4NHKA

Crystal structure of tpa1p from saccharomyces cerevisiae, termination and polyadenylation protein 1, in complex with pyridine-2,4-dicarboxylic acid (2,4-pdca)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
613
structure length
546
Chain Sequence
EDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGELEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords PKHD-type hydroxylase TPA1
total genus 191
structure length 546
sequence length 613
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4nhkA01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nhkA02
2V4AA 3EMRA 5L9RA 3GZEA 2Y33A 3MGUA 3PL0A 5LASA 2JIGA 3OUJA 3OUIA 4XC9A 2RDRA 4Q5OA 5M0TA 2Y34A 5A3UA 5IAXA 2FCVA 5EQUA 5L9BA 4XCAA 5LATA 5DAVA 2RG4A 2JIJA 4NHXA 5DAQA 5LB6A 4NMIA 4BQXA 5IATA 5EP9A 5DAWA 3NNMA 3OBZA 5LBBA 2A1XA 3NNJA 4IW3A 4NAOA 5L9VA 3OUHA 5HV4A 2RDQA 4NHYA 3NNLA 2FCUA 3W20A 3KT4A 5LBCA 4NHLA 3NNFA 4ZPIA 4J25A 4Y5TA 3GJAA 2HBUA 5DAPA 5LBEA 5IAVA 3ITQA 5ERLA 3W21A 3KT7A 4ZONA 2G19A 3KT1A 5DAXA 2HBTA 4XACA 2RDSA 3HQUA 5C5UA 2FCTA 4NHMA 4NHKA 4XABA 5LBFA 4MHRA 5EPAA 2RDNA 5C5TA 4JZRA 3BVCA 4XCBA 4XAAA 4UWDA 4KBZA 2G1MA 3DKQA 4BQWA 4BQYA 3GJBA 5LA9A 2OPWA 3HQRA 5HV0A 4MHUA 4Y5SA
chains in the Genus database with same CATH superfamily
3PIGA 4QWNA 1PVC3 3NL1A 3WNKA 4CCJA 5FZCA 1NCRA 1Q8OA 2UY9A 3U4SA 5GZEA 4Z07A 4LMFA 4AK3A 4IV3C 3MFAA 4BHPA 1AVBA 2VC9A 3ZXGA 5JI9A 2MEV1 3TB0A 4D0QA 5JZGA 3UGGA 5ACA3 4A44A 1YQ6A 4Q4X3 3HN1A 5FQ0A 4XILA 3WG4A 4HMZA 4FPCA 3MIHA 4XYXA 2YXSA 2DTYA 5FXZA 5FWJA 1IKPA 5F6KA 2A6YA 3K46A 1N47A 3OEAA 4MGYE 3RMYA 3ZKYA 4OZXA 2DDUA 1VBC1 1M4WA 4Q8LA 1BBT2 1UZZA 1MVEA 2BTVC 2FCVA 1WW7A 2QCSB 5G04L 2J1UA 2NMOA 4PBOA 5DQ0A 4Y5Z0 1W8WA 5L9BA 4E2QA 1O6UA 5GLUA 2CV6A 3T3YA 2CHHA 3ZO0B 1AYM3 1BCXA 3I2DA 4N43C 5LY1A 2D5FA 4GZ9A 4NROA 2X8KA 4NPRA 1BBT3 1F35A 3AYEA 4QM8A 5C9AC 3UGHA 1H9PA 1RUC1 2ORZA 3TWIA 5FP7A 2W1WA 4JV4A 2KM2A 3FE5A 4Y24A 1DIWA 4LLOA 4XTMA 2QQVA 2WS92 5EWSA 3LDKA 4QXHA 4BLIA 4Q1RA 3A23A 1VBA1 2ET7A 3HT2A 3O5SA 4OHVA 3A0KA 4XJUA 4AQ2A 1OQEA 2Q5TA 5GJ6A 1OF4A 2C1FA 4X8NA 1S2BA 3UK9A 2DCYA 3SCGA 1L3JA 1J1LA 4Y1XA 5CADA 3VZOA 2E7AA 1DP0A 1RL3A 1YO8A 3JCIA 3FBYA 5F6LB 3VL9A 5JR2A 1D4M3 3ME2A 1D0HA 1DQ0A 2C9AA 2XL7A 3GBFA 3VKOA 3M3OA 1DQ1A 4YW4A 4A6OA 4Q8KA 5CA6A 3NJXA 1ULOA 3B02A 3LEGA 5A3TA 3NJZA 2OX0A 2W1UA 2RMU2 3B01A 2VMGA 2HWF3 3OF1A 4LKFA 3WV6A 5E88A 2RS52 1LOBA 2AC1A 4RS5A 1CZTA 1AX0A 1E5HA 1WBFA 5JI7A 3WP3A 2WNEA 3VBUC 1I1EA 1RUJ2 3WG1A 5I0DA 4LK7A 1R1A1 4H55A 4Y1VA 1UOJA 3T08A 5A33A 2ZS6B 1NA1B 2C9KA 4NHMA 4A6SA 3WOGA 4BJ0A 2VG9A 4Q4W3 3ZXEA 1C5IA 2F4PA 2WLQA 3AK0A 4DXRA 5KHHA 2QTWB 2VECA 1O3RA 3GALA 1PO11 4BPZA 2JG8C 1CVNA 3T4VA 3VDBA 1R083 1UN1A 1YNAA 1FPN3 2JENA 3TNPB 1RMU3 4CEYA 4QMAA 5CISA 3U0ZA 5FZMA 3AB0A 3ILRA 4P08A 1VJ2A 2WKKA 2XJUA 1O8PA 1SCRA 4L2NA 4UXAA 3T0BA 3WQ1A 1O4YA 2XMLA 3FZ3A 3T2PA 4HFSA 3BIEA 1QJU1 1RHI1 3CJIB 1S2EA 3DL3A 4ARXA 4BQYA 2EIGA 1AF9A 2V5DA 3GHNA 4IE7A 1LHVA 5D8AC 4HBNA 4H3WA 1C57A 3NAPA 4FQ4A 2DFCA 5FUPA 3SNMA 4E8DA 3DPRB 3EB7A 5LWBA 3ZYPA 3MV01 1UOBA 5CKNA 1UMHA 2W95A 2P3YA 1YHFA 2VH9A 4IXLA 2AENA 3TN91 1HXS2 1SBEA 1ULEA 2G9ZA 1DZTA 2WN2A 1WGPA 4GH4A 3LZZA 4HK9A 5FZ1A 4A42A 4CEYC 4GB31 3MBWA 1JZ5A 3VGIA 1MR5A 2BPA2 1RC6A 2JDYA 4YVWA 3VKLA 3H0OA 2EALA 2JX9A 4LBKA 4DIQA 2VU9A 3VBUA 2E6VA 1NCQA 4KGGA 4FFHA 4CDUB 4XAEA 3OJBA 4JDMA 5D21A 4N8MA 4W6WA 1OLMA 2J1EA 1O7FA 1W6MB 3WVJA 1EP0A 1OLQA 2BGOA 2DUPA 2V09A 1RB8G 2P1BA 2HWC3 2WO1A 5LK7B 4BQ3A 1W3VA 3IM0A 3ASIA 1LENA 2JD9A 4AI0A 5I0RA 2AREA 1WA6X 2QZ2A 2X09A 1ND3B 3AZXA 2H6CA 4GJYA 4Z82A 1PMHX 4KWKA 4O61A 3K75B 1Q8QA 4QQOA 2WINB 5DZFA 4COZA 5C6CA 3BB6A 2DURA 2YPDA 2F6BA 2BGPA 1B09A 2VQTA 1H0BA 1W2NA 1IQAA 2CL2A 3O1PA 5FYHA 5FZ6A 1MEC1 2HWC2 3RS6A 1KJLA 3ZSJA 3HBZA 4MH0E 1H1MA 2HJIA 1DGWX 4AGGA 4Q4V1 1RUI3 3IDCB 4BH9A 5CFDB 4R4ZA 4XJ9A 1VMHA 3VBOA 4DOUA 1JZ6A 3BALA 5FPXA 2G4IA 3WDYA 2ZGNA 3OSDA 4IV1B 1GP5A 4WM7A 5FY7A 2GAUA 1HQNA 4D94A 4ORFA 2Q4SA 1GBGA 2Q8OA 5GLZA 1SFPA 4YNIA 1LOEA 2GU9A 4LEJA 5C4WA 4X6QB 1G9BA 1W2TA 4DY5A 1W9FA 3O1VA 2V5YA 5IK4A 1X8MA 3WG3A 5AC93 3CU7A 1UO9A 2W1QA 1CONA 3OD4A 1W28A 2Z69A 4IEUA 3ZSEA 3D8CA 4UF0A 4OI0A 1AR92 3TOJA 3S5QA 2BNMA 4E9KA 2W94A 2X10A 3LDRA 1JBCA 5F5IA 3W58A 1ODNA 4XFHA 4YG0A 1PM7A 4K9SA 3IN9A 5E8AA 3VBFC 4CCEA 2RMU1 4NHKA 3ZYHA 1O59A 2WFPA 3ZN6B 3VBHC 4AEDC 1WBLA 2ORXA 2XGXA 5K0UA 3FLPA 3RVHA 3TEZA 4FPFA 5F3IA 1BMV1 4J1WA 1U5YA 1RUJ1 2J7MA 3LF7A 3RNSA 5LCWL 2BJSA 5ANNA 5BNOA 3SHRA 4YW3A 2KR2A 2QJVA 2G1MA 3ZXDA 4LO7A 1NY72 2XWJB 4G9SB 3POGA 4B4QA 3TAYA 5FPVA 1JOJA 1DQ2A 3ZM8A 2XJVA 1O5UA 1YFWA 1UXXX 5F2SA 5JSOA 5GALA 4XJWA 3VBOC 3ZFFC 3NMBA 2KD7A 5FXVA 2VZUA 1LECA 3NVCA 2XUEA 3R4UA 2K46A 4KI5M 1XNDA 4W65A 3N7JA 5FIXA 1QJY2 2ZZJA 1CAWA 1FMD2 3PL0A 3TNQA 3ON7A 1VBB1 4Q5OA 2XJTA 3J26N 4CEWA 4ZU7A 2XBO1 2JEMA 4IESA 5EIYB 4YYOA 3V0BB 2ET1A 1H4GA 4GMP3 4WVMB 4LITA 4Q0VA 4QQ2A 4JGZC 4WM8A 5IK5A 3MW4A 1VP6A 3AFGA 3E5XA 5ACA1 4QDSA 5EQUA 5FZKA 5L7OA 1JYNA 1ONAA 4HK8A 3WZ1A 3GM8A 1ZRFA 1ASJ1 4YZ1A 4EWAA 5J7MA 3NQHA 1NLQA 