4NHKA

Crystal structure of tpa1p from saccharomyces cerevisiae, termination and polyadenylation protein 1, in complex with pyridine-2,4-dicarboxylic acid (2,4-pdca)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
613
structure length
546
Chain Sequence
EDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGELEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords PKHD-type hydroxylase TPA1
publication title Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 191
structure length 546
sequence length 613
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4nhkA01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nhkA02
3W20A 5DAXA 5HV0A 5LA9A 4Q5OA 3W21A 3NNFA 3HQUA 2G1MA 5L9RA 2OPWA 2RDRA 4MHUA 2HBUA 5ERLA 4JZRA 2RDSA 5HV4A 2JIJA 3DKQA 5IAXA 4XAAA 4XABA 2Y33A 2FCUA 5DAQA 4XC9A 4NHLA 3KT4A 5LBBA 5LB6A 4NHKA 5LASA 5A3UA 3MGUA 4BQYA 4Y5SA 5DAPA 4XCAA 5C5TA 2FCVA 5M0TA 5C5UA 2A1XA 3NNJA 5EPAA 4NAOA 5LBCA 2HBTA 4NHXA 4UWDA 5IAVA 4MHRA 5DAVA 5DAWA 2Y34A 4BQWA 3ITQA 2RDNA 4NMIA 2FCTA 3GJAA 2G19A 5LATA 4NHYA 2RDQA 5IATA 5EP9A 4IW3A 3OUHA 5L9BA 4NHMA 4XACA 4Y5TA 3EMRA 3OUIA 4ZONA 3NNMA 5LBEA 2V4AA 4BQXA 3KT7A 3OUJA 3GJBA 2JIGA 5L9VA 2RG4A 3GZEA 5LBFA 5EQUA 3PL0A 3KT1A 4XCBA 3OBZA 4KBZA 4ZPIA 4J25A 3BVCA 3HQRA 3NNLA
chains in the Genus database with same CATH superfamily
3MUY1 5F3IA 1ZRIA 3ZSJA 3BU7A 1BKZA 1NCQC 1NY71 2BGOA 2E7TA 1SCRA 1UNBA 1YNAA 3JD73 5HV0A 2VD7A 4GB32 3S57A 4Q5OA 1DIWA 4JAAA 5FREA 2BRTA 2JB8A 3H8OA 4CU7A 1LHNA 1WZXA 2FZ2A 2X10A 1LKNA 3ZMOA 2CAUA 3R6SA 5CFCB 4ASKA 1V0AA 4JGYA 1HLCA 2NLRA 4JDNA 3RJRA 2F4PA 4AI3A 4I01A 4XQWA 2VVDA 4XF1A 1LOFA 1AR91 1ASJ2 3OGVA 3ENRA 2Y38A 4D94A 4UFKA 3WV6A 1ACCA 3VZNA 2OPKA 4LK7A 2VZVA 5F2WA 5F5QA 2VZUA 4AHXA 4Q29A 2FCUA 4JGYB 5FZHA 3ZFGA 3DXUA 1XU1A 1POQA 2ADDA 3NJVA 1X8MA 4JQRA 5FPAA 3DCQA 5K7PA 3FHAA 5FUPA 1VMFA 1N1VA 1WMFA 5A3UA 3ILNA 3AYCA 1Z7S1 3KQRA 4N53C 1PO13 2VXJA 1H1AA 1R092 2GNMA 4P9XA 4E9KA 4F83A 4CEWC 3B93A 4QB2A 2KM2A 4AEMA 3E6CC 2F4LA 5CKMA 3ZFGB 3Q8EA 3SLIA 3NNJA 3RI9A 4XIKA 2BVVA 4FPEA 1FXZA 1R64A 3I2JA 5F5AA 4M01A 5IVBA 2YXSA 1EPZA 4CA9A 3MIDA 1UY2A 1U5ZA 2XGXA 5H9RA 4YZ2A 3IAQA 2XPJA 4MHRA 1MS8A 1NXMA 3I3EA 4PIXA 3JQXA 5GLVA 1CAVB 3ACLA 3E97A 2WWSA 1AYN2 3OF1A 3RJ2X 2D98A 2Y6FA 5C3RA 2RMU1 5LY1A 1XOYA 5T3NA 1VRBA 4AI0A 3POIA 3VHNA 4DNYA 1HJFA 1J59A 3LEIA 3H8XA 3JU9A 4ISQA 5EP9A 4IW3A 4L99A 4LE3A 3GBWA 4HG6B 1PO21 4M4RA 1O91A 4Y5TA 2O14A 3WNOA 5IT6A 5ANNA 1PZ8A 4AEKA 3GCXA 1G6NA 2D3SA 2R073 4PDWB 4A2UA 1ZZ9A 4KWJA 5LY2A 4DUXA 2OUHA 2ZGKA 3LIGA 4RGGA 4WVMA 4UT5A 3VL9A 4LOSA 2VOWA 2Z2SB 2VQUA 3KM5A 4XF3A 4CDUB 1KRIA 2ZGPA 2R041 2A6VA 4P9WA 3VZLA 2F6BA 1W6QA 3GXUA 2CL2A 2KR2A 4YM0A 4B8EA 4BU2A 4F8AA 1US2A 2R6QA 5FJKA 4IERA 4BXSV 3BTYA 1QJU3 3ZM8A 3I54A 3HD8B 1AL21 1LNSA 1HDKA 1YQ6A 1ODNA 5CG9A 1BEV2 3M1HA 3SEPA 4KWUA 1W6QB 1UF2C 3K48A 1H6XA 3MIFA 4Q4W3 4IEUA 3VBRB 5GZCA 5FMDA 4BISA 1HQWA 2D6PA 2ZACA 3JXSA 4IEOA 1H2LA 1DGWX 2Q4SA 2XBO3 4Q2FA 2JD9A 5K0UA 1UX6A 4FT8A 4JKKA 1E5SA 4CUAA 2VG9A 1K42A 1E5IA 3AMHA 2D6OX 1O3TA 2NPIA 2HWD1 4NE9A 5IUQA 4IUGA 3ZVXA 2LRPA 1OD5A 2D5HA 4LA2A 4Y20A 2E26A 2XUMA 5FLHA 3MICA 3D6EA 5T5JA 2XJSA 1FPN3 4BCUA 1NCQB 2RJKA 3S30A 4AHWA 2ATFA 2RS12 5T52A 1BK0A 4DIQA 1C4RA 4XBNA 2N7GA 3M3IA 5HCAA 4P08A 4QX2A 4XFIA 4LK6A 2QQOA 4IEYA 4AHZA 5JPNB 2ZMNA 4XHXA 2W1QA 3CJIC 3MPBA 5TSWA 3UKVA 1RB8G 3JB4C 4W8JA 1GFF2 3IZOA 3LQCA 4GWIA 4B7KA 1QY4A 3NKTA 2QUOA 3VD3A 1IQAA 1PX4A 1N1TA 1VAMA 2DVDA 4Q0SA 4YARA 5LB6A 1Y43B 3K3OA 1V6JA 1RL3A 2EXKA 3P3NA 2VNRA 4FI9A 3OYWB 5L36A 1S1AA 1GZWB 2ILMA 3GM8A 4CEWA 3MPPG 4C1XA 4Q4V2 2WA4A 4XIOA 3ZYJB 2NQYA 4ZY9A 1EAH3 1FV3A 4BQ5A 1PIV1 3I4IA 2C9KA 3ELNA 4E8DA 1DU3D 3ATGA 2BZDA 5FYVA 5LBCA 4D69A 2MEV2 2DCKA 1EAH1 4N53B 4UI9L 4U2AA 5AC93 4MVTA 2X29A 5CKNA 1W8ZA 4CEWB 1ZREA 2W9XA 4IQPA 4EN6B 4AFMA 1AX0A 4AXOA 2RS31 4YG3A 4XFHA 4B4PA 1MS0A 1CZSA 2PHUA 1I3HA 4NWWA 1VR3A 1MS9A 2PHLA 3AP7A 3GBFA 2A6XA 3LSDA 3G6JB 4YGEA 3KZ4C 4BB3A 2BYVE 1YUDA 2DTYA 1K5MC 4Q4X3 5BNNA 2C26A 1VBC3 1AR73 1NAEA 1W6MA 3KCCA 4I3PA 4KL1A 2A3XA 5HCFA 3THCA 5IK7A 4FTSA 4LUMA 2VR4A 2B45X 2QQJA 3N7LA 4LOTA 3WQ0A 5I8TA 4D6SA 3WCSA 3VLBB 1J3PA 4ZZ5A 4QKNA 5FMOS 4DRRA 1RUI2 5BY5A 2AH2A 1VBE2 4RGKA 3IBMA 1AR61 4XOGA 1H0BA 2LROA 4GQ7A 1CONA 4L11A 1IKPA 4V1PA 1IPKA 2BOIA 3KB5A 2R1DA 3MIGA 1TMF3 1UMIA 1O3RA 4C0HA 1W39A 1RHI3 3LSEA 4AGVA 1RYYA 3B7MA 3FHIB 3OPTA 1FOD2 2R1BA 3ZXEA 3VBSC 5IK8A 5ISLA 1OURA 3IPVB 3GHMA 2RVAA 5KHJA 3SEEA 3T3YA 5APAA 3R0RA 2JE8A 3B00A 5FMOL 4LBOA 1SBFA 5T50A 2WYFA 3POGA 2XWBB 2FMYA 4CRQA 1W9SA 2MNGA 2AYHA 3APBA 3ILFA 2NZ9A 1FX5A 4GA9A 3D0JA 1UOBA 1ZBE3 1S0DA 4LBLA 4IV3C 5BV6A 2YFUA 4Y1YA 4L2NA 4EN9B 1SFPA 1W2AX 3LOBA 4JVAA 3VBFC 2HBUA 3M3CA 3ZXFA 1AYM2 1VBA3 3W5NA 5JXJA 2JG8C 3AZXA 2GP3A 2EAAA 4IEPA 4JKLA 5CNAA 5JDBA 1RUOA 4NRQA 4HSLA 1YC61 1YO8A 2QDNA 4XABA 5FXZA 4OZXA 1RUE3 1HXS1 2XJTA 1MR5A 3ST7A 1GR3A 5FPXA 4OHXA 1QXPA 2K9ZA 4R8HA 2PLV2 4XFFA 3QACA 4BLIA 4CYDA 4CE8A 1UY3A 4JDOA 1GV9A 1SACA 1ZVFA 3CO2A 4NRMA 4AZZA 4J6GA 3IKWA 1KFXL 1EY2A 1KITA 4CUBA 