4AGRA

Structure of a tetrameric galectin from cinachyrella sp. (ball sponge)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
140
Chain Sequence
PIQSIKVDPMKSGGLGVVYRSPDKGRVSLYLYNDGEDILLVVDARFDWRGEQNVLVLNSKFWGPEVRPEGFPFPCCGYVTTITVRVEIGADGFTLSANGIEIVKYPYRDGLPPPVTKFQYVFQDQGASETAQLESLSAYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN
publication title Structure of a Tetrameric Galectin from Cinachyrella Sp. (Ball Sponge).
pubmed doi rcsb
total genus 25
structure length 140
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4agrA00
1GZCA 2OW4A 1O4YA 2V73A 1JYCA 5JOZA 1SLCA 4FPYA 4AVTA 4Y24A 3QCWA 2E51A 4BMEA 4YM2A 4M00A 4YZ4A 5BYNA 1G9CA 3V0BB 3SH3A 2R1BA 1MS5A 2P2KA 2CTVA 2GNBA 2Z42A 2CWMA 2D7FA 3D4KA 5L73A 3ZVXA 4XYXA 4MYEA 3SH4A 4XIKA 3MW4A 3B9CA 1G9FA 1WLWA 3AP7A 4Y26A 1W6MB 2DU0A 2LALA 5DG2A 3WG2A 2CWSA 4R9AA 5F5QA 4Z8BA 1W6NA 1X50A 3USUB 3ZXFA 2GN3A 2ZGMA 1YIFA 3O0XA 1DLLA 1OQ1A 2DTYA 2W68A 3ZSLA 1LOCA 3ASIA 5GZEA 4FOQA 4UW5A 1QU0A 3LSEA 2CY6A 5CBLA 1V6IA 4XILA 4W65A 1JYIA 5GLTA 4XBLA 1N1TA 1RINA 1N3PA 2ZGUA 4LBQD 3WV6A 5DUXA 2GMPA 4Q1PA 1KQRA 3FBYA 2EAKA 2ZKNA 3POSA 1EPWA 1FATA 3ZXLA 1KDKA 4BLJA 1KJLA 1LOFA 3M3QA 3V0BA 2JECA 2AYHA 4GALA 2ZHMA 1Q8PA 5KXEA 4FP3A 2UURA 3JU9A 1AX2A 3M1HA 4ISQA 2CL2A 3WG3A 4M3CA 2ZA9A 1W6MA 1IS6A 2DUOA 5GALA 1UMZA 4XJAA 3NV1A 3WG1A 2V5YA 1W6OB 1C4RA 1CESA 2ZGSA 5T5PA 3ZXEA 4ITCA 3ZSKA 2VH9A 3ZXJA 4AYUA 2ERFA 1QKQA 1BKZA 4NOTA 3INAA 1LTEA 3POWA 2ZHLA 4XZPA 4BM8A 4Q1RA 2AUYA 4BPZA 5JOXA 3BODA 5T54A 1GNZA 4YFWA 2LTNA 4FOVA 1N1YA 1IKQA 1SLAA 3HR9A 1ZM1A 3SNMA 5FRAA 4R9CA 1KDMA 1S0EA 4R9DA 2I2SA 1ONAA 4C1XA 3N35A 2A6XA 3PVOA 2A6VA 1JUIA 5DZEA 3SITA 2E7TA 2A3YA 1BYHA 4TYSA 1A8DA 1DQ1A 3O12A 4PBPA 4R9BA 3MW3A 3W59A 3DUIA 3FUQA 2AR6A 5GZGA 2FHRA 4YZ1A 4YGDA 1W6OA 4UW6A 1LU1A 3R4SA 1W0PA 1PZ8A 2D6KA 2D6LX 5DZGA 3IKWA 3NV3A 2DU1A 2R1DA 1DQ6A 2TEPA 3LSDA 3POYA 2JE9A 4ISRA 1PZ9A 4L8QA 5E89A 5HCAA 5GLZA 4M3CF 3WHUA 4XTMA 1W6QB 2AREA 3RMYA 1AXYA 4ASMB 4IQPA 1W6PB 4GWNA 3W58A 3QLQA 2NM1A 4YGBA 1HKDA 3T1LA 1G9DA 3ZYRA 1FV3A 1LCLA 2PELA 3PVEA 4DPNA 3IPVA 4Y1ZA 1AJKA 3SLIA 1J1TA 2R0FA 3OPZA 1AXKA 3RG0A 3M3OA 1MS8A 1YRZA 3WUDA 4Q8LA 1S1AA 3Q9OA 1LEDA 1UZYA 3MW2A 5F9TA 1R1ZA 4RA0A 1YO8A 1QGLA 4WZFA 1DQ2A 1MS4A 1FV2A 1LOBA 1WD3A 5DXDA 2PHRA 3FLPA 1LOEA 4FPFA 3U4XA 3LCPA 2ZGTA 3JUUA 1G9BA 4YFZA 1MS9A 1I1EA 1QDCA 5IK5A 3AYEA 4YG6A 2HYKA 3FFZA 2PHTA 4FOWA 4AGRA 2YV8A 3M3CA 3BOPA 3O5SA 3ILRA 2EIGA 5GJ6A 4YZ2A 4GKYA 5DZFA 1KRIA 1B09A 1LECA 2OVUA 1C1LA 1CVNA 4FVVA 3ZYPA 1FAYA 2ES3A 1W6PA 3AZYA 1GZWB 3I8TA 3O0VA 5SV8A 3VKNA 4PBOA 4AGVA 2UWBA 4DFSA 1FYUA 1DQ5A 5GZDA 1G9AA 1NXD1 2ZGQA 4F83A 1IOAA 4TZDA 1GLHA 2GALA 1ULCA 2OUJA 2WLQA 1S0GA 3WHTA 3B3QE 2JJ6A 5GZFA 2VW0A 1OFSA 1UKGA 4K21A 3APBA 4C1WA 4K1YA 3WG4A 1SLLA 1KJRA 4GKXA 4P9WA 2NZ9A 4P9YA 1LU2A 2ZAAA 5LK5A 5GLVA 1BQPA 1Q8QA 4YW1A 1Q8SA 3AXEA 4WVWA 5FREA 4KBBA 1FX5A 2ZHNA 2WNEA 3UJOA 3L2YA 3OY8B 1BJQA 2GNMA 5IK7A 3RS6A 1H9WA 1GZWA 4CTEA 2ZGNA 2VXRA 4Q27A 4XJWA 1MZ5A 1Q8VA 4YG0A 3HN1A 1CJPA 1V6JA 1HDKA 3WDYA 4M3CE 3N7MA 3SISA 1KITA 3AP5A 3USUA 3AZVA 1F31A 2NMNA 2WSVA 1BXHA 4Y1VA 5H9RA 1N47A 1D0HA 5H9SA 4PQ9A 1HQWA 5DUUA 1DFQA 3AP9A 1AX0A 4BMBA 2G4IA 3BIWE 2D3SA 4BLIA 1WW6A 1JW6A 1QDOA 2P3IA 5CB7A 5T52A 4AWDA 2DV9A 5DUVA 4RL7A 4XJUA 5E88A 4Q8KA 1ZA4A 5T5OA 1WBLA 1IS3A 1JXNA 3N7LA 3BTAA 3WCSA 4CZSA 4FQZA 1WLCA 2NYYA 1SACA 4XMAA 2GMMA 1CONA 4CRQA 3ENRA 2WQZC 4JCKA 1CQ9A 1QNYA 4YLZA 2VU9A 1Q56A 1Z0HA 1LGBA 1AJOA 3AZZA 1CR7A 2BQPA 3O0WA 2VW2A 2UWCA 4YZ3A 3M3EA 5JDBA 3N3HA 3KM5A 4XOGA 4K20A 2ZACA 2AH2A 5EYXA 3V0AB 1IS4A 3FLRA 1GZ9A 3OJBA 4PF5A 4XJ9A 4GA9A 4LBLA 4DRRA 4FPKA 1S0BA 1XQNA 5CAZA 4Y22B 1UZZA 3V65A 4LBNA 4XTPA 3VV1A 2D6MA 4Y1UA 1S0IA 2YY1A 2ZABA 5GM0A 2A3WA 1PZ7A 3WDXA 1TEIA 4OZXA 1GNHA 4U2AA 5GLWA 1QNWA 2A70A 4XHBA 4XJZA 2EXIA 3OYWB 2DVAA 1LEMA 1JN2P 1VALA 2E53A 2YROA 1WBFA 2WKKA 1S0FA 3WCRA 1N1SA 1GV9A 1Q8OA 1DHKB 2YXSA 3AFKA 4AGGA 1CPNA 4YW3A 4AVSA 1ULDA 2ZMNA 1VLNA 2C9AA 4Y20B 5AVAA 1G86A 4LBQB 1N1VA 3AK0A 1UPSA 3GALA 3N7JA 5CA6A 4XDQA 1C57A 2JKBA 2D3RA 1FNZA 1W0OA 3NWKA 2ZGKA 4Y1YA 1WCSA 3WLUA 2A6WA 1ULEA 2VY0A 1S0CA 1WW4A 1URXA 1WD4A 5EXOA 4Y1XA 1V6LA 5IK8A 2ZMLA 1A78A 2WT2A 1ENQA 2VW1A 2ZHKA 4XXAA 1VAMA 5GLUA 3UL2A 4FOYA 3WNXA 1U0AA 2EF6A 5HCFA 2P3KA 3WDTA 2PHXA 5EWSA 1I3HA 1MS0A 2YZ4A 3MEPA 1IS5A 2PHUA 1AF9A 1N3OA 3FUOA 4XIOA 1W6QA 2P3JA 2D44A 3VUOA 2ZZJA 3OYWA 5JLVA 3N36A 2D6PA 4YGEA 5JVVA 4LBJA 4FPOB 3V64A 2W08A 4XBNA 1V6MA 1GANA 1VIWB 4XE9A 3WZ1A 3MPPG 2GN7A 1VAVA 2ARXA 2JDZA 2GDFA 3R4UA 1HQLA 2KM2A 1AVBA 3TB0A 5GZCA 1MR5A 1LGNA 4UW3A 3N7KA 5JOYA 4YW2A 2ZBJA 2A71A 1CIWA 2SBAA 4FPGA 4FP2A 5DG1A 4D69A 5KXBA 1LHUA 5JMCA 1GKBA 2DWRA 1SLBA 3RSJA 2EXHA 4XHXA 3ZPYA 2ARBA 2E7QA 3H0OA 4YZ5A 1UL9A 3NV2A 4HANA 2SLIA 3AP4A 2JD4A 3WDVA 1V6OA 3T1MA 4M3CB 4JRAA 1APNA 1H30A 4YM0A 4FPCA 4LBMA 4K1ZA 1QMJA 4YW5A 1SLIA 1LHWA 4YGCA 3B00A 3WOGA 5KXDA 2DUPA 2P34A 2NN8A 3AZWA 3AX4A 1MS3A 1RIRA 5CNAA 4NO4A 3VKOA 4PCRA 1AZDA 5EYYA 3IN9A 4YW4A 4AVVA 4XXPA 4GWMA 3AJZA 2R16A 1DYPA 