1R092

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09200
1AR81 1CD3G 2ZTNA 5ABJA 3VBUC 4IV3A 2HWE1 2RR12 5CFCA 4QPGB 4BCUA 1W39A 1RUJ3 5C9AC 1COV3 2HWF1 1POV1 1RUE1 1SMVA 1RUH3 1RMU1 1MEC1 2X5IB 2HWC3 4RQPB 4Z92B 1V9U3 1VBC1 1QJU3 2RM22 3DPRB 4CEYA 1R091 1C8M2 2RS13 1NCQB 5J98B 4RS5B 1RUC2 1HX6A 4NWWA 3NAPB 5C8CA 2RMU3 5ABJB 4GMP0 1D4M3 1H8TB 1K5MB 4YVWB 1WCDJ 4Q4X1 1ND2C 1EV11 1QJY1 5CFCB 2HWB1 4RR3A 1HXS1 1NCRC 1TME3 3VBHC 3CJIC 4Q4Y1 2GH8A 5BNNC 1B35C 1EAH3 4PDWC 4Q4V2 4JGYA 1X33A 3VDDA 2RR11 5JZGB 3JBG3 1NY72 2BFUL 2RS53 4CEWB 5FMOL 4N53A 4IV1A 4YVSA 1AYM2 1RUF3 4GH4B 1FPN2 5C8CB 3ZFGC 2RM21 2Y26A 1ND3C 1R1A2 1C8M1 2HWD2 1PIV3 1VBD3 1AR82 3VBFA 4JGZA 1RUC1 5L7OC 1HQNA 2MEV3 2WS93 1VB4A 2WFF3 4RHV3 4CDWC 1QQP3 5CFDC 3VDDB 4EJRA 3TN92 1PO23 2HWF2 2ZZQA 1BEV3 4N43C 1RUE2 3M8LA 1RMU2 1RUI1 5ACA3 1ZBA3 4IV1B 3JD73 1ASJ3 4Q4V1 1OHFA 2R043 1RUH1 1RVF3 3J8F3 2HWC1 1AR73 1R092 1F8VA 4IV3C 4RFT0 1NY71 2X5IA 2R063 3JB8A 2RS11 3VBOC 4JGZB 5DDJ2 3DPRA 1AYM1 1M06G 4Q4W3 1FPN1 1AL23 1NCQA 1QJY2 1BMV1 2HWB2 4CDXC 1R083 1A6CA 2HWD1 4CEYC 4Q4Y2 1VBA2 1HRV2 1H8TA 1K5MA 4YVWA 4Y5Z0 5A33B 1VBE2 4QPIB 1HRI2 4FTBA 3TN91 3FBMA 3ZFEB 1NA1B 4RR3C 5JZGA 1TMF3 1POV0 4AEDC 2R072 5D8AB 1AR62 1RUG2 1PVC3 4WM7C 2RS32 3VBSC 4CDUA 5AC93 1VRH3 4JGYC 4CEWA 2WZR2 1RUD2 1FOD3 2XBO2 4GH4A 5DDJ1 1E57A 3ZXAC 5BNPA 1RHI3 4N53C 4YVSC 1AYN3 2PLV3 4WM8C 1AR91 5BNOA 2WS91 1Z7S3 1ZBE3 1QJX3 1MQTB 1RUI2 4GB33 1VBB1 1COV2 3VBUA 3VBRC 3VBFC 1VBA1 1HRV1 5C4WC 1FMD3 1RUH2 2HWC2 4CDQC 1VBE1 1HRI1 1PO13 2FZ2A 1QJU2 1CJDA 2R041 2GSYA 4CDUB 1AR71 2RS12 1OOPB 2BFUS 5K0UB 4NWVA 3VBOB 2R071 2HWE3 1AR61 1RUG1 3ZFFB 2RMU2 5BNPB 1BMV2 2RS31 4QPGC 4Q4W1 1D4M2 2WZR1 1RUD1 2HWF3 5BNOB 1IHMA 1POV3 2BUKA 1NG0A 1MEC3 2XBO1 1R081 1TME2 2QQPA 2X5IC 4RQPC 1VBC3 3VBUB 1BBT3 5A32A 4FTEA 3DPRC 1ND2A 3VBHA 1NCQC 3JBG2 4RS5C 5C9AB 1RUJ1 4GMP3 1COV1 3NAPC 5A33A 4QPIA 4AEDB 5ABJC 2TBVA 4Q4X3 1RUF2 1EV13 1V9U1 1K5MC 3ZFEA 4YVWC 1HXS3 1QJU1 1NA1A 1PVC1 5CFCC 1VRH1 5D8AA 1VBD2 2RR13 1FOD1 1AR92 2RMU1 2WS92 5A32B 1RHI1 2WFF2 2DF7A 4RHV2 1D4M1 1ND2B 1QQP2 5L7OA 1NCRB 1VBB2 3IDEA 3VBHB 3CJIB 4CEWC 1PO22 1TME1 1ZBE1 5BNNB 1BEV2 1B35B 1QJX1 4LLFA 4GH4C 2RM23 4Y4YA 4PDWB 5ACA2 1ZBA2 5C8CC 5J96B 1EAH1 1C8M3 3JD72 1ASJ2 2R042 1MQTA 1RVF2 3J8F2 1AR72 1AUYA 1RUC3 3JBG1 2R062 2RS51 1AL0G 1RUF1 3ZFGB 4Q4W2 2WWSA 1ND3B 1AL22 3VDDC 1OOPA 2IZWA 5K0UA 1RUI3 1R082 3VBOA 1PIV1 5L7OB 1VBD1 3ZFFA 4Q4V3 4IV1C 5LK7B 1PGW1 2MEV1 4CDXA 2XPJA 4CDWB 3HAGA 1BBT1 5CFDB 2WFF1 4RHV1 1QQP1 1X36A 1RUJ2 4N43B 1AYM3 1PO21 1NOVA 1VB2A 4JGZC 1BEV1 1F2NA 1FPN3 3S6PA 4GMP1 1TMF2 5ACA1 1R1A3 1ZBA1 1PGL2 1V9U2 4FSJA 4SBVA 3JD71 1ASJ1 1PVC2 5C9AA 2HWD3 1RVF1 4IV3B 3J8F1 1AR83 5AC92 1VRH2 4AEDA 2WLPA 2R061 5FMOS 1FOD2 2FZ1A 4WM7A 3VBSA 1RHI2 4QPIC 1GFF2 3TN93 1C8NA 1AL21 1AYN2 2PLV2 4CDXB 1RUE3 1VAKA 3ZFEC 4CEYB 1RMU3 1Z7S2 1NA1C 1ZBE2 1QJX2 4GB32 5D8AC 2BBVA 1EAH2 4WM8A 1R093 1FMD2 1NCRA 5FOJB 3CJIA 5GKAC 1PO12 5BNNA 1OPOA 1B35A 1DDLA 5DDJ3 3VBRA 4PDWA 2RS52 4RR3B 5C4WA 4CDQA 4FTSA 1AR93 1PGL1 1TMF1 1QJY3 1H8TC 3JB4C 2HWE2 2HWB3 3LOBA 2VQ0A 4WM7B 3VBSB 4Q4Y3 4JGYB 5AC91 1VBB3 1MQTC 1PIV2 1VBA3 1HRV3 1MEC2 3ZFGA 1ND3A 5JZGC 1RB8G 1PGW2 1VBE3 2MEV2 4N53B 1VBC2 1HRI3 4QPGA 4YVSB 1BBT2 4WM8B 1AYN1 2PLV1 4CDUC 1QJZA 2BPA2 1Z7S1 1OOPC 4RQPA 2R073 1AR63 5K0UC 1RUG3 4GB31 3VBRB 3VBFB 4CDWA 5C4WB 5CFDA 2RS33 3ZFFC 4CDQB 5BNPC 1FMD1 2WZR3 1RUD3 4Q4X2 1R1A1 4N43A 1EV12 4RS5A 5BNOC 1PO11 2XBO3 1HXS2 2ZAHA 3NAPA
chains in the Genus database with same CATH superfamily
4COZA 1AR81 2IFWA 3WOGA 5FZOB 2K9ZA 2JD4A 1ULCA 1VALA 2CL2A 3VHRA 4LBNA 1ENQA 4IV3A 4AHYA 5LY1A 1BVP1 3KT4A 5KC6A 2RR12 2JXAA 5F3EA 5HI0A 3KV4A 3OYWA 1Q8QA 1GQPA 1ZZ6A 4C1XA 5F3GA 5C9AC 1C5HA 1GQHA 2ZX0A 4XYXA 4AXOA 5J37A 3LA2A 1POV1 1RUE1 1WCQA 3NRUA 4WBBA 1RUH3 1W8FA 2HWC3 3KQRA 2YC0A 1JZ2A 1G9FA 1HQWA 4IGPA 1G9AA 4QX8A 2ARBA 3IZOA 1QJU3 5FY0A 3UGHA 4Y5SA 4GAZA 1J83A 1LR5A 5IVFA 1NCQB 2X05A 5J48A 2VXJA 2R0FA 5J98B 1WUVA 4EWDA 1YRZA 4YFWA 4ES8A 2BGOA 1VJ2A 2DCYA 5FYUA 4COUA 4ZZ8A 1REDA 4CCEA 2JDZA 4A7YA 1S2EA 5FPAA 1O7FA 2EIGA 4PJYA 4KNCA 1JYCA 5C6CA 4MH0E 2VZQA 4PI2A 2KA3A 1CAXA 4L9BA 1ZZ7A 3U1XA 1V6KA 1UMIA 1K5MB 2NN8A 4I01A 2VBPA 5GJ6A 1Y9MA 3K77A 3TWIA 4LULA 3GHNA 4W4ZA 5CFCB 2Q8DA 1GYKA 2B7YA 3ETQA 1SZBA 1NCRC 1TME3 2VXRA 4KQ7A 4AVAA 3WVJA 4P9GA 2AZ5A 2NM1A 3LEKA 1PHMA 2ATFA 4FO9A 5JPMB 1GZ9A 1HN1A 3DCQA 1MZ5A 3PDQA 2JEMA 1WA4A 3VL9A 4JGYA 1X33A 3VDDA 5DAWA 4XACA 5I8TA 2ZAAA 4H7LA 3OTFA 1U5XA 5L19A 1W6QB 1U12A 4Y1ZA 5JSPA 1WBLA 3NNFA 3ACLA 4Y1XA 3NO8A 1PMHX 4FFHA 3LPGA 3IMNA 1OF3A 2RS53 4FXGB 1GWKA 1JOPA 4IV1A 3MV01 4FFGA 3I2FA 1ULFA 1PMIA 2I2SA 2XVKA 1FPN2 3AKTA 1UW8A 1MS5A 3UV9A 3S57A 3VZJA 1R1A2 2P3JA 4N90A 1W90A 1C8M1 1A78A 3POIA 4FOYA 5LCWL 4AQ2A 3B9IA 4QX3A 5FY7A 2VQAA 2W2IA 3BB6A 3GHMA 4PLOA 1OUSA 1O8SA 4J1XA 3W5MA 2HYKA 3H50A 2PHUA 2WS93 4CXXA 4BOWA 1WKYA 3WINE 1QQP3 5DAXA 2WT0A 1LOBA 1GQGA 3LA7A 3SH4A 5A7OA 1F15A 1RJ7A 