2DVDA

Crystal structure of peanut lectin gal-alpha-1,3-gal complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvdA00
1V6JA 3AP6A 4FPJA 3UL2A 1IS6A 2D7FA 2EXJA 4RL7A 2A6YA 2ZGSA 3OYWA 3O12A 4RA0A 3FUQA 4DFSA 3QLQA 1A78A 1W6NA 4Y1UA 1IKQA 2GNTA 2XG3A 3ZYRA 2A71A 1JHNA 4LBQB 1YYNA 4UW3A 4XYXA 3R4SA 5GM0A 3RMYA 1N1TA 3ZXJA 4GWMA 4GXLA 4BM8A 1AX0A 5H9SA 3VUOA 3PJQA 4FPGA 2DVAA 4NO4A 2PELA 1Z78A 1DIWA 1QOSA 3AP9A 1LOFA 3GNEA 5T54A 5IK4A 2NYYA 1HQWA 1LJ7A 1D0HA 4AGVA 3SISA 5JOXA 3AYCA 2EALA 1LHWA 1LOGA 4Y20B 3L2YA 1VLNA 2VY0A 3LSEA 4Q8KA 4Q8LA 1G9CA 5HCAA 1VAVA 1CPNA 3WNXA 3FLPA 1VALA 1MVQA 3MPPG 1FNZA 4FQZA 1ULGA 1G9AA 1DZQA 3R05A 3ZXFA 3OYWB 1CR7A 2DTYA 1N1SA 1UZYA 1YIFA 1W6MB 2ZBJA 4K1ZA 5KXEA 1LOEA 5DUVA 3AXEA 1QOTA 2ARBA 5GZGA 3D4KA 2DV9A 1S0FA 3N35A 4FPFA 1QGLA 5KXCA 1WCSA 3C2UA 1N1VA 1UZZA 2SBAA 2D3PA 3ENRA 3A0KA 1CN1A 3BODA 5H9RA 2D6PA 3VKMA 2A6XA 3V0AA 3D5OA 1HQLA 2W52A 3N7MA 5DZFA 1ONAA 4Y20A 1O4ZA 1V6KA 1LOBA 2P34A 3OGGA 1SLTA 1GANA 3ATGA 2G4IA 4Y1VA 2GDFA 1IS4A 3BTAA 1AJKA 2CL2A 1UN1A 3Q9OA 3IMNA 1SBEA 2AREA 2E6VA 5HCBA 5CB7A 2B7YA 4XJ9A 3OBTA 1KJRA 4NOTA 2WT0A 5DG1A 1LHVA 3V0BA 2V73A 2YXSA 1CJPA 1NXD1 1VIWB 5CNAA 4YGBA 1CPMA 5DXDA 2DVFA 2AR6A 4DPNA 4DRVA 4LBNA 4XDQA 2GMMA 2DTWA 5JOZA 1S0GA 2R0FA 2WSVA 4PF5A 2GNMA 3T2TA 2WSUA 2JDZA 2R49A 2R16A 2Q5TA 3OBRA 4WZFA 2EXIA 3WG4A 1BYHA 4YM3A 1DQ5A 3UJOA 4YM1A 5CAZA 4XOGA 1URXA 3LCPA 1JOJA 2DVGA 3OY8B 3D6EA 1BZWA 1ULDA 4XJ8A 3AXDA 1QDCA 2VUAA 1Q8OA 1W6OB 4Z8BA 3AZWA 1F9KA 2ZABA 1CQ9A 1PZ7A 2AENA 4JRAA 3FFZA 5E89A 2ZA9A 2OW4A 3T1MA 3H0OA 2ZGQA 1N47A 4XE9A 1QF3A 2ZMKA 2DUQA 2ZGNA 1WUVA 2ARXA 3WDWA 1Q56A 1Q8QA 3W59A 1W6PB 5DUWA 5EYXA 3NWKA 3PVNA 5H9QA 1JW6A 3WG3A 4KBBA 4M3CB 5EWSA 4IQPA 3RMXA 3O5SA 1SBFA 2JKBA 1S0DA 1CIWA 2GALA 1YRZA 3AX4A 2W08A 3MW3A 3N7LA 4Y1XA 1EPWA 4BLJA 1DLLA 3O0VA 3WVJA 2UURA 1AZDA 1LGCA 3ZSMA 1O4YA 1MACA 4DS0A 4YG0A 5JMCA 4Y22B 2E53A 2D6NA 4YFZA 1AVBA 1GZWB 1LHOA 1WW7A 1WLCA 1GZWA 3NV4A 2DU1A 1G8WA 2DVDA 1BQPA 4YGDA 3WG1A 3WG2A 2ZHNA 2JE9A 2R0HA 3NV2A 1MR5A 2AUYA 4XIKA 4YM2A 2DVBA 4LBLA 3WDYA 4BLIA 3CNAA 1AX2A 4PCRA 4FPYA 1FNYA 4XJWA 3AFKA 4C1WA 2FMDA 4YW1A 2V5YA 5E88A 4BQ1A 1YO8A 2LALA 1GZ9A 2A3XA 2ZGKA 3AZVA 5T55A 1LHNA 4Y24A 1Y7BA 1QMJA 3RRDA 2EAKA 3NV3A 1KRIA 4YGEA 1SLCA 2FHRA 1S0EA 1UMZA 2A6ZA 4PQ9A 1MVEA 1SLIA 1S0BA 3WHUA 4CTEA 2D3RA 2YV8A 1D2SA 4F83A 1DQ6A 1LEDA 1S0IA 2WLQA 3ZPYA 2JE7A 2W68A 5JOWA 1GNZA 1S0JA 2ZAAA 3AP5A 2ES3A 1BXHA 4AGGA 2GN3A 4M3CE 3MW2A 5JOYA 2ZGTA 5FRAA 1W6OA 5GLWA 4Q26A 4GKYA 2EF6A 2ZKNA 4FPCA 4W65A 2EIGA 2GN7A 3WHTA 1HDKA 3DUIA 2UWAA 3OJBA 1AF9A 3AZZA 3POWA 3M3QA 1S0CA 2DYCA 2YZ4A 3V65A 4UW6A 5IUQA 4YW3A 2PHUA 3AZYA 4PBOA 1N3QA 1W6QA 1Q8SA 1QKQA 3PVOA 1MS5A 3UK9A 1MS4A 1RIRA 3ZXKA 2RHPA 2ERFA 2WNEA 5LK5A 2ZHKA 4ZXKA 1CONA 4M00A 1DQ4A 1ULCA 2VXRA 4K20A 2D44A 1G86A 4FOYA 4LBMA 1AXYA 1FAYA 3LSDA 2ZMNA 3WDTA 5CA6A 1W0OA 4ATFA 2ZHLA 3W58A 4H55A 4YG6A 4D69A 1QU0A 2D3SA 4YW5A 2HYKA 3IPVB 4JCKA 1ULEA 2D43A 5JVVA 3SITA 2P3IA 2DUOA 1V6NA 1H30A 1MZ6A 3AJYA 3SH4A 4HL0A 4ISRA 1N1YA 2GNBA 4LBOA 3RSJA 4YGCA 2R1BA 5GZCA 1LHUA 2ZGUA 2EXHA 4P14A 4R9DA 2AYHA 1PZ8A 2DU0A 1SFYA 1X50A 4GA9A 1C1FA 4ASMB 3ZSJA 1GYKA 1IKPA 3WCRA 2PHXA 2WT1A 4XXPA 5T50A 4XBLA 4Y22A 3WUDA 4BPZA 3AYDA 5IK8A 4GWNA 3WDVA 5JLVA 3A4UA 3B00A 4LBJA 3QCWA 2AGSA 2ZHMA 5KXBA 2XB6C 2UWCA 1LGNA 4BOWA 1CESA 3WV6A 2PHTA 2WJSA 3AYEA 1SCRA 1ZA4A 5H9PA 4DRRA 2NP0A 1DHKB 2OVUA 2CWMA 1GV9A 2DWRA 2I2SA 4OZXA 3M3EA 5HCFA 2ZGPA 3IKWA 4I30A 5L73A 2YY1A 1UAIA 3N3HA 3O0XA 4LBQA 5GLUA 4YFWA 3KQRA 3SH5A 4FPKA 4R9BA 5DZEA 2Z42A 2LTNA 1I1EA 3POSA 2E7QA 5T5LA 2A3WA 3N36A 2NN8A 1DFQA 2NMNA 3PVEA 4YW4A 1G9DA 1GLHA 4XZPA 4GALA 1FX5A 1HLCA 3WCSA 1V6IA 3B3QE 1B09A 4YZ3A 1AJOA 1QNYA 1V00A 1WBLA 1C1LA 1OQ1A 3RQ0A 3HR9A 1RINA 4WVWA 4Y26A 1I3HA 5DUUA 2A3YA 1AXKA 5GZFA 3M3CA 3POYA 4XMIA 2ZZJA 1NLSA 1YXWA 2A5ZA 3SLIA 3VKLA 3ZVXA 2R1DA 4FPEA 1Q8VA 5GALA 2SLIA 3N7KA 5IK7A 1G9BA 1KITA 5EYYA 1ENQA 2A75A 5JDBA 1WW6A 3M2MA 3ZXEA 1DQ2A 1G7YA 3I4IA 4TZDA 2P3JA 1C4RA 1DGLA 4YZ5A 2PHFA 1UL9A 2WKKA 4FOQA 4Y1YA 3BIWE 2WQZC 1LU1A 1LODA 1H9PA 1WLWA 4XIOA 4CRQA 2CWSA 1LENA 4LBQD 5T5OA 3AP7A 1WBFA 3AP4A 4FP3A 4MYEA 4GKXA 3AYAA 4Q2FA 3AJZA 4Q1RA 4WV8A 1JBCA 1KJLA 4P9WA 2ZGRA 3TAYA 4C1XA 2ZGLA 3OPZA 2ZMLA 5E8AA 1LCLA 3WLUA 4CZSA 2TEPA 4AWDA 5BYNA 1JYCA 2P3KA 5T5PA 1SLAA 1DQ1A 3FBYA 4DQAA 2CY6A 3A0NA 4WVVA 4XJUA 2GMEA 1MS8A 3N7JA 3SNMA 4ZKTB 2CNAA 3ASIA 2D6MA 4XXAA 1LU2A 3JU9A 4FPOB 4XHXA 3B9CA 1LGBA 2NZ9A 4HANA 1ENSA 3ZXLA 4XBNA 3FLTA 2UWBA 1FV2A 5KXDA 2P37A 1IS3A 4FPLA 4M3CA 3VKNA 3RG0A 1JYIA 1N3OA 1A3KA 1QOOA 2YROA 3KM5A 1LOFC 1UPSA 3PMEA 2ZACA 1F31A 1MS9A 2AH2A 5GZDA 2W39A 4K1YA 1G9FA 1SLLA 3SH3A 2CTVA 1Q8PA 5IK5A 4FP2A 3IM0A 1QDOA 4XBQA 4XTMA 1LTEA 4M3CF 3ILRA 3USUB 1DQ0A 1SCSA 3VV1A 2E51A 1KDKA 1IOAA 1WD4A 5EXOA 1H9WA 3ILNA 4UW4A 4XILA 1IS5A 3VKOA 2GMPA 3HN1A 4XMAA 2A6WA 3B69A 2OUHA 4FOVA 1FYUA 4FVVA 1JXNA 2YMZA 1OFSA 5SV8A 5IT6A 1GBGA 1ULFA 3DGTA 3IN9A 4R9CA 3T1LA 1LESA 4R9AA 