5HCBA 4Q2FA 1H9PA 1DYKA 3TAYA 1YYNA 3UJQA 3R05A 2A6ZA 1UN1A 5H9QA 4LBKA 1MVEA 2GMEA 3NV4A 3RRDA 4YM1A 1RITA 2DVDA 1YXWA 3VKLA 3T2TA 2GNTA 2WSUA 1ULFA 4WVVA 2DTWA 3AXDA 1V6NA 4P9XA 1HLCA 4ATFA 4YM3A 1WW7A 1SFYA 1SBFA 4GXLA 5T55A 1LHVA 1SBEA 1MACA 3FLTA 4P14A 4SLIA 2CYFA 2E6VA 1G7YA 2DUQA 1WW5A 2EALA 3AP6A 3HMYA 3I4IA 2CNAA 3C2UA 1QF3A 2H0BA 2WT1A 3PMEA 3DGTA 4U36A 1QOTA 3IMNA 2WJSA 3OY8A 1MS1A 1ULGA 1Z78A 4WV8A 4DQAA 3WDWA 2ZGLA 3AYAA 1CN1A 1N3QA 2C5DA 5DUWA 3VKMA 1GSLA 2XG3A 1JBCA 3AYCA 4Q26A 4ZXKA 4FQ4A 1DQ4A 3VKFC 1Y7BA 4H55A 1WLDA 4BOWA 2A5ZA 1LENA 3B01A 1LOGA 3D6EA 2D43A 1ENSA 2PHWA 4ZKTB 3PJQA 5JOWA 3A4UA 4M01A 4FPEA 2A7AA 4FPHA 4JC1A 4XJ8A 2A75A 1LOAA 2RHPA 5IUQA 4ATEA 4HL0A 1V00A 2W52A 3ILNA 3ZSMA 3OBRA 1V6KA 4DS0A 1BZWA 4BQ1A 3AYDA 2A3XA 1LGCA 3AZXA 3WUCA 3WDUA 2R0HA 3IPVB 3B69A 1A3KA 1WUVA 3AJYA 1JHNA 2A6YA 4I30A 1UX6A 3RQ0A 1C1FA 3M2MA 1D2SA 2PHFA 5IT6A 3PVNA 2DVFA 1UAIA 1DGLA 2ZMKA 5H9PA 1GBGA 1LOFC 1QOOA 3GNEA 5KXCA 1SBDA 1IKPA 2DVGA 2OUHA 2GNDA 2B7YA 4YG3A 2YMZA 3A0NA 3IM0A 1OKQA 2AGSA 1JOJA 2W39A 2DYCA 1MVQA 1G8WA 1YI7A 3V0AA 3SH5A 1FNYA 2D6OX 2P37A 3ILFA 1LJ7A 2ENRA 2DVBA 1S0DA 1F9KA 2WT0A 2EXKA 2ZGPA 1GICA 4FPLA 4XMIA 4LBOA 2AENA 2XB6C 1CPMA 2D3PA 4Y22A 1LULA 2EXJA 2UWAA 3D5OA 1F5FA 2VUAA 1SCRA 3OGGA 1S0JA 4DRVA 3WVJA 1GYKA 3ZXKA 4XBQA 2NMOA 1LHNA 2R49A 4UW4A 1DIWA 2UU8A 1LHOA 5T5LA 2NP0A 1SLTA 2JE7A 1LODA 1DQ0A 1LESA 2DURA 1AX1A 1O4ZA 1SCSA 2FMDA 2Q5TA 3ATGA 3UK9A 3OBTA 4FPJA 3ZSJA 1DZQA 1W6NB 5T50A 1NLSA 5T5JA 1ENRA 2D6NA 5E8AA 1QOSA 5IK4A 4Y20A 3KQRA 3CNAA 4LBQA 1DBNA 3A0KA 3RMXA 2ZGOA 1MZ6A 1AXZA 2ZGRA
chains in the Genus database with same CATH superfamily
1W2TA 2WUHA 5LK7B 2BBVA 1DLCA 4FPYA 4BK4A 4Y24A 3H8XA 4ZXEA 2ADEA 4KBZA 3HIFA 3V0BB 2P2KA 4IEOA 4AG4A 3GBGA 3SXWA 1X8EA 2QKDA 3WQ0A 4XYXA 3S7EA 5BNNB 4I0AA 2HWD1 2UYAA 5E6HA 4AHWA 4IEVA 2WWUA 4V2WA 4EWAA 5C8WA 1E57A 2VNGA 4JQRA 3VBUA 2IXLA 5BNPA 5LATA 3WG2A 4HVQA 4AF9A 5F5QA 1O59A 1REEA 2BNMA 4CE8A 5D1IA 1H2KA 2WNUC 3MF9A 5C70A 1DLLA 1OQ1A 5DPNA 2W68A 5D8AC 5FY4A 1RUG3 2FDJA 3C7EA 4ASLA 5I91A 4UW5A 1QU0A 2Q1ZB 4XILA 1AHSA 2VCMA 2WR9A 4W65A 5DABA 3P3PA 2OA2A 4XBLA 1VR3A 5J48A 4K6BA 4XF3A 4AHZA 4LBQD 2IZWA 3WV6A 1RUE3 4LO4B 5DUXA 2EAKA 3I3QA 4BE3A 2OT7A 1KDKA 4GB31 1EUTA 4ORFA 4XAAA 4CP1A 3GCXA 4A6OA 4XUTA 5F7UA 2VVFA 3WY6A 3E5UA 3BTYA 3JU9A 2F17A 1JHJA 2CL2A 4IESA 2ZA9A 1W6MA 2DUOA 1YWKA 4IGOA 5A7QA 2OIIA 2XJQA 5A80A 3U4SA 4XAEA 5I8TA 5FPZA 3NV1A 1LNSA 3QOPA 3WG1A 4LHSA 4N53A 1AR81 1CESA 5T5PA 5AVPA 1W9SA 2VH9A 4M4PA 1DZTA 3UKNA 1QKQA 3KVAA 4MH0E 3SEPA 5J7MA 4PIYA 3EHKA 4UBGA 4NOTA 2VR4A 1E5HA 3INAA 1LTEA 4BWOA 3B94A 1W04A 2WS91 5CEHA 4W6YA 2QZ2A 1CZSA 3ABZA 1VRH1 4XZPA 2VZUA 1GNZA 1YQ8A 1N1YA 4BU2A 1K3IA 4Y4RA 2Q0AA 1SLAA 3I2HA 5DQ0A 5FZLA 2VNOA 1ZM1A 3ZDSA 1I6XA 3U10A 4GH4C 5IAVA 5L9RA 2ARAA 2I2SA 4W50A 3VL9A 1XOYA 3N35A 4C1XA 1FMD3 2A6VA 1JUIA 1R1A2 1UOBA 2QQLA 3K77A 3LIGA 4WVZA 2E7TA 3SITA 5CFDB 2E33A 2DCJA 4EN6B 3K2OA 4XDOA 5JMOA 5LRRA 4PBPA 4R9BA 4CPBD 3W59A 5GZGA 4LOTA 4I3PA 3DN7A 3CL1A 1W6OA 4UW6A 4FFFA 4LK7A 1FPN2 4PHZA 1W0PA 3TN92 1POQA 2QQMA 4KWKA 2HWE1 4AEDB 2D6KA 3ZSEA 2DU1A 4QPIC 1DDLA 5FLJA 2RJLA 4Q4V1 3K4DA 3ON7A 1GQGA 2QBXA 3CJIC 2Y26A 4PI2A 4JAAA 1AXYA 1X33A 4LJHA 2QVSB 2AACA 3ZFEB 4I2OA 2TNFA 2VZOA 4Q4Y3 2HLEA 4AHYA 1HKDA 4FT8A 2WAOA 3T1LA 3NJYA 1FV3A 1LCLA 4BPZA 1YC61 3AC0A 2Y6JA 1AR93 2RR11 1MZFA 3PVEA 2VM9A 3IPVA 4Q0UA 5J37A 4MGZE 2KD7A 1NZIA 1RUJ3 5A33A 3OPZA 3K3NA 3ZMNA 5TSWA 1JYXA 1RTVA 2WO3A 3MW2A 1W8WA 3AB0A 3AKPA 3BI3A 2P6HA 4S2GA 1YO8A 2WFF3 3MPBA 3U78A 4O65A 3AKRA 5FYVA 1LOBA 5DXDA 5CG8A 3PLQA 3FLPA 3U4XA 1RXFA 5FLHA 4CDQA 3Q8EA 3JUUA 3MV11 4NROA 2JIGA 2H0VA 2VZRA 1W3VA 4ZU4A 4YG6A 3FFZA 2PHTA 2YV8A 1MEC2 5GJ6A 3ILRA 1TNRA 3PURA 4GKYA 5FMCA 1KRIA 1NZCA 4OHVA 1LECA 4A7ZA 5FY7A 2QE3A 3E5QA 1FAYA 3HQUA 1AR73 2ES3A 1W6PA 3AL6A 3MIHA 5LB6A 1QJX3 2DCTA 3AZYA 1VMHA 1X82A 5EJ3A 3I8TA 3O0VA 5SV8A 3VKNA 5ACA3 1ZRFA 4PBOA 1OURA 4AGVA 2UWBA 2BNNA 3VBFB 3VZLA 2VOXA 1JYNA 1I9RA 1DQ5A 5GZDA 4C0HA 5IJRA 1QXPA 3O1TA 2QUOA 5A3UA 2PLV3 4E2SA 2JDYA 4KU7A 2R061 2XDVA 3B3QE 3WHTA 5GZFA 2WDBA 4K21A 5C8CB 1ZZ8A 1S2BA 4EE2A 1OC1A 2R32A 5AC91 4P9WA 4LO7A 2GC3A 3T30A 3S0MA 5KHJA 1Q8QA 4YW1A 5FPUA 4B7KA 3KD4A 3VHOA 4FXKB 4BH9A 1HJFA 1OQEA 3FL7A 1OOPB 4KBBA 1FX5A 3THCA 4E2GA 4NIHA 5JI9A 3UJOA 1BJQA 1XNCA 5FXXA 2FZ2A 4G3YC 2XH6A 2ZGNA 5BNNA 2OQ6A 1MZ5A 4NHMA 3H3UA 3N9MA 4IV3C 2XJVA 1OVSA 2DBIA 1UU4A 1KITA 2WNOA 3W9AA 2K2SA 3AP5A 3AZVA 3DXUA 1W8OA 2NMNA 1BXHA 4GMP0 1UYYA 4J25A 4Y1VA 4AR2A 1N47A 1D0HA 5H9SA 3RZLA 1YFXA 1YJKA 4NWWA 4COUA 4PQ9A 3OBAA 3MBWA 1HQWA 1J58A 2V09A 3S5QA 4AXOA 1AX0A 2J7MA 4BMBA 2G4IA 3BIWE 2D3SA 3ZXAC 1CGPA 5FWJA 5EJZB 2VCAA 4COYA 2WWSA 3C7OA 2HEVF 4UFMA 2DV9A 4HVRA 4IV1B 4Q8KA 4DY5A 4CXWA 4HPKB 1GWKA 3JBG2 3LF7A 5FYSA 1IS3A 3N7LA 4XCBA 3USSA 1CAWA 2ZCWA 4FQZA 1WLCA 3MGUA 1UWWA 4HXCA 2Y38A 2NYYA 4K40A 4XMAA 4EZ4A 2CDPA 2E26A 2RS33 4KGGA 3BN6A 2BZDA 2WQ8A 2WQZC 4CRQA 1W8HA 4YLZA 1UIJA 1JOPA 2YUEA 1RUI2 3BB6A 5C71A 2P1BA 4QHBA 3ZN4A 5C6CA 3UKTA 