1RITA

Crystal structure of peanut lectin in complex with meso-tetrasulphonatophenylporphyrin and lactose
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ritA00
1QGLA 1UN1A 1S0BA 3IPVA 2EALA 1YO8A 4YZ3A 4PBOA 2EAKA 4I30A 1BKZA 3SITA 3WDVA 2ZGSA 2ZMLA 1SCSA 2P3KA 2R0HA 1VALA 1LOGA 4AGRA 3TAYA 1MACA 2CYFA 1SLLA 2D3RA 5CA6A 5IK8A 1AXKA 4XILA 1SBFA 4DFSA 5GZGA 4LBLA 1IS3A 5FREA 2D3SA 1ULDA 3H0OA 1KITA 3N7JA 1W6OB 1W6MB 2PHRA 1JW6A 2R1BA 2WSUA 2WSVA 1EPWA 2Z42A 1GICA 1FAYA 3FUOA 4WZFA 1APNA 1ZA4A 3FLPA 1UAIA 3N7MA 3SLIA 5H9QA 2ZACA 3USUA 3MPPG 4UW6A 1OQ1A 1W6NB 4FOQA 2D6KA 3SNMA 1N3QA 2ZGRA 1LHNA 2A3XA 1Q8SA 5GLZA 2EF6A 1D2SA 1IS5A 3WHTA 5HCBA 1C1LA 3WHUA 2DVAA 3IM0A 1Q8OA 4R9AA 1S0FA 2C5DA 2ERFA 1R1ZA 3AP7A 1C4RA 3U4XA 4F83A 3T1LA 4ZKTB 3NV3A 1C1FA 1PZ7A 5KXEA 3KQRA 1ULEA 1MVQA 2XB6C 4AGGA 1IOAA 2GALA 2CWMA 1JYCA 3AFKA 4FPLA 4C1WA 2D6LX 1S0GA 2A7AA 1WBFA 1H30A 4LBQB 1AF9A 3APBA 3DUIA 3O5SA 4XHXA 2D6NA 2ZZJA 2UWCA 5H9PA 3M3OA 4YM0A 2A5ZA 3O0XA 5H9RA 1Q8QA 1G9CA 1FATA 2WKKA 3N7KA 2ZMKA 2DYCA 5EWSA 1IS4A 2EXJA 1G9DA 3OBTA 1DQ6A 2JECA 2ZGNA 3ILFA 4WV8A 1U0AA 1JHNA 1WLDA 3Q9OA 4LBQD 3LSEA 3WOGA 3OBRA 1BQPA 1UZZA 4ITCA 1MS3A 1QU0A 1DHKB 1W6PA 2PHFA 3PVNA 4Y20B 5F5QA 3V0BB 1ENQA 1CIWA 1CPMA 1CVNA 3AZWA 3ZPYA 1V6LA 3HN1A 2EIGA 2DVDA 1DQ0A 1KDKA 1Q8VA 2OVUA 1SLIA 2Q5TA 3AJZA 3HMYA 1ULFA 2R1DA 1BXHA 2A3YA 2A75A 4BMBA 3AP6A 3WCSA 3ENRA 4AVSA 2YMZA 3BOPA 1UZYA 2XG3A 2FHRA 5GALA 3AYEA 4U2AA 3RMYA 3A0NA 4M01A 3SH3A 3R05A 4U36A 3V0AB 2CWSA 4HL0A 1SCRA 4YW1A 5JDBA 2EXIA 1WD3A 3D6EA 1LODA 2ZGKA 5JOWA 1N1YA 1WCSA 2YROA 3T2TA 1N3OA 2W68A 3POYA 3B9CA 2ZGQA 4HANA 4M3CA 4ASMB 5CBLA 1GANA 2P34A 1WW6A 2LTNA 2P37A 1Z78A 3D5OA 2ZA9A 1DQ1A 3VKOA 4AVTA 4XTPA 4XXPA 2NMNA 3WDYA 4YW5A 4FPFA 2EXHA 5EXOA 4M3CE 2W08A 1LGBA 1GZWA 3WVJA 5DG2A 1LULA 3ZYRA 1V6MA 1LHUA 3MW4A 1G86A 1SBEA 3AYAA 4XBLA 5F9TA 1ZM1A 3MEPA 1A8DA 1KDMA 1SBDA 1LECA 3NV2A 2UWAA 4YG3A 2CNAA 3ZYPA 4GKXA 1A3KA 1MVEA 4YM3A 1QNYA 5KXCA 5IK5A 1QOTA 1YIFA 1S0EA 4Y22B 2A6ZA 1CQ9A 4WVWA 4XTMA 4YZ2A 1J1TA 1S1AA 2ZGOA 4AGVA 1VAVA 4AYUA 4Q1PA 1UKGA 1MS8A 4PBPA 1CPNA 1N1SA 4AWDA 1WW5A 2AUYA 4FOVA 1SLAA 1BJQA 1H9WA 2OUJA 4FP3A 3UL2A 1KJLA 4GWNA 4XMIA 1DFQA 3I4IA 2OUHA 4KBBA 1PZ8A 1DQ5A 3PMEA 4UW4A 5GLVA 4FQZA 1QDCA 1LTEA 1RIRA 2R0FA 4K20A 4FPYA 1V6OA 2ENRA 1W6NA 2E7QA 4FP2A 2R16A 1RITA 1W6QB 1V00A 1DLLA 3AXDA 3ZXFA 1DGLA 4ISQA 5KXDA 3VUOA 1WLWA 3PJQA 2A70A 3IN9A 3BODA 1B09A 1SFYA 4XZPA 3WDTA 3RRDA 3OGGA 1UMZA 4LBMA 1X50A 5T5OA 3O0VA 1PZ9A 2B7YA 3RQ0A 2VW0A 1MS4A 2H0BA 3ZSMA 1N47A 4XMAA 3ZVXA 1C57A 1GZ9A 1SACA 2A6VA 3N36A 4Y1XA 5GZDA 4ISRA 1SLCA 4YGBA 2HYKA 1F31A 1IS6A 3ZXKA 2DVFA 3V65A 3OYWB 1GBGA 4D69A 3ZSKA 3VKNA 2WT2A 5DG1A 4XJAA 1IKPA 5JMCA 2YXSA 4FPKA 4Y1VA 2GNBA 2ZABA 4FPJA 3O12A 3A4UA 2GMEA 2D7FA 4FQ4A 3WV6A 1GSLA 2D44A 4Q1RA 4Q26A 3WDXA 3AZZA 5E8AA 3CNAA 4Y20A 2ARXA 3GALA 1LESA 4XJ9A 3V0BA 2W52A 4GA9A 3FLTA 1GLHA 2JD4A 3USUB 1QOOA 2GDFA 3IMNA 4YZ1A 3QLQA 3R4UA 4Q2FA 3LSDA 1YXWA 4XJUA 4ATFA 1LHVA 1UL9A 1AX1A 2NN8A 1HQWA 2ZHLA 1D0HA 3L2YA 5IK7A 3AP4A 1JUIA 2ZHKA 5JLVA 5DZGA 1URXA 1FV3A 4LBJA 3WZ1A 2ARBA 1V6NA 4FPGA 3V0AA 2A3WA 1LOBA 2UURA 4R9DA 3ILNA 4SLIA 1QDOA 1AJOA 2EXKA 1GKBA 3MW2A 4NO4A 5T55A 3WG1A 3B69A 3OY8A 4XJZA 4YG6A 5DUWA 1NXD1 2PELA 2D6OX 2DWRA 1GNHA 4YW3A 3VKFC 2PHUA 4PQ9A 2P3IA 2YV8A 3VKMA 1VLNA 4FPEA 5AVAA 1CESA 4PF5A 5JOXA 1LGCA 4BLIA 1SLTA 4K1YA 5LK5A 1JN2P 1OFSA 1I1EA 3AYCA 4K21A 2ZKNA 3WG4A 3C2UA 1ONAA 4M3CF 3AJYA 5DXDA 2DURA 4GWMA 2GNTA 1MZ6A 1DZQA 1LOFC 2SBAA 1LJ7A 2D6MA 3JUUA 5IUQA 3WCRA 3NV1A 3T1MA 1QKQA 2DUPA 2GMMA 2YZ4A 3WLUA 4M00A 3ZXJA 2LALA 1LHWA 1S0IA 2VW2A 2I2SA 2JJ6A 4K1ZA 2AH2A 2WLQA 4FOWA 4JC1A 4LBNA 1CR7A 1S0JA 2UU8A 4Y22A 1FX5A 5EYXA 1LHOA 1G9BA 2V73A 2VW1A 1MR5A 3VV1A 3W58A 2WNEA 3M1HA 1AXZA 2FMDA 2D3PA 3AP5A 1DYKA 1FYUA 2A6YA 2D43A 5BYNA 4BOWA 3GNEA 1FV2A 4XIKA 5GZCA 1HKDA 3BTAA 1QOSA 3M3EA 2A6WA 1W0PA 1WW4A 5KXBA 5HCAA 4IQPA 4BMEA 3A0KA 3RG0A 2NYYA 1GV9A 5JOZA 2AYHA 1Q8PA 2CTVA 5DUUA 2KM2A 4GXLA 4NOTA 1LU2A 4Y1ZA 1A78A 1W6QA 4MYEA 2DUQA 1W6OA 1NLSA 4P9XA 1W6MA 3WUDA 4OZXA 4YW2A 3R4SA 4DQAA 1G8WA 3WG3A 2WT1A 1WW7A 1DBNA 1SLBA 3N3HA 3PVEA 1V6KA 4CRQA 1MS9A 4LBKA 1LCLA 2ZHMA 5DUXA 2ZGTA 3B3QE 1RINA 4W65A 5T5PA 5GLTA 3D4KA 1GZCA 3M3CA 4YFZA 4Y1YA 3AX4A 4YM1A 3UK9A 1CONA 5JOYA 2E51A 1AX0A 1GNZA 1G9FA 4Y1UA 1LENA 3POWA 2E53A 1TEIA 4ATEA 1FNYA 3SISA 4YGDA 2JE9A 3AK0A 1DIWA 3OYWA 4BM8A 1WBLA 3WNXA 5CAZA 1LEMA 4FVVA 4DRVA 2GMPA 4BPZA 3WG2A 1G7YA 1KQRA 3IPVB 2WQZC 1Y7BA 5SV8A 1QMJA 1S0CA 3ZXLA 4YG0A 3WDWA 1H9PA 2WJSA 4YZ4A 4FOYA 3OPZA 4Q27A 1ENRA 1ENSA 2DU0A 1WLCA 2ZGLA 4CTEA 2JE7A 1Z0HA 3M3QA 5E89A 4Z8BA 3O0WA 5GLUA 3ZXEA 4LBQA 2AENA 2V5YA 4PCRA 1Q56A 5EYYA 4WVVA 1N1VA 4XXAA 4XBNA 4JCKA 3FLRA 3AP9A 3ILRA 4YW4A 3V64A 1LOAA 1O4ZA 4LBOA 2GNMA 2GN7A 1BYHA 1IKQA 2AREA 1AZDA 1JBCA 1LOFA 1O4YA 2ZAAA 3N7LA 3ZSLA 1I3HA 5IT6A 2JKBA 3RSJA 2VU9A 5E88A 1OKQA 3I8TA 5T5LA 5CB7A 1V6JA 2SLIA 1GYKA 1YYNA 1ULGA 4H55A 2ZGPA 4UW5A 4YLZA 3ZSJA 2CL2A 1S0DA 