A;  2YDE A;  5FY5 A;  4FQZ A;  2A6Z A;  1W8O A;  2Z4F A;  3WP3 A;  5F2W A;  2RR1 2;  4AYU A;  1PGS A;  2VQU A;  5JSP A;  4FXG B;  3B94 A;  4QB2 A;  1LHU A;  1PVC 1;  1FMD 3;  4BCU A;  5IVF A;  4XUP A;  1VBE 2;  1JZ3 A;  1PO2 3;  4CDU A;  2BER A;  5JI7 A;  2WNV B;  1D4M 2;  5IHR A;  2JEC A;  4XC9 A;  1FNY A;  2JXA A;  4HG6 B;  4ZXE A;  4P14 A;  2EF6 A;  1JYI A;  3LFM A;  4MO3 M;  4RHV 2;  1JZ6 A;  4NPR A;  3GJB A;  1SG3 A;  2PHF A;  4O9E A;  5A33 B;  3LD8 A;  1TE1 B;  2GMM A;  5I0D A;  5IK5 A;  1NYW A;  1ZRE A;  4EN8 B;  2ATF A;  4NRO A;  2W3J A;  1TMF 2;  5BNQ A;  2R07 3;  5F3I A;  3AL6 A;  4FPJ A;  5K9Y A;  4BDV B;  2FBE A;  1JZ4 A;  4CCE A;  5GLT A;  2VZ3 A;  1NCQ C;  1EPZ A;  2P2K A;  4Z2A A;  1EUT A;  4CCN A;  1U5Y A;  2AYH A;  2VUC A;  2BNM A;  2X5I A;  5D8A B;  5T50 A;  1ASJ 1;  4QHO A;  3FHI B;  3LEM A;  3HVD A;  1CD3 G;  2WNO A;  4AR2 A;  3NNF A;  4EWD A;  5JXH A;  1O8S A;  5HCB A;  4AGR A;  2PQQ A;  1IPS A;  1HB1 A;  4Y1Y A;  4CCK A;  3DN7 A;  5BNO B;  1FMD 2;  4XHX A;  3VDD A;  2FDJ A;  1U12 A;  5E88 A;  3V0B B;  1NUK A;  5JR7 B;  3I2D A;  1QIQ A;  1QJU 3;  1F2N A;  5L7O A;  1PVC 3;  2CAU A;  2W91 A;  4FI9 A;  5IAX A;  2X5I B;  4U2A A;  5FQ0 B;  4CYD A;  4HPK A;  5FCC A;  1O5U A;  2JDN A;  5GM0 A;  5L36 A;  2A6W A;  3AZW A;  3LEG A;  2JE8 A;  2X53 S;  5APA A;  4D6R A;  1HRI 3;  1GZT A;  4K6B A;  3U78 A;  1CON A;  3N7L A;  3NMB A;  3OGJ A;  3UES A;  4CCL A;  1VBB 3;  4DOU A;  1NT0 A;  5F9T A;  3V0B A;  2X09 A;  2YMZ A;  1HXS 3;  4LKD A;  4OMC A;  4LHK A;  2P37 A;  3KV4 A;  4U36 A;  1WW4 A;  5CKQ A;  3O1R A;  5L9B A;  3ITQ A;  5FYH A;  3V64 A;  2VZ1 A;  4FPH A;  1S0F A;  3GNE A;  1SFP A;  1N3P A;  3WG1 A;  4YLZ A;  4CXX A;  4AQ6 A;  1PMJ X;  3B00 A;  2ADD A;  4CDW B;  4MVT A;  5H9P A;  1FV2 A;  2KXL A;  5FZ0 A;  4AQS A;  4CXW A;  3BUC A;  1S0D A;  2DV9 A;  1JHJ A;  2ZX4 A;  3PHM A;  4XFC A;  2DFC A;  4FPF A;  4CDX B;  4RL7 A;  3S0M A;  4YW2 A;  1ZRD A;  2BGP A;  2ZS6 B;  4XJU A;  5DXD A;  2OZ6 A;  4DQA A;  2LRP A;  2VZT A;  4LOR A;  2YY1 A;  2UUR A;  5KWR A;  2B4K A;  1MS0 A;  1Z78 A;  4KU8 A;  2VGD A;  3ZYB A;  4RGK A;  4QX3 A;  2VOX A;  1AYM 3;  1Q3E A;  2FHR A;  4JTO A;  1HRI 1;  1LOF C;  3MFA A;  3MDP A;  4LBN A;  5D2A A;  1YI9 A;  3VKO A;  3VBR A;  3WSO A;  1COV 2;  4YGE A;  3MLL A;  2JG9 C;  3HT2 A;  1OI6 A;  2VNR A;  2WLP A;  3M70 A;  4CDX C;  4FT8 A;  2EIE A;  2Y6F A;  5FWJ A;  1J3P A;  3ES1 A;  1O4Z A;  4BB3 A;  2C5D A;  3ILF A;  3UKV A;  1C5H A;  2VME A;  1DQ1 A;  3AXD A;  4AGG A;  2OS2 A;  5LK7 B;  2Q8O A;  5A3O A;  2ZAC A;  2BFU S;  4WVZ A;  4WZF A;  5CKM A;  3AKS A;  4YZ4 A;  3IDC B;  2ARB A;  5FP7 A;  5I8T A;  2CDP A;  1YLL A;  3LDK A;  4JGZ B;  1YIF A;  1ZZ9 A;  4DIQ A;  1LOB A;  3CO2 A;  4N43 C;  2BNO A;  1XNK A;  1YXW A;  1JOP A;  3P6B A;  4YGB A;  1BMV 1;  3ZVX A;  5FR3 A;  1RUC 2;  1W03 A;  3HN3 A;  4QM9 A;  2VZO A;  4W6W A;  2VW2 A;  4JKL A;  2VVE A;  2Q8D A;  4N9I A;  3KSC A;  3WG3 A;  3N9L A;  4DUX A;  3NKT A;  1UY0 A;  5C70 A;  3WZ1 A;  1SPP B;  2QQM A;  2ZAB A;  4IEV A;  1AR6 2;  1GZW A;  1S0C A;  3ZXF A;  1RC6 A;  5DN2 A;  1V6J A;  1W9S A;  3HT1 A;  3P3P A;  1RUG 1;  5KHG A;  1DBN A;  2ZHN A;  1AYM 1;  2KD7 A;  3DPR A;  3OF1 A;  4AVT A;  1WLC A;  4ZZ5 A;  3TN9 1;  2C26 A;  2DBN A;  1BQP A;  3MW4 A;  5F6K A;  4EV0 A;  1GP4 A;  5DPN A;  3C7E A;  3VHR A;  1OXC A;  2A73 B;  2UYA A;  2WAA A;  3S7E A;  1QJY 2;  2W1Q A;  3MPB A;  4P08 A;  4FPK A;  2ZHL A;  5G05 L;  3ZN4 A;  3ZOI A;  1JUI A;  1G9A A;  4XF4 A;  4XF1 A;  2EAK A;  4QXC A;  5BNP B;  4LQR A;  5JPN B;  4KGQ A;  4HK8 A;  1OFS A;  3S7I A;  1TG7 A;  1F15 A;  3I59 A;  2HWB 3;  3UGH A;  2XON A;  4GJY A;  3TEW A;  4G3Y C;  1AZD A;  4GH4 C;  4IGP A;  2P3K A;  2UWC A;  4Q4V 3;  1PZ9 A;  2PLV 3;  4Q29 A;  5FRE A;  2XJP A;  3FFQ A;  3MO4 A;  5FLH A;  4E8C A;  4QKB A;  5JOX A;  4KI5 M;  1AL2 1;  4AWD A;  4XJW A;  2QQL A;  5IAV A;  3N9O A;  5JUV A;  1H6Y A;  1W05 A;  2HBT A;  2RS5 1;  2VZR A;  4UAP A;  4MGI E;  3KD4 A;  4QGN A;  1F35 A;  1U5I A;  2VG9 A;  4E27 A;  3KGL A;  2O8O A;  1JYV A;  4FP3 A;  5DDJ 1;  3LEK A;  1MVQ A;  1TEI A;  2A6X A;  1A34 A;  2DBI A;  5LBC A;  5LCW L;  2XVG A;  3AP6 A;  5CFC C;  1UMI A;  1J59 A;  3Q8F A;  5BNN A;  1URX A;  4YZ2 A;  1S2K A;  4HSJ A;  1D7P M;  1LOG A;  1W6N A;  4LTA A;  5JOZ A;  5GLW A;  3VDD B;  2VMC A;  5C71 A;  2XLG A;  2QVS B;  5L7O B;  4O65 A;  4FOY A;  5FYS A;  2QZ2 A;  3R4U A;  4G9S B;  3DYP A;  3ILN A;  2HWB 1;  4Q4V 2;  4RR3 A;  3I3D A;  3CDZ B;  3VZL A;  1PHM A;  1GOF A;  1RB8 G;  5JPM B;  4BXF A;  4NUB A;  4ARY A;  2HYX A;  2XJR A;  4JGZ A;  3A4U A;  3AMP A;  2HBU A;  3J7L A;  3RWK X;  1ND2 C;  4W4Z A;  2GAU A;  2ZEW A;  2D93 A;  2ZGT A;  2OYZ A;  3ZYR A;  4A7Y A;  3C7G A;  4XQ4 A;  4DY5 A;  3MLJ A;  1J83 A;  3FHA A;  5ABJ A;  2VOK A;  2RS5 3;  2CSG A;  3FJS A;  4N43 A;  2Z69 A;  4QDS A;  