2DVDA

Crystal structure of peanut lectin gal-alpha-1,3-gal complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvdA00
3KM5A 1V6OA 2ZHLA 3DGTA 1G9FA 1SLBA 3B69A 1KJLA 4LBQA 3ZXEA 2ZGNA 3WDVA 5F5QA 3ZSMA 2VW2A 2VXRA 2YY1A 1Q8QA 1CONA 1DQ1A 3N7LA 2DUPA 4WZFA 4YM1A 4AWDA 1O4ZA 1NLSA 2WT1A 2AUYA 4Y22B 2YV8A 1CESA 1W0PA 2DU1A 4FPYA 1WW5A 1SCRA 2EF6A 1MVQA 2GMMA 1W6OA 1QMJA 3MW4A 2D6NA 3M1HA 1DLLA 2A3YA 2JJ6A 4F83A 3A4UA 1IS3A 1ZM1A 1SFYA 2ENRA 2TEPA 3WDUA 1URXA 2VW1A 3VUOA 1UPSA 1LOCA 3M2MA 4XHXA 5KXEA 1C1FA 1FNYA 1LTEA 2AREA 1DZQA 4FOQA 2NM1A 4FPFA 3PMEA 4YGDA 1A8DA 2OUJA 5DUVA 4XXPA 2W52A 4Q8KA 1ULDA 4W65A 4YW4A 4BPZA 3V0AB 1Q56A 1UX6A 2GMEA 1W6MA 3RSJA 5EYYA 2DTYA 4YG0A 3RG0A 1QGLA 4UW5A 2RHPA 5HCBA 3ILFA 4Y1ZA 1N1YA 1ULGA 4YZ5A 5JDBA 1RITA 2UU8A 3GALA 4LBOA 2ZGMA 2WLQA 3WG3A 1S0DA 1WLCA 3ZYRA 5H9SA 1VALA 4FPEA 2CTVA 1JBCA 3MEPA 3OBTA 1LHUA 4GXLA 2JE9A 1Y7BA 4AGRA 2VW0A 1YI7A 3B3QE 4BLIA 4XHBA 3ZSLA 3ZSJA 1N1SA 1IOAA 1DQ2A 2GMPA 4AVTA 3U4XA 1MS0A 3SH3A 1AF9A 2WT2A 2D6KA 1GKBA 5EYXA 4CTEA 2CNAA 5KXCA 1G9DA 4BQ1A 1DQ6A 3FBYA 4M3CE 5GZDA 2LALA 4KBBA 4FPLA 2DVAA 1N3PA 2A75A 3M3OA 4M3CF 4BLJA 3AFKA 2A5ZA 5AVAA 5JLVA 1GZCA 1JUIA 1C57A 3OY8A 3AYEA 1KRIA 3I4IA 4FVVA 2Q5TA 1AX1A 2JKBA 1CJPA 1B09A 1N1TA 5GZGA 2ERFA 1MS3A 2D43A 3C2UA 3PVEA 1C4RA 1QNWA 2E7TA 3SH4A 1SLTA 1O4YA 2OW4A 3VKMA 1GYKA 1W6NB 2C9AA 2ZA9A 3AZVA 1SCSA 3LSEA 4XJ9A 2DTWA 3TAYA 3POSA 1FYUA 5DZFA 3BIWE 3I8TA 2P3KA 1H9WA 1WW6A 3N35A 4FPGA 1HQLA 5KXBA 4BMBA 1ENQA 4NO4A 3FUOA 2ZGLA 1CVNA 2ZGQA 4C1XA 5HCAA 4FP2A 1WW4A 4XDQA 1SBFA 1F5FA 1WUVA 1XQNA 2BQPA 1VLNA 3T1LA 4ZXKA 3WG4A 5GZCA 3NV1A 4XJWA 4Y24A 3AJYA 1MR5A 2EXJA 4K21A 3USUB 1SACA 1CR7A 4XE9A 1H30A 3WCSA 4XJ8A 5CB7A 3IKWA 2UWBA 1WW7A 3RMYA 2YMZA 2EXKA 1S0IA 5T52A 3WUCA 4Y26A 3LCPA 5GLTA 1GZWB 1BYHA 3AP9A 2FMDA 5IUQA 4XOGA 1GSLA 3IN9A 1IKQA 2P37A 1HKDA 2CY6A 5EXOA 5H9PA 5JVVA 4TZDA 2NP0A 2YROA 4Y22A 1SLAA 3AYAA 5CA6A 3NV2A 4WVWA 4M01A 1YXWA 2ZGSA 5DZEA 5GZFA 3V64A 1SLLA 2EXIA 4BOWA 4TYSA 4XJZA 5GLZA 1QKQA 1UZZA 3WDWA 3T2TA 1GV9A 2I2SA 2R1DA 1CIWA 3OJBA 4YZ1A 1GICA 1ENRA 3R4SA 4SLIA 5HCFA 1I1EA 2W08A 2DVFA 2ZMKA 1AX0A 1G8WA 4H55A 5DXDA 5EWSA 1WD4A 2WSUA 3D5OA 4AGGA 4DFSA 1LCLA 3V0AA 3MW3A 4Q1RA 1DBNA 2JE7A 2E7QA 4R9BA 5T5PA 1ULEA 1IS4A 4P9WA 2A6WA 1S0FA 2P34A 1MACA 4M3CB 1W6QB 4YW2A 5JOYA 4AGVA 2D6LX 2D44A 5H9RA 1QOTA 3PJQA 3VKOA 4XJAA 3PVNA 4DQAA 1WLWA 4MYEA 4DS0A 1Q8SA 2PHWA 2D7FA 3RRDA 3TB0A 1MS4A 3AX4A 2ZGKA 2ZHKA 3H0OA 3POYA 4L8QA 4ASMB 4PCRA 4CRQA 1Q8PA 4DRVA 4FPHA 1LECA 1AJOA 1WCSA 1GANA 3V0BB 1GLHA 1UKGA 2A3XA 2UWAA 3RQ0A 2DU0A 5FREA 1N3QA 3AP5A 3HMYA 4Y1XA 1V6LA 1MS5A 3D4KA 3ZXJA 4R9AA 4YFZA 4FPCA 2CWSA 3AXDA 2ZAAA 1LJ7A 1Z0HA 2CL2A 3OPZA 1AJKA 4ATFA 5IK8A 2ZKNA 3OBRA 3PVOA 1CPNA 2Z42A 3VKFC 1DGLA 1IKPA 3SNMA 1DIWA 3N36A 4YFWA 5GZEA 5H9QA 3WHTA 1LHWA 3GNEA 1AXYA 1V6IA 2AGSA 2JD4A 4LBKA 3R05A 3AP4A 1VIWB 2YZ4A 3IM0A 1W6NA 3LSDA 4XIKA 5JOZA 1KQRA 1W6PB 5DUXA 5BYNA 5L73A 4PBPA 1LENA 3ILRA 4FPKA 4R9CA 4XXAA 1V00A 1LU1A 1BZWA 1S0JA 3M3QA 2OUHA 4Z8BA 5CAZA 1CN1A 3FUQA 2DUOA 1S0EA 4Q8LA 4XIOA 1KJRA 4UW4A 1A3KA 1OKQA 5FRAA 3WOGA 1SLCA 4U2AA 4HL0A 1S0CA 2EALA 2ARXA 3USUA 1S0GA 1OQ1A 1JN2P 2CYFA 5E89A 3M3EA 5LK5A 4U36A 4YW5A 1WBLA 3SLIA 4Q27A 3IPVA 5CNAA 1FV3A 1GNZA 1LHOA 4XJUA 3ZPYA 3IMNA 4FQZA 1FATA 1GZWA 5GLWA 4LBQD 2NN8A 4P9XA 5DUWA 1LOFA 2PELA 1CQ9A 1HDKA 1OFSA 2WKKA 4GWNA 2XB6C 2NMOA 3AYCA 4YZ2A 1APNA 2VY0A 4UW3A 3OGGA 3KQRA 3NV3A 3WUDA 2A6ZA 2A7AA 2WJSA 2C5DA 1KITA 2EXHA 2WT0A 1LODA 4FOWA 3D6EA 1DYKA 2R16A 4HANA 5IT6A 2ZGOA 2ZGPA 3O0VA 3ZXLA 4JC1A 3O0WA 4YM3A 4XBQA 4YZ3A 4XYXA 1LOEA 5DZGA 3ZXFA 4YGBA 3AK0A 2AH2A 1G7YA 3T1MA 2FHRA 3W59A 1LULA 5T5JA 4ZKTB 1UL9A 4YM2A 1MZ6A 2OVUA 4IQPA 4K1ZA 1JOJA 1ULFA 3OYWB 4XTPA 3ZXKA 1HLCA 2GNDA 1LESA 1Q8OA 1QNYA 3N7MA 1AX2A 2NZ9A 3ASIA 3ILNA 1F9KA 3FLRA 1R1ZA 2A6YA 5JOWA 1RIRA 1YIFA 1JYCA 4M3CA 3WG1A 2D3RA 2SBAA 1UZYA 1W6QA 2KM2A 2UURA 1LU2A 2A6XA 3HR9A 1N1VA 1QDCA 3MPPG 3WVJA 1PZ8A 1TEIA 1RINA 4YG3A 1FNZA 1V6KA 1KDKA 1JXNA 4ATEA 2DVBA 2G4IA 3Q9OA 4GKXA 3MW2A 4YG6A 4Y20B 2GALA 2V73A 3AZXA 2P2KA 2HYKA 4PQ9A 2ZABA 2ZHNA 4YM0A 1V6NA 2DUQA 1SBEA 2JDZA 3B00A 2EIGA 1G86A 1MZ5A 2NMNA 3UJQA 2ZGRA 4Y1YA 3AZYA 3FLTA 4OZXA 3ZVXA 2V5YA 2LTNA 4ISRA 4D69A 4RA0A 2SLIA 3BTAA 2ARBA 4Q1PA 2DYCA 2VUAA 5JMCA 1LGBA 3N7KA 1VAVA 3QLQA 2P3IA 1MS1A 3POWA 1N3OA 2E51A 3AP6A 4FOVA 2DVDA 4P14A 2GDFA 4BMEA 4ITCA 4AYUA 3ATGA 1G9CA 1MS9A 1BQPA 4Y1UA 2YXSA 4XBNA 5DUUA 2DV9A 1IS5A 2D3SA 4GWMA 1D2SA 4JRAA 1GBGA 1YRZA 1UMZA 3AZZA 1LGCA 2DVGA 3APBA 1DYPA 3AP7A 4M00A 1W6PA 3AYDA 2A6VA 2GNMA 2GN7A 3V65A 1YO8A 3VKNA 2EAKA 1QU0A 1DQ0A 1SBDA 2D6OX 3O0XA 4LBQB 2PHUA 2ZGUA 4Y1VA 1NXD1 5GLUA 1DFQA 1LGNA 1WD3A 3WV6A 5IK7A 1DQ4A 3FFZA 1LHNA 3NWKA 4FPJA 4P9YA 4Q2FA 5GJ6A 3BOPA 1AXZA 4YW3A 1D0HA 3B01A 2A71A 2CWMA 4WV8A 2R0FA 1LOAA 1GNHA 1W6OB 2ZGTA 2GNTA 3WDXA 3WDTA 1Z78A 2ZMLA 3A0KA 2NYYA 5DG1A 5T55A 1PZ9A 4LBNA 4C1WA 1G9BA 3INAA 3UL2A 1PZ7A 2R1BA 1BJQA 2WNEA 2ZMNA 3VKLA 5CBLA 1YYNA 