1SBDA 3V0BB 2ZGOA 3FLRA 4P9XA 1AX1A 1MS1A 4M01A 4TYSA 1TEIA 2D6LX 2WT2A 3ILFA 2BQPA 2CYFA 4FPHA 1LULA 2VH9A 4U2AA 1N3PA 1WW5A 3RS6A 1DYKA 1MS3A 1XQNA 1W6QB 4L8QA 4Q27A 3I8TA 1C57A 3TB0A 2GNDA 1V6OA 4XTPA 3M3OA 4AVVA 2D6KA 3GALA 3NV1A 4FOWA 4ISQA 4JC1A 5FREA 1KDMA 1CVNA 1DBNA 2JJ6A 4BMBA 3FUOA 1ENRA 4K21A 1GICA 1ZM1A 3MEPA 2ZGMA 1LOCA 3ZSLA 2C9AA 2PHWA 2DURA 1LECA 4SLIA 1Z0HA 1WD3A 5F9TA 4YZ1A 3O0WA 4ATEA 5GJ6A 1GZCA 4XJAA 5AVAA 3WDXA 2VW0A 4YM0A 5T5JA 4UW5A 2ENRA 3ZYPA 4Y1ZA 1AXZA 1APNA 1HKDA 3APBA 2E7TA 2H0BA 1W6PA 1FV3A 1J1TA 2A70A 4YW2A 3VKFC 3WOGA 1GSLA 1WLDA 1BKZA 5DZGA 2PHRA 1QNWA 2UU8A 3UJQA 1V6MA 1YI7A 2A7AA 1FATA 4BMEA 1JUIA 1RITA 3BOPA 2VU9A 3M1HA 2VW2A 4AYUA 1KQRA 4ITCA 1A8DA 4AGRA 1LEMA 1OKQA 1SACA 1MZ5A 4AVTA 2DUPA 5GLTA 3AK0A 1W0PA 4XHBA 1GKBA 1DYPA 2A6VA 2VW1A 4U36A 3MW4A 3IPVA 1W6MA 5CBLA 2P2KA 2EXKA 4YG3A 1R1ZA 3V64A 3B01A 3R4UA 2C5DA 1F5FA 1V6LA 1UKGA 2JD4A 1W6NB 2NMOA 3INAA 4LBKA 1UX6A 3WDUA 3ZSKA 4FQ4A 3U4XA 1S1AA 5T52A 4PBPA 5DUXA 5F5QA 3AZXA 3V0AB 1GNHA 4AVSA 4XJZA 4YZ4A 4YZ2A 3HMYA 5GLZA 1BJQA 1SLBA 1WW4A 3JUUA 5GZEA 4YLZA 1VAMA 2NM1A 3WZ1A 1MS0A 2KM2A 4P9YA 1LOAA 2D6OX 3USUA 3WUCA 2OUJA 3OY8A 2JECA 1PZ9A 5DG2A 1U0AA 5GLVA 4Q1PA 1JN2P
chains in the Genus database with same CATH superfamily
1OA3A 4Q4X3 4QGNA 1W3VA 3OYWA 5FZ9A 2XJQA 3O12A 5FKCA 4N53A 4Y1UA 2GNTA 4RFRB 3LWCA 1YYNA 5F3IA 3JXSA 3VDDB 4XYXA 2RJLA 3FC0A 2XBO3 5FXWA 1N1TA 5FOBB 4GWMA 2X10A 5H9SA 1UD1A 4Y33A 2DVAA 2WS93 3GNEA 1QOSA 3HIFA 2NYYA 1QJU3 3EBRA 1JUHA 4RYDA 3ZO0B 4Q4V2 4AGVA 5A1FA 5ACA3 2FCUA 5B4XA 4CXYA 4JTOA 3U14A 2VUJA 3E1F1 1RUNA 5A3PA 4KWJA 1LHWA 1LOGA 2D40A 4Y20B 3EMRA 3VBFC 1VLNA 2VY0A 1GP4A 4D8MA 1PMIA 1WGPA 2IFRA 2R6QA 4QB2A 4QPGA 3N9LA 3KGLA 1G9AA 3ZSEA 1M06G 4GB33 1ZZ9A 3IIIA 2XJVA 1HX6A 1RUD3 1QJX1 3NJYA 4I3PA 2DTYA 4IERA 1YIFA 1JODA 3POIA 1ND3A 4A7KA 5AFEA 2G9GA 1RHI2 3T2QA 1LOEA 5GZGA 1QOTA 2C24A 3VDDA 3D4KA 5FZMA 1GP6A 3ZN6A 4FPFA 1WCSA 2SBAA 1X82A 2D3PA 5F3GA 1W90A 1UQXA 1VBB1 3S6PA 2D6PA 4IEYA 3VL8A 1UCXA 3OD4A 3CZUA 2ZX1A 1HQLA 2W52A 4S2HA 5FMOL 3WNMA 3CDZB 4AQTA 4Y20A 2P6CA 2FQPA 2WA3A 3MIBA 4UYBA 3S57A 2VUCA 4JDMA 1UXZA 5ERLA 1HRI3 1AR73 1GANA 5I8TA 4IW3A 1PO12 4H7LA 2GDFA 1IS4A 3WNLA 2BVVA 2VZRA 3PLQA 2CL2A 4LO5B 5D8AC 4J1WA 3VBHC 3IMNA 1H8VA 3J4UH 1JYNA 2JB4A 4MG2A 1SBEA 1UY0A 5CB7A 2XWBB 3H8XA 1IG0A 3C7EA 3OBTA 1KJRA 1RMU3 4NOTA 4NWWA 4E9KA 3V0BA 3UESA 4BZ4A 1ODNA 1CJPA 5CNAA 2QZ2A 1UIJA 3T2OA 2C4XA 2DVFA 3RI8A 1XNDA 4DRVA 4DPNA 2KA3A 1JU4A 4AEDB 4EJRA 2E33A 2WSVA 3KT4A 5I0TA 2F4PA 1NKGA 2Q5TA 3OBRA 2YYOA 3KV5A 3WG4A 4Z2WA 4RR3A 2CDOA 5IVCA 4CDUB 1C8NA 3ZFEA 1JOJA 3OY8B 1ULDA 2WWSA 4K9SA 4COVA 3K77A 5LRRA 1QDCA 4CDXC 2VUAA 2ZX0A 3T09A 2WO2A 3MF9A 3ZYHA 5G04L 1JYXA 1PZ7A 1ZX5A 3FFZA 4MV2A 3G7DA 4K6BA 2ZGQA 1X8EA 5ABJA 5J98B 4RS5C 4QPIB 4OQ9A 3T08A 4KWKA 4QD2A 2Y6JA 2ZMKA 3HWJA 2RDNA 2ZGNA 1WUVA 1Z7S2 5AC93 3K51A 3OGSA 2IXCA 1TMF2 1Q8QA 5A32B 1EV12 1W6PB 5DUWA 3WG3A 3NWKA 1JW6A 4M3CB 5A33B 1FMD2 1OVPA 4CEWC 3RMXA 1OC1A 1RVF3 2JKBA 1GWMA 2GALA 1YRZA 2W1WA 3AX4A 3KVBA 3MW3A 3TBDA 4CDWC 4BLJA 3O0VA 1AZDA 2J1AA 2WABA 4OHWA 1MACA 3LE0A 4GMP3 4YG0A 4S2GA 3ZFGA 2E53A 2DCTA 3MIFA 4YFZA 3ORJA 1LHOA 3LGRA 3NV4A 3NKGA 4E2GA 5B2GB 2EVXA 4XQWA 2BWCA 3KQ4B 4AF9A 4AAXA 4R8HA 1F8VA 4BQ3A 3NVCA 4HVRA 4OMDA 5F2WA 2G1MA 4NMIA 1DU3D 4RFT0 2ZHNA 5FXXA 3WG2A 1M4WA 2JE9A 2DDUA 2W46A 2D98A 5FYZA 1HRV1 5EJZB 4BLIA 4CP2A 1GFF2 1A8MA 1HRV2 4AEJA 4E2QA 1YJLA 5JR7B 3TEXA 3POGA 4ET7A 3AFKA 1J1LA 4OQ8A 4MXWB 4UBHA 2FMDA 3H42B 1DLCA 3POJA 3ZR5A 3IBMA 3LZZA 5BNPB 3ACGA 5FWEA 3BTZA 4IGQA 2LALA 3VZJA 4A45A 1GZ9A 1B35B 2HKXA 1RUE2 3AZVA 2IWGB 4I3GA 4BQYA 1B35C 3PTRB 4C90A 3O1RA 1BEV3 3JD71 2EAKA 3ZOIA 1W05A 1XYOA 2WIIB 5CFDB 1QJX3 1EUUA 1UOJA 3WHUA 2D3RA 2YV8A 3C3VA 4EROA 1RJ7A 1DQ6A 3B9IA 2WLQA 3ON7A 1XOYA 4F83A 2JE7A 1RUJ1 3ETPA 5JOWA 1GNZA 1S0JA 2X29A 1ND2B 4FFFA 3CHXA 3JBG2 2HWC1 3MW2A 5DDJ2 4AL9A 4GJYA 5FRAA 3AFGA 3NSTA 1REEA 2EF6A 1QXPA 4FPCA 4MGTA 2DCKA 1CZVA 4W65A 1JZ3A 1UYXA 3WHTA 3K4DA 5FYVA 2GC0A 1HDKA 5A6XA 4OHYA 3DUIA 3OJBA 1AF9A 3WW3A 1YQ8A 3POWA 1ASJ2 1XE0A 1RC6A 1J3RA 5KHJA 2VMHA 4S2DA 4YNIA 3DXUA 2BGPA 5FJKA 1I5ZA 3PVOA 2RMU3 2YBKA 1S2EA 1YQ2A 4CDWB 4PT6A 2G19A 4SBVA 1RL3A 1ZREA 2ZHKA 4RR3B 5FPAA 1LR5A 4D0QA 4YVWC 3HOBA 2Q8EA 1V70A 2VMDA 1CAVA 5A7QA 3WDTA 3O1OA 2ZMNA 3I3MA 1DGRA 4XFBA 5EHDA 4EN7B 3W58A 4H55A 3NNGA 2E31A 4YW5A 1SG3A 1RUC1 2D43A 5LK7B 1NX9A 1TE1B 2XQRA 5JVVA 3T2PA 2DUOA 2CGNA 4ISRA 4CCMA 1ZBE1 3AL5A 3VBRB 3ZFGC 3JD72 4YGCA 3VZMA 2BJSA 1VJ2A 2H6CA 3RNSA 2WO1A 4B4RA 4MXWA 5A3LA 5K0UC 4Q4Y2 3O1MA 1RUJ3 3LOIA 2I07B 4XDOA 2QQOA 5FPBA 4B7EA 3TEWA 4XXPA 2FDJA 2XJPA 3AYDA 4XURA 4BPZA 5IK8A 1OLME 5JLVA 1T6BX 2HLEA 3B00A 5DQ0A 1ZRCA 1YIPA 2W3JA 2AGSA 5KXBA 4AQ6A 2XB6C 5KHKA 1NZCA 4Q4X2 5CKNA 1MEC2 2UWCA 3I97A 1XE8A 1LGNA 4M0NA 5KBFA 3ZMOA 4NPLA 3LEKA 4CP9B 3JZVA 4IV3A 2VOXA 3BU0A 1SCRA 1ZA4A 2J1RA 1NT0A 2PMWB 2NP0A 5A3UA 1DHKB 2OPKA 2CWMA 4UF0B 1ALYA 5F7UA 2WFF1 1NUKA 5K8SA 5EPAA 2RDSA 5HCFA 