2BEOA

Prfa, transcriptional regulator in listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
226
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords LISTERIOLYSIN REGULATORY PROTEIN
total genus 69
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2beoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2beoA01
1J3RA 4YIIA 1J1LA 3OGJA 3TOBA 5JSOA 1J5YA 2O03A 3USSA 1UFMA 2D1VA 3WTZA 4J1XA 2CG4A 3R61A 4U7DA 3LWCA 1J75A 4JQFA 4WXCA 1P92A 3LWFA 3BOQA 5CVIA 1EH8A 4ONUA 1RUNA 3T5XA 3DKWA 4K8FA 1SMTA 1U5TB 1XMKA 4EJUA 1NE6A 3W6KB 2JZYA 4XSXF 1FZPB 2B5HA 2O1QA 2KXLA 4R79A 2VOPA 2W24A 2UYBA 2VT2A 3GUDA 2IXLA 1UB9A 2B9UA 1W4MA 2IXHA 3H1YA 4IETA 4QGLA 3H1WA 3EQEA 3BDDA 2DT5A 4G8XA 2W25A 3V7RA 3EETA 3MQ0A 4QGNA 1RI7A 1W7PD 1D8JA 2P6SA 2Z9OA 5KHJA 2IA2A 1FPQA 4R1HA 4U7BA 3RZZA 1T0FA 5I0RA 4MV2A 4HQEA 4WK8F 3F8BA 3HSFA 1YYVA 1X3UA 1LJ9A 4HV6A 1NE4A 4E2QA 2EA7A 5D8KB 1H1IA 1SD6A 2FBKA 3H7JA 1ZG5A 2NNYA 4YFXF 2EWNA 2MHFA 3RNSA 4YG2F 3C18A 5I8TA 2VQAA 2W57A 2D5FA 3GFJA 3QP6A 3SCFA 4L11A 5ICFA 1LEAA 1QGPA 2F5DA 2PMHA 5I93A 1WI9A 4L2NA 3WGGA 4RD7A 1OYYA 2DQRA 2FBIA 2XHKA 1K79A 1MKMA 3RDIA 4XFCA 2BNMA 3SXYA 1NHAA 4HDUA 4H7LA 3KEQA 1JHFA 1RGSA 3P7NA 1FYKA 3E3VA 2EV6A 2DW4A 2GZWA 3HOSA 1U12A 2MLKA 2P5LC 2OA4A 3HHHA 4XEZA 5CU1A 2B0LA 3I0TA 3DF8A 3IL2A 3EUHA 1DDNA 4BNCA 2ELHA 1SAXA 2DU9A 4O9EA 4NVPA 3MZHA 3U0ZA 1WRJA 3BP8A 1XMAA 4XFAA 2K4JA 1QBJA 2IA0A 1WGPA 2K4BA 1ZN2A 1ZH5A 1FYLA 4EM2A 3BJOA 3ES1A 5J7MA 3PVBB 5TJJA 2ADUA 2HJIA 4O3MA 2CAUA 1ZVFA 3RTRA 2DTRA 4UVCA 1YW7A 1PP8F 1FP1D 1TBXA 5E20A 4EWEA 1YO5C 2MPFA 2Q0AA 1X8MA 4BHPA 3NEUA 1YFYA 3LQRA 1Y0UA 4FBFA 3BZ6A 3RPQA 3ECOA 3FF5A 5HDGA 4QM9A 3WU1B 3WW4A 1TTYA 1T39A 4RB0A 2FF4A 2ISZA 3FHIB 5AONA 3FZVA 4HX4A 5CVVA 1HW5A 2PA7A 5AVPA 2D93A 1ZRFA 3M70A 2STTA 2HZTA 3EYIA 4KIGA 2EAAA 3E5XA 4RGSA 3H3ZA 2IXKA 1Z7UA 3PQJA 4IEWA 3RIRA 1HBXG 5FQ0B 3FM5A 5DEQA 1X8EA 2NNNA 3G73A 4KMFA 4XLPF 5F6FA 4ZZDA 1QY4A 4A5MA 3D0JA 1MZBA 4AVAA 3V7CA 1ZZ8A 3MDPA 3FXUA 2VBWA 1HXDA 5JFRA 4Y17A 1NXMA 4B29A 3I64A 4LG0B 4LUMA 3QPTA 1XSVA 2Y48A 3F22A 1VR3A 5L3BA 2EFOA 5T3NA 1Y3TA 2KJBA 3F72A 2FQPA 1BIBA 3LAPA 4I02A 3GWZA 4IJAA 5LGUA 1DP7P 3Q9SA 1G3YA 3F3XA 4A6EA 1O3QA 1FXZA 4G6QA 4Y15A 5CJ9A 2DPDA 3RYKA 4IEZA 1RIOH 2PN6A 2ACJA 5HS7A 5J6XA 4ORFA 4JTNA 4PIXA 4YARA 2KRFA 1QPMA 3E6BA 4FT8A 1S6LA 2F5CA 2XIGA 2QM3A 5J8CA 2Z5UA 1BC8C 4PGHA 5DUIA 4Q0VA 4P55A 3NW4A 1QXRA 2OAZA 2V9VA 3GFMA 3MFKA 2QYOA 1EPZA 3HSEA 4OIPF 3E97A 4KN4X 2K86A 1RL3A 1ZARA 1HSJA 2Y0MA 4L0ZB 2FEZA 2YX7A 2D2WA 2OZ6A 3GF2A 2F2EA 3HRMA 2IRFG 3PQKA 3ULQB 1XCVA 4JVAA 3GBFA 5HS9A 2ZKLA 1QQIA 1NZCA 1CAVA 2LKPA 1TNSA 2H94A 2MH9A 2QDRA 3NJZA 2BYVE 3ZMVA 1STZA 4M73A 3TQNA 1WSUA 4KYWA 5AIQA 2O6GE 4CHUA 3ML6A 1IN7A 2MA3A 2O61A 1P2FA 4RAZA 1BOAA 1XSXA 2HKOA 3G3ZA 3K2ZA 1PM7A 3GYDA 1E2XA 3MYXA 5ILSA 5FLXK 1J3PA 3WG9A 1U3EM 3I59A 5I8YA 4B8XA 1KU7A 4HLYA 3E6CC 3TDZC 4G9YA 1UHWA 1XGMA 2XL9A 4Q0UA 3TNPB 1WQ2A 4UUVA 3C3VA 1ZLKA 1LDKB 5BQTA 2PAEA 2JPBA 5FLHA 1K78A 3NKTA 2GXBA 3KETA 3MCZA 1QZZA 4ZYEA 1F5TA 4E70A 3CUQB 3HTSB 3FXQA 1BI2A 4EJTA 4WWCA 4TLFA 2EJRA 1J2XA 4YNIA 3KZZA 2ZXJA 4LUKA 5CADA 4EGZA 4AVCA 5FLJA 2QCSB 3BB6A 2FSWA 4KT5C 2VECA 4WBBA 4GYGA 3N97A 1HSTA 5LGNA 1USTA 4A0ZA 2W85A 1ZGAA 1ON2A 3CLPA 4WX9A 2IXCA 1JUHA 3EDPA 2MBFA 2J5OA 4UV9A 3BPZA 4ZU5A 5K5OA 2V09A 2HQNA 4UVBA 2OD5A 1ZLJA 1YFWA 5ILUA 1IXCA 1MJBA 2PHLA 3WODF 4M9ZA 4ASNA 4G94A 1LEBA 1MDMB 2F5EA 1G3SA 2QVOA 3L2HA 5FFXA 1GXPA 3UKVA 1LDJA 1R36A 3DXJF 5D1IA 4S04A 3BPXA 2E9QA 1LR5A 1PDNC 3DP7A 1L3JA 3MZYA 2LF7A 2P4WA 4AXOA 1S7OA 5D5WB 2WC2A 1P4XA 1SD7A 4IEYA 2PLYA 3VEPA 4HVOA 2LSOA 4RS8A 5JAXA 1HW1A 3WTWC 2CFXA 1UD1A 3GO5A 2FMLA 3FX3A 3CO7C 5ILVA 4L9TA 5I0SA 2E7XA 2CO5A 4BQAA 3J7AO 4IESA 5FPXA 4Q48A 4XF1A 5FLIA 1F9NA 4I09A 4LJZF 5DV5A 1Q5OA 3RI4A 3HHGA 1R22A 2V1UA 2Q4SA 1LRHA 4HZFA 4M6XA 1FP2A 4HQMA 1FSEA 3IRRA 1XGSA 5AIPA 4ETSA 3LOIA 2GC1A 3SCHA 4OFGA 5HI0A 1J59A 3U1DA 3CJXA 2WWYA 4ZZLA 1ODDA 2DI3A 2RV8A 2XVCA 3M1EA 4MQVA 3FXRA 4WVZA 4D7TA 2HOEA 4F8AA 4JTOA 3LQQA 2DAOA 4QGMA 1D5VA 3F21A 3NVCA 5FFZA 2KJCA 3VODA 3KEOA 4LTAA 1FBUA 4NB5A 4OLLA 3LA7A 4UXNA 5E18F 4OOIA 3VB2A 2VT3A 1WWXA 3ZQ7A 5D6FA 1O7FA 3B02A 3SQNA 3ZP5A 1ZRCA 2KIFA 4YRDA 2MC3A 4CICA 4CXFA 4OIQF 1GQHA 2PQQA 1TW2A 1YS7A 4HSJA 2CYYA 2P8TA 2H6CA 5HLHA 2F5FA 2OQGA 2YPRA 5BS6A 1KYZA 3ISPA 3RJPA 1QNTA 4F7ZA 1IRGA 2HYGD 2GH2A 3JZVA 4AIJA 2IT0A 5JVTA 2Q0OA 4KICA 4HSLA 5HVQC 1HKSA 2XAHA 2K02A 1ZZCA 3NQOA 3SHFA 1AOYA 3HSRA 3PNAA 3M7GA 5IT9Z 2Z2SB 1DPUA 1KQ0A 2Q1ZB 3HYIA 1A04A 5LLQA 2D45A 3EHKA 3QACA 2GXGA 5BMZA 4IRHA 1EH7A 3OF1A 4IRIA 5L3FA 2BBYA 2P5KA 5EZWA 2KKOA 5HLGA 2EFPA 4IRGA 4O9GA 3K1NA 3L2CA 5BPIA 2RN7A 1JXSA 3HIFA 2JT1A 2LDUA 1B59A 2FRHA 4A0YA 3DV8A 4IXAA 4CZZA 2VBZA 4XLNF 4ENJA 5BPDA 3ABUA 3COAC 2B8MA 1SQ4A 4E2GA 4R52A 3BWGA 1XDUA 2PAKA 2A6EF 4FAHA 2HS5A 4KWKA 2GC3A 4PDKA 1KGSA 1FWZA 2IXJA 5ICEA 2PMUA 3FE5A 4TV7A 4MHGA 5C6CA 4PCQA 2L4MA 5A2QK 1DUXC 4MTEA 1S29A 2UXXA 2QBYA 1J9IA 4EQQA 3R4KA 3J80Z 2PAMA 1XRUA 2A3SA 