2DVDA

Crystal structure of peanut lectin gal-alpha-1,3-gal complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvdA00
4PBPA 4M3CF 5JMCA 2ZGUA 2SLIA 1V6LA 3RQ0A 3ZSLA 5GZFA 4FPCA 1PZ7A 3O12A 4Y1YA 5HCBA 4Y22A 3DUIA 5E8AA 2ZBJA 1HDKA 4FPKA 2ZHLA 2UWCA 2AGSA 1V6KA 4FOVA 1LHNA 5CBLA 1GZWB 3OY8B 1URXA 4YFZA 1LEDA 1SLAA 2ZGKA 5JOWA 1QDOA 1WW4A 4AWDA 5GZEA 3AZWA 2ZHKA 3WDWA 1QOOA 2ZZJA 3GNEA 4Q8LA 5KXDA 2PHRA 3ZSMA 1LOFA 4Q1PA 3POYA 4YM0A 3R4UA 1FX5A 1G9CA 3AZXA 1MS8A 2C5DA 3V0BA 1DBNA 3POWA 1MR5A 2ARXA 3ILRA 4HANA 1SLIA 3SH4A 4Q8KA 4LBNA 4AVTA 2SBAA 4ASMB 1HLCA 4IQPA 1LULA 2B7YA 5H9QA 5GLVA 1VAMA 2D3SA 4AVVA 3T1LA 1LTEA 1LOAA 1ENSA 4UW3A 4YW5A 1QOTA 2VW0A 3RRDA 3GALA 4LBQD 3MW3A 2ZGLA 4YZ3A 3WCSA 2JE7A 3AX4A 4FPEA 3ZYPA 2D44A 4U2AA 4BPZA 4Q2FA 4FOWA 2PHUA 3PMEA 5T55A 4OZXA 3WLUA 2R49A 3AXEA 1S0FA 2E6VA 2P3IA 2UWBA 3D5OA 2GALA 5KXBA 2WJSA 5KXEA 3IPVA 5JOXA 1I3HA 2W39A 2WT1A 3AK0A 2FMDA 3USUA 1LOEA 2WSUA 4FOQA 3ZXFA 4BM8A 2D3PA 3Q9OA 1SBEA 1FNZA 4RL7A 3FBYA 1S0JA 4FPOB 1PZ9A 1WUVA 3O0WA 1GNZA 4YGCA 1W6OA 3BOPA 2DVFA 5DG1A 2H0BA 3R05A 3JUUA 1CVNA 3C2UA 1HQWA 4FP2A 3ATGA 4DFSA 5KXCA 1C1LA 4ZXKA 1JYIA 2D6LX 4AYUA 4XXPA 2ZGPA 1IKPA 4R9BA 1ULCA 1WW6A 3KM5A 1QF3A 3N36A 1LHUA 4AGRA 3AXDA 3FLTA 2GNDA 1W6PB 1MACA 4PF5A 2WSVA 4YM1A 3POSA 1CQ9A 2ZGOA 3OGGA 5JVVA 3BTAA 3I4IA 1N1TA 3OBRA 5GLZA 5GZCA 3LSEA 2DVAA 1CIWA 4YG6A 2R0HA 3JU9A 2ZGTA 1S0IA 3HMYA 3ZXLA 2EXHA 3OPZA 1BQPA 1LJ7A 2ERFA 2ZGMA 1CESA 1N1VA 3MW4A 1KDMA 5JOYA 1SCSA 2NMOA 1A78A 2A71A 4FP3A 4M00A 1S1AA 1CPMA 4XJWA 1V6JA 3SH3A 2VW1A 5CA6A 2E53A 4C1XA 4U36A 1LGBA 3B3QE 5DG2A 1H9PA 1LHVA 1LENA 2DU0A 1F31A 4YLZA 5AVAA 4LBOA 5E88A 2CNAA 4W65A 4SLIA 2ZGSA 3SITA 1H30A 3AZZA 1AJOA 1WBFA 2A6XA 2PHFA 2WNEA 2NN8A 5T5PA 1JW6A 1ULFA 2Z42A 1ULGA 1IOAA 1UN1A 4Q27A 1KQRA 2EALA 3AP4A 3N3HA 1IS4A 1NLSA 3APBA 2WT2A 4Y1XA 4F83A 4M3CA 5H9PA 2A3YA 1H9WA 1OFSA 2CY6A 2D6PA 2UU8A 1I1EA 3B01A 1QU0A 3KQRA 4UW4A 3O0XA 1G9FA 2A75A 2NM1A 2G4IA 5T54A 2R1BA 3V0AB 2E51A 1WLCA 4GKXA 3SLIA 3FUQA 2P2KA 4YM2A 1JN2P 1AXZA 1DQ1A 3UL2A 3WV6A 2GN3A 5DUUA 4XZPA 1PZ8A 3VKMA 2AH2A 1BJQA 2NZ9A 1MS3A 1MZ5A 1C57A 2JKBA 1N3OA 2NYYA 4Y1UA 1UMZA 3ZXKA 2XB6C 1HKDA 3N7KA 4XILA 5DZEA 1VALA 1GICA 1AXYA 1V00A 1MS9A 3NV2A 1DYKA 3IN9A 1LU1A 4FOYA 3SISA 4CRQA 4LBQB 4PCRA 1QKQA 1YO8A 1V6NA 3VKNA 1GNHA 4YG0A 3ZSKA 1JUIA 4YW1A 5EWSA 1S0CA 3V65A 3WDYA 5E89A 3VKOA 3AZVA 2A3WA 4FQZA 1IS5A 2ZGNA 2A6WA 4XHXA 1Y7BA 2ZGRA 3L2YA 3V64A 2YXSA 1LHOA 1GZWA 5GLTA 3OY8A 1LEMA 1KJRA 3A0KA 2UURA 1DQ0A 4FPHA 4XJ9A 2DURA 2FHRA 1VIWB 3N35A 4GXLA 1G8WA 1LESA 1SACA 1UL9A 2LALA 4YW3A 1QOSA 3W58A 1V6OA 4Q26A 4Y1VA 4WVVA 1GZ9A 5DZGA 3TB0A 1CPNA 2DVBA 4I30A 1FNYA 3HR9A 1AJKA 4XMAA 3AYDA 4DRRA 2ZMKA 2ENRA 2V5YA 3AP9A 5H9SA 1YRZA 2P3KA 3IM0A 2BQPA 3R4SA 1G7YA 5GZDA 4TZDA 1RIRA 3O0VA 1LODA 1Z0HA 3WOGA 2D43A 1Q56A 3OYWB 4R9DA 4FPLA 5T5LA 5EXOA 5CB7A 4FPFA 5CAZA 4R9AA 2EXJA 1N47A 4FPGA 4ISQA 1N3QA 4JRAA 3AFKA 1W0OA 3T2TA 3AZYA 2ZKNA 5IT6A 4K1ZA 4DPNA 1AVBA 3BIWE 3SNMA 5JOZA 3WUCA 3FUOA 1N1YA 1WCSA 2A6ZA 3B69A 2YROA 2LTNA 1W6NB 2ZMLA 4UW6A 1F5FA 1GV9A 1A3KA 2DWRA 2GMPA 1LOGA 1APNA 3A0NA 4YW2A 2VW2A 4YG3A 1SBDA 4Q1RA 1UPSA 5GM0A 1V6IA 4ZKTB 4CTEA 5FRAA 1MZ6A 1LGCA 1QNYA 2W68A 3WUDA 2W52A 2VH9A 3SH5A 4WV8A 5GALA 2ES3A 2JJ6A 4YW4A 2D3RA 1DHKB 2E7QA 5F9TA 1W6QB 3IMNA 4Z8BA 5JDBA 3VV1A 1XQNA 3WCRA 3NV1A 2ZABA 3A4UA 1UZZA 3NV4A 3UJQA 1TEIA 4AGVA 4DS0A 5DUWA 2YMZA 1W6PA 3ASIA 1B09A 1F9KA 1FAYA 1LOBA 1WLDA 1DZQA 1SBFA 3ZVXA 2DUOA 1QDCA 1UZYA 1UX6A 4JCKA 5T5JA 4BMBA 2CWSA 3VKLA 1S0EA 4XDQA 2DYCA 1DQ2A 3AYAA 3ENRA 1WBLA 4Y1ZA 2YY1A 3ZSJA 3PVEA 2VU9A 3AJYA 5IK7A 3CNAA 5GJ6A 1W6MB 2PELA 1BKZA 1IS6A 1C1FA 3M1HA 4Y20B 2C9AA 1S0GA 2YZ4A 4FPYA 3VKFC 3WG4A 4LBKA 3T1MA 4HL0A 5GLUA 2DUPA 1SLBA 4BQ1A 4FVVA 1AX0A 4NO4A 3MPPG 4WVWA 1GANA 1ZA4A 1O4YA 4LBLA 3AYCA 1FATA 4P9WA 1DFQA 2ZMNA 3M3QA 1BZWA 4YZ4A 4XTMA 3FLRA 1R1ZA 1KDKA 1WD4A 5EYYA 5IUQA 3ZPYA 3D6EA 1GYKA 4FQ4A 1LOCA 1WD3A 1Q8PA 1IS3A 2JD4A 2AENA 2DVDA 3AYEA 2DTYA 3B9CA 3BODA 3ZXJA 1CN1A 3I8TA 2OW4A 2WKKA 4WZFA 4C1WA 4ITCA 5GLWA 2WQZC 1Q8VA 1X50A 1WW5A 4XJAA 5F5QA 4ATFA 4PQ9A 2D6NA 4XBLA 2CTVA 1MS0A 2DVGA 5L73A 1ZM1A 5JLVA 3WG1A 2AYHA 2AREA 1J1TA 2CL2A 2DU1A 3W59A 1CJPA 1JBCA 2R16A 3M3CA 5HCFA 3V0AA 3PJQA 4PBOA 4BLIA 2JE9A 5CNAA 4Y26A 1QNWA 4Y22B 4XE9A 1S0DA 3WDUA 2A3XA 3LCPA 2I2SA 4XMIA 5DXDA 1RITA 2E7TA 2VY0A 4YGBA 5IK4A 2DV9A 1SLLA 2A6VA 1HQLA 3ILNA 3OJBA 2NMNA 1A8DA 2WT0A 1G9BA 3TAYA 1LU2A 2PHTA 3PVNA 2D6OX 3QLQA 4GKYA 4K20A 4XYXA 3FLPA 4UW5A 4YM3A 1KRIA 1S0BA 5DUXA 3WG2A 1DQ5A 1NXD1 1IKQA 3ILFA 4YFWA 1O4ZA 4FPJA 4LBQA 1G86A 1AX1A 4YGEA 2P37A 4XJUA 3AP5A 4YGDA 2GNMA 1DLLA 2KM2A 2P34A 4YZ5A 4L8QA 4RA0A 5DUVA 3V0BB 3HN1A 2EF6A 3VUOA 3B00A 3WDXA 1SFYA 5DZFA 1YXWA 3M3EA 3N7MA 3WVJA 1ENRA 5EYXA 1JHNA 1MS1A 1JXNA 5H9RA 3QCWA 1BYHA 2RHPA 1V6MA 4K1YA 1VLNA 3UK9A 4XJZA 2EXIA 2EAKA 2VUAA 4R9CA 1FYUA 5GZGA 1ULDA 3UJOA 1Q8OA 2OUJA 2V73A 4BMEA 2D6KA 3N7JA 3M3OA 1YIFA 2GNBA 2JECA 2OUHA 2ZACA 1Q8QA 3H0OA 