2JECA 4K1YA 5DG2A 4PF5A 5KXDA 4GKYA 3WZ1A 1AXKA 3NV4A 3AXEA 4R9DA 4XZPA 3ZYPA 1GZ9A 1W6MB 1N47A 2D6PA 4XILA 3VV1A 1F31A 2AENA 3SH5A 4RL7A 3N3HA 1C1LA 3HN1A 3A0NA 3JU9A 5E88A 2A3WA 4FPOB 3OYWA 4XBLA 3DUIA 3SITA 4CZSA 4DRRA 5F9TA 4DPNA 1EPWA 1UAIA 2WSVA 1VAMA 3AZWA 3AJZA 4K20A 1JW6A 4NOTA 5JOXA 3WHUA 2DWRA 2PHRA 1ZA4A 2PHXA 3B9CA 3FLPA 4FOYA 5GALA 5GM0A 4PBOA 3WNXA 1CPMA 1QF3A 1HQWA 1S0BA 2ZBJA 4FP3A 3N7JA 4LBLA 5E8AA 2A70A 4BM8A 1J1TA 4XMIA 1WLDA 1JHNA 3L2YA 2VH9A 4GA9A 5T50A 1AZDA 1FV2A 2ZZJA 2D6MA 2ZACA 1V6JA 2ZHMA 4Y20A 1MS8A 1LEDA 2UWCA 2P3JA 3W58A 3SISA 1LEMA 3BODA 3WCRA 3WG2A 4UW6A 4YGCA 1JYIA 1H9PA 3OY8B 2W68A 1X50A 2D3PA 2W39A 3RS6A 3UK9A 3QCWA 4Q26A 1QOOA 2VU9A 1LOGA 4YW1A 4I30A 1Q8VA 4XMAA 5T5LA 5IK4A 1BKZA 3O5SA 1DQ5A 2GNBA 3WLUA 1S1AA 5SV8A 4LBMA 1ULCA 5IK5A 1LOBA 1IS6A 4WVVA 4ISQA 1V6MA 3ZSKA 4AVVA 2PHTA 1ONAA 2B7YA 3M3CA 3IPVB 2XG3A 2WQZC 5T5OA 1WBFA 1SLIA 4FQ4A 1W0OA 2GN3A 5GLVA 2DURA 4JCKA 1FX5A 1U0AA 1QOSA 3UJOA 3WDYA 2AR6A 1A78A 1KDMA 1BXHA 2E6VA 2AYHA 1LOFC 2PHFA 1FAYA 1AVBA 1G9AA 3ENRA 1DHKB 1QDOA 5T54A 4YLZA 3V0BA 3CNAA 3JUUA 3O12A 2H0BA 2ES3A 2R49A 4AVSA 2R0HA 4XTMA 4GALA 4YGEA 1LHVA 1ENSA 4LBJA 1UN1A 3RMXA 1I3HA 2E53A 3R4UA 4YZ4A 1MVEA
chains in the Genus database with same CATH superfamily
3KM5A 5EP9A 4JDMA 1KJLA 3WDVA 3ETPA 5F5QA 4CPBA 4ZU4A 2VW2A 4BISA 5I0DA 1HJGA 1QH6A 4BYYA 5A33B 1RUNA 5C8CA 2EAAA 2WT1A 5DQ0A 4ES9A 2AUYA 1AR82 1CAVB 2VUCA 2YV8A 4BHPA 2JEMA 2YYOA 3ZPOA 1MVQA 4OLLA 2GMMA 2RDNA 5AFEA 1Z7S3 5FUPA 4HFSA 3M1HA 3ACHA 3G6JB 5IVJA 4RHV3 5KHGA 1AR91 2A3YA 2JJ6A 3JXSA 2EIEA 2XR4A 3A4UA 3BOWA 4M4PA 3RI9A 4F83A 1NAEA 2WNUA 3VBOA 4IV1B 2ZJCA 4AK3A 3E6DA 4IV1C 2PLV2 3OCPA 2XBO1 4WM7B 2BW8A 1H8TB 3M2MA 4XHXA 5HXVA 3T2OA 1CX4A 1DZQA 1H8TC 1UCXA 2AREA 2BBAA 2VTFA 4FPFA 2PHLA 4YGDA 2X29A 3RPQA 5CVRA 5DUVA 3ZN6B 2JX9A 4BXFA 1ZBA3 2IXIA 2W52A 4LKEA 5FUIA 5A1FA 3GBFA 1W0NA 4XUTA 3M70A 2OKXA 1VBC1 2QQPA 3RSJA 5BNPA 3RG0A 1AL0G 2YGMA 4IL7A 5HCBA 5K9YA 1ULGA 2K2SA 1C5IA 2Y6LA 2UU8A 2RVAA 4CXYA 1S0DA 4FPEA 2FCVA 3H8OA 5FYHA 1X33A 2JE9A 2MEV3 5L7OA 4PI0A 5L9RA 5LY2A 3ZFEB 1JYNA 4YVSA 2XLAA 4CVUA 5FYBA 5FLHA 5F3IA 3U4XA 4XCAA 5FQ0A 4BQ3A 1OVPA 2CNAA 3KGZA 3LIHA 4BQ1A 4NWVA 2JG8C 1JODA 2GSYA 1PX4A 4P00B 1JTZX 4EYUA 2LALA 5D8AA 4LOSA 1OH4A 3M3OA 2C9KA 3S5QA 4BLJA 4NR1A 3AFKA 2A5ZA 3KCCA 5AVAA 4GIQA 4YRDA 4UYBA 5JLVA 4HXCA 1KRIA 3I4IA 3ZFGB 4MH0E 3BTZA 1AX1A 2JKBA 4O9EA 4Q0VA 3ZFGC 4F8AA 1N1TA 3MV01 5GZGA 1QJEA 1VPHA 4QQ2A 5A1AA 1AR81 1W06A 3RZHA 1SDDB 1C4RA 1QNWA 2E7TA 2G9FA 2XLFA 1K3IA 1O4YA 3OUIA 4XQ4A 5AC93 2JG9A 4DXSA 1GYKA 3S30A 3AZVA 2I74A 3O1PA 1ND2A 4LKFA 2QQKA 3TAYA 3ZN5A 4A7YA 4XF9A 1AUYA 4OUSA 5DZFA 1BEV3 5JI9A 1RUI2 2ZX3A 5DAWA 1WW6A 5FPLA 1RMU3 2B39A 4D7TA 4IGQA 1DU3D 1HQLA 2IXLA 1PMIA 1ENQA 2PLV1 1VBA3 5HV4A 2VZ3A 2JDAA 4XDQA 3WQ7A 1WUVA 1XQNA 1ULPA 3HPNA 1C8M2 3AJYA 4LQRA 4K21A 3USUB 1W3VA 5AVPA 1R092 1CR7A 5FPVA 3H42B 3DYPA 4M0NA 1JYVA 5A7OA 1XE0A 3IKWA 1Y43B 1WW7A 2JXAA 3BTYA 4PHZA 5F7UA 1S0IA 3NNFA 4CDXA 5JCTA 2HWD2 5IUQA 1GSLA 1IKQA 4TZDA 1XYPA 1JMUB 5EXOA 4DINB 2NP0A 1OA4A 1WCQA 1NCRB 2YROA 1RL3A 2YGLA 1NCRC 3AYAA 2D5HA 3JZVA 3NV2A 4M01A 3D3AA 2ZGSA 1CAUA 1MEC2 1OPOA 1SLLA 3BU7A 2WR9A 4BOWA 4E27A 5A7SA 4QPGB 5CKQA 3T2TA 1HX6A 4QPGC 3WP6A 2BNNA 2VZOA 4AFAA 1D0GA 4YZ1A 4QQPA 3O1UA 4IEZA 3ZYJB 1WMXA 2XGXA 1ENRA 3VDBA 1FOD3 4SLIA 3OBAA 3TOJA 3VD4A 5LZ6A 1R093 2RV9A 1W90A 3AVRA 2Z69A 3LIGA 3VDDA 4AF9A 1G8WA 1ZZ7A 2ZCWA 4H55A 3UT0A 2W87A 2OX0A 4D3WA 3K48A 2H6BA 5J1XA 1PM4A 1LCLA 1ZRRA 1DBNA 5F8PA 2WIIB 4LR4A 5KC6A 3WINE 1IS4A 1XE8A 2CDOA 2LUWA 3VBRA 2HEWF 1W6QB 2HWD3 2O1QA 4UI9L 2ZKLA 2BRTA 2GC1A 3VKOA 4KQ7A 4JZRA 4FBFA 4RS5A 3U0ZA 1RUI1 1NCQA 3BUCA 2VXJA 1HRI2 3TB0A 1W2NA 3OGJA 5HXMA 4L8QA 1X9PA 1JOPA 3H0OA 4ASMB 5F3CA 4IEXA 1RXGA 5IAVA 1OA3A 4LPLA 3JCIA 1GANA 1SZBA 2XHNA 3MF6A 4FI9A 2WYFA 1C8M1 2UWAA 2Y6JA 3RQ0A 1O3RA 4IESA 4Z07A 4OHYA 1MPXA 4EQVA 2BFUS 1PK6B 3HMYA 3KV5A 2E9QA 3LDRA 1MS5A 1UZ0A 5JXJA 2PAKA 1BCXA 1O3QA 1Y9QA 3ACLA 3LPGA 3AMMA 2CDPA 2XUEA 2WO3A 3DPRA 1UOBA 2CL2A 2FDJA 2IXHA 3DEMA 4BQ2A 4ATFA 2O8OA 2WQ4A 3VD9A 3Q8FA 1VR3A 1DGWX 1QJU2 2Z42A 3JD73 3WNLA 2X53S 4COWA 4G3YC 4YFWA 5GZEA 4QKFA 2XJUA 2HEYF 3RZMA 3GNEA 2C6SA 2JD4A 2QQMA 5DDJ2 1UYXA 2BGOA 4WVMB 2R7EB 1MEC1 4BIFA 4E4DX 3LSDA 4LO7A 2E26A 3LZZA 5L73A 2O8QA 1LENA 1QQP2 2Y34A 4HK8A 5FYIA 1LU1A 4Z8BA 3VBSA 4CP2A 1CN1A 3M3IA 4KGQA 5C3OA 3VZJA 1FXZA 1CZVA 1OOPA 2HH9A 2VC9A 3G7DA 5FBZA 4MVTA 1S0CA 4PJYA 1VRH1 2ARXA 1S0GA 4MADA 3T0BA 3VDAA 2OZJA 4BJ0A 2FZ2A 3THCA 3WW3A 4U36A 1RUE2 3D8CA 3QH7A 3WXPA 3UNPA 3SLIA 5KHIA 3W20A 5CNAA 3M7AA 1QXJA 1XOYA 3CJIB 3VZKA 2VUDA 1H6YA 3CJIC 3RNSA 3N9MA 1GZWA 3POGA 4XF4A 4EN8B 1ZNPA 2XMLA 1CQ9A 1HDKA 1IG0A 1YQ6A 5DDJ3 5ANQA 2NMOA 4IUGA 4CPBD 4E9KA 4CU6A 4YZ2A 1HRI1 4ARYA 4EZHA 5FPUA 3OGGA 2BBVA 1EV13 3VGIA 3NV3A 4DO0A 1NE6A 2QE3A 2VZRA 2BOIA 4AW7A 1E57A 5J7MA 5FP4A 3VHNA 5IT6A 4K3UA 2Q8EA 3H1YA 2OA2A 4JC1A 4NPMA 4OMDA 1REEA 2B9VA 4XYXA 1OKOA 4YGBA 1GR3A 3AK0A 3W59A 