2DFBA 4RHV3 3ZPOA 1BBT1 3O1TA 2E32A 3CJIB 2HLEA 2Y60A 2C0ZA 1MEC1 2VUCA 5C71A 5ABJC 2P4EA 4GZ9A 5FY0A 5A1LA 1T2XA 3O0XA 2VNVA 2UY8A 2B8MA 4CCOA 1A8MA 5FP7A 4YPJA 5HBAA 3ZSLA 5J3UA 2VZ1A 4RS5C 4DINB 2GC2A 3K4ZA 1GZCA 1O5LA 1PMIA 4X8NA 3THTA 4AQ2A 5FP9A 1B09A 1VMJA 4UFLA 5F6KA 4CCLA 1TEIA 3E5QA 5FZ6A 3N9NA 2WS91 2DURA 4WZCA 1RUJ1 4UF0A 4W6WA 3AKTA 2P6CA 1DG6A 5DUUA 1ULFA 1OSGA 5D1IA 4MUVA 5KXEA 3ZYFA 5FP8A 3CDZB 2QTWB 1UCXA 3EJKA 5JR2A 1QGLA 3MF9A 4TLGA 1CAUB 1K5MA 1U0AA 1UKRA 1WCKA 3ACHA 2DVGA 1M4WA 4LBMA 4XILA 3WG1A 2X09A 5C6CA 3C8XA 4XMIA 1DGLA 2X8KA 1SEFA 4YGDA 5A7SA 4UF0B 1AXYA 1QNYA 4FPJA 1SLIA 2Q8DA 4QB1A 2RS53 2VOKA 3SHRA 4M3CA 2ZPXA 4BQ4A 4RN5A 2WFF3 4CXYA 1O4TA 1JOBA 1K5MB 2PTMA 4XBQA 3VGIA 4N9IA 1RUH2 2TEPA 4GB33 4OZOA 4YVWC 5A7WA 5JSOA 4LLOA 5GALA 4XE9A 4QXKA 1H2KA 1MQTB 4M3CB 4OVEA 2EXHA 3POFA 3R4SA 2VE1A 5JSRA 2KA3A 3RI8A 5FYZA 4KGQA 4DUVA 1F15A 2B46X 5JOXA 5C8CB 1K12A 3KVAA 3VBSA 3DUIA 1WCQA 4YW2A 3DL3A 4R9CA 4A45A 2UWCA 1POV1 5DZGA 1ASJ3 2JG9A 2W47A 3B3QE 3OEAA 5F3CA 3K4DA 2R7EB 3A22A 3O7OA 1W8HA 1FMD2 5EYXA 1UY0A 3K2OA 1I9RA 1RVF2 1WKYA 4L8QA 4N43B 4EYUA 3VL8A 5JZGC 1GQHA 2HWF2 3I3MA 2OQ6A 2G1MA 3AKPA 3AM2A 3VBSB 3I7DA 1H4GA 2YU1A 3O1SA 3BGAA 2ERFA 3C7EA 4QXCA 3BALA 4PHZA 4WVVA 4LUKA 1DF0A 1R093 3WUCA 4CVUA 4FPFA 4R4ZA 2PN5A 5ERLA 4YLZA 1D0HA 1Q8OA 1WMEA 4KH9A 4YWAA 2Q1ZB 2ZHNA 4XDPA 2VM9A 4Z2AA 2D93A 2YC2A 4BMBA 1WMXA 5A3TA 4ES9A 1RUNA 2PHFA 2QQUA 3T0DA 2DCJA 3T4VA 3OD0A 5A7OA 2J1TA 2WQ8A 4UAPA 4UOJA 4Y24A 3WQ7A 4AVTA 4IV3B 4QMAA 3TN91 5ACA2 3VBFB 2AR6A 5LASA 2Y0IA 2ZAHA 2JG8B 2ZGUA 3MGUA 3SC7X 3VKLA 3RRDA 1AYN3 4LHLA 5LEJA 2K46A 2OT7A 4Y5SA 1GP6A 3KWVA 4JCKA 4O9GA 4XCAA 4FFGA 5GLZA 1BLZA 1SPPA 3ZO0B 4CDXC 2VQTA 1JYXA 4HKOA 4MOAA 5SV5A 5I8YA 4OQ8A 2ZEWA 1XPWA 3WDTA 4BWOA 1DQ0A 1NLRA 1V9U2 3DKWA 5I0RA 5JXGA 4OI2A 5DABA 2W46A 4LBQA 2P3JA 2OIIA 1ZBA1 4MADA 2VPVA 5GKAC 3ZN4A 3AX4A 4ET7A 1W0NA 1VP6A 2GC0A 5ABJB 1SDWA 5DMYA 2XVKA 4FTEA 4WZFA 4KU7A 5JI7A 3LPFA 2K2SA 3AZYA 1R1ZA 2WZR2 3ETPA 5F3EA 4D6RA 5A6YA 4QX8A 1D4VB 3T30A 1ALYA 3P3PA 4RS5B 1WW5A 2XJQA 3ZDSA 3I2GA 1WUVA 2VZOA 2JDHA 1SLCA 1W06A 4FP2A 2WO1A 3HPNA 4AFBA 2OS2A 1GZTA 1SFYA 1UOJA 5K9YA 2C1FA 3VD7A 3CMGA 2OVUA 1YQ8A 4QX7A 1JBCA 5IYYA 1BEV3 1QJY2 1PNGA 5I0TA 5IVYA 3ZLIA 3AK0A 1DGRN 4K8FA 4QM8A 1MS4A 1YFUA 1Q8SA 4LA3A 1LECA 3Q8BA 1A78A 4JGZC 3FWEA 1PNFA 2L9LA 1YJKA 2CDPA 2PYTA 4PT6A 2XOMA 1W03A 1TME1 4YVWA 3IWZA 4IEVA 3WP4A 1NQJA 2HWC2 4BK5A 1RMU1 2HJIA 2JDKA 2VOXA 3OBZA 1W2UA 2BFUS 1UU6A 2HEYF 4AK3A 5FQ0B 4URAA 2BQPA 1HRV2 5HXVA 1QQP2 3T2PA 3HBZA 2RS13 2Y6GA 4QKBA 2OXBA 4YVWB 3NNLA 4HMZA 3WG2A 1OQDA 2VZPA 4DY3A 1FATA 1H1IA 3POYA 4PJYA 2BGPA 1F2NA 1R082 1UIKA 1W3XA 2XLFA 3PURA 4YG0A 5DAXA 1YFWA 2ZKNA 1BCXA 2H0VA 2GAUA 3TEZA 3NV2A 2EIGA 1Q8VA 1JU3A 1OA3A 4UFIA 3WSOA 4OHVA 4DXRA 5JZGA 4W4ZA 5FZCA 4IEXA 4W65A 5GZDA 3V56A 4FO9A 3GCWA 5CKQA 3BKZA 2FDKA 4I09A 4N9HA 2UYAA 5FZMA 2BFUL 2VULA 2RV9A 3I2OA 4R9BA 2ZGNA 3K4AA 5JMOA 4Q4V3 4BM8A 3I49A 5JZGB 5D8AC 1PVC2 5FZ9A 5FDBA 1JXNA 1OA4A 5FXWA 4UXAA 5CFCC 1ONAA 1LOGA 4LXLA 5CFDC 3ZYBA 1QKQA 3PIGA 2GZWA 4M0HA 4DUWA 2MEV3 3DYOA 4RA0A 4NHLA 2GN3A 5KR7A 3AP5A 5IVEA 4K8RB 3RZLA 3MW2A 2P6HA 1YQCA 3WW3A 1FT9A 2AREA 4NUBA 1N3OA 3DF0A 2A7AA 5LA0A 3TB0A 4XDOA 2RE9A 3Q8AA 1ULOA 4W6YA 3J4UH 1WWYA 4GJYA 1BYHA 3JUUA 2XQXA 2IVIB 5A3NA 2A6YA 4FCAA 4Y22A 4MSVA 2IXJA 3O14A 2B9UA 5FFOC 5LRRA 2QNKA 1X36A 1LR5A 1X50A 4IDZA 2EICA 4XZPA 2JKXA 2WLPA 1LRHA 3WF3A 2PMWB 4XEZA 4B29A 2B42B 4YW3A 4QDQA 5FZ8A 3LEKA 1SMVA 3RMYA 4CDXB 3S7EA 1RUI3 2FCTA 2WNUA 4LHKA 1Y9MA 4IE7A 4QPIC 1VBE3 4YZ3A 2JDMA 2ZA9A 4COUA 1UYPA 4QQLA 2XHNA 1DP0A 2ZCWA 2WO7A 3I3QA 2V4VA 3KMHA 3S6PA 4CXWA 5IFTA 2YROA 3LEGA 2YZ4A 4FPKA 1QF3A 3ETQA 3LA7A 3NJYA 2VTXA 1L7RA 1FOD3 1AHSA 4LKDA 3M3QA 4JTNA 1VBD1 3LDKA 1CVNA 4B1LA 4OHWA 4U36A 5BNQA 5ANQA 3C7FA 3T1MA 1HRI1 1KD7A 1APNA 2D3PA 2JE9A 3MV01 4YZ5A 3QH7A 3H50A 1DYKA 1GOHA 1CQ9A 3MW4A 1TZOA 4RR3A 5FLJA 4CDQA 4FPLA 5FYTA 3WP5A 2YDEA 4Q1RA 2DCYA 3VDDA 3C7HA 2ZMLA 1W6NB 4KBZA 2CDOA 2AZ5A 4YW7A 1AUYA 1W6PA 4QKDA 2LW8A 2AENA 2BBAA 1NG0A 4GKXA 2PAMA 5FZOA 4BJ0A 1CPMA 2YPJA 2JX9A 5CISA 1UMZA 1LHOA 2LALA 3AYDA 4JGZB 3LIHA 5A7QA 3TNPB 4AEDC 4A4AA 3HQRA 3AL5A 3RZHA 1AYM3 3NNGA 3USUA 3PHMA 4P00B 5T5PA 3WLUA 5KHHA 3RZGA 1IPJA 4K1ZA 4TSVA 2I2SA 4TXWA 4OUEA 3AMPA 1ZNPA 1U5XA 4NIHA 3BCWA 3POBA 5FZOB 3FUQA 4XF4A 2D6LX 2PLV3 4LBQD 4BIOA 2YHJA 1BZWA 1OH4A 2BNNA 2ZX3A 2ORXA 2ZGOA 1QOSA 2XQRA 3PTYA 1D0GA 1ST8A 1Y4WA 2YGLA 2VTXJ 4R52A 3J8F2 5IVJA 1PZ7A 5FK7A 3MLKA 3IAPA 1X82A 1RUC1 4I0AA 4XPVA 1ZZ6A 5D8AA 2E63A 1CZVA 1G7YA 5CFCA 5A1FA 5I0UA 1DQ2A 3VBHC 5K8SA 1Z78A 1IQDC 3NVCA 3PVEA 2ARBA 3RZZA 3TWIA 1XRUA 3A7QA 1JYNA 2VBPA 4FVVA 5F2SA 3WF2A 4CU8A 4DB5A 2EXIA 5LA1A 2XJUA 3HNBM 4BHPA 3JD71 2UU8A 4QXHA 5D8AB 1JODA 4GD4A 4PLNA 3RWNA 3HJRA 4AOCA 5CFDB 2NP0A 1HV0A 3UV9A 1GUIA 1MVEA 5K4LA 1COV2 2GC1A 2QVSB 3BB6A 3HR9A 3PLQA 1Q5OA 3I3BA 4GAZA 4LR4A 4M4PA 5FYYA 4BE3A 4XF9A 3RZMA 1ND2C 3OBRA 5I0SA 1YQ5A 3LAGA 4LMFA 3ZOIA 2DYCA 3AP6A 3O1OA 2QQPA 4LITA 1LGNA 4XJWA 5F1RA 2HWB2 2VXRA 1KS5A 