4NHKA

Crystal structure of tpa1p from saccharomyces cerevisiae, termination and polyadenylation protein 1, in complex with pyridine-2,4-dicarboxylic acid (2,4-pdca)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
613
structure length
546
Chain Sequence
EDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGELEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PKHD-type hydroxylase TPA1
publication title Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 191
structure length 546
sequence length 613
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4nhkA01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nhkA02
4J25A 4NHKA 5IATA 4XACA 5EPAA 5LA9A 3NNFA 5C5TA 5EP9A 4XCBA 5EQUA 5LATA 4NHYA 4MHUA 5M0TA 2JIGA 3EMRA 3KT1A 5L9RA 2Y33A 5HV0A 3NNMA 2RG4A 3OBZA 5LASA 2FCTA 5A3UA 4Y5SA 5HV4A 4NHMA 5LBCA 4NHXA 3NNJA 4ZPIA 2FCVA 2G19A 3HQRA 5DAWA 5DAQA 2RDRA 4MHRA 3GJBA 2Y34A 3NNLA 4UWDA 3KT7A 3W20A 5IAVA 4BQYA 2RDQA 4XCAA 3OUHA 4IW3A 3MGUA 5ERLA 4BQXA 4Q5OA 2A1XA 3KT4A 2G1MA 2HBUA 3OUIA 3BVCA 3W21A 5DAXA 5DAVA 4NMIA 2FCUA 4NAOA 4ZONA 3GJAA 2V4AA 2RDSA 5LBEA 3HQUA 5L9VA 5LB6A 3DKQA 3PL0A 4Y5TA 5LBBA 2OPWA 5DAPA 3GZEA 5LBFA 4BQWA 5IAXA 5C5UA 4NHLA 4XAAA 4XC9A 4XABA 5L9BA 3ITQA 2HBTA 3OUJA 4KBZA 4JZRA 2RDNA 2JIJA
chains in the Genus database with same CATH superfamily
2P3KA 2RS52 1EAH3 2CAUA 2W5FA 4LNVA 5AFBA 5DABA 4UBHA 2VTFA 3FBYA 3H1MA 1VBD2 3NNFA 1MEC3 4L2NA 4DUVA 4QAWA 3BODA 3ZXEA 1C8M2 1QJY2 5FDBA 4MHUA 4QHBA 3WOGA 1X8MA 2GC3A 2RS53 2KXLA 3MO4A 5FZFA 2I45A 2W1QA 4DS0A 4NE9A 3W58A 4GB31 5JXHA 2A7AA 1W8ZA 2ZGNA 3ZKUA 4EE2A 5J1XA 4FQZA 1ULFA 4Y4RA 1R082 1W8NA 4B4PA 1QJY3 4Y5SA 3ZLIA 4U2AA 1QJU1 4CEYA 5CADA 1G6NA 1G9BA 2DV9A 1W0OA 5FY0A 2W91A 2VZVA 1U5ZA 1GQGA 3E5XA 5FPVA 2RDRA 5DG1A 4RHV1 1MS8A 2ZKLA 2XVGA 5F6KA 2P34A 4OVEA 3IKWA 3IPVA 4AI3A 1ASJ2 1UPIA 3BPSA 4NRQA 3KHCA 2AUYA 1XYNA 1X8EA 3W20A 4H7LA 5C4WB 1VB4A 1QWRA 4EJRA 5F5CA 5JWPA 2X53S 2A75A 3OUHA 2ZMNA 4P5HA 1GFF2 1IOAA 4LBOA 5JI7A 4DOUA 2TUNA 1TMF3 3ZIWA 4IXLA 5T5OA 3I2OA 3AMHA 2HEVF 5D8AA 4LHLA 4IE5A 2PLV1 1BQPA 3E97A 1WBFA 4XW3A 4YVWC 1WCQA 5FYTA 3WF1A 1ASJ3 1RUD2 4QMAA 2ZABA 4LXLA 2WNVC 5FFOC 1ODMA 2A71A 2ZCWA 4NUBA 1CX4A 1NE6A 4QPGA 4CEWC 5JPNB 5FZ1A 3VBFC 5JMOA 1K5JA 3UJQA 1POV1 3ROUA 4LMFA 1Y7BA 3KF3A 4QHOA 1QJX1 2WA3A 3SMHA 3IDBB 5K4LA 3EO6A 3ZN6A 4C0HA 3MIGA 4LJHA 3CBNA 4Q4Y3 2Q5TA 5KXBA 2JG9B 3G7DA 5LB6A 1US3A 5SV5A 2E33A 3ZXJA 4CVUA 3LEIA 5A1AA 2GN7A 1QU0A 4QPIC 4LK7A 5AC91 2RE9A 1QH7A 4LBQA 3T4HB 4WM7B 3WCSA 1XE7A 5C9AC 5FY8A 4UFLA 4XTMA 4BH9A 1GNHA 4QKDA 2PELA 5A6XA 3B9IA 1GBGA 1WLCA 2Y64A 2MEV3 4FPFA 4UYBA 4E4HA 3T3YA 3EYPA 4A6SA 1FOD1 1EP0A 3IBMA 1PO11 1KJRA 5D1IA 1Y9GA 3O12A 3AKRA 5A7WA 1CJPA 3C7EA 4LBJA 4X8NA 1WMFA 4YGDA 1UMHA 4D94A 2QZ3A 1AX2A 2D98A 4EYUA 2B46X 1D2QA 1PVC3 4HBNA 3UL2A 1AR81 3AKPA 4A7KA 4UW3A 4LPLA 4Q0PA 2BNMA 1DGWA 3HBZA 4X6QB 1MS3A 1PK6A 3AYEA 4GQ7A 4JDMA 2D3SA 4OI2A 4CDXA 4Z2WA 4WVMB 4AVSA 5HCBA 2J1VA 5C8WA 4YG3A 5D2AA 3O0WA 3KGZA 1T2XA 2GNTA 3E1F1 2Y38A 3V0AA 3GYDA 5L9RA 1WLDA 2K9ZA 3GBGA 3N7JA 4XVHA 3VLBB 4A4AA 1G9AA 3SEPA 1UY3A 5F2SA 3KD4A 1UU5A 5IK5A 4BZ4A 1V9U3 3WNPA 1YFWA 2ZEXA 4IGOA 4GXLA 5A3UA 2IXJA 1W6NA 1B09A 1WMEA 2RV9A 4FOWA 1HB3A 3LEGA 3VBOB 1LHOA 3FLRA 4ZPIA 3VBUB 4AAPA 2C0ZA 4QQHA 1YQ5A 2ZAHA 4CUBA 5EV7A 1US2A 3POJA 3UKVA 1VMFA 3U4SA 4RR3A 1W9FA 5H9RA 1MS1A 4QGNA 2VW0A 2Z42A 3LOBA 4BXSV 3BALA 1QOTA 1I5ZA 2CSGA 3ZR6A 3PJQA 5C8CA 2XHNA 1PNFA 4M4PA 2DDUA 1RJ7A 3GJBA 1QHDA 1W3XA 1SFYA 1PGW2 4CP0A 1F4HA 4L8QA 4QX8A 2HWD3 2I74A 4Q1PA 4BYYA 1JZ4A 5F9TA 4S2GA 4RS5B 4AI8A 2HYXA 1KDKA 3B00A 3VKMA 2J1RA 1DQ5A 1ZYBA 1NZCA 4AWDA 3T2OA 4G4FA 3KGLA 1HXS1 4XEZA 4E2QA 1QJU2 2JJ6A 3POGA 2VY0A 2ILMA 1HRV1 1W8HA 2VO5A 3POWA 2FBEA 2XVKA 4PI2A 1E5RA 3B69A 2EAKA 2V5YA 3PUHA 2MNGA 4K20A 2CYFA 4BMBA 3EJKA 1HB1A 2FCUA 3PTYA 4RHV2 1GKBA 3OEAA 3TOJA 2CHHA 1GU3A 2C4XA 2V4AA 1PGSA 3MDPA 3FFQA 3WINE 2J1UA 4AQTA 4HKOA 4ASLA 1ST8A 5LK5A 2XKPA 4P00B 1NA1B 3UKTA 1JHJA 1QF3A 3H3ZA 4DY3A 4DMIA 1AXYA 2VOWA 2QKDA 3BPZA 1DYKA 4E4DX 4QB1A 2R7EB 1MZ6A 4PIZA 4BQ1A 4XZPA 4BMEA 1RMU3 5FQ0A 4XQ4A 5FO8B 3OB8A 4Y33A 2FDIA 3UJOA 4TLFA 1PMHX 4YZ2A 1YJLA 2WNEA 2F6BA 2ZZQA 4MOAA 3AB0A 4QM8A 3KMHA 2XL7A 4GH4B 3VDDC 4CUGA 4Y3OA 2A70A 2HWC3 3GCWA 2XR4A 1QJX2 1RUG3 4K6BA 4BHPA 3DGTA 1IS3A 1W2OA 3AP7A 5A7SA 3DYMA 4CDWB 1AVBA 3K4ZA 4XDQA 3ST7A 3CJIC 1DF0A 1W39A 3ZPOA 1DGLA 3H3LA 3WUDA 1AR72 3AJZA 4IUGA 5ACA3 5D21A 3IDEA 5AC92 1OPMA 4XF9A 4E8DA 1ULGA 3AP4A 2KA3A 5KHJA 1HLCA 4XUPA 5KXCA 5BNPB 1UXZA 3RZGA 2YC0A 2H6BA 2VZQA 1OUXA 2VD7A 3D6EA 3WDTA 1WD4A 5DDJ1 1OD5A 4XDOA 3SH3A 4E4ZA 4CXYA 1O7FA 1AR73 2IC1A 4RN5A 1REFA 2VMCA 4LKFA 1CAXA 3RPQA 4LHSA 1PO12 3R05A 3PVNA 5E88A 2ZGRA 2PHRA 4AQ2A 3KVAA 1QMJA 4AEKA 4Q0SA 4N53B 1UW8A 1UY0A 5F39A 3LA2A 2RS33 3WF0A 4BB3A 5LBCA 4LITA 1PIV3 2YUEA 3H0OA 1AR82 2IXCA 4Q4X1 3SCHA 4D7YA 1E5HA 3SCGA 5FP4A 3FL7A 3KS7A 1VMHA 3FE5A 4OULA 2ZGPA 1C57A 3FJSA 2X29A 2LUWA 4LBKA 5DAQA 3I3QA 4C90A 4YRDA 1A8MA 5ANQA 3S7IA 2YY1A 4Q4V1 3ZSJA 2YFUA 2WYFA 1AZDA 2Y60A 3DPRB 3ZYPA 1Q8QA 