4NJ4A 4FXKB 1LULA 5T5JA 2X05A 3TN92 1COV1 3LWCA 1UL9A 4YM2A 1J58A 2OVUA 3VHOA 2RS52 3OYWB 4Q0PA 1LESA 4QPIB 4B7EA 4Q4V1 1AX2A 1QJU1 1CAVA 2G9GA 2YPJA 1QJFA 5FZHA 4BQWA 1NA1C 2WFF1 4XABA 1OD3A 5JOWA 1RIRA 1YIFA 1JYCA 1T6BX 1OC1A 1QHDA 2LM3A 1UZYA 4JRLA 5C70A 1TNFA 2A6XA 1N1VA 1QDCA 1HB3A 3LPFA 3MPPG 4LO8A 1DCSA 2R062 4YG3A 1V6KA 4HLTA 2UY9A 3W5MA 5DPNA 1QQP1 3MW2A 5DABA 4NIIA 1H8TA 2GALA 1WMDA 1RUF3 1FT9A 4FXGB 4DUWA 2CGNA 2ZHNA 4YM0A 3KT7A 4IEQA 3UESA 1PNFA 1H6XA 1V70A 3IMMA 4META 4Y1YA 3AZYA 1UO9A 4A2UA 3DF0A 3TN93 5FO7B 2B45X 1W8FA 2LTNA 2K9ZA 4J1XA 4RA0A 4Q1PA 2ARBA 2XH6A 1RUE1 3J8F2 1FPN3 2Y6GA 5A3TA 1XYNA 3RWKX 2P3IA 3ZIWA 5AFBA 1N3OA 2PHDA 2WFPA 3IDAA 3KWVA 4FOVA 4N7IA 4QGLA 1FMD3 2C26A 1R083 2GDFA 1EPZA 2TNFA 4BA6A 3LDKA 5FP9A 2QDRA 3HQRA 4AYUA 1MS9A 1XU1A 5IYYA 4PLMA 4Y1UA 4Q5OA 3SCGA 2YFUA 5DUUA 2DV9A 2R063 4B3NA 2EIBA 3RJRA 1GNYA 4RD7A 2ARCA 1UMZA 2JG8A 2DVGA 3AZZA 3EJKA 1DYPA 3AP7A 3QACA 5FZLA 2JDMA 5F5IA 1W6PA 3AKQA 2J1AA 2KR2A 3DKQA 2VNVA 4P5HA 3TEXA 3RZKA 2R073 1LKNA 1YO8A 2QFEA 3VKNA 4AVBA 3WT3A 2YC2A 2ORZA 4HZFA 4AEDB 3K75B 3UGGA 4JHTA 1DQ0A 3VZNA 1LR5A 2F17A 4JX0A 4NPLA 2ZGUA 4LIVA 2WDBA 4Y1VA 2RS51 3ZFGA 3WV6A 1DYOA 2FCTA 2QQJA 3BALA 3J8F3 5FMOL 5C8CB 3FFZA 4FPJA 5EJZB 1F15A 1HN1A 2LS6A 1AXZA 2XVGA 3BOPA 4NIDA 4Z2WA 4YW3A 4YWAA 5JXHA 5D1IA 5F5AA 1H4HA 2ZGTA 2PQQA 4EN9B 3ROUA 4QT6A 4D7YA 1AYN3 5DG1A 3TEWA 4XC9A 4LBNA 4L2NA 2DCKA 3KZ4C 3DN7A 3VL8A 3RZJA 3UL2A 1PZ7A 4ZHNA 3ZM8A 5FY4A 5CBLA 1YJLA 4RN5A 5C3PA 2IVJA 2JECA 4JHZA 5FZKA 2W95A 3WF0A 4E2QA 3H8XA 4GKYA 3VZOA 4AFBA 4JDOA 2WAOA 1UPIA 4NHMA 3KQ4B 4CUBA 4ZS3A 2JE8A 5BNPB 3IWZA 1LAJA 5FZCA 4RL7A 1PGSA 3A0NA 4J6GA 4PT6A 4V2VA 4C91A 4AFCA 1R1A2 4X8NA 1YEWA 3SITA 4XBLA 3DUIA 4RQPB 3U07A 4CZSA 4DRRA 5CISA 3CMGA 4RQPC 1UZVA 1VMJA 1W9WA 1NCRA 3NNMA 5L7OB 1UAIA 2WSVA 2Q1FA 1RUG1 5FZ8A 5L7OC 1KGYA 4YVSB 4NOTA 5GM0A 4RFRB 1RVF1 1MZEA 1PO22 1QF3A 2ZBJA 3MBWA 4MZUA 5FQ0B 1DLCA 1W9SA 1Q3EA 2VPVA 3L2YA 4XFBA 3E5QA 4D0QA 2VOXA 4YYOA 2GH8A 3KT4A 2ZX4A 5BUVA 3EO6A 1V6JA 5D8AB 1AYM2 5FZAA 1SQ4A 3S57A 5FOJB 1RUC2 4AVAA 1E5HA 1I5PA 5CYYA 3WG2A 3H1MA 4UW6A 1V9U3 1NOVA 3MDPA 2W68A 2W39A 3TWIA 2BVBA 3RS6A 4AEJA 2Y60A 5KBFA 4YW1A 5T5LA 1Q8VA 2G1MA 2VNOA 2VMFA 4CCKA 4AHYA 1S1AA 2VULA 1R1A3 1UU4A 2VNGA 4GMP0 4AZZA 1ULCA 5IK5A 1LOBA 3KV9A 4DUXA 1B35B 3J7NA 4GMP1 1B35C 2IFWA 2JG9B 2VQAA 2WQZC 1WBFA 2JG9C 2J1TA 3GZTB 5GLVA 5T5OA 4W6XA 4BXSV 1KXGA 2RJKA 2HWB1 4PIYA 5FZ9A 4JTNA 1VBD2 5EZWA 4I0AA 4LXLA 4CU7A 1TG7A 1G9AA 1DHKB 4LE3A 2MNGA 5T54A 5I93A 4C8DA 1O4TA 2D5FA 3DV8A 1FI2A 4AVSA 1YQCA 2GAUA 3AKSA 4K6BA 2R0HA 5BNNC 4MV2A 1POV1 1XNAA 4MGTA 5CG8A 3IB3A 2ZHLA 1NYWA 3U1XA 3ZXEA 2YBKA 4LBQA 2WO2A 2ZGNA 5FIXA 4IETA 4GAZA 5FLIA 3ZSMA 4H7LA 3MFCA 2VXRA 5FZIA 4HK9A 4CDXB 2KXLA 1MZFA 1PVC2 2VZUA 1O4ZA 3LB9A 1IQDC 4UFMA 1D4M2 4AFMA 4DNYA 1ZZBA 4JKLA 4Y4RA 1PIV2 1WW5A 1SCRA 3Q8EA 4QXCA 2DF7A 2VGDA 4LHNA 1W8UA 1CAUB 1W6OA 2YUEA 1QMJA 3MW4A 3KHBA 3WSOA 1PO21 1VBD3 4GB32 5I0SA 3HWJA 1VB2A 2DFCA 2V4AA 4ZS2A 3I3BA 2OPKA 1SFYA 2ENRA 2OT7A 2TEPA 1AYM1 3MIHA 2NPIA 1W8NA 1W8OA 1UPSA 1RUC1 1PX3A 2FCUA 4QPWA 1FNYA 4KU8A 3WF4A 4E2GA 1HRV2 3VDDB 5C5TA 3O1OA 5IVEA 1W03A 2OUJA 4FTBA 1X7NA 2WNVA 1UOFA 5EV7A 3I3DA 1YFUA 1UIKA 1ULDA 4HKWA 4YW4A 2QZ2A 5FYYA 1Q56A 2RJLA 5ABJC 1UYPA 5FXXA 2E33A 4AQSA 5EYYA 3IAQA 4UW5A 3CJIA 5FZBA 4IEYA 3ES4A 3VBRB 3OPWA 1PVC3 4XDPA 4AQTA 2ZGMA 3WG3A 4NMIA 1PIV3 4AGVA 3DYOA 4RS5B 1W9TA 2A1XA 1O7FA 2ZS6B 3RZGA 1H1IA 1PMHX 3B3QE 4BLIA 1CWPA 4EROA 1EUUA 4XHBA 1K42A 4XF3A 4TLFA 1QJY2 1BBT2 2P5BA 1N1SA 1IOAA 1DQ2A 2GMPA 2ZEWA 3KD4A 4FCAA 1BMV2 1ZZ8A 3CF6E 1MS0A 4MOAA 4XAAA 3SH3A 1AF9A 2WT2A 5EYXA 1GKBA 1G9DA 5KXCA 1WMFA 2B8MA 4W6WA 1DQ6A 3FBYA 3H1WA 5LRSA 1DDLA 5GZDA 4JVAA 4KBBA 2R043 4FPLA 2B42B 1J3RA 2C1FA 3IAPA 4IGPA 4M3CF 4P9GA 1OUSA 5FMDA 2XHKA 5A3WA 2EIDA 1JZ7A 1C57A 3AYEA 1OQEA 2W1UA 3TNPB 3JBG3 4LLFA 3VD7A 1PVC1 5CU1A 1NA1A 1UZWA 2JICA 2AEZA 2WAAA 2VOVA 5I8YA 1D4M1 2ET1A 4I0WB 2D43A 4NHYA 5SV5A 4DOUA 2HWF2 1ZBE3 3KVBA 5FY8A 5FO9B 4XQDA 4QX0A 3SH4A 4PLNA 1PO13 2OW4A 4JTOA 4S2DA 3I2DA 2C9AA 4IEOA 2DDUA 2QDNA 4GB31 4XJ9A 5JPMB 4H2AA 3KB5A 1UIJA 2P1BA 3BIWE 4JV4A 5LA1A 1ZRCA 5A7QA 3RI8A 2P3KA 1C5HA 1BBT3 4XUQA 4FPGA 1OLMA 3VBSB 4RSUA 3FFQA 4ASLA 2KA3A 4HPKA 4FFFA 1AHSA 4BMBA 4BK5A 1UY0A 1H1MA 2ZGLA 1HRV1 4MLOA 1F5FA 5L36A 3T1LA 2Z2SB 1VLNA 3JB4C 3PU3A 1C3HA 1W39A 4XJWA 4Y24A 3T08A 4C90A 2EXJA 1T6GC 5GZCA 2JDPA 3R0RA 4EWDA 5FZMA 4CCCA 1REFA 3WCSA 4L0PA 5A7PA 3RMYA 3MLJA 4D6RA 1CAXB 3WUCA 4Y26A 1WA6X 3LCPA 3CDZB 3NAPC 1GZWB 4CP0A 5FP8A 2FMDA 1F2NA 3ABZA 1UXXX 5JXGA 1HKDA 2CY6A 1O91A 4O61A 1NX9A 1VAKA 4HOOA 4UFKA 1H2KA 4BU2A 3CLPA 2HWE2 3ALQA 3JB8A 1YXWA 4WVWA 5DZEA 4CXWA 2B46X 1QJY1 3V64A 1QXPA 2W2IA 1VP6A 3OF1A 5JWPA 2ZX0A 4XFIA 3AL5A 4TYSA 2DBIA 1QJX1 1O8SA 1UZZA 2AZ5A 3U75A 1BMV1 1RUJ3 1OUXA 4A7ZA 1NUKA 1VBE1 2V72A 3MLKA 4N53C 1QXRA 5C6CA 4JAAA 1UWWA 5FZEA 4A3XA 1TME3 3WQ0A 1CIYA 1QY4A 2W08A 1RUH3 5FK7A 4CDQC 5DXDA 4LO6B 3H7YA 4KWLA 5EWSA 3D5OA 