1VBC3 3RPQA 5JZGC 1TG7A 1AXZA 4LBLA 1XB9A 4CU6A 1D0GA 2JIJA 4YGDA 4HANA 1HRV1 1XNAA 1XXNA 1XYPA 2YBPA 3R0RA 2MHFA 2JDNA 4HKWA 4S2HA 5FTTC 1NQDA 3FHAA 4BQXA 4CDQC 3BTZA 3HD8B 3LE0A 4NOTA 3HVDA 1AR71 2BYVE 4K21A 4MGKE 5E6HA 3AVRA 4IEOA 3BI3A 1SQ4A 3IT8A 2F17A 1YJLA 3PU8A 2ZACA 4X8PA 4XETA 1KFXL 1UPIA 5A80A 2XJSA 2G9FA 5K4LA 2D6KA 5ISLA 1ND3A 3W20A 4LQRA 3GYDA 1W2AX 4EJRA 1PM4A 1QXRA 1VBA3 1YFUA 3H3ZA 5DN2A 1Y4WA 2GC1A 1ULPA 4IE0A 4AFCA 4AFDA 1UY4A 1EUTA 4ZY9A 4Y5TA 3CJIC 2RM23 4FT8A 1YWKA 2YBSA 1H2NA 1I5ZA 1L7QA 2ZBJA 3W5MA 3DYOA 4LT5A 4QQHA 3HR9A 3T1LA 4YGBA 2D3PA 2LALA 3T09A 1W9TA 4OHZA 4R8HA 1XNTA 3MV11 2GZWA 2VZ1A 4I0WB 1JTZX 3KCCA 4KG0A 3TYJA 1FX5A 4K1ZA 3KV9A 2K0GA 4M00A 3OD0A 2LRPA 5FLJA 2XOMA 4EROA 3RQ0A 2BQPA 5FRAA 1CD3G 3BTXA 1H2KA 2X5IB 2XHNA 3CZUA 3MW2A 4GKYA 1APNA 1GOFA 4PIYA 3I3BA 5AVAA 5GLTA 4XXPA 3M8LA 2J1SA 2YG0A 3HEIA 1WCUA 3NW4A 2VBBA 4XF0A 2ES3A 1EAH2 1OA4A 3J7LA 1WLCA 5FYYA 1QOSA 4Y4RA 5F32A 2QQMA 4JC1A 1OSGA 1XNKA 3HMYA 2CWMA 4TWTA 4XXAA 3SKVA 4MXWB 4EN0A 1QJZA 4EN8B 5F7UA 5DZEA 2OPKA 5HV0A 4Y5SA 3BUCA 2RS33 3ATGA 1UCXA 4YM3A 1QJU3 1RHI3 1SHWB 3IDAA 4H7LA 2RR13 4OMDA 1Z7S2 1CAWB 1S0IA 4IE5A 4DUXA 5A6ZA 2QE3A 1RUC2 5AVPA 1Q56A 3PUAA 4HETA 3AJZA 2E63A 1J84A 3WUCA 3IIAA 2AEZA 4BXFA 1G7YA 1CZVA 1KEXA 2QNKA 2XLAA 3H1YA 1WMXA 3I3EA 3W5NA 1LR5A 3H1MA 1HJGA 4QHBA 3THTA 1UNBA 4K8FA 1RUNA 4NIDA 1Z7S3 4YW1A 4LO5B 3U37A 1KXGA 4E2SA 5CEHA 1H30A 1ZBA1 2R063 2VXRA 4RN5A 1S4CA 3TEXA 2QVSB 4P9YA 3VZNA 3DCQA 4IEXA 1QMJA 4WM7B 1YCIA 4OHYA 3PTYA 4LBQD 3FLTA 2W2IA 2R073 5HCBA 1RXFA 1A8MA 2VW0A 3J7MA 5H9QA 3VDAA 1R082 2Y0IA 4COUA 1JYWA 4LKSA 5DUXA 2QQJA 2XL9A 4AAXA 3H3LA 2Y26A 3ILNA 5DAQA 2VL4A 3OPWA 2ZGMA 3ZYBA 5KR7A 3FX3A 5IATA 3KHBA 4BZ4A 2HWB2 1QH6A 5F5CA 4RGKA 4AG4A 4INDA 1W9WA 2D6MA 2VTXA 3K3NA 3WT3A 5KWRA 3FLRA 1UU5A 5FUNA 1JYVA 2FDIA 5B4NA 2UY8A 1UZ0A 3WUDA 5KXDA 5LZ6A 4XZPA 2DV9A 5C33A 1JW6A 4LA3A 3U1XA 3N7MA 4NAMA 1LEDA 2B9VA 2D43A 4OUEA 1HRV2 2FCUA 1S2KA 1BMV2 1H8VA 4M3CA 4Q26A 1ZX5A 1HRI1 4IERA 4XBLA 4AE2A 4ZU4A 5LBCA 2JB8A 1ZA4A 4PLOA 2ZX1A 4Y33A 4RA0A 1COV3 5FP4A 2ZGOA 3E6DA 4CDXA 1CGPA 4H7MA 3RDIA 2HWD3 3CHXA 2VZSA 2EIBA 5EXOA 4PHZA 4QGMA 2YHJA 2DUQA 3HNYM 3WR0A 2A6XA 4P14A 1BEV2 2VQAA 4Q0SA 1QJU2 1IOAA 1RHI2 3NO8A 1H8TA 2J1AA 1DLCA 1DDLA 3U78A 1NZIA 1SLBA 3THCA 1COV2 5J36A 3N35A 3VBHA 4AEDA 5JZGB 3N4MA 1QXJA 4MO3M 3TRSB 4PT6A 2BWAA 3ZXJA 4WVWA 3AXEA 5EJZB 2JDMA 2P17A 2ZMLA 1R64A 3HQUA 3KCXA 3RMXA 5F37A 1NCRB 3LPGA 1Q5OA 2FCTA 2XQRA 2XJPA 1N3QA 1ULCA 2QDRA 4QDQA 5T5LA 2R0HA 2J22A 3EJKA 1H6YA 2WO3A 3WP5A 1J1TA 2UWCA 2YBKA 4P00B 2GC3A 2YFZA 3AP5A 1ACCA 2IXLA 3UETA 5D8AB 3SEEA 4TTGA 2V73A 2WSUA 4EN9B 1UKRA 3LSDA 4TXWA 4OULA 2Y6LA 1AR63 5LRRA 2RMU3 5IJRA 5A1FA 2ZKLA 4BK4A 3KV5A 2R043 4Y20B 2CYFA 4L9BA 4XUOA 5FYUA 1HQWA 2YB7A 3QLQA 4QX0A 1GQPA 3NRUA 2A6ZA 3R05A 2ADDA 4BCUA 1CX4A 4Q27A 4CDUA 3PTRB 4QM9A 4UFLA 3VL8A 2WZPP 3N7KA 1DGRA 1VBE1 4BQ2A 4UFKA 4CXWA 1NCQB 4D8MA 5JXIA 1U5XA 3O14A 3KCYA 1YFXA 1PIV1 3ZSLA 1ND2A 4Y26A 1SBDA 4NWVA 5H9PA 3ZX7A 1JZ4A 3B69A 2UYBA 1RJ7A 2W92A 3BTAA 5A3NA 3MGUA 3VDCA 3SH3A 1AL22 2FDFA 2GH8A 1D2SA 1C1LA 4CZSA 2ZEYA 2X53S 1NOVA 2ARCA 4OQ9A 1GANA 1NXD1 2C26A 1CX1A 5A3UA 4B4PA 5A1LA 2O0OA 1HX6A 2HWF2 2PHXA 2X5IC 3WF4A 4N43A 1Q8SA 1CPMA 2HWD2 4Q4X1 1JODA 4YW5A 1TEIA 2XVGA 2R32A 3GBWA 1VBB3 1VRBA 1R1A2 4PLNA 4CXYA 2NP0A 2VZPA 1B35A 4UBHA 2VOKA 4FOVA 2W1SA 3AX4A 2DCZA 2K9ZA 1BZWA 1TMF2 1VBD1 4G4FA 5KXBA 1LHWA 5JSRA 5K0UB 1QNYA 1ND2B 1WLDA 1ZBA2 1GWLA 1YC61 3FL7A 4PJYA 4GWIA 3MW3A 5EP9A 4LBQB 4COVA 1GMMA 4IGPA 4WM8C 1CIWA 3NNJA 2HKXA 4OI1A 2AH2A 3AYCA 3AZVA 4MGQA 4B8EA 5LEJA 4NPLA 5BPXA 1XSQA 5FOBB 1F15A 1QJFA 3CO2A 5L73A 3AFKA 2WUHA 4Y20A 3T2OA 2W3JA 2BFUS 1GZTA 2HWB1 3EBRA 3INAA 3PDQA 4IDZA 4UYBA 5BNPC 3IZOA 3DKWA 3TN92 1WCQA 2YV8A 2GMMA 4KMQA 1UX7A 1FOD3 3LPFA 1QF3A 2OKXA 2HBUA 2VOWA 2CGOA 3LIHA 2DBNA 1W6PA 1W8OA 2IXCA 2VXJA 2ZZQA 5DAPA 3VDDB 5FPUA 5FZBA 1E5RA 2VMHA 1QU0A 4WVZA 2PMWB 4PF1A 2CAVA 2NQYA 5FY0A 2GP5A 1Z0HA 3VN4A 1Q3EA 1S55A 1SEFA 1OMIA 2NZ9A 1ULGA 2XG3A 4CDQA 1GZ9A 5L7OB 4XJ8A 1VIWB 3LGRA 2P5BA 2J1RA 1X7NA 4BU2A 2VBDA 1VAMA 3ST7A 1XE7A 4CEWB 1OFNA 5FY8A 2GH2A 3WQBA 2XLGA 4AEKA 4A7YA 4KWUA 4HOOA 2JE8A 3MHZA 1BHGA 1UY1A 4DO0A 1L7LA 1YXWA 3UJQA 3B5LB 3DN7A 1A34A 3SCHA 4UWDA 3GCXA 5FOJB 3V56A 4CEWC 3EXUA 3JBG1 4D6RA 2AYHA 1FPN1 1ASJ2 5A7SA 2ZJCA 1G9DA 2G9GA 4CP9B 5FY1A 4GB33 1LOGA 3T0AA 4CDXC 4KGQA 1ZRIA 3EMRA 4JHTA 4XUQA 3WNOA 3J8F2 5CU1A 2HEWF 3JB8A 5FQ0B 4NRQA 1RYYA 1OLME 5K9YA 3GZEA 3GXUA 1K5MC 3WG2A 2P2KA 3KD4A 2WAAA 5FZ9A 2VZVA 1J3RA 1XNCA 4AFMA 1IG0A 4AVVA 4RQPB 4GAZA 1MQTA 4NRMA 1I9RA 1CAVA 2YUEA 3PNAA 4MOAA 4GA9A 5T5OA 4N53C 4Q4V2 1NX9A 2VE1A 5FUIA 4ATFA 4AVAA 4CP0A 5HCFA 1O5LA 4XIKA 3VBFA 1ZZ6A 3E6CC 4IE6A 1K5MB 4BYYA 4XFBA 4BK5A 4BISA 3IAPA 1AX1A 3NJYA 4GXLA 1QEXA 2PHTA 4QKDA 2IFRA 3N9PA 4OCTA 2XPJA 5FKBA 3KV6A 1OPOA 2BOIA 4Q4Y3 2E9QA 2YZ4A 1US3A 1N1VA 1J59A 1V9U2 2LW8A 1NT0A 1JN2P 4EV0A 2RM22 4NMIA 2PN5A 3USUA 3DPRC 1FT9A 3M70A 3H8OA 2ZKNA 3OPZA 3TEYA 1YQCA 4BM8A 2Q1FA 3NNMA 1F4HA 4I3PA 