1RITA

Crystal structure of peanut lectin in complex with meso-tetrasulphonatophenylporphyrin and lactose
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ritA00
1UZYA 2R0HA 2Z42A 4YM1A 5DZFA 5DUUA 2ENRA 1F31A 5JLVA 3SH4A 5H9RA 4YW4A 1DQ0A 4YW5A 3AYEA 2E7TA 2ZGPA 2EXHA 3ILRA 2ZHNA 4BMEA 1WCSA 4DS0A 3WUCA 3AYCA 3NWKA 1LEDA 3OJBA 3AYAA 1LHNA 3AP6A 4Y1VA 1C4RA 1LOBA 1UZZA 1PZ8A 3V0AA 2EALA 1LHUA 2D6PA 1VAVA 1O4ZA 5T5LA 1CVNA 1UPSA 4UW3A 2GNBA 1IOAA 4XIKA 4C1WA 1WLCA 5GM0A 3WDWA 2D6LX 4AWDA 2W68A 4U36A 2ZGNA 1VIWB 3MW3A 2A6WA 2ZMLA 2PHFA 2ZGSA 2D3RA 1LGCA 2VU9A 5F5QA 2NM1A 2SBAA 1RINA 4YW2A 1N1TA 2DVDA 4FPHA 3BIWE 4XMIA 5E88A 3RMXA 3ATGA 2EF6A 1LOFC 1N3OA 5BYNA 2A7AA 3H0OA 3ZSMA 3M2MA 3POYA 2NMNA 3ZSLA 1BKZA 1BZWA 1AX2A 1OFSA 2UWCA 4YLZA 3VV1A 2OW4A 2R0FA 1HQLA 2ZHKA 3PVEA 4M3CF 4PF5A 4XXAA 4FPFA 5DXDA 1W0PA 4ISRA 4LBQD 1S0JA 1ULFA 1W6PA 3TB0A 4FPEA 5T52A 2P3IA 3D5OA 4AGRA 3LSDA 4FP3A 4OZXA 1YIFA 1WBFA 2P34A 2WQZC 4BPZA 1WUVA 2OUHA 1A8DA 2OVUA 2W08A 3UJQA 1LOEA 2A6VA 2YZ4A 4Q27A 2ZBJA 4YGDA 5IK5A 4W65A 1MS5A 2GN7A 4K1YA 2ZMNA 1ULCA 3WDXA 3FFZA 4LBJA 2GDFA 4AYUA 2P37A 1N47A 1BJQA 1GNZA 4I30A 1DBNA 1VALA 1SFYA 2VW0A 4XJZA 1WW7A 3ZSJA 1QGLA 5HCBA 2DV9A 3N7LA 1TEIA 2E7QA 1W6QB 1IKQA 1FV2A 2VH9A 2D3PA 1FYUA 1NLSA 1W6OB 2A5ZA 3PVNA 4K1ZA 4XTMA 5E8AA 4YGEA 1H30A 4TZDA 1MZ5A 2CY6A 3VKLA 2JECA 3WDTA 1HKDA 1JOJA 1MR5A 3NV4A 4LBMA 3WVJA 3USUA 1FATA 2V5YA 1LHWA 2D6KA 2D44A 1WLDA 3JUUA 5IK4A 1N1SA 1YXWA 2ZMKA 4GKXA 1Y7BA 2AR6A 3IPVA 5GLZA 3POWA 2ZGTA 3UL2A 4YZ1A 3B00A 4JC1A 4M3CE 2VY0A 1LOGA 2A6YA 3SITA 5JOZA 2RHPA 2WNEA 1SLCA 3AP7A 1G7YA 1DYPA 2WT2A 3AFKA 2A75A 1IKPA 1Q8VA 4Y22B 1DQ1A 2ZHLA 1MZ6A 2GNMA 2ZGOA 3AP9A 5IK7A 3OYWA 2H0BA 2KM2A 2DWRA 2VW2A 1W6NA 4UW4A 5CB7A 4M3CA 2W39A 5GZGA 1CR7A 2WKKA 5SV8A 5FRAA 5L73A 4CTEA 4CRQA 1S0FA 4XJWA 5DUWA 5T50A 2JJ6A 3ZYPA 3VUOA 4ASMB 3DGTA 3OBRA 1SLTA 4XIOA 1WW5A 3WUDA 3VKFC 4AVVA 2AENA 2Q5TA 4LBQB 2TEPA 2GALA 4Z8BA 1ZA4A 4Y20A 1LU1A 1SBEA 2PHUA 4ATFA 2LTNA 3AZWA 4YW3A 2FHRA 3BODA 3WHUA 3SNMA 2D43A 3WLUA 5JOWA 5KXCA 3V0BA 4M00A 3T1MA 4FOQA 3N3HA 2D6MA 1URXA 1MS1A 2CWSA 2R16A 3FUQA 2DTYA 2WT0A 3M1HA 1SLAA 4IQPA 3OPZA 4XJ8A 2A6XA 2R1BA 1GYKA 4K20A 4R9DA 1BYHA 1ULGA 4WVWA 4XXPA 1JBCA 3OBTA 4XZPA 3Q9OA 1QKQA 5FREA 1LOAA 2BQPA 3AYDA 1DQ2A 3WDUA 1H9PA 2ZAAA 2FMDA 2A6ZA 3M3EA 1QOTA 3IKWA 4YGCA 5DG2A 1Z78A 1DQ6A 1Q8PA 1H9WA 1XQNA 1S0BA 4FVVA 1D2SA 4YG3A 1W6MB 3AJZA 2PHTA 5GZFA 1ENSA 1FV3A 2P2KA 5GLWA 3MW4A 1G9AA 3M3QA 1AXYA 1IS3A 1WLWA 1KITA 3B01A 1V6MA 4UW6A 2NMOA 5CBLA 1I1EA 4WV8A 3LSEA 3OY8B 4FOYA 4LBOA 4BLIA 3HR9A 1SCSA 1NXD1 1N3PA 3WG1A 1O4YA 3AZXA 2WJSA 4ISQA 2WSVA 1GSLA 1G9CA 2PHXA 1ENRA 4FPOB 4PBPA 1BXHA 1JW6A 5GZEA 1UKGA 2G4IA 5KXBA 1SCRA 2PELA 3RS6A 4BLJA 1GNHA 4XBNA 3WV6A 2DVAA 2W52A 2AGSA 2ZACA 4NOTA 2YXSA 3RMYA 1DQ4A 4NO4A 4P9WA 3V0AB 4YM3A 4YG6A 2ZKNA 2GNDA 3N7JA 3ZXEA 1MS3A 1JYIA 2B7YA 3T1LA 3WZ1A 1FX5A 3A0KA 1YI7A 3I4IA 4H55A 4FPJA 4TYSA 2JE9A 4FOVA 2ZGMA 2PHRA 3ASIA 3N35A 4GKYA 4DQAA 4MYEA 5KXEA 1U0AA 5GZCA 4Y1UA 5IT6A 3B3QE 1GZWB 1LEMA 5GLVA 4YW1A 1ENQA 2AREA 2VW1A 1W6OA 1CN1A 3U4XA 5DZEA 1LHVA 4FP2A 1WD3A 1RIRA 3WNXA 1SBDA 4KBBA 1QOSA 3FLRA 5T5OA 5KXDA 1CIWA 4Y24A 2OUJA 2P3JA 1GICA 4XHXA 1DLLA 5DUXA 2E6VA 5E89A 3MEPA 1WW6A 1KJLA 4DFSA 1LODA 2ZGLA 3I8TA 1W6PB 1IS4A 3GALA 2YY1A 4YGBA 4DRRA 1QNWA 3MPPG 4Y22A 4Y26A 4P14A 4WVVA 4XJ9A 3R05A 3ZPYA 4HL0A 2DUOA 5F9TA 1UMZA 3WOGA 1DYKA 5JDBA 4XBLA 2V73A 2A70A 1B09A 3O0VA 1V6LA 5H9SA 2VUAA 1PZ9A 3T2TA 3KM5A 5JMCA 5H9PA 4LBLA 1G9FA 4XHBA 5JOXA 2DVFA 1V6IA 2E51A 2UWAA 1V00A 4FQ4A 3O12A 2EXJA 3AP4A 3UJOA 1LESA 5T5PA 1CJPA 3O5SA 4Q1PA 1VLNA 4LBQA 1G9DA 1RITA 1V6NA 1S0IA 2D6OX 2GMPA 3W59A 2D6NA 2XB6C 4ITCA 2ZA9A 1JN2P 1UL9A 1A78A 2DYCA 2NP0A 1HDKA 2AYHA 1ULEA 2GMEA 1LGNA 4P9XA 5HCFA 3PMEA 3AZVA 4YM0A 1G9BA 2CWMA 3UK9A 2CYFA 3WCSA 1AJKA 