2DVDA

Crystal structure of peanut lectin gal-alpha-1,3-gal complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvdA00
3HMYA 4FPGA 5KXEA 4PQ9A 1ONAA 4K1YA 2WSUA 1S0EA 4BM8A 3A0NA 3AZZA 3KQRA 4U36A 4AGGA 1ENSA 2UU8A 2D3SA 1LULA 5IT6A 2EALA 4YG3A 4YGBA 3AX4A 4AVTA 1JUIA 2VW0A 1APNA 4XJAA 4FPYA 2C5DA 1LEDA 4Q27A 1Q56A 1LOFA 1GV9A 1MS1A 5GZDA 2OUJA 3IN9A 4DQAA 1MS9A 3INAA 4R9CA 4FVVA 4K1ZA 1G9AA 5GZFA 5GM0A 1N1TA 3QLQA 2FHRA 1DQ2A 1DGLA 1MS4A 4XBNA 5T5OA 1UL9A 2BQPA 2DU0A 2GN7A 1GZWA 2JJ6A 2OUHA 3LSDA 4M3CF 3IPVB 4NO4A 4R9AA 4YFZA 1MVEA 2NMNA 1WW4A 1RINA 3NV4A 1AJOA 4AWDA 3U4XA 1GSLA 1LOGA 1SLAA 3N7KA 4XBQA 1LENA 1MACA 1N3QA 1QDOA 3AP9A 1VALA 2EIGA 4XJ9A 1N1VA 1JBCA 4U2AA 4UW5A 4YFWA 4PBOA 3AYDA 1UPSA 2D6KA 2SBAA 3QCWA 3AJZA 4YW2A 4AVVA 4PCRA 1SFYA 5JLVA 1AX2A 3WG2A 1RIRA 3DGTA 2ZACA 1YIFA 1DQ1A 1A3KA 2CWMA 2VUAA 2CYFA 4Y20A 1AX0A 1WBFA 1G86A 5T5PA 1DBNA 2DV9A 2PHRA 2DTYA 1F5FA 1W6OA 1C1LA 3POSA 1SLCA 4XTPA 3WHUA 4YW4A 1HDKA 1LU2A 1V6LA 1S0JA 2A3XA 2DWRA 2ZGPA 2ZGRA 1QDCA 3B01A 1GZWB 1QMJA 1I3HA 3VKNA 3HR9A 1F31A 2ZGOA 1A78A 3SH3A 3A0KA 2G4IA 5E89A 3B69A 3IKWA 3WUDA 1AXKA 3NV3A 2VW2A 1UN1A 3SH5A 5IK4A 2GNMA 3FLRA 1DYPA 2DTWA 3KM5A 4Q2FA 3ZXEA 3R4SA 2UWAA 2DUQA 3RMXA 4YZ2A 3ZSLA 5DUUA 3I8TA 1WLWA 1S0CA 1G9FA 3IM0A 1G9CA 1HKDA 2XG3A 3FUOA 3R4UA 4Y20B 2E53A 2DVFA 5EXOA 2CL2A 5GJ6A 1D0HA 4R9BA 4XHXA 5JOZA 4Y1XA 1W6OB 2D44A 2SLIA 1YRZA 3C2UA 5T55A 4P9YA 5IK7A 1C4RA 1UZYA 1UX6A 4L8QA 3UL2A 5JOXA 2R0FA 1DQ6A 2ZBJA 4FOVA 1KRIA 1AX1A 2AUYA 4DS0A 1GYKA 3FLPA 3SNMA 1OKQA 5JVVA 2AREA 3B3QE 3D4KA 4FPCA 4KBBA 4P9WA 1LHVA 1SBDA 2A71A 3IPVA 5JOYA 3BODA 3BIWE 5T50A 4AYUA 3WVJA 1WD4A 3T2TA 5H9QA 2EXIA 2P37A 3AK0A 1LOAA 4WV8A 1Q8VA 4GKXA 2DUPA 3APBA 1CESA 1IS4A 1UZZA 2E7TA 4Q1PA 2E6VA 5DUWA 3VKFC 1GANA 1NLSA 2GDFA 4XHBA 1KDMA 4Y24A 2ZAAA 1H9PA 4YZ4A 1LOBA 2ZGQA 2JE9A 4FP3A 1CONA 2A6YA 4XMIA 5DZFA 5L73A 4CRQA 1OFSA 4K20A 1SBFA 1QOSA 4FPOB 4Q26A 1YI7A 1BJQA 5KXBA 2YROA 5GZCA 3AP4A 4XE9A 2W39A 3WDTA 2WT0A 2TEPA 1SCSA 3OBTA 5CAZA 2JD4A 1WW6A 1WCSA 1DFQA 3NV1A 2ZGSA 1LGBA 1H9WA 4XZPA 1F9KA 5DG1A 3N36A 5GALA 2GNTA 3RS6A 3WCSA 1NXD1 2EAKA 2DUOA 4GWMA 1LECA 4Y1VA 1C57A 2DVAA 1A8DA 1W6PA 1IKQA 5CB7A 3ZSJA 4FOWA 1C1FA 1VAMA 4LBMA 2A3YA 4MYEA 5AVAA 5T5JA 4YGCA 3WDVA 2ZA9A 1G8WA 1LHNA 4ITCA 4BLIA 3AYCA 4Y26A 1LTEA 3OJBA 1MVQA 4GALA 1IS6A 1UAIA 2D3RA 2FMDA 1MR5A 2ZMKA 2ZHNA 3RQ0A 2GMPA 1WW7A 1MS3A 2D7FA 1S0DA 2YXSA 3SISA 4YGDA 2JE7A 3RMYA 1VAVA 1Q8OA 4XIKA 1QGLA 1CN1A 2P3KA 1GICA 2CTVA 4BQ1A 4GXLA 3M3EA 4PBPA 1S0IA 4ISRA 3OPZA 1W6PB 3ZXFA 1SLLA 4XYXA 1CPMA 2PELA 4UW6A 2JDZA 2GMEA 3PVOA 1MS8A 3AZYA 3L2YA 4GWNA 2LTNA 5E8AA 5F9TA 4BMBA 2B7YA 2DYCA 2ZHKA 2EXKA 1LOEA 4I30A 1QOOA 1S1AA 1WUVA 1W6MA 2P2KA 3O5SA 3N3HA 3M1HA 4UW3A 1CQ9A 2WQZC 4XIOA 4DRRA 3D6EA 2R49A 2ZMNA 3PMEA 3Q9OA 3RRDA 3PVEA 2D6MA 2A7AA 1FAYA 1CIWA 3O0VA 4JC1A 2GMMA 1Q8QA 4AVSA 3V64A 3WNXA 4GKYA 5F5QA 3I4IA 1Q8PA 3UJOA 4XJZA 1HLCA 2HYKA 5DZGA 3RG0A 3AXDA 2WKKA 4XOGA 2NN8A 4LBNA 4FPLA 1QF3A 3WHTA 4FPEA 2KM2A 3DUIA 3WV6A 4FP2A 4XJUA 2D6LX 1LGCA 4C1WA 2VU9A 2H0BA 4XMAA 4H55A 4Y1UA 4YZ3A 1W6MB 5GLVA 3AP6A 4ATEA 3TB0A 1LHWA 4DPNA 1LODA 1GNHA 3BTAA 1GKBA 3W58A 1BYHA 3M2MA 4YM3A 1CVNA 2WT1A 1AJKA 3B00A 4Q8KA 3ZVXA 1KJRA 4YG6A 1JXNA 4WVWA 1PZ7A 4JRAA 2W52A 3IMNA 4LBKA 1AXYA 2GNBA 1DQ4A 2W68A 3LSEA 5FREA 2CY6A 2EF6A 2ZZJA 4XILA 2AYHA 4YZ5A 3R05A 3OGGA 3ENRA 1MZ5A 3ZXKA 2WT2A 3N35A 1BXHA 3VKMA 2VY0A 4P9XA 4YZ1A 3BOPA 3V0AA 2ZGNA 2PHTA 3PJQA 4Q1RA 5IUQA 1N3OA 1LESA 1S0FA 2XB6C 4AGVA 5IK8A 1LHUA 1FX5A 3SITA 2A75A 1JOJA 1QNYA 1IKPA 3AP7A 5DUVA 1G9DA 4YM2A 1SACA 4XXAA 3M3OA 1QNWA 1LJ7A 4LBQD 5EWSA 1MZ6A 5HCBA 1AZDA 5JOWA 5GLWA 4P14A 2DU1A 1WD3A 3AXEA 2OW4A 1LHOA 1Z78A 5DUXA 3ZYPA 1AXZA 4YW1A 2LALA 4XJ8A 1WW5A 3HN1A 5CA6A 2ZGKA 4AGRA 2ZMLA 1DLLA 5H9PA 3AJYA 2ZKNA 3FBYA 2A6VA 1VLNA 5GLZA 4C1XA 2ZHLA 3M3CA 4YM1A 2DURA 1ENRA 3N7LA 2ZHMA 4LBQA 3V0AB 4GA9A 4FPKA 1N1YA 1ULCA 3MPPG 3FLTA 1TEIA 4UW4A 1O4ZA 5SV8A 4BOWA 4FQ4A 4M3CA 2E51A 1LOFC 3W59A 2R1DA 4CTEA 3SLIA 1JHNA 4RA0A 2UURA 3AYEA 3MW2A 1VIWB 1JW6A 2GALA 3SH4A 1W6QA 3WCRA 2AR6A 3O0XA 2D6PA 4FQZA 2V73A 3WDUA 5T54A 4K21A 4Y1YA 2JECA 4M01A 4M00A 1UMZA 1YXWA 1LEMA 2WLQA 1XQNA 4BLJA 3ILRA 2Z42A 3AFKA 4LBQB 2EXHA 3T1LA 3ASIA 1GZ9A 3VUOA 1LU1A 3D5OA 3USUA 2D43A 4XJWA 1SLBA 2DVBA 4LBJA 3M3QA 3WDXA 1AVBA 1U0AA 2D3PA 3B9CA 1R1ZA 4M3CB 5DG2A 1V6KA 5E88A 5GLTA 5HCAA 1KJLA 1FV2A 1DZQA 4BPZA 4NOTA 1V6NA 4LBOA 4TYSA 4F83A 4FPHA 2PHUA 2AGSA 1DHKB 1W6QB 1AF9A 5KXCA 3V0BA 2A5ZA 2ZGUA 4R9DA 1RITA 1WLCA 1KITA 1ZM1A 2ZGMA 1CR7A 4OZXA 2R0HA 4Q8LA 1UKGA 2ZABA 3WDWA 2NP0A 3VV1A 4FOYA 2D6OX 3ZXJA 1FNYA 2Q5TA 2R16A 3NV2A 3USUB 1BKZA 2DVGA 3FUQA 1JYCA 1QOTA 1G7YA 1URXA 1Y7BA 3T1MA 1MS5A 5EYXA 4Z8BA 1W6NA 3OBRA 1SLTA 1H30A 2I2SA 3JUUA 1D2SA 3O12A 1GZCA 2UWBA 3O0WA 2VH9A 3MEPA 2ZGLA 3WG3A 4YLZA 3V0BB 3N7JA 5H9SA 1FV3A 4Y1ZA 3WG1A 3TAYA 1DQ0A 2PHWA 2ES3A 1X50A 2P34A 2UWCA 4Y22A 2ARBA 1GBGA 1HQLA 2YV8A 5EYYA 5FRAA 4ASMB 4XXPA 1ENQA 1ULDA 4JCKA 2AH2A 