1MQTB 2DU1A 3WW2A 1SLAA 3OGJA 1NY71 1UU4A 4AI1A 1NQJA 2VCCA 1POV0 2ZAHA 4PQ9A 2IUWA 5EYYA 3T1MA 1KFUL 2VUDA 4CTEA 3DGTA 3I2IA 1PIV2 2WBKA 4AYUA 4E2GA 3PVEA 2Z4FA 1HIXA 1KJRA 2P4EA 4AHXA 1LNSA 1JZ7A 1IKQA 2QZ3A 4FAHA 4DEQA 3P3PA 1K5MA 5IVVA 1QJEA 2D6PA 3Q8AA 1HXS3 3BTYA 3B94A 5FAXA 1JHNA 4C91A 3UKVA 1IHMA 4Q0UA 3NV4A 5FLIA 5CFCC 4ISQA 3I49A 2XUMA 3HNMA 3MLLA 4FO9A 3MIEA 1NYWA 3AKSA 3MZHA 4V2VA 1OBNA 1UQXA 3JZVA 4WV8A 1JXNA 4Q4X2 5B2GB 3I3DA 5C3SA 4DXZA 2D93A 4I0AA 4YWAA 2JDKA 2W08A 3DXTA 1F4AA 4LO4B 4NVPA 1AR82 1REDA 3V65A 5BNNC 2IXKA 1TMF3 2WWUA 2JKXA 3K4DA 2NN8A 2JDUA 5HPOA 2EAAA 2PHLA 2W9XA 5H9SA 4BQ4A 1VBD2 4HPKB 4Y22B 5IYYA 2I07B 1RVF3 2WNVB 3FJSA 4YVSB 3RZJA 2ZGTA 2FDGA 3OYWA 1RUF3 4QU1A 1PGW1 1RINA 3GCWA 4DZGA 3LFIA 4UAPA 5FLHA 5A6QA 2FD8A 3MYXA 3H7YA 5FY5A 3FWEA 4XAAA 4OHWA 3G6JB 1UZVA 2EXHA 4HVOA 3MPPG 2XBO2 1Q8PA 2I2SA 4CU8A 3DYPA 1QQP3 4I0BA 4ZZ5A 1AYN2 1C8M1 5EZWA 4XMIA 3M7AA 4NIIA 2WNUC 2E7QA 4QKFA 4FTEA 3UL2A 1NE6A 1YQ8A 4FPJA 1RUG2 4LR4A 3ZDVA 4OVEA 1LU2A 2E32A 3S57A 3ILFA 5LEKA 1QXPA 1HN0A 3NSTA 4QQLA 5EFUA 4JQTA 4B1LA 1QOOA 2WZEA 3O7OA 5LASA 4QPWA 2VMFA 4YVSC 1E57A 1FV3A 4O9EA 3ZFFA 3OUJA 4XC9A 5DG1A 3L2HA 3UT0A 1SMVA 1VR3A 4EQVA 3PMEA 2A3XA 1O91A 1ENXA 3GZUC 5G05L 4D7YA 5J96B 3BIWE 1RUH1 2DVGA 3ZXLA 1RGSA 4WM8B 2ZGSA 5JVVA 3B93A 3K4AA 3L2YA 2WIIB 4L92A 4FXKB 1BBT1 2WQ8A 1G9FA 1V6KA 1Y43B 1ZA7A 3PUHA 3THPA 4P9JA 3VBRB 4M3CB 3KHCA 1E5IA 3ZPOA 3H8UA 4CDWC 3R4DB 4QDRA 2PELA 1JZ8A 1B35B 4MVTA 5I0SA 4LIVA 3Q8FA 2ZABA 1RIRA 4AVCA 1ASJ3 5A7QA 4L97A 4HONA 4LBNA 3VLBB 5F5AA 5A3PA 3GNEA 2BOJA 1TNFA 1BVP1 2A75A 2HWE1 2PHUA 4HG6B 4Q0PA 2A3WA 2IVJA 3M3CA 5T54A 1WMFA 4E4DX 1C8NA 1D4VB 1PK6C 1BK0A 4EE2A 2R062 4LNVA 3MPBA 1DYOA 4GD4A 4NHYA 3OBRA 1IS5A 1JZ3A 2BNOA 2RM21 3IMNA 4YZ4A 4K8RB 3BU0A 3AP9A 3BU7A 2VJXA 5JOYA 3NWKA 3HOBA 5C3OA 3VBSA 4OLLA 1VMJA 3NNFA 2D3SA 2RS53 3OGRA 1F8VA 1WLTA 1Y7BA 2DYCA 4Z1VA 3GJAA 3OY8B 2YYOA 2WWJA 4KWJA 4Y1YA 2R1BA 3WNLA 1LCLA 3I2KA 2HWB3 4ES8A 4ZS2A 1PVC2 4HN0A 5FCCA 2Y6HA 1JOBA 5KXCA 1PO22 1S0JA 3CDZB 3E1F1 1DYKA 3KT1A 3VHRA 4DXSA 2GNBA 1OQDA 2Y6KA 4HKLA 4AOCA 1ZRDA 4IEWA 4DRRA 1KGYA 4UI9L 5AFBA 4FTBA 2JG8B 4AVBA 4ARYA 4LUMA 5BNOC 2PLV3 2NYYA 4Q4W1 1PZ8A 1GP6A 5GZDA 5FZDA 1FI2A 5FBZA 4JKKA 3VBSC 1UW8A 1LOCA 2YY1A 2FDKA 1DBNA 2VZRA 5A7OA 4GWNA 3RGBA 2XDVA 3H8RA 1LJ7A 1A6CA 1YYNA 3VZJA 5JPMB 4HSLA 4MHRA 2ARXA 3VD5A 1LEMA 2GC0A 3DEMA 2VMCA 5KHJA 4JZRA 1ALYA 3MICA 1HN1A 2UURA 1GQHA 1NZCA 4S2GA 3V0AB 4RSUA 1E5SA 1W8HA 4WZCA 4XCBA 3W9AA 2PQQA 5A3MA 2HLEA 3ZN4A 1IG3A 2RS31 2OW4A 5BXXA 3WF0A 2RJLA 1WW6A 1F5FA 4JQRA 3MIFA 4ASLA 4I2OA 4XDQA 3I7DA 5JLVA 3L9JT 4Q0QA 2DBIA 4E27A 4GQ7A 4BOWA 4EZHA 5JAXA 4NE9A 1PGL1 3VUOA 1IPKA 5DABA 4ONUA 4YVWC 5JOWA 2B46X 2D40A 1RUE3 1JS9A 1MQTC 1MZ6A 1OD3A 3U11A 4KU8A 1KITA 2VMDA 3N9LA 4Z92B 3U4XA 2VM9A 3KQ4B 2B45X 3NAPC 4CU7A 1NAEA 3OTFA 4L99A 4XMAA 1NA1C 3OYWB 2MPFA 2VZQA 3KV4A 4D7TA 4XW3A 4LBQA 4FPGA 1GKBA 3ZYRA 2V72A 4BA6A 1X8EA 3CKHA 3LD8A 1AR93 4HLTA 2OQ6A 1OOPA 1W9YA 4QPYA 3JUUA 1WMDA 3BN6A 3B9IA 1QNWA 5FMCA 1LGCA 4YZ2A 1S0EA 3AKPA 3VKFC 1UOGA 1UKGA 2RG4A 3CMGA 4D6QA 4YFWA 1IS4A 2Y64A 1W03A 3NNGA 4Q4V3 3WCSA 2JDHA 4XZUG 1W8TA 3GGLA 3PUIA 1MVQA 4O7XA 3X29B 4M3CE 3W59A 1JOPA 4BIFA 1GOGA 2H6BA 2WQ4A 3D0SA 3N9MA 2ZHKA 2A1XA 4BE3A 5I8TA 1G86A 3I3MA 1HRI3 2Q0AA 2QFEA 3WP4A 1YQ2A 3SISA 5HBAA 3GZTB 5A3WA 3NNLA 2KA3A 1ULDA 5DG2A 3WF2A 2VO5A 1CN1A 2XB6C 4A45A 3FFQA 1U5ZA 3JB4C 5FP3A 1XC6A 3C8XA 4P9LA 2YMZA 3APBA 5JMOA 1ZZ7A 4EYUA 5J48A 5FPAA 3D0JA 3GZAA 4QX1A 4BWOA 2EXKA 4Z8BA 1AL21 1IQDC 4RHV3 1H1AA 4XQWA 1J83A 3R4SA 3ITQA 5IAVA 4QB2A 1UY2A 5AFEA 4FOQA 3KGZA 1OLRA 4LXLA 1F2NA 3SEPA 5KHIA 2ETEA 2RJ2A 2ZGRA 3IAQA 2HWD1 3RYKA 2IXHA 1OD5A 5FZAA 5F8PA 1XU2A 5EJ3A 2NM1A 5FJHA 2W46A 3KM5A 4IQPA 5DUUA 2JDAA 3SC7X 3AMPA 1GNHA 4ASKA 2YU1A 3S7EA 1PNFA 2ZGKA 2ENRA 3I4IA 4I01A 5ANQA 1TMF1 2FHRA 5LA0A 5IFTA 2WYSA 1GU3A 4RGGA 1DZQA 1LESA 2R041 5EPAA 4YPJA 4E4HA 1JZ2A 1SZBA 3D82A 2VZ3A 1IZ3A 3RI8A 3USSA 2E7TA 2O8OA 1JUIA 1H4HA 2YROA 2E53A 1W6NB 1HV0A 2D3RA 5FZ3A 3DECA 5CVRA 4D69A 1PIV3 4XFIA 3LEIA 1D4M2 3WF1A 1UPSA 3H7JA 3QH7A 1AR61 4PF5A 3WXPA 5FYIA 3P5BA 3EO6A 4DY3A 4ET7A 4FFGA 1K5JA 1QIQA 2VBPA 1MS5A 4HT1T 3WDUA 5JXHA 2TEPA 1NE4A 1QQP1 3DXUA 3K4ZA 1VPHA 4NJ4A 1V6LA 2P37A 2XBO3 4IETA 5D2AA 5FP8A 3SITA 2RS12 4PIZA 3O1RA 4QQPA 3C3VA 1U0AA 4GMP1 1VAVA 5T5PA 3AZYA 1XU1A 2WZR2 3MDPA 1OOPC 1AZDA 3A0NA 4LLFA 1JMUB 1NCRC 2WT1A 4QXBA 5FZFA 2A70A 4Y4YA 2QQPA 4R9BA 4FSJA 4Q2FA 1AYM2 4MGSA 4N7IA 1KS4A 1OVSA 4ATEA 3DUIA 4CSWA 1WCDJ 3LB9A 2BVVA 3IDBB 4IV3B 5C4WB 1EUUA 1VBD3 2ZHNA 4GJZA 4YFZA 5FZ4A 1GV9A 2Z79A 1OKOA 3LKJA 1ZZCA 5FV3A 3PURA 1CJPA 4I02A 3CNAA 2W5FA 1NG0A 4XPVA 4CPBA 1KS5A 1W2UA 2WN3A 2FZ2A 3VDDA 3V64A 1HLCA 1RITA 1SLLA 3HQXA 3VBOB 4M0HA 1LHOA 4LORA 1MS8A 1SDDB 2J1TA 4QGLA 3C7HA 2HH9A 5CIRA 3PUSA 4WVMA 2OZ6A 1UZYA 2R0FA 3I2JA 3H50A 4GKXA 4K20A 5J98B 2FDHA 4K7JA 1TNRA 5FMOS 1AX2A 2XWBB 4UFIA 5L9VA 1PO12 4K3UA 3A7QA 1ZZ8A 4P5HA 4M4PA 1N3OA 3VD4A 4P02B 4QX2A 3AMNA 1OURA 2EAKA 4HXCA 4JGZA 2RJKA 5C70A 5CFDC 2TUNA 