2BEOA

Prfa, transcriptional regulator in listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
226
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords LISTERIOLYSIN REGULATORY PROTEIN
total genus 69
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2beoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2beoA01
3IRRA 3HHGA 1CAWB 4OIPF 1G4DA 1SFUA 5HDNA 3ULQB 1X82A 5KHHA 1SFEA 2W57A 3P9CA 2KJBA 2JSCA 1K6OA 2OPKA 4HOBA 2UY8A 1YIOA 5K5QA 1DPRA 3DQVC 5LBQA 4GYIA 2ZNZA 4RS8A 4M9SA 5CVJA 2KIMA 4MQ9F 1YLLA 1DPUA 2E7XA 4EM1A 2G7UA 3QU6A 5E20A 3EDPA 2XL7A 4ZYHA 5I93A 3ECHA 2EV5A 3IDBB 1K78A 2Y0OA 5IT9Z 3I54A 3H1MA 4FAGA 4AVAA 2Z9OA 2C0ZA 1HKQA 3EUHA 4ZYEA 1O5UA 3I58A 5I8YA 1CAVA 4Y17A 2C6YA 4BH9A 4L0YB 3H1YA 2M30A 5JFRA 4AXOA 3JSOA 2O6GE 5TRDA 2ZFWA 4WK8F 3MAJA 1O57A 3D82A 2ZO4A 4EWDA 1UIKA 2VODA 3FXQA 5HS9A 4IEWA 1D3YA 2WFPA 1RI7A 1KGSA 3EHKA 2O8XA 4I3PA 3P7NA 1PP7U 4HVQA 3JTHA 1UCRA 1YS6A 2ESNA 4EJUA 2HYGD 2HTSA 2M5WA 3NL1A 1V4RA 3WTVC 3M9AA 5I8SA 4QM8A 3OGJA 1O7FA 3M1EA 3V7RA 3KEQA 2HKXA 3T0YA 4UV8A 1MGTA 1Y9QA 3S7IA 2ISYA 2QQ9A 4AIHA 4RGSA 4LA2A 3ZN0A 2DPUA 4MX3A 1O3RA 4G7OF 3BB6A 5D6EA 1YFUA 3ZMDA 4N9IA 4HMZA 1YFWA 1S6LA 3DPTA 2UZKA 4HF2A 4KN7X 1JUHA 1YWKA 4P96A 1GQGA 1E17A 3WW3A 5I91A 4Q0SA 1T98A 5ICFA 1FNNA 2JRTA 3BOQA 2XIGA 3BY6A 6PAXA 1ZX5A 2GC0A 2FNPA 2VE8A 4EWEA 2W85A 2LDUA 4M6XA 4NB5A 3S0MA 1BI1A 4OINF 2BGCA 1NXMA 2HWVA 3SMHA 1W4MA 5HLHA 3RYPA 4L0ZB 1D8JA 3N97A 4B09A 4PIYA 1KYZA 2OBPA 1ZG3A 3K1MA 1FBQA 3USSA 5DV5A 3RKYA 2OZJA 4NHJA 4ZZDA 2L01A 1O5LA 4BHBA 1U6GA 3OV8A 1W7PD 1CAUA 1VP6A 3P9KA 1G6NA 3ZDSA 2RKHA 2NS0A 4QLCU 4HDVA 4AIKA 4EJVA 5J8CA 4IEPA 4YSFA 2BEOA 2WV0A 4CZZA 3EQEA 3DKWA 3D0JA 2RDPA 3OOPA 4A0XA 1I1SA 3ZN1A 2FNAA 3E6MA 4HQMA 1DDNA 1PM7A 1USTA 4A0ZA 1HQCA 1PUEE 1B4AA 1RNLA 5KHGA 4HZFA 1ZN2A 5E1XA 3F3XA 2GC3A 2EFOA 2VT2A 4YARA 5ICGA 2K7LA 3P9IA 4UV9A 3RZZA 4EGYA 3FZVA 3FE5A 1ZRCA 3LWCA 2DLLA 5CVVA 2OU2A 4HSLA 1QZYA 3RPUA 1MDMA 2QQAA 4Y13A 1P4WA 4YG2F 1XCBA 3RKXA 5CADA 4U88A 3C1DA 3ZQ7A 3CEWA 3MYXA 5FQ0B 3HQXA 1U2WA 4KWLA 2VPVA 4L5IA 4TV7A 4P9UA 1FYLA 2HTJA 1B9NA 1WWXA 2O03A 2ETHA 4IHSA 2FRHA 2DK8A 3JW4A 4N9HA 3TOBA 2QBYA 4KICA 5K5OA 2XAGA 2VOOA 1BI3A 2BE5F 5K8SA 4AVCA 4HBLA 5E16A 1U8RA 1I27A 2K02A 3H50A 1ZZBA 1SFXA 4GO1A 4M9ZA 4XSZF 4LTAA 4QXKA 3LOIA 2V6CA 3WW2A 4Q47A 4IEQA 1LDDA 1ZRRA 4IRGA 5A2QK 3TQNA 3ML6A 2EFPA 1R1TA 3I59A 2UYBA 4OIRF 3MFKA 4QX5A 5H6RA 4EJWA 4LK0F 2VE9A 1X8MA 3C3WA 2IXHA 1FBSA 2Y0MA 2DPDA 3I0TA 1J3PA 3FX3A 2J5PA 3KE2A 2A68F 5LHGA 2Q0AA 3LZZA 3GFJA 3PQJA 1ZYRF 1SAXA 2V1XA 3RKWA 1BM9A 2EK5A 4KN4X 3EJKA 2Z69A 3SZTA 4LK1F 1LEAA 1KU2A 3GYHX 3Q5FA 2PYTA 3BWGA 3WW1A 5D1IA 2DQRA 2GQQA 2VBZA 4A12A 2P4WA 4HLXA 3HTSB 3F8BA 2NYXA 1SFNA 2YPRA 4H0EA 3QPHA 3EETA 2ACJA 3NSTA 5D5UB 3BPXA 1Z05A 3O2PE 2FMLA 1QXJA 4HN0A 3IWFA 5FPZA 2GAUA 1LEBA 2DT5A 3RYKA 3OCPA 5D8KB 1FLIA 1SQ4A 3WG9A 4FX4A 1Z7UA 3T5XA 3E5UA 5D4SA 3BJAA 3EO6A 2VBWA 3BJ6A 4LG0B 1ZZ6A 1RZ4A 4LB6B 2Y75A 4M9XA 5FLJA 5T3NA 4UBHA 2VC1A 2XAQA 5FB2A 2G7HA 1UHMA 3UKTA 5HOOA 1UD1A 3GLXA 2EWNA 2OD5A 1LDJA 1F9NA 1ZNPA 3LAJA 3GXOA 5BMZA 2V79A 1VTNC 2PJPA 4OMYA 2GA2A 2GC2A 2STWA 1B59A 1XGNA 3ZMZA 1R23A 1ZRDA 4HN1A 3G73A 4DQ2A 1R58A 2XUBA 5CVIA 5ILSA 2R7DA 2WTEA 4KIFA 3KETA 5BV6A 3G3ZA 1MJ9A 1EP0A 3N4MA 2K9ZA 1P92A 2YU3A 2NNYA 1ON1A 3VEPA 1DP7P 5CVUA 1NZCA 4J1XA 3VOEA 3QOPA 1EH7A 3IIAA 3SZPA 4MEXF 1DGRA 1IRFA 5I0UA 3M8EA 1ZREA 1T38A 4YRDA 3I64A 4S04A 5L3GA 1G3TA 5JSPA 4AQ2A 3H3ZA 1ZZ8A 1DUXC 4KT5C 1QGPA 4IEYA 1FY7A 3TNQA 2UXXA 1F1ZA 3M8FA 1CX4A 1P6RA 3MCZA 2ZMEB 4O9GA 1J75A 2VBXA 1R7JA 4KA4A 2D45A 4BXUA 3CUQB 3Q9VA 5D5XB 2MHFA 1NE4A 2ZKZA 1H9GA 5LHIA 1WGPA 2QNKA 4I01A 3V8KA 5DEQA 4EM0B 4WZCA 1UPIA 5J3UA 4L9VA 4FHTA 1T2KA 2A5YB 3ZMUA 5J8FA 3FFQA 1YFYA 4P55A 4R52A 3U9GA 1YW8A 3TOAA 4G7HF 3H92A 4A5MA 2K86A 5TJJA 2PI0A 3O14A 5E18F 1T39A 1J1LA 3LA2A 1CF7B 3K9TA 3GFLA 1BN5A 3DP7A 1ZGJA 5FFZA 2MBFA 1Q3EA 4RD7A 3F8FA 3V8LA 5ICEA 1K7AA 2Q0OA 2IVMA 4H7LA 1U5TC 4ZU5A 1UCXA 3O6BB 3MZYA 1Q1HA 1QWRA 4ASNA 4IEZA 1F5TA 4WBBA 4O3MA 3WTTC 3ABUA 2DO7A 2GA1A 2MNGA 2PMUA 2PEXA 1HW1A 5AIPA 4FT8A 4PGGA 5BOXA 2FE3A 3C3VA 2P7CB 3HT1A 1MD0A 2OZ6A 5AVPA 2RVCA 3I4PA 2F4PA 2IP2A 4XBFA 1JHFA 1XGSA 4HYEA 3IHUA 2GIVA 3PFIA 2Z2SB 2ISZA 2PA7A 1LQ1A 2MPFA 1X3UA 3GW2A 4ONUA 5JHUA 2W25A 5FFXA 1XDUA 1GXPA 4KU7A 1HXDA 3KFWX 3I59B 5CU1A 2STTA 4G6QA 5L3CA 2OA4A 2VQAA 2F5CA 1BC7C 1R1UA 3V7SA 2I45A 3HIFA 4XFCA 2CFXA 2HQRA 3I5UA 1LNWA 3U10A 3FM5A 5LGUA 4MGZE 2CAVA 1V3FA 1UW8A 3WTYC 3U2RA 5BS6A 1QNTA 3KCCA 2DTRA 1JHHA 4I0AA 4E70A 5L3FA 2PN6A 2Q2EA 3NJZA 3PVBB 2GC1A 2VBYA 4PCQA 4M72A 4MQVA 4EJOA 4D7TA 4RB3C 1PDNC 1SD7A 1UIJA 4GXOA 3ECOA 1D8KA 4LB5A 4L9NA 3KLOA 2W84A 3HSFA 5CYVA 3E6DA 5CLSA 2D5HA 5EEHA 4XLNF 2F2EA 4FAHA 5LLQA 1QPMA 2P6SA 2QDRA 2HJIA 1G3SA 1P2FA 3GX4X 3KGLA 1R22A 3CTAA 1WLTA 4EROA 2XLFA 1XD7A 2YR2A 3R6SA 1IF1A 1B6AA 1ZG1A 5FD5A 4BHPA 4S05A 3VODA 4G6DA 1BOAA 3GEZA 4PIXA 2A07F 5ED4A 1JXSA 3TO7A 1KA8A 5E1ZB 1X8EA 2P5KA 1EH6A 2KIFA 1TBXA 5H6QA 2YX4A 