3H7JA 1AJOA 3O0WA 2VW2A 2UWCA 2BP6A 3T0AA 2AH2A 1RHI2 3X29B 3VGIA 1K5MB 4PF5A 2VZVA 3RGBA 4AL9A 2PFWA 1L7QA 1W9TA 1PM4A 2RS53 1NCRB 2WO7A 2Y60A 5FO9B 4Y22B 3V65A 1IG3A 3KS7A 4OHXA 4FXGB 3C8XA 4XTPA 3BOWA 1E5SA 1NOVA 5I0UA 2DCKA 1PVC2 3O1PA 3WDXA 3KT1A 5F6KA 2ARCA 1TEIA 2CU5A 1US2A 1VBE2 1VP6A 1GP4A 2A70A 2HWC3 2Z79A 4XJZA 1LEMA 4JKLA 3MLJA 4CVUA 5A7PA 5BV6A 2P17A 1A34A 3WCRA 1N1SA 2CV6A 3AMNA 1WLTA 1B35C 1GWLA 3OGSA 4IW3A 5A3TA 1L3JA 4CEWC 3VD4A 4LOSA 4QX0A 4AGGA 1CPNA 2E7AA 1OI6A 2ZMNA 2C9AA 2VQUA 4HONA 1R1A1 1BEV3 3CO2A 3DECA 4WVMB 2PQSA 2JG8B 5CFDA 3WP3A 2NP0A 3VL8A 1C57A 2D3RA 1W0OA 3NWKA 4MSVA 3U37A 1LAJA 3U11A 1NG0A 2A6WA 2JXAA 4DB5A 1JZ8A 1ULEA 2VY0A 1WW4A 5EXOA 4N43A 1HX6A 1JUHA 2JDUA 1PMHX 2VL4A 4QPGC 4ZY9A 1FPN1 2B46X 2ZKLA 5FZ1A 3TN91 4XXAA 1PNFA 4AEDA 1UPIA 1AUYA 3N9PA 2EF6A 4NJ4A 2ZX0A 2RS13 4D3WA 2PHXA 2BJSA 3I3BA 4UFIA 2XLGA 1KGYA 1NCQB 3VBOB 4WZCA 2WQ4A 4K7JA 4O61A 1NA1C 1XE8A 2QQIA 4FPOB 2CGNA 3V64A 2HWF2 1CZTA 1BK1A 4QWNA 3WZ1A 4HSLA 2W46A 3WQ7A 4CXXA 2Z4FA 1VMFA 2W2IA 2VVDA 2GDFA 5IWFA 4N9IA 5FIXA 3WW2A 1DGRA 2R042 3VDDC 4DOUA 3N9LA 1AVBA 3ZYJB 3H8OA 1MR5A 1AYN3 4Q5OA 2VTFA 3IDCB 1LGNA 1VRBA 5A7OA 1L7RA 2YPJA 3N7KA 3WF1A 2ZEYA 1UU5A 4WBBA 4YW2A 3HNBM 2LRPA 1CIWA 3LDBA 2SBAA 4XABA 1NLQA 2Y8KA 3KMHA 1A8MA 2WO2A 5DG1A 3ZYGA 4D69A 3NRUA 2GP5A 2Q8CA 2EXHA 1S4CA 1JS9A 5FXWA 3V56A 5FYCA 2ARBA 2MHFA 4LEJA 3H0OA 4ES8A 3NV2A 3CF6E 5KC5A 3C3VA 1MEC1 1ZBE3 4HANA 4S2FA 1JZ4A 4PT6A 2OS2A 4M3CB 5ISLA 1CX1A 4GMP3 4OQ8A 1EAH3 3ZFFC 3IBMA 4NHKA 3VBSB 3UNPA 1SLIA 1RUC3 2XJSA 3JCIA 1RUD2 3B00A 5SV5A 3AZWA 1W39A 4XQWA 4Y4YA 5HV4A 3WF3A 4CP9A 1C8NA 5FZ9A 4KNCA 4M4RA 4EZHA 4LO8A 5DDJ3 1IGOA 1UYXA 4FTSA 1W99A 2V5DA 3VBFA 2NQYA 4XXPA 4HOOA 4XETA 3VD3A 3AJZA 2WN3A 2R16A 5JCTA 2DF7A 5HCBA 1V9U3 1H9PA 1HRI2 1LR5A 2BGPA 3OD0A 4Y5Z0 1UN1A 5C9AC 2XLFA 2ZS6B 5FPBA 2BGCA 2GMEA 1UD1A 5C8CA 1C5HA 4CDXB 1WMEA 1YXWA 4NAMA 4DXSA 5JZGC 5FZ3A 3H3LA 1UY2A 2DTWA 4HG6B 5FP3A 4NR1A 2B9UA 3UESA 4LA3A 2XKPA 3ZN6B 5F32A 1SFPA 1Y3TA 2LUWA 1W2AX 4IEYA 4KWLA 2Q30A 3EXUA 3KSCA 4IE7A 5FZ8A 3FLTA 1POV1 4IDZA 3I4IA 2DUQA 2O8QA 3KGZA 2CNAA 3PMEA 5A7NA 1H8TA 1HRV3 1UO9A 3KF5A 2MEV2 4OVEA 1ULGA 1W9WA 2ZZQA 3RJ2X 3ZM8A 2IFWA 3WEZA 4DQAA 1NAEA 2WWJA 4NPLA 3WDWA 2W5FA 1CN1A 5DUWA 3ES1A 5LASA 4FFHA 4NMIA 5CVRA 4CP0A 3HBZA 2FDGA 3ZR6A 1AR63 1TME2 3DPRB 1WLDA 2W1WA 3SC7X 2VZSA 5F1RA 1BMV2 2F6BA 2XQXA 3CDZB 4FPEA 1QY4A 1CX4A 4FPHA 4XJ8A 4YM3A 1LOAA 3RI9A 4E8CA 4IEPA 2WNUB 3ZSMA 3OPTA 1V6KA 4FFIA 1JZ7A 4ZZ5A 2BNOA 4DS0A 1LKNA 1DYOA 4GIQA 4JHZA 1JMUB 1AL21 1HJGA 3KCXA 4JVAA 3QD6A 1NE6A 3AZXA 4NHLA 4QXCA 5D8AB 4IV1A 3TRSB 1L7LA 3WUCA 2J1UA 3I3DA 4EQVA 4HPKA 2ZX1A 1XE7A 2A6YA 1PHMA 3UGGA 3M2MA 3R4DB 4HLTA 2QQWA 2CGPA 1GBGA 1QOOA 2HWB2 3GNEA 4NRMA 1SBDA 3RWKX 4YG3A 1RUI1 2D40A 2HWD3 2Y0OA 3TNPB 3ZFGC 2KR2A 4WM7C 5FKCA 4OHZA 2JWPA 2W39A 4BB3A 5LA9A 4BIFA 1R083 1YI7A 3AKSA 2EIDA 2ZXQA 2D6OX 2P4EA 1T2XA 1ZZCA 2JDPA 1K5MA 2QTWB 1REFA 3ILFA 2ORZA 1S0DA 2ZGPA 4RR3B 2EXKA 4FPLA 2Q8EA 1JZ6A 3N9QA 1D4M1 2XL9A 2XB6C 2D3PA 5FZ0A 4Y22A 1UXZA 3VZNA 4D94A 4QHOA 2RG4A 2BTVC 2XOMA 4XFHA 1S0JA 4IE5A 4DEVA 1OKOA 5FQ0B 4KL1A 1LHNA 1ZYBA 3A21A 1DIWA 1GOHA 3J7LA 1VBE1 3PTYA 4N7UA 2DBNA 4PIZA 4LKSA 3MIDA 1LESA 4WM8C 2DURA 1AX1A 3ATGA 3GZTB 4I09A 1YI9A 4UBHA 3JD72 1RVF2 5KHHA 3WQBA 4A7KA 1NLSA 3NNGA 2VZPA 4KGQA 2VMHA 2IXIA 2XBO1 3DYOA 3W20A 2HBUA 3KQRA 1VBC2 3IMMA 2WA4A 4XURA 1VMJA 4GH4B 1DBNA 5B2GB 4WVMA 3WUDA 1AXZA 1AYM3 1Y9GA 2ZGRA 1GZCA 4QQLA 4LA2A 4P9JA 1JYCA 3NNFA 1AR83 1ND2C 5T3NA 2JB4A 3QCWA 2E51A 4XF9A 1QJU2 4KU8A 4YZ4A 1ST8A 4GB32 4OZOA 3FN9A 3KCCA 4ET7A 3LE0A 2W94A 4Q0PA 4BQ4A 4IL7A 5C33A 1H2MA 4AAXA 2JDKA 2Y34A 2JIJA 2WS93 4CCKA 1RC6A 1S2EA 3SH4A 2J1SA 1NCQA 3MW4A 4XFBA 3PUSA 1W6MB 2BOJA 2AEYA 2DU0A 2LALA 4LE4A 2QQOA 4QPIB 5DG2A 5J09A 4R4XA 1W6NA 1ZRIA 3USUB 3AVRA 1NT0A 2GN3A 2HWF1 2ZGMA 1TMF1 1YIFA 3O0XA 4YNIA 1O3SA 4RQPC 5HXVA 4EV0A 5K0UA 4GULA 4XF1A 5GZEA 1JODA 2FCTA 3LSEA 2CY6A 5EHDA 2R041 3LPGA 1HV0A 2FDKA 1N1TA 3NJVA 2GSYA 3MHZA 2FMYA 1IPKA 2K9ZA 3PTRB 4QX7A 2WC2A 1RUH1 4BCUA 4Q1PA 1VRH2 1IZ3A 1UZ0A 2ZKNA 3POSA 4LKDA 1EPWA 1COV2 5D2AA 3LDKA 1EP0A 3NAPC 3NNLA 4QQHA 3AMPA 4RHV2 5EFUA 1LOFA 1ASJ3 2AYHA 4GALA 1YFUA 2ZHMA 4J1XA 1XC6A 3PU3A 3KT4A 1VBA1 1CZVA 4ISQA 1AX2A 3M1HA 4OYUA 4AFBA 1QEXA 3VZMA 3VZJA 1GQPA 4M3CA 3ACFA 3GZAA 3BKZA 1QIQA 2YGMA 3IDBB 4CUGA 1SDDB 5GALA 2ZX3A 4AFMA 2O0OA 3SCFA 3VBSA 1M06G 4MGYE 1QJFA 2V5YA 3NW4A 1W6OB 3TEYA 2ZGSA 4Q4W3 2RDNA 4XFCA 4AFAA 5CFCA 4JX0A 2R072 4OHYA 2ETEA 1GNYA 2DCZA 2Y6FA 3UYJA 5BNOC 3C7HA 4QX1A 1HRI1 2VZTA 1W9YA 3OGVA 4HK9A 3POWA 3J7NA 4Q1RA 5JI7A 3QBQA 4QKNA 4B4RA 2LTNA 3VN4A 3CQOA 4CDXA 1UOFA 3HR9A 1PGSA 3J9SA 4QPYA 4P08A 5K7PA 1UZVA 2ORXA 4D6RA 5FRAA 1H1MA 1IQAA 1O4TA 1KDMA 1S0EA 5FZKA 3M7AA 2BGOA 2D98A 3P1IA 4HETA 3HQXA 2RR12 3UT0A 4A41A 2A6XA 5JPMB 3MUY1 2XKOA 3M8LA 2J1RA 1V70A 5A33B 2A3YA 2WFPA 4NIIA 3SHRA 4TYSA 1BCXA 4X8PA 4BOWA 1HQNA 2MEV1 3MW3A 1W9FA 5LBEA 2FHRA 1OA4A 4BQYA 4XDPA 4IEUA 4YZ1A 4P00B 5FMOL 5FY8A 3WP6A 1LU1A 1KD7A 1O5UA 3R4SA 3ZIWA 