5A6XA 4COUA 1JYWA 1RYYA 3D0SA 2W1SA 3MW3A 4Q1RA 5FMBA 3POJA 2JE7A 4R9BA 2MEV2 1ULEA 4AXOA 2VOTA 2HWF1 4P9WA 2A6WA 4ES8A 4KI5M 4B8EA 4MXWB 5A32B 5FZ7A 2VZVA 4M4RA 2WZR2 3K3NA 2D44A 2RM23 4TSVA 2QQOA 1DF0A 1QOTA 2MPFA 2JDNA 2HWE3 3MLLA 4MYEA 2PHWA 4IEVA 4QKBA 4XURA 2D7FA 1A6CA 3RRDA 3GYDA 3THDA 1MS4A 4GJZA 3AX4A 2ZGKA 2ZHKA 1D2QA 4QKDA 2JIGA 1O8PA 5EJ1B 1CZTA 5JI7A 4A3ZA 3FL7A 2BEOA 2G9ZA 4ONUA 5LBCA 2Q30A 1LECA 4N7UA 1AJOA 5FYVA 1H1AA 1WCSA 1Y9GA 3V0BB 2Y33A 1VB4A 1UKGA 1WKYA 2BGCA 2YU1A 3I97A 4NROA 3MUZ1 5EPAA 3ZX7A 4HVQA 2DU0A 2J1UA 3J7MA 3PUQA 1W8HA 4JKMA 3TNQA 4D6SA 1PMJX 1TE1B 4Y1XA 3CHXA 1A8MA 5F1RA 4R9AA 4QX8A 2F4PA 4LORA 5BXXA 5JPNB 3AMPA 1OXCA 4KG8A 4RQPA 3HNMA 2Y26A 2ZAAA 1Z0HA 5L9BA 1Z7S1 5AC92 2XONA 4IEPA 5IK8A 2I45A 3PVOA 1GUIA 1JUHA 4RHV1 4BE3A 1OLME 3SNMA 3ZOIA 1J3QA 1VRBA 1BEV2 4AI8A 3PLQA 4MXVA 2WZR3 3O1MA 1AXYA 1V6IA 4LBKA 1RMU2 4KBZA 5FR3A 4FO9A 1YQ2A 2YZ4A 3LF7A 1VBA2 2WQ8A 2JG8B 5JOZA 1KQRA 1VBB2 1W6PB 2WO7A 3MUY1 5DUXA 5BYNA 4PBPA 3EHKA 1ZBA1 4FPKA 5KR7A 2XQRA 1BZWA 5HI0A 1S0EA 3NSTA 4IEWA 3TEYA 1GZTA 1XNKA 3OD0A 2BNOA 1A3KA 1OKQA 5FRAA 5FZ1A 4RGAA 3WOGA 5FP7A 3NQHA 4HL0A 4BZ4A 2DFBA 3CBNA 1GU3A 4LUKA 4QU2A 3E6CC 4UAPA 3P6BA 4QGMA 2CYFA 5E89A 3SQOA 3QOPA 1KFUL 4LOTA 1OLQA 1B35A 2MEV1 2Q1MA 2Y38A 5C9AC 3N4MA 4Q27A 4QX3A 5FXWA 1LHOA 1UNBA 4XJUA 2WZR1 1ZZ6A 3QD6A 4XFFA 5GLWA 4LBQD 2NN8A 2VCAA 5DN2A 2PELA 4PDWC 3SKJE 3WR0A 3GDBA 1AL23 2VZQA 4CCJA 5FTTC 2XJPA 1VBB3 2FDHA 4PQQA 5BNNA 3PL0A 2A6ZA 3N9NA 2WJSA 2GP3A 1FOD2 2YG0A 1JOBA 4FOWA 3D6EA 2R16A 1G6NA 4HANA 3ZXLA 3B9IA 3O0WA 2W46A 2ZEXA 4YZ3A 5DZGA 4O65A 2FHRA 1XNDA 1NLQA 2YC4A 3EBRA 4IQPA 1E5SA 1ULFA 2WABA 4QAWA 5AC91 3RZLA 1QNYA 2FMYA 3CZJA 5HCHA 2NZ9A 3ASIA 3NJXA 1R1ZA 1BEV1 1O59A 4PF1A 3FC0A 3T2QA 4XUNA 5ACA3 4M3CA 1RMU1 3IDEA 3MYXA 4Q4Y3 1M4WA 2KM2A 2UURA 1CZSA 3WP5A 1VBA1 1RJ7A 2RDSA 3ACFA 4AL9A 1QIQA 3LAGA 5FZ6A 1VBB1 1FNZA 4ATEA 1JXNA 1ZRDA 2DVBA 5FXZA 4GKXA 4NHLA 2XLGA 2V73A 1AR73 2CU5A 2P2KA 2W9XA 2WS92 4PQ9A 3U37A 2DUQA 4BCUA 2BOJA 4AOCA 1SBEA 1JYTA 1RUD3 5JR7B 2EIGA 1MZ5A 2NMNA 5ABJA 2ZGRA 4EWEA 2JB8A 3I3QA 3ZVXA 5C4WA 2PFWA 2V5YA 3JD72 3NJVA 1HB1A 5K4LA 1SFNA 3BTAA 1AR63 5JXIA 3T4HB 4LULA 4OHXA 1LGBA 4WZCA 5JMCA 4CCDA 2RE9A 3ZKYA 5FPAA 2LROA 4Q4W2 3POWA 4I0BA 1SEFA 2DVDA 1ZRFA 3RJ2X 2K46A 4P14A 3ZO0B 4BMEA 4ITCA 3WP3A 4CP1A 3AVSA 3ATGA 2V5DA 3GXUA 3POIA 1BQPA 2BUKA 2YXSA 4UXAA 4IERA 2WL1A 1UQXA 1IS5A 4Z2AA 4IV3C 3J9SA 4JGZB 4JRAA 4CCLA 4FAHA 5FDBA 1FOD1 1GBGA 4JGZC 2GH2A 1LGCA 5B2GB 2R32A 2GZWA 2XWBB 4M00A 3BPZA 1R091 3ZLIA 4KU7A 2WS93 2GN7A 1OT5A 4MUVA 3HT2A 3ZDVA 3BPSA 4IE6A 2QQUA 3AKRA 2Y6KA 4YARA 3W5NA 1SBDA 2D6OX 4LBQB 4ZU5A 4JGYC 2BDRA 4OHVA 2HWD1 3T30A 1WD3A 4XACA 3WNOA 4H14A 2X5IB 3DL3A 1LHNA 1W3XA 2X5IC 2J7MA 2X8KA 3NWKA 5GJ6A 1UMIA 4Q4W3 4MGYE 5LA9A 3UKTA 3ZMOA 3B01A 2A71A 1L7RA 1TMF3 1LOAA 1GNHA 1W6OB 1EV12 3WDXA 2Y6FA 3A0KA 3GZEA 3PTYA 4NVPA 5FMOS 1OI6A 4QMAA 4QHOA 3INAA 4LITA 3C8XA 5A3OA 4HN1A 5LATA 3SHRA 1YYNA 4CDUB 1XJAA 4K1YA 4CDUC 5LEKA 3LOBA 4PF5A 4PLOA 2O14A 3V56A 4XF1A 3AL6A 3OBZA 5KXDA 2ILMA 1DZRA 3PU8A 2WNVB 3MI8A 1AXKA 3NV4A 5J98B 2WNVC 3C7FA 3PMSA 2PA7A 4R9DA 5K7PA 4PIZA 1GZ9A 3JD71 5FYZA 4F7ZA 4IW3A 3U78A 3AKTA 1CAXA 3ACGA 4QX7A 3NAPA 4UF0A 5E88A 4Q4W1 1X8EA 2A3WA 4FPOB 5A3NA 4I2OA 4CU8A 4CEWC 4BWOA 5IATA 3WNMA 4RFT0 3T09A 3O1TA 4K20A 2D98A 2PHXA 3B9CA 3WNXA 4AVCA 4CDWB 3R6SA 4HVRA 5KHHA 4PBOA 3FJSA 4CDWC 1RUF2 2BU9A 1HQWA 3FHQA 4LBLA 5FKCA 4N53A 4K8RB 4YW6A 5E16A 4Q0SA 5E1RA 3BKZA 2ZHMA 4Y20A 2WYSA 3RDIA 2W94A 3K4ZA 4CDQA 1LEDA 1W04A 2UWCA 3ZYGA 3P1IA 2P3JA 4UFLA 3SISA 1JYIA 2PAMA 3BODA 4CUGA 1FPN2 1H9PA 3DXUA 3PDQA 3QCWA 4RYDA 4HN0A 1QOOA 4XUOA 2VU9A 4I30A 4XMAA 1FMD2 1NA1B 1U5ZA 1R082 1ST8A 1DQ5A 1LRHA 5IVBA 2DCTA 1W9FA 1EP0A 3VHRA 5J36A 4LBMA 5DDJ1 4MXWA 2CHHA 5A32A 1IS6A 3S0MA 1ONAA 1EV11 2XG3A 4LO4B 2GN3A 2HWC3 5FK8A 1FX5A 1U0AA 4N9HA 3UJOA 1UF2C 3WDYA 1DGRN 2RMU2 1H4GA 3OGSA 2R072 1LOFC 2ETEA 1FAYA 5IFTA 4HPKB 4HONA 4P5YA 1QDOA 5DAQA 1IHMA 1GP4A 1ZVFA 4UFHA 3V0BA 4OVEA 1XB9A 2OQ6A 1RUOA 2R49A 2WINB 5FY1A 2KD7A 3LA7A 4Z92B 4XTMA 2HJIA 4GALA 3ZXDA 1LHVA 3HJRA 1GOHA 4B4RA 1UN1A 4AHZA 4QB1A 4Y5Z0 3R4UA 2WN3A 4YZ4A 3LDBA 4AEMA 5FBJA 2Q8DA 1G9FA 1SLBA 2J1VA 3B69A 1XSQA 1Y4WA 1OFNA 4NN0A 3CZUA 3ZKUA 2OQ7A 3N7LA 3WF1A 1AYN2 3E6BA 2W0XA 2JENA 4E4HA 1NZIA 3WQ1A 3WW2A 2XL9A 1ASJ3 1CESA 3BTXA 2DU1A 5CZKA 3VBUC 5A70A 2EF6A 3WNNA 5B4NA 2WZPP 3CJXA 5C8WA 1U5XA 1RUF1 3MHZA 1DLLA 1OF4A 2Y8KA 2RMU3 3DKWA 1IS3A 1ZM1A 2ADDA 4TXWA 1OH3A 2X09A 2QQLA 4DIQA 3WDUA 4Q4X2 1HQNA 1K5MC 3TN91 3VUOA 2HKXA 4KGGA 2ADEA 1LOCA 2BFUL 2TBVA 2VUJA 3ITQA 4PI2A 2VVEA 1LTEA 4GH4C 2FDGA 2PN5A 3OG2A 3PMEA 3PTRB 1FPN1 1A8DA 3MFAA 5FY5A 5G05L 3KCXA 4XXPA 2V4VA 1Q5OA 5FAXA 5C9AA 1FMD1 1YFWA 1R081 2GMEA 2QZ3A 4XQWA 3THPA 5JMOA 2Y6HA 3ECQA 2DTYA 3I2IA 3EXUA 1QGLA 4EE2A 2RHPA 1JZ3A 2XVLA 4Y1ZA 4YZ5A 1RHI3 4R52A 3NNGA 1EUTA 4NIGA 4LBOA 2R061 4PDWA 5D2AA 5BPXA 2UYAA 5A3LA 1WLCA 5LCWL 1UD1A 3ZYRA 1PHMA 3EYPA 4XAEA 5A7NA 1LHUA 