2BEOA

Prfa, transcriptional regulator in listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
226
Chain Sequence
b'NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LISTERIOLYSIN REGULATORY PROTEIN
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 69
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2beoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2beoA01
2KRFA 2PJPA 1UCXA 1A04A 3JTHA 1T98A 2GC2A 4GYIA 1XGNA 1PP7U 4XETA 2PG4A 1UHMA 1U2WA 1XSDA 1LRHA 2CAVA 4KMFA 2WFPA 2VE8A 4JTNA 4QM8A 1J5YA 4ONUA 4DNCA 3GXOA 3KLNA 4HF0A 5BPIA 5HDGA 2Q1ZB 4Q0VA 1FI2A 2OU2A 2FE3A 5HLHA 1Q3EA 2DCTA 1ZGAA 3JAMK 5BOXA 1L3JA 2XV4S 3K69A 1FBSA 1ZZCA 5FQ0A 3GFMA 1IPKA 4I09A 3R4KA 2DT5A 2VBZA 3M8FA 2VONA 3QOPA 2PHDA 4L9TA 1OD5A 1XE7A 1ZYRF 2L4AA 4XFAA 4WXDA 4KU8A 3WTSC 1U5TB 3NQOA 4P96A 4U0VA 1XE8A 4IEZA 5DCFA 3J7AO 2EV0A 2QLZA 3USSA 2PLYA 4A12A 4ESJA 4MGIE 4UVAA 2PAKA 1EP0A 2Q0OA 3DPLC 3WTUC 5ILSA 2UWMA 2KIFA 1FBUA 4UVBA 3GO5A 3SMHA 1OKRA 2BBYA 1LDDA 1DPRA 4ZZDA 4BH9A 5JVTA 2AS5F 5HDKA 3K1MA 1YQAA 1G3SA 2ATFA 4LB6B 1JHHA 1YLFA 1JUHA 4QGLA 2YR2A 4KIGA 1R5GA 3SZPA 3SHFA 2MD5A 2HEOA 4KU7A 4L11A 4JBAA 3MQ0A 2RGVA 1VR3A 3H92A 5DEQA 2BNNA 2D2WA 1P4XA 3D0JA 4XFFA 1WSUA 4ENMA 2CG4A 4D7TA 3MZHA 1KYWA 3OOPA 2XAFA 1ZARA 3T8TA 5J3UA 5K5QA 4S04A 3ZMUA 1YFYA 5I0RA 4AIKA 5D5XB 4BQAA 3DXJF 2ZJ2A 4OIPF 3NW4A 2PI0A 1KQ0A 1O3TA 4LD5A 5HS9A 3BJOA 2L4MA 2WC2A 4XF0A 1OMIA 4IVNA 3HYIA 3SCGA 1FWZA 4KT5C 4A0YA 3KEQA 2ZCWA 2XKPA 1ZZ8A 3F23A 2MA3A 2FOKA 5ILUA 3WTVC 4HAMA 5CADA 4UXAA 2FQ3A 1T2KA 3FZ3A 5L3BA 1ZLKA 5I93A 2HQRA 4HBLA 1QNTA 1IXSB 1FYLA 2VT2A 4K2EA 4JVAA 3UKNA 1JHFA 4HN1A 4GCVA 4WCGA 1WQ2A 2NNNA 3I71A 3HTSB 5KBFA 4NQWA 5FDBA 2IC1A 5K5OA 3IC7A 4L0YB 4ESBA 3WTYC 2JRTA 3IKTA 3PVBB 4LA3A 2Q30A 1O5UA 5ICEA 4KWJA 2HYGD 1X8EA 5BY5A 4LULA 4Z82A 5E1WA 1JE8A 5I0TA 3OF1A 3UKVA 4ENNA 1F4KA 4EMSA 2H0VA 3CO6C 1ON2A 2OZ6A 3NL1A 5CVRA 4G6QA 1SD6A 2D5FA 1LR5A 2YX4A 1RIOH 3SCFA 4QXKA 4LLLA 3C18A 4PJYA 4LEJA 1FYKA 2BNOA 3GLXA 1IXCA 3WTTC 3RYRA 4HLTA 1V4RA 1YS6A 3ZPLA 1FT9A 2CW0F 2F4PA 1X8MA 5FFZA 2HKXA 4HX8A 2ACJA 1D5VA 5C6CA 3WE3A 3GFJA 4IEOA 2RVCA 3R0JA 2F5CA 4U0WA 5EEHA 4HBNA 2VBWA 4RB0A 2WWYA 2PAMA 2N7GA 3H3ZA 4L5IA 1XDUA 3K1NA 1KU9A 1IRFA 3HSRA 3BALA 3TNQA 4LTAA 2XAHA 4Y17A 4L9VA 4ZZLA 1MJ9A 2A5YB 2VT3A 2Y0MA 5DUIA 1FSEA 2V09A 4RD7A 3RKXA 3IDBB 5AIPA 1K6OA 1S3JA 2FMLA 3S2WA 2HZTA 4YSFA 2MNGA 1Q43A 2AXLA 1F5TA 1LJ9A 1XGSA 1Z91A 5JSRA 1RUOA 2P5KA 1CAUA 1J0RA 3GFIA 5KHHA 1SEFA 5JFRA 4KFCA 1MKMA 3E5XA 4BYYA 3C3WA 4Q0UA 1Q5OA 4Y15A 1PP8F 2H27A 1KQ8A 3TO9A 2LF7A 1QBJA 2D45A 1TBXA 1FP1D 2P6SA 2CAUA 3I54A 5TRDA 2KJCA 5KHGA 2XAQA 1OYIA 3BJ6A 4RB3C 2MHFA 1U8RA 1J7KA 1CF7A 4D0PA 3GW2A 3F6VA 3DPTA 1XCBA 4M71A 2GXGA 1R1VA 2ZMEA 3M3IA 1XN7A 1CAVB 5FLXZ 1ZG1A 3F72A 5E8IA 1LEAA 5A2QK 5ICCA 3E5UA 2IXKA 5E16A 3ZQ7A 2IRFG 1BIAA 1LQ1A 1EV7A 3OCPA 1Z7UA 4KN7X 2D5HA 1YO5C 3MFKA 4B09A 1TNTA 1E17A 1MZBA 2P17A 2PMHA 2QBYA 5AONA 4IHTA 1X82A 3W6KB 3CO2A 4FAGA 2LF8A 1FY7A 1I1SA 1LDJA 1YG2A 2DO7A 3FX3A 1U3EM 2P7CB 2QDRA 3EYIA 2EFWA 2JT1A 2MPFA 5JAXA 1H9GA 3ACLA 2GC3A 1SFNA 5JI6A 4RB1A 2JSCA 1O57A 4A0ZA 1RL3A 1ZAOA 4HVOA 4BAYA 5I8YA 4HX7A 5D5UB 4MTDA 5ED4A 1RUNA 1YFUA 5D8KB 1MJAA 4ZU4A 4I2OA 4XSZF 3VB2A 2L01A 5LEJA 2STTA 3PQJA 1BN5A 4U88A 2JTVA 2J5OA 1RGSA 2OAZA 2XVCA 5DUKA 1DP7P 1B59A 1XSVA 4QGNA 3C3VA 1JGSA 1U78A 5D6EA 1Q1HA 2CSOA 4JV4A 2QQBA 1BIBA 4XFCA 3BDDA 3RNSA 1YUDA 2COMA 3KFWX 5J6XA 5FLIA 2XAJA 2XASA 1QY4A 2K9ZA 4LLOA 1T0FA 3WW3A 5KVRA 4HSJA 5FO5A 2IW5A 5CVJA 4XLPF 2CO5A 2OA2A 4NVPA 3KLOA 5ICGA 3T5XA 3V7CA 3ZMZA 4X6RB 2HJIA 2KKOA 1H1MA 1CAVA 1ZRFA 3CJXA 2VPVA 1O7LA 2EFNA 1QZZA 3E6CC 1KU7A 3GBFA 2FU4A 1B4AA 4EM0B 2DPUA 3FXRA 3HHHA 1KGSA 4I7HA 4KMUX 2IXJA 4LLGF 3KP5A 3F3XA 3I5UA 3FMRA 2DI3A 1GHCA 4IXAA 2QCSB 4IESA 2BGCA 2IXLA 3H50A 3FXUA 4OOIA 1QWRA 3B73A 3ABTA 5CVIA 3RI4A 5I8SA 4XLNF 2CGPA 1J3QA 1G6NA 3ROUA 5FCCA 3TO6A 3DKWA 2DLLA 4IRGA 3UKTA 1MJBA 3BP8A 3ES4A 2MLGA 4G6DA 2YSRA 3ZMVA 5FQ0B 2ZNZA 4L2NA 5KK1A 3HRMA 3KP7A 5IT9K 4WBBA 4IETA 3ETQA 2W24A 4PDKA 3LWFA 3EUHA 4CGZA 3GFLA 5E17F 1XSXA 2RC4A 2VXZA 3HRSA 3LZZA 3GX4X 2XL7A 1IN4A 2R7DA 4HF1A 2RQPA 3QACA 1R7JA 3D0SA 4HOBA 4JQFA 3FM3A 3WU0A 1B9NA 4Q47A 2XLFA 4PGHA 3BZ6A 3ABUA 2X0LA 5D6FA 5L3GA 3EETA 2OA4A 2A61A 3RKWA 3IIAA 1BJAA 3TDZC 1BI1A 5CYVA 2HTJA 3FM5A 3M1EA 3LOIA 4MEXF 2H6BA 3HTUA 3HRUA 1OFNA 1PM7A 4QM9A 2UYAA 2IP2A 2TDXA 4ZU5A 3N97A 4R52A 4KIBA 1GQGA 3QU3A 3V7RA 3AAFA 3RPUA 2V1DA 3JW4A 1XD7A 3FF5A 2YX7A 2VN2A 1LEBA 3BOQA 4KWKA 5D4SA 1YS7A 2YPRA 4AXOA 1C0WA 2RKHA 1HW1A 3WW2A 3ELNA 5I91A 3CEWA 1IN6A 4RGSA 1LB2A 2PEXA 4M9SA 2HFHA 3NSTA 1BI2A 1OPCA 1Z9CA 1IN7A 4QMAA 1ZHFA 2GC1A 4I02A 1ZZ9A 3L2CA 1IAWA 3WG9A 2IT0A 1MGTA 1FLIA 1KU2A 2M5WA 4G9YA 5BUVA 5H20A 2OZJA 1FP2A 3TKYA 4AIJA 4CYDA 3MZYA 2IXIA 4XF9A 4UBHA 2WV0A 4CICA 2ESHA 3TOBA 3HSFA 2O3FA 5HDNA 1X3UA 2G7UA 4RGXA 2G7HA 2O1QA 3S7EA 4PIYA 4EROA 4RB2C 3GWZA 1I27A 2OBPA 2XHKA 1TQIA 2EFQA 4ESFA 4AIHA 1H9TA 3IKVA 2GC0A 3ZDSA 3F21A 2PBIA 3KMHA 2A6HF 3SXYA 