1TNRA 4JGYB 2YZ4A 4V2WA 1DIWA 1TME1 3NNLA 4LOTA 4YLZA 3NAPB 5FPZA 3ZFFC 5ABJA 1G9DA 4QPWA 3IMNA 1YFYA 3S6PA 5F5AA 4FXGB 2ET1A 3AFGA 3IIIA 4ISRA 1N1TA 4XMIA 1H0BA 2DUQA 3PUSA 1JZ2A 3I3DA 1GZ9A 3M4FA 3HR9A 4Q1RA 4CU6A 4EQVA 3N35A 3VKNA 2AACA 3USUA 2OUJA 4GULA 1S55A 2QQWA 4L11A 2C9KA 3T30A 4FTSA 1HQNA 4WVZA 5C3SA 1RUE3 1JW6A 2VGDA 1DQ6A 1A78A 1H6XA 1N3QA 1J3PA 3HNMA 4HSLA 5EZWA 1DYPA 2Z79A 2WWSA 1W2TA 4WZFA 5FMDA 1OF3A 4AHXA 5J7MA 1UX7A 5KXEA 3N3HA 4Q27A 2VNVA 3RI8A 2OS2A 4AZZA 3IIAA 3J4UH 4YZ4A 5FTTC 2GC2A 3RYPA 2WWJA 3T1MA 4Q0UA 2QQPA 4AL9A 4CCNA 1K5MB 1XYOA 3SLIA 4A3ZA 4MGKE 3VV1A 4NJ4A 2Y6LA 2FQPA 3ACIA 4OMCA 3OGJA 4FCAA 1NXMA 1ULDA 3BTAA 3PDQA 3VDAA 4DEQA 4FPLA 3VZNA 3CNAA 3U78A 1L7RA 4QX0A 1OURA 1SG3A 2VNRA 2RVAA 3ZR5A 1XYPA 5FPUA 5JXGA 2YYOA 4IEOA 1KEXA 4HPKA 1Q5OA 1HRV2 5F7UA 3AMNA 1UXXX 5T5LA 1KFUL 3ZFGB 5A3PA 5JSOA 5J3UA 3BIEA 4OUEA 1WMXA 4HETA 1GV9A 5T54A 4BQ4A 1ND2A 3LIHA 3AVSA 2E51A 1NQJA 1PX4A 1Z7S1 4C0BA 4JGZB 4PQ9A 4H2AA 1ULCA 3PMSA 3BCWA 3H7YA 3VD3A 5C4WC 5KC6A 5JZGA 3BYWA 2VQTA 3KSCA 3VDBA 2WLPA 4QX7A 1OLRA 5LRSA 4ZKTB 1UQXA 1CAVB 1W6MB 2VMGA 4CUCA 3VD5A 3IDCB 2D6NA 3GZAA 4C91A 4GALA 1C1LA 2VBBA 1VBA3 1RITA 2ZMKA 5FYIA 3WNXA 3POIA 4AYUA 3JQWA 2W2IA 5FY7A 3PVEA 4HSJA 3LE0A 4I0BA 1I5PA 3N9MA 3SKVA 3KZ4C 5A1LA 2QQJA 4QX5A 3P6BA 2WO7A 4I09A 4NIIA 2DCTA 5EJ3A 1H6YA 4LBNA 3Q8EA 4IV3B 3NL1A 5CFDA 1D4M2 4NHMA 3ORJA 3KLSA 4Q4W3 2GN3A 4W4ZA 3KM5A 4UAPA 5FPAA 5DN2A 1ENSA 1VBE1 5AVPA 3V65A 3PIGA 2YBKA 2BNNA 3FUOA 4F3JA 4HKWA 4MZUA 4WM7C 5F5QA 3RYKA 3U07A 4AEMA 5BNNB 1HN1A 2AZ5A 3V0BB 2FDFA 1S0EA 2BYVE 3DV8A 1D4M3 4DXTA 4A44A 5CEHA 3DXUA 2ZX1A 4K1YA 1CVNA 4N7IA 5HCFA 2JG8B 3GGLA 3M1HA 3UYJA 3DKWA 4PIXA 4COYA 4YNIA 4N9HA 2O8QA 2XG3A 4PHZA 5JIUA 5ERLA 1SFNA 4N9IA 5DG2A 5FZDA 5T52A 4YGEA 2NPIA 5EYYA 2LM3A 1ZVFA 4Q4X2 4PDWC 1PM4A 3OF1A 2EICA 1MVEA 4YW2A 5FXWA 3H1WA 5KWRA 2CWMA 3VZKA 1LESA 5HPOA 2ZEZA 3LPGA 4JRLA 2P3JA 3SH5A 3VBSB 1DDLA 3M3IA 4YGCA 4E27A 1TME2 4Z07A 1CN1A 1GICA 2X5IC 4CUAA 5IVCA 3DKQA 5CIRA 1LHWA 1JN2P 3R4SA 2WAAA 1DQ0A 3POFA 4FAGA 2VCAA 4EWAA 4J1WA 2E9QA 2WR9A 1O4ZA 1UD1A 5LBFA 3AMMA 3NJXA 4CPBD 4XFHA 1VMJA 4GWMA 1UY1A 3RQ0A 1UU6A 3JBG1 1N3OA 5A7OA 4LA2A 4N7UA 1BYHA 4OQ9A 3VZLA 1AX0A 4ZU4A 1ENQA 3HN3A 3KB5A 4TZDA 5GKAC 5FYBA 4GWJA 4MYEA 2GAUA 2JB4A 4YW7A 3J26N 5BPXA 1H2NA 2RJ2A 1XNDA 1W6OB 4GMP3 3JD71 5IK4A 2E7AA 4QKBA 4CCCA 2WN2A 4EWEA 2D6LX 1N1SA 3O1UA 5A70A 4G9SB 1LULA 4HANA 1V6KA 2WZEA 3JXSA 2QBXA 1YFUA 2B7YA 2LS6A 1O91A 2Q4SA 2R072 5IATA 1GWLA 1YQCA 1H2LA 5LA9A 5A7QA 3ZN6B 4AVVA 3OD0A 2E63A 1QH6A 2W1WA 2E31A 1XNTA 4K8RB 4XCBA 5EQUA 4BWOA 4BQ3A 3D8CA 4CP1A 5FZOA 5LK7B 2WQ8A 3PLQA 4IE4A 1NAEA 3IDAA 4QB2A 4O7XA 1DBNA 3QACA 4LBQB 1RL3A 5APAA 2Y6HA 1LGNA 2R073 3RNSA 4QDSA 2RS11 2GMEA 1NCQA 2QQNA 2XLFA 3I2GA 2DVDA 4P02B 1Z7S2 2IXKA 1YQ8A 1SFPA 2ZX0A 1JODA 5I0UA 4XUOA 5A7NA 3J7MA 3I2KA 4M0NA 3ZN4A 4RQPC 1ND3C 2A6ZA 4D7SA 4Q8KA 2BBVA 1KITA 4LUMA 2E7QA 2WO1A 1VR3A 2W47A 5DQ0A 4QGMA 3PHMA 5CFCB 3VD7A 3INAA 2D43A 2V72A 5IK8A 3OGGA 1UZZA 4NOTA 1KXGA 1EV11 1BBT1 1B35C 4UWDA 1HB2A 5JIAA 2A3XA 4NPMA 1PK6B 4CDXB 1SBFA 4KWUA 2PQSA 3I3MA 1CPMA 5FYMA 4NPLA 1OKQA 4DINB 1AR61 1OOPA 1J1TA 3HPNA 2HWB2 2PQQA 2WL1A 3VKFC 4COWA 4QQ2A 1XE0A 3O1VA 1TNFA 3BI3A 1RUOA 3CZUA 4FP3A 4CDUC 2XWJB 3AL6A 2P3IA 4CDWC 4LBQD 3LFIA 1YQ2A 4O9GA 1E5SA 3ZXDA 5KC5A 4YVSA 1IS6A 4P9WA 5CYYA 4NIAA 2VQ0A 2GC1A 4UFKA 3KHBA 3N9NA 3N9LA 1VBE2 2OVUA 3ZSEA 5DAXA 1PNGA 2E26A 1S4CA 2HWB3 5LCWL 3BTXA 3BUCA 3QH7A 4P9JA 1W6NB 4EN9B 3QH6A 1FV3A 3N9QA 2RDSA 1RYYA 1YC61 3KV5A 4XDPA 1REEA 1FNYA 3CL1A 1R64A 4RR3B 4CDQA 3FHAA 3GF6A 4Z1VA 1Q3EA 5B4NA 3MW4A 4TN7A 2WS93 3CF6E 3HNYM 4QQOA 5FZEA 1HJGA 2WNOA 5ISLA 5C8CB 1WCDJ 1FMD3 3VKLA 2ES3A 1AF9A 2XUEA 2ZHLA 2NMNA 3ACHA 2B9VA 3I7DA 4LEJA 4R8HA 5FZMA 1AX1A 3UGHA 2G9GA 1G9FA 1JYWA 2ORXA 2VNOA 4N53C 3ACGA 3I4IA 4TLGA 2DVFA 1DG6A 5C5UA 4UW5A 1YIFA 2JKXA 2PMWB 3NQHA 1XPWA 4W6XA 4XAAA 3RWNA 5HXVA 1IPJA 3WV6A 4MXWB 2VAUA 1UOJA 5FYHA 1DZQA 1SBEA 3DCQA 3T2QA 2WQZC 4QDRA 3BTZA 1WWYA 2BGCA 2BVVA 1XE8A 3JUUA 2ATFA 3J9SA 1SHWB 2Y6GA 3PU8A 4KBZA 3DPRC 1VPHA 2VZ1A 5BY5A 2IZWA 4BM8A 2JDHA 4JGYC 3VHOA 2PHFA 1RUH1 3NKGA 1PO22 4QPYA 4UFJA 3NAPC 2RR11 5FZ9A 2VCCA 4J25A 4H55A 4Z82A 2EXHA 4NRMA 4LR4A 1OQ1A 1JYNA 1JOPA 3VZJA 3UESA 3OGVA 2CY6A 5FZKA 5T50A 2VMHA 2BV4A 3WHTA 4IEVA 3JBG2 4NWVA 4LO5B 1PO23 2EIGA 1LHUA 5CG9A 2VUAA 1I3HA 1WUVA 1MACA 3C2UA 2CL2A 3DUIA 3AL5A 1K3IA 3WNLA 4KWLA 4XIOA 1BEV2 3NWKA 2RM21 2QQVA 2ADEA 2HLEA 3HEIA 4OFGA 4Q0VA 1QY4A 2OIIA 1LOEA 2R043 5LRRA 5I0SA 2OX0A 3JD72 2GH2A 3ZOIA 3WW4A 1V0AA 2D6OX 3CEWA 4INDA 4JHTA 4JKLA 3WW1A 1J83A 5HV4A 4W6YA 4CPBA 4ES8A 1UL9A 2ZZJA 2R061 1K5MC 2VMDA 5A3WA 3UGFA 3MBWA 3I3EA 2XQXA 1BEV3 3AXEA 5AFEA 2PHWA 4KU7A 1RUF2 4XXAA 4GKYA 1SBDA 1MR5A 4IDZA 1UN1A 1LHVA 2VZOA 3AYCA 2Y34A 4QX3A 2DU1A 1JZ3A 4OHYA 3ZXKA 2V73A 5CB7A 1UU4A 2ZX4A 5DUUA 5T5PA 2PXJA 5LEJA 3ZFGC 1VBD3 1YI9A 1UYZA 3MGUA 1IG3A 1LODA 3FN9A 4KI5M 2RS12 3ZXLA 3LFMA 4QPIA 2ZACA 1RUF3 1C8M3 2B8MA 1NLQA 4DIQA 5I8YA 1BMV1 5F3CA 1UPSA 4BA6A 1LTEA 4A3XA 4DZGA 3AZZA 