1R092

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09200
1NY72 5C9AC 2RM22 2MEV3 5ABJA 5ABJB 1AYN1 1VBE1 3ZFGA 3ZFGB 4Q4V1 5D8AA 5D8AB 3VDDC 1COV1 4GMP3 5ABJC 2BFUS 4WM8C 4CEYC 1HRI2 5L7OC 3JB8A 3IDEA 4GH4A 4GH4B 4WM8A 4WM8B 4Q4X1 1FPN2 2ZTNA 2RS53 4BCUA 5BNPC 3JBG2 1A6CA 5DDJ3 1BMV1 1RUD3 1MQTB 1MQTA 3NAPA 3NAPB 1SMVA 1PO22 2WFF3 1OOPA 1OOPB 5FOJB 1OPOA 3DPRA 3DPRB 3VBSA 3VBSB 4RHV1 1FOD1 1TMF2 3VBRB 3VBRA 1VBB1 4CDXA 4CDXB 2HWB1 2RR12 4QPGB 4QPGA 1CD3G 4QPIC 1AYM1 2HWC1 5CFDA 5CFDB 1RUD2 1PGL1 1ASJ1 2WFF2 1BEV2 1AR81 5CFCB 5CFCA 4CDUC 2RS12 5BNOC 1QQP2 2WZR3 1K5MA 1K5MB 4JGZC 1EV13 3CJIA 3CJIB 2R043 5C4WA 4EJRA 5C4WB 1QJX3 1PGW1 1NCRB 1NCRA 2R073 2BFUL 1RUH3 1AL23 1VBC1 3J8F3 1CJDA 4N43A 4N43B 4Q4Y2 1E57A 3VBFA 3VBFB 1RUI1 3VBOC 3ZFEC 1BBT3 1POV1 1RUE1 2HWF2 2RS13 2WLPA 4RR3B 4RR3A 1HXS3 4CEYA 4CEYB 5BNPA 5BNPB 1B35B 1B35A 1RB8G 4QPIB 2MEV2 4QPIA 4Q4X3 1V9U1 4SBVA 2WS92 1NA1B 1NA1A 1NG0A 1PVC1 1ZBA2 1VBD3 3TN92 1RUF1 1RVF1 1D4M1 1VB2A 5BNNC 1AYN3 1QQP3 2R062 4IV1A 1RMU3 4IV1B 4WM7B 1QJY1 4WM7A 1OOPC 4YVWA 4YVWB 1ND3A 1ND3B 4AEDB 4AEDA 3NAPC 4IV1C 1RUG2 1AL0G 1R083 2HWE3 1RUJ2 2HWC3 1RUI3 1EAH1 5C8CC 1Z7S2 5J98B 1RUE3 2RR13 4IV3C 5K0UC 2HWD3 5LK7B 4FSJA 1R093 2R063 1HRI1 5CFCC 1VRH2 1PO11 4GB33 2BUKA 1AR91 1VBB3 1VBD1 1TME1 4Q4X2 1C8M1 2RS52 5ACA3 1X36A 1HQNA 1AR71 3VBHB 3VBHA 4YVSB 4YVSA 2PLV3 4CDXC 1HXS2 2XBO1 5FMOL 1F8VA 1OHFA 4RHV2 1FOD2 1BBT1 1VBB2 2WZR1 4GMP0 2RR11 1RUH2 2RMU2 1NY71 1RHI1 2HWC2 2BBVA 1ZBE3 1ND2C 2WFF1 4FTEA 1R092 5A32B 5A32A 2BPA2 1EV12 1AL21 1VB4A 1QQP1 2DF7A 1ZBA3 1FPN1 1Z7S3 3DPRC 1EAH3 1PO23 2RS33 1H8TB 1H8TA 1AR83 4YVWC 1BMV2 4Q4W3 4FTBA 1RUG3 4CDQA 4CDQB 4Q4Y1 1IHMA 3JD73 1RUI2 2ZAHA 5L7OA 5L7OB 1RVF3 4GH4C 5AC92 4Q4V3 5C4WC 1PGL2 1QJU3 3VBHC 1PO13 4GB31 1COV3 5D8AC 4JGZA 4JGZB 3VBSC 3VDDA 3VDDB 1BEV1 2X5IC 2TBVA 4N53C 1QJX2 1PVC2 2RS11 1HRV2 1ZBA1 1D4M2 2RS31 3S6PA 5ACA2 1H8TC 1RUG1 4NWWA 1VRH3 1DDLA 2VQ0A 1D4M3 3FBMA 1HRV3 2PLV2 4CDUB 1RMU1 4CDUA 1NCQC 2HWD2 4CEWB 4CEWA 1R1A2 1RUE2 2HWF1 3M8LA 4RR3C 4GMP1 1AUYA 1AR61 1R081 3ZFFB 1RUC1 3ZFFA 2GH8A 1BEV3 4JGYA 4JGYB 4N43C 2X5IA 2X5IB 5DDJ2 1V9U2 2Y26A 4N53A 1PIV1 1C8M2 2RS51 2FZ1A 4RQPA 4RQPB 3TN91 1RUF2 5C8CA 5C8CB 1AR72 5A33A 5A33B 2R061 1B35C 2WWSA 1FMD1 2HWE2 1V9U3 3JD71 2R071 3JBG3 4FTSA 2R041 1VBE3 1W39A 5BNNA 1MEC1 5BNNB 2RMU1 1FPN3 1Z7S1 1RHI2 2HWF3 4RHV3 1QJU1 1ND3C 3J8F1 1VBA1 1HX6A 1AL22 1ZBE2 2RM23 1VRH1 1COV2 1PO12 1AR92 5JZGC 1NCQA 1NCQB 1VAKA 4RS5C 1HRI3 1F2NA 2XPJA 1ND2A 1ND2B 2XBO2 3LOBA 3ZFFC 4AEDC 3JBG1 1AR93 2HWB3 5GKAC 4Q4W2 2GSYA 1VBC3 1AR63 1POV0 1K5MC 4Z92B 1C8NA 1VBA3 4RQPC 1MQTC 1TMF3 1R091 2RM21 1AYN2 1VBE2 1EV11 1ASJ2 4Q4V2 3TN93 4NWVA 1HRV1 5J96B 1NOVA 1AR82 1TME3 4IV3A 4IV3B 1RUJ3 2RS32 5ACA1 4RFT0 2ZZQA 1AR73 1RUF3 4YVSC 1C8M3 1QJY3 1AYM3 1PGW2 2PLV1 1PO21 3JB4C 2HWD1 1VBC2 1GFF2 1TMF1 1R1A3 5AC91 1RUC2 5FMOS 2FZ2A 2HWB2 4GB32 1PVC3 1AYM2 5DDJ1 1RUD1 5C9AB 5C9AA 2MEV1 1QJX1 4CDWA 2IZWA 4CDWB 3ZFGC 2QQPA 2RMU3 3ZFEA 3ZFEB 2WS91 3VBFC 1RUC3 1FOD3 4Y4YA 3VBOB 3VBOA 4RS5A 4RS5B 1RVF2 2HWE1 1M06G 3JD72 3VBUC 1QJY2 1PIV3 2R042 3HAGA 1ASJ3 1POV3 4Y5Z0 4LLFA 1MEC2 1RHI3 1NA1C 1RMU2 1QJU2 1NCRC 1RUJ1 1FMD3 1R1A1 5AC93 1VBA2 1EAH2 1AR62 1R082 1ZBE1 3ZXAC 4JGYC 4PDWA 4PDWB 1MEC3 1WCDJ 4PDWC 1QJZA 1PIV2 1X33A 2XBO3 3VBRC 4CDWC 1VBD2 1TME2 4QPGC 4CEWC 5K0UA 5K0UB 5CFDC 1FMD2 2R072 1HXS1 3CJIC 4Q4W1 3VBUA 3VBUB 4CDQC 4Q4Y3 1BBT2 5BNOB 5BNOA 4WM7C 2WZR2 2WS93 4N53B 3J8F2 5JZGB 5JZGA 1RUH1
chains in the Genus database with same CATH superfamily
2AUYA 3DKQA 4MGQA 4AR2A 2BWAA 2GMPA 1A8DA 2ZX3A 2RM22 3FUQA 1XC6A 4BLIA 2DYCA 5IK4A 1MS5A 3NV3A 3ZFGA 2ATFA 5T54A 4V2WA 3ZFGB 1LB2A 1REFA 5L36A 1SEFA 2A73B 1COV1 3POFA 4GMP3 3W58A 3I2FA 3LDKA 2XHNA 1IZ3A 2WO1A 5JOWA 3NV1A 1AXYA 1OSGA 1LEMA 5J7MA 3PVOA 2EA7A 3IDEA 1IGOA 5HCAA 1FYUA 5GJ6A 2G4IA 3PUAA 2PN5A 2ZABA 4NRMA 4O7XA 1Z0HA 4XHXA 5LRSA 5IATA 4MOAA 1YFUA 1Y3TA 4HSJA 1BMV1 1RUD3 1CX1A 2GMMA 2QQLA 2Q8OA 1WMFA 2CU5A 1PO22 5LY1A 2VG9A 4NR1A 1C1FA 4Q8KA 5FLHA 4UFKA 3DCQA 4TWTA 3KCCA 4WVZA 3BTXA 4XF3A 1Q43A 1W3VA 3Q8BA 1GP5A 1O8SA 3ELNA 4RL7A 3THCA 4AI9A 5FPUA 4CDXA 1CVNA 3J7MA 3PUIA 4CDXB 2YC0A 3ZXDA 2QKDA 4EE2A 1KFXL 3GJBA 3MIGA 4FPOB 1AYM1 4IGQA 5CFDA 5CFDB 2IXLA 2VVFA 1F5FA 4UAPA 4YFWA 2VOVA 2ZX0A 3Q8EA 5DZFA 2AEYA 3H3UA 3M7AA 4RD7A 2JE8A 4BIFA 3EHKA 4XF4A 1CJPA 3J7HA 1AX2A 2PHDA 1BEV2 2CGOA 1GU3A 5EWSA 5CFCB 5CFCA 2A6XA 1SCRA 1S0CA 3P6BA 4XUPA 2RS12 1ALYA 1PK6C 4TN7A 4FT8A 2VC9A 2WZR3 3OD4A 1K5MA 1K5MB 4K8RB 3VD4A 5F3GA 5GLTA 1LHUA 1OLMA 5B2GB 2R043 5EP9A 3IDAA 5C4WA 5C4WB 1QJX3 2UWAA 3QH6A 2K46A 4D3WA 5CU1A 2IVJA 1JHNA 5I0DA 1WBFA 3TRSB 4BISA 1D2QA 2R073 1GWMA 5C3RA 1BHGA 4CE8A 4MVTA 1W0NA 1CJDA 2ZGNA 4N43A 3DXUA 4N43B 4AVSA 1W6NB 1W6NA 3I59B 3I59A 3K4AA 3INAA 4P9GA 1RUI1 2E31A 4FPCA 4YM2A 3WNLA 3ZFEC 5AVAA 1GNHA 2O0OA 3ILFA 4A7ZA 1CWPA 2HWF2 2P6HA 4RFRB 5BNPA 5BNPB 2JDYA 3T2OA 1UZZA 2QZ3A 3AP5A 3P5BA 3PMSA 4O65A 1B35B 1B35A 1N3PA 