3NV1A 3ZSKA 2C9AA 3FBYA 4YFZA 2JE7A 3NV2A 4YG0A 3ZVXA 4D69A 4Q1RA 3QLQA 1A3KA 3KQRA 1MS9A 2CL2A 1ZM1A 1MS4A 3OYWB 4XDQA 2YROA 1BQPA 1W6NB 4F83A 3BOPA 4RA0A 1DQ5A 4M3CB 1IS6A 4YZ3A 3AXEA 1CESA 4XBQA 2SLIA 2I2SA 1C1FA 4UW5A 1W6MA 2ES3A 4C1XA 3A0NA 3ZYRA 1AJOA 2A3XA 4Y1XA 3LCPA 5GLTA 2UU8A 4GWNA 3AX4A 3O0XA 5EYXA 5GLUA 1AX1A 4FPLA 5T54A 1WW4A 4BOWA 4BMBA 2R1DA 3ILFA 4Y20B 3OY8A 1AZDA 1CQ9A 1S0GA 1LU2A 2A3WA 1DFQA 2C5DA 3AZZA 3B69A 3N7KA 4GALA 3D4KA 1QDCA 3RSJA 3V0BB 3C2UA 3POSA 4JCKA 4PQ9A 1FNZA 3WG2A 1Q8OA 3WG4A 1APNA 1CPMA 1N3QA 4AVTA 2DTWA 4XJAA 1LOCA 2GMMA 2WLQA 4U2AA 3CNAA 1LULA 3A4UA 1C1LA 1UX6A 1SLIA 4Q8KA 3QCWA 1V6KA 1QOOA 1JXNA 4K21A 1W0OA 4FPKA 4LBKA 3IMNA 1C57A 3JU9A 1UAIA 3O0WA 1LHOA 3BTAA 2DU0A 4FQZA 2XG3A 2WT1A 1S0EA 4HANA 5CA6A 5JOYA 3OGGA 4YZ5A 3AK0A 4XOGA 1Q56A 2JDZA 3N36A 1OKQA 1R1ZA 2E53A 1JHNA 5DUVA 2DUPA 3NV3A 2ZABA 3MW2A 2VXRA 3WG3A 5EYYA 1S0DA 1LENA 4XTPA 5HCAA 1GKBA 1LTEA 1KDKA 1X50A 1AX0A 4BQ1A 1WD4A 1GZWA 3M3OA 4WZFA 3INAA 4CZSA 1GBGA 3D6EA 2ZZJA 2EXIA 3VKNA 4GWMA 3HMYA 1DGLA 1LGBA 4PBOA 4R9CA 2CTVA 1HLCA 2PHWA 1VAMA 5H9QA 4DRVA 4Y1ZA 4FPYA 1W6QA 1LJ7A 2D7FA 3SISA 1QF3A 1ULDA 1YO8A 2A71A 3RG0A 2NZ9A 2D3SA 4FOWA 3APBA 1I3HA 2DU1A 5DZGA 1UN1A 4ZXKA 2AUYA 3IN9A 1LECA 1Q8QA 2HYKA 2R49A 3FUOA 3WDVA 2EIGA 2GNTA 1KJRA 3V65A 3AP5A 3ENRA 2AH2A 2ZGKA 3FLPA 5CAZA 3R4SA 5JVVA 2EAKA 1AXKA 2ARXA 1S0CA 4Q2FA 3VKOA 2ERFA 1GLHA 2ZGQA 4GA9A 3RQ0A 3W58A 3DUIA 1MVQA 2DVBA 3B9CA 4Y1YA 1GANA 1EPWA 1SLBA 3PJQA 4GXLA 5EWSA 4FPGA 1F5FA 2UWBA 3GNEA 4YZ4A 5T55A 2ARBA 1SBFA 3WDYA 4YFWA 4FPCA 5GJ6A 1GZ9A 1MACA 4RL7A 1JYCA 3ZXJA 4AGVA 5IK8A 1S1AA 5CNAA 1G8WA 1AVBA 1LOFA 3ILNA 2JD4A 2UURA 4AVSA 3L2YA 2YMZA 3M3CA 1DIWA 1QDOA 1QMJA 2JKBA 2ZGRA 3USUB 1FAYA 1Q8SA 2DURA 1DHKB 1OQ1A 3IPVB 1GV9A 4Q8LA 4ZKTB 2GN3A 1KRIA 1HQWA 1MS0A 2P3KA 3WHTA 4BM8A 5GALA 1ONAA 2DUQA 3AXDA 1N1YA 1SACA 3RRDA 1CONA 2ZHMA 3SH5A 4M01A 3AJYA 1KDMA 1MVEA 1LCLA 1Z0HA 2DVGA 2NN8A 2LALA 1N1VA 3ZXKA 2YV8A 1J1TA 4XE9A 3HN1A 1QU0A 4YM2A 1YYNA 3VKMA 2A3YA 1V6OA 3IM0A 5DG1A 1AXZA 2WSUA 4AGGA 1D0HA 3R4UA 3SLIA 1YRZA 3ZXFA 1DZQA 4P9YA 4ATEA 4DPNA 1G86A 4YZ2A 3V64A 4LBNA 4PCRA 3SH3A 1IS5A 4SLIA 5IUQA 3ZXLA 5EXOA 1MS8A 1GZCA 4XILA 4JRAA 3WCRA 5AVAA 3FLTA 5T5JA 4XJUA 1CPNA 4L8QA 2EXKA 3N7MA 3AZYA 1FNYA 2ZGUA 4XMAA 5LK5A 5GZDA 1PZ7A 4R9BA 1V6JA 1WBLA 1SLLA 1AF9A 2NYYA 2CNAA 3PVOA 1F9KA 4Q26A 3TAYA 1QNYA 4R9AA 1KQRA 4XYXA 1JUIA
chains in the Genus database with same CATH superfamily
5D2AA 3WNLA 2VBBA 5ABJA 5JLVA 1F31A 4N9HA 1OBNA 2WABA 4LLOA 4YW4A 5IVBA 3ZFEB 1BCXA 3ILRA 4ORFA 4D7TA 1JU3A 1TME2 2O8QA 2VZ3A 1US2A 3NWKA 5FZGA 1NCQB 1EAH1 3LGRA 4PI2A 3V0AA 1C4RA 2JG9A 2QNKA 1PZ8A 4Y5SA 5F3CA 2G1MA 1QJX2 2Y33A 4HXCA 1O4ZA 1JUHA 4EWEA 1CVNA 4JGZA 1UPSA 1BEV1 1EAH3 4UFMA 4EWAA 3IIAA 4OQ8A 4C1WA 2I45A 2Y64A 3RZHA 2BFUS 4AWDA 2W68A 4FTSA 3AKRA 1VIWB 3C7EA 3MW3A 2ZMLA 2ZX3A 2ZGSA 3WNKA 2DCJA 2D3RA 2DF7A 1DG6A 2C6SA 4J1WA 5DQ0A 4AI2A 4B1LA 5FZ3A 2SBAA 1M4WA 4RGKA 4D6RA 5C3OA 2VTXJ 2J1SA 4HT1T 2DVDA 5F1RA 1XSRA 4SBVA 3ZN6B 5I91A 5F5CA 1ZREA 4XMIA 1BK1A 2J1TA 5IATA 2A7AA 2GSYA 1CZSA 1VB2A 3H0OA 1US3A 2NMNA 3UGFA 3ZSMA 5C5UA 1PO11 3VZKA 3KHBA 1OURA 2WL1A 3VV1A 4CEWA 2OW4A 1OQDA 3VBRC 3PVEA 4PF5A 5IK5A 4FPFA 1UIKA 1OQEA 3MIHA 1PO13 5HV4A 3MIBA 4PQQA 3J9SA 3EHKA 3HT1A 3TB0A 1HB1A 4WVZA 3MZHA 1XJAA 5T52A 4QPGC 3LSDA 4OZXA 3WNNA 3RYKA 1REFA 1WBFA 2P34A 2OVUA 4WVMA 1OUXA 5F5AA 2VUDA 4BQXA 4CUAA 2A6VA 4W65A 4TSVA 1ND3C 2GN7A 3POEA 4K1YA 4URAA 4NHXA 5C70A 1ULCA 3PNAA 2GDFA 4LBJA 4AYUA 1BJQA 1DBNA 3CF6E 4MADA 2VBDA 4FO9A 1WW7A 1HN1A 1GOFA 4TWTA 4XJZA 5EV7A 3ZSJA 5HCBA 3N7LA 5LY2A 5A6QA 1IKQA 1UD1A 1HV1A 4XTMA 5IVEA 3PUHA 5C5TA 4TZDA 2E9QA 3DXUA 3K48A 2OKXA 3LPFA 3WDTA 4META 1JOJA 2ADEA 1K45A 1UKRA 2JIJA 1NXMA 3HQRA 1RUF1 3LFIA 3NV4A 2GC3A 2V5YA 1LHWA 1PVC2 4V2WA 3TN91 5F8PA 3JUUA 