2YV8A 4YZ2A 2VXRA 3WHTA 3IPVB 2TEPA 1AXKA 4H55A 4NOTA 1GKBA 3USUB 1MS5A 3IKWA 1GLHA 3OYWA 1LGNA 4AVSA 1AZDA 3RMXA 1N1SA 5SV8A 1G9AA 1D2SA 1W6OB 5FREA 2W08A 5T52A 2D6MA 1DQ6A 2PHXA 1DIWA 4XIOA 1KJLA 2JDZA 3RMYA 1AX2A 1LECA 4GALA 2GMMA 1UKGA 4LBJA 4GA9A 2A5ZA 4XXAA 1W6NA 1SCRA 1MVQA 4ISRA 3ZXEA 3N7LA 4D69A 5BYNA 3AP6A 1QMJA 3OBTA 3ZYRA 4M01A 1ENQA 2R0FA 3RSJA 2XG3A 1DGLA 3RS6A 1DQ4A 4Y24A 4BOWA 1OKQA 2ZA9A 1W6QA 1WLWA 1SLCA 2CWMA 1AF9A 1Q8SA 3FFZA 1EPWA 5T5OA 2ZHMA 1GBGA 4XHBA 1N3PA 1LHWA 1U0AA 2ZAAA 2GNTA 4XBNA 1ULEA 1CR7A 2DTWA 1BXHA 1C4RA 4XOGA 1VAVA 1QGLA 1G9DA 5IK5A 5IK8A 4P9YA 2UWAA 1FV2A 3U4XA 1Z78A 4BLJA 4JC1A 3WZ1A 1RINA 4DRVA 2GDFA 3MEPA 2OVUA 4XJ8A 2P3JA 1W6MA 2Q5TA 1CONA 2ARBA 2GN7A 4MYEA 3WG3A 2AR6A 3LSDA 3PVOA 4XBQA 3WDTA 4Y20A 1D0HA 2NP0A 2D7FA 1FV3A 2ZGQA 4M3CB 1YYNA 1MS4A 3AJZA 1DYPA 3MW2A 4KBBA 2AUYA 1W0PA 5LK5A 1LCLA 3WHUA 1KITA 2HYKA 2A70A 4CZSA 3NWKA 1YI7A 1GSLA 2A7AA 3D4KA 2R1DA 3NV3A 5HCAA 1OQ1A 4GWMA 1UAIA 4M3CE 4P9XA 2CYFA 5T50A 4ATEA 3WNXA 4YZ1A 3DGTA 2DUQA 4AGGA 2EIGA 1GZCA 1MVEA 2EXKA 2GMEA 2PHWA 3O5SA 4XIKA 1WW7A 2WLQA 4LBMA 1ONAA 1LOFC 3WDVA 4XTPA 1SLTA 4GWNA 1JYCA 2A6YA 3RG0A 3M2MA 4DQAA 3AP7A 4K21A 4TYSA 2ZHNA 3INAA 1JOJA 4P14A
chains in the Genus database with same CATH superfamily
3B94A 2JG9C 5JR2A 3NO8A 3K4DA 4GMP0 4QHZA 1W90A 2I45A 4LORA 1GNYA 2IXHA 2JX9A 2BWAA 4Q0QA 3HQUA 4JAAA 4Y22A 3ZKUA 2WQ8A 1VJ2A 3D8CA 2XWJB 2ORZA 4BIOA 4XURA 1JMUB 1OD5A 4JGZA 3GHMA 2B42B 3O1VA 1RUI1 3OY8B 1URXA 3PUAA 4Q4Y3 5JCTA 3POFA 3QOPA 3WX5A 1YWKA 2WNVA 3VDDA 3AZWA 1QOOA 5EP9A 4HSJA 5FZCA 3ZXAC 5KXDA 5KHGA 4LT5A 3MF6A 2Q8OA 4L2NA 4PT6A 3MO4A 1LOFA 3SCHA 2VVDA 4PI2A 5FR3A 2V72A 1G9CA 3AZXA 2WN2A 3U1XA 4UFHA 5F7UA 1DBNA 4HANA 1MR5A 5LK7B 3ILRA 5D2AA 2HWB2 5D8AB 1FPN2 3VBUA 2YPJA 1HLCA 4IQPA 4BQ3A 4IESA 5JI9A 1HRV2 2JKXA 5FZ8A 5GLVA 1VAMA 4TLGA 2QQMA 1ENSA 4DEVA 5EPAA 2BTVC 4CP2A 3C7OA 1RUC3 3MW3A 4LBQD 3VB9A 3WCSA 2JE7A 4DXZA 2D44A 4U2AA 3S5QA 1WCKA 2YBSA 2GU9A 1OLME 3GCXA 4FOWA 4ONUA 3AMHA 3PMEA 1NE6A 3OEAA 5T55A 2WLPA 5FYZA 4OUSA 4XEZA 2WC2A 2GALA 1MQTA 2DBIA 2YHJA 3L9JT 3CEWA 4LA3A 1W9YA 5F39A 5FUIA 1UMIA 2Q30A 2VCAA 5FYTA 2W39A 3AK0A 3ZXFA 3ZYHA 5C9AB 2D3PA 1SBEA 3U37A 5CU1A 4FPOB 4DOUA 1WUVA 3M7AA 3O0WA 4UXAA 4YGCA 3H3ZA 4QXBA 3H8UA 2B5HA 2PTMA 5DG1A 1PIV3 3R05A 2VZPA 4ZXEA 3ATGA 1VE0A 2O14A 3H3UA 5BNPC 4HVQA 3NAPA 2D6LX 4XXPA 3CBNA 3ZM8A 1RUH1 1RUE2 1ULCA 2OPKA 5CKNA 3N36A 3AXDA 3FLTA 5AC93 4ES9A 3POGA 4BK5A 1OBNA 1YFXA 2E32A 5EQUA 4M0NA 2W91A 4QX3A 3OBRA 5GLZA 4XABA 1CIWA 1ZBA3 5K4LA 3A22A 1K45A 2BBAA 5BPXA 1RJ7A 2QZ2A 3IT8A 4AEMA 1UZVA 1EY2A 3MHZA 4XCAA 1EUTA 2ZGMA 4WM7B 4DY5A 1RMU2 5JOYA 2NMOA 1MZFA 1AR62 1NCRB 1T2XA 5FZFA 4DEQA 2BGOA 1CPMA 4CDXB 1V6JA 2YGMA 4WVMA 3H7YA 1U12A 2VW1A 3TEYA 1LGBA 5DG2A 5LRRA 1H9PA 3PUHA 5DDJ1 1F31A 1OKOA 3W5NA 1AYN1 2VOXA 5A7WB 2CAUA 5T3NA 3T2PA 4E2SA 1RUOA 4AAPA 1DGRN 1QJZA 5L7OA 5KHIA 3VBRA 1UQXA 1WBFA 2A6XA 3T30A 2NN8A 3FN9A 1PVC3 2W46A 2HJIA 4BIFA 4Y1XA 3AP4A 2RG4A 3MPBA 3VBHB 4M3CA 5FBJA 5LA0A 3S0MA 1GQHA 1TVGA 3T0AA 4AG4A 1QU0A 4V2WA 4QX8A 1UCXA 5FPXA 3MUY1 3IIAA 2A75A 3RZHA 2VUCA 2NM1A 4GH4B 2WZR3 2XLFA 1US3A 4Q4Y1 3V0AB 1W2TA 2E51A 2FDIA 1KEXA 3SLIA 2IXIA 4YM2A 3RWNA 4D94A 3GCWA 4H3WA 3VD4A 4W6YA 4ARYA 5EIYB 1BJQA 2OKXA 5CFDB 1MZ5A 3ACGA 1N3OA 2WNOA 1D7PM 1UMZA 3ZXKA 3N9PA 2WAAA 5FZDA 1YFUA 1GICA 2WYSA 3K3OA 5LA2A 3NV2A 1DYKA 2FQPA 5KHHA 1NYWA 4CRQA 3O1SA 5ABJB 2JG8A 1QKQA 1YO8A 5ACA2 1GNHA 4YG0A 4AFMA 2VECA 1NG0A 1S0CA 3DYMA 1RUC1 4MSVA 3LD8A 1HRI2 2XBO3 4LULA 4XHXA 1C8M3 5FZ3A 3MIGA 1LHOA 1KJRA 1DQ0A 2WYFA 5DPNA 4N9IA 2DURA 2W3JA 1CIYA 2JE8A 4QT6A 2P3YA 1IQAA 4QX0A 3OBAA 3POBA 3TRSB 2XKOA 3WF3A 2YU1A 3SEEA 3WP6A 4WVVA 4AQ6A 3LDBA 1IGOA 1J1LA 1GWLA 2BNMA 4LQRA 4XUPA 3U11A 1AJKA 4XMAA 3LZZA 1PX3A 4RS5C 1PIV1 2ZMKA 4IEWA 1U5IA 4OMCA 5J36A 2P3KA 2BQPA 4IERA 3M3IA 3Q8FA 4M4RA 5F8PA 1LODA 1Z0HA 3I49A 2VCCA 3EXUA 1NA1B 1Q56A 2GP5A 2PHLA 3VBSC 4AEDB 4R4XA 5AC91 4Z92B 4R9AA 4CU9A 4ISQA 1N3QA 4Q5OA 3AFKA 4NAMA 3DPRC 3BUCA 1MEC3 1AVBA 1JYTA 4J1XA 3BIWE 1XE0A 1ZBA1 1UY3A 3WUCA 4BA6A 4CPBA 1WCSA 2GC0A 4HK9A 5SV5A 2A6ZA 1BMV1 3N9NA 3D0JA 1UWWA 2PFWA 2XJVA 1GV9A 2DWRA 2X53S 2XWBB 1SBDA 4Q1RA 2HH9A 3MIHA 1V6IA 3KT4A 1DDLA 4EN7B 1MZ6A 1LGCA 4WM8A 4JHTA 5C8CA 2Q4SA 4X8PA 2VH9A 1CAXB 3T2QA 5GALA 4Y5TA 4H7MA 4DUWA 1JYXA 2E7QA 5A6XA 1W6QB 3BPZA 4NIGA 1HW5A 5JZGC 3DL3A 2ZABA 1VAKA 2VC9A 2ZTNA 4QM8A 1TEIA 3OGVA 3UJQA 2YMZA 2HBTA 1F9KA 3KF3A 5K8SA 1DZQA 2F6BA 1NKGA 3ZVXA 1PVC1 2HWB3 2J7MA 2RJLA 3I59B 1JU4A 4HKWA 3VD7A 1FPN3 3VKLA 1R082 3B93A 3H1WA 1HRV3 2ILMA 3ENRA 2J22A 4UBHA 5FPUA 3BB6A 4Y1ZA 1VBE3 2OX0A 2YY1A 2WA3A 4NN0A 1QQP2 2BFUL 2BW8A 5J98B 3ZYFA 4NPMA 3O1MA 1O3RA 2ARAA 4IE4A 2PELA 1PNFA 3MLLA 2W94A 2WZR1 2ZPXA 1OLRA 3D3AA 2YZ4A 3WG4A 3WQ0A 1O7FA 3RNSA 4YVSC 4DNYA 5GLUA 2LS6A 4N53C 2QQLA 3SXWA 1V0AA 3K2OA 4FVVA 4QPWA 4CDWA 3FC0A 3E5XA 1O4YA 1SPPA 3ZOIA 4P9WA 1BCXA 1VRH2 3M3QA 4YZ4A 4XTMA 1Y9MA 1WD4A 3CZUA 3ZPYA 5FMDA 1QWRA 1DZTA 2Y6LA 5ERLA 1LOCA 