4YW6A 2MEV2 1SHWB 5ERLA 4YZ2A 3W5MA 3BGAA 3RJ2X 3D0JA 4MLOA 1W6OB 1W6OA 4CU9A 5JMCA 4CUAA 5EYYA 3A0NA 2QCSB 4AAPA 1JZ5A 1NG0A 3FJSA 4O9GA 3RPQA 4XACA 1VBD3 2IXHA 1H4HA 2FDHA 1AXZA 3UV9A 1WMEA 2R062 4K1ZA 1VAVA 4XFCA 3FWEA 1QJY1 4IGOA 3OPTA 4YVWA 2R32A 1ND3A 1ND3B 1KDMA 2ZHLA 4YVWB 5LY2A 3ZDVA 5JSOA 1EYBA 2WLQA 3ZN4A 4MHRA 2E6VA 3KZ4C 5I8SA 2QNKA 4A6OA 4QD2A 3ZXLA 3MUZ1 3PVBB 3FFZA 1W0PA 2OS2A 3M3EA 3NNJA 1JZ3A 1U0AA 1EAH1 5EJZB 1W9WA 5J98B 2WYSA 4QDRA 3SH5A 2WSVA 2FD8A 1XE0A 4DNYA 1XNAA 4QQOA 5KXCA 5FZ8A 2GC2A 5LK7B 4KGGA 4FPHA 4QQHA 1TNFA 2O14A 3ACHA 2BOIA 4YW3A 2OA2A 5IYYA 1VP6A 4IE6A 3LF7A 3USSA 2AR6A 1PO11 5C3PA 2YU1A 3LD8A 3RYPA 3K3OA 1BK0A 3MV01 4XW3A 5GZGA 3BALA 2RS52 3DF0A 4BOWA 2Y6FA 1JOJA 1X36A 4IXLA 2UWCA 5CIRA 4O61A 4AFMA 4BA6A 1FXZA 3PDQA 1AR71 2PLV3 3RQ0A 3NL1A 3AYCA 4HXCA 2XJUA 5FMOL 5LWBA 3RZJA 2VMCA 3NVCA 1KQRA 3UGHA 3I3DA 3P3NA 4RGKA 1IOAA 2WNUC 2XWJB 4KQ7A 4Y3OA 2FCUA 4CCMA 3FUOA 4AHZA 1VBB2 1KJLA 2J1AA 4LIUA 2RR11 3R6SA 3ZYIB 1DQ0A 1RUH2 2WNVA 2DU1A 1UKRA 2WNVB 1XYPA 4EN8B 4QX0A 1SLAA 1RHI1 5IK7A 2BBVA 5A3OA 3AKQA 3ZIWA 3BU7A 4ZS2A 2WNVC 3I4IA 4Q2FA 1Q8OA 2XONA 3IMNA 3BI3A 3D82A 4NHMA 2WO3A 1W8OA 1Y9QA 1CIWA 4JZRA 3WG2A 5IFPA 4XIKA 4YGDA 2DUOA 2TUNA 5IVEA 2SLIA 1UWWA 3LA2A 5DG2A 3BODA 1FPN1 1HIXA 3DPRC 4I3GA 4K9SA 1PO23 4XF1A 3T30A 4DB5A 2RDSA 2RS33 3KGLA 3SQOA 4ZU7A 1UY2A 5FZHA 4HZFA 4LO6B 4A2UA 2E51A 4META 1RJ8A 4LO7A 2RVAA 1RUG3 1MZ6A 3G7DA 4XCAA 3RS6A 2QTWB 2OXBA 4XQ4A 4QQLA 3AJYA 4WVWA 2KXLA 3SC7X 4PF5A 1IHMA 3RWKX 3WF0A 1H1IA 2HH9A 1B09A 1IG0A 3GCWA 1YYNA 4PBPA 1QHDA 3RZZA 3RI9A 1W28A 1H4GA 1RXGA 1LHVA 2ID4A 2D5HA 3THDA 4QQPA 1UU4A 4P9YA 5AC92 5C4WC 2VW2A 1OF3A 1QJU3 1KS5A 1PO13 1COV3 1ZA7A 5D8AC 1WCQA 3VBHC 2FDIA 4URTA 4XABA 3RDIA 4XFIA 1RIRA 1SFYA 5K9YA 3L2HA 2TBVA 3E5XA 4PIYA 4N53C 1YRZA 3NMBA 5EPAA 4NIAA 3RZMA 4DO0A 2Z2SB 3ZOIA 1ZBA1 3LSDA 2X29A 2ZGPA 1KRIA 1UO9A 1H8TC 5FPBA 1WW7A 2UY8A 2OQ7A 5FPLA 5KR7A 1IQAA 3KHCA 1SBFA 4GULA 5JI9A 2WT0A 1LHWA 2OVUA 1DU3D 5HCFA 1KEXA 5I93A 5A1LA 1F35A 5FTTC 3W9AA 2WNEA 5KXDA 4HONA 1T2XA 4ATFA 2PLV2 1OKOA 3OF1A 4CDUB 3IB3A 4CDUA 4PI0A 2HWD2 5FZLA 4CEWB 4CEWA 4QPWA 1CZVA 2YBPA 3WHUA 4FXGB 1RUE2 4FQZA 4LBMA 4K1YA 4UF0A 4UF0B 2W3JA 3RSJA 3FLRA 4TLFA 4YYOA 1RUC1 5F3CA 1W90A 3LE0A 3N9MA 2OX0A 3MIFA 4NE9A 2GH8A 4QB6A 1BEV3 1AJKA 4N43C 4LO5B 4QQ2A 1RB8G 4YARA 2P37A 5FAXA 4NIHA 4QHOA 5CKQA 3N7KA 3VZLA 2Z69A 1IKPA 1E5HA 4K3UA 3DGTA 1RUF2 4ASMB 5C8CA 4M0HA 5C8CB 2VQTA 5GLUA 5A33A 3RNSA 5A33B 2QQJA 3AYDA 5HI0A 4K40A 5IVBA 1JXNA 1JUIA 1FMD1 1H2MA 4IE0A 2SBAA 5A7QA 3SMHA 2HLEA 3NRUA 1Q8SA 2R071 4UFJA 4GXLA 4Q26A 5LA2A 4E8CA 1VBE3 2GN3A 1RTVA 4AK3A 2CYFA 4GWNA 5LBEA 1W39A 3H1WA 2EF6A 4KBBA 4ZKTB 1RYYA 5JUVA 3EYPA 1Z7S1 2VM9A 3GBFA 2HWF3 3H1MA 1QJU1 1ND3C 3BCWA 2YROA 1GYKA 3J8F1 1SLTA 2BYVE 4HOOA 3W59A 4NHLA 4BQ4A 4P9IA 1G6NA 4B7EA 2QQUA 4YW1A 3ZN5A 2B5HA 1VRH1 4AVVA 5IT6A 1WBLA 3FC0A 4HKWA 2BDRA 1FV3A 4OFGA 3I2GA 1BVVA 3NV2A 3O7OA 2XVGA 2J1EA 4Q0UA 1W8ZA 1O91A 2W1UA 1UX7A 2A5ZA 1UY4A 5FWEA 5JPMB 1QNYA 2JX9A 4QXBA 1ND2A 1ND2B 1V6NA 1TEIA 2XBO2 1UW8A 4LHSA 2EALA 3B3QE 5APAA 4B7KA 2BP6A 2JEMA 2VVDA 3WNMA 2GC0A 1DYOA 1MVEA 4YGEA 5L9RA 4AW7A 1OA3A 5FZIA 3WY6A 4COVA 4ZU4A 1I5PA 3KT1A 4DINB 4QDSA 1POV0 2BVVA 4C91A 1ZRIA 2VPVA 4AVCA 2A1XA 1MQTC 4LXLA 3VDCA 2ZEYA 3VDBA 1TMF3 4ASLA 1A34A 4P9XA 4IEXA 1LODA 1UN1A 4JRLA 4LKEA 4B4PA 5EIYB 1ASJ2 4EZ4A 4LITA 3THPA 3ENRA 3OBTA 1HRV1 4RA0A 4MXVA 4IE7A 5FZEA 4EN0A 1JZ6A 2ET1A 3KCYA 5FZ4A 3ZXEA 3H8OA 2J1SA 2A7AA 4RFT0 4BHPA 3ETQA 3T1MA 1AR73 1W6PA 1W6PB 4OUMA 4YW5A 5FY8A 2LM3A 2P2KA 4YGCA 4PLMA 4EWAA 1W8TA 3D4KA 1ZRRA 3W20A 4N9HA 4XIOA 5CG8A 2F6BA 3VHRA 2ENRA 2ARXA 2VMFA 1WWYA 3B00A 1CR7A 1UYPA 2DCJA 3SEEA 5FUPA 5GLZA 1OVSA 1GFF2 3KB5A 4ES8A 4MADA 2D3PA 2LUWA 1WW5A 1U12A 1R1A3 4LT5A 2V09A 4I01A 3TNQA 2HWB2 1W0OA 4D69A 4GB32 3DYPA 3LA3A 1W9FA 2YB7A 4ZPIA 2XUMA 1E5IA 1RUD1 3AVSA 3N9OA 3NJVA 4COWA 5FRAA 4CDWA 4CDWB 5C33A 2IZWA 2D98A 2WUHA 3M3IA 2RMU3 2VZ1A 2B39A 2XOMA 3B69A 4AOCA 4LHKA 5HCBA 1MS3A 3VBFC 1RUC3 1DQ5A 4UBGA 3KVBA 5DN2A 1G9BA 3VBOB 3MLKA 3VBOA 4F7ZA 4RS5A 4RS5B 1GANA 3AP4A 5DZEA 1UY1A 2D3RA 2IC1A 1DFQA 3NNGA 3JD72 4UFIA 2DFBA 3L2YA 1LGNA 3SKVA 3QD6A 4IEPA 2FCVA 2R042 5CAZA 2BRTA 1UY0A 2VZ3A 1C5IA 2C5DA 1A78A 4J6GA 1W2UA 4PF1A 5FK7A 2VW1A 5A6XA 2GC3A 4XAAA 2B8MA 1NCRC 4OULA 1FMD3 5AC93 1BQPA 4OZOA 1LNSA 1ULOA 2LROA 5FIXA 4CYDA 1WD4A 2BNNA 1RL3A 1AR62 3I97A 4LO8A 3CF6E 4XUTA 4QMAA 1T6GC 2GH2A 3ACIA 4KU7A 1HB1A 2ES3A 4BDVB 2YY1A 1OQEA 1D4VB 2R0FA 5LBCA 3SNMA 5BUVA 1YQ2A 4ET7A 4XUNA 4JCKA 4K21A 5DG1A 3HT2A 4XTMA 1YI9A 2YYOA 4W6WA 1S0JA 3FMGA 4CP9A 4CP9B 2PHXA 1DCSA 3VBRC 1OXCA 4MUVA 1YUDA 4PLOA 4QPGC 1O6UA 2VCCA 1H9PA 3LSEA 3KT7A 3MHZA 1IPKA 3WF2A 3VUOA 1O3QA 1JZ2A 2XLGA 1D7PM 1G9FA 1UYZA 2QJVA 1S2KA 2Y6KA 3VV1A 4EWDA 2ZGSA 5C70A 2LS6A 4QX5A 2H0VA 4Q4W1 1JYWA 4UI9L 3J4UH 1MZ5A 1UZYA 3KCXA 2YG0A 4XJ8A 5FZAA 2J1RA 5I0TA 4LHNA 2D6MA 5FYZA 3WNNA 4NAOA 2DVAA 1UY3A 3MW4A 2D6OX 1BBT2 4Q4Y3 3USUA 