2PHWA 1G9AA 3UJOA 5H9SA 1KJRA 3UJQA 1VAMA 4R9BA 1AX2A 1VIWB 1DQ2A 3BIWE 1JYIA 1KRIA 2R49A 1MS1A 4XHBA 3W59A 2A6XA 2DU1A 3POSA 1BZWA 3QCWA 3DGTA 4XDQA 5DUVA 3IKWA 1LEDA 2E7TA 3AZYA 4P14A 1WUVA 1LOCA 3NWKA 4XJWA 4Y24A 2AR6A 5GZFA 2DUOA 4YZ5A 4FPHA 1AJKA 3FFZA 1N3PA 5T52A 2DV9A 2NMOA 2OW4A 3WDUA 2AGSA 4P9YA 3WUCA 3TB0A 4YFWA 1DQ4A 2VY0A 1QF3A 3HR9A 2GN3A 2TEPA 4Q8LA 2DVGA 4XJ8A 2ZBJA 1N1TA 2PHXA 4GKYA 2D6PA 1CN1A 3SH4A 3VKLA 2CY6A 3JU9A 1AVBA 3NV4A 2ZHNA 4UW3A 4XE9A 4FPOB 1HDKA 5DZEA 2P3JA 3RMXA 4JRAA 5GLWA 4Y26A 2DTWA 3N35A 4YM2A 1HQLA 2E6VA 5GZEA 3MW3A 4DRRA 3M2MA 5T54A 2W39A 2P2KA 1JXNA 1W6PB 1UX6A 3AYDA 3LCPA 4TYSA 4ZXKA 5T5JA 1HLCA 1MS5A 4RA0A 5T50A 4XBQA 3RS6A 4XIOA 5L73A 2VH9A 4BQ1A 1W0OA 4DPNA 1MS0A 3FUQA 2G4IA 2ZMNA 1FNZA 2NZ9A 3OY8B 5GM0A 4CZSA 1YI7A 4GALA 1UPSA 2WT0A 3PVOA 1LGNA 1LOEA 1LU1A 1F9KA 3B00A 4XYXA 3AZVA 2NP0A 1YRZA 2ZGMA 3INAA 4L8QA 2A71A 2GNDA 2C9AA 2UWBA 5IK4A 5CNAA 1F5FA 4FPCA 1MZ5A 4C1XA 1CJPA 1JOJA 1QNWA 2DVBA 2JDZA 2YY1A 2NM1A 1DYPA 3AXEA 4M3CB 5DZFA 3OJBA 4AVVA 3KM5A 2DTYA 2RHPA 3ASIA 3SH5A 4BLJA 3FBYA 5HCFA 2ES3A 1WD4A 2PHTA 5FRAA 5GJ6A 1V6IA 4TZDA 1XQNA 3ATGA 4DS0A 5JVVA 4RL7A 4XOGA 1ULCA 2ZGUA 4YGCA 1GZWB 3AZXA 1AXYA 4P9WA 3B01A 4Q8KA 2BQPA 4YGEA 4R9CA 2VXRA 2VUAA
chains in the Genus database with same CATH superfamily
1QGLA 3AKQA 1S0BA 4Q4V3 2E31A 2Z4FA 2ET7A 1WMXA 3VBSB 2EALA 3BIEA 4BK4A 5JSOA 4PBOA 3JQWA 5FPUA 2VZ1A 5JIAA 4B4PA 1EYBA 1OC1A 3FX3A 1ASJ3 1JYNA 2V4VA 2ZCWA 2C9KA 3AB0A 1SCSA 3UGGA 4UOJA 5FKBA 2Z79A 4CDUB 4RQPC 3P6BA 1SLLA 2D3RA 4OMCA 3WQ1A 2JIJA 4XILA 5B2GB 4DFSA 3AKSA 1IS3A 3FMGA 3FWEA 3H0OA 4P00B 1PVC1 2VTFA 2HWD2 2VCBA 2WSVA 4A6OA 4ARXA 1FAYA 5CFDC 5JXIA 5C5UA 1GOFA 1APNA 3JBG1 3MPBA 3WQBA 2R041 1NA1B 3N9MA 5F8PA 2RDSA 1GOHA 1N3QA 3NO8A 5C8WA 2QZ3A 3VBRA 2Q30A 3HOBA 3JZVA 4BCUA 1LHNA 1Q8SA 2A1XA 5CG9A 1BHGA 4D0QA 1IS5A 4ZXEA 4OZOA 3WHUA 2DVAA 2DBNA 4NWVA 3ZFEA 5HV0A 1C4RA 1NE6A 5EJZB 2VUCA 3H50A 4F83A 4HN0A 2IXKA 1C1FA 4CVUA 1Y9MA 2BUKA 2Z2SB 4QPWA 3WNLA 5G04L 1JH5A 2Y6LA 2DCTA 2GALA 3AFKA 4XFCA 5BPXA 2VOWA 4ORFA 3KV9A 3ZYGA 1RUH2 1PX4A 3O1OA 2ZX1A 1H30A 1AYN1 3DUIA 3O5SA 1YWKA 3THTA 3TN92 2ORXA 2BTVC 2XJTA 5H9RA 1HX6A 1Q8QA 1LB2A 2WKKA 5FP7A 2DYCA 5EWSA 2EXJA 4O9EA 5CIRA 2BFUS 1DQ6A 1VBA2 3WQ0A 1G9DA 3KT4A 5JZGA 4PLNA 1UY3A 3Q9OA 5FPBA 2VNOA 4H7LA 1RHI3 2P6CA 3WOGA 1OH4A 4ITCA 2ZOEB 2BPA2 4Y20B 2VZPA 4NPLA 4CEYB 3V0BB 1UZ0A 2RS12 5FZ0A 5C4WA 5K7PA 1CZVA 1WKYA 3LEGA 1DQ0A 3W9AA 2Q1ZB 3ZFFB 4XFGA 4FTSA 3BCWA 4AQ6A 1FMD3 1U5YA 3BOPA 2XG3A 1J3PA 2FHRA 2ZEYA 4U2AA 4ZZ8A 3OEBA 1ZBE2 3V0AB 3TEZA 4LKEA 4HL0A 1SCRA 4KI5M 3SKVA 3GZEA 4GAZA 2ZGKA 5KC5A 4XUQA 1VBD3 1AR61 2YROA 4WM8A 2ZGQA 3H9AA 4J25A 1UY4A 1WW6A 3VKOA 4XCBA 2HH9A 2NMNA 3Q8AA 4QXCA 4B29A 4FPFA 4GULA 3EO6A 3WXPA 3C7GA 3H1YA 2MEV1 5K9YA 1OI6A 5LRRA 4DEVA 4M3CE 1TME3 3OG2A 1S2BA 3K3OA 2HWB3 3ZYRA 2X05A 1LHUA 3UKVA 5I0RA 1BMV1 3PMSA 2YPJA 3AMMA 3LEKA 1EAH1 5DDJ3 2W1QA 3AYAA 2GP5A 2BDRA 3IDEA 4KQ7A 3VBFB 4FSJA 1SBDA 5FXZA 1LECA 2UWAA 1XYOA 1A3KA 3T2OA 1O91A 5BNPA 5KXCA 5IK5A 4UF0B 1S0EA 4WVWA 4XTMA 4YZ2A 1S1AA 2ZGOA 5AVPA 1DF0A 4MO3M 3ON7A 1VAVA 3GCXA 4Y5TA 3FHAA 4AYUA 5JXHA 1J1LA 1PIV2 5FY9A 1VBC3 2FMYA 1WW5A 2ZPXA 1C5HA 4NPMA 5FZAA 1NCQC 2IXIA 2OUJA 4CDWA 4GWNA 2HWD3 5CKQA 1FXZA 5FZLA 5FJHA 4NUBA 3ZN4A 3H7JA 4OI2A 4XABA 1IQDC 2VAUA 1QJX3 4A6SA 1DQ5A 4UW4A 5GLVA 2HWF1 3OBAA 4FQZA 1RIRA 4RD7A 3PJYA 1OF4A 2QQLA 2PQQA 2R0FA 4H14A 1R64A 4IEWA 5A7OA 1YHFA 3PIGA 1G6NA 3VZJA 3PUIA 4JHZA 3EXUA 5IAVA 2VZRA 4DEQA 3AXDA 3ZXFA 1JZ4A 4QPIB 4ISQA 5IHRA 5KXDA 4W6WA 2A70A 2GC3A 2KR2A 3LIGA 5ERLA 5FLIA 2BJSA 4I09A 3BODA 1SFYA 1W8HA 3J9SA 4XZPA 1W2OA 2NLRA 2JDYA 2F17A 2P6HA 2J1SA 3ZLIA 5F3CA 2Y60A 1POV0 3OGGA 2ZS6B 4LBMA 3O7OA 2BYVE 4HKOA 3VHNA 5CADA 1Y9GA 4TXWA 1J84A 2PLV3 1HJFA 2ZX3A 3ACIA 4CXWA 3BTYA 2J1AA 4L2NA 5FY8A 4XUNA 3U11A 1UMHA 1MS4A 2H0BA 2Y0IA 2O14A 4LOSA 5ANNA 4YYOA 3ZVXA 1C57A 1GZ9A 2XJUA 3ACFA 4BHPA 4BQ2A 2WC2A 1S55A 4ES9A 2WQ8A 1RUH3 1HV0A 5FQ0A 2HYKA 1XNTA 3PUQA 3SEEA 1YQ8A 2HYXA 2QQIA 1GBGA 3KGLA 1UWWA 4COWA 3VKNA 3TN93 1D4M2 3FHIB 1IKPA 2G1MA 3J4UH 4L0PA 4M0NA 4XJAA 5DG1A 5FPLA 5JMCA 1IPSA 4FPKA 4UFHA 3ZDSA 4BDVB 4LORA 3DYOA 2BNOA 4Y1VA 3HNYM 4ZU7A 3A4UA 3WV6A 4GJZA 5BXXA 1YJLA 3LEIA 3AZZA 4UAPA 5E8AA 3CNAA 1MQTC 3ZDVA 2Q8OA 2NPIA 4XJ9A 3KLSA 2CDOA 4GA9A 3BU7A 3VBUA 3PNAA 4YZ1A 3QLQA 4XJUA 4ATFA 2FDJA 1LHVA 2NN8A 4EZHA 2IFWA 1D0HA 1Y3TA 5E16A 4L97A 5IK7A 5JLVA 1URXA 1WA4A 2OQ7A 2R30A 4LBJA 4CA9A 4QB2A 1H2KA 3WQ7A 2ARBA 1ZBE3 4FAGA 5FTTC 4R9DA 4JGZA 2CHHA 1GOGA 3RZJA 4OI0A 4A4AA 1AJOA 1GKBA 1RUI3 1AR82 5EQUA 4CU6A 5FZOB 4LIVA 2I45A 2VQ0A 1SHWB 3T3YA 4ARYA 2XQXA 4I3PA 1RTVA 4LQRA 4I0WB 2DWRA 1R1A3 5FY7A 5IVCA 3OEAA 4BK5A 2P3IA 5F2SA 4Y3OA 3AMQA 3SCHA 1Y4WA 1TZOA 2B4KA 4PIZA 3BTXA 1KS4A 2B45X 1W03A 2ZEWA 3AMHA 4LHSA 2YUEA 3AYCA 5FYVA 2VQTA 3WW4A 3HWJA 3ME2A 3VBOA 3WG4A 4LE3A 1ONAA 4M3CF 3MLLA 1GP4A 4LKSA 1YQCA 4B1LA 2VPVA 4M4PA 1JU3A 2C6SA 3WLUA 5ACA1 2DUPA 4AG4A 4M00A 4OFGA 2Y6HA 2JD9A 3D0SA 3MFAA 