1YW7A 3U1DA 5BS6A 2FEZA 1YTYA 2IA0A 1W7PB 5ERIA 3T0YA 2EAAA 2V9VA 4FT8A 4HF2A 2W25A 2K4BA 3BU7A 1K78B 2Z9OA 4A0XA 3W6JB 2FSWA 2VBYA 3L7WA 2FBIA 4IF4A 2DQRA 3VOEA 3BPXA 1Y3TA 2PMUA 5JHUA 2QENA 4U7BA 4AVPA 4OIQF 3FFQA 3LWCA 4ASNA 3R61A 4FX0A 1DDNA 4AQ2A 1S29A 1CGPA 3EO6A 1Z6RA 2FA5A 3PFIA 2EV6A 1ZN2A 5E20A 1S6LA 1QZYA 3PNAA 4J1XA 4NHJA 4JK1X 2EV5A 1ZG3A 2XGXA 1HKQA 4MEYF 1HW2A 3OV8A 3FE5A 3QPTA 1Z6TA 3KGZA 5FPXA 3ZMDA 3GZ5A 4XFHA 3CJNA 5HLIA 1J2XA 1FXZA 1QQIA 2QWWA 3V4GA 3U10A 2PYTA 5E1RA 4IRHA 2XL9A 3LA7A 1RZ4A 4HV5A 3KP4A 1FNNA 1SD7A 3JAMZ 5KHIA 1IN8A 4BHPA 4MGYE 4HDUA 2Q0AA 1TTYA 1RI7A 1T6SA 1P4AA 3LA3A 3NVCA 1YW8A 3SQNA 2CQKA 3R0AA 5EFUA 1XCVA 1AWCA 3E6BA 5CU1A 5FGMA 1FPQA 2IA1A 1I1GA 3HHGA 1CX4A 4IEVA 4IERA 3L9FA 1BBYA 4O5VA 2DPDA 1ZRDA 1VP6A 2PHLA 1DZRA 5LEKA 1W7PA 1W7PD 4M73A 2XAGA 2PQQA 3B02A 3O6BB 3H3UA 3GZ6A 1CAUB 4I3PA 5HS8A 2XLAA 2MBFA 3NRVA 5TJJA 2BV6A 1G3WA 5FLJA 3F8FA 1K78A 3EDPA 2P6TA 3NEUA 3SCHA 4KDPA 2E9QA 3CUQC 4HMZA 4OINF 4OMYA 1QXRA 2K0GA 5BPXA 2M30A 1HXDA 1J59A 1P2FA 4N0BA 4CHUA 3BCWA 3CTAA 1PUEE 3LQQA 3GF2A 3QU6A 2Y75A 2FNAA 2IXCA 4BXUA 1BI3A 3KCCA 1USTA 2V6CA 4RGUA 3RJPA 4HLYA 1UIKA 1U6GA 4Q29A 1O3RA 1ZNPA 4A5MA 5I0SA 5DCMA 3HRTA 1Z1DA 1CF7B 2GAUA 3MYXA 1FZPB 3EQLF 2MLKA 2EVXA 2F5FA 5EZWA 4HX4A 4M9XA 2DBBA 2V79A 2ZMEB 4F8AA 2P5LC 3NKTA 2OD5A 5LGTA 3RPQA 2NNYA 1X7NA 2IVMA 2LNBA 4GYGA 2BYVE 2UXNA 5HVQC 4AD9A 4TLFA 1H0MA 2XRNA 2KIMA 4YIFA 1ZREA 1K7AA 2QBYB 1HKSA 1I5ZA 1U5TC 3IHUA 4FX4A 3I59B 4EV0A 4A5NA 4LB5A 3DEUA 1YWKA 3O3KA 1GVJA 3FMQA 1IXRC 4U0YA 4AWXB 4KYWA 1R1TA 1W5SA 3R6SA 2O0YA 1VJ2A 1LKNA 3NJZA 1YFHA 3JZVA 4LFUA 3HOTA 1S7AA 3PQKA 4ZYEA 3DF8A 3J81K 3KETA 3VODA 3RZZA 1YFWA 2ZKLA 3EYYA 1AOYA 1T39A 1B1BA 1IF1A 2A6EF 2A69F 1FX7A 1EYBA 1TQMA 4A6EA 6PAXA 2KIUA 5LGNA 2KXLA 4N9HA 3GUDA 3I4PA 1NZCA 5T3NA 2EB7A 3V8JA 3IRRA 4ZU7A 2E1NA 4FBFA 5IT3A 3P9KA 2VBXA 3U0ZA 1O3SA 2A07F 3U11A 1R22A 4D7SA 2EA2A 4HDVA 1HSTA 4LK1F 5K1YA 3JSPA 2H94A 1SQ4A 1YW9A 2X4HA 4L9JA 5BQTA 1DGWA 2WTEA 2EA7A 1J9IA 3LQRA 4LK0F 3TDUC 4MNUA 2QQAA 2GH2A 3H1MA 4YNIA 2F5EA 2STWA 5BXXA 4O9EA 3I59A 4CXFA 1ZRCA 3P9IA 1PMIA 1O4TA 5JR7B 3MEXA 3TQNA 2A68F 3IWZA 4AQ6A 3HOSA 2QUFA 1Y9QA 2FRHA 5AVPA 1OYWA 4O3MA 5BV6A 3WGHA 2ADUA 2MC3A 1QXJA 3H7JA 1OI6A 2DU9A 1G4DA 4EJWA 2H6CA 3GEZA 2F5DA 2VECA 5L3DA 4QLCU 2LSOA 3MDPA 2DAOA 4UV8A 3P9CA 1LVAA 1IPJA 4AVBA 1ON1A 2F2EA 3M7GA 5KHKA 1KA8A 4NB5A 1XGMA 2P7VB 1RTVA 5E8GA 5C8WA 1QGPA 4R1HA 1TQPA 3BPZA 1P6RA 3LAPA 4QGMA 1W4MA 3KZZA 5LBQA 1ODDA 1R23A 2FF4A 3R60A 4GGGA 3KEOA 4EGZA 2ZNYA 3K2ZA 1UFMA 1FBQA 2Z2SB 4EGYA 3T1BA 5HLGA 2Q4SA 3J80K 4RGRA 5CLSA 2QZ8A 1IW7F 4WWCA 1WRJA 3E5QA 3OD0A 1WLTA 4E2QA 5L3EA 1SAXA 4O9GA 2O61A 5AIQA 3I7DA 2ISYA 5JSOA 3U9GA 2M87A 4UXNA 4EJTA 1Y0UA 4P9GA 5J7MA 1FC3A 2GWRA 5D4RA 1XDSA 2OQGA 1ZZBA 4IEYA 3I58A 3ZMSA 4YIIA 4EJVA 1USSA 1EH8A 2IA2A 4CDGA 4XFGA 4WZCA 3HIFA 4MGKE 1T38A 2RDPA 4XFIA 4XRFA 1R1UA 1L3LA 3RDIA 3G73A 4DQ2A 3QP5A 3LSTA 2UXXA 1S7OA 2L3DA 5LRSA 4FAHA 3VEPA 3EHKA 4RAYA 4HQEA 3ECHA 4MX3A 4L9NA 1BOAA 1BC8C 4XBFA 4LUKA 3N4MA 3FWEA 1ZZ7A 4UHTA 3S7IA 1ZH5A 4MV2A 1NE4A 3RYPA 1ZX5A 4WVZA 3VFZA 1VTNC 4OMZA 2Y0OA 4AVAA 4ON0A 2UY8A 1REPC 4HZFA 3I64A 5BPDA 2MH9A 1F1ZA 2HGCA 1UPIA 1S8NA 3F8BA 1CAXB 1UCRA 3F8MA 1R58A 3DV8A 1J1LA 1TW3A 5J48A 3QP6A 2P8TA 3WW4A 5H6QA 1HSJA 5FPZA 4EJUA 1IRGA 4KICA 2BEOA 5I0UA 4M72A 2VODA 3G3ZA 1HKTA 1CAWA 2EFOA 2O8QA 3GVAA 4MGRA 5D8LB 3KP6A 3GYHX 5D1IA 1NE6A 1YIOA 2H09A 5FLHA 4META 2VQAA 4OU0A 4XSXF 4RS8A 1BC7C 3SZTA 2LDUA 2OZUA 4O6JA 2RNJA 4OIOF 2B9UA 2K7LA 4ZYHA 1DGRA 3SHRA 3TO7A 5K8SA 1ZZ6A 3JTGA 1DZTA 1U12A 5E1XA 4R8HA 2HDCA 4Q48A 2UYBA 2KJBA 2JPBA 4YG2F 3QPHA 5ILVA 4EM1A 2P4WA 2VOPA 3OGJA 2PFBA 4BHBA 5F1RA 2QQ9A 2L54A 2XLGA 4P5OA 4R79A 3H1WA 1SMYF 4GO1A 2XUBA 1WI9A 5IT9Z 2GIVA 2M8EA 3GYDA 5L3CA 3V8KA 2D1VA 2QJVA 1OYYA 1KU3A 1L0OC 4Z07A 1CAXA 2IPQX 1GQHA 1SFEA 4LG0A 3CO7C 4LMYA 2GQQA 4OIRF 1IUYA 3ES1A 4Q4ZF 4LA2A 4MGZE 1SD5A 2RN7A 4TV7A 1YYVA 3RIRA 5J8FA 1UD1A 2EJRA 3DN7A 1TNSA 5BMZA 1RC6A 4KNYA 1J3PA 4Q0SA 3ZMTA 4MQ9F 3L09A 5DYMA 4EWAA 4PGGA 3CUQA 3WGIA 2J5PA 5LHHA 1ULYA 4G94A 4MHGA 5E18F 4KN4X 3I53A 2ET1A 4MUVA 2HS5A 2NAZA 2ZO4A 1SFXA 3E6MA 4IEWA 4OLLA 1EH6A 1FOKA 1QO0D 2DTRA 4KUMA 4BHCA 2NYXA 5DCMB 1JXSA 4B29A 2QVSB 2OQRA 3WGGA 2PTMA 3V7SA 4YYOA 2GU9A 3WE2A 1D8KA 4ORFA 1HQCA 4M74A 3HSEA 3MAJA 4IEUA 1XGOA 3SFZA 1HBXG 2QVOA 2FMYA 2HKOA 1FYMA 2BE5F 3ZP5A 1O5LA 4GULA 4E2SA 3EJKA 2PN6A 2XKOA 2ZBKA 3FZVA 1O7FA 4XF1A 4KWLA 3F22A 5FFXA 4S05A 1UW8A 2P5VA 3F6OA 3H9AA 1R00A 4Q0PA 4ZH4F 1IZ1A 3KE2A 2VOOA 3RKYA 1U5TA 1HW5A 1ZLJA 3L00A 3KGLA 1J3RA 2GA2A 4E70A 3MPBA 2XIGA 1O3QA 1EH7A 3PLQA 3V8LA 1W5TA 3HUGA 1MDMB 3WU1B 5CVUA 1D8JA 3IL2A 3D82A 3K0LA 3OTFA 4WXCA 1WGPA 1G3YA 3Q9SA 5D5VB 3HQXA 5JR3A 5DD4A 3WODF 1BM9A 4CZZA 2PFWA 4XEZA 2ZFWA 3L2HA 3ULQB 3TGNA 4QX5A 2K86A 3H8UA 3KP2A 3G7DA 1YHFA 1NHAA 3ZN0A 2R7FA 2ZXJA 3K9TA 1WWXA 3C7JA 3E6DA 4Y13A 4WX9A 3DL3A 3D5LA 1ZRRA 2DK5A 2Z5UA 5F6FA 2IXHA 4L0ZB 3BJAA 3COAC 2VE9A 1V3FA 4MZUA 2PQ8A 4IEQA 5FLXK 