2P6HA 3PUSA 3TN92 1XE0A 3I2KA 5FQ0B 4EJRA 4YM3A 2HWF2 3WDXA 2P17A 1OA2A 2D6KA 1BEV3 4ZS3A 3WDYA 5HXMA 1D0GA 2GH2A 5LK5A 4COWA 1K12A 2PA7A 3AMHA 3O1SA 1AF9A 1ZBA3 4UBGA 2OYZA 3AKSA 1IS6A 2AGSA 2XMLA 1ASJ3 4H3WA 2WJSA 2V4AA 4Y1VA 4XJAA 5LZ6A 1QOTA 4XFAA 4IV3C 4RFT0 4CCMA 1IPKA 2W52A 1NY71 3ZKYA 4CYDA 5HV4A 5IVEA 3VL8A 5A6XA 2E53A 3NJXA 3U0ZA 2YMZA 4RA0A 2R063 4XFHA 3ZDSA 2IXKA 4PBOA 3VBOC 4DIQA 4DXRA 4XE9A 4JC1A 1AYM1 1W2OA 2VOKA 3C7EA 1YIPA 2WT1A 3L9JT 3OGSA 3RZLA 1SDWA 2JD9A 2P3IA 4JKLA 5DUWA 4EROA 2W92A 1QJY2 2GMEA 5KHIA 1BMV1 3SEPA 1R083 1FXZA 2VAUA 1Q8OA 4LORA 1ENXA 1PK6A 1V00A 4Q4Y2 2AH2A 4MGSA 5FZBA 5DZFA 3O1OA 2YFUA 2FCTA 3FX3A 4Q29A 1OURA 3WG3A 3QACA 1JZ6A 1OH4A 4XUPA 2ZHNA 1ULDA 2BERA 4BIFA 3ZO0B 3SC7X 4AHXA 4XDOA 4XQDA 1H0BA 1DLLA 2OW4A 2DFBA 4AK3A 4HK8A 2OPKA 1IG3A 1HRI2 1UF2C 2CDPA 2VMHA 3DYPA 3KM5A 4QKBA 5C7GA 4PIYA 1MS4A 3CZUA 1UYYA 2HEWF 3FBMA 4OZXA 5FP9A 1BK1A 2GALA 3IPVA 3CLPA 1YQCA 2BP6A 4UT5A 3LQCA 5T5JA 4TTGA 2EIDA 3WNKA 1TMF3 2PHXA 4JCKA 2NPIA 4AEDC 3IT8A 1PGSA 1SBDA 4QKNA 1EUTA 4J6GA 1JU3A 4WM7C 1UD1A 3FLPA 5IWFA 2RS32 2W1SA 4CDUA 2BZDA 2Y38A 2P2KA 5EXOA 5AC93 3UNPA 4QQPA 4JGYC 4AGGA 4K21A 3DXUA 2GC0A 2WZR2 4QKDA 5CG8A 1XQNA 2QZ2A 2B4KA 2QKDA 1FOD3 2Q0AA 2UWBA 1GNZA 1HJFA 3AMMA 1E57A 2EF6A 3AJZA 5APAA 4XMIA 3EHKA 1AVBA 3UL2A 4CA9A 3SLIA 1UY3A 4NPMA 4QM8A 4OYUA 1Z7S3 5FPXA 4EN6B 3CEWA 2Z42A 1QWRA 4XFCA 2JIJA 1JOBA 4Y26A 1RUI2 2WQ8A 3VB9A 4C90A 4CU6A 1COV2 4KG8A 4FPFA 1N47A 3T0AA 3VBRC 4EN9B 3LF7A 1HRV1 5C4WC 1VRBA 3FFQA 1H6YA 4YGBA 4AR2A 4EE2A 5FZCA 4P9XA 1VBE1 3RG0A 2UURA 5IK7A 4XVHA 1PO13 1UU4A 3SHRA 3K3NA 1S0GA 5ANQA 5IW0A 1B09A 1AR71 3AXDA 1W9SA 3D82A 4OZOA 3T2TA 5CBLA 1OUXA 1UMZA 2RS12 4K1YA 3RZMA 1FAYA 1N3PA 3KVAA 5F39A 4AHWA 5C3PA 4SLIA 2DVDA 3K75B 3VBOB 2QQVA 2R071 1UOFA 4GALA 3DUIA 1CAWB 2D5FA 2Q1FA 3WF0A 1RGSA 4ES9A 1O4ZA 2G9FA 2WNUC 4Q4W1 4UXAA 2P1BA 5CYYA 4QXKA 1RUD1 1CAUB 1VPHA 3K4DA 1W6PA 2Y0IA 3ZN6A 2QZ3A 5HXVA 4B7KA 4P9LA 1UY4A 4E8DA 1YXWA 3AZZA 1IG0A 3WNNA 4IEYA 4I30A 3VBUB 3BYWA 1NE4A 5LBEA 5A32A 1QDOA 1W6NA 2OS2A 2VNOA 5FY1A 3LOIA 3N35A 3APBA 1FYUA 1ND2A 2XVLA 4IDZA 1OD5A 2ZX1A 4X8PA 4XHBA 2VZ3A 1LRHA 1TEIA 3VBHA 3AP4A 3U11A 1OLMA 3JBG2 1DGRA 1S0CA 3ENRA 3IN9A 4E2GA 2ADDA 2HBUA 1AZDA 1HKDA 1RUJ1 2E26A 5IFPA 2A6ZA 2FQPA 2Y6JA 1QU0A 3MIFA 5FYVA 2VMIA 5CISA 3AKPA 1WD4A 3BUCA 4AEDB 2D40A 2O8QA 4DXSA 2D7FA 1FATA 3CKHA 3P5BA 1LJ7A 3ZFEA 1V6MA 3KZ4C 3JQWA 1F31A 1NA1A 5FWEA 2Z5WA 1N1VA 2PFWA 5AFEA 2VNVA 4Y5TA 2ARXA 5LB6A 1SLAA 3B3QE 2D3PA 2W08A 3NNMA 1VBD2 3ZYBA 4OHXA 1PZ9A 3ILRA 2G9GA 2R0HA 2RR13 2XONA 2OA2A 2ETEA 2Y60A 1UY2A 3AL5A 3MZHA 2BEOA 2NLRA 2A70A 1RHI1 2WNEA 4WV8A 4RHV2 1HN0A 3T30A 2W47A 3HIFA 2H0BA 2ORZA 4KG0A 2OUHA 2ZEZA 1SFPA 4R9AA 4CE8A 1PO22 3V65A 1C1LA 2WN2A 4GULA 3PURA 5LEJA 1XE7A 4M3CE 4IEVA 1REFA 4N7UA 5ACA2 4ASKA 2VH9A 4PI0A 2JB4A 3FLRA 2J1RA 1VR3A 2R042 2MHFA 5D1IA 3JUUA 2G4IA 1LHOA 3SKJE 2V72A 2VZTA 3FHAA 4GXLA 4ZXKA 4QM9A 1PX3A 5FY9A 3OBTA 3WY6A 2J1EA 4HANA 5FPUA 5FJHA 3V0AB 1Y9QA 4NPRA 4UOJA 3BTZA 5DG1A 1WW5A 5G05L 4R9DA 1RUF1 4M3CB 1HQLA 1GKBA 1OMIA 2VPVA 4YW6A 5A80A 3FMGA 3MLJA 4I0BA 5FXXA 4YM2A 2WINB 2YC2A 3M3CA 3POGA 4Z2WA 2VBDA 1JOJA 4N9IA 1DQ1A 3ZXKA 4BQ3A 4DFSA 4EZHA 1YO8A 2A73B 2H0VA 2W39A 1IQDC 1PIV1 3KHBA 2PMWB 3B93A 5A3OA 3OUHA 3I59B 1W03A 2ZGSA 3O5SA 3DECA 2UWCA 3ES4A 4KU8A 2P5BA 2PHLA 3J7MA 5E8AA 4OI1A 3THPA 1NZCA 2WLQA 1DHKB 5FZ0A 2JG9B 2OQ6A 4CDXA 2XPJA 1OKQA 4UW6A 1BBT1 5CFDB 4G3YC 4NAOA 4AFAA 1Q3EA 4HG6B 5FIXA 4CUCA 4LBQD 2BRTA 2DVBA 1XPWA 4MHUA 2FDHA 5K4LA 4Q27A 1VB2A 2V4VA 2XVGA 4JGZC 3IAPA 4WVZA 4Q0QA 1FPN3 4HFSA 4AVSA 3ZLIA 4TSVA 4M0NA 3O14A 4QHZA 3E97A 4GMP1 1PGL2 4FSJA 1R1A3 1JYIA 4P00B 4BMBA 2E9QA 2VE1A 2VNGA 3N7MA 2XOMA 2XR4A 1LOEA 3A21A 4KMQA 4N9HA 4E2QA 5KWRA 1GNYA 4DO0A 4XBLA 4UFMA 5FZMA 3E6CC 4HMZA 2RJLA 2W3JA 4I2OA 3DN7A 2X29A 2GNMA 1JS9A 2WLPA 3P3PA 3WDUA 3KT7A 3T4VA 4CP1A 5EJ3A 4HVQA 2ZMKA 3O1RA 4D69A 1NE6A 5D2AA 5AFBA 3VBSA 4ISRA 1XBFA 2VC9A 4A6OA 2YHJA 2ET1A 1S0BA 3HN1A 4O65A 1VAMA 3TN93 1AL21 2ZEXA 3I8TA 4DS0A 4H55A 1UWWA 3EJKA 4XF1A 5HV0A 4P08A 3GYDA 3EMRA 3VV1A 3N9LA 3ZFEC 4JTOA 4ZS2A 1NA1C 3DEMA 5HCAA 3THTA 3ECQA 2WABA 1ZYBA 4LOSA 4RGAA 5F5AA 2CU5A 4BH9A 1ODNA 3O0XA 1DYPA 1FMD2 3WXPA 4LITA 1W28A 2BYVE 5FOJB 2QJVA 5FV3A 2BNOA 2E7AA 2ZEYA 3CJIA 2YPJA 2D93A 3USUB 2RDNA 5BNNA 1L3JA 1OPOA 1OVPA 1B35A 4K1ZA 3RYPA 3Q8EA 1ZREA 3N7LA 3ASIA 3R4SA 1F5JA 5AVAA 5KHHA 2VECA 4ASLA 2RS52 3WUCA 1RITA 1PM7A 3ETPA 2OZ6A 1JYXA 1G6NA 3WNXA 2XJQA 4CCLA 4CDQA 3BPSA 4FTSA 3BIWE 2PYTA 1ZA4A 4PBPA 2AENA 1BZWA 1QJY3 1H8TC 1W04A 3KLSA 4XPVA 3A4UA 4LO5B 3ZYRA 3GZTB 4D8MA 4COYA 2DU1A 4DEQA 4Q4Y3 4XDQA 2CTVA 2D6MA 3B9CA 4GWMA 2W1QA 4XQ4A 4Y22B 3PUIA 1S55A 2MNGA 3NVCA 2I74A 5BYNA 3H1WA 3I2GA 3GCXA 4NOTA 4DXTA 3CZJA 3ZFGA 4B4PA 5B2GB 3V0BB 4QU2A 1ND3A 3U07A 5IVYA 2J1AA 3P1IA 2QQOA 3VDCA 5JZGC 1HRI3 1WMFA 4A7ZA 2F17A 3D5OA 4BLJA 1I6XA 5I0SA 1GZTA 2OT7A 1S0EA 3BVCA 3PU8A 4WM8B 5JMOA 1AYN1 3MF6A 5JWPA 4E4DX 5EIYB 1DQ5A 