1R092

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09200
4WM8A 1R092 3S6PA 3VBHB 4RS5B 2HWF3 2HWE2 4CDXA 3VBSB 2BPA2 2R041 3NAPC 1AR61 2R062 5C9AB 2RR13 2HWD3 1H8TB 4YVWC 3VDDB 5L7OC 1POV0 2X5IA 5CFCA 5BNPA 1HXS3 1RUI3 1QQP3 4PDWA 1HRI3 3VBUC 4CEWA 1PGL1 1RUF2 1RVF3 4GMP3 1COV1 1PO22 1TMF2 1RHI2 1VBA3 4IV1B 4Q4V2 1R091 3ZFGB 2ZTNA 2HWE1 1NCRC 4NWVA 1B35B 1NCQC 3TN92 2DF7A 2R061 1TME1 1PIV2 1EAH3 4WM8B 1VBE2 4Q4Y3 1OOPB 1AL21 3VBSC 5CFDC 1QJU3 2WS93 1ND3C 1VB4A 4RQPA 3VBRA 2WWSA 1RUF1 2X5IB 1V9U3 5CFCB 5BNPB 4QPIC 1MEC2 1PO21 2PLV2 3ZFEA 5DDJ2 1FMD3 1VBD3 4Q4V1 1R1A1 4Y4YA 1X33A 1GFF2 1RB8G 1PGW2 3TN91 3JD72 5JZGA 4Y5Z0 2RMU3 5ABJA 1PIV1 4AEDC 1VBE1 1MQTA 2HWB3 1RUE3 2WLPA 1C8M3 1ND2C 5GKAC 1BBT1 1FOD2 4CDXC 3FBMA 4N43A 2PLV1 5D8AA 2BBVA 1DDLA 1K5MB 2R072 4RQPB 3VBRB 1VRH3 4JGZA 1NG0A 1HRV1 1PGW1 2RM22 4WM7C 5CFCC 3ZFEB 4PDWC 2HWC3 1VAKA 3VBOC 3JB4C 4CEWC 2WFF3 1M06G 4RFT0 1BMV2 5JZGB 5ABJB 4IV3A 1AYN3 1RUC1 1ZBE3 3VBHA 4RS5A 2GH8A 5BNNB 1MQTB 4JGYB 4CDWA 4GH4A 5C9AA 2RS51 1H8TA 2R071 4RR3A 3CJIA 3VDDA 1Z7S3 1QJY1 4N43B 1AYN2 1RUH2 2TBVA 1AUYA 2BFUL 1BEV3 4JGZB 1D4M3 2RS31 2HWF2 1RMU3 1BMV1 1AYM3 1HX6A 2RR12 2HWD2 1FPN3 5AC93 1ZBA1 1NY72 3JBG3 5JZGC 4IV3B 1HXS2 3LOBA 1RUI2 1QQP2 2XBO1 5A33A 1CJDA 1HRI2 1RUJ1 4CDUC 1OOPA 2FZ1A 4CDWB 4GH4B 1RUG1 1RVF2 1PVC3 1VBB3 4RR3B 3CJIB 1AYN1 1RUH1 1VBA2 1F8VA 3J8F1 4NWWA 2WZR1 2R043 4N43C 5D8AC 1AR63 2QQPA 1VBC2 4CDQB 1EAH2 5C4WC 1NY71 4Q4Y2 1HXS1 1QJU2 5ACA3 2WS92 1HRI1 4N53A 1RVF1 4RHV3 1V9U2 4GMP1 1VBC3 4QPGA 1AR83 5BNOA 5A33B 1VBA1 1FMD2 1RUD3 1VBD2 2ZAHA 1VB2A 4RS5C 3VBHC 2RS13 5C9AC 5J96B 1K5MA 1TME3 2RMU2 4Q4W3 1H8TC 3HAGA 3CJIC 4RR3C 1EAH1 3VDDC 4EJRA 2IZWA 5FMOS 1TMF1 1AL23 1QJZA 1RHI1 2HWB2 1RUE2 2WS91 1C8M2 4SBVA 2BUKA 1OPOA 4IV1C 3DPRA 1FMD1 1R1A3 4N53B 3ZFGC 5BNNA 4JGYA 1VRH2 1B35C 3VBFB 4QPGB 1POV3 5BNOB 4WM8C 1QJX3 2HWC2 1PO13 1OOPC 2WFF2 1MEC1 1R083 5DDJ1 2HWB1 4YVSB 4CEYB 1AR73 1ZBE2 3ZFFA 1C8M1 1AR93 1BBT3 2X5IC 3JD71 2MEV3 5BNPC 3NAPA 5K0UB 1VRH1 1C8NA 1HRV3 1Z7S2 5C8CA 1NA1B 3DPRB 1FOD1 4Q4X3 1BEV2 2WFF1 1D4M2 1RMU2 1NOVA 1AYM2 1ASJ3 1RUC3 1ZBE1 2FZ2A 1FPN2 5AC92 2RM21 3JBG2 1NCQA 2RS53 1K5MC 4RQPC 4CDQA 3VBRC 4BCUA 3ZFFB 4GMP0 1Z7S1 3NAPB 1QJY3 1PVC2 1VBB2 3ZFEC 3ZXAC 4YVWB 1ND3A 4FTEA 3JB8A 5C8CB 2R042 4QPIA 5ABJC 4Z92B 2Y26A 1AYM1 1HQNA 1AR62 1WCDJ 3VBUB 1FPN1 5BNNC 5AC91 1MQTC 1ZBA3 4JGYC 1EV13 4GB33 1F2NA 5ACA2 2BFUS 1RUJ3 2HWF1 1NCRB 4AEDA 1NCQB 1RUG3 4RHV2 1VBB1 2RR11 2HWD1 1AR82 1RUD2 4JGZC 3ZFFC 3J8F3 2RS12 5CFDB 2WZR3 1RUI1 1QQP1 1TME2 1ND3B 4Q4W2 1IHMA 3VBFA 1COV3 4QPIB 5C8CC 1AL22 4WM7A 4IV3C 1R093 5ACA1 3VBOA 2HWE3 4CDWC 4GH4C 3M8LA 4RHV1 2R063 5FMOL 4YVSA 1VBC1 4CEYA 1AR81 1RUD1 1R1A2 4Q4Y1 1SMVA 4AEDB 2RS11 1QJU1 1CD3G 4FTBA 4Q4W1 4CDQC 5K0UA 1ND2B 1QJX2 1RUF3 1PO12 1V9U1 4CDXB 4FTSA 1PO23 1TMF3 1RHI3 5A32A 1R082 1NA1A 1VBD1 4Q4V3 4LLFA 1AR72 1AR92 1BBT2 3TN93 2MEV2 4WM7B 2RMU1 5LK7B 1PIV3 4PDWB 3VBOB 1VBE3 5J98B 2VQ0A 4CEWB 1HRV2 1RUE1 1POV1 1QJX1 4CDUA 1PO11 4Q4X2 1MEC3 2PLV3 5DDJ3 1R081 1X36A 4YVWA 1ASJ2 1AR71 1RUC2 5L7OA 1AR91 3JD73 2MEV1 5A32B 2RS52 2HWC1 3VBUA 4N53C 5C4WA 2GSYA 3VBFC 2XPJA 4QPGC 1QJY2 1E57A 1OHFA 5BNOC 1FOD3 1NCRA 4Q4X1 3IDEA 2RS32 4YVSC 2R073 1AL0G 4CEYC 1ASJ1 4CDUB 1ZBA2 2RM23 5CFDA 3VBSA 1EV12 4GB32 4FSJA 2XBO2 2ZZQA 1BEV1 5K0UC 5L7OB 1D4M1 1RUJ2 2RS33 1RMU1 1RUG2 5D8AB 5FOJB 1NA1C 3DPRC 5C4WB 3JBG1 3J8F2 2WZR2 2XBO3 4IV1A 3ZFGA 1PGL2 1A6CA 1W39A 1B35A 1PVC1 1COV2 1RUH3 1EV11 4GB31 1ND2A
chains in the Genus database with same CATH superfamily
1UPSA 4RS5B 1NLRA 2HWE2 2BPA2 3APBA 5FY0A 1EUTA 3RDIA 2R041 4L97A 3VBSB 4F7ZA 2VOXA 4FFIA 4I0BA 2WO3A 4YVWC 1H8TB 1SLLA 1W9FA 1PNFA 4XCAA 5FR3A 5L7OC 1XB9A 2B42B 4LO5B 2X5IA 4QX0A 3OPTA 5BNPA 3T2QA 1RUI3 1QQP3 2D6NA 2ZMKA 3B93A 5IVFA 1ZZ9A 2XHKA 2DTYA 1CVNA 1XYPA 5DG2A 3ZSJA 4QQHA 2IC1A 1RUF2 4K3UA 3SH5A 2VZPA 4IEVA 2RHPA 4ZZ8A 5T5LA 1UO9A 2BVBA 1WLWA 2VW2A 4AE2A 1URXA 2D97A 4YZ3A 1QOSA 2E33A 4XJ9A 4ARYA 4QX1A 3O1MA 3P5BA 4MHUA 2BTVC 3LSEA 5FUNA 4NIAA 5HXMA 1WLCA 1PIV2 3KV5A 3VUOA 1V00A 1VMFA 4GWJA 3POBA 5JCTA 4MHRA 2WQ4A 3N9MA 1VBE2 1SBDA 4Q4Y3 1OOPB 3OBRA 3VD3A 2LRPA 5CFDC 1G7YA 4R9AA 1ND3C 1ODNA 1VB4A 1FV3A 4RQPA 1XE0A 5L9RA 5DZFA 3RFRA 4CCCA 3NJVA 4M3CB 5KHHA 2WBKA 4D7TA 2X5IB 3H8UA 3LEKA 5FYUA 1W3XA 5JMCA 5BNPB 3U07A 3VDAA 1PO21 1OA4A 1AX2A 3ZFEA 5HBAA 2CYFA 4JKMA 4Y4YA 4XJWA 1HW5A 4QDSA 4AI3A 3LEIA 4QQOA 1RB8G 2QKDA 1VALA 3I8TA 4XAAA 5APAA 2DBNA 2I2SA 1PZ7A 4W65A 5JZGA 3ZYGA 5ABJA 2YFZA 3N36A 1ZRCA 3X29B 2WJSA 4MSVA 5F2SA 3WF3A 2JX9A 5FZKA 4K1YA 5F5QA 1OF3A 1JYNA 3VKFC 1RUE3 1HB3A 3HNMA 2J1EA 1C8M3 3E1F1 4Q5OA 3WNMA 3ZXFA 4EZHA 2Z69A 3SITA 3VKLA 5C33A 4JKLA 3HNYM 3JZVA 1UU6A 4N43A 2BBVA 5BNQA 3KGZA 3T4HB 2CWSA 1K5MB 2R072 4RGKA 4RQPB 2JIGA 2JG8B 4OCTA 5EIYB 1QHDA 4UFIA 4CUBA 1HRV1 1PGW1 1S0GA 1QWRA 3HWJA 2Q5TA 4FO9A 4YW4A 3ZMOA 2GNTA 3IAPA 3ZFEB 3EJKA 4NIIA 4PDWC 4NAOA 3VBOC 3USUA 2A6VA 4LE3A 4XJ8A 4NIGA 2D40A 5FTTC 4OQ8A 2HLEA 