4NIAA 5J37A 4LNVA 3HVDA 2TBVA 4NROA 4N8MA 2DVFA 4AG4A 1DHKB 3KGZA 3ZIXA 4Y1XA 1YXWA 2X53S 1GOFA 3GZUC 1RUH3 5IW0A 2VGDA 3H3ZA 2KD7A 1NZIA 2OX0A 2BGCA 3E6DA 2WAOA 1PGL2 5DUXA 5G05L 1CAVA 1C8M2 1EV12 1UYXA 1PO11 1OLMA 1SLLA 2Q1FA 3DGTA 1DQ1A 1H30A 3HN1A 4HXCA 4KWKA 4QPIB 1QJX2 4UBHA 2SBAA 3PIJA 3U07A 3TEYA 3KHCA 1UZZA 2EIDA 2Z79A 4RFT0 4QWNA 3TRSB 3OG2A 5AFBA 1E57A 2W94A 4Z1VA 3MDPA 1UU5A 1QWRA 3E1F1 1MZFA 1V6OA 4KMQA 2JDPA 1KS4A 1Q8QA 1FMD3 3U11A 2P5BA 1CIYA 1HB2A 1YEWA 2ZGTA 5FPVA 4F7ZA 3CL1A 1RVF3 4PDWA 2HWF3 1QEXA 1ULPA 2BERA 5IVCA 1O4ZA 2AEZA 1GANA 3EHKA 3NV4A 4Y4RA 4COVA 1DYPA 3FFQA 4NRPA 4CDUA 2OQ7A 4P02B 3FJSA 1LENA 1Q43A 5T5LA 4QHBA 4AEDA 2OPWA 2PAKA 2X5IC 4LLFA 1EUTA 1UYZA 1CJPA 2VZTA 4HK8A 3ILRA 4JTOA 3T1LA 5J98B 4EWAA 3AP9A 3GZAA 3JB8A 5L19A 1LHVA 2BNOA 4FXGB 1QJZA 1NQDA 2J7MA 3CBNA 1W8FA 4CP0A 2R071 4PI0A 3JBG2 3DYMA 4DO0A 1YIPA 1REFA 4XUTA 3U4SA 2GALA 2A75A 4AEDB 5ACA3 5G04L 5L9RA 4K7JA 1H8VA 3VBRA 2OYZA 1WMDA 2VQ0A 2I45A 2XLAA 5LWBA 4WV8A 1CIWA 2Y6HA 4YM1A 1CAXB 5H9QA 4Q1PA 2ZKLA 1Y7BA 4LO8A 2Y0OA 2XONA 4S2GA 4LEJA 2ZBJA 3IMMA 4JX0A 1V6NA 4IV1C 4E4HA 2BVBA 1LGCA 2ORZA 4QKFA 2J1AA 1QJU1 3LPGA 3L2YA 3WG3A 1V9U3 4XVHA 1KQRA 4WM7C 5DDJ2 1V6MA 1NCQA 2DTWA 3I2FA 3VBHA 5F7UA 2GMEA 1WGPA 1DZQA 1SBDA 4Q4W1 1XNBA 2VMEA 1ZA4A 4V2WA 2R0HA 4D7TA 5J7MA 4ORFA 4LULA 3PUIA 5EWSA 4LHNA 3PUQA 2D40A 5F5IA 2XBO1 3KVBA 3MI8A 1QOOA 2VBBA 4META 5DAPA 2BOJA 2BWAA 2WZR3 2FCVA 1NCRC 3BOPA 3OCPA 3VBHB 4ARXA 5FZ4A 1ULEA 1RUG2 1R1A2 3VDBA 2WZPP 1F31A 3MO4A 1VRH2 4I2OA 2JDYA 2XG3A 1FPN1 1JYIA 1ND2A 3N35A 5L7OC 3LGRA 4AFCA 1NOVA 2HEWF 3H8UA 3LB9A 4BK4A 3W9AA 3OYWA 2IXCA 1GZWA 1STMA 2ZXQA 3LA3A 3ZKUA 1OLRA 1MACA 4BDVB 3I59B 4IGPA 5C3PA 1QJY3 3IIAA 1RUF2 4EROA 5JIUA 1US3A 1S2EA 3NMBA 2R062 1UKGA 2D6KA 1ND2B 4QX0A 4ZHNA 2WZ8A 4N53A 5DG2A 2XL7A 3HN3A 4BOWA 1UWWA 4EN0A 5F9TA 4ATEA 3OJBA 5C4WC 3PVBB 4FOYA 1N1YA 4XFBA 2HWC3 2W1WA 4H7LA 1KEXA 2QZ2A 3SXWA 4XTMA 5LZ6A 2C5DA 4IGOA 3OUIA 2P3IA 2Q1MA 1D2QA 4HK9A 3LOIA 1HRV3 4ARYA 1QQP3 2O0OA 5FYSA 1B35B 2Q8EA 2DWRA 4YGCA 5EYYA 5DUVA 1W9WA 5CB7A 5FRAA 3ZXLA 3SH4A 3SCHA 4DOUA 3WF0A 3VV1A 1R083 2EXJA 2GNDA 2O8QA 5AC91 5HCHA 1G86A 1YHFA 3KT1A 1YYNA 1H9PA 4CZSA 1P8JA 2V73A 4KQ7A 1WBFA 4RQPC 4ZKTB 5FBJA 3G7DA 3EQEA 5FR3A 4AYUA 4CU9A 3AMQA 1AR82 4QD2A 1YQ2A 1HB3A 2GN7A 2RM22 4K40A 4QQOA 4TWTA 2LS6A 1BMV1 3AYEA 5FY8A 4E4ZA 1YFYA 5F8PA 4Q4X1 5JOWA 5D2AA 2D44A 3VBOC 2GDFA 3N4MA 1AR71 1MQTC 1VBC1 3D4KA 1PVC3 1V70A 3ACFA 5CZKA 4J1WA 1JHJA 5FWEA 2WKKA 5C8CC 3QCWA 3IPVA 2R16A 3CKHA 4HKWA 2B5HA 1D4M2 2HWE2 2WABA 3USSA 2X5IB 1W2OA 5A3MA 4L0PA 3OEBA 1WLTA 5CG8A 1XB9A 2YPDA 1S0JA 2XVGA 3CQOA 4Y1UA 1ODMA 2D5FA 2VTFA 2RDRA 1W8NA 2ZX0A 2D6MA 2CGNA 2SLIA 4XJZA 3ZDVA 1J1LA 1O3SA 1TMF1 2IFRA 4N43C 3WOGA 1RHI1 2TUNA 1ZZ7A 3POWA 4IV1A 3MF6A 2EAKA 4H3WA 3JQWA 3LCPA 4Q4Y2 5FWJA 1Q56A 2BWCA 1JYTA 3AP4A 2GMMA 1REDA 2XJPA 1IG3A 4QDRA 4WM8C 4YM2A 1N1SA 3SH5A 2RJLA 2RR12 1O4YA 4C91A 5FO8B 2MHFA 1JOPA 3ZSMA 1H2MA 1ENRA 1RUD2 4FQ4A 5FYMA 2W91A 5JVVA 4AVAA 3MUZ1 1OD3A 1LEDA 4IV1B 1XNCA 1K45A 1LOAA 3IT8A 4XFGA 2WO2A 5A33A 5J09A 5CBLA 3EB7A 3LZZA 3O12A 3WVJA 4FOVA 2IC1A 3ZR6A 5C5UA 5M0TA 4WM7B 2C9AA 3TNQA 3IMNA 4QB6A 5IK5A 2NYYA 4COYA 1YI9A 4QX3A 3ROUA 4V2VA 1ZBE1 4AAXA 4GALA 3MIHA 1LTEA 2XVLA 1K3IA 2DCTA 4XQDA 3T09A 2PFWA 4IEWA 5L7OA 1IOAA 2YB7A 3ZXKA 3V0AA 2XB6C 5A33B 1VBA1 4PF1A 3VD4A 3CJIA 2QQIA 5T55A 3ZXGA 1F35A 2DUOA 2O1QA 4MGZE 2V72A 3THPA 1NCRB 1PHMA 4BQWA 2RJ2A 2V5DA 4BQ1A 3PU3A 1QDOA 1LHUA 1RUE1 3H7JA 4OYUA 2ZHMA 2IVJA 4DXZA 3UKTA 3D8CA 1FNYA 3VHRA 5FZLA 3O0VA 1UZWA 2Y64A 5L7OB 2B4KA 5IATA 3V0AB 4B3NA 1W04A 3OPZA 3M2MA 2YMZA 4QPYA 1XC6A 5KXCA 1XNKA 4LKSA 1DYOA 2BDRA 1UPIA 1OPMA 4RHV1 4UFJA 4E2SA 2XL9A 2E6VA 2JDZA 4LTAA 1PGW2 1WCUA 1V6IA 4MGIE 2FQPA 1KXGA 1OKQA 1VBB3 2ID4A 1MS1A 3O1RA 1JZ4A 2QQNA 2BPA2 4LBJA 3RS6A 3AMMA 3AVSA 4HN1A 4XXPA 1CAUA 4NIDA 1GKBA 5C4WB 1VBB1 3BTAA 2FD8A 1W8UA 1BJQA 1A3KA 2ENRA 2DFCA 1FV2A 1UN1A 3HNMA 4OHZA 1XNAA 4RQPA 4B7EA 1LULA 2V5YA 4A42A 1NY72 5FZGA 3J7HA 2W1UA 2WO3A 5DN2A 2P2KA 3KCYA 4M0NA 4ZPIA 4YW5A 4A44A 4BH9A 1LODA 3WNMA 1CESA 1MZ6A 3J8F3 1AXKA 5F6LB 5DZFA 3Q9OA 4RQPB 1V6LA 3H8RA 1MQTA 1W9YA 2OA2A 2W87A 3BPSA 2G9GA 1LGBA 1RIRA 2CGPA 4FFHA 2FBEA 3N7MA 3VBUC 2WQZC 2YBPA 3OPWA 3K77A 4C8DA 3ZFEC 1AR92 1JMUB 1RXGA 1XQNA 2RS51 3NNFA 5C8CA 1OH3A 4AI8A 2WFF1 2I74A 5JSPA 1GU3A 1OQ1A 1EPWA 4P9GA 3VBOB 3N7KA 2E7QA 4GB31 2HKXA 2QQVA 4AEJA 2P3YA 1T6GC 1HN0A 3ACIA 1QIQA 3AFGA 4S2DA 3UJQA 1DDLA 4N43A 2JIJA 1HX6A 3I2KA 4IXLA 5F37A 1Z7S2 1COV3 1PZ9A 5FJHA 4OQ9A 4GMP3 1X8EA 4HL0A 1WBLA 1CJDA 3PNAA 2EIEA 4DRVA 2ZEZA 4FPGA 1FYUA 1QMJA 4NPRA 3GBGA 2A3WA 3U4XA 1T6BX 2UWBA 5EHDA 3RGBA 3SH3A 5JAXA 5JOZA 3TEXA 1ASJ1 2BEOA 3H9AA 4TN7A 2HWB3 4AE2A 3C7GA 3WDWA 4QAWA 1OUXA 2JDNA 3VUOA 2ES3A 1WW7A 5CADA 1NT0A 4ZS2A 5FPUA 2VMGA 3WT3A 2ZHLA 4WM8B 2CHHA 4IV3A 1FAYA 1JHNA 2W52A 3FHQA 3VBFA 4NJ4A 2VW1A 4QX1A 4DMIA 1C8M3 1EV13 3ALQA 2RMU2 2JG8A 4XF0A 2QFEA 1G9FA 1UZVA 1R091 2HH9A 3F2ZA 2IUWA 3GDBA 2A6WA 2P1BA 1OA2A 1QJX3 1PK6C 5DAWA 1RITA 3N9PA 2WIIB 4XHBA 5FO7B 