4Q47A 3ERED 1ZREA 3HTUA 2JRTA 1KU2A 4P9UA 2XAGA 3U2RA 2D5HA 4LEJA 3J80K 4B09A 2QENA 2BNOA 4HVRA 1G3TA 3WTVC 3CTAA 5EFUA 2OBPA 1XE7A 2XKPA 1IW7F 4OINF 1TNTA 3IWZA 2J5PA 4MX3A 4HF0A 3P9CA 4Q5SF 4X6QB 3ACLA 1KQ9A 5FO5A 1IZ1A 2OU2A 4KU7A 2GWRA 4KN7X 4I0AA 5LBQA 2O8XA 4G7ZF 3IDCB 2UYAA 3KP7A 2DQLA 5HDKA 4QM8A 3CO2A 4UV8A 3WTSC 2L02A 3ABTA 2PBIA 3M3IA 4NQWA 2PFWA 2WV0A 2CGPA 4EJVA 4HF1A 4YFNF 2VPVA 1YLLA 4OMZA 3DFGA 4S05A 1G4DA 2RDPA 4P96A 2ETEA 1UHMA 1R1VA 3S0MA 4M74A 4KIFA 1LQ1A 5KHGA 4RGUA 1R23A 3H92A 3FJSA 3BY6A 2Z33A 1EY2A 6PAXA 3E6MA 1VTNC 2EA4A 4JV4A 2CAVA 2M45A 4I3PA 2IC1A 3GLXA 1QWRA 3GEZA 4AQ6A 4AD9A 5LHIA 4ZU7A 4L0YB 4UHTA 3FM3A 1W5SA 3P9KA 4XFFA 2DLLA 1W5TA 1O7LA 2MLGA 4U0WA 1FY7A 2COMA 1ZNPA 3ELKA 4LK0F 4MTDA 4HN1A 3S7EA 3UKNA 1H9GA 3KMHA 1MJAA 3DN7A 4HX8A 4RB3C 3WGIA 4HBNA 4MH0E 3DPLC 2CWEA 4M9SA 1LB2A 3TO6A 2OZUA 2DFIA 5BXXA 1YWKA 2F4PA 4G7OF 1CX4A 2RGVA 4WCGA 5I0TA 4MEXF 1ZZ6A 4LGWA 1R58A 1TQPA 2NYXA 3VHRA 4P9GA 3CUOA 1J7KA 5LGTA 1Z1DA 1CAXA 2C6YA 5BOXA 4O6JA 4OU0A 1LKNA 4LFUA 2CV6A 1CAWB 5HLIA 3V4GA 2HDCA 5L3DA 3JAMZ 4IVNA 5K8SA 1XN7A 1ZG3A 1U2WA 2EB7A 4MGKE 1KYWA 2L54A 3RYPA 4A12A 5H20A 4LD5A 1R1UA 3IDBB 3SXWA 3JAMK 1IN6A 1BJAA 2HWVA 4P5OA 1XDSA 2VONA 5CVUA 5I8SA 1P4AA 5K1YA 3LFKA 2IP2A 2KIUA 3RYRA 5ED4A 4LA3A 1TW3A 2OZJA 1CAUA 2M5WA 4I2OA 3SMHA 4ZU4A 2ZFWA 1ZRDA 2PYTA 1I6XA 5JI6A 1FX7A 3JSOA 5I0UA 2A61A 3WGHA 4YSFA 4XBFA 2UY9A 5E1WA 1ONVA 3JSPA 3GZ6A 4HDVA 1X82A 3QP5A 3B73A 1BI0A 1G6NA 1BI1A 2KIMA 1XGNA 4A6DA 1L3LA 4UXAA 3KFWX 4HX7A 1K7AA 1YS6A 2QBYB 5E1XA 1IUYA 4HV5A 3LA2A 4LA2A 5K5QA 1V3FA 3KP6A 1YTYA 2M87A 2GC0A 3WTUC 2Z99A 2JPCA 2XRNA 2VC0A 1OFNA 5FB2A 4GCVA 3SZTA 3ROUA 2Z69A 1JE8A 5KK1A 1VP6A 1OR7A 4DQ2A 1F4KA 4Z2YA 4Y13A 1DZRA 3R0AA 1QO0D 1RNLA 4EM1A 2JTVA 3WW3A 4IEXA 3I7DA 1XCBA 3PFIA 1SEFA 1QXJA 4P9FA 4EWDA 3I5UA 5JSRA 1UPIA 4FAGA 1OKRA 3I4PA 4MEYF 2P7CB 1IN8A 1YLFA 3ELNA 1B9NA 3OCPA 3EO6A 5LEKA 3O14A 1AWCA 1O4TA 3Q9VA 1SFUA 2DCTA 3K0LA 3S2WA 1YW8A 4BH9A 5BUVA 1R5HA 2Z3YA 2H6BA 5E1ZB 4LB5A 1J58A 1ZZ9A 4ZYHA 4AIKA 1MGTA 4FHTA 3S7IA 2K7LA 4META 1TQMA 5EEGA 4HAMA 3TKYA 2DBBA 4EV0A 4EVIA 4XRFA 5BY5A 5KBFA 5D4SA 3U9GA 5I91A 3TO7A 3FFQA 5HDNA 3IHUA 2PJPA 2OA2A 1SD5A 2D1HA 2UY8A 2OYZA 1I27A 2PFBA 3FZ3A 4CDGA 2ESHA 1YQAA 2VC1A 1HKQA 5H6QA 1F1ZA 3W6JB 1YUDA 4MUVA 3KP2A 5LEJA 4AVPA 2XAJA 1OMIA 2EA2A 4A2UA 3LSTA 2ET1A 4JK1X 4O5VA 2E1CA 1YIOA 2QVSB 4IEPA 4UBHA 3GYHX 1ON1A 3BPVA 4XF9A 4BYYA 3KGZA 4AWXB 1P6RA 2Y0OA 2RKHA 4Q29A 1EH6A 2O3FA 2DK5A 4A0XA 3H3UA 3ZPLA 4GXOA 2FE3A 4M9XA 2FQ3A 2Q30A 4EJWA 2ET7A 4WXDA 4HMZA 1BI3A 4PZJA 5E1RA 2FMYA 1IF1A 1XD7A 2XLAA 1OI6A 3T8RA 2W84A 4KNYA 2LF8A 4Q0SA 3NL1A 3M8EA 2PG4A 2I45A 4R8HA 3CLOA 4ZYDA 5J8FA 1FNNA 4L5JA 2ZNYA 1IN4A 5KHKA 4QXKA 2HYFA 4YFKF 1ZZ7A 5FQ0A 3QPHA 3WE3A 2E1NA 2YR2A 1KQ8A 4I98B 4M71A 4ESJA 4CYDA 4Q0PA 1Z6RA 5KHIA 5CVRA 4ESBA 2VE8A 5LHGA 3EJKA 5E16A 1WA4A 4QWQA 3RPUA 4XF3A 3GFIA 3CO6C 5FCCA 4ZH4F 4MGZE 4RAYA 4MGRA 3TNQA 2QUFA 3ZMSA 2UZKA 2IA1A 1L0OC 4EMSA 1D8KA 1IXSB 4XF0A 3M8FA 1R00A 3RKWA 1KU9A 2STWA 2N7GA 2FNPA 2X0LA 4MNUA 1YFHA 4WZCA 1FLIA 1USSA 3ZMTA 3C1DA 4ENKA 1FT9A 3EQLF 2V1DA 2VE9A 4OMYA 4A5NA 5K5RA 5J3UA 5H6RA 4IHSA 1D3YA 3I59B 3SCGA 3DEUA 3ECHA 3QU6A 2R7FA 3JTHA 3KZYA 1LNWA 2H27A 2V79A 1CAWA 1LDDA 3C7JA 5D5XB 2K9ZA 2EV0A 3VOEA 2CW0F 2Q2EA 3F8FA 3RKYA 3SHRA 4LLGF 3KLNA 2PEXA 3MPBA 4FX4A 4HW0A 2GAUA 2YSRA 3V7SA 4GGGA 2FNAA 4J1WA 1IPJA 2Y75A 3I54A 1ZGJA 3E5QA 1UIKA 4ENMA 2ZCWA 1R1TA 5HS8A 1DGWA 4DNCA 1CGPA 1FC3A 4ON0A 4M72A 3QU3A 5JSPA 2GU9A 1DPRA 2QQBA 4XF4A 2ISYA 1GXQA 2E7WA 4LLNA 4RGRA 1U78A 2XROA 4KA4A 3FMQA 2NRAC 2VBYA 4N9HA 4PGGA 1UW8A 1QZYA 3EBRA 1I1GA 1XSDA 1DZTA 4L18B 4GO1A 2HKXA 2IJLA 4WXHA 1ZG1A 3HRUA 3Q5FA 1WLTA 4GYIA 4EWAA 2FA5A 1RTVA 1PUEE 4LG0A 1MDMA 2H09A 2M8EA 4IERA 2MD5A 3I58A 3M9AA 1O3TA 3ZN0A 4IEQA 4IEUA 2GC2A 2FBHA 2BV6A 1RC6A 4HYEA 2O0YA 1B4AA 3JW4A 1EV7A 1S7AA 4IPAA 3H7YA 3T8TA 2D40A 3D5LA 3AAFA 1K6OA 3HT1A 2BEOA 3LAGA 3U10A 4RGXA 4YYOA 1SFEA 3QRFF 2OPKA 1W7PA 1ZZBA 3IBMA 4AQ2A 2EVXA 3T0YA 4EM0B 5DCMA 2IPQX 1LVAA 4HBLA 3FHZA 3HUGA 2FOKA 1CF7A 2DO7A 5FGMA 1I1SA 4Q0QA 4PJYA 4OIRF 4HN0A 3WTTC 4XFIA 5JHUA 3RKXA 4EGYA 5D6EA 5FPZA 4LB6B 1FSHA 3WTYC 1OYIA 4N9IA 2P7VB 1IPKA 3BALA 3F23A 1NYWA 1JHHA 3KP5A 5L3EA 3GW2A 3BJAA 2OQRA 4UVAA 2XKOA 1ZYRF 2G9WA 1H9TA 5D5VB 3HQXA 5FD6A 5EEHA 3GXOA 4KL1A 3BJ6A 3FWEA 4X6RB 2RQPA 2VXZA 1U5TC 1HQCA 1Z91A 1BBYA 1CAUB 5JR7B 1OPCA 2RNJA 4QX5A 1BM9A 2JSCA 2HQRA 4KDPA 1SFNA 1T38A 5F64A 3KCCA 3K1MA 2PQ8A 4UBGA 1ZX5A 4DINB 5D8LB 4KFCA 5C8WA 1U8RA 4N0BA 4BAYA 3NSTA 4KWJA 5BV6A 1UCRA 2ETHA 2ATFA 2ZNZA 1OYWA 2GA2A 5E8IA 1KA8A 2MNGA 3WW2A 4PIYA 3CEWA 1GHCA 2FU4A 1BIAA 1FBSA 3FMSA 3LZZA 4I01A 2ZJ2A 2QJVA 3H8UA 5DD8A 5L3CA 1YHFA 1SD4A 2CQKA 2EFNA 2EFQA 4H0EA 2R7DA 3U11A 2L3DA 2PHDA 2HR3A 4HLXA 3TDUC 2YU3A 3V8LA 3QAHA 1R7JA 2P5VA 1O3RA 2DPUA 2CSOA 4RB2C 4L5IA 4MZUA 2ZO4A 4AIHA 4PIZA 1RUOA 4QMAA 5E17F 3E6DA 5DDGA 1T98A 1BN5A 1IRFA 5J48A 3H9AA 1CAVB 3MEXA 4I0BA 4E2SA 5FLXZ 5LHHA 1SMYF 4KMUX 2FXAA 