1WLDA 5IK4A 1D4M1 4NN0A 2Z69A 2VO5A 4XAAA 4AL9A 4EZ4A 2AR6A 5I0RA 1RUF3 5JXIA 2IXJA 5DAXA 2WAAA 3TN93 1XRUA 1ND2C 1VMHA 1Q5OA 2JICA 2ZGTA 2CDOA 3POWA 4AQ6A 4M3CE 4YWAA 1ZA7A 3AL5A 3AP7A 1HJGA 1I5ZA 1QJFA 1YUDA 1DYPA 2WT2A 4K8RB 2QQPA 2K9ZA 2WZPP 2V09A 2RS11 1H1MA 4Y22B 5FY4A 1DQ1A 5JPMB 2ZHLA 3VBSC 5FQ0B 1QH6A 3F95A 4KMQA 5DABA 5FYUA 5KR7A 3OYWA 2DWRA 2RS13 1W6NA 4QU1A 5CB7A 4FTBA 4M3CA 5GZGA 2Z5WA 4UF0A 2JXAA 3PU8A 4MO3M 2KA3A 5L73A 2GC0A 3PDQA 2QFEA 2I74A 3D82A 3MDPA 5T50A 1NQDA 2JJ6A 1ZZ9A 3KCXA 2ARCA 5C3PA 3DGTA 3OBRA 4XIOA 1WW5A 3CDZB 5JZGA 4O61A 2WYSA 2JE8A 4AVVA 3ZMNA 4Q0VA 1U12A 4Y20A 4CXWA 1PMJX 1SBEA 2PHLA 2QKDA 4JKKA 3H7YA 2FHRA 1DGRA 3H9AA 3BCWA 2VVEA 1ASJ1 4YW3A 2D43A 4IEZA 4YVSB 3WLUA 4IUGA 4PJYA 4M00A 3ZM8A 1VR3A 2WO7A 4J6GA 4S2HA 1W8NA 1H8TA 4IQPA 3M1HA 4N43C 1ASJ3 3CU7A 5FZ4A 5JI9A 1RB8G 2HWF1 4Q0QA 2A6XA 1H1AA 2JDUA 2R1BA 4IV1B 1ULGA 2RJLA 3Q8CA 2BTVC 1YFUA 4ZU4A 2NLRA 3LDBA 5FREA 3WXPA 2HWF3 4IL7A 4AVAA 1H9PA 2E33A 2FMDA 4GIQA 2VNVA 4QKNA 1QOTA 3IKWA 3MLJA 2IVJA 5A7PA 1NCQA 4I0WB 5LBEA 4V2VA 4A2UA 5BNPC 3PURA 2XDVA 3B9IA 1RUNA 1W6MB 2PYTA 3DPRC 3LEKA 1ENSA 3KQ4B 1XNAA 5GLWA 2ZX4A 3M3QA 1AXYA 1IS3A 5FY7A 2O0OA 2XQRA 2WNOA 4P9GA 2W46A 1JHJA 2W1WA 2WA4A 5KWRA 2Y8KA 4DXTA 3RZLA 4I3PA 5BNQA 4R8HA 3HR9A 4QDSA 1NXD1 1BMV2 2B9UA 5EQUA 1WMFA 4ISQA 3TBDA 1GSLA 1AR93 2GZWA 4PBPA 3ZR6A 2WC2A 1RUD1 3GBGA 3LIGA 3HNYM 1COV2 1UKGA 1POV1 3NAPB 5JSRA 2G4IA 5KXBA 2PELA 2C26A 1FT9A 2WYFA 2YG0A 1SZBA 1PK6C 4K8FA 1QJU2 1TZOA 5FYVA 1RUD3 2FDKA 1ZZ7A 4NOTA 1POV3 1WCKA 2N7GA 4LMFA 4BB3A 1CWPA 1DQ4A 3KT1A 2Y0IA 4P9WA 4QQ2A 1GUIA 5JAXA 5CG8A 4YM3A 1MEC2 1Q43A 1ODMA 3N7JA 3ZXEA 4OI0A 4M0HA 5CKQA 4QXBA 2WUHA 3VBHC 4LOTA 3VDDA 4IGOA 5I8YA 1FX5A 1CAVB 3A0KA 4QXCA 3UGGA 1YJLA 4E9KA 2RS32 4JV4A 5A32B 5K0UC 1G6NA 2CGOA 2JE9A 3AVSA 4FOVA 4JQTA 4NJ4A 5A80A 4B8EA 3AC0A 4MLOA 3HAGA 3AMQA 1U0AA 2F4LA 1UOJA 3ACHA 1UO9A 2HLEA 4UI9L 5IT6A 5L19A 1NOVA 1GZWB 4OHWA 4CDWA 2RDRA 4YW1A 4DXSA 4BDVB 2JD9A 1DGWA 5CIRA 4Q4W2 3LD8A 4A7YA 2EICA 2C0ZA 5DZEA 4D0QA 1RIRA 4RS5B 3N9NA 1RXFA 3IMMA 3JB8A 5JXGA 5C3SA 5KXDA 4CDQA 2OT7A 4BK4A 2OUJA 1RL3A 1CX1A 2WO2A 2XVKA 1UZWA 5DUXA 5FXVA 1IG3A 2ZGLA 4PLOA 4MUVA 2Y6HA 1IS4A 3S30A 4EN0A 3GALA 4CP9A 4ZHNA 1D0GA 4NVPA 4MHRA 5LASA 4DRRA 1QNWA 3MPPG 4Y22A 4CDXB 3R05A 3DKWA 1UMZA 2PTMA 1DYKA 4HLTA 4XBLA 2XOMA 1B09A 2VCMA 5JMCA 3MF9A 5H9PA 5JOXA 5FMOL 2DVFA 2UWAA 1C8M1 1RUJ2 4A45A 5IJRA 4CPBD 2WS92 3KSCA 1CJPA 1J1LA 1VLNA 2B8MA 3WW3A 5C7GA 1OT5A 4RGGA 4COWA 5C71A 5HXMA 3W5NA 1C8M3 5LA1A 1V6NA 2GMPA 1NZIA 2GC1A 4LHSA 1OXCA 3K75B 4XQWA 1VE0A 2ZA9A 1JN2P 4YVSA 4YVWA 3VHRA 2X09A 2DYCA 4IE4A 2Q8OA 3I2JA 4LK6A 1HDKA 2NP0A 1ULEA 1LGNA 5FWJA 2VZRA 1PX3A 1FPN2 2PAEA 1CZVA 3AZVA 4IV1A 1OH4A 4QU2A 3UKNA 2RE9A 4LHLA 2JE7A 3ALQA 1UX7A 4OQ9A 4QQHA 1EV12 4QPGB 2W94A 1RMU1 4IEYA 3PVBB 3QLQA 5C6CA 2CL2A 3EB7A 4Y5TA 4XAEA 5CYYA 5FZOB 4CUCA 4GJYA 4HOOA 1BQPA 5L9BA 4F83A 1RMU3 4RA0A 1DQ5A 2QQLA 1MQTB 1A34A 4A4AA 3CQOA 5KHHA 1VBD1 2XVGA 3KWVA 3H8UA 1C1FA 5JR2A 5F39A 1W6MA 4C1XA 5LK7B 4AR2A 1JYXA 4S2DA 3AL6A 1ZRDA 3BU7A 3O1TA 4AW7A 1ZBA1 1Y9MA 2RDNA 1AL22 3T08A 3T3YA 4O65A 4Q4X2 2OS2A 3JZVA 1ZBA3 4BHPA 5FPUA 1QDCA 3KF5A 3V0BB 4K40A 3C2UA 4QMAA 4JCKA 2QZ3A 3GJBA 4R4ZA 1APNA 3P6BA 1PGW1 3MUZ1 4IERA 3O1SA 4XJAA 5AFBA 4JQRA 2WLQA 4U2AA 1SPPB 2VE1A 1C1LA 2K2SA 1Y9GA 1W8HA 3QCWA 4E8DA 1XYOA 4ZU7A 1JXNA 4K21A 2D5FA 1JZ5A 1H4GA 1Y43B 2XLFA 1W0OA 2OZ6A 1PVXA 2C1FA 3P5BA 4FPKA 4NUBA 3JU9A 1UAIA 2ETEA 3WNMA 1LHOA 4LR4A 4FQZA 3WQ7A 2XG3A 4QGNA 5DMYA 4QGMA 3SMHA 4XUOA 2R32A 3IDCB 1Q56A 4QX2A 4GJZA 4AI8A 3IWZA 1EPZA 4PIXA 1H2NA 1NCRB 2YBSA 4FFGA 1O3SA 3MO4A 3NV3A 2ZABA 3MW2A 2VXRA 2X10A 1LENA 3ES4A 4XTPA 1GKBA 3MLKA 2VGDA 5FYMA 1AX0A 2GH8A 1KS5A 2HWE2 1GZWA 4WZFA 4AFMA 3KT7A 2J1EA 5D1IA 1GBGA 4IE5A 4E2GA 1IGOA 1RUC1 3D6EA 5JSPA 4QKBA 4C90A 