4XJUA 5HCHA 1YHFA 3IB3A 2FCUA 2EIEA 3VBFB 4CDWA 1OFSA 4YM1A 4Z2AA 3V64A 2RS33 5DAVA 2PHWA 2YXSA 3OPZA 3LIGA 3MPPG 4HVOA 2XWBB 5JXIA 5JOZA 5LBBA 5AVPA 1TE1B 2WZR3 3HQRA 2N7GA 2D6LX 5FBZA 4N43A 2ZCWA 4E4HA 4IE4A 4CCKA 3HQXA 1QXPA 2O1QA 2VW2A 5BNOC 1GOFA 2ZAHA 2GAUA 1C57A 4EYUA 1RYYA 1F5FA 3LAGA 1LHVA 1J1TA 1CPMA 1W6MA 1YIFA 3U14A 4CUBA 3KCXA 4GD4A 3LDBA 2Q8OA 3FWEA 2GN7A 3WW4A 5CFCA 4FPJA 4QPGB 5J3UA 3T0BA 1G9CA 1W39A 1NLRA 4META 1COV3 1S0JA 5IATA 5FOBB 4MGZE 2AC1A 4S2HA 1SMVA 3KHCA 3KCYA 1QY4A 1Z0HA 1RMU1 2X5IB 3EYPA 4RQPB 4HVRA 3BIEA 4P14A 3UYJA 1O4TA 1M4WA 3HT1A 2RDQA 2PAKA 3E5XA 2ZEWA 3GXUA 1C8M2 3QOPA 2RS13 3N9PA 1ENSA 3W59A 2Y6HA 4NHYA 4TLGA 1UNBA 5LA0A 4NWWA 3U78A 4AEKA 5A70A 4YNIA 1OQ1A 4MXWB 4GWJA 2VD7A 5CAZA 1DZRA 2LUWA 3MPBA 4AVVA 4B1MA 1H8VA 3OPWA 3POFA 5ABJB 4UFHA 1H8TB 2WKKA 5FRAA 3RS6A 4DINB 4YVWB 4Q4X1 3R4DB 1ZRDA 1EV11 2HWB1 2J42A 2WO7A 1UQXA 1HXS1 3ELNA 1HB2A 4KL1A 4CU9A 1KXGA 3ZXLA 4BQ2A 2GZWA 3CJIC 5CKMA 2YV8A 3RZKA 4L11A 1FV2A 5BNNC 1ZRFA 1B35C 3AMQA 1QJEA 1W2AX 2D43A 2GDFA 3WQ1A 3D6EA 3MIBA 4PCRA 3WF3A 3WUDA 3KF5A 3OEBA 3VKFC 4EN0A 5JZGB 1UU5A 4AI3A 1E5IA 1JUIA 2VTFA 2W68A 3JBG3 4UBHA 4BQ1A 1NY72 2CWMA 2YBPA 4LKEA 3WD5A 2VMFA 1NQDA 2BFUL 3MIGA 4OI2A 4PIZA 5FP8A 4YRDA 4DMIA 5DN2A 1O6UA 4CEWB 1RC6A 4YG0A 3TEXA 4N53A 1Q56A 4MADA 4QD2A 5A3PA 4YVSA 5ANNA 1H9PA 4B7EA 3RFRA 1AYM2 1BCXA 3IBMA 5FP7A 5C8CB 4XTMA 3HNMA 1W8ZA 3ZFGC 4F8AA 4DRVA 1ND3C 4NUBA 1CWPA 1BQPA 1XU2A 2YGLA 3NJZA 5HCBA 2OKXA 1ONAA 1WCUA 1VBD3 4YW5A 3I97A 4XHXA 1YFUA 4NHXA 5L7OC 5FO9B 2WA3A 2EXJA 4YW2A 2MEV3 3AZWA 4GIQA 4LBOA 4LUMA 5A7PA 3VHOA 4UW4A 2D98A 4RHV3 4CDWC 5L36A 2RDRA 4FPKA 2WO2A 3DKWA 2WNVA 2BV4A 5CG9A 2R6QA 1FV3A 1PO23 2TEPA 2VQUA 3PLQA 4NRMA 4FPCA 5F2WA 3H8UA 4N43C 3PUAA 5KXEA 2MPFA 1X50A 2ARCA 3POSA 1OH3A 4XETA 4Y33A 3OUIA 5ACA3 5CADA 3S5AA 4AHZA 3WP6A 4L0PA 3C3VA 2LRPA 4Q4V1 1OHFA 2R043 1RUH1 4YFZA 2HWC1 1DQ0A 4R9BA 1R092 3K4ZA 1DIWA 3AYAA 1JYTA 1RTVA 1H4HA 4FCAA 1D2QA 1LECA 4AG4A 5JOWA 1UOGA 1JZ5A 4J25A 2VMCA 2AEYA 3Q8FA 2Q1ZB 4OI4A 1ZZ8A 4KI5M 4A42A 4OUMA 3PTRB 2JG8B 2YU2A 3DPRA 4EQVA 3QH6A 5J36A 2ZOEB 1W6OA 2WFPA 4IE5A 4LOTA 4JDMA 3WHUA 2AREA 4F3JA 1KRIA 1JN2P 4BPZA 2PHFA 2XKOA 2FDIA 1NKGA 1QOOA 2O0OA 3AMPA 5BY5A 2WUHA 4I3PA 2IXHA 1OLRA 1OT5A 1QEXA 3POJA 5LBFA 3WQ7A 4M01A 3ZX7A 1HRV2 4KWLA 2XJPA 4LBJA 4O61A 4DPNA 2VVEA 4Y5Z0 1W8WA 5FPZA 1VBE2 2HEVF 1SHWB 5DABA 4NIHA 4CCJA 4TLFA 2JE8A 1DFQA 5A7NA 4YARA 4NIGA 2R072 4AOCA 3VHNA 4U2AA 5JXJA 5A3LA 5C3QA 2WO1A 5K7PA 4ZZ5A 2F4LA 3T2PA 1Q43A 2YU1A 4JDOA 1D2SA 4BM8A 1KDKA 4K8FA 2XLFA 1RUD2 2XUMA 3R4UA 5FZ1A 4I09A 4Y1YA 1XYNA 4DZGA 2BOJA 2ZX4A 3J7HA 4GH4A 3WLUA 4PQQA 5DDJ1 3QBQA 2ZX3A 4XAAA 2XJRA 4N53C 1GSLA 3LCPA 4YVSC 1YCIA 2FBEA 4D3WA 2R7EB 4XTPA 1AR91 1MR5A 1RJ8A 5FZDA 4B4QA 1HV1A 2WS91 1LCLA 5EJ1B 2B46X 4Y20B 3HNBM 2DVFA 3LE0A 4XW3A 4LBQA 2IXJA 1VBB1 3ZYPA 3VBUA 1MS3A 2VO5A 1VBA1 4OI0A 5T54A 1FMD3 1URXA 2DU0A 2W0XA 3WX5A 3ZVXA 4XOGA 2OUJA 2R1BA 2PAMA 4RYDA 2FZ2A 1GWLA 1W9TA 2GSYA 3C8XA 1UMHA 4XQWA 2IWGB 3CNAA 2FDFA 5FJKA 1CQ9A 4KWJA 1NLQA 2JE9A 2WNVC 2BOIA 4OHWA 1OOPB 4BK4A 3LFMA 3AVSA 1V6NA 3OSDA 2KM2A 4NWVA 4XF3A 4GJYA 4A6SA 2RDSA 5K0UB 3RZHA 1V6JA 1OFNA 3CBNA 1RUG1 3ZPYA 3ZFFB 4YZ2A 1JZ4A 3DYMA 5BNPB 3KD4A 3E1F1 5FK7A 3GBFA 2D5HA 2K2SA 3NMBA 4FQZA 3WW3A 4BHPA 3BTYA 3C7OA 2EICA 1IHMA 3DV8A 1POV3 2NZ9A 3I4IA 5DUVA 1PMJX 1R081 5FYIA 1NT0A 2R32A 1T2XA 3OG2A 4LO6B 1ZZBA 5F32A 1KGYA 3RGBA 3PVEA 2XGXA 3BALA 4NE9A 1GZWB 4XFBA 4XUTA 3DPRC 1GANA 2Y64A 1C28A 2DBNA 4FT8A 5FY5A 1AXZA 4C8DA 3RWNA 5JOYA 4NRQA 3PMSA 3ZOIA 3HBZA 2JDYA 4RS5C 5C9AB 2TUNA 3BOPA 2XJSA 2OX0A 1OQEA 3NAPC 2EAAA 1UXZA 5A33A 4QPIA 2PXJA 1CZVA 5JMCA 4IEWA 1LEDA 1UOJA 2TBVA 2XXZA 3KSCA 1XU1A 4HETA 1RUF2 1V9U1 3KV9A 1JBCA 1JMUB 2XHKA 4R4ZA 2JIGA 2ILMA 2VZRA 3WG1A 2GC1A 4CPBD 3OY8B 4LEJA 5D8AA 5CNAA 3WQ0A 1STMA 3V0AA 1PZ7A 4JQTA 4YG6A 4CU7A 3RJRA 1FOD1 2A1XA 3BCWA 3PJYA 3INAA 4M3CA 3SQOA 4A3ZA 3AP9A 4LXLA 2ZGOA 3UETA 2RMU1 2Y0OA 1UZYA 3ZN5A 3PIJA 4XBNA 1D4M1 2F6BA 1MZFA 2R30A 4X8NA 4RN5A 3S7IA 1NCRB 3ME2A 1PX4A 1YFXA 2BTVC 3I59A 5F9TA 5JI7A 4CU8A 5F5IA 4UF0A 1JODA 2X10A 3H8RA 4LLFA 4FQ4A 4CP0A 4GH4C 5IJRA 2JG9A 1UU6A 1E5HA 4Y4YA 5CU1A 3WT3A 5EFUA 3THDA 4QDQA 1EAH1 5J96B 1H4GA 2C24A 1C8M3 4JKKA 3LPFA 1MQTA 1JH5A 4NRPA 4A7KA 1WMEA 4W6WA 4IESA 4XUNA 4C0HA 5FXWA 3PNAA 2IXCA 4ZPIA 4AQ6A 3VZLA 1PNGA 3JXSA 4X6RB 3CU7A 4Q0SA 2ZGPA 3T09A 3I2HA 2OXBA 1YC61 4GZ9A 1FI2A 1LAJA 3FLTA 4YPJA 2EAKA 4QPYA 1AL22 3VDDC 3GZEA 4QGLA 4TN7A 3M3OA 4AEMA 1F4HA 1UO9A 1WW6A 3O1UA 3PIGA 3VZKA 1CAVB 2FMDA 1WLTA 4DUVA 5LRSA 1QXJA 2WN3A 3AFKA 4ARXA 2XLGA 2FDKA 4RGKA 1IKQA 1WW4A 4FPLA 2JICA 5E6HA 4IV1C 3PL0A 5LW9A 3VZOA 5GLTA 2YGMA 5LK7B 1PGW1 3NNGA 4QB6A 1G7YA 4WZFA 5I91A 2WFF1 5JR2A 2A6YA 3CQOA 1CPNA 3O0VA 2CHHA 2CYFA 4R9CA 4D6QA 3HPNA 1AYM3 4XFGA 1BYHA 3T3YA 3IAQA 1F2NA 1PZ8A 2QQWA 2W94A 1A34A 4DXZA 1LHNA 3J9SA 1G8WA 3WNPA 1L7LA 2JDUA 4HN1A 2VY0A 2QVSB 5IK5A 5F5CA 4NIIA 3JD71 4JHZA 3MO4A 1PVC2 2VTXA 1RIRA 