4MQ9F 2IVMA 3PLQA 3LA3A 1VJ2A 1MJ9A 1ZRRA 3R0JA 3GX4X 4EROA 3ZMDA 1YG2A 3KP3A 3R6SA 3ETQA 3D0SA 3OV8A 3DQVC 4Z07A 4D0PA 1ZAOA 2QLZA 2P6TA 3MWMA 1B6AA 3V8JA 4Z82A 2YX4A 1JGSA 4XFHA 4CGZA 3V8KA 3LAJA 1U6GA 1YFUA 1J0RA 1HW2A 5L3GA 1X7NA 2EV5A 5LRSA 5DD4A 4GULA 4KU8A 3OD0A 3ZMZA 1BC7C 1GQGA 2RC4A 3FMRA 1K78B 3QOPA 3N4MA 4G6DA 4L9NA 1B9MA 2ZKZA 4G7HF 3SZPA 1XE8A 2V6CA 1TLHB 3TOAA 3GFLA 4OIOF 1Z9CA 3JTGA 1TQIA 3IC7A 1XB4A 1V4RA 2EK5A 4RB1A 2ZMEB 4I7HA 3T1BA 4BIFA 5KVRA 3K9TA 5JR3A 3WU0A 2TDXA 2BNNA 1IN5A 5FDBA 2PTMA 1T6SA 3EYYA 4ENNA 2GIVA 4MGYE 3WTXC 2M1BA 4LK1F 1KU3A 2XAFA 3HT2A 4FX0A 3E5UA 5ICCA 2VODA 2WTEA 3IRQA 2A6HF 4BXUA 1IXRC 3L09A 2HTJA 4CO8A 4HLTA 4IHTA 4M6YA 3WE2A 3O6BB 4U88A 3TO9A 2WFPA 3KP4A 2RVCA 1SFXA 1G3WA 4JBAA 1RZ4A 2XLFA 4BHCA 3BU7A 1P4WA 4L9VA 3H1MA 2HFHA 2V1XA 4XFGA 1T2KA 5F1RA 2QZ8A 3MAJA 3KLOA 4WF2A 1TQ5A 3L7WA 2A5YB 1PMIA 4QLCU 4Q4ZF 2EFWA 3H50A 4KUMA 2MH2A 4NHJA 3WW1A 4XETA 1O57A 2VN2A 4KIBA 3CL1A 3SFZA 2K27A 2HEOA 1FBQA 5IT3A 3OTFA 3CJNA 3ST7A 4HF2A 2XGXA 1V70A 2O8QA 1OD5A 3NRVA 3I53A 1EP0A 1YW9A 1H1MA 2C0ZA 2XAQA 3DPTA 5DYMA 2XLGA 2G7UA 1CF7B 3F6VA 4ZYGA 3HRTA 2VBXA 1R5GA 1HKTA 3REOA 3F6OA 2XUBA 3D82A 1UIJA 5DUKA 2R3SA 3BROA 3CUQA 1XGOA 5CLSA 3IKVA 1YFXA 3OOPA 3R60A 4LLOA 2IW5A 1CAXB 3ZN1A 5DCFA 3ZDSA 1EYBA 1ZHFA 2PI0A 3KE2A 1IAWA 3F8NA 4L9JA 5ERIA 1B1BA 4BHBA 2ZBKA 2IXIA 2UXNA 3GVAA 3K69A 4HA8A 1GVJA 5JCTA 1PP7U 1UCXA 1MD0A 4EJOA 5TRDA 1FOKA 2UWMA 3O2PE 4IF4A 2DK8A 1DGRA 4IEOA 5E8GA 3KSCA 2L01A 3HRSA 4U0VA 1O5LA 2QNKA 2XASA 1Q43A 1C0WA 2A07F 3ZMUA 5IT9K 3L9FA 5HOOA 1FI2A 4KWLA 3F8CA 1S8NA 2BGCA 5FD5A 2XL7A 3DL3A 3G7DA 4MGIE 3HOTA 5D4RA 4K2EA 4UNOA 2ESNA 2VOOA 4XFBA 2NS0A 2QQAA 4U0YA 3C3WA 2G7HA 1Z6TA 5D5UB 1J3QA 2AS5F 3F8MA 3I71A 2M30A 2QQ9A 3IKTA 3BCWA 4LLLA 2X4HA 4YIFA 3CF6E 2HTSA 3K1PA 3KGLA 4LULA 3O3KA 2HGCA 3VFZA 5KHHA 2BE5F 2AXLA 1H0MA 5BPXA 3UKTA 2A68F 2L4AA 1W7PB 1E17A 4HOBA 5LRRA 4IEVA 1Q1HA 2H0VA 3P9IA 1I5ZA 2XV4S 1S3JA 1FYMA 4AVBA 5CVJA 5DCMB 1Y9QA 4ESFA 1WKMA 3CUQC 5ICGA 2NAZA 3CDHA 5A2QZ 3IWFA 2K0GA 4LMYA 2QWWA 2LNBA 4XSZF 3J81K 5CYVA 4HVQA 3L00A 3TGNA 3GZ5A 1Z05A 2P17A 2A69F 3IIAA 1O5UA 2Q8KA 3ES4A 3J81Z 1Q3EA 1ULYA 2GA1A 1REPC 4D7SA 2ZMEA 1O3SA 2GQQA 1U5TA
chains in the Genus database with same CATH superfamily
1W9YA 4B4CA 1Y0NA 4YIIA 3BCBA 1SPPB 1X4PA 2XJQA 1UFMA 5LD2C 4E7SA 2JDPA 4AI0A 2CG4A 2P81A 1YRZA 3K2OA 2AENA 2QKDA 4AM3A 1J75A 4WXCA 4NHYA 3VBOB 1G59A 2VBDA 1ETKA 2F6BA 4N8MA 2EQRA 3VSKA 3H8OA 1W36D 4XJ8A 3DKWA 3IAPA 1H9WA 2IGMA 4EJUA 1S0DA 2JZYA 4FCAA 3VBUA 4XSXF 2WKKA 2O1QA 1S0EA 4R79A 1AYN2 2UYBA 3DWLE 2GH8A 1VQMI 4AI8A 4D7MA 3H1YA 1RESA 2EBIA 2Y33A 3OBZA 4QGLA 1EAH1 4QB6A 5JMCA 4A3LJ 4UUSB 2GBYA 1WCQA 3VKLA 3O8GA 3BDDA 1JUMA 4G8XA 2W25A 3V0AB 3PUSA 1RI7A 5JOWA 1BOBA 2AZ5A 1D8JA 2P6SA 2Z9OA 2VU9A 4XUNA 1AR81 4C1XA 1IQAA 1AX0A 4Q8KA 2GLOA 4R1HA 2BXZA 2IS1A 2DOFA 3J8F3 5FOJB 1JW6A 1DU0A 1X3UA 3WEZA 1F4HA 1NE4A 1ND2B 1BMV1 2YB7A 1OUSA 1SD6A 2FBKA 4QWNA 2L9NA 1ZG5A 4LBKA 4CPBA 3NV3A 4XIOA 3FC0A 3C18A 4DUVA 1G9CA 4P9LA 1FX5A 1LJ7A 1U5YA 2CWMA 4W6YA 2VIXA 4HKOA 1WZXA 4ZXEA 3AG2H 5DZEA 4BQNA 4PF1A 4N53C 1MEC2 3K70C 1YI7A 4Q4V1 5EF6A 5IY5H 2KZVA 1GV5A 3AVRA 2R073 1K79A 5FR3A 5JZGC 4P02B 1OQEA 4YEJA 3SXYA 4H7LA 1QH7A 4E7LA 1FYKA 4ES9A 4CH7A 3FUQA 5GADJ 1RUD2 3E3VA 2GZWA 1B72A 2XVKA 2MLKA 4BXXJ 2EALA 2EILH 5FZFA 2TBVA 1HX6A 4CEYA 3IL2A 1FMD3 1W2TA 4BNCA 1V9U1 2ELHA 5FKKA 1BEV2 3DTKA 5FZ7A 3DCFA 1CQTA 4OWRB 5IAXA 1SPPA 1XMAA 1TWGJ 3THTA 5A3UA 4BE2A 3PVOA 2XSDC 1I3HA 5FXWA 1QBJA 3BI3A 1FYLA 1S0FA 1TEIA 2ADUA 4O3MA 4C91A 2HXIA 2VOKA 4LO7A 1AXZA 1FP1D 4CDXB 3DKYA 5E20A 5C70A 3HEFA 2A6TA 1A5JA 3TOJA 1X1DA 1RUC3 1X8MA 5IVJA 3CC7I 1ND3B 1YFYA 1WMDA 3LQRA 4ZTJA 3D5SC 4IGQA 4CCLA 3Q0VA 4PUSA 4JGYA 2RG4A 4YWAA 5HDGA 2BWCA 5IK8A 3WW4A 2UV1A 4OCTA 1OURA 4UW4A 1C5IA 1RUC2 1TT0A 2HZTA 5A33A 3EYIA 3QWLA 2EAAA 5IK4A 2CQNA 4ES8A 3H3ZA 3PQJA 3CJIB 1ZBE3 2ES3A 1HBXG 4IHWA 1LU2A 3UNPA 2VKVA 2NNNA 4ZZDA 2HWC1 1W0TA 5LB6A 4DFSA 3ZMOA 1MZBA 4PDWC 3BGAA 1BJZA 3B01A 2C1FA 4D7YA 1V9U3 4Y17A 4XCBA 4LG0B 4LUMA 5C5UA 3QPTA 4ITVA 2Y48A 1W36C 1XSQA 1VR3A 1XXNA 1PM4A 5ACA2 3F72A 3DBLB 5BNNC 1O91A 3EUKL 3KT7A 5M5YJ 4I02A 4XAAA 1SACA 3GWZA 4XZUG 3Q9SA 4EN7B 3HJEA 3SEZA 3H0OA 1MNEA 2L7KA 2DT6A 4G6QA 1OCOH 5CJ9A 5C3EJ 3RYKA 4UFHA 2DVFA 1RIOH 4Y20B 2ZX3A 4CA0A 1NCRB 4IL6C 2FDHA 4AVZA 1RR8C 3S17J 4FPOB 4G12A 1S6LA 2F5CA 2QM3A 5J8CA 1BC8C 4B3NA 2JG9C 3CU7A 3BC8A 5KXCA 2ZOEB 3AG1H 4DYRA 2V9VA 1R1A1 3DPRA 2DCKA 3MFKA 3MIFA 3T2PA 4HSRA 2QYOA 1EPZA 4XUTA 4A3MJ 3S1RJ 2DJNA 3BTJA 4C2TA 2L9SA 3VZMA 1OUXA 1HSJA 4TWTA 1HIXA 4RAGA 1Z0XA 1W3VA 2OZ6A 1SC7A 3HRMA 3PQKA 3OYGA 3ULQB 5A3LA 1BK1A 1VQ5I 3LSHA 4LBOA 4DW6A 2E7TA 4K40A 5K7PA 3NJZA 3ZVXA 4M73A 3ZFGB 4CU8A 2KRCA 3WD5A 1JKOC 1W90A 4E8CA 1P2FA 2JE8A 3G3ZA 3GYDA 5FUNA 5ILSA 1J3PA 3WG9A 1XS9A 3MUY1 2EIEA 3UETA 2CRGA 3TNPB 3CCUI 3W9AA 5IVEA 3ECQA 2NLRA 2BY1A 5GAEJ 5BQTA 2PAEA 2WNOA 4JHZA 4QXBA 1F5TA 4E70A 3CUQB 3HTSB 4CPBD 4OHYA 4EJTA 4I0WB 4WWCA 2EJRA 1J2XA 4H55A 