4UVCA 4ZYDA 3ISPA 4K8FA 2W85A 3F8CA 3FMSA 4AVCA 4N9IA 2VC1A 3KSCA 3CLOA 2XROA 4BIFA 4A2UA 4LJZF 1TQ5A 1SD4A 2D1HA 3QRFF 4P9FA 2NS0A 5CVVA 3HT1A 4IPAA 2W84A 2CV6A 2FQPA 2ESNA 4QWQA 4XF3A 1UHWA 2HR3A 3P7NA 2QNKA 1SMTA 5HI0A 4UBGA 1IN5A 3DP7A 3MCZA 5JSPA 2Z3YA 4U7DA 4LGWA 4WK8F 3BB6A 4XFBA 2FXAA 2VC0A 1SFUA 4UNOA 1EPZA 2EK5A 4HV6A 2O03A 5E1ZB 1LDKB 1FSHA 2QYOA 2V1UA 2K4JA 5LGUA 3U2RA 1MDMA 2B0LA 4P9UA 2MH2A 4M6YA 3BPVA 4M6XA 4HA8A 4KA4A 3CL1A 1QPMA 4HQMA 4PIXA 1V70A 2Q8KA 1OR7A 2CFXA 4ENJA 2DFIA 3CLPA 4LUMA 1DPUA 1UIJA 3Q9VA 1R36A 1XB4A 2LKPA 2L02A 4PCQA 1KQ9A 4MQVA 4P55A 3S0MA 4IEXA 3QAHA 4H0EA 4MTEA 1UB9A 1E2XA 4GXOA 2UZKA 4KL1A 4YFKF 4EWDA 3WTXC 4HN0A 3EQEA 2HWVA 3FHIB 5J8CA 4G7OF 5DD8A 1LNWA 1Z05A 1H1IA 4HVQA 3SXWA 1YFXA 4JTOA 4ENKA 1K79A 5KHJA 2C6YA 4WXHA 2ETHA 2DQLA 2ET7A 4I0AA 4HYEA 4WF2A 1XRUA 2B8MA 2JPCA 1G3TA 3Q5FA 4EM2A 3LFKA 5ICFA 2RV8A 1ONVA 2O6GE 4E2GA 4F7ZA 3H7YA 3FXQA 3ST7A 3I0TA 2D93A 2E7WA 4IEPA 3ECOA 3KZYA 3WTWC 4H7LA 4G7HF 1WKMA 4Q0QA 4DINB 4PZJA 3F8NA 3REOA 1J58A 3LA2A 2Z33A 3HT2A 3RYKA 3CF6E 2GZWA 4IRIA 3DQVC 3WTZA 4HVRA 2ELHA 4OFGA 5LHGA 2Q2EA 5JCTA 4Q5SF 2BNMA 4J1WA 5LRRA 2E1CA 5DDGA 3LAJA 4YARA 2PA7A 3J81Z 1STZA 2A3SA 2UY9A 1R5HA 3IDCB 3IBMA 4HSLA 3LAGA 2C0ZA 1NYWA 3E97A 3TOAA 1B6AA 4Z2YA 4YRDA 1P92A 3M9AA 5EEGA 2NRAC 3O2PE 3RTRA 5D5WB 1MD0A 3ZN1A 2M45A 3C1DA 4YFNF 2EA4A 4BNCA 5LLQA 3ML6A 1KYZA 4M9ZA 1DUXC 5HOOA 4ZYGA 4XF4A 4I01A 3ERED 5H6RA 2B5HA 1PDNC 1CAWB 4EQQA 3DFGA 2Z99A 2V1XA 2ZKZA 2GA1A 5FD5A 3E3VA 2Y48A 1ZGJA 3M8EA 4B8XA 3IWFA 3T8RA 2Z69A 1GXQA 4G8XA 2ISZA 3JSOA 1I6XA 4I0BA 3BY6A 5A2QZ 3H1YA 4L5JA 3ELKA 3IRQA 2CYYA 1TLHB 2DK8A 4RAZA 2M1BA 2K02A 2HOEA 3MWMA 2FBKA 5FD6A 1NXMA 4HW0A 4EVIA 1RNLA 2FNPA 5LHIA 4EJOA 2HQNA 3BWGA 3KP3A 4YFXF 2HTSA 2JZYA 4UV9A 1ZVFA 2HYFA 4MH0E 3VHRA 1YLLA 3O14A 3FJSA 4IJAA 2I45A 2QM3A 5HS7A 5K5RA 2PAEA 5CJ9A 3K1PA 5I8TA 2YU3A 1BI0A 4EWEA 4IHSA 2EFPA 5L3FA 2CWEA 4PIZA 1ZG5A 5F64A 2EWNA 2OPKA 1B9MA 2IJLA 4HLXA 4L18B 1EY2A 2OYZA 1F9NA 3CUOA 4FHTA 4ETSA 4KIFA 2GXBA 4LG0B 3TNPB 2W57A 3EBRA 3WW1A 4UUVA 1TW2A 1WA4A 1XMKA 2O8XA 4X6QB 5FB2A 2DW4A 3BROA 4LLNA 4CO8A 2ETEA 1P4WA 3FHZA 4A6DA 2D40A 5DV5A 1XMAA 1D3YA 3CDHA 3CUQB 4I98B 2FBHA 2E7XA 3J80Z 2K27A 1GXPA 2G9WA 2R3SA 1J75A 3M70A 4G7ZF
chains in the Genus database with same CATH superfamily
4FQZA 2PJPA 1A04A 4GYIA 1PP7U 4XETA 1NZIA 3IZOA 1R1A1 1LRHA 4W4ZA 4KMFA 2WFPA 3O8GA 3JD71 3K4JA 4MADA 2QQ8A 5LFAA 3IUOA 3UK9A 2WT2A 4NRQA 4ONUA 3GXOA 5ACA1 4MXWA 3MUY1 3KLNA 1O8SA 3H0DA 1FI2A 2OU2A 2KQRA 2RMU2 3WDYA 2OS2A 3JAMK 1AHDP 2LY1A 2XV4S 1ZBA1 4MOAA 3EUHC 1FBSA 4R9CA 3GFMA 4MHRA 4I09A 2DT5A 5KAIC 1XBFA 2VONA 4CUGA 1OD5A 1IQDC 2ZS6B 4MGSA 2L4AA 4KU8A 3BIWE 3WTSC 3ZFFC 3ZSJA 1I3AA 3IAPA 4P96A 4U0VA 1BLZA 4GMP1 2PHWA 2PLYA 2R071 2EIBA 3HNMA 5FYUA 3HUGB 4HSTA 1R081 2Q0OA 3DPLC 3F0CA 5ILSA 4YW5A 1GNZA 3UT0A 4EN6B 2KIFA 1AU7A 3K4NA 4BQ5A 2DJNA 4JKKA 1DPRA 4ZZDA 4RM2A 4XNFA 4BH9A 3VBOA 5HDKA 3K1MA 4NQWB 3S3OA 2ATFA 1T95A 1PO23 4QGLA 1D0ZA 5IVJA 3E1F1 4XUOA 3BG5A 1RITA 4OI1A 5DEQA 2BNNA 5TISC 4UFMA 1P4XA 4LBQD 4ZONA 3QH6A 2X9DA 3ZN6B 4ZZ5A 2AQEA 2CG4A 4D7TA 3OOPA 2WS91 4S04A 3HOWJ 2ZHKA 5D5XB 2W95A 1UHSA 3C7EA 4M3EA 3S6PA 2WJSA 3NW4A 3G6EI 2VKDA 3ETPA 3OPZA 1E5SA 2GN7A 4ASLA 2HU9A 2P34A 1DG6A 2L7ZA 4IHWA 3HYIA 3SCGA 4FP2A 4JHTA 1GR3A 1QVUA 3A1YA 2FOKA 5T5PA 4CSWA 1MBHA 4FVVA 4HAMA 1GNHA 1ONAA 5FOJB 2WNVA 3HEFA 1T2KA 3FZ3A 1WJDA 3B69A 3DEWA 3LSMA 5L3BA 4C3JJ 3USUB 2JG8B 1IXSB 1FYLA 1BVVA 4JVAA 3UKNA 3T4VA 3VBHB 4WCGA 1VQ5I 3VB9A 3LMMA 2NNNA 3HTSB 5KBFA 2VL8A 4NQWA 1F2NA 3FMGA 4BEHA 4YW3A 4L0YB 1WCMJ 4LA3A 1C5HA 2Q30A 4KI5M 5BY5A 1X8EA 4LULA 3HAGA 1JE8A 4FOYA 5I0TA 2LOOA 2R5ZB 4DJAA 3UKVA 1PNFA 4E27A 3UNPA 1XYNA 3TRSB 2DMPA 3ZO0B 3ZN6A 2GP5A 5FV3A 4YVWB 5EZGA 3NQHA 1LR5A 2VASA 2QQJA 1R1A3 2XUMA 1FATA 1FYKA 1DQ6A 2OQ6A 1CZVA 1QGLA 1YO8A 1IXCA 4ZTFA 4C3IJ 4XRSG 5FWJA 1I9RA 4AAPA 1YS6A 3QYBA 4L8QA 3IDEA 1FT9A 2F4PA 2ZEWA 3AYAA 5FFZA 4B3NA 2M3AA 4XOPA 3KF5A 4K20A 2R7XA 1COV2 5J09A 3GFJA 4IEOA 2RVCA 3M3OA 4QB1A 4U0WA 1F36A 1O4YA 4RB0A 2AR6A 2N7GA 1W04A 2WAAA 3DEEA 3K1NA 1DBNA 3BALA 3PL8A 3TNQA 4LTAA 4BXXJ 2E7AA 4XCAA 4AFBA 4Y17A 3CIHA 1SFOJ 2AEZA 3UESA 4YVSB 2W7NA 1FSEA 4GWJA 4MHUA 1ASJ3 5AIPA 1S3JA 2FMLA 2ERFA 5BNOB 1IGOA 1XGSA 1KDMA 1Z91A 1LGCA 5JSRA 1HB3A 2P5KA 3Q8FA 3FXOA 2WT1A 1GV5A 3GFIA 3SLIA 4CVUA 5JFRA 2V5YA 1ODMA 4BBRJ 1SLBA 4Q4Y2 2VW2A 2XJTA 1QJU2 3C3WA 3RMYA 1Q5OA 1MH4A 4K8RB 2JB8A 3N36A 1FP1D 5FZFA 2FDGA 5TRDA 1N1VA 4QPQA 3SNMA 1K45A 4NHKA 2IS1A 4D0PA 5CNAA 3IDAA 3T30A 5E8AA 3AZYA 4ET7A 1HRI2 3DPTA 1MMNA 4M71A 4COZA 4YELA 1CAVB 1HDPA 5FLXZ 1UMQA 3LSIA 1AL23 3S3NA 2WRAA 4ES9A 3ACHA 2ZAHA 1FOWA 3ZQ7A 3EXUA 1EV7A 3AKRA 2Q1MA 1Z7UA 1W8OA 4XE9A 3MFKA 2BGPA 3PU8A 5GPCA 1E17A 2GNBA 2P17A 4IHTA 5HXVA 2JA7J 3S5AA 2V9PA 2DA4A 3K3OA 3FX3A 3HPHA 3I2GA 4IX7A 2HOAA 1KFUL 3H5NA 1T8IA 1DQUA 1SFNA 3HNBM 1OKOA 4RS5B 1DHKB 4YVSA 4HVOA 2WB1A 4QHOA 4HX7A 1FIPA 1N47A 4Z92B 4MTDA 1YFUA 2JG9B 5F8PA 5D8KB 2VW1A 1MJAA 4RHV1 4RQPC 3GTQJ 4I2OA 