1OH4A 1W2UA 2Z4FA 1QIQA 1UX6A 4KL1A 4AI2A 4FAHA 4K3UA 1CAXB 2Q1ZB 2WFPA 2HWF1 3BIWE 3VUOA 5LA0A 5A3NA 1MPXA 1HRI1 3WNKA 1QKQA 5BUVA 4AAXA 2A6YA 3KQ4B 1ZX5A 5A80A 2Q8OA 5GLZA 3ZDSA 1R083 3TNQA 3OYWA 3TN91 2WBKA 3ZFEA 4FTEA 4I2OA 3ZIXA 4UFHA 3BOPA 3Q8BA 2K0GA 1EV12 5L9VA 1BBT2 3SQOA 5FLHA 4Y22A 2WQ4A 1TVGA 1PM7A 4NR1A 4QX2A 5CZKA 3T0AA 1AR62 3H8UA 3A0KA 3KCCA 3O1PA 1WW5A 1VIWB 2YB7A 4JAAA 4URAA 3HBKA 5LA2A 5CISA 1UZYA 1MQTC 3LPFA 1K45A 5ABJB 1NLRA 5ANNA 5I8SA 3TEXA 5FZGA 5L36A 2VECA 1N3PA 2WT2A 3VB9A 4LKSA 1QQP1 2ET7A 2VE1A 4P5YA 4META 2XXZA 3KWVA 1WCKA 4AXOA 2N7GA 1DU3D 3ZYFA 2GNDA 2VUDA 2BZDA 4Z92B 1VRH1 3J7LA 1JH5A 3USUB 5FWJA 4BXFA 3HMYA 1RUD3 3KV9A 3U75A 2YV8A 4XF4A 2PAKA 4HG6B 4XURA 4YZ3A 2XBO1 1PZ8A 2P37A 1I9RA 3VBRA 1LOGA 2JG8C 1IPKA 2FDGA 4OI1A 5IVEA 4W8JA 2W92A 3LAGA 1MZEA 1KRIA 2I2SA 5FY5A 2G4IA 3DECA 1O5LA 1W6QA 5C3RA 1FPN1 1N1VA 2B39A 2XWBB 3M2MA 4UI9L 3WDXA 2WZR1 1W8TA 1WA6X 5BXXA 4JKKA 5L7OA 1QDOA 2FMDA 4ARXA 4IQPA 5HXMA 4DRVA 1W05A 3EMRA 1O8PA 4KU8A 3AP6A 1AL21 1XNBA 3VZOA 5C6CA 3PUAA 1APNA 4D8MA 1H9WA 5I93A 3DL3A 4FPOB 3FC0A 3WW2A 4Q26A 3ZYRA 1UYXA 1NT0A 1KFXL 1LEMA 4YM0A 3WG1A 4I30A 1QJZA 1DHKB 3VL9A 1AR91 3WP5A 5JDBA 3VBSC 4HPKB 2LTNA 3POSA 4QQPA 3MICA 4AI9A 4R9DA 4E4SA 1S2BA 3MLJA 2BOJA 3K4DA 1UO9A 2RR12 3IWZA 3WX5A 4EV0A 3BU0A 2FCVA 5DZEA 1ND2B 4AF9A 5FYZA 1LCLA 1RVF2 1GZWA 2EXKA 3E6DA 1J58A 2X09A 4XILA 3WQBA 3C3VA 1ULOA 3P5BA 4CCDA 2FDJA 1RUI1 1YIPA 4M4RA 3HIFA 4W50A 5KHGA 1COV1 1W8UA 2DFCA 5JZGB 2WT1A 2D3PA 4AGVA 5G04L 1A8DA 3GHNA 4QM9A 3K77A 3LEMA 2D40A 5F3GA 2DUOA 1RVF3 4ZXKA 2RM22 2J22A 3I3BA 2BVBA 4K1ZA 1NCRB 2SBAA 2JECA 4HK8A 1OUSA 2JX9A 3KCYA 1OH3A 1O4TA 2BUKA 2P6HA 3AZYA 2R062 1YO8A 2Y0IA 3BVCA 3RMXA 2ZOEB 4IE7A 3UV9A 2ENRA 2E6VA 5CFDB 3CJXA 1K12A 3SNMA 1X9TA 3L2HA 3V56A 2BFUL 3IB3A 5LBEA 1Q8VA 4FPJA 2WABA 3OD4A 3WEZA 2BBAA 1OD3A 3A23A 1RXFA 4XIKA 4EZ4A 1O59A 5F8PA 4BOWA 2VBDA 1LJ7A 4GB32 3VBHA 1JTZX 2ZX3A 3KF5A 2AGSA 4FTBA 5A32B 2CWSA 1JZ8A 5I8TA 4RFRB 1BMV2 5BNOB 3RRDA 4XHBA 3MIHA 3DYOA 3NRUA 1T6BX 3C7GA 1OI6A 3TBDA 2HWF2 1S1AA 4GB33 1R091 4LA3A 1FI2A 2D6PA 1AJOA 1HRI2 3MF6A 1V70A 5CFCC 2VL4A 2XONA 5FUIA 5FZ0A 2ARCA 1TEIA 2E53A 3G6JB 1F9KA 4I01A 4XBLA 3TN92 3ZYJB 3KV6A 1QJU3 1PVXA 3AZVA 4IV1A 5J98B 4Y1YA 3WVJA 1RINA 4XFGA 5FUPA 2AEZA 4ET7A 1VBB1 3IN9A 4CDXC 3UKNA 5GLTA 1NE4A 2SLIA 4RHV3 1HRI3 4XE9A 2LROA 1SLLA 2J42A 1AYN1 2PLV2 3RVHA 4B1LA 4BQ2A 5C5TA 3OBTA 4ASKA 2C9AA 1GR3A 5C3PA 3LSEA 1YNAA 1RXGA 2A6XA 2EIBA 2ETEA 3KVBA 4AFBA 2VW1A 5F32A 2BW8A 2YPJA 2GNMA 3LZZA 4RYDA 1OXCA 4IEZA 3FLPA 3KT1A 3TNPB 4TTGA 2VTXA 2J1SA 1NQDA 2QFEA 3OSDA 1H8TC 1LR5A 1CAUA 1ZRIA 3MW3A 2UWBA 2BNOA 5FO7B 2PLV3 2NQYA 4XPVA 3ZSLA 1G9CA 5FR3A 5GZCA 4PQQA 3I2HA 2XHKA 4E2GA 1YLLA 1Y4WA 2R49A 2WNUA 4UF0B 4YGBA 3D5OA 3ZVXA 4QDQA 1JHNA 1XNCA 4RR3C 1W3VA 1POV3 4CYDA 3NO8A 2X10A 3A4UA 5FBJA 1QJX3 1Y9QA 1VBC1 4NROA 3K51A 3ES1A 3H1YA 1OLQA 4XMAA 1FPN2 4YG0A 4CCOA 4CU8A 3I59A 5FP9A 2W52A 1VB2A 2WZR2 2WSUA 5EYXA 1VJ2A 4EN0A 1GANA 1M06G 1OSGA 3TRSB 4B29A 5FK8A 2PAMA 4BQYA 3GBWA 5AC93 1FOD2 3GDBA 1BJQA 2HWE1 5FMOL 5GLVA 4FPKA 1RUJ1 2VOVA 1S0BA 4M3CE 4OHZA 5FK7A 1TQ5A 2YBPA 1ZA7A 1CWPA 3PVOA 3NW4A 1XU2A 4PJYA 1AR92 4M3CA 3RSJA 5CA6A 1GZTA 1UNBA 3MFCA 2A5ZA 1LU1A 2VZ3A 1MVQA 2VTXJ 1GWKA 1FOD3 1PZ9A 3OBRA 3OY8B 5FZLA 3RG0A 4IEPA 1PO13 4AEDA 4B8EA 2EIDA 5DAVA 4D69A 5FZ6A 4CXXA 4YG6A 3N4MA 3AZWA 1JZ5A 1CPNA 2J1EA 1RUI2 4YZ1A 2VW2A 5HBAA 1V6MA 1AR83 1Q8SA 1STMA 2C1FA 1COV2 1NY71 4A7YA 2AYHA 3U11A 2BWCA 2VU9A 1LOCA 3IMMA 2W39A 5CU1A 5FZ3A 3RZHA 2CGPA 3BOWA 2YGMA 2Y6FA 4N43A 2D44A 2IFWA 5LBBA 4HVOA 4GMP0 3R6SA 1HJFA 1PMJX 1TZOA 2HH9A 5DAPA 5JOXA 4JDNA 1ZZ8A 1CONA 3QLQA 4BLJA 1ZM1A 2RJLA 1V6IA 3USSA 4ZHNA 3BU7A 2VC9A 3O1OA 1SACA 3HQXA 3FZ3A 2RMU1 3B02A 1W8OA 1RC6A 1OOPB 2Z5WA 1C1FA 1LNSA 2CTVA 3CMGA 1IHMA 2VOTA 1QOOA 2J7MA 1BKZA 5E1RA 4LO8A 2DYCA 2L9LA 5IWFA 2XLAA 4KWKA 2VZUA 3WG4A 2WYSA 4M3CF 3AYAA 3SCFA 3LDRA 4B7EA 1UZVA 4PLOA 2R0FA 3IAQA 4AW7A 1SDDB 5KBFA 1OMIA 3ILFA 2A6WA 4V2VA 1YHFA 4KWJA 3ZXGA 1AUYA 5FOJB 1BXHA 2GU9A 1X82A 3M3CA 3WW3A 5FUNA 2JD4A 1SCSA 1HXS2 2YGLA 4NIGA 2VXJA 4OMDA 5IHRA 4CDQB 2R1DA 3H9AA 3CO2A 4EN6B 5FJHA 1NUKA 2ZA9A 2IUWA 4DUXA 4P9XA 1FXZA 3TEZA 4YPJA 4XQWA 1IS5A 1K42A 1R092 2CGOA 2NZ9A 2Z69A 4IE0A 3WDYA 4LT5A 3NV1A 4QQLA 3GHMA 4AG4A 1S2KA 1R1A1 4RD7A 3AVRA 2BJSA 3F2ZA 1HXS3 2IXLA 4COZA 2AEYA 4U36A 3ILNA 4FFGA 1UYPA 2YBSA 1HRV3 3LF7A 1ZRRA 2FMYA 2J1AA 2HEYF 1VBB2 3B94A 3MIEA 5CAZA 2Y0OA 3LQCA 2JXAA 3VN4A 4S2FA 5A7PA 1GZCA 4FPGA 2R30A 4HMZA 4FOVA 2DURA 1P8JA 4PDWA 2AR6A 4QKNA 1AYN2 4MHRA 3WR0A 4A45A 5C33A 4JQTA 2BFUS 4XTPA 2UWCA 3GM8A 5ABJC 2YU2A 4WVMA 4CU7A 2WO3A 3ILRA 1SLIA 1W06A 5IAVA 3SEEA 2PHTA 4Y1ZA 1RUC1 1UIKA 1YQ6A 4L9BA 2EAAA 1ZZBA 1FV2A 3LDKA 4UW4A 1QEXA 4KH9A 2X5IA 1JU3A 3OCPA 4RL7A 5SV8A 1KDMA 1O3SA 2VH9A 4NRPA 3A7QA 4B3NA 4AFDA 1XSRA 1VAKA 4J1XA 2JG9C 3P3NA 1WW7A 4N8MA 2X8KA 3KT4A 4FPHA 2CV6A 5IW0A 5T3NA 3SHRA 3OPZA 2G9ZA 1W6PA 5GALA 4BK5A 1VBC2 3LA7A 3GJAA 4LE3A 3R4UA 4D3WA 2C26A 4PBPA 5DDJ2 5DUXA 3LDBA 3ZN5A 1RHI1 5FP3A 2O0OA 