2DVDA

Crystal structure of peanut lectin gal-alpha-1,3-gal complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvdA00
1AJKA 1IS4A 2R0HA 1G8WA 5H9PA 2YY1A 5F9TA 2DVFA 2ZGKA 3INAA 1GNHA 3I8TA 2VW0A 2D6KA 3O12A 3N7MA 3WHTA 4FPJA 2AENA 4GKXA 1V6MA 1WLCA 1S0CA 4YZ4A 3AP7A 2AUYA 2DVGA 3UJOA 5EYYA 3QLQA 4XJWA 2AREA 4LBNA 4Y20A 2CWSA 2A3XA 1LEMA 2JJ6A 1S0IA 2A3YA 4Q1RA 4AGGA 3VKOA 3RMXA 3AYDA 2ZGRA 4AVVA 4BQ1A 1Q8VA 4R9AA 2VU9A 4IQPA 2DTWA 3M3QA 1Q8QA 3N7LA 2JE9A 2JECA 1QU0A 1G9FA 5H9SA 3M3CA 2JKBA 4Q2FA 5EYXA 2VH9A 4FOWA 4XZPA 2GDFA 2EXJA 1BXHA 3POWA 3ILNA 2E7QA 4XJZA 3MPPG 2CL2A 1LHNA 2G4IA 1GLHA 1G9CA 4TZDA 1XQNA 4ISQA 2YZ4A 4P14A 3FLPA 4M3CF 4DRRA 1KQRA 3SNMA 1N3PA 4UW6A 1SBEA 1N3QA 2D3SA 4XDQA 5JVVA 1DZQA 1MS0A 3ZXKA 3VUOA 1G86A 3WOGA 4DFSA 1YO8A 1GSLA 1LHOA 4ITCA 4XHXA 5E88A 1YIFA 2WJSA 2DUQA 1SBFA 1X50A 2D7FA 2ZACA 4XXAA 3AXDA 4YW3A 2A6XA 1SLTA 5E89A 5BYNA 1N1SA 1H30A 1Z0HA 3OJBA 2VW1A 4XBNA 3WDWA 4LBJA 4AVSA 1W6PB 2A6VA 2DURA 2GNMA 1GZWA 4K1ZA 4CZSA 3ZXEA 2TEPA 2DUOA 2VXRA 1A3KA 1QOOA 3VKMA 3PVNA 2E6VA 1YYNA 4I30A 3N35A 2PELA 3OBRA 2PHFA 1R1ZA 2P2KA 3MW4A 5JDBA 3V65A 3PJQA 4M00A 2W52A 1VLNA 1JUIA 1OKQA 1OQ1A 2P37A 1ENQA 1LULA 1G9AA 1G7YA 3M3OA 3MW3A 2R0FA 4FPKA 5DG1A 3WV6A 3HR9A 1O4ZA 1DBNA 3WG1A 2NP0A 1UPSA 2JDZA 1IKQA 1MVEA 3IPVA 3JU9A 1V6NA 4NO4A 3M3EA 1Q8SA 1SCRA 4CTEA 5L73A 4XYXA 1N1YA 5JOXA 2WT0A 1CONA 3O0XA 2D6MA 1A78A 2D3RA 2A6WA 1JW6A 3AXEA 3GALA 2AH2A 5LK5A 2D3PA 1LU1A 1ZM1A 4WVVA 2CWMA 2EALA 2P34A 4Y1YA 5GLWA 5IK4A 1S0GA 1JOJA 1V6JA 4D69A 5IT6A 4F83A 5IUQA 4PBPA 1BKZA 3O0WA 3UK9A 3WUCA 1UN1A 2YMZA 5DZFA 2D6PA 1DQ4A 3I4IA 4C1WA 2A5ZA 5DZGA 1SFYA 5T5OA 3V0AA 2AGSA 1F9KA 1WW6A 2V5YA 5DXDA 3B01A 2R16A 2XB6C 3M2MA 2ZGUA 3QCWA 3NV3A 4TYSA 2WKKA 4Y1ZA 2A70A 2A71A 3DUIA 1UKGA 1LCLA 3LCPA 4LBQA 2Q5TA 1IKPA 2RHPA 1HDKA 4U36A 1DYKA 1SCSA 3ASIA 3TAYA 2ZGPA 3AP6A 2AYHA 5DZEA 4R9BA 4BLJA 3SITA 4XIOA 3RG0A 3C2UA 5JOYA 4FOVA 1QOSA 4LBOA 3ZYRA 1LOAA 1URXA 3ILFA 2D43A 4DS0A 2ZHNA 3ZXJA 2ZA9A 1BJQA 1S1AA 1I1EA 4YG6A 5GZDA 1DQ0A 4XTMA 5KXDA 1UL9A 2FMDA 1MZ6A 3D6EA 4BOWA 2PHWA 3WG3A 3SH4A 1AX1A 3V0BA 4FPCA 1AXYA 3T1LA 2ZAAA 4XJ8A 4YW1A 1W6NB 2R1BA 3FLRA 2CTVA 1S0BA 1CESA 1LODA 5IK5A 3ZSMA 3N7KA 1JYIA 4RA0A 5CNAA 1W6OA 1CVNA 1SLCA 4FOQA 1JXNA 1H9PA 2PHRA 1SLIA 2E7TA 2UWAA 4H55A 3LSDA 4Q27A 4Z8BA 1VAMA 4FPLA 3RSJA 2EF6A 2UWCA 1UAIA 1W6MA 2ZGSA 2WT2A 2A75A 2WNEA 2ZGOA 2ZGNA 4NOTA 3O0VA 4GWNA 4ZKTB 3OY8A 2D6OX 1CN1A 1VALA 3AYCA 2WQZC 2PHUA 4WZFA 2GNDA 2ERFA 1W6QB 2ZMLA 3WDUA 1JYCA 3NWKA 4LBKA 1D2SA 1LOBA 2SBAA 3AJZA 4AVTA 1Q56A 3POSA 2GNTA 4XBQA 4DRVA 3FFZA 3N7JA 4XOGA 3JUUA 1C57A 4Y22A 1DQ1A 1GICA 1ENSA 1BZWA 4MYEA 4FPOB 3SH5A 3VV1A 3A4UA 2AR6A 3HMYA 2ZZJA 4XJ9A 1B09A 3OYWA 2DVDA 4YM1A 4AYUA 2DUPA 3ZXFA 3BTAA 2DTYA 5GLUA 1MR5A 4M3CB 3IKWA 1WUVA 3PVEA 5CA6A 1Z78A 3OBTA 1RINA 1I3HA 5GJ6A 3W58A 1KJLA 1MVQA 1AF9A 3FLTA 1MZ5A 1DQ2A 4Y24A 3USUB 2H0BA 1MS9A 3B69A 3PMEA 4XJAA 5GZGA 3BIWE 4BPZA 1FAYA 4XE9A 2OUHA 4Y1UA 4JCKA 1S0FA 2B7YA 1ULEA 5FREA 3M1HA 1ULDA 2WSVA 1CPNA 4ATEA 1YRZA 4LBMA 1LTEA 1N1TA 3NV4A 4YGDA 3ZSLA 2WT1A 1LOEA 1FNZA 2P3KA 2UWBA 4P9XA 2ZGMA 3TB0A 3WDVA 2D6LX 4XXPA 3RMYA 1BQPA 1GBGA 3R4UA 4YM0A 1LGCA 1GZ9A 3RS6A 1LOFC 1W0PA 1FV3A 1DQ6A 4FPFA 2NN8A 2ZMKA 4WV8A 1WD4A 5DG2A 1JHNA 2C5DA 4UW5A 1WLDA 2NMOA 3FBYA 2A7AA 4P9YA 4YG3A 3WDTA 4Y26A 3AK0A 4DQAA 1ONAA 1DQ5A 1S0JA 1DGLA 4JC1A 5H9QA 1QDOA 1QF3A 3U4XA 4YFZA 2EXKA 1ZA4A 4Y20B 4AWDA 3VKNA 1KDKA 3L2YA 4Q1PA 1FV2A 4YZ3A 1HQWA 3WNXA 3POYA 5KXCA 2EAKA 1C4RA 1HKDA 2ZGLA 2OVUA 1ULGA 3UL2A 2XG3A 3WZ1A 3T1MA 3AZXA 3FUOA 5H9RA 2ARXA 1GYKA 3N3HA 3WG2A 4GKYA 4CRQA 3RRDA 1CJPA 1WW5A 5KXBA 1GV9A 2CNAA 3VKFC 1LENA 2GALA 4LBQD 1AZDA 1QGLA 2DV9A 5GLZA 3WG4A 4GXLA 1UZZA 5CAZA 2UURA 3CNAA 1VIWB 5DUUA 1LHVA 3IM0A 1NLSA 2A6YA 1W6PA 3IN9A 2NZ9A 4C1XA 1N3OA 4YM3A 1UX6A 1WBFA 1APNA 1F31A 2I2SA 4WVWA 3AP9A 4L8QA 1W0OA 4K21A 1DIWA 1WLWA 3WUDA 4YGBA 3AP5A 4FQZA 4YFWA 2WSUA 4BMEA 4XMIA 1DYPA 4FQ4A 3AZZA 1G9BA 1QMJA 2KM2A 3ATGA 3RQ0A 4U2AA 1WW7A 5T5PA 1KJRA 3D5OA 1S0DA 4Q26A 3OGGA 1GZWB 1KITA 1V6LA 2PHXA 5T5LA 3WHUA 1A8DA 1F5FA 5T55A 1AJOA 5EWSA 1MACA 1MS3A 3Q9OA 4FPYA 3AZVA 1IOAA 1MS1A 1ULCA 4FPHA 5HCBA 3AZYA 1GANA 1C1FA 2VW2A 5JOZA 1D0HA 2ZBJA 2GMPA 1JBCA 2JE7A 3VKLA 5JOWA 5GALA 5JLVA 3WVJA 1RIRA 3ZSKA 1U0AA 4BMBA 3HN1A 3KQRA 2E53A 2YXSA 2ZKNA 1LESA 2R49A 3KM5A 5SV8A 4XTPA 5DUWA 5T50A 1N1VA 5JMCA 3IPVB 1LGNA 1LOFA 4XJUA 1J1TA 1QOTA 1LHUA 2GMEA 1MS5A 3MEPA 3D4KA 3B00A 3H0OA 3WDXA 3APBA 3SH3A 1SLAA 3AYAA 2CYFA 4YZ5A 3W59A 1UZYA 1CQ9A 3IMNA 4YGEA 1N47A 2A3WA 1SLLA 1LEDA 4FPEA 2OW4A 3DGTA 4YGCA 1IS6A 1GZCA 4RL7A 2D44A 1AVBA 3ZVXA 1LHWA 1WD3A 2P3JA 2NYYA 5AVAA 4DPNA 2PHTA 4YG0A 1MS4A 1ENRA 5IK7A 2BQPA 4Y1VA 3V0AB 3MW2A 3AFKA 1O4YA 4Y1XA 5KXEA 1TEIA 3AP4A 4FOYA 2DWRA 4AGVA 2D6NA 4FVVA 1DLLA 1LOCA 3UJQA 1IS5A 2DVBA 4BLIA 4LBQB 3WLUA 1UMZA 5CB7A 2V73A 4R9CA 4XMAA 2YV8A 2W39A 1LGBA 4KBBA 1AXZA 1BYHA 2LALA 1V6OA 4YZ1A 3WDYA 4PBOA 3WCRA 1DHKB 1Y7BA 4M3CE 2OUJA 4YW5A 1S0EA 