5GLTA 3VB2A 1IHMA 1LFBA 5LEJA 2JTVA 5FZ3A 1W9YA 2XVCA 3W21A 5FMDA 3ZFGC 5JOWA 1XSVA 3LSPA 3WINE 3LE0A 3VBSC 3PUIA 2I07B 1G9AA 1SG3A 4UUSA 3RNSA 5J6XA 1QQP3 5FLIA 1QY4A 2RQQA 4LLOA 2PXJA 4E4SA 2IW5A 5CVJA 4XLPF 4COYA 5M5XJ 3T2QA 3KLOA 5ICGA 3SEPA 1PYVA 2NS8A 5CG8A 2RR12 5FLVA 1CAVA 3CJXA 3TYJA 2AHQA 2FU4A 1X50A 3HHHA 1KGSA 4I7HA 4LLGF 4KISA 1P8JA 2AXTC 2DI3A 1UXZA 5FZMA 3WSOA 5FKNA 3AKQA 1GANA 2NLRA 3WQ1A 2BGCA 2KP6A 1EV11 5FUNA 3P6BA 5IK5A 3ABTA 5CVIA 3O5SA 5I8SA 4XLNF 1PK6B 4IW3A 4GKXA 1G6NA 3AYEA 2XJUA 3BG3A 1SFYA 3UKTA 4P02B 3BP8A 4O65A 3ES4A 5KXBA 4G6DA 3HRMA 1NK2P 1REDA 1DYKA 2JUCA 1T6BX 3LWFA 1CJPA 1GSLA 3VDDA 4GWMA 5J3LA 3HRSA 2R061 3LZZA 5FJKA 2XL7A 1IN4A 3K3NA 2YC4A 1R7JA 4JQFA 1B9NA 2XLFA 2MEV2 3BZ6A 4A3BJ 1W8NA 1CZTA 3EETA 1ULEA 1W05A 1AR61 3ATGA 3NWKA 3V0AA 2ZMNA 4RMNA 2OJED 5CYVA 3FM5A 3HWJA 3OIQA 3LOIA 5FZ7A 5FMOL 4PDWB 5GZFA 3HTUA 1PM7A 2ZMLA 3MIBA 2TDXA 1X2NA 4KIBA 2Y34A 3MFCA 5GPAA 4RYDA 3RPUA 1P7JA 2V1DA 1G86A 3OYLA 1XD7A 3CD6I 1DQ0A 5JVVA 3FF5A 5DAWA 3T09A 2OCCH 1ZA7A 1WBLA 1NG6A 1VMFA 3WNNA 3ORJA 4UFIA 1HW1A 2ADDA 5JVGF 2AYHA 4QXBA 1FOD1 3VKMA 2G0EA 3NSTA 3VV1A 2RS52 3AZVA 4IV3B 2W82A 1PK6A 2GN3A 1IAWA 3CJIC 1MGTA 2Y60A 3P3NA 1TMF2 2M5WA 1V5EA 4AIDA 4TN7A 4PK4A 1W28A 1IDYA 1NG0A 1BOBA 1M4WA 1WWYA 4C2UA 2KRHA 5HDNA 2HWC2 2VJ5A 4RGXA 2VOVA 4PJMA 2OCEA 4XIDA 2G7HA 1WMFA 2BUKA 3CJRB 4HSRA 1D0GA 4V1PA 2A6VA 3S7EA 4PIYA 1RUI2 4RB2C 5FKMA 1JU4A 3O1PA 2OBPA 2XHKA 1QA6A 4CXYA 3Q0UA 5EPAA 3IT8A 3IKVA 1XB9A 5J4VA 3WQBA 2BDRA 4JRAA 3POJA 3SXYA 4JX4A 5BNNB 5EWSA 3OIOA 2VQTA 5ERIA 2EAAA 4PDWA 1JZ2A 2W25A 3DPUA 2K4BA 4A0XA 2FSWA 2VBYA 2ZAAA 4A3LJ 2YU1A 2ZB9A 4QPIC 1FAYA 1Y3TA 3QYFA 2PMUA 5JHUA 2FBEA 2QENA 4PLOA 4Q4X1 4FPHA 1VMJA 4TYSA 3LEKA 4FX0A 1DDNA 4AQ2A 4R4XA 2YFUA 1CGPA 1MS8A 2BP6A 5IAVA 3WR0A 2FA5A 3CU7A 5K7HA 2EV6A 3TBDA 2LK2A 1MS4A 4IE5A 1QZYA 5FZLA 3WZ1A 4MXVA 4JK1X 2EV5A 2RM23 1HKQA 3BCBA 4ZYAA 1Z6TA 3ZMDA 2PX9A 4AI2A 2ZGKA 3T2TA 1VF9A 2QWWA 2AC1A 4XUTA 1WJCA 3PO2J 2OUHA 2V72A 4FO9A 3U10A 4CCOA 4PJNA 4S2HA 5E3LA 5E1RA 3OYCA 3LA7A 1RZ4A 2CH0A 1XSRA 3KPHA 1TVGA 3JAMZ 2P37A 1U9NA 4FASD 5F9TA 3LDRA 4Q4V1 1VBE2 4LO7A 3C2BA 5CAZA 1OLQA 3R0AA 5EFUA 2WINB 1AWCA 3K4MA 3ONQA 3K2AA 3LD8A 1FPQA 2QQKA 3GCWA 3HOYJ 3HHGA 1AYM1 3MUZ1 1CX4A 2BVMA 1V6NA 4GALA 2DPDA 2CY6A 3SISA 2CU7A 2PHLA 4BDYA 2Y6LA 3IH2A 5LEKA 4M73A 2XAGA 1DIWA 3AJYA 3J8F2 3B02A 2YV8A 2CHHA 2QKDA 2MBFA 3NRVA 4M3CB 2BV6A 1G3WA 3F8FA 3GTJJ 4D7YA 1S0DA 2A5WA 4HMZA 3VYUB 4OMYA 2K0GA 5BPXA 1J59A 3TN91 1P2FA 4CHUA 2CQXA 2P6HA 3GF2A 2IS4A 1UX6A 4FTBA 4QSHA 4C3HJ 2FNAA 2B42B 4BXUA 1USTA 3ZCOA 1JYVA 2X5IC 2ZGRA 4Q29A 1ZELA 1UX7A 5I0SA 2VAUA 2ECBA 2MD0A 2ZKNA 1SVLA 4OHXA 4QX7A 4UW5A 2F5FA 2ZXWH 2JK3A 3KQRA 4MIMA 2KA3A 3ZKUA 2DBBA 1GV9A 2V79A 4JDOA 4F8AA 4AU7A 2P5LC 2H0BA 3NO8A 3N9QA 2PMZN 4XABA 1QJX2 2EXJA 3DCFA 2QQOA 1WCQA 1K61A 1JU3A 3WF1A 4YZ1A 5IVCA 4BCUA 3H9JA 4N7IA 4YIFA 1TWAJ 5GZGA 1K7AA 3M2MA 3OBZA 2QBYB 1HKSA 1RUC1 1HN0A 1HV1A 4EV0A 3DEUA 2JD9A 3DXUA 2WIIB 1GVJA 3FMQA 1IXRC 5EG0A 1UAAA 4BJ6C 3N9PA 1NY71 3H5AA 2O0YA 4E7SA 1UO9A 4XUQA 2HWB1 5FKCA 3HOTA 4ZYEA 3J81K 2VPRA 1OA2A 4GH4C 3VODA 1JGGA 3RZZA 3S3MA 5J96B 1AOYA 1T39A 2X6XA 4UFHA 5C3RA 4OQ8A 5F5IA 5B66C 1EYBA 2C26A 2E31A 1JYNA 1OUXA 5LATA 2XQXA 1V5GA 2W0XA 3ME2A 1LJ7A 5T3NA 1NZCA 1W6MB 3IRRA 3BR3A 2JE9A 1E5IA 1XJAA 3U0ZA 1O3SA 1IS4A 3EMRA 3N9OA 4EYUA 3OOUA 1QZEA 1V54H 3H36A 1AR81 2DN0A 5K1YA 1SQ4A 2H94A 1F4HA 1XU1A 3FLPA 2VVDA 5F5AA 1DGWA 2BY3A 1W06A 1REEA 2PMWB 2EA7A 3CESA 4XLFA 1RUF1 5IWFA 1PVEA 3ECQA 4LIUA 4YNIA 2F5EA 1TME3 2M7BA 3MMYB 1SZBA 4GQ7A 4QPYA 3ZQGA 2W94A 1YJLA 1O4TA 4RLFA 4JQRA 3WHUA 4JAAA 2XONA 3GZEA 1MS3A 5FJ8J 1GZCA 2QUFA 5AVPA 1OYWA 4O3MA 3QQAA 4FPCA 1MMDA 4RAFA 2F5DA 1HDDC 1RUE3 1UPSA 2LSOA 3KZ4C 2VUMJ 3P9CA 2D6KA 1LVAA 4N43B 2WWSA 2X10A 2LY2A 3POWA 1ON1A 3TW7A 1W1WE 2F2EA 2EXKA 1W6NB 5L9RA 1KA8A 4P9LA 4XQFA 4NB5A 1CPNA 1RTVA 5H9SA 1OC1A 4RAGA 1AL0G 1W6MA 5C8WA 1TQPA 1B35C 1P6RA 3BPZA 3H8OA 3MEPA 1W4MA 2PLV2 4GGGA 2JDNA 3K2ZA 4F92B 5L73A 4XHBA 1RMU3 2R7ZJ 2V26A 3ZX7A 4JP0A 1PVC2 4GDFA 2Z2SB 2F4MB 2DVFA 2Q4SA 3HOZJ 3I2KA 4W50A 2FDIA 3J80K 5AC93 2QZ8A 2R7TA 5FPBA 3OR1C 1MMAA 5L3EA 2WUHA 4O9GA 4LHKA 2ISYA 1A5JA 3U9GA 4EJTA 2WNOA 4NHYA 3C8XA 1POV3 5EDNA 1HRV3 5D4RA 1HXS1 3I58A 3ZMSA 1USSA 3PTRB 2XJQA 3A4CA 5EF6A 5JDBA 2RDPA 3I3EA 2VUJA 1YOVB 4A4AA 5IJRA 3G73A 3LSTA 1S7OA 1S0BA 4PBOA 2VOXA 4FAHA 3VEPA 3LEMA 3EHKA 3P5BA 4RAYA 1RUJ2 4MX3A 2XBO3 4FSJA 1Q1VA 1BOAA 1BC8C 3WDUA 1V00A 5K0UC 1W6NA 5K9YA 4H3WA 4ASMB 2ADEA 3OPWA 5J98B 4B4QA 2XAUA 1HCRA 1K5MC 2Y0OA 1QDOA 3ZFEC 4ON0A 3RZLA 4HZFA 3I64A 4DEQA 4K3UA 3OGSA 1F1ZA 1PIV2 3WLUA 3F8BA 3F8MA 1K4TA 2HWF3 5HCFA 1SLCA 1HSJA 2GOXB 3KHBA 4KICA 4A45A 4C8DA 1JI8A 1Z7S1 2P2KA 2Y38A 3IMMA 2WO2A 2Y2ZA 2WNUB 3S1RJ 1BEV2 3MBWA 2I10A 2OX0A 3CNAA 5FTTC 2H09A 5FLHA 4CZCA 1YIFA 4META 3ZGKA 4NIIA 1BC7C 2CV2A 2WY7Q 3MKLA 1ND3C 1D0XA 3BQYA 4AHYA 4O6JA 5A3TA 1PZ9A 1VAVA 3LFUA 2RNJA 4FPKA 1VIWB 4BLIA 1GNYA 1C8M1 1VQ9I 4E6KG 4AFCA 4OHVA 2V4JC 5K8SA 