1H8TC 3E6BA 2AEYA 1UYYA 4FOWA 4MUVA 3POJA 2BFUL 3G7DA 3CEWA 3C7EA 4YGCA 3WHUA 1JYIA 3NKGA 5CBLA 1O3TA 3PVNA 4NN0A 3WNXA 3UV9A 1ZREA 4V2WA 2PAMA 4AEJA 3ROUA 2ZGLA 3E5UA 2PHRA 5CB7A 4BQ1A 1FOD1 5IHRA 1H1IA 1XNBA 2B42B 2HBTA 2QQKA 2ZAAA 1IPSA 2D98A 1ZBE1 2BDRA 4JRLA 1KDMA 1ND2C 4LHNA 4W50A 2N7GA 2J1VA 4AGVA 3A4UA 5DXDA 1RUG1 2VOTA 4LOTA 1DZRA 2VCAA 1AXKA 3QACA 4TZDA 1H9WA 5A1AA 1K42A 1BKZA 2WS91 3OCPA 5LBFA 1DLLA 1G8WA 2VOXA 5FZIA 1PX3A 5B4XA 5J09A 1V6OA 4P5YA 2WWSA 1PK6B 1BEV3 2DTWA 2OZJA 3BOWA 4XOGA 1SCSA 2DCKA 4UFHA 3LAGA 4IV1C 1BQPA 4YW7A 3EHKA 1ENSA 3VKMA 2RV9A 2VUAA 1RUH2 1ZZBA 4QXKA 1HQLA 1X82A 4Y3OA 5FYSA 4CEYB 5FO9B 1MS0A 2FDJA 3QBQA 1A8DA 1OFSA 4B7KA 1RJ8A 2WT2A 1W99A 2OPWA 4IEZA 4HN1A 1PMJX 2C0ZA 5IW0A 4NR1A 4AR2A 5GZCA 4Q29A 1QWRA 4FOYA 1LB2A 2QQNA 3JBG3 3AXDA 4CUBA 2VVEA 3B3QE 1EV12 4L0PA 1EY2A 3ZDSA 3I8TA 3ZPYA 2YC4A 4IV1A 5GM0A 1QJX1 2QDNA 5FJKA 1V9U1 2ZEZA 1SLIA 2WZ8A 4BB3A 2WR9A 5IWFA 4JCKA 5C4WC 1W0NA 4JGYB 2B7YA 5LK5A 4DINB 4AI2A 2R072 5C8WA 3VBFB 2GP3A 2OA2A 1LOFA 4A41A 2RS11 3WSOA 4AVSA 3JD73 1V0AA 3N9OA 1C28A 5IVYA 1Y9MA 1YFYA 2CAUA 3KF5A 4IL7A 5FZ8A 2E26A 5IVCA 2CY6A 3K48A 4C1WA 5I8SA 3WNMA 3FFZA 5T50A 1AR91 2VY0A 2TNFA 3H9AA 1CR7A 1UMIA 4MGZE 3VZKA 2WNUA 1SFYA 2PHDA 2B4KA 4OYUA 3K3OA 3POFA 2EXIA 2BGCA 4CDXB 5C3QA 2WFF1 3ACGA 5GZFA 3IDEA 2E51A 2WNVA 2AUYA 5I8YA 5JXJA 5FXXA 2VUJA 5BV6A 3ALQA 3ES4A 4GWJA 2UWBA 3AC0A 1G9AA 4YVWB 2QBXA 5JSPA 1C5HA 4XF9A 4Z2WA 1DQ4A 3KB5A 4PDWC 3LA3A 4A7KA 4CCNA 3QCWA 4JGYC 4XFCA 1RXGA 1ENRA 1OH4A 2VZTA 1V70A 2OS2A 2WO7A 3FN9A 4B7EA 4AZZA 2WZR1 1GFF2 4IGOA 1OUXA 2CGNA 4IEPA 3SCFA 3VKNA 3LDBA 1RUI2 3AYDA 3ZFGB 4FAGA 2XJRA 3AP4A 5E89A 1CAUA 2DVFA 5LBEA 1X9PA 1OXCA 2O1QA 2XLFA 4AXOA 3VBUB 4C0HA 1Q8VA 1W39A 4LPLA 2ZTNA 4LHLA 2VGDA 2WT0A 2PHFA 2W87A 3BGAA 3WDVA 3RZKA 4QPIC 3WDWA 3OEBA 3H3UA 3WLUA 4RHV1 4O65A 1ND3C 3D6EA 4XACA 3ZFGC 5F3CA 2UWAA 2RDSA 3PVBB 3WW1A 1T6GC 2I74A 1RUF1 2W68A 5L36A 1VBB2 3WX5A 3CQOA 1TME1 4Q4Y2 1RUD3 2FBEA 2QQLA 1W6PB 2JD4A 2UYAA 1OA3A 3J4UH 4HVRA 3USUB 1MS4A 3O1UA 1FAYA 5C5TA 1MZEA 4XDPA 1N1TA 1DGWA 4QB1A 3N9QA 2ID4A 1RVF1 4AFBA 3SXWA 2RE9A 4CUCA 3NV3A 1VE0A 3AM2A 1VBE3 2JB4A 3O0VA 4AL9A 4OHXA 4UW4A 4BQWA 4E8CA 1LGNA 3VZLA 5FMOL 2LROA 3OY8A 3F2ZA 4TLFA 3U10A 2WJSA 1GWKA 4K6BA 4XE9A 3NJVA 1LHUA 5A7PA 2D6NA 4DEVA 5C9AB 3WF3A 4XF4A 5FZHA 4Y1UA 2BV4A 2MEV2 2VNGA 1POV1 3LWCA 3K77A 4BXSV 1C8M3 1PMIA 2UU8A 2J42A 2EF6A 3CZJA 5FP9A 3WNPA 3WW3A 1WW5A 4RD7A 4YSFA 5DDJ1 4NRPA 4AAPA 1FOD2 1PVC1 1TZOA 2WL1A 2PTMA 2ZOEB 3ABZA 2P3KA 3FC0A 3FBMA 2OQ7A 1N3PA 3MLKA 1WA4A 2JIGA 2YPJA 2R1DA 4LE4A 4C1XA 1VBC2 2DUOA 2W52A 4RGAA 1PO23 4QD2A 5TSWA 3FHQA 3ZXAC 4AI3A 2MEV3 3LIGA 3URFA 2C5DA 4Q4W2 4CP9A 1ST8A 4PI2A 3KZ4C 4XDOA 5FKCA 1CAXA 4OQ8A 2FZ1A 1EAH1 2OVUA 3ZKUA 1US2A 1FNZA 5J1XA 2K2SA 5AC92 4BLJA 3AKRA 2EA7A 2WYFA 2P3JA 4P9XA 5JCTA 1WD4A 3POWA 3PU3A 1RUH3 3S5AA 3P3NA 4FPKA 3Q8BA 4IGQA 1GOHA 2ATFA 1R091 5T55A 4R9AA 4OUMA 4LKEA 1W05A 5EV7A 4M01A 4LO8A 5C8CA 3I54A 2R16A 3ACHA 3KVAA 2PYTA 3LA2A 4MADA 1WWYA 2Q1ZB 1EV13 2GC2A 2B39A 3ZFFB 3C7FA 4IE4A 5HV4A 1RUC3 3ZFEC 2Q8CA 3OOXA 1V6JA 1SG3A 1VRH2 1JYCA 2HWE3 4FTSA 1FMD1 1XSRA 1OC1A 1OF3A 1N1YA 1ODMA 3LSEA 1CESA 4YG3A 2XH6A 3S30A 3MF9A 5K7PA 2QQIA 1BK1A 4ZPIA 5A3OA 4AI8A 4DUVA 1T2XA 2VPVA 2FQPA 4ZU5A 1MS1A 4KWLA 4LBOA 3PVOA 4O9GA 3JD72 1PZ9A 4U2AA 4QPIB 1EYBA 2ZHMA 4WZFA 4KNCA 3VBRC 5FYBA 4URTA 4QHOA 2RS51 4W6XA 2BZDA 1SACA 3AVSA 1D4M1 2GMPA 2D97A 2D6LX 2DVBA 5KHKA 1ENQA 1UD1A 2P3IA 3VBHB 4AEDB 3F95A 3HPNA 1QJY3 2WSVA 1ZNPA 4UOJA 5IVFA 3ZYGA 1YIPA 4CRQA 5LW9A 5A6YA 3BKZA 1DQ5A 4NPMA 1DFQA 3RZZA 5A3LA 5A32B 2WABA 4FP2A 1NA1A 3LQCA 1PGL2 4YVSA 5A33B 5BUVA 4LOSA 1O4TA 2PLV1 3RZGA 1GLHA 4ISRA 1NLSA 2C6SA 3AZZA 1R1A3 3WDXA 5BNPB 3CF6E 2JDZA 5ACA2 4SLIA 1DGLA 1NLRA 2QKDA 3ECQA 3I59A 4JAAA 2WS93 3ELNA 5E1RA 5FO7B 1TQ5A 4CU9A 3K2OA 1HW5A 1PO13 4XQDA 2DWRA 4RR3A 1R081 4QAWA 1WMEA 1BEV1 3GJBA 3RWKX 1FXZA 1X36A 1DYPA 5IVBA 3M2MA 4CYDA 4FPLA 3UESA 4XUTA 1UX6A 1FPN2 1WUVA 3LEKA 3N7LA 4EN6B 5IT6A 4RQPA 2IXIA 3ZSKA 1RVF2 4UBGA 2HEVF 4QGNA 3SKJE 3MUY1 5BNOB 2JDPA 3D5OA 4KQ7A 1NXMA 4SBVA 1W0OA 4IEVA 1BJQA 4A3ZA 2WNOA 2R49A 4LUKA 4XHXA 3O1SA 3S7IA 1RUE1 3KS7A 5BNNA 4KG8A 4QPGC 1UZWA 1W0PA 5ABJC 4GMP0 1XJAA 3I3QA 3MIBA 1WZXA 2QUOA 2ZA9A 4LTAA 5FWEA 1VALA 4JTOA 1V9U3 1TME2 4Q4Y1 1W6QA 3OG2A 1CQ9A 2HEYF 1C3HA 1AJKA 2WAOA 2WRAA 4XCAA 1ZM1A 2BWCA 2GALA 4JGZB 1MPXA 1YRZA 3PIJA 5C3RA 1DF0A 5DAVA 1F5JA 2RS13 3S6PA 3VHPA 5BNPA 4C90A 1U12A 5FZGA 2B9UA 4CDUC 1MEC2 2HWC1 2BERA 1UAIA 3JQWA 4K1YA 4NHXA 3VHNA 2OXBA 1OPMA 4XJZA 5DPNA 1CAVB 3CIHA 3KSCA 4NUBA 1XE8A 3O1MA 3A22A 2W47A 3QH6A 3U14A 3RRDA 3POSA 5IUQA 4MGIE 3AYAA 1C1FA 3MLJA 4CDQB 2ZX2A 3B00A 3KWVA 2VOVA 2O8QA 2WFF3 2VMEA 4QPGB 5ABJB 3CL1A 3MF6A 1ZRCA 3AKQA 4W6YA 2A7AA 2VCBA 1AL23 1SPPA 5A7WA 4HL0A 1W8UA 2PAKA 3VD3A 2IFWA 3UNPA 1AXYA 4LIUA 4NHLA 4YM2A 4DXTA 5FO8B 3FHIB 5BY5A 3IKWA 5I0UA 1YI9A 3TBDA 1NCQC 1XPWA 2CWSA 2ZCWA 4KL1A 1RTVA 3UKTA 3O0XA 4N53A 2GN7A 1QGLA 4FP3A 4GULA 4COYA 1PVXA 1JU3A 5DAXA 5FXWA 5F5QA 1YQ5A 3JU9A 4CCLA 