5FZ1A 4LUKA 4MFDA 4W97A 2GMEA 1W6MB 4LKEA 4WBBA 2VNGA 4GYGA 3N97A 1HSTA 2C26A 1HJGA 4DRVA 1UAAA 3HG9A 5F08A 1C57A 2Y38A 3MFAA 1ZGAA 2GDFA 3KPHA 2IXCA 3ACHA 1ND2C 1O8SA 4X8PA 3BPZA 4Q2FA 1BBT3 1YIJI 4Y20A 3NJXA 1FMD1 1NCRA 4G94A 3AMPA 1MDMB 1RJ8A 3ZIWA 3DU5A 4Y1ZA 4NUBA 1LDJA 3ASNH 1R36A 1C3HA 4S04A 2XF6A 1PDNC 2XB6C 4CP0A 3D1NI 2DCZA 3VEPA 4RS8A 3A0KA 3WTWC 1UD1A 4CEYC 3GO5A 2NP0A 5FY9A 1LODA 4BEHB 3CO7C 1K5MA 2E7XA 5GTHC 3JD73 2XB5A 3PUBA 4RHV2 2VCCA 2VZTA 5DV5A 1K6YA 2DVDA 3RI4A 3HHGA 1PO23 3PU3A 3EUAA 1XQNA 4MXVA 4M6XA 3C7EA 4BQOA 4HQMA 1S7EA 4BJ6C 5AIPA 4ETSA 4DXTA 3MV11 5IOZA 2WWYA 3BTCA 2RV8A 5FKOA 2KDOA 2XVCA 3N9PA 2W87A 5K4LA 4E7HA 3DU6A 3GZUC 1VBE1 4MQVA 3FXRA 1SVOA 4D69A 4MXWA 2HOEA 3H35A 3LQQA 3H3LA 3VBUB 4QGMA 3W6VA 3AKPA 1D5VA 4ET7A 1S2BA 3NVCA 4PFPA 3HM5A 5FFZA 3CMYA 3KD4A 2XJRA 1H8TC 4NB5A 4OLLA 4UXNA 4TLGA 3O1OA 4OOIA 3VB2A 1SFKA 3ZQ7A 1F35A 4NDLA 2JKXA 3HPHA 1ZRCA 1JT0A 3AL5A 4CICA 4OIQF 3LOCA 4RA2A 4KQ7A 4HSJA 2CYYA 5HLHA 3WQ1A 1PMHX 2BY0A 1F5FA 4Y5SA 1MZEA 3RJPA 1HRV1 4O7XA 3RZJA 2HWB2 3EB7A 2NXNB 5GZEA 4NWWA 2VUDA 2HEYF 4GH4A 2XAHA 2K02A 1ZZCA 3NV4A 1HXS2 1SBFA 2BVBA 1AOYA 1VIWB 1JOPA 2XVLA 1V5EA 3HSRA 3PNAA 4X8NA 1PGL1 1MS8A 1DPUA 4FFGA 2Q1ZB 2DUOA 1GNHA 4LO5B 3QPLA 5FPBA 1A04A 2VLAA 3RQ0A 1K83J 5BMZA 1QA6A 4FFFA 4GMP3 4RR3C 1BK0A 1LULA 5C4XJ 2WY8Q 3MFCA 3WY6A 5F9TA 2IVJA 4HONA 5HLGA 4A3IJ 1K3IA 4IRGA 1EKEA 2B4KA 4O9GA 3K1NA 4RSUA 3BOWA 3PIGA 2JT1A 4HNTA 1OD3A 4XQDA 4IXAA 4CZZA 2VBZA 4XAEA 1A6IA 4BA6A 4FPJA 1SQ4A 3HOBA 2CV2A 1GDTA 5FP7A 4LITA 2GC3A 1KGYA 2AR6A 4DNYA 4K8RB 1FWZA 2CUJA 2PMUA 3HDDA 2DN0A 3UNGC 2VULA 5T52A 4AFCA 4PCQA 3B9CA 2L4MA 3DBRB 3BVCA 3IM0A 3FK6A 1LU1A 4XN0A 3ZN6A 4D7NA 3DTEA 3H36A 3KQRA 3QPSA 1MS1A 4NIAA 3CCLI 3K4JA 1TWAJ 2AH2A 2NVTJ 4BXSV 2RREA 3CESA 1Y8QB 2JRTA 1KU2A 4P9UA 2XAGA 3USUB 4GWMA 5JIUA 1VE0A 2XGCA 4ZXKA 3WTVC 5EFUA 1XE7A 2AEYA 1NCQC 3CJQB 1IW7F 1AR92 1QJX1 1TNTA 1AYM1 3OYCA 4Q5SF 2XDVA 4X6QB 3WZ1A 5IYYA 3S14J 3K4MA 1S0BA 1IZ1A 2OU2A 2HYKA 4RS5A 1WUVA 4KN7X 2VTFA 2O8XA 4G7ZF 1AXYA 3KP7A 4QM8A 3WTSC 3VYRB 2PBIA 3M3IA 3OBTA 3I49A 4LBMA 4A6SA 4S0HB 3DFGA 1YJNI 5DS9A 1JKPC 1R1VA 3S0MA 4M74A 4KIFA 1LQ1A 3K70D 3SEPA 3TEXA 3TN92 4P14A 2EIMH 5B5EC 4HETA 3Q0UA 3OOUA 1VTNC 2CAVA 1TP4A 4DZJA 3SDGA 1HB4A 3I3EA 4GB33 4M3CB 3SKJE 3S5AA 4UHTA 1GBGA 1PIV3 3BTYA 3M8JA 1NT0A 2B9SA 2WL1A 2YBPA 2MLGA 4U0WA 1QDCA 3OYWB 1ZNPA 2IGNA 2Y30A 3ELKA 4LK0F 3AL0B 5FOBB 4QHZA 1H88C 4AFAA 4EYUA 4RB3C 1ST8A 3A01A 1ZELA 4HBNA 3DECA 4G9SB 3E7LA 2DFIA 5BXXA 3K4BA 4TSVA 1UXZA 1Q8OA 5HNHA 3TP0A 4NRQA 1OR7C 4LGWA 1H8VA 2VKDA 4P9GA 4ZZ5A 3RI9A 4YZ5A 2C6YA 1D4M2 3VGIA 5A7WA 5HLIA 3JAMZ 2D6KA 1XN7A 4GMP0 3O0WA 1ZG3A 4N4NB 1U2WA 4EJRA 3H9JA 5H20A 3J8F2 3ZKUA 1RUJ3 1XDSA 2W0XA 5FLVA 3C2UA 5CVUA 3MW3A 5K1YA 1O4XA 1BR2A 2RDNA 1LOBA 5KAFC 1QJU1 1R082 2IFWA 4LA3A 1S0GA 1CAUA 4IV1C 2ZMNA 4ZU4A 2TCTA 3D4KA 3JSOA 3WGHA 2R5YA 2QDNA 3NAPA 2UY9A 4PF5A 5ISLA 3GZ6A 3VN4A 2FQ4A 3CJTB 4YLZA 3B73A 3WOGA 4E7KA 1SDDB 1UY1A 3R05A 1G6NA 3D8CA 1VQPI 1FTZA 2E32A 2QBYB 5E1XA 1GP5A 2XR4A 3LA2A 4LA2A 4MOAA 2VZSA 4DEQA 3TYJA 4BQ3A 5T5PA 1YTYA 2OQ7A 4R4ZA 1DCSA 2ZGTA 3ZN5A 4J6GA 4YFWA 2WZR3 3W58A 3VKMA 5FB2A 1VB4A 1VP6A 1OR7A 4DQ2A 1UKRA 4XORA 5IP7J 1DZRA 1QO0D 1RNLA 5FUPA 4OAZA 4EM1A 2D6NA 2P4EA 3I7DA 3VKOA 2FZ2A 4NNJA 4IV3A 4UFKA 4P9FA 1UPIA 4FAGA 4L0PA 1YLFA 2R041 4QPIB 1FPN1 5LEKA 2SLIA 5AFEA 1R5HA 5DAVA 3J7HA 2FDJA 2Z5WA 2J1AA 1BQPA 3NO8A 4OI2A 1D0YA 2CDOA 2W08A 4META 4Q26A 2DBBA 1N25A 4HOOA 5D4SA 2GIZA 5EG0A 5FROA 5HXMA 3LDRA 2XRLA 2VMEA 5CFCB 5HDNA 4LO6B 2PXJA 1VBC1 1YC61 1AA7A 4PLNA 3OWTA 3FZ3A 2ZBJA 2ESHA 3W5NA 1RETA 4BK4A 3N3HA 4NAOA 1YUDA 5LEJA 3GJBA 4NC6A 2XAJA 3TBIA 4A2UA 2WAAA 4EN9B 3CMEI 4O5VA 2E1CA 2MSYA 1HA8A 3HD8B 3RZMA 3BPVA 1U5XA 2V73A 2GALA 3ZSJA 1LPQA 3IMNA 2FDGA 3BG7A 2E7AA 5EJ1B 2DDBA 1GANA 3ZN4A 2VUAA 1EH6A 2DTYA 4A0XA 5C3QA 2AO9A 1OPOA 3BZCA 5GZGA 2I8DA 4WXDA 1BI3A 3PUHA 2FMYA 1IF1A 1A8DA 2A05A 4ARXA 3OY8B 3OGSA 2XLAA 3U1XA 1OI6A 1EUTA 4KG8A 4PJ0C 4XK4A 3T8RA 4Q0SA 4AI3A 3CZ6A 2B39A 4R8HA 1DQ4A 2RHPA 2E2IJ 3VKNA 4QPGA 4YFKF 2WN3A 3V64A 3WE3A 1ENXA 2XPJA 5H9SA 1R4NB 4Q5OA 5KHIA 4ESBA 2AXTC 3BUCA 4Q4X3 5FCCA 1K61A 2JA8J 2R7ZJ 2V4AA 3SC7X 1Y6IA 5J3LA 2YGLA 3MPPG 4EMSA 1ODMA 1D8KA 4XF0A 4YVSC 2ZGOA 1R00A 4FXKB 3CZJA 1WD4A 1BL0A 3J7ZI 2FNPA 2KFDA 1KEXA 4A3DJ 1T6BX 5LCWL 3ZMTA 3O0XA 4N43C 5LA0A 3QODA 1W8FA 3ZYIB 3QYFA 1MSFC 2HWF2 5C4WA 3EQLF 3ABMH 4A5NA 1GZ9A 1RUH1 4IW3A 4IHSA 5A70A 1XYNA 3I59B 5L7OB 1SLIA 2EIGA 1W8ZA 1YRNA 2HWC3 3K4LA 3M07A 2R7FA 1GZWB 3ZLIA 4YM0A 1CAWA 1LDDA 2WT1A 4BXFA 1OSGA 2DA5A 4GJYA 1OCRH 1IDYA 5DG1A 1QJU3 2GAUA 4GGGA 4J1WA 3M1CA 3I54A 4B8EA 3OYNA 1R1TA 3QYBA 1EAH3 1HLCA 2O8KA 3H8RA 3DLLF 4XL9A 4AEDB 3BZKA 2FDKA 4HXCA 4CDWA 4M72A 1DQ5A 5JSPA 4CXXA 2MEV2 2QQBA 2PJRB 1QDOA 1SLAA 2E7WA 4LLNA 1CPMA 4LO8A 5ABJC 2XROA 2R92J 2K46A 2VM9A 3WG7H 4CXYA 3HNMA 1PO11 2WO7A 1XSDA 1XB9A 5AC93 2IJLA 1KFUL 1NKGA 2ZPXA 3Q5FA 1RTVA 1PUEE 1G86A 2VR4A 1QQP1 3I58A 1JZ7A 1O3TA 1QGLA 2FBHA 3V0AA 