3FUQA 4Q8KA 5GZCA 1PZ8A 2UU8A 3A0KA 5DUXA 3BODA 2ENRA 4GALA 2E51A 1OFSA 2GN3A 2GN7A 1W6NA 4BM8A 1EPWA 2CY6A 4XIKA 4PF5A 4HL0A 1FYUA 4UW3A 2SLIA 3ZSJA 1CPMA 1ULFA 1WW4A 2YROA 1VAVA 1WCSA 3V64A 1LECA 4K1YA 4OZXA 4FP3A 3GNEA 1SBDA 4R9DA 2DU0A 1SACA 4YW4A 5IK8A 2EXHA 2W08A 3PVOA 2JD4A 1HQLA 2DVAA 3AX4A 3SISA 4YW2A 1MS8A 4ATFA 1NXD1 3V0BB 1FX5A 5GLTA 4W65A 1V6IA 4XILA 1LU2A 4GWMA 4HANA 1QNWA 2ES3A 4GA9A 3O5SA 4UW4A 3T2TA 3ENRA 3R05A 1W6QA 3B9CA 1JN2P 1YI7A 1G9DA 5DUVA 1DFQA 1W6OB 1HLCA 5GM0A 5T52A 1PZ7A 2ZHKA 1WBLA 3AYEA 3ZYPA 1Q8PA 4YM2A 4PQ9A 5GZFA 3AJYA 4LBLA 3LSEA 5GZEA 4ASMB 1QDCA 2A6ZA 4K20A 4ZXKA 1KDMA 1W6MB 5EXOA 1C1LA 3BOPA 2DU1A 3SLIA 2GNBA 2EXIA 2ZGTA 3OY8B 4Q8LA 1CR7A 2ZGQA 3OPZA 1RITA 5T54A 1Q8OA 2NMNA 1QKQA 2ZHMA 3N36A 1SLBA 4ISRA 2HYKA 3AZWA 2FHRA 1AXKA 2W68A 4M3CA 1IS3A 4P9WA 1FNYA 1V00A 1GNZA 4FPGA 3ILRA 4XHBA 2NM1A 1V6KA 5CBLA 2Z42A 4AGRA 4SLIA 4Y22B 2VUAA 5HCAA 3USUA 2ZHLA 3A0NA 2C9AA 2GMMA 3WCSA 1GKBA 2LTNA 3NV2A 4PCRA 5FRAA 4YLZA 1YXWA 2ARBA 3OYWB 5GLVA 1AX0A 4YZ2A 1FATA 1LJ7A 2DYCA 1PZ9A 3ZPYA 1LOGA 2VY0A 4FP2A 4JRAA 4M01A 5E8AA 1QNYA 5F5QA 3ZXLA 2ZABA 3R4SA 5T5JA 1CIWA 1KRIA 5HCFA 2ZMNA 2P3IA 1AX2A 2EIGA 4XBLA 3B3QE 2WLQA 3NV1A 1H9WA 2R1DA
chains in the Genus database with same CATH superfamily
3VB9A 4B29A 1IS4A 3KZ4C 3DL3A 1YQ8A 3IIAA 2YY1A 2P6CA 2DVFA 4EV0A 1NA1A 1NCQA 2VW0A 3O12A 3VHPA 2CGOA 2OX0A 2VMEA 3N7MA 4DY3A 2WNVB 2RM22 1V6MA 1XNTA 1S2KA 2B45X 3LEKA 5BNPC 1H1MA 1S4CA 1VB2A 4GULA 1ZBA2 3AP7A 3SCGA 1BEV3 4NN0A 3HVDA 1JZ8A 3C7EA 1PK6A 3ZO0B 3VBUC 2AREA 3BIEA 3U75A 1B35A 1IHMA 4Q4X1 3RNSA 5FJHA 1KS4A 2J1SA 3GZTB 1RXFA 2HBTA 4XUNA 1JTZX 4AGGA 1ZX5A 4TTGA 5JPNB 2FZ1A 1H8TC 2J1EA 2DTWA 4RR3B 1UZWA 2WA4A 1QU0A 3I2JA 4FT8A 1G9FA 1RVF1 4XURA 2V5DA 4Z92B 2WZEA 4RS5B 4Q2FA 5FYYA 2VH9A 4WVMA 2J7MA 2GDFA 2Y6HA 5JCTA 1VAKA 2YFUA 4N43C 2FD8A 4CCEA 1UU5A 3MPPG 1LHNA 3N9LA 1SMVA 4P14A 2YZ4A 5FWJA 1J1LA 2ORXA 3FLPA 4DRRA 2G9ZA 3SNMA 5CFDB 4BIFA 1PGL1 4Y5Z0 4XDQA 1N3QA 4E4DX 5BY5A 4IEZA 2AEZA 1R1A3 2WJSA 5JAXA 1X50A 2BGOA 3AXDA 2FCUA 4FSJA 3CZUA 1SLTA 5CKNA 5LEJA 1CD3G 1QJY2 3TEXA 1H30A 1Z0HA 1NCRC 3DCQA 4XBNA 1CGPA 4KI5M 5BV6A 3WDWA 3RFRA 2VTXA 2XONA 3NMBA 4CZSA 4K1ZA 4WZCA 1OURA 3D0SA 5A70A 3ZKUA 2VXRA 1CJDA 4FI9A 3VKMA 3PVNA 4I30A 4HXCA 2PELA 3OBRA 2DCYA 2OPWA 3URFA 2D5HA 2P2KA 3MW4A 3E6CC 3PJQA 4M00A 3HQRA 1OKQA 1OPMA 5IVYA 3ES1A 2PA7A 4LA2A 1G9AA 4NRQA 3M3OA 3MW3A 1SDWA 5FYCA 2D98A 3VZOA 2HKXA 5DG1A 1EUTA 1DBNA 5FP4A 3K75B 2JDZA 3HOBA 4IGOA 4DMIA 1MVEA 4QDRA 3FHIB 5JSPA 2VOVA 1RUH1 1FXZA 4LEJA 2EIBA 4JHZA 4MZUA 1W2AX 4MUVA 4QDSA 5FYZA 1S2BA 3ACLA 4XYXA 1N1YA 5JOXA 2WT0A 2K46A 2D6MA 4I3GA 1M4WA 1JW6A 1LRHA 2AH2A 1ZM1A 2ETEA 4E27A 2VMIA 4WVVA 4J1XA 5EFUA 1VBA1 2BGCA 1PM7A 2WNOA 1QIQA 5IK4A 1JOJA 4D69A 4JKMA 4EWAA 4PBPA 5FXZA 3NAPB 3GYDA 3IAPA 1BKZA 3ZN5A 4RSUA 3UK9A 1UN1A 3WX5A 1XSRA 5DZFA 4E8CA 3JBG1 4FBFA 5FK7A 2JDUA 1SDDB 2D6PA 4RFT0 5JI7A 3I2IA 3WQ1A 5BUVA 5EIYB 4AI1A 3JQWA 2CAVA 1FT9A 3JXSA 5FPBA 2V5YA 1TME1 2R16A 2R072 3QCWA 3NV3A 4TYSA 2WKKA 4XW3A 2A71A 3GHNA 4B4PA 1LCLA 1UY4A 3LCPA 1NZIA 1PIV3 2VECA 2WZR2 4UXAA 5FZBA 3RYRA 5C6CA 1IKPA 2JG9A 3ACHA 3ZFFA 4DEVA 1AYN3 5L36A 1HDKA 4MO3M 4CDUB 2ZGPA 3ZN6A 4Z2WA 3UGGA 3FN9A 4COZA 2C9KA 3WF2A 1NUKA 2AYHA 5DZEA 4MH0E 2XR4A 2Q1FA 2VPVA 3WW1A 1ZRFA 4XIOA 4SBVA 5EJZB 1PMIA 3RG0A 3ZXAC 1QOSA 2RS52 2XXZA 2VZ3A 4C91A 3ILFA 5IAXA 1BHGA 2OPKA 1WZXA 2D43A 4DXRA 2WFF2 2ZA9A 1BJQA 1O8SA 3N9NA 1GQHA 1MZFA 3KHBA 5FO8B 1VBB1 5DDJ2 2WO1A 5KXDA 3NJZA 5HXMA 4BOWA 1BVVA 5F3GA 2H6BA 4XUTA 2PHWA 1XE7A 2PHLA 3LF7A 1WCDJ 1W8TA 4GQ7A 5A33B 5ABJC 1CIYA 4XFFA 2QTWB 2R1BA 2X09A 1AL0G 4QX1A 1EV13 2QDRA 4B8EA 2B5HA 1CESA 1LODA 4PI0A 5IK5A 2F4PA 3T0AA 5CNAA 3MIFA 4S2DA 4AZZA 1SLCA 2J1UA 2YG0A 1UMIA 4FOQA 4HN1A 1DP0A 3S57A 4D6QA 5FYMA 1H9PA 3ES4A 1QY4A 1ASJ1 4H55A 4P02B 2UWAA 2QQMA 3LAGA 3LSDA 4YW6A 3VBSB 3ZYJB 1C3HA 1PVC1 3J8F3 5FPXA 2UWCA 2I74A 1OMIA 1VALA 4UF0A 4XUPA 4WM7A 1UYXA 1XB9A 2WQZC 1UY2A 1DGWA 3VDDA 1FPN1 1W6QB 5FYSA 4LHLA 4QX7A 2R063 1XNDA 3THCA 4Q0UA 1LOBA 1HRV2 4Q4W3 4AVTA 4QQHA 3L2HA 1SEFA 3VBFB 1Q56A 4K40A 2DCJA 2GNTA 2J1TA 3FFZA 3EJKA 3N7JA 4XOGA 4KWJA 2GC1A 4XFIA 2ZKLA 4Y22A 4JZRA 2VZ1A 3H7JA 4XDOA 3VV1A 1L7LA 1YFYA 4RQPB 4O9EA 1L7QA 4QX8A 1AR63 1B09A 3WQ0A 2DVDA 4D7YA 1E5RA 4D8MA 5KBFA 2Y6GA 3MDPA 3BTAA 4QX3A 4A3ZA 5L7OA 3LEMA 3IKWA 3PVEA 5J36A 1YNAA 4CP9A 3NJYA 1RUI1 2D40A 4A44A 2FQPA 5GJ6A 3W58A 2D93A 1AF9A 3B02A 1MZ5A 3USUB 5T3NA 5KHGA 2H0BA 4JGZA 4UWDA 4UFMA 1MS9A 3PMEA 4Y1UA 1GOHA 2ET1A 5DABA 1CZSA 2YDEA 1S0FA 1AYM2 3QBQA 1H1AA 1PMJX 3M1HA 1ULDA 2F17A 4PF1A 5GKAC 1AR73 3WNOA 4HPKB 4L99A 3PUHA 3BYWA 2XJUA 5LA9A 1LTEA 3I3BA 3WEZA 4XQDA 1Y3TA 2P3KA 5FUPA 4LO5B 1JZ3A 4AHXA 1YUDA 4YM0A 1LGCA 2RM23 2Z69A 3VL8A 3MGUA 5FY1A 3VBOA 1LOFC 4Y3OA 2WINB 5IFPA 1ZBA3 4DB5A 2YPJA 2WNUA 4RHV2 1WD4A 1NA1B 1NCQB 3T0DA 2NLRA 1IQDC 1GFF2 2NMOA 3FBYA 4KG8A 4P9YA 2GP5A 4GJZA 4IERA 2RMU2 4Y26A 3WDTA 4DQAA 4E9KA 1DQ5A 4Q5OA 1T2XA 1NAEA 1XBFA 3D3AA 1OOPC 3GM8A 