3SHRA 2V09A 5GLUA 4NJ4A 2WS91 4B29A 2D93A 2RM23 2BW8A 1H0BA 2JDAA 4BIFA 5DZEA 4CU6A 3N36A 2NN8A 3QD6A 1I5PA 3AMHA 2CAVA 4XZPA 4EV0A 4AK3A 5A3MA 2W47A 3B3QE 4O65A 1B09A 4Q4W2 1QXJA 4Q4V3 4YZ3A 1NY71 5K9YA 4BQ5A 1UU4A 1C1LA 2ORXA 5LCWL 4AE2A 4QPWA 3J8F3 1X33A 3VBSB 1I3HA 1S55A 2WZR1 4QPGB 2WZR3 2RJKA 3M3CA 4CXXA 2ZZJA 2R32A 4V2VA 5F6LB 3BIEA 3RZJA 5LZ6A 5GALA 1Q8VA 1TG7A 3VBHA 1H8TB 1KITA 4RSUA 1RMU2 5D8AA 2A75A 4L2NA 5JDBA 3RZHA 1WW6A 3P6BA 4Q4V1 1VBC3 1G6NA 3I2KA 5C4WC 3I4IA 4GIQA 4YVSB 3QH6A 1UL9A 4JX0A 5FMOS 2BTVC 3PUQA 3NQHA 4NR1A 5FP7A 4ZZ5A 3SCHA 1WLWA 4XIOA 4YYOA 5EZWA 2HWE3 4HSJA 2R073 5DABA 1UMIA 2ZZQA 3GGLA 3KGZA 2E32A 3DPRB 3ZMNA 2WYFA 4LLFA 5BNNA 2ZGLA 2Y0OA 4WM8A 3J7NA 2ZMLA 3VB9A 4CZSA 2TEPA 1QQP1 4AI2A 1JYCA 5T5PA 3VDDC 5FJHA 1DQ1A 3FBYA 1JS9A 1XNAA 5FAXA 1IQDC 2WRAA 4NIDA 3O14A 4FAGA 2GMEA 5BXXA 1R091 4EE2A 3N7JA 1JYVA 1WMXA 1IPJA 2Q1FA 5E6HA 5LASA 4Q0QA 2Q8OA 4D94A 3JU9A 4YRDA 1LGBA 5TSWA 4QPGC 1RHI1 1NCQA 3N9MA 4XBNA 4KQ7A 4NRQA 4XACA 1CX4A 4AFDA 2VOTA 5C3OA 5C3RA 1YHFA 1FV2A 1H1IA 2UWBA 1U5IA 2V4VA 5KXDA 4BIOA 1QEXA 2P37A 1IS3A 4FPLA 2Y6LA 3POBA 4I0WB 4CP0A 3E5UA 2UY8A 4WM8C 1JYIA 2XL9A 3ETQA 3VBOA 3THCA 5C9AA 1QJY1 1LOFC 5C9AB 3PMEA 2ZACA 1F31A 3AKSA 2AH2A 3DKQA 2BEOA 2PYTA 3KLSA 4K1YA 3THDA 5L36A 1NQDA 3SH3A 4RS5B 3H50A 5J96B 4FP2A 1PNGA 4BISA 4XBQA 4F3JA 4CUAA 3RZLA 1LTEA 4IE0A 3USUB 2YC4A 1O5UA 1HJGA 3Q8CA 3BTYA 1KDKA 5C6CA 3M3IA 1IS5A 1VP6A 3LEIA 3RZMA 2A6WA 4NWVA 4UI9L 1JXNA 1H8TA 1SPPA 2VC9A 5SV8A 5IT6A 1ULFA 3DGTA 3IN9A 2VXJA 4PLMA 5C8CA 1HJFA 1AX1A 4M01A 1F35A 2WT2A 2BQPA 3RJ2X 5IWFA 2B5HA 4BB3A 4WVZA 1BVP1 1LULA 4UFJA 4C0HA 4LPLA 2YG0A 3RS6A 1DYKA 1XQNA 3GXUA 4QX3A 1W6QB 1DDLA 4LIUA 1RUH1 1V6OA 4IEQA 2Y6KA 2Y34A 3M3OA 4LO8A 3GALA 2CV6A 3AMNA 2WA4A 2XWJB 5DAVA 1GOFA 4ISQA 4JC1A 1CVNA 1DBNA 1PGSA 4EQVA 2D97A 1KS5A 3A21A 5JI7A 1TMF1 2WDBA 3MEPA 4J1XA 4W6YA 3ZSLA 2GAUA 5FZFA 3N4MA 2DURA 5JWPA 1RUD2 4SLIA 2D5FA 4JQTA 4UFLA 3TRSB 3HNYM 4E4DX 5FZCA 2AZ5A 3CO2A 2JG9A 3VD4A 3AKQA 4UW5A 4XF4A 3ZYPA 1APNA 1R64A 2ARCA 3CQOA 1OD3A 1W6PA 4W50A 5LEKA 5A3WA 1AYM2 1WLTA 1GSLA 3VKFC 1BKZA 2H6BA 4B4PA 4D7TA 3DPRA 1BEV2 2VULA 5FP3A 4NHYA 1DYOA 1RUE3 2VU9A 5BNQA 5FZ4A 4JQRA 4AGRA 1VBE2 2MEV3 1OKQA 1SHWB 1SEFA 3ZIXA 2QE3A 4NROA 1NAEA 2DUPA 5GLTA 5FCCA 4LMFA 4QM9A 5FYHA 4YWAA 1UYZA 2ZEWA 4OVEA 2X05A 1XRUA 2P2KA 2W1SA 1GUIA 1X9TA 1ND2C 2EXKA 3MLKA 4NN0A 3U75A 2JDUA 3B01A 5JR2A 4YSFA 5D1IA 1W6NB 2NMOA 3MV11 3VBSC 1RTVA 2HWC3 4IEUA 4LBKA 4Y5TA 4GZ9A 1S1AA 2VQUA 3GBGA 1PO21 5F5QA 2RMU2 1UW8A 2WN3A 3VHRA 4AVSA 4XJZA 3U4SA 1V9U3 4BXFA 5GLZA 3B5LB 3NL1A 5LA2A 4ONUA 4XUPA 1RUG2 5GZEA 1W8TA 5F3CA 4DEVA 2XHKA 3K4AA 2KM2A 2XLAA 1JHJA 4P9YA 5JXHA 4PF1A 2Z79A 1PZ9A 3OTFA 3T3YA 5BNOC 4Q1PA 1JN2P 3RI9A 5ISLA 4FPJA 4EZ4A 4XCAA 4RL7A 5G05L 3LEMA 4LK7A 5I0UA 2DFBA 2ZGSA 4K7JA 1VBD2 3PUHA 3H7YA 3NAPB 4DFSA 5J7MA 2BBAA 4MOAA 3QLQA 1X7NA 4Q4W1 1WA6X 4BWOA 2QBXA 4ZU5A 4LBQB 4UW3A 3RMYA 5GM0A 2BFUS 2GH2A 2Z2SB 4XUNA 1AX0A 1OOPB 3PJQA 5CG8A 5CU1A 2PELA 1Z78A 4ES9A 2JIGA 3AP9A 1W2OA 1L7QA 1H4GA 1LJ7A 1XE7A 5L9BA 1QXRA 5A6QA 1RMU1 3AYCA 2EALA 5FMCA 5KHIA 3VGIA 2VMFA 3NMBA 3JQWA 2NPIA 1RVF1 4N9HA 5HCAA 3MPBA 5C7GA 3EQEA 3WNXA 1BK1A 1FNZA 3R4DB 4MHRA 4Q0SA 2R063 3R05A 3FZ3A 3OYWB 3BN6A 1W8HA 4HN1A 4TN7A 4AFMA 3TNPB 2BDRA 1N1SA 1Z7S1 1EYBA 1POQA 1W6MB 2XR4A 1US3A 5DUVA 2VQTA 4IV1C 1O6UA 2DV9A 1PVC1 3N35A 1QGLA 1ZVFA 1J83A 4BCUA 2XDVA 2F6BA 4QQPA 3BODA 2RM22 1OUSA 3VKMA 1BVVA 5KC6A 3N7MA 5FZOA 1YFYA 1V6KA 1V9U2 2WUHA 4RQPA 3RZZA 1TNRA 5IVFA 1SLTA 1CAWB 4Y1VA 4IEVA 3BTAA 4LTAA 5HI0A 4E4ZA 4XETA 1ND3B 4JRLA 4OCTA 3VD5A 2G9FA 2W94A 3THTA 1WCUA 5FLIA 2QQNA 3E97A 4OMCA 3SKVA 4XJ9A 5KC5A 5M0TA 4CDXA 4MVTA 1ULPA 1Y9MA 5DG1A 4QGMA 2VD7A 2VTFA 3KT7A 1NXD1 1VIWB 1Z7S3 5AC92 1XNKA 4QB1A 4LBNA 2P3YA 1EAH1 2GMMA 4FTBA 2O0OA 1S0GA 4GAZA 5C9AC 2DCYA 3S7EA 3T2TA 4BDVB 2R16A 4FCAA 2PN5A 4Q29A 4UT5A 5ACA2 2QQVA 3UT0A 1VR3A 1BYHA 3PMSA 4LUMA 4CCOA 4YM1A 4XOGA 3L2HA 1W9TA 1H4HA 4D6SA 3JB8A 1W06A 4DY5A 2ZX2A 1E5HA 1ZA7A 1Q8OA 2R7EB 4Z8BA 5A1LA 2YPJA 5IAXA 2ZABA 3OSDA 3PVBB 1RHI3 1CAUA 2Y60A 3AL6A 4JAAA 5E89A 4P9GA 1IZ3A 5FZ6A 4LHNA 3H0OA 1N47A 4IUGA 4DMIA 1W8WA 2B9VA 1QF3A 1W0NA 4LULA 2Y6HA 3WDWA 3H3LA 5HPOA 2ZEXA 2XLGA 4AFAA 5IVJA 5EYXA 2BPA2 1OLRA 1Q5OA 4OZOA 3GBFA 5EWSA 2YBSA 5FR3A 4IQPA 3KV4A 4PHZA 1CIWA 4Y1XA 2W08A 1RUJ2 4Q0UA 2VZSA 4KH9A 3ZYFA 1O4YA 4NVPA 3GJAA 1NXMA 4AFBA 5FLHA 4B8EA 2QQLA 1QJU1 4MO3M 4X8NA 5C3QA 1GZWB 2C6SA 4YVSC 2DU1A 5IFPA 1G8WA 2DVDA 2VMCA 4NIHA 1BQPA 4AQ2A 2YUEA 2O8QA 3LFMA 3WG1A 5DAXA 4HSLA 1ZNPA 4B7KA 1ASJ1 4X6RB 4FT8A 2VO5A 3NV2A 4FBFA 1K3IA 1WCDJ 4YM2A 5C8WA 4LBLA 5A7PA 3WDYA 4A3XA 2WL1A 3OF1A 5FZBA 5DMYA 2BNMA 3CNAA 1NQJA 1Y9GA 4FPYA 4K3UA 1LAJA 2HWD3 4A7YA 3IDAA 4KU8A 1PO11 2WNUA 5DAQA 3CKHA 1ZRFA 3VBFA 2BP6A 5FOJB 5E88A 5FYUA 3ZYIB 2KXLA 3PUIA 1PVC3 2A3XA 5T55A 1GNYA 3EJKA 1I6XA 5FZEA 1H2LA 1RUH2 3ST7A 4P08A 3NV3A 5CKQA 2RV9A 4YGEA 4F8AA 1SLCA 2FHRA 3CJIB 1SLIA 3WNNA 3GZUC 2XVLA 3K46A 1D2SA 1RUI3 