4RBOA 1X1CA 2W47A 1YO8A 1B4AA 1ENQA 1W6NB 3H7YA 4A3KJ 2W1SA 2ZACA 4F3JA 3HT1A 2CHHA 3LAGA 2LRDA 4AU7A 3URFA 4I30A 5JLXA 3OYJA 1ZZBA 3IBMA 5IYBJ 2EVXA 2X1DA 2C9AA 4BJ0A 5J98B 5AC91 5DCMA 2IPQX 1W5CC 4HBLA 5E3MA 3FHZA 1SFYA 4AGGA 5FZ8A 4NIDA 2FOKA 1IRZA 1YNAA 4OHWA 2K40A 1W6OA 4BIOA 1DQ1A 3BTLA 4IHYA 2YXSA 5D6EA 1KQRA 3IH3A 1FSHA 2XWBB 3ZR8X 3OB8A 3M3QA 1LHWA 1OYIA 3AX4A 3RKQA 1RUH3 2JXAA 2ZEWA 3OS0A 1NYWA 1JHHA 2EIBA 2VZVA 1UU5A 3BQYA 3BJAA 5CKQA 2LG4A 1J1TA 5LBBA 1ZYRF 5D5VB 1BBT1 1ZBA3 5EEHA 4KL1A 1OT5A 2RQPA 2VXZA 1MVEA 4AC0A 1FV2A 1H6XA 4ZS2A 2HQRA 5FY0A 5F64A 1RR7A 1DHKB 1C8M2 1ZX5A 2RM21 5D8LB 3VBUC 2DCJA 3THPA 3DXTA 2D3SA 1G9AA 2JIJA 2QSGX 4FPCA 3HNBM 2VI6A 4CUGA 2H8WA 1F15A 5JI7A 2WQ4A 3WW2A 2NVYJ 1HV0A 1GHCA 2W1OA 3RFRA 5A32A 1VQNI 3LZZA 1PK6C 2QJVA 2B7YA 4NHLA 3H8UA 4LO4B 2ARCA 5FY8A 1M06G 4JKLA 1YHFA 2E51A 2W48A 2Q8EA 3L2WA 4FISA 4LBNA 4BCUA 1F5JA 5FYHA 5DUXA 2YU3A 3ZR5A 3V8LA 3AB0A 4AUXA 4RB2C 4E4ZA 4L5IA 2PN5A 3ILRA 4UFIA 4AIHA 1J84A 2BWAA 5E17F 5GPCA 2RMU1 2RS52 2OTLI 5ERLA 4AQTA 5J48A 3H9AA 1CAVB 4DZPA 2LY2A 3BG6A 4JX5A 3N36A 3PL0A 1GMMA 4I0BA 4E2SA 1KDMA 2CW8A 2DXIA 1V55H 1LOEA 5L7OC 1KDKA 3O1UA 1FNYA 1K12A 2YFZA 3D0SA 4PBOA 2ZMKA 1N3PA 1TWFJ 5JVGF 1TME1 4Z07A 4D0PA 5C9AA 2QLZA 5A7SA 3CCYA 1B6AA 2VE1A 4XFHA 1HDPA 1WLWA 2VQTA 4QTRA 1U6GA 1OKQA 2VMFA 3I2IA 2EV5A 2RJ2A 1RXFA 4KU8A 2P0WA 2W9XA 2EXJA 3ZMZA 1YQCA 4XBLA 3VBSC 1K78B 4JZRA 4L9NA 2IWGB 3SZPA 1XE8A 4R9BA 2IBDA 2DVAA 5DN2A 3U07A 3JTGA 2VVEA 3KV6A 4G3YC 1XB4A 1V4RA 4LNVA 4M3FA 4I7HA 4HK9A 4BIFA 1V54H 2CYFA 3VUOA 4Y4YA 5JR3A 4YZ2A 2TDXA 2PTMA 4XDOA 3ORJA 2MABA 3H5NA 4C30A 4BACA 4ENNA 2GNBA 4Q4W2 3ABKH 4MHRA 4UW3A 2VQ0A 2XAFA 2HWE1 4ZY9A 4FX0A 4TXWA 1X50A 3LSPA 3L09A 1PZ8A 1QKQA 4IQJA 4HLTA 4IHTA 4M6YA 3WE2A 3CQZJ 3TO9A 2WFPA 3AYAA 2D6MA 4KMQA 2JRMA 4JDNA 3EXUA 2R043 1G3WA 2DA2A 3W21A 1RZ4A 4BHCA 1FNZA 2XBO1 1P4WA 1VBA2 2W7NA 3LSMA 5F1RA 1SBDA 3MAJA 1SVMA 1NY71 3FKJA 1W8OA 2R062 5E79C 3OY8A 5HNFA 5M3MJ 2FOWA 4NHJA 3FBIB 4HKLA 3WW1A 1O57A 3ZXLA 2VN2A 2VMIA 1PZ7A 2P37A 3CL1A 2I10A 5IT3A 3OTFA 2VMGA 3OPTA 3CJNA 3JXSA 1X36A 2K9SA 2XGXA 1V70A 2VNOA 2BOJA 2VG9A 1JXNA 1UMHA 4V19K 1ZM1A 3AKQA 1RUJ1 3M4FA 4WM8A 2WNUC 3LPFA 4KT6A 3WNKA 4ZYGA 3HRTA 4YIRX 3HOYJ 1VBB3 4UAPA 1W9WA 1HKTA 1UYZA 3REOA 1JTYA 1BKZA 2CMPA 3VBHB 4ZDPA 4QX3A 3CUQA 4TZDA 3ZFFB 2BFUL 4CU9A 3IT8A 3AL0C 1YFXA 3DTIA 5JUVA 1CAXB 2OX0A 3ZYGA 2QQIA 2PI0A 1B1BA 3G6EI 3A21A 2NYYA 2UXNA 2VVFA 3K69A 3LFUA 2C24A 5JCTA 2RJKA 1MD0A 1MS0A 3MIEA 1FOKA 2UWMA 3O2PE 5M3FJ 2WNEA 1BLZA 4Q4Y3 1LESA 2DK8A 1NLRA 5E8GA 4F52A 3KV5A 3ZYBA 4AIDA 2V7FA 3KSCA 3VHPA 5GZDA 1OLTA 5A7PA 2ZFUA 4B4RA 2QNKA 2XASA 1Q43A 4XVHA 4YGBA 3POEA 2X85A 1FI2A 3BR3A 1S8NA 5FD5A 5LATA 2XL7A 3DL3A 2AQFA 2DDUA 1FIPA 1ZRIA 4UF0A 1EV11 5EQUA 1GV9A 2ZXIA 2QQAA 4U0YA 3C3WA 2KR2A 3HVDA 1DGWX 3C2HA 1DGLA 5CFDB 3VYSB 4TN7A 1GZWA 1TNRA 3K4DA 4A4AA 3W5MA 4E4DX 3K4NA 4ASLA 1F9KA 3KGLA 2PJRA 1YQ5A 4IDZA 3RZKA 1NA1A 1VNDA 4YZ4A 2A68F 3KYDB 4DPNA 3UYJA 3HL2A 2H0VA 1I5ZA 4AVBA 4ATFA 3GJAA 2PHTA 4FCYA 3ACIA 1X19A 3CLQA 4E9KA 4QX8A 3KZ4C 5F04A 4RFRB 3L00A 4QX7A 3GZ5A 2VMDA 4ZC3A 3IIAA 3U4SA 4AHZA 4B7EA 4PQQA 2JB8A 4LBQB 5T5JA 1O3SA 1U5TA 3WP6A 3WF0A 3TOBA 5JSOA 4Q27A 4CP1A 2O03A 1MIJA 4II2A 3F2ZA 3WTZA 1PGW1 1IKPA 3MO4A 3ON7A 2DA3A 2HEVF 1WKYA 3ZFEB 3POBA 2CS3A 5CPRB 4NPMA 3BOQA 5CVIA 4BPZA 1EH8A 3W59A 5GAGJ 1RUNA 3BG5A 4K8FA 3TP3A 1CONA 4D3WA 3G2BA 4CUAA 4RR3B 3W6KB 3HPGA 2HI3A 2B5HA 1PVC3 4A3ZA 2I5UA 3ZXKA 3GUDA 4PLOA 1WFXA 2E26A 4AFMA 1W4MA 4QDQA 4SLIA 3OGVA 4EZHA 2RAEA 1I6HJ 5C3SA 2DT5A 3V7RA 3CCQI 1W7PD 1ZTRA 4W65A 2CUEA 3AYEA 1QJY2 4XLAA 2YZ4A 3VD3A 3MW4A 3GBGA 3OSGA 4MV2A 2L7MP 5EG0B 1IS5A 1YYVA 3CD6I 5DUWA 1LJ9A 2E31A 2R7QA 1RUD3 5EJ3A 3WQ7A 1H1IA 1ULFA 3UJOA 2WS91 2KMUA 3GCWA 2NNYA 4J01A 1X1BA 3POFA 4FXGB 4QPWA 1WHUA 4IE6A 2D5FA 1Z7S1 1IV6A 3LMMA 1HDDC 1ZGWA 1W03A 2WABA 4JGYC 4L11A 5IP6A 3GTKJ 5HCFA 1LEAA 1DFQA 4Q8LA 4Z2WA 2ZXHA 3VDDC 3KIOA 4V2FA 3HBKA 2FCUA 4BKXA 4RD7A 3W2AA 4AYBA 2FBIA 1OF4A 2XHKA 1PGSA 4Q4X1 4GZ9A 1MKMA 4A45A 2BNMA 1UJ8A 5DDJ3 1JHFA 3PIOF 2EV6A 2VBPA 4BL0B 1W2UA 1UZ0A 3WG2A 3WF1A 5APAA 3FFZA 2NM1A 1DDNA 4IOAF 2DU9A 1WI3A 4NVPA 4Z2AA 1WRJA 2QQMA 3BP8A 4C2MJ 1MW7A 2W68A 4M3CF 2ZGSA 2K4JA 3CCJI 1H2KA 4GB31 1RMU3 1ZN2A 1ZH5A 2W91A 4W4ZA 2WO1A 4UYBA 1JZ4A 3KLSA 5C3RA 2CAUA 1ZVFA 2TUNA 3L9JT 2HEWF 4UVCA 2R32A 4WM7B 3S30A 5F27A 3CJRB 3ALQA 1YO5C 5LY2A 1JJ6C 3IAQA 1IGOA 2Q0AA 4QIWN 5J1UA 1VAMA 4LHNA 1GOHA 2UWBA 4RL7A 3FF5A 3OUIA 2A3YA 2JDNA 2ZZJA 1IQDC 2ZJCA 2XF7A 3ZFFC 4RQPB 1TTYA 2DVGA 4RB0A 4XM3A 2FF4A 4A3FJ 2Q5TA 3FLRA 3FZVA 5CVVA 1HW5A 5IOYA 4KH9A 2AACA 3S2DJ 2D93A 2STTA 1A8MA 4KIGA 4QU1A 1UZVA 3BODA 2VUCA 2P2KA 4IEWA 2XC7A 1X8EA 2BHYA 3G73A 4KMFA 3ZXAC 4A5MA 4U2AA 1P7JA 4F3QA 2VZOA 4AVAA 3V7CA 2VB6A 1WBFA 1ZZ8A 1LGCA 1S1AA 4H7MA 2R7VA 1HXDA 5JFRA 1NXMA 3I64A 2RS31 5A80A 3F22A 4MG2A 2Z4FA 2EFOA 1Y3TA 1YIFA 1BIBA 1OA2A 2CSGA 3WG4A 4RM2A 1VBA3 1HQNA 1KZHA 3BU0A 1DP7P 1TMF2 4C3JJ 1FXZA 4Y15A 1FIAA 1U0AA 5IK7A 3I8TA 