1R092

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09200
1ND3A 1NCQC 5BNPB 3VBRC 1NCRB 2R071 1RUG2 1PGW1 1AR71 1RUC2 3VDDC 3VBOB 1FPN3 4IV1B 5DDJ3 4CEYC 3LOBA 5C9AC 2MEV2 3DPRA 4FTBA 1K5MA 1HXS2 2WFF2 1QJY2 2RS52 1OOPB 1TME3 1FMD1 4RHV1 3VBFC 4Q4Y3 4GH4A 3NAPC 1NY72 4Q4V2 1POV1 1QJU3 2HWF3 2X5IA 1D4M1 5AC92 4IV3B 3ZFFC 1FOD3 1OPOA 1WCDJ 2RR13 5C8CC 1RUD1 4RS5A 1B35A 3ZFEB 5ABJB 2DF7A 1VBE1 5A32B 2XBO1 4Q4W1 5D8AB 5K0UB 5DDJ2 1RMU3 5BNPC 1AR73 4N43C 1Z7S3 2RM21 2WZR1 4Q4Y2 3VBOC 4RQPB 1AYM1 1R092 4CDQA 2FZ1A 3JD71 2BFUL 1C8M3 1QJU2 2HWF2 1CJDA 1ZBA3 3M8LA 1OOPC 2XPJA 5ACA1 1QQP1 1H8TB 1VBB1 3CJIB 2GH8A 4GB33 5C4WA 1V9U1 2HWE1 5L7OB 3J8F1 1TMF1 1RUH1 1ND3B 3JB8A 1COV3 4Q4X1 4IV3C 1RMU2 1RUJ1 2HWB1 5CFCA 3JBG2 1VBC1 1AR72 2XBO3 3JB4C 4Q4W3 4QPGA 3ZFEC 4RR3A 5ABJC 1Z7S2 1GFF2 1F2NA 3DPRB 1K5MB 5D8AC 5K0UC 2TBVA 1AR81 3ZFGC 1MEC1 1NG0A 4GMP1 1HRV1 1C8M2 1R1A2 1X33A 1X36A 1ZBA2 2RM23 1AUYA 4GH4B 1DDLA 1RUI1 1AYM3 1EV11 5A33A 1QJX1 1VBD1 2HWC3 4GB32 1MQTA 4RQPC 4JGYC 2X5IB 5GKAC 1HRI3 1NOVA 4WM7A 2RS11 2HWD1 1COV2 1ND2C 4RS5B 4FTSA 1B35B 1H8TC 3CJIC 3J8F3 2XBO2 4Q4W2 1VBA1 1AR92 5JZGA 4Q4X3 1RHI3 1A6CA 1ND3C 1BBT1 1VBC3 1PVC1 1BMV1 3VBUA 4CEWA 4JGZA 4NWVA 1VB4A 2RS33 1VRH3 3VBHA 4CDQB 1MEC3 1AR63 4GMP3 4CDUA 1HRV3 4RFT0 2HWC2 4Y4YA 4AEDA 3DPRC 1HRI2 2R061 5CFDA 3VBSB 1EV13 2GSYA 1AL21 1R081 4QPIA 2RMU1 1SMVA 2WS91 4GH4C 2PLV1 1HQNA 1PO21 1RUF2 1EAH3 2RS13 2X5IC 1RHI2 1ASJ1 5CFCB 4RS5C 2R043 1B35C 4Y5Z0 4RR3B 3VDDA 2BBVA 2RS32 4CEYA 3FBMA 1VRH2 1MEC2 1PVC3 1AR62 1PGL2 1HRV2 1FPN2 2IZWA 2R073 4FTEA 4CDWA 5A33B 2WWSA 5FMOS 1PIV1 4YVWB 1NCRC 1BEV1 1TME2 4FSJA 3TN91 4CDQC 5BNNB 4WM7B 1AL23 1EAH2 2RS12 4IV1C 3ZFFA 2RMU3 3VBSC 1FMD3 4RHV3 5C8CA 4CDXB 1PO23 1E57A 1FOD2 5JZGB 1VAKA 2R042 2BUKA 1RUE1 2RR12 1RVF1 2FZ2A 1POV3 1F8VA 1ASJ3 1D4M3 3VBUB 4JGZB 1RUG1 1RB8G 1RUD3 4N43A 2R072 1RUC1 1PGW2 4RR3C 3VBOA 1VBE3 4AEDB 4PDWA 5CFDB 2MEV1 1HXS1 1QJY1 1VB2A 1AL22 2RS51 5BNOA 1PIV3 1BEV3 1FMD2 4RHV2 3TN93 1M06G 4YVWC 2WZR3 2Y26A 1NY71 4Q4V1 2WLPA 5BNNC 3JD73 1C8NA 2QQPA 5AC91 4WM7C 4YVSA 4Z92B 1D4M2 5J98B 5ACA3 1QQP3 1VBB3 4CDXC 1PO11 1RUD2 1V9U3 5JZGC 2HWE3 1CD3G 1VBE2 1TMF3 4GMP0 1RUH3 5DDJ1 3ZFGA 5L7OC 4N53A 1RUJ3 2HWB3 4CDWB 4JGZC 1RUC3 1AYN1 4Q4Y1 2RM22 2WZR2 1HXS3 4JGYA 1R091 5J96B 3ZFFB 1AYM2 1AR83 5CFDC 1QJU1 3JD72 2HWF1 1ND2A 1K5MC 5ACA2 1QQP2 3CJIA 1RUI3 1VBB2 1QJX3 2VQ0A 4LLFA 1VBD3 5AC93 3ZXAC 5C4WB 1V9U2 2HWE2 3J8F2 1AL0G 1TMF2 4WM8A 1RUH2 2HWD3 1NA1A 1PO13 4Q4X2 1RMU1 4N43B 1NCQA 3JBG1 1RUJ2 2HWB2 3VBRA 1VBC2 1ZBE1 1VBA3 1Z7S1 4QPGB 4PDWB 5BNOB 1BBT3 1AR82 5C9AA 1AYN3 4SBVA 1C8M1 1R1A1 1ZBA1 3S6PA 4CDWC 3VBFA 1R093 1RUI2 4NWWA 1EV12 3IDEA 1QJX2 4GB31 1POV0 1VBD2 5LK7B 4YVSB 3NAPA 1MQTB 2ZTNA 2R063 1COV1 2HWD2 1R083 1PO12 2WS93 2PLV3 1AR91 4EJRA 5FMOL 1VBA2 5C4WC 3ZFGB 2BFUS 4N53B 3JBG3 1BBT2 1ZBE3 1IHMA 1AYN2 1PVC2 1BMV2 5BNPA 1W39A 4CEWB 5CFCC 1NCRA 4JGYB 3VBHB 4QPGC 4PDWC 2HWC1 1R1A3 4IV1A 4CDUB 1ND2B 5BNOC 1HRI1 1OHFA 3VBSA 2R062 2WFF1 1OOPA 1R082 4QPIB 2RMU2 2WS92 2PLV2 1RUF1 1QJZA 1PO22 4WM8B 4YVSC 1MQTC 1RHI1 1NA1B 2BPA2 4BCUA 1NCQB 5FOJB 3VBRB 1ASJ2 4IV3A 1AR93 1ZBE2 1RUE3 1RVF3 3VDDB 2RS31 3ZFEA 1VRH1 5ABJA 4CEYB 5A32A 1AR61 5C9AB 1PGL1 4N53C 1FPN1 5D8AA 5K0UA 1RUG3 3VBFB 3VBUC 4CEWC 4YVWA 1PIV2 1TME1 1BEV2 3NAPB 5BNNA 3VBHC 3TN92 2MEV3 4RQPA 1EAH1 4CDUC 2WFF3 1QJY3 2RS53 4AEDC 4CDXA 5C8CB 1RUF3 2ZZQA 2ZAHA 4QPIC 1FOD1 1H8TA 2R041 2RR11 3HAGA 4Q4V3 1RUE2 1RVF2 4WM8C 5L7OA 1NA1C 1HX6A
chains in the Genus database with same CATH superfamily
5KC6A 1ND3A 1PMJX 2EICA 4HONA 1W8OA 2ZJCA 1VR3A 2R071 3VL9A 1BHGA 4LEJA 4CP9A 3LWCA 4W6YA 1KEXA 2FCUA 4GWIA 5I0TA 5T52A 1EP0A 3ZR5A 2JG9B 2JKBA 3D8CA 4ZZ8A 5KHIA 4A41A 5EPAA 4LIUA 3BTAA 1WLDA 2MEV2 2OPWA 2R0FA 4XFIA 5IK7A 1H4GA 1JN2P 1SLBA 4RHV1 2P37A 3EXUA 3ON7A 2GN3A 3MIBA 1MS8A 2DUOA 4ZU5A 4LBMA 2P6CA 2QQMA 2PHDA 4XFCA 2Y6JA 5M0TA 1MACA 1LULA 5IFTA 5D1IA 1F5JA 3LEGA 2JECA 3DL3A 4L8QA 4LTAA 5G04L 5J37A 1KRIA 5F3CA 4LQRA 2ZHMA 5DAQA 3OBTA 1AXKA 1FOD3 1W8FA 1D2QA 2BOIA 1WCDJ 4PIXA 4PI0A 4QQLA 1AJOA 2JG8B 3BU7A 5LATA 4QKNA 4YGEA 1RUD1 4BXSV 4AE2A 3GZEA 3IAQA 3ZFEB 1IPJA 1TNRA 2C26A 3VZJA 1SPPB 2X10A 2OUJA 2XBO1 5FIXA 4Q4W1 5FYMA 4BHPA 3I2IA 1SQ4A 5CA6A 2ORXA 5K0UB 3O1TA 4YGCA 4BQ4A 3O7OA 2KXLA 2QFEA 3PUAA 1STMA 3AXDA 5T5JA 1AF9A 3KD4A 2IWGB 2RE9A 2IXLA 2XB6C 2AEYA 4BIOA 4N43C 2LTNA 5F6KA 2AH2A 5F39A 4ZU4A 1Z7S3 2Z2SB 3RYPA 4XURA 4PF1A 1DG6A 1LAJA 2JG9C 3Q9OA 5FLHA 2IFWA 1AYM1 4PI2A 5C5UA 2J1AA 2G1MA 5JIAA 2Q8DA 3KGZA 5F9TA 3CL1A 3N7JA 3KHCA 1G8WA 1Q8QA 2ZX1A 1QJU2 4HVOA 4P9LA 2HWF2 3IAPA 4YFWA 1CJDA 2QQOA 5KXEA 2XPJA 2VMEA 2QKDA 1GQGA 3HMYA 4RGKA 4V1PA 1G9DA 3CJIB 4H7MA 2F17A 3V0BA 2R6QA 1SFNA 3NVCA 1HV1A 4XFFA 1V9U1 4M3CE 4QXHA 3FLRA 4MV2A 2HWE1 1KD7A 3J8F1 3WUCA 3ZPYA 2KR2A 4XDOA 2D98A 4YG0A 4QDRA 1CPMA 1ENQA 1QXPA 2OX0A 3MW3A 1CESA 1X9PA 4GULA 4RD7A 1RMU2 1KXGA 3ZXDA 2JG8C 5JI9A 1NT0A 3UESA 2ZX4A 3MV11 4OFGA 4QXCA 3WP4A 1DIWA 2R30A 