3WW2A 1NX9A 1PO22 3AJZA 4LE4A 3CHXA 3WG4A 3DV8A 1UX7A 4KU8A 3GJAA 3T08A 1CWPA 1XYOA 1JZ3A 4DY5A 2GC3A 5KC5A 4Y3OA 5T54A 1W8TA 3N9OA 1QJEA 3N9MA 2JJ6A 2ZEYA 2HYKA 4DEVA 3LDRA 5I93A 3WDUA 2B7YA 2C6SA 3ZYGA 3C7OA 3M4FA 1UO9A 3KSCA 5JUVA 4LKFA 1O59A 3LD8A 1MS5A 4HVOA 4JKMA 2ADEA 2R042 1AYN1 4PF5A 3WP6A 5ABJA 5AFEA 3P1IA 2VMDA 2CAVA 3FZ3A 4PQ9A 1DLCA 2OZ6A 3KV5A 3OSDA 1JZ2A 3GGLA 3PTRB 1F9KA 1C1LA 4XYXA 4RS5A 1H8TC 2W08A 3QH6A 3JZVA 4C90A 5A70A 3OGRA 3WW1A 1AL22 3PVNA 3SNMA 2QBXA 2X05A 3FLRA 3UL2A 3KF5A 4B4RA 4CCNA 2WNOA 2QQLA 3U78A 2YG0A 2LUWA 5GJ6A 3JBG3 3WW4A 2JDAA 1JS9A 2HYXA 2R49A 4GWMA 2QE3A 5FMCA 2BNMA 2DDUA 3ORJA 2RHPA 3U14A 2NMOA 5C8WA 4PIZA 1IS4A 1ZZ8A 1LOCA 3H1MA 2J22A 4OUMA 3X29B 2HWD2 1HB4A 4Z8BA 1GLHA 1C1FA 3POSA 5FBZA 4YW1A 1E5RA 3KQ4B 4S2FA 4AVCA 1OOPC 3ZXDA 4ZU7A 2WT2A 4QQPA 5FQ0A 2ZMKA 5DDJ3 1BEV1 3ZFEA 4E27A 3THDA 3HQUA 3OBAA 1HIXA 1G8WA 3O1MA 1D2SA 4HLTA 5FZDA 1W05A 2DUQA 4ZZ8A 1UXZA 1WLWA 4D7YA 1YCIA 5FYHA 1HV1A 1JW6A 3AL6A 3VBUB 3VD5A 5HV4A 3I2DA 1BK1A 4QGLA 3ZFEB 1ND3C 3AXEA 1W99A 2A71A 1RUG3 4SBVA 4XW3A 3H3UA 1R1A3 2VZ3A 2VMFA 4LIVA 2D7FA 3T2QA 1GP5A 4EE2A 1I1EA 1VRH3 5L73A 2OW4A 1Q3EA 4NIIA 1GICA 4N90A 4MGSA 3UGFA 1Q8PA 2RS11 5C70A 1VALA 1NA1C 3PVOA 4H7MA 4ES8A 1PIV2 1KJLA 5FPBA 4CP1A 5JWPA 2XH6A 5GM0A 2ZGMA 4R9DA 4BQYA 1RUF3 4Q0PA 2WN2A 4HOOA 1I5PA 3LE0A 1VIWB 3P6BA 2R063 2OKXA 1KGYA 4YVSB 4AI9A 2RS32 5FUNA 3WHTA 3LKJA 3ES4A 1GWMA 1SBEA 1YFXA 3HWJA 4LBKA 1J58A 4MH0E 5HI0A 2W1SA 1SZBA 4A41A 2FDIA 4ZU5A 4MZUA 5KHIA 3M8LA 1XU2A 2D3RA 5EIYB 5I0DA 4R4XA 3NQHA 5FY9A 1PMHX 4XETA 4Q0QA 1KJRA 4Q4V1 5DAVA 5GZGA 3WF4A 3BN6A 5BNPC 4LO6B 1HN1A 5FP3A 2V09A 2DCZA 2RDNA 4I30A 5FOJB 2WWUA 2J1EA 3EO6A 2DUPA 1C57A 2ARCA 3GALA 3HNYM 3MW3A 4MV2A 2MEV1 3RPQA 3AC0A 4TTGA 2VW0A 1LAJA 1NUKA 3ZKYA 1MVQA 2VCMA 3VHOA 1PK6B 4W50A 4CDWC 1AR62 1GNZA 1JI6A 2Y6LA 4MLOA 4X8PA 2CTVA 4CDXA 1AR83 5CU1A 2RM23 1TNFA 1LESA 2H0BA 2CU5A 1OF3A 1RJ8A 1ZM1A 2IXLA 3MV11 3FL7A 3GF6A 4AHYA 3BIWE 3CJXA 2UY9A 3L9JT 4NIGA 4PCRA 1V6KA 4YSFA 3D0SA 2JIGA 2WDBA 4AVVA 1H8TA 3BTZA 2CYFA 1DQ4A 2CWMA 3B94A 4CPBA 4MXWB 4XUOA 2WRAA 3C3VA 3RZKA 1SQ4A 2EIBA 4Q8LA 4P5YA 4YYOA 4NN0A 4BIFA 1CAWB 3PMSA 5D21A 5FIXA 4AI1A 1RUI1 3UKNA 2F17A 2VL4A 1D4M3 2HWE3 1LOFC 1H8TB 3HT2A 1VE0A 1OFSA 1VBE1 2W2IA 3UK9A 4WVWA 2VY0A 4J25A 1OC1A 4NPLA 1IS6A 3N3HA 4QU1A 1ZZCA 5LCWL 3ON7A 3VKNA 1LCLA 5LK5A 1GMMA 4CP2A 2XKPA 2JENA 2VOTA 4KG8A 1K5JA 1L7LA 3B01A 4UW6A 1W6NA 5BUVA 1SLTA 2E53A 4Q4Y3 3SITA 3VDCA 1OOPA 4LT5A 3TOJA 1FOD1 4PLOA 3PDQA 5IJRA 1F8VA 5BXXA 1S0BA 2P34A 3WNXA 2ET1A 5FKBA 2CWSA 3POJA 4JGZA 5H9PA 3AKRA 2RR13 4LORA 3LDBA 1RUD3 1WD4A 2B39A 1KDMA 1HXS2 3CZJA 4G9SB 4XUNA 4EJRA 5BYNA 1LB2A 1YWKA 1OOPB 4KNCA 5C3QA 1SFNA 3AXDA 3MEPA 4GMP0 5E88A 3J7LA 3DKQA 4F3JA 4IESA 1UOGA 3IDCB 3QBQA 4Z07A 1ND3A 3FMGA 1XYNA 4CCEA 1FNZA 2VECA 4Y1ZA 1BBT2 4HPKA 2Y33A 1W28A 1KFUL 3T2TA 1ULDA 1MEC2 2JE7A 3MLJA 4L97A 3VHPA 4CUCA 2Y8KA 4P14A 3H0OA 2ZGRA 1AYM1 3MHZA 1U12A 2XWJB 5FY1A 2DVAA 2R0FA 5FPZA 4E2QA 4UYBA 4Y1VA 1JZ7A 2YYOA 1ND3B 3HOBA 4FSJA 3K75B 5EXOA 3VZOA 4CCMA 4HPKB 2PLV1 1X9PA 1XNTA 2I07B 1GBGA 5EV7A 3TYJA 3W59A 4BLJA 3KV4A 2EALA 3BIEA 3RQ0A 3ME2A 2WS92 4L9BA 1NA1B 3UETA 1O7FA 3ZR5A 1RUJ2 2QKDA 4CTEA 3ACGA 3FUOA 1OMIA 4B1MA 1Y3TA 3UJOA 3ASIA 4C0BA 2YBKA 2HBTA 3GZTB 3KCXA 2WC2A 3MYXA 3URFA 5CFDA 2WYSA 4XFAA 4D8MA 5DG1A 2Y34A 4CCDA 5CEHA 3UGGA 5C3OA 2AGSA 3ES1A 3ITQA 4K3UA 5F5CA 1IHMA 1GQGA 5LATA 4AF9A 1OHFA 1JZ6A 1G9AA 1YI7A 5H9SA 3RFRA 2ARAA 5FUIA 5E8AA 5JMCA 1ENQA 2DV9A 4OHYA 5LRSA 1QXJA 4NWVA 3RYPA 2ZX2A 5KXBA 3K51A 5BNPB 3WR0A 3N9QA 5C33A 1O3QA 4LO5B 1OI6A 4N7IA 5EJZB 2V4AA 3PMEA 4FAHA 5A7NA 5C9AC 3OUJA 4QHOA 5K0UC 4IL7A 4KI5M 4HSJA 4OFGA 1MS3A 5FXVA 3IIIA 3FN9A 1SCSA 1TQ5A 2Y6KA 1Z0HA 5L9VA 1F5FA 4MX3A 5BNOC 2W5FA 5FKCA 5A3LA 1UZYA 3KF3A 2Y6JA 4CDWB 5FCCA 1GZ9A 3PL0A 3MZHA 3T4HB 4K6BA 1AR93 1VB2A 4JQTA 4QPIA 2H6CA 3FLPA 2P17A 1B35C 4UFMA 1UXXX 1SHWB 3ECQA 3J26N 5EJ1B 5A1AA 3O1PA 1J1TA 2W39A 2ZGSA 3R4DB 1EUUA 3H7YA 4Q26A 5GZFA 5A32A 1RUH1 1VAVA 3H1YA 4XQ4A 2C24A 4BQ3A 1H1MA 5IVVA 1C5HA 5LW9A 2A3YA 3KV9A 3NV1A 5LA2A 2VBDA 4JRLA 2P37A 1LJ7A 3MIBA 4Q0VA 1OQEA 4LBNA 1Z7S3 2GSYA 2XJRA 1GYKA 4LO4B 2PQQA 1N3QA 4SLIA 1C5IA 2WR9A 5DUWA 1D7PM 2DF7A 3E5UA 3LF7A 4OI1A 3W21A 5A32B 4P9IA 4DPNA 3INAA 4MGQA 1PGSA 2AACA 2YC4A 1XE7A 4DS0A 2GH2A 4M3CF 3WQBA 1HW5A 4JRAA 5A3OA 2YUEA 4IE5A 1HQLA 5KBFA 4FQZA 1FMD1 4QXBA 1JUHA 1UPSA 2J1RA 3RSJA 3TN92 3PUSA 1RVF1 4JHTA 1RGSA 2IXKA 3VZMA 1URXA 2DU1A 1L7QA 2FZ1A 2HWF1 4QHZA 2IXHA 4AFAA 4CPBD 4EZ4A 1UU4A 4YG6A 3Q8FA 3NSTA 3SISA 5B2GB 2RMU3 3OOXA 2DBIA 3NKGA 4XZUG 4QPWA 1H9WA 1CAXA 3NJZA 4FPYA 3B5LB 5LBBA 1IS5A 1OFNA 4Q0UA 3N9LA 4A7ZA 1XNDA 4YZ1A 3NJXA 1LU1A 1PO23 3M3OA 4X6QB 4XJ9A 1E5HA 4JHZA 5AVAA 2PHWA 1UAIA 3SMHA 4BXFA 1G9CA 4OI0A 3WCRA 5BNNC 4MG2A 2R30A 1ZBA2 4RGAA 5A6ZA 1BQPA 3AMNA 2QQWA 5ACA1 3NW4A 1YIFA 2E7AA 4DFSA 5KWRA 3WINE 3ZFFC 5F3GA 4NO4A 1V00A 3OY8A 5KHGA 4YRDA 3KV6A 2YV8A 2WWJA 4KBBA 2WNVC 3PJYA 2R043 5FV3A 4NHXA 1IS3A 3E5XA 4QGMA 4TLFA 1XE8A 2VNGA 2WT0A 3BODA 4YZ4A 3SKJE 1X9TA 