3KZZA 2P5LC 1J0RA 4E2GA 3ABTA 4ENMA 3MZHA 1WQ2A 2EFQA 2IXCA 2M1BA 2WWYA 2XLAA 4XSXF 4MEYF 5JSRA 4WCGA 2EVXA 3J80Z 1OD5A 2MD5A 3KSCA 3S7EA 3IWZA 4HVOA 2E7WA 1I5ZA 3KGZA 1V70A 1SD4A 5BQTA 4P9FA 2DBBA 1TTYA 1IN4A 1FC3A 5HS8A 1K78B 1EH8A 4MGIE 3LWFA 1CAUB 3SFZA 4JVAA 2NNNA 4ZYDA 3JAMZ 4MNUA 1HKSA 5J6XA 5L3DA 4IESA 4YFXF 1ZGAA 1ON2A 2FBIA 3ELNA 1ULYA 4FBFA 4U7DA 4CO8A 4IPAA 5FLHA 2H6BA 2HEOA 5ERIA 4CXFA 2F5EA 4JBAA 2HDCA 1P4AA 2H6CA 2DCTA 5K1YA 4M71A 2RV8A 2ADUA 3SHFA 3WODF 3M7GA 1W5SA 4Q0QA 4WWCA 5D4RA 1IN6A 3MQ0A 4J1WA 4P5OA 4HV5A 2XKOA 5E1WA 3CDHA 1A04A 2GH2A 2P17A 1IPKA 2AXLA 2H94A 1U3EM 3KLNA 1F4KA 1JGSA 2EA4A 3FMQA 2ATFA 2XAFA 2CSOA 3CO2A 3L2CA 1DZRA 4OU0A 2Z3YA 1NHAA 1U5TB 1XB4A 2A61A 2Q4SA 2PG4A 4UVAA 3FXUA 1YW7A 3L00A 3MPBA 3KP3A 2GXBA 1BI2A 3IBMA 2BNMA 4ESJA 4Q0UA 1XRUA 4ETSA 2CQKA 5J7MA 2JT1A 2YX7A 5E8IA 3CO6C 3FMSA 3ACLA 4LJZF 5HI0A 4Y15A 1KQ9A 2FEZA 4LLNA 2EV6A 3FHZA 2LNBA 1IAWA 4HW0A 1Q5OA 1USSA 5JI6A 1O4TA 1QXRA 2JTVA 2BBYA 1U78A 2CW0F 3IKTA 5AONA 4L9JA 3GZ5A 1KU3A 3LA3A 5LHHA 2PHLA 1LDKB 5LRSA 1J59A 5JSOA 4ORFA 4MGRA 4CICA 3BROA 5JR7B 4OLLA 1XCVA 3HRSA 3RNSA 4ENJA 1HSJA 2EJRA 3DXJF 2UWMA 4L11A 3DV8A 2HKOA 3RYRA 3V4GA 2KRFA 3K2ZA 2D5FA 3OD0A 1QY4A 3DN7A 3T8TA 1VR3A 4BIFA 3KMHA 2XRNA 4HAMA 4Q4ZF 2QVSB 1UB9A 3IL2A 3J80K 3EYYA 1FSEA 4HQEA 2WC2A 3FXRA 3CJXA 3BP8A 2D93A 3JTGA 2F5DA 2VONA 1J2XA 2QM3A 4PGHA 3H7JA 4QGMA 4A0YA 2V1DA 2VC0A 5KHIA 2HYFA 3CO7C 3IRQA 2HQNA 4KWKA 3F21A 1DGWA 4HLYA 4LFUA 4IRHA 1QBJA 4ZU7A 2VECA 1OYYA 2PAEA 3TDUC 2PHDA 4G9YA 1J3QA 1C0WA 3L7WA 5E8GA 2D2WA 1CAXB 4JK1X 4RB0A 3SXYA 4GYGA 5KK1A 2LSOA 2RNJA 4WF2A 3H8UA 4UUVA 2CAUA 4DNCA 4O6JA 4UXNA 1H1IA 3GUDA 1Z1DA 2ZMEA 2J5OA 4I0BA 1FT9A 4WX9A 2ET1A 3CLOA 1T6SA 1FP1D 2QBYB 2IA0A 1ONVA 3I71A 3J81Z 3B02A 4R8HA 1HW5A 4MTDA 1ZZ9A 2B0LA 4JV4A 4PIZA 3WE2A 4N0BA 2PQ8A 2KKOA 1O3SA 1YTYA 2XLGA 3EYIA 2YSRA 2PAKA 4XFFA 3ZMTA 1MJAA 2JZYA 2CG4A 4XEZA 3C18A 2PAMA 2UY9A 4KDPA 3REOA 4GGGA 1QQIA 4E2QA 3U11A 4YYOA 1D5VA 1XN7A 3U0ZA 1PMIA 4OMZA 4XF3A 3SQNA 3ETQA 2KJCA 1Z9CA 3SCFA 4MZUA 2QLZA 3KEOA 2B5HA 3IKVA 5FLIA 4EMSA 1ZVFA 4K8FA 1DZTA 1OMIA 3BPVA 4XF0A 1S8NA 2R3SA 2VN2A 1JE8A 3E6CC 5DD4A 4RB1A 2P6TA 4IHTA 2UXNA 1KQ8A 1G3WA 1RTVA 4I7HA 1WA4A 4M6YA 2XV4S 4CGZA 3F8NA 3HRMA 1FBUA 4BYYA 2ZBKA 1NE6A 4UXAA 3H3UA 3MEXA 4Q48A 2G9WA 4QM9A 4Z2YA 2ETEA 2QVOA 2ELHA 4XRFA 3WW4A 4EM2A 5HVQC 2OQGA 2HFHA 3VFZA 3M70A 4OIOF 3QAHA 3COAC 3L9FA 3Q9SA 2FXAA 4U0YA 4LEJA 4HBNA 1RUOA 3E6BA 4U7BA 5KHKA 4F8AA 1HKTA 2O8QA 2VT3A 5EZWA 4WXDA 1OI6A 3ROUA 3RTRA 2GU9A 3PLQA 1B9MA 1EPZA 2FBHA 3D5LA 1OPCA 3QP5A 5LEKA 3HOSA 1XGMA 4FX0A 3SXWA 2W24A 3V8JA 4Z07A 4IEOA 2DW4A 2OQRA 2VXZA 2N7GA 1OYWA 4UNOA 5FCCA 3R4KA 1H0MA 1S3JA 1FZPB 4XFGA 3HOTA 1J58A 2DU9A 1RGSA 1P4XA 3V7CA 2OA2A 4CDGA 3HTUA 2NAZA 3WU0A 3HSEA 2O1QA 4ZU4A 5BPDA 1IW7F 1XMAA 1I1GA 2MH9A 2QYOA 1ZLJA 3WGIA 4RGRA 3H7YA 3TNPB 3F6VA 4YNIA 5DUKA 1KU7A 3LAGA 1PP8F 2FSWA 4JQFA 1R1VA 3LSTA 1X7NA 5D6FA 1IN7A 5FDBA 3KP5A 3E3VA 1FPQA 5EEGA 1OYIA 1KQ0A 2GZWA 1LR5A 1YQAA 3BCWA 1S29A 4QMAA 3KP2A 5LRRA 2Q30A 1OR7A 1G3YA 3CUQC 1LKNA 1TLHB 4HF1A 3GBFA 4RAYA 3FM3A 5I8TA 4NQWA 4BQAA 1KYWA 1XE8A 3FF5A 3K1PA 3NKTA 3E97A 3DPLC 4KIBA 5CJ9A 1ZZCA 5C6CA 2A69F 3JZVA 2EFWA 3BPZA 2Y48A 5LGTA 5K5RA 3MWMA 1E2XA 1RC6A 4G94A 1BBYA 4OFGA 2RGVA 4I2OA 2QUFA 1MDMB 2Z99A 1FYKA 4UVCA 4D0PA 1RIOH 4MV2A 1EV7A 2XKPA 2E1NA 2OZUA 4MH0E 3LQQA 2KXLA 3K0LA 4WXCA 2PFWA 3KZYA 3FJSA 2EFNA 4ESBA 1YG2A 3RI4A 2AS5F 2A6HF 3H1WA 3HRTA 2QCSB 3WE3A 1MKMA 2IPQX 3BALA 3RPQA 4AVPA 1W5TA 4BHCA 2TDXA 1XMKA 2MH2A 2V09A 2MC3A 1RL3A 3WTSC 3O3KA 5A2QZ 2OYZA 2FA5A 4L2NA 4XFHA 5E1RA 1SEFA 1T0FA 5FLXK 1CF7A 3GZ6A 4ZZLA 2KIUA 3F8CA 3QU3A 5IT9K 2K4JA 2XROA 4ZYGA 3KP6A 1WI9A 4I09A 3W6JB 1WSUA 4AD9A 3DFGA 3EQLF 1SMTA 1BC8C 4KL1A 1REPC 4KIGA 4X6RB 4GCVA 1ZZ7A 1LVAA 4XF1A 2GWRA 3U1DA 1IN5A 3C7JA 4WXHA 1ODDA 3NW4A 3CUQA 2COMA 1IXCA 4U0VA 2DQLA 2BNOA 4UVBA 4HV6A 2UYAA 5FQ0A 2MA3A 1RUNA 1Z6TA 2XAHA 4IF4A 2E1CA 5F64A 3HHHA 4IETA 4LUMA 5J48A 1FOKA 3NQOA 4LLLA 4O9EA 1I6XA 4LMYA 1XE7A 1O3QA 4AWXB 1EY2A 2BYVE 2ZCWA 1U5TA 4OIQF 4QWQA 2LKPA 1YS7A 3HYIA 3SCGA 3BDDA 1YW9A 4XF9A 4ENNA 1CAVB 4RAZA 1IRGA 4PZJA 3CL1A 2O3FA 2A6EF 5JR3A 3NVCA 5BPXA 5HLGA 1ZLKA 3AAFA 4HDUA 1R00A 2V9VA 1B1BA 1IXRC 2LF8A 4YIIA 3GFIA 5BY5A 1BJAA 1R5GA 5ILUA 1CAXA 1Q43A 3OF1A 1FI2A 1AOYA 1Y3TA 4KU8A 3F72A 2L4MA 3SHRA 2Q1ZB 4I98B 4A2UA 3VHRA 2VOPA 4HLTA 1L3LA 3HUGA 5LGNA 4Q0VA 2DK5A 4HVRA 3ELKA 5D8LB 3IDCB 2V1UA 1QO0D 3L2HA 1LRHA 2R7FA 1QZZA 4IEXA 2PLYA 2HGCA 4Q5SF 1FP2A 2ESHA 2Q8KA 4A6EA 1TQIA 1CGPA 3PNAA 2IXJA 1W7PA 4IJAA 3BZ6A 5L3EA 5ILVA 3DL3A 3NEUA 3HT2A 2RN7A 1FWZA 4L18B 5AIQA 5E17F 1Y0UA 4M74A 3WTUC 3ST7A 4KUMA 4NVPA 3H9AA 4U0WA 3UKVA 5DYMA 3W6KB 2JPBA 4YIFA 1FXZA 1J5YA 1TQMA 1YUDA 2GXGA 4EJTA 1J3RA 4GULA 1TQ5A 3BU7A 3QRFF 3RDIA 2O0YA 1R5HA 3QP6A 4UHTA 1XSDA 1BI0A 3RIRA 2Z5UA 1GHCA 3WGGA 4XETA 2ZJ2A 3FHIB 4XFBA 3RJPA 3ZP5A 5FO5A 4F7ZA 4B8XA 5CVRA 4LG0A 2PBIA 2XAJA 2MLGA 3CF6E 2QJVA 3OTFA 2K27A 4HSJA 4IERA 2LF7A 3GWZA 3LQRA 