5FZAA 1Q8PA 4MADA 2J42A 2LROA 2ZEWA 2ZX1A 2AENA 2P5BA 2QDRA 5FKCA 4CCKA 4A6OA 2RMU3 1BK1A 1RUE3 2OW4A 4IV1A 4MXWB 3ZFEA 4PLNA 5FK8A 4WZFA 2QE3A 3W9AA 4C1WA 2H0VA 4P02B 2I07B 3ACFA 3O14A 1Q8VA 4ATFA 2Y6JA 3CJIC 5BNOA 2CTVA 1MS0A 2F4PA 2XBO1 5L73A 5I93A 5JLVA 1UOFA 3WG1A 2DU1A 3K3NA 2JDNA 1CJPA 1ZBE2 4BLIA 3W20A 4JGYC 4Y22B 5BNNB 3RZKA 2JDKA 4XUTA 3LCPA 1Y43B 5CFCA 5DXDA 1HJGA 3MIEA 1SLLA 1RMU3 2QFEA 2ET1A 3ILNA 4JGZB 1A8DA 2WT0A 3SCFA 3LA2A 1AR63 1JOBA 3FHAA 3QACA 4KGQA 1AYM2 3O7OA 4YM3A 5JAXA 1NXD1 4I0BA 4GAZA 2XVLA 2WNVB 3KV6A 3VDDB 4LBQA 2VBDA 1ZZ6A 3CJXA 2FBEA 1OC1A 4Q4W2 2BJSA 1ZZ7A 2BZDA 3ZKYA 1IPJA 5C4WC 2R063 3C3VA 4PIYA 4YZ5A 4GZ9A 4NWVA 1RHI2 1MEC1 1ND3C 1I9RA 2QUOA 3KSCA 1YXWA 1OOPA 3M3EA 3N7MA 2C1FA 5FXVA 3VBUB 3WVJA 5EYXA 1OVSA 1F4AA 3OPTA 2G9FA 3FJSA 3OGJA 1FMD2 1VBA2 5C3PA 2DCYA 5FP3A 2VVEA 2WWUA 2OQ6A 4IV3C 1GQPA 4IEVA 3UK9A 4E4ZA 2EXIA 3PIGA 4R9CA 5APAA 4HSLA 5F32A 4W4ZA 4X6RB 2OUHA 2JECA 3I2JA 5CKMA 5FYUA 1AR72 1MQTB 1OA3A 2ZACA 3H0OA 3HT2A 2LM3A 3NNJA 4QU2A 4XC9A 3PMSA 5BY5A 4H55A 2HKXA 1MS5A 3IKWA 2BERA 1YJLA 2IUWA 5C70A 4IETA 3VBFC 4UT5A 1OSGA 2XL9A 1G9AA 3B7MA 5JIAA 3BPSA 1H4GA 2W08A 2D6MA 3DKQA 3QBQA 2HWB1 5I0UA 1FPN1 3NJVA 2Z2SB 4UFMA 4XIOA 2RR12 1VBD2 1HRV1 3DKWA 3NAPB 5ACA3 2BPA2 4FAHA 2WNUA 1UF2C 1US2A 1VBE1 1SFPA 4Q4V2 4XXAA 4GA9A 4CUAA 4AEJA 1SCRA 2QVSB 3MF9A 2G19A 2W2IA 4ISRA 5BXXA 4AFDA 2WABA 4D69A 2I74A 4JVAA 1HRI3 2C0ZA 3AP6A 1EYBA 4BXFA 5C33A 3SQOA 3BTZA 5FWJA 4MGKE 2ZCWA 2BBVA 1UU4A 3B5LB 1DGLA 2X5IA 3GHNA 3TNPB 4Y24A 3P1IA 1AF9A 2B8MA 4PHZA 5F2WA 1H1AA 2VZQA 1CZSA 2X05A 1OVPA 2ZHMA 2VL4A 1QH7A 4RQPA 1N3PA 2CV6A 4XHBA 1U0AA 5J48A 2EIDA 4NROA 2LRPA 1KD7A 2O0OA 4HKOA 4O9GA 1VAVA 4XOGA 2WO1A 4WVMB 3JZVA 3MIFA 5IK5A 4OHYA 2K9ZA 3KV9A 1JZ3A 2RMU1 1W2AX 1RUE1 3HD8B 4BB3A 2IXLA 2Z4FA 4BLJA 2XDVA 3WT3A 4BQ5A 5FWEA 1LR5A 1SMVA 4E8DA 5L7OB 2YGLA 1QJU2 3VBRB 3THPA 3KT7A 3RJRA 2A1XA 5FFOC 3E1F1 4B3NA 1CONA 3WG3A 4A44A 3PNAA 1QY4A 4Y20A 1D0HA 4D6QA 2WFF3 1YNAA 5L36A 4M3CB 1MS4A 3JXSA 4IGOA 2VMGA 3ACHA 2XJUA 4LUKA 5LY1A 3WHUA 2A7AA 1GSLA 3D4KA 3GF6A 1RMU1 5HCAA 3PU8A 3VDCA 1PK6C 3U78A 1AR61 4MHRA 4MVTA 3ZYJB 3ZX7A 4YZ1A 4JDOA 5FZ9A 2RDRA 5FZBA 1W9SA 2GMEA 1WW7A 2TNFA 2WLQA 5FPAA 4J6GA 5L9BA 1JYCA 4XW3A 4DQAA 2XKPA 4NHKA 1W2UA 2R061 1HXS2 3I97A 4K21A 4TYSA 1TMF2 4QDSA 4DY3A 4LHNA 4CE8A 4CDUC 1W0NA 1QXJA 4AZZA 3HBZA 3VBOA 4AHYA 1R083 1WMXA 3ZSLA 5GZFA 1L7QA 2JG8B 4AR2A 3O12A 4Y5SA 3TYJA 1OD3A 5LA9A 4I2OA 2ZBJA 4IW3A 4CDQC 1QQP3 3POEA 4LTAA 4FPKA 2Q1ZB 1GP6A 1V6KA 4FOVA 3H1MA 3TOJA 5CBLA 4RR3C 2WAOA 4NPLA 3THTA 4B29A 4YFZA 2GP3A 1H1MA 3WP4A 1NQDA 2Q8CA 5FP7A 1B35A 4QQLA 4GB33 1M06G 1FOD2 1WW4A 4AWDA 1F5JA 5FMCA 4AK3A 4L92A 2ZAHA 2ZHKA 4PJYA 3KVAA 1JYNA 2OA2A 5A1LA 2PHRA 1I5ZA 1VRH3 5C3QA 1ODNA 4QPGA 2VZRA 3ZSMA 1NCQC 4Q1PA 3ZMOA 3POYA 4YM0A 2J1SA 1FX5A 2WO2A 1K5MA 1MS8A 3OUJA 3PUIA 3J9SA 4Q8KA 1YQ6A 2LUWA 1NLRA 1SLIA 4CU8A 2FDHA 3HQRA 4HVOA 1W2NA 5F3CA 2Q8EA 5ACA1 4HMZA 5F6KA 4CU7A 1EAH2 5H9QA 1ZRIA 4CCOA 1BVVA 1LTEA 4UW3A 4K6BA 1BEV2 2VQ0A 3OF1A 1QH6A 1QOTA 2VW0A 1RVF2 4D7YA 5C5TA 5J09A 5IK7A 1HRI1 2EIBA 4FPEA 4MGQA 5FBZA 3T08A 4Q2FA 1GUIA 2E7AA 3KCCA 3SKJE 4BZ4A 3UNPA 2R49A 3HIFA 3AXEA 3GYDA 4CU6A 2PMWB 1S2KA 5KXEA 5KXBA 1GP4A 2RE9A 2HWF2 2XUEA 3IPVA 3M70A 5C3RA 5JOXA 1LOEA 2QQOA 1SFNA 2X09A 4RL7A 1CX1A 4AHWA 1GOHA 1PZ9A 2YG0A 3MV01 1W6OA 4WM8B 5I0TA 4PI0A 2UYBA 4F8AA 1AYM3 1UYZA 5C8CB 2H0BA 1NY71 4EV0A 1CVNA 1HQWA 3DN7A 1SEFA 4FP2A 5FYVA 4B7EA 4DFSA 2IXCA 1JYIA 4Q4W3 2VNOA 1Q3EA 4QU1A 4W6WA 3ST7A 4R9BA 4CSWA 2B46X 1QF3A 2VMDA 3KM5A 4KQ7A 1XBFA 3H50A 4PF5A 2VMIA 2K46A 3AMMA 3J7LA 1D4M2 1RHI3 2P6CA 2ZGOA 4YM1A 1DG6A 1SHWB 2W9XA 3BTAA 1TME2 2WFF1 4HK8A 3DCQA 4JDNA 3LSEA 3IDCB 2EA7A 2DVAA 3DYPA 4META 4YRDA 5F5CA 4JDMA 2R0HA 5IJRA 3U07A 1IG3A 5J3UA 5JWPA 1FMD3 1S0IA 1VBA3 3KV4A 3ZXLA 5JXHA 5JSRA 1CAVA 4QMAA 4LLOA 2C4XA 1UIKA 1LJ7A 2ERFA 1CESA 1TNFA 2HEYF 2J1VA 3MW4A 3CQOA 4IEUA 4HN0A 4OYUA 3WNNA 4CA9A 4AFBA 4IV1C 2A71A 2DCJA 4FP3A 4M00A 4XF1A 1YHFA 5J7MA 1JS9A 2RDNA 3ZFFA 4P9IA 2L9LA 1AR73 1PGSA 2RS12 1ZZ8A 4CDWB 5FPLA 4U36A 3B3QE 5K0UA 2JDAA 2DU0A 1LENA 2XJRA 4Y33A 5LEJA 4LBOA 5E88A 1SPPB 2YC0A 2FMYA 1YCIA 2JDHA 5FY9A 3MIDA 4RFRB 1H30A 3AZZA 1RYYA 4NAOA 2PHFA 2WNEA 3FX3A 4OFGA 1ULFA 1IOAA 1R081 3HPNA 2RR13 2EALA 3GBGA 1X7NA 5SV8A 1NLSA 4F83A 5FO9B 1GQGA 3MBWA 2VZUA 5H9PA 3ZFEB 2KXLA 2D6PA 2Z79A 3CKHA 1QQP1 3B01A 4RFT0 4XZUG 4BHPA 5JIUA 3NNMA 3KQRA 3NKTA 5BV6A 1XB9A 3I2OA 5CG8A 4LOTA 3S7IA 2DBNA 4ZZ5A 5A1FA 2G4IA 5JXIA 1BLZA 2R1BA 1PX4A 3RZGA 5FZLA 4N43A 2CHHA 3FUQA 4GB31 3JBG2 4AHXA 1JI6A 3UL2A 1DQ1A 1RUJ2 1REDA 1VMHA 3ZYIB 3C8XA 2R6QA 3BVCA 4XZPA 5CFCB 1QJX3 2AH2A 2ZZQA 1VRH1 4YPJA 1MS3A 5BNNA 4Y1UA 3RZZA 4E8CA 2VMFA 3K46A 1E57A 5FMBA 3ZDVA 2JB4A 1WMEA 2PQQA 3WEZA 2FD8A 5D8AC 4EQVA 5LB6A 1OH4A 3LOBA 4FAGA 1AXYA 1V00A 1LU1A 4FOYA 4HLTA 3HQXA 4LBQB 4YW7A 4PCRA 4XQWA 2Z5WA 4C0BA 1QEXA 2XH6A 5IVCA 1OF4A 2P4EA 1W8FA 3VKNA 5JMOA 3PU3A 1JUIA 1KS4A 4IE5A 1QJU3 3JQWA 5LBCA 4MGSA 