1BMV2 2JEMA 3MIFA 1LOGA 1XNDA 5A3UA 5ABJB 5JZGB 1L7QA 1I3HA 2IFWA 2YBPA 3BN6A 4IV3A 1RUC1 1GU3A 2BRTA 1CIYA 2G9ZA 3KCYA 1NX9A 3AJZA 1QJFA 1VMJA 2C6SA 4AFDA 2VNVA 2MNGA 5C9AA 1W8NA 3H8RA 5JUVA 3RZJA 2PHLA 2PFWA 5LBEA 1HLCA 3CJIA 4RR3A 3VDDA 3AMHA 1UZVA 3H7YA 5DABA 4B7EA 3FFQA 4N43B 1G86A 2LTNA 3PVOA 1S0EA 3AX4A 5H9PA 5EHDA 3E5XA 1AYN2 2TBVA 1AUYA 1BEV3 1KS4A 2RJKA 4PQ9A 3C8XA 5JI7A 4DXRA 1QDCA 1RMU3 3QOPA 2X09A 3T0BA 3N7MA 2R1BA 4XTPA 2UY9A 5CG8A 1AYM3 3KF5A 3C7GA 2ZGTA 1JZ5A 3ZXJA 4AI1A 1FAYA 1QGLA 4Q0PA 4LOSA 4AXOA 3WR0A 3HQRA 1TVGA 4URTA 3LDRA 1GZ9A 1MR5A 4AEJA 5B4NA 1IQDC 4IV3B 4E2SA 1RUI2 1QQP2 3OUJA 5JXIA 4CDUC 4KG0A 1RUG1 2JENA 2OT7A 1EUUA 2NM1A 3IMNA 2XLGA 3CJIB 1RUH1 4RR3B 3ZN5A 4C1XA 3LZZA 3LA2A 1MPXA 5FYCA 3WOGA 3J8F1 2A6XA 4ISRA 3MF9A 1F8VA 5FPUA 1XRUA 2R043 4KBZA 1KDMA 2R0FA 4BQ4A 1JUHA 4OZXA 4B8EA 2O0OA 3B7MA 4LBNA 2QQPA 1IZ3A 1GP4A 2B5HA 4DY3A 1SACA 4K9SA 4Q4Y2 4FPOB 1UYXA 2JE9A 2W91A 2FDJA 2C4XA 3R05A 4CZSA 3TEWA 2YC2A 4LITA 3BOWA 1BJQA 5DN2A 4ES8A 5CKQA 1RVF1 2AYHA 1GKBA 4GMP1 2ZEZA 1AX1A 1VBC3 3WNXA 3K46A 1AR83 3GF6A 4JHZA 4L99A 1VBA1 1RUD3 3HD8B 2W1QA 2G19A 3WDXA 5FO8B 5GLWA 3M3EA 3USSA 1JU3A 1ZRDA 4BQ2A 3I2OA 3Q8EA 5J96B 2VVFA 5IATA 4ZKTB 3HAGA 5DMYA 3B94A 3ZSLA 1EAH1 1J83A 1TEIA 2OQ7A 3UGHA 4A7YA 1W06A 5IK4A 4UFMA 1VJ2A 2IZWA 4B29A 1NXMA 2JDHA 1CJPA 1TMF1 3OCPA 4LO7A 2F4LA 1RHI1 5I0TA 5HCHA 2DUPA 3MV11 1NZIA 1RUE2 2WS91 2UYBA 5CYYA 4AHWA 1F15A 5A7OA 1C8M2 4MADA 3SCHA 5FOBB 2G9GA 2VCAA 3GZUC 2EXIA 2WZEA 1AJKA 4LUKA 3BODA 3OBTA 2LS6A 3C7OA 3U10A 1FMD1 1IPKA 1MVEA 3ZXGA 2XJRA 2HYXA 2YMZA 4KGGA 5BNNA 5IK7A 1O3SA 3WQ7A 1W2TA 4XQDA 2CGNA 4H7MA 1V6MA 1POV3 5DUXA 4WM8C 5FWEA 4XDPA 1JBCA 2GAUA 5A3TA 4AZZA 1IS4A 5FFOC 5FYMA 5AFBA 3BTXA 3CZUA 3WEZA 1W8FA 1OLMA 2GC2A 4BK5A 2YHJA 4CEYB 1ZRFA 5EJZB 2B9UA 4Y1XA 1G9FA 3J7MA 5A80A 1I1EA 5IVJA 1RL3A 1V6IA 3JD71 2XH6A 5FXWA 2P6HA 4JTNA 4FVVA 5DPNA 3NNLA 3C7HA 2RDQA 1XYOA 3N9NA 3RI9A 3EXUA 3WXPA 1HRV3 4MGYE 1BCXA 4UOJA 3O1RA 2IXKA 3V65A 4XOGA 3RQ0A 1ENQA 4Q1PA 4ZU4A 2OPWA 3NL1A 3PIGA 5KXBA 1KRIA 1KJRA 3MLLA 3R0RA 1BEV2 1ACCA 2BERA 4V2VA 4XUPA 3ZYJB 4CVUA 3I3BA 3V64A 4QX2A 1RMU2 3OBZA 3HQUA 1WCUA 3LOIA 1SCSA 4P5YA 4XYXA 1AYM2 4XEZA 1RUC3 1BK0A 2WT2A 1OA3A 2H0VA 3NQHA 2RM21 4YRDA 1LEMA 3D0SA 2ZKNA 4BLJA 5JXJA 1MZEA 2PYTA 4CDQA 4PHZA 3VBRC 4BCUA 1VPHA 3I4IA 3ACIA 2E32A 4GMP0 4NIDA 1YQ5A 3LCPA 3LF7A 4E9KA 3HN1A 1J58A 4YVWB 1UOBA 1ND3A 4I0WB 1CWPA 1W99A 4FTEA 1P8JA 1KGYA 4Z2WA 1G9CA 1NLSA 2PHXA 3I49A 2Y6JA 3NRUA 1J3RA 4UFLA 1DGWX 3MPBA 2JB4A 2R042 4MGQA 4EWEA 5L9VA 4P14A 4D7YA 1HQNA 2VBPA 1YFUA 1WCDJ 3WDVA 4YG0A 2P5BA 4IE4A 3T4VA 2XLFA 3ZSKA 1SBFA 5A3LA 5AC91 1MQTC 2VCMA 3R4SA 2EVXA 3TRSB 1WBFA 3WDUA 4COUA 3IN9A 4UAPA 4EROA 1HN1A 1NXD1 5FZOB 2OVUA 1Q56A 4M4PA 4DMIA 1RUG3 2Q8OA 5F37A 4QQPA 3OPZA 2HWD1 3ROUA 1AR82 2H6CA 2EALA 1VRBA 1RUD2 1CAUA 4HG6B 3AMPA 3J8F3 1DCSA 3SNMA 5FQ0A 5F8PA 5C3OA 4NMIA 4OUEA 4A3XA 2ZAAA 5FK8A 5CFDB 2P37A 4LE4A 4FI9A 3EQEA 4FXGB 2GN3A 3MFAA 1UU5A 2JDYA 1ND3B 1UZWA 4MOAA 4Q1RA 1G6NA 2DVFA 3U11A 4P9GA 2J1SA 4ZU5A 2W1UA 3M4FA 5C8CC 4IEPA 5KR7A 1DG6A 3DKQA 1ULEA 2GMPA 4R9BA 4CA9A 1R093 3ES1A 3V0BB 1LECA 3VBOA 4MX3A 1O91A 2BQPA 3AL6A 4GH4C 5EP9A 2XG3A 5J7MA 4YVSA 3GNEA 3MIDA 1UYPA 3W9AA 3JCIA 5JSOA 2CAUA 5T3NA 2VTXA 3BVCA 4F8AA 3IWZA 3IDBB 3I2JA 3MV01 4CCDA 2WC2A 4HN0A 5FZFA 5FZ9A 2BOJA 3MIBA 2PAEA 1O7FA 1CD3G 4QX3A 5GM0A 4Q4W1 4D6QA 2XJSA 4Y24A 1TQ5A 4CU9A 1CAUB 2BDRA 5A7WA 3C7FA 2QQUA 1W0OA 4XF3A 1AXZA 1NQDA 2X10A 4YZ1A 3EBRA 1TMF3 3IPVA 1RHI3 2WNVC 1LCLA 4Q4V3 4QB1A 4LLFA 1K45A 4AVAA 1QY4A 1OLRA 4F83A 2B4KA 4HETA 4LKDA 3H8XA 4JDOA 2CAVA 1IPSA 2QTWB 3TN93 3BB6A 5LK7B 2YG0A 1ULCA 1WGPA 4CCLA 4PDWB 1LGNA 2ZGMA 3VBOB 5HCAA 1S0CA 1XNAA 4DXSA 3DYPA 5A7QA 1HRV2 1S0DA 5EYYA 1ZREA 2E7TA 3HPNA 3PMEA 3UK9A 1OH3A 3LDBA 3RZGA 1WWYA 2FDHA 1CPNA 2QQIA 1ZZ7A 3Q8CA 2QQNA 4N9HA 5FZHA 4CDUA 5CA6A 3CZJA 1YJKA 3SLIA 4AFBA 2QZ3A 3ETPA 5FPAA 2B46X 1Z0HA 3AP6A 4HK8A 1IKQA 1RUC2 5A7WB 2VXRA 1AR91 3KVBA 4I01A 3JD73 2JICA 1YEWA 2MEV1 1LHUA 1Q8PA 2FDIA 2C5DA 4Q29A 1PZ8A 3DXUA 4QX8A 2XJTA 1EYBA 2AEYA 3AKSA 1A78A 2X53S 2WYFA 1JYTA 4JC1A 3VBFC 3AP4A 2WO1A 5G04L 5IVEA 1PX3A 2XPJA 1J1TA 4XABA 1LU1A 4PI0A 1S2KA 2BGOA 3OEBA 3WSOA 3PJYA 1FATA 4WVWA 5L36A 1DP0A 4XFAA 5CU1A 4AOCA 3PNAA 3NNFA 1LRHA 3KCCA 4P08A 3VB9A 2AEZA 2ZHKA 1LKNA 4AFCA 1ASJ1 2N7GA 5FJHA 1H2MA 4GJZA 3KZ4C 3I2HA 1MACA 1TNFA 4CDUB 1W2OA 2RM23 3GM8A 3DECA 2VZ3A 2CL2A 4PLNA 4Y1YA 3AMMA 4Z2AA 5I8TA 1GQPA 1LTEA 1XYNA 2OS2A 5E16A 4LO6B 5BYNA 3TWIA 5K0UC 3S57A 1W6OA 1Z78A 2RS33 2YYOA 2ZX2A 3N3HA 4Z07A 5FXVA 5A1FA 5K7PA 3FMGA 2GMMA 3OSDA 4ZHNA 5GZFA 4TLFA 1RUG2 4AWDA 3PUIA 1NA1C 2DVAA 4CPBD 3DL3A 4IQPA 3H7JA 1DIWA 1W9WA 3PU8A 4K40A 5I91A 3J8F2 1GMMA 2QQKA 3H0OA 2BVVA 2RG4A 5FY9A 2XL7A 2XBO3 5DAXA 1J1LA 2YZ4A 4PF5A 3K2OA 3WP6A 1H9WA 2SBAA 3IKWA 1WKYA 4ZPIA 4NHXA 1PGL2 5KXDA 1DZTA 4OYUA 2YGLA 4GJYA 4NR1A 1E5HA 3VZNA 4AF9A 1EV11 3POEA 4GB31 4Y26A 4E4HA 5L19A 4WM8A 1R092 3O0XA 2WIIB 4HONA 