3E1F1 3OSDA 4QPGA 3VZOA 4RR3A 3ZFEC 5FKBA 1UCXA 5A6ZA 1C28A 1GYKA 1M4WA 4AL9A 5EV7A 3KT4A 2VXJA 1K5MB 3UKVA 2XJVA 1W03A 5K0UC 1AR81 4TXWA 2PAMA 4ARYA 3ZN6B 3VDCA 3GBFA 4EWDA 2IXKA 1C8M2 2XJQA 3AKTA 2WR9A 3M3OA 2VMHA 1X36A 1XYNA 4COZA 2VAUA 4UYBA 1RUI1 3W9AA 4LBQA 2PQQA 3CU7A 4XXPA 4XUOA 1RIRA 1GZWB 2HWC3 1MQTA 1PX4A 4DB5A 2J22A 3IDAA 1GQPA 3TYJA 5FPXA 1HRI3 3S7EA 1KDKA 4H7LA 2VZTA 1QOOA 1MS0A 1JUHA 2HEYF 5GZGA 1COV2 3ZPOA 1ND2C 1SZBA 1QNWA 1IZ3A 4CU8A 4RS5B 1ZZ8A 4JC1A 4Y5TA 4FTSA 2V5DA 1B35B 3BUCA 3LA7A 4KH9A 3CJIC 4XUTA 3AZVA 2XBO2 4BMBA 1PHMA 4Q4W2 4CE8A 1AR92 1UO9A 3I2HA 3RVHA 1X9TA 2BGCA 4KBZA 4IEXA 2GMMA 2VR4A 3LAGA 5FYBA 3WNNA 3HJRA 4KI5M 1VBC3 2RJ2A 3OD0A 1NXD1 4OLLA 5EHDA 1BMV1 4NR1A 4PQQA 1Q5OA 4CEWA 1KQRA 4JGZA 2Z69A 4YM0A 1LOFC 1WCKA 2VW2A 5E16A 4FAGA 2FD8A 1E5HA 2E7QA 3G7DA 4FPCA 5DG1A 4XFAA 3VBHA 5J48A 2XMLA 3KLSA 4E2GA 1YFWA 4A42A 3USUB 3EQEA 4AQ2A 4GMP3 1UIKA 2RV9A 5KHHA 5T54A 2RDQA 4CDUA 4OUSA 3JU9A 1WW6A 2X05A 1TG7A 3NWKA 1LOGA 4BOWA 2D7FA 2R061 1WW4A 3CZUA 3GXUA 2BERA 4MGTA 2E63A 2LM3A 1F35A 4LO8A 2CTVA 3LFMA 4DUWA 5FUPA 3LPGA 4NVPA 2PHTA 1HQNA 4UW4A 1DGWA 4DFSA 3GF6A 1PO21 1DF0A 2RS13 3WHUA 2DCTA 2O8OA 4BMEA 2NPIA 4S2GA 4OHYA 2R0HA 4AVAA 4IEVA 1ASJ1 5CFCB 4AK3A 1LB2A 1R64A 4OMCA 2A1XA 4JDNA 2GMEA 1HN1A 4RS5C 1H1MA 1FYUA 3TEYA 1B35C 3LDBA 2SBAA 2VQUA 1WLTA 4MGYE 5E8AA 2PAEA 2W1QA 3ZSMA 2RS32 3WG3A 4J1WA 2VC9A 3KVAA 1ZREA 1H0BA 1PVC3 4AZZA 2GN7A 3OBRA 2JD9A 2IZWA 3OY8A 3ZYJB 1REEA 1U12A 1SCRA 2W0XA 2EIEA 1G86A 3ME2A 4JQRA 1XOYA 2G9GA 1XYOA 3W20A 3FLTA 4CDWA 2HEWF 4NMIA 2QJVA 4XF0A 5A33B 1D2SA 5FMOS 4QB1A 4Y5SA 2W1UA 5J3UA 2VZQA 3M3QA 2GMPA 3POWA 5BNNB 2RVAA 5FY5A 2Y0IA 4WM7B 1IS6A 3S57A 5IVYA 4LT5A 2RMU3 5JSPA 3H8XA 4CDXB 2XJSA 2P3IA 2R7EB 1S0BA 2FMYA 4QX8A 2FZ2A 3GDBA 3CHXA 4AYUA 1Z78A 2VQAA 1JHJA 4XAEA 5C3SA 2H6BA 2UY8A 4OI1A 3EBRA 4NHMA 1AX0A 1ZVFA 3C7FA 5EWSA 2JXAA 1Y7BA 4JV4A 2WO1A 2WT1A 1RUG1 3HOBA 4M3CA 4XTMA 3WQ0A 3AKRA 2ES3A 1W6NA 2B9UA 5DMYA 2B5HA 3ILNA 1AZDA 1VBE3 1XRUA 3BODA 3VHNA 1MR5A 3FN9A 2VGDA 1D0GA 5DUVA 4PDWA 5FP7A 3BTZA 4E4SA 4C0HA 5CFDB 3HR9A 3MI8A 3WNXA 1C1FA 1O4TA 3U78A 1SLTA 3EB7A 3LF7A 3MFCA 5HXMA 4MUVA 1WCSA 1K45A 1U5ZA 2DU1A 3TN93 1M06G 5FWJA 4K8FA 5JMOA 2R16A 1ZZ6A 1WW5A 4V2VA 1SLLA 4XFGA 1NY71 3WF1A 4XQWA 4HKLA 1RXFA 4CP2A 5BNNC 3JD73 3T2PA 3LIHA 3O1SA 4WM7C 4YVSA 5FZAA 4A3XA 1IS4A 2Y6FA 1BK0A 3IIAA 2GZWA 3H3LA 5GLUA 1MS5A 5ACA3 4XQ4A 1XBFA 5GLVA 3DKQA 4CDXC 3VD4A 4L92A 2WZ8A 4UWDA 1JYNA 1W90A 3RZJA 5FO7B 2DUQA 5J36A 4FPHA 3LE0A 1E5RA 1H1IA 3U4SA 4B4QA 1XNTA 3ZFGA 2MHFA 5HXVA 2EVXA 4FOYA 3RMYA 3OOXA 1RUJ3 3VB9A 3N7LA 1QGLA 3T3YA 5EJ1B 1UAIA 2VTXA 3AC0A 3BCWA 5FXWA 1SLIA 1JU4A 1YYNA 2WZR2 4JGYA 1R091 4AQTA 1W2UA 1RUOA 5J96B 3ZFFB 1U5IA 4B8EA 1VRBA 3ECQA 5CFDC 2VCCA 3MGUA 1PK6B 2VMIA 2VBDA 2XOMA 1NUKA 1W8NA 4Z2AA 1JOBA 4LNVA 5BXXA 4EV0A 1PMIA 1JMUB 4KWJA 1Q8OA 3MICA 1QQP2 4OYUA 1GSLA 2QZ2A 3X29B 5C7GA 4IE4A 1VBB2 4AEKA 1CX1A 4IDZA 3OJBA 4LKFA 1UOFA 1DHKB 3OGRA 2P3YA 4LOSA 4NJ4A 2WT0A 3APBA 2FDGA 3MIFA 1RUH2 2HWD3 3K51A 3LCPA 4MGKE 1S2BA 4Q4X2 4DZGA 4ZZ5A 4LITA 3ZVXA 1GNZA 1OFNA 3JBG1 4LR4A 2HWB2 4UFLA 4UXAA 1CZVA 3WEZA 5A6QA 5FPLA 2C0ZA 1J84A 5JOYA 1VBA3 3ZSKA 1Z7S1 3K4DA 4I02A 1G9BA 4YG3A 1LGNA 1DQ0A 4GIQA 4HK8A 3KCCA 5FZEA 3RYRA 1BBT3 1QIQA 2J1VA 2JDMA 2W46A 5C9AA 5IK5A 1AYN3 4SBVA 1BQPA 4HT1T 1G9AA 4Y33A 1ZNPA 3U37A 4NPLA 2LW8A 5FY1A 2WWJA 3MBWA 1W8HA 3VKMA 1EV12 3IDEA 1R1ZA 1S0FA 4PBPA 1UW8A 4EN8B 1DYPA 3J7HA 4INDA 1VBD2 2WKKA 3NAPA 3WP6A 3POSA 1JYIA 2ZTNA 4KBBA 3QCWA 3TRSB 2XL9A 3ZDSA 1WMFA 1O3SA 4IETA 4XDPA 4UFMA 1YQ5A 5FBZA 4FP3A 2WS93 5KHGA 3I59B 2PLV3 4IESA 4XF4A 5FZGA 3I2FA 4KQ7A 3BPSA 1LENA 3LEIA 5JOWA 3Q8CA 4MOAA 5FUIA 4ZXEA 1VE0A 3OGSA 4YW1A 5JIUA 4AR2A 1JZ3A 2GAUA 4GKYA 1UMHA 2BFUS 1AVBA 4QU1A 4NIIA 1DQ5A 1L7QA 2FDIA 3WNMA 3ZXGA 4OHWA 4P9YA 1ZBE3 3RZHA 5FZDA 2BZDA 5A7QA 5CKMA 1MS9A 1VMJA 1W39A 2VL4A 1S2EA 2ERFA 1MS1A 1T6BX 1NCRA 4HLTA 4YW6A 5FO8B 4KU8A 2C24A 1DGRN 1CX4A 2QUOA 2YGMA 3K3NA 1DCSA 1UIJA 4Q5OA 5GLWA 3D3AA 3NV3A 2CAUA 2GP3A 2HWC1 2VOTA 2YZ4A 1XJAA 5A7NA 1PZ8A 2Q0AA 1HRI1 1KGYA 1W6PB 1OHFA 2UWCA 3C2UA 4CXXA 1UY0A 1YIFA 4C1WA 5KR7A 1CPNA 4CXYA 4QPIB 2XL7A 2HJIA 3KT1A 5A3WA 3R4SA 2WT2A 4M01A 4HZFA 1OA3A 4CUCA 5T5OA 3ZYBA 1ODMA 4IQPA 3TNPB 3WHTA 1QJZA 5FQ0B 4BQ1A 2Y38A 1UPSA 3B9IA 2A5ZA 3EYPA 4GD4A 5T5LA 3ZDVA 5JLVA 4AGRA 4BCUA 3IPVB 5FRAA 4W4ZA 3AMHA 2W47A 1ZM1A 1BLZA 4R9BA 4IV3A 1AR93 4ES9A 4QHZA 3ATGA 4IEPA 2NP0A 1GNYA 1RVF3 3VDDB 4AVCA 1DYKA 3MFAA 1LU1A 5A6YA 2JDAA 2CGOA 5ABJA 1UZVA 3POIA 2J1TA 1V0AA 4XETA 3MLJA 3WW4A 3KMHA 1LEDA 2VUCA 5FMDA 5CAZA 5LZ6A 4DINB 1PGL1 1FPN1 1W6MB 1O5LA 1JZ7A 4LKSA 3VKNA 1TZOA 2ZGTA 2WO2A 1IKPA 3WDWA 4A7ZA 3VBUC 3ETPA 3AJYA 1LODA 4TYSA 1PIV2 4BK5A 1TME1 1XU2A 2W1SA 5K7PA 3QH7A 5FZ8A 3KF3A 3J7NA 1EPZA 1OF3A 4KL1A 4YZ3A 3SH4A 3T2OA 4RQPA 1VMHA 4YWAA 3WG4A 1RTVA 2WQ4A 4XF9A 5AVAA 2RS53 3M3IA 3QACA 4AEDC 1S0JA 2EAKA 2PHRA 2WDBA 4YSFA 2P4EA 1QH6A 2VCMA 1C57A 1FT9A 1A3KA 2J1RA 2QQKA 