4P5HA 3WDYA 2J1EA 5E89A 4AF9A 4B4QA 2DFBA 1H2MA 3LEGA 1U5XA 2ZGNA 4ES8A 5JXJA 4L11A 2ZX0A 1Y7BA 3L2YA 4N7IA 2Y0IA 3V64A 5DMYA 1GZWA 2W47A 3A21A 1OOPB 1LEMA 2WZPP 5HCHA 4E4HA 2UURA 3IDEA 2RDQA 4KWLA 3M8LA 2FHRA 4GXLA 3ZFGA 2D97A 3N35A 1R1A3 1DGWX 1LESA 5FYCA 4A2UA 1NOVA 3ORJA 5C9AC 3RYRA 4YW3A 1QOSA 1Y3TA 4A3XA 3JCIA 4Q26A 1POV3 2HWD2 2BYVE 3BU7A 1CPNA 4GWIA 3TB0A 4S2FA 4AVAA 5HXMA 3N9MA 4J1WA 1AYM1 5FY8A 5JPNB 4LO8A 3KF5A 4BU2A 2ENRA 3UT0A 3AP9A 5A3PA 4FTBA 1YRZA 2IVIB 1UOBA 2ARCA 1G7YA 2WWJA 3ROUA 4TZDA 1BK0A 4Q4W1 2XUMA 1PGW1 1JZ8A 2VVFA 3HT1A 4R9DA 1HXS3 4FPLA 3KGZA 1AL22 1TMF3 2WN3A 1DZRA 2PAMA 5EXOA 1Y9QA 4PIZA 5IVFA 2RM22 4PLOA 2EXJA 5FY4A 3JQXA 5A6QA 5DAXA 2Y33A 1ZZCA 4IEXA 3T2TA 1RHI1 1EP0A 1W9TA 4KI5M 4FTEA 4K1ZA 4BISA 2VQAA 4LHKA 5FLIA 3SNMA 4OHZA 5JOZA 2QQJA 3CIHA 5IYYA 3ALQA 4A6SA 2WNUB 1N1YA 1FMD1 1VBA1 4CCNA 3L2HA 4LO6B 5FYMA 4MX3A 4CEYA 4WM7C 2VAUA 4UW6A 3UKVA 1A3KA 5CG9A 3NL1A 1W06A 4YW2A 5FPZA 2VW2A 4D6SA 1NCRC 3H7JA 1RXGA 3ZIXA 4CDXC 4NRQA 1QNYA 5CADA 2W68A 1AR71 1V70A 2X5IB 4Q0UA 4WV8A 4YNIA 3SMHA 3G6JB 1RUG2 1LRHA 2XHNA 4Q0VA 1HN1A 3C7EA 3ETQA 5JDBA 3VV1A 1XQNA 1XNBA 5FZMA 1STMA 2K2SA 3BU0A 1WA6X 4RQPB 4DS0A 3EMRA 4KNCA 4QX2A 1H2KA 1W6PA 3ASIA 3E97A 1FAYA 1LOBA 1WLDA 4YVWA 3B9IA 2PAKA 1SBFA 2YC4A 5K9YA 4AL9A 4ARXA 3VBHC 5C5UA 1W03A 2RR11 2W1WA 2D5HA 1XNCA 1S0EA 3TEXA 5A3MA 2ADEA 2KR2A 1DQ2A 3AYAA 3KMHA 1XYPA 3LA7A 3NJZA 3WQ7A 1WBLA 2NPIA 2Y6GA 3ZYGA 1IPKA 4CP9A 1BEV3 3BI3A 1I5PA 1RVF3 1X9TA 2VU9A 3AJYA 4GH4C 3ZXGA 1REEA 3CNAA 4KU7A 1OQDA 1OT5A 2QQPA 2BP6A 1IS6A 1C1FA 4Y20B 3ZN6A 3TEWA 2XMLA 2OYZA 3GGLA 4HL0A 1XE7A 1AX0A 2HWF3 4TTGA 1OFNA 3A7QA 5CFDC 1PMIA 3MPPG 1QJX1 4WVWA 4IEZA 4JRLA 4XFGA 4CEWA 3AYCA 2OZ6A 4OI4A 2JDUA 4TN7A 4UI9L 1BZWA 2Y6FA 4E4SA 3FLRA 4PDWA 1AL0G 1O91A 4I3PA 2VZTA 3D6EA 4FQ4A 5FZEA 2AACA 1WD3A 5ABJC 1IS3A 3OEBA 5FZOA 5C8WA 4OVEA 4RHV2 5FUPA 5F1RA 1ASJ2 2DTYA 3BODA 3HJRA 3BTXA 5G04L 2ZX3A 5JR7B 3NKGA 3WF2A 1OXCA 1QJY2 3MFCA 1QJU1 4D7TA 5GLWA 4NHMA 1UPIA 3K75B 1WW5A 3OD0A 5F5QA 4FO9A 3QD6A 2IWGB 1D4M3 4X6QB 3WNLA 2ZXQA 3AKTA 4XBLA 2DVGA 2RJ2A 2QBXA 1TME3 4AFAA 4OCTA 3U14A 3RYKA 3VBOB 4EROA 1PGL2 3X29B 3HVDA 5EFUA 3KCXA 5AFBA 1J59A 2QQKA 4QHBA 1QNWA 1R1A1 3ACIA 4XE9A 1S0DA 4M0HA 1DF0A 3WDUA 1W05A 5IVVA 5DAWA 4YGBA 3AL6A 3K51A 1POV1 1HQLA 2A6VA 1JODA 2VZVA 1RUD2 1GP5A 3PVNA 2Y6HA 3UV9A 5F37A 3HBKA 1OH3A 4TXWA 1YI9A 3BKZA 2RS13 3T0BA 4JZRA 1B35B 1PO12 5K7PA 1DQ5A 3ELNA 4UOJA 1NA1C 1G86A 5FO8B 4AEDC 4YGEA 4O61A 4GMP3 1KFXL 2VOVA 4Q29A 1HXS1 4QPGB 1TMF1 2P34A 1TNRA 4L97A 1WGPA 1K5MB 1JOPA 3HN1A 4XF3A 2WA4A 5FXZA 1SFYA 2BV4A 2XPJA 1J3RA 1ENRA 1HV0A 3CDZB 3HN3A 3I2KA 1TE1B 3POJA 3R4DB 5H9RA 1KXGA 4EYUA 4UFKA 1Y4WA 2VULA 4K1YA 3Q8EA 2QQVA 4XJZA 4UAPA 1FYUA 5LRSA 3KZ4C 2OUJA 1YQ8A 2ZEYA 3LB9A 4MOAA 4KWJA 5A7OA 1XNDA 4ASLA 3N7JA 2VZ1A 4AAXA 1OF3A 4QPIA 2EICA 2OS2A 3JBG3 4CCLA 4BK4A 2VD7A 2XL7A 3VHOA 4YZ2A 4AI2A 3NJYA 2V5DA 3WHTA 3IPVB 4QD2A 3WQBA 1JYWA 4EN9B 4NOTA 4RGAA 1GLHA 3AMPA 3RMXA 1ACCA 4PF1A 1W6OB 3LEIA 3ZLIA 1K5JA 1YFWA 5T52A 2KA3A 4COWA 2WRAA 4IGQA 3NNGA 3ZSEA 1TZOA 3N9OA 3RFRA 2PHXA 4OLLA 1KJLA 3RMYA 1X33A 4XAEA 2VUDA 4QPYA 4Q0SA 5FMOL 2A5ZA 1BEV1 1W6NA 4MXVA 1RVF1 1W2OA 3N7LA 1U5YA 5BYNA 4NJ4A 3KGLA 1V9U2 2NQYA 3OBTA 3BTYA 1DYOA 1ENQA 2PN5A 4JQRA 2XG3A 4XF9A 3WP5A 5IVJA 5EHDA 5F5IA 2VNVA 2HWF1 2ZA9A 5E1RA 2BGCA 2CWMA 1CAVB 3I54A 3FFZA 2HWD3 4DMIA 1GBGA 2PQSA 4NHXA 5DQ0A 4AE2A 1CWPA 1H1IA 3NRUA 4XBNA 1ULEA 2DTWA 3PIJA 4NR1A 3ZFFB 4BXSV 2P17A 1C4RA 4LKSA 5K0UB 4P9YA 5CKQA 1POQA 1FV2A 1NXMA 1Z78A 1XJAA 3WZ1A 1HB2A 4DRVA 2GC2A 3MEPA 4FFGA 1PVXA 4LKDA 1XRUA 1D4M1 2OVUA 4LMFA 5C7GA 3J8F2 4URTA 3O1PA 2P3JA 2Q5TA 1TME1 2GN7A 4MYEA 4QHOA 4ZY9A 2JXAA 4AEKA 4HKLA 3OSDA 2NP0A 1DLCA 2ZGQA 2IZWA 1YYNA 3MW2A 1UYYA 3PL0A 4KBBA 4XDOA 5FZKA 4JGZC 1RTVA 5DAVA 4S2GA 4UBGA 2DF7A 1YI7A 4BH9A 4GWMA 1UAIA 4M3CE 4P9XA 4ATEA 4EWAA 5A7SA 3I2GA 3WNXA 4AGGA 5IFTA 4LR4A 3VL8A 1IG0A 2EIGA 2WNVC 3VDDC 2RS11 4DXSA 1C8M1 2OIIA 2VTXA 4IEQA 4N43B 1RUG3 3NJXA 4XIKA 3D82A 2JIJA 1LOFC 2WZ8A 4GMP1 1GZTA 4XTPA 2XXZA 4LLFA 2A6YA 4EN8B 3M2MA 1Z7S2 1J3QA 3INAA 1JOJA 1WKYA 4Y4YA 4P14A 2XJSA 3VBUC 4ZHNA 4FXGB 5JMCA 4LKFA 4OI1A 1V6LA 4MHUA 4FPCA 1PZ7A 5FPVA 4Y1YA 5F3IA 2AZ5A 3DUIA 1RC6A 2VQTA 3ZO0B 4K7JA 3JB4C 2GH8A 3U4SA 1HDKA 2UWCA 1SDWA 1ZZBA 3LGRA 1BHGA 3ITQA 1LHNA 4NIHA 3T4VA 3WW3A 1GZWB 1MQTC 2JB8A 1H2LA 5A1AA 2CDPA 2XVKA 3BALA 1UZWA 4Z07A 4A41A 3LEKA 2DFCA 5JOWA 3JBG1 5JUVA 3ZFGB 1OQEA 1UMHA 1QIQA 2XHKA 3OUIA 1DGWA 1JH5A 4UFIA 5LEKA 5GZEA 3WDWA 1NAEA 3T2OA 1UNBA 4HBNA 1YFYA 2W1SA 3JD72 1ODMA 1W3XA 4YWAA 2ARXA 3NAPC 4LBNA 4RHV3 1ASJ3 2SBAA 1C5HA 4ASMB 1CGPA 1C28A 2BFUS 2JG9A 3BIEA 5LW9A 2D3SA 4IDZA 1QJY3 1K12A 4HONA 1CAWA 4AVVA 3EYPA 5DAQA 3T1LA 1RB8G 2MEV2 2B9UA 3LQCA 3GXUA 4SBVA 4YW5A 1UY4A 3RRDA 3GALA 2VG9A 3NSTA 4NWWA 4R8HA 4YZ3A 3AX4A 3ZYPA 5C6CA 1GOGA 5C71A 3HEIA 5FJHA 2ATFA 2PHUA 4XPVA 4A4AA 3LWCA 1VPHA 5FZ1A 2R072 2E6VA 2P3IA 3D5OA 3LE0A 3URFA 4CEYB 5G05L 1GU3A 2BU9A 2GZWA 1I3HA 