5IK8A 3AL5A 4LBMA 5DAWA 3A7QA 3V56A 4DNYA 5JXHA 4LO4B 2RDNA 3NAPC 5F3GA 2NQYA 1AR61 2UWBA 3JU9A 5B2GB 4IEWA 3LDKA 2HWD3 1RUOA 3EYPA 1W6OB 4YW1A 1GQGA 1WMDA 2ENRA 3SCFA 5CFCA 4GWNA 4XQWA 5FY4A 3WNLA 1WCSA 5DAQA 1GNYA 3KHBA 4LA3A 2W5FA 4WBBA 4QXBA 2RVAA 1O4ZA 1IG0A 1W0NA 1H4HA 3UJQA 3AXDA 3GBFA 2EIEA 1GP6A 1TMF2 4D6SA 1RHI2 2ADEA 1D4VB 2DBIA 3GBGA 3A4UA 4Q4V2 3O14A 1WW7A 2VE1A 4I3GA 5HCFA 3ZDVA 1NCRC 2WUHA 1I9RA 1UQXA 1NCQC 1O5UA 2DF7A 3AYAA 4NRPA 4LJHA 2R061 4QU1A 3TN92 4GAZA 5C5TA 4FOWA 3D4KA 5DAPA 4OHVA 4WM8B 4AGRA 3T1LA 4Q27A 2QDRA 3P3PA 4M0NA 4MVTA 2VZQA 1EPWA 1W9TA 3MHZA 2XMLA 1NLQA 4QMAA 2VVEA 2VQTA 4UW4A 3R6SA 4DUWA 2MPFA 2PHFA 3GYDA 1HKDA 3VBRA 3ZR5A 3K3OA 2WWSA 3UETA 1UMZA 5CFCB 4QPWA 5KHIA 4GULA 2AZ5A 4QPIC 3SEPA 2O1QA 1XNTA 1RTVA 1PVXA 1W8UA 1R1A1 2GP3A 1ZA4A 4BISA 4G3YC 2DVDA 4KU7A 4N7IA 2CTVA 3AMQA 4C90A 3O5SA 1I6XA 3JD72 4AW7A 3KVAA 1O59A 2VQAA 4UI9L 1S0JA 1PK6C 3MW2A 2YBSA 4XURA 4CTEA 1ZVFA 2W08A 5F5IA 1MQTA 3UKNA 1GICA 4XZUG 4DXTA 5FY8A 1WBLA 4RGGA 4HPKA 4OI4A 1DQ0A 4XZPA 2WLPA 3RGBA 3AB0A 3E6DA 1JZ4A 4WVMA 5FLIA 1W28A 1QDOA 3OD0A 2BZDA 3AVRA 4P00B 4AL9A 3TBDA 4CDXC 2ARXA 3FZ3A 1CR7A 4KWUA 1O8PA 4R4ZA 3A22A 2PLV1 3V0AA 4FAHA 1DDLA 1W9YA 3WNPA 3VBRB 1H2KA 4XXAA 2ZXQA 4J1XA 4X6QB 1VRH3 4XTMA 1NG0A 1UX7A 2L9LA 1GOGA 1FV2A 5JSPA 4LK6A 2ZKLA 4M3CE 2RM22 4WM7C 2EXJA 1HB1A 4E4SA 3NV4A 4PF1A 1W0PA 3OD4A 3CNAA 4HBNA 2VOTA 1WW4A 4CEWC 2FCUA 4NUBA 2WFF3 4QWNA 5DUWA 3FX3A 2A73B 3CLPA 2ADDA 4FQZA 1KEXA 1ZBE3 1NKGA 4L11A 4RS5A 2GH8A 2CDPA 1JXNA 2JDNA 1MQTB 2ARBA 4GH4A 3DN7A 1Q8QA 1VAVA 1SLAA 1H8TA 1ZZ6A 2JKBA 4HPKB 3K75B 1LESA 2DCJA 4YW3A 5JSRA 4WVMB 3VDCA 4IETA 1IQAA 4FPKA 1RITA 4XIOA 5H9QA 3RZMA 3CMGA 2WT1A 3RVHA 5JMOA 3IIIA 4QM8A 1JZ2A 2DFCA 1REDA 2Q4SA 4UFJA 5F6LB 1ENXA 3ENRA 3BPSA 3PDQA 4BXSV 2VZUA 1F35A 1WD3A 4QM9A 2BFUL 1JN2P 4AHXA 5KWRA 1VP6A 4HSJA 5JWPA 2VTFA 5FY5A 4TSVA 3WX5A 2BYVE 3T3YA 1UXZA 3IMMA 1XU2A 5FBJA 1S0IA 4IEUA 1HX6A 4XETA 4D3WA 5GZGA 2HWD2 3L2HA 4OVEA 2XKPA 5C3SA 1FPN3 2WWJA 3OGVA 1JI6A 1AXYA 3AMNA 2VNRA 3W5MA 1QIQA 2XQRA 1GSLA 3WD5A 4BA6A 3I97A 4XVHA 3LOBA 3ZVXA 4GALA 1VE0A 1L7LA 5A33A 1RUJ1 4JRAA 4XE9A 1OFNA 2VY0A 1OOPA 2WR9A 1D0GA 2WFPA 4GH4B 2ZHLA 4XIKA 1JH5A 2WZ8A 4UYBA 4MZUA 5FPLA 1LU2A 4M0HA 1OUSA 3PIJA 4M3CA 2W9XA 3BU0A 4NWWA 5K9YA 1RYYA 3SEEA 5FZBA 4BU2A 5D8AC 1AR63 3O1PA 4JQTA 4ZY9A 2PQQA 2VMCA 1APNA 2JE7A 2DTWA 4E8DA 1QMJA 2VOWA 1T6GC 1ULPA 2Y6LA 1NY71 4LLOA 1W03A 3AP5A 5HV0A 1UY1A 4GIQA 1HXS1 2YXSA 2KA3A 4DOUA 5ACA3 3E97A 4P5HA 3T0AA 1HRI1 4ATFA 2GC1A 3VKNA 4MGTA 1SLIA 3ZX7A 4JVAA 2DVBA 2YY1A 2ET1A 1V6JA 5C3QA 1LOAA 5D1IA 5LY1A 4TTGA 2Y0OA 3WQ1A 1JZ7A 3N4MA 1KFXL 2DVGA 5F5CA 5A33B 5F2WA 3VBHC 4C0HA 3CHXA 4IE5A 2W87A 2GN7A 4D94A 4CCOA 5JAXA 4NAMA 4Q0SA 2D6OX 2CV6A 1JYVA 2PXJA 4XDOA 5IAXA 1K5MA 4BLIA 1CONA 5A6QA 1DGRA 2JG8A 1LOFC 3CF6E 3PJQA 3ES4A 3KV6A 4BQ1A 4NO4A 4FAGA 1U5IA 1YC61 2JIJA 5F32A 3AJYA 4XACA 3WF1A 5BPXA 2G9FA 5T5OA 3WDYA 2HJIA 5LY2A 4B4PA 4CCJA 4KI5M 1BLZA 4JV4A 4CCNA 5LRRA 2XHNA 3UYJA 1U5ZA 3FHAA 3SC7X 3BIEA 1DQ4A 2Y6FA 3WCRA 1OPOA 5EJ1B 3L2YA 4DIQA 5A6XA 2OYZA 1R1A3 3Q8FA 5C71A 2BWCA 5I93A 1Q8VA 4K1ZA 1VRH2 4CP0A 1DQ6A 1B35C 3K4ZA 3VBFB 5CISA 2HBTA 4QB6A 5H9RA 1CPMA 2F6BA 4W6XA 2A3XA 5LW9A 1OKOA 1RC6A 1QJX3 2D6LX 2XUMA 3G7DA 5A6YA 3BI3A 1MS3A 1PO13 1W2AX 3KWVA 4LMFA 5FZMA 2ZS6B 4XCBA 1MEC1 2VH9A 2WFF2 2XVLA 1C3HA 1R083 2HWB1 5DDJ1 1GANA 2DFBA 2RE9A 4FPYA 5ISLA 1SEFA 2PHRA 1DHKB 3VZMA 5IFTA 1ZBE2 3KT4A 3ZFFA 5FYVA 1AXKA 1S0FA 3U0ZA 4KMQA 2A1XA 4QGMA 4BOWA 3NAPA 5KHGA 2ARAA 2VZTA 2BEOA 4TYSA 4YYOA 1N1TA 3CL1A 2B7YA 3SHRA 5K0UB 2XXZA 3DYMA 4CCKA 2IXHA 4AAXA 2BV4A 4FPFA 5FYHA 3HT1A 5LZ6A 2GALA 3LGRA 4FPGA 5A3NA 2BGCA 5LA1A 2XWBB 1YNAA 1NA1B 3NVCA 4YGCA 4QKBA 4GKYA 4Q4X3 3WW1A 4JX0A 3BGAA 3FLRA 3UT0A 4AVTA 2ERFA 4C91A 2D3SA 1WA6X 1N1SA 4R9DA 1NOVA 3N7KA 3ZYRA 2K9ZA 1C5IA 3UJOA 2FZ2A 4EV0A 4E4ZA 3RI8A 1FPN2 3I2KA 1SLBA 5G05L 5FK7A 4QDQA 1CZTA 3OUHA 2WQ8A 1NCQA 1TZOA 1LJ7A 4XXPA 5LK5A 2NN8A 3ZFFB 4HFSA 5JIAA 2IFRA 4AVSA 4PT6A 5K4LA 1Z7S1 1KDKA 4ITCA 3NAPB 2EXHA 3OGGA 4XMAA 2XVGA 2VCBA 3TB0A 2A6WA 3CU7A 2YV8A 4FP2A 5EXOA 3AVSA 5C3RA 5JOYA 2V72A 3KS7A 1CIWA 1GNZA 3O12A 4J1WA 3ON7A 2VZVA 4KU8A 4P9JA 4QPIA 1AR62 2XWJB 5CKMA 1DBNA 4J25A 1WUVA 1YYNA 1JZ3A 4JGYC 5T54A 2DU1A 4UFKA 5FO9B 3NV1A 3POSA 2WKKA 1GR3A 4CXXA 2UYAA 2ZZJA 4KNCA 1EP0A 5L73A 2A3YA 4LBJA 5ACA2 1RUJ3 1O3QA 2ARCA 1NCRB 3T0DA 3CDZB 4IL7A 2VMDA 5KC6A 1NCQB 2X8KA 5A3OA 1PM4A 3K51A 3AZYA 1VBB1 4XFFA 5KHKA 3I59B 3KHCA 2UU8A 3M1HA 4XC9A 1OLME 4NPRA 4JGZC 3LD8A 2EAKA 2YPDA 2A5ZA 4HK9A 4O9EA 5FBZA 3WUCA 2B45X 4O61A 3BTYA 1O8SA 1S2EA 2VUAA 4AI9A 2I74A 1GWKA 2G1MA 2OKXA 4UXAA 5FZLA 4XF9A 4Y5TA 1QH6A 2VZ1A 1G8WA 5HPOA 1IHMA 2PHTA 3NW4A 3THTA 2V4AA 2E9QA 2ZGRA 4QPIB 3ZKUA 4WM7A 2ID4A 1UOJA 3SISA 2ZABA 4K20A 5F3IA 1X9TA 3URFA 2D98A 4YW6A 2Y38A 3I3MA 4WZFA 1N3QA 5C5UA 4OHXA 4XILA 5LB6A 5T52A 2E31A 4CDWC 4CP2A 2A75A 4OUMA 2Y64A 3GDBA 2W52A 2XGXA 4YW5A 5FZCA 4RHV1 1BZWA 3H50A 4QQ2A 4PI2A 