3WOGA 5KXDA 1PZ9A 2EXJA 4DFSA 4ISQA 4HANA 1N1SA 3V65A 2GNDA 1FATA 2D6NA 1W6NB 4XBLA 1I1EA 3OY8A 3MW4A 3ILFA 2CWSA 3GALA 4WZFA 1V6IA 2YY1A 5CBLA 5DXDA 3VKLA 3AYAA 2DVDA 1O4YA 3AZXA 2E7QA 2YMZA 1WBLA 4D69A 1ULGA 5JDBA 4Y22B 1WLDA 2ERFA 1JYIA 1S0GA 2PHXA 1BQPA 3VKOA 3MW3A 1BZWA 3ILNA 5HCFA 1CPNA 2C9AA 2A6WA 2WJSA 3ZPYA 4WVVA 2NYYA 1JN2P 4M3CE 4RL7A 5BYNA 4ATFA 2VW1A 1EPWA 1MS0A 4TZDA 4YGEA 1ULFA 1LCLA 2JKBA 1YO8A 4YM0A 3WZ1A 3CNAA 1DQ5A 2WSVA 3OY8B 3GNEA 4YG0A 1KQRA 4XDQA 5GZEA 4FPJA 1Z0HA 4BMEA 2V5YA 5JMCA 2P3IA 2A6XA 5CNAA 2A6ZA 1LGNA 2R1BA 1CJPA 3ZSMA 3PVNA 1S0BA 4IQPA 3N7MA 3POWA 5LK5A 3H0OA 4PF5A 1SLIA 3A4UA 1LOCA 1G9BA 4YW3A 3ZYRA 3WDYA 1GLHA 2WNEA 1PZ8A 1YYNA 2NM1A 3POYA 2A3WA 2PHFA 1IS3A 2CNAA 3AZWA 1V6MA 3OYWA 1GNZA 2VXRA 4YW5A 3AP5A 4ZXKA 5IK5A 2ARXA 1W0OA 1B09A 1QKQA 4XTMA 1DYKA 1V6OA 2AENA 1SCRA 3FFZA 1DIWA 1Q8SA 4W65A 2ZGTA 3ATGA 1OQ1A 1V00A 3AZVA 4FOQA 2RHPA 4SLIA 2NMOA 1V6JA 1J1TA 5T5LA 1ZA4A 1N3PA 3WLUA 4FPFA 3ZSKA 3WUCA 1SBEA 1KDKA 1N47A 2YZ4A 1FNZA 4DRVA 1HQWA 2P3JA 5GLUA 3ZXLA 2GN3A 2NZ9A 5GZGA 1QU0A 1W0PA 2OVUA 2A70A 4ZKTB 1IS5A 3NWKA 4CZSA 5DZEA 2W08A 3UJQA 1FYUA 3JU9A 3LCPA 5T52A 3WG4A 5H9RA 3OYWB 2ENRA 4HL0A 3UK9A 1ULEA 3RSJA 4LBLA 1IOAA
chains in the Genus database with same CATH superfamily
2X8KA 4FPGA 5KXEA 4JAAA 4GJYA 2VMIA 2Z2SB 3A0NA 3CDZB 3AVRA 1JZ5A 4XUOA 2IVIB 2RM21 3J8F3 1CAWB 1LULA 1RXFA 2EALA 5IT6A 3S57A 4YGBA 3AX4A 4QX2A 1UU6A 4AVTA 4ES8A 1JUIA 2Y33A 1AYN1 1W8NA 4XJAA 3VHRA 2C5DA 1LEDA 5LBCA 1Q56A 1YEWA 1LOFA 5CG9A 4NMIA 3KF5A 5GZDA 2OUJA 4DQAA 1MS9A 4NROA 4LR4A 2HKXA 2WN2A 4H3WA 5GM0A 3UESA 1MS4A 1WGPA 4Q4W2 5FYVA 2QNKA 5J98B 2GN7A 4OI1A 2OUHA 3J9SA 2VR4A 1H8TC 2VZTA 3I2IA 5K8SA 4ZONA 2JWPA 5LA9A 2XOMA 1GOGA 4AWDA 4CDQB 4CP0A 3U4XA 5F7UA 1SZBA 1SLAA 1GNYA 1VBA3 4Q4V1 4GMP1 4IV1B 1MACA 2VBDA 1QDOA 2VGDA 4MLOA 5FZBA 5JI7A 4NIAA 5KHKA 2EIGA 2VL4A 4XFBA 3ORJA 4AEKA 1UPSA 3NJXA 4QPWA 4AVVA 4BIOA 5FZGA 5JLVA 4CCMA 1AL23 1AX2A 2ADEA 3DGTA 3HNBM 3WG2A 4CCNA 1A3KA 2CWMA 2WRAA 3OCPA 5JXIA 1K5MA 1HV0A 4ES9A 3D0JA 1OA4A 1QJY3 4AFAA 3GM8A 4XABA 2DCJA 2GC1A 3BCWA 1HDKA 2A3XA 4NPLA 2ZGPA 1RXGA 2ZGRA 1IG0A 1GZWB 1QMJA 2DCTA 2RR11 2ZAHA 3MLKA 4M0NA 1UY0A 4GH4A 5JCTA 3SH3A 3A0KA 4PJYA 4IESA 5FZ4A 4CP9B 1PMHX 4AHWA 1ENXA 1WMDA 5CYYA 3KVAA 3WUDA 4CCOA 5C8CB 2WZR3 2RMU2 5FQ0A 1ZVFA 1RVF1 5D8AB 2DTWA 3R4SA 1GU3A 2DUQA 1UU4A 3LEMA 1O8PA 3I8TA 1JOBA 5AVPA 3E5QA 5JSPA 4LIUA 4DB5A 5ABJB 1JZ2A 1BEV1 5IWFA 5IYYA 4BH9A 4QGMA 3NQHA 2E53A 5EXOA 2RS53 4QU2A 5GJ6A 2Y8KA 4XHXA 4CCJA 5IVVA 1OVSA 4Y1XA 5JOZA 2IXJA 1O4TA 1W6OB 2R071 2TUNA 3C2UA 3MUY1 4ZS2A 4LO7A 1UX6A 2VC9A 4QPGA 2R0FA 5FYUA 2RS32 3HIFA 1RUF1 2Q1FA 4QPIB 2WQ8A 1NE6A 3FLPA 4LOTA 4N43A 2JDYA 1AUYA 2DF7A 3PNAA 3B3QE 4P9WA 1LHVA 1SBDA 1VRBA 2A71A 5JOYA 2JG9C 3AKTA 3BODA 4HBNA 3AC0A 3LFIA 5IVCA 4NIIA 4D7SA 4NWWA 5D21A 1ZZ9A 2P3YA 1WD4A 2HEVF 2WWUA 5FJKA 4OUEA 4NAOA 5FZFA 2DUPA 4BHPA 5IAXA 1R1A3 2QQPA 1QJZA 1QXRA 1XSQA 3BTXA 3K51A 3VKFC 4XHBA 4Y24A 4FBFA 3FN9A 5FY0A 4EJRA 2JE9A 4DUVA 2V4VA 2WFF3 4XF0A 1OLMA 5LBFA 1WCQA 1AR92 1QOSA 1RUG1 4FPOB 2DCKA 2YDEA 1BJQA 1ODMA 4AQ2A 1OT5A 4J1WA 1PGSA 1IPKA 3AP4A 4RHV1 2W39A 4L2NA 2WT0A 3OBTA 3OOXA 5CAZA 1C5IA 1WW6A 3DXUA 5C4WA 4NUBA 1OLQA 4ZY9A 4XZPA 5DG1A 1YFUA 4O61A 4AR2A 5GALA 3WT3A 4Q4Y1 3RS6A 2R32A 3WCSA 4GWMA 1LECA 2DVAA 2JD9A 1RUH1 3ACFA 3RYPA 3VD3A 4FOWA 3H8XA 3AKRA 3WDVA 2ZA9A 1DGRA 3AYCA 4QT6A 1QQP1 2XUMA 4Y26A 4KWUA 2Y38A 1AL0G 3UKVA 2FBEA 3ZXDA 5A32A 3S0MA 1I9RA 4BK5A 5FZ3A 2D3RA 4S2DA 3IBMA 3TEXA 2R042 3LWCA 3SQOA 3MIDA 1AR71 2YBSA 2XKPA 5LEKA 4Q4W3 1DLCA 1S0DA 2J1SA 4YGDA 4ZXEA 4EZHA 2X29A 1WMXA 2QBXA 2QQLA 4BQ5A 4NHLA 5DQ0A 3M3EA 2XMLA 1QJX1 4ISRA 3SXWA 3OPZA 4L9BA 3T2QA 5ANQA 4ARYA 1CPMA 3VN4A 2XBO1 1NLRA 2GMEA 3GYDA 5F37A 2IZWA 5F9TA 5E8AA 2LTNA 3RZLA 2RDQA 2B5HA 2PYTA 5A3TA 2B7YA 1UO9A 4HPKA 5K0UA 4CXXA 1LOEA 5FMBA 4B4RA 2XJSA 4MX3A 4PDWA 5FPVA 1S1AA 3ZMNA 5FXZA 3NNLA 1RMU2 2FDJA 3ABZA 2P2KA 4HETA 3F2ZA 4OFGA 3CMGA 1J1LA 1O91A 3RYRA 4P9LA 3I3EA 5EPAA 3D6EA 2R49A 2ZMNA 2JDPA 3KMHA 3Q9OA 3RRDA 1TNRA 4ZU5A 3WW4A 4EN8B 4QPGC 1RUE3 1O6UA 1FAYA 2XKOA 1CIWA 1Q8QA 2RMU3 4AEDB 3AKQA 4UFIA 4HN1A 5F5QA 4N43C 3UJOA 1JZ6A 3AXDA 2WKKA 1JTZX 2KM2A 3DUIA 1FPN2 2XR4A 3E5UA 3WNNA 4D8MA 5IFPA 2D6LX 3ZPOA 3N9NA 1Q5OA 2WDBA 5FBZA 5GLVA 4XMAA 3MIGA 3I7DA 3CZJA 1XU2A 1LHWA 1LODA 3NAPC 3BTAA 1L7RA 1XU1A 3J4UH 5F6KA 1BYHA 2RS33 3U75A 2QQMA 4DXSA 3U14A 2CGNA 2FDKA 2RJ2A 5DDJ1 2WS92 2Y60A 4Q0QA 2WT1A 2E63A 3H8UA 4JGZA 4K3UA 4P9IA 2GNBA 2W68A 2CY6A 2GC0A 3LGRA 4LUMA 2BFUS 2ZZJA 4XILA 2VM9A 4QX7A 4YZ5A 1PHMA 5FYBA 1YQ6A 1W2OA 4KMQA 2C6SA 1MZ5A 3N35A 3LDRA 4P9XA 3ZN6A 3V0AA 3WINE 1V9U3 1UMIA 3PJQA 4CUAA 2WA4A 4C8DA 2XB6C 2XXZA 1CD3G 2BERA 3GZTB 5IK8A 4GB32 4BYYA 5C4WC 3NNJA 2WNVB 1D4M1 1E5HA 2HWF2 2Y6LA 3BGAA 4MHUA 5DUVA 2ZXQA 4WVZA 1ACCA 4XXAA 1VB2A 4BQ2A 1JZ3A 1G9DA 4N8MA 3CJIA 3CBNA 5JOWA 3O1VA 4MGYE 3VDDB 4JKLA 2QTWB 4X8PA 3AXEA 1LHOA 4H2AA 1JHJA 1AXZA 1E5IA 1OPOA 3A23A 4OMCA 3P3NA 1AR93 4RS5B 3TNQA 