1J7KA 4IEUA 4ENKA 2P7VB 5FPXA 3ES1A 3FWEA 3LA7A 4EQQA 1UHWA 4MGKE 2CWEA 1WKMA 1GVJA 1CAWA 5FD6A 3I7DA 4PJYA 3D0SA 3K1NA 1TNTA 4XF4A 2L54A 4KMFA 1Z6RA 2H09A 2PTMA 4XFIA 1YFXA 5HS7A 2IW5A 2FBKA 1FX7A 1UFMA 2PQQA 4QGNA 1MZBA 4BAYA 1GXQA 1SD6A 4KFCA 1LJ9A 1KU9A 3KP7A 2IRFG 2FU4A 3ISPA 2ZXJA 3UKNA 1OFNA 5HDGA 4X6QB 2K4BA 1H1MA 2PMHA 4EV0A 3E5XA 1MJBA 3WTWC 2X0LA 3GVAA 4JTOA 3SCHA 4LULA 2XL9A 3TO9A 1H9TA 5KVRA 2RQPA 4R79A 4B29A 4G7ZF 2RC4A 4META 1GQHA 5EFUA 2IXLA 4KNYA 2IJLA 3T8RA 3TO6A 5L3BA 3QACA 2O61A 3L09A 3GYDA 3IC7A 5HDKA 2K0GA 1K79A 2FOKA 5JAXA 2L4AA 3ES4A 2EA2A 5F6FA 1YFHA 5HLIA 3WTXC 4XLPF 4HX4A 1U12A 4E2SA 2IXIA 3FZ3A 4AIJA 1XSVA 4Q29A 2ET7A 3K69A 4HX7A 1S7AA 1ZARA 2FF4A 3GFMA 2BNNA 2IC1A 5D5WB 4L9TA 3R0AA 3TKYA 4MTEA 4P9GA 3R0JA 4XFAA 4RB2C 1YYVA 2DI3A 3F23A 5D5VB 1J9IA 3M3IA 3KP4A 4UBGA 2P8TA 4LUKA 5JVTA 5H20A 2CGPA 4HX8A 1XDSA 4ON0A 4IEVA 2E9QA 2FQ3A 5FGMA 1ZAOA 1HBXG 3R60A 4YFNF 3LAPA 2JPCA 4D7SA 3TDZC 1IN8A 4DINB 2PFBA 3CUOA 1AWCA 1XGOA 2HOEA 5I0TA 1FYMA 2H27A 1IZ1A 2CV6A 2HS5A 2IT0A 3NRVA 1TW2A 4EGZA 1S7OA 4A5NA 1ZG5A 2FQPA 1TW3A 2M45A 3J81K 1BIAA 5DDGA 2L02A 2M8EA 3DF8A 2EV0A 1OKRA 2BV6A 4AVBA 2FMYA 5BPIA 5DCFA 5JCTA 4YFKF 1EYBA 4CHUA 5F1RA 3HSRA 2QWWA 2DAOA 2EB7A 3JSPA 1ZHFA 4L5JA 4IXAA 5BUVA 1TNSA 1FSHA 4MHGA 3ZPLA 4LGWA 1HSTA 5DCMA 2CO5A 3B73A 3HRUA 1Z91A 2H0VA 4ZH4F 2DFIA 4HF0A 2D1VA 1IUYA 2IXKA 3FMRA 5I0SA 4CYDA 2L3DA 5FLXZ 4RGXA 2EAAA 1ZH5A 5BXXA 3VB2A 4Z82A 2QENA 2D1HA 2F5FA 2ZNYA 3QPTA 4HA8A 1L0OC 3E5QA 1NYWA 4EVIA 2XVCA 2HR3A 4IRIA 5IT3A 1XSXA 3R61A 1BIBA 4LD5A 2B8MA 1O3TA 3MDPA 3J7AO 5C8WA 2M87A 2A3SA 2CYYA 2P5VA 4A6DA 5ICCA 1YO5C 3F6OA 1VJ2A 2NRAC 4R1HA 4KYWA 4BNCA 4O5VA 2HZTA 4LA3A 3CLPA 3DEUA 4PDKA 3GF2A 3WGHA 1W7PB 2D40A 4LLOA 2MLKA 5I0RA 3S2WA 3F22A 5LEJA 4TLFA 1IXSB 2B9UA 3ERED 3JAMK 2QQBA 4G8XA 1IPJA 2IA1A 3I53A 5DD8A 5DCMB 2X4HA 3ZMSA 4KWJA 3BJOA 3F8MA 3WU1B 2XGXA 2ZKLA 3TGNA 4I02A 4QGLA 4MGYE 4OOIA 3G7DA 2IA2A 3T1BA 2OAZA 4K2EA 4JTNA 3EBRA 2XHKA 1SD5A 4AQ6A 1STZA 1O7LA 1LB2A 3LFKA 1L3JA 4IVNA 4LLGF 4ESFA 1YHFA 2XASA 2QZ8A 1SMYF 3GO5A 1ZRFA 1YLFA 3WTZA 1R36A 5DUIA 4EWAA 4WVZA 3CJNA 1TQPA 4Q0PA 4KMUX 3ZMVA 4MUVA 1WRJA 5KHJA 3PQKA 4M73A 2EA7A 5KBFA 1HW2A 4RGUA 2Z33A
chains in the Genus database with same CATH superfamily
4FQ4A 1OF4A 3HHGA 4OIPF 4EZ4A 2W57A 3P9CA 3ZYHA 2KJBA 1LFBA 1K6OA 2X85A 5K5QA 3AP9A 4Y5SA 4XQFA 2NZ9A 4XZPA 4GYIA 4RS8A 5FKKA 5CVJA 3JRFA 1AZDA 1H4HA 3NRUA 4MQ9F 3OOXA 2G7UA 5E20A 3EDPA 1GQPA 4ZYHA 1UMZA 2ZX1A 1IKQA 5JI9A 5A7WB 1V00A 1K78A 4KT6A 5DMYA 3B00A 3KCXA 4RFRB 2Z9OA 2C0ZA 4ZYEA 1X4PA 5A7QA 2FCUA 4BZ4A 3H1YA 4LHNA 3S6PA 1JYWA 3HPHA 5GZCA 2M30A 4AXOA 1GZCA 2O6GE 3EXUA 5DUUA 2ZFWA 1O57A 4CRQA 3D82A 4INDA 4EWDA 2B4KA 2WFPA 1RI7A 1FMD1 4P00B 2RS33 4UW5A 4V1PA 4I3PA 3P7NA 2R1DA 1UCRA 3UT0A 1ND3A 2KR2A 3TAYA 2M5WA 1V4RA 2J1VA 5I8SA 3M1EA 5GKAC 2HKXA 3T0YA 1S7EA 1DYOA 4OYUA 3DKXA 3PNVA 2WSVA 3GTGJ 4CZCA 3JREA 5LBCA 5LB6A 3ZN0A 2IS6A 3P5BA 3ZYPA 2H1LA 4BIOA 5E3LA 4FPKA 5F8PA 2GNTA 3KM5A 5D6EA 4HMZA 4KN7X 2L9VA 5FUPA 4P96A 1ZR2A 3AM2A 5I91A 1ZELA 1DP3A 2QKLB 5DTDA 3IT8A 3AXEA 5BNOB 2W85A 2WZR1 2ZEYA 3S0MA 1DU0A 1OD3A 1XC6A 1ITYA 3S2HJ 1RUI1 2Y6KA 2ZXWH 2RVAA 4XTPA 2IEKA 5LA9A 5IW0A 3S93A 1W8OA 3T4VA 3AL6A 4L0ZB 2XJUA 1D8JA 4B09A 2RAEA 1Q8OA 3PURA 3VHPA 4COUA 2OBPA 2Y0IA 1FBQA 4RA2A 4DEVA 1H2MA 5SV8A 3PUFA 1ASJ2 3UESA 1BKZA 1O5LA 5JIAA 1JTZX 1DU3D 3DEEA 4Q4Y2 3P9KA 3I9V2 2RKHA 2NS0A 3CQZJ 4QLCU 4HDVA 2E1OA 4IEPA 2KRCA 2BEOA 3BG6A 1SDDB 3WX5A 2ZMEC 3EQEA 2BW3B 5HLTA 3CQOA 3OOPA 2F4OB 2JA5J 3W2WA 1DDNA 4RM3A 5FY4A 1OQEA 1AL21 1OFCX 4A0ZA 1YHQI 3GTPJ 1PX4A 1PUEE 1RNLA 4FP3A 1E3PA 1R4NB 5T55A 4UF0B 3HL2A 1YJWI 1S0BA 5E1XA 3F3XA 4N53B 2NXNB 2CDOA 1P7IA 1QVTA 1POV1 3RWNA 2OU2A 1XPWA 1RHI1 1QZYA 5IATA 1NCRC 4Y13A 2JUGA 1P4WA 1GZTA 3OBZA 5CYYA 4QDQA 4UFLA 4XTMA 3A1YA 5A3LA 2ZTNA 3INAA 4RMNA 2RG4A 3HQXA 4IL7A 1GLNA 3A4UA 3T1LA 4MIMA 4BY7J 3DPUA 1MS5A 1OLMA 5FYYA 3P3PA 4KISA 2WN3A 1UOBA 1SFPA 3TOBA 1IUFA 1REFA 4E4ZA 2VOOA 1C8M2 1BI3A 3ZMOA 3WHTA 3I2JA 3WDXA 5JOYA 1IDZA 1I27A 3ZQQA 5AFEA 3H50A 2CV1A 5J4VA 1QOSA 5IFTA 2BY0A 1JN2P 4S2FA 2V6CA 2VW2A 2E36A 4Q47A 4WZFA 2VPRA 1D2QA 2E19A 3LSRA 3I59A 3FHAA 1WW4A 3MFKA 5H6RA 4EJWA 3Q9OA 5HXMA 3IDAA 3SEPA 3ZFFC 3KIOA 5JHFA 4Y24A 1X8MA 2IXHA 3LEIA 2Y0MA 2DPDA 3I0TA 3FX3A 2J5PA 2VMFA 2A68F 3AZZA 4XJAA 3LCPA 4PI2A 1MW7A 5DUWA 2EK5A 5A6XA 3EJKA 1C1LA 2Z69A 3SZTA 5EJZB 4LK1F 2BERA 1XC5A 2PYTA 3BWGA 2ZGMA 2DQRA 2BVLA 1KITA 3UNGC 4HLXA 2ID3A 2QQOA 5A7WA 2YPRA 2C9AA 2LY9A 3THTA 4CVUA 3AYEA 4I30A 4E9KA 2FMLA 2KDOA 3WQ7A 4HN0A 1XB9A 5FPZA 2KPMA 1LEBA 2DT5A 3H9QA 2VZUA 5D8KB 1JKRC 3HD8B 2NP0A 4NRPA 1SQ4A 1BVVA 1AU7A 3WG9A 2RS31 1W04A 3EO6A 5CEHA 3FHNA 2EZIA 2JB8A 4HG6B 4LG0B 1ENSA 4LB6B 5FLJA 2XAQA 2OPWA 3NQHA 3GM8A 3MW3A 2HZDA 1DCSA 1ND3B 2VIXA 2EWNA 4A3BJ 1LDJA 1A3KA 1ZNPA 1VQMI 1H2KA 3LAJA 3CDLA 2PJPA 1O8PA 3L9JT 4R9AA 2QGUA 3G1OA 3G73A 3DEWA 3CCLI 2XUBA 2R7DA 2GBYA 1HQNA 2MEV1 1ETXA 1MJ9A 3O1TA 3N4MA 2YU3A 1DP7P 1EUUA 3AMPA 3FLRA 5L19A 