3N9QA 2WT1A 4NIIA 2FMDA 4P9GA 3SKVA 3USUA 4BM8A 5E6HA 2HWD1 1ZX5A 5FDBA 1JYVA 3Q9OA 4BE3A 1RUD3 1OPOA 5FXXA 1C5IA 1S0JA 2R042 5FPBA 1GNZA 1HB3A 3BOPA 4MGTA 5FP8A 4D8MA 2ET7A 1WMDA 1PO13 4P9JA 2G9GA 3C2UA 1C1LA 4ZXKA 3KQ4B 5L7OC 4CVUA 2ZGPA 1IKPA 1IPSA 4NRMA 4PQQA 3VBRC 3WQ1A 4YARA 4AGRA 4QXKA 2VTXJ 4E4DX 3NVCA 1W6PB 1MACA 4YVWB 3MI8A 2CSGA 3KWVA 5A3LA 3OGGA 3S57A 1RGSA 3K4ZA 5F3EA 1VP6A 5JVVA 4EN0A 4B8EA 3DXUA 2FDJA 1YQ5A 5IWFA 3CLPA 4CP9B 3CO2A 3CMGA 2ZGTA 3JU9A 5DDJ2 4MLOA 4CCCA 3TN92 1W8NA 2EXHA 4QB1A 5A7PA 2XGXA 3OPZA 3THDA 3WY6A 2ZEXA 3ZR5A 3PJYA 3PTRB 4HZFA 1N1VA 2QQIA 1KDMA 3IDAA 1SCSA 5FYYA 4LKEA 1LKNA 2VZSA 3ZN6B 4BCUA 5CEHA 4GJZA 4N8MA 1H8TB 2DCTA 1CJDA 1RUG1 4XJWA 1D0GA 1X8MA 5FK7A 3VZOA 4MGIE 4XACA 3RZJA 4LK6A 5CA6A 3RDIA 2OXBA 1S2BA 1LHVA 4YLZA 5AVAA 4CEWB 3LOIA 5BNPA 4W65A 4SLIA 3MLJA 2Z69A 1EPZA 2PAEA 4PDWB 1LNSA 4H14A 3WR0A 4XCBA 1NLQA 2JG8C 2QCSB 2JEMA 1ULGA 2E33A 2W1QA 2Z42A 3OBZA 5FZOB 1UN1A 4Q27A 3SH4A 3APBA 2WT2A 2ZOEB 3VZJA 1R64A 1H9WA 1OFSA 2UU8A 4XVHA 3F2ZA 3OGSA 5FP9A 2YPDA 5IFPA 2HWC2 3UGGA 3RI8A 3MGUA 1A34A 5IAVA 1V9U3 1EV12 4J25A 2YUEA 5LCWL 4QQHA 5KBFA 3Q8AA 5CIRA 2CDOA 4IE7A 4LIUA 3H1YA 4GKXA 1L3JA 1A8MA 3WV6A 2GN3A 5DUUA 1PZ8A 3VKMA 4C0HA 5HXVA 1C57A 2NYYA 5M0TA 5DN2A 2VNGA 3UKTA 5FZGA 4QKDA 3S6PA 2XB6C 2OQ7A 2BDRA 2VPVA 4MH0E 3PURA 1WCDJ 2YC2A 2JDYA 4OMDA 4RHV1 5KC5A 1ASJ1 1ALYA 2VZOA 3T4HB 1SG3A 1ZRFA 1V6NA 3GBFA 2FCTA 1QJY1 3VZNA 4JTNA 4A3ZA 2C24A 4I0WB 3V65A 3J8F3 4CUGA 2A3WA 1IS5A 5FAXA 3IIIA 4B7KA 3J7NA 2YXSA 4N90A 5GLTA 4COVA 3I2DA 4A45A 3TNQA 4KWUA 4S2HA 4FPHA 4CUBA 1RUNA 1C3HA 4XJ9A 1XNAA 1VIWB 4BQ4A 2BNOA 1G8WA 4HXCA 2RS32 3W21A 2LALA 2RS52 2H6BA 1PNGA 4WM8C 1JTZX 2JWPA 1RUD1 2XJPA 4PLMA 4UF0A 4Y1VA 5DZGA 5FZ4A 4AQ2A 5FYBA 1FNYA 5C8CC 3HR9A 3V56A 3ES4A 4MUVA 4DRRA 1PO11 2V5YA 4QPIB 1BBT2 5B2GB 3R4SA 1X8EA 1ZBE3 4F3JA 1RIRA 5FLJA 5IVYA 3O0VA 1W9WA 2VOTA 3BGAA 1BMV2 1OA2A 3C7GA 2D43A 2EAAA 1Z7S3 1OLMA 3I3QA 4R4ZA 5T5LA 2TBVA 5CAZA 3O1RA 2CGOA 4FPGA 4JRAA 1SZBA 3ME2A 3PUSA 4RYDA 3JB8A 2BVBA 4KG0A 3T0DA 1S4CA 1QXRA 4HPKA 5FYHA 5KHKA 3KCYA 2OT7A 5FZIA 3E6BA 2YROA 2ZMLA 1W6NB 1O59A 1F5FA 2GMPA 2RV9A 3WF4A 1LOGA 1GR3A 4YG3A 3Q8BA 5GM0A 1H0BA 3VGIA 4ZKTB 4CTEA 1FT9A 5A70A 1F2NA 4KBZA 3AC0A 1OA4A 2AEYA 5FKBA 3I7DA 4CDWC 4JKLA 1UXXX 3SH5A 1SQ4A 2V09A 2ES3A 2JJ6A 4QGLA 4G3YC 1WA4A 3PLQA 4RS5A 4YW4A 5LASA 3E6CC 3IMNA 4Z8BA 5KWRA 5J37A 5FY7A 2QTWB 3NV1A 1COV2 3WCRA 3A4UA 3JD73 4M4PA 2QKDA 3NV4A 3RJ2X 3C7FA 4A7KA 3VZKA 5DUWA 4NE9A 3GBWA 3VBSA 1B09A 5ANNA 2WZR2 2XVGA 2PYTA 4XUOA 4D6RA 2G9ZA 1G6NA 1W8WA 1J3PA 1UZYA 2DUOA 1UX6A 4JCKA 4LJHA 3ZFEC 3DPRA 4BMBA 2Q1MA 3VLBB 3CF6E 4XDQA 3THCA 4P9LA 1E5HA 4YYOA 4ZPIA 4CPBD 2ZS6B 1K42A 2MEV3 2GC1A 4WBBA 3ZSJA 2HEVF 5IAXA 1IHMA 4XFHA 1IZ3A 1V9U1 5GJ6A 5A7NA 1D2QA 1ND2B 2CGNA 2MNGA 3VDAA 4OI0A 3USSA 1J83A 2E31A 2R073 4FPYA 4FCAA 4Y3OA 4W8JA 5DAPA 5FO7B 4I02A 3T1MA 3VKFC 5CFCC 2VJXA 1SLBA 5FUNA 1VBD3 4ZU4A 4DUXA 2VM9A 1GANA 4LBLA 1FATA 4Q4V3 1H6YA 4PIXA 3DYOA 2ZMNA 4LOSA 4P08A 2R043 5F6LB 4B4RA 5EYYA 5IUQA 5JZGA 5IW0A 5CZKA 3E5QA 3EO6A 5FJKA 5KR7A 5A32A 1J84A 2E63A 3BCWA 3KHBA 3T3YA 5BNQA 2VMEA 3I8TA 4V2VA 3VD9A 3A23A 2YDEA 4O9EA 3KB5A 1KGYA 5LBEA 1JZ5A 3J8F1 2IVJA 1OOPC 3HAGA 4JKMA 1WMFA 3FMGA 1F35A 2D98A 2AYHA 2AREA 2CL2A 3VN4A 3MFAA 2BVVA 3RGBA 1JBCA 2R16A 2DDUA 1XNTA 3PJQA 4G9SB 3P3NA 1VMJA 1PO22 2XR4A 4PBOA 4UFJA 4XQ4A 5CNAA 1T6GC 1XSRA 4YVSA 3TN93 4GQ7A 4RGKA 5A6ZA 3GDBA 4N53A 4XMIA 3O1TA 1RITA 2E7TA 2HLEA 2VY0A 4BQWA 1SDDB 5IK4A 2DV9A 1O3SA 1JUHA 1FI2A 4RGGA 4I3GA 5JI7A 2NMNA 2WR9A 4OULA 4P5YA 1LU2A 1MEC2 2PHTA 1HN0A 5BNOB 5LATA 2VCMA 3QLQA 1ZRDA 4NIDA 1VBC2 4XYXA 1XU2A 1KRIA 4Z1VA 5DUXA 3WG2A 1W28A 1ZBE1 1NT0A 5A3OA 1ULOA 2AEZA 2KD7A 2P37A 4XJUA 3AP5A 4Z82A 2QJVA 1Z7S1 4YGDA 4LPLA 4FFIA 4GJYA 1DLLA 1X9PA 4FI9A 4FSJA 3IDBB 1ST8A 2NLRA 4WZCA 5JSPA 4L8QA 4QB2A 3J7MA 4LO5B 4RA0A 5DUVA 1CX4A 1MPXA 2BOJA 2EF6A 3I3EA 3GJAA 3ON7A 4OZOA 3VUOA 3B00A 3FWEA 4RN5A 3WDXA 3ZR6A 5DZFA 3CJIA 3J4UH 1ZYBA 2WNUC 5FV3A 2E26A 2AC1A 2JG9B 4GD4A 4WVZA 1JXNA 1W8UA 1YQCA 2VOKA 1CAWB 1NQJA 2HWC3 3MZHA 4MV2A 3AL5A 2RHPA 4XFAA 4JGYA 5CYYA 2XLAA 4H2AA 1EV13 2ZJCA 4KWKA 5GZGA 1ULDA 4DB5A 1Q8OA 2B39A 2PXJA 2X5IC 3CL1A 3GZTB 3N9LA 4COYA 1O4TA 1RUF2 2VZ3A 3UKNA 1PM7A 2D6KA 2B9VA 1YIFA 2GNBA 3OTFA 1YC61 3AM2A 2BWCA 1O8SA 2YV8A 2G1MA 1UD1A 1VBE2 2VXRA 1I6XA 4RQPC 3USUB 1AXKA 3WNKA 4MG2A 4AVCA 3JD71 2W1UA 3OYWA 4AVSA 1N1SA 4INDA 5A6YA 4K9SA 5FQ0A 1D2SA 2W0XA 4ASKA 5C4WA 4I0AA 5FREA 1UY1A 4QDQA 3HNBM 1Q43A 5L9VA 1HQNA 4DO0A 1DIWA 1TQ5A 2FZ1A 2JDZA 1ND3A 3E6DA 1O5LA 4Z2AA 2BGPA 3O1UA 2JIGA 1FOD3 4XQDA 1LECA 4GALA 1UKGA 2MEV1 4LBJA 1ZZ9A 2WIIB 1MVQA 3ZXEA 2B45X 3FFQA 1QMJA 3ZYRA 4L0PA 3NW4A 4IV3A 1X36A 2R071 1YQ2A 2C26A 2RMU2 2JD9A 2QZ3A 2RS33 4XFCA 4N7UA 4BOWA 1VBD1 3LPFA 1EAH3 3UGFA 1JZ7A 2RS53 3WW2A 2D40A 4Q4V1 1RL3A 1EPWA 2XJQA 4QKBA 5T5OA 2OZJA 2R041 3I3DA 2W95A 4TLFA 5JXGA 2ZAAA 2JENA 3U75A 2XQRA 1CR7A 3VBFA 3U0ZA 1BXHA 1BBT3 1UOGA 1O3TA 4FFHA 1QGLA 