3O1VA 2AC1A 3H9AA 1XB9A 1H8TA 2XUMA 4HN1A 3PVEA 4QPIC 5FYTA 2Q1MA 3BALA 3PVBB 4AEMA 2ZPXA 3QD6A 4TZDA 1XNDA 4AFMA 4LUKA 2ZHNA 4QU2A 4D6RA 2QNKA 3R0RA 2YBPA 4OHVA 4F3JA 3ACFA 1O7FA 3MEPA 2VMDA 1KS4A 1J58A 4A6SA 2W92A 3U0ZA 1DGWX 1AR71 1DQ1A 2ZA9A 2LALA 3VDDC 4QX0A 1BVVA 1C5HA 4AAXA 4IV1B 4N9HA 4FFHA 4WVMA 5DQ0A 5FZIA 3WF4A 1VMFA 2UU8A 1TEIA 3C7GA 3UT0A 3LOBA 1CAXB 3HQXA 3GJAA 3NJYA 4GJYA 2A73B 4FTBA 5L73A 1QJY2 2ADDA 1ONAA 2WNOA 3DKWA 4YYOA 2D3SA 1OOPB 1UMIA 4A6OA 1JS9A 4TSVA 3NV4A 4GA9A 1DQ4A 2QTWB 5FY8A 4Q4Y3 3WW1A 1CGPA 4GH4A 1WA4A 3WUDA 5FP8A 1S2KA 4Q4V2 2AENA 1G9CA 5FZ4A 2EIBA 3NW4A 2X5IA 5IAVA 2IVJA 5AC92 2ET7A 2LS6A 3FFZA 2XWJB 5F6LB 3UGGA 4JRLA 3KGLA 1I6XA 3HNYM 4QKBA 3I2KA 1HB3A 4H14A 5HCFA 1GBGA 1VBE1 3EJKA 1JZ2A 1V6JA 2WNEA 1MZFA 5CNAA 2OS2A 1Q43A 3LKJA 5DDJ2 4CCKA 2WINB 1LTEA 2DVGA 4PJYA 5EP9A 1LJ7A 3PIGA 3A22A 4CPBD 2ZKNA 4EE2A 2VZUA 3IMNA 4D69A 1NLQA 4LORA 3AL5A 4P9IA 1K5JA 3THTA 1NE4A 2EALA 4AFDA 2BP6A 2W9XA 3QLQA 2RM21 4DXZA 1C1LA 4NN0A 3UYJA 5FJHA 1MZ6A 4C1XA 2FZ1A 2TEPA 3ENRA 3JD71 4IW3A 5FZ0A 3W5NA 4CPBA 1GOGA 2D6NA 3MUY1 4FQ4A 5J1XA 5EZWA 4DPNA 1OOPC 5ACA1 1A78A 1UOBA 2DVBA 2IFRA 3OF1A 4XCBA 4COVA 5FLIA 4HSJA 3ASIA 2ZS6B 1OVPA 3E97A 4MGZE 4N8MA 4XQDA 1MVEA 4P5YA 4IL7A 2AACA 5L7OB 4BISA 2J1EA 2VVFA 4E4DX 1OD3A 2BW8A 2IXJA 1ND3B 4E9KA 1Q8PA 2CGPA 1S55A 1JW6A 3AFGA 3L2HA 1YQ2A 1IG3A 1RUJ1 2XHNA 3B02A 4FQZA 4DXSA 1D0HA 1AR72 4I3PA 5GZEA 1S0GA 3CBNA 3JB4C 5DABA 3ZLIA 4BU2A 4UI9L 4LO7A 3H8RA 4EWEA 2GNMA 2ZMKA 1UKRA 3ZO0B 1F2NA 2DCKA 2JDZA 3RG0A 3BI3A 4Q26A 5F7UA 3UL2A 1R1A2 1C4RA 4J6GA 1ZBA2 4COWA 1YIPA 1MS3A 3P3NA 2QE3A 5ISLA 5FY4A 3R4DB 2DFCA 5I8YA 1UZYA 3DCQA 2VMCA 4J1XA 3KCYA 4OMDA 4RA0A 4GB32 3IMMA 3AXEA 1UX6A 4URAA 3VD7A 3D5OA 2CL2A 1DGRA 1IKQA 1V6NA 4META 5JOZA 2I2SA 1HN0A 2E33A 2WNUA 5FK7A 2HWD1 2OXBA 3K3OA 4GAZA 4MHUA 3WP3A 4P9JA 1FATA 4YW4A 1U5XA 1BXHA 1YCIA 2VTFA 3M2MA 4ZS2A 3WCRA 4XYXA 4LBOA 1VBA1 3H8OA 4YW2A 5GALA 4Q4X3 2W68A 3AYEA 3E5XA 3NJXA 1CAWA 4JKMA 5F1RA 4ES8A 5CEHA 1ND3C 1BBT1 2QDNA 2ZEZA 3DYMA 2JKXA 5E6HA 2VZOA 3EO6A 1GZCA 3I2JA 2ZGKA 2YFZA 3UK9A 1W06A 4EQVA 1TVGA 4K7JA 1VB4A 2NZ9A 1VRH3 3K46A 4BA6A 1WUVA 3VZKA 1PX3A 3J7LA 1MEC3 1V6LA 1AR63 1HRV3 3KSCA 3POBA 5A80A 2E32A 4BK4A 4LUMA 4MXWA 4U2AA 2DBIA 5IT6A 1PM7A 1X8MA 3VBSB 1KDMA 1EV13 2JE7A 1AL21 1MZEA 2PFWA 2ZAAA 2XH6A 4JTNA 1SMVA 2D6PA 4IEZA 2WS91 1W9WA 2PLV1 5CIRA 5FXXA 1ULEA 3LB9A 1RUF2 4LMFA 4XIOA 5LRRA 1XE8A 5TSWA 2WNVA 5CZKA 1YFUA 1IPSA 1ZRDA 1RHI2 3ROUA 3T2QA 5I8SA 1WD4A 5E88A 1JZ4A 3O14A 3R6SA 1YWKA 3AZXA 3PJYA 2A75A 2E6VA 5A1LA 3QH6A 3RQ0A 3VKFC 4D3WA 2A71A 2WAAA 4ARXA 4RR3B 1C3HA 4LKEA 1KJLA 2CDOA 3HNBM 1UXXX 3Q8AA 3SH5A 4AVBA 1XQNA 3WVJA 2BDRA 4BPZA 1N1SA 4LO5B 1HV0A 1QOTA 3VDAA 3ALQA 2D6OX 2XVGA 2XJRA 3T4HB 3ZN4A 1ACCA 3URFA 1GOFA 3KV4A 1VAMA 4AHWA 2YC4A 1J3RA 1GLHA 4FXKB 4FTEA 2DURA 2PELA 2WJSA 4XUPA 3WSOA 2YBSA 2RG4A 3CMGA 3MV01 2AEZA 4HANA 1LESA 1BEV1 2C4XA 4E4ZA 4Q0QA 4OQ9A 3LOIA 1Y9QA 4ZKTB 2A3XA 1LHOA 2PQSA 4M00A 2D5HA 1J59A 1EAH2 4DUXA 3POYA 2J7MA 2WIIB 1OMIA 2P34A 1FMD3 5EXOA 3VBSC 1YFYA 3NL1A 4XBNA 4CZSA 5I8TA 2BYVE 1LOCA 2D6KA 4R9CA 3NNMA 2YV8A 1LOBA 1JYWA 2BUKA 2ID4A 2R042 1MS4A 2RR12 1RVF1 5FREA 3Q8FA 1WKYA 5FPAA 1F8VA 3ZXFA 2YU2A 2AGSA 2RDRA 4KGQA 1D4M3 1OLMA 4OUEA 4ISQA 3C7HA 5LK5A 5JXGA 4NIGA 4LA3A 4JGZB 3ZX7A 1OI6A 3FHQA 3DECA 3M3EA 3OPWA 4ZPIA 3PMSA 4N43A 2XVLA 1RB8G 2R072 1H8VA 4IEYA 5HCHA 2A6XA 3AM2A 1RUC1 2EA7A 4RR3C 5C3QA 3R05A 2VUJA 1B09A 2JG9A 2V5YA 5DAXA 5FPZA 3WF2A 3ES4A 1AXZA 4Z8BA 4FO9A 1H2LA 4GWNA 4XTPA 3SCGA 5H9SA 4LBQD 1HXS1 1GQHA 3CKHA 5DZFA 5FXVA 2RS51 1AL22 5LWBA 2XVKA 4LJHA 1PIV3 2C9KA 1UZZA 1VLNA 4LOTA 5FP3A 1OUXA 1W28A 1AJKA 1YI9A 3LA3A 4RHV2 1DZRA 2W5FA 3ZM8A 5F2WA 4YZ4A 1RYYA 5FY9A 4Y3OA 5LRSA 3BGAA 3NNGA 3GALA 1SLAA 4ZS3A 3CEWA 1C8NA 1KFUL 4Z92B 2F4PA 2GALA 1N3OA 5F3IA 1W2OA 1YEWA 2DCYA 3OUJA 4K40A 3ACHA 1V00A 2W2IA 4C91A 4DNYA 2O8QA 4GJZA 3U14A 4LE3A 5FZHA 1RUD2 3OPTA 4JX0A 3MIEA 3FX3A 3SKJE 4DIQA 2VZ1A 5FOBB 3O12A 2N7GA 4JTOA 1TMF3 4GZ9A 2AZ5A 1L7LA 4PLMA 3OY8B 5JVVA 3D0JA 3AP9A 4N53A 3H7JA 4OZOA 4RFRB 1D4VB 3P6BA 4S2DA 3RDIA 4CDWB 1OLRA 1NAEA 4JGZC 2Y0OA 2OYZA 4GWJA 5ANQA 4QKFA 3J7MA 2VM9A 1I3HA 4K20A 4Q4Y1 4YW5A 3NKGA 2WLQA 2E7AA 4RGGA 1W05A 4OVEA 1AYM2 1PNFA 4BQYA 3M3CA 4DOUA 5I93A 5JSRA 1NLRA 4NPMA 3PU8A 1ND2A 1EUTA 2OA2A 2UWBA 1K5MC 4X6RB 4AW7A 1ZRRA 3CJIA 2ARAA 2YG0A 2K2SA 1S0CA 4F8AA 1CZTA 1QJX3 4LLFA 4YG6A 5I0UA 3AKSA 5AC93 3O0XA 2VW0A 2EXHA 4N90A 5C4WB 4QXBA 1V9U2 2CWSA 4QQHA 3CO2A 1CAVB 3G6JB 2HWE2 1GR3A 2JICA 3J8F2 5IK4A 1W9TA 2FCVA 2HYKA 3RI9A 3LGRA 1LHWA 1PO13 3F2ZA 3QOPA 4ISRA 3MF6A 4M3CB 3WDXA 4DEVA 1NCQA 2PHLA 1LOFA 3VBRA 3H42B 4XBQA 4O9GA 4QX2A 1O8PA 3PTYA 1E5SA 1QXRA 1J3QA 1L3JA 1W2AX 1YHFA 4QKDA 4PDWB 1IPKA 4MLOA 5DUXA 4XPVA 3GJBA 3VLBB 1WMXA 2ZACA 3TEZA 3ZN6A 1AR82 2BBAA 5DUUA 3T1MA 4M3CF 3SITA 4GXLA 5H9QA 1UY2A 2VD7A 4CDWC 4EWAA 3CJXA 3WT3A 5FMCA 2CY6A 4MSVA 4NRQA 3BN6A 1GOHA 3IBMA 5FYUA 3VBFA 3KHBA 1ZA4A 2VBPA 1RUI2 