1OI6A 2OUJA 2CDOA 5E16A 1IPJA 4WM7C 2B8MA 3PUQA 5JOXA 1UXZA 1W6QB 4J1XA 2TBVA 1AR62 4P9GA 2E33A 5FPZA 3MUZ1 5GKAC 1ZRRA 2WA3A 2Y6GA 4AWDA 3GHMA 4QU2A 4XVHA 1O4ZA 2VR4A 2ZX4A 4XIOA 4B1MA 5C5UA 2I45A 2GSYA 2BP6A 1AHSA 5FK8A 1QQP2 3WP6A 3TEWA 3MO4A 1UU6A 3WHTA 5HI0A 1GZWB 1S0BA 5JDBA 3PLQA 2IVIB 2HYKA 1W6NA 3I2FA 4RFRB 4Z2AA 3ZR5A 1W06A 1VRH1 3GBGA 4W4ZA 1RUD2 2PLV2 3DKQA 1DQ6A 3RJ2X 1O3QA 5C7GA 1CAXB 5FPBA 4YZ3A 4N43B 5APAA 2X29A 3ZMNA 1QDOA 2DU0A 5FY4A 3VD7A 3ZLIA 5K8SA 4AFAA 5L9RA 4JGYA 5JMCA 2PXJA 3HBKA 1YLLA 2QQWA 4MLOA 3CLPA 4Q1PA 4E4SA 3WCRA 1AL0G 2BVBA 2F4LA 5HXMA 2Y33A 4JVAA 3VZMA 1PX4A 2MNGA 5L7OC 3RYRA 4YM0A 3ACLA 1CWPA 5FREA 5FZOB 2Y34A 4EZ4A 1RUOA 3WEZA 3KF3A 1HB1A 4CPBD 4U36A 2ZX0A 4MGTA 4AQSA 1TE1B 1HRI2 3DV8A 1GWMA 3ZXFA 2OIIA 4ZKTB 1DG6A 1EPZA 3P6BA 5FK7A 4RS5B 4WBBA 4QXCA 3ACIA 4QX8A 1RUE2 5CG9A 3B9CA 3OGSA 4HVQA 4ZXEA 3POBA 3ZR6A 2FMDA 1XBFA 2L9LA 5D8AA 2AACA 1LOFC 1OH3A 4OI2A 4CP2A 4PI0A 4XF3A 3BODA 4IEQA 5LA2A 4QPIA 4AQ6A 4A7ZA 2CGPA 3N36A 4ASMB 1SDWA 3POIA 1AR72 1BVVA 4FPOB 2YDEA 3M1HA 5CFCA 1QHDA 1VBE2 4BDVB 5LBBA 2WLPA 4NIGA 1UY0A 1MS3A 4EN7B 4D6SA 1R093 1QDCA 2DCTA 3OUHA 3VB9A 3BOPA 2XONA 1M06G 4C0BA 4YGEA 1JH5A 5CKQA 1U5IA 4YM1A 5K0UC 1AR73 3O12A 4W8JA 1W6OA 4X6RB 2ZHLA 1W90A 1EV11 1J58A 4FXGB 2V4VA 4G3YC 4I09A 5C8CB 2PHWA 4J6GA 4FI9A 1UL9A 1LGBA 3ZMOA 1LTEA 4LJHA 2HWF1 3I2OA 1FMD3 2X05A 2Q30A 1ZBE3 5IVEA 4CDWB 2WC2A 1PGSA 1D2QA 4JKLA 1MZFA 2YC2A 4FPYA 4KU7A 4AHWA 1RUG3 1J3PA 1Y9QA 2R30A 1S1AA 2D44A 2A5ZA 3I2GA 4YW2A 3CJXA 4JHZA 4LBMA 5FYZA 1N1SA 4BMBA 5GZGA 3LEMA 2BBVA 2BUKA 1FATA 2ZEWA 2Y8KA 3ES1A 2YFUA 2JG9B 2IZWA 2D6OX 2VQUA 3T0DA 1F9KA 2JE7A 1OUSA 4N53B 5KHGA 4F8AA 2GNTA 1XE0A 2B5HA 2Y60A 4XABA 5DDJ2 2DF7A 2IC1A 4H14A 3ETQA 3J9SA 3BPSA 3HJRA 5T52A 2WFF2 5F1RA 4FPHA 2D5HA 2CTVA 2LM3A 2VTFA 4LK6A 5FYTA 3LA7A 3ZFEB 1LAJA 4XUNA 3THDA 1BLZA 2E31A 2CNAA 2ZMNA 1H8TB 3FUOA 3ZIWA 3BPZA 5C9AA 4NIAA 3ENRA 3SLIA 1DU3D 2FMYA 3EQEA 4QPGA 5ABJA 2XJQA 2WDBA 4JTNA 5JPNB 1WCSA 4RYDA 2ZPXA 1NUKA 1RMU1 5CFDA 4AVTA 2A73B 4S2DA 1Q43A 1I6XA 4AHYA 5FPLA 4AI9A 1GSLA 4UW5A 2WA4A 1VMFA 3KLSA 1KQRA 1QY4A 2KXLA 4CUGA 3J7NA 1UOFA 3RFRA 1R092 1IS6A 3WINE 1D7PM 1LODA 1UIKA 2VMIA 4TSVA 1OT5A 3UJOA 2JECA 2C4XA 1A78A 5J37A 3T2QA 3I97A 4XTPA 2BEOA 3JQXA 3MIDA 1G6NA 2SBAA 2DVAA 2VNVA 2VNRA 2XR4A 4PLMA 1PGW2 2GMEA 2DCJA 3RWNA 3TN93 4PBPA 4CDWA 2ZGQA 1W6MA 2WNVC 5FMBA 1HB4A 3AZWA 3QOPA 3ZXKA 1RUF2 2QQUA 3SMHA 4QHZA 1V00A 3PJYA 4XEZA 3SH4A 1JYTA 1PHMA 5BNNB 3AP6A 2RHPA 3J7HA 1W2OA 3NV2A 4LULA 3JD71 1IS3A 3Q9OA 4L11A 4OZOA 3C7OA 4JX0A 1RUI1 1X50A 3PMSA 4YLZA 2JKBA 1A3KA 3ZFGA 1AJOA 1V6MA 4XQ4A 4YW6A 5DAWA 3PHMA 5C71A 2R7EB 3ZOIA 4NIHA 5BNQA 1GNZA 4AGRA 1LU1A 5CFCB 3O0WA 3NAPB 4LHSA 2PAEA 4NAOA 2Y6JA 1S0GA 4HSJA 4OI4A 2LTNA 1YJKA 1SFNA 1XQNA 4LA2A 1MEC3 5GLVA 4RFT0 3DF0A 3RZMA 5KBFA 4XBNA 3RZLA 1QOTA 4CP1A 1CZSA 3KT4A 4JDNA 3NKTA 3WW4A 4UFMA 2RR12 1JHJA 1POQA 1ULFA 5FZEA 3RG0A 4QKBA 1AR83 1T6BX 4J25A 3VV1A 5EJ1B 4RQPC 4COWA 4FFFA 2EXJA 1Y9GA 5J3UA 4MXWA 5HXVA 2WZR3 4MV2A 4GB32 2JG9C 4DRVA 1URXA 3SQOA 5KXEA 2G19A 5FZOA 4B3NA 1COV1 3VD9A 3ETPA 5LA1A 1YEWA 3O1TA 4QB6A 2P6CA 1VAKA 3IBMA 4AW7A 1TME3 3UGFA 3HN3A 1HKDA 2P34A 1OHFA 4WVVA 1LOAA 2CU5A 4FCAA 5AC91 3J8F1 4CE8A 1PNGA 5FR3A 3D4KA 1HB2A 3MIGA 5DMYA 1GR3A 1XYOA 1HV1A 2X5IA 4B29A 2VCMA 4KBBA 4TYSA 3ZIXA 1Z78A 3LFMA 4CVUA 2Q8EA 1EPWA 4PDWB 4BIOA 3RZHA 1AYN3 2ZXQA 3IMMA 3LCPA 4AQTA 5F2WA 3C2UA 4S2FA 4DNYA 3ZYIB 3AMQA 3U07A 2BW8A 4LE3A 4YRDA 5JIAA 3B7MA 3ZYFA 3T4HB 2XXZA 1G9CA 1UMZA 1H2LA 3N9NA 1YI7A 4DPNA 1UYZA 1GZWA 4IEYA 4UT5A 2WO2A 1GQGA 4META 1IGOA 1OOPB 2JWPA 1UYPA 1RUJ3 3HQRA 5FYVA 5HCHA 2VVFA 2Z42A 3AL5A 4IUGA 1VRH3 1PZ7A 2HWE2 2V4AA 4JRAA 4OMCA 4Y1ZA 2VNOA 4F3JA 2VW2A 5CYYA 1K12A 1UF2C 4UW3A 3UKNA 2H0BA 4HPKA 1CPNA 2LUWA 5EYXA 2JG9A 1F31A 4A4AA 1FYUA 5DZGA 1V6NA 4CCOA 3M3IA 2VAUA 4ES9A 2EVXA 1HDKA 1PK6A 1LKNA 2A3YA 2EICA 1LHNA 1RMU2 2NLRA 2YU2A 3E5QA 4TN7A 1HB3A 4R9DA 5I93A 1EAH3 3OUIA 4XFFA 2JE9A 1B35C 3MEPA 4LBJA 4M3CF 1BYHA 1LRHA 4I3GA 2XKOA 2ZGPA 4JDOA 2VQ0A 5KC5A 5IAXA 2VUCA 5DDJ3 5C8CC 5C3PA 1TVGA 5F3EA 5F39A 5FY9A 1XYNA 2W39A 3IIIA 1AYM1 3KVBA 4MSVA 5F9TA 4NO4A 5L19A 3CJIA 3H8XA 4PIXA 1PO21 3JXSA 4GWMA 1KDKA 1HRV3 1WCKA 5CKMA 3WY6A 4F83A 3GF6A 3AMHA 3ZYJB 3N3HA 4PQQA 2EIEA 4AEMA 5FZLA 4YARA 1UIJA 5LB6A 2GN3A 4DFSA 5JOZA 4MX3A 3M3QA 5IVJA 3EYPA 2IXJA 2AGSA 4IW3A 4PCRA 5H9RA 1OKQA 2DFBA 2RVAA 4D3WA 2AR6A 2LS6A 4CCMA 2IWGB 5I91A 3K51A 5CNAA 2RDQA 5FYCA 3P1IA 4OUSA 1XRUA 2JG8A 4KH9A 2A6WA 3BYWA 3HAGA 3VBRA 1O3SA 2RS32 4XUPA 1REEA 3IPVB 1K3IA 1OA2A 4N7UA 4HZFA 5DUVA 2GNMA 3DYMA 4NWWA 1QJY1 4ZS3A 1ZVFA 5ERLA 3KT7A 3AL6A 1R1ZA 3POEA 1JYXA 1QKQA 2ARBA 3KMHA 4I30A 4XBQA 1SLTA 3KGLA 3MFCA 1S0DA 3ZFEA 2PA7A 4CCCA 3CBNA 2XQXA 3Q8EA 4MZUA 4UFJA 3WQ7A 2Q8DA 3E97A 4IV3A 5LY2A 4RR3C 3OPTA 4FFIA 1SBFA 4LKDA 2XVKA 4P9WA 1HJFA 2C24A 1ZBE2 1JI6A 4GH4C 4QX3A 5D1IA 3ZN6A 3VDDC 2EIDA 4V1PA 2VTXJ 4DB5A 2ERFA 4E4ZA 4XF1A 1V6IA 3M4FA 4AHZA 1CAUB 3WD5A 3GDBA 2RDNA 1OQ1A 4F7ZA 1H6XA 3HWJA 3O1OA 4XHBA 3PJQA 2Z5WA 2ZMKA 3AJYA 