2E53A 5F39A 5B4XA 3SH3A 4CEYA 4DUVA 5H9SA 5IAVA 4MUVA 1IGOA 2JWPA 4O65A 3SKVA 1R1A2 1YQ8A 2Q1FA 3F95A 3MICA 2RS11 4AI0A 3BYWA 1QJU1 2C24A 5EJ3A 3I54A 2XJVA 1F4AA 4I30A 3WG1A 5LRSA 3HBZA 4Y22A 2ZX3A 4PBPA 1QJX2 5E6HA 2W1SA 1PO12 1V9U1 5CZKA 2VOKA 4CDXB 3AYCA 3M70A 4FTSA 1PO23 4NPLA 2WSUA 1R082 1H1MA 1RJ8A 1VBD1 5FYSA 1W8ZA 3PURA 3O7OA 2ZHMA 1UY2A 2FBEA 4LBQB 1HQWA 2VW1A 2Y0IA 3O1OA 2EIGA 1UU4A 3PUSA 4MO3M 5FYTA 1UPIA 3LPGA 4WM7B 2OW4A 2RMU1 3ALQA 3OEAA 4H2AA 4ZXEA 5CB7A 3VKOA 3OUIA 2O8OA 1LAJA 1YI7A 1X82A 1HN0A 5J98B 4AQSA 4BHPA 4CEWB 4DXZA 1Q43A 5L9BA 3AP7A 3AM2A 4ES9A 4O7XA 4AFMA 1CESA 1ZYBA 2EICA 4OMDA 1LENA 1JODA 1V70A 1MVQA 4Q4X2 1MEC3 3FLPA 5DDJ3 3GXUA 1T6BX 1X36A 2KM2A 1YQ6A 1VIWB 4LOTA 4XFCA 4YVWA 4Y22B 1G9AA 1AR71 2LALA 5L7OA 5KC5A 3ACGA 2WNUC 1HJGA 3MGUA 1UKRA 5FZ6A 5HXVA 1J3QA 2NP0A 4OHZA 4Y20B 3B00A 4Q0QA 4DS0A 3MIHA 2H6BA 4WV8A 5A3WA 1PMJX 4QPGC 2H0BA 4GKXA 5JXGA 2R0HA 5FZOA 1D2SA 4K21A 3FJSA 4JRLA 4JKKA 4QKFA 4BB3A 4DFSA 5IK5A 5JLVA 2AUYA 3IDEA 4BQ5A 4LORA 3IDCB 1Y43B 4G9SB 4INDA 4XHXA 1L3JA 5FREA 3W21A 3WNNA 3MW4A 3U14A 2XJPA 3RG0A 1F5JA 4XFIA 1LOBA 2ZEYA 5F7UA 5CFDA 4JAAA 1OFSA 1OURA 3J7LA 1V6LA 2W47A 1YO8A 1HQLA 2WO2A 1UYZA 1Y9QA 4GA9A 5L7OB 5DZGA 1RUJ2 5A70A 3GHMA 1MS9A 3LA3A 3FLTA 2WNEA 4DRVA 1SCRA 5D8AB 2XQXA 3OG2A 4UW6A 3V0BA 5FV3A 1W6MA 2B8MA 3AZWA 4W8JA 4XFBA 2WZPP 4IEOA 4COYA 2J1AA 2DCYA 4BMBA 2JB8A 4YSFA 1HV1A 1W90A 1A6CA 1U0AA 3M2MA 4PLOA 1W39A 1AJOA 3E6CC 1B35A 3D3AA 5LCWL 4LHNA 1RUH3 1UMIA 4CXWA 3POWA 3HEIA 2VUJA 3VBHB 4L0PA 4FP3A 3R4UA 2FHRA 1LB2A 4E4DX 1GWMA 3NJXA 5TSWA 1NQJA 2AGSA 3THPA 4AAPA 4ZS2A 3WG4A 3VHNA 3MPPG 4DY5A 5JPNB 2HEVF 2ET7A 2P17A 4V1PA 4WZCA 5FUIA 1QOOA 4A6OA 3MFCA 3WP3A 3N9LA 4X6RB 4PDWA 5FP9A 1KFUL 2VO5A 3VBUC 5IVBA 1W6MB 2BNOA 3UL2A 1LGBA 2D3PA 1RVF3 1ENRA 2Z79A 1REFA 5D2AA 4GMP3 1COV1 1FNZA 4FBFA 1PO22 1JUIA 1A8MA 4I3PA 1VBA3 4M01A 1JYIA 2JKXA 2GU9A 4DO0A 3T1MA 2HWE1 4COWA 1SZBA 3VZLA 5FMDA 4KBBA 1B35B 4BH9A 4COVA 2G4IA 1PGSA 5FZ8A 1RINA 1GQHA 1O5LA 1A3KA 1HV0A 3I2FA 3W20A 1EAH3 4AVCA 4EN8B 1K5JA 4F3JA 3GALA 3ZXDA 4H55A 1AL21 1YQ2A 3B9CA 3VBSC 3SMHA 1OI6A 1QJU3 1V6KA 1TE1B 2WS93 1KITA 3HN3A 2ZGNA 1JYCA 1OF4A 5KBFA 3B01A 2P1BA 1XQNA 1RUF1 3QCWA 3AC0A 4PIXA 1V9U3 2Y34A 3B02A 3OGRA 4X8PA 4FOQA 2W3JA 1MEC2 2P2KA 2GC3A 3H1WA 5DDJ2 1FMD3 1VBD3 5FJKA 3NJYA 1X33A 5JIUA 4Y33A 1JOJA 1PGW2 3VZKA 1UYYA 5FCCA 2RMU3 3P6BA 4KWLA 2D7FA 4YG6A 1PIV1 3WW2A 3TEZA 4EWDA 4BM8A 3BU7A 3RWNA 3EO6A 1V0AA 4AEDC 1VBE1 5EFUA 2BBAA 4XF4A 3KD4A 2GZWA 1PM7A 5FZ3A 3SCGA 1VMHA 3WP4A 2XLAA 5CBLA 2BOIA 5GKAC 1ND2C 4LUMA 4YARA 1BBT1 3FHQA 4S2FA 2YROA 2ZGQA 3FN9A 1D7PM 2ES3A 4D0QA 1LODA 2WN3A 3O1VA 3A0NA 1YFXA 2ORXA 1PHMA 2ZEXA 4GQ7A 2YU1A 1OVSA 2VXJA 3DCQA 4HN1A 4JGZA 3G6JB 4PLMA 3K3NA 4YGBA 5FMCA 5DG1A 3ZXLA 3SKJE 2NZ9A 4LPLA 4COZA 2DUQA 3LKJA 2QQOA 5HV4A 2YC4A 3INAA 4BJ0A 4Y4RA 2ZGLA 3ACHA 2RV9A 3KCXA 3JB4C 3BTAA 3GZAA 1AZDA 2DU0A 4N7UA 4XQ4A 4Z82A 1QXJA 4YW2A 2ZPXA 1M06G 4YW7A 2P3KA 5FXXA 4NHMA 1I5PA 4QXKA 5K8SA 2TEPA 2Y60A 4Q8KA 4JGYB 3RS6A 4CDWA 1YFYA 4ZZ5A 1ULDA 2RS51 2LUWA 2R071 4Q26A 2D44A 1JHJA 1LOCA 1W9SA 2CHHA 3ME2A 1W6QA 3A0KA 5CG9A 2Q1ZB 2JXAA 3ILRA 3I3QA 2IXLA 1E5SA 2OQ6A 1SLTA 1MZ5A 2OUJA 2P6CA 1H6YA 2ZGUA 4JZRA 4NRQA 1T2XA 3AKRA 5FYBA 2Q8EA 1R64A 1RUH2 4JGZB 2FMDA 4LXLA 1JZ8A 1BMV1 1KD7A 4AR2A 4E8CA 3AZXA 1UIJA 1CZSA 4IGPA 4L92A 3LFIA 4HL0A 4OUSA 5AC93 2B39A 1ZBA1 2V73A 5FP3A 2FDFA 1PNGA 1E5IA 2A70A 1Y4WA 3DUIA 2D6PA 5FIXA 5JZGC 5LBCA 4P9LA 2E7QA 5FZEA 1C1LA 3OGSA 2VBBA 4FFHA 3O1UA 2GNDA 3POJA 4S2DA 4CDWB 4IEZA 1RVF2 1RJ7A 1F9KA 1GV9A 1XPWA 2Q8DA 4ASKA 3NKGA 1K42A 4YWAA 1AYN1 1OA2A 3RWKX 3WF2A 1W6QB 1VBA2 4KL1A 3GCXA 1ZNPA 5FPBA 2BP6A 3IT8A 2WZR1 5BV6A 1DZRA 1E5RA 4N43C 2VMEA 3M3QA 1PMHX 2WRAA 5EWSA 5SV5A 1EAH2 5FZ1A 1LHOA 2OPKA 3GZEA 5C4WC 3MO4A 2WNUA 3DV8A 4S2GA 2VBDA 2JDPA 3J4UH 4Q0UA 1QJU2 1SDWA 3NNJA 2WS92 3W59A 4I0AA 1F31A 2FQPA 1QNWA 4HVRA 3ZXKA 4QHZA 5LEJA 5JOZA 1ZRRA 5LWBA 1V9U2 3AFGA 1H0BA 1UOGA 4QPGA 2D6MA 2ZA9A 2D93A 1Q3EA 2Y8KA 1KJLA 1ZZCA 1FMD2 1VBD2 2WO7A 2YUEA 1VB2A 2ZAHA 2WAAA 4I09A 4R4XA 5FDBA 3KV4A 4LR4A 3PLQA 1HJFA 5FY1A 3M3IA 5FZGA 5FZ7A 1K12A 5C9AC 4QKDA 5FYZA 1YHFA 1NT0A 2RMU2 4LA2A 4Q4W3 5IYYA 2YBKA 1YWKA 3CJIC 4H3WA 4RR3C 5FYIA 3VDDC 2TUNA 2VC9A 1WCQA 2YB7A 3WHUA 5ANNA 1RGSA 4OI2A 4AI2A 1AL23 3VZJA 2VM9A 5HCBA 3WINE 4IUGA 2RJ2A 2VVDA 3WHTA 1J59A 2LW8A 4AHYA 2WLQA 4QGLA 3VHPA 2PHUA 1OD5A 1ZX5A 2WNUB 4M4RA 1G9BA 2J1UA 1UWWA 4ISQA 2BUKA 5E89A 4IV1C 1REEA 2HKXA 3ZFGC 4HKLA 5FP8A 3KT1A 4LHKA 2YGMA 4AGVA 1IKPA 1XXNA 4BZ4A 1ULOA 2V5DA 5DUUA 4QPGB 1ODMA 3ZYBA 3DXTA 3IAQA 4LIVA 1N47A 5F5AA 5I8SA 3PVBB 1Y7BA 1D0HA 2EXKA 2GMEA 3IDAA 5EZWA 4YPJA 4DRRA 1RXGA 5LATA 1XU1A 5FPVA 4BXFA 4YM2A 1CX4A 1W6PA 1NUKA 3Q9OA 1LOEA 5FY7A 1OH4A 1UZYA 3IIAA 2X05A 2CGPA 2YPJA 1C8M1 1AR93 3AZVA 1OT5A 5IHRA 2O14A 3LEMA 1BBT3 1UL9A 3I3EA 4D8MA 4Z1VA 5A3MA 3POYA 3UKTA 2MEV3 1QXRA 1W2NA 4FQ4A 4RSUA 5FZ0A 3WT3A 1GZTA 2ZJCA 1TG7A 2K2SA 1W6NA 2VMFA 5LA2A 1CGPA 