2DCZA 4MGQA 4LIVA 4R9CA 1XB9A 2Q0AA 4N43B 5BNOC 1VAMA 4AFCA 1PHMA 1IPKA 1WCDJ 4MVTA 3NSTA 4H14A 1W6QA 1RUC3 1LJ7A 2JKXA 3PIJA 4G3YC 4XC9A 3H3ZA 3ACFA 2A71A 2JX9A 3OPTA 1MZEA 2VAUA 5HPOA 4FOWA 1I3HA 2DU1A 3U10A 1UN1A 1ODNA 2HYKA 1Q8QA 4DEQA 3FUOA 3KCYA 3SHRA 4DMIA 3DYOA 4HN1A 3BTYA 1X36A 3C3VA 5BNPB 3KVBA 1QHDA 3GZTB 3OEAA 3KVAA 1D4VB 5LCWL 3RVHA 2IUWA 1RGSA 2QCSB 5FLHA 1QIQA 1GLHA 4GA9A 4QPIC 4Y1YA 2HKXA 1YQ6A 1EPWA 4GXLA 1JYNA 1M06G 1F5FA 3VDBA 3GNEA 4AFBA 2VZVA 4YFWA 3I3DA 4FPCA 5GJ6A 5HCHA 1MACA 2ORZA 1UNBA 2YGLA 3ZFEC 4QQOA 5SV5A 3WD5A 4G4FA 1JYCA 4FXGB 4OYUA 4QPWA 2ZCWA 3ZXJA 3OD4A 2PHDA 4ASLA 4TTGA 3K3OA 3I97A 5FYTA 4R9AA 2OQ7A 2UURA 4HKWA 3L2YA 2IXCA 2YMZA 3LEGA 5FPVA 1FMD1 3HWJA 4XDOA 3HOBA 3ZN4A 2E7AA 2KXLA 2OZJA 2JKBA 2ZGRA 3VBRA 2QDRA 4COUA 3MIGA 1A6CA 4XPVA 5HXVA 1P8JA 3FHQA 1S2BA 2MPFA 1FMD3 5A3TA 1Q8SA 4QX8A 4A6OA 5LZ6A 2NQYA 3IPVB 2DFCA 1OLQA 5F3GA 1GV9A 2VBPA 4QPGA 4ZKTB 3VBHB 2VOKA 2QQNA 1MS0A 1UOGA 1LRHA 3WHTA 2YDEA 1AL0G 1ONAA 4URTA 3JBG1 4CU8A 1WMDA 2Y0OA 5K0UB 2W1UA 1ND3A 5IFPA 1BBT2 2YV8A 4DEVA 2ZEZA 2JDAA 4E4DX 3ACIA 1SQ4A 4XFCA 3JBG3 3HN1A 1NZCA 4ZZ5A 5FPBA 1XOYA 1UYYA 4YM2A 3WP6A 5LEKA 1AR62 4I02A 1UW8A 4AGGA 3BTXA 4LUMA 1EYBA 1W9SA 3ZLIA 4W50A 4ATEA 4K3UA 4UFIA 5CFDC 3O1UA 3RZMA 4C0HA 1ST8A 1NKGA 3KV6A 2PN5A 3SH3A 3MYXA 4CU7A 4Z1VA 3FL7A 5IUQA 1YQ2A 1Y3TA 1NE4A 1MS8A 2XH6A 5AC92 1GZCA 2IC1A 5CZKA 4JTNA 2VG9A 3CJXA 4GMP0 3WCRA 1ND2A 3FLTA 2RDQA 5T5JA 3PJYA 2EXKA 3K77A 3N7MA 2ZGUA 2D40A 1VBB2 3L9JT 4JX0A 4E4ZA 3S0MA 3K3NA 1AF9A 2QQJA 4COZA 1F9KA 1H4HA 1OLRA 2QE3A 3PUSA 4KNCA 5FYSA 3OPWA 4EN6B 5DN2A 1UZYA 3VBSA 1K3IA 5DZFA 1J59A 5IYYA 5DUUA 2BRTA 2ENRA 3SH4A 1WA4A 2DFBA 5H9RA 4KU7A 3WVJA 2E7TA 2ZGPA 1WCSA 5LRRA 3AYCA 3W21A 2AZ5A 1DZRA 2FCVA 4S2GA 4ZS2A 5ACA1 4O7XA 1RVF2 4BJ0A 2TNFA 1VRH2 1XYNA 1VAVA 4HONA 1F4HA 2HWC2 3MGUA 2GNBA 1IOAA 4XIKA 2WFF2 2BFUL 2PLV1 2VZ1A 3I2HA 5FLJA 3T2OA 5A70A 3ABZA 5LEJA 4U36A 5A3UA 4QHBA 5LRSA 4CU6A 3HIFA 2RM22 4MGKE 2ZKLA 2FCTA 2PLV3 5A1LA 4M4PA 4N43A 1NA1C 4KBZA 3EXUA 1VBC3 5F5QA 3A21A 3C7FA 2R7EB 1UQXA 3JD71 3BIWE 5E88A 3ZXAC 4AI0A 2RMU1 1WA6X 3M2MA 3POYA 3JD73 3VD5A 3NJZA 1NQJA 5FZLA 3UV9A 1BKZA 4RGAA 5L9VA 1DP0A 3AMHA 4C0BA 2R0FA 2ZHKA 3AM2A 5BNPA 5E6HA 1W0PA 4ISRA 4LBQD 3TRSB 3MFCA 1O59A 1VMJA 3DPRA 1ULFA 1W6PA 5ISLA 4P9IA 1RUH2 2P3IA 2R063 3D5OA 3NO8A 4FT8A 4ZONA 2BPA2 1YIFA 3JXSA 4QKFA 2W08A 2Q8EA 4EV0A 4FTEA 5BY5A 3LAGA 2WO1A 4JRLA 2B9VA 2H6BA 3UYJA 4Q4V2 2P37A 3ZPOA 4I30A 1SFYA 2B39A 3POGA 3IBMA 2E32A 1QXRA 2JG8B 2DV9A 2K0GA 4BK5A 1TEIA 5IVVA 5CVRA 5KBFA 1FV2A 2ARAA 2A5ZA 2WWJA 1PK6A 2A1XA 5FZ0A 2ZJCA 1HJFA 4D3WA 1ZBE1 2R30A 4HZFA 2D6KA 4KGQA 4N9IA 2RDSA 5FP3A 1YXWA 2ZMKA 2IXHA 4YW7A 4GKXA 2FDIA 1J84A 1Y7BA 3IPVA 1OF4A 1ZBE3 1AR81 2V72A 3VBHA 2WRAA 4EQVA 1U5IA 3B00A 4JC1A 2BERA 1LOGA 2A6YA 2Y6JA 3SITA 3H42B 1XSQA 2WNEA 1RHI2 3FMGA 4Q0UA 5BPXA 5D21A 1AR83 2EA7A 5K0UA 2Y38A 3LA7A 4AHXA 3NAPC 3U1XA 2G9ZA 5A33B 2V4VA 1PX4A 5IK7A 2H0BA 4Q4Y2 5LY1A 2VW2A 5A7WB 1EY2A 5FZIA 3RWKX 1QQP1 1UYPA 2WKKA 4MSVA 5DDJ2 5SV8A 4PF1A 4ONUA 1YQ8A 1OLMA 3S6PA 5DUWA 3GYDA 2OPKA 3VGIA 3KMHA 4XURA 5BNOB 1QQP3 2P3YA 1W03A 4LUKA 1L7QA 3VKFC 3VB9A 3LOBA 1GQHA 2R042 2TEPA 4CU9A 4NWVA 1LU1A 2PHUA 1PIV1 4AOCA 1RUE1 1J3PA 3SNMA 4IE7A 2Y34A 5KXCA 5JMOA 4RHV3 3RNSA 3T1MA 3K4DA 4FOQA 1YHFA 1PIV3 1RUE3 5A7NA 3FUQA 5F3EA 2DTYA 2WT0A 4XJ8A 1SLAA 2ILMA 1DCSA 3OPZA 1I5PA 4K20A 4WVWA 1BYHA 2KR2A 5LATA 3ZYJB 2K46A 3OBTA 3Q9OA 4QD2A 1UIJA 1AR72 5KHKA 2XHKA 5L7OB 4QXKA 1CAWB 1LOAA 4QPIB 4Y4RA 2Z4FA 4RS5C 2GAUA 2RJ2A 2EIBA 1DQ2A 4OHXA 5I8SA 3WDUA 4FFIA 3M3EA 4LK7A 4XZUG 1QEXA 4W8JA 3ZR5A 3QACA 2WO3A 2HJIA 5J48A 3KB5A 2FBEA 1R092 1X7NA 1Q8PA 1H9WA 1QJZA 1S0BA 3LF7A 4FVVA 4JVAA 2IFWA 5BXXA 3OD0A 1ZVFA 1HRI2 5GZFA 5JXJA 2O8OA 1TMF1 3SXWA 5EJ3A 4OULA 1OVSA 1KITA 1S2KA 4CDUB 4EROA 1UYXA 4MX3A 