1S0IA 2AEYA 2W68A 2RJ2A 2UYAA 2J1SA 1UYPA 4FO9A 1W8FA 5A3OA 2GN3A 4M3CE 3E6DA 2E63A 1EPZA 1H1MA 3J8F1 2IFWA 2BWAA 4GKYA 3LA2A 3WW4A 2GN7A 2WLPA 3SXWA 4XFCA 2P4EA 3IDCB 2ZEYA 4LNVA 3AVRA 4KNCA 4COYA 1S0CA 2DYCA 5EIYB 1JI6A 2WBKA 1WMFA 2W9XA 1XU1A 1N3QA 2VZPA 1MS5A 2DBIA 1LNSA 4V2WA 2RHPA 1H1AA 1NCRA 2VQAA 2WNEA 1HV0A 1A34A 4EZHA 5CVRA 1JTZX 4M00A 1DQ4A 4WM8B 5JSOA 1UZVA 1HQNA 1J3QA 5JAXA 2BZDA 1BHGA 3DV8A 3VDAA 4PI0A 3KMHA 1HB2A 1UY4A 2IXKA 1RYYA 1Y43B 5EQUA 4ATFA 4QQ2A 4JGYC 1CZSA 4YG6A 1QU0A 2D3SA 4MXVA 3PURA 1NLQA 4NPMA 2HYKA 1RUC3 4JCKA 3ACFA 1ULEA 3HJRA 1NZIA 4NE9A 3SITA 2PXJA 2A73B 3TN93 3U1XA 4HL0A 4CVUA 3DYMA 1AR62 1N1YA 4QGLA 1L7LA 2B4KA 2GNBA 2R061 3OBAA 4LBOA 3RSJA 3VHOA 4CDQC 2R1BA 1J3PA 1PGW1 1GP5A 1LHUA 2EXHA 4P14A 1DZTA 2AYHA 1PZ8A 2DU0A 4R9DA 3THPA 1X50A 3VBFB 3WNKA 4AAPA 4ASMB 4QU1A 3ZSJA 1ZBA3 1IKPA 4LK6A 1AL0G 2PHXA 2QTWB 1ZBE3 1AR82 1ZRIA 2VOWA 3N9PA 4HVOA 4BE3A 1YLLA 1XYNA 3CBNA 4GD4A 4QM8A 3WDVA 4CP1A 3VZNA 2YGLA 4GWIA 4RS5A 1QJX2 5FP9A 3QCWA 3RYPA 2ZHMA 4CCLA 4BQXA 4V1PA 4J6GA 4CEYC 2JICA 2RVAA 2MEV1 2XQXA 4URTA 3W5NA 1W9YA 4DRRA 2BV4A 2FZ2A 1OHFA 3ZFFC 2OVUA 5BNOB 1WZXA 2I2SA 2WFF3 4OZXA 3GF6A 5LEJA 2BNOA 3LKJA 2ZGPA 1JYTA 4ZU4A 3IKWA 2ZJCA 1AR63 3N3HA 3O7OA 2W5FA 2WYSA 3E5QA 4QHBA 5IJRA 3O0XA 4C0BA 4C8DA 1O3SA 3HN3A 3KQRA 3NJVA 3SH5A 4QX0A 3IMMA 1L3JA 5LA9A 4D7YA 2E7QA 3MIEA 1U5ZA 2NMNA 3PVEA 4YW4A 1G9DA 3WCSA 3I2OA 3K3NA 1AL22 1QNYA 1WBLA 3W20A 1OQ1A 5J48A 3RQ0A 2HWB1 5I0SA 1RINA 4WVWA 1AYN1 1RXGA 4I01A 2JDKA 3PDQA 4ORFA 1J59A 5C8CC 1MZEA 3ZFFB 2A3YA 5GZFA 3POYA 1CX1A 3CIHA 1JOBA 1S2BA 4IE5A 4XQ4A 1UOBA 4A3ZA 2R1DA 4L0PA 2K46A 4FPEA 5ANQA 3UKNA 1G9BA 2W2IA 4FXKB 4QB6A 3ZXEA 1JZ4A 1DQ2A 4TZDA 4YVSA 4JGZA 2B8MA 1DGLA 1BEV1 1OQEA 3JD73 4FOQA 1HB3A 1HV1A 5FWJA 2W1UA 1H6XA 3BIWE 1S4CA 2WWUA 2JWPA 4DINB 3BUCA 1LU1A 4AXOA 4CCEA 4XUTA 3H1WA 4CRQA 5T5OA 4L9BA 1UU5A 3WF3A 4CPBD 4FP3A 1WBFA 3GM8A 1GMMA 2OZ6A 1PX4A 3AYAA 4LLOA 4Q1RA 4DY3A 1KJLA 4LEJA 2ET7A 3I3DA 4C1XA 3QH7A 2MHFA 3OPZA 2VJXA 2P3KA 1SLAA 4IV1A 4AG4A 3SEEA 3VBUA 1EAH3 4P02B 4XQDA 1COV3 2FZ1A 3FHQA 1L7RA 3SNMA 2CNAA 3D0JA 4HKWA 1HRI1 2BOJA 2N7GA 4ZKTB 1UY1A 1VBA1 1W99A 4GH4A 4FPOB 3B9CA 3NNJA 4HPKB 2NZ9A 5FYBA 2IXIA 2IVJA 3C8XA 4DB5A 1X36A 5FPXA 4XFHA 1F4AA 2XONA 3ACHA 2OIIA 2GU9A 3FLTA 4CDUC 2LM3A 5J09A 1DCSA 2EA7A 2YFUA 2QUOA 2Y33A 4M3CA 3RG0A 4E2SA 1N3OA 3UYJA 4LXLA 4S2FA 2YROA 5IVBA 2ADDA 4P9LA 2W39A 5FBJA 1NA1A 3J7LA 4NHMA 1ACCA 4AEDC 2KD7A 2CTVA 1Q8PA 1UOFA 2FDIA 1OOPC 4OI1A 2UY9A 5FZ3A 3BCWA 4HKOA 2VMIA 4NHXA 5FLJA 3VV1A 1FMD1 2RDQA 1DQ0A 1SCSA 3ILRA 3KCXA 4LA3A 1FOD1 2CGOA 3K4ZA 1WD4A 5CEHA 5EXOA 3FMGA 1MEC1 3ILNA 5C4WA 2RS32 3NO8A 3ZKYA 3HN1A 4FOVA 1FYUA 4KGQA 1NCQB 1VBA2 3EYPA 5BNOA 3LA7A 4R9CA 4IGPA 1VBD3 3WP3A 2EICA 3OEBA 3VD7A 4P9JA 2HEWF 2Z5WA 4XW3A 5CFCA 3FLRA 1W9FA 4I09A 3ZM8A 4P5HA 1VB2A 2FCVA 4MH0E 1MQTC 2XBO2 3AKTA 2A1XA 4D7SA 3TYJA 1OOPA 1AYM3 2XBO1 5CFDC 1N3PA 1S2KA 1W8OA 3U10A 1NA1B 3NJXA 1MS3A 3ZLIA 4WM7B 4L8QA 2OPWA 2VZVA 4Q27A 3C7OA 5LBBA 1C57A 3TB0A 2GNDA 5LATA 1O3RA 3PU3A 4AVVA 1XJAA 2D6KA 4ZPIA 2W1QA 3NV1A 1XSQA 1BMV2 3RWNA 4OUSA 3HBZA 1KDMA 2ID4A 3M7AA 1YQ6A 4QX7A 3RFRA 1ENRA 4IE4A 1EV11 1W9WA 2Q0AA 2TNFA 3U37A 1PM7A 1LOCA 2C9AA 2JKXA 4FSJA 2G9ZA 2PHWA 4N7IA 1R081 1LECA 1R1A1 1O3TA 2VZTA 2XVGA 4YZ1A 3ITQA 1CWPA 3O0WA 4ATEA 5AVAA 3ZKUA 5L7OC 1QJZA 2HWD2 4LOTA 2ENRA 4G3YC 4MGKE 1AXZA 2HWF1 5A7SA 3APBA 1TMF3 2ADEA 4XCBA 4H2AA 2H0BA 5IW0A 4YW2A 1FV3A 1J1TA 4QKBA 2PTMA 2VVFA 3N9NA 4HOOA 4ZY9A 2PHRA 1QNWA 1XNCA 4RGAA 2HBTA 4XFAA 3IAQA 2A7AA 3LA3A 4BMEA 1JUIA 1RITA 5A3NA 2ZTNA 3N9QA 2ZOEB 3P5BA 1LEMA 3L9JT 5FP8A 2ILMA 1TNFA 1UX7A 1MZ5A 4AVTA 1PGL1 2X53S 3WXPA 1W0PA 2PLV3 3PTYA 4AVAA 4QMAA 5HCHA 2ZXQA 3OB8A 4LA2A 1AYN2 2PFWA 1VRH2 3IAPA 3MW4A 3IPVA 4RGKA 1CGPA 1C8M3 1W6MA 3C7FA 3SCGA 1K5MC 1TZOA 1UY3A 2J7MA 5CBLA 4QU2A 4XF9A 2QQPA 3BTXA 3K48A 4YG3A 2C5DA 2JD4A 1PMJX 1UKGA 3IIAA 4LKEA 1YFXA 3B93A 3INAA 2RS52 5ACA1 3WDUA 4H3WA 1D7PM 3ZSKA 4JKMA 1PK6C 1UMHA 3U78A 2XL7A 1E5RA 1K5JA 2RDRA 2WZ8A 3NKTA 5FZIA 3U4XA 1BLZA 2ZEZA 3V0AB 3OBZA 2VUDA 4KL1A 4YZ4A 4QX5A 3CF6E 3JQXA 2GP3A 1XPWA 3ZR6A 4X8PA 3MO4A 4YZ2A 1LRHA 1IHMA 3TEZA 3LEGA 3JUUA 2LW8A 1R092 1R083 2X5IA 4B1MA 2OQ7A 5CFCC 3WZ1A 5JXJA 2IVIB 3MF6A 1LOAA 4XVHA 2OKXA 2XLFA 3WUCA 2OUJA 2ZPXA 1OI6A 1U0AA 2YU2A 1PO13 2JXAA 4CUCA 1EY2A 1ULOA 3AP6A 1HXS2 4OHXA 1IS6A 3BI3A 2W0XA 1KD7A 2A6YA 5E16A 5A3TA 2GH8A 5APAA 3ZXGA 3ES1A 1IKQA 2XG3A 2VTXJ 4LE3A 2A71A 3WP4A 2ARAA 1POV1 1JHNA 3OEAA 3TN92 4CU9A 3CL1A 3U0ZA 2JG8C 1FI2A 3WT3A 3R4SA 3C7HA 4O9EA 4URAA 2B42B 2WFPA 3ZXJA 2B45X 2VECA 4Q4Y3 4B4QA 3UGGA 4NO4A 2BGCA 1ZBA2 2VAUA 2QQKA 1NLRA 2HJIA 5FPVA 4BK5A 4DOUA 3SISA 5JOXA 3WP5A 2YPDA 5KHGA 4QHOA 4AHWA 1XBFA 4AVBA 2PQQA 5JZGC 3L2YA 1W04A 1VBB2 3FX3A 3LSEA 4HONA 1VMFA 3AB0A 2WNVA 3ALQA 3M8LA 2VOKA 4Q8KA 4BQWA 1YCIA 3J26N 1VBE3 2MEV2 3MPPG 4FQZA 1NG0A 1DZQA 2PLV1 4AR2A 2VL4A 2PLV2 1HXS3 2RR13 4K8RB 4LKDA 1NY72 4H14A 2BOIA 3RYRA 5C70A 2JDHA 1UZYA 5FPZA 4I0AA 