4CDQB 2H6CA 5DZGA 2IVIB 3LSDA 2R1DA 2TEPA 3NV3A 4ISRA 1PZ9A 4L8QA 1TME1 3DPRA 3IWZA 5E89A 5GLZA 4AZZA 3BU7A 3R0RA 4EYUA 3BTXA 5FKBA 3RYKA 3WHUA 1UIKA 4XTMA 1W6QB 1BMV1 5JR7B 4P9LA 4PDWC 4L11A 3AKQA 1W6PB 2WNUA 1LB2A 4N90A 3SCGA 3H8RA 1ZZ7A 1ULOA 3QLQA 3JZVA 4W4ZA 5D8AA 4QQPA 4AI1A 4COVA 1GU3A 4UT5A 4DPNA 3QACA 4Y1ZA 5JXGA 3EB7A 3SLIA 3R6SA 1JYWA 1AXKA 1QH7A 2FQPA 3A22A 3M3OA 1H4GA 2TUNA 2ATFA 3MLKA 2BBAA 3WP4A 2R062 4MLOA 1RB8G 1R1ZA 3WNNA 5A6XA 3NSTA 4MGQA 3MV01 4WZFA 1H0BA 4EWDA 1FV2A 4YVSB 3T0BA 5CYYA 4Z82A 4FPFA 1LOEA 3U14A 3MF6A 3VBHC 2P3YA 4F8AA 3KWVA 4DUWA 1CAUB 5IK5A 1NX9A 3T4VA 4JGYC 3O5SA 5L7OB 4EWEA 4RR3A 1ODNA 2W3JA 3LD8A 5DZFA 3LA2A 3VBRC 3TEXA 2OVUA 1CVNA 4FVVA 1QXJA 2GAUA 3ZYPA 1US3A 3BUCA 3WW4A 1IPJA 1KS4A 3VDAA 5FQ0A 5IATA 3VD9A 2QZ3A 4COZA 2F4LA 2WNVC 2RMU1 4AFDA 2R7EB 2VGDA 3U1XA 1QJZA 5IVEA 1O3TA 3LDRA 3JD71 1RVF1 5CKMA 4F83A 5DAVA 1GLHA 4MXWA 2WLQA 3UETA 2BOIA 1ZX5A 4NRQA 2JJ6A 2W1UA 4AI8A 2VW0A 1UKGA 3ZX7A 1FT9A 4C1WA 4K1YA 5FOBB 1VBC1 1B35B 1OBNA 4GH4A 4GKXA 4H14A 2Q8DA 4IGQA 2VO5A 2EICA 1LU2A 3ZYIB 4Y3OA 4NIDA 2JE8A 3Q8AA 3FX3A 2VMIA 4KWJA 5IVBA 4WVWA 1XSRA 1QJU1 1CAWB 4RS5B 2UY8A 5LEKA 2B9VA 2VAUA 3S30A 1Y43B 2ZHNA 2WNEA 2ET7A 3GJBA 2VZQA 5FPVA 3RS6A 4QX5A 4LKFA 5M0TA 1C8M3 1GZWA 2RJ2A 3I2KA 2VJXA 4OUSA 3RJRA 4CTEA 2VXRA 2IC1A 3J4UH 3OBZA 1PVXA 2XONA 3LA3A 1HDKA 4LIVA 4QPIA 5FJKA 3VDCA 2BFUL 3WDYA 3SISA 4XUNA 2XWBB 2VTXA 3USUA 4QT6A 5FP4A 5C5UA 3CJIA 5F37A 1XU2A 3THDA 2XUMA 3EMRA 4J6GA 4BLIA 3GXUA 3HQRA 5I0RA 2IVJA 4OMDA 2P3IA 4OUEA 5CB7A 5T52A 4MX3A 3OGJA 4JQTA 1OFNA 4RL7A 5DUVA 3MIFA 1ZA4A 3AMQA 5C4WC 1ENXA 1RUG2 2YBKA 1COV1 1FPN3 1K12A 5EV7A 4RHV1 3OEAA 1PM7A 2YFZA 2ZPXA 3MYXA 5EQUA 4B1MA 2XGXA 3ACGA 2WBKA 3W5NA 3CJXA 1CQ9A 1QNYA 4RN5A 1CAXB 3K4ZA 4A2UA 1Z0HA 3NKGA 3AZZA 3KQ4B 5FZOA 4YZ3A 5CISA 4XOGA 1UOJA 2ZACA 4YPJA 2OPKA 4ZPIA 4QHZA 4LXLA 4GA9A 4N43B 4LBLA 2Y6LA 5FXZA 4DRRA 5CAZA 1UZZA 2R071 2VECA 1HN0A 4UF0A 4Y1UA 2HBTA 5HBAA 3ORJA 1PZ7A 4MGTA 3ZIXA 4DUVA 1J59A 1XPWA 1GNHA 4U2AA 3S5AA 4BQXA 2EXIA 4IEWA 1JN2P 2IXCA 3P6BA 1JZ3A 1UCXA 2YROA 1JTZX 1FOD2 1S0FA 3T08A 1GV9A 1Q8OA 1PX4A 2YXSA 3IAPA 1W05A 5IVCA 3J8F3 2YDEA 1MEC3 5CZKA 5AVAA 1G86A 3KV5A 3N7JA 4UXAA 5ABJC 1Z7S2 1RGSA 5I8YA 2ZX4A 2ZGKA 4QGLA 1WCSA 4Y1YA 1TG7A 1Q3EA 1S0CA 4Y1XA 3ACHA 1YEWA 1ENQA 2XJUA 2ZHKA 1VAMA 5GLUA 3VZOA 2Y6KA 1U0AA 2BRTA 3KZ4C 4CU6A 4OLLA 2RV9A 3WDTA 2W47A 4B7EA 1I3HA 1MS0A 2YZ4A 1IS5A 1PMIA 2PHUA 3FE5A 4QU2A 1JYTA 2XMLA 4IV3A 1W6QA 4QPWA 1R64A 1H1AA 5JLVA 3N36A 2D6PA 5FYHA 3ST7A 4LBJA 2XVKA 3T09A 3EYPA 1VIWB 4CP9B 1HXS2 2GN7A 1VAVA 5AFBA 3P3NA 2L9LA 4R52A 4E4SA 2KM2A 1OLMA 4QXKA 5FYZA 5BXXA 1CAVB 2X5IC 1NQDA 3TB0A 4Q4Y2 2VQAA 4UW3A 5JOYA 5H9PA 4IE6A 5JWPA 2A71A 1T6BX 5F5IA 4FPGA 2JICA 4YVSA 5L19A 4FP2A 5KXBA 2WZPP 1LHUA 2VG9A 5JMCA 5JIUA 1ND3B 4JGZC 3RSJA 5A3MA 4XHXA 1VB2A 1CAUA 1RMU1 3E1F1 3WSOA 2CHHA 3ZFGB 4YZ5A 1XYPA 2WFF2 3NMBA 3POIA 3I2OA 2JD4A 5L7OA 3I59B 4RGKA 3I7DA 4KWUA 4JRAA 2WRAA 1H8TB 1REDA 2W91A 1ALYA 1JU4A 5KXDA 2UY9A 2DUPA 2NN8A 4C0BA 5C5TA 1CJDA 3TOJA 3TWIA 2YPDA 4NO4A 4F3JA 1AZDA 3JBG3 4RSUA 5DAWA 1OMIA 4GJZA 4GWMA 5A7WB 1AR72 1QJX2 5C3RA 1YYNA 4A3XA 3RDIA 4E4ZA 3LEGA 4WM8B 4XFAA 1RITA 2DVDA 2XXZA 1ZBA2 1DZRA 1HB4A 1ULFA 2JEMA 4WVVA 1B35A 5HXMA 1RHI3 4ATFA 1HLCA 3FHIB 1AL22 4CEWA 5JSRA 3KV4A 4P9GA 1SBFA 4GXLA 5T55A 2PHLA 1LHVA 4IE4A 4Z2AA 2DCYA 1QJY1 4XF0A 1VE0A 2WABA 3IT8A 4XHBA 4BA6A 4CP2A 2QFEA 3J7HA 3C2UA 4RS5A 1QF3A 2WT1A 4AI9A 1QOTA 3IB3A 3OUJA 5DN2A 1PVC3 2WJSA 4QMAA 1MS1A 4ASKA 1VBE3 3BU0A 3B9IA 4QPGA 2C4XA 3H1MA 4ZS2A 4BQ3A 1Q5OA 3GZUC 3JB8A 5ANQA 4CDWC 1N3QA 5A3LA 5LEJA 2WZ8A 4QX3A 2XG3A 4MHUA 1JBCA 1YFWA 2PQQA 3WR0A 3T0DA 1DQ4A 3VKFC 1UY4A 1LENA 3B01A 3D6EA 5A3PA 4K3UA 3RZKA 4PLOA 2A7AA 1D4M2 2R6QA 1UOGA 5G05L 2JKXA 4HL0A 2GC2A 1F5JA 1K42A 5A70A 3OBRA 1BZWA 1VBD3 2PHDA 3G7DA 3ZKYA 1D0GA 4YRDA 3W5MA 1X36A 2BU9A 1RUG1 1A3KA 1WUVA 3CHXA 3M70A 3VDDA 1UMIA 4I30A 3I2JA 1UX6A 3RQ0A 4AEKA 4RD7A 3PVNA 2LW8A 2DVGA 1ULPA 5FZ4A 2B7YA 2XBO2 3NAPB 1CAXA 4NPMA 4DO0A 3A0NA 3ZR5A 4KQ7A 5BNNC 2FCUA 1OUSA 1YQCA 4HN0A 5CIRA 1MVQA 3PNAA 5ERLA 4HSJA 5A32B 5HPOA 4XMIA 2W1SA 1GICA 1VB4A 4LBOA 3D3AA 3ZFFA 1CPMA 2B42B 4G4FA 4DINB 2R043 1LULA 1SCRA 1YQ6A 5FY9A 4R4ZA 4DRVA 5FPXA 3DKQA 1YHFA 4LUKA 4CEYC 5CG9A 1RJ8A 4HK8A 2VZ3A 5LRSA 1QQP3 3VD5A 2RS52 4A7YA 4RGAA 1QJEA 4LR4A 5T5LA 3T2QA 2Y0IA 1LODA 4AQSA 1X7NA 2FMDA 1O4ZA 2QQKA 3MLLA 3GYDA 4A44A 3OBTA 1WCDJ 3LEIA 1DZQA 1W6NB 2JDAA 2VOWA 5F5AA 5T5JA 1FOD1 1ENRA 3VB9A 5C9AA 4TXWA 1TMF2 1XBFA 1RUOA 4BQWA 1K5JA 5K0UB 3WT3A 3CZJA 4N7IA 3FHAA 4AK3A 2VMFA 1Z7S1 2DDUA 2PTMA 1MZ6A 1MQTB 1CD3G 1RUD3 3POEA 5FBJA 1RUH2 1O4YA 2V73A 4Z92B 5JOZA 1SLCA 1U5XA 1W3XA 2LM3A 3O1VA 3ECQA 1BBT2 2CDOA 4YM2A 1FMD1 4M00A 2B45X 3U0ZA 4QDSA 1BEV2 1KEXA 5BYNA 1J3PA 1G9CA 2V4AA 1OSGA 3SH3A 1MS5A 4OMCA 3CBNA 4XUQA 2CTVA 2GNBA 4L2NA 2Z42A 1HRI3 2ADDA 5L73A 2XUEA 1VBA2 3VHRA 4CDUB 4MYEA 1SPPB 2X53S 3B9CA 1G9FA 3AP7A 2E63A 2GC0A 4B4PA 4OI0A 4QM9A 1XE0A 2D97A 4XFIA 2CWSA 4CYDA 1OH3A 4R9AA 1JU3A 3KV6A 4BQ2A 4DZGA 