4IE4 A;  5DUV A;  2VXR A;  2VW1 A;  4RGA A;  1FPN 2;  5C8C B;  5KR7 A;  3VN4 A;  1QMJ A;  1MZF A;  2GAL A;  3D3A A;  4OUL A;  4CP2 A;  4NID A;  1KJL A;  2QTW B;  3VLB B;  3VBR C;  1A8D A;  2XLF A;  2JIJ A;  3VBS C;  2VOW A;  4N53 C;  3T4V A;  4CDW A;  3ILR A;  1FT9 A;  5E6H A;  2NZ9 A;  3ZSK A;  4QGM A;  4PQ9 A;  3ZXL A;  4CUG A;  1CAV A;  4CA9 A;  5BNP A;  3WNO A;  3S5A A;  3VDD C;  4N43 B;  1ZBA 1;  2R04 2;  4GXL A;  4CEW C;  3FLP A;  2BVV A;  1HQL A;  4RQP C;  3ZKU A;  1ULD A;  3J4U H;  5JVV A;  1NCR C;  4OHY A;  3H7J A;  4BZ4 A;  4OI4 A;  3MUZ 1;  1CIY A;  4N7U A;  3VZN A;  2WA3 A;  4DXS A;  3E97 A;  2JDY A;  5C8C C;  1RIN A;  4Y5T A;  2FDF A;  4BMB A;  5JWP A;  3A22 A;  4COY A;  5A1A A;  3FUQ A;  5DZF A;  2EAA A;  1SBF A;  1VBC 2;  5J7M A;  3M3Q A;  1HRV 2;  2D5F A;  4GZ9 A;  1S0J A;  5I93 A;  1US3 A;  2OPK A;  4EZH A;  1UU4 A;  5J98 B;  1DYO A;  3N7J A;  4WVM A;  3VBO B;  1BCX A;  4E2G A;  3C7F A;  3WVJ A;  1CPM A;  2VMG A;  2WSU A;  1Y7B A;  2A3X A;  1HDK A;  5GZE A;  3PTR B;  5F5I A;  3ZN5 A;  1ZM1 A;  2OQ6 A;  4MGZ E;  4OUM A;  1OOP A;  3FE5 A;  4CVU A;  4GUL A;  4Y1U A;  1QY4 A;  2A3W A;  3BI3 A;  4YM3 A;  1KJR A;  1ZBA 3;  4JHZ A;  5ANN A;  1V6N A;  2G4I A;  1UMZ A;  1DGW X;  4OYU A;  1SPP A;  1JYT A;  1EPW A;  4OHX A;  4RR3 B;  4JKK A;  2P17 A;  2Q5T A;  2D5H A;  3WUC A;  3H8U A;  4CP0 A;  1ULE A;  3AKR A;  1GNZ A;  1CX4 A;  3DPR B;  3LIH A;  4I0A A;  1HIX A;  2XQR A;  2ARC A;  3POS A;  2R1B A;  3K3N A;  1PIV 2;  1AR8 2;  2FDI A;  2JDM A;  4BQW A;  1WLT A;  1Y4W A;  1YO8 A;  5F37 A;  1UMH A;  4D6Q A;  3THT A;  2XG3 A;  4WZC A;  2E9Q A;  2VOT A;  2WN2 A;  4Q4X 2;  4LO8 A;  4MGQ A;  2GC1 A;  3J7N A;  1JZ7 A;  5J48 A;  5AC9 1;  4C8D A;  2IXC A;  4YAR A;  1HN1 A;  1LUL A;  2P6H A;  3DXU A;  4C91 A;  1Q8O A;  4QPI B;  3IAQ A;  5A70 A;  5KC5 A;  3H0O A;  2G9G A;  1BVP 1;  1V70 A;  4L0P A;  4HET A;  5EPA A;  4BQ1 A;  1QJE A;  2GN7 A;  1NCR A;  3WF1 A;  3SHR A;  5KHK A;  4QX1 A;  1OQE A;  5JZG A;  4IEX A;  1VJ2 A;  1UZZ A;  3OBZ A;  3ZSJ A;  3R4S A;  5HBA A;  4WBB A;  1W2N A;  1WCU A;  4Y22 A;  3MV0 1;  3WQB A;  4W8J A;  2PFW A;  5FZO B;  1F31 A;  3VBS B;  4QPG B;  4XJ9 A;  4A3Z A;  1CN1 A;  1BKZ A;  2X29 A;  4NMI A;  1LHN A;  3TNP B;  1F9K A;  4S2H A;  4XAA A;  2ZKN A;  4XFI A;  4B7E A;  2Y0I A;  1WME A;  3HD8 B;  2ZX3 A;  4LBJ A;  2D97 A;  1IS4 A;  1C8M 1;  4OLL A;  4D94 A;  5IUQ A;  5FO8 B;  4AEM A;  2DVA A;  2XGX A;  4NIH A;  4P9L A;  3CU7 A;  2QFE A;  3BOW A;  3D0J A;  4A7K A;  2JD4 A;  3ACH A;  4CDQ C;  5H9R A;  3OEB A;  4LIT A;  1B35 B;  4AHZ A;  1RL3 A;  4M3C E;  4D3W A;  4RD7 A;  1VMF A;  3DKW A;  4UW3 A;  1QQP 1;  2YPJ A;  3AC0 A;  4SLI A;  2BU9 A;  4UXA A;  4JGZ C;  3I4I A;  1XC6 A;  4IV1 A;  4JDO A;  3AYE A;  3MIH A;  5DAW A;  2D43 A;  4Q5O A;  2ZA9 A;  5A7Q A;  1H2M A;  1NZI A;  3USU B;  3PUR A;  2W9X A;  5C3O A;  4WM8 B;  2GP3 A;  2PHW A;  4JDM A;  4LK7 A;  5ERL A;  4LA2 A;  5EP9 A;  3GBW A;  3IPV A;  5DUW A;  5JI9 A;  1VP6 A;  4MXV A;  3WNM A;  3MLK A;  3WHU A;  2VD7 A;  5JXI A;  5I0S A;  1GYK A;  2I07 B;  1Y9M A;  1UXZ A;  1QJY 3;  4QX5 A;  2CWS A;  2ID4 A;  4UFH A;  5FYY A;  4XZP A;  1SDD B;  4ES8 A;  4RQP A;  4A2U A;  3PVN A;  5JCT A;  5C4W C;  2GN3 A;  1G9D A;  2QQP A;  4GMP 0;  1XB9 A;  4BME A;  3U1X A;  2D6L X;  2PMW B;  2VZU A;  2XWJ B;  1UN1 A;  3RG0 A;  3RZG A;  1OQ1 A;  3NO8 A;  4YW6 A;  1YI7 A;  5A32 B;  4ASK A;  3WCS A;  2ZGN A;  1RUE 3;  4OZX A;  1O91 A;  3JD7 2;  4FO9 A;  4COU A;  1MQT B;  1IG3 A;  1AUY A;  2C4X A;  5A7W A;  1X7N A;  4IW3 A;  3ZO0 B;  4E9K A;  5DQ0 A;  5CAD A;  2VBD A;  4A45 A;  4LBQ A;  4GQ7 A;  1K3I A;  1Y9Q A;  1SHW B;  2BW8 A;  5LA0 A;  2QCS B;  1E57 A;  5EFU A;  5FZD A;  3VHO A;  4AFM A;  4V2V A;  3V0A B;  3PIJ A;  4XDO A;  4E4S A;  4X8P A;  1NZC A;  3VBH B;  3BGA A;  2XHN A;  4FPC A;  5FZL A;  2F4L A;  4P9J A;  5A1F A;  5FZ3 A;  3URF A;  2HWD 1;  2J1U A;  5DAX A;  1HX6 A;  4CSW A;  1O3R A;  5EJ1 B;  4SBV A;  1UPS A;  1RUO A;  1AR7 3;  4X6Q B;  3T0B A;  1NLS A;  2WO7 A;  2VW0 A;  4QQO A;  1CGP A;  3KV5 A;  4KWU A;  1G9B A;  3T1L A;  1H4G A;  4Q26 A;  3AP7 A;  2E32 A;  1WD4 A;  1TME 3;  2WL1 A;  2XL7 A;  4W6X A;  1ULG A;  4OZO A;  1W6P B;  2ZOE B;  1E5R A;  3WW2 A;  1OD5 A;  1FOD 3;  3DV8 A;  4JX0 A;  4KMQ A;  4ZON A;  3MID A;  4JHT A;  4PI2 A;  1RUE 1;  1R1A 1;  2GC3 A;  3EO6 A;  5FZF A;  2O1Q A;  3VBU A;  3FLT A;  1LGC A;  5CFD B;  4BK5 A;  2WQ8 A;  2VE1 A;  3BVC A;  4R9A A;  1W8T A;  5FPL A;  1PIV 3;  1UU6 A;  1AF9 A;  3OJB A;  5DZG A;  1UOB A;  2WRA A;  2ZMN A;  4L11 A;  3WUD A;  4CEY B;  3W5M A;  1RVF 2;  2VU9 A;  3AKT A;  3H3U A;  4QGL A;  4MGY E;  2V72 A;  2EXH A;  1ZRR A;  2BGC A;  1IG0 A;  1NE4 A;  3U4S A;  2VJX A;  4XFB A;  1RUI 2;  2GH8 A;  2VMD A;  1NOV A;  2GMP A;  3I3B A;  3N7M A;  5GJ6 A;  1HXS 2;  3APB A;  1PM7 A;  1TME 1;  3GCW A;  1W6O B;  