5IYCJ 3WP6A 2IS6A 3ZR6A 1DZTA 3CCVI 2KJBA 2NP0A 4YG2F 1PGW2 4XURA 4BACA 4BIOA 3OY9A 2V4AA 4P9XA 3MICA 2Z42A 2DV9A 3CQZJ 1W0TA 4J25A 2PFBA 4BA6A 1RUD3 4GB32 2XLGA 4TSVA 4R79A 3H1WA 3ZXLA 3WG4A 1WI9A 4NPMA 3GYDA 1BK0A 1UYPA 3A0KA 4HOOA 5F3EA 3D6EA 1WJAA 3A21A 1KU3A 1C5IA 4RLQA 1S9HA 1BR1A 4Z07A 1HJFA 1ZQ3P 2HEYF 1GQHA 4I30A 5B4XA 5FYMA 4LMYA 3VSKA 4D69A 3VN4A 4LA2A 2WSVA 1FV2A 4CTEA 2BY0A 1YYVA 1S2BA 2LM3A 1PX4A 2DOFA 5BMZA 4HNVA 4JKMA 1X4PA 3VWBA 1GWLA 1AYN1 4G94A 2ZZQA 3I53A 4MUVA 2HS5A 1FOKA 2Y0SN 1VBB1 1QO0D 5DCMB 3CC4I 3WE2A 3B01A 1D8KA 5F7UA 2V7FA 3E7LA 5LD2C 2VKVA 4ORFA 4LR4A 3UGFA 2ARXA 2W52A 1MBKA 2NS7A 4XN0A 4BQNA 2QVOA 5FZ8A 1VBA2 4L92A 1N3OA 2NMOA 3DPRA 4PF1A 1HB4A 1W90A 3GALA 2BE5F 3ZP5A 2RE9A 1GP6A 2VPLA 4LQRA 5A3MA 1S72I 3OOXA 1QNWA 4XF1A 5FZDA 4M3CE 4YEJA 3ACFA 1R00A 2HVSA 2VOOA 1H4GA 1U5TA 3OG2A 4YGDA 1J3RA 2GNDA 1BJQA 2DA2A 4Y1XA 1X2MA 1ZR2A 1O3QA 4N53B 1E57A 1UYYA 2Y9YA 5CVUA 4AFDA 2WA4A 4F52A 3D82A 3DCQA 2HYXA 3VBOC 3OTFA 1G3YA 3Q9SA 3HQXA 2JJ6A 5JLVA 4CEYB 5DD4A 4HETA 1LFPA 5A7WB 4RFRB 1U0AA 3Q0WA 2VMDA 3ULQB 5FZKA 1G2HA 3OUHA 2VZ3A 3H8UA 3KP2A 2K9QA 1NHAA 4G3YC 4LG3A 2R7FA 2ZJCA 5C71A 4R4ZA 1AXYA 1WWXA 1VI0A 1MS0A 1MVEA 1WJBA 3ZXSA 3S93A 1B09A 1IG0A 1U8BA 2IXHA 4Y1UA 1NXD1 1YQ6A 1OVPA 4XW3A 4IEQA 3WCSA 4K8FA 4YIRX 4TXWA 4X6AJ 4PJ0C 4D9JA 4GFBA 5B5EC 2DFFA 3F8CA 1JOPA 1UY3A 1V0AA 2FDHA 3KSCA 1HX6A 3BR2A 4GA9A 3W2VA 1WJFA 2W08A 4YFWA 1TQ5A 3HG9A 2D1HA 4P9FA 5F5QA 4AI0A 4CU7A 2CV6A 2R041 4XF3A 1UHWA 1VRBA 2E63A 1SMTA 2LLKA 4BQQA 4IL7A 4JX0A 2VGDA 2QQMA 2GIZA 4Y5TA 2QQWA 2JX9A 4LGWA 1QU0A 3KIOA 1SFUA 4XACA 2XGCA 4HV6A 2DOEA 4MFEA 4Y4RA 2WNVC 1BBT3 4N53A 1FSHA 2V1UA 2K4JA 3T0DA 2JA8J 2XF5A 4M6YA 3BPVA 2IS2A 3O1SA 4CEYA 1O59A 3M7AA 2Q2EB 5B3SH 1OR7A 1KFXL 2CFXA 4ENJA 4LUMA 3HXLA 1DPUA 1UIJA 3Q9VA 5J36A 1R36A 4FCAA 4F83A 2LKPA 4MQVA 4DZPA 1Y39A 2ZABA 2QQNA 1Y9MA 3PL0A 1JYCA 2DFEA 1FTTA 3TAYA 4BY1J 2H1LA 3LFIA 3WTXC 2VNOA 3S1NJ 1CESA 4HN0A 3WDXA 1AR93 5A3OA 1Z21A 1J84A 1H8VA 3MIGA 3OYJA 2GMMA 3WDWA 1LPQA 3K10A 3DXTA 4ENKA 2NVQJ 5KHJA 4WXHA 4I0AA 1XRUA 3TBIA 4D5FA 3A02A 2JPCA 1VQLI 4WM7B 2V4VA 1G3TA 3K4CA 3Q5FA 4EM2A 2RV8A 1UOJA 2MABA 3ZPYA 2O6GE 1XNAA 2VBDA 1BK1A 4NHMA 4E2GA 1QOSA 3FBNB 5F08A 4IEPA 3ECOA 2HXIA 4G7HF 4MG2A 2EBIA 3REOA 1J58A 2Z33A 2M0CA 1TEIA 2LRPA 1QMJA 2EPFA 4IRIA 3DQVC 1JOJA 1LUJB 1OUSA 3DTEA 2RMU3 5FY1A 2F6CA 1YQ2A 2C9AA 1IRZA 2Q2EA 4TTGA 4J1WA 1COV1 5LRRA 4YARA 1JI6A 3J81Z 1UN1A 2A3SA 3THPA 2NVTJ 3IBMA 2NXNB 1NYWA 3NAUA 3TOAA 3LEGA 2EICA 4Z2YA 1EAH2 2SBAA 4XLHA 2K2SA 1HA8A 3QH7A 3M9AA 3RTRA 2Y6HA 3KWVA 3C1DA 4CUAA 2OTLI 2Z5WA 4A6SA 5LLQA 4AHZA 2G1MA 1DUXC 2CWMA 3OY8B 4XF4A 4BB3A 5H6RA 1W6PB 2B5HA 1PDNC 1CAWB 1DGWY 3JQXA 2CRGA 3FKJA 2GA1A 5FPAA 5EGOA 3IAS2 2XQRA 1HIXA 4LOTA 2Z69A 4Q4Y1 1CX1A 1AUYA 4G8XA 1QJU1 5DAXA 2ISZA 1POGA 5CQGA 1RUH3 5FPLA 2GMEA 2W39A 2QZ2A 2A71A 1JBCA 2P81A 3F95A 3RQ4A 3GZUC 2BERA 2K02A 1VPHA 1NOVA 4HW0A 2FZ2A 1RNLA 2WZEA 5LHIA 2DMNA 1HRI1 1RIRA 4YVSC 3KV5A 5JIAA 4UV9A 3BIEA 3IV5A 1IUFA 2W1QA 1KXGA 4IGPA 4MH0E 2VXJA 4AGVA 3FJSA 1R4MB 1LULA 1BA5A 2PAEA 1J1TA 4BXFA 4K1ZA 1R082 4E8CA 2YU3A 3WDTA 3K48A 1HLVA 3HOVJ 1ZG5A 3I4MJ 1BXHA 2IJLA 2OYZA 4N4NB 4ETSA 1D2SA 2BOLA 2W57A 3SEQA 3Q9OA 3MW2A 2D5VA 4CU8A 1IS3A 2E2HJ 3WHTA 4V2FA 2V1NA 3OY8A 4ES8A 3BROA 2YBKA 4QQ2A 4CO8A 2ETEA 5CG9A 3FHZA 3PHMA 1I1EA 2LTPA 3FDYA 4A6DA 2CL2A 3CDHA 2WFF2 3GHMA 4BE0A 1MEC2 2UWAA 4FTEA 2FBHA 3J80Z 2VMEA 2R3SA 3BZKA 1UCXA 1XXNA 2GC2A 1XGNA 1ODNA 3ZSLA 5EEAA 3O1MA 2XC7A 1XSDA 1VBC3 3BTCA 4YM3A 3SKJE 2RR11 5GZDA 1AA7A 5BPIA 2Q1ZB 2FE3A 2A6YA 2QA4I 2D3PA 3JXSA 3VDDC 5FQ0A 1XQNA 2I5UA 1WW5A 1WW6A 2VBZA 4PUSA 3QOPA 2PHDA 4L9TA 4DXZA 3KCXA 2LREA 5HCBA 2VI6A 4CCNA 1A36A 4OMCA 3NQOA 4EN8B 3ABZA 1XE8A 3I8TA 5DCFA 3LB9A 1D1AA 2WQZC 4EQVA 2EV0A 2CMPA 5C5UA 5LBBA 4ESJA 4OWRB 1M06G 4MGIE 4IE0A 4UVAA 2B9VA 3HM5A 3DKQA 1O4XA 4XMYA 3VHNA 3WTUC 4LOSA 4FPJA 2UWMA 1LOEA 3K75B 2XVKA 1FBUA 2ZSHB 2CV1A 1QNYA 2R5YB 3GO5A 2VMIA 3PO3J 4QT6A 3SMHA 2BBYA 1LDDA 3ZXGA 2BVVA 3K4ZA 3NNFA 4XKCA 5JVTA 2AS5F 1R49A 2ZEXA 1UWWA 2RVAA 3OYAA 4YW7A 1Y1VJ 1G9CA 2MEV1 2A05A 1YLFA 1SDWA 4KIGA 3O12A 1R5GA 3SZPA 3SHFA 2HEOA 4KU7A 4L11A 3QWLA 4FCYA 4JBAA 5FUIA 4EN9B 1UF2C 3M8LA 3Q8BA 2E51A 1PK6C 4DPNA 2EZKA 2ZGMA 5CFCB 1WSUA 1V6LA 2KHMA 4EATA 4CUCA 2NPIA 3C2GA 3VBRA 1WMDA 3FISA 4LBOA 3MZHA 2XAFA 5J3UA 3HR9A 5IVVA 5FZGA 3BTLA 2ZHMA 2X51A 1SMVA 2GALA 4AIKA 2CDOA 3DXJF 4OIPF 1V9U2 2PI0A 1APNA 1O3TA 4ZDPA 5FY7A 2RV9A 1LESA 3ZXKA 3DKXA 4OUSA 2RS51 3ZYIB 4IVNA 1OPOA 1QU3A 4KT5C 4A0YA 3KEQA 2ZCWA 1ULDA 2LFBA 1DLLA 4Y4YA 2ZGOA 3WTVC 5FUPA 4B7KA 1R092 3N7MA 1Q8OA 2FQ3A 4PDWC 1X36A 1JS9A 2K9NA 2BU9A 2HWC1 3VD5A 4CP0A 3T2OA 1OLME 4K2EA 1JHFA 2EILH 1RUI1 4K9SA 5A33B 5K5OA 1DGLA 3AG1H 4ESBA 2JRTA 3RZHA 5HV0A 4EE2A 3ZVXA 2DA1A 1PGL2 2XB0X 5IYBJ 2Q8EA 1O5UA 2P4EA 3GTOJ 5ICEA 1NT0A 2VH9A 2YHJA 2B7EA 3N7LA 3VKNA 1NCQB 3OF1A 3AKZA 5CFCA 5GAHJ 5GLVA 3VHOA 1RETA 3PJRA 4B4CA 1H8TA 3SCFA 3B93A 4QXKA 3RWNA 3SFIA 2LVSA 3DF0A 5D8AA 1WZ2A 3GZTB 3JB8A 