4NROA 2QQMA 1LHWA 1RUF2 4Y4YA 5C3PA 3J8F2 2JJ6A 4K1ZA 2XONA 5BNOC 4HXCA 2UU8A 2OZ6A 1JYWA 1GQHA 1LAJA 1SFPA 1G9BA 1W9WA 2VW1A 1JOPA 4OI4A 4HG6B 1CAXB 3M70A 1MZFA 3AP5A 3F2ZA 1FYUA 1PIV3 2A6YA 4LLOA 3EQEA 5CEHA 2D43A 4BE3A 2I07B 1X8MA 2J22A 5AC92 4XF3A 1JYVA 1PK6B 2WR9A 2JG8A 1FV2A 4XIKA 5GZCA 4RGAA 3BTAA 3KB5A 4L99A 2RR13 1OD3A 1MEC3 1W0PA 1HXS2 1UXXX 1H6YA 1WW4A 3CF6E 4S2FA 4MHRA 4E4SA 4HMZA 2D5FA 5FLJA 3T30A 3LGRA 1U5IA 3I2IA 1VBB1 4GXLA 1LU2A 2HWC1 4Y1ZA 3JCIA 1ULPA 1PO21 1W6QA 2LRPA 3D0JA 1W6OA 1BVVA 1R082 3ETPA 3EBRA 4JGYC 4NWWA 4P9XA 3QBQA 1JOBA 3JB8A 4GD4A 3W5NA 4QWNA 5HXMA 4WVMB 2JENA 1WW7A 4RHV2 5A32A 3N3HA 3K75B 5LA2A 4CRQA 1MS9A 2XBO1 3ZYJB 5KC6A 3OUHA 1H1MA 2WLPA 3J26N 5FYTA 1RINA 5FUIA 5I91A 1PM4A 1GU3A 2YG0A 1W3VA 4Y1YA 4YM1A 3VGIA 2FDIA 2VL4A 3FL7A 5JPNB 1AX0A 5KR7A 3PHMA 1NZCA 2AZ5A 1LENA 1PMHX 3POWA 4KWLA 1EY2A 1TEIA 4ATEA 4A44A 2YDEA 1UU6A 2JE9A 1DIWA 2KA3A 1CAVB 2Q1MA 3AK0A 3OYWA 4SBVA 3WNXA 5L7OC 2BNMA 1JU4A 1D4M3 3EHKA 3POEA 3I59A 1L3JA 4QXKA 5F5IA 1UIKA 2XJQA 1AUYA 2R042 1XXNA 3VDAA 1E5HA 1AR71 2XLAA 5SV8A 5FZKA 1H9PA 1QY4A 4YZ4A 3K4ZA 2WBKA 1S2EA 3PTYA 1NCRC 1ENRA 5FY5A 1ENSA 2DU0A 4Z8BA 5ABJA 3O0WA 2AENA 2V5YA 4QDSA 2FDHA 2DDUA 1N1VA 3NKTA 3OOXA 5FK8A 4XBNA 4X6QB 2RJKA 1RGSA 1K5MB 3SEPA 1IG3A 1YCIA 4A41A 3WP5A 2VMHA 1LOFA 1O4YA 3N7LA 2ZAAA 4IE7A 2JG9A 2PA7A 4NJ4A 3SMHA 3ZSLA 3RSJA 2VU9A 1DCSA 1OKQA 4MXWA 1ULGA 2ZGPA 2HEVF 2WRAA 3RWNA 3ZN6B 1SZBA 4DZGA 1S0DA 2PHWA 2WO2A 4EE2A 4COZA 3UJQA 1AX2A 2YPDA 1DQ2A 4YSFA 2XR4A 3MUZ1 4QKDA 4DXRA 2FCUA 1PO11 2Z69A 4FFHA 1BZWA 4WM7A 4D7YA 4Z1VA 1ALYA 1Y9QA 2RMU2 2E7TA 3AZYA 2LM3A 5B4XA 1LOCA 4K7JA 4E8DA 3NAPB 3OPWA 4XJWA 3WF1A 4AHZA 3KGZA 1CAUA 4LO8A 2MHFA 1N3PA 5KWRA 2ADDA 4GB31 1W2UA 4QPYA 1IPJA 4E8CA 3WF0A 2TEPA 3WNNA 4XJ8A 3RZZA 1NCQA 2ZBJA 1RUF3 4BB3A 5ANQA 2QTWB 3JU9A 5C3RA 1VE0A 3G6JB 1J59A 5CKMA 4UW3A 1BK1A 1VB2A 1XE7A 3QD6A 4NMIA 4XUTA 4XUPA 4XCAA 4YVSA 3ZYIB 2Y26A 3BPSA 3RPQA 2X8KA 2WL1A 3KV6A 3MI8A 4FFFA 1CAWA 4YM2A 1UY1A 4HK9A 4N7UA 5GZEA 3MW3A 3ECQA 4MLOA 2TBVA 4A2UA 3M2MA 4Z92B 4A3XA 1GNYA 2HWE2 4AOCA 1W6PB 4FFGA 4TYSA 3E5XA 5T5JA 4EROA 2WNUB 5J09A 1OBNA 4P08A 4DPNA 3FUQA 2VR4A 1BEV1 4I02A 2XUMA 2G9FA 4DIQA 1NQDA 5DAPA 4GALA 2Q1FA 3ZN5A 3BPZA 1LOEA 1LU1A 1F9KA 1R083 4QQOA 2IUWA 4XYXA 1EAH2 3SQOA 3I3EA 5IK4A 5CNAA 1NG0A 2BERA 4JAAA 1F5FA 4RHV3 5G05L 2R061 1MZ5A 1JOJA 4O61A 2JDZA 1RUC2 3U14A 3K77A 5BNQA 2ADEA 2XJPA 4GZ9A 5IW0A 2RM21 4QPGA 3MHZA 5JZGC 1BCXA 4IV3B 1COV1 2ES3A 1FPN1 1H1IA 5FRAA 5GJ6A 2W2IA 2BBAA 5FZIA 4OQ9A 3U10A 5C4WC 1UOBA 1AR92 4GWIA 1C28A 4XOGA 1NQJA 1GZWB 1QXPA 4P9WA 3I2JA 1PVC3 4Q8KA 2XUEA 3VDDC 5EZWA 3IZOA 3URFA 4NIHA 3J7NA 1DGWX 5C8CB 1L7LA 2EIEA 2VUAA 4ZZ5A 3JBG3 1UN1A 3DPRB 2WQ4A 1HRV2 2R043 4JRLA 3HT2A 1YO8A 2ZEZA 4YZ3A 5DMYA 5A7WB 2EAKA 1BKZA 2D5HA 3WDVA 2ZGSA 4LKFA 1VRH2 3MZHA 1LOGA 3Q8FA 1ZRDA 3NJYA 3HQXA 3R0RA 4WM8C 1UZWA 4MGKE 4FBFA 2CYFA 4NIDA 3VBHC 1YI9A 4FT8A 3VN4A 3SCGA 3I2FA 5I0TA 1UD1A 2K2SA 2CGOA 4HT1T 2C26A 1AL0G 3CU7A 2WAAA 2WINB 1ULDA 1KITA 3N7JA 2BEOA 1X9PA 2PHRA 3I54A 1EPWA 4AEDB 4MGSA 2P5BA 4DO0A 1ZA4A 3BU0A 1LKNA 1UAIA 4CEWB 4IGPA 2WNVB 4XFFA 1XYNA 2MNGA 1PHMA 2ZACA 3FE5A 3H8UA 4RS5C 4UYBA 5H9QA 3SLIA 3USUA 3CJIA 1XPWA 2KD7A 1K5JA 3MV01 4IEPA 5EJ1B 1IPKA 3UETA 3KHCA 1ZRIA 3ZYHA 4Q4Y1 5BNPC 4PIYA 3HPNA 3O14A 3VD7A 5BY5A 3MIFA 1O3TA 3ZOIA 4IE5A 2QQPA 3POFA 2J1UA 1GP5A 1Q8OA 3IM0A 3H3UA 4LA2A 4R9AA 1GFF2 5FOBB 2PN5A 1XNBA 3E6CC 2ERFA 3AP7A 2O1QA 4CUGA 1OD5A 1O3QA 1YEWA 3VDCA 2IWGB 1H0BA 4XC9A 2DCJA 3ES4A 1UX7A 2F4LA 1C8NA 3WNKA 4CP2A 3NVCA 4KU8A 3VLBB 3Q8EA 4HZFA 4CDQB 1VBE1 3LQCA 5AFBA 1WBFA 1H8VA 1AF9A 4GQ7A 4LBQB 4XHXA 3LA3A 4GH4B 4KH9A 1F8VA 3M3OA 1OLMA 4QU2A 1PGL2 3U1XA 1CD3G 3K2OA 1G9CA 2WFF2 4FAHA 3DL3A 2ZMKA 1XB9A 2UYAA 5J36A 1O6UA 4FO9A 2ZGNA 3AVRA 2JB4A 3ILFA 4WV8A 4CP0A 4OYUA 4LBQD 2IC1A 5BV6A 1AR63 3A21A 3ZFGB 4CUAA 1BQPA 1UZZA 5FV3A 5IYYA 3NJZA 2OPKA 1WCUA 5F5QA 3WF3A 5LA1A 4RFRB 1ZRFA 1CIWA 1ENQA 3AZWA 4B3NA 4PQQA 2Q5TA 2DVDA 3HMYA 3AJZA 1SLIA 3BYWA 2HEYF 3U4SA 3N9QA 2MEV3 4P9GA 4AFDA 2WN3A 4P9JA 5A1AA 3AP6A 2Q4SA 2C1FA 4RFT0 4GMP1 1X33A 1XNAA 2XWBB 4XAEA 3AYEA 5J98B 3RMYA 1W06A 2CGNA 1EAH3 2PAMA 3SH3A 4C0HA 4U36A 2CWSA 2VMFA 3N9NA 4JTNA 4LO7A 5JDBA 2EXIA 2VTXA 1WD3A 4CP9B 1X8EA 2CV6A 4N53A 5DAQA 4AVBA 5CBLA 2W68A 4M3CA 5IJRA 4ASMB 2RG4A 4HANA 4LXLA 1GP6A 2CU5A 1YIPA 3OCPA 4AI2A 5FR3A 3W5MA 2P37A 1A8MA 5A3TA 1DQ1A 2ZEXA 4XTPA 4XXPA 5L36A 3UNPA 4IDZA 4AEJA 4RGGA 5EXOA 1ND2A 1ENXA 3ZKUA 2VOXA 4AHYA 1EV11 2W08A 1NCRA 3VBUC 3WX5A 4XQWA 5JR2A 5DG2A 2QFEA 1LULA 4XPVA 3AKPA 4XF1A 5IVJA 5JCTA 1WCDJ 1SBEA 4XBLA 3H3ZA 4NN0A 1RUG2 4QKFA 2WIIB 1KDMA 3H8XA 3VBSA 1KGYA 2XVGA 3KWVA 1VBB2 1H2NA 1I5ZA 2HWC2 1QNYA 4JGZC 1QOTA 2B42B 4KGQA 1YQ2A 2A6ZA 1K3IA 1REDA 2WO1A 1J1TA 2XL7A 4QAWA 4CDUA 1CX1A 4YWAA 2WWSA 1UKGA 2BGOA 3E5UA 3N4MA 1NT0A 1OT5A 4TN7A 4AWDA 4YARA 2XBO2 5FZHA 3KT1A 4FP3A 5FZBA 1L7QA 1W8WA 1KJLA 3MDPA 1RXFA 3T2QA 3LDKA 3GHMA 3KV5A 4UT5A 3VBOC 4CXYA 2K46A 4KBBA 2ZXQA 