1X50A 3LAGA 2RS12 2X8KA 4JZRA 3DXTA 2X05A 1HXS1 3WNPA 5K9YA 5FLIA 2DTYA 3RVHA 3ZSLA 1LOCA 5CFCB 4JDOA 4FOQA 2RDSA 4RYDA 5CBLA 4L97A 1JYIA 1CAVA 2KXLA 3GHNA 5GLTA 4CCJA 5CFDC 1GQHA 4Q4Y1 5KWRA 2MEV3 2PN5A 4AAPA 3O1SA 2GMPA 2HYXA 2A73B 3ALQA 2XHNA 5FZGA 4ZHNA 2WYFA 4IERA 5BY5A 3MFAA 3ZXLA 3PDQA 1EPZA 1GWMA 2VPVA 3M3QA 1U5IA 1ND3A 1TME3 3N4MA 5KXEA 3ROUA 4FP3A 2UURA 2QCSB 2BERA 1OD3A 3ZFGA 1DU3D 4WM7A 4A3ZA 2B4KA 5J1XA 2WFF1 3VBHB 5I0TA 2OKXA 3I59A 3LGRA 1XSQA 5LBBA 3FWEA 4E2QA 3WNMA 1R093 5FZAA 1YIPA 1ZRCA 1F2NA 1JI6A 1UMZA 4XJAA 2F4PA 3ZFEC 1PK6C 2NLRA 1GP5A 4FO9A 4X6RB 3BCWA 3VBRB 2K46A 1C4RA 1QWRA 3NJXA 3IIAA 3ZXEA 2W92A 5JIAA 1HV1A 4AYUA 2ERFA 1DGWA 1EAH2 4MGIE 4AQ2A 4QB6A 1BKZA 4INDA 3IZOA 1AR71 2HWB3 5A7WA 2J22A 2YB7A 1QJX1 3THTA 3O1OA 2E31A 2ZHLA 2IWGB 2WNVB 3JQWA 2AUYA 2RM23 4WM8A 5DDJ2 3BODA 3GCWA 3LFMA 5T54A 3WF0A 1SDWA 4YFWA 5FZBA 4FOVA 1IKQA 1RUF2 3OD4A 4YW7A 1ZBA1 3QH7A 4HT1T 1V9U2 3NL1A 1PO12 3HT2A 4RGGA 5HV0A 4R9DA 4AVBA 1ONAA 3PVOA 5LY1A 3AL5A 5FY0A 5DZEA 2FDFA 3KHBA 5D21A 1BYHA 2BWAA 1U12A 1UYZA 2HH9A 2BV4A 1OH4A 1T6GC 2B5HA 3HNMA 3DUIA 2AR6A 1W8UA 5CKNA 1O6UA 3JXSA 1KS5A 1DGRN 1PZ8A 1YNAA 1UMHA 3D0JA 1OA3A 3VBFC 5FMBA 2BPA2 2EVXA 3JD73 1RVF3 1WMDA 4CUBA 1DQ6A 3POYA 2JE9A 5HCAA 1ZRRA 4AOCA 4L92A 4M3CF 4HMZA 2AREA 2FBEA 1VBC3 3RMYA 4ASMB 1PO22 5IVYA 5FP8A 3W58A 2WZR2 3FZ3A 4NUBA 5FZIA 4DXTA 1J83A 2NM1A 4RQPA 5JR2A 3AFGA 1D4VB 2Q8OA 4AEJA 1BVP1 3ZOIA 2WAAA 2Z5WA 1QJU3 2RMU2 2QJVA 3ZXDA 1AJKA 1W8NA 4GB33 1W03A 3ZKUA 3ZN5A 4AVAA 3RG0A 4CSWA 4E9KA 2C1FA 1YRZA 3DL3A 2X10A 1NYWA 5A3WA 4MXWB 1OOPC 4Q8LA 3Q9OA 5FPLA 1LEDA 2R30A 1UZYA 5C4WB 1KXGA 2BW8A 2YC0A 3NAPA 1QGLA 4G9SB 4HVOA 4BDVB 1DQ2A 1MS4A 1KFXL 1J3QA 2PHRA 4UWDA 3LCPA 2XVGA 2G9ZA 2MNGA 5LA0A 5A1LA 2RS31 3LEKA 4YFZA 1MS9A 4I02A 1QDCA 2JENA 3AYEA 3GBWA 4AGRA 3WP5A 5A32A 1JYVA 2EIGA 2WZEA 5IVFA 4J1WA 4YZ2A 1B09A 4UYBA 5A6ZA 5KC6A 2FDIA 4QKFA 3L2HA 3KLSA 5JXHA 5A6QA 4Y5TA 1GZWB 1MZEA 1SG3A 2VBDA 3OPWA 5FMDA 1VRH3 4L9BA 3S7IA 4E27A 5I0DA 2RS51 5CKQA 3E6DA 3NO8A 3PU8A 4RHV3 1JZ5A 3ETPA 1G9AA 2ZX2A 1DCSA 5FY1A 4JDNA 1ZREA 2ZGQA 4TZDA 1IOAA 4QKDA 2GALA 2OUJA 3CJIB 3WINE 2DFCA 2VNRA 2XWJB 4DMIA 1W8FA 5LWBA 1OFSA 1EV12 3APBA 1SLLA 1F15A 3PIGA 3DKWA 5F3GA 2VD7A 4PJYA 2VZ1A 1MQTA 3E5XA 2IXKA 3K46A 4QDRA 5GLVA 3RYRA 1AL0G 3EQEA 5FTTC 1D2QA 2X09A 3IIIA 5EJ1B 1VJ2A 5BPXA 3UKVA 1H2NA 1BBT1 1K5MC 5ABJB 5FREA 2R073 2LS6A 5FOJB 1BEV1 2HWE3 1NCRC 2WLPA 2BFUS 2Q1MA 4XPVA 3L2YA 3OY8B 4Q4V3 4PI0A 4YYOA 2XR4A 3OUHA 4MXVA 4XCAA 4CDUA 4LKEA 4QDQA 4Q27A 4XJWA 1SPPA 3M3IA 3K3OA 1VBB2 2AZ5A 2GU9A 3HN1A 4YG0A 1K45A 5FZOB 2G1MA 1CJPA 4GD4A 1F35A 4M3CE 4FAHA 2YU1A 2VC9A 4Q4X2 2OYZA 2J1VA 4XUOA 4F7ZA 2RS11 3OTFA 3WX5A 1UW8A 2VNVA 4MZUA 2RR13 3ACIA 5EZWA 5JSOA 3AP9A 4UF0B 3TBDA 2BUKA 1WW6A 2QQUA 1QDOA 2JG8C 4OI2A 4FTBA 3I49A 1E5RA 2CAVA 2GH2A 2V72A 3C7GA 1CIYA 3DYMA 2XL7A 4XJUA 1ZRDA 5T5OA 2GH8A 1WBLA 4ZU5A 4A6SA 2X5IB 1JXNA 3WCSA 3BTAA 4CZSA 5A7SA 3S6PA 5F3IA 1BLZA 3BGAA 4UOJA 1WKYA 5FZ7A 5A1FA 5KHKA 1AYN1 2PA7A 4OFGA 4JCKA 2FDHA 1H8VA 2EIBA 2VU9A 2YC2A 5FYBA 5EPAA 3VBHA 1LGBA 1C5IA 1NCQC 3AM2A 3VBOC 3WXPA 3HD8B 3NQHA 4JGZB 4CCMA 1ASJ2 3KM5A 1U5ZA 1A6CA 1DF0A 2YBSA 1OXCA 3F95A 4YVWC 5LCWL 3V0AB 1IS4A 4XEZA 4XJ9A 3B7MA 1X9PA 1SHWB 4LNVA 3VBRA 4QU1A 1F4HA 4FPKA 5FK7A 4TTGA 1HN1A 1UXXX 1LRHA 2ZAHA 3PUQA 1UY0A 1EAH1 4GMP1 4LBNA 4P5YA 4Z07A 1S0IA 4Z2WA 2ZABA 4V1PA 3PMSA 2G9FA 2RE9A 2C26A 2R063 4UFJA 5L9VA 4Q4W2 1TNFA 2WNVA 4IV3B 1QNWA 5DDJ1 4E4HA 4AQTA 2VCBA 4YSFA 5IYYA 3T3YA 1RUF1 2E53A 3CKHA 5AC93 2E32A 2BYVE 1V9U1 5FCCA 1DHKB 3AFKA 1PO11 2C24A 1W2UA 3AKTA 3D8CA 4XQ4A 5EP9A 4AVSA 4LBQB 3GALA 3P5BA 5CA6A 3EJKA 3THPA 4LO5B 1W90A 4CCEA 5JPNB 2VE1A 3VBSC 4HKLA 4BHPA 4B29A 1O5LA 1V6LA 3URFA 2VUJA 2ID4A 2ZMLA 4PLNA 3LB9A 4MHRA 1OT5A 3WW3A 5LA1A 3ACLA 2ZEXA 3LEMA 5ANNA 3UL2A 5FYUA 4FOYA 5HCHA 3WNXA 1O8SA 5IW0A 2GZWA 5HCFA 4LT5A 1GUIA 4X6QB 1RMU2 1SQ4A 5C3QA 4CDWB 3MEPA 1ZA7A 1AF9A 1N3OA 1YLLA 1ZNPA 3VLBB 4EN8B 5J96B 1ZZBA 2D44A 5F3EA 3VUOA 2ZZJA 3OYWA 2WINB 2QQPA 4NPRA 1PO21 5JVVA 4NVPA 2WZR1 5FK8A 5I8SA 4CDXC 1H2LA 2WIIB 4XBNA 1V6MA 4XE9A 3RZMA 2XJPA 1W2NA 3KVBA 3O14A 1IQDC 3R4UA 1HQLA 2QQNA 5FYMA 3HEIA 4B3NA 3HNYM 2E9QA 1PIV2 2VMEA 4BYYA 4HBNA 3WW1A 1SEFA 5C4WA 4OUMA 3SEEA 4AVCA 4K9SA 4FBFA 3N9OA 2J1EA 3Q8FA 2JG9C 4AEMA 4CEWB 5J98B 4NHYA 1POV0 2VMCA 5FFOC 2E7QA 3C7FA 1ODMA 3DPRC 3ZYHA 1OLRA 1QJY2 3AP4A 3POJA 2NPIA 1GMMA 2W0XA 3LOIA 4O7XA 4YM0A 3WF4A 4LBMA 2I07B 1QMJA 1R081 4YW5A 4XZUG 1LHWA 3OF1A 4BXFA 4PLMA 3AX4A 3SQOA 2JD9A 4QPGB 3VKOA 4DY3A 3IN9A 4YW4A 4AVVA 4CA9A 1GP6A 4CEYB 5BUVA 3GGLA 4K8FA 2HKXA 1HB3A 2AC1A 3R05A 1XJAA 1XNBA 5H9QA 1H6YA 1IG0A 4GZ9A 3ELNA 4JV4A 4MOAA 1NA1B 3FHQA 1MVEA 1EV11 3NV4A 4JTOA 4QQ2A 4YM1A 1R1A3 2PXJA 3T2TA 3I2IA 5FZEA 4LHKA 3BPZA 1X8MA 3LFIA 3UV9A 1WW7A 1SFYA 4QXHA 4RFRB 4CUAA 1NXMA 4QQOA 1MPXA 1NKGA 3VDDB 1MACA 4SLIA 3TN93 2CYFA 5ABJA 1G7YA 2EALA 2VOKA 3OOXA 3AP6A 4RR3C 4URAA 4QGMA 3KT7A 3BIEA 2H0BA 4U36A 3AMMA 2VQ0A 3IMNA 5JUVA 1AYM1 1RUE2 2BEOA 1Z78A 3OY8A 3MICA 5LBFA 5FJHA 