3USUB 5FKCA 4WM7C 4BH9A 5FP9A 1LEDA 1KS4A 3SCFA 1NY72 4K6BA 3WEZA 2JDZA 4M4RA 3ALQA 3QOPA 3RG0A 4Q4V1 3ZXGA 5D8AA 5D8AB 4XDPA 4E27A 3UNPA 4QB1A 1ULDA 4WZCA 4H14A 5ABJC 4WM8C 4OMDA 2JXAA 3LGRA 4MGYE 1QXPA 1CN1A 1RJ7A 2XQRA 5IVCA 3HWJA 1HN0A 5A70A 4LBQA 4LBQB 1DQ1A 1WMXA 4MHUA 3ZSJA 2A6WA 4GJYA 2AC1A 4I0WB 4EN6B 1JYNA 2W94A 1LULA 2ZTNA 2DCKA 2RS53 1FNZA 2F17A 3WX5A 1A6CA 4BCUA 5BNPC 4JHTA 5DDJ3 3M1HA 4LQRA 3VKFC 3GNEA 4AG4A 3NAPA 3NAPB 2YBKA 3SH3A 5A80A 3BIWE 1PNGA 2WFF3 2JG9A 2JG9B 3OB8A 4S2HA 2MPFA 5FOJB 2W92A 2PQQA 1US3A 3EXUA 1ENQA 3OGJA 2VE1A 3AXEA 4AI1A 1FOD1 5CEHA 1NUKA 4IEZA 4WVMA 4WVMB 4HVOA 4Z07A 4UFHA 1GOGA 3M2MA 4QPGB 4FFIA 4QPGA 5A7SA 1CAWB 1CAWA 1QJEA 3MI8A 4QPIC 5I0UA 2GAUA 2F4PA 3OY8B 3OY8A 1S2BA 1LOBA 3ES1A 3U10A 3M3CA 2HKXA 4PBOA 1UMIA 5T5OA 1FNYA 1C1LA 5FK8A 1JS9A 4C1WA 2XHKA 3HQUA 1SACA 3AMPA 4NPRA 3IPVA 3IPVB 5GLWA 2XLFA 2VMIA 2VQAA 4KI5M 5EYXA 4XZUG 1Q3EA 3ZYGA 5BNOC 1QQP2 2XG3A 4IEQA 1LGCA 3ZSLA 3N35A 3H7JA 1EV13 3CJIA 3CJIB 1O7FA 4YFZA 4BXFA 4BQ2A 1OD5A 5CBLA 2V73A 3ACFA 3J7NA 2JKXA 5FZBA 2RV9A 2YUEA 1LU2A 2P3YA 4E2QA 2WWJA 3ZO0B 5CADA 4EYUA 2ETEA 3OGGA 1Q8PA 1H2KA 3UESA 2B45X 5I8YA 1GOHA 2QDRA 2XUEA 4AXOA 3S5AA 2VNRA 3FL7A 3VBOC 4NIGA 2FBEA 3R0RA 2PYTA 2WC2A 2WLPA 2RS13 4LE3A 1QXJA 1DQ6A 4YZ4A 1QGLA 5B4XA 2QQWA 3VKNA 3BTAA 1GV9A 1QMJA 4QX1A 4X6RB 4Z2AA 3BTYA 1QOTA 4E4ZA 2KD7A 1V9U1 3PNAA 4Q0SA 2WS92 1NA1B 1NA1A 3N9QA 4OI2A 4CZSA 3W21A 2VO5A 3D6EA 4PQQA 1PVC1 4IEYA 2WINB 4OQ9A 1DGLA 5EJ1B 3K4ZA 1D4M1 3DECA 4NN0A 1GSLA 1AYN3 2VZRA 5K8SA 4NHKA 2WL1A 1D2SA 4LUKA 4A3ZA 4AGGA 2JG9C 1ULEA 1H2NA 3VD3A 3NKGA 4LOSA 3E6DA 3LEMA 1DLLA 2PA7A 3NAPC 4IV1C 1RUG2 2B7YA 4RN5A 5FP8A 5G04L 3O1VA 1R083 2ORXA 4GAZA 2J1TA 3C7HA 2GMEA 4NIIA 2YC2A 4J1WA 1NAEA 4DXRA 1QOSA 1RUJ2 2IXJA 2V5YA 1HV1A 3AFGA 4GWIA 1T6BX 3ZPYA 4KWKA 5C3SA 2E7AA 2RR13 1UKGA 4IV3C 2PAEA 4XQWA 4P00B 2HWD3 2J22A 2WYFA 1CAXA 1CAXB 2DWRA 1DQ4A 4JHZA 3B5LB 3V56A 4CCKA 1OUSA 2ZX4A 3NNMA 1W05A 1W06A 4LORA 4YG6A 1ZVFA 2R063 4EN7B 1HRI1 5EJ3A 2BW8A 4DUWA 5F39A 3FE5A 4G3YC 2Q8CA 3CO2A 1AR91 1VE0A 3T4HB 5J48A 1VBB3 3WLUA 3CZUA 4Q4X2 1GBGA 1EY2A 1KFUL 2UWBA 4I30A 4W6YA 4W8JA 2Q8DA 5CKNA 1ZX5A 2OPKA 4UXAA 5ACA3 1FI2A 1C57A 5I0SA 4AYUA 4Y26A 3POEA 1YQ6A 2OT7A 4HT1T 2DCZA 3SHRA 4ZZ8A 2I07B 2CGPA 1HXS2 4DRRA 5FBZA 5A6QA 3NWKA 5KBFA 3CDZB 2YZ4A 5J3UA 1WMDA 3AKPA 3OCPA 4JC1A 5T50A 4DXSA 4S2GA 4ZZ5A 5JIAA 2QDNA 4FFFA 5JXHA 1F8VA 4RHV2 4P9JA 4QU1A 3KHBA 4P5YA 3HNBM 4AZZA 1OVPA 4GMP0 4AQ2A 1G8WA 4QKDA 3AL6A 1ZM1A 4CXYA 2Y6GA 2R30A 4AQ6A 4F3JA 2HWC2 1JYCA 2YU2A 5HBAA 4YZ5A 2X53S 1EUTA 1XXNA 4W4ZA 2WFF1 3VZMA 4FTEA 4JDOA 5DAWA 1R092 2VNVA 3U4SA 4XTPA 2BPA2 2JDHA 3N7JA 3CL1A 1H30A 5FMDA 2C4XA 3OUIA 1AL21 5JVVA 3C2UA 2P34A 1N1SA 1GZCA 2DDUA 3POSA 2XLAA 5L73A 3WP5A 1WZXA 2W52A 2DF7A 2RG4A 1AJOA 3POIA 4XF0A 1XE7A 2ZGMA 3KQRA 4IERA 4M01A 1ZBA3 3A0KA 1Z7S3 3OPWA 4QGMA 2G1MA 5DAQA 2B4KA 3AP7A 2J7MA 4UFLA 4A6SA 4HANA 1H1AA 1OT5A 3ZYBA 3LIGA 2Q1FA 3ZYRA 5IK5A 1BMV2 3CU7A 4Q4W3 3TOJA 1TZOA 4FTBA 2WT1A 3I2DA 3KMHA 1CZTA 5T5JA 2D93A 5IUQA 1UIKA 4Q4Y1 4MYEA 2ZACA 2PFWA 2OYZA 1DG6A 3S0MA 3PIGA 2ZAHA 4KH9A 3AKRA 5L7OA 5L7OB 5TSWA 1GOFA 2K2SA 3B02A 4BJ0A 1IPJA 3BOPA 3Q8AA 3WW4A 1YJLA 4AEKA 4Q4V3 2ORZA 1CPNA 4JGZA 4JGZB 3UK9A 3VHNA 5FLIA 1BEV1 4E2SA 3MFAA 2D7FA 3JZVA 4ZHNA 3CMGA 3IDBB 3BYWA 3VZNA 4YWAA 3ZLIA 5BXXA 3WW3A 2A3YA 2RS11 3DYMA 3OOXA 4RYDA 4WBBA 2Z4FA 2VMEA 1YQ5A 4UBHA 2DVFA 1WA6X 3S6PA 3ZR5A 3O1TA 3OPZA 5AFBA 4PT6A 3T0DA 4BU2A 2V72A 2DU0A 5T55A 2ZXQA 2VECA 2ZJCA 3I3EA 3SKJE 3T2PA 3V64A 1YXWA 2WAAA 1QY4A 5J09A 3I2OA 1MZEA 2PHLA 2CAVA 4Z82A 2PQSA 1DDLA 3IN9A 1URXA 3H0OA 3AMNA 2A6YA 2AGSA 5IWFA 2VQ0A 4OHYA 5FPAA 1D4M3 3HVDA 3FBMA 3GZAA 2ZGQA 4OHVA 1HRV3 2A6ZA 4TXWA 4QXCA 3PVNA 1NCQC 2WNOA 4HKLA 4MG2A 2HWF1 4JQTA 4GMP1 4BQYA 3GF6A 1AUYA 1R081 4L11A 3ZFFB 3ZFFA 1OMIA 2XKPA 3AKTA 4AQTA 2Y38A 4XMAA 2J42A 2P3KA 3AXDA 3U14A 2DFCA 2WDBA 3MGUA 3ZXFA 3I2IA 3UJOA 4D94A 4DXTA 4BPZA 1TNRA 1PIV1 1C8M2 4Q5OA 2WZ8A 3FFQA 5FMCA 3VD5A 2WNUA 2WNUB 2Y6LA 5FYMA 3ACLA 2R061 4FP3A 5JIUA 4LEJA 1FV2A 4QAWA 4Y22B 4Y22A 1EPZA 4PIXA 1IS6A 1LENA 1JZ7A 5T5LA 4NIDA 4IEOA 1UPSA 1LOEA 4JKLA 4MSVA 5A7OA 1I3HA 2IWGB 4N7IA 3KSCA 3P3PA 2BVBA 5H9QA 5LEJA 4DRVA 4AVTA 5JMOA 3WP6A 5BNNA 1MEC1 5BNNB 1H6XA 2RMU1 3PJQA 2JDKA 3Q8CA 1TG7A 1F5JA 3U75A 3PTRB 3ME2A 1UU5A 5F3EA 5FYYA 1CAVB 1CAVA 2WN2A 1ZRDA 1G9AA 2IFRA 1JYVA 3QACA 4AI2A 4YW2A 5KHIA 3WDUA 3WF4A 1BK1A 5KHHA 1W6MB 1W6MA 4OI4A 5FZ0A 4G9SB 2QVSB 2OZ6A 1PO12 1GKBA 1C4RA 1SLIA 2ZBJA 4P5HA 5HPOA 1BLZA 2W39A 4HPKA 3JCIA 4HPKB 1WLWA 2O8OA 3HJRA 3GHMA 1JN2P 5JZGC 2ZAAA 1GZTA 1VAKA 4LKSA 3ST7A 3KT4A 5EHDA 2W91A 4RS5C 3G6JB 4JQRA 4U36A 2X05A 2XPJA 1REDA 3LDRA 4KWJA 2IXIA 2R16A 1JUHA 1NZCA 2E26A 4R8HA 3JBG1 3LOBA 4R52A 2YV8A 2HWB3 5DAVA 2FCTA 5G05L 2RE9A 1LOFC 1SDDB 1U5XA 2AYHA 4AWDA 4FVVA 3PJYA 4BK5A 3IT8A 3I3QA 4FPGA 3M4FA 1SG3A 1W8UA 5KWRA 4CTEA 1LHNA 5A3NA 3A23A 3MO4A 1JMUB 4MV2A 2NPIA 3GDBA 3SCHA 1ZZCA 1J1TA 1YLLA 2RM21 3LPGA 