4YGCA 5EQUA 4A45A 1RVF1 4HOOA 3J8F1 4IV3B 4CUAA 2YUEA 4LBKA 4NR1A 1LB2A 2W95A 3FZ3A 5JOXA 1VRH2 3MW4A 3OYWB 1JYVA 2IUWA 5KBFA 4M4RA 1QF3A 3NNJA 1C1FA 1YJKA 1LGBA 2YROA 5FMOS 5I0UA 3S0MA 2JDAA 3QH7A 3H42B 1JYNA 4Q1RA 3PUQA 1I5PA 3HBKA 5DG2A 1ZRCA 3GCWA 2QNKA 5IHRA 3ORJA 4D7SA 4QPIC 1WMDA 3Q8CA 2CGPA 3SCHA 1AYN2 1R64A 2Y8KA 4QHBA 3AXEA 4LJHA 3K46A 2RJ2A 1VAKA 3O1TA 3U4XA 2A7AA 3KVBA 5SV5A 4FPYA 4FXKB 1ZBE2 3ZSJA 3UT0A 5FZ9A 1QJX2 1UL9A 3V0BA 1ZA7A 1XNCA 5D8AC 3VUOA 1WLWA 2PTMA 4WM8A 1R093 2VZOA 4G4FA 5BPXA 3BTXA 5FXZA 1W2NA 4XUQA 1HLCA 4I0AA 4K20A 4K3UA 4QT6A 5GKAC 4BQYA 3B00A 4P9WA 1NXD1 1S2BA 4HPKB 3RMXA 3IDCB 2GMPA 4MSVA 2VW0A 3J7LA 4W8JA 4YGDA 4PDWA 1PK6C 5I0TA 5I0RA 1I1EA 3LEGA 3MIEA 5FXVA 3TB0A 2QQKA 5IVJA 2DYCA 4LPLA 3UGFA 2XQRA 4YM0A 4QXCA 2Y6KA 4AVCA 3MBWA 1RINA 2AYHA 3KB5A 3MF9A 1OA4A 4WM7B 5A1LA 2BNMA 2E63A 3UK9A 4JRLA 4UWDA 4JGYB 5FZIA 1QXRA 2VVFA 5IK4A 1SDDB 2ZA9A 1JZ8A 1MQTC 1IPJA 1YQ6A 3OOXA 5LBCA 4OHZA 1HRV3 2EALA 1WLCA 1GUIA 4N7IA 4Z1VA 2P4EA 4BQ4A 1X82A 3B69A 1VBE3 2MEV2 3ILNA 3AL6A 4UAPA 4QPGA 4BQXA 1QKQA 3ITQA 3OEAA 5EPAA 5FKBA 3GBGA 1UX7A 3H3ZA 5FBJA 4FBFA 3X29B 2PLV1 3P6BA 4CDUC 1D0HA 4Q5OA 1S2KA 3DKQA 3GZAA 1UZWA 1NX9A 3B94A 1XE8A 2C9KA 4RQPA 1Q8SA 2VTXJ 5L9RA 2R073 1HB4A 3H8OA 5FO7B 2ZMNA 1NAEA 1KS5A 4GB31 2HEYF 4QGMA 3VBRB 5C4WB 1JZ3A 3H1YA 3OBAA 4XJ8A 3WQBA 1ST8A 3OBRA 3Q9OA 1RUD3 4FP2A 4XCAA 5KC5A 2Y6FA 4Q4X2 3SMHA 1R1A1 3RDIA 1EV12 3H8XA 1U5ZA 1HXS2 4XXPA 3MIHA 5FLJA 4C0BA 4MXWA 1DBNA 2EXHA 3O12A 4YWAA 4Z8BA 5LEKA 2YZ4A 2LROA 5T3NA 4COVA 2HJIA 2WO3A 2ENRA 2QQIA 2ZHMA 1H2NA 2ZTNA 4AI2A 5ABJA 3HN3A 4YW4A 4ZXEA 4HXCA 2C0ZA 4XUOA 2HWE1 4J1WA 1X9TA 4KBZA 3E6BA 4QXBA 4R52A 4YZ4A 2DBIA 5BNQA 1W0PA 2WNUB 4Q2FA 3ZSKA 2VM9A 3SCGA 1RUJ3 1EP0A 3MW2A 4RSUA 4D7YA 1X8EA 2HWF1 3OF1A 3PMEA 1K3IA 2VR4A 3ZXGA 4W6YA 4E27A 1MEC1 2LTNA 4OUSA 5H9QA 2JDPA 1UYPA 4XBQA 5A1AA 1CIWA 5JVVA 2FD8A 1VBC1 4O7XA 1HV0A 4CEYA 4GQ7A 5FO8B 2Q1MA 1IQAA 4HONA 4IW3A 1UYXA 1VE0A 4WVVA 2VVDA 2NP0A 4PIXA 3WV6A 3AVRA 5JR7B 3ZXFA 1G9DA 5FLHA 1XC6A 2V5DA 1SBEA 1S4CA 4Z07A 5C8CA 2DFCA 4FFFA 2WRAA 1YLLA 2C6SA 2RG4A 1ZX5A 1SPPA 1ACCA 1MZEA 2J1SA 2QQJA 1OF4A 2WYSA 3HOBA 3IDAA 1VP6A 2BNNA 1KS4A 4EN7B 2QQMA 3TAYA 5IFTA 1WCDJ 1ND2C 1QJY1 3BKZA 4RR3A 3URFA 4QX2A 4ITCA 1EUUA 4C1WA 5FUIA 3VBHC 4Q4Y1 1D7PM 4INDA 2GH8A 3VDBA 4QB1A 3AP6A 3IPVB 1JW6A 1DZQA 3J26N 4PDWC 4Q4V2 1E5SA 3WDVA 4Q26A 3M3QA 1CX4A 3OGRA 4KH9A 4AZZA 3IDBB 4IE7A 5JXGA 3NKTA 2YG0A 3B02A 3H7JA 4WVMB 3T2OA 1XOYA 2UWAA 3O1PA 1W99A 5FMOL 3C2UA 1LOFA 2B5HA 2YYOA 4OUEA 2JJ6A 3DGTA 3N7KA 1G9BA 1RUF3 3AM2A 4QQOA 3K51A 3LSDA 4A4AA 5G04L 1QNWA 3SCFA 2W1UA 5FR3A 2D44A 2RM21 4F83A 1PVXA 4OQ8A 2X53S 1SACA 2XDVA 2XQXA 1FX5A 4LBLA 1JXNA 1O8PA 5FUPA 1LU1A 1PIV3 3VZNA 4NO4A 1AR82 4OHVA 5JSOA 1RUC1 2WIIB 3H1MA 1O5LA 4K7JA 1HQNA 2YB7A 3AC0A 5GLVA 2QQNA 1UPSA 5FUNA 2J1VA 2GP5A 4P5HA 1EY2A 2ZGQA 4DQAA 1ALYA 3M7AA 2A3XA 1X9PA 4HZFA 2BWCA 4FOVA 3IM0A 1W9WA 3RRDA 1YI9A 4XURA 4A2UA 4DY3A 4LT5A 3WG2A 2GMMA 2JDNA 1JTZX 3CO2A 3O7OA 5FZOA 5FY4A 2WSUA 1QDCA 3KQ4B 4I3GA 2ZZQA 4LA3A 5HBAA 1XNKA 1RUE2 1SFYA 1RUI1 3AP5A 2VUAA 4CTEA 1UN1A 5A7SA 1CR7A 1Q8PA 1WCKA 5FZEA 2VBBA 4Q8KA 2QDNA 1OVSA 3TBDA 2VNRA 4XABA 5FP4A 3OCPA 1HB1A 2XB6C 3MUY1 3O0WA 1N1SA 4E9KA 5F5QA 3R0RA 2EA7A 3ILFA 4B8EA 4XJZA 2O8OA 1YUDA 1R1ZA 4CPBA 1N3OA 3JB8A 3BPZA 2W87A 2RS11 4ZKTB 4P9IA 4JGZB 5DDJ2 5L9BA 5T5OA 4ATEA 1M06G 3WW2A 3OD4A 4MYEA 2A6XA 4XZUG 1AL23 1LGCA 2WYFA 2ZHLA 4QQ2A 4UW3A 5CKNA 1NCQA 3CF6E 1W06A 4QGNA 4P9JA 1W6NB 4Y3OA 4CDXC 2WZEA 1A6CA 1ENRA 2HWD1 5FZLA 4CEYC 2VUCA 1YQ8A 3ACFA 3C7HA 4IEOA 4IL7A 4JHTA 2VGDA 1TNRA 3K48A 5FYMA 3ZN4A 1SLBA 5KR7A 4IE0A 3I3QA 2V09A 4QHOA 1VBA2 2GN3A 1K5MA 1W8UA 4L99A 4GJZA 4XIKA 5I8SA 3MFCA 5JI9A 2LALA 3FHIB 5CEHA 4QMAA 4JVAA 2E51A 2F4PA 2GU9A 5LATA 4FTBA 1K42A 5BV6A 4B3NA 4ONUA 1U0AA 1MS0A 3MW3A 3ZFEB 2W5FA 3B7MA 5A6ZA 4XC9A 2XJVA 4BQWA 1NA1B 4XMAA 3POBA 4RR3C 2XJTA 3U75A 1POV0 2L9LA 2Q8CA 1RUG2 1W6QA 1PVC3 1XYPA 1L7RA 1K5JA 2ARAA 5LA9A 2PQSA 2P34A 3VBSC 5FREA 1VRH3 3W58A 3EXUA 1XRUA 4Q0UA 5A3TA 3WDTA 2VCCA 1SCRA 4A41A 5JXHA 4XIOA 1W2UA 3HJRA 1WMXA 2VOXA 1IZ3A 2ZABA 2VUJA 4UFIA 1O3RA 3ZXAC 4NPLA 4Y1UA 5BNPA 1LOFC 3ZSEA 1AYN3 1O5UA 1LULA 4ORFA 1GWMA 3I3BA 1OQDA 4YW3A 2QQUA 1CESA 2J7MA 3I2JA 2UY9A 1ZBE3 3MUZ1 4W6XA 5C3OA 1QJX3 1ULPA 1VMFA 2WR9A 2ZGRA 4QPWA 1LTEA 3THCA 1BKZA 2OZJA 4HKOA 4LLOA 1Q5OA 2CY6A 4V2WA 4W50A 4Z82A 3ZM8A 5J1XA 2G9ZA 3HEIA 4AVBA 3BU0A 2X8KA 4CDQC 2WQ4A 5HCFA 1KD7A 2WAOA 1MACA 4UFLA 3RJ2X 5FQ0A 1JYWA 3OJBA 2VJXA 3RPQA 3KGLA 4PLNA 4AE2A 2D6PA 1W8TA 2D6OX 2R041 5LASA 1QIQA 3ZMNA 2QBXA 3VHPA 3ZSLA 2C1FA 2DV9A 1J3PA 1AR61 4XEZA 3HD8B 1ULGA 2RMU2 3DF0A 4K6BA 2P6CA 1BMV2 3GJAA 5FMCA 1TQ5A 4MX3A 3CDZB 1D4M2 3LGRA 3MICA 2B9UA 1V6IA 5BNOB 2ZHKA 1O59A 2XKPA 1S0FA 4LMFA 2VQTA 5CA6A 2PHDA 2D3RA 2XBO1 1DYKA 4NHMA 1E5RA 2KD7A 1H1AA 1XSQA 5A6QA 4XF4A 4BK5A 3WF4A 4KBBA 4XFIA 3ZYHA 2GP3A 5T52A 4L97A 1CONA 4FTEA 4BMEA 4JTNA 3MEPA 2AACA 1PM4A 4MGQA 5L73A 3U37A 