4YFW A;  2W46 A;  4CCM A;  2WBK A;  1FAT A;  3K51 A;  1LHV A;  3KCX A;  2DUR A;  2PHX A;  2WZR 1;  3ZSE A;  1FOD 1;  5LWB A;  4J1X A;  4OUS A;  1NY7 2;  4Y3O A;  5ABJ C;  3T2O A;  2PXJ A;  1AR9 3;  3ZR6 A;  2O0O A;  4GH4 A;  4Y4Y A;  1CPN A;  1UYY A;  1X9P A;  5DAQ A;  4XUT A;  1W06 A;  4IV3 B;  1YFY A;  5F32 A;  2QZ3 A;  2WLQ A;  3AM2 A;  4QKF A;  2WZP P;  4FAG A;  5IK8 A;  2ZJC A;  2VBP A;  4JRA A;  1IPJ A;  1WMX A;  1WW5 A;  3N9M A;  3OD4 A;  4QX7 A;  1UX7 A;  3VL8 A;  4EN6 B;  5GKA C;  2RR1 3;  4K3U A;  5G04 L;  4RFT 0;  3ZXE A;  1ZRI A;  1YNA A;  5A1L A;  2YGM A;  3OSD A;  4AZZ A;  2BGO A;  1WWY A;  3VBH A;  1IS6 A;  3POY A;  2ZX1 A;  1HN0 A;  5FOB B;  4CP9 B;  2E6V A;  4LUL A;  3D0S A;  3K4Z A;  3J8F 1;  3NV4 A;  4DB5 A;  1DCS A;  4AFC A;  1W3V A;  3M3O A;  2IZW A;  4BOW A;  4LPL A;  1BVV A;  3JZV A;  1UYP A;  4PIY A;  3BTX A;  4CEW B;  1OT5 A;  4B29 A;  3W9A A;  2IXL A;  4AI8 A;  4BXS V;  1LJ7 A;  1TQ5 A;  3T3Y A;  3FMG A;  4TXW A;  2E7Q A;  5FXV A;  2FCT A;  1W2O A;  2WZR 3;  1MVE A;  4PJY A;  1AX1 A;  4OQ8 A;  1XE0 A;  3ETP A;  3VHP A;  5IK4 A;  4RFR B;  2JG8 B;  5EIY B;  2BBV A;  2WWU A;  1VAV A;  5A7P A;  1UY1 A;  1GAN A;  3SQO A;  1KRI A;  1C8N A;  3ZFF A;  1UY3 A;  4TZD A;  4YYO A;  1MZ5 A;  2BJS A;  4H2A A;  1H0B A;  5CB7 A;  2B46 X;  1HJF A;  2Y6K A;  2ET1 A;  3BB6 A;  4IV1 B;  2RM2 2;  2EXJ A;  3FC0 A;  1AVB A;  3GBF A;  3BOD A;  1OF4 A;  1ST8 A;  2RVA A;  3CQO A;  3OUI A;  3ES4 A;  3WT3 A;  1CJD A;  2WT2 A;  3ZKY A;  5DUX A;  3KQ4 B;  1O5L A;  1LR5 A;  2XJQ A;  1MS5 A;  2YXS A;  1LED A;  2HEY F;  3AKP A;  3TBD A;  1ND3 C;  1UXX X;  2BYV E;  3OY8 B;  2VNV A;  1VAM A;  4Y5S A;  1EAH 1;  3A23 A;  1W9W A;  3GBG A;  4JTN A;  2BQP A;  4H55 A;  4I2O A;  2QQK A;  1HB2 A;  2TEP A;  1I1E A;  3MIF A;  2YC2 A;  4AVS A;  1ND2 B;  2Y0O A;  5LAS A;  1VBB 2;  1VBA 1;  2Y6L A;  1OH3 A;  4LLO A;  4Y1X A;  4AHW A;  3OGG A;  5KHI A;  4BQ3 A;  1JS9 A;  3IIA A;  2HWC 1;  3HJR A;  3BPZ A;  3ZR5 A;  2P1B A;  3OYW B;  2Y60 A;  5EWS A;  1S1A A;  3B3Q E;  1QXR A;  2D6N A;  3IB3 A;  1W8W A;  2AEN A;  1DZR A;  2DU1 A;  4GJZ A;  1SLL A;  4YW5 A;  4GH4 B;  5FYM A;  1K5J A;  4IEZ A;  4JQR A;  5ABJ B;  3JB8 A;  2J1E A;  1JU3 A;  3O1T A;  4QWN A;  1AX0 A;  3FX3 A;  4XQD A;  3ACI A;  3NV3 A;  4GMP 1;  4HPK B;  3UJO A;  5FZE A;  5HCA A;  1US2 A;  3MIE A;  1XYN A;  4BLI A;  4HMZ A;  4LUM A;  4P9I A;  2D6K A;  5ACA 2;  4XYX A;  1GKB A;  1CQ9 A;  2BNN A;  3IM0 A;  4QQ2 A;  1A78 A;  4ZU7 A;  5J1X A;  3USS A;  1CWP A;  4OVE A;  3I2O A;  2RS5 2;  3O1S A;  3AZY A;  3PL0 A;  4UW6 A;  4TYS A;  5FO9 B;  3CIH A;  1G8W A;  3WF3 A;  2PEL A;  3M8L A;  4OQ9 A;  4RHV 1;  2HJI A;  3ZXD A;  3C8X A;  4BIS A;  4IEO A;  4BM8 A;  4LK6 A;  2IXH A;  5A6X A;  3P5B A;  2HWC 3;  3PME A;  2RS1 3;  2MHF A;  1SZB A;  3KT7 A;  1Q43 A;  1O4T A;  2ZGL A;  2WQZ C;  4D7T A;  1QJX 1;  5IWF A;  1UZV A;  1V6M A;  1AYN 3;  2OW4 A;  3LSE A;  4JAA A;  5FYT A;  1Y43 B;  1NA1 B;  5DG1 A;  5CIR A;  3JQX A;  4XBN A;  3CLP A;  4UF0 B;  1RUD 2;  2ZBJ A;  4LOT A;  3RWN A;  2PN5 A;  2A5Z A;  2OT7 A;  4P5H A;  5T52 A;  1W8F A;  4Q4W 2;  5F5A A;  5FXZ A;  3I2K A;  4JRL A;  2NQY A;  1DQ5 A;  4XAB A;  3VD7 A;  4IEY A;  2BTV C;  1JW6 A;  4QKD A;  3ZPO A;  4LT5 A;  1LOE A;  1ZZC A;  1LHW A;  2VMF A;  3AFK A;  3LPF A;  4ITC A;  4IV1 C;  3I2F A;  2IWG B;  1L7L A;  2BWA A;  2XBO 3;  5FZC A;  4M00 A;  4AED A;  3QLQ A;  4AI2 A;  4DXR A;  1WZX A;  1ZYB A;  2V5D A;  1GV9 A;  4L97 A;  2WFP A;  5L9V A;  1XE8 A;  1BXH A;  4E4H A;  1NCQ B;  1OLM E;  1G7Y A;  1NE6 A;  2ZGO A;  4HKW A;  2P5B A;  3VZM A;  1O7F A;  3RI8 A;  1LEC A;  1H2L A;  2OII A;  4ZY9 A;  1COV 3;  4O61 A;  3T08 A;  2RS1 1;  1Q56 A;  3EQE A;  3T4H B;  2XQX A;  1LOD A;  3LAG A;  2MEV 2;  4R4Z A;  5SV5 A;  2JG9 B;  5FZB A;  2HKX A;  1QJX 3;  3ECQ A;  3CJX A;  1AYN 1;  4HZF A;  4B8E A;  1QKQ A;  2EIB A;  3Q8B A;  2RS3 1;  1BBT 1;  1D0H A;  4TWT A;  2WQ4 A;  4G4F A;  3UJQ A;  3T0D A;  1CAX B;  1GOH A;  2V4A A;  3ZXA C;  2VM9 A;  4M01 A;  5FYC A;  4CU8 A;  4NVP A;  1UPI A;  5D8A A;  2XDV A;  2PLV 2;  4P9X A;  4QPI A;  4EZ4 A;  1ZA7 A;  1N1V A;  4UBG A;  4XE9 A;  2NM1 A;  2W1W A;  1WA6 X;  3OB8 A;  2WFF 1;  3NAP C;  1S55 A;  3HQU A;  3QAC A;  1QH7 A;  1R08 1;  3AMN A;  5FBZ A;  4ZPI A;  4FPL A;  2KA3 A;  2O14 A;  4D69 A;  3PTY A;  4N53 A;  2DCY A;  3VBS A;  1VR3 A;  5IT6 A;  2PAK A;  1N1Y A;  3WDY A;  1FI2 A;  4R9C A;  4XXA A;  3F95 A;  3ZFF C;  2GC2 A;  1DQ0 A;  2ZAH A;  3HN1 A;  1COV 1;  3KCY A;  1AHS A;  5AFB A;  1J3Q A;  2XJT A;  3AP4 A;  4MET A;  4AL9 A;  5DUU A;  4XQW A;  1JH5 A;  3LKJ A;  4JVA A;  2K2S A;  5CFD C;  3NJX A;  4WM8 C;  2QNK A;  2RS3 3;  5L9R A;  3HBK A;  3ZFE C;  1NA1 C;  4OI2 A;  5F2S A;  2F4P A;  3NJY A;  1WD3 A;  2D3S A;  1LHO A;  5CZK A;  5IVY A;  4ORF A;  2IXJ A;  3CEW A;  1RUC 3;  1AR8 1;  2ZZJ A;  3ZFG A;  3UL2 