5SV8A 2QKMB 5FY1A 5J6XA 4JTNA 4GRIA 1QIQA 2RS33 1ND3A 3VD9A 3U75A 1V0AA 1EA3A 2W92A 1QPMA 2XIGA 3H5AA 3M1HA 2DA4A 2JJ7A 1JGGA 4BZ4A 4PGHA 3BIWE 5DUIA 1TNFA 2A1XA 1QXRA 2WYFA 2OAZA 3WXPA 2JA2A 1QU0A 1LHVA 3WSOA 1EV13 2Y0MA 4L0ZB 2R6QA 1GR3A 1MVQA 2YX7A 4P9JA 4BWOA 3VBSB 1O59A 5LBCA 5HLTA 4LBQD 1JYIA 1A3KA 3PVNA 5EEAA 3T09A 2J1TA 2H94A 4FETA 2W1QA 1STZA 2Q8OA 4QPGC 4KYWA 1ULGA 1V6OA 3FXKA 3FXMA 3ML6A 4QKDA 1IN7A 2BOLA 2O61A 4B4QA 2ECCA 4UY8I 4RAZA 3JRGA 1BOAA 1XSXA 4H2AA 1A34A 3K2ZA 1PM7A 5A6YA 1H0BA 5DUUA 5FLXK 4B8XA 3BG3A 4KBZA 1BMV2 4HLYA 3E6CC 2XL9A 4Q0UA 1WQ2A 1D2QA 4DY5A 2NQYA 1B35C 4B43A 5KC6A 3BR0A 2EZLA 2JPBA 5FLHA 2VQHA 3Q8CA 1I50J 2GXBA 3ABZA 5FZOB 1DQUA 3MCZA 1IDZA 1UWWA 3FXQA 1FTTA 2HZDA 3WR0A 3DEWA 1HN1A 3KZZA 3UJQA 1HCRA 1MEC1 4NR1A 1PJRA 4YW2A 2HBUA 5IW0A 1FMVA 4AVCA 3HBLA 1X9TA 2R5ZB 4A42A 4IZZA 1RITA 2QCSB 3KCXA 4KT5C 2VECA 5JXIA 5J1RA 3AMQA 4FFHA 4QQ2A 4A0ZA 4PCRA 4IHVA 2W85A 1ULPA 3TAYA 2ARBA 1AX1A 2MFZA 1D4M3 4N90A 4UV9A 2WNVC 1LOCA 1G9BA 2E7QA 2L9VA 5GALA 2HQNA 4UVBA 2OD5A 1ZLJA 1Z78A 1MJBA 1GLNA 1LEBA 3PMEA 3IB3A 3DEEA 3L2HA 2RR11 5FFXA 1GXPA 3UKVA 1R64A 3DXJF 4EEFG 3BPXA 4KWUA 2Z16A 1MMDA 4XLEA 2ZGQA 1PVC1 4LJHA 2P4WA 2YC0A 4UWDA 3ZYRA 2WC2A 1P4XA 1SD7A 5J4YA 2PLYA 4D6SA 3OEAA 2G0EA 1TWCJ 4XNFA 5B66C 2R063 3AKZA 4YZ1A 1HW1A 5DZFA 5ILVA 3VZLA 4BQAA 5FUIA 4Q48A 1DQ2A 1F9NA 3O0VA 4FQZA 1IS4A 4LJZF 2VW0A 1R22A 2Q4SA 5LY1A 4HZFA 5FXXA 4OUMA 3U14A 5GAHJ 1XGSA 2WN2A 1ZBA1 2GC1A 4PQ9A 2WQ8A 3ZPOA 1TWHJ 2ZSIB 1J59A 3U1DA 3CJXA 3ZR6A 5C9AB 1X9PA 4ZZLA 3AG3H 2J1SA 2JVGA 5LK7B 3VHOA 1XU1A 3LGRA 1ETOA 3J4UH 2GMMA 2DAOA 1APLC 5FYSA 2HDWA 1CJDA 4N7UA 3SQOA 3L2RA 4R9CA 1E5HA 2BOIA 1R9TJ 4XC9A 3OY9A 1ORKA 4M3CA 2OT7A 5L9BA 2VQCA 4IEJA 1O7FA 1RUF2 4EN0A 4A6OA 3B02A 5FZAA 4YRDA 4B1LA 1AZDA 4CXFA 1GQHA 1ONAA 4Q1PA 5J4VA 1TW2A 3DBHB 4LOSA 2P8TA 2H6CA 5ABJB 2A5WA 2OQGA 1T95A 2YPRA 2CDPA 4Y1UA 1QNTA 5J40A 1OBNA 1IRGA 4DBRA 2GN7A 1VBD3 3NQOA 5HBAA 5FPUA 2WLPA 3Q3SA 2NOGA 5BNPC 5M5XJ 4XBQA 2QUOA 2Z2SB 1C5HA 3LNQA 1W6PB 1KQ0A 2D45A 1VZ0A 2E53A 3EHKA 4OHZA 2IGKA 2XWJB 3GZEA 2X5IB 2OKXA 1JKQC 3DKQA 2BBYA 1X1AA 1MS3A 5IFPA 1MBKA 3N7KA 2VXDA 3RSNA 2ZA9A 4XIDA 1JXSA 2HVSA 2VAUA 1CR7A 4H14A 1B59A 5FO8B 1U5ZA 4XLNF 1LOFA 5BPDA 2A6YA 2BFUS 1S9HA 5A7OA 3ABUA 3COAC 3JBG3 5FJ8J 4R52A 5FZHA 1Z3XA 1N1SA 4WM7A 3H0GJ 1MS9A 2Q1FA 5FMOL 2HWF3 4QQLA 3ZM8A 5JVVA 1DUXC 3IUOA 4MTEA 4FPYA 1S29A 3RZGA 4AYBN 1SZBA 2QBYA 1JBCA 2WINB 3TWIA 4XTMA 2OQ6A 1D2SA 2Y0SN 2YHJA 3LSEA 3AKTA 2F17A 2VBBA 3HTUA 2EH3A 4Y1VA 3U2RA 3UKGA 4LEJA 4ZHNA 4ANJA 2QENA 2BNOA 1G3TA 1RUE2 3K4ZA 5FK8A 1MMSA 3P9CA 3T08A 4JRLA 4HT1T 3MLJA 4KU7A 3C7FA 2KQRA 2K2SA 5FYMA 3H3VK 5LBQA 3SITA 1Q8QA 3FN9A 2UYAA 1Y9MA 3QLQA 2DQLA 2JD9A 3CO2A 4UV8A 3POJA 1IG3A 3I2FA 4XMAA 4NQWA 1ETXA 4IUGA 3A4CA 4HF1A 4YFNF 1NK2P 5D8AC 1AR72 1X1PA 1JYVA 4XBNA 4JAAA 4RGUA 2WAEA 2X5IC 3WLUA 1RKWA 2Z33A 1XC6A 3H8XA 4JX0A 2EA4A 3H9GA 3LB9A 4I3PA 1N3QA 1QRYA 2K3FA 3ESWB 4Y1XA 4IQ4A 3H1CA 1RVF3 5LHIA 4ZU7A 4L0YB 2VXJA 3CCSI 1VQ6I 2A6VA 1O7LA 1FY7A 1UN1A 3AMHA 5KAIC 2L9RA 2BGPA 5F6LB 1QXPA 2WNVA 2EXKA 3S7EA 2Y34A 1IOAA 4R9DA 4D6QA 3KMHA 3DN7A 4II3A 4HX8A 4LHSA 3TEWA 2A6XA 4MH0E 3MMYB 4B3XA 2CWEA 2OZUA 5JOXA 4BS9A 4G7OF 1D0ZA 2RGVA 2O0OA 3J7NA 5FTTC 2ZHLA 1QHHD 1WJBA 1TQPA 3VHRA 3CUOA 1J7KA 4PT6A 1Z1DA 2IZWA 3K77A 1K42A 4O6JA 4OU0A 2DBNA 2CV6A 1AYN1 4LHLA 2KPMA 1JZ8A 4MIMA 3V4GA 3A01B 4IVNA 2QZ2A 2EB7A 2WQZC 2QGUA 3I2JA 1POQA 2L54A 1PVXA 3M3YJ 3WDYA 5J1YA 5E3NA 3IDBB 2CNAA 3SXWA 3FLTA 2ZHNA 4CYCA 1IN6A 5GLVA 1X3WB 2VCBA 2VONA 2X48A 1AR82 2R1BA 5EZHA 5JPNB 2KIUA 3RYRA 2OZJA 2PLV2 2M5WA 4B44A 3HAGA 3G6JB 3WP5A 2ZFWA 4RYDA 2YU9J 2PYTA 2A61A 4YSFA 3JQWA 5L7OA 4XBFA 3GXUA 1ONVA 3JSPA 1N47A 1VB2A 4IHXA 4A3EJ 2HWB1 1XGNA 4A6DA 4AEJA 4UXAA 4HX7A 1K7AA 1S0JA 1IUYA 4RHV3 5K5QA 4QKBA 2GC0A 3PUIA 3KHBA 5IP9J 1OCZH 1VAVA 3I2OA 4NIHA 2PELA 1OFNA 3M3EA 5A1AA 5FRNA 2RR13 4NJ4A 3IH2A 2ZJQF 1RUI2 3CJIA 1UELB 4LBLA 4Y13A 1Z0HA 4H3WA 2JK3A 1YI2I 3S6PA 2CFOA 2R4GA 1XCBA 3PFIA 1SEFA 2R0FA 1YIPA 2E71A 5J36A 1XNTA 2P7CB 3RZHA 3DGTA 5KXDA 1P9QC 1B9NA 5A1FA 2PMWB 3O14A 1SFUA 5H2FC 1RUG3 3S2WA 4BH9A 2Z3YA 1ZZ9A 5K7ZA 5EDNA 3TL4X 2IFRA 3NWTA 4ZDLA 3VBHC 1U9OA 3T2TA 2K7LA 2JICA 5IVFA 1VRH2 1ITYA 1TMF3 4PFOA 4HAMA 3TKYA 5EJCA 4EVIA 3P6BA 5KBFA 1J09A 3LD8A 2IEKA 4MXWB 1WBLA 1MZ6A 4XJ9A 5CYYA 5SV5A 4LORA 2XJTA 2RDRA 3IHUA 2B9VA 4DQAA 2O5RA 3HB9A 1JI6A 2D1HA 5EV7A 2Y6LA 2UY8A 1I27A 2PFBA 3GZTB 2JDMA 3E1SA 3KB5A 4XPVA 3L2QA 2RE9A 5H6QA 1F1ZA 1VF9A 3JQXA 1OMIA 2EA2A 3LSTA 4JK1X 3PO3J 4IEPA 2ECBA 2HYJA 2VOXA 3GYHX 4IE4A 1BR1A 4YVWB 4OI0A 3VZNA 1LUJB 2FZ1A 3LL7A 5A3NA 1LKXA 1FOD2 3BTZA 2QZ3A 4AWXB 5CFCC 2VD7A 1R5ID 2Y0OA 3TN93 3U21A 5IPAA 2RKHA 1RUC1 4Q29A 3HMYA 4OMCA 3T0AA 3H3UA 1PIV1 2FE3A 3I3MA 4M9XA 5HCBA 2Q30A 2VZQA 5FBJA 4AHWA 2CQXA 4A7YA 4EJWA 1X2MA 4HMZA 2YC2A 1D0HA 4PZJA 2JDKA 2QSHX 2F4MB 4IV1A 3SH3A 1ZA4A 1W8UA 3DEMA 2P1BA 4NPLA 3GCMA 2X05A 5KWRA 4XCAA 3NL1A 2WDBA 2I45A 3S93A 1HN0A 1WCKA 3GBWA 4HL0A 3DPRB 1D0GA 4QXKA 