2ZBJA 4K1ZA 1VB4A 4ASLA 1SZBA 3AXEA 4R4ZA 4GULA 1S0FA 4YVWB 3KD4A 3OUIA 1RB8G 3C2UA 5IVVA 1N1VA 1UZZA 1BCXA 1ZZ8A 3ZYBA 4QAWA 3O1VA 3A0KA 1CN1A 1NE6A 2JEMA 4PIZA 5H9RA 5I93A 5LRSA 1D4VB 4LORA 2A6XA 3V0AA 3A22A 2HWF3 4AEKA 5DZFA 3MLLA 5LBFA 1KFXL 1O4ZA 4RGGA 4QXCA 5JXGA 1AL21 1MQTA 3OGGA 1W28A 3H8OA 1O3QA 1OKOA 2G4IA 5FY8A 3B02A 1R1A3 2X5IB 5FZLA 3FJSA 2XH6A 3T4HB 1COV2 1AJKA 5A80A 4A7ZA 3ZFEB 3KB5A 4LHKA 3Q9OA 4XFIA 1GQPA 4KWLA 3NNMA 1VRBA 3HVDA 2E6VA 5JIUA 2B7YA 1VBC2 2DCJA 2WC2A 3VHNA 1D2QA 2JE8A 1K12A 4FAHA 2TBVA 4W4ZA 4E8DA 3WF2A 4L11A 5FBZA 4Q0VA 4QDRA 2V73A 1XYPA 5C71A 2OT7A 4YGBA 4ASKA 4CA9A 1CPMA 2ETEA 4A4AA 5ABJB 3WINE 1ASJ3 3OGJA 4AEDA 5JSRA 3U07A 2WINB 5LBCA 2QFEA 1BK0A 2WZEA 2H0VA 4XDQA 4LKFA 3WP6A 2DTWA 2R072 3O1UA 1A6CA 1H2NA 1QJU2 1UU6A 1SFNA 2R0FA 1SMVA 1RUF3 3VD3A 1OPMA 5CYYA 4E4SA 3E6CC 4Q4W3 2OXBA 4Z92B 1DQ5A 5FXZA 3UJOA 2FCTA 5CAZA 2XJRA 4RHV2 1K45A 1URXA 3LCPA 2NQYA 1YFWA 4GB32 2R042 1ZZ7A 3MIDA 4XJ8A 1BZWA 4K8FA 4GH4C 2VZQA 4CCJA 2XXZA 3Q8EA 4D6QA 5FZKA 1O91A 2CDPA 1OMIA 4IV3C 4LE4A 2AENA 3GDBA 4JRAA 3LIHA 5FO9B 3BPZA 2OW4A 4FFIA 3T1MA 1QH6A 3VN4A 3W5MA 2XPJA 4PIXA 1I9RA 4OUEA 4NRPA 4WBBA 4XE9A 1REFA 2K2SA 1F2NA 4HFSA 4C91A 2VCCA 5H9QA 3KS7A 4AI9A 3SC7X 1UY2A 3O5SA 1SBFA 1TME1 1S0DA 4CEWB 4AI8A 2I74A 1OLQA 3NJZA 3WVJA 2UURA 3ZSMA 1ZZBA 3IB3A 4DS0A 5FTTC 3ZXAC 5BNNB 2J1EA 1UXXX 2XUEA 2D6NA 5L9VA 2VNRA 4Y5Z0 3OPTA 1WLCA 1GZWA 3VBRC 1DGWA 1KGYA 2AACA 2BERA 3DXTA 1XXNA 4QHZA 2PAKA 2VBPA 4JGYB 4ZZ8A 1W3XA 2R062 2R0HA 1MR5A 2PQSA 2VCAA 5CISA 1XNBA 1AX2A 2B9UA 1QIQA 1FNYA 3OGVA 4MGIE 5ANNA 3VLBB 1JZ5A 2PHDA 2WNVC 2JX9A 3OG2A 4C1WA 1NCRC 2QQMA 1D4M2 4ZS3A 4RR3C 1XSRA 4Y5SA 1QHDA 2V5YA 4YW1A 5FYTA 5C5UA 4BQ1A 1YO8A 2FMYA 1I1EA 1HW5A 2JIJA 3X29B 4Y24A 5EV7A 1UWWA 4QXHA 1KRIA 3IT8A 1S0EA 2ZS6B 4AI3A 2A6ZA 2VNGA 1MVEA 2WAOA 4PQ9A 5FZ0A 3RWKX 4CTEA 2C1FA 3ECQA 2XHNA 1UYYA 2WZR2 3FL7A 4RHV3 2ZAAA 3AP5A 2ES3A 1BXHA 4AGGA 2ZGTA 3T4VA 1W6OA 3B7MA 3KT1A 5GLWA 2LUWA 2GZWA 3PHMA 4JTNA 4DUXA 4NIIA 3MUY1 5D8AB 4RD7A 4EN0A 1SPPB 3ZN5A 1OH3A 2ZX4A 2XVKA 1EUTA 4E4HA 3NRUA 2JG9B 3WR0A 3WQBA 2GC3A 3M3QA 5FUPA 5FPLA 3RZGA 3SQOA 3PU8A 4PI2A 1GR3A 1AHSA 5IUQA 1AR92 2PHUA 2Q8DA 5A32A 4BK4A 1TQ5A 1AR91 1Q8SA 3A23A 1OSGA 1VAKA 5F2SA 3UK9A 3H3UA 1RIRA 3ZXKA 3LF7A 4GQ7A 2WNUC 4L97A 5LK5A 4CDQA 5BNPC 1REDA 1ULCA 3W9AA 4K20A 1G86A 4PLNA 3E5XA 3VBSA 4JKLA 4LBMA 3WF1A 1FAYA 3LSDA 3OCPA 4YW7A 5CA6A 2DF7A 2ZHLA 3RPQA 1CAXB 1AYM1 4A6OA 4D69A 2W87A 3RYKA 3HQUA 3J7MA 2FBEA 3BYWA 4TWTA 2Q8CA 1OA4A 4HG6B 4HPKA 4LJHA 3SH4A 4CCNA 1V6NA 5BY5A 1MZ6A 4GH4B 5JSPA 1HXS1 3K75B 1E5SA 2RS13 2E9QA 2VE1A 4DO0A 4HKLA 4EWAA 5EP9A 2I45A 3GZAA 1SDDB 4DNYA 4IEOA 1SFYA 1W03A 4I0BA 3OOXA 5FIXA 2HEYF 4RHV1 2NLRA 1OBNA 3BGAA 3DYPA 1FMD3 4M4RA 4XBLA 4O61A 3EHKA 1W8UA 5T3NA 5FZDA 4GWNA 4KG8A 5L7OB 3A4UA 3AC0A 4UFKA 3BPSA 1JMUB 4LBJA 4IESA 1W2NA 5ABJC 1H2MA 5LB6A 4NIGA 1YI9A 2WNOA 3I54A 5F39A 1CESA 2PHTA 2VTXA 3IDBB 3P1IA 1W2UA 4CCKA 3S5AA 4PLOA 4KG0A 5DPNA 1WWYA 3LB9A 1DF0A 1GV9A 2VVEA 3I3BA 3ZFEC 3M3EA 2LRPA 3I2FA 4I30A 2GC1A 4LBQA 2WO3A 4YFWA 1CIYA 1GOHA 4HXCA 4L99A 2CHHA 4FPKA 4R9BA 1COV1 3ZDSA 2Z42A 2RS11 2LTNA 5FYYA 4YPJA 3POSA 2XJUA 4META 1C5IA 5EJ3A 4A44A 4AI1A 2A3WA 1H2KA 4XF3A 1UNBA 3I59A 1DFQA 5C5TA 1MQTB 1WCKA 4B3NA 4ARYA 4GALA 1V6IA 1OPOA 4H7MA 1V00A 5CFDA 4GMP1 3HR9A 1HRI2 4Z1VA 1YC61 4I02A 5D2AA 5DUUA 1AXKA 1C3HA 1TVGA 1E57A 2HWD1 2F4LA 3HNMA 1IGOA 1NLSA 1YXWA 5A7OA 4EN9B 2SLIA 1WMEA 5IK7A 2VBDA 5F5AA 3M2MA 3WQ7A 1RUG1 4N53B 3H3ZA 3TN91 4JKKA 1XNTA 5FDBA 1OLMA 2YGMA 2PHFA 3AM2A 4N7UA 4UFMA 5FQ0B 5FY7A 4Y1YA 4CUBA 1DGWX 1LODA 4RQPC 5JZGB 2CWSA 2IXJA 3VZKA 1LENA 3DCQA 4LBQD 3JB4C 5IAVA 4LKSA 3AP7A 3AP4A 4G4FA 1OURA 1AR81 2MPFA 1VBD1 4Q2FA 4UWDA 3Q8AA 5IYYA 3GZEA 4P9WA 4TXWA 1GZTA 5HBAA 3W21A 3WLUA 5BYNA 1LCLA 2GP5A 2VZUA 2V4AA 4INDA 2JG8B 1F5JA 4DQAA 1CAXA 4QX1A 3S0MA 3A0NA 4ZHNA 1K5MB 2JDNA 2Q4SA 4QQHA 4YARA 2MNGA 1U5YA 4XJUA 5I0DA 4QQOA 3LAGA 1O7FA 2BGOA 4XXAA 4W6WA 1LU2A 3ZN6B 4DXSA 1ENSA 5KWRA 3A7QA 4EN6B 3UV9A 4BQ4A 4XEZA 2CSGA 5JXIA 5JUVA 1UO9A 4QKNA 1FXZA 2BNNA 1YEWA 5A6YA 1WMDA 3BU7A 3DYOA 2VZ3A 4MGQA 1QOOA 2C26A 2BU9A 1UPSA 4JV4A 5GZDA 3T0DA 5IATA 1G9FA 5JMOA 3POEA 1AL23 1OA2A 5C3PA 3QOPA 1TME2 3CJIA 4XTMA 4M3CF 3IDEA 3NAPC 3AKPA 2O8OA 2VZ1A 2Q1MA 5BPXA 1H9WA 1U12A 4EN8B 1UPIA 4UW4A 1HB1A 3PUSA 4XAEA 4OI0A 4XMAA 1H8TC 5K7PA 1QJFA 3I7DA 1GBGA 2VCBA 3J9SA 4TSVA 2WO7A 3UKVA 3MZHA 1SBDA 1GQHA 1Y4WA 1OD5A 2WFF2 4P9XA 5A6ZA 1SFPA 5F3EA 2W95A 1TEIA 2D6LX 1RUD1 2VGDA 3LFIA 4UOJA 4YW6A 2XOMA 2VH9A 3BB6A 2WAAA 3FBMA 3RDIA 3VHPA 4COUA 3KZ4C 4WM7C 1NA1C 4M0HA 4XF1A 3FE5A 1QH7A 5FO7B 2K0GA 3H8UA 2V5DA 3GZTB 4MZUA 4IEXA 4QKFA 4M4PA 5FY9A 2WZPP 4ES8A 4FOWA 2DCZA 3J8F2 5FREA 3WNOA 5J37A 1ND2A 2JJ6A 1C8M1 4BMBA 4DEQA 1W9SA 1EAH2 4N9IA 1GOGA 2HWE1 5A7WB 3TNQA 1PNFA 1ZM1A 3UETA 2ZGMA 3M4FA 1YUDA 4Q4Y1 1JH5A 3WY6A 2RS51 4OHZA 5F9TA 1WD3A 3RZKA 3I3EA 1UZWA 5IHRA 4IDZA 3HAGA 2YB7A 5GJ6A 1GZCA 1NOVA 3BALA 3KF5A 2BYVE 1F15A 4YM0A 5T5JA 