2Y6KA 1AJKA 3M7AA 3WDUA 4XYXA 1PGL1 5FCCA 2HWE2 1WCUA 2JD9A 1RUJ2 3CQOA 3H8XA 1AXKA 1H8VA 3HN1A 4OUMA 5AVAA 5CBLA 5IJRA 5DDJ3 4I3PA 5JOYA 2ZGSA 5C7GA 5EJ1B 3WNNA 1LAJA 3IT8A 4XFIA 1U12A 2PA7A 3MV01 3DEMA 2UURA 5BYNA 1DGRN 5IFPA 2HWE3 3C7HA 1ND2C 2EA7A 2VUCA 3VL8A 3Q9OA 4Q4V2 4CEYB 1SEFA 1UF2C 2QJVA 3WY6A 1ZBA1 3J8F1 4E2SA 2JDMA 1WW4A 1X9PA 2WFF1 3CKHA 1YWKA 4Q4X3 4JZRA 4OQ8A 1UOGA 3RZJA 2WINB 4M00A 4MGQA 4PI0A 2OQ6A 3JZVA 3B3QE 5FZBA 5DUVA 2WJSA 3IPVB 1BVP1 2VZRA 1OKOA 1H4HA 2GP5A 3OYWB 4Q4V3 1ND3A 2W3JA 4RQPA 5E89A 3ZFEB 1DLCA 1IQAA 1MZFA 3WHUA 5EP9A 4DB5A 5KXDA 4GIQA 1JMUB 1NCRC 1TME3 1WLWA 3BGAA 4Y22B 2V09A 1NKGA 3X29B 1V6OA 1UY2A 3VBOC 3VBUC 5IFTA 5FP7A 4XF1A 2WZ8A 1BLZA 2UY8A 1ZBE1 4GWNA 2XPJA 2Y33A 1ENXA 5D8AB 1B35A 5FMOS 3TYJA 2YROA 2JWPA 4QWNA 3AMQA 2RG4A 3FMGA 5G05L 5GM0A 1PZ7A 1GP6A 3OBZA 4KGGA 4F7ZA 3CLPA 4QPGB 4CCJA 4CDUA 1WGPA 1AYM1 1QXRA 2VM9A 3MLLA 3JB8A 4MGIE 4M0HA 4RS5C 4YARA 3IM0A 1O5UA 3CZJA 2DUPA 2XDVA 1EAH1 1WKYA 1OA2A 2O14A 3S57A 1S0FA 4GJYA 1IGOA 2YMZA 2FD8A 2IXHA 2WUHA 1ULPA 1RUNA 1MEC1 1SDWA 1W0NA 3WNMA 4XJ9A 5BNOC 2QNKA 3VBRB 1S0JA 2VVEA 1Q8PA 4HL0A 1DGRA 3WP6A 4AVAA 4XUNA 4JTOA 1X50A 3SITA 4DXZA 1LOBA 1W6QB 3D3AA 1C28A 1W8WA 2RS51 1VE0A 1NYWA 3K46A 3ZYHA 4LK6A 1D4VB 4XHXA 4JV4A 4DUWA 5L7OB 4AFCA 1A3KA 1KS4A 1R1A2 2ARBA 4SBVA 4BQXA 1X33A 4IGPA 5FMCA 2UYAA 2A6VA 3L9JT 3SH4A 1NA1C 2QQUA 1QJY1 2PAEA 5FZHA 4QU1A 1HV1A 4KG0A 5K8SA 3M3OA 5A7WB 1WD3A 4MGZE 1JYTA 3HAGA 2DVAA 1F5FA 4WM8A 2KD7A 4E8CA 1CR7A 2D93A 3BTYA 1GP4A 3RZLA 3R4DB 1Z7S3 3ES4A 2H6CA 2VQUA 4QXHA 4EN8B 2NM1A 2Q8EA 4B1MA 2TNFA 1SZBA 3AYDA 3WDWA 2XJPA 4CU9A 4DY5A 1J3QA 3DPRA 3ON7A 5BV6A 4GH4C 1GZWB 4I02A 3MF9A 1UOFA 2Q8DA 3WSOA 5FYSA 2QDNA 1LOAA 1QXJA 3NAPA 4DQAA 5FZ8A 3PURA 2JDAA 3UT0A 1SLTA 1TMF1 5IAXA 3V0AB 2TEPA 2V4VA 3AC0A 1XQNA 2IFRA 3H42B 3NMBA 1ASJ1 4A2UA 5BNQA 1TG7A 4ONUA 4NHLA 3RYRA 5JMCA 3ATGA 4XC9A 3GZTB 5K0UA 3O1RA 3RFRA 4QX1A 5DZGA 5C3QA 5LEKA 1Q56A 1OPOA 3ITQA 5BNPC 1O3QA 5CVRA 1O6UA 1XRUA 1XNAA 2O8OA 1W90A 2BTVC 4LIVA 5EHDA 4Q4Y1 4XBNA 1RHI2 5JXJA 1VBE3 4BU2A 1JZ7A 3P1IA 1Y43B 5TSWA 1O4YA 1RB8G 4IGQA 2FHRA 4GAZA 1O3RA 1PGL2 5FPLA 3VHPA 3WF4A 2BPA2 2YPDA 3SKJE 1K5MA 5FYVA 4XQDA 1PHMA 3AZXA 4LO4B 4A7ZA 4CP9A 3K75B 1CGPA 2ZEYA 3WLUA 3J7HA 1EUUA 1FYUA 1POQA 3MPPG 3U37A 1HIXA 3AJYA 1IZ3A 1Q43A 2E32A 2WIIB 3THPA 1CD3G 2MEV1 3VBHB 4F83A 4AK3A 2W9XA 3M70A 3MUY1 3VGIA 4MV2A 1DZTA 3AKSA 2BQPA 5FLIA 2MHFA 5BNOA 4EROA 4BLIA 1U0AA 2YU1A 3J8F2 3LGRA 4QGLA 4D6RA 4K9SA 5A6ZA 1EPZA 2DVGA 2WLQA 4A42A 5L73A 2OPKA 2WFF2 3ASIA 5F6LB 3FLTA 2PYTA 1PVC1 4LLOA 4LORA 4ITCA 3UETA 4D7TA 2LRPA 5DAWA 2FZ1A 1NXD1 1XOYA 2EIEA 5H9SA 4BISA 4FFFA 5J96B 5IK7A 2GALA 2CDPA 4ISQA 3WG2A 4JDOA 4IV1B 1SLBA 2ZHMA 2W1UA 1CIWA 5LA1A 4QU2A 5B4XA 1UMIA 3PUQA 1OLME 5F3IA 2XB6C 5GZEA 4H14A 3D0SA 1F31A 3ZMOA 5FQ0B 1ZBE2 1G7YA 4R4XA 3QCWA 2AREA 5FZ4A 4Q29A 4Y4YA 2Y26A 4NAMA 4YW1A 4AGRA 4COUA 3LB9A 3RJ2X 2VR4A 3BN6A 1DP0A 1EPWA 1QJFA 1O3TA 3K2OA 3JBG3 1V9U1 2OZJA 4OZOA 2BOIA 4BPZA 4NIDA 1YYNA 5FYYA 3T0DA 3P3PA 3I2JA 4YVWA 3ZSMA 5F2WA 3WNOA 5LWBA 2G1MA 1D7PM 3WQ1A 1MQTA 5IT6A 3SISA 2DU0A 3I2IA 2WNVA 4XUTA 5KHIA 1CAUB 2CNAA 3M8LA 4KGQA 4CEWA 3PUIA 4Q2FA 3VBFA 5EXOA 3I2FA 1ZA4A 2VCBA 4UXAA 3W9AA 3JD73 3HNBM 5A3OA 5JSRA 2WNUB 5IVBA 2OQ7A 1UZWA 4HOOA 1H9PA 3U0ZA 4AEJA 1YJKA 4K21A 3V0BA 1XSQA 2XVLA 3GCXA 2HWD1 4WVVA 1YXWA 2DCYA 3LEKA 4Y5TA 1O8SA 5DZFA 3RZMA 4NIHA 1TE1B 2ARAA 3I59B 2Y8KA 1CZVA 2JG8A 3IZOA 3THTA 3WG3A 4JGZC 1H4GA 1QJEA 1Y9MA 4FOQA 3THCA 4AGGA 5C9AA 2DCKA 4LULA 4RFT0 1JYVA 1XJAA 1PGW1 3ZYIB 1DGWX 4P9IA 1GP5A 1JOBA 2DBNA 1D0GA 1OA3A 2GDFA 2IVIB 4XFFA 2BU9A 2D5FA 2RS13 3MIFA 4GA9A 1ZRFA 2DTWA 4HZFA 1S0IA 3ACFA 4M3CB 2XJVA 2GMPA 4Y24A 3VD9A 3D4KA 3LCPA 4F8AA 1ODNA 1BCXA 5FAXA 1LOFC 4AEDB 4XUQA 2JE7A 4AI1A 1LECA 4BK4A 2VMEA 5A6QA 4Z2AA 1DQ4A 3VBSA 2JDPA 3WQ0A 3S5AA 1F8VA 4JQRA 1C8NA 2AH2A 4AFMA 4XACA 1GNYA 3A22A 5EPAA 4E9KA 5IVFA 3MZHA 4IV3C 3O5SA 1TMF2 1RMU1 4CTEA 4QXCA 1LB2A 1EV13 1BBT3 2RHPA 1JBCA 1POV0 5FXVA 1KQRA 4OZXA 3TAYA 5DUWA 4N43B 2D97A 4JHZA 3HVDA 4RGGA 1A6CA 4LBMA 5A33A 1QDCA 1AR63 2W94A 2XGXA 3POYA 2VVDA 2RJKA 1UY4A 4OYUA 1ZZ9A 3EXUA 4XAEA 1E5IA 2HWC1 3ACLA 1ULEA 5E6HA 2WZPP 5BNNC 1RUG1 3FFZA 3R0RA 2FCTA 5I0RA 1WZXA 4FPYA 3MEPA 4P9LA 1L7LA 4LKDA 5FMBA 1GMMA 1W9SA 4AFAA 2P1BA 4MVTA 4R4ZA 1GLHA 1W6OA 3LKJA 1W9WA 4Q4Y2 3S0MA 3THDA 3AFKA 4K7JA 4ATEA 4DNYA 5ACA1 1HX6A 2VOXA 2VBPA 4B7KA 2QZ2A 5J36A 4B4QA 2ZAAA 1U5YA 4PF5A 1JYXA 4UFMA 2VUJA 2QQIA 1RIRA 4ATFA 2GNBA 2JDYA 2XKOA 4Y1XA 1QXPA 2VPVA 3ME2A 4IL7A 1UKGA 4NVPA 2VCMA 3APBA 2VZSA 1AXZA 2MEV2 1QGLA 1AR71 1W0PA 2XLGA 3MYXA 4HVRA 3WP4A 4O9EA 2GSYA 2C6SA 1LKNA 4L92A 1W2AX 1NX9A 4CEYC 1JXNA 4OHXA 1DYOA 2XOMA 1DQ1A 3WF3A 4PLMA 1RUH2 2OT7A 1OFSA 2RS31 1WCSA 4JX0A 4BDVB 1PIV1 1PVC2 3B7MA 4MXVA 5LZ6A 3D82A 3JU9A 4MGSA 4MG2A 3GZUC 3NSTA 3AX4A 4IEYA 1D0HA 3FX3A 4FQ4A 3ZFEC 4TXWA 2OA2A 4IEWA 4ZONA 1OFNA 2EVXA 1CZSA 3RI9A 2QCSB 3AK0A 4NO4A 4D6QA 4LO7A 1RUH3 3DXTA 5KHHA 4YW4A 4OHVA 3ZM8A 5CFCA 1F5JA 2EF6A 2RR13 4CSWA 4URTA 2NN8A 3S30A 1UCXA 1BK1A 3MI8A 