3BVCA 5KC6A 4UF0B 1O8SA 2BNNA 3JBG2 4LHKA 3ACFA 5IFPA 1QH7A 2XHKA 4ITCA 1FNYA 4FPEA 4CA9A 1LULA 4ZXKA 5LA9A 1P8JA 1AUYA 2RR11 2ARAA 5FZ0A 2YC0A 4XURA 4HKOA 1JUHA 4L8QA 2BU9A 3OBTA 3QD6A 3H1WA 4MHUA 1X33A 1QJX3 4XFGA 1H2MA 4MXVA 2W91A 4JKMA 1S0CA 4Y22A 5FMDA 4DMIA 2ZEXA 5DUWA 1KRIA 3A21A 1W6OB 3I2HA 2NMNA 2GNDA 3ORJA 4UW6A 5CZKA 5A7WB 3R6SA 2AZ5A 2ZX3A 4QX7A 2WNUB 2SLIA 4GH4B 5FBJA 1MZ5A 3AKTA 1OVPA 2YGLA 4R52A 2CDPA 3IB3A 4H2AA 3LOIA 5FYMA 2VZOA 4PDWA 1ZBA3 2R061 1QJX2 3C7GA 4RS5C 4XFAA 1W8NA 2RDRA 3OGGA 4D7SA 3H42B 5BYNA 5M0TA 3DPRA 2OUHA 2JICA 5A7NA 4CUAA 4RL7A 2DVDA 2R071 3ZN5A 1CJDA 1K45A 1MACA 2VD7A 4CXXA 2Y0OA 2BRTA 3BCWA 4K40A 5LRSA 1SPPB 5LATA 3ZSMA 1Z7S1 3AMMA 5GLWA 5JUVA 4URAA 4YZ5A 1I3HA 1W8ZA 5I0TA 2CSGA 1REFA 1GZCA 1VBA2 5SV8A 3V0AA 1GP4A 4MYEA 4C8DA 2PQSA 5T5JA 3WQ0A 3MI8A 5FZ7A 2PFWA 4FQZA 1ZYBA 1WW4A 2ILMA 2VW1A 2JXAA 3OBZA 5CAZA 4DQAA 3V0BA 1DHKB 2ZGUA 5EHDA 2A6VA 5JIUA 1WKYA 2A71A 4BQ5A 1GICA 1X9TA 5FFOC 2R042 2Y38A 2JJ6A 3RJRA 3RSJA 4M0NA 1GNYA 4DS0A 4LO6B 2QQOA 2XVLA 2GDFA 2HYXA 1WD3A 4QX5A 2OT7A 4R4XA 3WDTA 4ZZ8A 2W0XA 4BMEA 3RYPA 4N9HA 3M3EA 3Q8CA 4XJAA 5JR7B 3T2TA 3FUQA 3UYJA 5JXGA 1Y3TA 3RI9A 1ZZ9A 4TLGA 4N90A 1BXHA 4FVVA 3S0MA 1DGRN 2P6HA 5F3GA 4A3XA 2Y6FA 4P9IA 3VHOA 2R6QA 3OBAA 4B4RA 3W21A 3SH5A 1MS9A 1J3QA 1GUIA 4RR3B 3VBSB 4ZONA 1YUDA 1HXS1 1W3XA 2Z2SB 1AR81 1W04A 4MG2A 4OFGA 3WNNA 3HT1A 1S0FA 2VULA 4GIQA 4R9CA 5JWPA 1L7RA 1RUD1 2D7FA 4M4RA 2BBAA 4A2UA 2YGMA 1NKGA 2H0VA 5T3NA 2OYZA 3NV1A 5CG8A 1GYKA 4RHV2 2WQZC 1JU4A 2NPIA 1DCSA 4CCKA 3OGVA 2O14A 4AF9A 2XKPA 5IK7A 3KQRA 3HNBM 5A32A 1W8FA 3OB8A 3LOBA 3J8F3 5A6XA 3U75A 4GALA 1UWWA 2ADEA 1C4RA 1SLCA 1VLNA 3IPVA 5SV5A 3ZVXA 4EWDA 5A70A 5FDBA 1I5PA 1KD7A 3I59B 5IK8A 3HIFA 4N9IA 4QKNA 1VB2A 3FMGA 4QT6A 3T30A 4EWEA 3AP7A 1STMA 1XOYA 4KBZA 1AYN1 1C8M2 3POYA 2VVDA 1FV2A 1YIFA 1CIYA 1WLWA 3D3AA 4CCDA 2Q1MA 4FBFA 1POV3 1UYXA 1VB4A 4DUWA 1W9SA 5HCAA 4YG6A 4ZHNA 3IWZA 1UY3A
chains in the Genus database with same CATH topology
1PVC3 3NL1A 1NCRA 1Q8OA 2UY9A 5GZEA 4Z07A 4AK3A 4IV3C 3MFAA 4BHPA 1AVBA 3ZXGA 5JI9A 2MEV1 3TB0A 5JZGA 5ACA3 4Q4X3 3HN1A 5FQ0A 4XILA 3WG4A 4HMZA 4FPCA 3MIHA 4XYXA 2YXSA 2DTYA 1IKPA 5F6KA 2A6YA 4MGYE 1N47A 3RMYA 4OZXA 1VBC1 1M4WA 4Q8LA 1BBT2 1UZZA 2FCVA 1MVEA 2BTVC 1WW7A 2QCSB 2NMOA 4PBOA 5L9BA 4Y5Z0 4E2QA 5GLUA 2CV6A 3ZO0B 1AYM3 1BCXA 3I2DA 4N43C 2D5FA 2X8KA 4NPRA 1BBT3 3AYEA 4QM8A 5C9AC 1H9PA 1RUC1 3TWIA 4JV4A 2KM2A 3FE5A 4Y24A 1DIWA 4LLOA 4XTMA 2WS92 5EWSA 4BLIA 4Q1RA 1VBA1 2ET7A 3HT2A 3O5SA 4OHVA 3A0KA 4XJUA 4AQ2A 1OQEA 2Q5TA 5GJ6A 2C1FA 4X8NA 1S2BA 3UK9A 2DCYA 3SCGA 1L3JA 1J1LA 4Y1XA 5CADA 3VZOA 2E7AA 1RL3A 1YO8A 3JCIA 3FBYA 5F6LB 3VL9A 1D4M3 3ME2A 1D0HA 1DQ0A 2C9AA 2XL7A 3GBFA 3VKOA 3M3OA 1DQ1A 4YW4A 4Q8KA 5CA6A 3B02A 3NJZA 2RMU2 3B01A 2VMGA 2HWF3 3OF1A 3WV6A 5E88A 2RS52 1LOBA 4RS5A 3WP3A 1AX0A 1WBFA 5JI7A 2WNEA 3VBUC 1I1EA 1RUJ2 3WG1A 4Y1VA 1R1A1 4H55A 5A33A 2ZS6B 1NA1B 4NHMA 3WOGA 2VG9A 4Q4W3 3ZXEA 1C5IA 2F4PA 2WLQA 3AK0A 1O3RA 5KHHA 2VECA 3GALA 1PO11 4BPZA 2JG8C 1CVNA 1R083 1UN1A 1YNAA 1FPN3 2JENA 3TNPB 1RMU3 4CEYA 4QMAA 3U0ZA 3AB0A 3ILRA 2WZPP 1VJ2A 2WKKA 2XJUA 3WQ1A 1SCRA 4L2NA 4UXAA 4B7EA 1O4YA 3FZ3A 4HFSA 1QJU1 1RHI1 3CJIB 3DL3A 4BQYA 2EIGA 1AF9A 3GHNA 1LHVA 5D8AC 4HBNA 4H3WA 1C57A 3NAPA 4FQ4A 2DFCA 3SNMA 3DPRB 3ZYPA 2VH9A 1YHFA 4IXLA 2AENA 3TN91 1HXS2 1SBEA 1ULEA 5JPNB 1DZTA 4CEYC 1WGPA 4GH4A 3LZZA 4HK9A 4GB31 3VGIA 1MR5A 2BPA2 1RC6A 4YVWA 3VKLA 3H0OA 2EALA 2JX9A 4LBKA 2VU9A 3VBUA 2E6VA 1NCQA 4KGGA 4CDUB 3OJBA 4JDMA 4W6WA 1O7FA 1W6MB 3WVJA 1EP0A 1OLQA 2DUPA 2V09A 1RB8G 2HWC3 5LK7B 3IM0A 3ASIA 1LENA 4AI0A 5I0RA 2AREA 2QZ2A 3AZXA 4YG6A 1ND3B 2H6CA 4Z82A 4KWKA 1Q8QA 4QQOA 2WINB 5DZFA 4COZA 5C6CA 3BB6A 2DURA 2F6BA 1B09A 1H0BA 1IQAA 2CL2A 3RS6A 3ZSJA 1MEC1 2HWC2 1KJLA 3HBZA 4MH0E 1H1MA 2HJIA 1DGWX 4AGGA 4Q4V1 1RUI3 3IDCB 4BH9A 5CFDB 4R4ZA 4XJ9A 3VBOA 4DOUA 3BALA 5FPXA 2G4IA 3WDYA 2ZGNA 4IV1B 4WM7A 2GAUA 1HQNA 4D94A 4ORFA 2Q4SA 1GBGA 2Q8OA 5GLZA 4YNIA 1LOEA 2GU9A 4LEJA 5C4WA 4X6QB 1G9BA 4DY5A 2V5YA 5IK4A 1X8MA 3WG3A 5AC93 3CU7A 1CONA 3OD4A 2Z69A 4IEUA 3ZSEA 3D8CA 4OI0A 1AR92 3TOJA 2BNMA 4E9KA 1JBCA 3W58A 4XFHA 4YG0A 1PM7A 4K9SA 3IN9A 5E8AA 3VBFC 2RMU1 4NHKA 2WFPA 3ZN6B 3VBHC 4AEDC 1WBLA 2XGXA 5K0UA 3FLPA 4FPFA 4J1WA 1U5YA 1RUJ1 3RNSA 5BNOA 3SHRA 4YW3A 2QJVA 2G1MA 3ZXDA 4LO7A 1NY72 2XWJB 4G9SB 4B4QA 3TAYA 1JOJA 1DQ2A 2XJVA 1O5UA 1YFWA 5JSOA 5GALA 4XJWA 3VBOC 3ZFFC 1LECA 3NVCA 3R4UA 1XNDA 4W65A 3N7JA 1QJY2 2ZZJA 3PL0A 1CAWA 1FMD2 3TNQA 1VBB1 4Q5OA 2XJTA 3J26N 4CEWA 4ZU7A 2XBO1 2JEMA 4IESA 3V0BB 4YYOA 2ET1A 1H4GA 4GMP3 4WVMB 4QQ2A 4Q0VA 4WM8A 4JGZC 5IK5A 3MW4A 1VP6A 3AFGA 3E5XA 5ACA1 5EQUA 5L7OA 1ONAA 4HK8A 3WZ1A 1ZRFA 1ASJ1 4YZ1A 4EWAA 5J7MA 1VBC3 3RPQA 5JZGC 1AXZA 4LBLA 1D0GA 2JIJA 4YGDA 4HANA 1HRV1 1XXNA 4BQXA 1XYPA 3R0RA 4HKWA 2MHFA 5FTTC 4CDQC 1BMV1 1NQDA 3HD8B 4NOTA 1AR71 2BYVE 4K21A 4MGKE 4IEOA 1SQ4A 3IT8A 1YJLA 2ZACA 4X8PA 4XETA 1KFXL 1UPIA 2XJSA 2G9FA 2D6KA 3W20A 1ND3A 3GYDA 4EJRA 1QXRA 1VBA3 1YFUA 3H3ZA 4AFCA 2GC1A 4AFDA 4Y5TA 3CJIC 2RM23 