1WBFA 4ZONA 1NCQC 4NROA 4AL9A 4CCDA 3POEA 1W8NA 4I02A 4FPHA 2BGCA 2WDBA 4M4PA 1DP0A 1IS5A 3VGIA 3TNQA 1UAIA 1GMMA 1QGLA 3NNLA 4QX5A 4Q4X3 1EV13 1XJAA 1H30A 1K5MC 4AI1A 3HQUA 1HXS3 1BLZA 1QJU1 5CFCC 2GNDA 2WZPP 4MUVA 3A7QA 4XXAA 2WSVA 5F2SA 1NYWA 3NSTA 1Z78A 1OSGA 4GA9A 2W46A 5LRRA 1UZ0A 4AFBA 1DGRN 3TEZA 3RYRA 2PQQA 2A6WA 5D21A 4QDSA 2H6CA 3WW1A 3WNLA 2CGOA 4LR4A 3WZ1A 2JDKA 5HPOA 1OI6A 1IPSA 4ARYA 5H9PA 4KGQA 1LODA 1ZZ9A 2WFF2 2DF7A 3LSEA 1J59A 2Z2SB 2A3WA 1ODMA 2O14A 3OBZA 1QMJA 2P3YA 3IDEA 1WLDA 3CJIB 1D4VB 4K9SA 4Q1PA 4CCNA 1TME1 3N9NA 5DZEA 5BNNB 1GU3A 1B35B 2ZX2A 1AJOA 3DL3A 1VAVA 3QD6A 1MVQA 4L8QA 1ZM1A 3BOWA 3JD72 4RFRB 2UYAA 3M70A 2BW8A 5EZWA 3R6SA 3MYXA 4IERA 1RVF2 5L9VA 2IVJA 3H3UA 3J8F2 3U10A 1AR72 1GV9A 2A75A 2CAVA 2XL7A 4A44A 5I0DA 2VMEA 4N8MA 2EXKA 2VZUA 4KGGA 2RS51 4S2FA 1GLHA 5FPBA 3MLKA 3ROUA 4AF9A 4CCCA 4RL7A 2YPDA 5FPVA 3BN6A 3I7DA 3MHZA 3N4MA 4LO8A 4DRRA 3RZJA 1MS1A 2EXIA 4EZ4A 1LHUA 1AL0G 1XNAA 5EP9A 5FZ6A 4Q4W2 2WWSA 3ZFGB 5KHKA 1ND3B 1OXCA 5BUVA 4OCTA 1U5IA 2IZWA 3PJQA 4LIVA 4HKWA 1G86A 2DCZA 2IXIA 1DGLA 3VBOA 5GZDA 5DMYA 1CAWA 5L7OB 1YQ2A 1SBFA 1EPZA 3R05A 1LEMA 4Q4V3 1GOHA 2DCTA 5KXDA 1OA3A 3B01A 3FC0A 2ORXA 1CAUA 2OPWA 4MO3M 1DF0A 5FLIA 1KJLA 4CDWB 2DURA 1VLNA 3TYJA 1L7QA 1RXFA 2A6VA 1QQP1 4PF5A 5A7WB 1X36A 2WQZC 4R8HA 4AFCA 1RUJ2 1JHNA 4IGOA 2Z79A 3L2YA 1GZCA 4N43B 1O4YA 3SH5A 1NOVA 2VUDA 1BEV1 4AAPA 3HWJA 5GZEA 5FZ3A 4CP2A 4NN0A 4JQRA 5F3IA 1NUKA 4BXSV 3WR0A 1ZBA1 1W6MB 5LA2A 1ASJ1 2A71A 3GNEA 4AI8A 5C33A 1AR83 4HPKA 5FPLA 3S30A 2ET7A 4YYOA 3AJYA 1W05A 5GZGA 4AEDA 4AFDA 4OHYA 2R061 1C4RA 3I54A 1H2KA 2RE9A 2VZVA 4WM7A 3NL1A 1AHSA 1IS3A 1CGPA 4FOQA 2RVAA 3L2HA 1RHI2 1BK0A 1C8NA 1RUNA 4JRAA 5EJZB 2PLV2 3CL1A 3W5NA 2DUQA 5FK8A 1RUE3 2WWUA 3SXWA 1CJPA 4LE4A 2Q30A 2VCAA 3UGGA 5FYTA 1WCSA 4L2NA 1WD3A 2CNAA 4JDNA 1A8MA 4D6SA 1ZVFA 4GB32 2WL1A 5IAVA 2BBVA 2DDUA 4HK9A 3SISA 2W1WA 5FYZA 3GJBA 1KJRA 2QTWB 4D0QA 1JZ7A 1US3A 5FMBA 1J3RA 4QDRA 4AYUA 3W9AA 2VCBA 1FNZA 3T0DA 4AAXA 1SQ4A 3WP5A 4FAGA 1APNA 4H14A 5IVVA 1LNSA 1BHGA 2BVVA 1LOGA 3KF3A 5DDJ3 3VBRA 4PLMA 5C4WA 1LGNA 2QCSB 1JU4A 2D6NA 2JKBA 4LKSA 1AR93 1TMF1 1Y4WA 2NMOA 2WA4A 2EIBA 3KCCA 3LEIA 4LUKA 2HWE2 4V1PA 3VDAA 3WDWA 2VQ0A 1VMHA 3LOBA 5LA1A 1UIKA 2GNTA 1GICA 4LKFA 1IGOA 1POQA 3WP4A 2P3KA 4URAA 5AC91 3A0NA 1HJGA 4D94A 1VBB3 4FAHA 3KMHA 3V56A 3N9MA 5EWSA 1PIV2 4HBNA 4TYSA 4XZPA 5JSRA 1VBA3 3LEMA 4HSJA 2AUYA 3AYCA 1MEC2 1RL3A 3FUOA 1A8DA 1GR3A 4N53B 1VBC2 5I8YA 3WEZA 2WNUA 4YVSB 5EYXA 5E89A 1BBT2 3AFGA 4EV0A 3WNOA 4IEUA 3PVBB 4FOWA 4CP9B 3LIHA 1DGWX 2OVUA 3H0OA 3N3HA 1W3XA 4HL0A 3H3LA 1GP6A 3D3AA 1Z7S1 3ZXDA 4DUXA 1WWYA 2IC1A 2XG3A 3D8CA 4IUGA 3K4AA 1CX1A 2XJUA 1UIJA 3I3DA 3J4UH 2AEZA 3M3IA 1AXKA 1RUG3 3FHQA 1YYNA 1X7NA 5E16A 3W21A 4L92A 5CFDA 2J1UA 1QH7A 5F6KA 5LWBA 2B39A 3AX4A 1S0DA 3VZMA 4Q8LA 1WA6X 1AX0A 1PO11 2GNBA 3AYEA 3KS7A 1AJKA 2WNVB 1CD3G 1H1MA 3NV3A 5H9RA 4QX1A 5KXCA 1MS8A 1W3VA 2JE7A 4OFGA 2BWAA 4IEZA 5IT6A 3VBUC 4GKXA 3K3OA 1PNFA 2VOTA 3AZXA 2W9XA 1DQ2A 2JX9A 4AEJA 5B4NA 4O9EA 2Y34A 2ZKLA 1OPMA 4BCUA 1IKPA 1AXYA 4LO4B 4BLIA 1W0OA 4E2SA 5JAXA 4MGTA 3SEEA 2HBTA 1Y3TA 4ZU5A 3MFAA 1OLQA 4WVWA 3BI3A 5FFOC 3I3MA 5IUQA 3MLLA 4NIDA 1F4AA 4YZ5A 4QKFA 5FYBA 1XNBA 2Q8EA 1CIYA 3AB0A 1W8OA 5DPNA 5DUUA 4MGYE 3WCSA 3D0SA 5GLZA 1V9U3 4Z92B 2VULA 2RM22 3DPRB 1FNYA 5C71A 1W6OB 4WVMA 2FDGA 1R091 1NQJA 2CWSA 3U4SA 2ADEA 5FYYA 3D4KA 2Y6GA 2FMYA 2B42B 1NXMA 1RUOA 5K9YA 4RS5B 2K46A 1GBGA 1RUC2 5CKQA 1HX6A 4MGIE 4PHZA 1OBNA 3NAPB 3T1MA 3LDKA 5T5PA 4EWAA 2RMU3 1O91A 1DZTA 3KGZA 1CN1A 3RYKA 3SNMA 3USUA 3FBYA 1N1YA 4GMP0 1H2LA 2SLIA 5CZKA 4E4SA 5A6YA 1D4M3 2DTYA 4QU1A 2E7QA 3TRSB 2D97A 2YFZA 3BODA 1GNHA 4LTAA 5E1RA 4YSFA 5K8SA 2XWJB 5A3NA 4DEVA 2OQ7A 1EAH3 2DWRA 2Q4SA 3VKNA 5EHDA 4LK7A 1SCSA 4Y22A 2RR11 3VN4A 4CXWA 3HR9A 3E5UA 4BU2A 1RXGA 4BQ5A 4MVTA 4I0WB 5DAQA 3A0KA 5TSWA 3TNPB 5FMDA 5GZCA 3N9QA 4AQSA 4PF1A 4M0HA 2VOVA 3E5QA 4DOUA 4EN8B 4FPOB 3ZYFA 3ZKUA 2FHRA 1KFUL 3HT2A 5GLWA 3TEYA 2HH9A 2ZZJA 3IWZA 1DQ4A 4QQLA 2IFRA 2K0GA 2ZS6B 2Q5TA 3PU3A 4GH4B 5M0TA 2VMGA 3WNMA 2ZMLA 2P37A 1ZRIA 3O1VA 2Y26A 4P5YA 4CXYA 5FYSA 1QH6A 1W0NA 1CAXB 5FDBA 1HB3A 2VG9A 5GZFA 3SH3A 2HWD2 4YW7A 1KEXA 2G19A 3AKQA 3VD7A 3ACHA 3VBFA 3PVNA 4JGZA 4B1LA 1C5IA 1UKGA 1WW7A 2I45A 1LU2A 1UOBA 4LBQB 3A23A 4LKDA 4LHSA 3LZZA 3VLBB 1QOSA 1VB4A 2JG9C 2WFF3 1BXHA 5C8WA 4BZ4A 4A3XA 5CFDC 4O9GA 3VDDB 4X6QB 4XILA 5T55A 4TXWA 5C5UA 3RSJA 5IAXA 4DUWA 1YFWA 5F3CA 2RJKA 4IEQA 1GP4A 3T4HB 5DQ0A 3SKVA 3M8LA 1RMU2 1YWKA 3F95A 1LESA 1S0IA 5JDBA 1V6LA 1XSRA 3AK0A 3JD73 4IV1B 2W91A 5A3WA 5FCCA 2LW8A 4FFIA 4HSLA 1RVF3 1I5ZA 2YDEA 3J8F3 1AR73 1F8VA 3TOJA 3Q8AA 3WG4A 1O3TA 4BE3A 2BGPA 2JKXA 4MV2A 4ISQA 3MDPA 2X5IA 3OGJA 3AKRA 3VD4A 1KDMA 3DXTA 3NV4A 4EWEA 2JDHA 4KU7A 2WC2A 5KHGA 3CMGA 4XJWA 3AZVA 4Q4W3 1OKOA 1FPN1 3ES1A 4W65A 4DY5A 2PN5A 3GM8A 1OC1A 4MXVA 2VZPA 5FZHA 3ON7A 2BBAA 2HWB2 2A3YA 4UI9L 4ZU7A 5FZKA 2DUPA 5F1RA 1SLIA 3M4FA 1HIXA 1MS9A 3IMMA 4MG2A 2XH6A 3ZR5A 