5JXIA 1UY1A 2JDPA 3VL8A 5JR7B 2D6LX 3MIHA 5K4LA 1POV0 5DAWA 1H1AA 5A3NA 1JZ5A 4YVSB 5F3GA 2JDHA 4BJ0A 3J9SA 2KM2A 4B4RA 4I0BA 3I4IA 1R083 1VPHA 5LASA 3VGIA 3F95A 4DRRA 5HCBA 4Q0VA 3TOJA 4MGQA 3OEAA 1UPIA 3T0BA 2X29A 4XJWA 1LCLA 2D93A 5FMOL 1IS5A 4QGNA 5C4WC 2WC2A 3I3BA 3ZFGB 1GWKA 4HG6B 4AVTA 4B1LA 5IAXA 3S5QA 4FAHA 4Q29A 3VDBA 4M4RA 2KA3A 3CZJA 3FJSA 5LEJA 3WINE 1BMV2 5BNPA 5DUWA 4WBBA 5CFCC 1CAUA 1N3PA 1EUUA 4QAWA 2ZGMA 3OEBA 4JGYB 4O7XA 3DGTA 4QX3A 4UT5A 1REFA 1NX9A 5FZ6A 4Y20A 5CVRA 1GZTA 2UWAA 4PDWC 3WQ7A 1Q56A 3HNMA 1R1A3 3B69A 2UYAA 4NRPA 3RWKX 3I97A 2R062 2WFF1 5JMCA 3M7AA 5A7WA 2VBBA 2JB8A 2WUHA 4YRDA 5E1RA 3ZOIA 3BIEA 4KWKA 1X82A 3MF9A 3K48A 5I0DA 4XMAA 1E5IA 2P2KA 2ET1A 2CSGA 1SACA 3LDKA 1PO22 2QDRA 3DV8A 4YVSC 2Y34A 2ZGUA 2NM1A 5LCWL 2XLGA 2JX9A 3A21A 3DUIA 1XNBA 3U1XA 3C8XA 2LROA 3PMEA 5FOJB 1RINA 1ASJ2 3A0KA 4HETA 4R9AA 2EXJA 1HQLA 1J83A 2AREA 2H0BA 2Y6GA 3SEEA 3I3QA 1RUE3 3S30A 4W6XA 3OG2A 4YGDA 3ILFA 3I49A 4DRVA 3WDYA 4J25A 1VRH1 5IWFA 4CEYB 1NYWA 5A32A 4JVAA 1AR61 5C9AB 3HIFA 4XVHA 5GM0A 4JAAA 3PDQA 1UYPA 5D8AA 4N7UA 1LR5A 1O6UA 3N3HA 1UY4A 1W8TA 4XUQA 2XDVA 2VVEA 4FPJA 2UURA 3B9CA 4HMZA 4NHYA 4XFHA 3MPPG 2ORZA 3INAA 3NAPB 4B7EA 5BNNA 4UBGA 2XJUA 4XZPA 1LOAA 2MEV3 3S7IA 1DGLA 3AP6A 2C5DA 2BWAA 2E53A 2QCSB 3NKTA 1UWWA 4CDXA 2E26A 4NHLA 5C8CB 1H2KA 3BOPA 1REDA 2Q1ZB 1RUF3 2Z42A 2ZZQA 2OPKA 1X8EA 4L11A 1FOD1 2VOWA 1W6OB 2HEVF 2BU9A 3BYWA 3HAGA 3ZSEA 2OT7A 3B5LB 3WNLA 1DYOA 3AMMA 3N9OA 2VJXA 4IEOA 4QPYA 4LA2A 1BJQA 3WD5A 3DYPA 2Y33A 1ENSA 2FDJA 4N9IA 4E8CA 2V73A 4YM2A 2DV9A 1NCRB 5LEKA 5C71A 1RUG2 5A1FA 4R52A 2Z5WA 5FZBA 5GLTA 1PGW1 4BZ4A 3JCIA 3J26N 4PBOA 1RGSA 3OTFA 1J1LA 3K77A 3VBOB 2PHUA 3LPFA 2VCAA 3I7DA 4CEYC 5JXJA 3FUQA 1HDKA 2G9FA 5FXZA 1Q8VA 5C9AC 1CZSA 1H9PA 5T50A 3DPRA 2O14A 2WFF2 4TN7A 3DXUA 4EYUA 5LA2A 2W39A 4Y1XA 1I5PA 1FMD1 1OKQA 4XEZA 2BV4A 3OYWA 3BU0A 3D4KA 1O91A 4JZRA 3VN4A 2IXCA 4OQ8A 1F15A 5A3MA 2BJSA 5JSOA 5LY1A 4LKDA 3NAPC 1NY72 2QQNA 2VZ3A 2FCTA 5GJ6A 4CCDA 1NQDA 1QJEA 1ULGA 3GZAA 1QJU3 5JUVA 2HWF3 3RZMA 1D4M1 3ABZA 3WY6A 3ZIWA 4IV3B 3ZFFC 3KZ4C 1AHSA 4EZHA 2RR13 1PK6C 5C8CC 5HV0A 1UYXA 4YARA 5BUVA 3D0SA 3VHRA 3T09A 5ABJB 3AJZA 5IATA 4FPFA 2DF7A 4LBJA 2DDUA 2FQPA 3WDTA 1VP6A 4HFSA 4NAMA 4OCTA 2VNOA 4HK9A 4BQ3A 2NMNA 3ZIXA 1RMU3 1W8ZA 1S0EA 3HN1A 3RZKA 4FVVA 3J4UH 1CIYA 4HXCA 3V0AA 3AVSA 4OZXA 5EJZB 3UV9A 2ADEA 2D3PA 2GH2A 2ZX2A 4D8MA 4DXRA 2WO7A 4EN0A 1CONA 3VBOC 2WQZC 4RQPB 4FFGA 1JYCA 1R092 3V64A 3DN7A 5FKCA 2R32A 4CDQA 4NOTA 1JOJA 3B7MA 2BFUL 1C8M3 3CF6E 2YROA 3KB5A 2A70A 2D5FA 1IQAA 3ETQA 3M70A 4LXLA 5I0SA 4XFBA 2VULA 4G4FA 1JOPA 1BKZA 2PHFA 1H8TB 1V70A 5FV3A 3LD8A 2GH8A 4LHNA 3I3MA 4JRAA 2BRTA 4BQ5A 4CU7A 2JWPA 2ZMLA 1TMF1 4X8NA 4CP1A 3JB8A 1COV3 2AUYA 3WG1A 4IV3C 2ZABA 3FC0A 4P00B 3BTXA 3JBG2 3NSTA 1VBC1 3RS6A 5I91A 2XBO3 2Y8KA 4Q4W3 4FPKA 5LY2A 1I5ZA 1RUNA 2GC0A 4UF0A 4WVMB 4AVVA 4QQ2A 5KXDA 5ABJC 2C1FA 2JENA 2A3WA 1Z7S2 4NHXA 5ANNA 3BKZA 1PZ9A 1UQXA 2BNNA 3NV1A 2GC2A 2TBVA 2Z79A 4QM9A 4CU9A 2CGNA 4JHTA 4GMP1 2A6YA 2DU0A 3DYOA 5FP4A 1HLCA 4Q8LA 3FLPA 1AUYA 3POJA 2OKXA 4W50A 5HV4A 1IQDC 4GH4B 5FY7A 4CUGA 3O0WA 1AYM3 1HJFA 1UD1A 2D44A 1ZRCA 1J1TA 1LEMA 1QJX1 4AGGA 2ZBJA 4RL7A 4GWMA 4RQPC 4K3UA 3BPZA 2VPVA 2X5IB 3K4ZA 5GKAC 4YLZA 5FZKA 1AX1A 1ULPA 2B8MA 3KVBA 1YRZA 2ZHKA 2RS11 3H0OA 5FZOA 3TNQA 4FOVA 4YPJA 5T5PA 2Q8OA 5FZ3A 2CNAA 2WO3A 3JQWA 4L97A 2WYFA 1H8TC 2DUPA 5FZ9A 4YM1A 3KS7A 3OUHA 3J8F3 4P08A 3RGBA 5C5TA 3ZXLA 2LUWA 3DF0A 2OW4A 5E89A 4DY3A 2VUDA 3PUSA 4IE0A 4UW5A 5JZGA 4B1MA 3GCXA 1K3IA 5IVJA 1A6CA 1CN1A 3ZYHA 3VZLA 4AVSA 4NE9A 1ZRIA 4YZ2A 1NXMA 3HN3A 4FXGB 4Z2WA 1U5YA 3KQ4B 5A7SA 3MO4A 4DUVA 1PVC1 5JI7A 3VBUA 5C3PA 2O0OA 2XGXA 1LHNA 1WCUA 4CA9A 5FP9A 2ZEYA 4AI3A 4NWVA 1T2XA 2RS33 4FCAA 4XCAA 5L9BA 5L9RA 1GUIA 4XHBA 3MLKA 3OUIA 1HKDA 1OFSA 1W3VA 3VHOA 3RNSA 4RFT0 2HWC2 4RGAA 4Y4YA 4AEDA 2VZVA 5FMBA 2WZEA 4K1ZA 3H1MA 4A7KA 1HRI2 3FHAA 2ENRA 3ZXJA 2GSYA 5AVPA 1O8SA 4D6SA 5AFBA 1R081 5HPOA 4QPIA 2RMU1 4KNCA 4GH4C 4CP0A 3I2DA 4HN0A 1O5UA 3R4UA 1N1YA 5IUQA 3GBWA 5C8WA 1OBNA 2X5IC 3RZZA 1W8UA 1QHDA 2WRAA 3ZN5A 1GP4A 3KF5A 2X53S 1UU6A 3WW3A 1OLQA 1XNAA 4XF3A 4Y5Z0 5FZFA 1LKNA 3VDDA 2D40A 3AL6A 3HVDA 4PLNA 4UBHA 2DVFA 2WL1A 3PUIA 3CLPA 4QGLA 3FBMA 1GKBA 1H6YA 4Y22B 1JYVA 3FBYA 2AR6A 1PGL2 3L9JT 1FPN2 4LE4A 4WV8A 3IB3A 2WWUA 1A34A 5JPNB 4QQOA 2RJLA 4RYDA 3THCA 1SLCA 5K9YA 5B2GB 2ZX0A 4YVWB 4XOGA 1TME2 3B93A 2BWCA 4EN7B 3VD9A 2WN3A 1DLCA 2JIGA 3TN91 2WA4A 5B4NA 2ETEA 4XC9A 4BLJA 4Y4RA 2WNUB 3ACIA 1RXGA 2RS12 4IV1C 3H50A 5ERLA 2YC2A 1OT5A 3W21A 1PGSA 1XNCA 5FJKA 2OZ6A 5FO9B 5CB7A 4M0NA 1PO23 2BGPA 5FZ1A 1OLME 1X7NA 4LIVA 3VD5A 1RUE1 4LO6B 4AI2A 5A1AA 4JKLA 1CAWB 1POV3 2IXHA 1ASJ3 4CCLA 4KU7A 4F83A 5KHKA 2VZSA 5BV6A 3NNJA 3FMGA 3U07A 1RJ8A 4RSUA 1I9RA 4KWUA 4HPKA 5CBLA 2NYYA 3I3EA 4F7ZA 4CP9B 3T08A 2JE8A 1ST8A 1G9FA 1WA6X 3N9PA 5DAVA 4BM8A 2JE9A 4MHRA 4DMIA 5LA9A 2DTYA 1XU1A 2I45A 2J1UA 3IWZA 4O65A 4YGBA 5A7PA 4FPOB 5A3LA 2MEV1 1GP6A 1WW7A 