4AGRA 4ASLA 1ND3C 1Z7S1 4DOUA 1H2MA 2FQPA 1NA1B 3WR0A 1PGW1 1YFYA 4C1XA 3JCIA 2JDKA 3M3CA 1W9FA 5FV3A 1OUSA 1UIKA 4YPJA 4CCKA 4LBQA 4MGTA 4YVWB 4FPKA 2FZ1A 1OMIA 1S2BA 1Y3TA 2VQTA 3FLTA 3JQWA 4UW4A 3UKNA 1O4ZA 1BK1A 2NPIA 5C3PA 1YQCA 1J3RA 1W9WA 2W5FA 4MGQA 2OA2A 3VBUA 3WP4A 4DXZA 4MG2A 4JGYA 5JUVA 3ZR5A 3K3OA 3AYEA 3MW2A 1XNDA 1RGSA 3POBA 1W6QA 3WCRA 2AR6A 2J22A 3DEMA 1GWKA 4LJHA 1IPSA 3H3ZA 2ZS6B 3NO8A 4FFFA 4FQZA 5FBJA 4XF1A 5K0UC 1XNCA 4K21A 1CAUA 1AR82 2VZUA 2R043 1UMZA 4BJ0A 1H1IA 5LA2A 2Z42A 1BHGA 1YLLA 1QJU2 3C7EA 3UNPA 3T1LA 4NE9A 3USUA 2C4XA 2D43A 1RUOA 2WZEA 3H8OA 1C8M1 3LAGA 1YWKA 3WDXA 2G9GA 4P5YA 3B9CA 2JKXA 5DG2A 3MDPA 5E88A 5EJZB 5CFDB 1KJLA 4N7UA 4NOTA 2B9UA 4LBOA 4EWEA 2J1AA 1UYZA 4F83A 1O8SA 1NZIA 1DHKB 4B29A 3SKVA 2A5ZA 1O3SA 3V56A 4HK9A 3TN92 3RI8A 1RITA 5A7SA 1DCSA 5A70A 4J6GA 1F4AA 5DPNA 3SMHA 2R0HA 1UF2C 1RMU3 1UKGA 2EA7A 3ACHA 4L99A 3RJRA 4EN6B 3VV1A 3ES1A 4PLOA 3ZYBA 3HNYM 3WQ7A 3KF3A 2F4PA 4N53B 2J1EA 3SC7X 2BNOA 1G7YA 4TWTA 4K8RB 2VOTA 3ZLIA 4V1PA 3H3UA 3WF0A 4QD2A 3SCGA 4FT8A 5JXHA 3OBRA 3WF4A 2PTMA 3MIBA 4QQHA 3ZYGA 4FFHA 5IFTA 2ZOEB 3IWZA 3KB5A 1D2SA 3O12A 4LITA 4NWVA 3O0WA 4JGZC 4D0QA 5FO8B 4JDNA 2VECA 4YLZA 4LOSA 5AFEA 4D6QA 1VBC1 3I2HA 5JR7B 3K46A 5H9SA 1FV3A 1FMD1 2HH9A 5C70A 4WM8B 4GIQA 5FFOC 2ARBA 1GBGA 1ULDA 4JCKA 1Y9GA 1PZ9A 5CFCB 2QQKA 1PMJX 3KHBA 4CEYB 4KWJA 4IGPA 4IUGA 4ARXA 2VG9A 4AI2A 3QH6A 1UY3A 2VTXJ 2WS93 4L92A 4XFFA 5IJRA 2XQRA 2YGMA 4JHZA 1OQDA 1PO11 4LT5A 3LEGA 3J8F1 2GNDA 2YG0A 5M0TA 3PL0A 1XOYA 2D6NA 2I07B 1EUTA 4WVMB 4Z82A 4OUMA 1POV0 3CJIC 2DCYA 4N7IA 1I1EA 1IGOA 1VBE2 3FL7A 3OBZA 3PMSA 3TOJA 1A34A 3ILFA 1U5YA 3VDCA 2PLV3 1J59A 5DXDA 5CU1A 1E5SA 1FOD3 2E7QA 1ZZ8A 2Q4SA 5FZLA 2YUEA 5JDBA 4Y22B 3TNPB 1ZREA 2BGOA 2ERFA 4CDWA 5FP9A 2HWF3 3VZOA 2PHXA 5FP4A 5LRRA 3E5XA 1BZWA 2WFPA 2CU5A 3ELNA 1W8UA 2IUWA 4V2VA 2VNRA 1ND2B 1OSGA 3ETQA 1VBA1 2XJPA 3JD73 2K46A 3VBUC 3ZPYA 5L7OA 1VPHA 4HOOA 4MGZE 4JGYC 3VZKA 1MS0A 2VE1A 1ULFA 3SHRA 2PN5A 3WZ1A 1X8MA 4YM0A 1DQ5A 1AL21 3ZDSA 2C26A 2WWJA 4DMIA 5FPLA 2PAMA 5JMCA 1D4VB 3UV9A 5J37A 2RS12 4XCBA 4A44A 5CNAA 4DY3A 3VBFC 2R1BA 1H4HA 1QJY1 4A7KA 3K77A 2BNNA 1WA4A 4QKNA 3UETA 4KGQA 1QJEA 2X05A 1OXCA 4IV3C 4XF9A 5I0TA 2VZQA 3I59A 4CXYA 1SLIA 2GAUA 3HBKA 2WZR1 4B8EA 1IHMA 5FO9B 3A4UA 4FAGA 1KGYA 3PIJA 1TE1B 2CDPA 5K4LA 3OB8A 1HJGA 1TZOA 2K2SA 1PZ8A 1YYNA 1NY71 2W1WA 2WNEA 3POYA 5FMOL 3O1RA 3I3QA 3M7AA 3ROUA 2G19A 1IS3A 2JDHA 4CDUB 4YW5A 3VD9A 1V6MA 2Y6JA 1AR83 2HWD2 3OYWA 1Y9QA 5LA0A 4LK7A 3I49A 1L3JA 3I3BA 4XDOA 2RS51 3EHKA 1QKQA 1QJU3 1V6OA 3K4DA 1UIJA 1QXJA 1YFXA 5L9RA 4W65A 1V00A 3VBOC 4UWDA 1HQNA 2GC3A 2RHPA 5EP9A 1CAWA 1S2KA 1W3VA 2VMGA 1BVVA 5T5LA 4FPFA 2YZ4A 2HJIA 1OVPA 1HQWA 3ZXLA 5GLUA 1XB9A 2GN3A 4Y4YA 5GZGA 3E1F1 2OVUA 2A70A 5G05L 4ZKTB 3NWKA 4JV4A 5DZEA 2VOWA 2W08A 3JU9A 4I2OA 2F4LA 3VDBA 1RUI3 4HL0A 1H1MA 4AVBA 2GZWA 2JB8A 1W2TA 3EYPA 1DGWA 5FYIA 3HMYA 4LO4B 5FZEA 1ONAA 4CDQA 3AZZA 4U36A 1VMHA 4IV1A 2UU8A 2WO2A 4XC9A 4KWKA 1W8ZA 1JZ8A 2WO7A 3O1MA 1AYM2 1SHWB 1YFWA 2NLRA 4IE5A 4L97A 5A6QA 2FDIA 1CX1A 2O1QA 3JBG2 1CX4A 4A3XA 3L2HA 4Q27A 1HRI2 1W03A 4B7EA 4CCCA 1MS1A 1VMFA 4R9CA 4Q4X1 4K1ZA 4AI0A 2WQ4A 3WEZA 1N1TA 3C7FA 2FHRA 4XBNA 4PF1A 1GMMA 1GZWA 4R9AA 3LIHA 3AFGA 1RINA 3NV4A 4QXCA 1AJOA 4CP9A 5C8CA 1GSLA 2XJTA 4IEPA 1LENA 5D8AA 3AP9A 4CCLA 5BV6A 1N1VA 1DGWX 2SBAA 5ABJA 1TMF3 3QCWA 4YW2A 4CUCA 2WBKA 4DY5A 4CUBA 1WCUA 2XVLA 3GBGA 1DQ1A 3BIEA 1AX0A 2DBIA 1G86A 4Q29A 1DBNA 1OPMA 2PHRA 2D98A 3MV11 1F5FA 1W6OA 4ASKA 1C1LA 1SLCA 4XTPA 5KHGA 4YW4A 1JMUB 1V6LA 3VL9A 3PIGA 3OG2A 4Q4W1 4CU6A 1I3HA 3HR9A 1F31A 2LUWA 1A78A 1REFA 2W3JA 4QPIA 2UY8A 5A33A 3ZX7A 2J1TA 3LOBA 1AXKA 3N9LA 3GGLA 3FLRA 2CDOA 2Z69A 4B1MA 5ACA3 2UWAA 5DUUA 5LY2A 2MHFA 1S0CA 2JDUA 4IEQA 2H0VA 1G9CA 2QUOA 1HKDA 2XG3A 3FUOA 3R4UA 3RFRA 5FZDA 4UFLA 3OGRA 4AHZA 3BVCA 4RGKA 1LNSA 2RS13 2KR2A 2D44A 4LLFA 1W8TA 1YC61 3ON7A 1PVC3 4L8QA 5L19A 3BKZA 1KRIA 1W2UA 2AUYA 3ETPA 3ES4A 4DUWA 1UZ0A 2DBNA 5JVVA 1XC6A 2VZPA 4E27A 2AREA 3D4KA 3UGGA 4OI4A 4XFHA 4B1LA 3BIWE 5T50A 4C90A 4PLMA 4AYUA 4EN9B 4QWNA 2VOXA 3DN7A 3WVJA 5JR2A 2ZEYA 2OT7A 1ZZBA 1RUD2 4S2GA 5FXXA 1UOGA 4WV8A 4RR3B 5CVRA 1TNFA 1W8WA 5F3EA 1W8HA 5F5CA 5B4NA 1UZWA 5I91A 4NVPA 1NCRB 1IS4A 2E7TA 2WZPP 3CHXA 3A21A 5C3OA 3QBQA 1GANA 2X09A 2GDFA 4XFAA 3EXUA 2KXLA 4XW3A 4ZPIA 2B8MA 1WWYA 5A1LA 2RS31 3GZAA 4CDQC 4FP3A 1CONA 2A6YA 4BWOA 3ITQA 1STMA 1R1A2 3WF3A 4IV1C 5EZWA 2XJRA 3BALA 3BU7A 5L9VA 2IXLA 1OFSA 1SBFA 1K45A 1YI7A 2Y34A 4JRLA 2YROA 4R4ZA 2ZZQA 5GZCA 5C3QA 4XE9A 2WFF2 3MIHA 2TEPA 2VCMA 3BPSA 3NV1A 3HQUA 4QX1A 2ZGSA 3VD7A 1H9WA 5BNNB 2VZ1A 2D5HA 2X10A 1NX9A 4ZHNA 3LDBA 4J1XA 4NR1A 4E9KA 1A8DA 3ZSJA 1VAMA 1U5ZA 1XYPA 1FT9A 1UKRA 2HBUA 2Z4FA 3KCYA 5AVAA 4YGCA 5T5JA 1AYM3 5C8CC 2HEYF 4RQPB 3S7EA 4XQDA 3T0AA 1LTEA 3JBG3 3OJBA 4GULA 1HN0A 1HRI3 5FZOA 1AR91 4UYBA 4FCAA 2VD7A 1IS6A 5ABJC 1X33A 1MR5A 2ZMKA 3RQ0A 1HW5A 2GMPA 4UFKA 3HQRA 3SISA 5FYSA 3RMYA 2HWB2 3WW1A 3EBRA 3SCFA 1CN1A 2Y64A 4GXLA 