A;  4I0W B;  3MW3 A;  3EHK A;  1BEV 1;  4PF5 A;  3IPV B;  4GKY A;  4LO7 A;  5FZ8 A;  5FPU A;  3VBH C;  2MNG A;  2J1V A;  1UNB A;  2YGL A;  4QPW A;  1GLH A;  1R08 3;  4Z2W A;  2AUY A;  1GBG A;  1VBE 3;  2QBX A;  5BNN B;  5ACA 3;  1RED A;  1YQC A;  2WDB A;  1RUG 2;  4UW4 A;  1XSR A;  3H50 A;  3T09 A;  4ES9 A;  3WCR A;  5CG8 A;  5FO7 B;  3SXW A;  2RDR A;  4AFA A;  1GWK A;  1GWM A;  4F7Z A;  5FYI A;  1JZ2 A;  4IGQ A;  4XUN A;  1NAE A;  2FMY A;  2W0X A;  4IES A;  3E5X A;  3KZ4 C;  5K4L A;  3VDA A;  1WKY A;  4P9Y A;  3TWI A;  1OOP B;  1ZRC A;  4FTS A;  3ATG A;  3MI8 A;  2OZJ A;  1XU1 A;  1YRZ A;  3A21 A;  1RMU 1;  3WQ1 A;  3UNP A;  5FLJ A;  3VBF A;  4QPY A;  3OGV A;  3RJ2 X;  3ZMO A;  1LCL A;  4XBL A;  2A75 A;  1LAJ A;  1JOD A;  4QD2 A;  4OFG A;  3THP A;  2J7M A;  3KF5 A;  2EXK A;  2WS9 3;  3MYX A;  5EQU A;  4YM2 A;  3AJY A;  1C57 A;  3EMR A;  3K4A A;  5D1I A;  4D7S A;  1DGR N;  4IE5 A;  5IVB A;  1AR8 3;  2DF7 A;  3H3Z A;  3U37 A;  1IQD C;  3IDB B;  3PUI A;  3R4D B;  1BEV 3;  1UIK A;  2CAV A;  2ETE A;  3NAP A;  1BLZ A;  2I45 A;  3K48 A;  4Y4R A;  1IS3 A;  1PX4 A;  3ZDS A;  4BJ0 A;  1D4V B;  1VBE 1;  4I01 A;  4K1Y A;  4K21 A;  5CYY A;  3WQ0 A;  4NWV A;  2ZGU A;  1M4W A;  1RVF 3;  1XOY A;  2PHL A;  2R6Q A;  4PBO A;  1VB2 A;  2LW8 A;  2WZE A;  2D40 A;  1SBD A;  5HI0 A;  3M4F A;  1BJQ A;  4IER A;  2IUW A;  3LFI A;  5K0U B;  4ASL A;  1E5S A;  2XXZ A;  1TMF 1;  1W8U A;  3D5O A;  4BWO A;  4YSF A;  1DLL A;  1VB4 A;  2CHH A;  4XJA A;  4LBO A;  1UD1 A;  1UF2 C;  2E7A A;  4Y1V A;  1X8E A;  4IXL A;  3VD3 A;  3PLQ A;  1GNH A;  1NG0 A;  5K0U C;  1ASJ 2;  3U75 A;  2WS9 1;  4JGY B;  5A3M A;  1X50 A;  5I0T A;  3ZFE B;  4RSU A;  2E33 A;  1OC1 A;  3OUH A;  2NYY A;  3I7D A;  4BE3 A;  3VKN A;  4MGT A;  5E1R A;  5IK7 A;  1QOS A;  1UYZ A;  1AJO A;  2DVF A;  1O4Y A;  2UU8 A;  4XF0 A;  1KIT A;  1REF A;  4KG0 A;  4NHL A;  1RTV A;  1G6N A;  3ZXK A;  4LHN A;  3H8X A;  4FOV A;  5E8A A;  2JE7 A;  1S0E A;  2X10 A;  2YBK A;  1FPN 1;  3BYW A;  4AFD A;  1KD7 A;  2H0V A;  1A6C A;  1OA4 A;  2JDH A;  2V4V A;  4HBN A;  3TB0 A;  1G86 A;  4ZHN A;  3E6D A;  2HWD 2;  3K77 A;  5CFC B;  1K5M A;  1AR7 2;  4FPE A;  2JDA A;  1CZV A;  4XUO A;  4QB1 A;  4ZXK A;  4CDU B;  1TMF 3;  1CZT A;  3E5U A;  3VHN A;  4E2S A;  2DDU A;  4QKN A;  4URT A;  1CAX A;  4NHM A;  5H9Q A;  3SH5 A;  2YG0 A;  3AK0 A;  3POJ A;  5JZG C;  1RUF 3;  3IT8 A;  2P6C A;  4M0H A;  4CXY A;  4LMF A;  3VD9 A;  4E4D X;  3SCH A;  3GCX A;  1H6X A;  3I2J A;  5K8S A;  1PO1 1;  3NV2 A;  4N90 A;  3RRD A;  5LY1 A;  1UL9 A;  2VMH A;  2XVL A;  1R09 3;  1VRH 3;  4Q27 A;  5IVV A;  5C4W A;  5BUV A;  5EXO A;  1PGW 2;  1RUE 2;  3I3Q A;  2AZ5 A;  3QOP A;  1VBC 3;  2ADE A;  2A71 A;  2ZMK A;  3KF3 A;  2KM2 A;  4JCK A;  1UAI A;  4Q0U A;  4Y33 A;  4Q4W 3;  1CAU A;  4Q8K A;  1OFN A;  1PGL 1;  3D4K A;  2B42 B;  2HWE 3;  1YUD A;  3ACF A;  1OA2 A;  1MQT A;  4C90 A;  2CWM A;  5F8P A;  1CAW B;  1GWL A;  4M3C F;  1Q8Q A;  3HNB M;  4XMI A;  3I2G A;  1DFQ A;  1SLC A;  3AB0 A;  3WF2 A;  1JU4 A;  4QQH A;  2BP6 A;  5C4W B;  3N9P A;  4ET7 A;  5JMC A;  1W9T A;  2XUM A;  3MW2 A;  1MAC A;  4JKM A;  4EN0 A;  5FYZ A;  2JIG A;  3JXS A;  4BQ5 A;  2C0Z A;  1FV3 A;  3C3V A;  4LO5 B;  3B69 A;  4Z92 B;  2JG8 A;  2R1D A;  5FMC A;  1RUI 3;  2HYK A;  4IV3 A;  1VE0 A;  1XNT A;  2VR4 A;  3C2U A;  2VZQ A;  3CNA A;  1O3T A;  3PIG A;  2Q8E A;  2D6P A;  4GD4 A;  2A1X A;  1C5I A;  1RUF 1;  1UOF A;  4BIO A;  1Z7S 1;  2CDO A;  1WCK A;  3LA3 A;  4FVV A;  1RJ7 A;  5IW0 A;  4YZ1 A;  3RZH A;  3SMH A;  1H4H A;  1PO1 3;  4NHY A;  5T3N A;  1EV1 1;  4JGY A;  3EBR A;  2ZGQ A;  4Q0Q A;  5F5Q A;  3T2Q A;  4XDP A;  1R09 1;  1VRH 1;  3N9Q A;  3ROU A;  4EN9 B;  4IQP A;  1YC6 1;  2B9U A;  2Z42 A;  5GLU A;  3SEP A;  4RS5 C;  2RE9 A;  2FMD A;  4NRQ A;  5FMO L;  4I0B A;  4YFZ A;  3PVB B;  1YQ5 A;  3UKT A;  2HWE 1;  1DYP A;  1CIW A;  4Q4X 1;  3SKV A;  2HEW F;  4BYY A;  4BQY A;  5FJK A;  4YGD A;  1OKQ A;  4PHZ A;  3OCP A;  1EP0 A;  1SQ4 A;  4K9S A;  1XRU A;  1ZX5 A;  3NWK A;  4I3G A;  5A33 A;  4GWI A;  3TN9 2;  2VPV A;  3WP6 A;  4BH9 A;  2A70 A;  2QDR A;  1PO2 1;  3WDX A;  4L2N A;  4XOG A;  3O14 A;  3MEP A;  3RYK A;  5JIU A;  1SMV A;  1POV 3;  2XJS A;  2ZGP A;  3LSD A;  4JGY C;  1GZ9 A;  1W6N B;  3AP5 A;  4K7J A;  4P5Y A;  4RGG A;  4WVM B;  4Q1R A;  4ASM B;  5C3P A;  3S57 A;  2XH6 A;  4L8Q A;  4A3X A;  4Z1V A;  5C3R A;  4EWA A;  5JXG A;  2JEM A;  5HV0 A;  2JX9 A;  4ZU5 A;  1FXZ A;  3HAG A;  4NJ4 A;  4V2W A;  1JHN A;  1Z7S 3;  4MH0 E;  5HXV A;  4AG4 A;  1K12 A;  4JDN A;  3EXU A;  1SLA A;  4MZU A;  3ACG A;  4TLG A;  3WNX A;  2PQS A;  1EV1 3;  2LS6 A;  3SEE A;  3AZZ A;  2BBA A;  1JN2 P;  2YZ4 A;  2VVD A;  4HT1 T;  3VUO A;  2DVG A;  3MIB A;  3BAL A;  3LDB A;  3M2M A;  3ZYH A;  5CAZ A;  1ASJ 3;  3W59 A;  4HOO A;  2B45 X;  4NIG A;  3TAY A;  1RUH 2;  2P3I A;  1AL2 2;  2DTY A;  4LA3 