1BCXA 3N7MA 1H4HA 5LBEA 1VB2A 5BNOA 3TWIA 1CQ9A 2YU1A 5F5CA 2GP5A 2YDEA 2XG3A 2MPFA 1GANA 4G3YC 4FT8A 2BEOA 1MVQA 4QB6A 4AG4A 1RC6A 3PNAA 2A7AA 4YVWC 1XC6A 2P17A 2R1DA 2WZR3 2PHXA 3AFKA 4E8DA 2Y26A 5JXHA 3UNPA 4Z82A 3ORJA 3PUHA 2G9ZA 2WNVB 3AZYA 1W2TA 1NZIA 2EF6A 2QQPA 5FFOC 2WNUC 3CDZB 4EZ4A 2EIGA 5J98B 4YFZA 3BVCA 3K4AA 1XPWA 1GNHA 1NE6A 1W2NA 1W0PA 1QQP3 2OUHA 3I54A 4O61A 3TEXA 3A7QA 1V6IA 1J3PA 2ZX3A 1VBB3 2VY0A 2J1SA 2ZOEB 3GM8A 2QQWA 4CCOA 3AK0A 4QGMA 3IDBB 2WZPP 3HPNA 5FZCA 5F5IA 4M0HA 1WGPA 4XABA 5EFUA 1VBE2 3VKLA 1JZ8A 4MH0E 2WAOA 3U75A 2D97A 2W95A 5L19A 1RUH3 2V4VA 5IVBA 3L2YA 2HBUA 3I2GA 5L7OC 5H9PA 3WNPA 1DFQA 2HWB3 2VNRA 2DCJA 4WZFA 4NHKA 2X8KA 1AYN1 3CQOA 5KHJA 2XQRA 3H3UA 4RN5A 5FLJA 2JB4A 2BGOA 3O1OA 5K8SA 2RM22 4I3GA 1SBEA 3D82A 2YY1A 1QOSA 3TAYA 2ZMNA 1LNSA 2DWRA 1W6QA 4QMAA 1QJU1 3JD72 4BB3A 2HWF1 1GWMA 3LEKA 4I2OA 2Y6KA 2XKOA 1AX2A 3ZYGA 4Q8KA 3FZ3A 2XONA 2K0GA 4UW6A 5ACA2 3USSA 2YB7A 5B4XA 1NQJA 2ZEXA 3V0BB 3SISA 1VBD3 4C90A 3ZXAC 3JZVA 2YC0A 3GNEA 4V2WA 5LBBA 2D3RA 2PA7A 4A7YA 2WNVC 3CNAA 3MIDA 2J42A 5HI0A 1Y3TA 3WNOA 4YM3A 1XSQA 5JWPA 1N47A 1N1VA 2WSVA 4WM8A 2TUNA 4AF9A 3EHKA 2VNGA 1VALA 1NA1A 3O0VA 1RMU1 5HCAA 4N43B 1SBFA 2YUEA 4LBNA 1RUJ2 4CCEA 1ZBE1 3SHRA 1X50A 4D7SA 1CJPA 4LBKA 5KXCA 3ACGA 4Q0PA 3S5AA 2JDNA 4PT6A 2CU5A 4QPGB 4Y26A 3HT1A 5F3EA 4NIHA 4E27A 2IUWA 2VECA 4AQSA 2DVAA 2XXZA 4IGQA 4NUBA 2Q4SA 4ZONA 1C8M1 1W9FA 1Y4WA 3RRDA 2W94A 4B3NA 2VE1A 3GYDA 2MNGA 1QKQA 3NRUA 3H1YA 5SV8A 1R093 5EQUA 2HLEA 3N9LA 4X8PA 4AXOA 5L36A 4LBQB 4MZUA 3POFA 2A6VA 2V72A 3JXSA 5EYXA 4IXLA 2YBKA 3E5QA 3ZKUA 1MQTB 1FNYA 1FAYA 2JEMA 5T55A 4D7TA 2CWMA 3MHZA 1COV1 1S4CA 4UOJA 4YNIA 5JR2A 2HWD2 1WLCA 4AFCA 3UKTA 3WNKA 2Y60A 2XLFA 2PMWB 4HOOA 1Q3EA 3P5BA 3OGJA 2QQLA 1AR91 4ET7A 2IC1A 1DP0A 1VBA2 3Q8BA 4D94A 2PN5A 1SHWB 4IERA 2RDSA 5LB6A 1LECA 4OUMA 4N53B 3IN9A 3JBG3 4NROA 1UF2C 4ORFA 4QT6A 3WQBA 5EIYB 1BBT2 4YW7A 5A70A 1IHMA 3RJ2X 1UX7A 3O5SA 4MG2A 1AYN2 1ENXA 3D6EA 4CEWB 3NJVA 3RWNA 1POQA 5C33A 4QD2A 2YHJA 4PIZA 4K21A 3VBHB 4QPGC 2OIIA 5A6XA 2Q30A 3MYXA 1GMMA 2QQVA 1F4HA 2PYTA 3SMHA 1WMEA 4CDUB 4UFKA 3H3ZA 1ND2B 2NLRA 2SLIA 1XE7A 5CG9A 2VOVA 3VBSA 3HQUA 1H30A 1UKGA 1Y9MA 3WDVA 4C8DA 5J7MA 1W04A 2UYBA 2WBKA 4QHOA 3SXWA 3GGLA 2WS92 1SG3A 2PLV2 5IVCA 4EROA 1YQ8A 3IKWA 3LQCA 3N36A 2WN2A 1DZTA 1DBNA 1LU2A 1MQTC 1OH4A 5F37A 1YXWA 4A45A 4AHZA 4CVUA 4E2QA 1NCQB 3ZKYA 4URTA 3VZMA 3VBRB 3KV5A 1QXJA 3T4VA 1ZBE2 3E6CC 3T2TA 4XMIA 3UGHA 2JG8A 2ZHLA 3GHMA 5FYSA 2XHKA 3FUOA 4HKWA 4MX3A 3M4FA 2RS31 1QNYA 3ZFEA 1UOGA 5H9RA 1SPPA 1YNAA 3AYAA 3Q8EA 2DCZA 4XJZA 2CAVA 5FCCA 2OQ6A 5GZCA 5LW9A 5EYYA 4Y1YA 4N53C 4QM8A 1ZYBA 5K0UA 1YQCA 1PM4A 2GU9A 5CISA 3VBFB 3AP5A 2I07B 2FDKA 2PXJA 2W08A 1YLLA 2Y6LA 4CEWC 1CVNA 5FYZA 2VU9A 4W8JA 4XHXA 4B29A 1BEV2 3NMBA 1BVP1 2E31A 5F5QA 3VBHC 1QF3A 1UZWA 3AZWA 4DO0A 1YFXA 4U36A 4CDUC 1QJY3 1PMHX 4XILA 3BIWE 2VCBA 4IE7A 1OQEA 3NO8A 1UL9A 3AKQA 2K9ZA 3ZYIB 4NAOA 1NZCA 2KD7A 3ST7A 2W3JA 3MLLA 3WF3A 3PUQA 1OPMA 5KXBA 2ZAHA 1ZA7A 3N7KA 4BLIA 4Q4V3 3HT2A 5FYIA 1RVF2 1S0IA 3N35A 1MZ5A 4XAAA 1JTZX 2XWBB 2ZGPA 2YFUA 4H2AA 3LIGA 1QWRA 2YGLA 3PURA 3AZZA 4FFFA 1YJKA 3OB8A 1OQDA 1NCQC 2EIDA 2ZGQA 4R4XA 3WDUA 3VBRC 5BNPB 3S0MA 3W5MA 1CAUB 2ZGRA 3I8TA 2ATFA 1O3TA 1LOEA 2XLAA 2D6MA 3ZYRA 1W6NB 5CG8A 4XBLA 4Y20B 1RUC2 1I1EA 1FPN3 2Q8CA 2JIJA 5JOXA 1V6OA 5DDJ3 2GNBA 3MUZ1 4GQ7A 4XDQA 5LBFA 1IOAA 2WFPA 2QQUA 1K5MA 1HXS2 1SDDB 3NNLA 4AI9A 4QQPA 2RS52 5A7WB 1XNKA 2F4LA 2BOJA 4Q1RA 1TME3 5FYYA 2WABA 3VBFC 3VUOA 4FI9A 1O3RA 4Y1VA 3WOGA 3WQ1A 1OURA 4A2UA 1WZXA 3SEPA 3ZSJA 5CKNA 3BTYA 1U0AA 2B39A 3LFIA 1C5IA 4XZUG 3I2OA 1POV1 3NQHA 1GZWA 2BNOA 5DN2A 2FDHA 2R49A 2P1BA 5GLZA 1RITA 3C7EA 3FL7A 4XACA 1UN1A 1OH3A 3A23A 1OPOA 4IEUA 4FBFA 2FDFA 4FPGA 1URXA 3TB0A 4ASLA 4Y24A 4RS5A 3RYKA 1A8MA 2QBXA 1B35A 3AMPA 5GZFA 3WF0A 5A32B 2VMGA 4KG0A 4CYDA 2RJKA 4D6QA 3WZ1A 2ILMA 5D8AB 4Y1UA 3GZUC 3ZYPA 3B01A 4XJ9A 1XYPA 2ZGNA 1JBCA 1HB1A 3NNFA 4BXFA 1AR73 5BNPC 5FYHA 3H8UA 2RDNA 3U10A 3PVNA 5FZMA 4FP2A 2ARXA 2WZR1 3VD3A 4Q4Y2 3RI8A 2L9LA 5I0RA 5FYVA 3MW2A 5A3OA 5BYNA 1OXCA 1SFYA 3AMQA 1SEFA 1QDCA 3USUA 5FPBA 3RFRA 4L2NA 5DAPA 4A4AA 5DZEA 4IGOA 1ZBA3 3M8LA 4XXAA 4AI0A 4OI0A 1YUDA 1OF4A 1QQP1 5DG2A 2H6CA 1VBB1 1PVXA 2IXIA 1CR7A 4X6QB 4GB33 4LLOA 5C4WA 5KBFA 1NLSA 1CAVA 4ASKA 2CYFA 2VTXJ 1RUH1 1W3XA 1WBLA 4FPYA 2DBNA 4Q4X1 2WA3A 4MYEA 1PZ7A 4O9EA 2FBEA 1O4YA 4AI8A 2Q5TA 2LRPA 3O1PA 2HWB1 1OD5A 3E6BA 4TWTA 5CFCA 3WG2A 5DXDA 2BVBA 4BQ2A 1W99A 1LGBA 2GC3A 2W91A 3FE5A 4IE5A 3OD4A 3P1IA 4OULA 3O1MA 1GFF2 1HJGA 3DPRB 2A6WA 5D8AC 2W87A 3LSDA 4JKKA 1Q8SA 3PJQA 4PLOA 1MEC1 2ZXQA 1NG0A 2E7TA 3ZFGC 5G05L 5IVVA 1HRV1 2EAAA 4NRMA 1SFPA 3OYWB 1X33A 1FV3A 2P3KA 2RM23 1H9WA 3HWJA 4AOCA 1BYHA 2ARCA 1DDLA 4Z07A 4DEQA 4BYYA 4DY5A 1EV11 1ODNA 5A33A 4AFAA 4OI4A 2ZKLA 4BQWA 4XJUA 1VBD1 3ZXKA 1FX5A 2JDKA 4JGYC 2GC1A 2PHWA 2VMFA 4R8HA 1NOVA 2Y64A 4WM7A 4I09A 5FTTC 3RSJA 5FZ7A 2B42B 5APAA 1OQ1A 1L7RA 4AWDA 1P8JA 4L0PA 3M1HA 3ZYFA 