1MZEA 2YU2A 2X8KA 4DZGA 5FTTC 2QQNA 1W9FA 1YIPA 1H8TA 3I3BA 1UY0A 2IXJA 5BNPB 4FTSA 5A7QA 5HV4A 1RINA 3J26N 3J7HA 4FBFA 4JX0A 4QQOA 1DGRA 4GWJA 3VBOC 3MLKA 4LO7A 4AI3A 4L9BA 1W6MA 3RWKX 3I3MA 2ARBA 2AR6A 2XJTA 3LSDA 4XBQA 3UGHA 3WDTA 2BNNA 5LY2A 2PLV2 2D7FA 1NZCA 1FV3A 3H3LA 4Q4X2 3EB7A 1DYPA 2JICA 3TN91 3ETPA 5I8TA 2OPWA 5LK5A 2R062 1S2EA 1ZRRA 1KITA 2A70A 1ZA7A 1OI6A 3OPWA 4IE0A 3OUHA 2CYFA 5ANQA 3DGTA 2DUQA 3GZEA 1B35C 3TBDA 1W99A 2IFWA 1CAUA 1MVEA 3O5SA 3BYWA 1Y9GA 1JHJA 4R52A 4Y5Z0 4FT8A 4LBMA 1VRBA 4QPGC 1ONAA 5EJ3A 3WDVA 1COV3 3WF0A 4GWNA 2GSYA 4NHLA 3RG0A 1K5MC 2RDSA 3DEMA 2FDFA 2VUJA 3HNMA 3WP3A 3AVRA 3MV11 2ZHNA 4E9KA 3IZOA 3H8OA 2VCBA 4IE6A 4FXKB 4PBPA 1RJ8A 1W3VA 2QQUA 4M3CF 4HT1T 2ZGUA 4KMQA 2SLIA 4XFBA 4C91A 2IC1A 1M4WA 3RQ0A 3GJBA 2VNRA 3POIA 3H8XA 2MHFA 3ABZA 5HCBA 5IVEA 4IEYA 3KVBA 3DF0A 4LITA 2HWC1 4XDPA 5E8AA 1HB1A 5BUVA 5FZ0A 5C3SA 4LHLA 1EV11 2PHDA 2VO5A 2ZHLA 4ZONA 4CCDA 1H2NA 2AGSA 4KL1A 1LB2A 3N4MA 2F17A 3PUQA 4RD7A 3AB0A 1AR92 4MGYE 1PK6A 1LEDA 1SLAA 2GH2A 2ZGKA 5DABA 1QDOA 3GZUC 4AI1A 3GZAA 3LEMA 1L7RA 4NVPA 3PDQA 2A73B 3RYPA 3FE5A 4JV4A 2RVAA 2R7EB 3VD5A 2ZZJA 3GNEA 4Q8LA 5IHRA 2WFPA 4UF0B 2Q0AA 2O8QA 3R4UA 4QX1A 5TSWA 1GMMA 2VOWA 2C5DA 3B02A 3V0BA 1XYOA 3EQEA 3POWA 4AOCA 2ZEZA 4CDUA 5HV0A 4AVTA 2UYAA 1AR82 2WINB 3ECQA 5ISLA 2WS92 3H9AA 3FHQA 1LULA 5F2SA 2B7YA 3G7DA 3WW1A 1ZRCA 1FOD1 1PMHX 2QQWA 4DXTA 1RUJ3 3S7EA 1LOAA 4BQXA 2ZGLA 4CDQA 4BPZA 2V4VA 1NY72 3ZN4A 1UOJA 1A6CA 2E9QA 2VBPA 1OLQA 4DXRA 4EWEA 4OZXA 4QQ2A 3WLUA 4HPKB 4RR3A 5EJ1B 1S0FA 1PO23 2UWBA 1FXZA 3LFIA 1C8NA 1UO9A 2RS31 2WJSA 4HETA 4LXLA 4HFSA 5AFEA 3H42B 1EAH1 5CISA 2RS51 4C8DA 2WSUA 4FOQA 2O8OA 4K3UA 1FNZA 4OQ9A 3FBYA 3C7HA 4IXLA 3ZFFC 1QXPA 3EBRA 4NPRA 4XFIA 1T6BX 4O7XA 1NCQA 1VBC3 2DVFA 2WFF2 1BBT1 5FY0A 4CCMA 5FOBB 5IVBA 5K0UC 4B1MA 3JUUA 4W6XA 5KXCA 4RS5B 3QH7A 1NX9A 4AYUA 1WZXA 5GKAC 1WW6A 2J1UA 1LHUA 1U5ZA 2GNDA 2W5FA 5JPMB 1OUSA 2BUKA 3ACLA 3DECA 3VBSB 2WSVA 4AQTA 4DIQA 3POSA 1CQ9A 1PM4A 2FDKA 3OG2A 3WF1A 4ORFA 1E5IA 3I4IA 1N1TA 1XSQA 3DPRB 5FY5A 1BVP1 5GZCA 4UYBA 4BJ0A 4YG6A 2XONA 1O6UA 2WZEA 5A3UA 3HMYA 4ZU5A 2HWE2 2YBKA 4NMIA 1BQPA 2J1RA 3FZ3A 1AL23 4EZ4A 2RM23 1A78A 1WLTA 4N43C 1UYPA 1RUF3 2BEOA 1VBB2 2QNKA 4LK7A 1S1AA 4AHZA 5I0SA 2GAUA 4CYDA 5HPOA 1ND2A 3CU7A 3SH3A 5A80A 2VXJA 2E53A 4LIVA 4C1XA 5BNNC 1COV1 5A3WA 4AI0A 2Y64A 1GWMA 2CNAA 4JTOA 4URAA 1UY2A 3FBMA 2ZGSA 3SITA 3RI9A 2UY9A 5JZGB 2V4AA 1D4VB 1AJOA 3NMBA 1F15A 2CU5A 5A33A 2CAVA 1R092 1JW6A 5T5PA 3SC7X 5A32B 4D0QA 4GB32 1W39A 1KQRA 3LAGA 3N3HA 1IS4A 4E2QA 1H6XA 1XNKA 2WUHA 2A3YA 3HWJA 2CY6A 1I1EA 1HV1A 1W8OA 2C9KA 4QX7A 4COUA 4IGPA 1DU3D 4UW4A 4E2GA 3O0XA 4CXYA 1G9FA 4ZS2A 4B1LA 1IQDC 1KFUL 5HI0A 2VBBA 3ZFGC 5T54A 1PHMA 1RUI2 3F95A 1WLCA 3AKRA 5FYIA 4NHYA 2P2KA 1JN2P 1AXZA 4YVSB 4EJRA 2VQUA 2LW8A 3D0SA 4N53B 1AUYA 3WNMA 2EIEA 5AVPA 2NZ9A 4BDVB 5I0DA 2JKBA 4A7ZA 2W92A 1XYNA 1JU3A 1HKDA 2WQ4A 2XOMA 3N7KA 4XILA 5DZEA 1VALA 4CXWA 2XLGA 3W5MA 3MUZ1 1MS9A 3EHKA 4S2DA 1UZ0A 3CHXA 3IN9A 5FMOS 3SISA 2RJKA 3LIHA 3TEZA 3KHCA 1F4HA 2ZX2A 2P6HA 3WNOA 1RUJ1 3ZSKA 5FYSA 1XU1A 5JSOA 4YW1A 5EWSA 3VHPA 3GM8A 3WSOA 3VKOA 3AZVA 3AKQA 2Q1FA 4FQZA 2FDGA 2A6WA 4QGNA 2ZGRA 3CJIB 2X29A 3OY8A 4AW7A 2PLV3 4OHXA 3IBMA 3MDPA 3A0KA 5EZWA 5KC6A 4CEYC 1HB4A 1PO21 4Q4X3 1PGW2 3WNPA 4Q0PA 1SACA 1UL9A 3W58A 3AFGA 3ZXDA 1V6OA 4JGYB 3I2HA 5FP4A 3UESA 1GZ9A 3AKPA 2DVBA 2VTFA 4I30A 2D93A 3KD4A 4OQ8A 4LUMA 1VBC1 3QH6A 3AYDA 3TWIA 4QDRA 5H9SA 2WWSA 3IM0A 4DUVA 4L99A 3LF7A 5D8AA 5GZDA 4MGZE 1UXZA 2K0GA 3VHNA 5D21A 3WOGA 3Q8CA 1RUH2 3OYWB 4JKKA 4K8RB 4YVWC 1RXFA 2X10A 5FQ0B 4FPFA 5CB7A 3OOXA 3T09A 4A7YA 5LBBA 1N47A 5C4WB 3DV8A 1W0OA 5EV7A 4HVRA 3AZYA 2ZKNA 5IT6A 4DPNA 1ND3B 2EVXA 3FL7A 3FUOA 2VGDA 3ZMNA 4KH9A 1O8PA 3B69A 2LTNA 2Y60A 5C3OA 4EE2A 3P5BA 5D1IA 1APNA 1VR3A 3A0NA 3PVBB 1AL21 1UPSA 3KT1A 2J1AA 5C9AA 5LBFA 4AI9A 2RM21 3K4AA 3H8RA 3R0RA 1H8TC 1RUF1 4IV3B 4OHWA 1AR93 5FRAA 3NQHA 4QX5A 4XAAA 4D3WA 3WUDA 2W52A 1UX7A 3SEPA 3IAQA 1REFA 4K8FA 4KU8A 5F5AA 3AMNA 5FIXA 4IUGA 1Q5OA 3EJKA 3IMMA 4N9HA 2D3RA 3R6SA 3VHRA 1DHKB 1VB2A 2J1TA 4CEWC 5F9TA 4PDWC 3S5AA 3VZMA 3LDKA 1UZZA 3FHIB 1AYN2 4AGVA 3WXPA 5L19A 2Y0OA 3BN6A 2YFUA 5I91A 4OUEA 3VBFB 3VL9A 2BOIA 2YBPA 3WD5A 3HOBA 1QDCA 1AR83 4G4FA 4JQTA 5T5JA 3KS7A 2CWSA 2WS93 2IFRA 2DYCA 1QJFA 1CD3G 3LIGA 3UETA 1QHDA 1QJX2 3WW4A 4CP0A 2ETEA 2JDMA 1UW8A 3PVEA 1DCSA 2DCZA 2HBUA 3OB8A 3M4FA 3SHRA 4WM7A 4I01A 1W6MB 4BYYA 1BKZA 2F4LA 3LPGA 3M1HA 4ZZ8A 4LE4A 2C9AA 1S0GA 4BQYA 1NCRA 3ZN5A 4LBKA 1XC6A 4OUMA 4AQSA 1WCUA 2DUPA 4XF0A 4Q4Y2 4BQ1A 1EUUA 2DCKA 4CDXA 4CXXA 1GWKA 4NO4A 1UU5A 1ZA4A 1LAJA 3IB3A 5A7WA 1WCQA 1XPWA 5B4XA 1DFQA 3SCGA 5FOJB 5I8SA 1GFF2 1R1ZA 1KDKA 5A3NA 1ULPA 2YFZA 1YJKA 3LA3A 3E5UA 3LFMA 4H7LA 5B4NA 3BOWA 1GYKA 1K3IA 3DXTA 4NIAA 4C90A 1CAUB 1X82A 2JD4A 4E27A 4IEOA 4AXOA 1R1A2 4YSFA 2DVDA 3AYEA 3B9CA 1VMFA 3ZXJA 1H4HA 2WO3A 4NRPA 3VBHA 1CN1A 2WKKA 4ITCA 2WQZC 3I2IA 1X50A 2MPFA 4XJAA 2B4KA 1NE4A 4PQ9A 1RUC2 2D6NA 4OHVA 