1OPOA 5FUPA 3POFA 3AYAA 1VBB1 4GWJA 3GDBA 2VMGA 4L0PA 5FZFA 3GM8A 1GSLA 3VBUC 4Q26A 5BNPC 4Q4X1 4CCCA 1FOD3 2ZJCA 4OI1A 2A5ZA 2D5FA 3MI8A 1C8M2 4ZKTB 2D43A 2PHWA 4MV2A 2J1AA 1QHDA 4YWAA 3ZFFB 4ATEA 4EROA 5IUQA 1S55A 2RHPA 4Z1VA 4S2DA 1V00A 2W52A 2C9KA 1Z7S3 3ZYFA 4BQ1A 1Y9MA 3FC0A 4HFSA 3ZYBA 3VDBA 4QD2A 1XNAA 4W6WA 1W2OA 4IEQA 1ZZ6A 4IETA 2R0HA 3B69A 3AJYA 2X5IA 4S2HA 4TN7A 1C1FA 2WO1A 3HT1A 3KB5A 5IT6A 4META 2ZMKA 4COWA 3LA7A 5C9AB 1OF3A 4B4QA 2WN2A 1IKPA 1OLQA 4K8RB 4QXBA 1X9TA 2BDRA 3TNQA 5JZGB 2VCCA 2J1TA 3TEZA 2RJKA 2AGSA 5F2SA 2DYCA 4H7MA 1ASJ1 4JGZA 4BIOA 3V0AA 3SH5A 1HXS3 2ENRA 3MFCA 2JDHA 2OQ7A 2YFUA 4DXZA 1WMFA 1FMD2 4N53C 1QXRA 2D93A 3Q8BA 4IGPA 4CUCA 4DUXA 4HKWA 3LIHA 3U75A 4JRLA 4LHLA 1XNDA 1PK6B 2B39A 2VQTA 3OGGA 4KH9A 4NIAA 1GYKA 4NN0A 3WVJA 5FO8B 3H3ZA 2R49A 4OCTA 4B1LA 4MADA 4LLOA 4Q4W1 2JE7A 4YGBA 2Q5TA 4H3WA 3FJSA 2JX9A 4MVTA 4I0BA 2QQJA 2FZ1A 4FPJA 3ZXGA 1D7PM 1W8ZA 3GF6A 1UY3A 5L9BA 2JB8A 1JH5A 1QOSA 2CSGA 1POV3 4M0NA 3I3MA 4LBQA 2LROA 4LLFA 3KHCA 3A0KA 1OLME 1O3RA 3I54A 1DQ1A 4DEQA 3GJAA 2OW4A 1F4AA 4XVHA 3J8F2 4NHXA 1NUKA 4AVTA 4BMEA 1AR92 4ARYA 2P6CA 4L99A 4OULA 3DV8A 1J1LA 5JAXA 1YUDA 1RUJ2 1Q43A 2PYTA 4AI3A 2R1BA 4KI5M 4DIQA 2CWMA 2D7FA 3D4KA 3ZVXA 1OVPA 4WM7B 4XIKA 4CDWA 5I93A 3E97A 4KG8A 4N9HA 1WLWA 2O1QA 3ME2A 4O9EA 4Y26A 3CLPA 4ES9A 5F39A 1ZBA3 4LORA 1G6NA 3I2DA 3MIGA 4Z8BA 3HJRA 3ZXFA 4DXRA 1AL23 4D7SA 4R8HA 4LUMA 2PMWB 3ASIA 2PAMA 4URTA 1NY72 4ONUA 4ARXA 2IXJA 1V6IA 4GAZA 1RUNA 2EIEA 3BALA 1UYPA 1RINA 3O1RA 1N3PA 1PIV1 2ZGUA 3B5LB 3BVCA 4EN0A 1SMVA 1IPSA 1WCKA 4ZU7A 5FR3A 1KQRA 1RUI3 3FBYA 5ACA2 3ETQA 1OPMA 2HEWF 5E16A 1FATA 4BLJA 1KJLA 3V0BA 1GFF2 2JECA 4CDQC 1Q8PA 5C3SA 4AW7A 2PLV2 1RJ7A 1I5ZA 2D5HA 4MGKE 3WG3A 5K8SA 1D4M3 4SBVA 4CPBA 1IS6A 3JQXA 5FYYA 3NVCA 1WA4A 1BHGA 1ND2B 4Q0QA 1XNKA 4E8DA 2YGLA 4QAWA 2I45A 2W87A 3ZXJA 5I0SA 4ITCA 3ZSKA 4LTAA 3SKVA 3A7QA 5B4NA 4CEYA 1XNTA 3ZMOA 3T4HB 1PGW2 1O7FA 4LMFA 2N7GA 4H7LA 3CZUA 2XBO3 1W8TA 4UFKA 5FPAA 4BM8A 4GJYA 3GZEA 1IHMA 1XXNA 3KV9A 5FYIA 4UFHA 5JOXA 1NA1A 3OG2A 4LK6A 3CU7A 1J3RA 3B02A 4JDMA 3K4AA 4YVSC 1STMA 4IUGA 3H1YA 3SNMA 5JXIA 2YG0A 4RQPB 4R9CA 1O8PA 2UYBA 3KGLA 5L7OC 4LQRA 4PIXA 1A8DA 4XFFA 3O12A 3CMGA 1RUE1 3D0SA 3FUQA 5C3OA 3B93A 5KBFA 4YGDA 3ITQA 5DAXA 1WMXA 4AFCA 2RVAA 4NWVA 4I0WB 4Q0SA 5APAA 2D6LX 3IKWA 2RS32 3HVDA 3HAGA 2HWF3 4O9GA 1TMF3 3RPQA 4TLGA 1C8M1 3T2OA 4EJRA 1EYBA 4MG2A 5E1RA 5IFTA 3OB8A 4IQPA 4FCAA 3NJZA 4GWNA 1FI2A 1YQ5A 3OEBA 1RUH3 3VZKA 4LE3A 1G9DA 3TYJA 3ZYRA 2CGOA 2VOTA 2PELA 5F8PA 1BBT3 1HB2A 2VMDA 1ZVFA 5BNOB 2XHKA 5FY5A 1UX7A 3FMGA 1J1TA 2R0FA 4YW6A 4D7TA 4D6SA 1MS8A 3IDAA 1VBD2 4RS5C 4MGSA 4XQDA 2H6BA 1S1AA 1VBA3 4I01A 4AQ6A 5F9TA 4RA0A 2HWC2 4CCOA 5JZGA 3JB4C 1WD3A 1DGWX 1YFYA 1OF4A 4MO3M 5G04L 2ZGTA 3I3EA 4QX8A 1SZBA 2Y6HA 4QM8A 1G9BA 1I1EA 3PL0A 2HYKA 3WNOA 5A3OA 4FOWA 3M3CA 3BOPA 1PX3A 1UF2C 1YCIA 1OHFA 2C0ZA 2ZTNA 3D82A 4YVWB 3PVBB 5IAXA 1C1LA 3PJYA 2B8MA 3N9NA 4XACA 2O8OA 3ZFEA 2XJTA 4X8NA 1PK6A 3LQCA 3RZGA 4DFSA 3I2GA 5L36A 1FYUA 4A45A 2YYOA 3KCYA 5FZMA 2QQVA 5HI0A 3EBRA 4LIUA 1F8VA 4LO6B 2YHJA 1NXD1 4OHWA 3Q8CA 4XW3A 1XRUA 1ULCA 1HB1A 2YBPA 5KHGA 1S0GA 1PGL2 1QQP2 2K0GA 3T2PA 4PDWB 2OZJA 3WG4A 1W28A 2HJIA 4XF4A 1GOFA 4IEZA 3RZJA 1OD5A 1KJRA 2Q4SA 2CAUA 3DF0A 3VHNA 2NZ9A 4P9YA 5A3NA 4E4DX 4D8MA 2ZAAA 4IE0A 5LK5A 4IXLA 1BQPA 3DCQA 3J8F1 5A1AA 4JHTA 3RNSA 3ZLIA 1AR91 1Q8SA 3AXEA 1W06A 4N43C 5GKAC 3SKJE 3O7OA 2G9GA 5IHRA 1RUJ1 1AYN2 4AEDC 2GNMA 5IK7A 4QB1A 3DYPA 1H9WA 4OI4A 4TSVA 1SFNA 3MDPA 1Q8VA 4ZZ8A 2V4VA 1H6XA 1RUF3 5J36A 1V6JA 5CU1A 4FSJA 3N7MA 1PNGA 4JGYB 4D7YA 1HIXA 1H1IA 5FV3A 1PO13 1F31A 2WSVA 3J7MA 2XJRA 4EN9B 4HZFA 5H9RA 1ZBE2 4IEXA 5DUUA 2C6SA 1DFQA 1P8JA 1NY71 1UZWA 3DEMA 3FFQA 3OGRA 2W9XA 3I2FA 2WA3A 1DG6A 1JW6A 1YJLA 1RUC2 5DAPA 2OXBA 1RL3A 4AWDA 1JOBA 4LULA 5JSPA 3S57A 5ACA1 1WGPA 1PMJX 1OUXA 3K48A 3MUZ1 2WYSA 2BVVA 3LPFA 4UFLA 3RI8A 1OOPA 1TVGA 4Q29A 1SACA 3E6CC 2GMMA 3UGFA 1CONA 5CADA 3ENRA 3K51A 3VHPA 2PLV1 5FBZA 4BK5A 4CXYA 2IUWA 4BJ0A 5FMOS 2JG9B 3LWCA 1Q56A 5A6YA 3HBKA 1VAKA 1CR7A 3KF3A 2BQPA 4TLFA 5LW9A 1QH6A 3BTZA 1C28A 3M3EA 1PO23 5JDBA 3N3HA 5EYXA 2QNKA 3MO4A 1BK0A 4K20A 2WZR3 5FZHA 5AFEA 4UAPA 3FLRA 1GZ9A 3OJBA 1ND2A 3W21A 4FI9A 2RDRA 4NRPA 3O1UA 1TZOA 5FUIA 4M0HA 2QDRA 1S0BA 1XQNA 2VULA 5FZCA 2RMU3 4QGNA 3POGA 4CCNA 3VV1A 2D6MA 1R092 2FCVA 2YY1A 1OA2A 1HRV2 1ZZ9A 2A3WA 5GM0A 2I74A 3LOBA 1PGW1 2X29A 3O1MA 4OZXA 2FD8A 5GLWA 3L9JT 3GHMA 4FFGA 3HN3A 3JBG1 3OYWB 2DVAA 2Q1FA 1DP0A 3PUIA 5IVJA 1VALA 2ZOEB 2OPWA 5C8CC 1WBFA 2WKKA 1AR62 3K75B 2IXHA 5KR7A 2XPJA 3PHMA 1O3QA 1ND3C 3NNJA 2VXJA 2RM22 1ULDA 4YW3A 2ZEWA 1VLNA 4Y20B 5B4XA 3WF2A 5EIYB 4ZONA 5FP9A 1N1VA 2Y6GA 1UPSA 2BVBA 3AK0A 3FBMA 3ZDVA 5F3CA 3UGHA 2ILMA 3QH6A 4XDQA 2JKBA 1FNZA 3WLUA 4QKBA 1RHI1 2Y64A 1M4WA 5FAXA 3SMHA 1H8TC 4FAGA 3IAQA 3OUIA 1URXA 1WD4A 5IK8A 1A78A 1NCRA 2WT2A 3HPNA 2VW1A 1XU1A 2Z2SB 4CU8A 1NLRA 3J26N 4BISA 4PF1A 1HW5A 1PVC1 2P3KA 3BPSA 4HN1A 5EWSA 4MUVA 2XVLA 2HWD2 4XIOA 2IFRA 1GZTA 1WWYA 1EV13 3FUOA 2P3JA 3VBUB 3PUHA 2QDNA 