4AWDA 1DGLA 3ASIA 2VUCA 3NNMA 1D7PM 3QOPA 3T30A 1EH7A 3IIAA 3SZPA 2RV9A 2K5CA 1RUE3 4EQVA 1EV13 1ZREA 1HB1A 4YRDA 3QODA 4WVMB 3ON7A 5JSPA 4AQ2A 4OHWA 5DZFA 2ZXHA 1DUXC 4KT5C 4ATFA 3TW7A 5JPMB 1QGPA 4IEYA 4Q26A 3JR9A 3VSLA 1P6RA 3A0NA 5J1UA 3T2OA 4CEYC 3W6VA 2DVGA 5IVYA 1MZ5A 2R5ZA 4BGDA 2LRDA 2CQQA 3CUQB 4OZXA 2ZABA 1WCKA 4F52A 3UGHA 3TEWA 3QWLA 2UWAA 1KJRA 3WCRA 2HWE3 2WZ8A 3AKPA 3V8KA 5FYBA 4EM0B 3MIHA 1W2UA 3TMOA 3USUA 1ENHA 4XRMA 1TME3 2HWE2 4P55A 3U9GA 4MFDA 3TOAA 5A33B 5FKMA 1RJ7A 4I3GA 3OBTA 5FZEA 1T39A 3LA2A 1RUF3 5CB7A 1DLCA 1BN5A 3DP7A 1UU6A 1K7AA 1H8TA 2H1KA 2Z4FA 4HL0A 1V6MA 4S2HA 1U5TC 2W5FA 2JQ7A 5FKBA 3ZYBA 1ULFA 1WW7A 3MZYA 2R49A 4JZRA 5F0FA 2ZACA 4ASNA 4CUCA 1F5TA 4UFHA 1FJLA 1VF9A 1X4OA 2RM22 4L0PA 1SZBA 3ABUA 2MNGA 3M8LA 1HW1A 2XAUA 2DYRH 1YEWA 4FT8A 4PGGA 5BOXA 2P7CB 4Y7NJ 2ADEA 2VJJA 3U37A 4YVSA 3OYCA 4XBFA 5GAGJ 2F4IA 3CKHA 3D5SC 1GYKA 2R7VA 1X3UA 3GW2A 4ONUA 3CNAA 4NBQA 3KV4A 5JHUA 1O4XA 3BR3A 2W25A 5FFXA 1GXPA 4KU7A 4YVWB 4CCNA 5LASA 2ZSIB 1CPNA 1LAJA 5L3CA 2OA4A 3VYRB 4N53A 1WJ5A 3V7SA 4X8NA 2CFXA 3VYSB 3I5UA 4FPLA 3ILFA 5LGUA 2VCBA 5FMOS 1XNAA 2CAVA 1RUC2 3WTYC 3U2RA 4GB33 1QNTA 2J1TA 4CDWB 4DRRA 4E70A 2RR11 2RM21 4MQVA 4W4ZA 1D8KA 4LB5A 3GTMJ 3KLOA 2W84A 4BE1A 2A5ZA 1US2A 4IDZA 5CLSA 1S2BA 2HOAA 2BXYA 1H4GA 1TMF2 2XF6A 4KQ7A 1KDMA 4QX1A 2HJIA 5LK5A 1P2FA 4BXSV 1JHJA 1FNYA 2P3YA 3K51A 3CTAA 1Y8RB 1PK6B 1UYPA 1W2NA 4DMIA 1XD7A 5JLVA 3RMYA 2YR2A 1ULDA 2C1FA 4GH4C 1PIV2 5J1XA 2VNRA 3OY8B 3FXOA 4QX2A 1B6AA 1ZG1A 5FY5A 4BHPA 2EQRA 3GEZA 2RS11 2LY2A 3ZKUA 4OI4A 5E1ZB 1QJEA 2LC2A 1EH6A 4XXAA 2YX4A 3WT3A 3KZZA 2CV0A 2W3JA 1K12A 1J0RA 4E2GA 4HSTA 2VQLA 3MZHA 4Z1VA 1Q8SA 2YXSA 2ZHLA 1LGNA 1OA2A 1MNEA 2AEZA 3GZAA 2GDFA 2EVXA 3FKIJ 2PJRA 2MD5A 1F9KA 3TP3A 2CMPA 4AHXA 4W65A 1WA6X 3S7EA 1T56A 3IWZA 1W8WA 1I5ZA 4K1ZA 2PMZN 1REEA 1UZZA 1VIWB 4PJJA 5F2WA 2ZXIA 4P9FA 2VXRA 1MMNA 3FUQA 2A7AA 2QQIA 3DKYA 1AL22 5HS8A 1UKRA 3T2PA 1EH8A 1IDYA 4JVAA 3SFZA 1VI0A 1CAUB 3JAMZ 4COZA 3BCAA 1WJCA 5D8AA 5TSWA 5M0TA 1BZWA 4HKWA 2FBIA 2E1MB 3ELNA 2DMTA 4CDXA 2DA3A 4CXFA 5FO9B 2F5EA 3Q3SA 2HDCA 1PGL1 3AKSA 2DTWA 5K1YA 1CIWA 4M71A 4GJYA 3H8RA 2RV8A 4NIGA 3M7GA 3BTCA 4WWCA 2IGMA 1IG3A 3LSKA 1IN6A 2DMQA 4J1WA 2E53A 3B5LB 3RZOJ 1YRNA 1TME2 4G3YC 2AH2A 1UAAA 5FP4A 5F08A 5GP9A 2D98A 4LBOA 1RUC3 5BNOC 1MMGA 3KQ4B 3BTZA 2D6MA 3DCFA 3BT9A 4BE2A 1PX3A 1ETWA 5K0UC 3KP3A 1QPIA 2R7QA 2GXBA 1NTCA 2QQVA 3LL7A 3IBMA 4Q0UA 1V9U1 2BDRA 2YX7A 3CO6C 2JG8B 1FOWA 3ACLA 1AR93 5HI0A 2ZJQF 4RR3B 2FEZA 4LLNA 2EV6A 4FPGA 1MEC2 4M3CA 3POWA 1IJWC 4FPJA 3HNBM 1IAWA 1XU2A 1QXRA 2K9NA 3HNMA 1R083 2D6NA 5AONA 4L9JA 3GZ5A 1DF0A 2QQUA 1V5FA 3OYWB 2YC2A 1HV0A 5F3CA 4OI0A 4PDWC 1SVMA 3O8HA 5FJ8J 4BY1J 3BROA 1AJOA 1FOD1 4ENJA 3RJ2X 2EJRA 2PHWA 5HV0A 4AU7A 1K6YA 2UWMA 3DV8A 1OCRH 2HEYF 3K2ZA 4J25A 1V54H 3OYMA 1ULCA 3LSIA 1QY4A 2Y6GA 5FRNA 1VR3A 4XLEA 2WAQN 4BIFA 4HAMA 2QVSB 4Q4ZF 4PQQA 2BTVC 2FDHA 3FXRA 2IVJA 3BP8A 1JZ5A 4UFJA 1NCRB 1AXYA 1EPWA 3UGGA 1J2XA 4NRQA 4PGHA 2W68A 2ZX4A 1D1BA 4KG8A 4Q1RA 2W2IA 2ILMA 2OUHA 4N8MA 3B9IA 3CO7C 4UFIA 2KM2A 4AUXA 4HLYA 1W0TA 2QSFX 4YW2A 4JGYB 1FTZA 2PAEA 3NAPC 3IP4B 1A8MA 2WRAA 2G4IA 1BW6A 1C0WA 4IQPA 2D2WA 1GP6A 2JE7A 4PF5A 4GYGA 3ZXGA 4PQ9A 4ITCA 3ACHA 4QPIA 4UUVA 3N9LA 4HKOA 1LTEA 4N43C 3HUGB 5IYBJ 2KMUA 1FT9A 2JDHA 3CLOA 4YVSB 1FP1D 3ETPA 2IA0A 1A8DA 4KMQA 3UV9A 3B02A 1NAEA 2VMHA 4LXLA 5IP6A 2B0LA 2LALA 4IOCF 3DU5A 3JD71 2AO9A 3WE2A 4N0BA 5FIXA 3I2DA 1YTYA 2WN2A 4AYBA 3HXLA 2L0KA 4XFFA 1M1EB 2VR4A 1Y0NA 5K9YA 2XONA 3C18A 1PGW2 2Q8DA 1TWHJ 1ASJ1 4LT5A 4GGGA 1QQIA 4AI2A 4EYUA 1JZ6A 2XGDA 3VYTB 1D5VA 3PL0A 4D3WA 2B9VA 3SKVA 4OMZA 2WNVC 2DVFA 3WP5A 2B5HA 3KEOA 2LYCA 4IHYA 3M3CA 3RZHA 4EMSA 1MS8A 2W52A 2VCCA 4F83A 4Q4X3 3MLLA 3I4IA 2JG9C 1K4SA 1OMIA 3HBKA 2TEPA 3DPRA 5LBBA 4FOVA 3H36A 4RB1A 4IHTA 1W6NB 4LNVA 1RTVA 3LOBA 4I7HA 4ITVA 3NNLA 1O8SA 4M6YA 3KVBA 1BW5A 2M8GX 2KFDA 3F8NA 1FBUA 5DPNA 3N7JA 2VVEA 1QHHD 2KP6A 1OR7C 1FV3A 2XH6A 3WW4A 2XWBB 5HVQC 2OQGA 3WZ1A 4E7LA 3T0DA 1XYPA 3BR5A 1KZHA 4NIHA 2WAAA 3TEDA 4OIOF 4Q4W2 3COAC 1IG0A 1ND3C 4LEJA 3SJMA 1W05A 4LBKA 5EZWA 4WXDA 4YG0A 2UURA 3OIPA 1RMU1 1BXHA 4NR1A 5L9VA 3D5LA 1OPCA 3THDA 1E5HA 3QP5A 4BQOA 1VLNA 2NLRA 2KLOA 2D43A 1GZWA 1VRH1 4CDUC 1DYKA 3SXWA 3V8JA 2OQRA 2VXZA 4CCOA 3HB9A 1K4TA 5EGOB 1OJLA 4Q27A 4HONA 1OYWA 4UNOA 1H0MA 2X1DA 1FZPB 4EZHA 3HOTA 5IVFA 2ZB9A 2AZ5A 4NO4A 2DU9A 1RHI2 1BK0A 1YRZA 4Q4Y3 1GVDA 2O1QA 2GN3A 4ZU4A 1IW7F 4CEWB 3WGIA 1CX1A 4ISRA 4CU8A 3F6VA 4YNIA 1T8IA 4RHV3 1SC7A 5D6FA 2MEV2 3E3VA 1KQ0A 2FX0A 2WJSA 2ORZA 1VQ9I 4XURA 1X2MA 4OQ9A 1JXNA 5LRRA 2Q30A 1JYXA 1LKXA 1AX2A 1TLHB 4CP9B 1NH3A 2GH8A 4HF1A 3GBFA 3FM3A 4EN7B 4CYCA 2XJSA 2V9PA 1NY72 3HBZA 3LEKA 1KYWA 4OCTA 2FDKA 3H5AA 3NKTA 3E97A 4KIBA 5CJ9A 2HBTA 5K4LA 3E1SA 2A69F 3FIWA 4CSWA 2EFWA 1OPOA 4H2AA 5LGTA 2A3XA 4BE3A 3MWMA 1RC6A 2JSPA 5J1RA 2PHFA 3AK0A 1YQCA 2CUFA 1X33A 1MDMB 4IZZA 1NZIA 3KB5A 2X1EA 2CL2A 1X58A 1D0HA 2E1NA 4E7HA 4MH0E 1PO21 1E57A 4BJTA 2PFWA 3KZYA 3FJSA 3JRAA 2EFNA 