3TWIA 3WDXA 3PL0A 5JZGA 4IETA 4LQRA 1EV13 4NUBA 1WA4A 3WOGA 2R30A 5DZGA 2QQWA 3DKWA 3F95A 2UU8A 5AVPA 3T0AA 2PAMA 1YQ5A 2JG8A 3M1HA 2VW2A 4QPIC 3WW2A 2JG9C 4ZONA 1A8DA 1DP0A 4AQSA 1SACA 4DXRA 3ZYJB 3ZIWA 1O8SA 4AI0A 5CADA 1GWKA 4XHBA 3KCYA 4QT6A 4UBGA 3VBUB 4BU2A 2A6VA 4WZCA 5BV6A 2HWB2 3D8CA 3PNAA 2YDEA 3H1MA 2W91A 3HD8B 1RJ8A 4QDSA 2JDYA 1ZBA1 2XJSA 3LPFA 5BUVA 1P8JA 3R4UA 1V6LA 4FI9A 5FY5A 2JD9A 3OUHA 1AUYA 2OZJA 1UX6A 5FY1A 1OQDA 4G9SB 1AR93 2JENA 2P17A 5T52A 5DUXA 3ELNA 1HN1A 4NHLA 3MUZ1 3MICA 1GNHA 3CEWA 4D6RA 5LA1A 2EIEA 4EYUA 2QKDA 1HB4A 2K9ZA 3HMYA 4XDPA 2HYXA 2QVSB 1SLBA 3I59B 3NNLA 3VZLA 5F1RA 5JPMB 4XAAA 4YLZA 5FZAA 5FZ1A 1MS0A 3U11A 3USUA 4O7XA 5IVEA 1PO23 2IZWA 2F17A 2FDKA 3OY8A 5J36A 2JECA 1JZ6A 3H9AA 3JBG3 3CJXA 4MLOA 1V6JA 1AR61 2GC2A 2PA7A 4FFHA 4HK8A 4QX8A 3UL2A 2D7FA 2EXJA 3VDBA 2HWB3 4FFGA 4LO6B 1W8NA 5E1RA 4RA0A 3FUQA 4L92A 5C8CB 1A78A 1W6NA 4JGZB 1PHMA 1VBA3 3ZYRA 3CJIC 4CPBA 2VPVA 3FHIB 4HN0A 2VVDA 4P9IA 1V9U1 4XPVA 2FDGA 4UAPA 5FK7A 1CZTA 4IEWA 2QQJA 4GXLA 4BM8A 3VUOA 2VQ0A 3IWZA 4FPGA 5I8SA 1DIWA 4N8MA 5IK4A 1LOFA 5T54A 1HQWA 2ATFA 3MHZA 1PK6B 4KBZA 1D0HA 3VBOC 2X09A 1J58A 1PIV1 2DBNA 2CAUA 4PDWC 3ROUA 2XKPA 4CCDA 4MGYE 4TTGA 1VMHA 3OD0A 4CDUA 4IL7A 4ZS2A 3HBKA 4Q8LA 1G9CA 4MGZE 1VAVA 5FZHA 1CPNA 3FLPA 2Y38A 1RGSA 1MVQA 1VALA 2OA2A 1ZZCA 2VMEA 1ULGA 2Z69A 2E26A 3FN9A 2LROA 3KV6A 4MSVA 3QBQA 2GSYA 2QZ3A 2ZAHA 3ZXFA 2FDHA 1CR7A 2YFZA 2QNKA 4LHSA 1PX3A 3NW4A 4CEYB 5KXEA 3BKZA 4MX3A 2YC0A 2Z4FA 3POFA 2ARBA 4FXGB 2RS53 2HWC2 3UNPA 4DXTA 4AHZA 3VBRA 5FZ8A 4A42A 5KXCA 2YHJA 3GJBA 1IQAA 3ACIA 4LO7A 1O4TA 3ENRA 1PGL2 4OI2A 1RVF2 1HN0A 3BOWA 4LR4A 4TLFA 3UGHA 1F4HA 3D5OA 1ONAA 1PIV2 2W92A 1RUH3 1LOBA 2P34A 4N43C 3ATGA 5FYMA 1OXCA 3OGRA 3ZXDA 4MADA 2RR11 1POV0 3IZOA 5CZKA 5FMBA 1PO22 4P00B 1UN1A 3H1YA 3FWEA 2Y64A 3KHBA 2AREA 5HCBA 2OYZA 3SKJE 1AYN3 4CDXB 5HV4A 1HRV3 3NAPA 4UXAA 2XKOA 2WT0A 3PIJA 1LHVA 3KCCA 3MYXA 4B1LA 2YXSA 5FZ7A 4BQ2A 4CCCA 4CU8A 4A41A 5DXDA 3P3NA 1XC6A 2AR6A 4KGGA 5KR7A 1J84A 3KF3A 2VMGA 1JZ2A 5JOZA 4PF5A 3R0RA 2GNMA 3CLPA 2WSUA 1PVC2 2JDZA 2R49A 3LDBA 4MHUA 4WZFA 2EXIA 2IUWA 5HXVA 4YM3A 1XB9A 3LDKA 1NCQC 2DVGA 4IE6A 2Y6FA 3D6EA 1CJDA 3ZFFA 2EAAA 1GQGA 2O14A 3AXDA 3GCXA 4XFFA 1W6OB 1OUXA 3AZWA 1F9KA 4W6XA 1CQ9A 5FYSA 4AFCA 1Y9QA 5DDJ3 2ZA9A 1LB2A 5L9RA 2WQ4A 1T6GC 2EIBA 3LD8A 3GYDA 2OQ6A 3SCFA 5FQ0A 2DUQA 5FP4A 2ARXA 2QDNA 4GB31 4ARXA 4CYDA 1Q56A 3W59A 3PVNA 4KBBA 4CU7A 3BVCA 3N7LA 4XFGA 1EPWA 3ZX7A 1DLLA 2JDMA 3MLJA 1D0GA 1LGCA 3HQRA 5F8PA 1AR83 5JMCA 4HVQA 3ZYGA 3O1TA 4Y22B 2WR9A 1KEXA 2XGXA 1AVBA 3K2OA 1CAVB 1K42A 1MEC3 1WW7A 4HT1T 1QWRA 1R1A2 1KFUL 4QWNA 3WF4A 4YGDA 1NYWA 3I2JA 1KS4A 4K40A 4TLGA 3WX5A 4FTEA 3AVSA 1C8M2 4AZZA 1VE0A 2AUYA 3LDRA 4GWJA 4XIKA 2C9KA 2DVBA 1RUC2 4QPYA 5EJ1B 1OFNA 3N9OA 4ZU7A 2E7AA 1Q43A 4LOSA 4PCRA 2OX0A 1ZRRA 2O1QA 3VDCA 4XJWA 1GWLA 4CUGA 2R071 2ET1A 1PM4A 1BMV1 1BBT1 1RUF2 2HH9A 3UGFA 5I8YA 2Y26A 5C33A 2ZGKA 1LHNA 1X9PA 4I2OA 2XMLA 1Y7BA 1QMJA 3RRDA 1AR71 1CAWA 3AMPA 5FY4A 3F2ZA 1AR72 2J1UA 1UMZA 1V0AA 1S0BA 2X8KA 1QY4A 1UF2C 1LEDA 4LIVA 1RXFA 1QJY2 3ZPYA 5C4WB 2FDFA 2Y8KA 1D4M1 5F5IA 3EB7A 4E8CA 4JHZA 3GHNA 2Q30A 4NHKA 1Y3TA 5JOYA 3C7GA 4JZRA 4Q26A 4LO4B 2ZKNA 4J25A 2EIGA 5FXVA 2ZX3A 5IVYA 3OUJA 3GHMA 5FKBA 2RS12 1YNAA 2UWAA 3D3AA 3AZZA 3ABZA 1YFUA 4XUOA 1FOD2 1QJEA 5DAWA 4N43B 2YZ4A 1CD3G 1O59A 4UW6A 3V65A 1B35A 1IPSA 4YW3A 3H8RA 4X6QB 3KV9A 2BRTA 3AZYA 1W6QA 3JCIA 1ST8A 4PBOA 1QKQA 3I2IA 3QACA 1MS4A 2TUNA 2ERFA 2XJTA 4DXZA 4ZXKA 1CONA 2Y0IA 4Y4YA 4F7ZA 2VXRA 2ZCWA 2D44A 2IC1A 4FOYA 2Y6GA 1ZZ6A 2IXHA 5LWBA 1AXYA 2R041 3J7HA 3S5QA 3ME2A 1W39A 1W0OA 3VBOB 2WN2A 4BH9A 1VRH3 2VOVA 3OPWA 1ND3C 1WCQA 2BUKA 2RR12 3AMMA 3KWVA 4JGYA 3CZJA 4Q0PA 3MFAA 3IPVB 3LQCA 5FK8A 3RGBA 4GMP0 5FZGA 4COWA 4DUWA 4DIQA 3WF0A 2P3IA 3AJYA 5GKAC 1H30A 2AEZA 1UKRA 4YVWA 1KXGA 4KI5M 5GZCA 4PDWB 2ZGUA 3R6SA 3VL9A 2WNUB 4Q4X1 4QKDA 3TEYA 4GA9A 1C1FA 3DECA 1D4M3 4NRMA 2BBVA 3AKRA 5IK5A 4CEWA 1GYKA 3WCRA 2WT1A 5T50A 1SQ4A 4Y22A 5FUNA 3WUDA 2RMU1 3D82A 4OLLA 3S30A 4DUVA 4AW7A 4EWDA 4NPRA 1XU2A 2BFUL 4BOWA 2RM21 4OULA 4N53C 4Z2AA 2B39A 3WV6A 2WJSA 4CP9A 2B46X 2WWJA 3AYEA 4IGOA 4MGSA 5H9PA 2FD8A 1WKYA 5FPUA 4HETA 4AHXA 2DWRA 1DGRN 1NE4A 2ZKLA 4KWUA 1OH4A 3HEIA 5FV3A 1OF3A 3WEZA 2QQIA 1IG3A 2VZOA 1HIXA 2VNOA 2VR4A 5L73A 4N90A 3ACLA 2YY1A 1UAIA 3MGUA 3KHCA 3PUAA 3WQ1A 1PMHX 1US2A 1FOD3 4BJ0A 5IFTA 5HV0A 2P6HA 2RS31 2QCSB 4KMQA 5T5LA 4KU7A 3I2DA 5A1AA 1GLHA 1FX5A 1HLCA 1UIKA 3FFQA 3MIHA 5K4LA 4CXWA 1NCRB 2LS6A 1AJOA 2HEVF 4HBNA 4EWEA 4PIYA 5LY2A 3WQ0A 3RVHA 5JPNB 2YBPA 3MFCA 4QXBA 5J3UA 4Y26A 2R043 1FPN2 2YC2A 1RUI2 5J1XA 1FPN1 2C0ZA 4XMIA 3WNPA 2A5ZA 3SLIA 3VKLA 3VBHB 3ZVXA 1K5MA 2VBBA 3KVAA 4IXLA 3N7KA 5FYIA 4CE8A 5EYYA 1ENQA 3ZN4A 4AOCA 3MDPA 1G7YA 2P3JA 4QDQA 1RUF1 4UFHA 1C4RA 3MBWA 4YZ5A 2WKKA 4UFIA 5DDJ1 4D3WA 2WQZC 3I49A 1JZ7A 1H9PA 4XUQA 4AHYA 4CDWA 3MI8A 1Q3EA 4MYEA 4GKXA 1YWKA 3DPRC 3AJZA 1C28A 5CKMA 4WV8A 2D5HA 4IEPA 1JBCA 3HPNA 4JDOA 2ZGRA 5D21A 