2ZGLA 5FZ7A 2DTWA 3T1LA 1H8TA 3HVDA 1WZXA 2YBKA 1J1LA 1QNYA 4QQHA 4YVWA 5JCTA 2FCVA 2BU9A 5A33B 3CIHA 2DCKA 4QPIB 3BTAA 4YLZA 2C4XA 3UKTA 3TN91 5CIRA 2ERFA 1X8MA 2Z69A 1MVEA 2E31A 2UYBA 3T2QA 3ZIXA 5ISLA 3AYDA 4Y24A 1YI7A 1N3QA 4FI9A 5JZGA 3RVHA 1JHJA 3WF1A 5D8AB 1XNDA 3NQHA 4GWIA 2C26A 4MOAA 4NVPA 5SV8A 4QX7A 5C3RA 1AR62 2I07B 3M1HA 3SITA 1JUHA 1TNFA 2E32A 3AZYA 4R4XA 2WBKA 1LOAA 1J84A 1UY0A 2VW1A 3VD3A 1FT9A 1SLCA 4CEWA 3ZIWA 5FWJA 5FYCA 3ATGA 2XBO2 2VZSA 5EV7A 1ULEA 1PK6B 2JDMA 3GBWA 5DZGA 3GALA 1VIWB 1RHI3 5GM0A 4UF0B 4H2AA 4UFKA 3S7EA 1P8JA 4C91A 4HT1T 2PLV3 3EBRA 4WM8C 1DGWA 1REEA 5BNOA 1BJQA 3BGAA 3KWVA 3ZXJA 3ZXEA 5A3MA 4XF9A 3KV6A 2WNOA 2ID4A 4ZY9A 2ZGTA 3ACIA 4QXHA 3POWA 1MQTB 4GB33 5A1FA 4YG3A 5FTTC 3QLQA 4QWNA 3VBFC 3G7DA 5FKCA 1QJFA 1RUH2 4CCOA 2HWC2 3LA3A 4MGKE 3PHMA 5FP3A 1DU3D 1HRI1 4OQ9A 1YJLA 2ZGMA 1QJU2 3ZPOA 1CJDA 1Q8VA 4PQ9A 4CDUB 4TZDA 3LD8A 4Y4RA 3ABZA 3NKGA 5ERLA 4AQTA 1OD3A 4NIAA 4AWDA 5FZFA 2BFUS 3PUHA 4OULA 3VKLA 1S1AA 3VKMA 2JENA 3K2OA 2HWE3 2VL4A 4LA2A 1J58A 4KWUA 1IOAA 2DCJA 3N9OA 4NAMA 4TWTA 2RS31 4QPGC 1I9RA 1SLTA 1W8HA 1UY1A 2V5YA 2WZR1 2HWF3 2R1DA 2ZPXA 4XCBA 2JG8A 4CUGA 3HNYM 4CZSA 3FFZA 2BUKA 3GF6A 1NG0A 2WZ8A 1MEC3 4IEPA 4Q0PA 4LHKA 4UYBA 5E88A 2ZGKA 1TME2 4BIOA 3FL7A 4YW1A 2X5IC 4RQPC 3VKOA 1VBC3 2QQPA 2A5ZA 3NJVA 5F7UA 2PELA 1BBT3 3NWKA 4V2VA 2WAAA 4ASMB 5FAXA 4WZCA 2OIIA 1DQ6A 4KWKA 1HDKA 2CAUA 5BXXA 3ZDVA 5FZ4A 1DYOA 3UKVA 2IXLA 3FE5A 1TZOA 2KXLA 1COV1 4GMP3 3NW4A 3KV5A 2ES3A 2E33A 2HKXA 4IXLA 5IVBA 2XLAA 1SEFA 1VMJA 5H9SA 1YQ5A 1ZNPA 5ABJC 1I3HA 3KT1A 3MGUA 4Q0VA 4IGQA 2Y33A 5JUVA 4YVWC 3USSA 2D3SA 2BJSA 1PVC1 1UYZA 2QDRA 1GP5A 4MHRA 2BDRA 5F37A 4M00A 1W9FA 2VZ1A 1OLME 3POYA 1VRH1 1U5YA 2H6BA 3I2OA 2UU8A 3N7JA 1W6PB 3ZN6B 4K40A 4ZHNA 1LOCA 4CRQA 2CGNA 1F35A 3BU7A 5B4XA 5C3SA 3AP7A 2WWJA 3JCIA 2VU9A 3M3EA 3RI8A 4AW7A 1AR92 4CVUA 4XFFA 2WS92 5A32B 4IQPA 1WGPA 4DB5A 4OMCA 4F7ZA 1Y9GA 3LKJA 1XB9A 4NMIA 1ND2B 4NHKA 1QQP2 4U36A 2NQYA 1W9YA 5L7OA 4FPGA 4GWNA 1VBB2 4LQRA 3VBHB 4CEWC 3O1MA 1SFNA 4BA6A 1ZBE1 1BEV2 1QJX1 2SBAA 1UKRA 1UXXX 2RM23 4FP3A 5FZAA 4PDWB 5C8CC 1ZBA2 3CJXA 3G6JB 4IEXA 5CVRA 3T08A 4Y20A 2CSGA 1ASJ2 1XNTA 2DUOA 3OUJA 5A7WA 2LS6A 1AX2A 3WHTA 1AUYA 1QHDA 3ZYIB 1RUC3 3W20A 4BJ0A 3JBG1 2YY1A 2GC2A 1NZIA 1SG3A 2WT2A 5JIUA 1IS4A 1LHWA 2R062 4JKMA 1O3SA 1DG6A 4JV4A 4LK6A 1KFXL 3S5QA 2RHPA 3C7FA 4XDPA 3UJOA 3NV1A 2B45X 2QQLA 4K8RB 5FYHA 4HLTA 3J7NA 1UCXA 4BYYA 5C70A 4S2DA 3OGGA 2R16A 1OOPA 3FN9A 4G9SB 1GOGA 2IVIB 1CZSA 2CV6A 1UX6A 4S2GA 5EYYA 3EB7A 1Y7BA 1RUI3 5K0UA 1HW5A 1R082 2ZGNA 4QB2A 3I2IA 2JWPA 1KITA 2HYXA 3ZR6A 4BXFA 1VBD1 3RQ0A 3ZFFA 5C5TA 1T6BX 3TEWA 5FZ8A 5IYYA 3Q8BA 2VMDA 1DLCA 4LNVA 2MEV1 3VD5A 3PVOA 4DNYA 5KHJA 2NYYA 3HAGA 1KQRA 4P9YA 1BVVA 4RHV1 5J7MA 2DVGA 3GGLA 2BQPA 3JZVA 4BB3A 2Y6LA 1AX1A 5T5LA 2YBSA 1J3QA 2JECA 3ZMOA 2HLEA 1PO21 4OVEA 2PHTA 1H2MA 2VCMA 1GZWA 2JG8C 1TG7A 4P02B 2X09A 4LIUA 3DYOA 3PTYA 3RZGA 5T50A 3S6PA 3GDBA 3LB9A 2RV9A 1TMF2 3WP3A 5ACA1 1V9U2 1ZRRA 4SBVA 5FZGA 5A3UA 2ZGUA 4JAAA 2ZKNA 4LHLA 1ZZCA 3ALQA 3RI9A 3ZYGA 2HWD3 5C9AA 1N1TA 1T6GC 1UZVA 1YNAA 1UPIA 3ST7A 5AC92 5FY8A 2QE3A 1SLLA 1EYBA 1NLSA 1XXNA 5JLVA 2FDJA 4AI9A 4ET7A 3IIIA 4RD7A 5I93A 4LO7A 3WSOA 1DCSA 1FOD2 3CHXA 5DXDA 2FZ1A 3M2MA 4QAWA 5F8PA 3UKNA 1MPXA 3E6DA 1H1IA 1GFF2 3OY8A 4JX0A 2J22A 4D7TA 2KR2A 2JB8A 1V0AA 2G1MA 4CDXB 2NMNA 4XF0A 3A22A 1CZTA 4ZU4A 4CEYB 1RMU3 1Z7S2 4YZ3A 2UY8A 3LWCA 1JI6A 1ULOA 3OPTA 3OD0A 4AVTA 3RZZA 2YC4A 2CDOA 2XL9A 1EAH2 3EO6A 4B4RA 3FUQA 2B9VA 4IE6A 4B29A 5KXBA 2Z4FA 4CP9A 2E6VA 4E8CA 3QCWA 4UW5A 1NCRA 3LFIA 4AI0A 3I49A 5A7QA 5LY2A 1SPPB 4E4ZA 4NJ4A 3NV2A 1PO12 5DUXA 4AGRA 3EQEA 3OGVA 2PHRA 4M3CF 3OB8A 4LBMA 4UFJA 1MZ6A 3VD9A 1DDLA 2PAEA 4CSWA 3I2DA 1TVGA 4RR3B 4AGVA 4IETA 2C5DA 1A3KA 3B5LB 5GALA 3IKWA 1UZZA 2B8MA 4JZRA 2QUOA 4PT6A 1PGL1 3JQXA 1YEWA 3C7GA 3JB4C 2HWB3 3N36A 2LM3A 5JPNB 3UESA 1YFYA 3RWKX 3ZSMA 1XYOA 4LHNA 3H7YA 1V6OA 4URTA 3RNSA 3VBSB 3AMNA 4BISA 1EPWA 2GC3A 4XJ9A 4NHLA 4RGGA 3H9AA 5IVCA 4YGEA 1US2A 1C3HA 4BDVB 4BWOA 2J1TA 5IK8A 4XAEA 1LENA 4HN0A 4ATFA 2XUEA 1F9KA 4FVVA 3F2ZA 4H7MA 2XHNA 3RMYA 1W2TA 2TNFA 3JU9A 1RB8G 1PGW2 4GKYA 4YZ1A 5J09A 5JIAA 2BVBA 1CAVA 5CB7A 3WF2A 1H6XA 2ZJCA 3D0JA 2ZXQA 2EVXA 3GZUC 3UJQA 1QJZA 2BPA2 1O3QA 3MI8A 4HKLA 3ACGA 1OOPC 2V73A 3MIDA 1CVNA 4MZUA 1H9WA 1AR63 5K0UC 2AR6A 2VOWA 3MV11 4LE3A 2ZBJA 2ZACA 3IIAA 3HMYA 5DAPA 2QFEA 3ZFFC 5GLUA 1K45A 1V70A 1LKNA 3LDRA 4CDQB 1FMD1 3ZYJB 5BNPC 3NJYA 3WCRA 2E7TA 1Y43B 4FPEA 3FJSA 2R49A 4MLOA 4RS5A 4AFMA 2DVAA 2C9AA 2XBO3 4OMDA 5F6LB 3P3NA 4QX0A 3I3EA 3NAPA 4D6RA 4OLLA
chains in the Genus database with same CATH topology