2WNUB 3RI4A 2A6HF 3HRTA 2QCSB 1RC9A 1MNDA 4BU2A 3WE3A 1OBNA 1MKMA 5CFCB 2W46A 3RPQA 4AVPA 4BHCA 2V09A 5IHRA 4CCLA 2FA5A 4RR3A 1WJDA 2LW8A 4ES8A 3IV5A 1T08B 1T0FA 3K4CA 2CGOA 4ZZLA 3HN1A 2HWB3 2D44A 3QU3A 1HF0A 2M7BA 2XROA 2NVUB 4BBSJ 1RKWA 4Z2AA 1RUG2 4D94A 1WI9A 4NC6A 3WLUA 1WSUA 2VUAA 1MMAA 2E26A 4GWNA 3EQLF 1BMV2 3AYAA 3J7MA 1RUE2 4BJ6C 2M7AA 1DLLA 3PHMA 1JJ6C 3C7JA 1VAMA 1CIYA 3GMEA 4K6BA 5FZ9A 1JMUB 3W3CA 4YG3A 4M01A 2W0XA 3SISA 3ZFFA 1IXCA 4JQRA 2BNOA 3D6EA 2LTNA 4HV6A 1QJU1 4W6YA 1UNBA 5FQ0A 1URXA 2XXZA 1UOFA 2LBFB 1LHUA 1VB4A 5F64A 4NPRA 1RINA 4E7ZA 4OHYA 4O9EA 1TZLA 5K7ZA 2YYOA 1O3QA 3RQIA 4B44A 4OIQF 4QWQA 1DGRN 4DQAA 4XF9A 2X51A 1AL0G 3BOPA 2V26A 4RAZA 1IRGA 3AG3H 4A7KA 2O3FA 1KS4A 4PHZA 3BC8A 5HLGA 5JZGB 1IC8A 2E7AA 3AAFA 4Q4V1 1TWAJ 1B1BA 4XQWA 1BJAA 5FY8A 1HKDA 5FZLA 2BY2A 3OF1A 3KVAA 1D1AA 3K4AA 5A7PA 2X6YA 4JKLA 3F72A 3WNMA 3WSOA 3OYWA 4A2UA 1C8M1 1R4MB 5EF6A 4Q0VA 2ZEWA 2WT1A 3RG0A 1GOGA 4BKXA 4E7IA 3ELKA 2W87A 3L2HA 2DTZA 3BZCA 2MGQA 3Q8BA 3FN9A 1QZZA 1XNKA 4Q5SF 5GALA 2Q8KA 5E6HA 2JE9A 4A6EA 4DXRA 1TQIA 5L9RA 3CESA 2EIEA 1N1YA 3GBWA 5C71A 1W7PA 2QKDA 5FMCA 4FOQA 3OUHA 4BQNA 2EIJH 1YX5A 3ZFEC 3HOZJ 2RN7A 1FWZA 3MIGA 1DIWA 1GWKA 2B45X 3F0CA 2JDKA 2ZGSA 3C2GA 4IEJA 2ZX3A 2VQ0A 3VBUB 3WTUC 3ST7A 4BQQA 4NVPA 2EIDA 4U0WA 3UKVA 2R7EB 4LKDA 1FXZA 1J5YA 4EJTA 3H0GJ 1TQ5A 3BU7A 2VQUA 3QRFF 3RDIA 2BOJA 3PIGA 2Z5UA 1GHCA 1G7YA 5KC6A 2ZJ2A 4FFFA 3HPNA 3BPSA 3RI9A 2QJVA 5KC5A 1X19A 3IPVA 5C44J 1RUD3 2P6CA 1ODNA 1TE1B 3PSFA 4NIDA 1UWWA 3ES1A 1R1A3 2LTPA 1UZYA 1UHWA 1WKMA 1GVJA 3I7DA 2DFHA 2E71A 1TNTA 4D7NA 4XF4A 1FTTA 4KWUA 2PTMA 4KMFA 1CESA 3Q0VA 1YFXA 2FBKA 9ANTA 2EZKA 3MZ8A 3ZFGA 4KFCA 1LJ9A 4PLNA 3KP7A 2IRFG 1QJU2 1UOJA 5HDGA 4ARXA 3NJXA 1MJBA 1LULA 2NOGA 3PUHA 3WTWC 3SCHA 4LULA 1MZFA 1H9TA 1R092 2RQPA 2QQWA 4B29A 1H88C 4META 1V5EA 3BR0A 5AFBA 4KNYA 4ARYA 2GNDA 2IJLA 2YC0A 2FCVA 2RS51 3TO6A 1KXGA 1J83A 3VBFC 2JA6J 5K0UB 3Q8EA 4LK6A 5JDBA 2FOKA 5JAXA 2L4AA 4M3DA 4BE0A 3M07A 5F6FA 2R041 3MIDA 1DZQA 3OEBA 1RESA 4XLPF 3H8XA 3H3LA 2IXIA 2B7EA 1PIV3 3FZ3A 4AIJA 3NAUA 3LSGA 3FUOA 4BEHB 2XJPA 5FK7A 2ET7A 1H8TC 1N1SA 3K69A 1IQDC 1W6NA 2FF4A 3GFMA 2JKBA 3FL7A 2BNNA 2XB6C 2IC1A 5D5WB 4L9TA 2RHPA 1AF9A 4R4ZA 3R0JA 3O8GA 1YQ5A 5D5VB 3L2WA 4X8PA 3MHZA 1RVF2 5JVTA 4NHKA 2VNGA 2V1NA 4AHWA 2VH9A 4XN3A 5L73A 3LAPA 2JPCA 4D7SA 2VJIA 4DINB 2PFBA 1B72A 4C2TA 1FYMA 2H27A 2K85A 1JKQC 1FAYA 1V0AA 2IS2A 4D7YA 5F6KA 3RGBA 4EGZA 2FQPA 3EB7A 3MF9A 2EV0A 1OKRA 3OG2A 2VKEA 2HYXA 1CWPA 3ILNA 3CDZB 1MBJA 4CHUA 2VOWA 3HSRA 4XKVA 1QHDA 2W7NA 1LHWA 1JUMA 1S0DA 3BN6A 2QWWA 3ZR5A 3MKZA 1NLQA 4IXAA 5BUVA 1TNSA 1MS1A 2HQAA 2OCCH 3KX2A 4RAGA 1NCQC 1HSTA 1KRIA 1X2NA 5KXBA 2ZGRA 1Z91A 1U0AA 4HF0A 3QOEA 1Z7S3 4FSJA 5CBLA 1ULPA 5FP3A 2IXKA 5BNPB 2DA5A 2VNVA 1BK1A 5IVBA 2WYSA 4EEFG 1JU4A 3VB2A 5DUVA 2D1HA 3WCSA 5ACA3 2ZNYA 5DUXA 4HA8A 4Y1XA 2P34A 2M0CA 4EVIA 2XVCA 4IRIA 3IDEA 2G9GA 1C28A 2B8MA 1O3TA 1OQ1A 4JGZA 4CPBA 2O7OA 3O0XA 1PO11 1HRI1 4GALA 2HWD2 4ASKA 1QJY1 2X48A 1E5IA 5FBZA 3F6OA 1W99A 2EXHA 2RQQA 1VJ2A 5FYHA 2Z5WA 3VBRB 1VBD1 1VMHA 4O5VA 2GMMA 4LA3A 5FK8A 4L5EA 3WGHA 1W7PB 5LBEA 5EDNA 3FDYA 5K7PA 1RUG3 2HWD1 2J1UA 1S4CA 2HU9A 3CMEI 2W9XA 4TLFA 1I5PA 2LKSA 4D6RA 1VQ8I 3BTXA 5E89A 5DD8A 2D97A 1X1BA 5HCAA 2ME6A 3F8MA 3WU1B 2XGXA 4EATA 1GR3A 4LPLA 4MGYE 1WMFA 1JZ7A 3G7DA 3KT1A 3W21A 2XHKA 4D69A 4UWDA 1W0NA 4FFIA 3LFKA 1L3JA 4IVNA 4ESFA 2XASA 3M4FA 4HPKA 3GO5A 1UL9A 1OLTA 1R36A 4EWAA 2LOOA 5EV7A 2OTJI 1TQPA 2LD5A 3ZMVA 3GCMA 3TBDA 3U75A 4ZONA 4M73A 3B6CA 1GU3A 2D6LX 3N9NA 5KBFA 3WG1A 3H8OA 3KLSA 1VE0A 3N35A 1TWCJ 1D0YA 1SFUA 3ULQB 1SFEA 2WV1A 4NMIA 2UY8A 3C7OA 1LGCA 3SEEA 1X1PA 2ZNZA 2XBO3 3BTJA 2KIMA 2BBVA 1YLLA 1AR81 4XXPA 2E7XA 4EM1A 3S3NA 3QU6A 2KA3A 1TWGJ 2VY0A 3IDBB 3VWBA 3I54A 4ZYAA 3L2VA 2VTFA 4AVAA 3CMGA 5JMCA 1O5UA 4JX6A 1CAVA 2ZX2A 1VRH3 5KNLA 3B6AA 3N9PA 4UW4A 2VLAA 4RHV1 5JFRA 3JSOA 1WPKA 3F2ZA 5TRDA 3S1MJ 1GNYA 2VULA 3BR2A 1ETQA 4KBBA 1FPN2 4FASD 3MI8A 1LJ7A 3ZDVA 3FXQA 1S5LC 4FOYA 5HS9A 1HXS2 2VMDA 3EHKA 3MFAA 4WM8C 3JTHA 3HEIA 1HIXA 1BR1A 4EJUA 4AIDA 2B9SA 2HTSA 2JD9A 4U87A 3M9AA 1Y56A 2Q8OA 1O7FA 3KEQA 5L36A 5A1LA 1YRNB 4DNYA 4K20A 4ZXEA 2G1MA 2RS12 2KZGA 2ZS6B 4LA2A 4JHZA 5JWPA 1PZ7A 1W03A 3BTYA 1VBC2 2EIBA 4G7OF 4OMCA 3ZMDA 5EYXA 3IAM2 5A3PA 3TB0A 1NCRA 4X0GA 1XE0A 1GQGA 1E17A 3HOVJ 2YBPA 3JRCA 2VI6A 5ICFA 3OUIA 2JRTA 3J4UH 2XIGA 3NV3A 1TMF1 2BJSA 1ZX5A 3E1F1 3CIHA 2F4MB 3A0BC 4IL6C 1OLRA 3CCQI 2J7MA 2FHRA 1BI1A 3OUJA 5C3PA 4IE0A 4OINF 1X9PA 2BGCA 1IRZA 2HWVA 4CU6A 2CUEA 5HLHA 3RYPA 4A3GJ 3OBAA 4PIYA 1ZG3A 4Q4W3 5A7NA 3K1MA 2COBA 4P5HA 3RKYA 4NJ4A 4XILA 4BQ5A 2L01A 5KXEA 1SPPA 3K6GA 2BPA2 1VP6A 3VKNA 1W8TA 5F5QA 4OHVA 3ZDSA 4Z92B 4AIKA 5J8CA 3RQ0A 4YSFA 5FY0A 2OS2A 3DKWA 3D0JA 4A0XA 5JXGA 3ZN1A 2FNAA 3E6MA 2JECA 1Y1WJ 1PM7A 2Y6HA 5T52A 2JE8A 1C57A 1GT0C 3WEZA 2R061 5KHGA 1ZRIA 1ZN2A 1HDKA 1JTXA 1YJ9I 5ICGA 2K7LA 3P9IA 4UV9A 4LORA 3FE5A 2JVGA 5CVVA 4CXWA 3HR9A 1EA3A 1SBDA 3CBNA 4N90A 1MQTA 2DU0A 4AFMA 3Q0WA 1JKOC 