4JC1A 4W6XA 5H9QA 4LO4B 1QF3A 4OVEA 3ZPOA 1PK6B 3U4XA 4YFZA 3VKNA 1B35B 5EHDA 4Q1PA 3H3ZA 1O8PA 1HQWA 4QPIC 1WGPA 1BEV1 4CA9A 2Z79A 1HKDA 2ZGLA 5FZOA 3MV01 3WQBA 3MPBA 5G04L 3AZXA 3FUOA 2E7AA 1GYKA 3CU7A 1BCXA 1HQNA 1TQ5A 1YWKA 2ORZA 3E5QA 3VKFC 3MFCA 4WVMB 2VG9A 5GLZA 5KHHA 3QACA 4B7KA 5CAZA 2FDKA 1XYOA 4XFAA 3ETPA 1WMFA 1W6PA 2JDNA 3DV8A 2NZ9A 3DXTA 3M7AA 4CDWA 2VVEA 4YM3A 1UX6A 2I2SA 1WMEA 1CWPA 3A21A 1QJY3 1VJ2A 1W9TA 1HJGA 3BPSA 4K21A 3CMGA 2QBXA 4L8QA 5DAXA 4YVSC 1ULPA 4YGBA 1MPXA 3IT8A 4YFWA 4BMEA 3NNMA 4XMIA 5FPUA 5BNNC 3S5AA 5FBJA 1IGOA 4NHLA 1D2QA 2BNMA 5F8PA 2RE9A 1XOYA 4JHTA 3D5OA 1S0DA 1S55A 5J48A 4PIXA 4ZONA 4NIAA 1KITA 1R1A1 2PHXA 5JR7B 5EQUA 3CLPA 4AEKA 4AI2A 3K4DA 3WHUA 3G7DA 1NT0A 4H7LA 3ZYGA 4YVWC 1T6BX 1MACA 3DN7A 4B1LA 1XRUA 1RXGA 2BV4A 3AZVA 4AI8A 4CEYA 1GWMA 1ULCA 2QE3A 4FPHA 1XU2A 4QQPA 5HCBA 4CCDA 1GANA 4UYBA 2VW2A 3AMQA 1D0HA 2W1QA 1MZEA 4AQTA 1JBCA 5JOWA 5GALA 4S2GA 4FFIA 3ZSKA 2VCCA 2RDNA 3ZFEC 5JXHA 1OHFA 3W21A 1RJ8A 4BMBA 3JQXA 2E53A 2YXSA 2ZKNA 3KM5A 2R49A 4YYOA 5C3OA 2WO3A 3VHNA 4XTPA 5DUWA 5T50A 3NW4A 3LPGA 1LGNA 1J1TA 1Q3EA 1LHUA 1MS5A 3PUAA 3KQ4B 3D4KA 5DQ0A 4AOCA 2DCZA 3VBHA 1RMU2 2WRAA 3APBA 5F3IA 4LKFA 2X8KA 3AYAA 2FCVA 3IMNA 4JDNA 5FPAA 1N47A 4QGMA 5DAVA 1IPKA 2BOJA 2YGMA 2WYFA 1TE1B 1KGYA 1SLLA 1LEDA 3KGLA 2VOTA 1FMD2 2ZXQA 3NSTA 3LGRA 2OW4A 4FPEA 1V0AA 4LKEA 1IS6A 2G9FA 2R073 2D44A 3AFGA 4DPNA 5AVAA 4FO9A 4YG0A 3ACIA 4B3NA 2XBO2 1O3QA 4QGNA 3ETQA 2WZR3 1FOD2 4Y1XA 3U4SA 5KXEA 1GR3A 3AP4A 1REFA 3E5XA 4BA6A 2X53S 4R4XA 5C5TA 1KFXL 1DLLA 4ARXA 2O0OA 5AC92 3K4ZA 4TN7A 2YFZA 3UJQA 4CP1A 4CCKA 1ZYBA 4FAGA 5FZ0A 5CB7A 2HH9A 2V73A 1UIKA 2JG9B 3ZFFB 1DG6A 3M8LA 5FMCA 3WNKA 3GGLA 3HWJA 1X7NA 3E6DA 4KBBA 1AXZA 1BYHA 1UXXX 2RS53 3ZN6B 4YZ1A 3WDYA 4EJRA 1W99A 4C90A 3LFMA 1RGSA 4NUBA 1CAWA 1PIV1 2WFF3 3A0KA 4Z2AA 3UYJA 1AYN1 4GALA 4IE7A 5DDJ3 2E51A 2GN7A 2HWC2 4CDQA 1W6NA 2EIEA 4HL0A 4UW3A 5FLHA 2XOMA 1WW4A 4CDXA 2FZ2A 3F2ZA 1WCSA 3MIDA 3V64A 3KWVA 4OZXA 4FTSA 1PO22 2XHKA 3GNEA 1KFUL 1GWLA 1SACA 2VMGA 3BCWA 2Y6FA 2JDMA 4L97A 2DVAA 3AX4A 3SISA 4ATFA 5A6ZA 4QAWA 3F95A 1FX5A 5GLTA 1LU2A 1QNWA 3MFAA 2ES3A 3ST7A 4GA9A 5LZ6A 1CX1A 1O6UA 1STMA 4O61A 1HLCA 4OI4A 5JPMB 1PZ7A 3PIJA 2ZHKA 4GAZA 1H2MA 4EE2A 2Q1MA 1YFXA 3CEWA 1XXNA 3AJYA 2ZX2A 1O7FA 2VXJA 4N53A 1UQXA 3LSEA 1EV11 2R043 5GZFA 2PAEA 4ASMB 3EB7A 3WF0A 3O1OA 2GNBA 4Q8LA 4I0AA 4UF0B 1HRV3 2PAMA 1CR7A 4KBZA 4WM7B 3NJXA 3VDDB 5IFTA 2H6CA 5T54A 3OB8A 4LO8A 1AR92 2X29A 2ZHMA 3H1WA 3J8F1 3K46A 1F35A 5FXVA 4A6SA 2BEOA 1SLBA 3KT4A 4ISRA 2HYKA 4HONA 4CP0A 4K7JA 2WQ4A 4QKDA 5JZGA 5JI9A 3RGBA 3MHZA 1GNZA 4AK3A 3JD72 5FOJB 2WZPP 4F8AA 4Y22B 4X6RB 1OPOA 2ZHLA 2R061 2C9AA 2W92A 1DYOA 2LTNA 1ZRDA 5B2GB 1FATA 1LJ7A 5EP9A 1TNFA 5E8AA 5LB6A 2PLV1 2VM9A 3ACGA 1AL22 3IDAA 3MZHA 3SQOA 4XF3A 4CP9B 1UYYA 2EIGA 4LIUA 1AR61 1AYM3 2WUHA 4QU2A 3RJ2X 4MOAA 4XEZA 1ZZ6A 4JGZB 5FMOS 4DXSA 3WW2A 1G8WA 1Y43B 4V1PA 4A45A 3TNQA 3INAA 1GNHA 3I8TA 1XNCA 4IUGA 2AENA 2QQLA 4GKXA 3O1PA 1SHWB 3ABZA 4TSVA 1F5JA 4M0NA 2DVGA 3DXUA 4K8RB 3I7DA 4RHV3 2TUNA 2Z5WA 2UY9A 3TOJA 1K42A 2JENA 4XJWA 5J7MA 1XJAA 3WW3A 2RMU3 4GH4C 1AR71 1QXPA 4NROA 4CPBA 2A3XA 1ND3C 2WNUB 4M4RA 4ZS3A 3VKOA 4X6QB 2XVKA 5FDBA 1W2NA 1TMF2 2RM21 1GP5A 4I0WB 4PLNA 3N7LA 4HZFA 2FDIA 2JE9A 2K0GA 2P5BA 3B93A 3DPRA 4UOJA 3O1UA 2B42B 1ZBA1 3M3CA 4XQ4A 4BISA 4P5HA 2BGPA 2EXJA 1R092 5FZKA 5C9AB 3DYMA 4LO7A 3Q8FA 3VZJA 3WF4A 4TZDA 1RYYA 2UYBA 1XQNA 4MLOA 2VE1A 3TRSB 5A1AA 3BB6A 1Y9GA 1KQRA 5C71A 5FZOB 4Q0PA 5JSOA 1MS0A 3NNLA 1YO8A 1GSLA 1LHOA 4XHXA 4CP2A 4E2SA 1YIFA 2D7FA 3ZFGB 2XPJA 2ZACA 2QUOA 4NIGA 2A6XA 5E89A 3RPQA 4EZHA 4FFFA 2VW1A 2E63A 4OUMA 4LBJA 1W6PB 2A6VA 1GZWA 4GWIA 4HK8A 4MHUA 4XFBA 3ZXEA 3NNJA 4CDWB 2FDJA 2WL1A 1A3KA 2XQXA 1QOOA 4NE9A 3WNMA 5F37A 2E6VA 5K9YA 3N35A 3THDA 1WA4A 2PHFA 2ZTNA 4NRMA 5AFEA 1PO12 3MO4A 1JUIA 2P37A 1AR82 3TN92 1QJY1 4BQ5A 4G3YC 4P9GA 5C3PA 1EPZA 2Z4FA 4JV4A 1ODMA 3LZZA 4MGZE 4BJ0A 4BXSV 1JZ5A 2NP0A 4LOTA 3P1IA 1ZRIA 3IWZA 3QOPA 1NQJA 4CEYB 1UO9A 1Q8SA 4CU7A 4CE8A 2HWB2 3I3DA 3W9AA 5LCWL 2HWF2 5L73A 2DBIA 3AMNA 5BNOC 1J3QA 4LJHA 1NE4A 5LK5A 4I01A 1LU1A 2YBSA 3ON7A 1ODNA 1QH6A 5FZ7A 5JUVA 1V6JA 2IVJA 1RMU3 4JQTA 5A7NA 1K5MC 3VBUA 4F83A 3VUOA 2LUWA 3NVCA 1ZZ8A 3J7LA 5C7GA 2QQPA 3M3IA 2ADDA 1I6XA 2C6SA 4OFGA 4C1WA 4GZ9A 4P9JA 2A5ZA 3PLQA 3VBHB 1H8TA 1SFYA 4CXWA 5T5OA 4LE3A 1WCUA 1F9KA 1FMD3 3ZXGA 2VZUA 3SCHA 2PN5A 2XB6C 4P9IA 2ZGUA 2G1MA 3S7EA 4Y1ZA 4OCTA 2VQTA 3UGFA 4RYDA 2Y0OA 2HEWF 1UKGA 2IXKA 1H2LA 1RUF2 3MIGA 2X10A 2XBO3 4LBQA 4MGKE 2BP6A 1FOD3 4N43A 5K7PA 3FZ3A 5CFCC 3O14A 1C8M2 3AM2A 3DKQA 4E2QA 4LA3A 4O7XA 3K4AA 5AC93 1S2EA 4XCAA 4OYUA 3JB8A 3JB4C 4UBGA 1R082 3EBRA 2IXJA 5FUNA 1W28A 4AFMA 1HX6A 3IBMA 1QJFA 3ZYRA 1LOAA 1URXA 2WC2A 2DCKA 3RZZA 4ES9A 3VDBA 4QX2A 1NCRA 3BGAA 2XWBB 4YG6A 3J7MA 3WF3A 3GCWA 5GZDA 3GF6A 5FYIA 2RJ2A 3D0JA 2HWC3 3P6BA 3S7IA 1CAWB 4R8HA 1P8JA 4FAHA 2Y6KA 3SH4A 1AX1A 3BUCA 1PO23 4FPCA 4UI9L 3T1LA 4CDQB 1W6NB 1POV3 1RUD2 3FLRA 1OLME 