4HMZA 4QX8A 4OI1A 2NP0A 2WQZC 5LBBA 2NMNA 4IUGA 4LUMA 4NO4A 4NWVA 4ZONA 3WNPA 2BBAA 5J96B 1AR82 1YO8A 2VOXA 2VCMA 4IV3A 4IV3B 4AFBA 1RUJ3 2RS32 5ACA1 1NT0A 1OH3A 3GALA 3I54A 4QGLA 5E16A 4HVQA 4LBQD 3UKNA 2PHWA 4I02A 3RYKA 2PHTA 2VNOA 5FO8B 2WQ8A 2IFWA 5FP4A 1X50A 4LE4A 1UOJA 4L2NA 2FHRA 4OCTA 1ZYBA 1C8M3 4XFBA 3MIBA 1OFSA 3SH4A 3UT0A 3FHQA 1TQ5A 2VULA 4NAMA 3ZKYA 1TVGA 4CRQA 3EBRA 1G9DA 4LBOA 1PGW2 2K0GA 1PO21 4Q8LA 3IZOA 1PX3A 1MS0A 2ZEXA 1VR3A 1VBC2 5FR3A 1Q5OA 1ZZBA 1GNYA 4XOGA 5C5TA 4FOVA 1HB3A 1OPMA 1MS4A 4FPYA 5T52A 1DGWX 3OBRA 2OKXA 3TBDA 3U37A 2P1BA 3ZSEA 4CCCA 5AC91 1OKQA 3HOBA 3WG1A 3ACGA 1IPSA 3ORJA 5FXWA 4CU7A 3EQEA 1W99A 1AYM2 1WGPA 2RJKA 1APNA 2ZX1A 2JJ6A 5DDJ1 5JWPA 4Y33A 4ZU5A 3LDBA 3URFA 4GIQA 3WW2A 5BYNA 3BKZA 4OHZA 4KWLA 4R9AA 3H1YA 3ZFGC 2VTXJ 2YXSA 4MZUA 3IMMA 5FXZA 1V6JA 2Y64A 3MEPA 3ZVXA 2BERA 4BLJA 3LKJA 2VUJA 2KA3A 4OZXA 1FOD3 1XQNA 3OGVA 2NMOA 1XSQA 4HSLA 2P5BA 4BMEA 3WCSA 1RVF2 4EQVA 2HWE1 3H8XA 4LIVA 3VBUC 1SLBA 5DUUA 1ZZ9A 5F6KA 4CP0A 3K3NA 1PIV3 2VCAA 2LRPA 1POV3 1Q8VA 4Y5Z0 4ZXKA 3K51A 4H7LA 4PHZA 2X8KA 5IAXA 1RHI3 4Q0PA 2DUPA 3AB0A 3POJA 2YPJA 1AVBA 5FY4A 2FDGA 1VBA2 2AZ5A 1N3QA 1S4CA 1SPPA 1SPPB 4IETA 4QKFA 3O12A 4LOTA 3RI8A 1XU2A 2ZGOA 2XVKA 4JKKA 4B29A 2XWBB 4YM1A 1ZBE1 2WQ4A 3NNFA 4ITCA 4JGYC 3T09A 3ZXAC 4EWEA 3PLQA 1HLCA 3WUCA 4D8MA 1MEC3 1WCDJ 1OQDA 3O1PA 1V6LA 2XJRA 1WA4A 3VD9A 4AFDA 2XBO3 1SDWA 3B9CA 1NLRA 2JDAA 4LPLA 1SZBA 2JE7A 4CDWC 1VBD2 1TME2 5K0UA 5K0UB 5FZ9A 5E8AA 4GKYA 3OEBA 1FMD2 3DEMA 4Q1RA 4LHLA 1WD3A 4NRQA 4COUA 2W47A 2XDVA 1LOFA 2VMHA 4CPBA 3WQBA 2R072 5DXDA 4HFSA 4DQAA 5FPVA 4OLLA 4BM8A 3KQ4B 1OI6A 1DP0A 3VBUA 2GNDA 3VBUB 1S55A 2D6NA 2W1SA 5A1AA 2WIIB 3MICA 2DTWA 4I0AA 4BZ4A 4CA9A 1N47A 2DTYA 4XEZA 2WZR2 2WS93 3UJQA 2GALA 1RGSA 1PM7A 3IDCB 3J8F2 3WG4A 5HXMA 4QWNA 5C9AC 1XJAA 5ABJA 3PMEA 1AYN1 1VBE1 2B46X 2BTVC 5ABJB 1IG3A 2OQ6A 3N7MA 5EXOA 4MGSA 4LBNA 3TAYA 4A41A 4R9BA 5FP3A 1V6KA 5H9SA 1QDCA 5LB6A 3WG3A 1XPWA 5FZMA 1HDKA 3FX3A 4MGKE 2D6PA 4L0PA 4CCDA 4AHYA 5L7OC 3JB8A 3N7LA 4WM8A 4WM8B 5I0RA 3EO6A 2WN3A 3LCPA 4KG8A 2FDFA 1HB4A 2YDEA 3WF1A 3I3MA 5FZ3A 2OZJA 5FQ0B 5FQ0A 2CNAA 1HV0A 5FYCA 5IVYA 4DS0A 2H6BA 1MQTB 1MQTA 3WZ1A 1SMVA 3VL9A 1O3RA 1OURA 2ZS6B 2LW8A 3SCGA 5A1FA 4OYUA 3K4DA 2ERFA 1J1LA 1MZFA 4ZXEA 1TMF2 4KWUA 3ILRA 2HBUA 3VBRB 3VBRA 1VBB1 3EB7A 3PUQA 5B4NA 1CONA 1W2TA 2D43A 2RR12 3BPSA 1CD3G 1PM4A 5FZCA 4I3PA 4B1LA 5BNQA 1GICA 1HQWA 1PGL1 1ASJ1 2JIGA 3HN3A 4LLOA 5CISA 1UXXX 4GKXA 4XFFA 5T3NA 3H3LA 1JODA 1H9WA 4Y1VA 1Q8QA 3JQXA 4CDUC 4FFHA 2B9VA 2Z79A 2G9GA 4PLNA 5JDBA 4RGGA 2VZSA 4LO4B 3ZN6B 3ZN6A 4UW4A 1E5RA 3KV5A 3O0VA 4AI0A 2DBNA 2IXCA 4EJRA 1O5LA 4N7UA 1UQXA 1S1AA 3EJKA 4IE5A 1GQHA 2PAMA 1N1TA 3R05A 4YW7A 4HK9A 4N90A 1NCRB 1NCRA 5FJHA 3AZXA 4FAHA 5FY0A 2BFUL 3QCWA 3HBKA 5JI7A 1AL23 1UOBA 3J8F3 4BXSV 2CSGA 2D6KA 2PHFA 3VBFA 3VBFB 5HCHA 1PK6A 1PK6B 5F9TA 2WKKA 2JD9A 4UW5A 2NM1A 2V4VA 3HT1A 1BBT3 1POV1 2E53A 4NJ4A 4RR3B 4RR3A 5F5IA 1J59A 1YQCA 4DEQA 4E8DA 5JAXA 1JW6A 4CEYA 3UL2A 2IUWA 4CEYB 5IVFA 4JVAA 3MLLA 1YWKA 2ZZJA 2GNBA 2A6VA 3DUIA 4QPIB 4QPIA 4BB3A 4BQWA 3CEWA 4N8MA 3ZM8A 5JOZA 1VRBA 5A7NA 4OVEA 5J37A 5E6HA 2W68A 1UU6A 4BYYA 3VDAA 1S0GA 4OMCA 2H6CA 3ABZA 1ZBA2 1LOGA 5LA9A 3TN92 1JYIA 3GZEA 1VB2A 3LAGA 5FKBA 4MGZE 5BY5A 5CYYA 5IHRA 5BNNC 3J9SA 1RC6A 2Q5TA 1RMU3 4IV1A 4IV1B 2JD4A 4LNVA 5LZ6A 4YZ3A 4AEDB 4AEDA 2R6QA 3N9NA 1M4WA 1QU0A 3DV8A 1R1ZA 4PI2A 1AL0G 5F2WA 2QZ2A 5J1XA 3ZIXA 4HL0A 4ATEA 4EN9B 2XJQA 2QQNA 2ZKLA 3HNMA 4CVUA 3UYJA 1WCSA 2XJPA 5J36A 4QT6A 2ARBA 1UZWA 4CCNA 5FY7A 2LALA 3V0BB 3V0BA 1Y43B 1ZZ8A 4Q29A 1RUE3 4LK7A 2EXHA 2JDPA 3SXWA 5K0UC 4R9CA 4YLZA 3POYA 3PVEA 4FPLA 2VXRA 3R4UA 5KHGA 4XC9A 1BZWA 1R093 2C0ZA 4E4SA 5FO7B 1AZDA 3MPBA 5A3LA 4LKFA 3AZWA 5FFOC 1BXHA 5CFCC 4Q27A 3LEKA 3AMHA 4DMIA 1ODMA 2BUKA 5FZFA 5SV5A 3OGSA 4OUEA 1ZREA 1NLSA 2GU9A 4GALA 5FZOA 5FZOB 2DURA 1C28A 2ZMKA 5C3OA 4X6QB 5C6CA 2G9FA 1YIPA 5DZGA 2WO7A 1HQNA 1UD1A 4TTGA 2FMDA 2YGMA 3VBHB 3VBHA 4YVSB 4YVSA 4CDXC 5JSPA 1OBNA 3O1RA 3BPZA 4V1PA 5LW9A 3OJBA 3GJAA 1UOGA 1J83A 3GXUA 4BK4A 4A7YA 4FOWA 4HN1A 3WSOA 1IKQA 2VTXA 3JU9A 5FLJA 1K5JA 5D1IA 3POBA 1LECA 4XJ9A 5FXXA 1BBT1 1CQ9A 5IJRA 3J26N 1UAIA 3CQOA 4CCJA 3WINE 3E6CC 1WLCA 2PXJA 2A70A 3K48A 1NY71 2CWMA 4BIOA 4H3WA 1ZBE3 1ND2C 1NKGA 2NN8A 3CIHA 2Q1MA 5DUXA 4DY5A 3KS7A 5A32B 5A32A 4JX0A 2CWSA 1NQDA 5FCCA 1ENSA 1F4AA 4IL7A 1EV12 3VKLA 1YHFA 5A3WA 2DV9A 1DGRN 1VB4A 2ARCA 3OBZA 4IGPA 4QGNA 2ZOEB 4XPVA 5LASA 3RMXA 2J1VA 2ZA9A 4B4QA 4QX2A 4ES9A 2Y33A 1WKYA 4M4PA 5AFEA 3VKMA 1XNDA 1EAH3 1X7NA 2AENA 1V70A 1NXMA 2JICA 4K7JA 4M3CF 3HNYM 1H8TB 1H8TA 1JU4A 1O59A 3D8CA 4YVWC 4SLIA 1NXD1 3IAPA 3PU3A 5EV7A 4Q0VA 3HPNA 5LA0A 1BCXA 1W03A 4F8AA 4ORFA 4LK6A 1J3QA 2VCBA 4KNCA 1DF0A 1SFNA 3VB9A 5IVJA 2CTVA 2W46A 3K77A 4AI3A 3JD73 1KXGA 1RUI2 5FZKA 1RVF3 4GH4C 4XDQA 4FOYA 3U1XA 1G7YA 4XUQA 3GBGA 3I7DA 2ZGKA 4Y4RA 5JCTA 3WXPA 1K12A 2K9ZA 2O8QA 4OHWA 2EICA 3VDDA 3VDDB 4AL9A 3ZX7A 2EIEA 3S30A 5F7UA 4NPMA 