1JODA 1F31A 1BK1A 5F5AA 3DXTA 3IDCB 2OZJA 4QWNA 5IW0A 1F4AA 3MPBA 4C0BA 1RHI3 3KQRA 2GNDA 2UY9A 5D21A 3LZZA 5D2AA 2JD4A 2VNVA 2ZEWA 3W58A 3T1LA 4IE6A 3K75B 4FOQA 3V0AB 5FYCA 1WMDA 4LK6A 4AHXA 4YW3A 3AVRA 4CCMA 4ITCA 2FMDA 4MXVA 4LK7A 3JQXA 3MDPA 4MGIE 1W9SA 3AX4A 2OQ7A 1N1TA 1N3QA 1US3A 4FPLA 1QU0A 1ULCA 4CDQB 5FK8A 3T0AA 1VJ2A 4QX1A 4IUGA 3DPRC 4P9XA 4XW3A 2JDUA 4XUNA 1Y43B 2BTVC 3AB0A 4S2FA 3IT8A 4CUAA 1ENRA 1ZZCA 3H1WA 4LHLA 5CFDA 3LA2A 4OHXA 4S2HA 5C70A 1NKGA 3ZMNA 5BY5A 3U4XA 4XF1A 4P9WA 5L9VA 3T0DA 1DZQA 1QDOA 1JZ6A 4NPRA 3BOWA 3ITQA 3VV1A 1EAH3 3RJRA 1DQ6A 3WXPA 1EYBA 3B3QE 1EPWA 4NIAA 4CCCA 1UZ0A 3UETA 1YC61 2JJ6A 1GU3A 2P5BA 2D43A 4OHZA 4EN9B 4YZ1A 2NN8A 1WD3A 3NV2A 2CHHA 1LHUA 4HSLA 2G4IA 4UF0B 3HD8B 2R043 5LBCA 1CIWA 3NJZA 3POGA 2BBVA 1JU3A 3OCPA 3RPQA 4EN6B 3POEA 4CEYA 4H55A 1VRH2 1UMZA 3C7OA 2VXRA 1OUSA 1MEC2 3OGGA 4M4PA 1AR62 4COYA 1H6XA 1HRV2 4JDOA 2R073 3KT7A 5IJRA 3E5UA 2CDPA 2WWSA 1PIV1 1GV9A 1OSGA 4ATEA 2VG9A 1NCRC 1UYYA 4HKOA 4FSJA 2Z4FA 4AAPA 4IEWA 4Y1ZA 4ZXKA 4WVVA 4CDQC 5JDBA 3THDA 1CWPA 3WX5A 1AL23 3CIHA 5A7OA 5FZOB 2IVIB 4Q1PA 3ZFFA 4BDVB 5BPXA 4HBNA 1SBDA 3B94A 3ILRA 4QX5A 4SLIA 1PK6A 5SV5A 4RHV3 1T6GC 1DU3D 5C8CA 4QB2A 1YO8A 1APNA 5DPNA 5F32A 1W6OA 1E57A 2V09A 1FOD2 5T3NA 1VAKA 4WVZA 5JZGB 1HB4A 2DYCA 3V56A 1XE0A 5J09A 4ZHNA 3T30A 2QZ3A 4MVTA 5FY0A 1JI6A 1KJRA 2WSUA 3LSEA 2BQPA 3K2OA 5F8PA 4MADA 3VBUB 4KMQA 2EXIA 3SC7X 3PHMA 1OC1A 4CSWA 1RUD3 4QXKA 1KS5A 4XJAA 3ZXEA 2EXKA 4NO4A 5JPMB 5LA0A 3WW2A 1PGW2 1YJLA 3VBOA 3E6DA 3GZTB 5FAXA 3AYDA 4AEDB 4YZ5A 2YPJA 4N7IA 4MO3M 1HB2A 1JYTA 1SDWA 1QJY1 1TQ5A 3UJQA 3GCWA 2GNTA 4WVWA 4XJ8A 2VH9A 1BEV3 5BNQA 4I0WB 1FMD2 1ULDA 3ACLA 4XIKA 1QMJA 4ZU7A 4JDMA 4UFIA 4CCNA 4R9DA 1AXYA 5A3PA 1LHVA 4Q4V1 4CCJA 2WLPA 3FWEA 4WZCA 1W9YA 2HYXA 2ZGLA 3VKOA 2CV6A 5AC91 2PAKA 2OVUA 4FFIA 1D4M2 1H2MA 4IGPA 4ONUA 4AI1A 1OA2A 2F6BA 2C6SA 4CTEA 3H7YA 4JQTA 3O1UA 1O59A 1ULOA 3AYCA 4I0AA 2BNMA 4UW3A 1PO11 3I59A 1V9U3 2V4AA 2DVDA 4DS0A 5JZGC 2HWE3 1CD3G 1QEXA 1ZZ7A 3N9MA 3OBZA 4GMP0 1JHNA 4QPWA 5FWEA 2DFBA 5DDJ1 3SCHA 1XXNA 1JH5A 3THPA 1QY4A 1UU4A 3QBQA 4P14A 2JDYA 5JAXA 1RUC3 1ZX5A 5IFPA 3LEMA 3AP4A 5FR3A 4ATFA 3GBGA 5A3UA 3PTRB 4BIFA 4D0QA 1W8WA 1WLWA 1FXZA 4FOWA 1HXS3 4PHZA 3PIJA 1HQWA 3RZGA 4XE9A 1AR83 2H0VA 1WCQA 4P5HA 5FPVA 4K8RB 3HQRA 2FHRA 2DTWA 5GZDA 1W6PA 3KV6A 4A44A 5FDBA 1S1AA 2W1WA 1RUI3 2QVSB 3MZHA 2VQ0A 3EMRA 1JYXA 3FHIB 3ELNA 3UJOA 4KG8A 1G6NA 2XQXA 2B45X 2ZCWA 1GZ9A 3LDRA 4LHKA 3VZNA 2YXSA 1AL0G 3MW4A 1TMF2 4LHSA 4TLGA 5FQ0A 2VZPA 4TLFA 4E2SA 3SLIA 2B9VA 2YMZA 3IPVA 4HPKB 4P9GA 3UKNA 5IVEA 2XR4A 4LULA 4B4PA 1VBC2 1RL3A 1S0DA 5CYYA 2AYHA 2VOXA 1OKOA 2B4KA 4HVRA 4JCKA 3KV9A 4A3ZA 3SCFA 4GKXA 5FBJA 2BVVA 2TNFA 2WQ8A 4LO4B 2XJTA 1HW5A 5FUNA 4ZY9A 4LBLA 5BNOB 3WR0A 1DQ2A 5C6CA 2B7YA 4UFJA 5F2SA 1R1A1 2NQYA 1W6MA 1H2NA 1ZBA1 4UFHA 3S6PA 1IGOA 1ULFA 1GWLA 3JUUA 2RHPA 2O1QA 2NMOA 4H3WA 4NWWA 4BWOA 5C3RA 2P6HA 1QJX2 4GB31 3KWVA 5LK7B 2VVDA 3TBDA 2C9AA 1YI7A 2E9QA 2R063 2VZRA 4W6WA 1ZZ9A 3RZLA 1UOJA 1QJFA 2ZGOA 1FV2A 3HBKA 4L9BA 1PO12 2HH9A 4GALA 4K9SA 4QHBA 2Q8EA 5IVFA 1UXZA 2K46A 2X09A 5KWRA 4EJRA 4DQAA 3KCXA 4PQ9A 4NIDA 2P3JA 2B46X 1KITA 2HKXA 3W59A 4Q27A 5DZGA 3OPZA 1K42A 5JCTA 4KGGA 2ZZJA 5EJ3A 3SQOA 2YYOA 1UY3A 1XSRA 3AP7A 4JHZA 3MIGA 1PVC2 2VW1A 2VUAA 5C3OA 3WV6A 3N9NA 4AEJA 5IK8A 1EY2A 3WCSA 3HBZA 3N4MA 4QDQA 4AHYA 3WP5A 3P3PA 4L99A 3ES1A 4HVQA 1F9KA 1V6KA 3PVOA 4QX7A 1IS3A 1TE1B 1W6QB 2Y6HA 1HIXA 4UAPA 3ZMOA 1D7PM 4IV1A 4Q2FA 5CKQA 5BNOC 4MXWB 1US2A 1CAXA 5FPUA 3N9QA 4BE3A 1QH7A 2HBTA 1VAVA 2W52A 3AMNA 3U11A 1OOPA 1LGCA 5FZLA 1R082 2GDFA 2VO5A 1WWYA 2RMU2 3FFQA 4COUA 3WLUA 3KM5A 2PTMA 4AFBA 4CRQA 1RUF1 4MGSA 4R4ZA 1RJ7A 3UGFA 3SNMA 2E51A 4WM8B 2R1BA 3A4UA 3VHPA 1V6MA 2XUEA 1RHI1 1F5FA 1NA1B 3IM0A 1LRHA 4G9SB 4P02B 2BPA2 1OA4A 4HL0A 3SH3A 5AFEA 5KC5A 3PU3A 5CU1A 4BH9A 2I74A 1TNFA 3I3DA 4PIYA 4KWLA 4CXWA 3DEMA 1UNBA 4W65A 1GICA 1WBFA 4ASMB 3V65A 2XJPA 4LPLA 1YQ6A 1O4ZA 3HEIA 4Z1VA 2Q1FA 4Y22A 5A3TA 4B7KA 1KFXL 2YPDA 1JXNA 3C3VA 4K6BA 3OBAA 1SCSA 3SKVA 2A6ZA 3B00A 2VQTA 1DLLA 3A0NA 3O1RA 4I30A 1MPXA 4PCRA 3PL0A 1GP5A 1JUIA 1PNGA 2VOKA 1ALYA 4BQXA 5HBAA 1RUG3 1IG0A 1FNZA 4FPEA 1ZZBA 4IEQA 4YVWA 4D7YA 1FI2A 4Q0SA 2QQIA 2WYSA 2ZGSA 1OVSA 1UU5A 2A3YA 3ZSLA 2XKPA 4CUBA 4AGVA 3IZOA 3TN92 4OI2A 5LA1A 1W0OA 1UYZA 1EAH1 3TEWA 2WFF3 1G7YA 1Y9GA 1K12A 1Z0HA 2QQJA 5CADA 5IHRA 1ZRFA 3AKPA 3BB6A 3ZR6A 1BZWA 2G19A 4I01A 4TTGA 3RMXA 4E4HA 2R041 3IIIA 2ARBA 2RR11 3OGVA 1A8DA 4PF5A 1RUE2 3PLQA 3GHNA 4K1YA 4Q0UA 4QDSA 4DXTA 4CU6A 1O3QA 4WM8C 1VIWB 5L7OA 4AQ6A 1NA1C 1HX6A 1W0NA 5IYYA
chains in the Genus database with same CATH topology