A;  2R06 1;  1MEC 1;  1WBL A;  1MQT C;  1GFF 2;  2CYF A;  2FZ1 A;  2BFU L;  1R64 A;  3CZU A;  2AGS A;  5FUN A;  3ZDV A;  2BPA 2;  3J7M A;  4AVB A;  2VAU A;  5LA9 A;  1QJU 1;  1D4M 1;  4TSV A;  4AGV A;  1UX6 A;  2XLA A;  1GSL A;  3KM5 A;  3OBR A;  1W90 A;  2OUJ A;  3VKM A;  1CAV B;  3L2H A;  3LCP A;  4FQ4 A;  3IBM A;  2WNU C;  5J36 A;  2XVK A;  1POV 1;  4XET A;  5A32 A;  1W0O A;  3BOP A;  1O8P A;  3H42 B;  4ATF A;  4DFS A;  5CKN A;  1EY2 A;  1G9C A;  1NCR B;  4LKF A;  1VBA 2;  1VBB 1;  3I8T A;  2BWC A;  2G9Z A;  2GH2 A;  2HWC 2;  5EHD A;  4IET A;  4AVV A;  3WOG A;  1H1A A;  4CDQ B;  1SDW A;  2HWB 2;  5F3G A;  3WEZ A;  5KXB A;  5J3U A;  1CX1 A;  4CUA A;  3ASI A;  4JC1 A;  1W04 A;  3WW4 A;  1RUH 3;  3OOX A;  2IXK A;  4Q2F A;  2QQU A;  3K3O A;  2CNA A;  5IVJ A;  2RDQ A;  2W1S A;  3ST7 A;  5JOW A;  1JOJ A;  2VUJ A;  3KT1 A;  4KGG A;  4PLN A;  1PMH X;  1H9W A;  3H3L A;  3KS7 A;  3VD4 A;  4BQ4 A;  1MEC 3;  3RZK A;  3IDE A;  1W6Q B;  1O6U A;  1ZZ7 A;  3VBO A;  1DQ2 A;  4AEK A;  1F8V A;  1X82 A;  3AVR A;  2YYO A;  5AVP A;  2D44 A;  2Y38 A;  3D82 A;  1ALY A;  4A4A A;  3MUY 1;  1J3R A;  4IEU A;  1MZE A;  1ZBE 1;  1H30 A;  1FMD 1;  3D8C A;  3NNM A;  4O7X A;  5FV3 A;  1UZ0 A;  4LBQ D;  4QU2 A;  1IPK A;  4AEJ A;  4AW7 A;  5BV6 A;  1PZ8 A;  5F6L B;  3OGS A;  2ZX0 A;  1W6O A;  5EZW A;  5A3W A;  4CUC A;  2OVU A;  3DXT A;  5H9S A;  4OI1 A;  3ZX7 A;  4CCC A;  3UYJ A;  2PAE A;  4FFG A;  2J22 A;  5FOJ B;  1OLQ A;  3K46 A;  3LQC A;  1W8H A;  3OEA A;  4MGS A;  4QPI C;  3WIN E;  2W95 A;  4RR3 C;  3I2I A;  2X8K A;  2DUP A;  5JMO A;  4Q4Y 2;  2WAB A;  3PJQ A;  5TSW A;  2MPF A;  2C9A A;  3V56 A;  2W1U A;  1YYN A;  5FYB A;  4DXZ A;  2WYS A;  1GOG A;  3E5Q A;  4QMA A;  1H1M A;  1PVX A;  3O0V A;  4XFH A;  2UWA A;  1KQR A;  3OBT A;  4M3C A;  4YVS C;  5T54 A;  5J37 A;  3CHX A;  3VV1 A;  1DDL A;  3NRU A;  3ZFG C;  1PZ7 A;  4Q0S A;  4A7Z A;  3RYP A;  1ULP A;  3GGL A;  1OUS A;  3M3I A;  3BKZ A;  1OPM A;  1QF3 A;  3X29 B;  3GZE A;  3L9J T;  2Z5W A;  4TLF A;  1RXG A;  1LU2 A;  1UY2 A;  2ORX A;  2PA7 A;  3S6P A;  1ZBE 3;  1XQN A;  2JG9 A;  4EN7 B;  3QCW A;  1JMU B;  1HB3 A;  2JDU A;  3B02 A;  4GIQ A;  1IHM A;  2WKK A;  3U10 A;  1POV 0;  4NAM A;  4FTE A;  4YVS B;  4ISR A;  2WAO A;  2RMU 1;  3SLI A;  2BDR A;  2QJV A;  1OMI A;  3G6J B;  1HXS 1;  4F3J A;  1HRI 2;  4FTB A;  4DMI A;  2BRT A;  2CU5 A;  1AX2 A;  2RS1 2;  3C7H A;  5T5P A;  5JDB A;  4KNC A;  3B01 A;  3LE0 A;  1SLB A;  2GZW A;  1SBE A;  2WZR 2;  1DGR A;  5A6Y A;  4ISQ A;  3RI9 A;  5AFE A;  1OH4 A;  3P3N A;  2AH2 A;  4ZS3 A;  5LW9 A;  3KVA A;  3KWV A;  4L99 A;  3E6B A;  4TN7 A;  5HCF A;  1BYH A;  3W5N A;  2Q1M A;  4CEY C;  1GU3 A;  3CBN A;  5F3E A;  3ZXG A;  1NQD A;  1V00 A;  2PLV 1;  3KLS A;  3OY8 A;  2FDK A;  1W6Q A;  3MV1 1;  1LGN A;  2DU0 A;  3LA2 A;  2AC1 A;  3ZXJ A;  2JKB A;  3AMM A;  5JSO A;  1AL2 3;  1HV0 A;  3KGZ A;  4KBZ A;  1W0N A;  3IWZ A;  3PMS A;  4I09 A;  2WNV A;  3K4D A;  4LUK A;  1AYM 2;  1I3H A;  4P02 B;  4YW7 A;  5FP9 A;  5IVE A;  1ZNP A;  2JEN A;  4AAX A;  1BMV 2;  1STM A;  4B1L A;  4COW A;  1MS9 A;  3WX5 A;  2XKP A;  4IUG A;  1K45 A;  4BHP A;  2BV4 A;  1YIP A;  3AP9 A;  5D21 A;  5A80 A;  5DDJ 3;  2JDZ A;  3A7Q A;  1W39 A;  3ZFF B;  3SC7 X;  4AVA A;  5A6Q A;  2PTM A;  2RMU 3;  3QH7 A;  4A41 A;  2DWR A;  2V5Y A;  4QXK A;  4RN5 A;  4XCB A;  2B8M A;  3C7O A;  1OF3 A;  4QHB A;  4FSJ A;  5A3P A;  5LZ6 A;  4CUB A;  1L7Q A;  1H2N A;  4C0B A;  1PM4 A;  5BY5 A;  4W50 A;  4J25 A;  2R07 2;  2HWF 2;  4MUV A;  4QM8 A;  1C8M 2;  4UFJ A;  3HBZ A;  3O1P A;  1JOB A;  5CIS A;  4M3C B;  2K9Z A;  5FMB A;  4DUW A;  1HLC A;  1QU0 A;  1SFY A;  1UWW A;  1VAL A;  1FNZ A;  1CES A;  4H7M A;  3S5Q A;  3HMY A;  2VC9 A;  2C1F A;  2Q8C A;  4P9G A;  3TEX A;  3TNQ A;  5A3L A;  2HH9 A;  4QB6 A;  1APN A;  5EJZ B;  5C9A B;  1MZ6 A;  3JBG 2;  4XUR A;  4BPZ A;  3Q9O A;  4AE2 A;  3LPG A;  2XBO 2;  1OQD A;  4HL0 A;  3ZPY A;  3H8R A;  2ZZQ A;  4M4R A;  2SLI A;  1RUG 3;  3SIT A;  1U5X A;  1PVC 2;  5LA1 A;  2UY8 A;  3LDR A;  2JE9 A;  5JIA A;  3TN9 3;  2K46 A;  4LOS A;  5A7O A;  4S2F A;  2D3P A;  1BHG A;  2R16 A;  4RA0 A;  1ODN A;  5FXW A;  5FRA A;  4UBH A;  2ZEX A;  4BA6 A;  3MFC A;  2PHR A;  4AI9 A;  3IAP A;  3BN6 A;  1W28 A;  3WDW A;  3LWC A;  4ZZ8 A;  5GZD A;  1T2X A;  3THD A;  1OHF A;  4PCR A;  4UWD A;  3V65 A;  2QDN A;  4ZU4 A;  5FUI A;  2IVJ A;  1ENQ A;  2FD8 A;  5JLV A;  1YHF A;  3BTA A;  3GDB A;  3JD7 1;  5C5T A;  1UCX A;  1IGO A;  2C24 A;  3T1M A;  4Q4V 1;  1LB2 A;  1XBF A;  4WM7 B;  1OPO A;  1WCD J;  3PVO A;  1D2Q A;  1JTZ X;  3JU9 A;  5KC6 A;  1UOG A;  3J7H A;  2LTN A;  1W9Y A;  3GZU C;  4AI1 A;  5LA2 A;  5IFT A;  5F39 A;  3VZK A;  4QX2 A;  1X33 A;  1DQ6 A;  1I5Z A;  4XJ8 A;  2VUD A;  1DHK B;  3AMH A;  1RHI 2;  1WW7 A;  4YM1 A;  5C3S A;  3O1M A;  3NJZ A;  2JDK A;  3PU3 A;  4AHX A;  2H0B A;  3I3M A;  1PK6 A;  