4AI0A 3LFIA 3AB0A 5LB6A 4KL1A 2RMU1 2VW0A 3MPBA 2R6QA 1YI7A 2R071 1XE7A 3WY6A 5I0RA 2QQVA 3O1SA 3ZSJA 3U11A 2W5FA 5KHJA 4Q4X3 1V9U2 1NG0A 2D6KA 2GU9A 2VQTA 1BHGA 1JZ2A 2ZX2A 4AQ6A 4HG6B 4XFCA 3J8F1 3VN4A 3Q8CA 3MZHA 1X82A 3J7HA 5IAXA 3T2PA 2CGPA 2R30A 5APAA 3IIAA 4COYA 5IFPA 1GZCA 5DAPA 1W9YA 2Q5TA 5LK7B 4S2HA 1AYN1 1CJPA 1MQTC 2D40A 2DBNA 2D93A 2Q4SA 3KGLA 2ERFA 2J42A 3RZZA 2WZ8A 3W21A 1ODMA 3A23A 5JAXA 3C2UA 4L92A 3PVEA 1RGSA 2OIIA 1SLTA 5FMCA 3MIDA 1W2UA 5FYUA 1IG3A 1PNGA 3VKMA 2ZA9A 3LSEA 3POEA 4AFDA 2DTWA 5I8TA 2RDQA 1FYUA 2EA7A 3T0DA 3I8TA 5M0TA 1H9WA 2GC2A 1RTVA 4HSJA 5ANNA 2GP5A 3B94A 5F5CA 2BZDA 2WLPA 1KD7A 5KXBA 1I9RA 1J84A 5C33A 2C4XA 3FUOA 1CVNA 4YVWC 5A7WA 3HD8B 5HCAA 1SBFA 4B1LA 4NAOA 2JDYA 5FZFA 2WUHA 1MR5A 4XE9A 2VQUA 5F2SA 3UKNA 2UWBA 2YMZA 2EXKA 5T52A 4C0BA 5GLTA 2RR12 3AP9A 2VMGA 3C7GA 4Q0QA 2EVXA 2WBKA 4QWNA 4XOGA 4OFGA 5H9PA 3B5LB 1V0AA 4BIOA 1DGWA 3B93A 4Y22A 3HT1A 3HN3A 4IV3A 4A42A 4JGZA 4P02B 3Q8BA 2FDFA 5BNNB 2W47A 4Y33A 3GJBA 3DCQA 2C0ZA 5LASA 3WDWA 1V9U1 2WZEA 1PGL2 2Z5WA 1GV9A 4B4QA 3TYJA 4MSVA 4QXBA 4MGKE 1A34A 3HAGA 3SCHA 4JGYA 4JDNA 1R1A1 4QGNA 4SBVA 5HCFA 5J09A 3BU0A 3FWEA 2YFZA 2ZXQA 3PIGA 2DVFA 3I2GA 2W1QA 2ZMKA 1AX0A 2VOKA 2X5IA 4IE0A 1WD4A 2VZTA 1POQA 2WSUA 4AGGA 3HEIA 4DFSA 5A3PA 3V0AA 1GP6A 3GBGA 5FLJA 2XXZA 1J3PA 2VMDA 5T5PA 1R64A 5BNOC 4OUMA 2P6CA 3ZYHA 4QDSA 5DAXA 4M3CB 2P34A 3CO2A 1MACA 3DECA 2RR13 4O7XA 2PMWB 4YW2A 3OSDA 1F4HA 3UGHA 3LGRA 5H9RA 2JWPA 3Q8AA 3AMHA 3FHAA 4L11A 3PJQA 5EHDA 1ZREA 2HBUA 2ET7A 3M8LA 4DQAA 1WLWA 4DS0A 2RS12 1Q8SA 2TUNA 5CFDB 1YIPA 1P8JA 5CFDC 4OHWA 4QB6A 2RDRA 3ZN4A 4CDUA 3AMNA 3J7LA 1REDA 3POYA 3WQBA 3PJYA 2R042 2WWSA 4PCRA 2XDVA 2FDKA 4CRQA 2O0OA 1BLZA 2E32A 1HXS3 5ABJB 3FE5A 3RYRA 1GLHA 2A3XA 1NY72 4K40A 2BV4A 5C4WB 2BTVC 5FREA 3JBG2 5C4WC 3AP5A 1OPMA 3RVHA 4NUBA 1U5YA 3D4KA 4YFZA 5HBAA 5JZGC 3N9PA 4FPCA 2CWSA 3BN6A 3MF9A 1ZBE2 1UY2A 2VG9A 5FYSA 4CEWA 3ON7A 3WW4A 1LJ7A 3VB9A 1PO12 2ZKNA 5C3SA 1VBD1 4MGZE 5KC5A 1UYYA 4OYUA 1J59A 3ST7A 1IKPA 1DIWA 4LMFA 4UWDA 4EN7B 4AI1A 3H3UA 1M06G 4CDWA 4ZY9A 1LHWA 2ZPXA 2AGSA 4NE9A 4D94A 1ZYBA 3R05A 3AP4A 1NXMA 1VIWB 4MHUA 4PIXA 2RS13 3IM0A 2BERA 4EN6B 4XVHA 1W6NA 4I3GA 4QD2A 4AG4A 1J83A 1ACCA 5A6QA 1GP5A 4G4FA 5FYMA 3ILRA 2FDIA 3SC7X 1PGL1 4R9CA 4XXAA 1V00A 4W8JA 4X8PA 1CGPA 2OUHA 5CAZA 5GKAC 3VZMA 1XYOA 4Q8LA 4IDZA 2B5HA 2ARAA 4UW4A 5A1LA 4LK6A 2VMIA 4IXLA 4WM8B 4U2AA 4WM8C 2QKDA 3VBFB 1JYXA 3VBFC 4Q0UA 1PIV1 3TEZA 1JN2P 1F35A 3M3EA 4LKDA 5LK5A 2XL7A 1WBLA 2Q0AA 1FV3A 3ZDSA 3BCWA 1IPKA 2RS33 3A22A 1GNZA 2EICA 3I2JA 1OQDA 4KWKA 4MX3A 5FUNA 1IZ3A 4UFJA 4N43C 2E7AA 4P9XA 1LOFA 2WKKA 1OFSA 2CSGA 2RS11 3ME2A 5IVYA 3H7JA 4FFIA 1BK0A 1APNA 1RUJ2 1TVGA 2J22A 1NKGA 2VY0A 2Y0IA 2BNMA 4B4PA 2XKPA 3KQRA 2R041 2BJSA 4CSWA 3ELNA 1KEXA 2A7AA 1O3SA 2C5DA 1KITA 1TME2 2EXHA 2VZ1A 2WT0A 2YU2A 3NNLA 4GWIA 1BVP1 1DYKA 1RUH2 2ZGOA 3O0VA 4YM3A 2WN2A 4XBQA 1W2TA 2P6HA 3GCXA 4LUMA 5F37A 1J1LA 3JBG1 2VMCA 4AHXA 4CYDA 1G7YA 3IT8A 3NAPB 1SPPA 3FMGA 3I59A 4LE4A 4LHLA 4UF0B 1ZBE1 2XBO2 4K1ZA 5KWRA 4CP9A 4MO3M 2BYVE 2E31A 1PO11 1Q8OA 4UBGA 1W2OA 2RM22 4QX5A 5FPZA 5JSPA 1O6UA 2Z4FA 3E1F1 4NPRA 3VBUA 4COZA 3ILNA 3P5BA 3WP4A 1VJ2A 3FLRA 2D97A 1VBC2 3L2HA 2XJSA 1BBT1 2IXCA 2VJXA 3WG1A 2D3RA 4AQ2A 2PTMA 2SBAA 4JQRA 2IFRA 4QQOA 3ZFFC 2I07B 4Z1VA 3LEIA 4G9SB 4N53B 1PZ8A 1TEIA 1RINA 1K5MA 1PGW2 3SCFA 5HV0A 1U5IA 3PURA 4DUVA 2G4IA 4YG6A 5FYCA 3I3EA 4Y20B 4OCTA 4AI9A 2Y64A 4GH4A 4OMCA 3AZXA 3J26N 3LEKA 5FXVA 4TLGA 3HBKA 4O9GA 2ZABA 1AR93 4CDQB 4DY3A 1V6NA 1OMIA 5LA0A 1HV0A 1F5JA 4ARXA 3KVAA 2BWCA 2JDZA 4D8MA 4XZUG 4BB3A 4LKSA 1G86A 1NT0A 3H50A 4NRPA 4L9BA 1ND3A 4OZXA 4ISRA 1IPJA 1H2LA 2XBO3 5FY9A 2SLIA 1TNRA 2QQNA 4QKNA 4LIUA 5CFCC 1VAVA 4JQTA 5EIYB 1UYZA 1MS1A 4W4ZA 3NW4A 3OB8A 1VBC3 4B29A 1G9CA 5LRRA 2BPA2 1RUJ1 4CCMA 3BIEA 5FWJA 2YB7A 2D3SA 2RG4A 3C3VA 4GZ9A 4GWMA 4KG0A 4COVA 1D2SA 1NQJA 1H2NA 3VBHB 1TME1 2XVKA 3APBA 4NRQA 1UKRA 3VBHC 2G19A 1RUH1 2CAUA 1XBFA 1YI9A 3AYDA 2A6VA 3I2FA 4CU9A 4P08A 1L3JA 5FWEA 4UBHA 4WVZA 2HLEA 1KS4A 1RJ8A 3VDCA 3S6PA 3O0XA 4IE5A 2PHUA 1ENXA 3HBZA 3IBMA 3ZYBA 1JHJA 4DY5A 4WM7C 1MQTA 5GLUA 5ISLA 4ET7A 3LE0A 1LGNA 4M0HA 1JZ4A 4EV0A 1DQ4A 3KHCA 2J1RA 2RM21 2PXJA 3GJAA 4P9YA 3GZUC 3POBA 1OF3A 3HOBA 2HWE1 3RWNA 3QBQA 1AL22 3BGAA 2R0FA 4A41A 1DP0A 4HSLA 2GNTA 3WDTA 1Z78A 2VBPA 3IZOA 2ZMLA 3KV4A 4HVOA 2LW8A 2VZPA 3PUSA 4C1WA 1XXNA 2E63A 1PGW1 4AEKA 1AR83 1G9BA 4OI2A 4UOJA 3AFGA 4FFHA 2PAEA 2WNEA 3MICA 2ZMNA 3VKLA 4YVWA 3VHPA 1EYBA 4BQXA 4FAGA 4XFHA 3ZFEC 2W3JA 2IVIB 1CAWA 1CD3G 2HYXA 2XJTA 4XZPA 3VD3A 3ZYPA 5C5UA 3AKPA 4LEJA 5C9AB 2JDKA 2PLV3 2H0VA 1F31A 4AI3A 3ZYIB 3USSA 3N3HA 4FTEA 1I5ZA 2VL4A 5ACA2 1GOGA 3NL1A 4PDWB 4KNCA 4Q4Y2 5F9TA 5FZ3A 3GHNA 4AR2A 5FZGA 3SEEA 3FBMA 4DPNA 4Z82A 4XFGA 1VAMA 4E8DA 5F2WA 3T0AA 2IXJA 2Q1ZB 1JW6A 4RGKA 5JOXA 1CX1A 2DWRA 2PHRA 1ZA4A 2VBDA 3FLPA 4FOYA 5GALA 4NIHA 1AR72 1JI6A 3RYKA 2VVFA 5CKNA 4XDOA 1S0BA 5D21A 4FP3A 3N7JA 2A70A 1ZRIA 1J1TA 2DCYA 1JHNA 2WO1A 1D4VB 