4FT8A 1YWKA 1H2NA 1I5ZA 2ZBJA 4LT5A 4QQHA 3HR9A 3T1LA 4YGBA 2D3PA 2LALA 4OHZA 4R8HA 2GZWA 4I0WB 1JTZX 3KCCA 4KG0A 3TYJA 1FX5A 4K1ZA 2K0GA 4M00A 3OD0A 5FLJA 4EROA 3RQ0A 2BQPA 5FRAA 1CD3G 1H2KA 2X5IB 3MW2A 4GKYA 5AVAA 4PIYA 1APNA 5GLTA 4XXPA 3M8LA 3NW4A 4XF0A 2ES3A 1EAH2 1OA4A 1WLCA 1QOSA 4JC1A 1OSGA 1XNKA 3HMYA 2CWMA 4TWTA 4XXAA 4EN0A 4MXWB 4EN8B 1QJZA 5DZEA 2OPKA 5HV0A 4Y5SA 2RS33 3ATGA 1UCXA 4YM3A 1QJU3 1RHI3 4H7LA 2RR13 1Z7S2 1CAWB 1S0IA 2QE3A 1RUC2 5AVPA 1Q56A 4HETA 3AJZA 2E63A 3WUCA 3IIAA 1G7YA 2QNKA 2XLAA 3H1YA 1LR5A 3H1MA 4QHBA 3THTA 4K8FA 1RUNA 1Z7S3 4YW1A 4LO5B 1KXGA 4E2SA 1H30A 1ZBA1 2R063 2VXRA 2QVSB 4P9YA 3VZNA 4IEXA 1QMJA 4WM7B 1YCIA 4OHYA 3PTYA 4LBQD 3FLTA 2R073 5HCBA 1A8MA 2VW0A 5H9QA 4COUA 1R082 2Y0IA 5DUXA 2XL9A 2Y26A 5DAQA 3ILNA 2ZGMA 3FX3A 5IATA 4BZ4A 2HWB2 1QH6A 4AG4A 4INDA 3WT3A 2D6MA 5KWRA 3FLRA 1UU5A 2UY8A 5KXDA 3WUDA 4XZPA 2DV9A 5C33A 1JW6A 4LA3A 3N7MA 1LEDA 2D43A 1HRV2 2FCUA 1S2KA 1BMV2 1H8VA 4M3CA 4Q26A 1ZX5A 1HRI1 4IERA 4XBLA 4AE2A 5LBCA 4ZU4A 1ZA4A 4PLOA 2ZX1A 4RA0A 1COV3 2ZGOA 3E6DA 4CDXA 1CGPA 4H7MA 3RDIA 2HWD3 5EXOA 4QGMA 2YHJA 2DUQA 3WR0A 2A6XA 4P14A 1BEV2 2VQAA 4Q0SA 1QJU2 1IOAA 1RHI2 3NO8A 1H8TA 1DDLA 1SLBA 1COV2 5J36A 3N35A 3VBHA 4AEDA 5JZGB 3N4MA 1QXJA 3TRSB 2BWAA 3ZXJA 4WVWA 3AXEA 2P17A 3KCXA 2ZMLA 3HQUA 3RMXA 1NCRB 1Q5OA 2FCTA 5T5LA 2XJPA 1N3QA 1ULCA 2QDRA 2R0HA 3EJKA 3WP5A 1J1TA 2UWCA 2GC3A 3AP5A 2IXLA 5D8AB 2V73A 2WSUA 4EN9B 1UKRA 3LSDA 4OULA 1AR63 5LRRA 2RMU3 2ZKLA 2R043 4Y20B 2CYFA 4L9BA 1HQWA 3QLQA 2A6ZA 3R05A 4BCUA 1CX4A 4Q27A 4CDUA 4QM9A 3VL8A 3N7KA 1DGRA 1VBE1 1NCQB 1U5XA 3O14A 3KCYA 1YFXA 1PIV1 3ZSLA 1ND2A 4Y26A 1SBDA 4NWVA 5H9PA 3ZX7A 3B69A 2UYBA 1RJ7A 3BTAA 3MGUA 3SH3A 1AL22 2GH8A 1D2SA 1C1LA 4CZSA 2X53S 1NOVA 1GANA 1NXD1 5A3UA 4B4PA 1HX6A 2O0OA 2HWF2 2PHXA 2X5IC 4N43A 1Q8SA 1CPMA 2HWD2 4Q4X1 4YW5A 1TEIA 2XVGA 2R32A 3GBWA 1VBB3 4PLNA 1R1A2 2NP0A 1B35A 4UBHA 2VOKA 4FOVA 3AX4A 2DCZA 2K9ZA 1BZWA 1TMF2 1VBD1 4G4FA 5KXBA 1LHWA 5JSRA 5K0UB 1QNYA 1ND2B 1WLDA 1ZBA2 4PJYA 3MW3A 5EP9A 4LBQB 4COVA 4WM8C 1CIWA 3NNJA 2HKXA 4OI1A 2AH2A 3AYCA 3AZVA 4B8EA 5LEJA 5BPXA 5FOBB 3CO2A 5L73A 3AFKA 4Y20A 2BFUS 2HWB1 3EBRA 3INAA 5BNPC 3DKWA 3TN92 2YV8A 2GMMA 1FOD3 1QF3A 2HBUA 2VOWA 5DAPA 2CGOA 1W6PA 2IXCA 2ZZQA 3VDDB 2VMHA 1QU0A 4WVZA 2CAVA 2NQYA 1Z0HA 3VN4A 1Q3EA 1S55A 1SEFA 2NZ9A 1OMIA 1ULGA 2XG3A 4CDQA 1GZ9A 5L7OB 4XJ8A 1VIWB 3LGRA 1X7NA 3ST7A 1VAMA 1XE7A 4CEWB 1OFNA 2GH2A 2XLGA 4AEKA 4A7YA 1YXWA 3UJQA 3B5LB 3DN7A 3SCHA 4UWDA 5FOJB 3V56A 4CEWC 3EXUA 3JBG1 2AYHA 1FPN1 1ASJ2 2ZJCA 1G9DA 2G9GA 4GB33 1LOGA 4CDXC 4KGQA 3EMRA 3J8F2 5CU1A 2HEWF 3JB8A 5FQ0B 5K9YA 3GZEA 1K5MC 3WG2A 2P2KA 3KD4A 1J3RA 1XNCA 4AFMA 4AVVA 4RQPB 1MQTA 1I9RA 1CAVA 2YUEA 3PNAA 4GA9A 5T5OA 4N53C 4Q4V2 4ATFA 4AVAA 4CP0A 5HCFA 1O5LA 4XIKA 3VBFA 1ZZ6A 3E6CC 1K5MB 4BYYA 4XFBA 1AX1A 4GXLA 2PHTA 2IFRA 2XPJA 1OPOA 4Q4Y3 2E9QA 2YZ4A 1N1VA 1J59A 1V9U2 1JN2P 4EV0A 2RM22 4NMIA 2PN5A 3USUA 3DPRC 1FT9A 3M70A 2ZKNA 3OPZA 4BM8A 3NNMA 4I3PA 1MQTB 2DU1A 3WW2A 1SLAA 3OGJA 1NY71 1UU4A 4AI1A 1NQJA 1POV0 2ZAHA 4PQ9A 5EYYA 3T1MA 1KFUL 4CTEA 3DGTA 1PIV2 4AYUA 4E2GA 3PVEA 1HIXA 1KJRA 4AHXA 1IKQA 2QZ3A 4FAHA 3P3PA 1K5MA 2D6PA 1HXS3 3B94A 5FAXA 1JHNA 4C91A 3UKVA 1IHMA 4Q0UA 3NV4A 5FLIA 5CFCC 4ISQA 2XUMA 4FO9A 3MLLA 3MIEA 1NYWA 3AKSA 3MZHA 4WV8A 3JZVA 5B2GB 1JXNA 4Q4X2 4DXZA 2D93A 4I0AA 2W08A 4LO4B 4NVPA 1AR82 1REDA 3V65A 5BNNC 2IXKA 1TMF3 2NN8A 2EAAA 2PHLA 5H9SA 1VBD2 4HPKB 4Y22B 2I07B 1RVF3 2WNVB 3FJSA 4YVSB 2ZGTA 3OYWA 1RUF3 1PGW1 1RINA 4DZGA 5FLHA 3MYXA 3H7YA 3FWEA 4XAAA 4OHWA 3G6JB 2EXHA 4HVOA 3MPPG 2XBO2 1Q8PA 2I2SA 1QQP3 4I0BA 1AYN2 1C8M1 5EZWA 4XMIA 3M7AA 2WNUC 2E7QA 4FTEA 3UL2A 1NE6A 4FPJA 4LR4A 1RUG2 4OVEA 1LU2A 3ILFA 5LEKA 1QXPA 3NSTA 4QQLA 5EFUA 1QOOA 3O7OA 5LASA 4YVSC 1E57A 1FV3A 4O9EA 3ZFFA 3OUJA 4XC9A 5DG1A 3L2HA 1SMVA 1VR3A 3PMEA 2A3XA 1O91A 1ENXA 3GZUC 4D7YA 5J96B 3BIWE 1RUH1 2DVGA 3ZXLA 1RGSA 4WM8B 2ZGSA 5JVVA 3B93A 3L2YA 4L92A 2WIIB 4FXKB 1BBT1 1G9FA 1V6KA 1Y43B 3THPA 4P9JA 3VBRB 4M3CB 4CDWC 3H8UA 3R4DB 2PELA 1B35B 4MVTA 5I0SA 2ZABA 1RIRA 4AVCA 1ASJ3 4L97A 4LBNA 3VLBB 3GNEA 1TNFA 1BVP1 2A75A 2HWE1 2PHUA 5T54A 4Q0PA 2A3WA 3M3CA 1WMFA 4E4DX 1C8NA 1D4VB 1PK6C 2R062 4LNVA 3MPBA 4NHYA 3OBRA 1IS5A 2BNOA 2RM21 3IMNA 4YZ4A 3AP9A 3BU7A 5JOYA 3NWKA 3VBSA 4OLLA 3NNFA 2D3SA 2RS53 1F8VA 1WLTA 1Y7BA 2DYCA 4Z1VA 3GJAA 3OY8B 2YYOA 4KWJA 4Y1YA 2R1BA 1LCLA 2HWB3 4ES8A 1PVC2 4HN0A 5FCCA 5KXCA 1PO22 1S0JA 3VHRA 1DYKA 3KT1A 2GNBA 1OQDA 4HKLA 1ZRDA 4IEWA 4DRRA 5AFBA 4FTBA 2JG8B 4AVBA 5BNOC 4LUMA 2PLV3 2NYYA 4Q4W1 1PZ8A 5GZDA 1FI2A 5FBZA 3VBSC 1UW8A 1LOCA 2YY1A 1DBNA 4GWNA 1LJ7A 1A6CA 1YYNA 3VZJA 4HSLA 4MHRA 2ARXA 1LEMA 2GC0A 5KHJA 4JZRA 1ALYA 3MICA 3V0AB 2UURA 1GQHA 1NZCA 4S2GA 4RSUA 4WZCA 4XCBA 3W9AA 2PQQA 5A3MA 3ZN4A 2RS31 2OW4A 5BXXA 2RJLA 1WW6A 1F5FA 4JQRA 3MIFA 4ASLA 4I2OA 4XDQA 3I7DA 5JLVA 3L9JT 4Q0QA 4E27A 4GQ7A 4BOWA 5JAXA 1PGL1 3VUOA 1IPKA 4ONUA 4YVWC 5JOWA 2B46X 2D40A 1RUE3 1MQTC 1MZ6A 3U11A 4KU8A 1KITA 4Z92B 3U4XA 2B45X 3NAPC 3OTFA 4L99A 4XMAA 1NA1C 3OYWB 2MPFA 4D7TA 4XW3A 