1LGBA 2X5IC 1BJQA 5FYHA 3ECQA 3KF5A 3D0SA 2HYKA 3E1F1 4YM3A 1NX9A 1QJX2 1XNTA 1HRV2 3K75B 5JLVA 5E1RA 5E88A 2CY6A 1O3SA 1O4ZA 3S57A 2Y34A 4AFAA 1UYXA 4W6XA 2RJ2A 2W1QA 3VHOA 1N1YA 3VKOA 5FJKA 4A4AA 1W2AX 4BQ1A 4NWWA 1VRH3 3HQRA 1JOPA 1X9TA 3ILNA 2R7EB 3FZ3A 3FN9A 1YEWA 2QQVA 1MS9A 1DIWA 3C3VA 3CBNA 4XBNA 5ANQA 4A45A 4HLTA 1OC1A 3PUSA 1RMU1 4UW3A 2BQPA 2YMZA 4H7MA 4UWDA 5JXJA 2UYBA 3TEZA 4E4DX 2NYYA 4A3XA 1R1A2 2R1BA 3GM8A 2B9UA 1QIQA 4OHXA 1PZ9A 1PZ7A 1Y7BA 4RR3C 1WCKA 1LCLA 4UOJA 5CZKA 1DBNA 4KU8A 1GQGA 1ZRCA 3KV9A 3OGRA 4GD4A 2JDNA 3QLQA 3BN6A 3J7LA 5JXIA 2XL7A 4AGVA 3I3BA 3E5QA 1V9U2 2Y26A 1L3JA 1W04A 3CKHA 5DQ0A 3RRDA 2RS51 4KG0A 1V0AA 2FZ1A 5FYTA 4PCRA 2IXKA 4L97A 4RQPA 2C1FA 3LEIA 4RQPB 4GJZA 5FO9B 1K45A 3GGLA 4W65A 1AR72 4CU8A 2WSUA 1B35C 4Z1VA 3A4UA 5EZWA 1S2EA 4ISQA 4JV4A 1O4TA 3ZSKA 4CSWA 5FDBA 1V9U3 2P6CA 2VU9A 3KV4A 3JD71 2WA3A 3JBG3 1OLME 2I45A 3B94A 1ZRFA 2R041 1H6YA 3VN4A 3NNLA 2WRAA 3O1OA 2W9XA 5IW0A 2R49A 3HBZA 3Q8FA 2QQKA 1HW5A 1NLQA 1RHI2 4RHV3 3AX4A 2WWUA 2UURA 1QH6A 4QM8A 2ZGLA 4H55A 2G19A 4HKOA 4CP2A 4D7TA 3NV4A 4DPNA 2W5FA 5FUNA 3GCXA 3N3HA 3T3YA 2BNOA 4M0NA 4QDQA 2XVLA 2RM23 2DVBA 1VPHA 3AZYA 1N3OA 5A7WA 3OTFA 1COV2 4X8PA 5A7WB 3TNPB 5F3IA 5I8TA 1UYYA 3UGFA 1AR92 1JBCA 1YFWA 1X82A 1MR5A 1I5ZA 1XRUA 3B9IA 3KD4A 1CZSA 1W3XA 3IWZA 2UU8A 5GALA 5JOXA 2JB4A 3ASIA 1HRI3 1F2NA 3NJYA 2EIDA 2VZPA 2W08A 2GZWA 1H8VA 2CAUA 4Q0QA 1NE6A 2VW0A 4Y1UA 1QEXA 3MFCA 3C7EA 5DUWA 4WVVA 4LKDA 3H3ZA 1ST8A 3KWVA 1AR93 3RGBA 1DYPA 1N1VA 5GKAC 1RUOA 2V5DA 3QH7A 4Q4W2 2GSYA 4JDMA 3KV6A 2HEYF 2BEOA 2P4EA 1VBC3 2ZGRA 4MGTA 5BV6A 3BOWA 1LOCA 4Z92B 1C8NA 4OI0A 1VBA3 1OUXA 1PMHX 2ZHMA 4O9EA 5IFTA 3HMYA 2HJIA 4D0QA 4KGQA 1VMHA 1R091 4PJYA 4BQ5A 1HN1A 2YGLA 4Q4V2 1ZZ6A 3JUUA 2BGOA 3KGZA 1UOFA 5EQUA 1LOAA 3AMQA 4QHZA 3SEPA 3TYJA 3PIJA 3WP4A 2VBPA 1H1MA 3JQWA 3FHAA 4NPLA 1UIJA 2FQPA 2ZZQA 5H9RA 3P1IA 3A22A 2Y60A 1RUF3 2YHJA 1PMJX 4YVSC 1HJGA 2GN7A 1S0BA 2C26A 5FZ1A 2BZDA 2NQYA 4LBJA 3MBWA 3EMRA 2OPWA 1SLCA 4M3CE 1F9KA 3WOGA 1K3IA 2PLV1 2GC1A 2HWD1 3V0AB 3V0AA 2VVEA 2A75A 2Q30A 1XYOA 3RMYA 3L9JT 4R4XA 4XMIA 1GP6A 1UMHA 3AP6A 1RUC2 4NRPA 3S7IA 3WD5A 1QNWA 3ETPA 2FZ2A 2DVDA 2I2SA 4FQ4A 1MVQA 2P3JA 2WBKA 4GA9A 2XKOA 4Q1PA 4ONUA 5C9AB 5C9AA 1AF9A 1RINA 3VZJA 5FOBB 2HYXA 3T2TA 2ADEA 2MEV1 3C7GA 3FLTA 1UF2C 3DYOA 3ZFEA 3ZFEB 4ASKA 1VMFA 2XQXA 1CPMA 2AACA 4M3CA 4M3CB 1ULPA 1V00A 2EAKA 3SITA 4XF9A 3RFRA 3IAQA 4BQXA 3H7YA 4EROA 4KBZA 1AX0A 2VOWA 3AFKA 4AEMA 4J1XA 1M06G 5D21A 1QJY2 4GZ9A 1Y4WA 1WW4A 5A7PA 5IVVA 1KDKA 2VZOA 1ASJ3 4HBNA 1GWLA 1KITA 4LLFA 3IM0A 3WNKA 2WO2A 4L92A 1HB2A 1JHJA 1EUUA 2GNTA 3U4XA 5F5QA 3AP9A 1ZA4A 4CUCA 1QJU2 1XNCA 2C9AA 5LATA 2XH6A 3S5QA 4TZDA 3TB0A 2QE3A 3RZGA 4HN0A 1UCXA 3AJZA 3B93A 1EAH2 5FZ7A 4NUBA 5JR2A 1VAMA 2DCYA 2RDQA 1R082 1J58A 3BTZA 3HIFA 3GYDA 4E9KA 3ITQA 4PDWA 4PDWB 3MLJA 4AF9A 3H42B 2P3IA 5M0TA 1DYKA 3IIAA 4YZ1A 1QDOA 1QWRA 3AL5A 1PIV2 1X33A 4PDWC 4QKNA 1UL9A 3WNXA 1VJ2A 3LZZA 4HVRA 3WDVA 3I2HA 5FREA 3MIDA 4XFGA 2VH9A 1I6XA 2C24A 4URAA 2D44A 3U07A 3TWIA 4FFGA 1GMMA 3HR9A 4P14A 5F6LB 5CFDC 3MW3A 5GLVA 2QQIA 2E33A 3PUHA 3V65A 2XJTA 2A71A 4NROA 1FX5A 1XBFA 4DUVA 4COZA 1I1EA 4K8FA 4G4FA 5FZ6A 1QOOA 5JSRA 3NKTA 1L7LA 4CDQC 4I2OA 1S0FA 4FPJA 2D40A 4K20A 4L99A 5HXVA 5BNOB 1J3PA 1ULFA 4YW4A 5BNOA 2ZGTA 2BOJA 3ZMNA 4N53B 4N53A 4S2DA 1STMA 1RUH1 2NZ9A 1AHSA 1YNAA 1I9RA 1UX6A 4HG6B 1GWKA 2MEV3 4COYA 3VL8A 3VDDC 4QX7A 2W1WA 4BMBA 2DVGA 2RDRA 4CPBD 1HQLA 4OQ8A 1OH4A 2BFUS 2VBDA 4CEYC 1HKDA 1HRI2 1VMJA 3N36A 3RYRA 1POQA 3H9AA 3IIIA 1G9CA 3KM5A 4GH4A 3M3QA 4GH4B 3VLBB 4YSFA 2D5FA 2YFUA 4MH0E 4AFCA 2EVXA 1L7RA 4TYSA 2WA4A 5FY5A 5LRRA 1W2OA 4Q4X1 3DKWA 1FPN2 3HN1A 3RZKA 5F32A 2HEVF 4D6SA 2QFEA 2VMGA 3JBG2 4YGBA 2XXZA 5KC5A 5IK8A 1WLTA 3F2ZA 1X8MA 2ZMNA 4IEWA 2CHHA 3TEXA 2H0BA 4QXHA 1ENRA 4XJAA 1W2NA 4XXPA 3MF9A 1XOYA 1OOPA 1OOPB 3AK0A 3M70A 1OPOA 3DPRA 3DPRB 5E89A 4FP2A 3VBSA 3VBSB 4KMQA 4XAEA 4ZY9A 1EPWA 4RHV1 3WT3A 4LBLA 4FAGA 3I2KA 4QKBA 3DN7A 2BGCA 2HWB1 1DHKB 1PX4A 3WDWA 4XYXA 1K42A 1X9PA 2VR4A 5BPXA 2HWC1 1V6OA 3SLIA 1LR5A 3O14A 2MHFA 4JDNA 4LJHA 3I2JA 1LTEA 1RUD2 1GP4A 4C8DA 3W5NA 2WFF2 5A3UA 3CHXA 1IQDC 1XSRA 5KC6A 2OUJA 1AR81 1VLNA 4A44A 1CIYA 1QF3A 1UNBA 2IVIB 2UY9A 2TNFA 1KJRA 4U2AA 3AKSA 4JGZC 2Y0OA 4D6RA 1RUNA 2QBXA 4MO3M 4XFHA 4CUBA 4XBQA 4V2VA 5I91A 4B1MA 5A3MA 3NO8A 3RZHA 2C6SA 3ZXKA 4QPYA 1PGW1 3GZUC 4P9WA 4FXKB 4FOQA 2VAUA 1RUH3 1VBC1 2Z42A 2VXJA 2E7TA 1LESA 2OUHA 1RXFA 5GZFA 1E5SA 4Q4Y2 1E57A 1OD3A 3ATGA 5IAVA 3NSTA 5T5PA 3WUDA 3BU0A 2ZHKA 1GUIA 3MUY1 4NMIA 4FCAA 5KHKA 1JZ8A 3WDXA 1RUE1 2XB6C 4E2GA 4C0HA 4YM0A 1W8HA 1O3TA 1HXS3 2VD7A 2X09A 4EV0A 1QXRA 1LAJA 2ILMA 1Q56A 2VJXA 4R4ZA 5F5CA 3CJXA 4Q4X3 1LU1A 3K46A 3MIHA 1ZZ7A 4SBVA 4XILA 3WQ0A 3LWCA 4LMFA 4IESA 5GZCA 3TEYA 2Z5WA 3ZSMA 2EXIA 1WCUA 1RUF1 2J1UA 1RVF1 2WT2A 3M3OA 5FBJA 2BGPA 1QQP3 3MYXA 5DUVA 1UXZA 1OLQA 1MS1A 2L9LA 2ZEZA 3LEGA 1OOPC 3AM2A 4QB2A 4WM7B 4WM7A 4XXAA 5FYUA 2UYAA 5HV0A 4CUGA 1O8PA 4CCEA 