4R8HA 1RUD2 4GA9A 5T50A 2ZZJA 1W8ZA 2D6MA 2VAUA 3R4DB 2ZACA 4WBBA 4URTA 3UV9A 1MS8A 5L19A 2PQSA 1AR62 2ATFA 3OOXA 3KCYA 3WCRA 4HKOA 2Y0OA 3KF5A 2WA4A 3GM8A 1X50A 3VZLA 4Q26A 3WEZA 5IK4A 2XKOA 5BNOA 1BKZA 5CADA 5KHKA 1JH5A 2GNBA 1ODNA 2NQYA 2P4EA 4AE2A 3HNYM 3IDCB 1GFF2 4N9IA 3ZR6A 2ZEZA 3GZAA 1AL21 4WVVA 2VD7A 2VTXA 4AVVA 3IPVB 4H7MA 5FZ4A 1JU3A 3I2HA 4FQ4A 1W0OA 2PYTA 4I02A 5CFDA 1E5RA 2DURA 3AMQA 4N90A 2AR6A 1A78A 1KDMA 3NNJA 2V09A 3BYWA 3LD8A 4NWWA 4RGGA 2Z79A 4RR3B 4RR3C 1K12A 2AYHA 2YC0A 1UXZA 4S2GA 4QQHA 3ENRA 4P9JA 3HQUA 4LJHA 5LWBA 5A7WB 4EWAA 5LY1A 2OXBA 3CNAA 3O12A 1US3A 1UX7A 1YNAA 2H0BA 2ES3A 4OHZA 3I2OA 1RUI3 4OQ9A 1DG6A 1UW8A 5FV3A 2ZOEB 5JZGA 1I3HA 3PIJA 1PM7A 1MVEA 1S2BA 1V6OA 2UY8A 3FN9A 3DGTA 3NMBA 5A3MA 1Y3TA 3ZMNA 1YLLA 1TMF2 2VMEA 3I2KA 3EQEA 1C8M3 3LFMA 4AAXA 3J4UH 5ACA1 2VCCA 4Q4Y1 2YY1A 1Q8QA 1CONA 1DQ1A 2DUPA 4WZFA 4YM1A 4AWDA 5IHRA 1DZTA 1NLSA 1WCKA 4W50A 1VRH2 2ZX1A 1EAH2 3HQXA 4Y22B 4IV3B 5BNQA 1W0PA 3QH6A 2WRAA 4FPYA 3AM2A 4DEVA 3C7HA 3UGFA 2JDHA 5LBEA 5LW9A 1AR71 1UMHA 2D6NA 2XJRA 4R4XA 5FZOB 2OS2A 3MIGA 4DEQA 3K2OA 1S2EA 3H3LA 1RUD1 4ORFA 3VD5A 2BVVA 1URXA 4FT8A 5ERLA 5DMYA 3W9AA 2VW1A 4JGYB 1GWLA 1MEC3 5KXEA 1AR61 1C1FA 4FOQA 4WM8A 3MIFA 1HB2A 3UKVA 2NM1A 5EJ3A 3VBFA 2QCSB 1ZZ9A 3ZIXA 1YUDA 3FX3A 4Q8KA 3I49A 1SG3A 4W65A 4BPZA 3EB7A 3V0AB 1UX6A 1QJZA 1XNCA 1GWKA 1W6MA 2B9UA 3HNBM 5FY0A 5JSOA 4YG0A 1YQ5A 2QQIA 2DCJA 3GBWA 3NKTA 5JIAA 2VECA 1PK6C 1N1YA 3ILFA 4XUPA 4QQLA 4YSFA 4N43A 3X29B 1COV2 1T2XA 5I8SA 1RITA 5JDBA 2C24A 1SDWA 3GALA 1VRH3 2VZSA 1EAH3 2WLQA 4GJYA 5IJRA 4OI4A 2YBSA 4OUEA 1VALA 3CEWA 2CTVA 5H9SA 1JBCA 2YDEA 3MEPA 3OBTA 3CQOA 5FPXA 4GXLA 1WA4A 1Y7BA 4Q4V2 3K77A 4H3WA 3LA3A 4AGRA 2WS91 1I6XA 1RB8G 4IEUA 2WFF2 5J37A 1WGPA 3ZSLA 1X36A 4AVTA 4CCOA 1SHWB 4NHXA 4TTGA 4CTEA 1HRI3 5F6LB 1STMA 4A44A 4M3CE 4EN0A 2W1WA 4LO5B 2DVAA 1N3PA 1QH7A 2A75A 1UOGA 5FCCA 5BV6A 4CEWB 1W99A 3H9AA 1TMF1 1YCIA 1JUIA 3JQWA 3OY8A 3N9OA 4FVVA 4LTAA 2WWJA 3N9QA 4CUCA 1B09A 1XRUA 2HWC2 4MHRA 5F32A 1COV3 1EAH1 1MS3A 1YHFA 5CG9A 2GC0A 3B7MA 3ZFFA 2Q8CA 2VM9A 4CA9A 4B7KA 1GQHA 1W6NB 2WA3A 4Q4V3 1QJU3 1SCSA 4OZOA 4V2WA 4CEYB 3I7DA 3POSA 4CEYC 3ACIA 2AACA 2WFF3 3O7OA 1WCUA 1X9TA 2WWUA 3IDBB 3N35A 3NVCA 4X6RB 2J1SA 4NO4A 2ZGQA 3E97A 4C1XA 1VE0A 2F6BA 4FP2A 1WW4A 1US2A 4UFIA 1JS9A 2BQPA 1E5IA 1QQP3 4ZXKA 2QBXA 1UU5A 3WG4A 3NV1A 3ZXGA 3BB6A 3N9LA 4INDA 1SACA 3T3YA 2P17A 2AEYA 1H30A 5CFCA 5I91A 4LNVA 3WNKA 1YC61 3LEGA 4XJ8A 5CB7A 1ASJ2 5JSRA 2FBEA 2J1EA 4YPJA 1BYHA 4K9SA 5A33A 5FZDA 4NIAA 5FOBB 3IN9A 2P37A 1RUE3 1UY1A 5JVVA 4ASKA 2VE1A 4QPIC 4OI1A 2VQ0A 1ULOA 1SLAA 2A73B 3UETA 2YPDA 5CA6A 1VMFA 5GZFA 5I0UA 3VBHA 4AAPA 4GWJA 2ZZQA 3MIBA 2EXIA 4XJZA 5GLZA 1OLRA 1QKQA 3C7OA 4KMQA 4HMZA 2I2SA 1U12A 1UU6A 1WMEA 2X10A 3E5UA 2R1DA 1CIWA 3OJBA 3OGVA 5F39A 3U14A 5TSWA 4IV1A 3KLSA 1GICA 3GCWA 3R4SA 3JQXA 3MO4A 4WM7A 1SPPB 1NQDA 1S55A 3I59B 1I1EA 3EMRA 1BVVA 1XNTA 4CP9B 1VMHA 3ZN6A 1RHI2 4DXRA 4QX2A 3O1VA 5IVVA 4A45A 1UY3A 3WF3A 3VBUB 2HWC1 3AC0A 4MGIE 2E7QA 5FPBA 3SXWA 3PUHA 1YFYA 2RS53 2VNRA 1S0FA 5JUVA 5JOYA 4QU1A 1HV1A 2D6LX 1D7PM 4XW3A 2VVDA 1HW5A 3PVBB 1HN0A 1K5MB 4XJAA 1YFXA 3PVNA 2MHFA 1H8VA 4DMIA 2QUOA 3PHMA 2OYZA 3DYMA 1Q43A 3ZFEA 1K45A 4GH4B 1RUG2 3P3PA 5K0UB 4FFGA 4MG2A 5K0UC 1SMVA 2UYBA 4QM9A 3SKVA 1Q8PA 3KSCA 4DRVA 2Q8OA 4FPHA 3I54A 4E4ZA 1JU4A 2B4KA 1RVF2 2BWAA 1ND3B 3RGBA 1DGRA 5E6HA 1ND3C 1N3QA 2K0GA 4L97A 4MGSA 1V6LA 3LKJA 1CJDA 3ZXJA 4CXXA 5L9VA 2WC2A 3RFRA 4A4AA 1YJKA 1ASJ1 1GQGA 3AXDA 2BGPA 2ZTNA 5IWFA 3ZSEA 1XU2A 4AEDC 4DXZA 3OTFA 3OPZA 2QJVA 3POFA 1AJKA 3E5XA 3OBRA 4GULA 1CPNA 4QHBA 3VKFC 4L99A 1DGLA 3MIEA 1Y9MA 3PUAA 4XCBA 3N36A 3U4SA 1W8TA 5K8SA 2VTXJ 5H9QA 2AC1A 4BDVB 3WHTA 5C8CC 4KWUA 3OUJA 3WD5A 4GQ7A 3K3OA 5FJKA 1W8WA 3H3ZA 4XIKA 1S2KA 3H8RA 1RUG3 2IC1A 3RYPA 1O5LA 5CEHA 4QDRA 3SEPA 3D0JA 4ZU7A 2HWB2 1JZ6A 1S0JA 3M3QA 2WNUB 3VBOB 5EFUA 3VL9A 1RVF3 3FUQA 2WNUC 2DUOA 3VBOC 4XIOA 1KJRA 3KT1A 2H6CA 5T3NA 1MQTB 3WX5A 1RHI1 1SLCA 3P3NA 4P9IA 3WW1A 2OZ6A 2EALA 3TRSB 1GWMA 3USUA 5FY7A 1OQ1A 2W91A 1W2AX 4JKKA 5FP3A 4E2SA 1LNSA 4KWJA 4NRMA 4FTSA 1L7LA 4DB5A 1OBNA 4YW5A 4F3JA 5JR2A 3IPVA 4ZONA 5BNPC 2QQWA 3TBDA 4IE7A 3ZPYA 3IMNA 4FQZA 4YNIA 1FATA 4NAMA 4NHKA 4RR3A 3S7IA 5DUWA 4LA2A 2JKXA 3K4DA 3PNAA 4GWNA 3OPTA 2W92A 4Q4X1 2XB6C 5LBFA 3AYCA 4BK4A 2LRPA 4URAA 3UYJA 4YVWB 2VO5A 4GMP3 4UW3A 1GMMA 4A6SA 1ZX5A 1ZZCA 3WUDA 3LQCA 4YVSC 2IXKA 1CAWB 1LODA 1L7QA 2HWB3 3NKGA 5CKMA 3MV11 1GQPA 2ZGPA 3FHIB 5LBBA 4QPGA 2ZAHA 3CL1A 3ZXFA 1LOEA 3WF2A 4Y5TA 1WWYA 2AH2A 3CIHA 3LOIA 3OEBA 2VBBA 3T1MA 1C28A 1HJFA 4CE8A 4ZKTB 5D8AC 4GD4A 1MZ6A 1WZXA 2OPWA 3OEAA 3OUHA 1JOJA 4DZGA 4XTPA 3ZXKA 1HLCA 2GNDA 3N7MA 1POV3 4EJRA 4BQYA 4I01A 2FQPA 2L9LA 3GF6A 4OULA 4QXHA 1F9KA 5CIRA 3I3MA 4OI0A 2A6YA 3ZYFA 3L9JT 4QDQA 4ZZ8A 1ZA7A 1W6QA 5FZOA 1LU2A 3HR9A 5I0TA 4XF0A 3WVJA 3BVCA 3H8UA 5A80A 4Y5SA 1KDKA 1HXS2 1ND2B 3ES1A 1ND2C 3Q9OA 1S4CA 5LEJA 1QWRA 4LLOA 4W6YA 1PO23 2HYKA 2VOWA 5A6ZA 3B00A 2WNOA 3UJQA 5BNOB 