2CTVA 1S0BA 1U5IA 4CDXB 1VRBA 1BVP1 4G9SB 1ZRCA 2GU9A 2WFF1 4MADA 1H4GA 4CPBD 1H6XA 5F6LB 2VQAA 1OF4A 2MPFA 5DDJ1 3ZSEA 1ZZBA 3ZR6A 4AHYA 3U0ZA 5FO9B 1O4TA 1W9WA 4Q27A 1XSQA 4HVOA 4FPLA 1VBD2 3RSJA 3O1SA 2ZGNA 1W6MA 1ND2A 2E32A 2WT2A 2A75A 2WNEA 4RFRB 5LRSA 3O0VA 4NR1A 3POGA 2TBVA 2OYZA 1CN1A 3AYCA 2WWSA 2ERFA 1DU3D 2N7GA 1JYCA 2WWUA 4IEXA 2XVLA 1D2SA 5C8CC 4HKWA 1D0GA 4N53B 1NY72 4X8PA 5F7UA 4AQ6A 3POSA 4OZOA 3W20A 4XBQA 2IWGB 4WVZA 1AR93 2PFWA 1OUXA 3JUUA 4MGYE 4WBBA 5K4LA 5LA0A 1DQ1A 3N9PA 2HYXA 3EQEA 5I8YA 3BVCA 3A4UA 3POJA 2AR6A 5FZ1A 4GMP3 3HMYA 2ZZJA 2W95A 3CDZB 3BTYA 3JD73 2R041 4YM1A 2WA3A 2GC3A 4H14A 4URAA 3ZXFA 3OTFA 2Y64A 1HRV1 5JZGB 2VD7A 1Z78A 3ZFGC 1H8VA 1RINA 3AKPA 4AXOA 5IAVA 1C28A 3ZIXA 4TXWA 5ACA2 2P6HA 4QPGC 2BFUL 4QKBA 2ZJCA 5F2SA 5GZGA 5LY1A 3OSDA 4BPZA 1AL23 1FAYA 3H1MA 4TLGA 4XE9A 4JCKA 2VNOA 5C4WC 2Y60A 4N7UA 2WO2A 4IDZA 1XPWA 5FREA 4CUCA 2V72A 3HJRA 3H9AA 4ATEA 5CKQA 2O8QA 2NPIA 1YRZA 1E5HA 1WA6X 1E57A 1JHJA 1NCQC 4YGDA 5E1RA 1X33A 4ASKA 1LOEA 4P9XA 3TB0A 1C5IA 3WDVA 4XXPA 4YPJA 5CU1A 3WP6A 4ZU5A 4BDVB 1GZ9A 3RS6A 1W0PA 1KD7A 1FV3A 1DQ6A 4BYYA 1DDLA 2NN8A 5B4XA 4QDQA 4WV8A 1PMHX 4CCOA 3FWEA 1OI6A 2A7AA 4AQ2A 3AK0A 1W90A 1OA2A 1S0JA 3M70A 2Y0IA 5SV5A 2WN3A 3KS7A 2MEV2 3CQOA 1QDOA 2JDPA 5LATA 3S0MA 4ES8A 1W8NA 3ECQA 2EXKA 2XKOA 3MUZ1 1XYNA 1TMF3 1ZA4A 3FMGA 1BLZA 3GCXA 4S2FA 1LB2A 1OLQA 4QM8A 4RHV1 4B4RA 1R093 4F7ZA 4JGYA 3ACFA 1W06A 3T0BA 3UL2A 3WZ1A 4ASLA 2RMU1 2VQUA 3DPRB 2C4XA 1NOVA 1CJPA 3RRDA 3ZDSA 3EXUA 4CRQA 1GV9A 4GB32 4WM8C 4LBQD 4CCJA 5LBBA 3PMSA 1COV2 1W2TA 1VIWB 5DUUA 2P17A 1F4HA 1LHVA 3I2GA 3POFA 1NLSA 4BQXA 2A6YA 2RS12 2HEYF 1YCIA 3IDEA 3MUY1 4C1XA 5FQ0A 2L9LA 1APNA 3AP9A 5JSRA 3Q8CA 1W0OA 1DIWA 3SEEA 2LS6A 4FQZA 2WSUA 4QD2A 5HI0A 2QQIA 4K3UA 2KM2A 3RQ0A 1WW7A 2WYSA 1KJRA 2VOWA 3LIHA 5A3TA 2YBKA 1Z7S2 1GZWB 1V6LA 5T5LA 2BDRA 1PO13 3TNPB 5EWSA 1AR83 2C1FA 4FPYA 3TN93 4QM9A 4QGLA 4K8FA 4QB6A 1CZTA 4NMIA 4YWAA 4D0QA 3LDKA 5JOZA 1IPJA 2BBAA 5KC6A 2XJVA 3K77A 3VKLA 2JE7A 1HRI2 1XNBA 1UOJA 5KR7A 1RIRA 1OA4A 4I3PA 2B9VA 2RR12 2VOXA 2WLPA 5FAXA 3HN1A 5AVPA 2HWB3 5SV8A 3WP3A 3MBWA 1UU4A 2BRTA 3RZHA 1RVF2 4MGQA 1IZ3A 1N1VA 5FLIA 2FDGA 1LOFA 1QOTA 1UXZA 1QHDA 2H0VA 4HETA 3N9MA 1J3PA 1HV0A 4A41A 1OF3A 5A3WA 4GJYA 3DYPA 2KA3A 1RTVA 3AKTA 3PL0A 3WF1A 4CCNA 3PHMA 4UBHA 1UOBA 3W59A 3KV4A 1PGL2 2VUJA 1OOPA 4LIVA 4LMFA 1YJKA 2F4LA 1YEWA 5I0UA 5I91A 3VBUB 1YI9A 3V56A 3DGTA 4YGCA 3MLKA 4YNIA 1J84A 4QPIA 1QQP2 3CKHA 3NNGA 5FCCA 1LHWA 2P3JA 3ZVXA 2NYYA 1YFWA 4IE5A 4OMCA 1ENRA 1RUF3 1H8TB 4P5YA 1IG3A 1RMU1 2JIJA 2C26A 1U5XA 1TEIA 2DWRA 4CXXA 2D6NA 4NHXA 1A6CA 1C8M3 2RVAA 4FVVA 2ZS6B 5LEKA 1LOCA 2HBUA 4JDMA 1IS5A 2DVBA 4G4FA 4LUMA 4LBQB 4R52A 3WLUA 1R083 4N43B 2QQWA 4R9CA 4KGGA 1FMD1 2W39A 3OEAA 1D4M2 1LGBA 1OD5A 4QXBA 4ZZ5A 5J37A 1W8UA 2LALA 4QX5A 3WCRA 1DHKB 1RHI2 2XBO1 3J26N 5GZCA 2RJKA 2KD7A 2UU8A 1FOD1 1PVXA 1QXJA 5DUXA 4Z82A 4YVSA 1GOGA 5E6HA 5FZMA 2LM3A 3U14A 2VBDA 5I8TA 5FYUA 1POQA 1V70A 1WCKA 2OT7A 4PF5A 5AC91 1EP0A 4HKOA 1UD1A 2SLIA 1CAXA 4HOOA 3UV9A 3P3PA 1NCRB 1A34A 4K1YA 1HB1A 4LKSA 3OEBA 2VZOA 3ORJA 2BUKA 1X82A 2DU0A 4ONUA 3NKGA 4CSWA 1NE6A 1RUD3 3X29B 4YVWA 1HQLA 2O14A 5LA1A 1YQCA 4XCBA 4CCMA 4XILA 2JD9A 2PQSA 2HWC1 3U37A 5C9AA 1J59A 3O5SA 1UYPA 3H7YA 3I2OA 1VBD3 2PTMA 1VBC2 3B9CA 3ZFEA 3ELNA 4PDWC 2Q8EA 4WM7C 5T52A 4FTBA 2E9QA 1PO21 3AYEA 3H8UA 5A3MA 5A80A 5C3QA 3BKZA 3PIGA 4PQ9A 4AE2A 3GZUC 2Q0AA 1POV1 4LLFA 1QDCA 2A6ZA 4ZXKA 2RG4A 3SLIA 1QWRA 1ND2B 1C1LA 1REEA 1W6MB 2JG8C 2XHNA 3BN6A 3DKWA 4MVTA 4JQRA 4KWUA 3B5LB 2KXLA 5ANNA 4M0HA 3I2HA 3H8OA 3OPZA 1HB3A 3LFIA 1V9U2 4LHKA 4Z07A 4AAPA 2NMNA 1K3IA 2VJXA 4OQ9A 5IYYA 5HXVA 4FTEA 2YC2A 1W2OA 2K9ZA 2FHRA 3AC0A 2W68A 3CJIA 4GIQA 5IVBA 1HXS2 4M3CA 4DIQA 4IV1A 4XC9A 1YIPA 2ZEYA 4QXHA 3T3YA 4LLOA 3SEPA 2Z42A 4AGRA 3IB3A 5L7OC 2XJPA 3ITQA 3A0NA 2BYVE 1ZBE2 4MXWA 3WCSA 2CHHA 1U12A 4PCRA 5GLVA 5FP3A 4JGZC 4LHNA 4ZPIA 3CBNA 2DYCA 3RI8A 1AR91 2WAAA 1LOGA 2VY0A 4OULA 5G05L 5I8SA 3ZPYA 4JRAA 4M01A 1JMUB 2YC4A 4AI3A 4CU9A 1PX3A 3ZKYA 2ZABA 2R7EB 2ZOEB 3R4SA 4KG0A 4GMP1 2ZMNA 2P3IA 4UFIA 5T5JA 4EZ4A 1US2A 4LE4A 1O5LA 1HV1A 3JD71 5IVVA 3AKSA 3NV1A 1W8WA 1H9WA 4R9AA 1D7PM 1AHSA 2R0HA 3KT7A 3H3UA 2PMWB 3RYPA 5F9TA 2BERA 1OVSA 3LOIA 2W46A 3KLSA 1XE0A 4UAPA 3WHTA 3VBOC 3POBA 5L19A 4PLMA 5FP7A 3B7MA 3FE5A 4OI1A 3O1MA 1DGRN 1WLCA 2WNUC 4YZ4A 2QVSB 2VTXJ 4D7TA 1IG0A 1VRH2 3J7HA 1AL21 1QJX2 2BW8A 3UJOA 1RUC2 3KSCA 3QLQA 4HFSA 4AEDA 1GNYA 2GP3A 5A6YA 2JJ6A 1S0IA 4Q1RA 1WMDA 4TWTA 2MEV3 3AYDA 3SMHA 2ZGRA 3LEGA 1RUE2 4AVVA 4BQ1A 3VZNA 4YRDA 2VU9A 4ZS2A 3M3QA 5BXXA 1X8MA 2I07B 2JECA 1F15A 2Y34A 1MQTC 3LE0A 5A32A 3NL1A 4XZPA 4EN7B 2B9UA 1BXHA 4W8JA 3VBRC 5C70A 2E7QA 4CU6A 1BK1A 4XJZA 2LW8A 1UU6A 2Y26A 1GQPA 3AVRA 4KWLA 4DEQA 5DAPA 4KU7A 4GB33 1OD3A 4M3CF 1VBE2 5HCHA 1COV3 1F2NA 1I9RA 4UW6A 4JGYB 4YW7A 3WINE 1SBEA 1O5UA 2D3SA 3PJYA 4PQQA 1DZQA 3A7QA 5JVVA 3ZXKA 3GHMA 4A7ZA 3I2FA 2AZ5A 2W91A 4DFSA 4ITCA 3UESA 4NWVA 2RS13 4YW3A 5JXIA 3VZMA 