4HKOA 5BNPB 5FP7A 2A1XA 4YGEA 2GP3A 1TQ5A 1R082 4CCDA 2W08A 5FYTA 2EA7A 1GANA 1GOGA 3MPPG 1EY2A 1Y9QA 2ARXA 1I5PA 2JDZA 4XUPA 3U07A 4CU7A 4IV1C 2VUDA 1COV3 4XC9A 5BNOA 1V0AA 2VBBA 4I3GA 4BZ4A 2JG8A 4BXSV 3SCHA 5GZCA 1VBD1 5KHIA 1RYYA 3MZHA 1NE4A 3H8UA 2PAEA 1WA6X 4CU9A 4JKKA 4ZS3A 2ZBJA 2HWC1 1VPHA 1VBB3 3RZZA 5C3PA 3E6BA 4KMQA 4Y5SA 1GKBA 4Q4X3 2DWRA 1SLBA 2W95A 5LBCA 4C8DA 3ZPYA 2VBPA 1O91A 1UL9A 3LZZA 4TWTA 2SLIA 3VBOA 3WDVA 3M4FA 1V6OA 1UY1A 2YC4A 4NE9A 3T1MA 4YVWA 1UQXA 1APNA 1H30A 4W8JA 4FPCA 4K1ZA 3TEWA 2JDNA 1AYM2 4YGCA 3WOGA 5FXVA 3OSDA 2P34A 4GQ7A 4B8EA 4N53B 1AR82 1MS3A 1RIRA 5CNAA 4PCRA 4PQQA 5EYYA 5C7GA 4P02B 3PUAA 1OQDA 2VOVA 1DYPA 4OQ9A 1CWPA 2VVEA 4Q2FA 2Z69A 1DYKA 2OX0A 1NQJA 2WS92 3TAYA 3UJQA 2A6ZA 1PGL1 5IFPA 1QQP1 1W0NA 2HEYF 5FO7B 4LBKA 2MPFA 4PDWA 3G6JB 3RRDA 4EN7B 2KA3A 3MIEA 5JXJA 3VKLA 2GNTA 2WSUA 3AXDA 1V6NA 4NAOA 4P9XA 1RXGA 2DFBA 5FWEA 1SBEA 4CCLA 3RZHA 4Y33A 5IVVA 1XYNA 4P14A 3H9AA 4KG0A 2E6VA 3HMYA 4AI2A 1WW5A 2RDQA 2VTXJ 2G19A 2J42A 1Y4WA 2GC1A 2YU2A 3DGTA 1WCUA 1RUD1 1UKRA 5F6LB 3MIBA 2JDMA 1GR3A 4P9IA 4WV8A 4C91A 2ZGLA 1E5IA 2C5DA 3VKMA 2HWE2 2PAKA 4V2VA 1H4HA 3WNKA 3AYCA 4ZXKA 3NKTA 5J3UA 4FQ4A 4JGYA 1Y7BA 4H55A 4Q0VA 4Q4V2 4A42A 3VD7A 4H2AA 1LOGA 4QB2A 3RFRA 1ENSA 2XQRA 4YARA 1KFUL 3PJQA 5JOWA 2AEZA 3A4UA 3ES4A 4M01A 1ZBE1 4D6QA 4JC1A 2A75A 1UU6A 4N8MA 5K0UC 3ILNA 1ACCA 1FXZA 1RUC1 3AYDA 2A3XA 3RWNA 3ZN6A 1LGCA 1MQTC 3WDUA 2VUCA 3IPVB 3RYPA 3H1WA 1JHNA 3EO6A 1S2KA 3OCPA 3IDEA 1TE1B 3ZO0B 1D2SA 1C3HA 2PHFA 3H7YA 2DVFA 1UAIA 1DGLA 3I97A 1BVVA 1UNBA 1LOFC 4LHNA 3BYWA 2BWCA 2Y33A 3H42B 5KXCA 4P5HA 5LZ6A 2WL1A 2OUHA 1RMU3 2GNDA 2XLAA 4AE2A 5FZDA 2YMZA 3A23A 2JG9A 3IM0A 3NNMA 1WCQA 4QX2A 4XFGA 4CDUC 4BQ5A 1OKQA 2EAAA 2W1QA 3AVSA 1YQ2A 1JOJA 2ET1A 5LA2A 4FTEA 1WZXA 3CIHA 5FDBA 4AI0A 1G8WA 2OZ6A 5F5CA 4AHXA 1FNYA 5FZ6A 2P37A 4JKMA 5LY2A 3HOBA 1LJ7A 2DVBA 4NIGA 1F9KA 2WT0A 1U5YA 3CEWA 3GBFA 2AENA 5CFCC 3ZPOA 2EXJA 2UWAA 3D5OA 3WD5A 1F5FA 1R091 2VUAA 1HRV1 1PIV3 3ZXKA 3POBA 4A4AA 4XBQA 3LKJA 5DMYA 2NMOA 4GWIA 4UW4A 2UU8A 1LHOA 2O14A 1SLTA 1XYOA 4JTNA 1DQ0A 5F2WA 1SCSA 2ZEZA 3H50A 3UK9A 1JZ2A 3WQ1A 4LITA 3ZSJA 1XB9A 4DNYA 4W6XA 2TBVA 2HWB1 4RFT0 5T50A 3HWJA 5FUNA 5BNQA 1AR61 4D0QA 2D6NA 5E8AA 4C90A 3WNLA 1EUUA 2P5BA 2RM21 3F2ZA 5K4LA 1QJY3 5IK4A 3PIJA 4Y20A 5DAQA 3CNAA 4LPLA 3AMHA 5AC92 3RMXA 2ZGOA 5E88A 4UI9L 1J84A
chains in the Genus database with same CATH topology
5LK7B 2BBVA 4FPYA 4Y24A 3HIFA 3V0BB 2P2KA 4IEOA 4AG4A 3GBGA 3SXWA 1X8EA 2QKDA 3WQ0A 4XYXA 3S7EA 5BNNB 4I0AA 2HWD1 2UYAA 4AHWA 4IEVA 5C8WA 4EWAA 1E57A 2VNGA 4JQRA 3VBUA 2IXLA 5BNPA 3WG2A 4HVQA 4AF9A 5F5QA 1REEA 2BNMA 5D1IA 1H2KA 2WNUC 3MF9A 1DLLA 1OQ1A 2W68A 5D8AC 1RUG3 4ASLA 5I91A 4UW5A 1QU0A 2Q1ZB 4XILA 1AHSA 4W65A 3P3PA 2OA2A 4XBLA 1VR3A 5J48A 4K6BA 4XF3A 4AHZA 4LBQD 2IZWA 3WV6A 1RUE3 4LO4B 5DUXA 2EAKA 4BE3A 1KDKA 4GB31 4ORFA 4CP1A 2VVFA 3WY6A 3E5UA 3JU9A 2CL2A 4IESA 2ZA9A 1W6MA 2DUOA 1YWKA 2OIIA 2XJQA 5I8TA 5FPZA 3NV1A 3QOPA 3WG1A 4N53A 1AR81 1CESA 5T5PA 5AVPA 2VH9A 1DZTA 3UKNA 1QKQA 4MH0E 5J7MA 4PIYA 3EHKA 4UBGA 4NOTA 3INAA 1LTEA 4BWOA 3B94A 2WS91 4W6YA 2QZ2A 4XZPA 1VRH1 1GNZA 1N1YA 2Q0AA 1SLAA 2VNOA 1ZM1A 3ZDSA 1I6XA 3U10A 4GH4C 2I2SA 3VL9A 4C1XA 3N35A 1FMD3 2A6VA 1JUIA 1R1A2 4WVZA 3SITA 5CFDB 2E7TA 2DCJA 4EN6B 5LRRA 4PBPA 4R9BA 3W59A 5GZGA 4I3PA 3DN7A 3CL1A 1W6OA 4UW6A 1FPN2 3TN92 1W0PA 4KWKA 2HWE1 4AEDB 2D6KA 3ZSEA 2DU1A 4QPIC 1DDLA 5FLJA 2RJLA 4Q4V1 1GQGA 3CJIC 2Y26A 4JAAA 1AXYA 1X33A 2QVSB 3ZFEB 2TNFA 4Q4Y3 4AHYA 1HKDA 4FT8A 3T1LA 1FV3A 1LCLA 3PVEA 1AR93 2RR11 1MZFA 3IPVA 4Q0UA 5J37A 4MGZE 1RUJ3 5A33A 3OPZA 3ZMNA 5TSWA 1RTVA 3MW2A 3AB0A 3AKPA 4S2GA 1YO8A 2WFF3 3MPBA 3AKRA 1LOBA 5DXDA 5CG8A 3PLQA 3FLPA 3U4XA 5FLHA 4CDQA 3JUUA 2H0VA 4ZU4A 4YG6A 3FFZA 2PHTA 2YV8A 1MEC2 5GJ6A 3ILRA 1TNRA 4GKYA 1KRIA 1NZCA 4OHVA 1LECA 4A7ZA 2QE3A 3E5QA 1FAYA 1AR73 2ES3A 1W6PA 3MIHA 1QJX3 2DCTA 3AZYA 1X82A 5EJ3A 3I8TA 3O0VA 5SV8A 3VKNA 5ACA3 1ZRFA 4PBOA 4AGVA 2UWBA 2BNNA 3VBFB 3VZLA 2VOXA 1I9RA 1DQ5A 5GZDA 4C0HA 1QXPA 2QUOA 2PLV3 4E2SA 4KU7A 2R061 3B3QE 3WHTA 5GZFA 4K21A 5C8CB 1ZZ8A 1S2BA 2R32A 5AC91 4P9WA 4LO7A 2GC3A 3S0MA 5KHJA 1Q8QA 4YW1A 4B7KA 3KD4A 3VHOA 4FXKB 4BH9A 1OQEA 1OOPB 4KBBA 1FX5A 4E2GA 5JI9A 3UJOA 1BJQA 1XNCA 2FZ2A 4G3YC 2XH6A 2ZGNA 5BNNA 1MZ5A 4NHMA 3H3UA 4IV3C 2XJVA 1UU4A 1KITA 3W9AA 2K2SA 3AP5A 3AZVA 2NMNA 4Y1VA 1BXHA 4GMP0 1N47A 1D0HA 5H9SA 1YFXA 1YJKA 4NWWA 4COUA 4PQ9A 1HQWA 1J58A 2V09A 4AXOA 1AX0A 4BMBA 2G4IA 3BIWE 2D3SA 3ZXAC 1CGPA 4COYA 2WWSA 2HEVF 2DV9A 4HVRA 4IV1B 4Q8KA 4DY5A 4HPKB 3JBG2 1IS3A 3N7LA 3USSA 1CAWA 2ZCWA 4FQZA 1WLCA 3MGUA 4K40A 2Y38A 2NYYA 4XMAA 2RS33 4KGGA 4CRQA 2WQZC 4YLZA 1UIJA 2YUEA 1RUI2 3BB6A 4QHBA 3ZN4A 5C6CA 3UKTA 3H7JA 1AJOA 3O0WA 2VW2A 2UWCA 2AH2A 1RHI2 3X29B 3VGIA 1K5MB 4PF5A 2PFWA 2RS53 1NCRB 5FO9B 4Y22B 3V65A 3KS7A 4OHXA 4FXGB 4XTPA 3BOWA 1NOVA 5I0UA 2DCKA 1PVC2 3WDXA 3KT1A 5F6KA 1TEIA 1VBE2 1VP6A 2HWC3 2A70A 2Z79A 4XJZA 1LEMA 3MLJA 5BV6A 2P17A 3WCRA 1N1SA 2CV6A 3AMNA 1B35C 1WLTA 1L3JA 4CEWC 4AGGA 1CPNA 2E7AA 