4COZA 1AR81 2IFWA 3WOGA 2K9ZA 2JD4A 1ULCA 1VALA 2CL2A 3VHRA 4LBNA 1ENQA 4IV3A 4AHYA 1BVP1 3KT4A 5KC6A 2RR12 2JXAA 5HI0A 3OYWA 1Q8QA 1ZZ6A 4C1XA 5C9AC 1C5HA 1GQHA 2ZX0A 4XYXA 4AXOA 5J37A 3LA2A 1POV1 1RUE1 4WBBA 1RUH3 2HWC3 3KQRA 2YC0A 1G9FA 1HQWA 1G9AA 2ARBA 1QJU3 1LR5A 1NCQB 5J48A 2R0FA 5J98B 1WUVA 4EWDA 1YRZA 4YFWA 4ES8A 1VJ2A 2DCYA 4COUA 1REDA 2JDZA 4A7YA 1O7FA 2EIGA 4PJYA 4KNCA 1JYCA 5C6CA 4MH0E 2KA3A 1CAXA 4L9BA 1ZZ7A 1V6KA 2NN8A 1K5MB 4I01A 5GJ6A 3TWIA 4LULA 3GHNA 5CFCB 1GYKA 2B7YA 3ETQA 1NCRC 1TME3 2VXRA 4KQ7A 4AVAA 3WVJA 4P9GA 2AZ5A 2NM1A 1PHMA 2ATFA 4FO9A 5JPMB 1GZ9A 1MZ5A 2JEMA 1WA4A 3VL9A 4JGYA 1X33A 3VDDA 5I8TA 2ZAAA 4H7LA 3OTFA 1U5XA 5L19A 1W6QB 1U12A 4Y1ZA 5JSPA 1WBLA 4Y1XA 3ACLA 3NO8A 3IMNA 2RS53 4FXGB 4IV1A 1ULFA 1PMIA 2I2SA 2XVKA 1FPN2 3AKTA 1UW8A 1MS5A 3UV9A 3VZJA 1R1A2 2P3JA 4N90A 1C8M1 1A78A 4FOYA 4AQ2A 3B9IA 2VQAA 3BB6A 3GHMA 4PLOA 4J1XA 2HYKA 3H50A 2PHUA 2WS93 4BOWA 3WINE 1QQP3 2WT0A 1LOBA 1GQGA 3LA7A 3SH4A 4EJRA 1RJ7A 3TN92 5FQ0B 4YM3A 2HWF2 3WDXA 2P17A 1OA2A 2D6KA 1BEV3 3WDYA 1D0GA 2GH2A 5LK5A 4COWA 2PA7A 3AMHA 1AF9A 1ZBA3 4UBGA 2OYZA 3AKSA 1IS6A 2AGSA 1ASJ3 4H3WA 2WJSA 4Y1VA 4XJAA 1QOTA 4XFAA 4IV3C 4RFT0 1IPKA 2W52A 1NY71 4CYDA 3VL8A 2E53A 3U0ZA 2YMZA 4RA0A 2R063 4XFHA 3ZDSA 2IXKA 4PBOA 3VBOC 4XE9A 4JC1A 1AYM1 2VOKA 1YIPA 2WT1A 3L9JT 1SDWA 2P3IA 5DUWA 4EROA 1QJY2 2GMEA 5KHIA 1BMV1 1R083 1FXZA 1Q8OA 1ENXA 1PK6A 1V00A 4Q4Y2 2AH2A 5DZFA 3FX3A 4Q29A 3WG3A 3QACA 2ZHNA 1ULDA 4BIFA 3ZO0B 4AHXA 4XQDA 1H0BA 1DLLA 2OW4A 2DFBA 4AK3A 4HK8A 2OPKA 1HRI2 1UF2C 2VMHA 3KM5A 4PIYA 1MS4A 2HEWF 3FBMA 4OZXA 1BK1A 2GALA 3IPVA 3CLPA 5T5JA 1TMF3 2PHXA 4JCKA 2NPIA 4AEDC 3IT8A 1PGSA 1SBDA 4J6GA 4WM7C 1UD1A 3FLPA 2RS32 4CDUA 5AC93 5EXOA 2Y38A 2P2KA 4QQPA 4JGYC 4AGGA 4K21A 2GC0A 2WZR2 5CG8A 1XQNA 2QZ2A 2QKDA 1FOD3 2Q0AA 2UWBA 1GNZA 3AMMA 1E57A 2EF6A 3AJZA 4XMIA 3EHKA 1AVBA 3UL2A 3SLIA 4QM8A 5FPXA 1Z7S3 4EN6B 3CEWA 2Z42A 1QWRA 4XFCA 4Y26A 1RUI2 4C90A 1COV2 4KG8A 4FPFA 1N47A 3VBRC 4EN9B 1HRV1 5C4WC 3FFQA 4YGBA 3RG0A 4P9XA 1VBE1 5IK7A 2UURA 3SHRA 1PO13 1UU4A 1S0GA 1B09A 1AR71 3AXDA 3D82A 3T2TA 5CBLA 1UMZA 2RS12 4K1YA 1FAYA 1N3PA 4AHWA 4SLIA 2DVDA 3VBOB 2R071 4GALA 3DUIA 1CAWB 2D5FA 1RGSA 4ES9A 1O4ZA 2G9FA 2WNUC 4Q4W1 4UXAA 4QXKA 1RUD1 1CAUB 1W6PA 2Y0IA 3ZN6A 2QZ3A 5HXVA 4B7KA 4P9LA 1YXWA 3AZZA 4IEYA 4I30A 3VBUB 1NE4A 5A32A 1QDOA 1W6NA 2VNOA 3LOIA 3N35A 3APBA 1FYUA 1ND2A 2XVLA 4X8PA 1OD5A 2ZX1A 4XHBA 1LRHA 1TEIA 3VBHA 3AP4A 3U11A 4EWAA 3JBG2 1DGRA 1S0CA 3ENRA 3IN9A 4E2GA 1AZDA 1HKDA 1RUJ1 2A6ZA 2FQPA 1QU0A 3MIFA 2VMIA 3AKPA 1WD4A 4AEDB 2D40A 2O8QA 2D7FA 1FATA 1LJ7A 3ZFEA 1V6MA 3KZ4C 3JQWA 1F31A 1NA1A 2Z5WA 1N1VA 2PFWA 5AFEA 2ARXA 1SLAA 3B3QE 2D3PA 2W08A 1VBD2 4OHXA 1PZ9A 3ILRA 2G9GA 2R0HA 2RR13 3MZHA 2OA2A 2ETEA 2BEOA 2NLRA 2A70A 1RHI1 2WNEA 4WV8A 4RHV2 3HIFA 2H0BA 4KG0A 2OUHA 4R9AA 1PO22 3V65A 1C1LA 4GULA 5LEJA 1XE7A 4M3CE 4IEVA 1REFA 4N7UA 5ACA2 2VH9A 3FLRA 2R042 1VR3A 2MHFA 5D1IA 3JUUA 2G4IA 1LHOA 4GXLA 4ZXKA 4QM9A 3OBTA 3WY6A 4HANA 3V0AB 1Y9QA 4NPRA 5DG1A 1WW5A 4R9DA 1RUF1 4M3CB 1HQLA 1GKBA 1OMIA 2VPVA 3FMGA 3MLJA 4I0BA 4YM2A 2WINB 3M3CA 4Z2WA 4N9IA 1JOJA 3ZXKA 1DQ1A 4DFSA 1YO8A 2A73B 2H0VA 2W39A 1PIV1 3B93A 3I59B 2ZGSA 3O5SA 2UWCA 3ES4A 4KU8A 2PHLA 4OI1A 5E8AA 3THPA 1NZCA 2WLQA 1DHKB 2JG9B 4CDXA 2XPJA 1OKQA 4UW6A 1BBT1 5CFDB 4G3YC 4AFAA 1Q3EA 4LBQD 2DVBA 4Q27A 1VB2A 2XVGA 4JGZC 4WVZA 4Q0QA 1FPN3 4HFSA 4AVSA 4TSVA 4M0NA 3O14A 3E97A 4GMP1 1PGL2 4FSJA 1R1A3 1JYIA 4BMBA 2E9QA 2VNGA 3N7MA 1LOEA 4N9HA 4E2QA 5KWRA 3E6CC 4XBLA 4HMZA 2RJLA 4I2OA 3DN7A 2X29A 2GNMA 2WLPA 3P3PA 3WDUA 4CP1A 3KT7A 5EJ3A 4HVQA 2ZMKA 4D69A 1NE6A 5AFBA 3VBSA 4ISRA 2YHJA 2ET1A 1S0BA 3HN1A 3TN93 1VAMA 4DS0A 1AL21 3I8TA 4H55A 4XF1A 3EJKA 3GYDA 3VV1A 3ZFEC 4JTOA 1NA1C 5HCAA 3THTA 3ECQA 1ZYBA 4RGAA 4BH9A 3O0XA 1DYPA 1FMD2 3WXPA 2BYVE 5FOJB 2QJVA 2BNOA 2E7AA 3CJIA 3USUB 2YPJA 2D93A 5BNNA 1L3JA 1OPOA 3RYPA 1B35A 4K1ZA 1ZREA 3N7LA 3ASIA 3R4SA 1F5JA 5AVAA 5KHHA 2VECA 4ASLA 2RS52 3WUCA 1RITA 1PM7A 2OZ6A 1G6NA 3WNXA 2XJQA 4CDQA 4FTSA 3BIWE 2PYTA 1ZA4A 4PBPA 2AENA 1BZWA 1QJY3 1H8TC 3KLSA 4XPVA 3A4UA 4LO5B 3ZYRA 3GZTB 4COYA 2DU1A 4Q4Y3 4XDQA 2CTVA 2D6MA 3B9CA 4GWMA 4XQ4A 4Y22B 1S55A 2MNGA 3NVCA 2I74A 5BYNA 3H1WA 4NOTA 3ZFGA 4B4PA 5B2GB 3V0BB 4QU2A 1ND3A 3U07A 5JZGC 1HRI3 1WMFA 4A7ZA 3D5OA 4BLJA 1I6XA 5I0SA 4WM8B 1S0EA 1AYN1 3MF6A 5JWPA 4E4DX 1DQ5A 4XJUA 1YHFA 3VBFB 4CDWA 1OFSA 4YM1A 3V64A 2RS33 2PHWA 2YXSA 3OPZA 3MPPG 4HVOA 2XWBB 5JOZA 5AVPA 1TE1B 2WZR3 2N7GA 2D6LX 5FBZA 4N43A 2ZCWA 3HQXA 1QXPA 2O1QA 2VW2A 5BNOC 2ZAHA 2GAUA 1C57A 1F5FA 3LAGA 1LHVA 1J1TA 1CPMA 1W6MA 1YIFA 3KCXA 2Q8OA 3FWEA 2GN7A 3WW4A 5CFCA 4FPJA 4QPGB 5J3UA 1G9CA 1W39A 1NLRA 4META 1COV3 1S0JA 5FOBB 4MGZE 4S2HA 1SMVA 3KCYA 1QY4A 1Z0HA 1RMU1 2X5IB 4RQPB 4HVRA 4P14A 1O4TA 1M4WA 3HT1A 2PAKA 3E5XA 1C8M2 3QOPA 2RS13 1ENSA 3W59A 4NWWA 4AEKA 4YNIA 1OQ1A 4MXWB 5CAZA 1DZRA 2LUWA 3MPBA 4AVVA 1H8VA 5ABJB 1H8TB 2WKKA 5FRAA 3RS6A 4DINB 4YVWB 4Q4X1 3R4DB 1ZRDA 1EV11 2HWB1 1HXS1 3ELNA 4KL1A 1KXGA 3ZXLA 2GZWA 3CJIC 2YV8A 4L11A 1FV2A 5BNNC 1ZRFA 1B35C 3AMQA 3WQ1A 2D43A 2GDFA 3D6EA 3MIBA 4PCRA 3WUDA 3VKFC 4EN0A 5JZGB 1UU5A 4AI3A 1JUIA 2W68A 3JBG3 4UBHA 4BQ1A 1NY72 2CWMA 3WD5A 1NQDA 2BFUL 3MIGA 4OI2A 4PIZA 4DMIA 4YRDA 4CEWB 1RC6A 4YG0A 4N53A 1Q56A 4QD2A 4YVSA 1H9PA 4B7EA 1AYM2 1BCXA 3IBMA 