2Q8CA 4PDWB 5D8AC 3ZDVA 4WVWA 2OPWA 3U1XA 5FZIA 3E5QA 4Y26A 4AVBA 1J84A 2GMMA 2YDEA 1F4AA 1Y3TA 3SC7X 4FSJA 1V9U2 1YUDA 4QPGC 4WBBA 2ZTNA 5C71A 5A3MA 1NOVA 4XJAA 2XMLA 2B4KA 2DCZA 3B9CA 2ZGQA 3HOBA 4CCLA 2X5IB 1V00A 4W65A 3O1TA 3I8TA 5EWSA 1RUE1 2F4LA 1BVVA 1CZTA 3NVCA 4EN7B 2RM23 5FPXA 3KQRA 3VDDA 4PIYA 4N90A 3N7LA 5FY9A 1PX3A 5FO9B 1GOFA 2OZ6A 5FJKA 1WBLA 1YEWA 5FPBA 4AE2A 1YRZA 4XFAA 1H8TA 1JOJA 2YXSA 1NZIA 3S5QA 4PF1A 1LGBA 2IWGB 3VBRC 2R063 2RDNA 3E6BA 5T55A 3WCRA 3CJIA 1F35A 1W6PB 3VDCA 2JDUA 2HWD2 5B2GB 2PHDA 2QQMA 3H8OA 2FZ2A 3OOXA 3OBAA 4Y20A 5I0DA 1CAWA 4FO9A 3T0BA 3ALQA 3T2PA 5L7OC 2HEWF 3UNPA 1J1LA 4ZXEA 5M0TA 3ZYBA 5CKQA 2WDBA 4AOCA 4DEVA 2OXBA 4KQ7A 1DZRA 1W04A 1H2MA 4JVAA 4PCRA 5HV0A 1FAYA 3DYPA 1H1IA 3CDZB 1T6GC 1VAVA 1OA4A 3W5NA 4L99A 4MXWA 2ZEWA 5JR2A 1CJDA 1RTVA 3CU7A 2A3WA 2DFBA 1XXNA 1XC6A 1U5XA 2R1BA 1PK6C 1WA4A 3MIDA 4C1XA 2HWF3 5FYUA 3NNJA 5DMYA 3C7OA 2WC2A 4ZU7A 4FT8A 1HW5A 3QD6A 2D7FA 1DCSA 3H50A 3L2YA 4UW6A 3RZZA 3OG2A 4LOSA 3TN93 5J09A 2VG9A 4AHZA 2GZWA 3I49A 1RMU2 4ZS3A 1LHNA 4GJZA 2Q1MA 1YI7A 2P17A 2QTWB 3RDIA 1OBNA 2VXRA 2XH6A 5FOBB 1QQP2 1VBA1 4HLTA 3QBQA 1XB9A 3OTFA 2VMIA 1HV0A 3E6CC 4P14A 4DXRA 2RDQA 2Q30A 4XCAA 3ZFFA 4OUSA 1ND3B 4RQPB 4FBFA 4DRRA 4IW3A 2VJXA 4CP2A 3MLKA 2PFWA 1VRH2 2LALA 4TWTA 4XZUG 4XFCA 1H2KA 2HWC2 2W68A 3CIHA 2FDKA 1RUG2 2VQAA 2OYZA 3LD8A 4Q5OA 3KV4A 4DFSA 5FZ7A 1X36A 4MH0E 1ZREA 2XBO2 1QQP3 3ZYGA 4QD2A 1VRBA 3LIGA 4Q4W1 1B35B 1ZRCA 1ALYA 4YFWA 1S0CA 3VKOA 2YHJA 3OUIA 1SPPA 3MFAA 4M01A 5C8CC 3K4AA 5ACA2 5FKBA 2B9UA 2KM2A 1VRH3 2YC2A 4NMIA 4MUVA 3NV2A 2I07B 1EY2A 3QOPA 4CDUB 2Q0AA 3ETQA 3HQUA 1W2NA 2XBO3 5JVVA 1D4M1 4QT6A 4IEQA 4D6SA 2F4PA 1AL22 1REDA 2ZMLA 3RMYA 1ZZCA 3POBA 1GOGA 5E16A 3VBHC 4IETA 3FWEA 5C3OA 3I2DA 3LSDA 5F37A 5FZOB 1JUIA 1FPN3 1HB4A 1GWMA 3URFA 5CG8A 1V6NA 1F2NA 5FWEA 3H3UA 3NV3A 1ZZ7A 2PHUA 2WZR3 2ZS6B 2B45X 3C7FA 2XUMA 2H0BA 3Q8CA 1I1EA 2RS32 1AL23 2XJTA 1PIV2 3AP5A 1NCQB 3PVBB 1VALA 3CHXA 4DO0A 3T1LA 5GZGA 3MW2A 1XNKA 4YSFA 1QNYA 3OUJA 2BGOA 1OVSA 3TB0A 1AR93 1UOBA 3IAPA 3OPTA 4IV1C 4D0QA 5K7PA 2AC1A 1FATA 1ONAA 5GZFA 4Y5Z0 4XXPA 2O1QA 3VZMA 3TEWA 1LEDA 4C1WA 4WM8B 2QVSB 3AP9A 4HVQA 4I0WB 2B5HA 2WT0A 2WA4A 5C4WA 4NHKA 3B01A 1VP6A 3H8RA 1GUIA 5DXDA 1RUI3 2W0XA 4LQRA 4YZ5A 4GD4A 3U4XA 4FVVA 4YYOA 3WQ7A 1COV3 2HJIA 5EJZB 1JZ6A 3NNGA 1OF4A 5A6YA 1LENA 1JUHA 3O0VA 5JOWA 3N7KA 2WWUA 5FREA 2PHLA 2WN3A 4TSVA 4LE4A 4HONA 3DN7A 2P5BA 3O0XA 2P4EA 3D0JA 2DVBA 1RUE2 1W9YA 2ARXA 1C5HA 4MSVA 3ETPA 3UGGA 4DXSA 4MO3M 4O61A 4YFZA 4AVTA 1KD7A 3ZXAC 2ZGLA 1HDKA 4BCUA 4YVSB 5JOZA 3T08A 1UZ0A 2D5HA 2WNUC 4HXCA 4NWWA 1QOSA 2YC4A 4GMP1 4ORFA 1N1YA 1J59A 3Q8AA 2ERFA 1MS5A 2ZX2A 3PIJA 5K0UB 4UOJA 3N7MA 4RA0A 5DPNA 3T4VA 2BGPA 2G19A 1L7QA 2JG9A 2K2SA 4FP2A 1S0DA 2XQRA 2FDHA 3EQEA 1KS5A 2DTYA 2C24A 1URXA 5E8AA 3BKZA 4XJUA 2TBVA 4P9GA 4WM7A 3A21A 2YFZA 1RJ8A 4R52A 2NYYA 3KT7A 5EIYB 5LY2A 4LBLA 2IXIA 2DF7A 4ZU5A 2ZGTA 2ZGKA 5IUQA 4CP9B 3U10A 4YW6A 2R071 4XF3A 2NMOA 3SXWA 3ECQA 3ZO0B 4AHYA 3W5MA 2K46A 5F1RA 1W03A 4NPRA 2CDOA 2BWAA 1YFXA 3TWIA 4AEDC 5H9PA 2W1SA 2G9FA 1W28A 4Y1VA 3VHRA 3HJRA 1A34A 4OI0A 1R093 1LU2A 1SQ4A 2GH8A 4XFBA 3VD4A 3MHZA 3K3OA 1VLNA 2OKXA 1H1MA 4MLOA 5HI0A 1H1AA 5J37A 5GLUA 3O1MA 1JS9A 1UYYA 5IYYA 1JYCA 1VBB3 1VBA2 3JQXA 1XU1A 4LHNA 3EB7A 4N43C 3LA3A 3PJYA 4QXBA 5FZCA 3O1SA 2ADDA 5HCAA 4XBQA 1GQPA 2UU8A 1BZWA 1AYN3 2R6QA 1LGCA 3FBMA 3PMEA 2R0HA 5GZDA 4PLNA 3POEA 5FYCA 3S7EA 4GKXA 4I0AA 4XJWA 4O65A 3ZPYA 1ENRA 4ZZ8A 2PHXA 3WDVA 4Q4W2 3T2TA 4CRQA 1NCRA 3PU3A 4CCEA 1JU4A 4Y1UA 5L9BA 3VBOA 4LLFA 2D3RA 3VBUA 3UK9A 2IVJA 3OJBA 4JC1A 3TEYA 1PMIA 2ZXQA 4JKMA 5A3TA 2VVFA 2HWB1 3WT3A 4UBGA 4YVWB 2Y6JA 2CGNA 3HWJA 1ACCA 1MQTB 2GC0A 1XBFA 4K8FA 2WNVB 4MGYE 1MS0A 2DWRA 4ASMB 4CEWB 4SLIA 3VBFB 4X6RB 1ZRDA 4XJ8A 1CX1A 2PTMA 4I3GA 1VBC3 2WKKA 2BEOA 1OQDA 3VHNA 2WS91 4AR2A 3RZKA 2JE9A 4NN0A 2W87A 4RS5A 1FMD1 4PBOA 3WP3A 4L0PA 1C3HA 5LW9A 5EFUA 5F3EA 5J48A 2OUHA 4ZY9A 4FPCA 1R1ZA 1SLAA 4IERA 5A32A 3MUZ1 2QQOA 5IVYA 2NLRA 4QPIB 2VMFA 2YG0A 1RUJ3 1HN0A 3I54A 4EZHA 2XJQA 3T09A 2QDRA 1C5IA 5C9AB 5LASA 4LKEA 4QHZA 5JZGC 1NY72 1UIJA 2F17A 1FX5A 1QNWA 3MIBA 2R16A 4FFIA 1CIYA 5HCHA 4CA9A 4GWIA 1UMZA 3B93A 3B5LB 2EALA 3HQRA 1NA1A 3FHQA 1HQLA 4YM2A 2ZJCA 1UKRA 1SLCA 2P2KA 5H9QA 4OLLA 4R9AA 4FFHA 2JICA 1X7NA 2RMU2 1F15A 1N47A 3BB6A 4LTAA 3GALA 4H3WA 1PO21 4RSUA 2W95A 3H7JA 1EUTA 1MS9A 2WSVA 1GNZA 3J7NA 1RGSA 5CFDC 2NP0A 4QXKA 2QUOA 4GH4A 3PNAA 5JI9A 3JB4C 3ELNA 3NV4A 4QB6A 2XJRA 4W6WA 1IKPA 2R041 4YM3A 5K9YA 2A1XA 2H0VA 2RMU3 4CCMA 5A33B 4L97A 4RGAA 4CDWA 3RJRA 2DCJA 2XJUA 4IEUA 3WF2A 2ZGOA 1AL0G 3K48A 3WZ1A 5A1FA 2VOKA 5KHKA 3ZSKA 1J3RA 3W21A 1FNZA 2A3YA 4IESA 1IS4A 3AXDA 4UF0A 1MS4A 1S2EA 3EHKA 4FPEA 4PT6A 4BE3A 1BEV1 1GOHA 2ZHKA 2BERA 3A0NA 2EXIA 2A73B 4KMQA 5FIXA 3ZX7A 5BNPA 1OVPA 5C70A 3AKTA 4HKLA 2CAVA 2JENA 2PN5A 3AKQA 4IE6A 4JRAA 1DFQA 5GLWA 3W59A 4ARYA 5I91A 2Z2SB 1U5IA 1W8FA 2D6KA 4CE8A 3O7OA 4XOGA 3FHIB 3U14A 4AVCA 1D2SA 1VBD1 4LUKA 3WD5A 4BJ0A 2QQLA 3KCXA 1SCRA 1Z0HA 1RUF1 1C8M1 2BDRA 3HT1A 4A41A 4LIUA 