2PHDA 4RYDA 1WCSA 2ZZQA 5FY7A 3KLSA 4ZXKA 4A6SA 3ZX7A 3Q8CA 2Q8CA 5AVPA 2BV4A 5JIAA 3RYKA 4EQVA 2WSVA 2PQSA 1W8OA 3LFMA 4AFDA 3OY8B 4D3WA 1AL23 1SDDB 1V9U1 3LEMA 3WUDA 1A34A 1O6UA 4CCKA 5HXMA 3SQOA 1UYYA 4WVMB 5F39A 4FOWA 3BU0A 4XJAA 3I59A 5L9BA 3TEWA 3BI3A 1M06G 1ZX5A 3MFCA 1ENSA 3EMRA 1WCDJ 2YU2A 4ZONA 1JZ5A 4Z2WA 1A6CA 1TME2 1JOJA 4LHSA 2WZR1 3J7MA 1S0FA 4H2AA 1NXD1 1RINA 2WL1A 4BQXA 1RMU2 4J1XA 4RD7A 3ABZA 2HWD3 5GZEA 5C9AA 4HT1T 1PX3A 5LBFA 1Y9GA 5BNOA 2FDFA 2VMHA 4MO3M 1WA6X 1HKDA 3FBYA 5IK4A 4YW6A 3J9SA 4BA6A 4G3YC 1QJY1 1UL9A 3ZIWA 1LEMA 1B35A 2WFPA 3I3DA 5FZBA 3SCFA 1NZCA 5C9AB 5K0UB 2VUAA 3T0AA 2PHRA 4MYEA 5JXIA 2WSUA 5DXDA 1GOGA 2HEVF 3S5QA 5BNOB 5DPNA 5BPXA 5FO9B 4DXTA 2MPFA 1VMHA 4Y20B 2HWC1 3EBRA 5JPMB 3KD4A 4GXLA 3VD9A 3WEZA 1BVP1 2XLGA 3DN7A 5LA9A 1O5UA 1EP0A 1UY4A 2VMCA 2J42A 4LIUA 5J1XA 3WDVA 3CEWA 3EYPA 1HRV1 1QQP1 4ATFA 5FXXA 4ZS3A 1ZRDA 4P5HA 4UW5A 1PIV3 3N7JA 3WQ1A 1CX1A 3GNEA 1I5ZA 1TG7A 3NAPC 1J84A 4HONA 2YGMA 1R081 5E1RA 3GYDA 1O8PA 1DZTA 3MFAA 1EYBA 3UYJA 3QLQA 2VAUA 5IAXA 3OGGA 4QX5A 2WNEA 2RS33 3PUAA 1MPXA 5FZ3A 2Z4FA 3A0NA 3CZUA 2X5IA 1QU0A 3JCIA 3BUCA 4R9AA 3A21A 4EZHA 5FK8A 5FZEA 2G9ZA 2K0GA 4BQ2A 1AVBA 1DLLA 5DZEA 3IB3A 1GNYA 2WQ4A 5A80A 4DZGA 4YNIA 3TAYA 1OVSA 1PVC1 3ZSEA 4E4SA 1KDKA 1VPHA 5FAXA 2PAEA 5FZ7A 3R05A 4AI2A 4COZA 2Q30A 2FMDA 5B4XA 1W6OA 4IEQA 3D5OA 4FFFA 1W0OA 2A6ZA 1QH6A 4NAOA 1NE6A 4OMCA 3ZFFA 3S5AA 4FFIA 1AR63 1W2TA 3FC0A 3FBMA 2WNVA 3ZYRA 1SG3A 3IN9A 1ZRFA 3HIFA 5BNNB 1J3RA 1GWLA 3NV3A 1W6MB 3OB8A 4WM7A 4OUSA 1W6OB 2VZSA 4CXXA 4M3CE 1W8WA 4NHYA 3ZFFB 2RDQA 5GLUA 2VCBA 2JDUA 3WDXA 3WP3A 1VBD2 2WNVB 2ZAAA 4A7KA 3DEMA 3FE5A 2BW8A 2ZABA 4O61A 3U1XA 1HRI2 2ZS6B 3D82A 4LKEA 4P9JA 4Y4YA 1H2NA 1NCRA 3NO8A 5FZ0A 3T0BA 4AVSA 4DEQA 1XYPA 3BYWA 2H6BA 3NL1A 3ZYHA 2A73B 2JG9C 5C3SA 1XBFA 2EVXA 2VU9A 2XDVA 5CAZA 3KT7A 5C7GA 4MGYE 2W95A 3NRUA 1ZA7A 2GNBA 4HFSA 4ONUA 5FZKA 4YFZA 5KHKA 2RG4A 5A7PA 3DPRC 3GZEA 4QQ2A 4AVBA 1PVXA 5KC6A 1QH7A 4A6OA 2R32A 4PQQA 4XFCA 2AEYA 2W0XA 3FX3A 4LQRA 3B02A 1TNRA 1DGRA 2E51A 4AGGA 5A6XA 2VC9A 3RZJA 1F4HA 1F4AA 3OBTA 1LOBA 4TYSA 4URTA 5C4WA 1IPSA 1HXS3 3C2UA 3I97A 4IE6A 4GH4C 4Z92B 1PM7A 1U5IA 2E33A 5FLIA 2Q5TA 2EA7A 1CR7A 1OUSA 3BVCA 4FPOB 4AQSA 1S0CA 4OI4A 4UW3A 3VZJA 4QQHA 5JOYA 5CYYA 4BMEA 4FXKB 1VAKA 5CA6A 4LJHA 5E16A 2J1VA 2VH9A 1BBT3 1RJ7A 2BUKA 1W2NA 1HQNA 1MEC3 4FP3A 1RUC2 1QOTA 1UOFA 3WHUA 4JV4A 4CUGA 5J36A 4KWLA 4IGQA 2Q0AA 4NAMA 4YW4A 5FYUA 1S55A 2GH8A 3NAPA 4EN7B 2ZX1A 1IG0A 3BOWA 2WINB 3HMYA 4Y5Z0 3CF6E 2NN8A 3U37A 4JZRA 2WZEA 1DQ5A 2UURA 2YY1A 4YFWA 3JD72 2WS93 2IFWA 4LO7A 2ZHKA 3E6BA 2IWGB 3M7AA 4OCTA 5CVRA 1RUJ3 2CSGA 5HPOA 1G9DA 3VBOA 2JKBA 3M70A 4I0BA 3NAPB 5DAQA 3J8F1 3T2OA 4XC9A 4NR1A 2FDGA 2XJVA 4JC1A 3ZYIB 1JUIA 3U0ZA 3KT4A 5EFUA 3QOPA 1ZRCA 4M00A 1S0GA 1ZYBA 1FI2A 2JB4A 1WLDA 3KS7A 5FZ1A 5FY5A 3IDEA 4XUPA 4UBGA 4PI2A 5FPLA 4I02A 4AGRA 1GQPA 3R4UA 4ZU4A 1XE0A 2A1XA 5FMBA 1DCSA 2BU9A 1WD3A 5JI9A 3AYAA 1BHGA 2XKOA 4DXSA 2D6NA 5B4NA 4A3ZA 2ZOEB 2ZX4A 2DU0A 3W58A 1JN2P 2GMPA 3H42B 4QDSA 2XMLA 4YVSC 2PHXA 3KHBA 1UD1A 1COV1 1OXCA 4WM8A 5T5OA 1PO12 3ZSKA 4GMP1 1GSLA 3HQXA 2OZJA 4FPHA 4NMIA 5DQ0A 2QJVA 4RFRB 3ZN5A 1WLCA 1NE4A 3WD5A 4CU6A 3FFZA 2JWPA 5GLWA 1I6XA 3PUHA 3PJQA 3CU7A 3OUHA 2HWB1 3O1VA 3BPZA 4YGBA 1POV3 2W3JA 1ULCA 2GNTA 2VCAA 2W92A 4HZFA 3U75A 4NHMA 4XACA 1RTVA 3VZKA 4AW7A 1AF9A 1OVPA 3AZWA 4O7XA 5A7WB 3NNMA 5SV8A 4E4DX 5LBEA 3VDAA 5FZAA 1S0EA 4E8CA 3WNLA 3ZYPA 1QHDA 2WN3A 3GJBA 4GIQA 4ASMB 1PGL1 1C8M1 1EV11 1QNWA 1IGOA 3HT1A 3DPRA 2VQAA 2VCCA 1S2KA 4G4FA 5EQUA 2Y26A 1C8NA 1XSRA 4IE4A 4MGTA 1UQXA 1S4CA 1QJX1 5FY4A 2A70A 2JG9B 2PELA 2VZQA 2XXZA 5GLTA 2Z69A 3AZZA 4CCJA 3L2HA 4S2HA 2B9VA 2YC0A 4K1YA 4UW4A 1UZ0A 4LPLA 3AKSA 2R072 3DPRB 1W90A 3UESA 4GH4A 3M3EA 5FYCA 5FZIA 4AR2A 4Y26A 4HKLA 3TN93 4MGKE 3B9CA 1VLNA 2WAAA 2LTNA 4EN8B 3I8TA 4HVQA 2VUDA 4GKYA 3S7IA 1W9FA 4NVPA 2WBKA 5IHRA 1CZTA 2D97A 4N7UA 4ITCA 3F95A 4XTPA 1IKQA 4O9EA 4GH4B 3V0BA 3J7NA 2IXIA 3ZN6A 1QJU2 5I8SA 2NM1A 1CD3G 4QPGC 2JXAA 2FHRA 3PU8A 4HVRA 3ZPYA 3VKMA 5JCTA 4MHUA 1SLBA 4Q4W2 4HANA 3CLPA 3JBG1 5HCBA 1JH5A 2NMNA 2RDSA 3RMXA 2TNFA 1ZBA3 1OKOA 4FTBA 3KGLA 2JEMA 3V0BB 1N47A 4XAAA 2XBO2 1H6YA 1VB4A 3A0KA 4Q27A 3A4UA 3AKQA 3ZN6B 4RSUA 2O8OA 5E89A 1X7NA 4ISRA 2CGOA 1SPPB 4K21A 4D6QA 2VMIA 2WNUC 3I2HA 2XHKA 2D43A 1JYWA 3VBUA 4WBBA 4Q8KA 4BYYA 1FPN2 3VN4A 4FBFA 4IEZA 4AAPA 5LEKA 4CEYC 4XBLA 2JICA 2FDJA 2Z42A 4LBQB 5C5TA 5DDJ1 2PA7A 1G9BA 1W3VA 4H55A 2WLQA 2VOVA 3RWKX 2VJXA 4JDMA 5EZWA 4A3XA 1YRZA 4GWNA 4ZXEA 1J83A 3OD4A 4IETA 4Z82A 2VNOA 1MZEA 2ZTNA 4X6RB 1NKGA 3D3AA 3WZ1A 2YFZA 1LU2A 2ARXA 5IAVA 3SKVA 2WJSA 2PHTA 3FLTA 2QQKA 1TME3 2J1SA 1MZ5A 4XXAA 4YVSA 3POEA 1X33A 1RMU3 1RUG1 3LA2A 1R1A1 2E31A 4RR3C 4KGGA 3ZXAC 3ZXJA 1VRH1 2G19A 3IDAA 4CDQC 5IFPA 1RXFA 1GWKA 1ENXA 3RDIA 3VDDC 5IVFA 5FYBA 2ZGLA 5JR7B 4AQTA 1EAH2 2PXJA 1SLAA 1CGPA 5LK7B 2GP5A 1C28A 5A3WA 2EF6A 1QDCA 4XJ8A 1L3JA 3DECA 5IWFA 1RUF1 4PBOA 4CP9A 3RNSA 5AC92 1UY1A 2R061 3NWKA 4TZDA 3H1WA 1UMHA 5FTTC 1C3HA 1W0PA 4BZ4A 3RG0A 4I0WB 1RC6A 3O5SA 