4DY3 A;  3NKG A;  3H7Y A;  2W52 A;  4YNI A;  3RSJ A;  4C1W A;  5FPV A;  2X5I C;  1NXM A;  1Q5O A;  3FN9 A;  2ZGM A;  4XW3 A;  4PDW C;  1TZO A;  5FY4 A;  1WCS A;  2YV8 A;  3BTZ A;  4NR1 A;  4CCO A;  1J1T A;  4IGO A;  1NQJ A;  1WGP A;  3I97 A;  3SCG A;  2K0G A;  1HJG A;  3III A;  1JZ5 A;  2Y33 A;  2B39 A;  4HAN A;  4AK3 A;  1H8V A;  1F5F A;  4RS5 B;  4HVR A;  1H9P A;  2AEY A;  2HLE A;  1R1A 2;  2BUK A;  1VRB A;  2N7G A;  5GLV A;  3BU7 A;  3ORJ A;  3VBF C;  3JD7 3;  1U5Z A;  2F6B A;  3CL1 A;  1MS4 A;  1UY4 A;  3KHB A;  1LNS A;  2R0H A;  2VCC A;  3U07 A;  1NKG A;  1W6M A;  1K5M C;  2DCT A;  2DYC A;  2GSY A;  5FP4 A;  4Z07 A;  3QBQ A;  2WYF A;  3B93 A;  3RS6 A;  4N53 B;  1GZW B;  3PUH A;  2YPD A;  1WCQ A;  3AVS A;  4YVS A;  1HKD A;  3U11 A;  5C9A C;  3O12 A;  3NAP B;  4QDR A;  5C7G A;  1HRV 1;  1Y9G A;  3M3E A;  4EQV A;  3N7K A;  4GB3 1;  4LBQ B;  1F5J A;  1VAK A;  2XL9 A;  1Q8S A;  4B4P A;  4DNY A;  3DYM A;  2OPW A;  1JZ8 A;  1VMJ A;  3IMM A;  5J09 A;  4ONU A;  1C1F A;  1PNF A;  2JB4 A;  2A3Y A;  1WA4 A;  4DXT A;  2VY0 A;  2ARA A;  4W65 A;  3NNG A;  1ND3 B;  5FTT C;  4YPJ A;  2EA7 A;  2NPI A;  4XDQ A;  4YVW C;  4QU1 A;  5FQ0 A;  2GNM A;  3EJK A;  1NY7 1;  1L7R A;  2OXB A;  1BK1 A;  3AYA A;  4S2G A;  4RYD A;  4DPN A;  5HPO A;  1S2E A;  1BBT 2;  1ULO A;  4EJR A;  1F4A A;  1ACC A;  3W20 A;  5FZK A;  5A6Z A;  2FCU A;  3HWJ A;  5L19 A;  1IZ3 A;  3KCC A;  4X6R B;  4FOQ A;  5FP8 A;  2VL4 A;  3H1Y A;  3VKF C;  2E53 A;  4WM7 A;  1RUN A;  2PYT A;  1HV1 A;  1V9U 2;  2YFU A;  4NHX A;  5DG2 A;  2G1M A;  1NA1 A;  1C28 A;  2TBV A;  5EYX A;  5FY0 A;  1B35 C;  1KGY A;  4IND A;  5B2G B;  1R08 2;  4WM8 A;  5CFD A;  4K20 A;  3GAL A;  3WQ7 A;  1HRV 3;  3W58 A;  2CGO A;  4R8H A;  4AED B;  4IEP A;  2NN8 A;  4GB3 3;  3T30 A;  1G9F A;  2FDH A;  3RZZ A;  1LKN A;  4KBB A;  5T5J A;  3WNL A;  4URA A;  2VTF A;  5JR2 A;  2XHK A;  3KHC A;  4YZ3 A;  2Y8K A;  3FWE A;  4LBK A;  1YQ8 A;  4KWK A;  4CCJ A;  2DCJ A;  3POG A;  4FOW A;  4CDU C;  1H8T C;  4XCA A;  4XIK A;  5LRR A;  1QJY 1;  1S4C A;  1ZA4 A;  4ERO A;  4CCD A;  3LZZ A;  1JYN A;  3I49 A;  3VBR B;  1QDO A;  4PDW B;  5CVR A;  3WD5 A;  1QXP A;  3O7O A;  1DGW A;  3ZYI B;  1MS3 A;  2Y26 A;  3AKQ A;  1J58 A;  2RHP A;  3FBY A;  4RS5 A;  4ARX A;  4YW4 A;  5DAV A;  1OVP A;  4FFI A;  1N1S A;  1LGB A;  1W99 A;  3RQ0 A;  2JB8 A;  3DPR C;  4NOT A;  2PAM A;  2VNG A;  1GUI A;  1SCR A;  3MF6 A;  4HON A;  3A0N A;  2ZPX A;  4YZ5 A;  3VBU C;  3H9A A;  3MHZ A;  2VMI A;  4Q0V A;  5CBL A;  2B5H A;  5BNO A;  2QQJ A;  5GZG A;  1IKP A;  5JOY A;  1A3K A;  4O9G A;  2GME A;  3S30 A;  1LU1 A;  4BLJ A;  4WVV A;  2Q1F A;  3KQR A;  5AC9 3;  1J1L A;  4DUV A;  1DLC A;  4UFL A;  2GNB A;  4V1P A;  3ZIX A;  5FKB A;  3O1U A;  1ZVF A;  3DYO A;  2JKX A;  1D0G A;  4IV3 C;  5T5L A;  1VLN A;  3WP4 A;  1QQP 2;  2P34 A;  3DUI A;  4ZS2 A;  2P3Y A;  2Z79 A;  2XR4 A;  5LBF A;  3Q8E A;  4XXP A;  4C1X A;  4CDQ A;  5I8Y A;  2XOM A;  1JYX A;  5DDJ 2;  2R49 A;  1RUJ 2;  2ET7 A;  4E2Q A;  2YFZ A;  5FFO C;  4CP1 A;  1K42 A;  5FK7 A;  3WW1 A;  3HIF A;  1HW5 A;  2ZEY A;  4NII A;  2E51 A;  1KXG A;  2VOV A;  3ZFE A;  2W47 A;  4DZG A;  2UWB A;  4P00 B;  5FIX A;  5FZG A;  3KT4 A;  3N36 A;  2X05 A;  1XSQ A;  3VD5 A;  1ULC A;  3GJA A;  1XE7 A;  3JQW A;  3VDB A;  1C8M 3;  2QQW A;  1AXZ A;  1MS1 A;  2ZCW A;  4QPG A;  5F5C A;  4D8M A;  4GAZ A;  1R1Z A;  4Q1P A;  5DZE A;  1GZC A;  1YQ6 A;  2J1A A;  2Q0A A;  4D7Y A;  1EUU A;  3OBA A;  2VTX A;  3POI A;  3B9C A;  4QT6 A;  1ENX A;  1LES A;  2FZ2 A;  1DIW A;  5FKC A;  2VBB A;  1C1L A;  1QQP 3;  3RPQ A;  3OUJ A;  2VO5 A;  3FBM A;  3NL1 A;  3ZFG B;  4NRP A;  4NO4 A;  1LOA A;  1VMH A;  4XAC A;  1UOJ A;  5FZ7 A;  2D3R A;  2BOJ A;  2Y6H A;  1ZZ8 A;  1YFU A;  2RV9 A;  4B1M A;  4X8N A;  4IDZ A;  5FZ6 A;  2VZS A;  1ZZB A;  3PUS A;  3WR0 A;  4AHY A;  2JG8 C;  2WO2 A;  2ZEZ A;  5FPX A;  2OA2 A;  4FPY A;  5EYY A;  1LEN A;  5EV7 A;  3ZYF A;  2JDP A;  5JAX A;  4LNV A;  3H1M A;  3RZJ A;  1KEX A;  3ZYJ B;  1W8N A;  3HR9 A;  3DF0 A;  3Q8A A;  1E5H A;  2KR2 A;  3WF0 A;  2WS9 2;  1I9R A;  2XB6 C;  3WP5 A;  4D6S A;  1UW8 A;  3R05 A;  2AAC A;  4AED C;  5CFC A;  2Q4S A;  2ARE A;  2R32 A;  3R0R A;  1UZY A;  1RYY A;  3CKH A;  2RJ2 A;  4MSV A;  3I2H A;  3MF9 A;  5E16 A;  5CA6 A;  1O3Q A;  3RJR A;  3OD0 A;  4UOJ A;  3GHN A;  2Y34 A;  4PLM A;  3NNL A;  5BYN A;  5L7O C;  1S2B A;  1RXF A;  3E6C C;  2VCA A;  2BVB A;  1P8J A;  4XPV A;  1DZQ A;  1HQN A;  1QNW A;  2ZML A;  3D6E A;  3NJV A;  3UK9 A;  5DAB A;  5C3Q A;  4IE0 A;  4BIF A;  1ZBE 2;  1AR6 3;  2XWB B;  4GWN A;  3GZA A;  2ENR A;  4YGC A;  1ND3 A;  5HV4 A;  1N1T A;  2VZP A;  3KVB A;  3BPS A;  2HWD 3;  4R4X A;  4F83 A;  1RIR A;  2Y64 A;  2WO3 A;  1AR7 1;  1UYX A;  3AJZ A;  3AX4 A;  3NVC A;  5I8S A;  3ELN A;  1EYB A;  3AFG A;  3H1W A;  4HFS A;  4NN0 A;  3AXE A;  1CAU B;  3I59 B;  1QDC A;  