3FLTA 1AYM3 3NJYA 3NRUA 1K5JA 1POV0 4D69A 1RUC3 1PK6A 4I09A 3A7QA 4QPYA 2DYCA 2N7GA 2VUAA 5J96B 3N7KA 3D82A 3QLQA 4FSJA 2VCBA 2XUMA 1XNBA 2E51A 3AP6A 5F6KA 4CCEA 3MGUA 2NLRA 2XQXA 3C7EA 3F95A 1H2MA 3GGLA 3O1RA 4CDXC 4TN7A 1IQAA 4QM8A 1WCDJ 3B02A 3CKHA 4XBNA 2RJ2A 4LHKA 1EY2A 4E8CA 4WVMA 4XEZA 3DXTA 1ALYA 1YRZA 2QVSB 3KS7A 3FZ3A 5FZ0A 5C7GA 2XOMA 4IGOA 4B1MA 5FO8B 5F3GA 2GNMA 2ORXA 5JZGB 4QXKA 2HEVF 4HETA 3ZXAC 3A21A 2JDUA 3V65A 5A3UA 2EAKA 1QU0A 1C8NA 1SFPA 1UOJA 2FZ1A 4EZ4A 4QHZA 1NXD1 2F4LA 2RR11 4J1WA 2RS32 1DFQA 4ZZ5A 5IK7A 3THTA 2GC3A 1X8MA 1YQ8A 3VDDC 3K51A 4Q2FA 1NLRA 1F4AA 4D7SA 1HIXA 3ETQA 4Q29A 4YW7A 1D0HA 4A7KA 2CWMA 4V1PA 4WV8A 4P9LA 1OVSA 3KMHA 4UT5A 4CEYA 4QB2A 5FKBA 2XJQA 3VBRC 5C71A 2NYYA 2ID4A 4HBNA 1HB4A 1PZ9A 5T55A 4MGQA 1D4M3 3O14A 4C0HA 5A6YA 3U10A 5J48A 1HXS1 5DAVA 3PUIA 2R1BA 1BJQA 4S2FA 2QNKA 1NE4A 1TZOA 4A6OA 1NCQB 4RS5C 5BY5A 1NCQC 4K7JA 5DG2A 4BH9A 4GB33 4XFAA 5IVCA 3NJZA 4I3PA 4LA3A 3KF3A 5IW0A 3WZ1A 4Y4YA 4AHWA 1LB2A 3KV6A 1O5UA 3AXEA 1QJX2 2FD8A 1IGOA 2VR4A 3HVDA 1W6MB 2CGOA 5FJHA 1N47A 1VBE2 2D6PA 4XILA 3VV1A 3VLBB 2AENA 1HRV3 4TWTA 5G04L 3SH5A 1C1LA 1UY4A 3HN1A 3JU9A 1RC6A 4N43B 4BQ4A 4R4ZA 1KS5A 1OHFA 5C3QA 1W28A 3OYWA 3WNPA 4OQ8A 4BQ5A 3DPRB 2VCMA 3DPRC 4QPIA 4ZXEA 1IPSA 1EPWA 1KFXL 3AZWA 3AJZA 2IWGB 3IIIA 3S7EA 5JIUA 5LA2A 1F8VA 3WHUA 2XPJA 4XPVA 1CPMA 2XWJB 5E8AA 1AR92 4BM8A 4ZPIA 1BK1A 1NY71 4XMIA 1WLDA 2VH9A 4IE4A 1WLTA 3BI3A 5HPOA 1AZDA 1FV2A 1NZCA 3OD4A 4LT5A 3K46A 4Y3OA 1QEXA 3ORJA 5EQUA 5FFOC 1OD5A 2VMHA 1QJY3 2JB4A 3LA2A 3W58A 3OGRA 4HT1T 3CU7A 1LEMA 1QJX3 4XETA 3T4VA 4YGCA 3VBSC 5J3UA 3OY8B 5F3EA 2D3PA 5FYTA 3UK9A 2JIJA 5IVFA 1VBE3 1OOPB 2RS31 3K4AA 1LOGA 1OURA 1OOPC 3M4FA 2YHJA 3O5SA 2CV6A 3WLUA 5B4XA 2XJVA 4QX1A 3GHMA 5SV8A 4D6QA 3ZFFB 1TQ5A 4KH9A 3S5AA 4ISQA 1V6MA 3ZSKA 2PHTA 2B7YA 3M3CA 4DXTA 1SLIA 4CCNA 3LEMA 5C3RA 1H0BA 1O3TA 4HKLA 1GOFA 4JCKA 4CUAA 1QOSA 1Z7S2 4AI2A 1BXHA 2HWF3 2ZEYA 2IZWA 3NO8A 4RHV2 5K0UA 3SMHA 3ZR5A 2E6VA 2IUWA 2HBTA 4LHSA 2PHFA 1AVBA 1OA2A 3URFA 1JZ5A 2JD9A 1RXFA 1XSRA 1PVXA 4J25A 4K8FA 1YWKA 4LK7A 4N8MA 4YLZA 3JUUA 2DCZA 4E4SA 2CAVA 4X6QB 2P3YA 1XPWA 3HIFA 4YGEA 2BP6A 1XC6A 1ENSA 3F2ZA 2YBPA 4LBJA 1JZ8A 1W05A 5CFCB 1OSGA 3RMXA 2E53A 1ZBA2 2QTWB 4AEDA
chains in the Genus database with same CATH topology
3KM5A 4JDMA 1KJLA 3WDVA 5F5QA 4ZU4A 2VW2A 1QH6A 4BYYA 5A33B 1RUNA 5C8CA 2EAAA 2WT1A 4ES9A 2AUYA 1AR82 1CAVB 2YV8A 4BHPA 2JEMA 2YYOA 1MVQA 4OLLA 2GMMA 5AFEA 1Z7S3 4HFSA 3M1HA 3G6JB 4RHV3 5KHGA 1AR91 2A3YA 2JJ6A 4F83A 3A4UA 3RI9A 3BOWA 2WNUA 3VBOA 4IV1B 2ZJCA 4AK3A 3E6DA 4IV1C 2PLV2 3OCPA 2XBO1 4WM7B 2BW8A 1H8TB 3M2MA 4XHXA 5HXVA 1CX4A 1DZQA 1H8TC 1UCXA 2AREA 4FPFA 3RPQA 2PHLA 4YGDA 2X29A 3ZN6B 5CVRA 5DUVA 2JX9A 1ZBA3 2IXIA 2W52A 3GBFA 3M70A 1VBC1 2QQPA 3RSJA 5BNPA 3RG0A 1AL0G 2YGMA 4IL7A 5HCBA 5K9YA 1ULGA 2K2SA 1C5IA 2UU8A 1S0DA 4FPEA 1X33A 2JE9A 2MEV3 5L7OA 3ZFEB 4YVSA 2XLAA 5FLHA 3U4XA 5FQ0A 3KGZA 2CNAA 4BQ1A 4NWVA 2JG8C 2GSYA 1JTZX 2LALA 5D8AA 3M3OA 4BLJA 4NR1A 3AFKA 2A5ZA 3KCCA 5AVAA 4GIQA 4YRDA 5JLVA 1KRIA 3I4IA 3ZFGB 4MH0E 1AX1A 2JKBA 4O9EA 4Q0VA 3ZFGC 4F8AA 1N1TA 5GZGA 4QQ2A 1AR81 1C4RA 1QNWA 2E7TA 2G9FA 2XLFA 1O4YA 4XQ4A 5AC93 2JG9A 1GYKA 3S30A 3AZVA 2I74A 1ND2A 3TAYA 3ZN5A 4A7YA 4XF9A 1AUYA 4OUSA 5DZFA 1BEV3 5JI9A 1RUI2 2ZX3A 1WW6A 1RMU3 2B39A 4D7TA 1DU3D 1HQLA 2IXLA 1PMIA 1ENQA 2PLV1 1VBA3 4XDQA 3WQ7A 1WUVA 1XQNA 1C8M2 3AJYA 4K21A 3USUB 5AVPA 1R092 1CR7A 4M0NA 3IKWA 1Y43B 1WW7A 2JXAA 1S0IA 4CDXA 5JCTA 2HWD2 5IUQA 1GSLA 1IKQA 4TZDA 1XYPA 5EXOA 4DINB 2NP0A 1OA4A 2YROA 1NCRB 1RL3A 2YGLA 1NCRC 3AYAA 2D5HA 3JZVA 3NV2A 4M01A 2ZGSA 1CAUA 1MEC2 1OPOA 1SLLA 3BU7A 4BOWA 4E27A 4QPGB 3T2TA 1HX6A 4QPGC 3WP6A 2BNNA 4AFAA 4YZ1A 1D0GA 4QQPA 4IEZA 3ZYJB 2XGXA 1ENRA 1FOD3 4SLIA 3TOJA 1R093 3VDDA 2Z69A 4AF9A 1G8WA 1ZZ7A 2ZCWA 4H55A 4D3WA 3K48A 2H6BA 1LCLA 1ZRRA 1DBNA 2WIIB 4LR4A 5KC6A 3WINE 1IS4A 1XE8A 2LUWA 3VBRA 2HEWF 1W6QB 2HWD3 2O1QA 2ZKLA 2GC1A 3VKOA 4KQ7A 4FBFA 4RS5A 3U0ZA 1RUI1 1NCQA 1HRI2 3TB0A 3OGJA 4L8QA 3H0OA 4ASMB 4IEXA 1OA3A 3JCIA 1GANA 3MF6A 1C8M1 2UWAA 3RQ0A 1O3RA 4OHYA 4IESA 4Z07A 2BFUS 1PK6B 3HMYA 2E9QA 1MS5A 2PAKA 1BCXA 1O3QA 1Y9QA 3ACLA 3AMMA 3DPRA 2CL2A 2IXHA 4ATFA 2O8OA 2WQ4A 1VR3A 1DGWX 1QJU2 2Z42A 3JD73 2X53S 4COWA 4G3YC 4YFWA 5GZEA 2XJUA 2HEYF 3GNEA 2JD4A 5DDJ2 4WVMB 1MEC1 4BIFA 4E4DX 3LSDA 4LO7A 3LZZA 5L73A 2O8QA 1LENA 1QQP2 4HK8A 1LU1A 4Z8BA 3VBSA 4CP2A 1CN1A 3M3IA 4KGQA 3VZJA 1FXZA 1OOPA 3G7DA 5FBZA 4MVTA 1S0CA 4PJYA 1VRH1 2ARXA 1S0GA 2OZJA 2FZ2A 3WW3A 4U36A 1RUE2 3D8CA 3QH7A 3WXPA 3SLIA 5KHIA 5CNAA 3M7AA 1QXJA 3CJIB 3VZKA 3CJIC 3RNSA 1GZWA 4XF4A 4EN8B 1ZNPA 1CQ9A 1HDKA 5DDJ3 4E9KA 4YZ2A 2NMOA 1HRI1 3OGGA 2BBVA 1EV13 3VGIA 3NV3A 1NE6A 2QE3A 4AW7A 1E57A 5J7MA 3VHNA 5IT6A 4K3UA 3H1YA 2OA2A 4JC1A 1REEA 4XYXA 4YGBA 1GR3A 3AK0A 3W59A 4FXKB 1LULA 5T5JA 3TN92 1COV1 3LWCA 1UL9A 4YM2A 1J58A 2OVUA 3VHOA 2RS52 3OYWB 4Q0PA 1LESA 4QPIB 4B7EA 4Q4V1 1AX2A 1QJU1 1CAVA 2G9GA 2YPJA 1NA1C 2WFF1 5JOWA 1RIRA 1YIFA 1JYCA 1QHDA 