4I6ZA 2ZMLA 4WVWA 4O61A 2P34A 1FYUA 4CYDA 2FDIA 4XF3A 4IV3C 2WAQA 3CO6C 4ZH4F 4A3JJ 2QQVA 5F5AA 4ZONA 4MGRA 4NHKA 3ZRGA 3QD6A 1IXSB 3HOVJ 3M8FA 2WNUB 2YDEA 3K3NA 3FHQA 2STWA 4P5YA 2VOTA 4MNUA 1YFHA 2X9DA 1CIYA 2CTVA 1W6MA 1NK3P 2WYSA 2QCOA 5FP9A 2WLQA 3NMBA 2VY0A 2CU5A 2VE9A 1JKRC 1RUG1 4OMYA 1QHDA 5DABA 5K5RA 5J3UA 4LE4A 1MS4A 2WZR2 4FPEA 3DEUA 3BKZA 3O1VA 3IMMA 3ZFEC 3C7GA 2H27A 2JDHA 1PUFA 2EV0A 1KITA 3ZIXA 2RS12 1WWYA 2A71A 2PEXA 3MKZA 4C3IJ 5HV4A 2YSRA 3V7SA 1RIRA 3JBG1 2FNAA 5GPAA 1A78A 1PX3A 3K3OA 4LK7A 2Y75A 3E5QA 2A6ZA 2A6WA 2ZCWA 2VGDA 4GJZA 2DMNA 1KJRA 3I2KA 2MYSA 4DNCA 1FC3A 1YRNB 4XW3A 3Q0WA 3QU3A 2BVLA 2GU9A 1UX6A 1DPRA 2M0MA 1GXQA 1Y8RB 5AFBA 1AR62 3N7MA 1UOBA 1U78A 4PGGA 3MF6A 4BJTA 2CGNA 2HKXA 3KVBA 4FI9A 3WU2C 3HKZN 5FLMJ 4FTHA 3VKFC 4EWAA 2EICA 1S55A 2HBTA 2YGMA 5F2WA 3MKWB 4GD4A 1VQLI 1YXWA 3K10A 4XUPA 1MDMA 4IEUA 1RMU1 1G8WA 2XXZA 2UWAA 5C44J 3OYWA 4HG2A 3JW4A 3T8TA 1WGXA 1K6OA 4CDQC 4RAFA 4RGXA 1OCCH 3LFMA 4YYOA 1IUFA 3RWNA 3QRFF 1ZR2A 1W7PA 1OISA 1VALA 2OVUA 1K5MB 1WJDA 1Y43B 3T0YA 2GSYA 2RV9A 2CJJA 1QH6A 3HUGA 1XU2A 2DO7A 2J1RA 1I1SA 3VZJA 4PJYA 2R7WA 3GHMA 4HN0A 3WTTC 4XFIA 5FYIA 1JN2P 5JHUA 2W5FA 3RKXA 1ODNA 2VJ5A 3G1OA 5A7WB 5T5LA 4N9IA 1W8WA 4YZ3A 1WCSA 3UESA 3HN1A 2V5YA 3KP5A 3GW2A 3LDKA 4UVAA 4FP3A 3UGHA 2OCEA 3THCA 3BJ6A 3FWEA 1WLDA 1HQCA 1Z91A 4AHXA 1BBYA 1CAUB 2VCMA 2RNJA 4CDXC 1W99A 4LIVA 1T38A 2ZX2A 3JD71 4DINB 4PJJA 1HV1A 1LE8A 4BAYA 2E60A 2BZDA 3NSTA 1NTCA 5BV6A 2ETHA 4COVA 2ATFA 1H8TB 2DFBA 2ZNZA 2GA2A 3G1LA 2Z42A 5E8IA 1KA8A 4PIYA 1OA4A 3LSGA 3PDQA 1FBSA 4BDYA 5A6QA 4I01A 1ENHA 1ZBE1 3FKIJ 4Y1YA 1JHJA 4Q4V3 3U78A 2EFNA 4WZFA 5JHFA 4M3DA 4YM2A 3U11A 4Q4Y2 3ACGA 2PHDA 2HR3A 3TDUC 3QAHA 1FOD3 2DPUA 2CSOA 2G1MA 1JUSA 2LD5A 4PIZA 4DO0A 3JCIA 2E35A 1BN5A 4TTGA 4OAYA 2LY9A 5F1JA 1CZSA 1HRV2 4DMIA 2RDQA 3MEXA 3R0RA 1AL22 1T0FC 5LHHA 2Q2EB 4QSHA 4MQ9F 2IVMA 1OF3A 5F37A 2EINH 1GLHA 1FATA 3LA3A 1O4ZA 1VJ2A 3F0CA 3R0JA 2DFFA 4OMDA 1AR83 4AE2A 2D6LX 1PGL2 1XYPA 3KP3A 1MPXA 2RJLA 3ZQCA 4COUA 1Q8SA 2P6TA 1N3OA 4BLJA 2BZTA 4Z82A 1HRV3 4XE9A 3V8KA 1YFUA 2ILMA 1J0RA 2J22A 5L3GA 5E6HA 1BW6A 4GULA 1BC7C 3A23A 1GQGA 2JUGA 2LBFB 1GWMA 1LOFC 3WINE 1YYNA 4YW6A 4XJUA 2HWB3 4WM7C 2ZKZA 4G7HF 5CNAA 2V6CA 4HANA 3PNTA 1K4SA 3WT3A 5JI9A 1TQIA 2FCTA 2HPIA 2W52A 3WHCA 2LUWA 4CDUC 5KVRA 3K9TA 2EPFA 3SH5A 3ZDVA 4XQ4A 3L2VA 2BNNA 2WAFA 5C71A 3BR6A 3EYYA 5H9PA 2GIVA 4MGYE 3WTXC 3N7JA 4LK1F 3ZQIA 3JRBA 2VODA 1AJOA 4AI9A 4BXUA 1IXRC 2HTJA 4CO8A 3ILNA 3HPNA 4P9IA 3WP3A 1PO22 3O6BB 5FRAA 1VMFA 2ID4A 2RVCA 1SFXA 2XG3A 1ASJ2 1RUD1 4KJZA 1A31A 4DGWB 2A73B 2RQQA 4JBAA 2F5VA 1ND2A 3MICA 5A6XA 1QQP2 1ULEA 4WVMB 3CDZB 3PL8A 1J83A 5T54A 1PMIA 3MW2A 2JG8A 4QLCU 1HRI2 2ZX1A 2Y6GA 4CE8A 3W3CA 1GWLA 2YMZA 5CG9A 4NC8A 3SFZA 2K27A 2HEOA 2DA7A 4HF2A 2K3PA 1X2NA 3T0DA 1H1MA 3WDWA 3JRAA 4GWIA 5FZEA 2XAQA 1R49A 2J1VA 4DOZA 2VZ1A 4UW6A 1MH3A 2G19A 3PNYA 1CF7B 4MSVA 3F6VA 1R5GA 3OYFA 4CCDA 1K4TA 2XUBA 2WJSA 3BTIA 3D82A 4FOWA 1WJEA 1UIJA 2G9FA 5JR2A 2WBKA 1L7QA 1XGOA 1F36A 2AGSA 5CLSA 3IKVA 4XYXA 1OLMA 2RVAA 3R60A 2FD8A 3QOEA 1CZVA 2P3YA 3HBZA 2IW5A 3ZN1A 3NQHA 1C8NA 3F8NA 1NA1C 3TMOA 2R5ZA 2IXIA 1CJPA 1IG7A 3M3OA 1R092 3S1NJ 1CX1A 1GVJA 1PNGA 4EJOA 5TRDA 2ARAA 5C8CB 3NARA 2A3WA 3BQZA 1MBGA 1DGRA 3ONQA 4ZTFA 2JDUA 2VTXA 2BVVA 3J7YJ 4U0VA 2MGQA 4QB1A 2SBAA 2M0CA 2AC1A 2RM22 3ZMUA 4KWLA 3B6AA 4MGIE 3PUFA 2I2SA 3ZFGC 1ETVA 4XFBA 2NS0A 2G7HA 4HRIA 4UFMA 2CGOA 2M30A 3IKTA 1OCPA 2OCCH 2X4HA 1WLCA 2ZS6B 3K1PA 1W6NA 1GVDA 4YG0A 2X8KA 4DEVA 1TC3C 1L7LA 5KHHA 2BE5F 5JLVA 2JD4A 2QA4I 4HOBA 4A7ZA 3ZYHA 3P9IA 4EN8B 2BQPA 5DCMB 1Y9QA 4ESFA 5FYUA 1B35A 3CUQC 1KS4A 3IWFA 2WZ8A 4PBPA 4UI9L 1XE0A 4LMYA 2DODA 5B3SH 3UT0A 4XSZF 1XNBA 3J81K 4IXLA 3KYCB 3D5RC 3TGNA 4JX4A 3AZVA 3ABLH 2DU1A 2P17A 1O5UA 5C33A 5A7NA 3ES4A 3ZQQA 4CP9A 1Q3EA 5DDJ2 3GNEA 1REPC 3HEIA 2NS8A 3D6EA 2EAKA 4IV3B 2ZMEA 2WAOA 2QQJA 4RDUA 5EIYB 1MQTA 2KM2A 3OGJA 1V00A 3USSA 1Q8PA 4NBQA 1B8IA 4YVSB 5ANNA 2D1VA 1AXKA 3O8HA 3R61A 2E1OA 4UUSA 4U7DA 5D21A 1W2NA 3OGRA 2BW8A 3LWCA 1UYPA 4JQFA 3K7AJ 1P92A 1H1AA 1FPN2 4P9XA 4JP0A 3MZ8A 4LHKA 3BT9A 4IKFA 1V9U2 4XMYA 1U5TB 1XMKA 1BVVA 1O4YA 1V5GA 1CPNA 1NE6A 2XUEA 1QNWA 3F95A 3GM8A 3VBFC 4CDQA 4CUCA 2WS93 3PJRA 5LBFA 3PNVA 2W24A 2VT2A 2H1LA 1MMNA 2IXLA 1UB9A 4M3GA 4IETA 4AVVA 2DMTA 1BR4A 3H1WA 1V6LA 4PK4A 5DM7F 1VBC2 1VLNA 1VBD2 1OVSA 3TW6A 3EETA 3MQ0A 2XAUA 1OQ1A 5FZBA 5A3MA 1Z67A 1QOTA 5FWJA 3L2UA 1I3AA 4U7BA 3LIHA 1JMUB 5I0RA 3X29B 3F8BA 2LH9A 3F9KA 3OUHA 4XZPA 3PHMA 3N9NA 1OH3A 4HV6A 2B42B 4E2QA 4INDA 4PJMA 5D8KB 4DZGA 4COWA 4YFXF 2ZXWH 2VJIA 3PURA 1WJCA 2EWNA 2W00A 2BY3A 1WD3A 2HLEA 2JDAA 2ZGKA 2MG4A 3WQ0A 2X6YA 2ZGRA 1S2KA 3PFYA 3WX5A 2D44A 4BK5A 2VTXJ 2X6WA 1QGPA 2QE3A 5A3OA 2F5DA 2HWD1 1H8TA 5I93A 3SJMA 3WGGA 1OYYA 2FDFA 2L0KA 3RDIA 4XFCA 2PHFA 5F5QA 1NHAA 2YUSA 1HXS3 3KEQA 5KR7A 5ACA1 3P7NA 1QU3A 3WG3A 2DW4A 2P5LC 2OA4A 4XEZA 3I0TA 3EUHA 4XHXA 2BJSA 2IS6A 1NQDA 4O9EA 1E3PA 4JGYB 3MZHA 3OSFA 5C4JJ 4RM3A 2QEXI 4N53B 2V9KA 3IH4A 