4OLLA 3UT0A 1YLLA 1PK6A 2ET7A 4HBNA 4XDQA 2QCSB 5EJ3A 1DGWA 2FDHA 3IDBB 1CN1A 4CP9B 5FP4A 5A3PA 2QDRA 1BMV2 1AJKA 5F32A 4Q4X2 2XUEA 5J48A 4QM9A 5E6HA 1JYVA 3DYPA 1AR72 1VBC2 4EV0A 1F5JA 4MXVA 2VZRA 4XURA 2P3KA 4AWDA 1OBNA 2UYBA 5JLVA 2JD4A 1XJAA 2UWAA 3RYRA 4MXWA 4P9YA 3V64A 3WNKA 2J1UA 1CPNA 5KXDA 3OGSA 2VVFA 4INDA 2VO5A 4I3GA 1CX4A 1IZ3A 3MLLA 1TVGA 2WA3A 3OTFA 3W20A 1CAWA 1UW8A 1AR81 4UFHA 1WW6A 2RM21 2W68A 1DFQA 1TMF2 1ULGA 1WA4A 2BTVC 2C4XA 3WNPA 1AX2A 1RHI2 1WW4A 1ZRRA 4FPCA 5FYIA 4A7YA 4E2GA 4D0QA 4KG0A 2AC1A 1GNHA 3AB0A 2VW2A 4JGYC 4QPGA 4XAEA 3UGHA 4ASLA 5FOBB 4EWEA 2XR4A 3CIHA 3B9IA 3UNPA 1QJFA 2Q8OA 1NLSA 3O1UA 4OMDA 3H3LA 3U10A 1AXZA 2CNAA 2ETEA 2JECA 2Z5WA 4FOQA 1H4HA 3P5BA 3VKFC 2LM3A 4P9LA 4QU2A 1U5YA 1D4M1 2HWE1 2ZEXA 3HBKA 2QQMA 1GP4A 1OT5A 1UIJA 4QPGB 2BP6A 3ZFGC 1Y9QA 2YBSA 3SCGA 1JZ8A 1NYWA 2VVEA 4Y22B 3W5MA 1DZRA 2WUHA 3VKOA 3WNNA 3IM0A 1NLQA 4NHKA 1ZBE2 2E9QA 2GU9A 2ZJCA 3AFKA 3AZVA 3LFIA 3S0MA 1W9TA 4Q4Y1 1AZDA 1S2BA 4AQ6A 4CEYA 1LOEA 5JXHA 1VBA2 2AUYA 4L92A 4NOTA 2RR11 1VBD3 3DXTA 1RUD1 2G9FA 5EPAA 1TE1B 2WT1A 2WNUB 1RUE2 3B69A 4DQAA 1VJ2A 3WF1A 1HRI3 4CCCA 1BXHA 5FZFA 4HETA 1N3PA 4EWDA 3QD6A 1S0IA 3LWCA 1QXRA 1OLME 5J96B 4AL9A 3AJYA 4UWDA 2VUJA 4CEYB 2IZWA 4GWJA 4CSWA 4B4QA 4QT6A 2BJSA 1O8SA 2QZ3A 1OPOA 1AX1A 4RHV2 3BTXA 1NA1A 4PDWC 1PMJX 3GHNA 4K9SA 3V65A 4QGNA 1POV0 1XSQA 2OUJA 3WDYA 1PM4A 3WXPA 4D7SA 1YJLA 4XMAA 3ZMNA 4PLMA 3K46A 4Y33A 4CDUC 1VBB2 2DBNA 3HAGA 4WVZA 3A23A 4RL7A 1AJOA 3MIEA 1HJGA 4RR3B 4C1WA 1HB1A 4GJZA 4K20A 3WX5A 4CDQB 1OF4A 3N36A 1AL0G 3VDDB 2BBVA 2ZGQA 3RVHA 1A8DA 5A6QA 4YM3A 4PIYA 1ZZBA 3TBDA 1W6PB 2DVBA 2G4IA 3VB9A 3CNAA 5BNPA 4O65A 1DQ6A 1JTZX 2KXLA 1JU4A 4W6XA 1PGW1 3VBRC 3O0WA 3USUB 3OGJA 2CV6A 4OULA 4GULA 1DBNA 4PBPA 4XCBA 4COWA 4BPZA 1OLQA 3WY6A 5I91A 1RUC3 3EXUA 4IE0A 3MBWA 4HN0A 2CY6A 1J3QA 3I2IA 3K3NA 4NPMA 4XUQA 4FAGA 1REEA 2A5ZA 3AVRA 3HEIA 2RS52 1XXNA 4H14A 4CDWA 4XJUA 5CIRA 2ZZJA 1LHWA 1BVVA 2WFF2 1JYCA
chains in the Genus database with same CATH topology
3ZSJA 3BU7A 1BKZA 1NCQC 1NY71 1YNAA 1SCRA 2E7TA 5HV0A 3JD73 4GB32 4Q5OA 1DIWA 4JAAA 5FREA 1LHNA 2FZ2A 1LKNA 3ZMOA 2CAUA 3R6SA 5CFCB 4JGYA 1HLCA 2NLRA 4JDNA 3RJRA 2F4PA 4AI3A 4I01A 4XQWA 2VVDA 4XF1A 1LOFA 1AR91 1ASJ2 3ENRA 2Y38A 4D94A 3WV6A 3VZNA 2OPKA 5F5QA 4AHXA 4Q29A 2FCUA 4JGYB 3ZFGA 1XU1A 4JQRA 5K7PA 1X8MA 1N1VA 5A3UA 1WMFA 3ILNA 3AYCA 1Z7S1 3KQRA 4N53C 1PO13 1H1AA 1R092 2GNMA 4P9XA 4E9KA 4F83A 4CEWC 3B93A 2KM2A 4AEMA 3E6CC 3ZFGB 3SLIA 3NNJA 3RI9A 4XIKA 2BVVA 4FPEA 1FXZA 4M01A 2YXSA 1EPZA 4YZ2A 3MIDA 1U5ZA 2XGXA 5H9RA 2XPJA 4MHRA 1MS8A 1NXMA 4PIXA 3JQXA 5GLVA 1CAVB 3ACLA 3E97A 2WWSA 1AYN2 3OF1A 3RJ2X 2D98A 2RMU1 5T3NA 4AI0A 3VHNA 1J59A 4DNYA 3JU9A 4ISQA 5EP9A 4IW3A 4L99A 4LE3A 3GBWA 1PO21 1O91A 4Y5TA 5IT6A 1PZ8A 4AEKA 1G6NA 2D3SA 2R073 4PDWB 4A2UA 1ZZ9A 4KWJA 2OUHA 2ZGKA 4RGGA 4WVMA 3VL9A 2VOWA 2Z2SB 3KM5A 4XF3A 4CDUB 1KRIA 2ZGPA 2R041 2A6VA 4P9WA 3VZLA 2F6BA 1W6QA 2CL2A 4B8EA 4YM0A 4F8AA 2R6QA 4IERA 1QJU3 3I54A 3HD8B 1AL21 1HDKA 5CG9A 1BEV2 3M1HA 1W6QB 1UF2C 3K48A 3MIFA 4Q4W3 5GZCA 4IEUA 3VBRB 1HQWA 2D6PA 2ZACA 4IEOA 1H2LA 1DGWX 2Q4SA 2XBO3 4Q2FA 5K0UA 1UX6A 4FT8A 2VG9A 3AMHA 2D6OX 1O3TA 2NPIA 2HWD1 5IUQA 3ZVXA 1OD5A 2D5HA 4LA2A 4Y20A 2XUMA 5FLHA 3MICA 3D6EA 5T5JA 2XJSA 1FPN3 4BCUA 1NCQB 2RJKA 3S30A 4AHWA 2ATFA 2RS12 5T52A 1C4RA 4XBNA 2N7GA 3M3IA 5HCAA 4XFIA 4IEYA 4AHZA 5JPNB 2ZMNA 4XHXA 3CJIC 3MPBA 5TSWA 3UKVA 1RB8G 3JB4C 1GFF2 4B7KA 1QY4A 3NKTA 2QUOA 1IQAA 1VAMA 1N1TA 2DVDA 4Q0SA 4YARA 5LB6A 1Y43B 1V6JA 1RL3A 2EXKA 3P3NA 2VNRA 3OYWB 5L36A 1S1AA 1GZWB 2ILMA 4CEWA 3MPPG 4C1XA 4Q4V2 2WA4A 4XIOA 3ZYJB 2NQYA 1EAH3 1FV3A 1PIV1 3I4IA 3ELNA 1DU3D 5LBCA 3ATGA 4D69A 2MEV2 2DCKA 1EAH1 4N53B 4U2AA 5AC93 4MVTA 2X29A 4CEWB 1ZREA 4IQPA 4EN6B 4AFMA 1AX0A 4AXOA 2RS31 4YG3A 4XFHA 4B4PA 1MS0A 2PHUA 1I3HA 4NWWA 1VR3A 1MS9A 2PHLA 3AP7A 3GBFA 2A6XA 3LSDA 3G6JB 4YGEA 3KZ4C 2BYVE 1YUDA 2DTYA 1K5MC 4Q4X3 5BNNA 1AR73 1VBC3 1W6MA 3KCCA 4I3PA 4KL1A 5IK7A 2A3XA 5HCFA 4FTSA 4LUMA 2B45X 3N7LA 3WQ0A 5I8TA 3WCSA 3VLBB 1J3PA 5FMOS 4DRRA 1RUI2 5BY5A 2AH2A 1VBE2 3IBMA 1AR61 4XOGA 1H0BA 4GQ7A 1CONA 4L11A 1IKPA 4V1PA 1IPKA 3KB5A 2R1DA 3MIGA 1TMF3 1O3RA 4C0HA 1W39A 1RHI3 3LSEA 4AGVA 3B7MA 3FHIB 1FOD2 2R1BA 3ZXEA 3VBSC 5IK8A 3IPVB 3GHMA 5KHJA 3R0RA 5FMOL 3B00A 4LBOA 1SBFA 5T50A 2XWBB 2FMYA 4CRQA 2MNGA 2AYHA 3APBA 3ILFA 2NZ9A 1FX5A 4GA9A 3D0JA 1ZBE3 1S0DA 4LBLA 4IV3C 5BV6A 4Y1YA 3LOBA 4L2NA 4EN9B 4JVAA 3VBFC 2HBUA 3M3CA 3ZXFA 1AYM2 1VBA3 2JG8C 3AZXA 4IEPA 2EAAA 5JDBA 5CNAA 1RUOA 4HSLA 2QDNA 1YO8A 4XABA 4OZXA 1RUE3 1HXS1 2XJTA 1MR5A 3ST7A 1GR3A 5FPXA 4OHXA 1QXPA 2K9ZA 4R8HA 2PLV2 4XFFA 3QACA 4BLIA 4CYDA 4JDOA 1GV9A 1SACA 1ZVFA 3CO2A 4J6GA 3IKWA 1KFXL 1EY2A 1KITA 2DFBA 4RHV3 1BBT1 3CJIB 2C0ZA 1MEC1 5ABJC 3O0XA 2UY8A 2B8MA 1A8MA 5HBAA 3ZSLA 5J3UA 4RS5C 4DINB 2GC2A 4X8NA 1GZCA 1O5LA 1PMIA 3THTA 4AQ2A 1B09A 5F6KA 1TEIA 3E5QA 2WS91 2DURA 4WZCA 1RUJ1 4W6WA 3AKTA 1DG6A 5DUUA 1ULFA 1OSGA 5D1IA 4MUVA 5KXEA 1UCXA 3EJKA 1QGLA 3MF9A 1CAUB 1K5MA 1U0AA 1UKRA 1WCKA 2DVGA 1M4WA 4LBMA 4XILA 