3TAYA 1PIV3 4BA6A 5E8AA 3RJRA 4OFGA 4AWDA 5KHHA 4HMZA 3LOBA 1PGW2 2CY6A 4LUKA 4R52A 5F32A 2L9LA 2J1TA 4IE7A 1RUI1 4WVVA 3WW1A 3H7JA 3O1PA 2V72A 2P1BA 4NAOA 1MS8A 4IV3B 3E6BA 3ASIA 2D6MA 4XHXA 1E5IA 4HANA 3ZXLA 4JVAA 2AC1A 5LW9A 5DN2A 2PHLA 1UOGA 3P3PA 4O9GA 1MZFA 4OYUA 4QQLA 4XABA 4DZGA 4FTSA 3PJYA 3MIGA 4PDWA 4IEZA 4AVCA 3EXUA 3SEPA 3VKNA 2VG9A 5I0RA 1A3KA 3DN7A 3KM5A 5FMDA 3HT1A 1MS9A 1ZBE2 4P5YA 3G6JB 1O5LA 5JI9A 4WM7A 1SLLA 5DAPA 2WQ8A 3DEMA 3KSCA 4HLTA 4Y4RA 3M70A 4Z82A 3TOJA 3ZDVA 1R093 1R082 4QXKA 3IM0A 1QDOA 5B4NA 4XC9A 3ES4A 4LHLA 3WD5A 2RG4A 3I3QA 2E51A 2VNVA 4XF0A 1IOAA 1VBE1 3URFA 3WSOA 4CSWA 5CG9A 4JGZC 2J42A 4XILA 1FPN3 1OF4A 5EFUA 3UKTA 3VKOA 2GMPA 1QQP3 3JBG1 4BYYA 3B69A 2OUHA 1UZ0A 2QJVA 4FVVA 4R4XA 2YMZA 1OFSA 5F5CA 3Q8BA 5FO8B 1H6YA 2BVBA 1JU3A 1W8ZA 3T1LA 4NAMA 1LESA 5L19A 4W8JA 3CU7A 4R9AA 3V0BB 2ZGOA 5LBEA 2X5IC 4HZFA 1MS1A 2J1VA 4TYSA 1ZRDA 3I2GA 2VCMA 3ILFA 4N43A 3MV01 1W2AX 1FT9A 2CYFA 4FPHA 4BHPA 4HK9A 4U2AA 3B94A 2HBUA 1LKNA 1WW5A 2J22A 2RE9A 3LIGA 2CGPA 1VPHA 5A33A 1VBC1 3I8TA 1RUG3 1U5XA 4WVMA 1OVSA 3T30A 3FHAA 4XTPA 4LT5A 3VD9A 1IPKA 3EO6A 3ZPOA 1RUOA 1QJY3 2JDPA 4BXSV 4CDQB 1VBB3 2WNVB 4GJZA 1STMA 5A70A 3FUOA 5K0UB 3LPGA 4K21A 5LY1A 5A7WA 4E27A 1GICA 5SV5A 3DF0A 3HNBM 5AC91 1CAUB 4JDNA 4JHTA 3DL3A 2CU5A 5LA0A 1T2XA 1Z0HA 4Q5OA 4PJYA 3VBUC 2P5BA 4XJAA 2PAEA 2VW0A 4QPIA 4CEYA 3D0SA 1RUE1 4Y1ZA 5C3SA 1VRH1 1HKDA 3GCWA 1GU3A 1BBT3 2E7TA 3HQXA 2JB8A 1W2TA 2HWE2 2A70A 5BNNC 2QDRA 2QQUA 1WLDA 4WVMB 1ODMA 1YQCA 4ZXEA 2ORZA 4Z07A 3UJQA 1V6MA 1YI7A 4OI4A 4OUMA 1FATA 4RQPB 3V56A 1O8PA 3ZFGB 2IXLA 2OS2A 3BOPA 5JIAA 4IV1B 5AFBA 5K0UA 1ENXA 4AYUA 5L7OA 1KQRA 4ITCA 5FYCA 2EIDA 3VZOA 2DFCA 5A7NA 1DZRA 2RS33 5HXMA 1ZYBA 3AK0A 1YJKA 3GBWA 5I91A 1GKBA 1DYPA 4U36A 1POV3 2UYBA 2VW1A 3HT2A 2KR2A 4MUVA 1JYWA 1EP0A 1QQP2 4COZA 1DG6A 1C5HA 3S7IA 4A2UA 5F6KA 2XUMA 3I2HA 4RN5A 3SMHA 4OHVA 2Q1ZB 3V64A 1R1ZA 4UF0A 4Y3OA 5FFOC 1JZ8A 1F5FA 1SDWA 3AMQA 5FUIA 3K3OA 5CFCB 3Q8FA 5CIRA 2VM9A 1JOPA 3PIGA 1BBT2 2YU1A 4FQ4A 4AEMA 1MPXA 4PBPA 5BNPA 2WS92 4NIAA 3AZXA 3T0BA 4PQQA 5JCTA 5FZOB 1X8MA 3USSA 1VMJA 5FY0A 1BJQA 2HWF2 4A6SA 1WW4A 1PK6A 4LITA 1VAMA 2NM1A 4XZUG 3O1SA 4QX2A 1OT5A 1PVXA 2D6OX 3NNFA 3CMGA 1TME3 5DG2A 5GLVA 5F37A
chains in the Genus database with same CATH topology
1OA3A 4Q4X3 4QGNA 3OYWA 2XJQA 3O12A 4N53A 4Y1UA 2GNTA 3LWCA 1YYNA 3VDDB 4XYXA 2RJLA 3FC0A 2XBO3 5FOBB 1N1TA 4GWMA 5H9SA 1UD1A 2DVAA 2WS93 3GNEA 1QOSA 3HIFA 2NYYA 1QJU3 3EBRA 1JUHA 3ZO0B 5ACA3 4Q4V2 4AGVA 4JTOA 2VUJA 1RUNA 4KWJA 1LHWA 1LOGA 2D40A 4Y20B 3VBFC 1VLNA 2VY0A 1PMIA 1WGPA 2IFRA 2R6QA 4QPGA 3KGLA 1G9AA 3ZSEA 1M06G 4GB33 1ZZ9A 2XJVA 1HX6A 1RUD3 1QJX1 4IERA 4I3PA 2DTYA 1YIFA 1ND3A 4A7KA 5AFEA 2G9GA 1RHI2 1LOEA 5GZGA 1QOTA 3VDDA 3ZN6A 3D4KA 4FPFA 1WCSA 2SBAA 1X82A 2D3PA 1VBB1 3S6PA 2D6PA 4IEYA 3VL8A 1UCXA 3OD4A 2ZX1A 1HQLA 2W52A 4S2HA 5FMOL 4AQTA 4Y20A 2FQPA 2WA3A 3MIBA 4JDMA 1HRI3 1AR73 1GANA 5I8TA 1PO12 4H7LA 2GDFA 1IS4A 2BVVA 3PLQA 2CL2A 4LO5B 5D8AC 4J1WA 3VBHC 3IMNA 1H8VA 3J4UH 1SBEA 5CB7A 2XWBB 3OBTA 4NWWA 1KJRA 1RMU3 4NOTA 4E9KA 3V0BA 4BZ4A 1CJPA 5CNAA 2QZ2A 1UIJA 2DVFA 3RI8A 1XNDA 4DRVA 4DPNA 2KA3A 4AEDB 4EJRA 2WSVA 3KT4A 5I0TA 2F4PA 2Q5TA 3OBRA 2YYOA 3WG4A 4Z2WA 4RR3A 4CDUB 1C8NA 3ZFEA 1JOJA 3OY8B 1ULDA 2WWSA 4K9SA 4COVA 5LRRA 1QDCA 4CDXC 2VUAA 2ZX0A 3MF9A 1PZ7A 1ZX5A 3FFZA 4MV2A 3G7DA 4K6BA 2ZGQA 1X8EA 5ABJA 5J98B 4RS5C 4QPIB 4KWKA 4QD2A 2ZMKA 3HWJA 2ZGNA 1WUVA 1Z7S2 5AC93 3K51A 2IXCA 1TMF2 1Q8QA 5A32B 1EV12 1W6PB 5DUWA 3WG3A 3NWKA 1JW6A 4M3CB 5A33B 1FMD2 4CEWC 3RMXA 1RVF3 2JKBA 3MW3A 2GALA 1YRZA 3AX4A 3TBDA 4CDWC 5C6CA 4BLJA 3O0VA 1AZDA 4OHWA 1MACA 4GMP3 4YG0A 3ZFGA 4S2GA 2E53A 2DCTA 3MIFA 4YFZA 1LHOA 3LGRA 3NV4A 3NKGA 4E2GA 5B2GB 2EVXA 4XQWA 2BWCA 4AF9A 4R8HA 1F8VA 3NVCA 4HVRA 3WG2A 1DU3D 4RFT0 2ZHNA 1M4WA 2JE9A 2D98A 1HRV1 4BLIA 4CP2A 1GFF2 1A8MA 1HRV2 4AEJA 4E2QA 1YJLA 5JR7B 3AFKA 1J1LA 4MXWB 4UBHA 2FMDA 5BNPB 3IBMA 3LZZA 2LALA 3VZJA 1GZ9A 1B35B 2HKXA 1RUE2 3AZVA 2IWGB 4I3GA 1B35C 4C90A 1BEV3 3JD71 2EAKA 1XYOA 2WIIB 5CFDB 1QJX3 3WHUA 2D3RA 3C3VA 2YV8A 4EROA 1RJ7A 3B9IA 1DQ6A 2WLQA 4F83A 2JE7A 1RUJ1 5JOWA 1GNZA 1S0JA 2X29A 1ND2B 3JBG2 2HWC1 3MW2A 5DDJ2 5FRAA 3AFGA 3NSTA 1REEA 2EF6A 1QXPA 4FPCA 2DCKA 4W65A 3WHTA 4OHYA 2GC0A 1HDKA 3DUIA 3OJBA 1AF9A 3WW3A 3POWA 1ASJ2 1RC6A 1J3RA 5KHJA 2VMHA 4S2DA 4YNIA 1I5ZA 3PVOA 2RMU3 4CDWB 4SBVA 1RL3A 1ZREA 2ZHKA 4RR3B 1LR5A 4YVWC 1V70A 1CAVA 3WDTA 2ZMNA 1DGRA 4XFBA 4EN7B 3W58A 4H55A 4YW5A 1RUC1 2D43A 5LK7B 1TE1B 5JVVA 2DUOA 2CGNA 4ISRA 1ZBE1 3VBRB 3ZFGC 3JD72 4YGCA 3VZMA 4B4RA 1VJ2A 2H6CA 3RNSA 5K0UC 4MXWA 5A3LA 4Q4Y2 1RUJ3 3LOIA 2I07B 4B7EA 4XXPA 2XJPA 3AYDA 4BPZA 5IK8A 5JLVA 3B00A 1ZRCA 1YIPA 2AGSA 5KXBA 4AQ6A 2XB6C 5KHKA 1NZCA 4Q4X2 1MEC2 2UWCA 1XE8A 1LGNA 4M0NA 5KBFA 3ZMOA 3JZVA 4IV3A 2VOXA 1SCRA 1ZA4A 2NP0A 1DHKB 2OPKA 2CWMA 1ALYA 2WFF1 5K8SA 5HCFA 3SHRA 2V09A 5GLUA 2WS91 4B29A 2D93A 2RM23 2BW8A 1H0BA 4BIFA 5DZEA 3N36A 2NN8A 3QD6A 3AMHA 2CAVA 4XZPA 5A3MA 4AK3A 3B3QE 