1O4YA 2YB7A 3C1DA 3ZQ7A 1GOFA 1JBCA 3GZEA 1DG6A 2VCMA 3MYXA 5GAHJ 4KWLA 3NNFA 5E3OA 4QPIB 1RUH3 2ZGLA 2BZTA 4P9UA 4JKMA 5IUQA 2BU9A 5EYYA 2DK8A 4E7SA 1W8ZA 4N9HA 4YGBA 2QBYA 4P14A 4KICA 3KZ4C 2QCOA 3HQRA 2DF7A 4EE2A 1Q8QA 4HK8A 3ZQHA 4W1UA 2YMZA 5E16A 4CDQA 1SFXA 4QXKA 3SITA 3LOIA 1BCXA 1DQ5A 2WAEA 5K7HA 1HXS3 3FXLA 4QX0A 1LDDA 5A2QK 3TQNA 5HXVA 4E8DA 1R1TA 2EBIA 4OIRF 3AFGA 4C0BA 5A6QA 2BY3A 2W48A 3ZXLA 4LK0F 2VE9A 2E51A 3MEPA 1ETKA 3C3WA 1ZR4A 3CC2I 1N78A 1MVQA 4QPGB 5F27A 4QAWA 3DTEA 2Q0AA 3LZZA 3IUOA 5IVJA 3GFJA 2E5NA 3PQJA 1ZYRF 2W1UA 3VKLA 2TUNA 5IK8A 3VBUC 3PO2J 1KD7A 2RMU2 3V42A 2DVBA 1S2KA 5GPCA 5KHDA 3JCUC 3CC7I 3L2RA 3VBSB 3WU2C 3KHBA 3IH3A 2GQQA 4XJ8A 4CDUA 2IFWA 2P4WA 2BGOA 1ZBE2 1Y8QB 2R16A 4MXVA 1LE8B 2JDPA 1EUTA 4RS5B 2NYXA 1UX7A 3D3AA 4H0EA 1ULOA 4R9BA 4F3JA 1VQOI 3NSTA 1BMV1 5D5UB 3O2PE 5DAXA 1VQNI 2XQXA 2CGNA 3IWFA 1N3QA 4BOWA 1CONA 2F17A 3RKQA 4AHZA 2XF5A 2YU1A 4GD4A 4F93B 3KHCA 1SG3A 5E8AA 2XJQA 3BJAA 2HWF2 2VBWA 2OF7A 1V6OA 1RZ4A 3G4SI 2Y75A 4M9XA 1SDWA 4URAA 1T95A 5FB2A 1HRV2 4AVTA 2XVGA 1RHI3 2G7HA 4EN9B 3GLXA 3BR6A 1H2LA 5JXJA 2V79A 2X53S 4TXWA 3C8XA 2XJTA 2ZGQA 4GKYA 4RM2A 2STWA 2JX9A 2R1BA 1B59A 1XGNA 1R23A 4XLCA 4A3KJ 3W9AA 4C0HA 2E7TA 4DQ2A 1R58A 2V9KA 5ILSA 2WTEA 2OQ6A 1GNZA 1NK2P 2H8RA 4Y1ZA 1EP0A 1EJ9A 1P92A 4A93J 3VDAA 3CCJI 2HWC1 4R4XA 3VEPA 2ZGPA 1N77A 1JZ8A 2Q8EA 2GLOA 3VKFC 3A0KA 2RJLA 4M3CE 3V64A 2VJ4A 4DRVA 1W28A 3KF3A 1IRFA 1NUKA 1XSQA 5I0UA 2HXIA 1G9AA 5J98B 4QKDA 2Y34A 5FP7A 4CA9A 3H3ZA 3U1XA 1HCRA 1YX3A 4IHXA 1T0FC 4HPKB 3WQBA 3ZN5A 4ANJA 1K5MA 2MD0A 3SFIA 2JDAA 4BQWA 2ZMEB 2JWTA 1B09A 3F9KA 2VBXA 2WZR3 4JOMA 4HPQA 4KA4A 2D45A 1K42A 5B3SH 4PCRA 2ICWG 4BXUA 3U14A 3Q9VA 1NE4A 2M0MA 2ZKZA 1XTAA 4C1WA 1WMEA 2X6OA 2PHTA 4C8DA 3M3EA 1WGPA 4N53C 4BJ0A 3OYNA 5DEQA 3JBG2 4WZCA 5J3UA 1VRH2 1HV1A 1T2KA 2VW1A 1H89C 2W92A 3JRGA 3BCBA 1OOPC 4IHVA 2VAUA 4LBQD 4R52A 1PYVA 3H92A 5IT6A 5A7SA 4N4NB 2R072 1YO8A 4I99C 5TJJA 5E18F 1U9OA 1LOCA 3AKTA 4A69C 1IPSA 3MFCA 1ZGJA 1GANA 4CUBA 1Q3EA 5F5AA 2XB5A 3AC0A 3S17J 2Q0OA 2HEVF 3FXKA 3CCVI 2K2SA 4ZU5A 2L7ZA 1UCXA 1Q1HA 5DDJ1 1AR73 4DXSA 4IXLA 3VKOA 4IEZA 3AKQA 1MS9A 4QDSA 2FDFA 4CCJA 4WBBA 1MBKA 1RVF1 2VVDA 3O5SA 2DO7A 1LCLA 3WDUA 1XS9A 4GH4A 4B8EA 3KYDB 5IVEA 2RM23 3C3VA 4CZSA 4LBLA 1OH4A 1MD0A 2OZ6A 2RVCA 3I4PA 2F4PA 1XGSA 3IHUA 1L7QA 2PA7A 5M3FJ 4B7KA 1CJPA 4OZOA 2ZGUA 4W8JA 2QF7A 3KFWX 2BY1A 1T6BX 3B94A 2D6KA 3HBLA 3VDDC 2Y60A 2IFRA 4DXTA 2VQAA 4Q4Y1 3M4OJ 2VZRA 1R1UA 1H6XA 4D8MA 4XFCA 3R4UA 3OYBA 1UU5A 4OUEA 1PUFA 3U78A 2HQRA 1OLQA 2XPJA 2QBXA 3X2QH 1V3FA 1UW8A 4LITA 4LBMA 3ZFEA 1JHHA 2XF7A 1H2NA 2PN6A 4IGQA 2E31A 3JD72 4A6SA 1JOBA 4D7TA 2R5YA 1Z7LA 4GXOA 3WV6A 4L9NA 2WZPP 1E3HA 3JRIA 4XABA 5D8AC 5CYVA 2D5HA 2WBKA 1QGLA 2F2EA 4MOAA 4YW6A 3CCMI 2ORXA 5HCBA 2UU8A 4CDXC 2Q1FA 3K7AJ 5F3EA 2HWE1 4JYKA 2NOJB 4J19A 1WLTA 4EROA 1CQTA 4A41A 2XLFA 4XM3A 1AR62 1DQ2A 4XOPA 2YFUA 1IF1A 2VMGA 4V2FA 1R093 5FD5A 1BOAA 1LESA 5A1AA 1O59A 1R49A 2A07F 1JXSA 1W5CC 1KA8A 1X8EA 2RMU3 4B3NA 2KIFA 4QX8A 2E7QA 2HH9A 4EN6B 3GGLA 4A3IJ 2VBDA 2R7TA 5KR7A 2WA4A 4XRSA 4Q4X1 3ABTA 1WQ2A 2YPDA 4MEYF 5JSRA 2M4GA 4RQPB 3GTLJ 1OD5A 3DTIA 2XHNA 3KSCA 4K3UA 4GWMA 2ZXQA 2DA6A 1F2NA 2FQ4A 1V70A 1SD4A 5GADJ 3VBHB 1EV11 3BQZA 1TTYA 2HQ5A 1IN4A 1FC3A 3AKZA 1ZQ3P 4MGIE 3LWFA 4FI9A 3VB9A 4MNUA 3ENRA 3FK7A 1HKSA 5J6XA 5CQEA 2LP0A 4YM2A 5L3DA 2XUEA 2A70A 3BGAA 1Y9MA 1IO2A 1MEC1 1AVBA 4FBFA 4QKBA 1CD3G 3NNGA 2XRLA 2H6BA 5ERIA 2CV2A 1WFXA 4FE4A 4KNCA 4A3MJ 3I55I 1DQ6A 1IS3A 1G9FA 4AI1A 4CA0A 4P5OA 4HV5A 2PHXA 5E1WA 2GNMA 2B7YA 5IYDJ 3S14J 5DQ0A 2WO7A 2ZEXA 1IPKA 2L7MP 2AXLA 5H9QA 2H94A 1U3EM 3KLNA 5IYYA 2ATFA 3DU6A 5GPAA 1F36A 2CSOA 3URFA 2Y30A 4OU0A 2Z3YA 3VBSA 3S1NJ 1U5TB 1UY0A 3L00A 4AFDA 2V4JC 4CDUB 3MPBA 2JA8J 3NAPA 5T50A 1GSLA 2BNMA 5D21A 1POGA 4ZDPA 4Q8KA 5E8IA 4XYXA 2PELA 3MO4A 3G2BA 2QQ8A 4OMDA 4OAYA 2A71A 2E5ZA 4CP2A 3PJQA 1Q5OA 5JI6A 2CDPA 2JTVA 2FD5A 2R7RA 2ES3A 2CY6A 3ZSJA 3HZJA 3D5RC 3LA3A 1KU3A 1WH5A 3M3OA 3BU0A 2V73A 1SHWB 1FOD3 3OWTA 1QJFA 4CICA 1JHNA 5JR7B 3VZKA 4OLLA 2WO2A 2FDJA 3HRSA 1BYHA 1W0OA 3DXJF 4L11A 3V4GA 5HODA 2ARBA 3JB4C 3OD0A 5JXIA 4AI9A 4RAFA 5EG0B 3DN7A 5FZ4A 5C3RA 4JGZC 2OVUA 4AGGA 3NMBA 4IV1B 3J80K 2BW3A 1FSEA 1IS4A 1VNDA 5FYSA 2D93A 3JTGA 4JP0A 3MUZ1 4GWIA 2NYYA 1ZTRA 2QM3A 3VD9A 1F8VA 4QGMA 4A0YA 1LECA 2P3IA 3LSDA 1OT5A 1AXKA 3FBYA 4XE9A 4MGTA 2HYFA 2JIJA 5FMOL 2JG8A 4AVSA 2LY1A 2X09A 3O1MA 4KGQA 5DG2A 5GM0A 4ZU7A 3RSNA 1MMDA 5T5JA 2B46X 5E3NA 4G9YA 3HJEA 1J3QA 1PK6C 3M2MA 4QU1A 1CAXB 5GZGA 4RB0A 3BG9A 2I5UA 3I49A 4ZHNA 4BLIA 5KK1A 2RNJA 4Q1PA 3SQOA 2CAUA 2ZAHA 4O6JA 3GUDA 3H35A 4QU2A 2J5OA 1AR83 1VBA3 1ETOA 1BJQA 4AFAA 4F55A 3OYKA 2C24A 1AHDP 1W6QA 3RRDA 1HW5A 4B1LA 3IMMA 1YC61 1VBD2 3A0HC 2MABA 2BVVA 2WDBA 2ME0A 2PQ8A 2KKOA 1O3SA 2R042 2XLGA 2WKKA 2ID6A 2PAKA 3DEMA 1XNTA 3AFKA 3CP8A 3ILRA 4XEZA 4X1EA 5DG1A 2UY9A 3REOA 3WNNA 3HGYA 2VOXA 4XONA 1PMIA 4XUPA 1APNA 2X5IB 1RMU2 3ETQA 3SCFA 2WINB 3H5RA 3UKGA 3A03A 2XOMA 2L5QA 1AUYA 5A3WA 3IKVA 