2LM3A 1UZYA 4JRLA 1TNFA 2A6XA 1N1VA 1QDCA 3MPPG 4LO8A 2R062 4YG3A 1V6KA 4HLTA 2UY9A 1QQP1 3MW2A 1H8TA 2GALA 1WMDA 1RUF3 1FT9A 4FXGB 2CGNA 2ZHNA 4YM0A 3KT7A 4IEQA 1PNFA 1V70A 4META 4Y1YA 3AZYA 4A2UA 3DF0A 3TN93 5FO7B 2B45X 2LTNA 4J1XA 2K9ZA 4RA0A 4Q1PA 2ARBA 2XH6A 1RUE1 3J8F2 1FPN3 1XYNA 2P3IA 3ZIWA 5AFBA 1N3OA 2PHDA 2WFPA 4FOVA 4N7IA 4QGLA 1FMD3 1R083 2GDFA 1EPZA 2TNFA 4BA6A 2QDRA 4AYUA 1MS9A 1XU1A 4PLMA 4Y1UA 3SCGA 5DUUA 2DV9A 2R063 4B3NA 3RJRA 4RD7A 1UMZA 2JG8A 2DVGA 3AZZA 3EJKA 1DYPA 3AP7A 3QACA 1W6PA 3AKQA 4P5HA 2R073 1LKNA 1YO8A 2QFEA 3VKNA 4AVBA 3WT3A 4HZFA 4AEDB 1DQ0A 3VZNA 1LR5A 2ZGUA 4Y1VA 3ZFGA 2RS51 3WV6A 3BALA 3J8F3 5C8CB 5FMOL 3FFZA 4FPJA 2XVGA 3BOPA 1AXZA 4Z2WA 4YW3A 5D1IA 1H4HA 2ZGTA 2PQQA 4EN9B 3ROUA 4QT6A 4D7YA 1AYN3 5DG1A 4LBNA 4L2NA 2DCKA 3KZ4C 3DN7A 3VL8A 3UL2A 1PZ7A 5CBLA 1YJLA 2JECA 4E2QA 4GKYA 3VZOA 4AFBA 4JDOA 1UPIA 4NHMA 5BNPB 3IWZA 4RL7A 1PGSA 3A0NA 4J6GA 4C91A 4AFCA 1R1A2 4X8NA 3SITA 4XBLA 3DUIA 4RQPB 3U07A 4CZSA 4DRRA 4RQPC 1NCRA 5L7OB 1UAIA 2WSVA 1RUG1 5L7OC 4YVSB 4NOTA 5GM0A 1RVF1 1MZEA 1PO22 1QF3A 2ZBJA 4MZUA 5FQ0B 1Q3EA 2VPVA 3L2YA 4XFBA 3E5QA 2VOXA 4YYOA 2GH8A 3KT4A 2ZX4A 5BUVA 3EO6A 1V6JA 5D8AB 1AYM2 1SQ4A 1RUC2 4AVAA 3WG2A 3H1MA 4UW6A 1V9U3 1NOVA 3MDPA 2W68A 2W39A 3TWIA 2BVBA 3RS6A 4AEJA 5KBFA 4YW1A 5T5LA 1Q8VA 2VNOA 4AHYA 1S1AA 2VULA 1R1A3 1UU4A 2VNGA 4GMP0 1ULCA 5IK5A 1LOBA 1B35B 4GMP1 1B35C 2IFWA 2JG9B 2VQAA 2WQZC 1WBFA 2JG9C 3GZTB 5GLVA 5T5OA 4W6XA 1KXGA 2RJKA 2HWB1 4PIYA 4JTNA 1VBD2 5EZWA 4I0AA 1G9AA 1DHKB 4LE3A 2MNGA 5T54A 5I93A 1O4TA 2D5FA 3DV8A 1FI2A 4AVSA 2GAUA 3AKSA 4K6BA 2R0HA 5BNNC 4MV2A 1POV1 5CG8A 2ZHLA 1NYWA 3ZXEA 4LBQA 2ZGNA 4IETA 3ZSMA 5FLIA 4H7LA 3MFCA 2VXRA 4CDXB 4HK9A 2KXLA 1MZFA 1PVC2 1O4ZA 3LB9A 1D4M2 4AFMA 4DNYA 1ZZBA 1PIV2 1WW5A 1SCRA 2DF7A 2VGDA 4LHNA 1CAUB 1W6OA 2YUEA 1QMJA 3MW4A 1PO21 1VBD3 4GB32 5I0SA 3HWJA 1VB2A 2DFCA 2OPKA 1SFYA 2ENRA 2TEPA 1AYM1 3MIHA 2NPIA 1UPSA 1RUC1 1FNYA 4KU8A 4E2GA 1HRV2 3VDDB 2OUJA 4FTBA 1X7NA 2WNVA 5EV7A 1YFUA 1UIKA 1ULDA 4HKWA 4YW4A 2QZ2A 1Q56A 2RJLA 5ABJC 4AQSA 5EYYA 4UW5A 3CJIA 4IEYA 3ES4A 3VBRB 1PVC3 4AQTA 2ZGMA 3WG3A 1PIV3 4RS5B 2ZS6B 1O7FA 1H1IA 3B3QE 4BLIA 4EROA 4XHBA 4XF3A 4TLFA 1QJY2 1BBT2 1N1SA 1IOAA 1DQ2A 2GMPA 3KD4A 4FCAA 1BMV2 1ZZ8A 3CF6E 1MS0A 3SH3A 1AF9A 2WT2A 5EYXA 1GKBA 1G9DA 5KXCA 1WMFA 2B8MA 4W6WA 1DQ6A 3FBYA 3H1WA 5LRSA 1DDLA 5GZDA 4JVAA 4KBBA 2R043 4FPLA 2B42B 1J3RA 2C1FA 4M3CF 4P9GA 2XHKA 1C57A 3AYEA 1OQEA 3TNPB 3JBG3 4LLFA 1PVC1 5CU1A 1NA1A 2JICA 2VOVA 5I8YA 1D4M1 2ET1A 4I0WB 2D43A 5SV5A 4DOUA 2HWF2 1ZBE3 5FO9B 4XQDA 3SH4A 4PLNA 1PO13 2OW4A 4JTOA 4S2DA 3I2DA 2C9AA 4IEOA 4GB31 2QDNA 4XJ9A 5JPMB 3KB5A 1UIJA 3BIWE 4JV4A 1ZRCA 3RI8A 2P3KA 1C5HA 1BBT3 4FPGA 3VBSB 4RSUA 3FFQA 4ASLA 2KA3A 4HPKA 4BMBA 1AHSA 1H1MA 2ZGLA 1HRV1 4MLOA 1F5FA 5L36A 3T1LA 2Z2SB 1VLNA 3JB4C 1C3HA 1W39A 4XJWA 4Y24A 5GZCA 4C90A 2EXJA 1T6GC 3R0RA 4EWDA 1REFA 3WCSA 3RMYA 3MLJA 1CAXB 3WUCA 4Y26A 3LCPA 3NAPC 4CP0A 1GZWB 2FMDA 1F2NA 1HKDA 2CY6A 1O91A 1VAKA 1H2KA 3CLPA 2HWE2 3ALQA 3JB8A 1YXWA 4WVWA 5DZEA 2B46X 1QJY1 3V64A 1QXPA 3OF1A 1VP6A 5JWPA 2ZX0A 4XFIA 4TYSA 1BMV1 1QJX1 1UZZA 2AZ5A 1RUJ3 4A7ZA 1VBE1 3MLKA 4N53C 1QXRA 5C6CA 4JAAA 4A3XA 1TME3 3WQ0A 1QY4A 2W08A 1RUH3 4CDQC 5DXDA 4LO6B 3H7YA 4KWLA 5EWSA 3D5OA 4COUA 3D0SA 3MW3A 4Q1RA 2JE7A 4R9BA 2MEV2 1ULEA 4AXOA 2HWF1 4P9WA 2A6WA 4ES8A 4B8EA 4MXWB 5A32B 4AGVA 2WZR2 4TSVA 2D44A 2RM23 1DF0A 1QOTA 2MPFA 2HWE3 3MLLA 4MYEA 2PHWA 4IEVA 2D7FA 1A6CA 3RRDA 3GYDA 1MS4A 3AX4A 2ZGKA 2ZHKA 1D2QA 5JI7A 4ONUA 2BEOA 2Q30A 1LECA 4N7UA 1AJOA 1H1AA 1WCSA 3V0BB 1VB4A 1UKGA 4BH9A 2BGCA 3ZX7A 4HVQA 2DU0A 3TNQA 1TE1B 4Y1XA 1A8MA 5F1RA 4R9AA 2F4PA 5BXXA 5JPNB 3AMPA 4KG8A 4RQPA 2Y26A 2ZAAA 1Z0HA 1Z7S1 5AC92 4IEPA 5IK8A 2I45A 3PVOA 1JUHA 4RHV1 4BE3A 3SNMA 1J3QA 4AI8A 1BEV2 3PLQA 4MXVA 2WZR3 1AXYA 1V6IA 4LBKA 1RMU2 4FO9A 2YZ4A 1VBA2 2JG8B 5JOZA 1KQRA 1VBB2 1W6PB 5DUXA 5BYNA 4PBPA 3EHKA 1ZBA1 4FPKA 1BZWA 5HI0A 1S0EA 3NSTA 4IEWA 1XNKA 3OD0A 2BNOA 1A3KA 1OKQA 5FRAA 4RGAA 3WOGA 4HL0A 4BZ4A 2DFBA 4QU2A 4LUKA 3E6CC 4QGMA 2CYFA 5E89A 3QOPA 1KFUL 1OLQA 1B35A 2MEV1 2Q1MA 2Y38A 5C9AC 3N4MA 4Q27A 1LHOA 4XJUA 2WZR1 1ZZ6A 3QD6A 4XFFA 5GLWA 4LBQD 2NN8A 2PELA 4PDWC 3WR0A 1AL23 5FTTC 2XJPA 1VBB3 5BNNA 2A6ZA 2WJSA 1FOD2 4FOWA 3D6EA 2R16A 1G6NA 4HANA 3ZXLA 3B9IA 3O0WA 4YZ3A 5DZGA 2FHRA 1XNDA 3EBRA 4IQPA 1ULFA 5AC91 1QNYA 2FMYA 2NZ9A 3ASIA 1R1ZA 1BEV1 3FC0A 5ACA3 4M3CA 1RMU1 3IDEA 3MYXA 4Q4Y3 1M4WA 2KM2A 2UURA 3WP5A 1VBA1 1RJ7A 3LAGA 1VBB1 1FNZA 4ATEA 1JXNA 1ZRDA 2DVBA 4GKXA 4NHLA 2XLGA 2V73A 1AR73 2P2KA 2WS92 4PQ9A 2DUQA 4BCUA 1SBEA 1RUD3 5JR7B 2EIGA 1MZ5A 2NMNA 5ABJA 2ZGRA 4EWEA 3ZVXA 5C4WA 2V5YA 2PFWA 3JD72 1SFNA 3BTAA 1AR63 4LULA 4OHXA 1LGBA 4WZCA 5JMCA 2RE9A 4Q4W2 3POWA 4I0BA 1SEFA 2DVDA 1ZRFA 3RJ2X 4P14A 3ZO0B 4BMEA 4ITCA 3WP3A 4CP1A 3ATGA 1BQPA 2BUKA 2YXSA 4UXAA 4IERA 2WL1A 1IS5A 4IV3C 3J9SA 4JGZB 4JRAA 4FAHA 5FDBA 1FOD1 1GBGA 4JGZC 2GH2A 1LGCA 5B2GB 2R32A 2GZWA 2XWBB 4M00A 3BPZA 1R091 4KU7A 2WS93 2GN7A