3PTRB 2QQNA 2Y6LA 5L9RA 4NJ4A 5CADA 2J42A 1JYVA 1QJZA 1R091 1N1SA 3BOWA 2B8MA 2R6QA 3GDBA 2VC9A 2CGNA 2DURA 4QKNA 5FQ0B 1TZOA 4J25A 1JYXA 3VGIA 3UKTA 3J9SA 2QDNA 3MIHA 3Q8AA 1DCSA 2FMYA 5J3UA 2ZX4A 1DZRA 1R1ZA 5JDBA 1Z7S3 2YB7A 1GU3A 3VD5A 3RZLA 1J3RA 1OQ1A 4A7YA 1ENQA 1LULA 4MV2A 1G7YA 1W2UA 3FC0A 4B7EA 4BHPA 4FPKA 4BK5A 3RJRA 3HR9A 4OHXA 2E33A 4ZU7A 3NKTA 2RS32 3WG1A 1UPSA 5J1XA 4AW7A 5IVCA 5FXWA 3CHXA 1HRI3 1VPHA 3JU9A 1UF2C 3M3EA 4E8DA 4LHSA 2RR13 3HBKA 3ZXDA 3BALA 3O0XA 1A78A 1PO11 2D3RA 3AXEA 4IV3C 1TNRA 5DPNA 3SC7X 4MGTA 1AR81 1BEV2 3TN91 4P00B 2R30A 1BBT2 4Q0QA 4QU1A 3FBMA 3AL5A 4QWNA 4R4ZA 4XQWA 5A7WA 3VBHC 2P34A 3CF6E 4NPRA 5GLWA 4DY5A 5IT6A 1DF0A 5IUQA 1KS5A 2VZQA 4GH4A 4HSLA 4COWA 5C3SA 1O3RA 4JKLA 3U78A 4HT1T 3I2DA 1ND3A 1UNBA 4AG4A 2VCAA 1DQ4A 1DGWX 2HWB1 3I4IA 5DZGA 3RYKA 3V0AA 4KGQA 5FR3A 5A7QA 1W04A 2OQ7A 2QNKA 3B01A 3KCXA 4AVAA 3POEA 3K3OA 1QQP3 1OOPB 4AEJA 4LOSA 2RDSA 3DUIA 2EA7A 5IWFA 1W9YA 4QQOA 3BPZA 4QXKA 2J1VA 3OGSA 4LORA 4Q4W1 4CEWC 2Q8DA 3ZIWA 2VMHA 4QPIB 3TAYA 3R0RA 3AP6A 1X9PA 3HAGA 2IC1A 4AHZA 3H1YA 3RZKA 2XDVA 3NRUA 4BLJA 5FIXA 1IPSA 2WNVC 5JOYA 4A42A 1D4M3 5F3CA 4PIZA 5HV0A 3HIFA 3E5UA 1RUJ2 2XL9A 1RUF1 2ZHNA 1RHI3 2VL4A 4IGQA 5EV7A 5FZ4A 1X36A 1I1EA 1S1AA 1QEXA 1W9FA 1NZCA 2VMCA 2BFUS 3UGHA 4CYDA 4K9SA 5F39A 4AFBA 4LUKA 3BI3A 1C8M1 1DQ0A 1RUG2 2BNOA 1MZ6A 3D6EA 5FY9A 2A73B 3NO8A 1R081 4UFLA 5BPXA 4IE6A 4YVSB 3WG3A 3V0BA 1AXYA 3UT0A 4D6RA 1W8OA 4RR3C 5BNNB 1Y4WA 4KU8A 5F5AA 1CAXB 3VD4A 3FJSA 1DLCA 1VMJA 2JDHA 2X5IA 3N9OA 4RS5C 1W03A 3N7KA 1BK0A 3ZSMA 1JYIA 1W6OA 2CAUA 5D2AA 1CVNA 3VHOA 4RD7A 3I54A 4D6SA 3OCPA 4ET7A 3HT2A 1SLIA 4P08A 4YVWB 1L7RA 1VAMA 1RC6A 2EF6A 2VUDA 4O9GA 4NOTA 1VBC3 2OZJA 2P1BA 3ZSLA 5CFDC 1W8ZA 1YQ6A 4GWNA 3U10A 3OY8A 2D6OX 2Y33A 4C8DA 3KVBA 3TWIA 4BE3A 3CJXA 2R32A 5I0TA 4XPVA 4AL9A 1RUD1 2XMLA 5BNOA 4NWWA 3ZFEB 2ZMLA 4JRLA 3WDUA 3WNPA 4A7KA 4LBKA 2B39A 2Z2SB 5C8WA 4CCCA 1Y9MA 3HEIA 1MEC2 4N9IA 1K5MA 2VBBA 3GBWA 4Q29A 1V9U3 2W9XA 4DRVA 4IE4A 5LASA 1HN0A 1VBD1 5KHJA 1C57A 4L9BA 4BZ4A 4HVRA 4FPOB 1JZ4A 1HXS3 4HLTA 3PUSA 1UZ0A 3R6SA 5K0UA 5FY4A 2BZDA 4URTA 3SXWA 4DOUA 4AYUA 1JH5A 2QQJA 2ZPXA 1OA3A 1DZTA 5I0RA 3TBDA 3CJIB 2DTYA 5GLUA 1ZBE3 4M3CB 1WUVA 2ZX3A 1AYN2 5CA6A 4IV1B 1NY71 1JUHA 1I3HA 1JOPA 2RV9A 2WDBA 3LD8A 1KJLA 1OUSA 3C7OA 3FLTA 3FX3A 5CFCA 1YHFA 1DQ2A 4Y24A 3WNLA 3VD9A 1OLRA 2AEYA 1J58A 3ALQA 4MXWB 5LWBA 5D8AC 3BIWE 2OUHA 2VULA 3HPNA 4EQVA 2B7YA 2HWE2 2ZEZA 4YSFA 2WSVA 3EHKA 4XUOA 5JXGA 3O1VA 1N1TA 3FHQA 5FZDA 4F3JA 2YGLA 2WT1A 4QX0A 5JXJA 4BQWA 3FFQA 3MIBA 2W87A 3KCYA 1GBGA 3IAQA 5F6KA 2ZX1A 2UY8A 5L9BA 3TEWA 5FTTC 3NAPC 4QXCA 4NPMA 1VRH3 5BNPA 5D1IA 2ZX0A 1QJX3 5DG2A 1I5ZA 2WS92 1RUC3 1WLDA 3OD4A 4UW5A 1EV12 1ZZ7A 2BVVA 2WFPA 4LK7A 3VD3A 1ZVFA 3CO2A 4META 2B46X 1UZVA 1RUE3 3OPWA 5FK8A 3VLBB 4AEDB 1O59A 3KB5A 3LOBA 1KDKA 4FFHA 3L2YA 3JCIA 4YZ3A 1HJFA 4CDUC 5FXXA 2CDPA 5FO7B 5CVRA 3WNXA 4IL7A 4BQ2A 2EAKA 1QJU2 5KXCA 3KHCA 1U5YA 3LA7A 3T1MA 2OZ6A 4HVQA 1DGRA 1VP6A 3N3HA 3WG2A 3Q8BA 1WW5A 4Q0SA 1TVGA 2CNAA 4IEVA 5A32B 1LENA 2GALA 1AZDA 1QGLA 2MEV1 5EPAA 3VD7A 1VBE3 2ZEXA 2QZ2A 1RB8G 3NJVA 2BPA2 1LAJA 4GXLA 4CVUA 2VVDA 3GJAA 5D8AB 5ACA3 5C8CA 2ARAA 1OBNA 2RDRA 3KF5A 1ST8A 2IFWA 4OI2A 3T2QA 4LK6A 2PLV2 4WVWA 2R071 5A7PA 5TSWA 3EO6A 1RUOA 2CSGA 3BTXA 3P3NA 2Q8OA 1WLWA 2TNFA 4NIDA 2WZR1 3W5MA 2W47A 4GB31 3AZZA 5DAWA 3ATGA 1COV1 1H4HA 4DXTA 5I0DA 4U2AA 3MICA 4BQ3A 3RZGA 3KMHA 1CZVA 5CZKA 2CGPA 4NAMA 2RS11 2BTVC 3I3MA 1F5FA 1UY3A 2ET7A 2YU2A 4Y33A 5T55A 1AJOA 3I49A 2RS51 3CIHA 3VBSC 2CU5A 4QPGA 4E4ZA 1IOAA 1MS1A 1UW8A 2A1XA 4JVAA 5CIRA 2XVGA 3I2KA 2FCTA 5C4WA 5K8SA 3M4FA 2ZBJA 4LR4A 2RS33 1YFUA 1SFPA 5JLVA 3WVJA 1KXGA 2HWD2 3ZOIA 4AF9A 1PGW2 1OT5A 2WO7A 1U0AA 4ARYA 3T30A 3OUJA 3KQRA 1CAVA 1UCXA 2QQKA 1Z7S1 1LESA 2XL7A 3WSOA 3A23A 1SG3A 3VBFC 4H2AA 3PNAA 5JMCA 4EN6B 3VL9A 3IZOA 4XJUA 5A3OA 4QB1A 2GMEA 1BBT3 2QJVA 4JDOA 1HW5A 5FZ6A 1W3VA 5CEHA 4AI0A 2JB8A 3B00A 3H0OA 3WDXA 3KV6A 4RQPC 4MHRA 5M0TA 4QT6A 5CG9A 1SLAA 1G6NA 2CYFA 1HRI1 1VMFA 2ZEWA 1UZYA 4MGIE 3MF6A 5A7WB 4YGEA 2JDYA 2RR11 1RJ7A 2A3WA 4LPLA 1OQEA 4GH4B 1OVPA 4IESA 4NHMA 1K12A 1GWKA 1AUYA 4IXLA 3E97A 4HG6B 4RL7A 4CU8A 1ND3B 4IEYA 2IXCA 3GXUA 2PHTA 5F5IA 3PTYA 2W1WA 1RL3A 2BQPA 3T4HB 3ZYFA 1BMV2 3V0AB 4N8MA 3P5BA 2GC0A 5ERLA 3AFKA 4OHVA 1O4YA 1UKRA 3LWCA 4B4QA 2CV6A 4FOYA 4AFDA 2YPDA 4WM8A 5LRRA 3ZX7A 4AQSA 4BLIA 4EYUA 1HB4A 2E26A 2VUCA 5LBCA 1SQ4A 3K51A 4JTOA 4QQ2A 2YV8A 3USSA 4QHBA 3D8CA 1QQP1 3U1XA 1J83A 1QJEA 4PBOA 5FZHA 5FY7A 1RUJ3 1GUIA 4OHZA 4YW5A 2VO5A 5FYVA 1NA1C 1PZ8A 3ZYBA 4BXFA 3G6JB 5A3NA 3BODA 1W39A 5J98B 4EN9B 3AKRA 3OBZA 3T2PA 3IDCB 4AAXA 1OFSA 2GN3A 3KT1A 4PLOA 4AEMA 4BM8A 4XIKA 1FYUA 1RUG3 2VCBA 1CPMA 3JZVA 5FMOL 2W0XA 2V4AA 1VAVA 4Q4Y2 1PK6C 4XF1A 1LECA 5LBFA 3VZLA 3HBZA 1D4M1 1AYM1 2PQQA 1B35C 2BOIA 3PVOA 5ABJA 1RHI1 4JX0A 4UFKA 4YW2A 1MS8A 4Y4RA 1JYWA 4YARA 2AACA 3V0BB 3RZMA 1K45A 2HJIA 5F3EA 4CUGA 4W65A 4HANA 2IXIA 3WNNA 3HN3A 2Q30A 2QKDA 4DUVA 1ND2C 4UW4A 