4D7SA 5FBJA 1O7FA 1TQ5A 1NA1A 4YW7A 5FY1A 1WGPA 2XWJB 4AW7A 4FPYA 1QH6A 1V6OA 3WNOA 1VBC2 2E7QA 2ENRA 2R16A 2DCZA 4OLLA 2RDNA 4Q0SA 1UW8A 1DLLA 4UI9L 4J1WA 3VUOA 1ZA7A 1HB4A 1DGRN 1QJX2 1B09A 1FOD1 2JDUA 3CZUA 3WDTA 4ZPIA 1UMZA 4COUA 5T5OA 2P3YA 1TMF1 2HBTA 2X10A 4FXKB 2JG8C 4IE4A 4N43B 2IXLA 1XJAA 1D4VB 4AAXA 3FZ3A 5KHIA 5FYIA 1IG0A 3D3AA 4AI1A 5CU1A 1UF2C 1WWYA 1ZX5A 5A6YA 2XL9A 4XEZA 1IS6A 2PLV2 1XC6A 3TYJA 3V65A 3G7DA 2AEYA 4OUSA 3ZSKA 5KHGA 4ZS3A 2WZPP 2WT2A 2BGCA 5K8SA 1GMMA 1OOPC 2WFF3 3DKWA 4DXTA 3NNJA 4YPJA 2YB7A 3MIGA 4FPJA 3ZIWA 3O12A 4FTEA 3I2DA 1OUSA 1GSLA 3ZR6A 2WZR1 1VR3A 4AI0A 4Q1RA 3WDXA 3I3MA 2GAUA 1T2XA 4XURA 4Y20A 3GALA 1CIYA 2DCYA 4CEYA 3V0BA 3KMHA 1UQXA 1AYM1 1XYPA 1RUE1 2GDFA 3OPTA 3ZFFA 3ZM8A 2YC4A 3VD9A 4LKDA 5A3WA 3VBRB 2ZHLA 3ZMNA 3L2YA 3OUIA 3U37A 1JUIA 2ZHKA 5DZGA 1FV3A 1OLME 4RR3B 5EHDA 4JHTA 4KWUA 1XE8A 5ACA3 1ZRCA 3V0AA 1W0NA 1LOBA 2XPJA 3ZFEB 4XQDA 3M8LA 4MG2A 3ILNA 1ND3B 4LUKA 1QDOA 4SLIA 3WG1A 2BBVA 1OMIA 3B69A 4YG6A 3VDDA 4AFAA 5C5TA 2W91A 3ES1A 2PELA 5FUPA 4A7ZA 1K45A 3UESA 1GNHA 3VKFC 4BIOA 3QH6A 4PQ9A 5ABJC 3VKMA 4INDA 5AVAA 1CESA 1J3RA 3MIBA 4PF5A 4C91A 3LPFA 3U0ZA 1JN2P 4AI3A 1DU3D 1OFSA 1W8TA 4K21A 1RUI2 3ZX7A 5FZ8A 2JDNA 1W04A 4OVEA 1QJZA 3TEXA 2GNTA 3P5BA 5CZKA 1MZ6A 1LOFC 2SBAA 4HVOA 3WCSA 2JG9C 3VBHA 1R1A2 2N7GA 2ARCA 3DKQA 1RUG3 4WVZA 5BNNB 3VBFA 4NHXA 4S2DA 1O59A 5A3MA 2LALA 2BGPA 2VOVA 3D8CA 3WEZA 1S0IA 2VW2A 1VBB3 2O8QA 5DUXA 2HWC3 4FOWA 3GBGA 4OHYA 3WW1A 1R091 1QH7A 1S0JA 4LO4B 1SG3A 4UF0A 1FX5A 3WSOA 1OVPA 2W94A 4P9IA 5FCCA 3POJA 3DXUA 1AXZA 4QX1A 3N9LA 2D3PA 4RS5A 3E1F1 1ZZ9A 3A7QA 3AVSA 3UV9A 4WM7C 4DINB 4AE2A 4BOWA 1S4CA 3POGA 3T0DA 5A3LA 2XBO3 1QJY1 1UIJA 1W28A 1EUTA 1H2MA 2VMEA 1V0AA 5FPZA 1JHJA 2A6WA 4BMEA 5JIUA 3H1WA 3HJRA 1FPN2 4LPLA 1Q8PA 1X9TA 4E4ZA 4NOTA 1AL21 1VP6A 5CFCB 1YNAA 4Y4RA 1RB8G 3ZKYA 1W6MA 4QPIA 1W90A 1STMA 4IEXA 5T3NA 5C33A 2RR12 3R4SA 4YW2A 4DQAA 1MEC2 3WG3A 3HQUA 2WT1A 5LCWL 4YVSC 3FN9A 3PVEA 1V6KA 2ETEA 4TLGA 3KHBA 3T2PA 4CDXB 5DPNA 1HQNA 5DN2A 3I7DA 3NNFA 1MPXA 5T5PA 2W92A 3IDBB 4BQ4A 2W1UA 3AMPA 4ASLA 3H8RA 3M3CA 2VVFA 3NNMA 3UK9A 3POBA 2OPWA 4B4QA 4AHWA 2X5IB 4W50A 4Y1UA 1BVP1 5D8AA 2IFRA 4NPRA 2QZ2A 2V72A 2CGPA 1FNYA 3SISA 4HFSA 2Y6KA 4QHZA 2VQUA 5LBEA 3K4AA 4FVVA 5FLHA 4QGNA 3PL0A 3WP6A 4DRVA 1SDDB 4BIFA 3WG2A 2B39A 5FO9B 5FMBA 3ZXAC 3IPVB 2VECA 3PU8A 5LW9A 5EPAA 1QMJA 3ZXLA 3RJRA 1Q43A 3WDWA 4CDWB 2OX0A 4MGYE 5FZ9A 1CZSA 4Q27A 2W46A 4EJRA 3JXSA 5KXEA 4CYDA 3MICA 2DCKA 5E89A 5FAXA 5GLUA 1PMJX 3C7HA 4QPGC 4N8MA 3WINE 1PO13 4LUMA 4PCRA 5EYYA 4WVVA 2JDHA 4IGQA 4JCKA 4A3ZA 3AP9A 3V64A 4LBOA 2YFZA 1BYHA 2FDFA 2VBBA 1SDWA 3CBNA 1HN1A 4H3WA 1I3HA 3HNMA 2B9VA 2JXAA 5I8YA 3I8TA 1V9U1 2SLIA 4H55A 3ZSJA 1E57A 3NL1A 3POIA 5A7SA 3P3NA 4XF4A 4IETA 4LR4A 2Y6FA 5FMCA 2JE8A 4PDWB 5FKCA 4RSUA 1IGOA 4BISA 2CL2A 3MLKA 1G9AA 5LB6A 3UJOA 5DABA 5H9SA 3HT1A 2YU2A 2XKPA 2Z5WA 4LK7A 3BTZA 1ODNA 1VBE2 5FZOA 5K0UA 4C90A 2W1WA 2R49A 1MS1A 2R32A 3SHRA 4JQTA 4PT6A 3DGTA 4XDQA 5DUVA 3IKWA 1WCQA 4AXOA 2VOTA 4KL1A 2VZVA 4YVWB 5C6CA 1O3SA 4OHZA 4Y24A 2XOMA 2PYTA 3IWZA 1UOJA 1B35B 1QWRA 1QQP1 1ZBA1 2DV9A 2GU9A 2NMOA 3CZJA 2IXCA 2Q8EA 3WDUA 4OHWA 2PQSA 3LE0A 3VD4A 1OSGA 2DVGA 2WYFA 4RGKA 3LAGA 1BEV3 2PHXA 5LA9A 4E2SA 1CN1A 4N9IA 4JKLA 5FMOS 3CJIC 3NV4A 1HW5A 2FCTA 2W95A 4UFLA 1FI2A 2WA3A 4MOAA 1HDKA 5F2WA 5J1XA 5JPMB 1CAXA 2P3JA 1K42A 4JRAA 5GLWA 2R063 4EN8B 2DTWA 1NXMA 5JI7A 1HQLA 2WFPA 1PK6A 4DRRA 2BFUL 3UKNA 2RM23 2W39A 3LFIA 2P2KA 1JXNA 2E33A 2BVBA 2JDKA 2LW8A 3O1UA 1HN0A 2RV9A 4W8JA 1COV3 5T50A 4XIOA 1FPN3 4DY5A 1WZXA 1WMEA 4EZ4A 4N7IA 5A6XA 4X8NA 3IMMA 3S0MA 4CCOA 5GM0A 1RHI1 2WT0A 1LGNA 2Y38A 4QHBA 4DNYA 2EVXA 3B00A 4E2GA 2NP0A 4ZY9A 5HI0A 2ZGMA 3TNPB 1H8TC 3VD3A 2C9AA 2UYBA 5CKNA 2QCSB 4C1XA 2DVBA 4NRMA 4OULA 2NM1A 2QQUA 5F3EA 3LDBA 5FYYA 4AEKA 4HETA 4RQPB 3OJBA 2PHDA 3BVCA 1OOPA 3CEWA 2RHPA 4BLJA 3ACGA 5HCFA 3DN7A 1OA4A 4QX3A 2O0OA 1V6IA 5A80A 1XQNA 5F6LB 3ATGA 4DS0A 1QEXA 4RL7A 4YGCA 2ZGUA 5FIXA 4E4HA 4HPKB 4QB6A 1UY0A 4AR2A 5CFDB 4MX3A 1OA2A 4XFBA 1OPOA 1CAVA 4XACA 4YGEA 5I0UA 4D6SA 4R9CA 1KXGA 2QE3A 2EICA 1GWLA 1KFUL 1NKGA 4S2GA 3IBMA 1TME1 3RYPA 4TTGA 2Q8CA 5BUVA 3FBMA 3RYKA 4O9GA 3SITA 2ZMLA 2XMLA 1PVC2 4N53C 2R0HA 1VALA 4Q4X1 3KS7A 1VMFA 1ZZBA 4QHOA 2FBEA 3TAYA 4GMP0 4CPBA 4GWJA 1FOD2 5LASA 2ZKLA 1AXKA 3JBG2 1K5MA 1SBFA 4DUWA 1DDLA 1QJEA 5GZGA 1LRHA 3LB9A 5FDBA 1HB1A 3MFCA 1E5RA 2D3SA 1ND2C 1TMF2 1W6OB 1JW6A 2R1BA 3DECA 5FY0A 2Z42A 1GICA 4LHLA 5EV7A 5GKAC 3FUOA 5LEKA 4OUMA 4WZFA 3ROUA 1W99A 1YQ5A 3RVHA 1X7NA 1VRBA 5A32B 3ZN6A 3N7MA 4IV1C 4EN7B 2XQRA 3MPPG 1OQ1A 1W6NB 3THPA 4FOQA 2D6KA 3DEMA 1HRI1 3VBSC 2D93A 1VBE3 4CCLA 4XUOA 3PVBB 3CJXA 5GLZA 4UFJA 3JQXA 1T6GC 5FYCA 1ZVFA 2EF6A 3WHTA 3LWCA 1M4WA 4JVAA 5HCBA 4CDUC 4UBGA 3OB8A 4I3GA 3RGBA 3TEWA 4IEZA 3U4XA 3BALA 4HN1A 3T1LA 2VZTA 3I2GA 4LOTA 2WZR2 5FBZA 2CDPA 4ZKTB 1PZ7A 4CCJA 2XLFA 3LFMA 1AYN2 4C8DA 2MPFA 3KVAA 1NLQA 1PMIA 1HJGA 1MVQA 1XSRA 2JB8A 1AYM2 4R8HA 2CWMA 2OXBA 3B9IA 4AK3A 