5KC6A 1ND3A 2ZJCA 1VR3A 2R071 3VL9A 4LEJA 3LWCA 4W6YA 5I0TA 5T52A 1EP0A 2JG9B 2JKBA 3D8CA 5KHIA 3BTAA 1WLDA 2MEV2 2R0FA 4XFIA 5IK7A 1H4GA 1JN2P 1SLBA 4RHV1 2P37A 3EXUA 2GN3A 3MIBA 1MS8A 2DUOA 4ZU5A 4LBMA 2PHDA 4XFCA 1MACA 1LULA 5D1IA 1F5JA 2JECA 3DL3A 4L8QA 4LTAA 5J37A 1KRIA 2ZHMA 3OBTA 1AXKA 1FOD3 4PIXA 1D2QA 1WCDJ 4QQLA 1AJOA 2JG8B 3BU7A 4YGEA 1RUD1 4AE2A 3ZFEB 1IPJA 1TNRA 3VZJA 2OUJA 2XBO1 4Q4W1 4BHPA 5CA6A 1SQ4A 5K0UB 4YGCA 3O7OA 2KXLA 2QFEA 3AXDA 5T5JA 1AF9A 3KD4A 2IWGB 2RE9A 2IXLA 2XB6C 4BIOA 4N43C 2LTNA 5F6KA 2AH2A 4ZU4A 1Z7S3 2Z2SB 3RYPA 1DG6A 2JG9C 3Q9OA 5FLHA 2IFWA 1AYM1 5F9TA 5JIAA 3KGZA 3CL1A 3N7JA 1G8WA 1Q8QA 2ZX1A 1QJU2 4HVOA 4P9LA 2HWF2 4YFWA 1CJDA 5KXEA 2XPJA 2QKDA 1GQGA 3HMYA 4V1PA 3CJIB 4H7MA 3V0BA 2R6QA 1SFNA 3NVCA 1HV1A 4XFFA 1V9U1 4M3CE 3FLRA 4MV2A 2HWE1 1KD7A 3J8F1 3WUCA 3ZPYA 2D98A 4YG0A 1CPMA 1ENQA 1QXPA 3MW3A 1CESA 4GULA 4RD7A 1RMU2 1KXGA 3ZXDA 2JG8C 5JI9A 2ZX4A 4OFGA 3WP4A 1DIWA 2R30A 4QPGA 3ZFEC 3VZOA 4RR3A 1UCXA 1C28A 1GYKA 1M4WA 5EV7A 3KT4A 3UKVA 1K5MB 2XJVA 5K0UC 1AR81 2PAMA 3ZN6B 3GBFA 4EWDA 2IXKA 1C8M2 2XJQA 3AKTA 4COZA 3M3OA 2VMHA 1X36A 1XYNA 1RUI1 3W9AA 4LBQA 2PQQA 3CU7A 4XXPA 1RIRA 1GZWB 2HWC3 1MQTA 4DB5A 3TYJA 5FPXA 1HRI3 3S7EA 1KDKA 4H7LA 1QOOA 1MS0A 1JUHA 2HEYF 5GZGA 1COV2 1ND2C 1QNWA 1IZ3A 4RS5B 1ZZ8A 4JC1A 4FTSA 1B35B 3LA7A 4KH9A 3CJIC 3AZVA 2XBO2 4BMBA 1PHMA 4Q4W2 1AR92 2BGCA 4IEXA 2GMMA 3LAGA 1VBC3 3OD0A 1NXD1 4OLLA 1BMV1 4NR1A 4CEWA 1Q5OA 1KQRA 4JGZA 2Z69A 4YM0A 1LOFC 1WCKA 2VW2A 5E16A 4FAGA 3G7DA 2E7QA 5DG1A 4FPCA 4XFAA 3VBHA 5J48A 3KLSA 4E2GA 1YFWA 3USUB 3EQEA 4AQ2A 4GMP3 1UIKA 5KHHA 5T54A 4CDUA 4OUSA 3JU9A 1WW6A 4BOWA 3NWKA 1LOGA 2D7FA 2R061 1WW4A 2E63A 2LM3A 4LO8A 2CTVA 4NVPA 2PHTA 1HQNA 4UW4A 1DGWA 4DFSA 3GF6A 1PO21 1DF0A 2RS13 3WHUA 2DCTA 2O8OA 4BMEA 2NPIA 4S2GA 4OHYA 2R0HA 4AVAA 4IEVA 1ASJ1 5CFCB 4AK3A 1LB2A 4JDNA 2GMEA 4RS5C 1H1MA 1FYUA 1B35C 2SBAA 1WLTA 4MGYE 5E8AA 2PAEA 3ZSMA 2RS32 3WG3A 4J1WA 1ZREA 1H0BA 1PVC3 2GN7A 3OBRA 2IZWA 3OY8A 3ZYJB 1REEA 1U12A 1SCRA 2W0XA 3ME2A 1G86A 4JQRA 2G9GA 1XYOA 3FLTA 4CDWA 2HEWF 4XF0A 2QJVA 5A33B 1D2SA 5FMOS 3M3QA 2GMPA 3POWA 5BNNB 2Y0IA 4WM7B 1IS6A 4LT5A 2RMU3 5JSPA 4CDXB 2XJSA 2P3IA 1S0BA 2FMYA 2FZ2A 4AYUA 1Z78A 2VQAA 2H6BA 2UY8A 4OI1A 3EBRA 4NHMA 1AX0A 1ZVFA 5EWSA 2JXAA 1Y7BA 4JV4A 2WT1A 1RUG1 4M3CA 4XTMA 3WQ0A 3AKRA 2ES3A 1W6NA 2B9UA 2B5HA 3ILNA 1AZDA 1VBE3 1XRUA 3BODA 3VHNA 1MR5A 2VGDA 1D0GA 5DUVA 4PDWA 4E4SA 4C0HA 5CFDB 3HR9A 3MI8A 3WNXA 1C1FA 1O4TA 1SLTA 3MFCA 4MUVA 1WCSA 1U5ZA 2DU1A 3TN93 1M06G 4K8FA 2R16A 1ZZ6A 1WW5A 4XFGA 1SLLA 1NY71 4XQWA 4HKLA 4CP2A 5BNNC 3JD73 4WM7C 4YVSA 4A3XA 1IS4A 3IIAA 2GZWA 5GLUA 1MS5A 5ACA3 4XQ4A 5GLVA 4CDXC 4L92A 5FO7B 2DUQA 5J36A 4FPHA 1H1IA 4B4QA 3ZFGA 2MHFA 5HXVA 2EVXA 4FOYA 3RMYA 1RUJ3 3N7LA 1QGLA 1UAIA 3BCWA 1SLIA 1YYNA 2WZR2 4JGYA 1R091 4AQTA 1W2UA 1RUOA 5J96B 3ZFFB 1U5IA 4B8EA 3ECQA 5CFDC 3MGUA 1PK6B 2VMIA 4LNVA 5BXXA 4EV0A 1PMIA 4KWJA 1Q8OA 3MICA 1QQP2 3X29B 1GSLA 2QZ2A 1VBB2 4AEKA 3OJBA 1DHKB 2WT0A 3APBA 3MIFA 1RUH2 2HWD3 3K51A 3LCPA 4MGKE 1S2BA 4Q4X2 4DZGA 3ZVXA 1GNZA 1OFNA 3JBG1 4LR4A 2HWB2 4UXAA 2C0ZA 5JOYA 1VBA3 3ZSKA 1Z7S1 4I02A 1G9BA 4YG3A 1LGNA 1DQ0A 4GIQA 4HK8A 3KCCA 3RYRA 1BBT3 5C9AA 5IK5A 1AYN3 4SBVA 1BQPA 4HT1T 1G9AA 1ZNPA 3VKMA 1EV12 3IDEA 1R1ZA 1S0FA 4PBPA 1UW8A 4EN8B 1DYPA 4INDA 1VBD2 2WKKA 3NAPA 3WP6A 3POSA 1JYIA 2ZTNA 4KBBA 3QCWA 3TRSB 2XL9A 3ZDSA 1WMFA 1O3SA 4IETA 5FBZA 4FP3A 2WS93 5KHGA 3I59B 2PLV3 4IESA 4XF4A 4KQ7A 5JOWA 1LENA 5JIUA 4YW1A 2GAUA 4GKYA 2BFUS 1AVBA 1DQ5A 3ZXGA 4OHWA 4P9YA 1ZBE3 1MS9A 1W39A 2ERFA 1MS1A 1NCRA 4HLTA 5FO8B 4KU8A 1DGRN 1CX4A 2QUOA 2YGMA 5GLWA 1UIJA 3NV3A 2CAUA 2HWC1 2YZ4A 1PZ8A 2Q0AA 1HRI1 1W6PB 1OHFA 2UWCA 3C2UA 1YIFA 4C1WA 1CPNA 4QPIB 2XL7A 2HJIA 3KT1A 3R4SA 2WT2A 4M01A 4HZFA 1OA3A 5T5OA 4BQ1A 4IQPA 3TNPB 3WHTA 1QJZA 5FQ0B 2Y38A 1UPSA 3B9IA 2A5ZA 5T5LA 5JLVA 4AGRA 4BCUA 3IPVB 5FRAA 3AMHA 4R9BA 1ZM1A 4IV3A 1AR93 4ES9A 3ATGA 4IEPA 2NP0A 1RVF3 3VDDB 4AVCA 1DYKA 3MFAA 1LU1A 2CGOA 5ABJA 4XETA 3MLJA 3WW4A 3KMHA 1LEDA 5CAZA 1PGL1 4DINB 1FPN1 1W6MB 1O5LA 3VKNA 2ZGTA 3WDWA 1IKPA 4A7ZA 3VBUC 3AJYA 1LODA 4TYSA 1PIV2 1TME1 1XU2A 5K7PA 3QH7A 1EPZA 4KL1A 4YZ3A 3SH4A 4RQPA 3WG4A 1RTVA 2WQ4A 4XF9A 5AVAA 2RS53 3M3IA 3QACA 4AEDC 1S0JA 2EAKA 2PHRA 4YSFA 1QH6A 1C57A 1FT9A 1A3KA 3H9AA 2XUMA 1H8TA 4HN1A 4QPIC 3PVEA 2Q1MA 3BALA 3PVBB 2ZPXA 3QD6A 4TZDA 1XNDA 4AFMA 4LUKA 2ZHNA 4QU2A 2QNKA 3R0RA 4OHVA 4F3JA 1O7FA 3MEPA 1KS4A 1J58A 3U0ZA 1DGWX 1AR71 1DQ1A 2ZA9A 2LALA 3VDDC 1BVVA 1C5HA 4IV1B 4N9HA 4WVMA 2UU8A 1TEIA 3LOBA 1CAXB 3HQXA 2A73B 4FTBA 5L73A 1QJY2 3DKWA 1ONAA 4YYOA 2D3SA 1OOPB 4TSVA 3NV4A 4GA9A 1DQ4A 4Q4Y3 3WW1A 1CGPA 4GH4A 1WA4A 3WUDA 1S2KA 4Q4V2 2AENA 1G9CA 3NW4A 2X5IA 5AC92 2ET7A 3FFZA 2XWJB 5F6LB 4JRLA 3KGLA 1I6XA 4H14A 5HCFA 1GBGA 1VBE1 3EJKA 1V6JA 2WNEA 1MZFA 5CNAA 5DDJ2 1Q43A 3LKJA 2WINB 1LTEA 2DVGA 4PJYA 1LJ7A 2ZKNA 3IMNA 4D69A 4P9IA 4AFDA 3THTA 1NE4A 2EALA 3QLQA 2RM21 4DXZA 1C1LA 4NN0A 1MZ6A 4C1XA 2FZ1A 2TEPA 3ENRA 3JD71 2D6NA 4FQ4A 5EZWA 4DPNA 1OOPC 5ACA1 1A78A 2DVBA 2IFRA 3OF1A 4COVA 5FLIA 4HSJA 3ASIA 2ZS6B 3E97A 4MGZE 4XQDA 1MVEA 4IL7A 5L7OB 2VVFA 4E4DX 2BW8A 2IXJA 1ND3B 4E9KA 1Q8PA 2CGPA 1S55A 1JW6A 3AFGA 3L2HA 3B02A 1RUJ1 4FQZA 1D0HA 1AR72 4I3PA 5GZEA 1S0GA 3JB4C 4LO7A 4EWEA 2GNMA 2ZMKA 1UKRA 3ZO0B 1F2NA 2DCKA 2JDZA 