2R7RA 5HV4A 3GLXA 1FMWA 4HLTA 1V4RA 1RJ7A 1QF3A 4F91B 5JPNB 3ZPLA 2HKXA 5EYXA 3WE3A 3DYMA 1OT5A 3CLQA 1ENHA 3H3ZA 3RZDJ 1XDUA 1KU9A 3I3DA 4XDQA 4E4ZA 3CJQB 5BYNA 4CA0A 3JRBA 1W9TA 4L9VA 1IPSA 3N7KA 3VGIA 2R7OA 2EZIA 3IDBB 1K6OA 4A3ZA 5GLUA 2MNGA 1LJ9A 4JCKA 1RUOA 3OUJA 1XNDA 1CAUA 3UJQA 3QBQA 2HWD2 5JOZA 2F5VA 4YM0A 1J0RA 3HVDA 5FZBA 1YRNB 1SEFA 2EIGA 2ZMKA 4NBQA 4A41A 1VQPI 3WHBA 2F4IA 1WHUA 4FPLA 4WM8B 2JKBA 4Q0UA 1PP8F 2M0MA 1TBXA 3ZYGA 1REFA 3I54A 2CAUA 2KJCA 3J8F1 5KHGA 2XAQA 4D3WA 1OYIA 3BJ6A 4AYBA 5FZEA 4AE2A 1DF0A 1J7KA 1CF7A 1WMEA 1RPWA 1HQWA 2HNHA 1W5CC 1SLIA 1S0EA 5GTHC 1XCBA 3KYCB 2WN3A 3V0BA 2D6MA 4GJZA 4BY7J 5C3EJ 1J83A 4JX5A 1K3IA 1SHWB 1ZG1A 5A2QK 1F43A 1DQ5A 5J1XA 5E16A 3BUCA 1FOYA 2IRFG 4B7EA 3OCPA 4KN7X 2D5HA 1YO5C 4B09A 3A4UA 1W6OA 1TNTA 3RI8A 4NN0A 2PMHA 5AONA 4J19A 3ZMOA 5C3QA 3VYSB 1X82A 2MGQA 4Y22B 2WLQA 2W1SA 2E33A 4LHNA 4A69C 1TWGJ 1U3EM 2P7CB 1W2TA 2EFWA 2MPFA 1QJX1 4IE4A 2XJRA 3ACLA 2RREA 2GC3A 4RB1A 5CBLA 2WBMA 1RL3A 1UMIA 1ZAOA 4A3GJ 5DTDA 5D5UB 5J37A 1RUNA 1TMF3 3VZOA 1AR62 4RGGA 4U36A 1MS9A 5L7OB 2IGMA 3C7OA 2QQPA 4C1XA 2OTJI 4X8PA 2STTA 4NAOA 3NNMA 4CRQA 4P1WA 1DP7P 1B59A 2VJIA 5A3UA 1NLSA 3DU5A 3NAPB 5D6EA 5FKKA 1Q1HA 5C3SA 3FBMA 2QQBA 3HKZA 5KXDA 3RKQA 4B43A 2ORZA 1K4SA 3WW3A 4CDXB 5KVRA 4FPOB 1VBD3 4DUXA 5C4WA 1S4CA 3KT7A 3T5XA 1H1MA 2BHZA 1ZRFA 1O7LA 5C7GA 1KU7A 3VDBA 1G9BA 1UQXA 3I5UA 1PZ7A 2QFEA 5KC5A 3HZJA 4FOQA 2BQPA 1GHCA 1J09A 4IXAA 2QCSB 2IXLA 5A7PA 2RG4A 3H50A 3FXUA 4QHZA 1UY4A 3G1LA 2XF7A 1J3QA 3TO6A 2Z16A 3DKWA 2VULA 2OV7A 2DLLA 4IRGA 3BG9A 2RS12 1V6MA 1ND2B 1MJBA 3M4FA 3ZMVA 5IYYA 1APLC 1AKHA 4NPLA 3U1XA 2ZNZA 2JDYA 4L2NA 2GXAA 5IT9K 4WBBA 4AGRA 2JVHA 2M9HA 2UUZA 3WUDA 4CGZA 4LLFA 5E17F 4CCDA 2RC4A 5FK7A 5C4JJ 4E8DA 2JB4A 3QACA 3NAPA 4DEVA 1YQ8A 4Q47A 1VBE3 4CDWB 5KHDA 4LBKA 5D6FA 3PSIA 1OBNA 1IS5A 4Q4X2 2L9NA 1V6IA 3PVNA 1B8IA 1FEXA 1YNAA 5L36A 2KDZA 2HTJA 2NN8A 1A34A 1JTYA 5LA2A 2H6BA 3HRUA 3H9QA 1OFNA 4CYCA 2VM9A 2HZDA 3W3CA 2D3SA 4HNUA 4B1LA 4R52A 2PELA 1GQGA 5JWPA 4OULA 3QU3A 3V7RA 2W1WA 2X48A 3JW4A 4P9YA 1AF9A 1LEBA 1RUG2 2PLV1 2ZPXA 1YS7A 2WZR1 2JRMA 4B44A 2XRLA 1L7QA 3ELNA 3WW2A 2OXBA 5GJ6A 3CEWA 1FTZA 1NG7A 4RGSA 1LB2A 1PVC1 2HFHA 1OPCA 1RHI2 1Z9CA 2AREA 2WWJA 4IL6C 2LBFB 4AI9A 4I02A 1ZZ9A 3L2CA 2JJ7A 4CP9B 2IT0A 4FQGA 1ND2A 4AAXA 5H20A 4FPGA 2JICA 3W59A 1TZLA 1FP2A 3TKYA 4CDQB 3MZYA 2WV0A 2HWE2 3ILFA 5J4YA 4P00B 1LHUA 4N90A 3TOBA 9ANTA 1X3UA 1WPKA 5CKMA 2JDPA 1E5RA 2Y33A 3GWZA 1I27A 3KB5A 2WAOA 3S30A 4ESFA 5CFDB 1XSQA 3UETA 1H9TA 1AVBA 4QAWA 2GC0A 5FYHA 3WF2A 4IZZA 1Q8SA 1RUJ1 5BS6A 1W3VA 1YTYA 3ZQHA 1BCXA 3BN6A 4G6TB 1W7PB 2X6YA 5DUUA 3T0YA 2WT0A 4BUPA 4HF2A 4EJRA 2VZTA 1F9KA 3VL8A 1K78B 3W6JB 1G9DA 2R93J 3RG0A 1YX3A 2DQRA 1E3PA 3UV9A 3PUQA 3FFQA 1PIV1 4QPOA 1MZFA 5DDJ3 1S29A 1Z6RA 3SJMA 1ZN2A 3PNAA 1ETYA 2LBFA 4YGCA 1WUVA 1HW2A 4QWNA 3QPTA 4DW6A 3KGZA 5EZHA 4XFHA 3U4SA 4ZZ8A 2PHXA 1QQIA 3V4GA 3B00A 1BEV1 4CCJA 3O1VA 4HKWA 4CDQA 1K5JA 4BDVB 2XL9A 5TGTA 1VRH2 3KP4A 4J00A 5FXZA 2ZGNA 1NY72 5FPUA 1IN8A 4BHPA 5IFPA 5FP4A 4HDUA 2Q0AA 1OOPA 1T6SA 1EF4A 3FK7A 4YW1A 1P4AA 1H9PA 1Y6IA 2CQKA 1GUUA 4HKOA 3TEZA 4CDUB 3E6BA 5ISLA 4PQQA 1NCRB 1RC9A 1YI2I 5LW9A 4IEVA 4AOCA 4IERA 1BBYA 1PGW1 3AP9A 3OR2C 1DZRA 4XZPA 1W7PA 2DMQA 2A6XA 1V5FA 3APBA 1US2A 2R7VA 4GB31 2D44A 3O6BB 1HF0A 1GLHA 3GZ6A 4CEWB 5HS8A 5JR2A 3H0GJ 1Y8QB 1K78A 3EDPA 3SCHA 1TT0A 4BPZA 1B72B 2E9QA 3HMYA 4OINF 3N3HA 1QXRA 1AR82 3VBFA 4DY3A 4MGTA 4N0BA 1PUEE 3LQQA 4IOAF 4D6QA 5LY2A 2E53A 3A01B 2IXCA 1BI3A 2XMLA 4AYUA 3S57A 4IXLA 3PFYA 4NOTA 1O3RA 1ZNPA 2QSHX 3HRTA 4NDLA 2GAUA 3EQLF 4CPBA 2MLKA 1SEUA 5E6HA 3DPRC 2ZMEB 2FD5A 3NKTA 1QJY3 3WF3A 1Y9GA 4NC7A 5HNFA 1DU0A 2LNBA 4GYGA 1HLCA 1ZBE3 4TLFA 4P9IA 1MBEA 4OAYA 2KIMA 5IHRA 3MLKA 1HC8A 3NWSA 4KT6A 1U5TC 3IHUA 4C30A 3OGRA 3I59B 2EIKH 4LB5A 3LSEA 2ELJA 4CDUA 4KWUA 1YWKA 2WA3A 2WB1N 3J7NA 1GWKA 5BNPA 1VBA1 4EZHA 2LG4A 3THTA 2O0OA 2EF6A 3JZVA 4LFUA 3CMYA 3PQKA 2ZX3A 4QX8A 3KETA 1UKGA 1FPN3 4W6XA 4XJUA 1FMD3 1B1BA 1B72A 4ISRA 2CYFA 2IBDA 5FRMA 5E3MA 1TQMA 4A6EA 5K7FA 4XVHA 1VZ0A 5LGNA 4YZ3A 4Z2WA 2PHFA 3GUDA 4YW4A 4HRIA 1QHDA 3VLBB 4DGWB 3A01A 5A3PA 2BWAA 3KYDB 4F55A 2R0QC 2C5DA 3LSDA 1WJEA 3AVRA 3GDBA 2VBXA 2DUQA 3ZQQA 4HDVA 5FAXA 1HSTA 1SBDA 1N75A 2YC2A 2M4KA 2XUEA 2R0HA 2K3FA 5B1BH 1SDDB 4UW4A 3IAM2 2ZGPA 3CZ6A 1UU6A 5BQTA 5M3FJ 1SCRA 1J9IA 5ANQA 1W99A 2J1VA 3CCLI 2DU0A 4LK0F 2GH2A 1JJ6C 1VLNA 2KIQA 2E1MB 1EKEA 2VJXA 3V56A 3I59A 1ZRCA 2VR4A 4W65A 1PMIA 5JR7B 3MEXA 1SLTA 1Z3YA 4AQ6A 1SVMA 4N53C 3HOSA 4FOVA 1CONA 2VB6A 5BV6A 2DA6A 4EJWA 2H6CA 4BLJA 2TEPA 4CEYC 3FXKA 5L3DA 4E4HA 3MDPA 2AQFA 1OR7C 4UV8A 2WAQA 4HANA 4AVBA 5JI7A 1IRXA 3M7GA 2VUCA 3IMNA 1VE0A 3SDGA 2P3KA 2P7VB 2XR4A 4H55A 5E8GA 1Z7S2 3ZFFB 4CP1A 5E3NA 1QGPA 2WQ8A 2UURA 5E3OA 4GJYA 2LROA 2Q5TA 3WNKA 1BMV2 2K3PA 1ODDA 2FF4A 4QX2A 3KEOA 2G9FA 3POGA 2BZDA 1CIWA 3FFZA 4X1EA 3T1BA 1D4VB 4CU9A 5CLSA 1IW7F 2R7SA 1Y7BA 4FPYA 3E5QA 1C8M2 1WLTA 3GTMJ 4E2QA 5EJCA 2F17A 5AIQA 1MQTB 4UF0B 4UXNA 3IH4A 1Y0UA 5J7MA 