1KEXA 4X6RB 4LK6A 5DAVA 1NA1C 4LO5B 2OKXA 1S0GA 3UKTA 2A7AA 1KS5A 4GMP3 2EAAA 2YBSA 1CZTA 3V56A 2X29A 3APBA 4YNIA 5H9PA 2D6NA 2J1TA 2UWCA 2FZ2A 2A5ZA 3O0XA 2OQ6A 4QQ2A 3LDRA 1OLQA 3N7KA 1J3QA 4KU7A 3VZMA 3K48A 1IS4A 4K6BA 4KG8A 3OBTA 1PVXA 2JECA 3THDA 3ZYFA 1WLDA 3IB3A 3LSEA 3R4DB 3OBRA 4PF1A 3ZIXA 2XKOA 3T0BA 5LWBA 1QU0A 1DHKB 1W6PA 1O8PA 2VULA 3PVNA 3AKTA 3LZZA 2WNUA 4O65A 4CU9A 1CPMA 5C7GA 4QM8A 3JD71 2EIGA 2OVUA 1KDKA 1VBA1 3MBWA 4J1XA 4Y33A 2R1DA 1FT9A 1BXHA 4IERA 2VMDA 1JTZX 4UBHA 4IE6A 4AVSA 1W8ZA 3OD4A 5GALA 1AR62 4QX8A 2AEZA 3O1VA 2BNNA 2RS11 2VXJA 3A0NA 1REEA 4M01A 5FPXA 4I2OA 4CSWA 5F5AA 3HBZA 3KF5A 3NNLA 2MEV2 1VMHA 1LODA 2IZWA 3S30A 1R092 1N3OA 3POYA 3KQ4B 3B9CA 3T2TA 2P34A 4MADA 2LTNA 2YBKA 1POV1 1Z78A 3D5OA 2ZA9A 4Q0PA 3M3IA 1BMV2 2ID4A 5KHHA 2J42A 4BH9A 1DLCA 4K8RB 3S5QA 4HVRA 3WDYA 4CEYC 5CG8A 1NCQB 4FXGB 1EPZA 5K4LA 1A6CA 4E9KA 5JXGA 1GZWA 1O4TA 3ZFFC 5A33B 2V5DA 1RUD1 3GJAA 1G86A 1TNRA 3HN3A 5TSWA 5C8CA 5FFOC 1ZM1A 4G9SB 4NVPA 1A8DA 4NHKA 3DPRA 3THCA 3ZYPA 3NV2A 4YG3A 4AFBA 4P5YA 1POQA 4GKXA 1PGSA 4W6YA 1AL22 1YIFA 4IEYA 3KCYA 5F3IA 4Y22B 3M7AA 1CQ9A 4H7MA 1DYOA 5L9BA 3USSA 4JDOA 5LATA 1DZTA 5IAXA 2TNFA 4AVCA 4IGOA 2VUDA 3CKHA 1FOD3 1CPNA 1N1SA 5F32A 2HWF2 3RNSA 5F37A 3CL1A 1BJQA 1H9WA 2BW8A 3MIEA 1TMF3 5LBBA 3UL2A 5F3GA 3U07A 1W2NA 2VOKA 4XMIA 1RVF1 3OGRA 4FFIA 3I4IA 4DUVA 4AEDA 1W2AX 5FUNA 4E27A 1RUNA 4K8FA 1X36A 3VDBA 3E97A 3PMEA 5FP3A 2WNVA 1QDCA 1LTEA 1OLRA 1NLRA 2UY9A 2Q0AA 5FXVA 3NQHA 3VBFC 2B8MA 2RDRA 1HB2A 2BV4A 2RVAA 1RITA 5HV4A 2IVJA 5I0SA 1YFUA 1V00A 1DGLA 2G19A 1EUUA 1E5SA 1GWMA 4BXSV 1WLWA 3PJQA 2LS6A 1OQDA 3KZ4C 2VD7A 3ZYBA 1ZNPA 4A45A 2QQNA 3B5LB 4W4ZA 2C24A 4QMAA 2GP3A 3RRDA 3FC0A 2OT7A 1W39A 2ARAA 1X50A 1UU4A 5A6ZA 1MQTB 4LHKA 4G3YC 2YC0A 3IIIA 2WZR3 4M4RA 2E32A 2RE9A 5ISLA 2B7YA 3T09A 2VW0A 1AYN3 3ZSMA 4XMAA 1W9YA 3K3NA 3ITQA 1I9RA 1SACA 1AYM3 1Z7S1 2A6VA 3N36A 4Y1XA 4AF9A 2X53S 5LEJA 5I0DA 3H7YA 4JX0A 5FJKA 4ISRA 4MZUA 4CDQA 1SLCA 4LITA 3U78A 2HKXA 1YLLA 5D1IA 1F31A 4RYDA 4D69A 2BVVA 4YRDA 2QUOA 1V9U2 3AL6A 4Z2AA 4Z07A 4NIGA 2F6BA 4QPIC 4C0BA 3ZR5A 1OF3A 1US3A 2YXSA 2P4EA 4AVAA 5F39A 4KBZA 1W8FA 3HQRA 4P9LA 2RS31 3WD5A 1IQAA 1RMU1 2GMEA 2F4PA 3TNQA 1SPPA 2C4XA 2D44A 4Q26A 4H2AA 1H8TA 1LESA 4K40A 4Q0UA 1GLHA 2JD4A 3USUB 1QOOA 4AQTA 3IMNA 4IEOA 2E26A 4OCTA 4Q2FA 1WMFA 1HV1A 1UL9A 1UU5A 2PAEA 2DFCA 1H2LA 1SEFA 2VTXJ 2ILMA 3H3LA 1RXGA 5I8SA 1YUDA 2QKDA 1XOYA 3AP4A 3CLPA 2OYZA 4QXBA 5D8AC 4I0AA 5A1FA 2XDVA 1TVGA 4PHZA 3ZMOA 2RS51 3W21A 5BNOB 2EXKA 2CAUA 4K3UA 4NO4A 2LROA 5T55A 4V2WA 4V2VA 4XJZA 3OY8A 3S7EA 4AQSA 5DUWA 1NXD1 1R093 2GC0A 3LOBA 2R071 5FPAA 3ELNA 4YW3A 3PIJA 5J37A 1JZ6A 4QD2A 1OA3A 5ACA2 4HOOA 4BLIA 4DXZA 1SLTA 4AAPA 4K1YA 1AR81 2VMIA 1O5LA 2G9ZA 2ZKNA 1QJY3 2P17A 3MUY1 2DURA 4GWMA 2VZQA 4S2HA 1DZQA 3ZXDA 2D6MA 5D21A 5IUQA 4HBNA 3NV1A 3WCRA 4DXSA 1CX4A 4KNCA 4META 1UYZA 4MGIE 2WAOA 2I2SA 3ETQA 4JGYB 2AH2A 1AL23 2WLQA 4JC1A 4LBNA 1CR7A 3EJKA 4NIAA 4CUBA 5C3SA 5EYXA 1LHOA 2VNVA 2VMCA 4ASKA 5K0UC 1MR5A 3VV1A 4MGZE 4IV1A 3M1HA 3OF1A 2LUWA 1PM7A 5FZ6A 2HWF3 3J8F1 4NAMA 4J6GA 4B8EA 2WN2A 5BYNA 2VVEA 1RYYA 1W8NA 3SXWA 4ZHNA 2QBXA 4PI0A 2JX9A 1HKDA 1QOSA 1V70A 1GUIA 1PO22 2X09A 2ZX2A 3RFRA 4IQPA 5IVEA 2AYHA 3CMGA 5FZ1A 5AC91 5FZGA 1NYWA 5AFEA 3GZUC 1BBT1 5DUUA 4EWAA 5FWEA 3BI3A 2YFUA 1UOFA 5L7OB 1PNFA 4CCDA 2DUQA 1C5IA 1HXS1 2ZTNA 4OZXA 2DFBA 1ODMA 4LIUA 4JQRA 3RZKA 1TG7A 4Q29A 2QVSB 5LY2A 4AQ2A 4R4ZA 1SLBA 4F8AA 3TRSB 3BOWA 2YGLA 1JZ8A 1NCRB 1GQGA 2XVKA 2J1RA 4CU7A 4LBKA 4AEMA 1JZ2A 1LCLA 3W20A 2ZGTA 1UMIA 3B3QE 3EMRA 4O7XA 1PK6C 3DYMA 1O5UA 3RJ2X 4CE8A 3A23A 4Q4X2 5GLTA 3D4KA 4N43A 1GZCA 3VZKA 1QJFA 2ZJCA 3MYXA 3AX4A 3MIHA 1WLTA 4RHV1 1CONA 5JOYA 2C0ZA 4BJ0A 2QQKA 1SMVA 3AFGA 5IFPA 4N9HA 1AR72 4MHUA 3DCQA 1CJDA 3WR0A 2E53A 4YW6A 5A3NA 3PUAA 4B4RA 2W47A 4B7EA 1C3HA 3I49A 4BM8A 2XXZA 2JIGA 2GC1A 5CAZA 1RUOA 1LEMA 1V9U3 4BPZA 5FYUA 3LA7A 2FDGA 3SKJE 1KQRA 3LA2A 3KD4A 2WQZC 3AMNA 5FOJB 4IEQA 5FWJA 5KBFA 1HRI2 2VZ3A 3OPZA 5FO7B 5FZ4A 1GWKA 3O1TA 3RZGA 2ZGLA 2VCAA 1WLCA 3I3BA 4CTEA 5FXXA 1Z0HA 4NHLA 3VB9A 5A6QA 3ZXEA 4IEUA 1ULOA 1Q56A 3WP3A 1K12A 2RJ2A 4QB1A 2VBPA 4XVHA 1F15A 4XXAA 1OHFA 4YW4A 3FLRA 3ILRA 1LOAA 2ZZQA 4OQ8A 2GN7A 1QJU1 1IKQA 2YYOA 2VG9A 4LE4A 1JBCA 4Q4W1 1RUJ1 2R6QA 4BZ4A 3EYPA 4IE0A 2PXJA 5E88A 3WT3A 1QQP3 1ZBA3 5FY4A 4RR3A 1GYKA 2D97A 4COVA 4YLZA 3K4DA 1PO12 4HKLA 1TE1B 1ND3A 2G9GA 2QJVA 5FYBA 5FYZA 4AL9A 1VAMA 1VIWB 2VM9A 3U75A 3QACA 2CAVA 5C3QA 1JYIA 1WCKA 2XHNA 1HB3A 2TUNA 3W59A 2JDPA 2A6XA 5KHKA 4GB32 4WBBA 3J7HA 3J7MA 3VL8A 1LEDA 4QX2A 1W9FA 2VE1A 4PLOA 4QKBA 1WUVA 3D82A 4KMQA 1K5MC 2KXLA 4QQLA 1CWPA 4YZ5A 1J83A 3ACHA 3AM2A 2VNRA 4AZZA 2OW4A 2WZ8A 2AGSA 2VMGA 4P9YA 3TB0A 1DQ4A 2JWPA 2RMU1 3HR9A 3LKJA 2GN3A 4XDOA 5BNNA 1US2A 3FJSA 3GZTB 3JD72 3I2KA 4GKYA 2D6PA 3SH4A 2CY6A 4IESA 4PIXA 5LRSA 4XE9A 4MH0E 4TWTA 4FI9A 1XU1A 2WWJA 2XJRA 4BQXA 3RMXA 1F4AA 5F5CA 2YC2A 4LJHA 2Y64A 2VC9A 2P1BA 4XFAA 2E6VA 4RN5A 2XLGA 1BEV2 5JZGB 5LBFA 4OHVA 3LOIA 