4UW6A 4CDXC 5CBLA 1I1EA 4INDA 5GKAC 5FTTC 1TMF3 4OUMA 5JPNB 3GZEA 4BLIA 3OGSA 1SCSA 5BNNB 3T09A 1N3PA 1JH5A 4OI4A 1BEV3 3AZXA 3ZYGA 2PHXA 1ENRA 2WZR1 2YUEA 3N4MA 1UY2A 1BXHA 3ACGA 4YNIA 4AHZA 4L2NA 1VRBA 2CDPA 1SCRA 3WT3A 3RS6A 2WZR3 1NG0A 2DVAA 2V4AA 2W52A 3ZKYA 1VAKA 3AFGA 3EBRA 1MZFA 3IDBB 4FXKB 4NROA 1VB4A 3B93A 2ZKNA 2BU9A 4JGYB 3M4FA 2JB8A 3CLPA 3WZ1A 1HB3A 1NY72 4GD4A 4OI1A 3T0DA 2VMIA 1UY0A 2YC0A 5CFDB 2VECA 3I4IA 4OUEA 5A7QA 3ZFGC 2PHRA 3ASIA 3N35A 5C8WA 4PLNA 4GKYA 4FAGA 3POBA 5FCCA 3VZJA 1WZXA 5KXEA 4I0BA 5GZCA 4LT5A 2WN2A 1MQTC 4LKFA 3OGJA 3PMSA 3J26N 3THDA 2VW1A 3H8XA 2XBO2 4ES9A 4LHKA 5JIAA 1WD3A 3WX5A 2MEV1 4LULA 4AEMA 3NL1A 4ZPIA 1MEC1 1ZX5A 3LWCA 4JDOA 4XETA 3SC7X 1CIWA 3QH7A 4Y24A 2P3JA 1GICA 4EN7B 5F2SA 3ZSEA 3I3EA 4CCDA 5E1RA 1XNTA 2BGOA 3SKVA 1H8VA 2YY1A 2VNGA 4GMP1 1GWKA 3HNBM 1YFXA 1D4M3 4HL0A 1I6XA 1TNRA 2W91A 4GMP3 4YSFA 2A70A 1STMA 1V6LA 1V9U1 2VUAA 5A7WA 3KM5A 3OUHA 1IPJA 1G9FA 1V6IA 2E51A 2IWGB 2MNGA 4JHZA 3RJRA 4QX7A 4KWLA 3O12A 3AP4A 1IG0A 1V9U3 4QM9A 1K5MC 5T5PA 3UJOA 1NA1B 1ZZCA 2VMEA 4OUSA 3O5SA 3WQBA 3WP4A 3BPZA 4CEYC 2AEZA 4FI9A 3DV8A 4FFFA 1PMHX 2OPWA 3W59A 4EN8B 1NCRC 2FQPA 4X6QB 4I2OA 3DF0A 2D6NA 3EJKA 1I9RA 2XMLA 3GF6A 1W8OA 3CJIC 3P3NA 2GMEA 2AYHA 3FN9A 3RYRA 4WM7A 2FDJA 2CAVA 3J8F1 3ZSKA 3NV1A 3ZN5A 3WW2A 4YFZA 4QDRA 3NV2A 4LEJA 2VOVA 1RXGA 4RQPB 3ZVXA 2RR11 4QPIA 4C91A 4MGZE 3DXTA 3J8F3 1RUJ1 3TEWA 4IEWA 3OBZA 1MS9A 4NRQA 2GP3A 4QB6A 1ZM1A 5FXZA 2YBKA 1MS4A 2ZAHA 2VCBA 2YFUA 4KWKA 2QQIA 2RR13 5FR3A 3LA3A 3THTA 3ZYHA 3ZFEA 3AXEA 4XBQA 4PIYA 3RWNA 3CO2A 4HPKB 4N90A 1HRV1 3ZYRA 2A3XA 4GB31 2BV4A 3NRUA 2Y60A 4GWNA 1EAH2 3AX4A 4GQ7A 3CBNA 3O0XA 4XVHA 2BYVE 5GLUA 3RI8A 4AHYA 2W2IA 1WW4A 1HRV3 2R1DA 4WZCA 4GB33 4EN9B 2FMYA 1CQ9A 1S0GA 2A3WA 3B69A 3RJ2X 1K12A 3VZLA 1AYM1 3RSJA 4NPMA 3POSA 2PQSA 4FFHA 4PQ9A 3HBKA 4BIOA 5I93A 3ME2A 2LROA 1FNZA 5FZKA 3WG2A 1XU2A 1CPMA 2FZ1A 5FUPA 3H1MA 5A1FA 1IHMA 1AYM3 1UOFA 1H2MA 1LOCA 2UY8A 4OFGA 4I01A 4A3ZA 3S57A 4LKSA 2FDHA 3UETA 4OMDA 1VBE1 3ZN6A 1CZTA 2RV9A 3HEIA 4BE3A 2XJQA 3KV9A 5CKNA 4NMIA 4XFIA 1KGYA 3BIEA 2YU1A 1REEA 4E4HA 1VBE3 3GHNA 3NQHA 4NRMA 3BTAA 2VPVA 1PO12 3CZJA 4CCEA 2WT1A 4HANA 5F3IA 2EIEA 1SEFA 2ZX0A 5JOYA 1JTZX 5G05L 1DU3D 3OGGA 4Q4X1 3WY6A 4EJRA 4YZ5A 2QQOA 1SG3A 5CFDA 1JZ2A 3LDKA 3DEMA 3N36A 5FFOC 1W8ZA 1O3QA 5DUVA 4MGTA 3HQXA 2H6CA 3POIA 3WG3A 4RYDA 2YB7A 1S0DA 2BDRA 5EYYA 1VP6A 5HCAA 1KDKA 3JB4C 2BEOA 3RZZA 1WD4A 1OFNA 1PGL1 4COVA 3U78A 2RS51 4LHNA 5FK8A 4O9EA 4QHZA 3MV01 3I3QA 5H9QA 2PHWA 5FY1A 5KHJA 2BUKA 5I0TA 1OA3A 2RS53 4FPYA 5EZWA 2Q30A 2ORXA 3KGZA 2OA2A 1ULDA 3E1F1 1YO8A 3PUIA 1F5JA 4RSUA 5FPXA 2D3SA 3MPBA 3APBA 5DZGA 4ARYA 3SCHA 2AUYA 1HQNA 1LECA 3BGAA 1W9FA 2R49A 1OF3A 1RUF2 3IN9A 5FYBA 1YNAA 3TN92 2AH2A 1YQ5A 4X6RB 4AZZA 2JB4A 2ZGKA 3FLPA 2ZTNA 5ANQA 1UF2C 3B02A 1AXKA 3VKOA 2ERFA 3BOWA 4LOSA 1UY4A 4RN5A 5FWEA 5EWSA 2RS12 2UWBA 3VZNA 3LPGA 5FQ0A 4XFGA 1AHSA 5F5IA 2VCAA 5C8CC 5BUVA 4RL7A 4PLMA 3BPSA 2VULA 5CU1A 4AEKA 3ST7A 5C4WB 1R1A1 1Z7S1 3CHXA 2FDGA 3ZMOA 3K51A 2QQWA 3VZMA 3OGRA 1AVBA 3ILNA 5J36A 3ZDVA 2BGPA 1R1A3 1Z7S3 3ZKUA 1GR3A 2CU5A 4DUVA 4XUPA 1QMJA 3GCWA 4LIUA 1VBA1 1FAYA 2QTWB 1UZ0A 4MGIE 1QJEA 2DCTA 4AF9A 2MHFA 4WM8B 4CCLA 1ASJ2 5J1XA 1L3JA 1VBA3 1KRIA 1BVP1 4GWIA 4BM8A 1RJ7A 4V1PA 5GALA 2DUQA 2HWF2 2X29A 2X5IC 4JKLA 1SACA 3S7IA 2ZHMA 5FY9A 3SH5A 4M01A 3ZFGB 1W8WA 1MVEA 5F6KA 1LCLA 5FY0A 3QOPA 1Y4WA 4C8DA 2WNVB 4XE9A 4A44A 4XUNA 2J1UA 4AHWA 4QX5A 5FBZA 2EVXA 1NLRA 1XYPA 3JQWA 3IM0A 2WSUA 4JHTA 2ZOEB 3R4UA 3SLIA 4P9YA 4DPNA 3OCPA 5FV3A 3TEYA 2G19A 2WLPA 4LBNA 5F32A 4LXLA 4L9BA 1R081 1VBD3 5G04L 1U5XA 1IS5A 4SLIA 4IGPA 3R4DB 5JI7A 5EXOA 5I0DA 1UOBA 5KC5A 2HWB1 4YRDA 4XILA 1R083 1W8FA 5AVAA 4YPJA 1PNFA 1AR92 3LEMA 3W20A 3AZYA 1FNYA 2HWB3 1BBT1 2J1RA 4NPRA 1PZ7A 1C5HA 1GU3A 5FYCA 1WBLA 1EP0A 2NYYA 3ITQA 