3B9IA 2OIIA 4PBPA 2LS6A 4AF9A 2ZEZA 3BN6A 2GU9A 4AEDA 1JZ4A 2J42A 4UW6A 4N9HA 2JDZA 4J25A 1MS8A 4OHWA 1LR5A 4D7YA 5C7GA 2E32A 1UMHA 3VL8A 2DYCA 4B4QA 2ZHKA 4CEWB 2EXKA 4OZOA 3ZIXA 3SCHA 5FUIA 4AQ6A 2O0OA 2XHKA 1VMJA 1PIV2 5BNQA 2I45A 3H50A 2PAEA 3MIEA 5LB6A 4BZ4A 2F17A 2R041 3O5SA 3M1HA 2WAAA 1CQ9A 4XIOA 2I74A 3M8LA 2YC0A 2VQAA 5A3WA 2IVJA 1F8VA 2ZX1A 3PVEA 3ZYHA 2D6MA 1OI6A 2WA3A 3O0VA 5FYMA 1JZ7A 4OLLA 4BU2A 4UF0B 2YU1A 1ZZ6A 5DMYA 2CGOA 4IEOA 3V64A 1Q8PA 1QH6A 4QX3A 1OF3A 1HLCA 5J3UA 2AEZA 5DZGA 1RUE2 3RG0A 3I2KA 2FD8A 3THTA 4ET7A 1QF3A 5LWBA 4XJUA 2JG8C 4NHMA 2X5IB 4E4HA 4FI9A 4AEJA 2VU9A 4RGAA 2JEMA 1XXNA 1COV2 4H55A 3KSCA 4YZ3A 1W6MB 2WNVA 3AP6A 3MF6A 1X82A 3OGSA 4IEWA 4LNVA 3TB0A 5KC6A 3BTZA 1GNHA 1PX4A 2WNUB 5LASA 2RVAA 1CVNA 4Q8KA 3BYWA 3VDDA 2XL9A 4ONUA 4YNIA 1UCXA 1JXNA 3K48A 1H8VA 2VCAA 3IMNA 4JRAA 4LA2A 1DQ4A 4RS5A 5FREA 5IAVA 5JZGC 5EHDA 1UYXA 1NA1A 4CXWA 3KHCA 4AFDA 4Q0UA 2AYHA 3H1MA 3R05A 2K9ZA 3OGGA 3OEBA 4OQ8A 4XAAA 4RN5A 2WT2A 4AE2A 2PAKA 1RUD3 2VY0A 1OLME 4OCTA 5ANNA 3ZFGC 5IVEA 5FKCA 3N4MA 3GBWA 1FPN1 4Q1RA 4YVWA 5FZAA 1OLRA 3GHNA 1N3OA 1MEC2 4UI9L 5IUQA 2B9VA 3HVDA 4AGVA 3HNMA 5I0UA 1UOJA 3SITA 2O14A 2KD7A 1L7LA 2A75A 4G4FA 2YGLA 4AHYA 1V9U2 4QXHA 4YM2A 1SACA 3M3OA 2VUJA 1QNWA 5EFUA 5HCBA 3NRUA 1AZDA 2WS91 5GLWA 1OQEA 4P14A 3ZYPA 4WZCA 1KS4A 1PO22 4XJ8A 3HN1A 4LO5B 2ZMLA 3E97A 1JYWA 2ZKNA 4LHKA 4I0AA 3C3VA 4QXKA 1NCQB 5GLZA 3O1PA 3CU7A 4EYUA 3I3MA 2ZHLA 4QQPA 4YM1A 4EQVA 1CAVB 1F4HA 2ARAA 2ZHMA 3LFMA 4QB2A 2YFZA 1ULCA 4LO6B 4HKOA 3WF2A 3U07A 4LE3A 2OPWA 4FQ4A 2JDNA 4GB31 1LOFC 3ZKYA 1ZRFA 1VBB2 5F5IA 3JQXA 2HWF1 1DGRN 4R4XA 3SLIA 1EYBA 5CFDA 4AG4A 4LHNA 4LPLA 1SFNA 2UURA 4QB6A 1I5ZA 1VIWB 1JW6A 3GF6A 5FR3A 2Y6GA 4YVSB 4PIYA 3HT2A 1W9TA 5FTTC 2D6PA 5FUNA 4OULA 2V73A 4A42A 1FXZA 4M00A 1YXWA 3ZM8A 3CZUA 3ILRA 5FAXA 1NOVA 2PA7A 3LE0A 1BLZA 2A73B 3PU8A 3KZ4C 4N53A 1GZ9A 1TME2 1YQ2A 2Q8CA 3D5OA 3F95A 1ODNA 5AC92 2HWB3 1SLBA 3M3QA 4M4PA 4QM8A 5BXXA 4HSLA 1U0AA 2D3PA 4M3CB 4RYDA 1JYTA 5LW9A 1HB4A 5GLTA 3ZYFA 5HCAA 2CAVA 4E4ZA 1K5MC 1PVXA 1V6NA 5IVYA 3RYKA 1MQTA 3ZXGA 4Q0SA 1ZRRA 2PHUA 2AGSA 3IDEA 4R9DA 4O7XA 4Z1VA 3FHAA 3LEKA 3I97A 1RUNA 4GH4C 5FMOS 1GFF2 4CU9A 4WM8A 1ZM1A 2ZPXA 3GXUA 3MF9A 1CR7A 4OZXA 1PIV3 5HXMA 2E33A 1AR81 1GQPA 2ZABA 4MO3M 3WD5A 3IDAA 5CFCA 3ZXJA 4AOCA 4BQYA 1QJU1 1U5IA 4CEYA 1FNYA 1OH3A 2Q5TA 5LEJA 2Y6KA 3R6SA 2IXIA 5A6ZA 2DVGA 3FUQA 4RSUA 4QKBA 1EAH2 3JB4C 5FMDA 1MS5A 4EWDA 3QH7A 4Z8BA 5FPXA 1UY4A 4LULA 4WVMA 4IE7A 4QAWA 4BK4A 5K7PA 1SLTA 2VTXA 1C8NA 3VDDC 1XNKA 1GZCA 5FXVA 2VBBA 2CSGA 4RS5C 5LCWL 2ZGLA 3HD8B 4XUTA 3N7JA 5A6XA 4LUKA 4QXBA 4PI2A 3TN91 4UXAA 4Y1ZA 3SEPA 3TAYA 1S55A 2P34A 4Y22A 2OXBA 5EYYA 1COV3 2YV8A 1I5PA 4ASMB 1SQ4A 1WA6X 4YVWC 4FTSA 5CADA 5KXDA 2CHHA 4FTEA 2FCVA 1Q3EA 1W90A 2VCBA 1ND2A 2YYOA 2HLEA 5I0RA 4COYA 3ZSEA 4FO9A 1EPZA 1OFNA 3IIAA 3V65A 4BQXA 3I2FA 4D6SA 1R093 1JS9A 4XBLA 5FZ7A 1US3A 2UYAA 2R063 4WZFA 4A6OA 2VZ3A 1Y9MA 3IMMA 1O4YA 3HPNA 2W46A 4JTNA 4Y3OA 4DIQA 2W92A 1MEC3 1ULGA 2ZX4A 4L11A 4LO8A 5A7WB 1EP0A 1JYIA 3WW2A 2PLV2 4QU1A 2ZEWA 4IDZA 3RGBA 1BQPA 3E6CC 2OS2A 1FOD2 3MW3A 5HCFA 2WABA 1REEA 1EUUA 5EJ3A 4EWAA 3I3DA 5HV4A 1GQGA 2OZJA 4AFBA 1JN2P 4BISA 2BOIA 2VW1A 1PO23 2MPFA 4HFSA 4YGEA 5F2SA 2ID4A 1JYVA 2JKBA 1YO8A 4CDUA 3CNAA 1GOFA 3JD72 5J1XA 1VBE1 1KQRA 4HT1T 4XDQA 3BPZA 4QHZA 3RPQA 4AVAA 4BMEA 2V5YA 1O3RA 5FYYA 2A6XA 4AEMA 1CJPA 2V09A 1CZTA 2EIBA 1YI9A 4TLFA 5BNOB 2ZKLA 3M70A 1DZTA 2P4EA 3H42B 1S4CA 3FHQA 3KGLA 3N7MA 4N53C 4CDXB 2QE3A 1VBB3 1ZX5A 3KV6A 4JDMA 2EIDA 2WINB 3UGFA 4XETA 3HEIA 1XYNA 2RDNA 1S2EA 2OQ6A 5FJHA 3LPFA 2Q1MA 3AKPA 1LOCA 2AACA 5HXVA 1X7NA 3WDYA 4ZU7A 5LZ6A 5LRSA 1MQTC 3FHIB 3GBFA 4KU8A 1R64A 3LKJA 3AZWA 5A3PA 2VXRA 4GD4A 4K9SA 4YW7A 5IK5A 2VOVA 1HB3A 1WMFA 2ARXA 1YNAA 4CCEA 1DYKA 5FK7A 2RS11 1AYN3 2GH8A 1TME3 2XQXA 4AAXA 3FFZA 5AC93 2NQYA 5FY7A 2ZGTA 1ZBE1 3ATGA 2VQUA 4FOQA 3TWIA 3GZUC 3VZJA 2NMOA 3NKGA 4PDWC 4LA3A 4CEYC 1V6JA 1J1TA 3VBHB 4NHKA 1W2AX 3S5QA 4A45A 3WUCA 1SBEA 4DRVA 4KWLA 3U0ZA 4NRMA 2P3JA 3KV4A 3G7DA 4DXTA 2J7MA 2NZ9A 2EICA 3NAPB 1QU0A 3FMGA 1W0PA 3AM2A 1OBNA 1QJX2 3OSDA 5IW0A 4IETA 5T52A 1YIPA 1JYNA 5H9RA 5ISLA 3HOBA 2HWD1 4Y5SA 1POV3 5DAXA 5LK7B 2W1UA 4B7KA 2Q0AA 3KQRA 3EO6A 4QGLA 1RUI2 2X53S 1EAH3 3MGUA 5EV7A 2P17A 1X8EA 3D82A 2VNVA 4EE2A 5FZIA 4YG3A 5F8PA 1REDA 1ND2C 4AQTA 4JX0A 1B35B 4AI8A 5CZKA 2AZ5A 2RR13 3VBSB 2XLFA 2PXJA 3PUHA 3X29B 4FVVA 1G9AA 3FFQA 1GUIA 5FZ0A 3ST7A 5GZFA 2WL1A 1XRUA 1DQ2A 1DGLA 1GWMA 5FP7A 4YW6A 2BQPA 2DU0A 4NO4A 4YFZA 2JJ6A 4BQ3A 3IPVB 5C9AB 1MVEA 2NMNA 1WW4A 3T3YA 2BJSA 1ND3B 3L9JT 1ULPA 3OUIA 3OBAA 2WR9A 4Q0PA 5FLJA 3J7NA 3N7KA 4XBQA 1JI6A 1POQA 4P00B 1VALA 1HJFA 4XJ9A 4U2AA 1JBCA 2OKXA 2VZVA 4YFWA 3LF7A 1AYM1 3AYDA 3MV01 1UPIA 2YC4A 3DL3A 1RIRA 3JBG1 5I0SA 1ZBA2 4GMP0 1WBFA 3FJSA 3H7YA 5T5PA 4CDUC 4PIXA 2DV9A 1TMF2 4IEUA 3POSA 3WHUA 2RDRA 1LU2A 1S0JA 5A3NA 2DWRA 1QDCA 3CF6E 4GJZA 1PK6B 2Y26A 2EVXA 2ZGOA 3A7QA 3PDQA 3U10A 3DF0A 3LZZA 3UT0A 2D5FA 3PUSA 