4QM9A 3ZDSA 4Y4RA 4I09A 1ZM1A 4W50A 1GOFA 2HYXA 4GH4A 2WDBA 1J1TA 3W59A 1AHSA 4OI2A 2PLV1 1W8ZA 4K40A 3AKSA 4COZA 1JZ4A 3M3CA 2GC3A 4Q4X1 5HCFA 3V0AA 2JE9A 5J1XA 4QXCA 4Y26A 4Z2WA 2HWE3 2PA7A 2WO7A 2Y26A 2A3XA 1VB4A 2JDPA 2I2SA 3HNYM 5FZ6A 1O3QA 5CFDA 5LWBA 2ZX4A 3OJBA 2FZ2A 4HG6B 1W8HA 4YW6A 1G9BA 3TAYA 3NNLA 1KS5A 1QJEA 2ORXA 1VBB3 4QPIC 2D6OX 1P8JA 4TSVA 4GKYA 4K20A 3ZIWA 1PK6B 3FLPA 3OCPA 4UW5A 1PIV2 1S0BA 4LEJA 1PGL1 1IKQA 3ILFA 4YFWA 1O4ZA 2YYOA 4FPJA 1AX1A 5ABJA 1POV0 4QKNA 2WBKA 2GNMA 4A42A 1UIJA 5L9RA 2Q8DA 2QDNA 2KM2A 3VD3A 1DP0A 2R30A 5AC92 4AI8A 4RSUA 2H6CA 5LZ6A 1ZNPA 2R32A 3LKJA 3V0BB 1R093 1NZIA 3NNFA 2ID4A 4CDUB 4QXHA 4KGGA 4EN6B 2Y8KA 3ES1A 1WWYA 3LDRA 1HX6A 3IAPA 1OURA 1JHNA 1ENXA 1MS1A 1ZBA2 3MYXA 3O1OA 3QCWA 4NUBA 1H8VA 1BYHA 5KHJA 1V6MA 3AMQA 4CDQB 1VLNA 4LE3A 2W87A 2EAKA 2VUAA 2XQXA 3PHMA 1NUKA 3UJOA 1AR91 1E5SA 1RUI3 2V73A 4BMEA 1CZTA 1YUDA 4FFFA 3M3OA 4RR3B 5E16A 2Y34A 5FLHA 4V1PA 3WINE 3OD4A 1Q8QA 2N7GA 3KV5A 1L7LA 2TEPA 4QQPA 1GKBA 3RVHA 5I0RA 2ADDA 2HEWF 1NA1A 4CP1A 4AFCA 1PMJX 1LGNA 4AEDA 1HIXA 1AZDA 1OPMA 4CCEA 4F7ZA 3MICA 1UKRA 5LA1A 1S55A 4GIQA 1NCQB 3P3PA 4QWNA 4B4PA 1DQ6A 4GULA 1JZ6A 1AR81 1PVC2 2FCUA 1JZ2A 2WS91 4TWTA 5F3GA 4LNVA 1AX2A 1ZVFA 3ZPOA 2O1QA 2GMMA 5J96B 2VMHA 2VR4A 4LO4B 1ND2C 4CUCA 4DINB 5HBAA 5A3TA 3RZMA 4ZU7A 3OGRA 4M01A 1YEWA 2UY8A 2R0FA 3PTYA 4UWDA 3RSJA 1CAXA 3RS6A 1W8TA 4HOOA 4P00B 1DQ4A 1OKQA 2Y6KA 2FCVA 1W6QA 1WLWA 1SLCA 2D5FA 3K77A 1Q8SA 4IL7A 5CVRA 4BWOA 4CCJA 2Y38A 4QKFA 1LHWA 1OMIA 1W04A 2GNTA 4QAWA 4XFFA 3CZJA 5FCCA 1ZREA 3P6BA 3I59A 5FY1A 1G9DA 1J58A 1O5UA 1YLLA 5IK8A 3IWZA 1HJFA 1UU6A 2CGPA 3ZYBA 4D7SA 2UWAA 1RUH3 3U4XA 1OUXA 4UFLA 2TUNA 1E5RA 2YB7A 4JC1A 4ZS3A 4EZHA 2GDFA 1TG7A 2WL1A 4QB6A 3S30A 3VDBA 2BRTA 4XJ8A 5A33B 5FZHA 5EJZB 4HN1A 5FXWA 2XBO2 1C8M2 3PVOA 3U10A 3RPQA 2IXKA 4AVBA 4KG8A 4XUQA 4MZUA 3AJZA 4IEPA 2HWE1 5I8YA 5IATA 4BQ2A 1OHFA 1W0PA 2AUYA 3I2FA 4QGMA 1LCLA 3KLSA 2C6SA 1F8VA 2HYKA 3UYJA 2VMCA 4CZSA 1XOYA 1UYXA 3NWKA 3NV3A 4LA2A 2R1DA 4JHZA 1XE8A 1OQ1A 5BNOC 5T50A 1VBB1 4MO3M 3MIBA 3VZLA 4IV1B 1GZCA 2EXKA 2PHWA 4O65A 2ZKLA 4LHSA 3K48A 4X8NA 3RZLA 3AVSA 1XXNA 1SLTA 4MXWA 2VE1A 5DDJ3 4ET7A 4XUNA 1AYN3 4EWDA 3AP7A 1CZVA 2P1BA 5FZ7A 4XF4A 4XETA 1R091
chains in the Genus database with same CATH topology
3B94A 2JG9C 3NO8A 4GMP0 2I45A 2IXHA 2JX9A 2BWAA 4Q0QA 4JAAA 4Y22A 1VJ2A 3D8CA 2XWJB 4BIOA 1OD5A 4JGZA 3GHMA 2B42B 1RUI1 3OY8B 1URXA 4Q4Y3 5JCTA 3QOPA 3WX5A 1YWKA 2WNVA 3VDDA 3AZWA 1QOOA 4HSJA 3ZXAC 5KXDA 5KHGA 4LT5A 3MF6A 2Q8OA 4L2NA 1LOFA 3SCHA 2VVDA 1G9CA 3AZXA 1DBNA 4HANA 1MR5A 5LK7B 3ILRA 2HWB2 5D8AB 1FPN2 3VBUA 2YPJA 1HLCA 4IQPA 4IESA 5JI9A 1HRV2 5GLVA 1VAMA 1ENSA 2BTVC 4CP2A 4LBQD 1RUC3 3MW3A 4DXZA 3WCSA 2JE7A 2D44A 4U2AA 1WCKA 4ONUA 2GU9A 4FOWA 3AMHA 3PMEA 1NE6A 5T55A 2WLPA 4OUSA 4XEZA 2WC2A 2GALA 1MQTA 2YHJA 3L9JT 4LA3A 3CEWA 2Q30A 2W39A 3AK0A 3ZXFA 5C9AB 2D3PA 1SBEA 5CU1A 4FPOB 4DOUA 1WUVA 3M7AA 3O0WA 4UXAA 4YGCA 3H3ZA 3H8UA 2B5HA 2PTMA 5DG1A 1PIV3 3R05A 3ATGA 3H3UA 5BNPC 4HVQA 3NAPA 2D6LX 4XXPA 1RUH1 1RUE2 1ULCA 2OPKA 3N36A 3AXDA 3FLTA 5AC93 4ES9A 1YFXA 4M0NA 3OBRA 5GLZA 1CIWA 1ZBA3 5BPXA 1RJ7A 2QZ2A 3IT8A 4AEMA 1EY2A 4DY5A 2ZGMA 4WM7B 1RMU2 5JOYA 2NMOA 1MZFA 1AR62 1NCRB 1CPMA 4CDXB 1V6JA 2YGMA 4WVMA 3H7YA 1U12A 2VW1A 1LGBA 5DG2A 5LRRA 1H9PA 5DDJ1 1F31A 1RUOA 1AYN1 2VOXA 4E2SA 2CAUA 5T3NA 1DGRN 1QJZA 5L7OA 5KHIA 3VBRA 1WBFA 2A6XA 2NN8A 1PVC3 2HJIA 4BIFA 4Y1XA 3AP4A 3MPBA 3VBHB 4M3CA 3S0MA 1GQHA 4AG4A 1QU0A 1UCXA 5FPXA 3IIAA 2A75A 4GH4B 2NM1A 2WZR3 2XLFA 4Q4Y1 3V0AB 2E51A 3SLIA 2IXIA 4YM2A 3RWNA 4D94A 4H3WA 4W6YA 1BJQA 5CFDB 1MZ5A 1N3OA 1UMZA 3ZXKA 1YFUA 1GICA 3NV2A 1DYKA 2FQPA 5KHHA 1NYWA 4CRQA 5ABJB 2JG8A 1QKQA 1YO8A 5ACA2 1GNHA 4YG0A 4AFMA 2VECA 1NG0A 1S0CA 1RUC1 4MSVA 1HRI2 2XBO3 4LULA 4XHXA 1C8M3 3MIGA 1LHOA 1KJRA 1DQ0A 4N9IA 2DURA 4QT6A 1IQAA 3TRSB 2XKOA 3WP6A 4WVVA 4AQ6A 1IGOA 1J1LA 2BNMA 3U11A 1AJKA 4XMAA 3LZZA 4RS5C 1PIV1 2ZMKA 4IEWA 1U5IA 5J36A 2P3KA 2BQPA 4IERA 3M3IA 1LODA 1Z0HA 3EXUA 1NA1B 1Q56A 3VBSC 2PHLA 4AEDB 4R4XA 5AC91 4Z92B 4R9AA 4ISQA 1N3QA 3AFKA 3DPRC 1MEC3 1AVBA 4J1XA 3BIWE 1ZBA1 3WUCA 4BA6A 1WCSA 2GC0A 4HK9A 5SV5A 2A6ZA 1BMV1 3D0JA 2PFWA 2XJVA 1GV9A 2DWRA 2X53S 2XWBB 1SBDA 4Q1RA 3MIHA 1V6IA 3KT4A 1DDLA 4EN7B 1MZ6A 1LGCA 4WM8A 5C8CA 2Q4SA 4X8PA 2VH9A 1CAXB 5GALA 4H7MA 2E7QA 1W6QB 3BPZA 1HW5A 5JZGC 3DL3A 2ZABA 1VAKA 2ZTNA 4QM8A 1TEIA 3UJQA 2YMZA 1F9KA 5K8SA 1DZQA 2F6BA 3ZVXA 1PVC1 2HWB3 2RJLA 3I59B 4HKWA 1FPN3 3VKLA 1R082 3B93A 3H1WA 1HRV3 2ILMA 3ENRA 4UBHA 3BB6A 4Y1ZA 1VBE3 2YY1A 2WA3A 4NN0A 1QQP2 2BFUL 2BW8A 5J98B 1O3RA 2PELA 1PNFA 3MLLA 2WZR1 2ZPXA 1OLRA 2YZ4A 3WG4A 3WQ0A 1O7FA 3RNSA 4YVSC 4DNYA 5GLUA 4N53C 3SXWA 4FVVA 4CDWA 3FC0A 3E5XA 1O4YA 4P9WA 1BCXA 1VRH2 3M3QA 4YZ4A 4XTMA 1WD4A 3ZPYA 1QWRA 1DZTA 1LOCA 1Q8PA 2ZX1A 2AENA 2QDRA 2RMU3 1BK1A 1RUE3 2OW4A 4IV1A 4MXWB 3ZFEA 4PLNA 4WZFA 2QE3A 3W9AA 4C1WA 2H0VA 2I07B 3O14A 1Q8VA 4ATFA 3CJIC 2CTVA 1MS0A 2F4PA 2XBO1 5L73A 5I93A 5JLVA 3WG1A 2DU1A 