4NOTA 3B5LB 1O6UA 3VDBA 2NMNA 2E6VA 5C8CA 2XL9A 4XBNA 2ETEA 5C3PA 3MZHA 1FOD1 5DUVA 2Q1MA 1ULGA 4CYDA 5I0DA 1YQCA 2ZBJA 3ILNA 3WP5A 4UBGA 2JD9A 4C0BA 2JJ6A 1JTZX 3EHKA 2OZ6A 3RNSA 3RRDA 2Y33A 3ZR6A 1ASJ3 4OMCA 2IVJA 2WA3A 2NLRA 5AC92 4CPBA 3N7LA 1W6PB 1XC6A 4C8DA 3D5OA 3AKTA 2JDUA 4CCEA 2RS53 4JQRA 2ZGKA 3WW3A 1ONAA 2J42A 1O4TA 2WWUA 4A7ZA 5A1LA 2WNOA 5LA0A 3HBKA 4PQQA 2WNVA 3AFKA 3ZXAC 1W6NB 1DU3D 1UY0A 4D69A 1W8WA 1SQ4A 2E26A 2OXBA 5CKNA 4HXCA 1DYPA 3WQ0A 5C8CB 1Q8SA 3GGLA 4XMIA 4N8MA 3WY6A 4Z92B 2Y26A 5F1RA 3ACFA 1AYM1 3VGIA 4FPCA 3VBUB 4CUAA 4KGQA 5JDBA 2D5FA 3S30A 5BNNC 1YLLA 1ZBA3 1GOHA 1AVBA 5IVCA 2AC1A 3F2ZA 1EV13 4GB33 2XDVA 3TNQA 4BQWA 5FYYA 2GP5A 1SHWB 2QVSB 2Y6HA 1KS5A 2HWF1 3VLBB 1W8OA 4AEDA 4XF1A 2VNGA 1MZFA 5EPAA 2DCZA 2QE3A 4YM1A 4TWTA 5I0UA 5C70A 2RR11 4YLZA 3B3QE 1DQ1A 1FX5A 1UY4A 2WQZC 4RA0A 4HVOA 4R52A 2EIBA 4A42A 1SFYA 1ZZBA 1M4WA 2WNVB 2WZR3 2JG9C 4LKEA 4NE9A 5E8AA 5FRAA 3HNBM 5DZEA 4Q4W2 2GDFA 5A6ZA 4L8QA 1QH7A 4K8FA 3VBFA 1FI2A 2Y6GA 2IXJA 4LBQD 4EQVA 3H1MA 4B7KA 1AL22 4FOVA 4DEQA 1H2NA 1DQ2A 2D5HA 2AR6A 3PTRB 4IXLA 3ZO0B 1CAXA 1LULA 4E2GA 3RJ2X 3UKVA 3TEYA 2R063 1EPZA 2D3RA 3ILFA 3RZZA 1GUIA 5CAZA 1VBC1 4ZXKA 1AR81 4BQ3A 3EB7A 1RUD1 3POFA 1GWLA 3BOPA 5GLVA 5T55A 5CIRA 4AEDB 3MI8A 4UW5A 3H3LA 3E5UA 1U5YA 4CUCA 4XDQA 3K48A 3P1IA 5BUVA 3QBQA 4FTBA 2WINB 4CDQC 2ZOEB 4OQ9A 5K0UA 1ND2B 3MYXA 4YZ5A 3AYDA 4A2UA 3ZM8A 1W8TA 4IERA 4QXCA 2PA7A 4KWKA 5A32A 1NA1A 5FP7A 2VZSA 3A21A 3I2IA 1VAMA 2UURA 3S5QA 2VPVA 3NKTA 2ZCWA 2IUWA 1A8DA 1AR92 3WNKA 5FPXA 4G4FA 1BBT2 1WW6A 1HB2A 1K3IA 3DF0A 3ZYHA 2CY6A 2MEV2 4P02B 4ARXA 1KQRA 2W94A 1CAXB 2VQ0A 1GP5A 1X50A 2R16A 4Q8LA 3LQCA 3HT2A 3WW4A 4FFGA 2WN2A 1POV1 2E51A 3KQRA 4A4AA 3NNMA 3WLUA 3RYPA 3VV1A 1EY2A 3ASIA 4BQYA 5J09A 4FPEA 2VU9A 1W3VA 4XFHA 3FBYA 1QKQA 1AX0A 2PLV3 2W92A 3M3OA 3NMBA 3PUQA 2XONA 1OMIA 1ASJ2 3K77A 2QCSB 1NAEA 3D82A 1UF2C 5D21A 4NHYA 3WF0A 1ZA7A 1GOFA 1N1VA 2QNKA 1CAVA 4NHKA 1WLDA 5A32B 5EV7A 2BNMA 1DZQA 2RS52 2HWC1 5IT6A 4N53C 5CVRA 1UW8A 2CGOA 4CU7A 2FDGA 3CBNA 5C4WA 2VQUA 2GSYA 5JOWA 3ZYIB 4A7KA 4EN0A 4P9IA 1E57A 5BNOC 2JDAA 2AACA 5CNAA 1OLQA 4CCMA 1FOD3 4OZOA 1N1YA 3N9QA 5BY5A 1NCRA 4ET7A 3AKPA 1OUXA 4IE0A 5GZCA 3PMSA 2X29A 2ZGSA 1XE7A 1YJLA 4YVSC 3J9SA 3I59A 1AL0G 1PZ9A 5F3EA 1S2BA 5J48A 4NVPA 2R6QA 3HIFA 4LHSA 4EYUA 5GLTA 1ZBA2 3UV9A 5LA9A 4FPHA 4Z8BA 2VUDA 2BGPA 3N7JA 1FXZA 3KB5A 4NN0A 3MIEA 4TN7A 3U4SA 1U12A 1EV12 3TYJA 4GB32 1O3TA 4FSJA 2ZZQA 4OHYA 1WZXA 5GLUA 1QF3A 1D4M1 4LQRA 4GXLA 1R1ZA 4QXHA 3J7NA 3S7EA 1QU0A 3GBWA 4BPZA 1CAVB 4W6YA 1YIFA 3T2TA 5A1AA 3VD9A 2W2IA 3DPRC 2PAMA 4LIUA 2V4VA 4HKOA 2J1RA 5ERLA 5FZIA 3WZ1A 1FNYA 3LAGA 3JBG1 5A7PA 2NMOA 3OYWA 5C4WB 5KHJA 3OB8A 1WD4A 2PMWB 4CU6A 1LHNA 2WZR2 1PK6A 2LROA 4LKSA 4IV1A 1ULFA 3WDTA 4OI1A 4O9GA 3ZFGA 3PVNA 3USUB 4IEXA 4BIFA 4AK3A 1JW6A 2VW0A 4EWAA 5IW0A 3RZLA 1PVC1 2A71A 5DXDA 2AREA 3I2GA 4Q0VA 2VMHA 3S6PA 5I0RA 2FD8A 2JE8A 4Y1UA 1JS9A 3U37A 1YCIA 2HWF3 1V6NA 3U78A 4CDXA 2OIIA 4IGQA 2GNMA 2JDMA 3A23A 1IS5A 2R062 5C9AB 4DUXA 2WDBA 2ORZA 2RR13 3OY8A 2QQMA 4LBQA 4W6WA 2OUHA 3BALA 3VDDB 2K46A 4A3ZA 3MF6A 4Y3OA 1POV0 4UT5A 3MW3A 2ZGOA 1HXS3 1MS0A 4QHOA 2P3IA 3VN4A 3S0MA 1HRI3 1SLCA 1VLNA 1GLHA 2QZ2A 1X8EA 4H14A 4IEYA 4CEWA 1PGL1 3IBMA 2J1VA 3OYWB 2EIDA 3ATGA 5GZDA 4U2AA 1H1IA 2W39A 3PVEA 1ST8A 3IM0A 1PK6B 1WMXA 4U36A 4IV1B 1R091 3ZFGB 2OA2A 2ZGPA 2UWAA 2ZTNA 4IGOA 3RYKA 4NWVA 3VL9A 3OGJA 1IPJA 4MLOA 2WYSA 1TME1 3VL8A 3VHOA 3T30A 3O1TA 2YFUA 2J7MA 4E2QA 5FPZA 2WABA 1QNYA 2DCKA 4YM0A 3Q8BA 4YZ2A 4JDMA 3LFMA 1DFQA 2AENA 4ATEA 4Y20A 2Q30A 4P9XA 2Z2SB 3OY8B 4HKWA 2VUCA 3W5NA 1S55A 5A7NA 1GBGA 4N90A 1GNHA 3OBAA 2JD4A 1BYHA 2PLV2 3ECQA 1SPPA 2XB6C 4Q4V1 3NNGA 3HOBA 3ZIXA 1LEDA 4QB2A 4L9BA 1GFF2 4WVZA 5FKBA 4KQ7A 5A7SA 4ONUA 2VTXJ 3SQOA 4IE7A 3TN91 1JOPA 2PHWA 4AHZA 4ZU7A 2R30A 4Y5Z0 1Y9GA 5IVYA 5SV8A 2NYYA 3J26N 2Q8CA 2PTMA 2ZX0A 4FFFA 3WNOA 3RZKA 1WLTA 1C28A 2GC0A 3FE5A 5ANQA 3ZKYA 5I8YA 4IW3A 3HVDA 4I02A 3M7AA 4A44A 3QH7A 1IS3A 2HWB3 3E5QA 4TXWA 2K0GA 5FLHA 4OI0A 1UN1A 1XSQA 3WUDA 4PBOA 1YFWA 2QUOA 5IVVA 2WAOA 1FOD2 3WQBA 4NROA 4Y1VA 3THCA 2P34A 2BJSA 3FBMA 3W58A 5D8AA 3OTFA 1O4YA 4QGNA 1BQPA 1N3OA 4LHLA 4Y1ZA 2I07B 5FWJA 5LEKA 4MYEA 2LM3A 1UZ0A 4MG2A 3BCWA 2VCCA 2AH2A 3UGFA 4CP1A 5CFCC 1SPPB 2CSGA 2JG9A 3ABZA 1J3PA 2Q0AA 3D6EA 3J7HA 2HWC3 1VAKA 3WF4A 1CZVA 1XE8A 1CAWA 4JTOA 4HMZA 3M3CA 3I3DA 4RFT0 3Q8AA 4QQLA 1S4CA 1UCXA 1UY3A 1OC1A 3OPWA 4GWMA 5FMBA 3ZN6A 2DCTA 3VBHA 3WG2A 1N3PA 4QKNA 5BNNB 4XW3A 1IS6A 2VG9A 3I2DA 1HB4A 2C26A 4DZGA 1XBFA 2ZACA 4NPMA 1DF0A 5CEHA 4XUOA 2KR2A 1LOFA 2JECA 2W46A 3EMRA 1CN1A 3OOXA 2QQWA 2VD7A 4QX7A 4XJAA 4OULA 4BE3A 3V0AB 4HOOA 4ORFA 4FT8A 1Z7S3 4AI8A 1RXFA 2BU9A 4V2WA 2XKOA 3DGTA 1QJY1 4P9YA 2ZEWA 4DB5A 2KXLA 3C2UA 3PU3A 1L7RA 2W68A 4P9WA 2V09A 3QLQA 2HEYF 1OBNA 4TLGA 4XFGA 3GHNA 1YRZA 5C7GA 1D4M3 2RS31 5IJRA 2HWF2 2CDOA 4R9CA 1H30A 2C9KA 2JG9B 4ZONA 4XF0A 5EQUA 3ITQA 5JOXA 2RR12 4GD4A 4MGKE 4DPNA 1A34A 1CAWB 1DLCA 4MXVA 