2JG8C 1KXGA 4Q26A 3TAYA 5FO7B 5IFTA 3VBFB 3NAPA 2C9KA 4LO7A 1AR61 4XYXA 4DXZA 1RUD2 1GP6A 4YM1A 3WW4A 2BBVA 3VBUB 4I09A 3K2OA 3SKJE 5C3RA 3MBWA 3AYEA 2EXHA 4BMEA 4DS0A 4CP0A 4FSJA 3I59B 4KWUA 2IFRA 2QQKA 4Y1VA 3AP6A 4JAAA 5FYZA 4OI2A 1K5MB 1OI6A 5DAWA 4LITA 4BQ5A 1RUI1 2D6PA 3RZJA 4CEYB 5T5LA 5AC91 4E8CA 1CAVA 4UW3A 5FOBB 1WWYA 1GNYA 4QX1A 1JYVA 2BWAA 5A32A 1RUI3 3BYWA 2D6LX 5IHRA 1X9PA 2ZGNA 4AE2A 3N9LA 1OOPB 2PA7A 3E6DA 5FO9B 4I3GA 3GBWA 3RI9A 3CJIB 1JI6A 3IB3A 2F17A 1O3TA 2P6CA 1QJY1 1LGCA 2VU9A 1YEWA 4NIGA 1RINA 2VR4A 1N1TA 2WQ4A 5C9AC 4GZ9A 5J7MA 4XCBA 1QJY3 3RMXA 2FCUA 2BP6A 2XJUA 3ATGA 2EF6A 5BYNA 5J96B 4RS5A 1BVVA 1O6UA 5J98B 1OH3A 3MLLA 3ZSLA 3KV4A 2WZ8A 2XPJA 2XQXA 4QB2A 3GM8A 1BZWA 1VRH1 3VHPA 2R071 4MOAA 1UZVA 2CGNA 1OPMA 4HVOA 1T6BX 4XXAA 2WDBA 3D8CA 4D7SA 3GXUA 2WFF1 5FMBA 2ET7A 1FOD1 1X8MA 2R073 3MIFA 4H2AA 1TVGA 3G6JB 4FPEA 3OGVA 4N7UA 4FP3A 5FLIA 2WQZC 4BPZA 4IEOA 1WUVA 2OUHA 1A8DA 3J4UH 4QHOA 4A42A 1FOD3 5J37A 1OSGA 4MXWB 1LOEA 4CDXA 1JZ6A 4CP2A 4Q27A 4YGDA 1RUG1 2ZBJA 3LDRA 5IAVA 5LBFA 4ES8A 5L7OC 3GCXA 3QD6A 1ZRRA 3GJAA 4R52A 3HQUA 2D5HA 5FKBA 2BNNA 2HBUA 1A8MA 4GH4B 1E57A 1N47A 1RUG3 2YC4A 1J58A 1LKNA 1VALA 2R6QA 2VW0A 4DINB 3J7LA 1QGLA 5T3NA 1C28A 1C8M2 4KG8A 3U11A 1SDDB 3H1WA 3TNPB 2TBVA 1OPOA 1FYUA 1W6OB 2D3PA 3AMMA 3TWIA 2QBXA 3WF1A 5A3MA 1H30A 4HN0A 4QM8A 3ETPA 3PU3A 2AACA 1MR5A 4AFDA 2C4XA 4IEPA 2B46X 4MH0E 3O1RA 5I8TA 2W0XA 2JDPA 4OMCA 4CDUC 1NLQA 3EMRA 2QQMA 2Z2SB 3GHMA 5EPAA 5BNNC 3IAQA 3UL2A 4ASKA 4DUXA 3OUJA 1CD3G 1UPIA 2VY0A 5JOZA 2Q8CA 4NAOA 4KH9A 3EO6A 4A7KA 4B4QA 1NT0A 3AFKA 4KU8A 3ZFGA 3CL1A 4BQ4A 2A75A 2YBPA 3ACLA 4AQTA 1Q8VA 3DYMA 5A3NA 2FZ2A 3AP9A 2GNMA 1RMU2 4W6XA 4XFFA 5FO8B 3NKGA 2KM2A 5FZOA 3RZGA 4BA6A 3HPNA 3PHMA 4UW4A 5F7UA 5M0TA 1MQTA 2W39A 4XW3A 1X8EA 2BVVA 4IEQA 4LJHA 2Y6GA 2QJVA 2QZ2A 3FC0A 3ZYPA 1E5HA 2VCCA 2XJSA 4JGYC 3VUOA 1SLTA 3AMPA 3WUDA 2AC1A 2AENA 2VQ0A 2XJVA 1B35B 1UU5A 4P02B 5FP8A 1ZBA2 3WQ1A 4Z8BA 3PTYA 3HVDA 2Y6LA 1AYN1 1QH7A 3CEWA 2JDHA 2W92A 3WINE 3V0BA 4LA3A 2WWUA 1DLCA 2D6MA 3UKVA 3THPA 2CWSA 2R16A 4KGGA 1AYN3 5FPAA 4R9DA 2W1SA 2D97A 1PGW2 1UWWA 4E2SA 4XXPA 5CEHA 3T2PA 1JBCA 4HVRA 3KLSA 1SPPA 4QXHA 4QKDA 3VDCA 5FZ7A 1VJ2A 4NWWA 2YU2A 2WA3A 3AYDA 3S7EA 3I59A 3LKJA 4YGCA 1GWLA 1HXS1 1ZRIA 1R64A 2HWD1 2VMHA 4RD7A 5C8CB 1Z78A 4P08A 1K5MA 3JCIA 4CEYA 2ET1A 4CP1A 1XQNA 5C3QA 1K5JA 1HXS3 2W5FA 3AJZA 4CE8A 2HWD3 2PHTA 2J42A 4HBNA 2VOWA 3E97A 3CKHA 3N9MA 2JDNA 1NCRA 1G9AA 1YCIA 3K46A 3M70A 3B01A 1YQCA 4HSLA 2NMOA 3CJIA 5A1AA 1PO21 5ACA3 3OY8B 4ZU5A 4LBOA 5L36A 3LFMA 2BOIA 4BISA 3WG1A 1X9TA 3H8OA 1PO23 5JCTA 4A7ZA 4LORA 2WSVA 1RUC2 4FPOB 4B7KA 1NYWA 4NIHA 1JW6A 5B4XA 3HT2A 1C5IA 2X5IB 4DY3A 5ABJB 4E27A 2CV6A 5JUVA 1TME1 2ZACA 4MHUA 2ZEYA 1HRI1 4NO4A 5E16A 4IW3A 4L99A 1QJX1 3V0AB 1TME3 2JG9B 2GNDA 2WQ8A 1MS3A 1JYIA 1AUYA 3I54A 3URFA 5LWBA 3T1LA 2RMU3 4D94A 2XUMA 4N53C 2OIIA 3X29B 4IE6A 4JGZB 2H0VA 2XLAA 1QJX3 1WMEA 3Q8AA 1YI7A 2CAUA 4H55A 5I0UA 4TYSA 4RQPC 4IETA 5LBBA 1HB4A 4Y5Z0 2UYAA 4DQAA 1GP5A 2L9LA 4MYEA 2YPDA 2XVLA 4Y1UA 1Q3EA 3RYPA 4Y4YA 4BCUA 4XQ4A 3PIGA 4GWJA 5FZBA 4BQ3A 2F6BA 1ENQA 2AREA 2XJRA 4UFHA 1W6OA 3IAPA 4LE4A 1CN1A 3WF2A 2WZEA 5AFEA 5JR7B 3ZO0B 1LHVA 5FOJB 4IDZA 1SFNA 1SBDA 2Q1FA 4KBBA 1QOSA 1GFF2 1KFUL 1W8TA 3I2GA 5T5OA 4AAXA 4DO0A 5CFCC 4Q29A 3KD4A 4K9SA 1FMD2 4XHXA 3SEPA 3PLQA 3LOIA 5E89A 3MEPA 4KWJA 3WF4A 2E63A 4O9GA 2Q4SA 2LRPA 2OQ6A 3I2FA 3TYJA 3VLBB 1QXJA 4OHYA 1J3QA 1EUTA 1D7PM 4QT6A 4P14A 5FZCA 3OBAA 4LO8A 4XJ9A 1O91A 5LB6A 4IEVA 5F9TA 3WOGA 1GP4A 2XUEA 2J1VA 2VC9A 4CVUA 2ZX2A 2DCYA 3JBG2 1HB2A 1YC61 3M8LA 3VDAA 5J09A 1POV0 1CIYA 3BI3A 3B94A 3U0ZA 4MG2A 1BLZA 2DCKA 2XXZA 1LESA 3FE5A 2VMDA 4RFRB 4CSWA 1JOBA 5C9AB 2VOXA 3N9QA 1H6YA 4HK9A 1PVC1 1RYYA 2D6OX 4X8PA 4NIIA 3O7OA 3KCCA 1A78A 4FBFA 5FZ6A 3NJXA 1PVC3 1F8VA 3VBOC 1IZ3A 