2PHRA 4L8QA 4I0BA 1NE4A 1GNZA 5FYIA 4WZFA 4XURA 2LTNA 4DUXA 2HWE3 2HWC3 1RUI3 4NHXA 4HK8A 1YFYA 5C8CC 1Z7S2 1O5UA 5A6YA 2CV6A 2VOKA 3NQHA 1CAUA 1CAUB 1X8EA 2QQOA 4DOUA 5LEKA 5CVRA 5JXGA 4FSJA 1W6QA 1W6QB 3B01A 2CDPA 3OEAA 5DPNA 4D7YA 5CB7A 1GLHA 1QH7A 1WUVA 3UKVA 1ENXA 1OFNA 3T0AA 1JH5A 4XHBA 1VRH2 3BB6A 1H0BA 3U78A 3WR0A 3KLSA 4GB33 5C5UA 3ZYHA 1G86A 3GBWA 4AGRA 1V6IA 1VBD1 1TME1 2NLRA 3R4SA 1RITA 4IDZA 1C8M1 4A42A 4D7SA 4DZGA 5F37A 1YCIA 3IBMA 4UYBA 2D6LX 4C1XA 3KF3A 4CCLA 4UW6A 3O1MA 5SV8A 3ON7A 3FBYA 1YJKA 2VOTA 2EIBA 3S7EA 3N4MA 2BNMA 2XBO1 1NZIA 2C9KA 2GDFA 2YBSA 3PL0A 3FHIB 1YQ8A 4YG3A 2YFZA 3VGIA 1JYXA 2ZPXA 3OBAA 2CDOA 1H2LA 2VNGA 4I09A 1FT9A 3PU8A 4GWMA 1NQJA 1OHFA 1U5IA 3C7OA 3ZYFA 2VTFA 3WQ7A 1FOD2 1HJFA 1LHOA 1U5YA 4XUOA 2WZR1 2JENA 4YNIA 5DABA 2RMU2 3T1LA 4NOTA 1QKQA 3ZYJB 1D0GA 4XDOA 1LKNA 3UETA 2PTMA 1DZQA 3WDYA 1SFPA 2Y0IA 3TEWA 1P8JA 3CLPA 1BKZA 3O1UA 5H9PA 1LRHA 1PMIA 1UZVA 2VZVA 4Z2WA 3OUHA 4BQ3A 3RWNA 1V6MA 1DGWA 2DBIA 2W0XA 2JDMA 3OSDA 1QQP1 2V4AA 2ET7A 5CA6A 2JE9A 1BYHA 4LBKA 1ULGA 4QHBA 1GQPA 2GNMA 5LBFA 3NJXA 3WV6A 1JTZX 2JG8A 2JG8B 1AR83 3E97A 4L9BA 4Y1XA 4C90A 5C8WA 1ZNPA 2WABA 5DAXA 3D5OA 3THTA 2VUAA 4B4RA 1MPXA 3ROUA 4WV8A 4CDQA 2HEWF 4CDQB 3HQXA 5HV4A 1FAYA 4NHYA 2I74A 4RSUA 1F4HA 2XMLA 3LOIA 5K7PA 2OIIA 4LULA 3GHNA 4AI8A 1ULCA 4AEJA 3U0ZA 5KHJA 3HD8B 5FWJA 1PGL2 1XB9A 4Y1ZA 2EAAA 1XE8A 4GB31 4XE9A 3VBSC 4RGAA 1YFXA 3MIEA 3UGGA 2RHPA 3LQCA 4XQDA 5FXVA 3NJZA 3C8XA 3NW4A 1IS4A 3WP3A 1PVC2 2ZGUA 1AX1A 2VY0A 5ANNA 2E63A 1D4M2 3ZXJA 4C0BA 3ZKUA 4MX3A 4DFSA 2RS31 5ACA2 5FUIA 4PQ9A 2JG8C 3OG2A 4IEVA 2VBBA 3F95A 1F15A 3AVRA 1JU3A 1RUG1 1W8WA 3VHPA 2AREA 4DEVA 3LPFA 5F5AA 1KD7A 5C71A 1J3RA 2N7GA 4M00A 4FI9A 5L9VA 3SISA 4FBFA 1D0HA 2WFPA 2X10A 5L9BA 1AXKA 1J84A 4S2FA 3JXSA 3VD7A 4DY3A 3E5UA 5C3QA 4KL1A 4TLGA 3M8LA 4B3NA 4CU6A 5CKMA 4ZS3A 1DZRA 5FZGA 1AR61 4CP1A 2PELA 2VZQA 3ZYPA 2G9ZA 3B7MA 4FO9A 4AVBA 4P02B 2QQMA 2FDKA 3MV11 2FDJA 4JGYA 4JGYB 2X5IA 2X5IB 3T2QA 1SLLA 3POWA 3OD0A 1R64A 5DDJ2 2VMDA 5CNAA 4AHWA 1EP0A 2RJLA 1F31A 5A3TA 1JYTA 1GR3A 2CGNA 4Y1YA 3TN91 2WZPP 4Y5TA 4Z8BA 1YI7A 2PMWB 2Y6HA 4MGIE 4X8NA 4EZHA 1OLRA 2WWSA 5A6ZA 1ONAA 1DLCA 2Q0AA 2HWE2 3WNOA 2EXJA 2VZTA 1JI6A 1XYNA 1OQ1A 4FTSA 2GP3A 1TE1B 3LFMA 5LK5A 4YPJA 3WF3A 1O4YA 3APBA 4QU2A 1WLDA 1Y9GA 3C7FA 4JAAA 3Q9OA 5K4LA 3PHMA 3N9PA 1FPN3 1YIFA 1Z78A 4Y24A 3A21A 2WZEA 3O5SA 1VBA1 1UZ0A 3N9LA 3WCRA 2VUDA 1ODNA 2WR9A 3KVAA 1HX6A 4PIZA 5FMBA 1AL22 1WW6A 3MW2A 1ZBE2 3HEIA 5GZEA 5DMYA 4YRDA 2O1QA 5L19A 2W87A 1UMZA 1W9YA 2JWPA 2OW4A 3POGA 5JZGB 1XNBA 2CL2A 3RZLA 1NYWA 4GQ7A 4BE3A 3WHTA 1DQ2A 4FPEA 5FY9A 4CXWA 5KXEA 4F83A 1IS3A 1NCQA 1NCQB 1Y9MA 1IS5A 5EFUA 3T0BA 5FY1A 1U5ZA 2DCTA 3CZJA 4ARYA 2ZHNA 1MACA 3ZFFC 3ES4A 2VUCA 4AEDC 4XFAA 3ZPOA 3BIEA 2F4LA 4UT5A 1PZ8A 1YC61 4XCBA 1JZ4A 3DL3A 4IE4A 1BVP1 3ZR6A 5GM0A 1PHMA 3LB9A 3OUJA 4LA2A 5FPXA 1OA4A 2TEPA 1C5HA 4XJUA 4XZPA 1AR63 3WW1A 2BV4A 4DIQA 3QBQA 1K5MC 4RQPC 2QUOA 5AVPA 3BUCA 4LTAA 4E4HA 1W9TA 2GP5A 2XJVA 4AHXA 2E7QA 5F8PA 1SCSA 3AMMA 2E9QA 2VGDA 2WAOA 1PGSA 4J25A 4QM9A 3PURA 1C3HA 1AYN2 1QJFA 1EV11 1VBE2 4JRAA 4BWOA 3T4VA 5GZDA 3TN93 3WVJA 2VQUA 1UPIA 4FPKA 1PNFA 1NOVA 3I8TA 1A3KA 1TME3 3H8UA 3LFIA 3LA7A 3ZDSA 3D3AA 1GZ9A 2A3XA 2BWCA 2JDUA 3CNAA 4JTOA 4HETA 4Y5SA 3MZHA 2JECA 5JPNB 3IKWA 1GZWB 1GZWA 2PHUA 3UKTA 3AYAA 5FYBA 2D97A 2Q8EA 5JOYA 1US2A 2FMYA 5DAPA 2P17A 1QJY3 2ZKNA 5FPZA 2MNGA 2YC4A 4INDA 2ZCWA 4YG0A 1S0IA 3R4DB 1AYM3 2Q4SA 2BU9A 5F1RA 3AZVA 1SBEA 3K2OA 2JKBA 3JB4C 2XJSA 4LA3A 1DGRA 4QX3A 4XETA 3PTYA 4JTNA 2KR2A 1CX4A 1TMF1 4LR4A 2R0HA 1W8NA 5FMOS 4R9DA 4P08A 2E32A 3ZMOA 3BVCA 1PVC3 2DUQA 4IEUA 3A7QA 2Y8KA 2ARAA 3MPPG 4Y20A 4Y20B 1A8MA 4ARXA 4DXZA 1KGYA 1MS8A 1QJX1 2VL4A 5FYSA 4OUSA 2QQPA 5ISLA 3O1SA 3I49A 2EIGA 2WJSA 4MXWA 2PAKA 2BJSA 1XU1A 2WS91 3MDPA 4MXWB 5FP7A 5FV3A 2JIJA 1SBDA 2B42B 4UFMA 4D6QA 4Y4YA 3RJRA 3AC0A 2JB8A 2W2IA 4N9IA 1REEA 1ACCA 3WDTA 1PVXA 1FATA 3X29B 3H8RA 2AH2A 4FPFA 5JR7B 1LJ7A 3FLPA 3HAGA 4AVAA 4JKMA 1S0EA 5C7GA 5KXBA 4TSVA 1MEC2 4AQSA 2D3SA 1NA1C 1RMU2 2EXKA 1CGPA 1DZTA 1RUJ1 2W95A 1CESA 1R1A1 3RVHA 3MF6A 5D2AA 3E6BA 2A3WA 1JOBA 2ZX2A 4AAXA 5FZDA 5JZGA 2AEZA 2RDNA 3WQ1A 3H50A 4W50A 2YPDA 4ISRA 3O0WA 4XBLA 5F2SA 4CXXA 4XJWA 2ZEWA 1W9SA 1QJZA 2Q1ZB 2R1DA 5LCWL 5FYVA 3DXTA 2XL9A 4XJZA 4H2AA 1S0DA 1VALA 1OF4A 4CEWC 3LIHA 2KM2A 3VZOA 2XGXA 3U11A 1XNKA 4XVHA 4IW3A 5A3PA 2ZMLA 1W8FA 1HXS1 3CJIC 4IQPA 3AYEA 4NVPA 3GZTB 1OA2A 3O0XA 5CG9A 3OYWA 3AZZA 3OYWB 5LA1A 3VZKA 2XR4A 4AE2A 1L7QA 1VIWB 4P9LA 2Y6JA 2HBTA 4QXKA 4CCOA 2ADDA 2VZUA 4GWJA 3T08A 4A7KA 4B8EA 1SQ4A
chains in the Genus database with same CATH topology