1OI6A 2ZMNA 2C9AA 1R1A1 1BEV3 3CO2A 5CFDA 4WVMB 2JG8B 3WP3A 3VL8A 1C57A 2D3RA 1W0OA 3NWKA 4MSVA 3U11A 1NG0A 2A6WA 2JXAA 4DB5A 1ULEA 2VY0A 1WW4A 5EXOA 4N43A 1HX6A 1JUHA 4QPGC 1FPN1 2B46X 2ZKLA 3TN91 4XXAA 1PNFA 4AEDA 1UPIA 1AUYA 2EF6A 2ZX0A 2RS13 4D3WA 2PHXA 2XLGA 1NCQB 3VBOB 4WZCA 2WQ4A 4K7JA 1NA1C 1XE8A 4FPOB 3V64A 2CGNA 2HWF2 1BK1A 3WZ1A 4HSLA 3WQ7A 2VVDA 2GDFA 4N9IA 3WW2A 1DGRA 2R042 3VDDC 4DOUA 1AVBA 3ZYJB 1MR5A 1AYN3 3IDCB 1LGNA 2YPJA 3N7KA 1UU5A 4WBBA 4YW2A 1CIWA 2SBAA 3KMHA 1A8MA 5DG1A 4D69A 2EXHA 3V56A 4ES8A 2ARBA 2MHFA 4LEJA 3H0OA 3NV2A 3CF6E 5KC5A 3C3VA 1MEC1 1ZBE3 4HANA 4S2FA 4M3CB 4GMP3 1EAH3 3ZFFC 3IBMA 4NHKA 3VBSB 1SLIA 1RUC3 2XJSA 3JCIA 1RUD2 3B00A 5SV5A 3AZWA 1W39A 4XQWA 4Y4YA 1C8NA 4KNCA 4LO8A 5DDJ3 1IGOA 4FTSA 3VBFA 2NQYA 4XXPA 4XETA 3AJZA 2R16A 5JCTA 2DF7A 5HCBA 1V9U3 1H9PA 1HRI2 1LR5A 3OD0A 4Y5Z0 1UN1A 5C9AC 2XLFA 2ZS6B 2BGCA 2GMEA 1UD1A 5C8CA 1C5HA 4CDXB 1WMEA 1YXWA 5JZGC 2DTWA 4NR1A 2B9UA 3ZN6B 4LA3A 2XKPA 1Y3TA 2LUWA 4KWLA 4IEYA 2Q30A 3EXUA 3KSCA 3FLTA 1POV1 3I4IA 2DUQA 2O8QA 3KGZA 2CNAA 3PMEA 1H8TA 1HRV3 2MEV2 4OVEA 1ULGA 2ZZQA 3RJ2X 2IFWA 4DQAA 3WDWA 1CN1A 5DUWA 3ES1A 5CVRA 4CP0A 3HBZA 1AR63 1TME2 3DPRB 1WLDA 5F1RA 1BMV2 2F6BA 4FPEA 1QY4A 1CX4A 4FPHA 4XJ8A 4YM3A 1LOAA 3RI9A 4IEPA 2WNUB 3ZSMA 1V6KA 2BNOA 4DS0A 1LKNA 4GIQA 4JVAA 1AL21 5D8AB 3KCXA 3QD6A 1NE6A 3AZXA 4NHLA 3TRSB 4I2OA 4IV1A 3WUCA 4HPKA 2ZX1A 1XE7A 2A6YA 1PHMA 3M2MA 3R4DB 4HLTA 2CGPA 1GBGA 1QOOA 2HWB2 3GNEA 1SBDA 4YG3A 1RUI1 2D40A 2HWD3 2Y0OA 3TNPB 3ZFGC 4WM7C 4OHZA 2W39A 4BIFA 1R083 1YI7A 3AKSA 2D6OX 3ILFA 1ZZCA 1K5MA 1REFA 1S0DA 2ZGPA 4RR3B 2EXKA 4FPLA 1D4M1 2XL9A 2XB6C 2D3PA 4Y22A 3VZNA 4D94A 2BTVC 4XFHA 1S0JA 5FQ0B 4KL1A 1LHNA 1ZYBA 4N7UA 1DIWA 3PTYA 5I0SA 1VBE1 4PIZA 3MIDA 1LESA 4WM8C 2DURA 1AX1A 3ATGA 3GZTB 4I09A 1YI9A 4UBHA 3JD72 1RVF2 5KHHA 4A7KA 1NLSA 4KGQA 2VMHA 2IXIA 2XBO1 3KQRA 1VBC2 2WA4A 5B2GB 4GH4B 1DBNA 4WVMA 1AXZA 1AYM3 2ZGRA 4QQLA 1GZCA 4LA2A 4P9JA 1JYCA 1AR83 1ND2C 5T3NA 3QCWA 2E51A 4XF9A 1QJU2 4KU8A 4YZ4A 4GB32 3KCCA 5C33A 4Q0PA 4IL7A 1H2MA 2WS93 1RC6A 3SH4A 1NCQA 3MW4A 4XFBA 1W6MB 2DU0A 2LALA 4QPIB 4LE4A 5DG2A 5J09A 4R4XA 1W6NA 3USUB 4YNIA 2GN3A 2HWF1 2ZGMA 1TMF1 1YIFA 3O0XA 1O3SA 4RQPC 5HXVA 4EV0A 5K0UA 4GULA 4XF1A 5GZEA 3LSEA 2CY6A 2R041 1HV0A 1N1TA 2GSYA 2FMYA 1IPKA 2K9ZA 2WC2A 1RUH1 4BCUA 4Q1PA 1VRH2 1IZ3A 2ZKNA 3POSA 1EPWA 1COV2 1EP0A 3NAPC 4QQHA 3AMPA 4RHV2 5EFUA 1LOFA 1ASJ3 2AYHA 4GALA 1YFUA 2ZHMA 4J1XA 3KT4A 1VBA1 4ISQA 1AX2A 3M1HA 4AFBA 3VZMA 3VZJA 4M3CA 3GZAA 2YGMA 3IDBB 5GALA 2ZX3A 4AFMA 2O0OA 3SCFA 3VBSA 1M06G 4MGYE 2V5YA 3NW4A 1W6OB 2ZGSA 4Q4W3 4XFCA 4AFAA 5CFCA 2R072 4OHYA 2ETEA 2DCZA 5BNOC 1HRI1 4HK9A 3POWA 4Q1RA 5JI7A 3QBQA 4B4RA 2LTNA 3VN4A 4CDXA 3HR9A 1PGSA 3J9SA 4QPYA 5K7PA 5FRAA 1H1MA 1IQAA 1O4TA 1KDMA 1S0EA 3M7AA 2D98A 4HETA 3HQXA 2RR12 2A6XA 5JPMB 2XKOA 3M8LA 1V70A 5A33B 2A3YA 2WFPA 3SHRA 4TYSA 1BCXA 4X8PA 1HQNA 2MEV1 3MW3A 2FHRA 1OA4A 4YZ1A 4IEUA 5FMOL 3WP6A 1LU1A 1KD7A 1O5UA 3R4SA 3ZIWA 4CDQB 2H6CA 5DZGA 3NV3A 3LSDA 2R1DA 2TEPA 4ISRA 1PZ9A 4L8QA 1TME1 3DPRA 3IWZA 5E89A 5GLZA 3BU7A 3R0RA 3RYKA 3WHUA 1UIKA 4XTMA 1W6QB 1BMV1 5JR7B 4P9LA 4PDWC 4L11A 3AKQA 1W6PB 2WNUA 1LB2A 4N90A 3SCGA 1ZZ7A 3QLQA 3JZVA 5D8AA 4QQPA 4AI1A 4COVA 4DPNA 3QACA 4Y1ZA 3SLIA 3R6SA 1AXKA 1QH7A 2FQPA 3M3OA 1H4GA 2TUNA 2ATFA 3MLKA 3WP4A 2R062 4MLOA 1RB8G 1R1ZA 3NSTA 4WZFA 1H0BA 4EWDA 1FV2A 4YVSB 4Z82A 4FPFA 1LOEA 3VBHC 3MF6A 4F8AA 1CAUB 5IK5A 4JGYC 3O5SA 5L7OB 4EWEA 4RR3A 3VBRC 5DZFA 3LA2A 2OVUA 1CVNA 4FVVA 1QXJA 2GAUA 3ZYPA 3WW4A 1IPJA 1KS4A 5FQ0A 2QZ3A 4COZA 2WNVC 2RMU1 4AFDA 2VGDA 1O3TA 1QJZA 3JD71 1RVF1 4F83A 1GLHA 4MXWA 2WLQA 1ZX5A 2JJ6A 4AI8A 2VW0A 1UKGA 3ZX7A 1FT9A 4C1WA 4K1YA 5FOBB 1VBC1 1B35B 4GH4A 4H14A 4GKXA 1LU2A 3ZYIB 3FX3A 2VMIA 4KWJA 4WVWA 1QJU1 1CAWB 4RS5B 2UY8A 5LEKA 3S30A 1Y43B 2ZHNA 2WNEA 2ET7A 3RS6A 4QX5A 1C8M3 1GZWA 3RJRA 4OUSA 4CTEA 2VXRA 2IC1A 3J4UH 1PVXA 3LA3A 1HDKA 4QPIA 3WDYA 2BFUL 3SISA 2XWBB 3USUA 4QT6A 3CJIA 1XU2A 2XUMA 4J6GA 4BLIA 5I0RA 2P3IA 5CB7A 5T52A 4MX3A 3OGJA 1OFNA 4RL7A 5DUVA 3MIFA 1ZA4A 3AMQA 5C4WC 1ENXA 1RUG2 1COV1 1FPN3 5EV7A 4RHV1 1PM7A 3MYXA 2ZPXA 2XGXA 3CJXA 1CQ9A 1QNYA 1CAXB 4A2UA 1Z0HA 3NKGA 3AZZA 4YZ3A 4XOGA 2ZACA 2OPKA 4N43B 4GA9A 4LBLA 4DRRA 5CAZA 1UZZA 2R071 2VECA 4Y1UA 5HBAA 1PZ7A 3ZIXA 1J59A 1GNHA 4U2AA 2EXIA 4IEWA 1JN2P 2IXCA 1UCXA 2YROA 1JTZX 1FOD2 1S0FA 1GV9A 1Q8OA 2YXSA 3J8F3 2YDEA 1MEC3 5AVAA 1G86A 3N7JA 4UXAA 5ABJC 1Z7S2 1RGSA 2ZX4A 2ZGKA 4QGLA 1WCSA 4Y1YA 1Q3EA 1S0CA 4Y1XA 1ENQA 2XJUA 2ZHKA 1VAMA 5GLUA 3VZOA 3KZ4C 1U0AA 4OLLA 3WDTA 4B7EA 1I3HA 1MS0A 2YZ4A 2PHUA 1IS5A 1PMIA 3FE5A 4QU2A 4IV3A 1W6QA 1H1AA 5JLVA 3N36A 2D6PA 3ST7A 4LBJA 2XVKA 1VIWB 1HXS2 2GN7A 1VAVA 5AFBA 3P3NA 4E4SA 4R52A 2KM2A 4QXKA 5BXXA 1CAVB 2X5IC 1NQDA 3TB0A 4Q4Y2 2VQAA 4UW3A 5JOYA 5JWPA 2A71A 4FPGA 2JICA 4YVSA 5L19A 4FP2A 5KXBA 2WZPP 1LHUA 2VG9A 5JMCA 5JIUA 1ND3B 4JGZC 3RSJA 5A3MA 4XHXA 1VB2A 1CAUA 1RMU1 3ZFGB 4YZ5A 1XYPA 2WFF2 2JD4A 5L7OA 3I59B 3I7DA 4JRAA 1H8TB 1REDA 1ALYA 5KXDA 2UY9A 2DUPA 2NN8A 4C0BA 1CJDA 3TOJA