2D93A 4BQ2A 5HCFA 4B4PA 3MFAA 1G9BA 2CWMA 3UK9A 5KHIA 1AJKA 5FZEA 2A73B 2J7MA 2P6HA 2WBKA 4D69A 2HEVF 4Q1RA 5A6YA 2RG4A 3EYPA 2JEMA 2B45X 3D0SA 3VD7A 4L0PA 3OYWB 4UT5A 4XDQA 2G9GA 2YROA 5C8CA 1W6NB 4OLLA 3T0AA 1OC1A 4M3CB 2BZDA 1IS6A 4YZ3A 2P1BA 1CESA 1W2AX 2WFPA 2SLIA 2I2SA 3FBMA 4UW5A 1J3RA 5IAXA 2ES3A 3CMGA 2IXKA 5JWPA 1AJOA 4Y1XA 3OTFA 4ET7A 1O5UA 5FP4A 5JZGB 4S2FA 5EYXA 2IXIA 2WNUC 1SMVA 1UYZA 4Y20B 3OY8A 1UXZA 1AZDA 4B29A 1LU2A 2C5DA 1DFQA 3AZZA 4XFHA 3NMBA 3D4KA 3VBSB 3VL8A 2PLV2 3ELNA 1JZ7A 5KC6A 4QQLA 1VBC2 4IE0A 5J3UA 4IEUA 2FDFA 1N3QA 2XL9A 2Z79A 3USSA 4AAPA 2GMMA 3E6BA 2W3JA 1LULA 2X5IA 5C4WC 1KFXL 3A4UA 5IVJA 4XFBA 3ZX7A 4Q8KA 3JD72 1UU4A 5FP9A 1V6KA 3C7HA 4LNVA 2AEYA 3ZOIA 1KEXA 3WSOA 1W2OA 1H1IA 4LKEA 2RMU2 3NNFA 2VJXA 2DU0A 3D3AA 4P00B 1SDWA 1S0EA 4N8MA 5CA6A 3NJYA 4UYBA 4D7YA 2R062 4XOGA 1X33A 2JDZA 4WM8C 1OKQA 5DAQA 2OXBA 2VMFA 2DUPA 2QUOA 2BWCA 2YHJA 5LA0A 1K42A 2GP5A 1F35A 1KS4A 1JZ3A 1LTEA 2LUWA 1BMV1 1PMIA 3INAA 4IXLA 4CXYA 4CZSA 2WNVC 2ZZJA 4P9JA 3VKNA 3HMYA 1COV1 3SEEA 1LGBA 2PQQA 4YYOA 2CTVA 4XF9A 2JG8A 3FZ3A 4DRVA 4NE9A 4Y1ZA 1QJU1 2XLGA 5LW9A 2D7FA 1RJ8A 1E5SA 1E5RA 1COV3 5FPZA 3RG0A 2NZ9A 1O5LA 2WIIB 2YYOA 4IESA 3WF0A 4DB5A 1QJU3 1XBFA 3A7QA 3I2IA 5FDBA 3BB6A 4DZGA 4AXOA 1ZBE2 4L11A 4X8NA 2GNTA 5FPLA 4BZ4A 4MZUA 1UY1A 1KJRA 3GZAA 5DAPA 3V65A 2MEV3 5B4NA 3NKTA 1Y9QA 3ROUA 3VDDB 1CAUB 1MEC3 3WR0A 2RS31 4XQDA 1AR82 2CGPA 4YW6A 5CAZA 1W04A 3R4SA 2EAKA 5FXWA 2ARXA 1S0CA 5JVVA 3V56A 3BN6A 3OOXA 1CGPA 3W58A 3DUIA 1MVQA 2DVBA 4ZZ8A 1HIXA 1SLBA 2VOTA 2RS33 4XF4A 4BQYA 3VBFC 3UGHA 1XPWA 3VHNA 5A33A 4GULA 4XUQA 1W8UA 4YZ4A 1VPHA 3VBUC 5T55A 2ARBA 1SBFA 3WDYA 3S5AA 4CDWB 4Q4W1 3HN3A 1V70A 2GU9A 2VZTA 3WEZA 2I07B 4QQPA 4UAPA 1UMIA 4AGVA 5C9AA 1QQP2 1ULPA 5CNAA 4AEDC 2YGMA 1W9TA 1G8WA 3P3PA 4Q4W3 4CUBA 4E4SA 1W2NA 3C7GA 3R6SA 4NAMA 3U14A 2CSGA 4R4XA 5FP7A 3E5UA 5DAVA 3T4HB 4CDQB 4BXFA 3M7AA 4P5YA 4XF0A 3AKQA 2LW8A 2YFZA 4RHV2 3EQEA 1W99A 1PIV2 3OEBA 1RUE2 1OOPC 1H6XA 1O8PA 2VD7A 3SCGA 1JYWA 4YARA 1JS9A 4K7JA 1EUUA 1DHKB 1OQ1A 2E31A 4PDWC 4PIZA 4QB1A 3RFRA 4CP9B 5KHGA 2VZUA 2GN3A 2ZS6B 3F2ZA 4N53B 2P3KA 2EAAA 3ZDSA 4FAHA 3AXDA 1N1YA 5K8SA 3RZKA 3MIDA 1IQAA 5L7OA 1KDMA 2NN8A 1CAWA 2DVGA 1N1VA 3ZXKA 3WW1A 3J7HA 4MV2A 2VZPA 2WS91 1XE7A 4KI5M 3VKMA 2O1QA 3HNMA 3UT0A 5DG1A 3Q8BA 1RUJ3 2VZSA 3FJSA 3U07A 1OD5A 1CAXB 1W3XA 1XE0A 2WS93 5D8AC 3D0JA 3C7OA 3U4SA 2XHNA 1YI9A 1UY3A 2G9FA 3IZOA 2C24A 5A3PA 4YVWB 2V5DA 1TMF2 1V0AA 4CDUA 5CFCB 3ZXLA 2ZPXA 3ZFFC 1T6GC 1FPN1 3O1OA 4AVCA 3KGLA 1BEV2 4D6SA 5BNNA 5IWFA 2XL7A 4W6YA 2VQTA 4XMAA 1EV11 2RVAA 4GH4C 1FPN3 4M4RA 4PT6A 3I3MA 5B2GB 1V6JA 3HJRA 1SLLA 4CPBA 1BK0A 2CNAA 1W06A 3IIIA 4HG6B 2WZR2 1QNYA 5ANNA 4L97A 1KQRA 1EV13 4B4RA 2R0HA 5CADA 2Z42A 2VQAA 5FYYA 1QY4A 2OX0A 2KD7A 1DQ0A 4K6BA 4YW5A 4CA9A 4DNYA 1WLTA 2ZHNA 3USUA 2WINB 5FJHA 3WUCA 2XJPA 1NX9A 4P9LA 1LEDA 3OJBA 3AYAA 1LHNA 1YLLA 2IVIB 1LOBA 1UZZA 3A22A 4IV3C 4JGYA 2EALA 4NHMA 1LHUA 1AL21 3FFQA 3AB0A 2Y26A 3H1YA 1W39A 1WLCA 5GM0A 1AR91 1AL23 2IZWA 3WDWA 1NUKA 4UFJA 4DXRA 4Q4X3 2JENA 2Y6FA 2A6WA 4JZRA 3JQXA 3LZZA 2PHFA 3VBOB 3OUIA 5CISA 1YIPA 3WQ0A 3HBZA 3BU0A 5IVCA 2NM1A 4UFLA 4XACA 4YW2A 1LB2A 4CCJA 4QAWA 1PM7A 4FPHA 2FD8A 4Q0PA 4TLGA 1LOFC 1N3OA 4JKMA 4B3NA 4G9SB 2J1AA 4LQRA 2MEV2 1S55A 1B35C 1XNBA 1AX2A 1OFSA 2UWCA 3M3IA 4YLZA 4LTAA 1J83A 1HQLA 5FJKA 4M3CF 4F7ZA 2IXLA 5DXDA 1CAUA 2VQUA 1XNCA 5LA9A 1S0JA 1U5YA 3KV5A 4KQ7A 4AGRA 1D4M2 1OVPA 2DBNA 3OG2A 4RR3C 3THCA 2WR9A 2WNUB 3KZ4C 3UJQA 5HI0A 1UXXX 2HWE1 2YZ4A 4W4ZA 4HKOA 4CXXA 1MS5A 3DL3A 3U75A 5EFUA 4OVEA 1YJKA 3J7NA 5FZAA 2ZMNA 3LE0A 3WDXA 3FFZA 2QQVA 4XFAA 3ZXGA 2PAKA 1V9U2 2HWE3 1GNZA 2XGXA 3TEXA 4XEZA 3SCFA 2O14A 2VMCA 1NA1A 2E7QA 3AKTA 5F37A 1W6QB 1DYOA 2XONA 3PUQA 2VH9A 4K1ZA 5E8AA 1NLSA 3FHAA 3PVNA 3QBQA 4I0AA 4YGEA 1MZ5A 2CY6A 3VKLA 2JECA 