3Q8CA 4NHYA 5T54A 3NAPC 4CCCA 1PO23 1UX6A 2VO5A 3AYDA 3LCPA 4COYA 1MS5A 3OGSA 4RA0A 5C4WB 3RS6A 5L73A 4NE9A 4IL7A 2VH9A 3IDAA 4BQ1A 1W0OA 3UGFA 2R062 2ZMNA 2NZ9A 3VDDB 4CCMA 4BXFA 2H6BA 1UPSA 2FD8A 1RUD2 2HWE1 3PVOA 3I2OA 2RM22 4XAAA 2J7MA 3AZVA 4X8PA 4CU8A 2WNOA 4D94A 3INAA 4L8QA 3S7IA 2A71A 2GNDA 2UWBA 1COV2 3BB6A 3T08A 2FQPA 4FPCA 4CP1A 1XSQA 4K9SA 3TOJA 4CDXA 3AXEA 4KG0A 4QDRA 4WM8B 3VZOA 1PGW1 5DZFA 5FP9A 3VBHB 4Q4X3 1YQ6A 4Y5SA 4BA6A 2DTYA 2QDRA 3ASIA 4BWOA 1WD4A 2PHTA 2Y0OA 1NE4A 2WNUC 3CHXA 3LD8A 1RUC1 3PUSA 3VD5A 2WS91 5JVVA 2HBUA 2X5IA 4XETA 1AR73 1ULCA 3K51A 1VJ2A 5J48A 1MZEA 2WWUA 3C8XA 1ZZCA 2QNKA 2BOJA 1RVF2 4Y5Z0 4EN9B 2VXRA 5A70A 2VUJA 3ALQA 1O8SA 4RS5B 3B02A 1AR91 3IPVA 1C8M1 3KF3A 1W9TA 1XBFA 3T4HB 5BNPB 1OQEA 4I30A 1HRI3 5A7NA 1RC6A 2P3KA 4D8MA 3KV4A 3S5AA 5A3UA 2D40A 4ET7A 4CCKA 2JICA 4AGRA 1LR5A 1MACA 1HRV1 3ACLA 5CA6A 2EA7A 2W87A 5IK8A 4IV3C 4IUGA 4UWDA 5D2AA 5FYHA 1D7PM 4NIIA 1XE0A 1W8OA 2R7EB 4LBLA 5FREA 4JKKA 5I93A 1QIQA 1YJKA 3HVDA 3PU3A 4JTOA 2W0XA 1VRH1 5F7UA 3O1PA 2JEMA 1W6MB 3QH7A 4IXLA 4Q4Y2 3DYPA 2WSUA 4LLFA 5EJ3A 3OSDA 4GJYA 3BGAA 4PJYA 1HIXA 3FLPA 4I01A 4OUEA 3DV8A 3NMBA 4Q4V1 4PDWA 3GDBA 1Z7S2 2O8OA 5C8CC 1VAKA 4ZU4A 4QQHA 4UW6A 5JMOA 2JDMA 3DPRC 3SNMA 1ASJ1 2ZGRA 5LK7B 4P02B 4QX0A 3KSCA 2A3XA 3ZO0B 1RJ8A 1D2SA 1JMUB 1D2QA 2PTMA 3KT7A 1UKRA 3P3PA 4GB33 4FTBA 1C1LA 4QGLA 4NAOA 2HJIA 4QXHA 2IXJA 1S0FA 5A3OA 4YVWA 2C5DA 3M4FA 4Z82A 1R1ZA 5D8AB 2RS32 1RMU2 3NV3A 1B35A 3GHNA 1SFNA 3KQRA 4MXVA 5C70A 1ULEA 3JB4C 3CQOA 4XDPA 2XB6C 3JD73 4AEDC 4D7TA 4AGGA 1IOAA 1VBA3 3IIAA 1JYCA 3LF7A 4FPLA 3WF2A 4C1WA 4CEWC 1JZ3A 1X82A 2D6LX 2WNVC 1UZVA 1W05A 1ZZ6A 4QU1A 4Z2WA 5FQ0B 5C9AC 1JYXA 5CFCC 4MUVA 1H4GA 5DQ0A 4LHNA 4KGGA 2RS13 2ZZJA 3KCCA 3UGHA 4YM0A 4EV0A 1XU2A 1GQPA 5KHJA 1FATA 2CSGA 2RS52 3J7LA 5C71A 2OS2A 4BU2A 1U0AA 1JHNA 4UXAA 2HLEA 5IATA 2Y6GA 4QT6A 3UYJA 1MS3A 3O1MA 2PAKA 1VMJA 2H6CA 2R072 1POV3 2PHFA 4UFKA 2VVDA 1PGL1 1QXJA 2WFF1 1CVNA 5FMDA 2BP6A 3IAQA 1V6LA 2RDQA 3HN1A 3K46A 3ZPYA 1Q8VA 4OMDA 3VBUB 5A7PA 3OD0A 1ULFA 4R52A 2B9UA 2A75A 2A3YA 4MSVA 4BMBA 5K0UB 2RJLA 3ENRA 2EIDA 1RUD3 2YMZA 1UZYA 2VZUA 5IFTA 3AL5A 4CDQC 3ORJA 3T4VA 1XNDA 3R05A 1NY71 1PNGA 4GH4C 2E9QA 4YW1A 4JGZB 4NR1A 3GJBA 1CGPA 3D6EA 4V1PA 2GZWA 3C7EA 1N1YA 1EV12 1WCSA 5FZEA 5JOWA 3OBZA 4RQPA 1IHMA 5APAA 4DY3A 1GANA 3NJVA 3ZPOA 2XGXA 5JR7B 1VB4A 4ZU5A 3QOPA 3MLJA 3ZFGC 2QDNA 4AVTA 1A34A 1Y43B 2QQWA 1YFYA 3RZHA 4YW5A 4WVMA 2EXHA 2BWCA 1DGRA 4LNVA 3GCWA 3IT8A 1LGBA 4XF9A 3WVJA 1REFA 3VBOB 1FMD1 4HPKA 2ATFA 4LO6B 1V6MA 5CFDA 2JDAA 3B7MA 3MW4A 3MIDA 1RVF3 3OUJA 3TBDA 4KWJA 5F9TA 4E4DX 3MEPA 4HSLA 3I2HA 5C3OA 3N9PA 2CNAA 1BBT2 4HKWA 4WZCA 4AI9A 1MVEA 4YM3A 5A1LA 1UCXA 1VBD1 4N90A 5HBAA 2DBIA 1F5JA 2WABA 2L9LA 1QXRA 1BK0A 4F3JA 2K9ZA 4AGVA 1W2TA 3PLQA 1RUG1 3F95A 3GF6A 2PFWA 4NRQA 4Q1PA 1MS8A 4PBPA 1JS9A 1KFXL 2AUYA 4FOVA 3PDQA 1SLAA 5FPVA 3RI8A 2JG8B 2HWB1 5HCHA 4Q4Y3 1DFQA 4LTAA 1BLZA 5DDJ1 3BUCA 5CYYA 4URAA 2OUHA 1PZ8A 3LIHA 4K20A 4AFCA 1DP0A 1Z7S3 4EQVA 1W6NA 4FP2A 4Q5OA 3B94A 1JZ5A 1RL3A 2VBDA 4DB5A 5FZFA 1W6QB 3VHRA 1DZRA 2GH8A 1OOPB 4EN0A 3VZLA 3IN9A 5L19A 5CVRA 5IVVA 3MO4A 3HIFA 5C9AB 1F35A 1VBC1 5FP4A 3H42B 2J1VA 2RS33 3NW4A 1RMU3 3O0VA 4CCNA 1PZ9A 3DF0A 2HWD1 3VL9A 1F2NA 5FYSA 1UXZA 3RQ0A 4BYYA 2WA4A 2BU9A 1QJX1 4XFHA 1N47A 5A3PA 3X29B 5CISA 4W6XA 3I97A 4D6RA 3I3DA 4JKMA 3WF4A 4BQYA 2Q8DA 2BZDA 3H1MA 5GZDA 1QJU2 5EFUA 3KVBA 4YGBA 3NAPA 4Q4W2 1ZYBA 2QQJA 2UY8A 1RUJ2 2J1EA 5LBCA 3ZXKA 2DVFA 1OKOA 3OYWB 2VZSA 4M0HA 3NSTA 3RZLA 1JYTA 2W9XA 3I59B 1S2KA 2V09A 3TEYA 2RS53 4OI1A 1OXCA 4EYUA 4B7KA 1RUE2 5IWFA 2GC2A 2GNBA 2ZABA 1U5ZA 2K0GA 2OZJA 1OPMA 2D7FA 1EP0A 2PLV1 4FQ4A 4MVTA 5JSRA 1PX3A 2WO7A 2GSYA 4CPBD 5ABJB 5JSPA 2R073 4CXXA 2ARXA 4P5HA 2D98A 4ZS2A 3GGLA 3GBFA 2W52A 3FLTA 4N43C 2FCVA 3GYDA 3T0AA 5JI9A 1I5PA 3R4UA 3LSDA 1YXWA 1AR83 1RUH1 1AX1A 1HQWA 2FDKA 3A22A 2JG9B 3NRUA 1H6XA 1Q5OA 2Y34A 3AKRA 3GZAA 5EIYB 3FFQA 4HVQA 1XNCA 3TN91 4PI2A 1M06G 4EWEA 4MXWB 3WZ1A 1V6NA 4FPGA 1RJ7A 1XRUA 2A3WA 4XQ4A 3O1RA 2UURA 1OFNA 1YFXA 1ZZ7A 3MW2A 1W8UA 4A7KA 2WDBA 1EV13 4XF0A 3UT0A 3RZMA 4QKNA 2D6OX 2PHUA 5F1RA 2VQAA 2YV8A 4WM7B 5JWPA 1VLNA 4FPEA 3VHPA 1YC61 5JOXA 2WYSA 1LGCA 2OIIA 1TNFA 3J8F3 5E6HA 5LK5A 4D6QA 4G4FA 1I1EA 5A33A 3C2UA 1CAUB 3L9JT 3VHOA 3AJYA 5DXDA 4D3WA 3VBRC 4JDNA 4LEJA 3JUUA 1LJ7A 3T1MA 1ZREA 1QKQA 1T6BX 1UO9A 2GMMA 1ZBE1 2YZ4A 4IV3A 4LULA 3ZXJA 2XJSA 1O3RA 4RR3C 5AC93 5LZ6A 4PLMA 1NZIA 3HBKA 1BBT3 4HSJA 3ST7A 1RUI1 5I8TA 4BQ5A 3ZFEC 1KD7A 4CUCA 5E1RA 3LPGA 1ND3C 1UYYA 2QQOA 4Y22A 1QJY2 3HD8B 2YHJA 2V73A 3ABZA 3GM8A 1R1A1 1HXS3 5FMOL 5FYMA 2VCMA 3S6PA 4YVSB 2PHLA 3W58A 2WNEA 3OTFA 4LA3A 2FMDA 1DG6A 1DYKA 2H0VA 2EIBA 1CAWB 4DOUA 1ACCA 4L92A 3GNEA 5A7WA 4ZONA 3M3EA 1PGW2 4QGMA 4Q0VA 5FP8A 4ES8A 4URTA 5HXVA 1WMDA 5KXBA 5HCAA 3A0KA 3RG0A 2NYYA 1GV9A 5JOZA 1NX9A 4IW3A 2DF7A 5EP9A 2CTVA 5FZMA 5BNNC 2WS92 2KM2A 1W3XA 5HPOA 1H1AA 4MGTA 1A78A 2WUHA 5IVYA 4MYEA 4UFIA 1NLSA 1OVSA 3WUDA 1NUKA 2HEWF 2IVIB 