2WN2A 3IIIA 3ENRA 2E31A 2BJSA 3QH7A 2X5IB 3RWNA 3ZM8A 3KCCA 3S5QA 4JTNA 5DUVA 1W6OB 4AFCA 3OUHA 5B4NA 1JYNA 3LPFA 3ZYPA 1Q8PA 4ZHNA 4LBLA 1EAH2 4A3XA 5GZEA 5HV4A 3PDQA 4K20A 4EN8B 3H8RA 1KDMA 3BOPA 3HNYM 2DU1A 4Q4V2 4NPLA 4AHWA 2EXIA 2ZGTA 3OY8B 4LULA 2BU9A 3ZDVA 4Z1VA 1H2NA 1MEC3 4LXLA 1Q8OA 5BNOB 3C8XA 3HNMA 4I02A 1VBC1 3N36A 1W8FA 3ZMOA 3T09A 3E1F1 3AZWA 1UOFA 1AXKA 2MNGA 2VTFA 3ZYHA 4OMDA 1NXMA 3OD0A 4XZUG 4P9WA 1K5MB 1V00A 5ISLA 1O3TA 2OQ6A 3ILRA 2NM1A 1JZ2A 3R4DB 4SLIA 3OOXA 4XAAA 4DXZA 2HLEA 5FY8A 1JZ7A 1F4AA 2GMMA 1UY1A 2GH2A 2QQOA 1T6GC 5K0UB 5FRAA 4YLZA 1YXWA 1A8MA 4IEUA 1AX0A 1V9U1 3FHAA 4IW3A 5FMDA 1PZ9A 4FP2A 2DCTA 1JYTA 1QNYA 5F5QA 3EMRA 3ZXLA 5IHRA 1HXS1 2ILMA 5HCFA 1ACCA 1AX2A 3WD5A 1POV0 3WQ7A 2HWE3 3ME2A 2PYTA 4XBLA 5CFCB 4NHYA 1PM4A 1H6YA 2R1DA 4Q4X2 1AJKA 2IZWA 1ZBE1 5F2WA 5H9PA 2ZGKA 5LW9A 2LROA 1X8EA 1HB2A 1UYZA 2EAAA 2D6KA 1C8NA 4FPJA 2W2IA 4LITA 2HWF3 1S0CA 3OGVA 4KNCA 2FDHA 4E2GA 3GBFA 1I5PA 2AUYA 1NLRA 2XLGA 4ZXEA 2WS93 2YHJA 2DBNA 2FBEA 2V4VA 5EYYA 3W5NA 1XC6A 4LBNA 4Y20A 2EICA 2CWSA 4XFHA 1LEMA 4OHWA 1YQ5A 5FP9A 4LKDA 5BNPB 2A3YA 4RGGA 5APAA 3C7GA 5A7SA 3RMXA 1Q8VA 2XWJB 2LRPA 2FDFA 4IQPA 1Q8QA 3MYXA 1ENXA 3ROUA 5H9SA 1VRH1 2JKBA 3QD6A 4GMP0 1QJX1 2VGDA 3LDBA 2QZ3A 4FOWA 4JGYC 5EYXA 4PDWA 1QJU3 1RUC1 1UX7A 4NIHA 3POWA 3ILNA 3MLLA 4BB3A 5J96B 2JG9C 2R042 3HNBM 2ZCWA 2CL2A 5FYBA 3ZFFC 2G4IA 1GLHA 4RN5A 4ZU4A 5A6QA 1G9CA 2VBPA 4ISQA 4QB2A 3THTA 2VZSA 3T08A 2JG8A 4LQRA 1ZNPA 3I59A 1N3PA 1RUE1 5FY0A 2WZ8A 3O1RA 3VN4A 1D4VB 1G86A 3WOGA 2YU1A 3H8XA 5E88A 1Y9QA 3AVSA 1GQGA 2DUQA 1E5IA 1PNFA 1SBFA 4XXAA 2PLV3 5BYNA 2C0ZA 5A1FA 1SPPA 3OJBA 5JIAA 5C8CB 3OGJA 2JICA 4AVSA 1XNKA 2YBPA 1JZ6A 2GNMA 1JU4A 4JKKA 5KHKA 1OQDA 2GZWA 2TEPA 4MSVA 1NQDA 3O7OA 1VBE1 2DUOA 2JDKA 1RUH2 3RWKX 5BNNA 3MF9A 1YYNA 5L9VA 1W8HA 5ACA1 1NG0A 5CKMA 2XJRA 2WBKA 3V65A 2W52A 1VLNA 4HN0A 3AL6A 4KL1A 2EVXA 1GZTA 5FZ3A 4DO0A 1F8VA 4J6GA 1VBA2 5FZAA 2R0FA 5IJRA 4DUWA 2GH8A 3WV6A 2PXJA 5A3UA 1O4ZA 2VAUA 3DEMA 1L3JA 1IKQA 3UETA 3IPVA 4FFGA 4QPGB 2HWD3 3FL7A 1V6NA 3MLJA 4NO4A 1ZRRA 2XJSA 1YC61 3JBG2 4GWJA 2VZVA 5FZLA 1GOFA 5C4WB 5LY2A 3I97A 1SCRA 3J7NA 4CTEA 2OA2A 3HQUA 1VMHA 1CONA 3VDDC 2ID4A 1JOBA 2A6WA 3GALA 1TME2 4N9HA 1TG7A 2D3PA 1JI6A 4L92A 5IATA 5ANQA 5FYTA 2EALA 2BVBA 1H0BA 2CWMA 1CAVB 1UOGA 2BWCA 2Y38A 3LEIA 4Y1YA 3RI9A 2JWPA 1S0GA 3B9IA 1QH7A 4O65A 4P9LA 4CUAA 1GP4A 5J09A 2RS31 2IXLA 3O0WA 3SKJE 3PUQA 3WUCA 4E4SA 2YMZA 1ZA7A 5A3PA 3K3NA 1WMXA 4NVPA 1NYWA 2Y6JA 1UPIA 2AGSA 2XUEA 3LDRA 5F5CA 5EJ3A 1WW6A 5DXDA 4L0PA 4UFJA 3M2MA 1BBT1 1MQTA 2VCMA 2A70A 4HK9A 1ZREA 3LA3A 1UWWA 5FV3A 3HD8B 4HKLA 3VBRA 2Q5TA 2JKXA 1WKYA 1E5SA 2OS2A 2RHPA 1VBB2 2JB4A 1WCQA 5A1LA 5HPOA 4U36A 4DNYA 1DYKA 3KVAA 1SCSA 2WWJA 3ASIA 1HIXA 3I3EA 4QQLA 3PU8A 1RUNA 4DINB 1CAUA 5FLJA 4C0BA 2Q8CA 2NQYA 5FYHA 5FZGA 4BK4A 4R9BA 3SITA 5FMBA 2JX9A 3C2UA 4FOVA 1JU3A 2IXHA 4LBOA 4Y5SA 2YC0A 4I09A 4WM8B 5AFBA 4NAOA 3J4UH 1PGSA 4S2HA 4DS0A 3D82A 2WQ8A 2W3JA 3LIGA 3ZXJA 2J22A 5FUIA 4OQ8A 4H3WA 3IDBB 3SHRA 1Q43A 3VHRA 4XTMA 1ASJ2 2JE8A 1UL9A 2FMDA 3THPA 3ZN4A 1PVC2 4AVBA 2WIIB 1XNAA 2RDQA 3WR0A 3Q8EA 4Q4Y3 4CCLA 4IEPA 3CL1A 3WW4A 5JMOA 1PHMA 2ZAAA 4XJ8A 4YW1A 2VR4A 1US3A 3OBAA 5IW0A 1FPN2 1O91A 1VR3A 3UNPA 1RUJ1 2WABA 4UFHA 4RA0A 3LA2A 5C9AC 2JDAA 2VVFA 4N7IA 4HBNA 4LT5A 4I2OA 1JXNA 4PJYA 2PHRA 5CYYA 2E7TA 4H7MA 1CX4A 1RUG1 4HSJA 2O8OA 2QCSB 4Z8BA 5C3RA 5ABJB 4IEWA 5FOBB 1UAIA 2ZGSA 1OSGA 4W4ZA 2ZGOA 4BIOA 3KV5A 3UKNA 4ZKTB 3SKVA 4PIYA 2W1SA 2PHUA 4IV3A 4WZFA 1EAH3 2GNDA 4D94A 3S30A 2XJQA 3NWKA 4XFCA 4Q4V3 4B1MA 5I93A 2SBAA 4ORFA 2VZPA 3AJZA 3U11A 2DDUA 1RUI2 1IQAA 4CUBA 1TMF1 2DFBA 4CDWC 5EZWA 5FKCA 3CJIC 1GICA 1ENSA 1BZWA 1OKOA 4I0BA 4MYEA 5DMYA 4IV1C 1ALYA 3SH5A 5FZ8A 4XJ9A 3TYJA 2Q4SA 3OYWA 2DUPA 2PHDA 3RZJA 2J1AA 4PHZA 1UIJA 5KC5A 5F1RA 1MR5A 2IFRA 2AC1A 4MXVA 1MEC1 2D97A 2OXBA 3OBTA 5FWEA 3AMMA 4CEWA 4QMAA 4MG2A 1MVQA 1NLQA 4AVCA 1SFNA 3B69A 5LA2A 4XJAA 4ZZ8A 4CEYC 1OLMA 2WLQA 3LKJA 5FPLA 4DZGA 4XAEA 4OUEA 1ULEA 4EN0A 2WNVA 4XABA 1CPNA 4Q4X3 3H3LA 4LBMA 4OLLA 3NV4A 4PT6A 1XU1A 2VNVA 3UKVA 1C5HA 1FNZA 2UWBA 2J1RA 2QQVA 2ZGMA 4BQ4A 3LB9A 1NX9A 2D6LX 2VMFA 3A22A 1BQPA 3R4UA 2W94A 3RMYA 2XQRA 4CXYA 4IGPA 2XLAA 4L2NA 1REDA 4FPFA 5EJ1B 1RVF3 2IVIB 5JWPA 4N90A 2OIIA 4MGSA 2F6BA 2ZMKA 3LQCA 1R64A 4AEDC 1JHNA 4C0HA 2DF7A 2C5DA 2JIGA 2VZTA 2HWE1 4NRPA 4YG3A 5CG8A 3B94A 2VNGA 3OGRA 5FZIA 1ONAA 2VOKA 3HQXA 4M4PA 4RR3A 2DFCA 5D21A 5DAQA 5JIUA 1DGLA 2BWAA 4RS5A 2P3YA 3OG2A 1U5ZA 3PU3A 1WWYA 4XACA 4Y20B 4AWDA 4ZY9A 2HWF1 1FV2A 1OH3A 1X9TA 4OHYA 4IEQA 2YUEA 3POYA 2QFEA 5IVEA 1C4RA 2WS91 2JEMA 5CFDA 2WR9A 4BWOA 2OVUA 1OC1A 1ULGA 3KV9A 2XG3A 5H9RA 1EY2A 2ZZQA 2ARXA 5FP8A 5KXBA 4GKYA 2ARCA 3E6BA 4GD4A 4LO6B 3KF3A 4A6OA 2DV9A 3WG4A 4PDWB 1UZZA 2UURA 3CNAA 4XF4A 3QH6A 4V2WA 4QPYA 3IM0A 1R1A2 4FXKB 3IN9A 2I45A 3HT1A 3IMMA 1N3OA 4FXGB 4XF0A 1WBFA 2JG8B 1JODA 1F31A 1ULOA 1H1IA 3I59B 3PUIA 5FKBA 1QJU1 3C3VA 3WP5A 4BU2A 2Q1ZB 2XUMA 2ADEA 3WUDA 4W50A 3AP5A 3NNFA 