3PTYA 1NY72 3JBG3 3ST7A 2P3YA 2W0XA 3MUZ1 3ZN6B 4AQ6A 1ALYA 3BKZA 1HXS2 2WSVA 2XBO1 3RZHA 1WMFA 1BVVA 1CJDA 2RDSA 1HRI2 3ETQA 3PL0A 4QPYA 4EE2A 3I7DA 3K4DA 2FZ1A 2PQSA 2A6YA 4Y5SA 4EN9B 4K6BA 1PVC3 1VBB3 1UX6A 2DWRA 1WW5A 1F5FA 1XOYA 2DURA 3L9JT 3QACA 4LTAA 3VD4A 1B09A 5J37A 5KXCA 3O0VA 1YIPA 2VL4A 1CX1A 3NWKA 5F6KA 4KG8A 4A41A 1OQEA 1Q8OA 1C57A 1FT9A 5T50A 1H8VA 1VBC2 4CDQB 4CU8A 2IXIA 2QQLA 5HI0A 1STMA 2VULA 2ZMNA 3JQXA 5KXEA 3AKQA 3LE0A 3MIGA 4HZFA 3KV9A 3VD7A 3WCSA 2WA4A 4LO8A 2F4PA 4LK7A 4NJ4A 5IFPA 2IXCA 2J22A 5CADA 2OX0A 4M00A 1XNBA 4N53A 1MS8A 5J3UA 4RHV3 1Y3TA 3B9IA 3NJZA 4RN5A 1MS5A 1C1FA 1S0BA 3E6BA 4LBLA 5BNOA 1DLLA 4FCAA 4X8NA 4QX5A 4HANA 5JPMB 4RS5C 4K7JA 1RIRA 1JHNA 2RS13 1OD3A 4UF0A 1O3RA 3GJBA 3LIHA 3LWCA 4BIOA 2NPIA 2BW8A 1TME3 2UWCA 3DYOA 4FPJA 1DYOA 1PMIA 1H8TC 2PN5A 3CQOA 3LEGA 2XVKA 3GCWA 3U1XA 3B69A 5JR2A 3RSJA 2VECA 3KLSA 4EJRA 5FMOS 3BIWE 1QJZA 4AFAA 1ZZ8A 3H3ZA 2HWB2 2MHFA 1SFPA 2BNNA 2R7EB 4ASLA 3SXWA 3PUHA 1V6OA 1W2UA 4XJZA 1D2QA 3NV3A 4SBVA 1NE4A 4H7LA 3MUY1 5FQ0B 4B1MA 5JVVA 4CSWA 1QOTA 3CJXA 2XJQA 3DPRA 5EYXA 2XUEA 4N53B 1H4GA 1GYKA 3NSTA 3MLJA 4JGYA 5GALA 4LKFA 1DQ5A 3HR9A 4PIZA 3RJRA 3H8OA 2Z42A 5GJ6A 5BNOB 3S7IA 4XAEA 3FUQA 5I0SA 2HWC2 5GLZA 3IZOA 4UF0B 1OOPC 1C5HA 3O0WA 2SLIA 3THDA 1ZM1A 1C4RA 1CQ9A 1HIXA 4YVSB 2Z4FA 1JU4A 3ZDSA 3MBWA 4BWOA 1UZZA 3U75A 1AR73 5LBBA 1OQ1A 3N9PA 4AQ2A 3ZXEA 1OSGA 2QDNA 4CXYA 3POGA 1JYXA 2X5IC 3UNPA 5BNPC 3KT7A 2ZMLA 2VR4A 4AVBA 1W05A 1JYWA 4NIHA 4B4RA 5J36A 3LIGA 2QBXA 3ZPOA 4UW3A 3POIA 1H9PA 4CRQA 1J84A 1DYKA 1VRH1 2TNFA 5F9TA 1C8NA 4WVVA 4LULA 1Z7S2 2VMIA 1XNCA 1LHVA 4RD7A 4YZ4A 5E1RA 3IPVB 1VR3A 1DGLA 2VZOA 4B4QA 4E27A 4AG4A 3DPRB 2FDKA 2BWAA 2XOMA 1UKGA 3C7EA 2ILMA 3ACLA 1GZWA 2WFF1 2ZHNA 1D4M2 4FOYA 2Y6KA 3T2OA 4CE8A 2D6KA 2CNAA 3QH6A 4B1LA 4RGAA 3AK0A 1H1AA 1H2LA 1ZBE1 1Y9MA 2EA7A 5IUQA 4QHBA 4HSLA 4YGDA 4A6SA 3BUCA 4A45A 2V5YA 3VKMA 4YNIA 4I2OA 3JBG2 1QJEA 3PHMA 4L2NA 1RUNA 1K5MC 4RQPC 3TEXA 4EZ4A 4DEVA 2JG8C 2W1WA 4GWIA 1BHGA 4PIYA 4LEJA 4FXKB 5AVPA 2VAUA 4MXWA 5LASA 4S2HA 1QJY3 1PVC2 1VBB2 3ZFEC 1LNSA 3FUOA 1LR5A 2QQVA 1XJAA 3FFZA 4MGSA 3RYRA 3HQXA 4AGGA 5M0TA 3JB8A 3ZMNA 3R4DB 2VJXA 2ZX1A 2WL1A 3KQ4B 1OPMA 2IVIB 5ABJC 1UXXX 3GJAA 4N9IA 4QD2A 1FYUA 3H9AA 4NRMA 5FZ4A 2PELA 1QEXA 2DYCA 3RMXA 1FPN1 1XSRA 1GZWB 2RJLA 3CKHA 4D7SA 3DEMA 2DV9A 3CIHA 4DQAA 1W04A 1UIKA 4YM3A 3AZZA 3C3VA 4LBOA 1IOAA 1F2NA 4YGEA 4IE6A 2BFUS 2I45A 3LSDA 4ZS3A 1H6XA 3ZOIA 4AEMA 4LT5A 1SBEA 1QXPA 4B3NA 2HH9A 4XBQA 3QD6A 4RHV2 4XBLA 5JR7B 3N35A 4EN6B 4GZ9A 4IESA 3U4XA 4UFHA 1XNKA 3KF3A 3UESA 3ZFFC 5C6CA 1LGCA 4MXWB 1NE6A 2RS12 2JDKA 1SDDB 3K4AA 1NZCA 1QQP1 1RUI1 3TNPB 4K8RB 4CUGA 3T09A 1US2A 3WDWA 1TME2 1JMUB 4BDVB 4MH0E 3ZN4A 1BXHA 2A3WA 4FPLA 5FO7B 1JOBA 2W95A 1COV3 5DAVA 5AVAA 3VZOA 1UD1A 3PUAA 4W4ZA 3WG3A 4BK4A 4BYYA 4IV3C 4YG3A 1US3A 1OVPA 2FMYA 3H3UA 5ACA1 3AYEA 4HT1T 4KWJA 2HWE3 5DQ0A 2A7AA 4AYUA 3LB9A 3OJBA 2VZRA 2GNBA 3M8LA 4XUQA 5FLJA 5FMOL 2UY8A 1DGRN 2VMGA 2QJVA 4UWDA 4RFRB 1DGWA 2C1FA 4XJUA 3KM5A 4META 3T2PA 2E63A 1SMVA 4Q4Y1 4MGZE 4KH9A 4XUNA 3ZSMA 2DDUA 2O8QA 1OQDA 4QU2A 1BKZA 3BPZA 2Z5WA 1BK1A 2CWMA 2D43A 2VOVA 1RUF3 3MEPA 3ZPYA 5F3CA 3LA7A 1UMHA 2R32A 1HDKA 2JDZA 2PAKA 3ZYPA 4CP9A 3NO8A 4MV2A 3DKWA 1AR72 1TNRA 2YU2A 4TZDA 4NHLA 3UGGA 3IB3A 2R49A 3ZIWA 1YXWA 3FHIB 1MS1A 4PCRA 2C9AA 4BMEA 1PIV3 1OXCA 4XHBA 1YUDA 5GZEA 3FWEA 5JI9A 1I5ZA 2GH2A 1VBE3 1W8HA 4UBHA 3JUUA 4JDNA 4JHTA 4LBKA 3VHRA 4OLLA 1MS4A 1RUE1 5BXXA 5FKCA 2QQJA 1X8MA 4HVQA 4YFZA 2HEWF 1QJX1 4XPVA 3TOJA 1PO11 3ZYFA 2KD7A 1UNBA 1R081 2YDEA 3AXEA 2EF6A 5FZDA 5T5JA 3O1SA 2C0ZA 4R8HA 3ELNA 3D0JA 1SG3A 1AHSA 1KXGA 4OHWA 3WVJA 4CP9B 3D8CA 3ZSEA 1UAIA 3KSCA 4JCKA 1NYWA 3VBUA 3HJRA 5C8WA 5FAXA 5FUPA 4URAA 2YC0A 2B9VA 4BQXA 2FCTA 4D6RA 1LHWA 1WA4A 1QJY2 4J6GA 1OHFA 3SH4A 4YFWA 3N9OA 4RYDA 1SFNA 4HLTA 3BTZA 1ENSA 3ZLIA 3KMHA 5J1XA 5E88A 4Q4X1 2EAAA 3VD5A 3OF1A 2XJUA 3JXSA 2RS32 4PJYA 4QDRA 1MZ6A 1S1AA 5IWFA 3TAYA 1U5XA 2R073 2P4EA 4CEYC 1GZCA 1UOFA 4AVVA 5A3PA 2A6ZA 2CU5A 1IG3A 2ATFA 1G9DA 3CEWA 3VBSA 1YI9A 3RMYA 5FP4A 2P3JA 2FCVA 1F4HA 3NV2A 3P3NA 3AP9A 1X9PA 2IWGB 3HMYA 3LPFA 3ORJA 2RDRA 3WV6A 2R1DA 2OZJA 1BEV1 2XBO2 1Q5OA 1WCKA 2VNOA 3MDPA 1OKQA 1ZRIA 4LNVA 4AEKA 2WT0A 2HBUA 1RMU1 1AF9A 3FC0A 5FXZA 2PHDA 4XUTA 4QAWA 5FZAA 4DINB 1X7NA 1JZ6A 1PX4A 3FL7A 4EN7B 3T08A 5FOJB 3S5AA 3H1YA 2HYKA 4M3CF 4C1WA 4IDZA 2E7AA 4OFGA 4ASMB 5AFEA 5T5PA 2QFEA 4RL7A 3JQWA 2F17A 4QT6A 4IEQA 3RPQA 3MLKA 3CO2A 4AQTA 2J1TA 2XR4A 1BVP1 1POQA 2DUOA 2VGDA 2ZX4A 3H42B 3KGLA 4SLIA 1COV2 4Q2FA 4W50A 4MGIE 1WMEA 5LBFA 1AYN3 1ND2A 3GZTB
chains in the Genus database with same CATH topology