2R5YB 1DU6A 1GP4A 4Y20A 2FBEA 1ODMA 5FJHA 4K8FA 2J1RA 2NS7A 5FYZA 2R3SA 1S2EA 5T54A 4FOWA 5DD4A 2HI3A 1G3WA 2E1MC 2RS13 2K9QA 4BM8A 1NE6A 1SACA 4UXAA 4NOTA 2G9WA 1RR7A 1OQYA 4XRFA 1OA3A 3Q9SA 1R5ID 3R0RA 2FD8A 4U0YA 1C4RA 4RBOA 4F8AA 5C5UA 3VUOA 3CCUI 2HPMA 4NN0A 1WMXA 4QPQA 2WAFA 1ETYA 2Y38A 1ZGWA 2YROA 3DBLB 3LEMA 3BQYA 1B9MA 3PLQA 4BQYA 1EPZA 1UQXA 3AMNA 3VHNA 3GBGA 1UZWA 3K46A 5HCFA 4ZS3A 2WFF2 1ZYBA 2DW4A 2XC7A 2N7GA 3R4KA 1POV0 5F37A 1VAVA 5CFDA 1Z7S1 4RR3C 5FZOA 1S0JA 2OA2A 4CDGA 2WA0A 1N3OA 1XMAA 2WUHA 3VBHA 2PMZA 1I1GA 2QYOA 5M5XJ 4B4QA 1QHGA 4RGRA 3TNPB 1VQKI 1PP8F 2FSWA 4JQFA 1R1VA 3AZVA 4XCBA 4ATEA 1IN7A 4QD2A 5FDBA 1HA8A 3KP5A 4QIWN 2O9LA 1FPQA 1Z3XA 4N4OB 5EEGA 4AYUA 2GZWA 4MO3M 2K9SA 1LR5A 3K4MA 1S29A 2DVDA 1W90A 3DWLE 2V4VA 1G3YA 4MVTA 1LKNA 2ELJA 3K4NA 4RAYA 1RJ8A 3O12A 3I2GA 4BQAA 4UFMA 1XE8A 5C6CA 4AFCA 5K5RA 2D6OX 4CCEA 4HNUA 1VBB1 1OOPB 2JEMA 1BBYA 3HC7A 3W2VA 2RGVA 5CAZA 2ZHMA 1JOPA 1MH4A 3VDXA 2ZGNA 3OSDA 2XG3A 4B43A 4UUSB 4Q4W1 3CCYA 1FMVA 1RIOH 4NHMA 2OZUA 2SLIA 4YFWA 4DS0A 4F92B 1YG2A 3A01A 4JGYC 2G9ZA 2IPQX 3WHUA 3VBFB 3BALA 1R091 4TTGA 1XMKA 4M3BA 2MH2A 5CKNA 3KCYA 1RL3A 2JRMA 1W8UA 3GF6A 3WTSC 5A2QZ 2OYZA 4M3EA 1OCCH 2Q1MA 5IOYA 1SEFA 4QQOA 2CWMA 3F8CA 5IT9K 1Y9GA 3M1HA 5C4WB 3J7AY 4ZYGA 5E3MA 3FMGA 2NPIA 3POBA 4AD9A 3OYDA 2RS53 4C2UA 3FHQA 2EIGA 1SMTA 2C26A 1REPC 4CDQC 4KIGA 1DGWX 4GCVA 4MG2A 1ZZ7A 4QQHA 1AYN1 2GWRA 2BQPA 3BTAA 4QKFA 1NQJA 3CLQA 1RR8C 4OWRB 3D4KA 4WXHA 1PO12 4GZ9A 1R71A 1ODDA 3NW4A 3CUQA 3PNTA 2COMA 5EG0A 3RZGA 4EN8B 3LFIA 4U0VA 3M3YJ 3K4ZA 4UVBA 1GUIA 1WJEA 3FC0A 5B1AH 3U21A 4XR6A 2WNVB 2MA3A 2Z79A 2LG4A 4LUMA 4IETA 1K45A 2VZOA 4LLLA 5F2SA 4B1RA 3GTOJ 4AI3A 1EY2A 4ES9A 3VBUA 3BDDA 4BQ4A 5C7GA 2OX0A 3HVDA 2J42A 4PZJA 5FBJA 3PM1A 3NVCA 2Y9YA 2W95A 1ZLKA 5FXVA 3G1MA 1L7RA 2XBO2 2AUYA 1R00A 1AYM2 2DYSH 2YFZA 4AAPA 1NA1A 3CMAI 1B35A 1R5GA 1PO22 1ZBA1 4B4CA 4CDXB 5FZFA 4HG2A 3FK6A 1AOYA 2DA7A 1OA4A 2L4MA 3ZMNA 3L2QA 1HB3A 2Q1ZB 2VOPA 4HLTA 2LKXA 3J8F3 2RDQA 5IY5H 1L3LA 3ACGA 4JRLA 5LGNA 1X50A 4GDFA 4OULA 5D8LB 3IDCB 1LRHA 2VQCA 2WQ8A 3AZXA 3PIOF 4XK4A 4P9WA 2A6YA 2HGCA 3W5NA 1FP2A 1NLRA 3E0JB 3NV1A 4Q4V2 2R92J 3PNAA 1Z7S2 2LRPA 2JVHA 2IXJA 4AC0A 3MF6A 2E63A 4IJAA 5L3EA 4YVWA 3J26N 3AP4A 1LHNA 3NEUA 4YW5A 3HT2A 3DBHB 3RQ4A 3VBFA 2O5RA 3TYJA 2J1EA 2Q5TA 5AIQA 4Q4X2 5AVAA 1LPQA 1AR72 4M74A 4YM0A 2DA4A 3SC7X 1D4VB 1HC8A 1SLTA 5IWFA 3J7LA 3U07A 2HXOA 4HKLA 5IP9J 1W36D 5DYMA 5A3TA 4MFEA 4HXCA 3VZJA 1J3RA 5J47A 3JXSA 2R32A 2W4SA 4RGKA 1BI0A 1QKQA 1UELB 4GJZA 4XETA 1RUG1 2HWD3 4BMEA 4IV3B 2LR8A 5EJ1B 1S9HA 1X3ZB 4XFBA 4DY5A 5FO5A 4F7ZA 1D4M2 1Z21A 4XKCA 4B8XA 1LU1A 2C4XA 1APLC 1VBD3 3CF6E 4S2GA 3PMEA 1W8FA 2K27A 1PGSA 3LQRA 2YPJA 2RS52 3I8TA 2KISA 4ENKA 2ZZQA 5FPXA 4Y1VA 1LOEA 5F04A 1QRYA 2C5DA 2CWEA 5LZ6A 4PJYA 3D0SA 2HDDA 3VDBA 3B3QE 3AG2H 5FRMA 2L54A 1Z6RA 3HPGA 3OS0A 4PT6A 2Y0SN 5IVCA 2PN5A 1MZBA 1VBC1 1GXQA 1SD6A 2FU4A 4WVVA 4K9SA 3ISPA 2P3KA 2K9LA 3RZDJ 4FCAA 1AR63 2ZXJA 1G8WA 3D1NI 4YW3A 2XGEA 2PMHA 2UV1A 5FO7B 2XL9A 1H0BA 5KVRA 2VMCA 4ZPIA 4G7ZF 2O8OA 1GQHA 5EFUA 2X6XA 2IXLA 3T8RA 1OOPA 3P3NA 2X5IA 5L3BA 3L09A 3ASNH 2JJ6A 3A23A 1B35B 4M3CF 3IAPA 1Y4WA 2Y6FA 5HLIA 1YI9A 4FTSA 1SVLA 3WTXC 4WVWA 4HX4A 3LKJA 1XSVA 4Q29A 1S0IA 4NPMA 3JCIA 1LOBA 4GQ7A 3LB9A 1LE8A 1EF4A 4E27A 4MTEA 5A6ZA 2DU1A 3MPPG 4P9GA 1SFYA 2DCZA 4RB2C 2EAKA 2BZDA 3LFMA 1YYVA 2DI3A 3F23A 1PO23 3LE0A 2ZGOA 1FNZA 3I3QA 3OJBA 4CP0A 3KP4A 5H20A 2CGPA 3BI3A 4YM3A 4ON0A 4CEYB 2E9QA 4AI0A 1ST8A 5KWRA 2ZSHB 5HNFA 4QT6A 3R60A 4FPEA 3J8F1 3TDZC 2JN6A 5FZ8A 3CUOA 3THPA 2HOEA 1IZ1A 1F4AA 4XJUA 4ASLA 1A6IA 4IV1C 5FYIA 4AEJA 5IVVA 4A7YA 1ZG5A 1TW3A 2HOTA 5DDGA 1I6HJ 5IPAA 2Q2EB 1Z0XA 3AP6A 5DCFA 3ZO0B 3OD4A 1EYBA 4Y26A 4CPBD 2DAOA 2EB7A 5C5TA 4TWTA 3WF4A 3S3OA 3AMQA 2QEXI 1NOVA 3TOJA 4BPZA 3VZOA 2AHQA 3CJQB 4C30A 4XLAA 4CYDA 4M3CB 1CZVA 2DTYA 3PO3J 2EAAA 2OJED 4A42A 2E6VA 1IZ3A 2EZHA 1D0ZA 1WI3A 5C8CC 2YV8A 3R61A 5C8WA 2M87A 2OC6A 4XJ9A 2LFBA 4COWA 1VQLI 4HANA 1MH3A 2CFOA 4AGVA 1VFCA 1JYTA 1D5YA 3N3HA 1HQWA 5ICCA 3SH4A 1LOFA 1YO5C 2WS93 1GZWB 5F3GA 2A6VA 5FZDA 4XRSG 5FZ1A 5J40A 3ME2A 3ZIXA 2NRAC 1G9BA 2Y33A 1UY3A 4YW7A 3S5AA 4XIDA 3GHNA 4PLOA 5GLTA 4RLFA 5DABA 2D40A 4LLOA 2MLKA 4XLFA 1AYM3 3AXDA 1LHOA 1UZ0A 3S57A 1IXSB 5FV3A 2B9UA 4JAAA 3PTYA 3WHBA 1N1VA 1MPXA 2IA1A 3I53A 2NN8A 2VBPA 5DCMB 3CJIB 3ZMSA 3PL8A 2ERFA 3WP4A 4LO6B 4K2EA 1AHSA 2CWSA 3EBRA 4M4RA 5F32A 1SD5A 1VBB3 1HJFA 4WM8A 1V6NA 1JOJA 4DGWB 1COV1 1ND2B 1QJX2 1WW6A 2JWPA 1FIPA 4C9YA 1OKQA 4QSHA 5LWBA 4A3DJ 2ZFUA 2DBIA 2VXDA 4BBRJ 5JOXA 4LE3A 4GH4B 4KMUX 1WRJA 2SBAA 3AMMA 1RITA 1FIAA 1HW2A 4RGUA 1K83J 3PJRA 3W59A 5ABJB 5CQGA 5HBAA 1X82A 5KHHA 1V6LA 2OPKA 5FZIA 4HOBA 3AP5A 1TVGA 4AW7A 1O6UA 4W6WA 1YIOA 3KYLA 3DQVC 5LBQA 3ZN4A 4NWVA 2TRTA 3MVPA 1DPUA 3BOWA 1JZ4A 2DN0A 4KH9A 3K4JA 3U1KA 5I93A 4QWNA 3ECHA 1JZ2A 3ZSEA 1LGBA 3R4SA 4LO7A 4NPLA 2EV5A 2Y0OA 5IT9Z 3H1MA 1I50J 3EUHA 3QBQA 5I8YA 3N9QA 3J7NA 3VBSC 4BH9A 5ERLA 3MAJA 2WS91 5FLVA 1IV6A 2ZO4A 4BXFA 