3VD5A 3NV3A 4LORA 3ZDVA 5IK4A 3SH5A 5FY1A 4FTBA 1VR3A 3RNSA 1DYPA 4BB3A 3KM5A 4Q2FA 3RJ2X 3ZXEA 2QQOA 1G9FA 2ZEXA 4COUA 3GZEA 2ADDA 3MICA 3MPBA 1OF4A 3DPRB 4RR3A 1OOPB 4BQ4A 5ACA2 4Y20B 5IVFA 2VVFA 4EZ4A 4JTOA 2CL2A 1NCRA 2XDVA 3IB3A 4R9BA 1RJ8A 4OI0A 2B45X 2SLIA 4LMFA 3CO2A 4IERA 4BIFA 3VBRB 1RUG3 1UXZA 2VNGA 3H7JA 3UL2A 2ZBJA 3BU0A 4FOVA 4RHV3 5J48A 1J3QA 5FZKA 2ORXA 4DS0A 3FZ3A 1NG0A 1F2NA 3DKWA 1XNBA 4EN0A 1QIQA 4BA6A 1DYOA 1PVC2 1J58A 4QB1A 4FPCA 4R52A 4MXWB 3HT1A 2RJLA 1RHI2 2J1VA 4Q4Y3 3RI9A 4E2SA 5FPZA 4LKEA 3T08A 5H9QA 2EXIA 1QJFA 2P37A 2ZJCA 3AK0A 1CWPA 2YB7A 5I93A 4I0BA 1Q8VA 5BNNA 4GKXA 4B4PA 3APBA 5A3MA 3D0SA 4XUNA 4IW3A 3RZZA 5EIYB 3H1WA 5DUWA 1NLSA 4QX5A 1RUJ2 1CAXB 3IAQA 2ZGQA 1OUXA 5DZFA 3THPA 3KGZA 1OH4A 3WP6A 4RQPA 2WIIB 2BW8A 3IDCB 3ZN6B 4YARA 4IEXA 5FK8A 5KXBA 3HQXA 1YJKA 1ZRCA 1QJX3 1SCSA 4CPBD 2JD4A 2HWE2 1WCSA 3M3IA 1DFQA 1W05A 1RUD1 1YQ8A 1BVP1 5IHRA 1F9KA 2YBKA 5JXJA 4HXCA 3LA3A 3N36A 3J7MA 4UBHA 1NXD1 2EAKA 2XL7A 2EIEA 3VDAA 2FDGA 5CB7A 5FZOB 1NKGA 3C7OA 5BNPB 1C1FA 4LBMA 1KEXA 4GAZA 4MYEA 5ERLA 1G8WA 4ITCA 1VAKA 4CEWA 1R1A1 4A7YA 4MXVA 2XHNA 4W50A 1GWLA 3IDBB 4AK3A 1MVQA 3WP3A 1RUC2 3CKHA 1NQJA 2C1FA 2FCUA 1XYOA 2WFF1 5AFBA 4QDSA 1MS3A 1EV12 2H6BA 2D7FA 3O7OA 3OPTA 4TXWA 1JH5A 2YXSA 5FZCA 3DV8A 2JE7A 3Q8AA 1VAVA 4AXOA 4XIKA 4WM7B 3WX5A 4BQ1A 1ZRDA 2B39A 3FC0A 2VVDA 4FAHA 4KH9A 1QH7A 1W6PB 1SLLA 4UF0A 1H6XA 3MLLA 3NNFA 1ALYA 2PELA 3T09A 4DNYA 3PVOA 4CU8A 5HBAA 4GWNA 2QQWA 4DEVA 2J1RA 4LQRA 3VBFB 2VMFA 4BMBA 4ZS3A 1TQ5A 3DYOA 4GWIA 3ZKUA 4CDWC 2VO5A 1Y43B 4I30A 5FXWA 4IV3B 4Z2AA 2Q1ZB 2VUDA 2QCSB 2X5IA 1ZBA3 1SPPB 4FFGA 5DDJ3 1UD1A 5EQUA 3T0DA 2BEOA 1WUVA 2BRTA 1W6MA 1PX3A 5A7NA 3WNPA 3N3HA 1IQDC 1ZNPA 5L7OC 4AQSA 4JHTA 4DRRA 5FYTA 1NCRC 1W0NA 2ARCA 2GC2A 4PIZA 2QDNA 3H8RA 4NIGA 4QDRA 2WNUA 4LKDA 4META 2HWB1 5FKBA 2A7AA 4W8JA 2AC1A 2GMMA 4NN0A 4AI9A 4GKYA 4RD7A 2UY9A 3LIGA 3GCWA 3UKTA 2TBVA 3QD6A 2HYKA 2ATFA 4XOGA 3WQ0A 3WV6A 3VBOB 2LM3A 2GP3A 4AW7A 2ZX3A 4FP2A 3URFA 2QZ2A 4QQLA 4C1WA 2IWGB 2P5BA 3GCXA 2H0BA 5F39A 1BMV2 1PIV1 4DPNA 1H0BA 3MBWA 4GWJA 5A7QA 2E26A 3C7HA 4BCUA 4XFGA 1GKBA 2BGCA 2BVBA 3FX3A 3PLQA 3W58A 4MGSA 4YM3A 2W0XA 4QMAA 3TYJA 5FPBA 2PMWB 3B00A 3ZVXA 5J7MA 3RZHA 4WVWA 3O1OA 3JXSA 5E6HA 1PZ7A 2YPDA 2W52A 1DG6A 3LSEA 4RQPC 1WCDJ 1RHI3 2ZTNA 3B7MA 3PUIA 1NCQA 4L0PA 5D2AA 5L9BA 3KT1A 3T30A 4KL1A 4DINB 2WYFA 1RUE1 3ZXKA 4YZ1A 1CAVA 3VKMA 5F3IA 2RMU1 3BOPA 2ZGNA 2PHTA 1T6GC 1S0FA 4Q5OA 1BK0A 1LHUA 2IXCA 2XUEA 1COV1 4F3JA 1SG3A 5A80A 2GP5A 1JOJA 1QNYA 1WLTA 2LROA 2VVEA 2F6BA 3MHZA 2QQIA 4BE3A 1RUJ3 4PLNA 3TEYA 3KS7A 5I8SA 1NE4A 1W8FA 1LJ7A 4XEZA 1D0GA 1RL3A 2W1QA 2DU1A 4YVSA 1WD3A 3PJYA 3WQ1A 4QGNA 2ZX0A 1L7QA 2LALA 1WW5A 5CA6A 5L36A 2ZGKA 1DLLA 3AJYA 3FBYA 1VLNA 3RZJA 2BOJA 3VLBB 2V4AA 4XUPA 3WY6A 2DURA 2IXHA 3DYPA 1ENRA 3POFA 2HWE3 5FYCA 3AMNA 5A7PA 4FSJA 4I02A 1TVGA 4GA9A 4HZFA 3T0BA 1N1YA 1X9TA 3MI8A 1J84A 2HWC2 4TSVA 1A8MA 4CP1A 1MEC1 3NKTA 5SV8A 4BOWA 3POIA 4M3CA 2E51A 3W59A 2BWCA 1QWRA 2R1DA 3E6BA 2A1XA 4CTEA 4NRQA 4UT5A 4COVA 2O8OA 1V9U1 4UFHA 3AMQA 3M4FA 5FY8A 2TNFA 3ZFFB 5DN2A 4CA9A 1VBD2 5JIUA 3QOPA 4QQOA 1PO21 3ZOIA 1RUC3 5T54A 4Y1YA 3FBMA 4AI3A 4M01A 5BY5A 4HN0A 5DAQA 1LEMA 1QY4A 1HRV2 1XQNA 4I3GA 1VRH2 5D8AC 3AFKA 1EV13 1W9YA 3ASIA 1JODA 1GP6A 3ZMOA 2DVBA 4LBJA 1A6CA 3N9OA 1R1ZA 5HV0A 1VBC3 3CEWA 1H2KA 1FV2A 4BPZA 3P3PA 4KU7A 4TYSA 4M0HA 4FPHA 3THCA 3AB0A 3OTFA 4DFSA 1SDDB 5KXCA 1AF9A 1QHDA 4O9EA 2D97A 2R7EB 1HXS2 4KI5M 3WNKA 4QPIC 2Q8OA 5K9YA 1V70A 2HEWF 2HBTA 3O1UA 1K42A 4Z2WA 1PO13 4Q8LA 3OEAA 2G1MA 3PTRB 4FOYA 1G6NA 2D6OX 2BP6A 1BBT2 2XGXA 2RE9A 4I09A 5FP8A 1TME1 4KNCA 5AC91 5JXGA 5KWRA 1JYCA 1URXA 3BI3A 5JWPA 2Y6HA 1UW8A 5LBBA 2VCCA 5F32A 3ZFEB 1YUDA 2E31A 5FPUA 4MZUA 1H30A 2I2SA 3JUUA 2DDUA 1ZZCA 5JIAA 4F8AA 4QQ2A 3ECQA 1NXMA 3MEPA 4TTGA 3V0BB 2MNGA 1H6YA 1OURA 1NCQC 4HKLA 1OA2A 5C3RA 4QKDA 2ES3A 1DZRA 1X50A 2BZDA 2ORZA 2QQJA 2JIGA 5A7WA 5HPOA 1HQLA 4K6BA 5FRAA 1AR62 1NYWA 1R082 1POV1 5G04L 4JQTA 3MFCA 2EXJA 1KFXL 2B4KA 2LW8A 1OA3A 3D8CA 1ASJ2 1EAH1 1RMU1 1SDWA 3MFAA 1FATA 1W3XA 1Q43A 1W6NB 4E2QA 1T6BX 3BB6A 4YVSC 2IC1A 3CJXA 4GZ9A 3K4ZA 2CWSA 3GALA 4NIDA 1V6IA 4XCAA 3J7HA 1R092 4XF3A 2DVDA 2VAUA 3N9QA 4LLOA 3WF1A 2RDSA 4EN7B 2YMZA 3MIFA 1WBLA 3T2PA 3N9MA 2ET1A 5BNOA 4YSFA 4XPVA 1UYYA 4CDXA 2R062 5JAXA 2G9FA 2JX9A 3K4AA 3IAPA 3VKOA 2VXJA 5KHJA 2Z79A 4MGIE 1RC6A 3ILNA 3MZHA 1CPNA 1PGL2 2C9AA 1D2QA 2WJSA 1W8OA 4WVVA 1RJ7A 3O1TA 1XE0A 5C8WA 2BTVC 4RL7A 4C0HA 4AFCA 2QFEA 5KR7A 1F35A 4ATFA 3B93A 1EPWA 4TZDA 1LCLA 4HLTA 2LRPA 3NNMA 4E4DX 3OY8B 4YG0A 1ST8A 5FYZA 5KBFA 1PM7A 5GZEA 5DABA 1W39A 3H1YA 5A33B 1VJ2A 2QKDA 1LGNA 1W99A 2Y6FA 1H8TB 5J09A 1U5XA 3WSOA 2FDFA 4PT6A 3LA2A 2HWC3 4K8FA 2XONA 5I8YA 3POWA 3H0OA 2PLV1 4PHZA 2W94A 5SV5A 1VB4A 3VBHA 2VOKA 4TLGA 1FOD1 2RJKA 1HB2A 2MEV2 5FMCA 4AI1A 3NAPA 4YW3A 4QDQA 1GLHA 1VBD3 3I2GA 3O14A 4LKSA 1US2A 4DO0A 4HG6B 2A3WA 3SEEA 4CUGA 3T2OA 2VMDA 1SEFA 2PHFA 1C3HA 3VGIA 1GNZA 3JB8A 3JD71 4AEDC 3AP5A 