4UT5A 4CDQC 3DF0A 5FZEA 2XLFA 1DYPA 1ZZCA 4FQ4A 1W9SA 1QMJA 4IE0A 1G9BA 5DN2A 5IVJA 4CDXC 1SPPB 1RUH3 1GMMA 5T5PA 4XUQA 1O3SA 2YYOA 2HEVF 3OGGA 4Q26A 4OI0A 4EROA 5CISA 1KEXA 1LR5A 4NHKA 1A8DA 5L7OB 1JS9A 5E16A 3AKQA 4J1WA 1MS3A 3Q9OA 1YJLA 2OKXA 5D8AA 3ZMNA 2GSYA 2XKPA 3WXPA 1VBA3 3AZYA 1VB4A 4QHZA 3ZR5A 1C1FA 5IVFA 2XJTA 3KGZA 1H2KA 3GZAA 1W0NA 5F32A 2D5FA 2GMPA 1M06G 4EWEA 1YLLA 4A2UA 2W5FA 4KWKA 2PAKA 3JBG3 4BCUA 4D3WA 3MV11 3VDAA 3WP4A 4AR2A 3RDIA 4N53C 4NIIA 4W6WA 3T4VA 3WT3A 2WAOA 3IPVB 3NAPA 3VDCA 1EUUA 1TME3 1K5JA 3MEPA 4K6BA 3VBOB 1GP6A 4IETA 2ZAHA 3H50A 3SH3A 4A4AA 4YZ5A 4JAAA 1CQ9A 2GAUA 2HWD1 1OXCA 1PGW1 2VZRA 3T2OA 1XYPA 2Y8KA 3TEZA 3CZJA 4OUSA 3DECA 5JR2A 5A6XA 4COVA 5JZGC 3K48A 2G9GA 3S6PA 3TEYA 1LNSA 2K2SA 2XH6A 2BNNA 5LBEA 3BU7A 1GZCA 4CDUA 1AVBA 2EIDA 1WD3A 2ATFA 1MS4A 5IK7A 4Y1VA 1PIV2 3MW2A 2KR2A 5FPZA 5KHIA 1VBB3 4AGVA 1LKNA 1MQTB 4EWDA 3BTZA 3L9JT 2UYAA 4IEOA 5C5UA 5FY5A 1EYBA 1WLTA 3VBRB 1UMZA 2QQUA 3N4MA 4XMAA 4QPWA 2O1QA 3NQHA 1FI2A 1V6OA 1CAUB 4COYA 1VE0A 1Y7BA 4M3CE 2OUJA 1S0EA 3FUQA 2X05A 4Q8KA 1BMV1 4KQ7A 2ENRA 4E4HA 5A3LA 5A33A 3PVBB 4DUXA 1OH4A 1EPWA 1ASJ3 2CY6A 4BH9A 3PURA 3ZSJA 1PVC3 1ULFA 2YROA 2RJLA 4Q0VA 3VZKA 4INDA 4FP3A 2VNRA 1SBDA 4R9DA 2IUWA 2X5IC 4YW4A 4KMQA 5IK8A 1FPN3 2EXHA 2W08A 2JD4A 3RVHA 5FBZA 3VBSA 3EYPA 4RGKA 4XVHA 3OF1A 4QHOA 1NXD1 3KD4A 4W6YA 4TLFA 5KWRA 4Y4YA 1V6IA 4GWMA 3DPRC 4COUA 5I0SA 3T2TA 1OFNA 3J8F2 2G19A 3R05A 4XDPA 1W6QA 4D7SA 1JN2P 1YI7A 5FZFA 1G9DA 1DFQA 2JXAA 1YQ2A 2P4EA 3POIA 4Q4Y1 5GM0A 1WBLA 1ZZ9A 2XGXA 5FPVA 1XE8A 4YM2A 3AMHA 5FZCA 3VBFA 5LK7B 2V09A 3BU0A 4L11A 1W05A 3U07A 3WY6A 5FFOC 4X8NA 2R062 3I3QA 4HMZA 3DYOA 4Q4W2 4QKFA 2ZGQA 4RQPA 1RUI3 1RITA 1HN1A 2B4KA 2VQ0A 3AB0A 4IV3B 5BNQA 5C33A 3O1TA 1QKQA 3OUIA 3ZYIB 4MX3A 3GJBA 4FCAA 1SZBA 4LTAA 5K0UC 4KH9A 1Q5OA 3AMPA 1IS3A 5HBAA 4V2VA 5FZ9A 1FNYA 1AR62 3MIEA 3C7FA 4FPGA 1EAH1 4XHBA 2CDOA 3N9QA 1NKGA 1V6KA 3GBGA 1QXRA 5CBLA 2VUAA 5HCAA 3SCFA 3USUA 1PNGA 3GZEA 4Q4V1 2MHFA 3MI8A 1W3XA 4PI2A 1GKBA 3K2OA 3NV2A 3OPTA 4XFGA 2ARBA 3OYWB 5FJKA 4AFAA 4YZ2A 4XETA 5A7OA 3ZFGA 2C24A 5EXOA 4HPKA 3ZLIA 3C7HA 2GC2A 4AI9A 4BQYA 2BBVA 2VMDA 1CIWA 1UY0A 1KRIA 4RGAA 3H42B 4CEWB 1UMHA 4XF9A 4LNVA 3B3QE 1PX4A 1AR72 2W1UA 4Y5TA
chains in the Genus database with same CATH topology
4B29A 1IS4A 3KZ4C 3DL3A 3IIAA 2YY1A 2DVFA 4EV0A 1NA1A 1NCQA 2VW0A 3O12A 3VHPA 2CGOA 3N7MA 4DY3A 2WNVB 2RM22 1V6MA 1S2KA 2B45X 5BNPC 1H1MA 1VB2A 4GULA 1ZBA2 3AP7A 3SCGA 1BEV3 4NN0A 1PK6A 3ZO0B 3VBUC 2AREA 1B35A 1IHMA 4Q4X1 3RNSA 1KS4A 3GZTB 4AGGA 1JTZX 1ZX5A 5JPNB 2FZ1A 1H8TC 2DTWA 4RR3B 2WA4A 1QU0A 4FT8A 1G9FA 1RVF1 4Z92B 4RS5B 4Q2FA 2VH9A 4WVMA 2GDFA 5JCTA 1VAKA 4N43C 1UU5A 3MPPG 1LHNA 1SMVA 4P14A 2YZ4A 1J1LA 3FLPA 4DRRA 3SNMA 5CFDB 4BIFA 1PGL1 4Y5Z0 4XDQA 1N3QA 4E4DX 5BY5A 4IEZA 1R1A3 2WJSA 5JAXA 1X50A 3AXDA 4FSJA 1SLTA 5LEJA 1CD3G 1QJY2 1H30A 1Z0HA 1NCRC 4XBNA 1CGPA 5BV6A 3WDWA 4CZSA 4K1ZA 4WZCA 3D0SA 2VXRA 1CJDA 3VKMA 3PVNA 4I30A 2PELA 3OBRA 2DCYA 3URFA 2D5HA 2P2KA 3MW4A 3E6CC 3PJQA 4M00A 1OKQA 1OPMA 3ES1A 2PA7A 4LA2A 1G9AA 3M3OA 3MW3A 1SDWA 2D98A 3VZOA 2HKXA 5DG1A 1DBNA 2JDZA 4DMIA 1MVEA 3FHIB 5JSPA 2VOVA 1RUH1 1FXZA 4LEJA 4MZUA 5D8AB 4MUVA 1S2BA 3ACLA 4XYXA 1N1YA 5JOXA 2WT0A 2D6MA 4I3GA 1M4WA 1JW6A 1LRHA 2AH2A 1ZM1A 2ETEA 4E27A 2VMIA 4WVVA 4J1XA 5EFUA 1VBA1 2BGCA 1PM7A 5IK4A 1JOJA 4D69A 4EWAA 4PBPA 3NAPB 3GYDA 3ZN5A 1BKZA 4RSUA 3UK9A 1UN1A 3WX5A 4FBFA 5DZFA 3JBG1 4RFT0 2D6PA 5JI7A 3WQ1A 5BUVA 4AI1A 3JQWA 2CAVA 1FT9A 2V5YA 1TME1 2R16A 2R072 3QCWA 3NV3A 4TYSA 2WKKA 4XW3A 2A71A 3GHNA 4B4PA 1LCLA 3LCPA 5C6CA 1PIV3 2VECA 2WZR2 4UXAA 3RYRA 1IKPA 2JG9A 3ZFFA 5L36A 1AYN3 1HDKA 4CDUB 2ZGPA 3ZN6A 4Z2WA 4COZA 2AYHA 5DZEA 4MH0E 2VPVA 3WW1A 1ZRFA 4XIOA 4SBVA 1PMIA 3RG0A 3ZXAC 1QOSA 2RS52 4C91A 3ILFA 2OPKA 2D43A 2WFF2 2ZA9A 1BJQA 1GQHA 1MZFA 5FO8B 1VBB1 5DDJ2 5KXDA 3NJZA 4BOWA 1BVVA 2H6BA 2PHWA 1XE7A 2PHLA 5A33B 1WCDJ 4GQ7A 5ABJC 4XFFA 2R1BA 1AL0G 2QDRA 1EV13 4B8EA 2B5HA 1CESA 1LODA 5IK5A 2F4PA 5CNAA 3MIFA 4S2DA 1SLCA 4FOQA 4HN1A 1ZREA 1H9PA 3ES4A 1QY4A 1ASJ1 4H55A 2UWAA 3LAGA 3LSDA 3VBSB 3ZYJB 1C3HA 1PVC1 3J8F3 5FPXA 2UWCA 2I74A 1OMIA 1VALA 4WM7A 2WQZC 1DGWA 3VDDA 1FPN1 1W6QB 4LHLA 2R063 1XNDA 4Q0UA 1LOBA 1HRV2 4Q4W3 4AVTA 4QQHA 3L2HA 1SEFA 3VBFB 1Q56A 4K40A 2DCJA 2GNTA 3FFZA 3EJKA 3N7JA 4XOGA 4KWJA 2GC1A 4XFIA 2ZKLA 4Y22A 3H7JA 3VV1A 1YFYA 4RQPB 4O9EA 1AR63 1B09A 3WQ0A 2DVDA 4D7YA 5KBFA 3MDPA 3BTAA 5L7OA 3IKWA 3PVEA 5J36A 1YNAA 1RUI1 2D40A 2FQPA 5GJ6A 3W58A 2D93A 1AF9A 3B02A 1MZ5A 3USUB 5T3NA 5KHGA 2H0BA 4JGZA 1MS9A 3PMEA 4Y1UA 2ET1A 2YDEA 1S0FA 1AYM2 3QBQA 1H1AA 3M1HA 5GKAC 1ULDA 3ZFGB 1AR73 4HPKB 4L99A 2XJUA 1LTEA 4XQDA 1Y3TA 2P3KA 4LO5B 4AHXA 1YUDA 4YM0A 1LGCA 2RM23 2Z69A 3VL8A 3MGUA 3VBOA 1LOFC 2WINB 1ZBA3 4DB5A 2YPJA 2WNUA 4RHV2 1WD4A 1NA1B 1NCQB 2NLRA 4KG8A 1GFF2 2NMOA 3FBYA 4P9YA 4IERA 2RMU2 4Y26A 3WDTA 4DQAA 4E9KA 1DQ5A 4JC1A 5H9QA 4W6XA 1OOPC 4LO4B 1QF3A 4OVEA 3U4XA 1PK6B 4YFZA 3VKNA 1B35B 4Q1PA 3H3ZA 1HQWA 4QPIC 1WGPA 