5LEJ A;  3CJI B;  4Q4Y 1;  1V6L A;  5FZA A;  2OKX A;  2RS3 2;  1WW6 A;  3AYC A;  4FAH A;  4FFF A;  2D7F A;  1JI6 A;  3PNA A;  3VB9 A;  4COV A;  2G19 A;  3K2O A;  4MV2 A;  5SV8 A;  2WNU B;  1SAC A;  4R9D A;  4HKO A;  1FOD 2;  4PIX A;  5K7P A;  4WVW A;  1CR7 A;  1R1A 3;  4MHR A;  1XPW A;  4E4Z A;  2WNE A;  2B7Y A;  1H1I A;  2JIC A;  1UKG A;  4Y24 A;  4MXW A;  1KFX L;  2VZV A;  3ON7 A;  5FPZ A;  1Z0H A;  1PIV 1;  2CY6 A;  4AI0 A;  3OTF A;  1DQ4 A;  1REE A;  3PUA A;  4A42 A;  3ZYG A;  4CZS A;  3IZO A;  4NIA A;  3J8F 2;  2E7T A;  4KG8 A;  2WT1 A;  4K8R B;  4Y5Z 0;  4AAP A;  2EXI A;  5AC9 2;  1AR6 1;  4MG2 A;  1GQG A;  4S2D A;  1W2A X;  5JSR A;  2CTV A;  5C33 A;  2RDN A;  1EAH 3;  4IE7 A;  1WBF A;  4CU9 A;  1XJA A;  2XJU A;  1S0I A;  4MLO A;  1AL0 G;  3ENR A;  2ZXQ A;  2IFW A;  4RQP B;  1QXJ A;  3A0K A;  1XXN A;  4Q4Y 3;  1ZZ6 A;  4HXC A;  4NWW A;  5BNO C;  5JXJ A;  1K5M B;  2QQV A;  2J42 A;  5CG9 A;  1VBD 2;  3DGT A;  3HQX A;  4EWE A;  4XF9 A;  4QX0 A;  4YWA A;  3ZN6 B;  4HLT A;  3LEI A;  2IXI A;  1AR9 1;  2P4E A;  4BQX A;  4H14 A;  3PVE A;  1IKQ A;  4P9W A;  2DCK A;  1QOO A;  1YQ2 A;  5L73 A;  4DEQ A;  2ES3 A;  4LO6 B;  4PT6 A;  4AXO A;  3HNY M;  2VUA A;  4LBL A;  2RR1 1;  3DCQ A;  5C8C A;  4HVQ A;  1CZS A;  5FZI A;  2Y6J A;  3ZN6 A;  4KWJ A;  4C0H A;  3NNJ A;  2E26 A;  1EAH 2;  2Z2S B;  5LY2 A;  2GP5 A;  2GND A;  2YRO A;  2W5F A;  3IMN A;  4WV8 A;  5FY1 A;  1ODM A;  2W2I A;  1VIW B;  2W94 A;  2YBS A;  3SH4 A;  2YBP A;  3AMQ A;  3J8F 3;  4CPB A;  5FDB A;  4AQ2 A;  4OHW A;  1MPX A;  2WT0 A;  4PF1 A;  1E5I A;  1RIT A;  4CU7 A;  2QKD A;  1WLD A;  4HN1 A;  3SCF A;  4D0Q A;  1OA3 A;  3ZLI A;  4NPL A;  5LB6 A;  1FAY A;  2ORZ A;  5FZ9 A;  1DG6 A;  1XND A;  2PHD A;  4MX3 A;  1RMU 2;  5AVA A;  2Y6G A;  4LIV A;  4UF0 A;  4FCA A;  4XBQ A;  4FBF A;  1OBN A;  4OUE A;  3MBW A;  1JBC A;  3TEZ A;  2DFB A;  3N35 A;  4UFK A;  5FMD A;  4CU6 A;  2J1S A;  2WNU A;  2WWS A;  4QQP A;  4E8D A;  2CGP A;  4PI0 A;  3MIC A;  1S0G A;  2DTW A;  1MR5 A;  4CPB D;  2B9V A;  2R0F A;  1IOA A;  1YEW A;  3P1I A;  1YJK A;  4K1Z A;  3RDI A;  2XKO A;  4CEY A;  3O1O A;  3VZO A;  2WII B;  3ME2 A;  4A6O A;  3AZV A;  3JBG 1;  1QJU 2;  3L2Y A;  3CJI C;  2GNT A;  3GM8 A;  5LRS A;  3RMX A;  2XBO 1;  1QJZ A;  3VGI A;  4JV4 A;  3INA A;  1TNR A;  1Q8P A;  1RHI 3;  4LKE A;  3N9N A;  1DZT A;  2YC0 A;  3JB4 C;  1V6O A;  2AEZ A;  3WV6 A;  1PMI A;  2XPJ A;  4R9B A;  3RYR A;  2L9L A;  3DL3 A;  4N9H A;  4AOC A;  4NRM A;  1VBA 3;  2RG4 A;  4QPG C;  4PQQ A;  4DIN B;  1QJX 2;  3I54 A;  2G9F A;  3RNS A;  1N3O A;  2CGN A;  2EVX A;  3M7A A;  5BNP C;  5ISL A;  3DKQ A;  5FZM A;  2VTX J;  3POF A;  4YG6 A;  1T6G C;  5HCH A;  2BZD A;  5FUP A;  2GU9 A;  4BU2 A;  4QAW A;  1QJF A;  1RUD 1;  2WR9 A;  3J26 N;  3RGB A;  1OUR A;  1CJP A;  3ZM8 A;  3O0X A;  2FQP A;  4Y1Z A;  4GWJ A;  4DO0 A;  1W0P A;  4Q0P A;  5FXX A;  3ALQ A;  1KS4 A;  3GXU A;  2NMO A;  3AL5 A;  3POW A;  1O3S A;  4A44 A;  4FPG A;  5FY7 A;  2J1R A;  3Q8C A;  3FLR A;  1UKR A;  1TVG A;  1CAW A;  3I3E A;  4GMP 3;  5FK8 A;  3UT0 A;  3QD6 A;  1X36 A;  2CL2 A;  2V09 A;  1ENR A;  2WUH A;  3B7M A;  2WFF 3;  4K40 A;  5FZ1 A;  3JBG 3;  3CJI A;  4LE3 A;  1AXY A;  2OX0 A;  5FLI A;  5FZ4 A;  3RMY A;  4CRQ A;  5GAL A;  2R7E B;  3VZJ A;  1RHI 1;  5FY8 A;  2LRO A;  5LBE A;  3MGU A;  4MOA A;  3M1H A;  4XEZ A;  5IJR A;  3SNM A;  3POB A;  2BOI A;  1FX5 A;  4FP2 A;  4RHV 3;  5C8W A;  3V0A A;  2IVI B;  2ZGS A;  2VCM A;  4XUQ A;  2W39 A;  2E63 A;  2MEV 1;  3WNP A;  5EJ3 A;  4MAD A;  2GDF A;  3FHQ A;  3LOB A;  2V73 A;  4I30 A;  1N47 A;  5LBB A;  5CU1 A;  3ZYP A;  5FBJ A;  1XNC A;  2SBA A;  5J96 B;  4IEQ A;  4J1W A;  1RUD 3;  2RDS A;  4KWL A;  4XIO A;  4UI9 L;  1OKO A;  2XJV A;  3SIS A;  4GA9 A;  4TTG A;  3BU0 A;  2TUN A;  2YU2 A;  1W6P A;  1AYN 2;  4PIZ A;  4I02 A;  2Q1Z B;  3FZ3 A;  3CF6 E;  3KB5 A;  5F3C A;  4Y20 B;  4Q8L A;  2J1T A;  3PUQ A;  1J84 A;  1V9U 3;  2LUW A;  1RUC 1;  3GYD A;  4A6S A;  2C9K A;  4BQ2 A;  5A3T A;  3RVH A;  2EIC A;  2D6M A;  3LB9 A;  3OGR A;  1UZW A;  1Y3T A;  4HKL A;  1YFX A;  2VCB A;  3WF4 A;  4PLO A;  2WIN B;  4XAE A;  3O5S A;  1XNA A;  1F4H A;  3BIW E;  3USU A;  3VBU B;  3WG2 A;  1U0A A;  3O0W A;  4IEW A;  4Y20 A;  1XYP A;  4PDW A;  4CDX A;  3LF7 A;  5IYY A;  2CV6 A;  1D2S A;  2VEC A;  3VL9 A;  4LBM A;  2RMU 2;  3ACL A;  3UGF A;  4EYU A;  2MEV 3;  2W87 A;  3JUU A;  5FAX A;  3BCW A;  3LA7 A;  1NXD 1;  4LR4 A;  4XVH A;  1DP0 A;  1RUF 2;  2QUO A;  1DGL A;  3KV6 A;  1Z7S 2;  4LEJ A;  4N8M A;  1OUX A;  4NPM A;  2VQ0 A;  4H3W A;  4XJZ A;  1GP5 A;  5LEK A;  3R6S A;  2ILM A;  2LAL A;  1WLW A;  3U14 A;  3UGG A;  1BBT 3;  3OPZ A;  2VXJ A;  3BTY A;  2H6B A;  1X8M A;  1QNY A;  2VH9 A;  4Y26 A;  2A6V A;  4UYB A;  4YRD A;  3W21 A;  5GZC A;  2R30 A;  2ARX A;  4KQ7 A;  2HEV F;  1M06 G;  2DUO A;  5JZG B;  2RJK A;  1V9U 1;  5A7W B;  3LGR