4HN1A 4KG8A 2ID4A 4N53A 4MX3A 4TYSA 4YW5A 3RWKX 1JYIA 5FRAA 2Q1FA 2UWAA 4S2DA 1ZNPA 4XABA 5JR7B 4YW3A 1GYKA 3I97A 1SMVA 3NKTA 3RS6A 2B42B 5F5IA 4OI4A 1R1A3 1G8WA 1M4WA 2HBTA 3OY8A 5GJ6A 2HYKA 1HKDA 1OHFA 1R081 4S2HA 4AI0A 2J1TA 1UWWA 5L19A 1WLTA 3GBFA 2MPFA 3HD8B 4MADA 1RUC2 4HK9A 4JGYA 4IEXA 3WXPA 2JIJA 3MV11 4UFIA 4FOYA 4X8PA 1G86A 5FLJA 3ZKYA 4R9BA 4Z8BA 3NJVA 2EXJA 3AM2A 1DQ2A 1MZ5A 3DF0A 4JTNA 5JUVA 2QQKA 4K40A 3V64A 2XL9A 1IQDC 3F95A 5LATA 4J6GA 4Q8LA 2UYBA 3E5UA 3EBRA 3ENRA 2OW4A 4NHYA 1CESA 3Q8FA 5JXIA 5JLVA 1V6JA 2E7TA 1RUC3 3OGRA 2JIGA 4AQ6A 3OPWA 2ZKNA 3M3EA 4MGTA 2ZGUA 4XJZA 1OC1A 1IG0A 4C8DA 5FY1A 1FT9A 3NNMA 1JI6A 3OGSA 2VULA 5FZAA 4H7MA 3GXUA 2C5DA 1RUD1 1HQWA 2D6MA 2JDNA 4EWDA 1KGYA 3LOIA 3PTRB 2BRTA 4NHXA 3ZMNA 4CZSA 3N36A 3C8XA 2GP3A 3AMPA 4CXWA 1AHSA 3VDDB 2JE8A 1LRHA 1OT5A 3GNEA 5IVVA 2WS92 1W9TA 4KBBA 4BQ5A 1H8TB 1FMD2 1VAMA 4ZZ5A 4B4RA 4ZS2A 5KR7A 4JCKA 1S0GA 5IVJA 3LWCA 2HKXA 3CJIB 1RHI3 3JCIA 2X05A 1KJLA 4DPNA 2LW8A 4P08A 4Y20B 4LHKA 1NCQC 5FBZA 1CAWB 4R9CA 1GSLA 5T5JA 1BK0A 1I6XA 4YWAA 5FP8A 2WO2A 1ZBA2 5JCTA 3ZFGA 2KR2A 3M3QA 1Z78A 1E57A 1UAIA 1Q8OA 2WRAA 2P3YA 2ZBJA 1YCIA 4OHWA 2CU5A 1DLLA 2JKBA 4QKFA 2JDZA 4A6OA 5LY1A 2HBUA 4JGZA 4XETA 5FY4A 1GQHA 4WM8C 4HN0A 5FXZA 4WV8A 2JEMA 3O14A 2XJSA 4HFSA 4AQSA 1IPSA 1NLSA 2WAOA 2VZTA 3RGBA 1ZBA3 3J8F3 4LO6B 5FXXA 5A3LA 4NAOA 1WW6A 2WFF3 4P9YA 1CAVA 5CKMA 3N9PA 4KNCA 1W6MA 2ZHNA 4G3YC 2UY9A 1OOPC 1OLMA 3PL0A 2ZGMA 1LOFA 1L3JA 1W99A 2VZPA 3FUQA 3ZXFA 1BHGA 2JB8A 2ZPXA 5FKCA 1H30A 4COVA 4WZCA 3GZEA 1RVF1 1WMDA 3NJYA 2ORZA 4Q0QA 4YVSC 1V6LA 4BQWA 2W08A 2R32A 1ZZ6A 2R042 2P6CA 4V1PA 4OCTA 1AYM2 1NG0A 3N9OA 4IV3A 3ZFFB 5K0UC 4RGKA 1ZBE3 2BP6A 4XF0A 4FI9A 4AHWA 4BIFA 1OQEA 3WUCA 1EAH2 2AENA 3ABZA 1CQ9A 2V5DA 4FXKB 4GZ9A 4HT1T 5CKNA 5JSPA 4ES9A 2DBIA 5JPMB 3NJZA 4BIOA 2QE3A 4UT5A 1MEC2 3HT2A 3K3NA 5I0TA 1EYBA 3OEBA 4CDQC 4CCKA 1IKQA 2VNGA 3MPBA 5FV3A 1AYM3 4YM1A 2JDKA 5BNNA 1SPPB 5JAXA 1C4RA 5CNAA 2W46A
chains in the Genus database with same CATH topology
2P3KA 2RS52 1EAH3 2CAUA 4LNVA 5AFBA 4UBHA 3FBYA 3H1MA 3NNFA 1VBD2 1MEC3 4L2NA 3BODA 3ZXEA 1C8M2 1QJY2 5FDBA 4MHUA 4QHBA 3WOGA 1X8MA 2GC3A 2RS53 2KXLA 2I45A 4DS0A 3W58A 4GB31 2A7AA 2ZGNA 4FQZA 1ULFA 1R082 4B4PA 4Y5SA 1QJY3 4CEYA 4U2AA 1QJU1 5CADA 1G6NA 1G9BA 2DV9A 1W0OA 1U5ZA 1GQGA 3E5XA 2RDRA 5DG1A 4RHV1 1MS8A 2ZKLA 2XVGA 5F6KA 2P34A 4OVEA 3IKWA 3IPVA 4AI3A 1ASJ2 1UPIA 2AUYA 1XYNA 1X8EA 3W20A 4H7LA 5C4WB 1VB4A 1QWRA 4EJRA 5JWPA 2X53S 2A75A 3OUHA 2ZMNA 4P5HA 1GFF2 1IOAA 4LBOA 5JI7A 4DOUA 2TUNA 1TMF3 3ZIWA 4IXLA 5T5OA 3AMHA 2HEVF 5D8AA 4LHLA 4XW3A 2PLV1 1BQPA 3E97A 1WBFA 4YVWC 1ASJ3 1RUD2 4QMAA 2ZABA 5FFOC 2WNVC 2A71A 2ZCWA 1CX4A 1NE6A 4QPGA 4CEWC 5JPNB 3VBFC 3UJQA 1POV1 3ROUA 1Y7BA 1QJX1 2WA3A 3SMHA 3IDBB 3EO6A 3ZN6A 4C0HA 3MIGA 4Q4Y3 2Q5TA 5KXBA 2JG9B 5LB6A 3G7DA 5SV5A 3ZXJA 2GN7A 1QU0A 4QPIC 5AC91 2RE9A 1QH7A 4LBQA 4WM7B 3WCSA 1XE7A 5C9AC 4XTMA 4BH9A 1GNHA 2PELA 3B9IA 1GBGA 1WLCA 4FPFA 2MEV3 1FOD1 1EP0A 3IBMA 1PO11 1KJRA 5D1IA 3O12A 3AKRA 1CJPA 4LBJA 4X8NA 1WMFA 4YGDA 4D94A 2QZ3A 1AX2A 2D98A 2B46X 1D2QA 1PVC3 4HBNA 3UL2A 1AR81 3AKPA 4A7KA 4UW3A 4Q0PA 2BNMA 1DGWA 3HBZA 4X6QB 1MS3A 1PK6A 3AYEA 4GQ7A 4JDMA 2D3SA 4OI2A 4CDXA 4Z2WA 4WVMB 4AVSA 5HCBA 5C8WA 4YG3A 3O0WA 3KGZA 2GNTA 2Y38A 3V0AA 3GYDA 5L9RA 1WLDA 2K9ZA 3GBGA 3N7JA 1G9AA 3VLBB 3KD4A 1UU5A 5IK5A 4BZ4A 1V9U3 1YFWA 4GXLA 5A3UA 2IXJA 1W6NA 1B09A 1WMEA 4FOWA 3VBOB 1LHOA 4ZPIA 3FLRA 3VBUB 2C0ZA 4QQHA 2ZAHA 5EV7A 3UKVA 4RR3A 5H9RA 1MS1A 4QGNA 2VW0A 2Z42A 3LOBA 3BALA 1QOTA 1I5ZA 5C8CA 3PJQA 1PNFA 1RJ7A 3GJBA 1QHDA 1SFYA 1PGW2 4CP0A 4L8QA 2HWD3 2I74A 4Q1PA 4BYYA 5F9TA 4S2GA 4RS5B 4AI8A 1KDKA 3B00A 3VKMA 1DQ5A 1ZYBA 1NZCA 4AWDA 4G4FA 3KGLA 1HXS1 4XEZA 4E2QA 1QJU2 2JJ6A 2VY0A 2ILMA 1HRV1 3POWA 2FBEA 2XVKA 3B69A 2EAKA 2V5YA 2MNGA 4K20A 2CYFA 4BMBA 3EJKA 3PTYA 2FCUA 4RHV2 1GKBA 3TOJA 2V4AA 3MDPA 1PGSA 3FFQA 3WINE 4AQTA 4HKOA 4ASLA 5LK5A 2XKPA 1NA1B 3UKTA 1QF3A 3H3ZA 4DY3A 4DMIA 1AXYA 2VOWA 2QKDA 3BPZA 1DYKA 4E4DX 1MZ6A 4PIZA 4BQ1A 4XZPA 4BMEA 1RMU3 5FQ0A 4XQ4A 5FO8B 3UJOA 4TLFA 4YZ2A 1YJLA 2WNEA 2F6BA 2ZZQA 3AB0A 4QM8A 3KMHA 2XL7A 4GH4B 3VDDC 2A70A 2HWC3 1QJX2 1RUG3 4K6BA 4BHPA 3DGTA 1IS3A 3AP7A 4CDWB 1AVBA 4XDQA 3ST7A 3CJIC 1DF0A 1W39A 1DGLA 3WUDA 1AR72 3AJZA 5ACA3 3IDEA 5AC92 1OPMA 4XF9A 1ULGA 3AP4A 2KA3A 5KHJA 1HLCA 5KXCA 5BNPB 2YC0A 2H6BA 3WDTA 3D6EA 4E4ZA 1WD4A 5DDJ1 1OD5A 3SH3A 1O7FA 1AR73 2IC1A 1REFA 1CAXA 3RPQA 1PO12 3R05A 3PVNA 5E88A 2ZGRA 2PHRA 4AQ2A 1QMJA 4AEKA 4Q0SA 4N53B 1UW8A 3LA2A 2RS33 5LBCA 1PIV3 2YUEA 3H0OA 1AR82 2IXCA 4Q4X1 3SCHA 4D7YA 3SCGA 3KS7A 3FE5A 4OULA 2ZGPA 1C57A 3FJSA 2X29A 2LUWA 5DAQA 4LBKA 4C90A 4YRDA 1A8MA 3S7IA 3ZSJA 2YY1A 4Q4V1 3DPRB 1AZDA 3ZYPA 1Q8QA 1TNRA 4JGYB 2YZ4A 1DIWA 1TME1 3NNLA 4YLZA 3NAPB 5FPZA 3ZFFC 5ABJA 1G9DA 3S6PA 3IMNA 1YFYA 4FXGB 2ET1A 3AFGA 4ISRA 1N1TA 4XMIA 1H0BA 2DUQA 1GZ9A 3M4FA 3HR9A 4Q1RA 3N35A 3VKNA 3USUA 2OUJA 4GULA 1S55A 4L11A 4FTSA 1HQNA 4WVZA 1RUE3 1JW6A 2VGDA 1DQ6A 1A78A 1N3QA 5EZWA 1J3PA 4HSLA 1DYPA 2Z79A 2WWSA 4WZFA 4AHXA 5J7MA 5KXEA 