4HRIA 4YZ3A 1UIKA 2VODA 4IEWA 4EJRA 2M4KA 2X6WA 3I3DA 2LROA 1VMJA 1JKPC 3T0AA 4P9JA 3VZMA 1YS6A 2ESNA 2KT0A 3NL1A 3WTVC 4QM8A 4QX7A 4Z8BA 2TNFA 4XKWA 3OGJA 4RN5A 3V7RA 2VE1A 1Y9QA 2IVIB 2XSJC 5AC92 2NMNA 3PMSA 2ISYA 3N9MA 2ZZJA 2QQ9A 3C7GA 4RGSA 2BRTA 3OMYA 2CU7A 3ZQFA 1H8VA 3KYCB 4BA6A 4Y1UA 3TBIA 1RUF2 1UG2A 3DPTA 4UAPA 2UZKA 4HF2A 1JUHA 1YWKA 4MGSA 4CP9A 1MQTC 3WW3A 1YCIA 1BL0A 2ZAAA 1FNNA 3N05A 4LBQB 5IK5A 3BY6A 3UYJA 4NHLA 3I4MJ 1PM4A 2LMDA 3OPZA 3UNPA 2GC0A 3ZIWA 2VE8A 4JX5A 4EWEA 2BOLA 4NB5A 4BCUA 4Y3OA 2WWJA 2LLKA 3ZYIB 2BFUS 2VQTA 3WQ0A 1UJ8A 5BNQA 1JT0A 2VZPA 1JUPA 1RPWA 2JG8C 3P6BA 3N97A 1VBB2 1LHVA 1KYZA 3USSA 4Q5OA 1T6GC 5DV5A 1W0UA 2P6HA 3ZPOA 2OZJA 4NHJA 3VD7A 2AENA 4BHBA 1U6GA 3OV8A 2VZ1A 1W7PD 1UKGA 3A7QA 1BEV2 5J1YA 1G6NA 2PLV3 1JYVA 1SLAA 2WV0A 2YU9J 2AGSA 2RDPA 3APBA 1XYOA 1I1EA 5B4NA 4HQMA 1F35A 1PNGA 2W1OA 1REDA 5FPLA 1BR2A 3FBIB 1USTA 5LA1A 1HQCA 5A33A 1QMJA 3T09A 1B4AA 1WCQA 4HZFA 4BQ2A 4YARA 3RZLA 2CU5A 3FZVA 4HNTA 3LWCA 1F15A 1KGYA 3RPUA 1MDMA 2QQAA 3G6EI 3VHOA 2EIKH 5GLWA 3WQ1A 4YG2F 5FZ6A 1ULGA 3SYTA 4U88A 5FZ3A 4XIOA 2R7ZJ 3VZLA 5JOWA 3ABLH 5FQ0B 1U2WA 3U4XA 4RSUA 2L7KA 1V5GA 4ZS2A 4L5IA 3VL9A 1PMJX 2WNUA 4TV7A 1FYLA 1WWXA 4FTHA 5AC91 5LD2C 3JW4A 3NAPB 5K5OA 2IGOA 1S72I 4D5CA 2BE5F 4AVCA 5GZFA 4TZDA 3MIFA 4CE8A 2K02A 2CSGA 1IS6A 2W1SA 2K40A 2OT7A 4XSZF 4LBNA 4LTAA 4TN7A 3K10A 3WW2A 1GMMA 4IEQA 4IRGA 3HKZN 2EFPA 3QPLA 5EEAA 2HNHA 1WMDA 4TYSA 2EPFA 1YJLA 3Q8AA 4YZ2A 2Y0SA 1FBSA 3NO8A 4YPJA 3ZXAC 3CF2A 1FOYA 1QQP2 1CR7A 1DQ4A 1Z3YA 3KE2A 4D0QA 3SDGA 1MIJA 4H55A 1KDKA 4CU9A 3RKWA 2MFZA 2UWBA 3S30A 5BNGA 3LOCA 4JC1A 2DYCA 1KU2A 4AF9A 4FPYA 3TEYA 3ZSMA 3WW1A 5D1IA 2GIZA 2KZVA 3ZGKA 1OCOH 3VBOB 5FUIA 3V0AB 3C7EA 3D8CA 1S0EA 3QPHA 3AZWA 4UW3A 3EETA 2ACJA 2J1SA 3BPXA 1QXJA 1K5MC 3A4CA 3B7MA 2I8DA 1S0GA 2GAUA 4Y22A 4X6AJ 1E5SA 3RYKA 4XN0A 2W00A 3WUDA 3T5XA 3E5UA 1U5XA 3JD73 2CS3A 3DYOA 1UG0A 2WWUA 5ANQA 2M3AA 2W1WA 2XPUA 3IAS2 4BK4A 2VTXA 2KQRA 2PX9A 3TRSB 3UKTA 5HOOA 2FDIA 2NVTJ 1UD1A 2OD5A 3ZR8X 4YLZA 3GXOA 5BMZA 1WVRA 1ACIA 4IE7A 1VTNC 3Q8FA 4OMYA 2JJ7A 2GC2A 3ZMZA 1X1DA 1HX6A 1ZRDA 3MLKA 3OYIA 4C91A 2DWRA 2IS1A 1XSRA 4A3LJ 4W6XA 4KIFA 5SV5A 3G3ZA 2K9MA 4AEDA 2K9ZA 2W94A 1ON1A 1NZCA 1Q8VA 2P2KA 4F91B 4RS5A 4RQPC 4PI0A 3OIOA 4P9XA 4J1XA 1A35A 5JPNB 1V55H 3H9JA 3T0BA 1GLHA 3S2DJ 2WBMA 4ZY9A 4MEXF 3EYPA 2CW8A 1R1A1 2YY1A 1BJZA 3M8EA 1SBFA 4AAXA 1TG7A 3OYEA 3LGRA 2DFEA 3I64A 3C7FA 5L3GA 1G3TA 1GV9A 2CQXA 4NC7A 1ZZ8A 2CTVA 3UL2A 2WA3A 5FY1A 2Y2ZA 1AYN3 4OI1A 4IQJA 1QF3A 4O9GA 3MW2A 2P1BA 1GWLA 2P37A 1R7JA 3WF2A 3W5MA 2P3JA 1RRJA 3VDDA 4TLGA 5M5YJ 1H9GA 2IS4A 5LHIA 5CG8A 1A6CA 2QNKA 1W3XA 4I01A 3ZFGB 2ARCA 1Y6IA 4FHTA 3GZUC 3ZMUA 3M7AA 2DFCA 5J8FA 3FFQA 4MXWA 1YFYA 5EJ3A 3GJBA 4XAAA 3K4BA 1WKYA 1YE9A 4G7HF 1V9U2 3OSGA 4PUSA 1CQ9A 2PI0A 3S3MA 4PBPA 3WUCA 1J1LA 2HVSA 4FP2A 3JQXA 1V9U3 4JDMA 3WR0A 3GFLA 5C4WA 4RD7A 3V8LA 1ENXA 1PVC2 5LA0A 4H7MA 2IVMA 4H7LA 2QSHX 1SEUA 3CZJA 1F43A 4RGAA 3HMYA 3QH6A 5T5LA 5L9BA 1WLCA 1RUC1 2VMEA 2OTLI 3AX4A 2AYHA 3SKJE 5A3MA 3WG2A 4O3MA 3WTTC 3BYWA 2PMUA 1PHMA 2QQJA 3NWTA 3SDBA 1NA1C 5AIPA 2C6SA 2FE3A 4L9BA 4QB6A 4PK4A 3N9OA 5AVPA 1XPXA 4GKXA 1ENRA 1JHFA 4HYEA 2E35A 4ZXKA 3OEAA 5J4YA 3TWIA 1K3IA 2Z2SB 2ISZA 1KQRA 5F7UA 1BBT3 1OSGA 2B42B 2ZKNA 2XR4A 2JENA 3MLJA 1RUJ1 4CCMA 1AR92 1XDUA 3I59B 1HRV3 5CU1A 2RJ2A 2STTA 3ITQA 2HDWA 4G6QA 3S1RJ 1WH7A 4YZ5A 1KFXL 3IH2A 2VW0A 3CJRB 3MGUA 1VBE1 3ZYGA 5C9AB 3HIFA 2VBBA 2R0FA 1N25A 1LVKA 1W3VA 4XUOA 1LNWA 3FM5A 2LM3A 1TNFA 3LMMA 4LKEA 3TN91 3KCCA 2DTRA 3PDQA 2A6WA 4I0AA 4B47A 5L3FA 5EJCA 3GALA 5FZMA 3ZOBA 2GC1A 1W9WA 1G9DA 5JXHA 2VB6A 4RB3C 1WLWA 1PDNC 1SD7A 3SH3A 4CH7A 5GLUA 1PZ8A 1RVF3 2E2JJ 3HSFA 5JZGC 2GOXB 5E88A 5EEHA 5JLXA 4OUSA 2IAIA 3R05A 4FTEA 2B63J 4MHRA 2QDRA 5CKMA 5M3MJ 3CCSI 3GX4X 4XHBA 2NM1A 2RJKA 5FPBA 2OXBA 1QXPA 4A3EJ 5FYTA 3R6SA 1BR4A 4S05A 4Y52J 2WSUA 4M0HA 3VODA 4G6DA 1ZM1A 4JQTA 2W1QA 2XMLA 4PIXA 5ED4A 1TT5B 2GM4A 3EUAA 3UJQA 1OXCA 3POIA 1HB4A 1W36C 4ISQA 5H6QA 4E6KG 1JJ8C 2P5LC 1XNBA 2GMPA 3ZFEB 2M1BA 2A05A 2KD7A 4BDVB 1AR82 5FKCA 1W9YA 5LY1A 2X1CA 2R4GA 4WCGA 1SANA 3J80Z 3O7OA 5DM6F 2QUOA 4K8RB 2WS92 5ACA1 4GB32 1LUJB 4HVOA 2E7WA 2X5IC 1QEXA 2WADA 2P81A 5DAPA 1AR61 3KGZA 4YZ4A 4AM3A 4PJLA 2QE3A 4LO8A 3WF1A 5BQTA 3TN93 1X3WB 2JA7J 2XVKA 2H8WA 3J9SA 5FOJB 2B39A 2NNNA 3FBNB 1MSFC 1OVPA 1HN0A 3WOGA 1XQNA 4YFXF 2L9LA 1ZGAA 2EZLA 1ULYA 3L1PA 3VDCA 5EPAA 3VV1A 1YOVB 4IPAA 4WVMA 3PUAA 1RUJ3 2R7UA 1SCSA 2FOWA 4FTBA 4JBAA 1Y7BA 3U4SA 1P4AA 2HYJA 4MYEA 5J96B 2DCTA 2E2HJ 5K7FA 2ADUA 1MS4A 3WODF 1W8HA 4IGOA 3PUBA 4GXLA 4QXHA 5D4RA 3MQ0A 5F0CA 2XKOA 2XDVA 2XPVA 1GZ9A 2XWJB 1A04A 4C1XA 2Z42A 2P17A 5IJRA 1F4KA 5FYVA 2EA4A 5APAA 2QKMB 2XAFA 3L2CA 4Y1YA 1DZRA 3HGGA 2VKHA 2WT0A 2R93J 4UVAA 4YRVA 5FPAA 1ZBE1 1QJY2 2Y64A 1XRUA 2CQKA 1PK6A 1PGL2 5J7MA 4AEKA 1TT0A 2JT1A 2I2SA 3LSEA 1QH6A 3FMSA 2AREA 3GZNB 4FPFA 1KQ9A 1X36A 4IGPA 2HEWF 4XOTA 3FHZA 2NMOA 4YEJA 2WL1A 4N7IA 1USSA 1O4TA 3NNJA 2BBYA 4KITB 4HFSA 1U78A 2PHLA