5C8CB 4XTMA 3ZFGC 4F8AA 4DRVA 1ND3C 1BQPA 1XU2A 2YGLA 3NJZA 5HCBA 1ONAA 1VBD3 4YW5A 4XHXA 1YFUA 5L7OC 5FO9B 2WA3A 2EXJA 4YW2A 2MEV3 3AZWA 4GIQA 4LBOA 4LUMA 3VHOA 4UW4A 2D98A 4RHV3 4CDWC 5L36A 4FPKA 3DKWA 2WNVA 5CG9A 2R6QA 1FV3A 1PO23 2TEPA 3PLQA 4FPCA 3H8UA 4N43C 5KXEA 2MPFA 1X50A 3POSA 4XETA 5CADA 5ACA3 4AHZA 3WP6A 3C3VA 4Q4V1 1OHFA 2R043 1RUH1 4YFZA 2HWC1 1DQ0A 4R9BA 1R092 1DIWA 3AYAA 1RTVA 1H4HA 4FCAA 1D2QA 1LECA 4AG4A 5JOWA 2Q1ZB 4OI4A 1ZZ8A 4OUMA 2JG8B 3DPRA 3QH6A 5J36A 2ZOEB 1W6OA 2WFPA 4JDMA 3WHUA 2AREA 4F3JA 1KRIA 1JN2P 4BPZA 2PHFA 2XKOA 1QOOA 2O0OA 3AMPA 5BY5A 4I3PA 2IXHA 1OLRA 3WQ7A 4M01A 3ZX7A 1HRV2 4KWLA 2XJPA 4LBJA 4DPNA 2VVEA 4Y5Z0 5FPZA 1VBE2 2HEVF 4TLFA 1DFQA 4YARA 2R072 3VHNA 4U2AA 5A3LA 5K7PA 1Q43A 4JDOA 1D2SA 4BM8A 1KDKA 4K8FA 2XLFA 1RUD2 2XUMA 3R4UA 4I09A 4Y1YA 1XYNA 4DZGA 2ZX4A 4GH4A 3WLUA 5DDJ1 3QBQA 2ZX3A 2XJRA 4N53C 1GSLA 3LCPA 4YVSC 1YCIA 2FBEA 4D3WA 4XTPA 1AR91 1MR5A 1RJ8A 4B4QA 1HV1A 2WS91 1LCLA 2B46X 4Y20B 2DVFA 4XW3A 4LBQA 2IXJA 1VBB1 3ZYPA 3VBUA 1MS3A 1VBA1 4OI0A 5T54A 1FMD3 1URXA 2DU0A 2W0XA 3WX5A 3ZVXA 4XOGA 2OUJA 2R1BA 2PAMA 2FZ2A 2GSYA 4XQWA 2IWGB 3CNAA 1CQ9A 4KWJA 2JE9A 2WNVC 4OHWA 1OOPB 1V6NA 2KM2A 4NWVA 4XF3A 5K0UB 1V6JA 1OFNA 1RUG1 3ZPYA 3ZFFB 4YZ2A 5BNPB 3KD4A 3GBFA 2D5HA 2K2SA 4FQZA 3WW3A 4BHPA 1IHMA 3DV8A 1POV3 2NZ9A 3I4IA 5DUVA 1R081 2R32A 4LO6B 1ZZBA 3PVEA 2XGXA 3BALA 4XFBA 1GZWB 3DPRC 1GANA 4FT8A 1C28A 1AXZA 3RWNA 5JOYA 3PMSA 3HBZA 4RS5C 5C9AB 2TUNA 3BOPA 2XJSA 1OQEA 3NAPC 2EAAA 5A33A 4QPIA 5JMCA 4IEWA 1LEDA 2TBVA 3KSCA 1XU1A 4HETA 1RUF2 1V9U1 1JBCA 2XHKA 4R4ZA 2ILMA 3WG1A 2GC1A 3OY8B 4LEJA 5D8AA 5CNAA 3WQ0A 3V0AA 1PZ7A 4YG6A 3RJRA 1FOD1 3BCWA 3PJYA 4M3CA 3INAA 3AP9A 2ZGOA 2RMU1 2Y0OA 1UZYA 3ZN5A 4XBNA 1D4M1 2F6BA 1MZFA 2R30A 4X8NA 3S7IA 1NCRB 3ME2A 5F9TA 1YFXA 2BTVC 3I59A 5JI7A 4LLFA 4FQ4A 4CP0A 4GH4C 2JG9A 1UU6A 4Y4YA 5CU1A 3WT3A 5EFUA 5J96B 1EAH1 1H4GA 1C8M3 1MQTA 1JH5A 4A7KA 1WMEA 4W6WA 4IESA 4C0HA 3PNAA 2IXCA 4AQ6A 3VZLA 1PNGA 4X6RB 3CU7A 4Q0SA 2ZGPA 1FI2A 3FLTA 2EAKA 4QPYA 1AL22 3VDDC 4QGLA 3M3OA 4AEMA 1WW6A 3VZKA 1CAVB 1WLTA 2FMDA 5LRSA 1QXJA 3AFKA 2XLGA 1IKQA 1WW4A 4FPLA 2JICA 4IV1C 3VZOA 5GLTA 2YGMA 5LK7B 1PGW1 1G7YA 4WZFA 5I91A 2WFF1 2A6YA 1CPNA 3O0VA 2CYFA 4R9CA 1AYM3 4XFGA 1BYHA 1F2NA 1PZ8A 4DXZA 1LHNA 3J9SA 1G8WA 4HN1A 2VY0A 2QVSB 5IK5A 3JD71 1PVC2 4YGCA 1RIRA 1RVF1 4IV3B 3J8F1 1LB2A 2YUEA 4LBKA 4NR1A 3FZ3A 5JOXA 1VRH2 3MW4A 3OYWB 5KBFA 1QF3A 1C1FA 1YJKA 1LGBA 2YROA 5FMOS 5I0UA 3S0MA 3QH7A 4Q1RA 5DG2A 1ZRCA 2QNKA 4D7SA 4QPIC 1WMDA 2CGPA 3SCHA 1AYN2 4QHBA 3AXEA 1VAKA 3U4XA 2A7AA 5SV5A 4FPYA 4FXKB 1ZBE2 3ZSJA 3V0BA 1QJX2 1UL9A 1XNCA 5D8AC 3VUOA 1WLWA 2PTMA 4WM8A 1R093 4G4FA 5BPXA 1HLCA 4I0AA 4K20A 4K3UA 4QT6A 5GKAC 3B00A 4P9WA 1NXD1 1S2BA 4HPKB 3RMXA 3IDCB 2GMPA 4MSVA 2VW0A 5I0TA 4YGDA 5I0RA 4PDWA 1PK6C 1I1EA 3MIEA 3TB0A 2DYCA 4YM0A 4AVCA 1RINA 2AYHA 3KB5A 3MF9A 1OA4A 4WM7B 2BNMA 2E63A 3UK9A 4JRLA 4JGYB 1QXRA 2VVFA 5IK4A 2ZA9A 1MQTC 1IPJA 4OHZA 1HRV3 2EALA 1WLCA 4N7IA 4Z1VA 1X82A 3B69A 1VBE3 2MEV2 3ILNA 4QPGA 1QKQA 3GBGA 3H3ZA 4FBFA 3X29B 2PLV1 4CDUC 1D0HA 1S2KA 3GZAA 3B94A 1XE8A 4RQPA 1Q8SA 2R073 5FO7B 2ZMNA 1KS5A 4GB31 2HEYF 4QGMA 3VBRB 5C4WB 3H1YA 4XJ8A 3OBRA 3Q9OA 1RUD3 4FP2A 5KC5A 4Q4X2 3SMHA 1R1A1 3RDIA 1EV12 1U5ZA 1HXS2 4XXPA 3MIHA 5FLJA 4C0BA 4MXWA 1DBNA 2EXHA 3O12A 4Z8BA 5LEKA 2YZ4A 5T3NA 4COVA 2HJIA 2ENRA 2ZTNA 2ZHMA 1H2NA 4AI2A 5ABJA 4YW4A 2C0ZA 2HWE1 4J1WA 3E6BA 4R52A 4YZ4A 5BNQA 1W0PA 2WNUB 4Q2FA 3ZSKA 3SCGA 1RUJ3 1EP0A 3MW2A 4RSUA 4D7YA 1X8EA 2HWF1 3OF1A 3PMEA 3ZXGA 4W6YA 4E27A 1MEC1 2LTNA 4OUSA 5H9QA 4XBQA 1CIWA 5JVVA 1VBC1 1HV0A 4CEYA 4GQ7A 5FO8B 2Q1MA 1IQAA 4WVVA 2VVDA 2NP0A 4PIXA 3WV6A 5JR7B 3ZXFA 1G9DA 5FLHA 1SBEA 4Z07A 5C8CA 2DFCA 1YLLA 1ZX5A 4BWOA 1MZEA 1VP6A 2BNNA 1KS4A 4EN7B 3TAYA 1WCDJ 1ND2C 1QJY1 4RR3A 3URFA 4ITCA 4C1WA 3VBHC 4Q4Y1 4INDA 2GH8A 3AP6A 3IPVB 1JW6A 1DZQA 3J26N 4PDWC 4Q4V2 3WDVA 4Q26A 3M3QA 1CX4A 4KH9A 3IDBB 3NKTA 3B02A 3H7JA 4WVMB 2UWAA 5FMOL 3C2UA 1LOFA 2B5HA 2YYOA 2JJ6A 3DGTA 3N7KA 1G9BA 1RUF3 3AM2A 4QQOA 3K51A 3LSDA 1QNWA 3SCFA 2D44A 2RM21 4F83A 1PVXA 2X53S 1SACA 1FX5A 4LBLA 1JXNA 1LU1A 1PIV3 3VZNA 4NO4A 1AR82 4OHVA 5JSOA 1RUC1 2WIIB 3H1MA 1O5LA 4K7JA 1HQNA 5GLVA 1UPSA 4P5HA 1EY2A 2ZGQA 4DQAA 1ALYA 3M7AA 2A3XA 4HZFA 2BWCA 4FOVA 3IM0A 3RRDA 4LT5A 1YI9A 4A2UA 4DY3A 3WG2A 2GMMA 3CO2A 1JTZX 3O7OA 2WSUA 1QDCA 4I3GA 4LA3A 2ZZQA 5HBAA 1XNKA 1RUE2 1SFYA 1RUI1 3AP5A 2VUAA 4CTEA 1UN1A 1CR7A 1Q8PA 1WCKA 4Q8KA 2QDNA 3TBDA 2VNRA 3OCPA 2XB6C 3O0WA 1N1SA 4E9KA 5F5QA 3R0RA 2EA7A 3ILFA 4B8EA 4XJZA 2O8OA 1YUDA 1R1ZA 1N3OA 3JB8A 3BPZA 2RS11 4ZKTB 4P9IA 4JGZB 5DDJ2 5T5OA 4ATEA 1M06G 3WW2A 3OD4A 4MYEA 2A6XA 1AL23 1LGCA 4QQ2A 2ZHLA 4UW3A 1NCQA 3CF6E 4QGNA 4P9JA 1W6NB 4CDXC 1A6CA 1ENRA 2HWD1 4CEYC 4IEOA 4IL7A 2VGDA 1TNRA 3K48A 3ZN4A 1SLBA 2V09A 1VBA2 2GN3A 1K5MA 4L99A 4XIKA 5I8SA 3MFCA 5JI9A 2LALA 3FHIB 4QMAA 4JVAA 2E51A 2F4PA 2GU9A 4FTBA 5BV6A 4B3NA 4ONUA 1U0AA 1MS0A 3MW3A 3ZFEB 3B7MA 2XJVA 1NA1B 4XMAA