3Q8BA 1HRV3 1VRH3 1B09A 1H2LA 4XTMA 3ZIWA 3W5MA 3AMPA 1DIWA 1Q8SA 2RM22 1OQ1A 2WAOA 3PUQA 4HONA 3J26N 2V5DA 5A1FA 4Q4X3 2JG8B 1AYN2 1ZA4A 1N3PA 2JENA 4IEZA 4LXLA 1B35A 1KDKA 1N47A 1H1AA 1NT0A 2VPVA 1W28A 4MH0E 3VBSA 2EAAA 3KCXA 3EJKA 4FFIA 2HYXA 4QKFA 4LTAA 3VZMA 1UY1A 1HXS3 3J7LA 2JB4A 3HJRA 4CZSA 3UJQA 3NVCA 3LCPA 4MADA 4XAEA 4AAPA 1V0AA 5J36A 2ENRA 3UGHA 3UK9A 1ULEA 3IPVA 3KWVA 4IGQA 1IOAA 5C9AA 2JICA 4ZZ8A 4PQ9A 1ND3A 5JZGB 4K1YA 1BBT3 1S0EA 2WSUA 4Y5Z0 4BM8A 4E2GA 4Q4V2 3MYXA 5LY1A 4AGGA 5JPNB 3LDKA 1ENSA 2P1BA 4FXKB 2D3SA 4NRPA 3WXPA 2PQQA 1F15A 2C9KA 4OI2A 2GH2A 3RWNA 3ZFGB 1CZVA 4AVCA 1WKYA 5FZ6A 5C5TA 5F3GA 2JG9B 5FO7B 3B02A 2VW0A 1APNA 2WNVC 4FPYA 2XJVA 3ALQA 3CL1A 1GV9A 3IN9A 2PQSA 4WBBA 3INAA 3Q8CA 4N9IA 1K3IA 2VQ0A 1LAJA 3QLQA 3PURA 4HK8A 2H6CA 5CG8A 3ZXAC 2RR12 5T5OA 1RTVA 1TG7A 1UL9A 2WLPA 2XH6A 1PK6A 3LSDA 4M3CF 4D7TA 1AR63 2VZOA 1R083 1NA1C 4NJ4A 3JZVA 2C24A 5A1AA 5BNOC 1LOGA 1RVF2 4CDXC 1N3QA 1QEXA 4IE6A 4XFCA 4NAMA 1RUI1 1ASJ3 4UW5A 2J1UA 4QPYA 4PBOA 3DXTA 1BEV2 2D6KA 2WWSA 3K3NA 3AJZA 4I01A 4KG0A 4PCRA 3T4VA 1SFYA 3AMHA 3DPRA 1GZTA 2ZACA 4H7MA 1YIFA 2BBVA 1OOPA 4V2WA 2VUAA 4Y20A 4OUSA 2CYFA 5FZMA 4QHBA 1UQXA 2R072 3AL5A 2E9QA 2DTYA 4D6RA 2Y0OA 5FY9A 2FZ2A 3VBRA 5H9PA 4LK6A 1RUF2 3B01A 5DAPA 3KV5A 3VKNA 2BGPA 5FZHA 1W2NA 5FOJB 2D93A 4RFT0 1PNGA 2G4IA 4Y5TA 5E89A 3B69A 1CJDA 3IKWA 3OGVA 2R30A 2VW2A 1UN1A 1J3PA 2GNMA 4A2UA 4AFMA 4BDVB 3FWEA 3MO4A 4MXWA 5JPMB 4X6RB 4F7ZA 4YZ2A 3RMXA 1CIYA 3VBHC 3P6BA 3ZSLA 4CVUA 4XF4A 5F3CA 1WLWA 4PQQA 1AHSA 3IM0A 2P6CA 4HVOA 1J83A 3VHNA 4UBGA 3P5BA 2JXAA 1NQDA 3NJZA 1E57A 4Y4RA 5CFDC 5J96B 2DVFA 1JUHA 1ZBA1 1D0HA 1K5MB 1MZEA 2PFWA 1CGPA 1XNAA 2WNOA 3Q8EA 1TMF1 1YRZA 5T55A 4P9YA 4OVEA 3CLPA 1C4RA 2W1SA 1UZYA 5IK7A 5JOXA 2YHJA 1DQ6A 1CZSA 1ZRIA 3I2JA 1WMEA 1CAXA 1X36A 2Y0IA 5JSOA 4OHXA 1AX1A 4GH4B 5FDBA 5KHIA 2PHLA 5FZ1A 1GYKA 3G6JB 3SNMA 1OKQA 1RUG2 5FQ0B 5BPXA 5T3NA 3U78A 3HBZA 4KBBA 2XPJA 2MEV3 3B5LB 2L9LA 4RHV2 4TN7A 1OKOA 5F1RA 3KD4A 1B35C 3T2TA 3VBSC 1M06G 3PHMA 3NNGA 1HV1A 1LOAA 3U1XA 2BV4A 1O5LA 2ZCWA 4Q4Y2 5ACA1 2BU9A 1CESA 5LBEA 1UZZA 2N7GA 5FYHA 1ZYBA 4Q1PA 2E6VA 3ZYIB 3WNLA 1RUH2 1NZCA 3LOIA 5C9AC 1E5RA 4QPGB 1KDMA 2RM23 2ZAAA 1H9PA 2BYVE 1X9PA 1LOBA 3K2OA 2E7AA 3ME2A 2FMYA 3POEA 5BNPA 4XMIA 4S2FA 4H14A 5L73A 3NMBA 4WM8C 1QQP2 4N43B 4CRQA 3TEWA 3K75B 3KV9A 4OQ9A 1ZA7A 1Y4WA 4K20A 1PVC1 4A6SA 3ZR6A 4Q26A 4INDA 5C33A 1KS5A 5DAWA 5CFCC 1O7FA 4MV2A 2OYZA 1RHI1 4K40A 3E6DA 4XUQA 3WDTA 2VMEA 1AR72 2VZSA 1NLQA 3KT4A 1DF0A 3VZNA 4MOAA 1F5JA 4BQWA 1XBFA 2R6QA 3B94A 1LGBA 3GHMA 4MSVA 1RB8G 2VMCA 3ACIA 2QQVA 2GNTA 4WM7A 2CGPA 2DUOA 2XLAA 1O59A 4Y1VA 1C57A 3ZN4A 4Q4V3 4GMP3 1PK6C 1W6PA 3AMMA 1IKQA 1YJLA 2XBO2 5FUPA 4P9JA 1RUJ1 2A3YA 4I0WB 4CPBA 4E8DA 1XSRA 3O1SA 1LHNA 2WN3A 3GDBA 2W2IA 3VBFA 4BLIA 2DFCA 4IGOA 4HSJA 3OD0A 4OMDA 3RZKA 4IV3A 4GALA 1UOBA 4MGKE 1SPPA 1UAIA 1XE7A 2FMDA 2W47A 1UX7A 4YYOA 3BUCA 2ZHNA 3DPRC 3WNOA 2B42B 1OOPC 1WW7A 3S30A 3Q8FA 2JE8A 2HWE1 5C4WB 5BUVA 4YWAA 4HVRA 5FWJA 1Q8OA 1HX6A 1QGLA 2P3KA 1GICA 3DCQA 3P1IA 2CTVA 2W91A 3DYMA 3LD8A 4MUVA 4XACA 1S0IA 3VBRC 5EJ1B 1RVF3 3H3LA 1MPXA 3ZXFA 2IFRA 4AZZA 4XQWA 4XYXA 4JKMA 4PI0A 1DP0A 3AZYA 3L2YA 5E16A 5FLHA 3W21A 4KG8A 4YRDA 1YHFA 4XFIA 1BEV3 4OHZA 5B2GB 3WW3A 4Q0VA 1KXGA 2DFBA 2W87A 3BOWA 3VBOA 1OHFA 2WC2A 3PVBB 1QOOA 5A32B 1GP5A 3KVBA 4LHLA 1RUC1 1C28A 2R073 4IL7A 4D94A 4X8NA 4UW3A 2WQZC 5FZ8A 1EV11 1UWWA 3LB9A 1RUF3 5DDJ2 1HRI1 3PMEA 4BXSV 1MQTB 1GP4A 4UAPA 3FE5A 3OUHA 4KGGA 2YFUA 4O65A 2VZRA 5FOBB 4JC1A 2XJQA 3VB9A 2OZ6A 4AVSA 4EV0A 1FPN3 2BWAA 5LA1A 1WZXA 4G3YC 1IG3A 3VHPA 3WNXA 2VNOA 3I4IA 2ETEA 4XJZA 1RYYA 4C0BA 2KA3A 5K0UB 4HPKB 1KFUL 2NN8A 4LBNA 4FPLA 3POGA 3WHTA 4FPEA 4NPMA 3IZOA 1HB1A 3OGJA 5A7OA 3D3AA 4PDWB 4D3WA 4YZ4A 3LQCA 5CEHA 1LGCA 2XWJB 1D4M2 4Y1UA 2BBAA 4ATEA 1H2NA 4NHXA 3ZN5A 4DEQA 4ZZ5A 4OYUA 5GKAC 2G9ZA 3M2MA 4JZRA 2QVSB 3SKJE 1AJKA 4O9GA 4P5HA 3EMRA 3NW4A 1KJRA 4YG6A 4QHOA 5BNPC 4XDPA 3S5AA 2VTFA 3WLUA 4LBKA 1XPWA 1AXYA 5DAVA 1PMIA 1SMVA 1Z7S2 1UOFA 2EF6A 2VMHA 1U12A 2YBPA 3QACA 1PGW2 4H7LA 4UFMA 1K5JA 4CCDA 4GB33 5A6YA 3ENRA 4LEJA 1BXHA 1M4WA 3I54A 4QM9A 2FCTA 4HMZA 4P08A 1VP6A 3U37A 1LESA 3NL1A 4RFRB 1FX5A 2ZX2A 4QX8A 1RUH3 4W6WA 1BMV1 4JVAA 4LE4A 1IKPA 1C5HA 3AP7A 4WM7C 3HN3A 1DDLA 3KLSA 2IFWA 4LBQD 5EWSA 1MZ6A 1QQP3 4M4RA 3ZFFA 1XE8A 2WO1A 4JGZB 2OW4A 5DUXA 1Z78A 1FI2A 1UXXX 5C6CA 1YCIA 4YW1A 4C91A 3THDA 1JOPA 2O8QA 1EY2A 1ZBE2 2A6VA 2XVGA 3R4DB 4NPRA 5HI0A 1IQAA 3TRSB 5IVJA 2ET7A 5A3LA 4IE4A 5F2WA 5FIXA 1AR73 5I0DA 4CU7A 4P02B 3N7LA 3V0AB 3C8XA 2PHDA 3AL6A 3VZLA 2WYSA 1C8M2 3MPPG 1W06A 1TEIA 3PU3A 4LIVA 1GOHA 2XJUA 3WP5A 2C0ZA 3ACGA 3C7GA 2W95A 3RVHA 4B3NA 4URTA 2CV6A 1JHNA 2XBO3 2XLGA 1T2XA 4RA0A 1OC1A 3POJA 3MUZ1 2OQ7A 2GALA 3CJIB 5CIRA 3S7IA 3SH4A 3O0XA 2JIJA 5CKMA 2ILMA 4NHYA 5JSRA 1QXPA 4ORFA 4IEVA 4ZU4A 1MZFA 3WDUA 3KQ4B 3NJYA 5I8TA 2JECA 1JYXA 1GR3A 1W04A 5CKNA 2WLQA 5CKQA 5B4XA 5FLIA 4BLJA 5JMOA 3DKQA 2D40A 4XZUG 4LBQB 2EXHA 2VUCA 4MHRA 