4LBQA 4FPGA 1GKBA 3ZYRA 4BA6A 1X8EA 4HLTA 1AR93 1OOPA 4QPYA 3JUUA 1WMDA 3B9IA 1QNWA 1LGCA 4YZ2A 1S0EA 3AKPA 3VKFC 1UKGA 2RG4A 4YFWA 1IS4A 4Q4V3 3WCSA 1MVQA 3X29B 4BIFA 4M3CE 3W59A 3D0SA 2H6BA 2WQ4A 2ZHKA 2A1XA 4BE3A 5I8TA 1G86A 1HRI3 2Q0AA 2QFEA 3WP4A 3SISA 5HBAA 3GZTB 3NNLA 2KA3A 1ULDA 5DG2A 2XB6C 1CN1A 3FFQA 1U5ZA 3JB4C 4P9LA 2YMZA 3APBA 1ZZ7A 5J48A 3D0JA 3GZAA 4BWOA 2EXKA 4Z8BA 1AL21 4RHV3 1H1AA 5IAVA 3R4SA 4XQWA 3ITQA 5AFEA 4FOQA 3KGZA 1OLRA 5KHIA 1F2NA 2ETEA 2ZGRA 2HWD1 3RYKA 2IXHA 1OD5A 1XU2A 5EJ3A 2NM1A 3KM5A 4IQPA 5DUUA 3AMPA 1GNHA 3S7EA 2ZGKA 1PNFA 2ENRA 3I4IA 4I01A 1TMF1 2FHRA 4RGGA 1DZQA 1LESA 5EPAA 2R041 3D82A 1IZ3A 3RI8A 3USSA 2E7TA 2O8OA 1JUIA 1H4HA 2YROA 2E53A 1W6NB 1HV0A 2D3RA 5CVRA 4D69A 1PIV3 4XFIA 1D4M2 1UPSA 3H7JA 3QH7A 1AR61 4PF5A 3WXPA 3EO6A 4DY3A 3WDUA 1MS5A 4HT1T 2TEPA 1NE4A 1QQP1 1V6LA 2P37A 2XBO3 4IETA 3SITA 2RS12 4PIZA 4QQPA 3C3VA 1U0AA 4GMP1 1VAVA 5T5PA 3AZYA 1XU1A 2WZR2 3MDPA 1OOPC 1AZDA 3A0NA 4LLFA 1NCRC 2WT1A 2A70A 4Y4YA 2QQPA 4R9BA 4FSJA 4Q2FA 1AYM2 4N7IA 1KS4A 4ATEA 3DUIA 1WCDJ 3LB9A 2BVVA 3IDBB 4IV3B 5C4WB 1VBD3 2ZHNA 4YFZA 1GV9A 2Z79A 3LKJA 1ZZCA 4I02A 1CJPA 3CNAA 1NG0A 4XPVA 1KS5A 1W2UA 2FZ2A 3VDDA 3V64A 1HLCA 1RITA 1SLLA 3HQXA 3VBOB 4M0HA 1LHOA 1MS8A 4QGLA 5CIRA 4WVMA 2OZ6A 1UZYA 2R0FA 4GKXA 3H50A 4K20A 5J98B 4K7JA 1TNRA 5FMOS 1AX2A 2XWBB 5L9VA 1PO12 4K3UA 1ZZ8A 4P5HA 1N3OA 3AMNA 2EAKA 4JGZA 2RJKA 5CFDC 2TUNA 1H8TC 3E6BA 4FOWA 4MUVA 2BFUL 3G7DA 3CEWA 4YGCA 3WHUA 1JYIA 3NKGA 5CBLA 1O3TA 3PVNA 4NN0A 3WNXA 3UV9A 1ZREA 2PAMA 4AEJA 3ROUA 2ZGLA 3E5UA 2PHRA 5CB7A 4BQ1A 1FOD1 1H1IA 2HBTA 1XNBA 2B42B 2ZAAA 2D98A 1ZBE1 4JRLA 4AGVA 1KDMA 1ND2C 4LHNA 2N7GA 3A4UA 5DXDA 1RUG1 1DZRA 1AXKA 3QACA 4TZDA 1H9WA 5LBFA 1BKZA 2WS91 3OCPA 1DLLA 1G8WA 2VOXA 5J09A 1V6OA 2WWSA 1PK6B 1BEV3 2DTWA 2OZJA 3BOWA 4XOGA 1SCSA 2DCKA 3LAGA 4IV1C 1BQPA 3EHKA 1ENSA 3VKMA 2VUAA 1RUH2 1ZZBA 4QXKA 1HQLA 1X82A 4CEYB 5FO9B 1MS0A 3QBQA 1A8DA 1OFSA 4B7KA 1RJ8A 2WT2A 2OPWA 4IEZA 4HN1A 2C0ZA 5GZCA 4NR1A 4Q29A 1QWRA 4FOYA 1LB2A 3JBG3 3AXDA 2VVEA 3B3QE 1EV12 3ZDSA 1EY2A 3I8TA 3ZPYA 4IV1A 5GM0A 1QJX1 2QDNA 1V9U1 1SLIA 4JCKA 5C4WC 4JGYB 2B7YA 5LK5A 4DINB 4AI2A 2R072 5C8WA 3VBFB 2OA2A 1LOFA 2RS11 4AVSA 3JD73 1C28A 1YFYA 2CAUA 4IL7A 2CY6A 3K48A 4C1WA 5I8SA 3FFZA 5T50A 1AR91 2VY0A 2TNFA 3H9AA 1CR7A 4MGZE 3VZKA 2WNUA 1SFYA 2PHDA 2EXIA 2BGCA 4CDXB 2WFF1 5GZFA 3IDEA 2E51A 2WNVA 2AUYA 5I8YA 2VUJA 5BV6A 3ALQA 3ES4A 2UWBA 1G9AA 4YVWB 5JSPA 1C5HA 4XF9A 4Z2WA 1DQ4A 3KB5A 4PDWC 3LA3A 4A7KA 3QCWA 4JGYC 4XFCA 1ENRA 1V70A 2WZR1 1GFF2 2CGNA 4IEPA 3SCFA 3VKNA 1RUI2 3AYDA 3ZFGB 4FAGA 2XJRA 3AP4A 5E89A 1CAUA 5LBEA 2DVFA 2O1QA 2XLFA 4AXOA 3VBUB 4C0HA 1Q8VA 1W39A 2ZTNA 4LHLA 2VGDA 2WT0A 2PHFA 3WDVA 4QPIC 3WDWA 3H3UA 3WLUA 4RHV1 4XACA 1ND3C 3D6EA 3ZFGC 2UWAA 2RDSA 3PVBB 3WW1A 1T6GC 2I74A 1RUF1 2W68A 5L36A 1VBB2 3WX5A 1TME1 4Q4Y2 1RUD3 2FBEA 1W6PB 2JD4A 2UYAA 1OA3A 3J4UH 4HVRA 3USUB 1MS4A 1FAYA 5C5TA 1MZEA 1N1TA 1DGWA 1RVF1 4AFBA 3SXWA 2RE9A 3NV3A 3AM2A 1VBE3 3O0VA 4BQWA 4OHXA 4UW4A 1LGNA 3VZLA 5FMOL 3OY8A 4TLFA 3U10A 2WJSA 4K6BA 4XE9A 1LHUA 2D6NA 5C9AB 4XF4A 4Y1UA 2MEV2 2VNGA 3LWCA 1POV1 1C8M3 1PMIA 2UU8A 2EF6A 3WW3A 1WW5A 4RD7A 4YSFA 5DDJ1 5JPMB 1FOD2 1PVC1 2WL1A 3FC0A 2PTMA 2ZOEB 3MLKA 2P3KA 3FBMA 4S2HA 1N3PA 1WA4A 2JIGA 2YPJA 2R1DA 4LE4A 4C1XA 1VBC2 2DUOA 2W52A 4RGAA 1PO23 4QD2A 5TSWA 3ZXAC 4AI3A 2MEV3 3URFA 2C5DA 4Q4W2 3KZ4C 1CAXA 2FZ1A 1EAH1 2OVUA 1FNZA 2K2SA 5AC92 4BLJA 3AKRA 2EA7A 2P3JA 4P9XA 5JCTA 1WD4A 3POWA 1RUH3 3P3NA 4FPKA 2ATFA 1R091 5T55A 4R9AA 4OUMA 5EV7A 4M01A 4LO8A 5C8CA 3I54A 2R16A 2PYTA 3LA2A 2Q1ZB 1EV13 2GC2A 2B39A 3ZFFB 5HV4A 1RUC3 3ZFEC 1V6JA 1VRH2 1JYCA 2HWE3 4FTSA 1FMD1 1N1YA 3LSEA 1CESA 4YG3A 2XH6A 3S30A 3MF9A 5K7PA 4ZPIA 1BK1A 4AI8A 2VPVA 2FQPA 4ZU5A 1MS1A 4KWLA 4LBOA 3PVOA 4O9GA 3JD72 1PZ9A 4U2AA 4QPIB 1EYBA 2ZHMA 4WZFA 4KNCA 3VBRC 4URTA 2RS51 4W6XA 1SACA 1D4M1 2GMPA 2D97A 2D6LX 2DVBA 5KHKA 1ENQA 1UD1A 2P3IA 3VBHB 4AEDB 1QJY3 2WSVA 1ZNPA 3ZYGA 1YIPA 4CRQA 1DQ5A 1DFQA 3RZZA 5A3LA 5A32B 4FP2A 1PGL2 1NA1A 4YVSA 5A33B 5BUVA 1O4TA 2PLV1 1GLHA 4ISRA 1NLSA 3AZZA 1R1A3 3WDXA 5BNPB 3CF6E 2JDZA 5ACA2 4SLIA 1DGLA 1NLRA 2QKDA 3ECQA 3I59A 4JAAA 2WS93 3ELNA 5E1RA 5FO7B 1TQ5A 1HW5A 1PO13 4XQDA 2DWRA 4RR3A 1R081 3GJBA 1BEV1 1WMEA 1FXZA 1X36A 1DYPA 3M2MA 4CYDA 4FPLA 1UX6A 1FPN2 1WUVA 3N7LA 4EN6B 5IT6A 4RQPA 2IXIA 3ZSKA 1RVF2 4UBGA 2HEVF 4QGNA 5BNOB 3D5OA 4KQ7A 1NXMA 4SBVA 1W0OA 4IEVA 1BJQA 2R49A 4LUKA 4XHXA 3S7IA 1RUE1 3KS7A 5BNNA 4KG8A 4QPGC 5ABJC 1W0PA 4GMP0 3MIBA 2QUOA 2ZA9A 4LTAA 1VALA 4JTOA 1V9U3 1TME2 4Q4Y1 1W6QA 1CQ9A 2HEYF 1C3HA 1AJKA 4XCAA 1ZM1A 2BWCA 2GALA 4JGZB 1YRZA 5DAVA 1DF0A 1F5JA 2RS13 3S6PA 3VHPA 5BNPA 4C90A 1U12A 4CDUC 2B9UA 1MEC2 2HWC1 4NHXA 1UAIA 3JQWA 4K1YA 3VHNA 1OPMA 4XJZA 1CAVB 3KSCA 1XE8A 3QH6A 3RRDA 3POSA 5IUQA 4MGIE 3AYAA 1C1FA 3MLJA 4CDQB 2ZX2A 3B00A 1ZRCA 2VOVA 2O8QA 2WFF3 4QPGB 5ABJB 3CL1A 3MF6A 3AKQA 4W6YA 2A7AA 1AL23 4HL0A 2PAKA 2IFWA 1AXYA 4NHLA 4YM2A 5FO8B 3FHIB 5BY5A 3IKWA 5I0UA 1YI9A 3TBDA 1NCQC 2CWSA 2ZCWA 4KL1A 1RTVA 3UKTA 3O0XA 4N53A