3RG0A 4Q26A 3UL2A 1R1A2 1C4RA 4J6GA 1ZBA2 4COWA 1YIPA 1MS3A 3P3NA 2QE3A 3R4DB 2DFCA 5I8YA 1UZYA 4J1XA 3KCYA 4RA0A 4GB32 3AXEA 1UX6A 3D5OA 2CL2A 1DGRA 1IKQA 1V6NA 4META 5JOZA 2I2SA 2WNUA 2HWD1 3WP3A 4P9JA 1FATA 4YW4A 1U5XA 1BXHA 1YCIA 3M2MA 3WCRA 4XYXA 4LBOA 1VBA1 4YW2A 5GALA 4Q4X3 2W68A 3AYEA 3E5XA 1CAWA 5F1RA 4ES8A 1ND3C 1BBT1 2QDNA 3EO6A 1GZCA 2ZGKA 3UK9A 4K7JA 1VB4A 2NZ9A 1VRH3 4BA6A 1WUVA 3VZKA 1MEC3 1V6LA 1AR63 1HRV3 3KSCA 4LUMA 4MXWA 4U2AA 5IT6A 1PM7A 1X8MA 3VBSB 1KDMA 1EV13 2JE7A 1AL21 1MZEA 2PFWA 2ZAAA 2XH6A 4JTNA 1SMVA 2D6PA 4IEZA 2WS91 2PLV1 5CIRA 1ULEA 3LB9A 1RUF2 5LRRA 4XIOA 1XE8A 5TSWA 2WNVA 1YFUA 1ZRDA 1RHI2 3ROUA 5I8SA 1WD4A 5E88A 3O14A 3R6SA 1YWKA 3AZXA 3PJYA 2A75A 2E6VA 3QH6A 3RQ0A 3VKFC 4D3WA 2A71A 4RR3B 1C3HA 3SH5A 1KJLA 4AVBA 1XQNA 3WVJA 4BPZA 1N1SA 4LO5B 1HV0A 1QOTA 3ALQA 2D6OX 2XVGA 2XJRA 3ZN4A 3URFA 1VAMA 4AHWA 1J3RA 1GLHA 4FXKB 4FTEA 2DURA 2PELA 2WJSA 4HANA 1LESA 1BEV1 4E4ZA 4Q0QA 3LOIA 1Y9QA 4ZKTB 2A3XA 1LHOA 4M00A 2D5HA 1J59A 1EAH2 3POYA 2WIIB 1OMIA 2P34A 1FMD3 5EXOA 3VBSC 1YFYA 3NL1A 4XBNA 4CZSA 5I8TA 2BYVE 1LOCA 2D6KA 4R9CA 2YV8A 1LOBA 2BUKA 2R042 1MS4A 2RR12 1RVF1 5FREA 1F8VA 3ZXFA 2AGSA 4KGQA 1D4M3 4ISQA 5LK5A 4LA3A 4JGZB 3ZX7A 1OI6A 3M3EA 1RB8G 3PMSA 4N43A 2XVLA 2R072 1H8VA 4IEYA 2A6XA 3AM2A 1RUC1 2EA7A 4RR3C 3R05A 2VUJA 1B09A 2JG9A 2V5YA 5FPZA 3ES4A 1AXZA 4Z8BA 4FO9A 1H2LA 4GWNA 4XTPA 3SCGA 5H9SA 4LBQD 1HXS1 1GQHA 5DZFA 2RS51 1AL22 2XVKA 1PIV3 1UZZA 1VLNA 1AJKA 1YI9A 3LA3A 4RHV2 1DZRA 4YZ4A 5LRSA 3GALA 1SLAA 3CEWA 1C8NA 1KFUL 4Z92B 2F4PA 2GALA 1N3OA 2DCYA 4K40A 1V00A 4DNYA 4C91A 2O8QA 4LE3A 1RUD2 5FOBB 3MIEA 3FX3A 3O12A 2N7GA 4JTOA 1TMF3 2AZ5A 4PLMA 3OY8B 5JVVA 3D0JA 3AP9A 4N53A 3H7JA 3RDIA 1D4VB 4S2DA 4CDWB 1OLRA 4JGZC 2Y0OA 2OYZA 4K20A 1I3HA 4Q4Y1 4YW5A 3NKGA 2WLQA 2E7AA 4RGGA 4OVEA 1AYM2 1PNFA 3M3CA 4DOUA 5I93A 5JSRA 1NLRA 1ND2A 2OA2A 2UWBA 4X6RB 1K5MC 4AW7A 1ZRRA 3CJIA 2K2SA 1S0CA 4F8AA 1QJX3 5I0UA 4LLFA 4YG6A 3AKSA 5AC93 3O0XA 2VW0A 2EXHA 4N90A 5C4WB 1V9U2 2CWSA 4QQHA 3CO2A 1CAVB 3G6JB 2HWE2 1GR3A 2JICA 3J8F2 5IK4A 2HYKA 3RI9A 3LGRA 1LHWA 1PO13 3QOPA 4ISRA 3MF6A 4M3CB 3WDXA 1NCQA 2PHLA 1LOFA 3VBRA 4XBQA 4O9GA 3PTYA 1QXRA 1J3QA 1L3JA 1YHFA 4PDWB 1IPKA 4MLOA 5DUXA 4XPVA 3VLBB 2ZACA 3ZN6A 1AR82 5DUUA 3T1MA 4M3CF 3SITA 4GXLA 5H9QA 4CDWC 4EWAA 3CJXA 3WT3A 2CY6A 4MSVA 3VBFA 3IBMA 1ZA4A 1RUI2 3VL8A 5JR7B 2D6LX 3MIHA 1POV0 1H1AA 4YVSB 3J9SA 2KM2A 4B4RA 4I0BA 3I4IA 1R083 3VGIA 4DRRA 5HCBA 4Q0VA 3TOJA 1UPIA 2X29A 4XJWA 1LCLA 2D93A 5FMOL 1IS5A 4QGNA 5C4WC 2WC2A 3ZFGB 4AVTA 4FAHA 4Q29A 2KA3A 3FJSA 5LEJA 3WINE 1BMV2 5BNPA 5DUWA 4WBBA 5CFCC 1CAUA 1N3PA 2ZGMA 4JGYB 3DGTA 1REFA 4Y20A 5CVRA 4PDWC 2UWAA 3WQ7A 1Q56A 1R1A3 3B69A 2UYAA 2R062 2WFF1 5JMCA 3M7AA 4YRDA 5E1RA 4KWKA 1X82A 3MF9A 3K48A 4XMAA 2P2KA 2ET1A 1SACA 1PO22 2QDRA 3DV8A 4YVSC 2ZGUA 2NM1A 2XLGA 2JX9A 3DUIA 1XNBA 3PMEA 5FOJB 1RINA 1ASJ2 3A0KA 4HETA 4R9AA 2EXJA 1HQLA 2AREA 2H0BA 1RUE3 3S30A 4W6XA 4YGDA 3ILFA 4DRVA 3WDYA 1VRH1 4CEYB 1NYWA 5A32A 4JVAA 1AR61 5C9AB 3HIFA 5GM0A 4JAAA 5D8AA 4N7UA 1LR5A 3N3HA 2VVEA 4FPJA 2UURA 3B9CA 4HMZA 4XFHA 3MPPG 3INAA 3NAPB 4B7EA 5BNNA 4UBGA 2XJUA 4XZPA 1LOAA 2MEV3 3S7IA 1DGLA 3AP6A 2C5DA 2BWAA 2E53A 2QCSB 3NKTA 4CDXA 4NHLA 5C8CB 1H2KA 3BOPA 1REDA 2Q1ZB 1RUF3 2Z42A 2ZZQA 2OPKA 1X8EA 4L11A 1FOD1 2VOWA 1W6OB 2HEVF 3HAGA 3ZSEA 3B5LB 3AMMA 4IEOA 4QPYA 4LA2A 1BJQA 3WD5A 1ENSA 4N9IA 2V73A 4YM2A 2DV9A 1NCRB 5LEKA 1RUG2 4R52A 2Z5WA 5GLTA 1PGW1 4BZ4A 3JCIA 3J26N 4PBOA 1RGSA 3OTFA 1J1LA 3VBOB 2PHUA 3I7DA 4CEYC 3FUQA 1HDKA 2G9FA 1Q8VA 5C9AC 1H9PA 5T50A 3DPRA 2WFF2 2W39A 4Y1XA 1FMD1 1OKQA 4XEZA 3OYWA 3D4KA 1O91A 3VN4A 2IXCA 5A3MA 5JSOA 3NAPC 1NY72 5GJ6A 1NQDA 1ULGA 3GZAA 1QJU3 2HWF3 1D4M1 3WY6A 3ZIWA 4IV3B 3ZFFC 3KZ4C 1AHSA 2RR13 1PK6C 5C8CC 5BUVA 4YARA 3D0SA 3VHRA 5ABJB 3AJZA 4FPFA 2DF7A 4LBJA 3WDTA 2FQPA 1VP6A 4HFSA 2VNOA 4HK9A 2NMNA 3ZIXA 1RMU3 1S0EA 3HN1A 4FVVA 3J4UH 3V0AA 3UV9A 4OZXA 2D3PA 2GH2A 2ZX2A 4EN0A 1CONA 3VBOC 2WQZC 4RQPB 1JYCA 1R092 3V64A 3DN7A 4CDQA 2R32A 4NOTA 1JOJA 3B7MA 2BFUL 1C8M3 3CF6E 2YROA 3KB5A 2A70A 2D5FA 1IQAA 3ETQA 3M70A 5I0SA 4XFBA 2VULA 4G4FA 1BKZA 2PHFA 1H8TB 1V70A 2GH8A 4LHNA 4JRAA 2ZMLA 1TMF1 4X8NA 4CP1A 3JB8A 1COV3 2AUYA 3WG1A 4IV3C 2ZABA 3FC0A 3JBG2 3NSTA 1VBC1 3RS6A 5I91A 2XBO3 4Q4W3 4FPKA 1I5ZA 1RUNA 2GC0A 4AVVA 4WVMB 4QQ2A 5KXDA 5ABJC 2C1FA 2JENA 2A3WA 1Z7S2 1PZ9A 2BNNA 3NV1A 2GC2A 2TBVA 2Z79A 4QM9A 2CGNA 4GMP1 2A6YA 2DU0A 1HLCA 4Q8LA 3FLPA 1AUYA 4GH4B 3O0WA 1AYM3 1ZRCA 1UD1A 2D44A 1LEMA 1J1TA 1QJX1 4AGGA 2ZBJA 4RL7A 4GWMA 4RQPC 4K3UA 3BPZA 2VPVA 2X5IB 5GKAC 4YLZA 1AX1A 2B8MA 1YRZA 2ZHKA 2RS11 3H0OA 3TNQA 4FOVA 5T5PA 2Q8OA 2CNAA 3JQWA 4L97A 1H8TC 2DUPA 4YM1A 3KS7A 3J8F3 3ZXLA 2LUWA 3DF0A 2OW4A 5E89A 4DY3A 4UW5A 5JZGA 1A6CA 1CN1A 3VZLA 4AVSA 4YZ2A 1NXMA 4FXGB 4Z2WA 1U5YA 1PVC1 5JI7A 3VBUA 2O0OA 2XGXA 1LHNA 4AI3A 4NWVA 2RS33 4FCAA 4XHBA 3MLKA 1HKDA 1OFSA 3VHOA 3RNSA 4RFT0 2HWC2 4RGAA 4Y4YA 4AEDA 4K1ZA 3H1MA 4A7KA 1HRI2 2ENRA 3ZXJA 2GSYA 5AVPA