2VBPA 4N90A 2V72A 5FPAA 1LU1A 5FWEA 3VUOA 4XJWA 4NIHA 3ZYJB 3BTYA 3IT8A 1D7PM 2HWC1 2QJVA 1AVBA 2BDRA 3TBDA 5HCHA 5KHHA 3N9PA 3WQBA 4AHXA 4KBZA 1V6KA 1O5UA 3VBUB 4IEYA 4URAA 3ZFEA 2QZ3A 3TN93 4JGYB 1DZQA 4UOJA 5D1IA 4CE8A 4IE0A 1WCKA 3UYJA 3NJVA 5APAA 1W6QB 2DCZA 3V0BA 2ZGUA 1VBC2 3ACLA 1FMD2 1VBD1 4KQ7A 3OD4A 4CP2A 1NUKA 4EROA 1WLCA 1KITA 2ZGMA 1OD5A 1CAUB 1K12A 2BUKA 2CAUA 3WDWA 4Z07A 2NP0A 4XQ4A 1HRV1 1VRH1 1OD3A 2WO3A 2R16A 3NV2A 3T4HB 3USUB 1BKZA 4XURA 3TEZA 1QOTA 1PO12 1VE0A 3AVSA 5JI9A 1Y7BA 4RR3C 3J8F2 3T1MA 5EYXA 4K7JA 4IXLA 4I3PA 1W6NA 3LPGA 1JU4A 1KD7A 2BFUL 4A41A 2UWBA 1NAEA 1UY2A 2VH9A 3GJBA 5A3UA 2UYBA 4DZGA 3WG3A 4DUXA 1GQHA 2AEYA 5FCCA 1HXS1 4R8HA 3WG1A 5IVBA 1DQ0A 2PHWA 4Z92B 2UWCA 1XNTA 4SBVA 3EB7A 4QX0A 4AL9A 2VULA 1D4M3 2YPJA 1UYPA 3OF1A 4COWA 3PUAA 4XXPA 1ENQA 5F5AA 1IZ3A 2AH2A 3WOGA 2QDRA 3PTYA 2JDMA 4Y33A 4HVQA 1BBT1 3LA7A 3W5NA 3I2OA 2QQNA 1O3QA 1VBA2 1VBE3 4ISQA 4E8CA 1PNFA 4OHVA 2YU2A 4HANA 1N1SA 3WNMA 4G9SB 5BNNC 4BXFA 1Z7S3 1AL22 1H4GA 4JDOA 3ZFFC 3RZMA 3OY8A 3MW4A 5LATA 2VJXA 4LHSA 4CYDA 5IATA 2RV9A 5CBLA 2YY1A 3A22A 3VKLA 3AYAA 3GJAA 1LRHA 1ZZ7A 3U4SA 5CISA 4P9GA 3AZXA 1QJY2 2Z5WA 1H8TA 1UNBA 2BNMA 4D69A 1WLDA 2BVVA 2OPKA 2W9XA 3H9AA 4S2HA 3HAGA 4A3ZA 1S0GA 1AR61 3LEIA 5C71A 1R081 4W6YA 4W4ZA 5FP3A 1W9SA 3VD4A 2WZR2 2A6WA 3W9AA 5TSWA 3S6PA 2NYYA 1NY72 4M3CE 1ASJ1 1BCXA 1HIXA 1JU3A 5BYNA 5C5UA 5KC5A 4JKKA 1ZBE3 2WSVA 3GNEA 2Q30A 4A7ZA 2JDAA 1IPJA 3KCCA 4FPJA 1Z0HA 2RS52 1UU5A 3DECA 4MVTA 2P3IA 4COZA 1R091 2A6ZA 1ULOA 3HWJA 4LKFA 3ZSMA 5FZ9A 1C8M3 5F6LB 4CEWC 3PVNA 3U11A 1S0BA 4IQPA 4CDWB 1LB2A 4RGGA 5LK5A 1P8JA 2R061 2WZ8A 2Q8EA 2JG8A 2YC2A 3NSTA 5FY4A 4CSWA 4PF5A 4GQ7A 1O3TA 1PGL1 2RG4A 4X6QB 5L7OB 3EQEA 2IXKA 4JQRA 2HWD3 3I2DA 3ZFEC 3ZO0B 1G9BA 3ZYRA 2NM1A 2QQUA 3USSA 5A3OA 3RWKX 1LKNA 3KT7A 2P6HA 4FXGB 2BPA2 2CNAA 1SFPA 1HN1A 3W20A 4ZXKA 5E1RA 3AKSA 3IIIA 1W0OA 1XJAA 5JZGA 4HKWA 2GSYA 5C3SA 2Q8DA 2AENA 1SCRA 4UFJA 5FY5A 3AZVA 2OX0A 2XWBB 1DU3D 4SLIA 3ZFGA 4A4AA 2X5IC 3CIHA 2JG9A 3RZGA 2XVKA 4XVHA 3ZSKA 3I59B 4OHYA 1FNZA 4E4SA 3R0RA 3MLJA 4Q4X2 2MEV1 4DXRA 3OUJA 2B46X 3CQOA 1VBB1 1IS5A 4W6XA 1FMD3 2WNUC 2WUHA 1FYUA 2FDHA 1I6XA 1UZVA 3VHOA 3WG4A 3RDIA 2K0GA 3OYWB 3OPWA 1PM4A 3RSJA 4LBLA 1YQ5A
chains in the Genus database with same CATH topology
2X8KA 4FPGA 5KXEA 4JAAA 2VMIA 2Z2SB 3A0NA 2RM21 3J8F3 1CAWB 1LULA 5IT6A 2EALA 4YGBA 3AX4A 1UU6A 4AVTA 4ES8A 1JUIA 1AYN1 4XJAA 3VHRA 2C5DA 1LEDA 1Q56A 1LOFA 5CG9A 5GZDA 2OUJA 4DQAA 1MS9A 4LR4A 2HKXA 4H3WA 5GM0A 1MS4A 1WGPA 4Q4W2 2QNKA 5J98B 2GN7A 4OI1A 2OUHA 3J9SA 1H8TC 5K8SA 3MZHA 4CP0A 4AWDA 3U4XA 4CDQB 1SLAA 1VBA3 4Q4V1 4GMP1 4IV1B 1MACA 4MLOA 1QDOA 2VGDA 5JI7A 5KHKA 2EIGA 4XFBA 4AEKA 1UPSA 4AVVA 4BIOA 5JLVA 1AL23 1AX2A 3WG2A 3DGTA 1A3KA 2CWMA 3OCPA 1K5MA 1HV0A 4ES9A 3D0JA 1OA4A 1QJY3 4AFAA 2DCJA 2GC1A 3BCWA 1HDKA 2A3XA 2ZGPA 2ZGRA 2RR11 1GZWB 1QMJA 2DCTA 3MLKA 2ZAHA 5JCTA 4M0NA 4GH4A 3SH3A 3A0KA 4PJYA 4IESA 4AHWA 1ENXA 1WMDA 5C8CB 3WUDA 2WZR3 2RMU2 5FQ0A 1ZVFA 1RVF1 5D8AB 2DTWA 3R4SA 2DUQA 1UU4A 5AVPA 3I8TA 3E5QA 5JSPA 4DB5A 5ABJB 1BEV1 4BH9A 4QGMA 2E53A 5EXOA 2RS53 4QU2A 5GJ6A 4XHXA 5JOZA 4Y1XA 2IXJA 1O4TA 1W6OB 2R071 2TUNA 3C2UA 4LO7A 1UX6A 4QPGA 2R0FA 2RS32 3HIFA 1RUF1 4QPIB 1NE6A 3FLPA 4N43A 1AUYA 2DF7A 3PNAA 3B3QE 4P9WA 1LHVA 1SBDA 2A71A 5JOYA 2JG9C 3AKTA 3BODA 4HBNA 4D7SA 4NWWA 1ZZ9A 1WD4A 2HEVF 2DUPA 4BHPA 1R1A3 2QQPA 1QJZA 1QXRA 3K51A 3VKFC 4XHBA 4Y24A 4FBFA 4EJRA 2JE9A 2WFF3 4XF0A 1AR92 1QOSA 1RUG1 4FPOB 2DCKA 2YDEA 1BJQA 4AQ2A 4J1WA 1PGSA 1IPKA 3AP4A 4RHV1 2W39A 4L2NA 2WT0A 3OBTA 5CAZA 1C5IA 1WW6A 5C4WA 1OLQA 4XZPA 5DG1A 1YFUA 5GALA 3WT3A 4Q4Y1 3RS6A 2R32A 3WCSA 4GWMA 1LECA 2DVAA 1RUH1 3RYPA 4FOWA 3AKRA 3WDVA 2ZA9A 1DGRA 3AYCA 4QT6A 1QQP1 2XUMA 4Y26A 3UKVA 2Y38A 1AL0G 2FBEA 3ZXDA 5A32A 3S0MA 1I9RA 2D3RA 4S2DA 3IBMA 2R042 3LWCA 3MIDA 1AR71 2XKPA 5LEKA 4Q4W3 1S0DA 4YGDA 2X29A 4NHLA 3M3EA 4ISRA 1QJX1 3SXWA 3OPZA 4L9BA 1CPMA 3VN4A 2XBO1 1NLRA 2GMEA 3GYDA 2IZWA 5F9TA 5E8AA 2LTNA 2B5HA 2PYTA 2B7YA 5K0UA 4HPKA 1LOEA 4B4RA 2XJSA 4MX3A 4PDWA 1S1AA 3ZMNA 1RMU2 4HETA 2P2KA 4OFGA 1J1LA 1O91A 3RYRA 4P9LA 3D6EA 2R49A 2ZMNA 3KMHA 3Q9OA 3RRDA 1TNRA 4ZU5A 3WW4A 4EN8B 4QPGC 1RUE3 2XKOA 1FAYA 1CIWA 1Q8QA 2RMU3 4AEDB 3AKQA 4HN1A 5F5QA 4N43C 3UJOA 3AXDA 2WKKA 1JTZX 2KM2A 3DUIA 1FPN2 3E5UA 2D6LX 1Q5OA 5FBZA 5GLVA 4XMAA 3MIGA 3I7DA 1XU2A 1LHWA 1LODA 3NAPC 3BTAA 1XU1A 3J4UH 5F6KA 1BYHA 2RS33 2CGNA 5DDJ1 2WS92 4Q0QA 2WT1A 2E63A 3H8UA 4JGZA 4K3UA 4P9IA 2GNBA 2W68A 2CY6A 2GC0A 3LGRA 4LUMA 2BFUS 2ZZJA 4XILA 4YZ5A 1PHMA 1MZ5A 3N35A 3ZN6A 4P9XA 3V0AA 3WINE 1V9U3 3PJQA 2WA4A 2XB6C 3GZTB 1CD3G 5IK8A 4GB32 4BYYA 5C4WC 2WNVB 1D4M1 2HWF2 5DUVA 1G9DA 4WVZA 4XXAA 1VB2A 3CJIA 5JOWA 4MGYE 3VDDB 4X8PA 3AXEA 1LHOA 1AXZA 4RS5B 1OPOA 3TNQA 3P3NA 1AR93 4AGRA 4ASLA 1ND3C 1Z7S1 4DOUA 1H2MA 2FQPA 1NA1B 3WR0A 1PGW1 1YFYA 4C1XA 3JCIA 3M3CA 1UIKA 4LBQA 4YVWB 4FPKA 1OMIA 1S2BA 1Y3TA 2FZ1A 3FLTA 3JQWA 4UW4A 3UKNA 1O4ZA 1BK1A 2NPIA 1J3RA 3VBUA 3WP4A 4DXZA 2OA2A 