2XJVA 3SC7X 1ZRRA 1G8WA 1GZTA 3OGJA 3RDIA 1DBNA 1PIV1 4CEWA 1C8M2 1J58A 5C9AA 3C7FA 4AI8A 5CFCA 4QM9A 2ZHMA 1MQTA 3I3QA 4QPGB 4CCEA 3HNBM 4I0BA 4W65A 2RR11 1MEC1 1UPIA 4YFZA 4DUXA 4JZRA 2NQYA 4Q0QA 1Q3EA 4A7YA 1OUXA 4BQ3A 2E51A 3H8OA 1GNZA 3BKZA 1G9FA 4L11A 5F6KA 1QJU3 4LT5A 2E7AA 4Q4W3 1RUJ3 4QDQA 4YGDA 3CO2A 1WBLA 3TWIA 2W1SA 3KCXA 2GMPA 1G7YA 1UNBA 4Q4V2 5IVFA 5JXJA 4DMIA 5JUVA 5J3UA 1Y7BA 1RUE3 1S0CA 4HONA 4YG0A 2WJSA 1QHDA 3MV11 1ASJ2 4FOYA 2OA2A 3PTRB 4MV2A 5FZCA 3RWKX 4EWDA 2BWAA 2JE7A 2WO3A 3M3QA 3R6SA 5FZ3A 4FCAA 4CDXC 4F7ZA 2ZX4A 4LBQA 5L9RA 4E2QA 5M0TA 4GH4A 2AC1A 2V4AA 2IXHA 1UOGA 2B46X 1O4ZA 2PMWB 2VNGA 5JAXA 2GNMA 2AREA 3WY6A 3CIHA 3WNPA 5FZ7A 1AZDA 3NNGA 5IT6A 2X5IC 2JKBA 3S57A 3ZFGA 5SV5A 3GXUA 5CB7A 1V6JA 4UW5A 1OURA 1D4M1 1YYNA 4IEVA 5T5LA 2RMU3 2Y8KA 5J96B 1JODA 1IZ3A 2ET1A 5BNOA 1NOVA 1NAEA 1AHSA 1OH3A 3CJIB 1KJRA 3B93A 4R9BA 1SQ4A 1F4HA 5J7MA 3BIWE 3DXTA 3RYRA 4A42A 1KRIA 4MGQA 2ZAHA 1ST8A 2QQVA 3OGVA 2XHKA 4XHBA 4CDWC 2DU1A 1L7RA 1QQP2 1UYPA 1ZBA2 3POSA 3P1IA 2Y33A 3QCWA 4HK8A 4TSVA 3WP4A 1UY2A 3HEIA 2BRTA 2W3JA 4P14A 2A73B 4B1MA 3NWKA 1JZ7A 4CP9A 3MGUA 2AR6A 4JDMA 4LMFA 5GZFA 1YFWA 2DUOA 4GIQA 2XVLA 4FPHA 4JV4A 1AJKA 3GBWA 3N9OA 3FFZA 4XW3A 5T52A 3O1SA 5A7QA 3WUCA 2ORZA 4YFWA 2VY0A 1QF3A 3C3VA 1E5IA 5B4NA 4Q8LA 1U5XA 3WW2A 1N1TA 2VJXA 4PDWC 4JGYA 3VKLA 1W9SA 1AVBA 1SPPB 2WZEA 4QX5A 2BOIA 4KWKA 2HWE3 2AACA 1H8TB 1ZZ8A 2ZHNA 3ZXGA 4AHXA 4FPOB 2ZX0A 5DAWA 5DZEA 1NY72 2YBPA 4R4XA 4EN6B 2GH2A 1JI6A 4QX7A 4Y26A 4OHXA 2VGDA 3N35A 4UFMA 5FXWA 1D0GA 3C7OA 4YVWC 1RHI2 5FO8B 2W5FA 2JKXA 3BN6A 3E6DA 5FZDA 4ZXKA 5LA0A 1HLCA 2VZOA 3MF6A 1B35C 2VCCA 4QQPA 4XBQA 2YU1A 4ONUA 1MS0A 3WNMA 1RUF1 2G4IA 1RUC3 1FNZA 1LNSA 2WS93 2E63A 1DGWA 3OY8B 4CZSA 1YI7A 3ZSEA 1FMD2 3NKGA 1H4HA 5L7OA 3E6BA 5IVBA 1WA6X 2XH6A 4XZUG 3FHQA 4TLFA 1YRZA 3Q8BA 1P8JA 4HLTA 4XFIA 3VZNA 3PUHA 5FK7A 1AR93 1JUHA 1C8M3 2YGMA 1CJPA 1QNWA 1VPHA 2YY1A 1I6XA 4NHMA 4L9BA 1DYPA 4N53B 1VBD2 1XNKA 4AFMA 4M3CB 3MF9A 4NRPA 3E5QA 2B5HA 4AVVA 3NJXA 5DAXA 5L9VA 3KM5A 2FZ1A 3IDCB 4BQWA 3CDZB 3SH5A 3AC0A 3FBYA 3HAGA 1HRV3 3LEMA 3SCFA 2I74A 3WW3A 4TZDA 1GR3A 1ND2B 3PURA 3RI9A 2Y6JA 5LY1A 1TME2 1U12A 3AZXA 1AXYA 3EB7A 3L2HA 2HWB2 1VRH3 3B01A 3IAPA 1R081 2BQPA 1UYXA 5DDJ2 4IV1B
chains in the Genus database with same CATH topology
1QGLA 3AKQA 1S0BA 4Q4V3 2ET7A 3VBSB 2EALA 5JSOA 4PBOA 3JQWA 5JIAA 1EYBA 3FX3A 1ASJ3 2ZCWA 3AB0A 1SCSA 2Z79A 4CDUB 4RQPC 3WQ1A 1SLLA 2D3RA 4XILA 5B2GB 4DFSA 3AKSA 1IS3A 3FMGA 3FWEA 3H0OA 1PVC1 2HWD2 2WSVA 1FAYA 5CFDC 1APNA 3JBG1 3MPBA 2R041 1NA1B 1N3QA 3NO8A 5C8WA 2QZ3A 3VBRA 2Q30A 3JZVA 4BCUA 1LHNA 1Q8SA 5CG9A 1IS5A 3WHUA 2DVAA 4NWVA 3ZFEA 1C4RA 1NE6A 3H50A 4F83A 4HN0A 2IXKA 1C1FA 2BUKA 2Z2SB 1JH5A 2DCTA 2GALA 3AFKA 4XFCA 5BPXA 2VOWA 4ORFA 3ZYGA 1RUH2 2ZX1A 1H30A 1AYN1 3DUIA 3O5SA 1YWKA 3THTA 3TN92 2BTVC 2XJTA 5H9RA 1HX6A 1Q8QA 1LB2A 2WKKA 2DYCA 5EWSA 2EXJA 4O9EA 5CIRA 2BFUS 1DQ6A 1VBA2 3WQ0A 1G9DA 3KT4A 5JZGA 4PLNA 3Q9OA 2VNOA 4H7LA 1RHI3 3WOGA 4ITCA 2ZOEB 2BPA2 4Y20B 4CEYB 3V0BB 2RS12 5C4WA 5K7PA 3W9AA 1DQ0A 4FTSA 2Q1ZB 3ZFFB 4XFGA 3BCWA 4AQ6A 1FMD3 1U5YA 3BOPA 2XG3A 1J3PA 2FHRA 4U2AA 1ZBE2 3V0AB 4HL0A 1SCRA 2ZGKA 5KC5A 1VBD3 1AR61 2YROA 4WM8A 2ZGQA 3H9AA 1WW6A 3VKOA 2NMNA 4B29A 4FPFA 4GULA 3EO6A 3WXPA 3H1YA 2MEV1 5K9YA 1OI6A 5LRRA 4M3CE 1TME3 1S2BA 2HWB3 3ZYRA 5I0RA 1LHUA 3UKVA 1BMV1 3PMSA 2YPJA 3AMMA 1EAH1 5DDJ3 3AYAA 3IDEA 4KQ7A 3VBFB 4FSJA 1SBDA 1LECA 2UWAA 1XYOA 1A3KA 5BNPA 1O91A 5KXCA 5IK5A 1S0EA 4WVWA 4XTMA 4YZ2A 1S1AA 2ZGOA 5AVPA 1DF0A 1VAVA 4AYUA 1J1LA 1PIV2 1VBC3 2FMYA 1WW5A 2ZPXA 1C5HA 1NCQC 2IXIA 2OUJA 4CDWA 4GWNA 2HWD3 1FXZA 3ZN4A 3H7JA 4OI2A 1QJX3 1DQ5A 4UW4A 5GLVA 2HWF1 4FQZA 1RIRA 4RD7A 3PJYA 2R0FA 4IEWA 2PQQA 4H14A 1YHFA 1G6NA 3VZJA 3EXUA 3AXDA 3ZXFA 4QPIB 4ISQA 5KXDA 4W6WA 2A70A 2GC3A 5FLIA 4I09A 3BODA 1SFYA 4XZPA 3J9SA 2NLRA 1POV0 3OGGA 2ZS6B 4LBMA 3O7OA 2BYVE 4HKOA 3VHNA 5CADA 2PLV3 2ZX3A 4L2NA 3U11A 4YYOA 1MS4A 2H0BA 2Y0IA 3ZVXA 1C57A 1GZ9A 2XJUA 4BHPA 2WC2A 1S55A 4ES9A 1RUH3 1HV0A 5FQ0A 2HYKA 1GBGA 3KGLA 4COWA 3VKNA 3TN93 1D4M2 3FHIB 1IKPA 3J4UH 4M0NA 4XJAA 5DG1A 5JMCA 4FPKA 3ZDSA 4Y1VA 2BNOA 4ZU7A 3A4UA 3WV6A 5BXXA 1YJLA 3AZZA 5E8AA 3CNAA 1MQTC 2Q8OA 2NPIA 4XJ9A 3KLSA 4GA9A 3BU7A 3VBUA 3PNAA 4YZ1A 3QLQA 4XJUA 4ATFA 1LHVA 2NN8A 2IFWA 1D0HA 1Y3TA 5E16A 4L97A 5IK7A 5JLVA 1URXA 1WA4A 2R30A 4LBJA 1H2KA 3WQ7A 2ARBA 1ZBE3 4FAGA 5FTTC 4R9DA 4JGZA 4OI0A 1AJOA 1GKBA 1RUI3 1AR82 2I45A 2VQ0A 4I3PA 1RTVA 4I0WB 2DWRA 1R1A3 2P3IA 3AMQA 3SCHA 4PIZA 1KS4A 2B45X 3AMHA 2YUEA 3AYCA 3WW4A 3HWJA 3ME2A 3VBOA 3WG4A 4LE3A 1ONAA 4M3CF 3MLLA 2VPVA 3WLUA 5ACA1 2DUPA 4AG4A 4M00A 4OFGA 3D0SA 3MFAA 1LHWA 1RUF2 4Y4YA 3J8F2 2JJ6A 4K1ZA 5BNOC 2UU8A 2OZ6A 1GQHA 1G9BA 2VW1A 4OI4A 1CAXB 3M70A 1MZFA 3AP5A 1FYUA 1PIV3 2A6YA 4LLOA 3EQEA 2D43A 4BE3A 2I07B 1X8MA 5AC92 4XF3A 1PK6B 2JG8A 1FV2A 4XIKA 5GZCA 4RGAA 3BTAA 3KB5A 4L99A 2RR13 1W0PA 1MEC3 1WW4A 1HXS2 3CF6E 4S2FA 4E4SA 4HMZA 2D5FA 5FLJA 3LGRA 1U5IA 1VBB1 4GXLA 1LU2A 2HWC1 