3N3HA 4Q27A 3RI8A 3IIAA 3J4UH 4YZ4A 5FTTC 2GC2A 3RYPA 3T1MA 4Q0UA 2QQPA 1K5MB 1XYOA 3SLIA 4MGKE 3VV1A 4R52A 2FQPA 3OGJA 4FCAA 1NXMA 1ULDA 3BTAA 4FPLA 3VZNA 3CNAA 2VNRA 1XYPA 2YYOA 4IEOA 4HPKA 1Q5OA 1HRV2 3AMNA 5T5LA 1KFUL 3ZFGB 5JSOA 5J3UA 4HETA 5T54A 1GV9A 1ND2A 2E51A 1NQJA 1Z7S1 4C0BA 4JGZB 4PQ9A 1ULCA 3PMSA 3BCWA 3H7YA 5C4WC 5KC6A 5JZGA 3KSCA 2WLPA 1OLRA 5LRSA 4ZKTB 1CAVB 1W6MB 2VMGA 3IDCB 2D6NA 3GZAA 4C91A 4GALA 1C1LA 1VBA3 1RITA 2ZMKA 3WNXA 4AYUA 3JQWA 3PVEA 4HSJA 4I0BA 3KZ4C 4QX5A 4I09A 2DCTA 5EJ3A 4LBNA 4IV3B 3NL1A 5CFDA 1D4M2 4NHMA 4Q4W3 3KLSA 2GN3A 3KM5A 1ENSA 1VBE1 5AVPA 3V65A 2BNNA 3FUOA 4F3JA 4HKWA 4MZUA 4WM7C 5F5QA 3RYKA 3U07A 4AEMA 5BNNB 2AZ5A 3V0BB 1S0EA 2BYVE 3DV8A 1D4M3 5BNOA 2ZX1A 4K1YA 1CVNA 4N7IA 5HCFA 2JG8B 3M1HA 3DKWA 4PIXA 4COYA 4YNIA 4N9HA 2O8QA 2XG3A 5JIUA 5ERLA 1SFNA 4N9IA 5DG2A 5T52A 4YGEA 2NPIA 5EYYA 2LM3A 1ZVFA 4Q4X2 4PDWC 3OF1A 1MVEA 4YW2A 3H1WA 5KWRA 2CWMA 3VZKA 1LESA 4JRLA 1DDLA 2P3JA 3SH5A 3VBSB 3M3IA 4YGCA 4E27A 1TME2 4Z07A 1CN1A 1GICA 2X5IC 3DKQA 5CIRA 1LHWA 1JN2P 3R4SA 1DQ0A 4FAGA 4EWAA 4J1WA 2E9QA 1O4ZA 1UD1A 5LBFA 3AMMA 4XFHA 4GWMA 3RQ0A 1UU6A 3JBG1 1N3OA 4LA2A 4N7UA 1BYHA 3VZLA 1AX0A 4ZU4A 1ENQA 3KB5A 4TZDA 5GKAC 4MYEA 2GAUA 3J26N 5BPXA 1H2NA 1XNDA 1W6OB 4GMP3 3JD71 5IK4A 2E7AA 4EWEA 2D6LX 1N1SA 4G9SB 1LULA 4HANA 1V6KA 1YFUA 2B7YA 2Q4SA 1O91A 5IATA 2R072 1H2LA 5LA9A 3ZN6B 4AVVA 3OD0A 2E63A 1QH6A 4XCBA 5EQUA 4BWOA 4CP1A 3D8CA 5LK7B 3PLQA 1DBNA 3QACA 4LBQB 1RL3A 1LGNA 2R073 3RNSA 2RS11 2GMEA 1NCQA 2XLFA 2DVDA 1Z7S2 2IXKA 2ZX0A 5I0UA 4M0NA 3ZN4A 4RQPC 1ND3C 2A6ZA 4D7SA 4Q8KA 2BBVA 1KITA 4LUMA 2E7QA 1VR3A 4QGMA 3PHMA 5CFCB 3INAA 2D43A 5IK8A 3OGGA 1UZZA 4NOTA 1KXGA 1EV11 1BBT1 1B35C 4UWDA 5JIAA 2A3XA 1PK6B 4CDXB 1SBFA 1CPMA 1OKQA 4DINB 1AR61 1OOPA 1J1TA 4COWA 2HWB2 2PQQA 2WL1A 3VKFC 4QQ2A 1TNFA 1RUOA 4FP3A 4CDUC 2XWJB 2P3IA 4CDWC 4LBQD 4O9GA 3ZXDA 5KC5A 4YVSA 1IS6A 4P9WA 2VQ0A 2GC1A 3ZSEA 1VBE2 2OVUA 5DAXA 1PNGA 2HWB3 3QH7A 4P9JA 1W6NB 4EN9B 3QH6A 1FV3A 2RDSA 1REEA 1FNYA 3CL1A 4RR3B 4CDQA 4Z1VA 3GF6A 1Q3EA 3MW4A 2WS93 3CF6E 4QQOA 5C8CB 1WCDJ 1FMD3 3VKLA 2ES3A 1AF9A 2ZHLA 4R8HA 2NMNA 3I7DA 4LEJA 1AX1A 2G9GA 1G9FA 2VNOA 4N53C 3I4IA 2DVFA 1DG6A 5C5UA 4UW5A 1YIFA 4XAAA 4W6XA 3RWNA 5HXVA 1IPJA 3WV6A 4MXWB 1DZQA 1SBEA 2WQZC 2BGCA 2BVVA 1XE8A 3JUUA 2ATFA 3J9SA 4KBZA 3DPRC 5BY5A 2IZWA 4BM8A 4JGYC 3VHOA 2PHFA 1RUH1 3NKGA 1PO22 4QPYA 3NAPC 2RR11 4J25A 4H55A 4Z82A 2EXHA 4LR4A 1OQ1A 3VZJA 2CY6A 5T50A 2VMHA 3WHTA 4IEVA 3JBG2 4NWVA 4LO5B 1PO23 2EIGA 1LHUA 5CG9A 2VUAA 1I3HA 1WUVA 1MACA 3C2UA 2CL2A 3DUIA 4KWLA 4XIOA 1BEV2 3NWKA 2RM21 4OFGA 4Q0VA 1QY4A 2OIIA 1LOEA 2R043 5LRRA 5I0SA 3JD72 2GH2A 3WW4A 2D6OX 3WW1A 3CEWA 4INDA 5HV4A 4W6YA 4ES8A 1UL9A 2ZZJA 2R061 1K5MC 3AXEA 1BEV3 5AFEA 2PHWA 4KU7A 1RUF2 4XXAA 4GKYA 1SBDA 1MR5A 1UN1A 1LHVA 3AYCA 2Y34A 2DU1A 4OHYA 3ZXKA 2V73A 5CB7A 1UU4A 2ZX4A 5DUUA 5T5PA 5LEJA 3ZFGC 1VBD3 3MGUA 1YI9A 1LODA 2RS12 3ZXLA 4QPIA 2ZACA 1RUF3 1C8M3 2B8MA 5I8YA 1BMV1 1UPSA 4BA6A 1LTEA 4A3XA 4DZGA 3AZZA 1W2UA 4AI2A 1UX6A 4KL1A 4FAHA 4K3UA 1CAXB 2Q1ZB 2WFPA 2HWF1 3BIWE 3VUOA 1HRI1 1QKQA 5BUVA 2A6YA 1ZX5A 2Q8OA 5GLZA 3ZDSA 1R083 3TNQA 3OYWA 3TN91 3ZFEA 4FTEA 4I2OA 3ZIXA 3BOPA 5L9VA 1EV12 2K0GA 1BBT2 5FLHA 4Y22A 2WQ4A 1PM7A 4NR1A 1AR62 3H8UA 3A0KA 3KCCA 1WW5A 1VIWB 4JAAA 1UZYA 1MQTC 5ABJB 1NLRA 5I8SA 5L36A 2VECA 1N3PA 2WT2A 1QQP1 2ET7A 4META 1WCKA 4AXOA 2N7GA 1DU3D 2GNDA 4Z92B 1VRH1 3USUB 1JH5A 3HMYA 1RUD3 2YV8A 4XF4A 2PAKA 4YZ3A 2XBO1 1PZ8A 2P37A 1I9RA 3VBRA 1LOGA 2JG8C 1IPKA 4OI1A 3LAGA 1MZEA 1KRIA 2I2SA 2G4IA 1O5LA 1W6QA 1FPN1 1N1VA 2B39A 2XWBB 3M2MA 3WDXA 2WZR1 5L7OA 5BXXA 1QDOA 2FMDA 4IQPA 4DRVA 3EMRA 4KU8A 3AP6A 1AL21 1XNBA 3VZOA 5C6CA 1APNA 1H9WA 5I93A 3DL3A 4FPOB 3FC0A 3WW2A 4Q26A 3ZYRA 4YM0A 1KFXL 1LEMA 3WG1A 4I30A 1QJZA 1DHKB 3VL9A 1AR91 3WP5A 5JDBA 3VBSC 4HPKB 2LTNA 3POSA 4QQPA 3MICA 4R9DA 4E4SA 1S2BA 3MLJA 3WX5A 4EV0A 2RR12 3IWZA 2FCVA 5DZEA 1ND2B 4AF9A 1LCLA 1RVF2 1GZWA 2EXKA 3E6DA 1J58A 4XILA 3C3VA 1RUI1 1YIPA 3HIFA 5KHGA 1COV1 2DFCA 5JZGB 2WT1A 2D3PA 4AGVA 1A8DA 3GHNA 4QM9A 2D40A 2DUOA 1RVF3 4ZXKA 2RM22 2BVBA 4K1ZA 1NCRB 2SBAA 2JECA 4HK8A 2JX9A 3KCYA 1O4TA 2BUKA 3AZYA 2R062 1YO8A 2Y0IA 3BVCA 2ZOEB 3UV9A 2ENRA 2E6VA 5CFDB 3CJXA 3SNMA 3L2HA 3V56A 2BFUL 5LBEA 1Q8VA 4FPJA 3OD4A 4XIKA 4BOWA 4GB32 1LJ7A 3VBHA 1JTZX 2ZX3A 2AGSA 4FTBA 5A32B 2CWSA 5I8TA 1BMV2 5BNOB 3RRDA 4XHBA 3MIHA 1OI6A 3TBDA 2HWF2 1S1AA 4GB33 1R091 4LA3A 1FI2A 2D6PA 1AJOA 1HRI2 3MF6A 1V70A 5CFCC 1TEIA 2E53A 3G6JB 1F9KA 4I01A 4XBLA 3TN92 3ZYJB 1QJU3 1PVXA 3AZVA 4IV1A 5J98B 4Y1YA 3WVJA 1RINA 4XFGA 1VBB1 3IN9A 4CDXC 3UKNA 5GLTA 1NE4A 2SLIA 4RHV3 1HRI3 4XE9A 5C5TA 1SLLA 1AYN1 2PLV2 3OBTA 2C9AA 1GR3A 3LSEA 1YNAA 2A6XA 2ETEA 4AFBA 2VW1A 2BW8A 2YPJA 2GNMA 3LZZA 4IEZA 3KT1A 3FLPA 3TNPB 1NQDA 2QFEA 1H8TC 1LR5A 1CAUA 3MW3A 5FO7B 2UWBA 2BNOA 2PLV3 2NQYA 4XPVA 3ZSLA 1G9CA 5GZCA 2XHKA 4E2GA 1YLLA 2WNUA 2R49A 4YGBA 3D5OA 3ZVXA 1JHNA 1XNCA 4RR3C 1POV3 4CYDA 3NO8A 3A4UA 1QJX3 1Y9QA 1VBC1 3K51A 3ES1A 3H1YA 1OLQA 4XMAA 1FPN2 4YG0A 3I59A 2W52A 1VB2A 2WZR2 2WSUA 