2AUYA 2BWAA 2GMPA 1A8DA 2ZX3A 2RM22 3FUQA 4BLIA 2DYCA 5IK4A 1MS5A 3NV3A 3ZFGA 2ATFA 5T54A 3ZFGB 1LB2A 1REFA 5L36A 1SEFA 2A73B 1COV1 4GMP3 3W58A 5JOWA 1IZ3A 3NV1A 1AXYA 1OSGA 1LEMA 5J7MA 3PVOA 2EA7A 3IDEA 1IGOA 5HCAA 1FYUA 5GJ6A 2G4IA 2PN5A 2ZABA 1Z0HA 4XHXA 5LRSA 1YFUA 1Y3TA 4HSJA 1BMV1 1RUD3 2GMMA 2Q8OA 1WMFA 1PO22 2VG9A 4NR1A 1C1FA 4Q8KA 5FLHA 4TWTA 3KCCA 4WVZA 4XF3A 1Q43A 3ELNA 4RL7A 4CDXA 1CVNA 4CDXB 2YC0A 3ZXDA 2QKDA 1KFXL 3MIGA 4FPOB 1AYM1 5CFDA 5CFDB 2IXLA 2VVFA 1F5FA 4YFWA 2VOVA 2ZX0A 5DZFA 4BIFA 3H3UA 3M7AA 4RD7A 3EHKA 4XF4A 1CJPA 1AX2A 2PHDA 1BEV2 2CGOA 5EWSA 5CFCB 5CFCA 2A6XA 1SCRA 1S0CA 2RS12 1ALYA 1PK6C 4FT8A 2WZR3 3OD4A 1K5MA 1K5MB 5GLTA 1LHUA 5B2GB 2R043 5C4WA 5C4WB 1QJX3 2UWAA 3QH6A 4D3WA 5CU1A 1JHNA 1WBFA 3TRSB 1D2QA 2R073 4MVTA 1CJDA 2ZGNA 4N43A 4N43B 4AVSA 1W6NB 1W6NA 3I59B 3I59A 3INAA 4P9GA 1RUI1 4YM2A 4FPCA 3ZFEC 5AVAA 1GNHA 2O0OA 3ILFA 4A7ZA 2HWF2 5BNPA 5BNPB 1UZZA 2QZ3A 3AP5A 3PMSA 1B35B 1B35A 1N3PA 2MEV2 4YZ2A 3RJ2X 3D0JA 4MLOA 1W6OB 1W6OA 5JMCA 5EYYA 3A0NA 2QCSB 1NG0A 3FJSA 4O9GA 3RPQA 1VBD3 2IXHA 1H4HA 1AXZA 3UV9A 2R062 1WMEA 4K1ZA 1VAVA 4XFCA 3FWEA 1QJY1 4YVWA 2R32A 1ND3A 1ND3B 1KDMA 2ZHLA 4YVWB 5JSOA 1EYBA 2WLQA 3ZN4A 2E6VA 3KZ4C 5I8SA 2QNKA 4QD2A 3ZXLA 3PVBB 3FFZA 1W0PA 3M3EA 1U0AA 1EAH1 5J98B 3SH5A 2WSVA 4DNYA 4QQOA 5KXCA 2GC2A 5LK7B 4KGGA 4FPHA 4QQHA 1TNFA 4YW3A 2OA2A 1VP6A 3USSA 2AR6A 1PO11 3RYPA 4XW3A 5GZGA 3BALA 2RS52 3DF0A 4BOWA 1JOJA 1X36A 4IXLA 2UWCA 5CIRA 4AFMA 4BA6A 1FXZA 1AR71 2PLV3 3RQ0A 3NL1A 3AYCA 2XJUA 5FMOL 3NVCA 1KQRA 3P3NA 1IOAA 2WNUC 2XWJB 4KQ7A 3FUOA 4AHZA 1VBB2 1KJLA 2RR11 3R6SA 3ZYIB 1DQ0A 1RUH2 2WNVA 2DU1A 1UKRA 2WNVB 1XYPA 4EN8B 5IK7A 1SLAA 1RHI1 2BBVA 3AKQA 3ZIWA 3BU7A 2WNVC 3I4IA 4Q2FA 1Q8OA 3IMNA 3D82A 4NHMA 1Y9QA 1CIWA 3WG2A 4XIKA 4YGDA 2DUOA 2TUNA 2SLIA 3LA2A 5DG2A 3BODA 1FPN1 1HIXA 3DPRC 4I3GA 4K9SA 1PO23 4XF1A 4DB5A 3KGLA 2RS33 4ZU7A 4HZFA 4LO6B 4A2UA 2E51A 4META 1RJ8A 4LO7A 1RUG3 1MZ6A 3G7DA 3RS6A 4XQ4A 4QQLA 3AJYA 4WVWA 2KXLA 4PF5A 1IHMA 1H1IA 1B09A 4PBPA 1YYNA 1QHDA 3RZZA 3RI9A 1H4GA 1LHVA 2D5HA 4QQPA 1UU4A 4P9YA 5AC92 5C4WC 2VW2A 1QJU3 3VBHC 1KS5A 1PO13 1COV3 5D8AC 4URTA 3RDIA 4XFIA 1RIRA 1SFYA 5K9YA 3L2HA 2TBVA 3E5XA 4PIYA 4N53C 1YRZA 2Z2SB 1ZBA1 3LSDA 2X29A 2ZGPA 1KRIA 1H8TC 1WW7A 2UY8A 1IQAA 1SBFA 4GULA 5JI9A 2WT0A 1LHWA 2OVUA 1DU3D 5HCFA 5I93A 5FTTC 3W9AA 2WNEA 5KXDA 4ATFA 2PLV2 4CDUB 3OF1A 4CDUA 2HWD2 4CEWB 4CEWA 3WHUA 4FXGB 1RUE2 4FQZA 4LBMA 4K1YA 3RSJA 3FLRA 4TLFA 4YYOA 1RUC1 3MIFA 2GH8A 1BEV3 1AJKA 4N43C 4LO5B 4QQ2A 4YARA 2P37A 5FAXA 3N7KA 3VZLA 2Z69A 1IKPA 4K3UA 3DGTA 1RUF2 4ASMB 5C8CA 4M0HA 5C8CB 5GLUA 5A33A 3RNSA 5A33B 3AYDA 5HI0A 4K40A 1JXNA 1FMD1 1H2MA 1JUIA 2SBAA 3SMHA 1Q8SA 2R071 4GXLA 4Q26A 1VBE3 2GN3A 1RTVA 4AK3A 2CYFA 4GWNA 1W39A 3H1WA 2EF6A 4KBBA 4ZKTB 1Z7S1 3GBFA 2HWF3 3H1MA 1QJU1 1ND3C 3BCWA 2YROA 1GYKA 3J8F1 1SLTA 2BYVE 3W59A 4NHLA 4P9IA 1G6NA 4B7EA 4YW1A 3ZN5A 2B5HA 1VRH1 4AVVA 5IT6A 1WBLA 3FC0A 4HKWA 1FV3A 4OFGA 1BVVA 3NV2A 3O7OA 2XVGA 4Q0UA 1O91A 2A5ZA 5JPMB 1QNYA 2JX9A 1ND2A 1ND2B 2XBO2 1TEIA 1V6NA 1UW8A 2EALA 3B3QE 4B7KA 2JEMA 2VVDA 2GC0A 1MVEA 4YGEA 4AW7A 1OA3A 3WY6A 4COVA 4ZU4A 3KT1A 4DINB 1POV0 2BVVA 4C91A 2VPVA 4AVCA 1MQTC 1TMF3 4ASLA 4P9XA 4IEXA 1LODA 1UN1A 4JRLA 4B4PA 1ASJ2 3THPA 3ENRA 3OBTA 1HRV1 4RA0A 4MXVA 4EN0A 2ET1A 3KCYA 3ZXEA 2A7AA 4RFT0 4BHPA 3ETQA 3T1MA 1AR73 1W6PA 1W6PB 4OUMA 4YW5A 2LM3A 2P2KA 4YGCA 4PLMA 4EWAA 3D4KA 1ZRRA 4N9HA 4XIOA 5CG8A 2F6BA 3VHRA 2ENRA 2ARXA 3B00A 1CR7A 2DCJA 5GLZA 1GFF2 3KB5A 4ES8A 2D3PA 2LUWA 1WW5A 1U12A 1R1A3 4LT5A 2V09A 4I01A 3TNQA 2HWB2 1W0OA 4D69A 4GB32 3LA3A 2XUMA 1RUD1 4COWA 5FRAA 4CDWA 4CDWB 5C33A 2IZWA 2D98A 3M3IA 2RMU3 2B39A 3B69A 4LHKA 5HCBA 1MS3A 3VBFC 1RUC3 1DQ5A 4UBGA 1G9BA 3VBOB 3MLKA 3VBOA 4F7ZA 4RS5A 4RS5B 1GANA 3AP4A 5DZEA 2D3RA 2IC1A 1DFQA 3JD72 2DFBA 3L2YA 1LGNA 3QD6A 4IEPA 2R042 5CAZA 1C5IA 2C5DA 1A78A 4J6GA 1W2UA 2VW1A 2GC3A 2B8MA 1NCRC 4OULA 1FMD3 5AC93 1BQPA 4CYDA 1WD4A 2BNNA 1RL3A 1AR62 4LO8A 3CF6E 4QMAA 1T6GC 2GH2A 4KU7A 2ES3A 2YY1A 1OQEA 1D4VB 2R0FA 3SNMA 5BUVA 4JCKA 4K21A 5DG1A 3HT2A 4XTMA 1YI9A 2YYOA 4W6WA 1S0JA 3FMGA 2PHXA 3VBRC 4MUVA 1YUDA 4PLOA 4QPGC 1H9PA 3LSEA 3KT7A 1IPKA 3VUOA 1O3QA 2XLGA 3VV1A 1G9FA 2QJVA 1S2KA 4EWDA 2ZGSA 4QX5A 2H0VA 4Q4W1 3J4UH 1MZ5A 1UZYA 3KCXA 4XJ8A 5I0TA 4LHNA 2D6MA 2DVAA 3MW4A 2D6OX 1BBT2 4Q4Y3 3USUA 3USUB 4WM7C 4BH9A 1LEDA 1KS4A 3SCFA 1NY72 4K6BA 2JDZA 3ALQA 3QOPA 3RG0A 4Q4V1 3ZXGA 5D8AA 5D8AB 4E27A 1ULDA 4WZCA 4H14A 5ABJC 4WM8C 2JXAA 3LGRA 4MGYE 1QXPA 1CN1A 1RJ7A 3HWJA 4LBQA 4LBQB 1DQ1A 3ZSJA 2A6WA 4I0WB 4EN6B 1LULA 2ZTNA 2DCKA 2RS53 1FNZA 3WX5A 4BCUA 1A6CA 5BNPC 5DDJ3 3M1HA 3VKFC 3GNEA 4AG4A 3NAPA 3NAPB 3SH3A 3BIWE 1PNGA 2WFF3 2JG9A 2JG9B 4S2HA 5FOJB 2MPFA 2PQQA 3EXUA 1ENQA 3OGJA 4AI1A 3AXEA 1FOD1 4IEZA 4WVMA 4WVMB 4Z07A 4HVOA 5EZWA 4QPGB 3M2MA 4QPGA 1CAWB 1CAWA 3MI8A 4QPIC 5I0UA 2GAUA 2F4PA 3OY8B 3OY8A 1S2BA 1LOBA 3ES1A 3U10A 3M3CA 2HKXA 4PBOA 5T5OA 1FNYA 1C1LA 4C1WA 2XHKA 1SACA 3AMPA 4NPRA 3IPVA 3IPVB 5GLWA 2XLFA 2VMIA 2VQAA 5EYXA 1Q3EA 3ZYGA 5BNOC 1QQP2 2XG3A 4IEQA 1LGCA 3ZSLA 3N35A 3H7JA 1EV13 3CJIA 3CJIB 1O7FA 4YFZA 5CBLA 1OD5A 2V73A 2YUEA 1LU2A 4E2QA 3ZO0B 5CADA 2ETEA 3OGGA 1Q8PA 1H2KA 2B45X 5I8YA 4AXOA 2QDRA 2VNRA 3VBOC 2FBEA 3R0RA 2PYTA 2WC2A 2WLPA 2RS13 4LE3A 1QXJA 1DQ6A 4YZ4A 1QGLA 3VKNA 