1CJPA 1ZBE2 4BLIA 4JGYC 4Y22B 5BNNB 3LCPA 1Y43B 5CFCA 5DXDA 3MIEA 1SLLA 1RMU3 2QFEA 2ET1A 3ILNA 4JGZB 1A8DA 2WT0A 3SCFA 3LA2A 1AR63 3QACA 4KGQA 1AYM2 3O7OA 4YM3A 5JAXA 1NXD1 4I0BA 2XVLA 2WNVB 3VDDB 4LBQA 1ZZ6A 3CJXA 2FBEA 4Q4W2 1ZZ7A 5C4WC 1IPJA 2R063 3C3VA 4PIYA 4YZ5A 4NWVA 1RHI2 1MEC1 1ND3C 1I9RA 2QUOA 3KSCA 1YXWA 1OOPA 3M3EA 3N7MA 2C1FA 3VBUB 3WVJA 5EYXA 2G9FA 3FJSA 3OGJA 1FMD2 1VBA2 2DCYA 2VVEA 4IV3C 4IEVA 3UK9A 4E4ZA 2EXIA 4R9CA 4HSLA 4X6RB 2OUHA 2JECA 1AR72 1MQTB 1OA3A 2ZACA 3H0OA 3HT2A 2LM3A 4QU2A 3PMSA 5BY5A 4H55A 2HKXA 1MS5A 3IKWA 1YJLA 4IETA 3VBFC 1OSGA 2XL9A 1G9AA 3B7MA 5JIAA 1H4GA 2W08A 2D6MA 3QBQA 2HWB1 5I0UA 1FPN1 2Z2SB 4XIOA 2RR12 1VBD2 1HRV1 3DKWA 3NAPB 5ACA3 2BPA2 4FAHA 2WNUA 1UF2C 1VBE1 4XXAA 4Q4V2 4GA9A 4AEJA 1SCRA 2QVSB 3MF9A 4ISRA 5BXXA 4AFDA 4D69A 2I74A 4JVAA 1HRI3 2C0ZA 3AP6A 1EYBA 5C33A 4MGKE 2ZCWA 2BBVA 1UU4A 3B5LB 1DGLA 2X5IA 3GHNA 3TNPB 4Y24A 1AF9A 2B8MA 1H1AA 2ZHMA 4RQPA 1QH7A 4XHBA 1N3PA 2CV6A 5J48A 1U0AA 1KD7A 2O0OA 4HKOA 4O9GA 1VAVA 4XOGA 5IK5A 4WVMB 3JZVA 3MIFA 4OHYA 2K9ZA 2RMU1 3HD8B 1RUE1 2IXLA 4BLJA 3WT3A 1LR5A 1SMVA 5L7OB 2YGLA 1QJU2 3VBRB 3THPA 3KT7A 3RJRA 5FFOC 4B3NA 1CONA 3WG3A 3PNAA 1QY4A 4Y20A 1D0HA 2WFF3 1YNAA 5L36A 4M3CB 1MS4A 2VMGA 2XJUA 4LUKA 3WHUA 2A7AA 1GSLA 3D4KA 3GF6A 1RMU1 5HCAA 1PK6C 1AR61 3ZYJB 4MVTA 3ZX7A 4YZ1A 4JDOA 2GMEA 1WW7A 2TNFA 2WLQA 4J6GA 1JYCA 4XW3A 4DQAA 2XKPA 4NHKA 1W2UA 2R061 1HXS2 4K21A 4TYSA 1TMF2 4DY3A 4LHNA 4CDUC 1QXJA 3HBZA 3VBOA 4AHYA 1R083 3ZSLA 5GZFA 2JG8B 3O12A 3TYJA 4I2OA 2ZBJA 4CDQC 1QQP3 4LTAA 4FPKA 2Q1ZB 1V6KA 4FOVA 3H1MA 3TOJA 5CBLA 4RR3C 4B29A 3THTA 4YFZA 3WP4A 1H1MA 1NQDA 1B35A 4QQLA 4GB33 1M06G 1FOD2 1WW4A 4AWDA 1F5JA 4AK3A 4L92A 2ZAHA 2ZHKA 4PJYA 2OA2A 2PHRA 1I5ZA 1VRH3 4QPGA 3ZSMA 1NCQC 4Q1PA 3ZMOA 3POYA 4YM0A 1FX5A 1K5MA 1MS8A 3J9SA 4Q8KA 2LUWA 1NLRA 1SLIA 4HVOA 5ACA1 4HMZA 5F6KA 1EAH2 5H9QA 1BVVA 1LTEA 4UW3A 4K6BA 1BEV2 2VQ0A 3OF1A 1QH6A 1QOTA 2VW0A 1RVF2 4D7YA 5J09A 5IK7A 1HRI1 4FPEA 5FBZA 4Q2FA 2E7AA 3KCCA 4BZ4A 2R49A 3HIFA 3AXEA 3GYDA 5KXBA 1S2KA 5KXEA 2RE9A 2HWF2 3M70A 3IPVA 5JOXA 1LOEA 1SFNA 4RL7A 4AHWA 1PZ9A 4F8AA 1W6OA 4WM8B 5I0TA 2UYBA 1AYM3 5C8CB 2H0BA 1NY71 4EV0A 1CVNA 1HQWA 3DN7A 1SEFA 4FP2A 4B7EA 4DFSA 2IXCA 1JYIA 4Q4W3 2VNOA 1Q3EA 4W6WA 3ST7A 4R9BA 2B46X 1QF3A 3KM5A 4KQ7A 3H50A 4PF5A 2VMIA 3AMMA 1D4M2 1RHI3 4YM1A 2ZGOA 1DG6A 3BTAA 1TME2 2WFF1 4HK8A 4JDNA 3LSEA 3IDCB 2EA7A 2DVAA 4META 4YRDA 3U07A 5J3UA 4JDMA 2R0HA 5JWPA 1FMD3 1S0IA 1VBA3 3ZXLA 5JSRA 1CAVA 4QMAA 4LLOA 1UIKA 1LJ7A 2ERFA 1CESA 1TNFA 2HEYF 3MW4A 4IEUA 4HN0A 4AFBA 4IV1C 2A71A 2DCJA 4FP3A 4M00A 4XF1A 1YHFA 5J7MA 3ZFFA 4P9IA 1AR73 1PGSA 2RS12 1ZZ8A 4CDWB 5K0UA 4U36A 3B3QE 2DU0A 1LENA 2XJRA 5LEJA 4LBOA 5E88A 2YC0A 2FMYA 1YCIA 3MIDA 1H30A 3AZZA 2PHFA 2WNEA 3FX3A 4OFGA 1ULFA 1IOAA 1R081 5SV8A 2RR13 2EALA 3GBGA 1X7NA 5FO9B 1NLSA 4F83A 1GQGA 5H9PA 3ZFEB 2KXLA 2D6PA 2Z79A 1QQP1 3B01A 4RFT0 4BHPA 5JIUA 3KQRA 3NKTA 5BV6A 5CG8A 3S7IA 2G4IA 2R1BA 4N43A 3FUQA 4GB31 4AHXA 3JBG2 3UL2A 1DQ1A 1RUJ2 1REDA 3ZYIB 5CFCB 2R6QA 4XZPA 1QJX3 2AH2A 2ZZQA 1VRH1 1MS3A 5BNNA 4Y1UA 3RZZA 1E57A 1WMEA 2PQQA 5D8AC 3LOBA 4FAGA 1AXYA 1V00A 1LU1A 4FOYA 4HLTA 3HQXA 4LBQB 4PCRA 4XQWA 2Z5WA 4C0BA 2XH6A 3VKNA 1JUIA 1KS4A 1QJU3 3JQWA 4P5HA 3WDYA 4AF9A 5E89A 4B4QA 2DFBA 1H2MA 4ES8A 1U5XA 2ZGNA 4L11A 2ZX0A 1Y7BA 3L2YA 4N7IA 2Y0IA 3V64A 1GZWA 1OOPB 1LEMA 2WZPP 2UURA 3IDEA 4KWLA 3M8LA 2FHRA 4GXLA 3ZFGA 2D97A 3N35A 1R1A3 1DGWX 1LESA 4A2UA 1NOVA 5C9AC 3RYRA 4YW3A 1QOSA 1Y3TA 4A3XA 3JCIA 4Q26A 1POV3 2HWD2 2BYVE 3BU7A 1CPNA 3TB0A 4AVAA 4S2FA 4J1WA 1AYM1 5JPNB 4LO8A 2ENRA 3AP9A 4FTBA 1YRZA 3ROUA 1G7YA 4TZDA 4Q4W1 2XUMA 1PGW1 2VVFA 3HT1A 4R9DA 1HXS3 4FPLA 3KGZA 1AL22 1TMF3 1DZRA 2PAMA 5EXOA 1Y9QA 4PIZA 2RM22 4PLOA 2EXJA 3JQXA 4IEXA 1ZZCA 3T2TA 1RHI1 1EP0A 4FTEA 4K1ZA 2VQAA 4LHKA 5FLIA 3SNMA 4OHZA 5JOZA 3ALQA 2WNUB 1N1YA 1FMD1 1VBA1 3L2HA 4LO6B 4MX3A 4CEYA 4WM7C 4UW6A 3UKVA 1A3KA 5CG9A 3NL1A 4YW2A 5FPZA 2VW2A 1NCRC 3H7JA 3ZIXA 4CDXC 1QNYA 5CADA 2W68A 1AR71 1V70A 2X5IB 4Q0UA 4WV8A 4YNIA 3SMHA 3G6JB 1RUG2 1LRHA 4Q0VA 3ETQA 5JDBA 3VV1A 1XQNA 1XNBA 2K2SA 4RQPB 4DS0A 4KNCA 1H2KA 1W6PA 3ASIA 3E97A 1FAYA 1LOBA 1WLDA 4YVWA 3B9IA 2PAKA 1SBFA 5K9YA 3VBHC 2RR11 2D5HA 1XNCA 1S0EA 5A3MA 3NJZA 1DQ2A 3AYAA 3KMHA 1XYPA 3LA7A 3WQ7A 3ZYGA 1WBLA 2NPIA 1IPKA 1BEV3 1RVF3 2VU9A 3AJYA 4GH4C 3ZXGA 1REEA 3CNAA 4KU7A 1OQDA 2QQPA 1IS6A 1C1FA 4Y20B 3ZN6A 2OYZA 4HL0A 1XE7A 1AX0A 2HWF3 1OFNA 5CFDC 1PMIA 3MPPG 1QJX1 4WVWA 4IEZA 4JRLA 4XFGA 4CEWA 3AYCA 2OZ6A 4OI4A 1BZWA 4E4SA 3FLRA 4PDWA 1AL0G 1O91A 4I3PA 3D6EA 4FQ4A 1WD3A 5ABJC 1IS3A 5C8WA 4OVEA 4RHV2 5F1RA 1ASJ2 2DTYA 3BODA 2ZX3A 5JR7B 3NKGA 1QJY2 3MFCA 1QJU1 4D7TA 5GLWA 4NHMA 1UPIA 3OD0A 1WW5A 5F5QA 4FO9A 3QD6A 2IWGB 1D4M3 4X6QB 4XBLA 3AKTA 2DVGA 1TME3 4AFAA 3VBOB 3RYKA 4EROA 1PGL2 3X29B 5EFUA 1J59A 3KCXA 5AFBA 4QHBA 1QNWA 1R1A1 4XE9A 1S0DA 4M0HA 1DF0A 3WDUA 4YGBA 3K51A 1POV1 1HQLA 2A6VA 1RUD2 3PVNA 3UV9A 1YI9A 2RS13 5K7PA 1B35B 1PO12 1DQ5A 3ELNA 1NA1C 1G86A