1UPSA 4RS5B 1NLRA 2HWE2 2BPA2 3APBA 3VBSB 3RDIA 2R041 4L97A 4F7ZA 2VOXA 4I0BA 4YVWC 1H8TB 1SLLA 1PNFA 5L7OC 2B42B 4LO5B 2X5IA 5BNPA 1RUI3 1QQP3 2D6NA 2ZMKA 3B93A 1ZZ9A 2XHKA 2DTYA 1CVNA 1XYPA 5DG2A 3ZSJA 4QQHA 2IC1A 1RUF2 4K3UA 3SH5A 4IEVA 2RHPA 5T5LA 2BVBA 1WLWA 2VW2A 4AE2A 1URXA 2D97A 4YZ3A 1QOSA 4XJ9A 2BTVC 3LSEA 1WLCA 1PIV2 1V00A 5JCTA 2WQ4A 1VBE2 1SBDA 4Q4Y3 1OOPB 3OBRA 5CFDC 1G7YA 4R9AA 1ND3C 1VB4A 4RQPA 1FV3A 5DZFA 4M3CB 5KHHA 4D7TA 2X5IB 3H8UA 5JMCA 5BNPB 3U07A 1PO21 1OA4A 1AX2A 3ZFEA 5HBAA 2CYFA 4Y4YA 4XJWA 1HW5A 4AI3A 4QQOA 1RB8G 2QKDA 1VALA 3I8TA 2I2SA 1PZ7A 4W65A 5JZGA 3ZYGA 5ABJA 3N36A 1ZRCA 3X29B 2WJSA 4MSVA 2JX9A 4K1YA 5F5QA 3VKFC 1RUE3 1C8M3 3ZXFA 2Z69A 3SITA 3VKLA 5C33A 3JZVA 1UU6A 4N43A 2BBVA 5BNQA 3KGZA 2CWSA 1K5MB 2R072 4RQPB 2JG8B 1QHDA 1HRV1 1PGW1 1S0GA 1QWRA 3HWJA 2Q5TA 4FO9A 4YW4A 3ZMOA 2GNTA 3ZFEB 3EJKA 4PDWC 3VBOC 3USUA 2A6VA 4LE3A 4XJ8A 2D40A 5FTTC 1BMV2 2JEMA 3MIFA 1LOGA 1XNDA 5JZGB 5ABJB 2IFWA 1I3HA 4IV3A 1RUC1 3KCYA 3AJZA 4AFDA 5C9AA 2MNGA 2PHLA 2PFWA 1HLCA 3CJIA 4RR3A 3VDDA 3AMHA 3H7YA 4B7EA 3FFQA 4N43B 1G86A 2LTNA 3PVOA 1S0EA 3AX4A 5H9PA 3E5XA 1AYN2 2TBVA 1AUYA 1BEV3 1KS4A 2RJKA 4PQ9A 5JI7A 1QDCA 1RMU3 3QOPA 3N7MA 2R1BA 4XTPA 2UY9A 5CG8A 1AYM3 2ZGTA 3ZXJA 4AI1A 1FAYA 1QGLA 4Q0PA 4AXOA 3WR0A 4URTA 1GZ9A 1MR5A 4AEJA 4IV3B 4E2SA 1RUI2 1QQP2 4CDUC 4KG0A 1RUG1 2JENA 2NM1A 3IMNA 2XLGA 3CJIB 1RUH1 4RR3B 3ZN5A 4C1XA 3LZZA 3LA2A 3WOGA 1F8VA 3J8F1 2A6XA 4ISRA 3MF9A 1XRUA 2R043 1KDMA 2R0FA 1JUHA 4OZXA 4B8EA 2O0OA 3B7MA 4LBNA 2QQPA 1IZ3A 2B5HA 4DY3A 1SACA 4K9SA 4Q4Y2 4FPOB 2JE9A 3R05A 4CZSA 3BOWA 1BJQA 4ES8A 1RVF1 2AYHA 1GKBA 4GMP1 1AX1A 1VBC3 3WNXA 1AR83 3GF6A 4L99A 1VBA1 1RUD3 3HD8B 5FO8B 3WDXA 5GLWA 3M3EA 3USSA 1ZRDA 5J96B 2VVFA 4ZKTB 3HAGA 3B94A 3ZSLA 1EAH1 1TEIA 4A7YA 5IK4A 1VJ2A 2IZWA 4B29A 1NXMA 3OCPA 1CJPA 1TMF1 4LO7A 1RHI1 5I0TA 2DUPA 1RUE2 2WS91 2UYBA 4AHWA 1C8M2 3SCHA 5FOBB 2G9GA 3GZUC 2EXIA 4LUKA 1AJKA 3BODA 3OBTA 3U10A 1FMD1 1IPKA 1MVEA 3ZXGA 2XJRA 5IK7A 2YMZA 4KGGA 5BNNA 1O3SA 3WQ7A 4XQDA 2CGNA 4H7MA 1V6MA 1POV3 5DUXA 4WM8C 1JBCA 2GAUA 5AFBA 1IS4A 5FFOC 2GC2A 2YHJA 4CEYB 1ZRFA 2B9UA 4Y1XA 1G9FA 1I1EA 1RL3A 1V6IA 3JD71 2XH6A 4JTNA 4FVVA 1XYOA 3RI9A 3EXUA 3WXPA 1HRV3 4MGYE 1BCXA 2IXKA 3V65A 4XOGA 3RQ0A 1ENQA 4Q1PA 4ZU4A 3NL1A 5KXBA 1KRIA 1KJRA 3MLLA 3R0RA 1BEV2 3ZYJB 3V64A 1RMU2 3LOIA 4XYXA 1SCSA 1AYM2 4XEZA 1RUC3 2WT2A 1OA3A 2H0VA 2RM21 4YRDA 1LEMA 3D0SA 2ZKNA 4BLJA 1MZEA 2PYTA 4CDQA 3VBRC 4BCUA 3I4IA 4GMP0 3LCPA 4E9KA 3HN1A 1J58A 4YVWB 1ND3A 4I0WB 4FTEA 4Z2WA 1G9CA 1NLSA 2PHXA 1J3RA 4EWEA 1DGWX 3MPBA 2R042 4P14A 4D7YA 1HQNA 1YFUA 1WCDJ 3WDVA 4YG0A 5A3LA 3ZSKA 2XLFA 1SBFA 5AC91 1MQTC 3R4SA 2EVXA 3TRSB 1WBFA 3WDUA 4COUA 3IN9A 4EROA 1NXD1 2OVUA 1Q56A 4DMIA 1RUG3 2Q8OA 4QQPA 3OPZA 2HWD1 3ROUA 1AR82 2H6CA 2EALA 1RUD2 1CAUA 3AMPA 3J8F3 3SNMA 5FQ0A 4A3XA 2ZAAA 5CFDB 2P37A 4LE4A 3EQEA 4FXGB 2GN3A 3MFAA 1UU5A 1ND3B 4Q1RA 1G6NA 2DVFA 3U11A 4P9GA 4ZU5A 3M4FA 5C8CC 4IEPA 1DG6A 1ULEA 2GMPA 4R9BA 1R093 3ES1A 3V0BB 1LECA 3VBOA 4MX3A 1O91A 2BQPA 4GH4C 2XG3A 5J7MA 4YVSA 3GNEA 3MIDA 3W9AA 3JCIA 5JSOA 2CAUA 5T3NA 4F8AA 3IWZA 3IDBB 2WC2A 4HN0A 3MIBA 2PAEA 1O7FA 1CD3G 5GM0A 4Q4W1 2XJSA 4Y24A 1TQ5A 1CAUB 1W0OA 4XF3A 1AXZA 1NQDA 4YZ1A 3EBRA 1TMF3 3IPVA 1RHI3 2WNVC 1LCLA 4Q4V3 4LLFA 4AVAA 1QY4A 1OLRA 4F83A 4HETA 4JDOA 2CAVA 3TN93 3BB6A 5LK7B 1ULCA 1WGPA 4PDWB 1LGNA 2ZGMA 3VBOB 5HCAA 1S0CA 1HRV2 1S0DA 5EYYA 1ZREA 2E7TA 3PMEA 3UK9A 1CPNA 1ZZ7A 4N9HA 4CDUA 5CA6A 3SLIA 1YJKA 4AFBA 2QZ3A 2B46X 1Z0HA 3AP6A 4HK8A 1IKQA 1RUC2 2VXRA 1AR91 4I01A 3JD73 2JICA 2MEV1 1LHUA 1Q8PA 2C5DA 4Q29A 1PZ8A 2XJTA 1EYBA 3AKSA 1A78A 2X53S 4JC1A 3VBFC 3AP4A 2XPJA 1J1TA 1LU1A 1S2KA 3PJYA 1FATA 4WVWA 5L36A 4XFAA 5CU1A 3PNAA 1LRHA 3KCCA 2ZHKA 1LKNA 4AFCA 1ASJ1 2N7GA 1H2MA 3KZ4C 1MACA 1TNFA 4CDUB 2RM23 2CL2A 4PLNA 4Y1YA 3AMMA 5I8TA 1LTEA 1XYNA 5E16A 4LO6B 5BYNA 3TWIA 5K0UC 1W6OA 1Z78A 2RS33 2YYOA 2ZX2A 3N3HA 4Z07A 5K7PA 3FMGA 2GMMA 5GZFA 4TLFA 1RUG2 4AWDA 1NA1C 2DVAA 3DL3A 3H7JA 1DIWA 4K40A 5I91A 3J8F2 3H0OA 2BVVA 2XL7A 2XBO3 3WP6A 1J1LA 2YZ4A 4PF5A 1H9WA 2SBAA 3IKWA 1PGL2 5KXDA 1DZTA 2YGLA 4NR1A 3VZNA 4AF9A 1EV11 4Y26A 4GB31 5L19A 4WM8A 1R092 3O0XA 2WIIB 5IK8A 4LBMA 3V56A 4DNYA 4LO4B 3NAPC 2NQYA 1AR61 2UWBA 3JU9A 5B2GB 4IEWA 2HWD3 1RUOA 1W6OB 4YW1A 1GQGA 1WMDA 2ENRA 3SCFA 5CFCA 4GWNA 4XQWA 1WCSA 4LA3A 4WBBA 1O4ZA 1H4HA 3UJQA 3AXDA 3GBFA 1TMF2 1RHI2 1D4VB 3GBGA 4Q4V2 3A4UA 3O14A 1WW7A 4I3GA 5HCFA 1NCRC 1I9RA 3AYAA 1NCQC 1O5UA 2DF7A 3TN92 2R061 4FOWA 3D4KA 4OHVA 4WM8B 4AGRA 3T1LA 4Q27A 2QDRA 3P3PA 4M0NA 4MVTA 1EPWA 3R6SA 4QMAA 2VVEA 4UW4A 2MPFA 2PHFA 3GYDA 1HKDA 3VBRA 2WWSA 1UMZA 5CFCB 5KHIA 4GULA 2AZ5A 4QPIC 2O1QA 1RTVA 1PVXA 1R1A1 1ZA4A 4G3YC 2DVDA 4KU7A 4N7IA 2CTVA 3AMQA 4C90A 3O5SA 1I6XA 3JD72 4AW7A 2VQAA 1S0JA 1PK6C 3MW2A 4CTEA 1ZVFA 2W08A 3UKNA 1MQTA 1GICA 1WBLA 4RGGA 4HPKA 4OI4A 1DQ0A 2WLPA 3AB0A 3E6DA 4WVMA 5FLIA 1QDOA 3OD0A 3TBDA 4CDXC 2ARXA 3FZ3A 1CR7A 4R4ZA 2PLV1 3V0AA 4FAHA 1DDLA 3VBRB 1H2KA 4XXAA 4J1XA 4X6QB 1VRH3 4XTMA 1NG0A 1FV2A 5JSPA 2ZKLA 4M3CE 2RM22 4WM7C 2EXJA 4E4SA 3NV4A 1W0PA 3OD4A 3CNAA 4HBNA 1WW4A 4CEWC 2WFF3 5DUWA 3FX3A 2A73B 3CLPA 4FQZA 1ZBE3 4L11A 4RS5A 2GH8A 1JXNA 1MQTB 2ARBA 4GH4A 3DN7A 1Q8QA 1VAVA 1SLAA 1H8TA 1ZZ6A 2JKBA 4HPKB 1LESA 2DCJA 4YW3A 5JSRA 4WVMB 4IETA 1IQAA 4FPKA 1RITA 