2GNTA 4AI8A 1FC3A 2GWRA 1FYUA 1AR73 4ITVA 4YIIA 2IA2A 1STMA 1OCOH 1T38A 3FLRA 4XFIA 5KXEA 1LHNA 1L3LA 2ME0A 4DQ2A 4JX6A 4LO5B 2BZTA 2AO9A 3S15J 1F8VA 5FP9A 3CCMI 4IQPA 1JH5A 3ZXJA 4NUBA 1POV0 1JHJA 2CFOA 1I6HJ 4UFJA 3ECHA 5BNQA 4GKYA 4L9NA 3EB7A 5LA9A 4JGYA 1VQKI 3B7MA 1C8NA 4LUKA 3N4MA 3FWEA 1ZZ7A 4UHTA 1ETXA 4FFGA 3OB8A 1TZOA 4DS0A 1W3XA 3VD3A 4WVZA 4BL0B 4KBBA 1VAMA 4AVAA 1PO11 4DRVA 1Y43B 3H8XA 4BE2A 5F6KA 1NLRA 5BPDA 2MH9A 2FJ1A 3AJZA 2HGCA 1H2MA 1UPIA 1A3KA 1IOAA 1R58A 3GTPJ 3DV8A 1TG7A 3O1RA 4M0NA 3JBG1 2P8TA 3H1CA 3WW4A 2RS33 2Y0IA 5IP6A 4FISA 1W2OA 1AL22 1ULOA 1IRGA 1LU2A 5I0UA 4M72A 2VODA 1RVF3 1HKTA 1CIYA 2O8QA 5FYYA 4MGRA 5JUVA 3KP6A 5FY0A 1R71A 1EAH1 1MQTA 4FTHA 3MLJA 4UF0A 4LOCA 1W9SA 3ZYHA 4OU0A 2CDPA 3AG2H 2LDUA 3P1IA 2ZJQF 2OZUA 4UWDA 1KJLA 3EUAA 3HOBA 4FOWA 4HG2A 4OIOF 4N7UA 3JUUA 3JR9A 2DBNA 3SHRA 3TO7A 1ZZ6A 3MF6A 2LMDA 1U12A 4K7JA 5E1XA 2YDEA 4R8HA 3MD2A 2HDCA 2K9LA 4IHYA 1F5FA 1X19A 5AFBA 2E7QA 3QPHA 2ARBA 5M3MJ 5T55A 4D1QA 1X1PA 2L54A 1R1ZA 3VDXA 4P5OA 2KM2A 5F3CA 1SMYF 3BZCA 3BGAA 5IT9Z 2GIVA 2VCBA 1W9WA 1KJRA 1XYPA 3WHCA 1QQP2 4LNVA 3TEYA 5AFEA 1VQ8I 5FKOA 3VZNA 2EQRA 3HD8B 2DODA 4DYRA 3M3CA 4NIHA 5FYCA 2GQQA 4H4KC 3AKSA 3O1OA 1IUYA 4QTRA 3ES1A 2WO1A 4OQ9A 3WP5A 2DDBA 3ZIWA 2EJRA 5H9QA 4F93B 5FP8A 1E5HA 4CCKA 4HPKA 1TNSA 1BQPA 5H9PA 2O14A 4NNJA 1GP5A 4SLIA 2WDBA 3ZXAC 2H1KA 5FO7B 4EWAA 4PGGA 3CUQA 3WGIA 2J5PA 1L7RA 5LHHA 1EJ9A 2D6NA 4MHGA 2NM1A 4RDUA 2ET1A 2ZEZA 1SFXA 2A6WA 4Y1VA 2X05A 1SAUA 2DTRA 4KUMA 4BHCA 2NYXA 3WGGA 4YYOA 3V7SA 5F37A 5LWBA 2GU9A 2VU9A 5F3GA 5JI9A 2R042 2X6OA 3DUIA 3PNTA 4M74A 3UGHA 2WFF1 2AGSA 3LCPA 1MEC1 4IEUA 3WV6A 1HBXG 4QQOA 4NWWA 4YM1A 2HKOA 1RR8C 1A6IA 1FYMA 4QX1A 4W6WA 2FCTA 4XCBA 1KEXA 2ZXIA 4E2SA 3EJKA 3OSDA 2L0KA 2ZBKA 3FZVA 2ZA9A 4Z2AA 2P5VA 2OUJA 1BKZA 4ZH4F 3KE2A 3RKYA 1DP0A 3L00A 3KGLA 2EZLA 1N3PA 3MPBA 4Q26A 2XIGA 1OJLA 3PLQA 2QF7A 3HUGA 1MDMB 1K42A 1SBFA 1IKPA 1D8JA 1MR5A 3K0LA 4WXCA 1DU3D 1WGPA 5D5VB 5JR3A 3WODF 4RQPB 3NRUA 4CZZA 5DUVA 2W5FA 3W2AA 2E1OA 3L2HA 1YE9A 2R49A 1GVDA 4QX5A 3ZN5A 3G7DA 2J1UA 1NAEA 4J01A 3ZN0A 2KMUA 2XF6A 4FE7A 1XNBA 1MVQA 1LNSA 1PUFB 1NQDA 4WX9A 4CPBD 2DCJA 5F6FA 3VBRC 1RESA 4NC6A 4HPQA 1G7YA 3I2FA 5G04L 5JPMB 5DAPA 4S0HB 4QDQA 3ISPA 1X58A 1GBGA 2JDAA 1O91A 4N9IA 2QBXA 3CLOA 5IPAA 2XROA 4A2UA 3JD73 3AC0A 2NYYA 5CVVA 1C28A 2ORXA 5ACA3 2ESNA 3QPSA 3P7NA 5GKAC 1OKQA 3WDVA 3OIPA 1POQA 1T33A 3R05A 1K12A 3AFKA 1ZBA3 4II2A 2J22A 2MG4A 3HJEA 1VAKA 5ABJB 2EK5A 5FWEA 3ZXDA 2GP3A 5E1ZB 1LDKB 1UYXA 1MDMA 4PFOA 4P9UA 1V9U1 2QUOA 3MIEA 3CL1A 2OF7A 2VZPA 3SITA 1VQMI 5KWRA 3USUA 4GMP3 5GM0A 2JG8A 4GD4A 2R073 3VBHA 4RSUA 1R083 5JLWA 3KVAA 2L02A 4PCQA 4FPEA 3JRDA 3ERMA 5B2GB 5IUQA 2DFHA 4IEXA 4RR3B 2W4SA 1R091 3LQCA 4LBLA 4XDOA 5CFCC 4H0EA 4CCMA 4HG6B 3I3BA 4NROA 3VDAA 1E2XA 5K7PA 2UZKA 2BWCA 3K70C 1AX0A 2LRDA 1H8TC 2R5ZA 2HWVA 3FHIB 4XQDA 4M00A 4G7OF 1VQOI 1JUSA 5JOXA 1W0NA 1RR7A 3VL9A 1H1IA 3ZSKA 5D8AC 4XONA 4YVWA 1QJFA 5FMCA 2YB7A 4K21A 5FK8A 3GCXA 1ENXA 1K79A 3AZWA 4HONA 1PGL1 2ET7A 4WF2A 2B8MA 2AEYA 1C1FA 4LBJA 4RN5A 1CR7A 2L2OA 1PHMA 2EXIA 4F3JA 4BE1A 2VE1A 2G9ZA 1QXPA 2VBBA 3A2KA 3H7YA 3POSA 2WS93 4OUMA 4KMQA 2OIIA 4QXCA 3CF2A 3I0TA 2E7WA 1H2KA 2VQCA 1H6XA 5ABJA 4LE3A 2D6LX 4Q4W1 5FZAA 4BJ0A 4RFT0 4DINB 2JEMA 5E88A 2R32A 1LCLA 3LA2A 3PU3A 4RGAA 3HPNA 1PJRA 2GZWA 3I3LA 2B7YA 2K5CA 2X1DA 3HJRA 5BNOA 2DYSH 1EUTA 2DCEA 2UY9A 1R5HA 4II3A 1NKGA 2DUPA 3IDCB 2HVRA 4K1YA 4RR3A 5GTIC 4AR2A 4ZC3A 2C9KA 5EEGA 1PX3A 5FZ0A 2VKEA 2M45A 2KFDA 4A3MJ 1E0EA 3I2JA 4QX0A 4BNCA 1KYZA 3ILRA 3BTYA 1H30A 3FBIB 4I01A 2HXOA 3RGBA 4EQQA 2HWD1 2Z99A 4R9AA 1SFPA 5C3PA 4WVMB 3FXJA 1QVTA 3OYHA 5FD5A 3E3VA 2Y48A 1ZGJA 3SH4A 3T8RA 1HKDA 2JWPA 1MH3A 1SANA 3JSOA 5FYVA 2BHYA 2VMCA 1DFQA 3B9IA 2LP0A 4L5JA 4ARXA 3ELKA 1X1CA 2FZ1A 2VTFA 2DK8A 3ALQA 4BOWA 1JXNA 5DM6F 4D5CA 3MWMA 1MS1A 2NVUB 4EVIA 2FNPA 4EJOA 3KP3A 4RA2A 3H35A 3GZNB 2YGMA 3CZUA 1ZVFA 2KT0A 2HYFA 5DABA 1LTEA 3VHRA 1YLLA 3FKIJ 1JZ8A 4M6VA 4RS5A 2ZX0A 3LEIA 2XB5A 5K5RA 1R6RA 2LTNA 5CJ9A 1JUIA 1XX5A 2JDZA 2JG9A 3OS0A 5L3FA 5F64A 2EWNA 4XKVA 3POYA 1RXGA 3AM2A 2XVGA 4L18B 1MZEA 1GQPA 5FZ1A 1D0HA 4Q8KA 2GXBA 4LG0B 2RJ2A 3MPPG 4XDPA 3KVBA 4L5EA 3EBRA 3ZSMA 2CNAA 3WW1A 5C4WC 4KG8A 2DA3A 2D43A 2VL4A 3WF4A 1DQ2A 3UL2A 2J42A 2WA0A 3WEZA 1N78A 1H2NA 1GOHA 1XMAA 1TME2 2LC2A 2AACA 2FDFA 4I98B 2JECA 5FJHA 2E7XA 1TNRA 1GXPA 1MPXA 1N1TA 1YI9A 1T98A 2PG4A 2ZACA 1UHMA 1U2WA 2NMNA 2E26A 2CAVA 2X5IB 3LIGA 2VE8A 3ZYBA 2BV4A 3ZDVA 1JYWA 4DZJA 2D7FA 5FZOB 4N4OB 4LBQB 1J5YA 2DCKA 3MKZA 4A42A 3K51A 4DNCA 1UZ0A 4HF0A 3P3PA 3CJTB 1LHWA 2DCTA 5DMYA 5BOXA 3K69A 4E7KA 2IGKA 2BVBA 4E7JA 5KR7A 4DOZA 3RS6A 5CYYA 3M8FA 3WNLA 1VQ6I 2XOMA 1XE7A 1WA6X 1ZYRF 5F3IA 3OYNA 4XFAA 4WXDA 3NAPC 2VQLA 3U14A 3W58A 2QQVA 2X1CA 3J7AO 3M3EA 2QLZA 3USSA 2RS11 2Q8CA 4RHV3 1R4NB 4XM3A 3V65A 2PAKA 5FZ6A 2WZPP 5I0DA 1ACCA 1W8HA 1U5IA 3HGYA 5C70A 3V42A 2P5BA 1R64A 4OHZA 4CXXA 1N1YA 2XPUA 3J7ZI 4C0HA 2R92J 5IVBA 1WCUA 4UI9L 4GH4B 1OKRA 5DS9A 1AZDA 1HRV2 2VIXA 