A;  1ZRF A;  3PU8 A;  4AI3 A;  4Y22 B;  3ZIW A;  4KH9 A;  3UET A;  1KS5 A;  1GMM A;  1XNB A;  1N3Q A;  3OG2 A;  4JQT A;  2W68 A;  4LO4 B;  4XMA A;  5FZO A;  3U0Z A;  4L9B A;  4QDQ A;  4B3N A;  4UT5 A;  2VVF A;  2XML A;  3PJY A;  4M0N A;  3IDA A;  4QQL A;  4UFM A;  4FXK B;  4QXH A;  4GKX A;  3GHM A;  4UFI A;  1SEF A;  4I3P A;  4XF3 A;  4IE6 A;  4YG3 A;  2BEO A;  5DAP A;  5M0T A;  1W2U A;  1CVN A;  1RUJ 3;  3B9I A;  3T0A A;  4EE2 A;  4DRR A;  3RZL A;  4M4P A;  3WW3 A;  2VNO A;  2IC1 A;  4XTM A;  3G7D A;  2HWF 1;  3T2P A;  4LJH A;  4B4R A;  2YC4 A;  3H8O A;  4GAL A;  1RJ8 A;  2TNF A;  1LRH A;  3NQH A;  3OPW A;  2IFR A;  2Q30 A;  4NE9 A;  5LK5 A;  4LXL A;  1WMF A;  3WNN A;  1SCS A;  1X9T A;  2I2S A;  2LM3 A;  3NV1 A;  4B7K A;  4CEW A;  1L3J A;  4B4Q A;  5A3N A;  4OI0 A;  5CEH A;  3J9S A;  3IKW A;  2PHT A;  3DEM A;  1KDK A;  4CDW C;  1BZW A;  3WXP A;  1NLQ A;  2WC2 A;  5BPX A;  2VQA A;  3HNM A;  3WLU A;  1LOC A;  2D98 A;  4YVW B;  1NCQ A;  2RJL A;  1YWK A;  3QH6 A;  2H6C A;  1S0B A;  2E31 A;  3UKN A;  5ACA 1;  5DMY A;  1JYC A;  3CZJ A;  3HPN A;  4MGK E;  1OD3 A;  5I91 A;  5ANQ A;  5FYV A;  1JUH A;  5C5U A;  3PDQ A;  4K8F A;  4XFG A;  4HK9 A;  3EYP A;  5FPB A;  3WG4 A;  1AJK A;  1RUJ 1;  3MIG A;  5FP3 A;  1GQH A;  1ULF A;  2ERF A;  3TOJ A;  2DVD A;  4N7I A;  1OOP C;  1LEM A;  1RMU 3;  1ZBA 2;  2R04 1;  4YG0 A;  1W6M B;  4LLF A;  2HWF 3;  2ZGK A;  5KHJ A;  3IN9 A;  5GLZ A;  3VDC A;  2AR6 A;  3OYW A;  2EAL A;  4HN0 A;  2ZKL A;  4XTP A;  1GQP A;  2WN3 A;  1ND2 A;  4ATE A;  4MYE A;  3ABZ A;  4OHV A;  4KL1 A;  4CTE A;  3F2Z A;  4IL7 A;  3THC A;  4YM0 A;  1GP6 A;  1A8M A;  4LHL A;  5E89 A;  2FDG A;  1VBC 1;  3N4M A;  1SLI A;  4Q4W 1;  1XU2 A;  5FWE A;  1KFU L;  1HQW A;  4NHK A;  2WWJ A;  5B4X A;  1H8T B;  1V6K A;  1ONA A;  4QXB A;  2UYB A;  3SKJ E;  1HB4 A;  4Z82 A;  2ZAA A;  1WMD A;  4CP9 A;  2NLR A;  1PNG A;  1RVF 1;  4FFH A;  2P3J A;  2WA4 A;  1QGL A;  2WZ8 A;  5BNN C;  5C9A A;  4FPO B;  1QHD A;  2WSV A;  4LHS A;  2C6S A;  5C6C A;  1YCI A;  2DUQ A;  1RUI 1;  5KXE A;  4OMD A;  1YJL A;  5I0U A;  5FMO S;  4YW1 A;  4XHB A;  1C3H A;  5IVC A;  2JJ6 A;  4W6Y A;  5IAT A;  4R52 A;  1TME 2;  1PO1 2;  4YW3 A;  1QEX A;  2OQ7 A;  2R04 3;  4DRV A;  5KXC A;  4HSL A;  3EB7 A;  5CNA A;  1IQA A;  5K0U A;  4MXW B;  3ZSL A;  2QQO A;  4DS0 A;  3GF6 A;  5A3U A;  1IS5 A;  2EID A;  1GNY A;  1PX3 A;  1PGW 1;  3OPT A;  5FPA A;  1AXK A;  3UV9 A;  2QQN A;  5F1R A;  3HQR A;  1PGL 2;  3FL7 A;  1H2K A;  3AZX A;  3NW4 A;  4H7L A;  1GR3 A;  4LKS A;  3SH3 A;  3ZMN A;  5KBF A;  2YU1 A;  2ZX2 A;  3NST A;  5KXD A;  3WHT A;  4XFA A;  2VUL A;  2RM2 3;  4Q4X 3;  3HEI A;  3MPP G;  1MS8 A;  4BK4 A;  1VPH A;  3WDV A;  1RGS A;  1LTE A;  1TNF A;  3LOI A;  5GZF A;  2WFF 2;  4JZR A;  3LIG A;  2WNV C;  4GB3 2;  4XFF A;  1FPN 3;  2DCZ A;  4XIL A;  2YB7 A;  2A7A A;  2YUE A;  3WY6 A;  1OSG A;  1SLT A;  2WJS A;  2JWP A;  5FY9 A;  4HVO A;  1PK6 B;  3WDT A;  3RZM A;  4AVC A;  3MZH A;  3FUO A;  3RFR A;  1POQ A;  2EIG A;  3O1V A;  4AQT A;  1QOT A;  3VBF B;  2ZHK A;  3WNK A;  3TEY A;  2ZHM A;  1UU5 A;  2YHJ A;  1DF0 A;  1EV1 2;  1XYO A;  1YFW A;  2D6O X;  1NX9 A;  2WO1 A;  3FFZ A;  4AF9 A;  1JYW A;  1R09 2;  1VRH 2;  2JD9 A;  2NMN A;  1VBD 3;  1T6B X;  1OVS A;  2PHU A;  3K75 B;  4DEV A;  3DEC A;  1DU3 D;  3CMG A;  3VBO C;  1V0A A;  1V6I A;  5FJH A;  4QX8 A;  1GIC A;  2I74 A;  3N3H A;  1OLR A;  3WDU A;  3ZSM A;  3KV9 A;  3M3C A;  1W3X A;  1WUV A;  1C4R A;  1W8Z A;  4LE4 A;  3HOB A;  4PBP A;  4XZU G;  1BK0 A;  2RM2 1;  1H8T A;  2R06 3;  5A7S A;  4OHZ A;  3T2T A;  4AFB A;  2GC0 A;  4J6G A;  3B5L B;  3TRS B;  5HXM A;  5BXX A;  1UQX A;  1NLR A;  2A6Y A;  1BEV 2;  2F17 A;  2W92 A;  5F7U A;  2HWE 2;  4QHZ A;  1D4M 3;  3ETQ A;  4LIU A;  5FYU A;  3KMH A;  1I6X A;  3GZT B;  1B09 A;  4NAO A;  1QWR A; 
#chains in the Genus database with same CATH homology
 5LAS A;  4ZON A;  5LB6 A;  3HQU A;  4ZPI A;  4MHU A;  3GZE A;  4UWD A;  5EPA A;  3OUH A;  2Y34 A;  3BVC A;  3NNL A;  5HV0 A;  3OBZ A;  5C5T A;  5LAT A;  4XCA A;  4NHK A;  2HBU A;  4NHL A;  5HV4 A;  2FCV A;  4NMI A;  4XAA A;  5DAV A;  5L9R A;  3W21 A;  4NHM A;  5LA9 A;  3PL0 A;  5IAT A;  2G19 A;  2JIJ A;  5DAQ A;  2RG4 A;  4XC9 A;  5A3U A;  4MHR A;  5DAW A;  4Q5O A;  2Y33 A;  3GJB A;  3DKQ A;  3HQR A;  3KT7 A;  4KBZ A;  5ERL A;  5LBF A;  5EP9 A;  4Y5T A;  2RDR A;  5DAP A;  5M0T A;  3KT4 A;  4JZR A;  2RDN A;  4XAB A;  3GJA A;  4XCB A;  2RDQ A;  2JIG A;  3NNF A;  3KT1 A;  4J25 A;  5EQU A;  2OPW A;  5L9V A;  2FCT A;  4IW3 A;  5LBE A;  2A1X A;  3EMR A;  3MGU A;  3NNM A;  5IAX A;  4BQX A;  3OUJ A;  4NHY A;  4XAC A;  5LBB A;  5DAX A;  3W20 A;  5IAV A;  2FCU A;  2RDS A;  5C5U A;  3OUI A;  2HBT A;  3NNJ A;  5L9B A;  3ITQ A;  2V4A A;  4NHX A;  4BQY A;  2G1M A;  4BQW A;  4Y5S A;  5LBC A;  4NAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...