4Y1ZA 3JCIA 1PO21 1W6QA 3D0JA 4JGYC 1W6OA 1BVVA 1R082 4NWWA 3EBRA 4P9XA 3QBQA 3JB8A 4WVMB 2JENA 1WW7A 4RHV2 5A32A 3N3HA 4CRQA 1MS9A 2XBO1 3ZYJB 5KC6A 1H1MA 2WLPA 3J26N 1RINA 5I91A 4Y1YA 4YM1A 3VGIA 5JPNB 1AX0A 3PHMA 1NZCA 2AZ5A 1LENA 3POWA 4KWLA 1EY2A 1TEIA 4ATEA 2YDEA 1UU6A 2JE9A 1DIWA 2KA3A 1CAVB 2Q1MA 3AK0A 3OYWA 4SBVA 3WNXA 5L7OC 2BNMA 1D4M3 3EHKA 4QXKA 3I59A 1L3JA 1UIKA 2XJQA 1AUYA 2R042 1XXNA 1AR71 2XLAA 5SV8A 1H9PA 1QY4A 4YZ4A 3PTYA 1NCRC 1ENRA 1ENSA 2DU0A 4Z8BA 5ABJA 3O0WA 2AENA 2V5YA 1N1VA 3NKTA 4XBNA 4X6QB 2RJKA 1RGSA 1K5MB 1YCIA 3WP5A 2VMHA 1LOFA 1O4YA 3N7LA 2ZAAA 3ZSLA 2JG9A 2PA7A 4DMIA 3SMHA 3RSJA 2VU9A 1OKQA 4MXWA 1ULGA 2ZGPA 2HEVF 3RWNA 3ZN6B 4DZGA 1S0DA 2PHWA 4COZA 3UJQA 1AX2A 1DQ2A 4YSFA 1PO11 2Z69A 1BZWA 4WM7A 4D7YA 4Z1VA 1ALYA 1Y9QA 2RMU2 2E7TA 3AZYA 2LM3A 1LOCA 4K7JA 3NAPB 4XJWA 4AHZA 3KGZA 1CAUA 4LO8A 2MHFA 1N3PA 5KWRA 4GB31 1W2UA 4QPYA 1IPJA 2TEPA 4XJ8A 3RZZA 1NCQA 2ZBJA 1RUF3 3JU9A 3G6JB 1J59A 4UW3A 1BK1A 1VB2A 1XE7A 3QD6A 4YVSA 3ZYIB 2Y26A 3RPQA 2X8KA 2WL1A 3MI8A 1CAWA 4YM2A 4HK9A 4N7UA 5GZEA 3MW3A 3ECQA 4MLOA 2TBVA 4A2UA 3M2MA 4Z92B 4A3XA 2HWE2 1W6PB 4TYSA 3E5XA 5T5JA 4EROA 2WNUB 5J09A 4DPNA 3FUQA 1BEV1 4I02A 2XUMA 2G9FA 1NQDA 4GALA 3ZN5A 3BPZA 1LOEA 1LU1A 1F9KA 1R083 4QQOA 4XYXA 1EAH2 5IK4A 5CNAA 1NG0A 4JAAA 1F5FA 4RHV3 2R061 1MZ5A 1JOJA 2JDZA 1RUC2 2XJPA 2RM21 4QPGA 5JZGC 1BCXA 4IV3B 1COV1 2ES3A 1FPN1 1H1IA 5FRAA 5GJ6A 3U10A 5C4WC 1AR92 1C28A 4XOGA 1NQJA 1GZWB 1QXPA 4P9WA 1PVC3 4Q8KA 3VDDC 5EZWA 3URFA 1DGWX 5C8CB 2VUAA 3JBG3 1UN1A 3DPRB 2WQ4A 1HRV2 2R043 4JRLA 3HT2A 1YO8A 4YZ3A 2EAKA 1BKZA 2D5HA 3WDVA 2ZGSA 3MZHA 1VRH2 1LOGA 1ZRDA 4WM8C 3HQXA 3R0RA 4FBFA 4MGKE 2CYFA 3VBHC 1YI9A 4FT8A 3VN4A 3SCGA 5I0TA 1UD1A 2K2SA 2CGOA 4HT1T 3CU7A 1AL0G 2WINB 1ULDA 1KITA 3N7JA 2BEOA 3I54A 2PHRA 1EPWA 4AEDB 1ZA4A 1LKNA 1UAIA 4CEWB 4XFFA 2WNVB 1XYNA 2MNGA 1PHMA 2ZACA 3FE5A 3H8UA 4RS5C 5H9QA 3SLIA 3USUA 4AEJA 3CJIA 4B4PA 4IEPA 5C9AB 5CFCB 1IPKA 4Q4Y1 5BNPC 4PIYA 5BY5A 3O14A 3MIFA 1O3TA 2QQPA 3IM0A 1Q8OA 4R9AA 3H3UA 4LA2A 5FOBB 1GFF2 2PN5A 1XNBA 3E6CC 2ERFA 3AP7A 2O1QA 1OD5A 1O3QA 2IWGB 1H0BA 2DCJA 3ES4A 1C8NA 4CP2A 3NVCA 4KU8A 3VLBB 4HZFA 4CDQB 1VBE1 5AFBA 1WBFA 1H8VA 1AF9A 4GQ7A 4LBQB 4XHXA 3LA3A 4GH4B 4KH9A 1F8VA 3M3OA 4QU2A 1PGL2 1CD3G 1G9CA 2WFF2 4FAHA 3DL3A 2ZMKA 2UYAA 5J36A 4FO9A 2ZGNA 3ILFA 4WV8A 4CP0A 4LBQD 2IC1A 5BV6A 1AR63 3ZFGB 1BQPA 1UZZA 3NJZA 2OPKA 5F5QA 1ZRFA 1CIWA 1ENQA 3AZWA 4B3NA 2Q5TA 2DVDA 3HMYA 3AJZA 1SLIA 2HEYF 2MEV3 4P9GA 4AFDA 4P9JA 3AP6A 2Q4SA 2C1FA 4RFT0 4GMP1 1X33A 5J98B 2XWBB 3RMYA 3AYEA 2CGNA 1EAH3 2PAMA 3SH3A 4C0HA 4U36A 2CWSA 5JDBA 4JTNA 4LO7A 2EXIA 1WD3A 1X8EA 2CV6A 4N53A 4AVBA 5CBLA 2W68A 4M3CA 4ASMB 4HANA 4AI2A 3OCPA 1YIPA 2P37A 1A8MA 1DQ1A 4XTPA 4XXPA 5L36A 4RGGA 5EXOA 1ND2A 1ENXA 4AHYA 2VOXA 1EV11 2W08A 1NCRA 3VBUC 3WX5A 4XQWA 5DG2A 2QFEA 1LULA 4XPVA 3AKPA 4XF1A 5JCTA 1WCDJ 1SBEA 4XBLA 3H3ZA 4NN0A 1RUG2 2WIIB 1KDMA 3VBSA 2XVGA 1VBB2 1H2NA 1I5ZA 2HWC2 1QNYA 4JGZC 1QOTA 2B42B 4KGQA 2A6ZA 1REDA 1J1TA 2XL7A 4CDUA 2WWSA 1UKGA 3E5UA 3N4MA 4AWDA 4YARA 2XBO2 3KT1A 4FP3A 1KJLA 3MDPA 3GHMA 3VBOC 4KBBA 4D7SA 1O7FA 1TQ5A 1NA1A 1WGPA 2XWJB 4AW7A 4FPYA 1QH6A 1V6OA 1VBC2 2E7QA 2ENRA 2R16A 2DCZA 4OLLA 4Q0SA 1UW8A 1DLLA 4J1WA 3VUOA 1DGRN 1QJX2 1B09A 1FOD1 3WDTA 1UMZA 4COUA 5T5OA 1TMF1 4FXKB 2JG8C 4N43B 2IXLA 1D4VB 3FZ3A 5KHIA 4AI1A 5CU1A 1UF2C 1ZX5A 2XL9A 4XEZA 1IS6A 2PLV2 3TYJA 3V65A 3G7DA 3ZSKA 4OUSA 5KHGA 2WZPP 2WT2A 2BGCA 5K8SA 1OOPC 2WFF3 3DKWA 3MIGA 4FPJA 3ZIWA 3O12A 4FTEA 3I2DA 1GSLA 2WZR1 1VR3A 4AI0A 4Q1RA 3WDXA 2GAUA 4Y20A 3GALA 4CEYA 2DCYA 3V0BA 3KMHA 1AYM1 1XYPA 1RUE1 2GDFA 3ZFFA 3VBRB 2ZHLA 3ZMNA 3L2YA 1JUIA 2ZHKA 5DZGA 1FV3A 4RR3B 1XE8A 5ACA3 1ZRCA 3V0AA 1LOBA 2XPJA 3ZFEB 4XQDA 3M8LA 3ILNA 1ND3B 4LUKA 1QDOA 4SLIA 3WG1A 2BBVA 1OMIA 3B69A 4YG6A 3VDDA 4AFAA 3ES1A 2PELA 4A7ZA 1GNHA 3VKFC 4BIOA 3QH6A 4PQ9A 5ABJC 3VKMA 4INDA 5AVAA 1CESA 1J3RA 3MIBA 4PF5A 4C91A 3U0ZA 1JN2P 4AI3A 1DU3D 1OFSA 4K21A 3ZX7A 1RUI2 4OVEA 1QJZA 2GNTA 1MZ6A 1LOFC 2SBAA 4HVOA 3WCSA 2JG9C 3VBHA 1R1A2 2N7GA 4WVZA 1RUG3 5BNNB 3VBFA 4S2DA 5A3MA 2LALA 2VOVA 3D8CA 1S0IA 2VW2A 1VBB3 2O8QA 5DUXA 2HWC3 4FOWA 3GBGA 4OHYA 3WW1A 1R091 1QH7A 1S0JA 4LO4B 1FX5A 4P9IA 5FCCA 1AXZA 4RS5A 2D3PA 1ZZ9A 3UV9A 4WM7C 4DINB 4AE2A 4BOWA 5A3LA 2XBO3 1QJY1 1UIJA 1H2MA 5FPZA 2A6WA 4BMEA 5JIUA 3H1WA 1FPN2 1Q8PA 4E4ZA 4NOTA 1AL21 1VP6A 1YNAA 1RB8G 1W6MA 4QPIA 4IEXA 5T3NA 5C33A 2RR12 3R4SA 4YW2A 4DQAA 1MEC2 3WG3A 2WT1A 4YVSC 3PVEA 1V6KA 2ETEA 4CDXB 1HQNA 3I7DA 5T5PA 3IDBB 3AMPA 4ASLA 3M3CA 2VVFA 3UK9A 4B4QA 4AHWA 2X5IB 4Y1UA 1BVP1 5D8AA 2IFRA 4NPRA 2QZ2A 2CGPA 1FNYA 3SISA 4HFSA 4FVVA 5FLHA 4QGNA 3WP6A 4DRVA 4BIFA 3WG2A 2B39A 5FO9B 3ZXAC 3IPVB 2VECA 1QMJA 3ZXLA 3RJRA 1Q43A 3WDWA 4CDWB 4MGYE 4Q27A 4EJRA 5KXEA 4CYDA 3MICA 2DCKA 5E89A 5FAXA 5GLUA 3WINE 4QPGC 1PO13 4LUMA 4PCRA 5EYYA 4WVVA 4JCKA 3AP9A 3V64A 4LBOA 1BYHA 1SDWA 4H3WA 1I3HA 2JXAA 5I8YA 3I8TA 1V9U1 2SLIA 4H55A 3ZSJA 1E57A 3NL1A 3P3NA 4XF4A 4IETA 4LR4A 4PDWB 4RSUA