5EYXA 1VJ2A 4EN0A 1GANA 1M06G 1OSGA 3TRSB 4B29A 4BQYA 2PAMA 3GBWA 5AC93 1FOD2 1BJQA 2HWE1 5FMOL 5GLVA 4FPKA 1RUJ1 2VOVA 1S0BA 4M3CE 4OHZA 1TQ5A 3PVOA 3NW4A 1XU2A 4PJYA 1AR92 4M3CA 3RSJA 5CA6A 3MFCA 2A5ZA 1LU1A 1MVQA 3RG0A 1PZ9A 1FOD3 3OBRA 3OY8B 3RMXA 4AEDA 4IEPA 1PO13 4B8EA 5DAVA 4D69A 3N4MA 4YG6A 3AZWA 1CPNA 4YZ1A 1RUI2 2VW2A 5HBAA 1V6MA 1AR83 1Q8SA 2C1FA 1COV2 1NY71 4A7YA 2AYHA 3U11A 2BWCA 2VU9A 1LOCA 2CGPA 2W39A 5CU1A 3BOWA 2YGMA 4N43A 5LBBA 2D44A 2IFWA 4HVOA 4GMP0 3R6SA 5DAPA 5JOXA 4JDNA 1ZZ8A 1CONA 3QLQA 4BLJA 1ZM1A 2RJLA 1V6IA 3USSA 3BU7A 1SACA 3HQXA 3FZ3A 2RMU1 3B02A 1RC6A 1OOPB 2Z5WA 1C1FA 2CTVA 1IHMA 1QOOA 1BKZA 5E1RA 4LO8A 2DYCA 2XLAA 4KWKA 3WG4A 4M3CF 3AYAA 3SCFA 4B7EA 4PLOA 2R0FA 4AW7A 5KBFA 1OMIA 3ILFA 2A6WA 1YHFA 4KWJA 3ZXGA 1AUYA 5FOJB 1BXHA 2GU9A 1X82A 3M3CA 3WW3A 2JD4A 1SCSA 1HXS2 2YGLA 4CDQB 2R1DA 3H9AA 3CO2A 4EN6B 2ZA9A 4P9XA 1FXZA 1IS5A 1R092 2CGOA 2NZ9A 2Z69A 3WDYA 4LT5A 3NV1A 4QQLA 3GHMA 4AG4A 1S2KA 1R1A1 4RD7A 4COZA 1HXS3 2IXLA 4U36A 3ILNA 1HRV3 1ZRRA 2FMYA 2HEYF 1VBB2 3B94A 3MIEA 5CAZA 2Y0OA 2JXAA 3VN4A 4S2FA 1GZCA 4FPGA 2R30A 4HMZA 4FOVA 2DURA 4PDWA 2AR6A 4MHRA 1AYN2 3WR0A 5C33A 2BFUS 4XTPA 2UWCA 5ABJC 4WVMA 3ILRA 1SLIA 5IAVA 2PHTA 4Y1ZA 1RUC1 1UIKA 4L9BA 2EAAA 1ZZBA 1FV2A 4UW4A 4KH9A 2X5IA 4RL7A 3OCPA 5SV8A 1KDMA 1O3SA 2VH9A 4B3NA 4AFDA 1VAKA 4J1XA 2JG9C 3P3NA 1WW7A 2X8KA 3KT4A 4FPHA 2CV6A 5T3NA 3SHRA 3OPZA 1W6PA 5GALA 1VBC2 3LA7A 3GJAA 4LE3A 3R4UA 4D3WA 4PBPA 5DDJ2 5DUXA 3ZN5A 1RHI1 2O0OA 1AJKA 3M7AA 3WDUA 4XYXA 1PGL1 5FCCA 2HWE2 1RUJ2 1AXKA 1H8VA 3HN1A 4OUMA 5AVAA 5CBLA 5DDJ3 4I3PA 5JOYA 2ZGSA 3IT8A 4XFIA 1U12A 2PA7A 2UURA 5BYNA 1DGRN 2HWE3 1ND2C 2EA7A 3VL8A 3Q9OA 4Q4V2 4CEYB 1SEFA 1UF2C 2QJVA 3WY6A 1ZBA1 3J8F1 4E2SA 1WW4A 2WFF1 1YWKA 4Q4X3 4JZRA 2WINB 4M00A 3JZVA 3B3QE 5DUVA 2WJSA 3IPVB 1BVP1 5E89A 1H4HA 3OYWB 3ZFEB 4Q4V3 1ND3A 4RQPA 1MZFA 1IQAA 3WHUA 5EP9A 4DB5A 5KXDA 4GIQA 1TME3 1NCRC 1WLWA 4Y22B 2V09A 3X29B 1V6OA 3VBOC 3VBUC 4XF1A 4GWNA 2UY8A 1ZBE1 2XPJA 2Y33A 1ENXA 5D8AB 1B35A 5FMOS 3TYJA 2YROA 3AMQA 2RG4A 3FMGA 5GM0A 1PZ7A 3OBZA 4KGGA 4F7ZA 3CLPA 4QPGB 4CDUA 1WGPA 1AYM1 1QXRA 3MLLA 4MGIE 3JB8A 4YARA 4M0HA 4RS5C 3IM0A 1O5UA 2DUPA 1EAH1 1OA2A 1S0FA 1IGOA 2YMZA 2IXHA 1RUNA 1MEC1 1SDWA 4XJ9A 5BNOC 2QNKA 3VBRB 1S0JA 2VVEA 1Q8PA 4HL0A 1DGRA 3WP6A 4AVAA 4JTOA 1X50A 3SITA 4DXZA 1LOBA 1W6QB 1C28A 2RS51 1NYWA 1D4VB 4XHXA 4JV4A 5L7OB 4AFCA 1A3KA 1KS4A 1R1A2 4BQXA 2ARBA 4SBVA 1X33A 2UYAA 2A6VA 3L9JT 3SH4A 1NA1C 1QJY1 2PAEA 1HV1A 4KG0A 5K8SA 3M3OA 1WD3A 4MGZE 3HAGA 2DVAA 1F5FA 4WM8A 1CR7A 2D93A 3R4DB 1Z7S3 3ES4A 2H6CA 4EN8B 2NM1A 2TNFA 3AYDA 3WDWA 2XJPA 4DY5A 1J3QA 3DPRA 5BV6A 4GH4C 1GZWB 4I02A 3MF9A 2QDNA 1LOAA 1QXJA 3NAPA 4DQAA 1SLTA 5IAXA 1TMF1 3V0AB 2TEPA 1XQNA 2IFRA 1ASJ1 4A2UA 5BNQA 4ONUA 4NHLA 3RYRA 5JMCA 3ATGA 4XC9A 3GZTB 5K0UA 5DZGA 5LEKA 1Q56A 3ITQA 1OPOA 5BNPC 1O3QA 5CVRA 1XRUA 2O8OA 2BTVC 4Q4Y1 4XBNA 1RHI2 1VBE3 5TSWA 1Y43B 1O4YA 1RB8G 2FHRA 1O3RA 1PGL2 3VHPA 2BPA2 1K5MA 4XQDA 1PHMA 3AZXA 4LO4B 4A7ZA 1CGPA 3WLUA 1FYUA 3MPPG 1HIXA 3AJYA 1IZ3A 1Q43A 2WIIB 3THPA 1CD3G 2MEV1 3VBHB 4F83A 4AK3A 3M70A 3VGIA 4MV2A 1DZTA 3AKSA 2BQPA 5FLIA 2MHFA 4EROA 4BLIA 1U0AA 3J8F2 4QGLA 3LGRA 4K9SA 1EPZA 2DVGA 2WLQA 5L73A 2OPKA 2WFF2 3ASIA 5F6LB 3FLTA 2PYTA 1PVC1 4LLOA 4ITCA 4D7TA 5DAWA 2FZ1A 1NXD1 5H9SA 5J96B 5IK7A 2GALA 4ISQA 3WG2A 4JDOA 4IV1B 1SLBA 2ZHMA 1CIWA 4QU2A 5GZEA 2XB6C 4H14A 3D0SA 1F31A 3ZMOA 5FQ0B 1ZBE2 1G7YA 4R4XA 3QCWA 2AREA 4AGRA 4Q29A 4Y4YA 2Y26A 4YW1A 4COUA 3LB9A 3RJ2X 1O3TA 1EPWA 3JBG3 1V9U1 2OZJA 4BPZA 1YYNA 3P3PA 4YVWA 3ZSMA 2G1MA 3WQ1A 1MQTA 5IT6A 3SISA 2DU0A 2WNVA 5KHIA 1CAUB 2CNAA 3M8LA 4KGQA 4CEWA 4Q2FA 3VBFA 5EXOA 1ZA4A 4UXAA 3W9AA 3JD73 5JSRA 2WNUB 3U0ZA 1H9PA 4AEJA 1YJKA 4K21A 3V0BA 2XVLA 4WVVA 2HWD1 5DZFA 1YXWA 2DCYA 4Y5TA 1TE1B 3I59B 2JG8A 3THTA 3WG3A 4JGZC 1H4GA 4FOQA 4AGGA 5C9AA 2DCKA 4LULA 4RFT0 1PGW1 3ZYIB 1DGWX 4P9IA 1D0GA 1OA3A 2GDFA 4XFFA 2D5FA 2RS13 3MIFA 4GA9A 1ZRFA 2DTWA 4HZFA 1S0IA 4M3CB 2XJVA 2GMPA 4Y24A 3D4KA 3LCPA 4F8AA 1BCXA 5FAXA 1LOFC 4AEDB 2JE7A 4AI1A 1LECA 1DQ4A 3VBSA 3WQ0A 1F8VA 4JQRA 1C8NA 2AH2A 4AFMA 4XACA 5EPAA 4E9KA 3MZHA 4IV3C 3O5SA 1TMF2 1RMU1 4CTEA 1LB2A 1EV13 1BBT3 2RHPA 1JBCA 1POV0 1KQRA 4OZXA 3TAYA 5DUWA 4N43B 2D97A 4RGGA 1A6CA 4LBMA 5A33A 1QDCA 1AR63 2XGXA 3POYA 2VVDA 2RJKA 1ZZ9A 3EXUA 2HWC1 3ACLA 1ULEA 2WZPP 5BNNC 1RUG1 3FFZA 3R0RA 2FCTA 5I0RA 4FPYA 4P9LA 3MEPA 4AFAA 4MVTA 4R4ZA 1GLHA 1W6OA 3LKJA 4Q4Y2 3S0MA 3AFKA 4K7JA 4ATEA 4DNYA 5ACA1 1HX6A 2VOXA 4B7KA 2QZ2A 5J36A 4B4QA 2ZAAA 1U5YA 4PF5A 2VUJA 1RIRA 4ATFA 2GNBA 2XKOA 4Y1XA 1QXPA 2VPVA 3ME2A 4IL7A 1UKGA 4NVPA 3APBA 1AXZA 2MEV2 1QGLA 1AR71 1W0PA 2XLGA 3MYXA 4HVRA 3WP4A 4O9EA 2GSYA 1LKNA 4L92A 4CEYC 1JXNA 4OHXA 1DQ1A 4PLMA 1RUH2 1OFSA 2RS31 1WCSA 1PIV1 1PVC2 3B7MA 4MXVA 3D82A 3JU9A 3GZUC 3NSTA 3AX4A 4IEYA 1D0HA 3FX3A 4FQ4A 3ZFEC 2OA2A 4ZONA 4IEWA 1OFNA 2EVXA 3RI9A 2QCSB 3AK0A 4NO4A 4LO7A 1RUH3 5KHHA 5CFCA 4YW4A 4OHVA 1F5JA 2EF6A 2RR13 4URTA 2NN8A 3S30A 1UCXA 1BK1A 3MI8A 4PDWB 5D8AC 4WVWA 2OPWA 4AVBA 3E5QA 4Y26A 2GMMA 2YDEA 1Y3TA