4XIOA 5H9QA 2WT1A 4QM8A 3V0AB 2DFCA 1REDA 2Q4SA 5F6LB 1ENXA 3ENRA 1WD3A 4QM9A 2BFUL 1JN2P 4AHXA 5KWRA 1VP6A 4HSJA 5JWPA 3WX5A 4TSVA 2BYVE 1XU2A 1S0IA 4IEUA 1HX6A 4XETA 4D3WA 5GZGA 2HWD2 3L2HA 4OVEA 2XKPA 1FPN3 1AXYA 3AMNA 2VNRA 1GSLA 3WD5A 4BA6A 3LOBA 3ZVXA 4GALA 5A33A 1RUJ1 4JRAA 4XE9A 1OFNA 2VY0A 1OOPA 1D0GA 2WFPA 4GH4B 2ZHLA 4XIKA 1JH5A 4MZUA 1LU2A 4M0HA 4M3CA 4NWWA 5K9YA 5D8AC 1AR63 2PQQA 1APNA 2JE7A 2DTWA 1QMJA 2VOWA 1T6GC 1NY71 4LLOA 3AP5A 4GIQA 1HXS1 2YXSA 2KA3A 4DOUA 5ACA3 3E97A 4P5HA 1HRI1 4ATFA 2GC1A 3VKNA 1SLIA 3ZX7A 4JVAA 2DVBA 2YY1A 1V6JA 2ET1A 1LOAA 5D1IA 2Y0OA 3WQ1A 3N4MA 1KFXL 2DVGA 5A33B 3VBHC 4C0HA 4D94A 2GN7A 5JAXA 4Q0SA 2D6OX 2CV6A 1K5MA 4BLIA 1CONA 1DGRA 2JG8A 1LOFC 3CF6E 3PJQA 3ES4A 4BQ1A 4FAGA 4NO4A 1U5IA 3AJYA 5BPXA 2G9FA 5T5OA 3WDYA 2HJIA 4B4PA 4JV4A 5LRRA 1U5ZA 1DQ4A 3WCRA 1OPOA 3L2YA 2OYZA 1R1A3 2BWCA 5I93A 1Q8VA 4K1ZA 1VRH2 4CP0A 1DQ6A 1B35C 3VBFB 5H9RA 1CPMA 2F6BA 4W6XA 2A3XA 1RC6A 1QJX3 2D6LX 2XUMA 3G7DA 1MS3A 1PO13 2ZS6B 1MEC1 2VH9A 2WFF2 2XVLA 1C3HA 1R083 2HWB1 5DDJ1 1GANA 2DFBA 2RE9A 4FPYA 1SEFA 2PHRA 1DHKB 3VZMA 1ZBE2 3KT4A 3ZFFA 1AXKA 1S0FA 3U0ZA 4QGMA 4BOWA 3NAPA 5KHGA 2BEOA 4TYSA 4YYOA 1N1TA 3CL1A 2B7YA 3SHRA 5K0UB 2IXHA 4FPFA 3HT1A 2GALA 3LGRA 4FPGA 2BGCA 2XWBB 1YNAA 1NA1B 3NVCA 4YGCA 4GKYA 4Q4X3 3WW1A 3FLRA 4AVTA 2ERFA 4C91A 2D3SA 1N1SA 4R9DA 1NOVA 3N7KA 3ZYRA 2K9ZA 1C5IA 3UJOA 2FZ2A 4EV0A 4E4ZA 3RI8A 1FPN2 1SLBA 1NCQA 1LJ7A 4XXPA 5LK5A 2NN8A 3ZFFB 4HFSA 5JIAA 2IFRA 4AVSA 1Z7S1 1KDKA 4ITCA 3NAPB 2EXHA 3OGGA 4XMAA 2XVGA 3TB0A 2A6WA 3CU7A 2YV8A 4FP2A 5EXOA 5JOYA 4KU8A 3KS7A 1CIWA 1GNZA 3O12A 4J1WA 4P9JA 4QPIA 1AR62 2XWJB 1DBNA 1WUVA 1YYNA 4JGYC 5T54A 2DU1A 5FO9B 3NV1A 3POSA 2WKKA 1GR3A 2UYAA 2ZZJA 4KNCA 1EP0A 5L73A 2A3YA 4LBJA 5ACA2 1RUJ3 1O3QA 1NCRB 4IL7A 5KC6A 1NCQB 2X8KA 3K51A 3AZYA 1VBB1 4XFFA 5KHKA 3I59B 2UU8A 3M1HA 4NPRA 4JGZC 2EAKA 2A5ZA 4HK9A 4O9EA 5FBZA 3WUCA 2B45X 2VUAA 2I74A 4UXAA 4XF9A 1QH6A 1G8WA 1IHMA 2PHTA 3NW4A 3THTA 2E9QA 2ZGRA 4QPIB 4WM7A 3SISA 2ZABA 4K20A 3URFA 2D98A 2Y38A 4WZFA 1N3QA 4OHXA 4XILA 5T52A 4CDWC 4CP2A 2A75A 4OUMA 4YW5A 2WZPP 2W52A 2XGXA 4EN8B 4RHV1 1BZWA 3H50A 4QQ2A 2E53A 3SH3A 4CEYA 5H9SA 4MUVA 1IGOA 1R1A2 3MICA 2RS11 4AI0A 1QJU1 5EJ3A 3I54A 2XJVA 4I30A 3WG1A 5LRSA 3HBZA 4Y22A 2ZX3A 4PBPA 1QJX2 1PO12 1V9U1 4CDXB 2VOKA 3AYCA 3M70A 4FTSA 1PO23 2WSUA 1R082 1H1MA 1RJ8A 1VBD1 3O7OA 2ZHMA 2FBEA 4LBQB 1HQWA 2VW1A 2Y0IA 2EIGA 1UU4A 1UPIA 4WM7B 2OW4A 2RMU1 3ALQA 5CB7A 3VKOA 2O8OA 1YI7A 1X82A 4AQSA 5J98B 4BHPA 4CEWB 4DXZA 1Q43A 3AP7A 3AM2A 4ES9A 4AFMA 1CESA 1ZYBA 1LENA 1V70A 1MVQA 4Q4X2 1MEC3 3FLPA 5DDJ3 1X36A 2KM2A 4YVWA 1VIWB 4XFCA 4Y22B 1G9AA 1AR71 2LALA 5L7OA 5KC5A 2WNUC 3MGUA 1UKRA 5HXVA 1J3QA 2NP0A 4OHZA 4Y20B 3B00A 4Q0QA 4DS0A 3MIHA 2H6BA 4WV8A 4QPGC 2H0BA 4GKXA 2R0HA 1D2SA 4K21A 3FJSA 4JRLA 4DFSA 5IK5A 2AUYA 3IDEA 3IDCB 1Y43B 4G9SB 4INDA 4XHXA 1L3JA 5FREA 3MW4A 2XJPA 3RG0A 1F5JA 4XFIA 1LOBA 5CFDA 4JAAA 1OFSA 1V6LA 1YO8A 1HQLA 1Y9QA 4GA9A 5L7OB 5DZGA 1RUJ2 3GHMA 1MS9A 3LA3A 3FLTA 2WNEA 4DRVA 1SCRA 5D8AB 4UW6A 3V0BA 1W6MA 2B8MA 3AZWA 4XFBA 4IEOA 4COYA 2DCYA 4BMBA 4YSFA 1HV1A 1A6CA 1U0AA 3M2MA 4PLOA 1W39A 1AJOA 3E6CC 1B35A 4LHNA 1RUH3 3POWA 2VUJA 3VBHB 4FP3A 3R4UA 2FHRA 1LB2A 4E4DX 5TSWA 1NQJA 2AGSA 3THPA 3WG4A 3VHNA 3MPPG 4DY5A 5JPNB 2HEVF 2ET7A 2P17A 4V1PA 4WZCA 1QOOA 3MFCA 3WP3A 4X6RB 4PDWA 1KFUL 3VBUC 1W6MB 2BNOA 3UL2A 1LGBA 2D3PA 1RVF3 1ENRA 2Z79A 1REFA 4GMP3 1COV1 1FNZA 4FBFA 1PO22 1JUIA 1A8MA 4I3PA 1VBA3 4M01A 1JYIA 2GU9A 3T1MA 2HWE1 4COWA 4COVA 3VZLA 4BH9A 4KBBA 1B35B 2G4IA 1PGSA 1RINA 1GQHA 1O5LA 1A3KA 1HV0A 1EAH3 4AVCA 4F3JA 3GALA 3ZXDA 4H55A 1AL21 3B9CA 3VBSC 3SMHA 1OI6A 1QJU3 1V6KA 1TE1B 2WS93 1KITA 2ZGNA 1JYCA 5KBFA 3B01A 1XQNA 1RUF1 3QCWA 4PIXA 1V9U3 3B02A 4X8PA 4FOQA 1MEC2 2P2KA 2GC3A 3H1WA 5DDJ2 1FMD3 1VBD3 1X33A 5JIUA 1JOJA 1PGW2 3VZKA 5FCCA 2RMU3 4YG6A 4KWLA 2D7FA 3WW2A 1PIV1 4EWDA 4BM8A 3BU7A 3RWNA 3EO6A 4AEDC 1VBE1 5EFUA 4XF4A 3KD4A 2GZWA 1PM7A 3SCGA 3WP4A 2XLAA 5CBLA 5GKAC 1ND2C 4LUMA 4YARA 1BBT1 4S2FA 2YROA 2ZGQA 2ES3A 1LODA 3A0NA 1YFXA 4HN1A 1PHMA 4GQ7A 4JGZA 4XZPA 4YGBA 4PLMA 3ZXLA 3G6JB 5DG1A 2NZ9A 4COZA 2DUQA 3LKJA 3INAA 2ZGLA 3KCXA 3JB4C 3BTAA 3GZAA 1AZDA 2DU0A 4N7UA 4XQ4A 4Z82A 1QXJA 4YW2A 2ZPXA 1M06G 2P3KA 4NHMA 4QXKA 5K8SA 2TEPA 4Q8KA 4JGYB 3RS6A 4CDWA 1YFYA 1ULDA 2RS51 2LUWA 2R071 4Q26A 2D44A 3ME2A 1LOCA 1W6QA 3A0KA 5CG9A 2Q1ZB 2JXAA 3ILRA 2IXLA 5JLVA 1SLTA 1MZ5A 2OUJA 2ZGUA 3AKRA 1RUH2 4JGZB 2FMDA 1BMV1 1KD7A 3AZXA 1UIJA 4L92A 4HL0A 4OUSA 5AC93 2B39A 1ZBA1 2V73A 1PNGA 2A70A 3DUIA 2D6PA 5JZGC 4P9LA 2E7QA 1C1LA 2GNDA 4S2DA 4CDWB 4IEZA 1RVF2 1RJ7A 1F9KA 1GV9A 3NKGA 1AYN1 1OA2A 1W6QB 1VBA2 4KL1A 1ZNPA 3IT8A 2WZR1 5BV6A 1DZRA 4N43C 3M3QA 5EWSA 5SV5A 1EAH2 1LHOA 2OPKA 5C4WC 2WNUA 3DV8A 4S2GA 3J4UH 4Q0UA 1QJU2 1SDWA 2WS92 3W59A 4I0AA 1F31A 2FQPA 1QNWA 4HVRA 3ZXKA 5LEJA 5JOZA 1ZRRA 1V9U2 3AFGA 1H0BA 4QPGA 2D6MA 2ZA9A 2D93A 1Q3EA 1KJLA 1ZZCA 1FMD2 1VBD2 2YUEA 2ZAHA 1VB2A 4I09A 4R4XA 5FDBA