3WG1A 5C6CA 4XMIA 4YGDA 1DGLA 2X8KA 1SEFA 1AXYA 1QNYA 4FPJA 1SLIA 2RS53 2VOKA 3SHRA 4M3CA 2ZPXA 2WFF3 1O4TA 1K5MB 2PTMA 4XBQA 3VGIA 4N9IA 1RUH2 2TEPA 4GB33 4YVWC 5JSOA 4LLOA 5GALA 4XE9A 4QXKA 1H2KA 1MQTB 4M3CB 4OVEA 2EXHA 5JSRA 3R4SA 2KA3A 3RI8A 4KGQA 2B46X 5JOXA 5C8CB 3VBSA 3DUIA 4YW2A 3DL3A 4R9CA 2UWCA 1POV1 5DZGA 1ASJ3 2JG9A 3B3QE 3O7OA 1FMD2 5EYXA 1I9RA 1RVF2 4L8QA 4N43B 3VL8A 5JZGC 1GQHA 2HWF2 3VBSB 2G1MA 3AKPA 3AM2A 3I7DA 1H4GA 2ERFA 3BALA 4WVVA 4LUKA 1DF0A 1R093 3WUCA 4FPFA 4R4ZA 5ERLA 2PN5A 4YLZA 1D0HA 1Q8OA 1WMEA 4KH9A 2Q1ZB 2ZHNA 2D93A 4BMBA 4ES9A 1RUNA 2PHFA 2DCJA 3OD0A 4Y24A 3WQ7A 4AVTA 4IV3B 4QMAA 3TN91 5ACA2 3VBFB 2AR6A 5LASA 2Y0IA 2ZAHA 2JG8B 2ZGUA 3MGUA 3VKLA 3RRDA 1AYN3 4LHLA 5LEJA 4Y5SA 4O9GA 4JCKA 4XCAA 5GLZA 3ZO0B 4CDXC 4HKOA 5SV5A 5I8YA 3WDTA 4BWOA 1DQ0A 1NLRA 1V9U2 3DKWA 5I0RA 4OI2A 4LBQA 2P3JA 2OIIA 1ZBA1 2VPVA 5GKAC 3ZN4A 3AX4A 1VP6A 2GC0A 5ABJB 1SDWA 2XVKA 4FTEA 4WZFA 4KU7A 5JI7A 2K2SA 3AZYA 1R1ZA 2WZR2 1D4VB 1ALYA 3P3PA 4RS5B 1WW5A 2XJQA 3ZDSA 1WUVA 1SLCA 4FP2A 4AFBA 1SFYA 5K9YA 2C1FA 2OVUA 1JBCA 1BEV3 1QJY2 1PNGA 5I0TA 3AK0A 1DGRN 4K8FA 4QM8A 1MS4A 1YFUA 1Q8SA 4LA3A 1LECA 1A78A 4JGZC 3FWEA 1PNFA 1YJKA 2PYTA 1TME1 4YVWA 3IWZA 4IEVA 3WP4A 1NQJA 2HWC2 2HJIA 1RMU1 2VOXA 3OBZA 1W2UA 2BFUS 1UU6A 2HEYF 4AK3A 5FQ0B 2BQPA 1HRV2 5HXVA 1QQP2 3HBZA 2RS13 4YVWB 3NNLA 4HMZA 3WG2A 1OQDA 4DY3A 1FATA 1H1IA 3POYA 4PJYA 5DAXA 1F2NA 1R082 1UIKA 2XLFA 4YG0A 1YFWA 2ZKNA 1BCXA 2H0VA 2GAUA 3NV2A 2EIGA 1Q8VA 1OA3A 4OHVA 5JZGA 4IEXA 4W65A 5GZDA 3V56A 4FO9A 4I09A 4N9HA 2UYAA 2BFUL 2VULA 4R9BA 2ZGNA 4Q4V3 4BM8A 5JZGB 5D8AC 1PVC2 5FDBA 1JXNA 1OA4A 5CFCC 4UXAA 1ONAA 1LOGA 5CFDC 1QKQA 2GZWA 4M0HA 2MEV3 4RA0A 4NHLA 2GN3A 3AP5A 3MW2A 3WW3A 1FT9A 2AREA 1N3OA 3DF0A 2A7AA 3TB0A 2RE9A 4W6YA 3J4UH 1BYHA 3JUUA 2A6YA 4FCAA 4Y22A 4MSVA 2IXJA 3O14A 2B9UA 5FFOC 5LRRA 2QNKA 1X36A 1LR5A 1X50A 4XZPA 2WLPA 1LRHA 4XEZA 4B29A 2B42B 4YW3A 1SMVA 3RMYA 4CDXB 3S7EA 1RUI3 2FCTA 2WNUA 4LHKA 4QPIC 4YZ3A 1VBE3 2ZA9A 4COUA 4QQLA 2ZCWA 3KMHA 3S6PA 2YROA 2YZ4A 4FPKA 1QF3A 3ETQA 3LA7A 1FOD3 1AHSA 3M3QA 4JTNA 1VBD1 1CVNA 4OHWA 4U36A 5BNQA 3T1MA 1HRI1 1KD7A 1APNA 2D3PA 2JE9A 4YZ5A 3QH7A 3H50A 1DYKA 1CQ9A 3MW4A 4RR3A 5FLJA 4CDQA 4FPLA 3WP5A 2YDEA 4Q1RA 2DCYA 3VDDA 2ZMLA 1W6NB 4KBZA 2AZ5A 1AUYA 1W6PA 2AENA 1NG0A 4GKXA 2PAMA 1CPMA 2YPJA 2JX9A 1UMZA 1LHOA 2LALA 3AYDA 4JGZB 4AEDC 3TNPB 3HQRA 1AYM3 3WLUA 3USUA 3PHMA 5T5PA 5KHHA 1IPJA 4K1ZA 4TSVA 2I2SA 3AMPA 1ZNPA 1U5XA 3BCWA 3FUQA 4XF4A 2D6LX 2PLV3 4LBQD 4BIOA 2YHJA 1BZWA 2BNNA 2ZX3A 2ZGOA 1QOSA 3PTYA 1D0GA 2YGLA 4R52A 3J8F2 1PZ7A 3MLKA 1X82A 1RUC1 4I0AA 4XPVA 1ZZ6A 5D8AA 2E63A 1G7YA 5CFCA 5I0UA 1DQ2A 3VBHC 5K8SA 1Z78A 3NVCA 3PVEA 2ARBA 3RZZA 3TWIA 1XRUA 4FVVA 4DB5A 2EXIA 2XJUA 4BHPA 3JD71 2UU8A 5D8AB 4PLNA 3RWNA 5CFDB 2NP0A 1HV0A 3UV9A 1MVEA 1COV2 2GC1A 2QVSB 3BB6A 3HR9A 3PLQA 1Q5OA 4LR4A 4BE3A 4XF9A 1ND2C 3OBRA 5I0SA 3LAGA 2DYCA 3AP6A 2QQPA 1LGNA 4XJWA 5F1RA 2HWB2 2VXRA 1KS5A 5J37A 4LNVA 2TBVA 2DVFA 4AG4A 1DHKB 3KGZA 3ZIXA 4Y1XA 1YXWA 2X53S 3GZUC 1RUH3 2VGDA 3H3ZA 2BGCA 3E6DA 1PGL2 5DUXA 1CAVA 1C8M2 1EV12 1PO11 1SLLA 3DGTA 1DQ1A 1H30A 3HN1A 4KWKA 4QPIB 1QJX2 4UBHA 2SBAA 3U07A 1UZZA 2Z79A 4RFT0 3TRSB 5AFBA 1E57A 4Z1VA 3MDPA 1UU5A 1QWRA 1MZFA 1V6OA 1KS4A 1Q8QA 1FMD3 3U11A 2ZGTA 4F7ZA 3CL1A 1RVF3 4PDWA 2HWF3 1O4ZA 1GANA 3EHKA 3NV4A 4COVA 1DYPA 3FFQA 4CDUA 3FJSA 1LENA 1Q43A 5T5LA 4QHBA 4AEDA 2OPWA 2PAKA 2X5IC 4LLFA 4HK8A 1CJPA 3ILRA 4JTOA 3T1LA 5J98B 4EWAA 3AP9A 3GZAA 3JB8A 5L19A 1LHVA 2BNOA 4FXGB 1QJZA 1NQDA 4CP0A 2R071 3JBG2 1YIPA 1REFA 2GALA 2A75A 4AEDB 5ACA3 5L9RA 4K7JA 1H8VA 3VBRA 2OYZA 1WMDA 2VQ0A 2I45A 2XLAA 4WV8A 1CIWA 4YM1A 1CAXB 5H9QA 4Q1PA 2ZKLA 1Y7BA 4LO8A 2Y0OA 4S2GA 4LEJA 2ZBJA 1V6NA 4IV1C 2BVBA 1LGCA 1QJU1 3L2YA 3WG3A 1V9U3 1KQRA 4WM7C 5DDJ2 1V6MA 1NCQA 2DTWA 3VBHA 2GMEA 1WGPA 1DZQA 1SBDA 4Q4W1 1XNBA 1ZA4A 5J7MA 2R0HA 4D7TA 4ORFA 4LULA 5EWSA 4LHNA 2D40A 2XBO1 3MI8A 1QOOA 4META 5DAPA 2BWAA 2WZR3 2FCVA 1NCRC 3BOPA 3OCPA 3VBHB 1ULEA 1RUG2 1R1A2 2WZPP 1F31A 1VRH2 4I2OA 2XG3A 1FPN1 1JYIA 1ND2A 3N35A 5L7OC 3LGRA 4AFCA 1NOVA 2HEWF 3H8UA 3LB9A 3W9AA 3OYWA 2IXCA 1GZWA 3LA3A 1OLRA 1MACA 3I59B 1QJY3 3IIAA 1RUF2 4EROA 5JIUA 2R062 1UKGA 2D6KA 1ND2B 4N53A 5DG2A 2XL7A 4BOWA 4EN0A 5F9TA 4ATEA 3OJBA 5C4WC 3PVBB 4FOYA 1N1YA 4XFBA 2HWC3 4H7LA 3SXWA 2QZ2A 4XTMA 2C5DA 3OUIA 2P3IA 2Q1MA 1D2QA 4HK9A 3LOIA 1HRV3 1QQP3 2O0OA 1B35B 2DWRA 4YGCA 5EYYA 5DUVA 5CB7A 5FRAA 3ZXLA 3SH4A 3SCHA 4DOUA 3VV1A 2O8QA 1R083 2EXJA 2GNDA 5AC91 1G86A 3KT1A 1YHFA 1YYNA 1H9PA 4CZSA 4ZKTB 2V73A 4KQ7A 1WBFA 4RQPC 3G7DA 3EQEA 4AYUA 3AMQA 1AR82 4QD2A 2GN7A 2RM22 4K40A 4QQOA 4TWTA 1BMV1 3AYEA 4E4ZA 1YFYA 5JOWA 4Q4X1 2D44A 3VBOC 2GDFA 3N4MA 1AR71 1MQTC 1VBC1 3D4KA 1PVC3 1V70A 5C8CC 4J1WA 2WKKA 3QCWA 3IPVA 2R16A 4HKWA 2B5HA 1D4M2 2HWE2 3USSA 2X5IB 5A3MA 1WLTA 5CG8A 1S0JA 2XVGA 4Y1UA 2ZX0A 2D5FA 2RDRA 1O3SA 2D6MA 2CGNA 2SLIA 4XJZA 1J1LA 1TMF1 2IFRA 4N43C 3WOGA 1RHI1 2TUNA 1ZZ7A 3POWA 4IV1A 3MF6A 2EAKA 4H3WA 3JQWA 3LCPA 4Q4Y2 1Q56A 2BWCA 3AP4A 2GMMA 1REDA 2XJPA 4WM8C 4YM2A 1N1SA 3SH5A 