3BTAA 1GV9A 1QMJA 4X6RB 1QOTA 4E4ZA 1V9U1 3PNAA 4Q0SA 2WS92 1NA1B 1NA1A 4OI2A 4CZSA 3D6EA 1PVC1 4IEYA 2WINB 1DGLA 1D4M1 4NN0A 1GSLA 1AYN3 5K8SA 4NHKA 2WL1A 1D2SA 4LUKA 4AGGA 2JG9C 1ULEA 1H2NA 3NKGA 3E6DA 1DLLA 2PA7A 3NAPC 4IV1C 1RUG2 2B7YA 1R083 2GMEA 4J1WA 1QOSA 1RUJ2 2IXJA 2V5YA 1HV1A 3AFGA 3ZPYA 4KWKA 2E7AA 2RR13 1UKGA 4IV3C 2PAEA 4XQWA 2HWD3 1CAXA 1CAXB 2DWRA 1DQ4A 3B5LB 3V56A 2ZX4A 4YG6A 1ZVFA 2R063 4EN7B 1HRI1 5EJ3A 2BW8A 3FE5A 4G3YC 3CO2A 1AR91 5J48A 1VBB3 3WLUA 4Q4X2 1GBGA 1EY2A 1KFUL 2UWBA 4I30A 4W6YA 1ZX5A 2OPKA 4UXAA 5ACA3 1FI2A 1C57A 5I0SA 4AYUA 4Y26A 4HT1T 2DCZA 3SHRA 2I07B 2CGPA 1HXS2 4DRRA 5FBZA 3NWKA 5KBFA 5J3UA 2YZ4A 1WMDA 3AKPA 3OCPA 4JC1A 5T50A 4S2GA 1F8VA 5JIAA 2QDNA 4RHV2 4P9JA 4GMP0 4AQ2A 1G8WA 1ZM1A 2R30A 4AQ6A 4F3JA 2HWC2 1JYCA 5HBAA 4YZ5A 2X53S 1XXNA 2WFF1 3VZMA 4FTEA 4JDOA 1R092 4XTPA 2BPA2 3N7JA 3CL1A 1H30A 1AL21 5JVVA 3C2UA 2P34A 1N1SA 1GZCA 3POSA 2XLAA 5L73A 3WP5A 2W52A 2DF7A 1AJOA 4XF0A 1XE7A 2ZGMA 3KQRA 4IERA 4M01A 1ZBA3 3A0KA 1Z7S3 4QGMA 3AP7A 4HANA 1H1AA 5IK5A 3ZYRA 1BMV2 3CU7A 4Q4W3 3TOJA 4FTBA 2WT1A 3I2DA 3KMHA 5T5JA 2D93A 5IUQA 1UIKA 4Q4Y1 4MYEA 2ZACA 2PFWA 2OYZA 1DG6A 3S0MA 2ZAHA 4KH9A 3AKRA 5L7OA 5L7OB 5TSWA 2K2SA 3B02A 1IPJA 3BOPA 3WW4A 1YJLA 4AEKA 4Q4V3 1CPNA 4JGZA 4JGZB 3UK9A 3VHNA 5FLIA 1BEV1 4E2SA 3MFAA 2D7FA 3JZVA 3IDBB 3VZNA 5BXXA 3WW3A 2A3YA 2RS11 4WBBA 4UBHA 2DVFA 3S6PA 3OPZA 5AFBA 2DU0A 5T55A 3V64A 2VECA 2ZJCA 3VZKA 1YXWA 5J09A 1QY4A 1DDLA 1MZEA 2PHLA 2CAVA 4Z82A 3IN9A 1URXA 3H0OA 3AMNA 2A6YA 2AGSA 2VQ0A 4OHYA 1D4M3 3FBMA 3GZAA 2ZGQA 4OHVA 1HRV3 2A6ZA 3PVNA 1NCQC 4HKLA 2HWF1 4GMP1 3GF6A 1AUYA 1R081 4L11A 3ZFFB 3ZFFA 1OMIA 2XKPA 3AKTA 4AQTA 2Y38A 4XMAA 2P3KA 3AXDA 2DFCA 3MGUA 3ZXFA 3UJOA 4D94A 4BPZA 1TNRA 1PIV1 1C8M2 3FFQA 2WNUA 2WNUB 3ACLA 2R061 4FP3A 5JIUA 4LEJA 1FV2A 4Y22B 4Y22A 1EPZA 4PIXA 1IS6A 1LENA 5T5LA 4IEOA 1UPSA 1LOEA 4MSVA 1I3HA 2IWGB 4N7IA 3KSCA 3P3PA 2BVBA 5H9QA 5LEJA 4DRVA 4AVTA 3WP6A 5BNNA 1MEC1 5BNNB 2RMU1 3PJQA 1F5JA 3ME2A 1UU5A 1ZRDA 1CAVB 1CAVA 1G9AA 2IFRA 3QACA 4AI2A 4YW2A 5KHIA 3WDUA 1BK1A 5KHHA 1W6MB 1W6MA 4OI4A 4G9SB 2QVSB 1PO12 1GKBA 1C4RA 1SLIA 2OZ6A 2ZBJA 4P5HA 2W39A 4HPKA 3JCIA 4HPKB 1WLWA 2O8OA 3GHMA 1JN2P 5JZGC 2ZAAA 1VAKA 3ST7A 3KT4A 4RS5C 3G6JB 4JQRA 4U36A 2XPJA 1REDA 4KWJA 2IXIA 2R16A 1JUHA 1NZCA 4R8HA 3LOBA 3JBG1 4R52A 2YV8A 2HWB3 2RE9A 1LOFC 1U5XA 2AYHA 4AWDA 4FVVA 3PJYA 3IT8A 4FPGA 3M4FA 5KWRA 4CTEA 1LHNA 4MV2A 2NPIA 3SCHA 1ZZCA 1J1TA 1YLLA 2RM21 4HMZA 4OI1A 2NP0A 2WQZC 2NMNA 4LUMA 4NO4A 4NWVA 5J96B 1AR82 1YO8A 2VOXA 4IV3A 4IV3B 4AFBA 1RUJ3 2RS32 5ACA1 3GALA 4QGLA 3I54A 5E16A 4HVQA 4LBQD 3UKNA 2PHWA 4I02A 3RYKA 2PHTA 2VNOA 5FO8B 2IFWA 1X50A 4LE4A 4XFBA 4L2NA 2FHRA 1ZYBA 1C8M3 3SH4A 3MIBA 1OFSA 1TQ5A 2VULA 4CRQA 1G9DA 3EBRA 4LBOA 1PGW2 2K0GA 1PO21 4Q8LA 1MS0A 1VR3A 1VBC2 1Q5OA 1ZZBA 4XOGA 4FOVA 1OPMA 1MS4A 4FPYA 5T52A 1DGWX 3OBRA 3TBDA 3ZSEA 5AC91 1OKQA 3WG1A 3EQEA 1WGPA 1AYM2 2RJKA 1APNA 2ZX1A 2JJ6A 5DDJ1 5JWPA 4ZU5A 3URFA 4GIQA 3WW2A 5BYNA 4OHZA 4KWLA 4R9AA 3H1YA 3ZFGC 2YXSA 4MZUA 3ZVXA 4BLJA 1V6JA 3MEPA 3LKJA 2VUJA 2KA3A 4OZXA 1FOD3 1XQNA 2NMOA 4BMEA 4HSLA 3WCSA 1RVF2 2HWE1 3VBUC 1SLBA 5DUUA 1ZZ9A 5F6KA 4CP0A 1PIV3 1POV3 1Q8VA 4Y5Z0 4ZXKA 3K51A 4H7LA 2X8KA 1RHI3 4Q0PA 2DUPA 3AB0A 2YPJA 1AVBA 1VBA2 2AZ5A 1N3QA 3RI8A 4IETA 3O12A 1XU2A 2ZGOA 2XVKA 4B29A 2XWBB 4YM1A 1ZBE1 2WQ4A 4ITCA 3ZXAC 4JGYC 4EWEA 3PLQA 1HLCA 3WUCA 1MEC3 1WCDJ 1OQDA 1V6LA 2XJRA 1WA4A 4AFDA 2XBO3 1SDWA 3B9CA 1NLRA 2JE7A 4CDWC 1VBD2 1TME2 5K0UA 5K0UB 5E8AA 4GKYA 4Q1RA 1FMD2 4LHLA 1WD3A 4COUA 1LOFA 2VMHA 2R072 5DXDA 4HFSA 4DQAA 4OLLA 4BM8A 1OI6A 3VBUA 2GNDA 3VBUB 1S55A 2D6NA 2WIIB 3MICA 2DTWA 4I0AA 4BZ4A 1N47A 2DTYA 4XEZA 2WZR2 2WS93 3UJQA 2GALA 1RGSA 1PM7A 3IDCB 3J8F2 3WG4A 5JZGB 5C9AC 5ABJA 3PMEA 1AYN1 1VBE1 2B46X 2BTVC 5ABJB 3N7MA 5EXOA 4LBNA 3TAYA 4R9BA 3WG3A 1V6KA 5H9SA 1QDCA 1HDKA 3FX3A 4MGKE 2D6PA 4AHYA 5L7OC 3JB8A 3N7LA 4WM8A 4WM8B 5I0RA 3EO6A 3LCPA 4KG8A 2YDEA 2OZJA 5FQ0B 5FQ0A 2CNAA 1HV0A 4DS0A 2H6BA 1MQTB 1MQTA 3WZ1A 1SMVA 3VL9A 1O3RA 2ZS6B 3SCGA 2ERFA 1J1LA 1MZFA 1TMF2 3ILRA 3VBRB 3VBRA 1VBB1 1CONA 2D43A 2RR12 1CD3G 4I3PA 5BNQA 1GICA 1HQWA 1PGL1 1ASJ1 4LLOA 4GKXA 4XFFA 5T3NA 1H9WA 4Y1VA 1Q8QA 3JQXA 4CDUC 2Z79A 2G9GA 4PLNA 5JDBA 4RGGA 4LO4B 3ZN6B 3ZN6A 4UW4A 3O0VA 4AI0A 2IXCA 4EJRA 1O5LA 4N7UA 1S1AA 3EJKA 1GQHA 2PAMA 1N1TA 3R05A 4HK9A 4N90A 1NCRB 1NCRA 3AZXA 4FAHA 2BFUL 3QCWA 5JI7A 1AL23 3J8F3 2D6KA 2PHFA 3VBFA 3VBFB 1PK6A 1PK6B 5F9TA 2WKKA 4UW5A 2NM1A 3HT1A 1BBT3 1POV1 2E53A 4RR3B 4RR3A 1J59A 5JAXA 1JW6A 4CEYA 3UL2A 4CEYB 4JVAA 3MLLA 1YWKA 2ZZJA 2GNBA 2A6VA 3DUIA 4QPIB 4QPIA 1RB8G 3CEWA 5JOZA 4OVEA 5J37A 2W68A 1UU6A 4BYYA 1S0GA 2H6CA 1ZBA2 1LOGA 1JYIA 3TN92 3LAGA 1VB2A 4MGZE 5BY5A 5BNNC 3J9SA 1RC6A 2Q5TA 1RMU3 4IV1A 4IV1B 2JD4A 4LNVA 4YZ3A 4AEDB 4AEDA 2R6QA 1M4WA 1QU0A 3DV8A 1R1ZA 1AL0G 2QZ2A 3ZIXA 4HL0A 4ATEA 4EN9B 2XJQA 2ZKLA 5J36A 1WCSA 2XJPA 4QT6A 2ARBA 2LALA 3V0BB 3V0BA 1Y43B 1ZZ8A 4Q29A 1RUE3 2EXHA 3SXWA 5K0UC