3BN6A 2IA0A 3NRUA 2K4BA 4EM2A 3ES1A 4XQWA 4EN6B 1LNSA 2XQXA 3HR9A 2HJIA 4IE0A 1YW7A 1PP8F 1EAH2 1TBXA 3MIBA 5CA6A 4GWJA 4EWEA 3O5SA 2BUKA 4AEDA 4XKVA 4BQ2A 1R1A2 2MPFA 5BNNA 4BHPA 1C1FA 1MH4A 3NEUA 4YM1A 3AZWA 1YX5A 4FBFA 3KQ4B 2MW8A 2JG8C 2OS2A 3GGLA 2XSJC 1JH5A 2PHRA 3N05A 3ECOA 4Y24A 3RI8A 4QM9A 2K9MA 2YFUA 3WU1B 5A1LA 2ENRA 5KC5A 3Q8AA 3PSFA 5CQEA 1QOOA 3FHIB 4LQRA 5AONA 5FZKA 4HX4A 2VZ3A 1FMWA 2PA7A 3IPVB 4S2HA 5HCAA 4JQTA 5AVPA 4I99C 3M70A 1SCRA 1VQ7I 1S0IA 5GTIC 1DBNA 4BQQA 3E5XA 4RGSA 2GP5A 5E89A 1G9DA 3RIRA 1QEXA 2Y60A 5FQ0B 4AK3A 5DEQA 3HOUJ 1QY4A 2Y9YA 5F6FA 4XLPF 1PUFB 3IDEA 1UY0A 5J1XA 2OV7A 1SLBA 4I3GA 3I56I 4Q4V2 3VV1A 5GLWA 1UY3A 4L5EA 3MDPA 3IV5A 2VBWA 4RQPC 2WO2A 4I76A 4QAWA 1AHSA 3ZXJA 1XSVA 5B4NA 5T3NA 3I2HA 2KJBA 2FQPA 3THDA 4OULA 2R0QC 1ULCA 3LAPA 1AYN3 1GNYA 3AFKA 1X3ZB 2LREA 1G3YA 3F3XA 4IGPA 4A6EA 1O3QA 1JS9A 1VBB2 3LFIA 2DPDA 2DURA 1IKQA 5L36A 2ACJA 4ORFA 1AL23 4JDMA 1WMXA 3OYDA 4YARA 1YJ9I 2KRFA 4JHTA 4GAZA 1H2LA 2E36A 3E6BA 4QDSA 4XRSG 4FT8A 4BBSJ 2VW1A 3NW4A 1SHWB 2LTPA 3WNMA 4YW5A 2HU9A 4D94A 3ZFGA 4JQRA 2ME0A 3GFMA 1XSRA 3CF5F 4OYUA 2I07B 2LY1A 3HSEA 2HPMA 4OIPF 3E97A 1WVRA 4KN4X 2K86A 1RL3A 3JRHA 1COV3 1GWKA 1IHMA 1AYM3 3M8LA 1T56A 2XBO3 2D2WA 3GF2A 2JVHA 1E3OC 2IRFG 3J7LA 2RNGA 2Y2ZA 3GBFA 3H9QA 5HS9A 2ZKLA 1RKTA 1I9RA 1DYOA 2QDRA 2VZUA 5A32B 2ZEZA 3HZJA 1WSUA 1DYPA 4CHUA 2QQNA 5C3PA 3AJYA 3POGA 1QJY1 2MA3A 1UMQA 2HKOA 1E2XA 1UZZA 2XJSA 3MYXA 1NLQA 1U3EM 1KU7A 1DU6A 4FOQA 4FPHA 5FY4A 3TDZC 4G9YA 1UHWA 3AZZA 3OSDA 3FDYA 4UUVA 1DGWY 4XICA 1C8M1 3N35A 4LMFA 2A70A 3C3VA 3P5BA 3ENRA 1ZLKA 3GTJJ 1LDKB 4JGZB 2WA3A 3S2HJ 3RPUD 1OA3A 1K78A 3NKTA 2GXAA 1QZZA 4ZYEA 2ADDA 4IOCF 1WCUA 1LFUP 4TLFA 3T3YA 3KZIC 1E57A 2JDYA 2X5IA 1N78A 4YNIA 5CIRA 2ZXJA 4HPKA 2V6EA 3EPZA 1VQ9I 3OIPA 1U8BA 1AR73 5CADA 1LCLA 3O7OA 5J09A 5FLJA 2RMU3 3I2DA 1BVP1 1OQYA 4RGAA 3N9OA 1IRXA 5LGNA 4W6XA 1USTA 1B35B 2JENA 1W9FA 5FZOA 2LRPA 2CU7A 3I3QA 4WX9A 2C4XA 1NOVA 3RZOJ 1JUHA 3OBRA 3EDPA 2MBFA 4OVEA 4ZU5A 1UU6A 4MADA 3K2AA 4U87A 5FMOS 1JI8A 4LK6A 3VZOA 3CKHA 5ILUA 3S5QA 3WODF 5I0DA 3IAM2 1IZ3A 3WUCA 4CP9B 1G3SA 3POIA 4GXLA 4GB32 2FBEA 2K5CA 1XX5A 4NAMA 5EYRA 1LFBA 2E9QA 1SCSA 3DP7A 1ERDA 3GDBA 2WR9A 3MZYA 3I3LA 4G6TB 3K46A 1TT5B 1VQOI 4HVOA 3O1SA 5JAXA 3CMAI 3T2QA 1AHDP 4L99A 1N1VA 4CEWA 2VZPA 1TL8A 3FX3A 1UU4A 1XTAA 4L9TA 2EF6A 5I0SA 2CO5A 4MO7A 4IESA 5FPXA 3GLLA 2L2OA 4RN5A 4XF1A 1QOSA 5C8CC 3NAPC 5FLIA 1UQXA 4LOCA 1AU7A 4KNCA 4I09A 4IX7A 2V1UA 1LRHA 1HJFA 5FXVA 5DAXA 4GH4C 1FSEA 3IRRA 3K4KA 5IYDJ 1T33A 4C8DA 1BEV1 4OFGA 3AVSA 5EWSA 1FOYA 5BNQA 5EHDA 3DYMA 3GHNA 1N1TA 3I2GA 3VDDA 2HXOA 2HOSA 4D7TA 2WY7Q 2GN3A 2D43A 4JTOA 1LHUA 2X1EA 1NG6A 5JZGA 3HOXJ 3VODA 2KJCA 4NIGA 4D0QA 2KZGA 3LA7A 5E18F 2HWD3 3MEPA 1ETYA 1WWXA 2VT3A 2BY2A 5D6FA 2A7AA 3NNFA 2R0HA 3RJRA 3MIHA 3ZP5A 2F6CA 2KIFA 1VQ4I 2MC3A 4NC7A 4AOCA 4BY1J 3N9MA 2WNVB 2F5FA 4HPKB 1AYM2 4LG3A 5DM6F 1SLCA 2M4KA 1FMD2 1FAYA 4ISRA 1NY72 1GSLA 4AIJA 4Z8BA 1RHI3 2IT0A 5JVTA 4KICA 1WZ2A 3P3PA 4HSLA 4NMIA 1HKSA 1YJWI 2VCAA 2DMPA 5LASA 3M7GA 1VQKI 3M2MA 1ENSA 3ZXFA 1HC8A 2GNTA 2ZX0A 2KDZA 3VBHA 4HEA2 4WVMA 3DCQA 5IVYA 5CBLA 5LLQA 1GOFA 4OQ8A 4CP2A 3QACA 1JZ3A 2GXGA 4DUWA 1EH7A 1ZR4A 4M01A 4IRIA 5A3TA 5L3FA 4BQXA 2P5KA 1POV1 1AKHA 3GTOJ 2EFPA 4LPLA 3VHNA 3L2CA 2RN7A 4OHVA 3HIFA 2LDUA 4AVTA 2FRHA 4A0YA 2YBKA 1JOBA 4W50A 4ENJA 3KVAA 5FZ4A 1W6PA 3RG0A 5K0UA 4FAHA 2HS5A 4KWKA 1IV8A 4PDKA 1W3XA 2IXJA 1REDA 3FE5A 4P5HA 4CUBA 3LF7A 4K1ZA 1K45A 1JYTA 2WUHA 1BA5A 1IC8A 3MIDA 1ENRA 2R7UA 2VPLA 2PHWA 4DY3A 3OYMA 2FD5A 4EQQA 2ZMEC 3R4KA 1UG2A 5CEHA 2A3SA 4Q47A 4W1UA 1ZREA 1H89C 4NN0A 3MN2A 2KL4A 2D5HA 2CH0A 3C8XA 3J80K 4B1MA 4B09A 4HVRA 2OBPA 3K4AA 2GOXB 2XKPA 4JRAA 3ZKYA 3SEEA 5IVBA 3IWZA 2DV9A 4OUSA 1UL9A 4MX3A 4NRPA 4HF0A 5K7HA 3ACLA 1KQ9A 5FO5A 1LEDA 4FE7A 1MBJA 2R1DA 3IDCB 5BYNA 4YW3A 5L73A 1RB8G 1O8PA 5HDKA 1W0OA 3N7LA 4JYKA 2L02A 2DA1A 2CGPA 4TYSA 2NMOA 1S4CA 4HKWA 1YI9A 2VNRA 5EGOA 4J00A 3WF4A 2HWF1 4OMZA 2J42A 2FJ1A 4S05A 2ERFA 3MD2A 4P96A 2BDRA 1UHMA 3MIGA 1R23A 3H92A 3I97A 3MKLA 3OS2A 3BY6A 3PTYA 3E6MA 2LMDA 1L7RA 2J7MA 4JV4A 2HOTA 2M45A 2RR12 1MZ5A 5HODA 4F55A 1OKOA 2NMNA 2IAIA 2Y9ZA 3I3DA 2LR8A 3PUAA 3GEZA 2ZC2A 3UV9A 3QH6A 2TEPA 2DVBA 2DJIA 3P9KA 4XFFA 4PI2A 2DLLA 1W5TA 1QVUA 1QPIA 1REEA 5DUVA 2COMA 3IP4B 1JHNA 4MTDA 2UURA 4HN1A 3UKNA 4Y5Z0 1MJAA 1FOWA 3GTMJ 3LSKA 5FYVA 3WGIA 4GFBA 4AG4A 2PLV3 2PMZN 4U36A 3WNOA 3TO6A 1D4VB 5FV3A 2QKLB 4XJAA 1YWKA 3S15J 2E6VA 1Q1VA 3C7OA 5H9QA 3AP9A 4D1QA 3RZDJ 1ZZ6A 2JA5J 1JYNA 1A6QA 3B00A 4IV1B 3UK9A 4Q4W3 3O1MA 3CDIA 1Y1VJ 1MR5A 2DYCA 1CAWB 2HDCA 5L3DA 4HG6B 1R71A 4AW7A 3GTLJ 1RHI2 4CA9A 3RYPA 4A12A 3IAS2 2Y26A 1Y56A 3JAMK 3S57A 2HWVA 3D3AA 3KS7A 4ZZ8A 4Y4RA 5G04L 5I8SA 3LFKA 3ILFA 3GTQJ 4YRVA 1RVF1 1YQ2A 5FYTA 1RUF1 3LIGA 5ED4A 3LE0A 1VFCA 1TW3A 4I2OA 1TZLA 1ZRDA 4NPRA 4FPKA 4ISQA 1FX7A 5I0UA 5FREA 5D8AB 5LA1A 3AKRA 1N1YA 3B7MA 4HDVA 1X82A 1KJLA 3QP5A 4AFDA 3VDAA 5F32A 5B2GB 1BI0A 1BI1A 4E4SA 2MD0A 2DUQA 2XMLA 4C2UA 5BNGA