2RJLA 2RR12 1O4YA 4C91A 5FO8B 2MHFA 3ZSMA 1H2MA 1ENRA 1RUD2 4FQ4A 5JVVA 4AVAA 1LEDA 4IV1B 1XNCA 1LOAA 3IT8A 4XFGA 5A33A 5J09A 5CBLA 3O12A 3LZZA 3WVJA 4FOVA 2IC1A 5M0TA 5C5UA 4WM7B 2C9AA 3TNQA 3IMNA 5IK5A 2NYYA 4COYA 1YI9A 3ROUA 1ZBE1 4GALA 3MIHA 1LTEA 2XVLA 2DCTA 4XQDA 5L7OA 2PFWA 4IEWA 1IOAA 3V0AA 3ZXKA 2XB6C 5A33B 1VBA1 3CJIA 5T55A 3ZXGA 2DUOA 2O1QA 4BQWA 4MGZE 3THPA 1NCRB 1PHMA 4BQ1A 1QDOA 1LHUA 1RUE1 3H7JA 2ZHMA 4DXZA 3UKTA 3D8CA 1FNYA 3VHRA 3O0VA 5L7OB 5IATA 3V0AB 4B3NA 3OPZA 3M2MA 2YMZA 4QPYA 5KXCA 1XNKA 1UPIA 1OPMA 4RHV1 4E2SA 2XL9A 2E6VA 2JDZA 4LTAA 1PGW2 1V6IA 4MGIE 2FQPA 1KXGA 1OKQA 1VBB3 1MS1A 2BPA2 4LBJA 3RS6A 3AMMA 4HN1A 4XXPA 1CAUA 1GKBA 5C4WB 1VBB1 3BTAA 1BJQA 1A3KA 2ENRA 2DFCA 1FV2A 1UN1A 4OHZA 4B7EA 4RQPA 1LULA 2V5YA 1NY72 4ZPIA 2P2KA 3KCYA 4M0NA 4YW5A 4BH9A 1LODA 1CESA 1MZ6A 3J8F3 1AXKA 5F6LB 5DZFA 3Q9OA 4RQPB 1V6LA 1MQTA 2OA2A 2G9GA 1LGBA 1RIRA 2CGPA 2FBEA 3N7MA 3VBUC 2WQZC 3ZFEC 1AR92 3NNFA 1XQNA 2RS51 5C8CA 4AI8A 2WFF1 2I74A 5JSPA 1OQ1A 1EPWA 4P9GA 3VBOB 3N7KA 2E7QA 4GB31 2HKXA 4AEJA 1T6GC 3AFGA 4S2DA 3UJQA 1DDLA 4N43A 2JIJA 1HX6A 4IXLA 1Z7S2 1COV3 1PZ9A 4GMP3 1X8EA 4HL0A 1WBLA 1CJDA 3PNAA 4DRVA 4FPGA 1FYUA 1QMJA 4NPRA 3GBGA 2A3WA 3U4XA 2UWBA 3SH3A 5JAXA 5JOZA 1ASJ1 2BEOA 3H9AA 4AE2A 2HWB3 3WDWA 3VUOA 2ES3A 1WW7A 5CADA 2VMGA 3WT3A 2ZHLA 4WM8B 4IV3A 1FAYA 1JHNA 2W52A 3VBFA 2VW1A 4DMIA 1C8M3 1EV13 3ALQA 2RMU2 2JG8A 4XF0A 2QFEA 1G9FA 1R091 2A6WA 1OA2A 5DAWA 1PK6C 1QJX3 1RITA 5FO7B 2WIIB 4XHBA 3WW2A 1PO22 3AJZA 4LE4A 3WG4A 3DV8A 4KU8A 3GJAA 1XYOA 4DY5A 2GC3A 5KC5A 5T54A 2JJ6A 2HYKA 5I93A 3WDUA 2B7YA 3ZYGA 3M4FA 3KSCA 1MS5A 4HVOA 2R042 5ABJA 1AYN1 4PF5A 3WP6A 5AFEA 2CAVA 3FZ3A 4PQ9A 2OZ6A 1F9KA 1C1LA 4XYXA 4RS5A 1H8TC 2W08A 3QH6A 3JZVA 4C90A 3WW1A 1AL22 3PVNA 3SNMA 3FLRA 3UL2A 4B4RA 2LUWA 5GJ6A 3JBG3 3WW4A 2R49A 4GWMA 2QE3A 2BNMA 2RHPA 2NMOA 5C8WA 4PIZA 1IS4A 1ZZ8A 1LOCA 3H1MA 4OUMA 3X29B 2HWD2 4Z8BA 1GLHA 1C1FA 3POSA 5FBZA 4YW1A 4S2FA 4AVCA 1OOPC 3ZXDA 4ZU7A 2WT2A 4QQPA 5FQ0A 2ZMKA 5DDJ3 1BEV1 3ZFEA 4E27A 3HQUA 1HIXA 1G8WA 1D2SA 4HLTA 2DUQA 1WLWA 4D7YA 1YCIA 1HV1A 1JW6A 3VBUB 5HV4A 3I2DA 1BK1A 4QGLA 3ZFEB 1ND3C 3AXEA 2A71A 1RUG3 4SBVA 4XW3A 3H3UA 1R1A3 1ZRFA 2D7FA 1I1EA 1VRH3 5L73A 2OW4A 1Q3EA 1GICA 4N90A 1Q8PA 2RS11 1VALA 1NA1C 3PVOA 4H7MA 4ES8A 1PIV2 1KJLA 4CP1A 5JWPA 2XH6A 5GM0A 2ZGMA 4R9DA 4BQYA 1RUF3 4Q0PA 1VIWB 2R063 4YVSB 2RS32 3WHTA 3LKJA 3ES4A 1SBEA 1YFXA 3HWJA 4LBKA 1J58A 4MH0E 5HI0A 4ZU5A 4MZUA 5KHIA 3M8LA 1XU2A 2D3RA 4R4XA 5DAVA 4XETA 4Q0QA 1KJRA 4Q4V1 5GZGA 5BNPC 4LO6B 2V09A 2DCZA 2RDNA 4I30A 5FOJB 3EO6A 2DUPA 1C57A 3GALA 3MW3A 4MV2A 3RPQA 2MEV1 2VW0A 1MVQA 3VHOA 1PK6B 1AR62 4CDWC 1GNZA 4MLOA 4X8PA 4CDXA 2CTVA 1AR83 5CU1A 2RM23 1TNFA 1LESA 2H0BA 1ZM1A 1RJ8A 2IXLA 4AHYA 3GF6A 3BIWE 3CJXA 2UY9A 3L9JT 4PCRA 1V6KA 4YSFA 3D0SA 2JIGA 4AVVA 1H8TA 2CYFA 1DQ4A 2CWMA 3B94A 4MXWB 3C3VA 1SQ4A 4Q8LA 4YYOA 4NN0A 4BIFA 1CAWB 3PMSA 4AI1A 1RUI1 3UKNA 1D4M3 2HWE3 1LOFC 1H8TB 3HT2A 3UK9A 1OFSA 1VBE1 4WVWA 4J25A 2VY0A 1IS6A 3N3HA 1ZZCA 3VKNA 1LCLA 5LK5A 4CP2A 2XKPA 2JENA 4KG8A 3B01A 5BUVA 4UW6A 1W6NA 1SLTA 2E53A 4Q4Y3 3SITA 1OOPA 4LT5A 3TOJA 1FOD1 4PLOA 1F8VA 5BXXA 1S0BA 2P34A 3WNXA 2ET1A 2CWSA 5H9PA 4JGZA 3AKRA 2RR13 1RUD3 1WD4A 2B39A 1KDMA 1HXS2 4G9SB 4EJRA 5BYNA 1LB2A 1YWKA 1OOPB 4KNCA 1SFNA 3AXDA 3MEPA 4GMP0 5E88A 3DKQA 4F3JA 4IESA 3IDCB 3QBQA 4Z07A 1ND3A 3FMGA 1XYNA 1FNZA 2VECA 4Y1ZA 1BBT2 4HPKA 2Y33A 1KFUL 3T2TA 1ULDA 1MEC2 2JE7A 3MLJA 4L97A 3VHPA 4P14A 3H0OA 2ZGRA 1AYM1 1U12A 2XWJB 2DVAA 2R0FA 5FPZA 4E2QA 4Y1VA 2YYOA 1ND3B 4FSJA 5EXOA 3VZOA 4HPKB 2PLV1 2I07B 3W59A 4BLJA 1GBGA 5EV7A 3TYJA 2EALA 3RQ0A 3ME2A 2WS92 4L9BA 1NA1B 1O7FA 1RUJ2 2QKDA 4CTEA 3FUOA 1OMIA 1Y3TA 3UJOA 3ASIA 4C0BA 2HBTA 3GZTB 3KCXA 2WC2A 3MYXA 3URFA 5CFDA 4XFAA 5DG1A 2Y34A 2AGSA 3ITQA 3ES1A 4K3UA 1IHMA 5LATA 1GQGA 4AF9A 1OHFA 1G9AA 1YI7A 5H9SA 5E8AA 5JMCA 1ENQA 2DV9A 4OHYA 5LRSA 1QXJA 4NWVA 3RYPA 2ZX2A 5KXBA 3K51A 5BNPB 3WR0A 5C33A 1O3QA 4LO5B 1OI6A 4N7IA 2V4AA 3PMEA 4FAHA 5C9AC 3OUJA 5K0UC 4IL7A 4HSJA 4OFGA 1MS3A 5L9VA 1SCSA 1TQ5A 1Z0HA 1F5FA 4MX3A 5BNOC 5A3LA 1UZYA 4CDWB 5FCCA 1GZ9A 3PL0A 3MZHA 4K6BA 1AR93 1VB2A 4QPIA 2H6CA 3FLPA 2P17A 1B35C 3ECQA 3J26N 1J1TA 2W39A 2ZGSA 3R4DB 3H7YA 4Q26A 5GZFA 5A32A 1RUH1 1VAVA 3H1YA 4XQ4A 1H1MA 1C5HA 2A3YA 3NV1A 4JRLA 2P37A 1LJ7A 3MIBA 4Q0VA 1OQEA 4LBNA 1Z7S3 2GSYA 2XJRA 1GYKA 4LO4B 2PQQA 1N3QA 4SLIA 1C5IA 5DUWA 2DF7A 3E5UA 4OI1A 3W21A 5A32B 4P9IA 4DPNA 3INAA 1PGSA 1XE7A 4DS0A 2GH2A 4M3CF 1HW5A 4JRAA 2YUEA 1HQLA 5KBFA 4FQZA 1FMD1 1JUHA 1UPSA 3RSJA 3TN92 1RVF1 3VZMA 1RGSA 2IXKA 1URXA 2DU1A 2FZ1A 2HWF1 4AFAA 2IXHA 1UU4A 4YG6A 3NSTA 3SISA 5B2GB 2RMU3 3NKGA 1H9WA 1CAXA 3NJZA 4FPYA 5LBBA 3B5LB 1IS5A 1OFNA 4Q0UA 4A7ZA 1XNDA 4YZ1A 4X6QB 1LU1A 1PO23 3M3OA 4XJ9A 5AVAA 1G9CA 4OI0A 2PHWA 1UAIA 3SMHA 3WCRA 5BNNC 2R30A 1ZBA2 4RGAA 1BQPA 3AMNA 5ACA1 3NW4A 1YIFA 2E7AA 4DFSA 5KWRA 3WINE 3ZFFC 4NO4A 1V00A 3OY8A 5KHGA 4YRDA 2YV8A 4KBBA 2WNVC 3PJYA 2R043 4NHXA 1IS3A 3E5XA 4QGMA 4TLFA 1XE8A 2VNGA 2WT0A 3BODA 4YZ4A 2PHDA 4ZXKA 1WCSA 2ZZQA 3KLSA 3ZX7A