4JGYA 3AYEA 3MW2A 1XNDA 1RGSA 1W6QA 3WCRA 2AR6A 3H3ZA 2ZS6B 3NO8A 4FQZA 4XF1A 5K0UC 1XNCA 4K21A 1CAUA 1AR82 2R043 1UMZA 1H1IA 2Z42A 1YLLA 1QJU2 3T1LA 3USUA 1RUOA 2D43A 1C8M1 3LAGA 1YWKA 3WDXA 2G9GA 3B9CA 5DG2A 3MDPA 5E88A 5CFDB 1KJLA 4N7UA 4NOTA 2B9UA 4LBOA 4EWEA 4F83A 1DHKB 4B29A 2A5ZA 1O3SA 3V56A 4HK9A 3TN92 3RI8A 1RITA 4J6GA 3SMHA 2R0HA 1UF2C 1RMU3 1UKGA 2EA7A 4L99A 3RJRA 4EN6B 3VV1A 3ES1A 4PLOA 3WQ7A 2F4PA 4N53B 2BNOA 1G7YA 4TWTA 4V1PA 3H3UA 4QD2A 3SCGA 4FT8A 3OBRA 2PTMA 3MIBA 4QQHA 3ZYGA 2ZOEB 3IWZA 3KB5A 1D2SA 3O12A 4NWVA 3O0WA 4JGZC 5FO8B 4JDNA 2VECA 4YLZA 5AFEA 1VBC1 5JR7B 5H9SA 1FV3A 1FMD1 4WM8B 4GIQA 5FFOC 2ARBA 1GBGA 1ULDA 4JCKA 1PZ9A 5CFCB 4CEYB 4KWJA 2VG9A 4AI2A 3QH6A 4L92A 2WS93 4XFFA 4DFSA 2YGMA 1OQDA 1PO11 4LT5A 3J8F1 2GNDA 2I07B 2D6NA 4WVMB 4Z82A 4OUMA 1POV0 3CJIC 2DCYA 4N7IA 1I1EA 1IGOA 1VBE2 3PMSA 3TOJA 3ILFA 1U5YA 2PLV3 1J59A 5DXDA 5CU1A 1FOD3 2E7QA 1ZZ8A 2Q4SA 2YUEA 5JDBA 4Y22B 3TNPB 1ZREA 2ERFA 4CDWA 2HWF3 3VZOA 2PHXA 5LRRA 3E5XA 1BZWA 2WFPA 3ELNA 2VNRA 1ND2B 1OSGA 3ETQA 1VBA1 2XJPA 3JD73 3VBUC 3ZPYA 5L7OA 4MGZE 4JGYC 3VZKA 1MS0A 3SHRA 1ULFA 2PN5A 3WZ1A 1X8MA 4YM0A 1DQ5A 1AL21 3ZDSA 4DMIA 2PAMA 5JMCA 1D4VB 3UV9A 5J37A 2RS12 4DY3A 5CNAA 3VBFC 2R1BA 1H4HA 1QJY1 4A7KA 2BNNA 1WA4A 4KGQA 4IV3C 4XF9A 5I0TA 3I59A 1SLIA 2GAUA 2WZR1 4B8EA 1IHMA 5FO9B 3A4UA 4FAGA 1TE1B 2WNEA 2K2SA 1PZ8A 1YYNA 1NY71 3POYA 5FMOL 4CDUB 3M7AA 3ROUA 1IS3A 1RB8G 4OI0A 4YW5A 1V6MA 3OYWA 1AR83 2HWD2 1Y9QA 1L3JA 2RS51 3EHKA 1QKQA 1QJU3 1V6OA 1UIJA 1QXJA 1YFXA 4W65A 1V00A 3VBOC 1HQNA 2GC3A 2RHPA 1CAWA 1S2KA 2VMGA 1BVVA 5T5LA 4FPFA 2YZ4A 2HJIA 1HQWA 3ZXLA 5GLUA 2GN3A 4Y4YA 5GZGA 2OVUA 2A70A 4ZKTB 3NWKA 4JV4A 5DZEA 2VOWA 2W08A 3JU9A 4I2OA 1RUI3 4HL0A 1H1MA 4AVBA 2GZWA 1DGWA 3HMYA 4LO4B 1ONAA 4CDQA 3AZZA 4U36A 4IV1A 2UU8A 4KWKA 1AYM2 1YFWA 2NLRA 4L97A 2O1QA 3JBG2 1CX4A 4A3XA 3L2HA 4Q27A 1HRI2 4B7EA 1MS1A 4R9CA 4Q4X1 4K1ZA 4AI0A 2WQ4A 1N1TA 2FHRA 4XBNA 4R9AA 1GZWA 3AFGA 1RINA 3NV4A 1AJOA 5C8CA 1GSLA 2XJTA 4IEPA 1LENA 5D8AA 3AP9A 5BV6A 1N1VA 1DGWX 2SBAA 5ABJA 1TMF3 3QCWA 4YW2A 4DY5A 2XVLA 3GBGA 1DQ1A 1AX0A 4Q29A 1G86A 1DBNA 1OPMA 2PHRA 2D98A 1F5FA 1W6OA 1C1LA 1SLCA 4XTPA 5KHGA 4YW4A 1V6LA 3VL9A 4Q4W1 1I3HA 3HR9A 1F31A 2LUWA 1A78A 1REFA 4QPIA 2UY8A 5A33A 3ZX7A 3LOBA 1AXKA 3FLRA 2Z69A 5ACA3 2UWAA 5DUUA 2MHFA 1S0CA 4IEQA 2H0VA 1G9CA 2QUOA 1HKDA 2XG3A 3FUOA 3R4UA 4AHZA 2RS13 2D44A 4LLFA 1PVC3 4L8QA 5L19A 1KRIA 1W2UA 2AUYA 3ES4A 5JVVA 4E27A 2AREA 3D4KA 4OI4A 4XFHA 3BIWE 5T50A 4C90A 4PLMA 4AYUA 4EN9B 2VOXA 3DN7A 3WVJA 1ZZBA 1RUD2 4S2GA 4WV8A 4RR3B 5CVRA 1TNFA 5I91A 4NVPA 1NCRB 1IS4A 2E7TA 2WZPP 3QBQA 1GANA 4XFAA 2GDFA 3EXUA 2KXLA 4XW3A 2B8MA 2RS31 3GZAA 4CDQC 4FP3A 1CONA 2A6YA 4BWOA 1R1A2 4IV1C 5EZWA 2XJRA 3BALA 3BU7A 2IXLA 1OFSA 1SBFA 1YI7A 4JRLA 2YROA 4R4ZA 2ZZQA 5GZCA 4XE9A 2WFF2 3MIHA 2TEPA 3NV1A 2ZGSA 5BNNB 1H9WA 2D5HA 4J1XA 4NR1A 4E9KA 1A8DA 3ZSJA 1VAMA 1U5ZA 1XYPA 1FT9A 1UKRA 3KCYA 5AVAA 5T5JA 5C8CC 4YGCA 1AYM3 2HEYF 4RQPB 3S7EA 4XQDA 1LTEA 3JBG3 3OJBA 4GULA 1HRI3 1AR91 4FCAA 1IS6A 5ABJC 1X33A 1MR5A 2ZMKA 3RQ0A 1HW5A 2GMPA 3SISA 3RMYA 2HWB2 3WW1A 3EBRA 3SCFA 1CN1A 4GXLA 3B9IA 2OIIA 4PBPA 4AF9A 2GU9A 4AEDA 4UW6A 4N9HA 2JDZA 1MS8A 4OHWA 1LR5A 4D7YA 3VL8A 2DYCA 4B4QA 2ZHKA 4CEWB 2EXKA 3ZIXA 3SCHA 4AQ6A 2O0OA 2XHKA 1PIV2 5BNQA 2I45A 3H50A 2PAEA 3MIEA 4BZ4A 2R041 3O5SA 3M1HA 1CQ9A 4XIOA 2I74A 3M8LA 2YC0A 2VQAA 1F8VA 2ZX1A 3PVEA 2D6MA 1OI6A 2WA3A 3O0VA 4OLLA 1ZZ6A 2CGOA 4IEOA 3V64A 1Q8PA 1QH6A 1HLCA 5J3UA 5DZGA 1RUE2 3RG0A 3THTA 1QF3A 4XJUA 2JG8C 4NHMA 2X5IB 4AEJA 2VU9A 4RGAA 2JEMA 1XXNA 1COV2 4H55A 3KSCA 4YZ3A 1W6MB 2WNVA 3AP6A 3MF6A 1X82A 4IEWA 4LNVA 3TB0A 5KC6A 1GNHA 2WNUB 1CVNA 4Q8KA 3VDDA 2XL9A 4ONUA 4YNIA 1UCXA 1JXNA 3K48A 1H8VA 4JRAA 4LA2A 4RS5A 5FREA 1DQ4A 5JZGC 1NA1A 4AFDA 4Q0UA 2AYHA 3H1MA 3R05A 2K9ZA 3OGGA 2WT2A 4AE2A 2PAKA 1RUD3 2VY0A 3ZFGC 3N4MA 3GBWA 1FPN1 4Q1RA 4YVWA 5IUQA 1OLRA 3GHNA 1N3OA 1MEC2 4AGVA 5I0UA 3SITA 2A75A 4G4FA 2YGLA 4AHYA 1V9U2 4YM2A 1SACA 3M3OA 2VUJA 1QNWA 5EFUA 5HCBA 1AZDA 2WS91 5GLWA 1OQEA 4P14A 3ZYPA 4WZCA 1KS4A 1PO22 4XJ8A 3HN1A 4LO5B 2ZMLA 3E97A 2ZKNA 4LHKA 4I0AA 3C3VA 4QXKA 1NCQB 5GLZA 3CU7A 2ZHLA 4QQPA 4YM1A 1CAVB 2ZHMA 1ULCA 4LO6B 4HKOA 3U07A 4LE3A 4FQ4A 4GB31 1LOFC 1ZRFA 1VBB2 3JQXA 2HWF1 1DGRN 4R4XA 3SLIA 1EYBA 5CFDA 4AG4A 4LHNA 1SFNA 2UURA 1I5ZA 1VIWB 1JW6A 3GF6A 4YVSB 4PIYA 3HT2A 5FTTC 2D6PA 4OULA 2V73A 1FXZA 4M00A 1YXWA 3ILRA 5FAXA 1NOVA 2PA7A 2A73B 3KZ4C 4N53A 1GZ9A 1TME2 3D5OA 5AC92 2HWB3 1SLBA 3M3QA 4QM8A 5BXXA 4HSLA 1U0AA 2D3PA 4M3CB 5GLTA 5HCAA 2CAVA 4E4ZA 1K5MC 1PVXA 1V6NA 3RYKA 3ZXGA 1MQTA 4Q0SA 1ZRRA 2PHUA 2AGSA 3IDEA 4R9DA 4Z1VA 1RUNA 4GH4C 5FMOS 1GFF2 4WM8A 1ZM1A 2ZPXA 3MF9A 1CR7A 4OZXA 1PIV3 1AR81 2ZABA 3WD5A 5CFCA 3ZXJA 4CEYA 1QJU1 1U5IA 1FNYA 5LEJA 2Q5TA 3R6SA 2IXIA 2DVGA 3FUQA 4RSUA 1EAH2 3JB4C 1MS5A 4EWDA 3QH7A 4Z8BA 5FPXA 4LULA 4WVMA 5K7PA 1SLTA 1C8NA 3VDDC 1XNKA 1GZCA 4RS5C 2ZGLA 3HD8B 3N7JA 4LUKA 3TN91 4UXAA 4Y1ZA 3TAYA 1S55A 2P34A 4Y22A 5EYYA 1COV3