1BEV1 2Z79A 1HKDA 2ZGLA 3MPBA 3AZXA 3FUOA 2E7AA 1GYKA 3CU7A 1BCXA 1HQNA 1TQ5A 1YWKA 3E5QA 3VKFC 3MFCA 4WVMB 2VG9A 5GLZA 5KHHA 3QACA 4B7KA 5CAZA 1XYOA 4XFAA 1WMFA 1W6PA 3M7AA 3DV8A 2NZ9A 4CDWA 2VVEA 4YM3A 1UX6A 2I2SA 1WMEA 1QJY3 1VJ2A 4L8QA 4K21A 4YVSC 4YGBA 3IT8A 4YFWA 4BMEA 4XMIA 5BNNC 1IGOA 4NHLA 1D2QA 2BNMA 2RE9A 3D5OA 1S0DA 1S55A 5J48A 4PIXA 1KITA 1R1A1 2PHXA 5JR7B 4AEKA 3CLPA 4AI2A 3WHUA 3G7DA 4H7LA 3ZYGA 4YVWC 1MACA 3DN7A 1XRUA 3AZVA 4AI8A 4CEYA 1ULCA 2QE3A 4FPHA 1XU2A 4QQPA 5HCBA 1GANA 2VW2A 3AMQA 1D0HA 1MZEA 4AQTA 1JBCA 5JOWA 5GALA 4S2GA 3ZSKA 3ZFEC 1OHFA 4BMBA 1RJ8A 3JQXA 2E53A 2YXSA 2ZKNA 3KM5A 2R49A 4YYOA 3VHNA 4XTPA 5DUWA 5T50A 3NW4A 1LGNA 1J1TA 1Q3EA 1LHUA 1MS5A 3D4KA 2DCZA 3VBHA 1RMU2 3APBA 2X8KA 3AYAA 3IMNA 4JDNA 1N47A 4QGMA 1IPKA 2YGMA 1TE1B 1SLLA 1LEDA 3KGLA 1FMD2 3NSTA 4FPEA 3LGRA 2OW4A 2R073 1IS6A 2G9FA 2D44A 3AFGA 4DPNA 5AVAA 4FO9A 4YG0A 1O3QA 4B3NA 2XBO2 4QGNA 3ETQA 2WZR3 1FOD2 4Y1XA 5KXEA 1GR3A 3AP4A 1REFA 3E5XA 4BA6A 2X53S 4R4XA 1KFXL 1DLLA 5AC92 2O0OA 3UJQA 4CP1A 1ZYBA 4FAGA 5CB7A 2V73A 1UIKA 2JG9B 3ZFFB 1DG6A 3M8LA 3HWJA 1X7NA 3E6DA 4KBBA 1AXZA 1BYHA 2RS53 3ZN6B 4YZ1A 3WDYA 4EJRA 4C90A 1RGSA 1CAWA 1PIV1 2WFF3 3A0KA 1AYN1 4GALA 5DDJ3 2E51A 2GN7A 2HWC2 4CDQA 1W6NA 4HL0A 4UW3A 5FLHA 1WW4A 4CDXA 2FZ2A 1WCSA 3MIDA 3V64A 4OZXA 4FTSA 1PO22 2XHKA 3GNEA 1KFUL 1SACA 2VMGA 3BCWA 4L97A 2DVAA 3AX4A 3SISA 4ATFA 1FX5A 5GLTA 1LU2A 1QNWA 3MFAA 2ES3A 3ST7A 4GA9A 1HLCA 4OI4A 5JPMB 1PZ7A 2ZHKA 1H2MA 2Q1MA 1YFXA 3CEWA 1XXNA 3AJYA 2ZX2A 1O7FA 4N53A 5GZFA 3LSEA 3ZIWA 1EV11 2R043 4ASMB 2PAEA 2GNBA 4Q8LA 4I0AA 1HRV3 2PAMA 1CR7A 4WM7B 3VDDB 2H6CA 5T54A 4LO8A 1AR92 2X29A 2ZHMA 3H1WA 3J8F1 2BEOA 1SLBA 3KT4A 4ISRA 2HYKA 4CP0A 4K7JA 2WQ4A 5JZGA 5JI9A 1GNZA 4AK3A 3JD72 5FOJB 2WZPP 4F8AA 4Y22B 4X6RB 1OPOA 2ZHLA 2R061 2C9AA 2LTNA 1ZRDA 5B2GB 1LJ7A 1FATA 1TNFA 5E8AA 2PLV1 1AL22 3MZHA 4XF3A 2EIGA 1AR61 1AYM3 4QU2A 3RJ2X 4XEZA 1ZZ6A 4JGZB 5FMOS 3WW2A 1G8WA 1Y43B 4V1PA 3TNQA 3INAA 1GNHA 3I8TA 1XNCA 2AENA 4GKXA 4TSVA 1F5JA 4M0NA 2DVGA 4RHV3 3TOJA 3I7DA 2TUNA 2Z5WA 2UY9A 2JENA 4XJWA 5J7MA 3WW3A 2RMU3 4GH4C 1AR71 1QXPA 2A3XA 1ND3C 2WNUB 3VKOA 4X6QB 2XVKA 5FDBA 1TMF2 2RM21 4I0WB 4PLNA 3N7LA 4HZFA 2JE9A 2K0GA 3B93A 3DPRA 2B42B 1ZBA1 3M3CA 4XQ4A 4P5HA 2EXJA 1R092 5C9AB 4LO7A 3VZJA 4TZDA 2UYBA 1XQNA 4MLOA 3TRSB 3BB6A 1KQRA 4Q0PA 5JSOA 1MS0A 1YO8A 1GSLA 1LHOA 4XHXA 4CP2A 4E2SA 1YIFA 2D7FA 2XPJA 2ZACA 2QUOA 2A6XA 5E89A 3RPQA 2VW1A 2E63A 4OUMA 4LBJA 1W6PB 2A6VA 1GZWA 4XFBA 4HK8A 3ZXEA 4CDWB 2WL1A 1A3KA 1QOOA 2E6VA 5K9YA 3N35A 1WA4A 2PHFA 2ZTNA 5AFEA 1PO12 1JUIA 2P37A 1AR82 3TN92 1QJY1 4G3YC 4P9GA 1EPZA 4JV4A 3LZZA 4MGZE 2NP0A 3IWZA 3QOPA 1NQJA 4CEYB 1Q8SA 2HWB2 3W9AA 2HWF2 5L73A 3AMNA 5BNOC 1J3QA 5LK5A 1NE4A 4I01A 1LU1A 1QH6A 1V6JA 1RMU3 3VBUA 1K5MC 4F83A 2LUWA 3NVCA 1ZZ8A 2QQPA 3M3IA 1I6XA 4OFGA 4C1WA 3VBHB 4P9JA 2A5ZA 3PLQA 1H8TA 1SFYA 5T5OA 4LE3A 1F9KA 1FMD3 3ZXGA 3SCHA 2PN5A 2XB6C 4P9IA 2ZGUA 3S7EA 4Y1ZA 2Y0OA 2HEWF 1UKGA 2IXKA 1H2LA 1RUF2 3MIGA 2XBO3 4LBQA 4MGKE 1FOD3 4N43A 5K7PA 3FZ3A 5CFCC 3O14A 1C8M2 3AM2A 4E2QA 4LA3A 5AC93 3JB8A 3JB4C 4UBGA 1R082 3EBRA 2IXJA 4AFMA 1HX6A 3IBMA 3ZYRA 1LOAA 1URXA 2WC2A 2DCKA 3RZZA 4ES9A 1NCRA 2XWBB 4YG6A 5GZDA 3GF6A 3D0JA 2HWC3 3S7IA 1CAWB 4R8HA 4FAHA 3SH4A 1AX1A 1PO23 4FPCA 3T1LA 4CDQB 1W6NB 1POV3 1RUD2 3FLRA 2CTVA 1S0BA 1U5IA 4CDXB 1BVP1 4G9SB 1ZRCA 2GU9A 2WFF1 1H4GA 5F6LB 2VQAA 3ZSEA 2MPFA 5DDJ1 4AHYA 1ZZBA 3U0ZA 5FO9B 1O4TA 4Q27A 4HVOA 4FPLA 1VBD2 3RSJA 2ZGNA 1W6MA 1ND2A 5LRSA 2WT2A 2A75A 2WNEA 3O0VA 4NR1A 2TBVA 2OYZA 1CN1A 3AYCA 2WWSA 2ERFA 1DU3D 2N7GA 1JYCA 4IEXA 2XVLA 1D2SA 5C8CC 4HKWA 1D0GA 4N53B 1NY72 4X8PA 4AQ6A 3POSA 4XBQA 2IWGB 4WVZA 1AR93 2PFWA 4MGYE 3JUUA 4WBBA 1DQ1A 5I8YA 3EQEA 3A4UA 2AR6A 4GMP3 3HMYA 2ZZJA 3JD73 2R041 4YM1A 2WA3A 2GC3A 4H14A 3ZXFA 3OTFA 1HRV1 5JZGB 1Z78A 3ZFGC 1H8VA 1RINA 3AKPA 4AXOA 1C28A 3ZIXA 4QPGC 2BFUL 2ZJCA 5GZGA 4BPZA 1AL23 1FAYA 3H1MA 4XE9A 4JCKA 2VNOA 5C4WC 4N7UA 5FREA 3H9AA 4ATEA 2O8QA 2NPIA 1YRZA 1E57A 1NCQC 4YGDA 5E1RA 1X33A 1LOEA 4P9XA 3TB0A 1C5IA 3WDVA 4XXPA 3WP6A 5CU1A 4ZU5A 1GZ9A 3RS6A 1W0PA 1KD7A 1FV3A 1DQ6A 4BYYA 1DDLA 2NN8A 4WV8A 3FWEA 1OI6A 2A7AA 4AQ2A 3AK0A 1OA2A 1S0JA 3M70A 2Y0IA 5SV5A 3KS7A 2MEV2 1QDOA 3S0MA 4ES8A 3ECQA 2EXKA 2XKOA 1XYNA 1TMF3 1ZA4A 3FMGA 4S2FA 1LB2A 1OLQA 4QM8A 4RHV1 4B4RA 1R093 4F7ZA 4JGYA 3UL2A 3WZ1A 4ASLA 2RMU1 3DPRB 4CRQA 1NOVA 1CJPA 3RRDA 3ZDSA 3EXUA 1GV9A 4GB32 4WM8C 4LBQD 3PMSA 1COV2 1VIWB 5DUUA 2P17A 1LHVA 1NLSA 2A6YA 2RS12 2HEYF 1YCIA 3IDEA 4C1XA 5FQ0A 1APNA 3AP9A 5JSRA 1W0OA 1DIWA 4FQZA 2WSUA 4QD2A 5HI0A 4K3UA 2KM2A 3RQ0A 1WW7A 1KJRA 2VOWA 1Z7S2 1GZWB 1V6LA 5T5LA 1PO13 3TNPB 5EWSA 1AR83 2C1FA 4FPYA 3TN93 4QM9A 4QGLA 4K8FA 5JOZA 1IPJA 5KC6A 2XJVA 3VKLA 2JE7A 1HRI2 1XNBA 1RIRA 1OA4A 4I3PA 2VOXA 2RR12 2WLPA 5FAXA 3HN1A 5AVPA 2HWB3 5SV8A 3WP3A 1UU4A 1RVF2 1IZ3A 1N1VA 5FLIA 1LOFA 1QOTA 1QHDA 2H0VA 4HETA 1J3PA 1HV0A 2KA3A 1RTVA 3AKTA 3PHMA 4UBHA 3W59A 1PGL2 2VUJA 1OOPA 1YJKA 5I0UA 5I91A 3VBUB