3U07A 2DDUA 5KCMA 1X3ZB 1NUKA 1ULGA 5A1AA 5A6ZA 4IDZA 4LB6B 4IUGA 2ZJRF 1XC6A 4UOJA 2YR2A 4B1RA 1UY0A 4OI4A 2MD5A 1A6QA 3OWTA 5F0HA 3AP7A 3SEZA 5EP9A 2RGVA 3ZLIA 1VR3A 4RBOA 2EALA 1CQTA 2EXHA 1CQ9A 3D0JA 1VB2A 1ND2C 2XBO2 4ENMA 5FP7A 5C4XJ 4IV3A 2OPWA 2E19A 3T8TA 2X8KA 2W3JA 4XK4A 2JENA 3G1OA 2Z4FA 2JMWA 5I0RA 1RKWA 1RUG1 4BQAA 2ZJ2A 4MGQA 1EV13 2ZXHA 1K83J 1KQ0A 4LD5A 4OUEA 3KX2A 5HS9A 3VDCA 3BJOA 4YW6A 1RHI1 3MGUA 2KISA 1OMIA 3GJAA 4WVVA 1ETQA 2HWF2 2VTXJ 1DYOA 1GP4A 2WSUA 5CZKA 1W6QB 2XKPA 4FE4A 3F23A 2MA3A 1ENSA 3PJYA 4GIQA 2HBTA 1W0UA 2HWE1 4LHLA 2W9XA 5FMBA 4PJJA 2R063 5BNNA 5I93A 3BG7A 4HBLA 1QNTA 2G4IA 4CCEA 3KM5A 4HN1A 1AX2A 5LASA 4C2MJ 4YG6A 1WQ2A 3I71A 1IO2A 2PHUA 3UJOA 5KXCA 1GLNA 2IC1A 1AR63 4O61A 2WKKA 4Z1VA 3IC7A 5LY1A 4OI2A 1OA3A 2M7AA 1D4M1 3AP5A 2PN5A 1B35B 4KWJA 2M34A 1T2XA 3N9LA 2VOKA 2HEWF 3NARA 1OQ1A 4HNTA 2Y69H 5FYSA 3ZKYA 4ENNA 2H0VA 3CO6C 3POIA 5J1YA 2RDRA 2GSYA 3ZR5A 5JZGB 2RJLA 1UU4A 4G6QA 1SD6A 3BR1A 4CDQC 1NK3P 2YX4A 1RIOH 1XPXA 4QB6A 5D2AA 4LLLA 3C18A 4PJYA 1FOD3 2GM4A 2BNOA 3RFRA 1OOPC 3RYRA 1JZ4A 1DLCA 2Y6FA 4LO8A 2CW0F 3PM1A 1W8WA 4HX8A 2ACJA 3Q8CA 4OCTA 1WD3A 2F5CA 1D0YA 1IV8A 1UOFA 1W6QA 4IEJA 4B48A 3KHCA 3TEDA 5H9RA 2BPA2 2LYCA 3HSRA 3J7HA 4Y1YA 1UY2A 1VRH1 1BYHA 5FBZA 5B1AH 1MJ9A 2VT3A 5DUIA 2V09A 3RKXA 3WUCA 1JKPC 2FDKA 2HZTA 1N25A 1W2AX 2X85A 3OGGA 3K6GA 5K0UB 3C7FA 5C9AB 3VBFC 5EYYA 4M3CA 2FQ4A 5KHHA 4JRLA 2PHTA 4KFCA 1K5MB 4JGZB 4IV1B 4BYYA 1GWMA 2H27A 5FRAA 1KQ8A 3TO9A 2DOAA 2LF7A 2Y8KA 1QBJA 2D45A 2BXZA 5IAXA 1E3HA 2P6SA 3HC7A 2JDUA 1WGXA 2E2IJ 2E35A 4IGQA 2DXIA 4P9WA 4RB3C 2MHFA 5JZGA 4Q4X3 4D8MA 2O8KA 3CMMA 4A6OA 4E7HA 3LGRA 3W5NA 2GDFA 3O8HA 1W8FA 5FKBA 1R1VA 2ARCA 5CISA 2JA5J 4Q8LA 1LEDA 5JLXA 2VZOA 3I3MA 5GP9A 3F72A 5E8IA 5ICCA 2Y6KA 1O8PA 1BIAA 3PURA 2R16A 5H2FC 4PSWA 4CDUC 1WZXA 2KDOA 1ND3B 4LITA 3JB4C 2R30A 3B94A 3RZOJ 1H89C 2QBYA 3WP4A 4C0BA 3W6KB 3JRFA 3AXDA 5BNPC 4FAGA 4I76A 2LF8A 1I1SA 1LDJA 1YG2A 2DO7A 3WNXA 3TP0A 4XLCA 2R7QA 5JAXA 3BT9A 1SACA 3ZPOA 3EUKL 2Y31A 2Q1FA 5JI6A 4PCRA 4A0ZA 4Q4V3 1JZ5A 3GF6A 2IFRA 1OVSA 3MW4A 4A3EJ 1OFSA 4ZU4A 4Y3OA 5C9AA 3AL0C 4XSZF 1AYM3 1Z0HA 1I50J 1BN5A 3VHPA 1Y1WJ 1ETVA 5DUKA 4JGZA 4IV1A 3PTYA 2VNGA 3C7HA 1HQLA 5IOZA 1JGSA 4BQ4A 1U78A 4JV4A 3ASNH 1BIBA 4XFCA 2YGLA 3H8RA 1VALA 2W00A 3TEWA 1YUDA 2COMA 1KITA 4BISA 1PO21 2XASA 2KLOA 3UR3C 2WZR2 2H8WA 1IJWC 1T0FA 2QKMB 2CUEA 3J9SA 2CO5A 3TN93 4NVPA 3LSKA 2HJIA 4Y5SA 2KKOA 3L2WA 3AZXA 3BTAA 2VPVA 2EFNA 1QZZA 4QU2A 3E6CC 2LY9A 3CMEI 3GBFA 5HODA 5DXDA 1B4AA 3J7YJ 2DPUA 4NR1A 3FXRA 3ZQIA 4KMUX 3I97A 2IXJA 4QDSA 2TUNA 1UZZA 3KP5A 4YG0A 1BBT2 3O0VA 3M1CA 4AC0A 2DURA 4MXWB 3B73A 4GRIA 3RI4A 1YXWA 2IZWA 3ROUA 3TMOA 5F32A 1IG7A 2H8RA 3OJBA 1RUC3 4IGOA 3BU0A 3HBLA 5FP3A 5KK1A 1V55H 4AEKA 1QH7A 4AEDB 4NHLA 3ETQA 4M3FA 3NNJA 4N43A 2A6TA 3A0HC 1LKXA 1X1BA 1XSXA 3AXEA 2XXZA 1PMHX 5DZFA 2R7DA 4KG0A 4HF1A 3H5RA 2RQPA 4HOBA 3FM3A 1AR92 2HWB3 4M4RA 3ABUA 5JXJA 5L3GA 3L2VA 1YIJI 2FCUA 2A61A 1X3WB 2OC6A 3OUIA 4BQ2A 5FRNA 3RKWA 1UYZA 3IIAA 4ZY9A 3OBAA 3WP3A 2LD5A 2WADA 2B63J 5T5OA 1OH4A 1BI1A 3OD4A 4CH7A 1LFUP 3K4DA 4A3CJ 1DZQA 3AMMA 4MEXF 3VBOB 2W2IA 4QM9A 4DB5A 4ZS2A 1LENA 2IP2A 3O7OA 4ZU5A 1HB1A 2E1MC 4XLEA 3CP8A 1BMV1 3RPUD 4DOUA 2WLPA 2R4GA 3BTIA 5ERLA 1XOYA 2YX7A 3BOQA 3OGVA 1US3A 2YPRA 4A93J 1AR83 4AXOA 2RKHA 4QKDA 2VMFA 4M9SA 2DMTA 2GC1A 5GZCA 3EYPA 3WG9A 1RUF3 1FLIA 1XC5A 5A80A 4LKSA 2Q8DA 2WN2A 3AMQA 5FY9A 4FTSA 2OZJA 3ITQA 4JGYC 5EHDA 2ZSIB 4XF9A 4CYDA 3WOGA 1AJOA 4LO4B 4UBHA 4CICA 2ESHA 1F31A 4AEDA 2GH8A 1WI3A 2O3FA 4DYQA 3NKGA 5FY5A 2O1QA 5JHFA 2CV0A 1JTZX 5IT6A 1S1AA 4N8MA 1ASJ1 5CKNA 2K40A 1W36C 5IYDJ 2ZOEB 3N35A 4UT5A 3ZN4A 5IY5H 4PFPA 4AIHA 3KMHA 2WNVB 4RA0A 4HEA2 2FEZA 2L5QA 1QH6A 3POFA 2QQIA 4NIDA 2VOTA 2V9VA 3M1HA 1RUH2 2GLOA 1LEMA 4FT8A 1MQTC 4UFLA 1RXFA 2COBA 4BEHB 1ERDA 5LBFA 4E7IA 4QKFA 3VBUB 3G2BA 2IUWA 3MFAA 5EXOA 3VOEA 4XBNA 3BPXA 1O6UA 2JQ7A 2WNUA 4BJTA 4AVPA 4OIQF 1TWFJ 3HB9A 5CIRA 2TBVA 2E7TA 2DMUA 3G6JB 2EIEA 4QPWA 2W92A 2VQHA 1AL21 5FPVA 3J26N 1LE8B 4LKEA 3QPLA 2R1BA 4C1WA 1ZG3A 4HK8A 4RM3A 4AGGA 4MEYF 3OV8A 3FE5A 3F9KA 5FPXA 4NE9A 5HLIA 5LCWL 4IKFA 1HXS3 4URAA 1Z78A 4M3DA 1VB4A 4IRHA 3ACIA 1FNNA 3GHNA 5LB6A 4TLGA 2QCOA 3RMXA 1SD7A 1YI7A 1MS5A 3TP3A 1TTYA 1GFF2 4NIAA 2VZ1A 3NVCA 2XPJA 3WD5A 3SQNA 4A3JJ 3VZJA 1XCVA 3PDQA 4BQXA 3D5OA 1ST8A 2IA1A 3NV2A 4AM3A 3ZMNA 2K85A 4COVA 1ZRDA 1VP6A 3AFHA 1OQEA 2JSPA 1AXKA 3H3UA 3MO4A 2XLAA 5E89A 2P6TA 3NEUA 3VBUA 3CUQC 3HNYM 1QQP1 3T0BA 1RYYA 5FYZA 2E5NA 1HXDA 3LPFA 1VBC2 3BCWA 3CTAA 4ZJZA 3RZJA 3KZIC 4AYBN 1U0JA 3KCCA 1WCSA 1QHHD 1Z7S3 2V6CA 4RGUA 3PVEA 4HLYA 2L7KA 2MC4A 1UIKA 4Y24A 1OCCH 1LE8A 1U6GA 2XDVA 4LKDA 4A5MA 5DCMA 1Z1DA 2A7AA 5T5LA 1U9OA 3MYXA 3VKFC 5T50A 1LU1A 2EVXA 1KONA 3KLSA 3AFGA 4HT1T 2VZVA 2G9GA 5C3OA 3JREA 2E6VA 2IGOA 3KV6A 4F3QA 3RPQA 4M01A 4NRMA 2BYVE 2UXNA 4AD9A 3FUOA 5D21A 2DCYA 4OMDA 1C8M3 1ZREA 5K4LA 2WZ8A 3JU9A 1OCTC 1I5ZA 1ZK8A 4ZHNA 3D5RC 4A5NA 5A3NA 4E4DX 5EJZB 2VQ0A 5J40A 2A3WA 3LSJA 4GZ9A 3U1KA