4Q4W2 1B09A 4YZ3A 1QXJA 4Q4V3 5K9YA 1NY71 1UU4A 1C1LA 4AE2A 3J8F3 1X33A 3VBSB 1I3HA 1S55A 2WZR1 4QPGB 2WZR3 2RJKA 3M3CA 2ZZJA 2R32A 5F6LB 5GALA 1Q8VA 3VBHA 1H8TB 1KITA 4RSUA 1RMU2 5D8AA 2A75A 4L2NA 5JDBA 1WW6A 4Q4V1 1VBC3 1G6NA 5C4WC 3I4IA 4GIQA 4YVSB 3QH6A 1UL9A 5FMOS 2BTVC 4NR1A 3SCHA 1WLWA 4XIOA 4YYOA 5EZWA 2HWE3 4HSJA 2R073 2ZZQA 3KGZA 3DPRB 3ZMNA 4LLFA 5BNNA 2ZGLA 2Y0OA 4WM8A 2ZMLA 4CZSA 2TEPA 1QQP1 4AI2A 1JYCA 5T5PA 3VDDC 1DQ1A 3FBYA 5FAXA 3O14A 4FAGA 2GMEA 5BXXA 1R091 3N7JA 1IPJA 4Q0QA 2Q8OA 4D94A 3JU9A 4YRDA 1LGBA 5TSWA 4QPGC 1RHI1 1NCQA 4XBNA 4KQ7A 4AFDA 1CX4A 1YHFA 1FV2A 1H1IA 2UWBA 1U5IA 5KXDA 4BIOA 4I0WB 2P37A 1IS3A 4FPLA 4CP0A 3E5UA 2UY8A 4WM8C 1JYIA 2XL9A 3ETQA 3VBOA 5C9AA 1QJY1 1LOFC 5C9AB 3PMEA 2ZACA 1F31A 3AKSA 2AH2A 2BEOA 2PYTA 3KLSA 4K1YA 5L36A 1NQDA 3SH3A 4RS5B 3H50A 5J96B 4FP2A 1PNGA 4XBQA 4F3JA 1LTEA 3USUB 1O5UA 1KDKA 3M3IA 1IS5A 1VP6A 2A6WA 4NWVA 1JXNA 1H8TA 5SV8A 5IT6A 1ULFA 3DGTA 3IN9A 4PLMA 5C8CA 1AX1A 4M01A 2WT2A 2BQPA 3RJ2X 4C0HA 2B5HA 4WVZA 1BVP1 1LULA 3RS6A 1DYKA 1XQNA 1W6QB 1DDLA 1RUH1 1V6OA 4IEQA 3M3OA 4LO8A 3GALA 2CV6A 3AMNA 2WA4A 2XWJB 4ISQA 4JC1A 1CVNA 1DBNA 1PGSA 2D97A 1KS5A 5JI7A 1TMF1 3MEPA 4J1XA 4W6YA 3ZSLA 2GAUA 3N4MA 2DURA 5JWPA 1RUD2 4SLIA 2D5FA 3TRSB 4E4DX 2AZ5A 3CO2A 2JG9A 3AKQA 4UW5A 4XF4A 3ZYPA 1APNA 1W6PA 5LEKA 3VKFC 1AYM2 1WLTA 1GSLA 1BKZA 2H6BA 4B4PA 4D7TA 3DPRA 1BEV2 2VULA 1RUE3 2VU9A 5BNQA 4JQRA 4AGRA 2MEV3 1VBE2 1OKQA 3ZIXA 1SEFA 2QE3A 2DUPA 5GLTA 5FCCA 4QM9A 4OVEA 1XRUA 2P2KA 4NN0A 1ND2C 2EXKA 3MLKA 3B01A 4YSFA 5D1IA 1W6NB 2NMOA 3VBSC 1RTVA 2HWC3 4IEUA 4LBKA 1S1AA 3GBGA 1PO21 5F5QA 2RMU2 1UW8A 3VHRA 4AVSA 4XJZA 1V9U3 5GLZA 3B5LB 3NL1A 4ONUA 1RUG2 5GZEA 2XHKA 2KM2A 2XLAA 4P9YA 2Z79A 1PZ9A 3OTFA 5BNOC 4Q1PA 1JN2P 3RI9A 4FPJA 4RL7A 5I0UA 2DFBA 2ZGSA 4K7JA 1VBD2 3H7YA 3NAPB 4DFSA 5J7MA 3QLQA 1X7NA 4Q4W1 4BWOA 4ZU5A 4LBQB 4UW3A 3RMYA 5GM0A 2BFUS 2GH2A 2Z2SB 1AX0A 1OOPB 3PJQA 5CG8A 5CU1A 2PELA 1Z78A 4ES9A 3AP9A 1H4GA 1LJ7A 1XE7A 1QXRA 1RMU1 3AYCA 2EALA 5KHIA 3VGIA 3JQWA 2NPIA 1RVF1 4N9HA 5HCAA 3MPBA 3EQEA 3WNXA 1BK1A 1FNZA 3R4DB 4Q0SA 2R063 3R05A 3FZ3A 3OYWB 4HN1A 4AFMA 3TNPB 1N1SA 1Z7S1 1EYBA 1W6MB 5DUVA 4IV1C 2DV9A 1PVC1 3N35A 1QGLA 1ZVFA 4BCUA 2F6BA 4QQPA 3BODA 2RM22 3VKMA 1BVVA 5KC6A 3N7MA 1YFYA 1V6KA 1V9U2 4RQPA 3RZZA 1TNRA 1SLTA 1CAWB 4Y1VA 4IEVA 3BTAA 4LTAA 5HI0A 4E4ZA 4XETA 1ND3B 4JRLA 2G9FA 3THTA 5FLIA 3E97A 4XJ9A 5KC5A 4CDXA 4MVTA 5DG1A 4QGMA 3KT7A 1NXD1 1VIWB 1Z7S3 5AC92 1XNKA 4LBNA 1EAH1 2GMMA 4FTBA 2O0OA 1S0GA 5C9AC 2DCYA 3S7EA 3T2TA 2R16A 4FCAA 2PN5A 4Q29A 5ACA2 1VR3A 1BYHA 3PMSA 4LUMA 4YM1A 4XOGA 3L2HA 1H4HA 3JB8A 4DY5A 2ZX2A 1Q8OA 4Z8BA 2YPJA 2ZABA 3PVBB 1RHI3 1CAUA 4JAAA 5E89A 4P9GA 1IZ3A 4LHNA 3H0OA 1N47A 4DMIA 1QF3A 4LULA 3WDWA 2XLGA 4AFAA 5EYXA 2BPA2 1OLRA 1Q5OA 3GBFA 5EWSA 4IQPA 1CIWA 4Y1XA 2W08A 1RUJ2 4Q0UA 4KH9A 1O4YA 4NVPA 4AFBA 1NXMA 4B8EA 5FLHA 1QJU1 4X8NA 1GZWB 4YVSC 2DU1A 1G8WA 2DVDA 1BQPA 4AQ2A 2YUEA 2O8QA 3WG1A 4HSLA 1ZNPA 4B7KA 1ASJ1 4X6RB 4FT8A 3NV2A 4FBFA 1WCDJ 4YM2A 5C8WA 4LBLA 3WDYA 4A3XA 2WL1A 3OF1A 2BNMA 3CNAA 1NQJA 4K3UA 4FPYA 2HWD3 4A7YA 4KU8A 1PO11 2WNUA 1ZRFA 3VBFA 5FOJB 5E88A 3ZYIB 2KXLA 1PVC3 2A3XA 5T55A 3EJKA 1I6XA 1H2LA 1RUH2 3ST7A 3NV3A 4YGEA 4F8AA 1SLCA 2FHRA 3CJIB 1SLIA 3GZUC 2XVLA 1D2SA 1RUI3 1S0IA 2W68A 2UYAA 4FO9A 2GN3A 4M3CE 3E6DA 2E63A 1EPZA 1H1MA 3J8F1 2IFWA 2BWAA 4GKYA 3LA2A 3WW4A 2GN7A 2WLPA 3SXWA 4XFCA 3IDCB 4LNVA 4KNCA 4COYA 1S0CA 2DYCA 1WMFA 1XU1A 1N3QA 1MS5A 2RHPA 1H1AA 1NCRA 2VQAA 2WNEA 1HV0A 5CVRA 1JTZX 4M00A 1DQ4A 4WM8B 5JSOA 1HQNA 1J3QA 5JAXA 3DV8A 3KMHA 2IXKA 1Y43B 4ATFA 4QQ2A 4JGYC 4YG6A 1QU0A 2D3SA 4MXVA 2HYKA 1RUC3 4JCKA 1ULEA 3SITA 3TN93 2A73B 4HL0A 1AR62 1N1YA 4QGLA 2GNBA 2R061 3VHOA 4LBOA 3RSJA 4CDQC 2R1BA 1J3PA 1PGW1 1LHUA 4R9DA 2EXHA 4P14A 1DZTA 2AYHA 1PZ8A 2DU0A 3THPA 1X50A 3VBFB 4ASMB 3ZSJA 1ZBA3 1IKPA 1AL0G 2PHXA 1ZBE3 1AR82 2VOWA 4HVOA 4BE3A 1YLLA 1XYNA 4QM8A 3WDVA 4CP1A 3VZNA 2YGLA 4RS5A 1QJX2 3QCWA 3RYPA 2ZHMA 4V1PA 4J6GA 4CEYC 2JICA 2MEV1 4URTA 4DRRA 2FZ2A 1OHFA 3ZFFC 2OVUA 5BNOB 2I2SA 2WFF3 4OZXA 5LEJA 3GF6A 2BNOA 3LKJA 2ZGPA 4ZU4A 3IKWA 2ZJCA 1AR63 3N3HA 3O7OA 3E5QA 4QHBA 4C0BA 3O0XA 1O3SA 3KQRA 3SH5A 1L3JA 4D7YA 2E7QA 3MIEA 1U5ZA 2NMNA 3PVEA 4YW4A 1G9DA 3WCSA 1AL22 1QNYA 1WBLA 1OQ1A 5J48A 3RQ0A 2HWB1 5I0SA 1RINA 4WVWA 1AYN1 4I01A 4ORFA 1J59A 5C8CC 1MZEA 3ZFFB 2A3YA 5GZFA 3POYA 1S2BA 4XQ4A 2R1DA 4FPEA 3UKNA 1G9BA 4FXKB 3ZXEA 1DQ2A 4TZDA 4YVSA 4JGZA 2B8MA 1DGLA 1BEV1 1OQEA 3JD73 4FOQA 1HV1A 3BIWE 4DINB 1LU1A 4AXOA 3H1WA 4CRQA 5T5OA 4L9BA 1UU5A 4FP3A 1WBFA 2OZ6A 3AYAA 4Q1RA 4LLOA 4DY3A 1KJLA 4LEJA 2ET7A 4C1XA 3QH7A 2MHFA 3OPZA 2P3KA 1SLAA 4IV1A 4AG4A 3VBUA 1EAH3 4XQDA 1COV3 2FZ1A 3SNMA 4ZKTB 2CNAA 3D0JA 4HKWA 1HRI1 2N7GA 1VBA1 4GH4A 4FPOB 3B9CA 4HPKB 2NZ9A 2IXIA 4DB5A 1X36A 5FPXA 4XFHA 4CDUC 3FLTA 5J09A 2OIIA 2GU9A 2LM3A 2EA7A 2QUOA 4M3CA 3RG0A 4E2SA 1N3OA 4S2FA 2YROA 4P9LA 2W39A 1NA1A 4NHMA 4AEDC 2CTVA 1Q8PA 1OOPC 4OI1A 2UY9A 3BCWA 4HKOA 2VMIA 5FLJA 3VV1A 1FMD1