1HKDA 4LBMA 1GQGA 5IVYA 3VZOA 1FATA 1TE1B 2HEYF 4MGSA 1W2TA 2D44A 5CG9A 4XCAA 1N1SA 1SHWB 4NHKA 2OYZA 3B7MA 1D2QA 1WCUA 1XNDA 3I2DA 1O3RA 2VNOA 5FAXA 4NIAA 2VM9A 3NVCA 5GLZA 4N53A 2VTFA 5A3OA 4YZ1A 3TEZA 4CCCA 2RHPA 1SLCA 4H7MA 5APAA 3J8F2 1G7YA 5IVFA 2X8KA 3GDBA 2W1QA 4RQPA 5FMDA 1IKPA 3NW4A 1S4CA 1MZ6A 2RR12 2ZGOA 1HN0A 5HBAA 3KHCA 1X82A 4W6WA 5ABJC 4LA2A 1KD7A 1F2NA 1CR7A 3MUY1 4CTEA 5FRAA 1CAXA 4CRQA 4B7EA 4HPKA 1S0FA 4XJWA 4KG0A 4IEXA 1H0BA 2JG9C 3H50A 4ASMB 1HRV2 4GB32 4H7LA 4EZHA 4JGZC 2Q5TA 4XUTA 2ZZQA 3J7MA 4LBQB 5FZFA 4DOUA 5CFCA 2GALA 2GH2A 5F6LB 1ZA4A 3VBRB 4ATFA 1O7FA 2LTNA 3AZWA 5FZDA 3BODA 5K4LA 3WHUA 4BYYA 5FZHA 5JOWA 4Z07A 3MICA 1DDLA 1AYM2 1OMIA 1URXA 2ZEWA 3N3HA 1LAJA 1MS1A 4DIQA 4JDNA 1GYKA 3IDEA 4Q0SA 4XZPA 1QKQA 2DBIA 5DPNA 3DECA 5FUNA 1ND3B 3RDIA 2BQPA 1W9YA 1VBE2 1GWMA 1C3HA 3BUCA 2ZAAA 5FYHA 2A6ZA 2J22A 2P5BA 1BBT3 3R0RA 5DG2A 4BXSV 3G7DA 4CEWC 2UY9A 2D98A 2BVBA 4GAZA 1DQ6A 5FMCA 1JZ4A 1AR63 2ZXQA 4H3WA 1D2SA 4YG3A 1WCQA 1ZRCA 4AEDB 2W95A 3PTRB 5FZ9A 5BV6A 3E6CC 1FV3A 2P2KA 3S5QA 3K4ZA 3MW4A 3DN7A 3DCQA 1WLWA 5FYIA 3ORJA 1V6MA 3E5XA 1POQA 1XC6A 5IW0A 2VZQA 3C8XA 4WV8A 3LSEA 3VBOA 4FOYA 5LA2A 1ND2B 4OCTA 4QDQA 2VUJA 5CKMA 2RJKA 1VBB1 5AC93 1O4YA 5FY8A 5C33A 2WJSA 1PGL2 2W47A 4PDWB 4TXWA 4COYA 1G9CA 1W0NA 2RS52 4XDPA 1VBB3 5GZEA 5HV0A 4HVQA 3IT8A 4BLJA 2WWSA 1GNHA 4B1MA 4XBNA 3WV6A 2AGSA 2VXJA 3ZXDA 2YXSA 4ZY9A 5FK7A 3RMYA 1RVF1 4N7IA 3GGLA 4UFKA 4YG6A 1O8SA 2X05A 1PGSA 1YFYA 4CYDA 2B7YA 2HWC1 5A7OA 1RVF3 5D8AB 2WNUA 2P17A 1VRH3 1TG7A 4HK8A 4MGYE 2LS6A 5EJ1B 4FPJA 3RGBA 1H2LA 2HWC3 3L2HA 2ZGMA 2RM21 3LA2A 2WFF3 1LNSA 4LLFA 1O4TA 5L9RA 3NNGA 4J1XA 3ZFFB 3LEIA 3TNQA 3B3QE 3T0BA 2RM23 1LEMA 5GLVA 1GOGA 1DGWX 2Q1MA 5EIYB 1MPXA 2XKOA 1ZYBA 5FZ8A 5C4WA 3ECQA 3U4XA 3DYPA 4A3XA 4CUGA 2TUNA 4FP2A 1R1A2 1Z7S2 5FIXA 3WNXA 3UKTA 5JZGC 1ZZ6A 3FLRA 2ADDA 3ZIWA 2UYBA 2HYXA 5FKCA 5EHDA 3KF3A 4AG4A 4LE3A 1DLLA 4WM7C 1IPSA 1UCXA 2E6VA 4IGQA 5FUIA 4CCKA 1KJLA 1WW6A 4DFSA 1DF0A 1LODA 1RUH1 3DPRB 1W6PB 1XE8A 1OD3A 1VBA2 3I8TA 3NNMA 4FCAA 4WM8A 4NR1A 4Z2WA 3Q8FA 4IV3B 1H8TC 1ZZBA 1JODA 2BJSA 4YGBA 5EJZB 2BNOA 5LBCA 3WNOA 4ZXEA 4EE2A 4Y26A 1CX4A 1RUH3 1F15A 1RC6A 4WVVA 3UNPA 4QGLA 3ZPYA 3O1PA 2DUOA 4BWOA 5JDBA 3MI8A 2PXJA 2V73A 3O0VA 4Q4V1 5H9SA 3T2TA 1PZ9A 4LBLA 4XHBA 1YFWA 2WNVA 1PNGA 1W3VA 1V00A 5FMOS 4FQ4A 4ARXA 1BHGA 1TNFA 4J25A 3QH6A 1NCQC 4Q4V3 2EXJA 3O1VA 5F2WA 3I3BA 4Q1PA 4NIDA 4LBQA 1PK6B 2JIGA 1G9DA 3AVRA 1RITA 1VBD2 2QQUA 1S0IA 3VN4A 1L7RA 4CCMA 4AVBA 2HBTA 2BGCA 3FWEA 4F3JA 2ZEXA 3MIEA 2XB6C 2VTXA 4ITCA 5EP9A 1UL9A 2VUCA 3LB9A 1R082 3BALA 3VD4A 1OA2A 2W9XA 4P9XA 2HWB2 3H3UA 3PMEA 1RHI1 4YM0A 3AMNA 3WNPA 2CYFA 3WCSA 5K9YA 5JSOA 2C9AA 3FBYA 2JDMA 4YG0A 1WKYA 1JOPA 4BU2A 5A6XA 4RR3B 1C8NA 4A41A 1RHI3 4Z2AA 3W9AA 3VBFA 1A3KA 3Q8EA 3KQRA 4Q4Y1 3NJVA 1GOHA 3VBUA 5FXXA 3MHZA 5DDJ1 4OHVA 3BOPA 3FX3A 3UESA 3I2KA 3O1MA 2Y6KA 4Q4Y3 4UXAA 3U37A 4Z92B 5JXHA 4AEDA 3A0NA 5DDJ3 3LCPA 5GLTA 2UU8A 4AI1A 4HMZA 4DUWA 2XR4A 2R041 5I0SA 3VDDC 1ZNPA 1AX1A 4FPLA 5T54A 3AKSA 1RUI2 4BMBA 4BOWA 3HD8B 3ILFA 1W28A 4CCOA 1W05A 2Q8DA 1RUOA 4GALA 2R043 1ULOA 3N7KA 3POFA 2Q1ZB 3N9OA 2F4PA 1OOPA 4CCNA 2BNMA 1Q8OA 3VL9A 3AKPA 4PDWA 3WG4A 1ZRFA 3P1IA 4Y3OA 3WP3A 4AVTA 2YPJA 2DTWA 4CDWC 4ZS3A 1JU4A 3NNJA 1AR71 2LM3A 1QJY2 3CNAA 4DY5A 1W2UA 3KT4A 1FXZA 4P5HA 1UX6A 1SLIA 4D8MA 1JMUB 1AR73 1QOOA 4UBGA 3TOJA 1OHFA 5A3LA 4LBKA 4D6QA 3IMNA 4HSJA 1C57A 4UOJA 2HH9A 3O0WA 4CDQC 1DZTA 1R091 5FZ1A 5TSWA 3VD3A 2B5HA 1VMFA 3WF3A 2R072 4AQSA 5D8AA 1T2XA 3AK0A 1HX6A 1R093 1WGPA 1R1ZA 2E53A 2BBAA 4Y33A 4AI3A 1JHNA 1ENXA 1FOD2 1XU1A 1DGRN 1HRI3 2W87A 1VBC1 1IQDC 1XXNA 3OF1A 2JWPA 1SFPA 3OSDA 1ZZ8A 2VMGA 3A23A 1ACCA 4MXWA 3FHIB 4BQWA 3ZFFA 5JIUA 1X50A 4NPLA 4Q5OA 4BQ1A 2ID4A 3GZUC 3M3OA 1OA4A 1RUG2 4QPYA 4MXVA 4TLFA 1U5ZA 3CZUA 3VHOA 1JZ8A 3ZIXA 1JYTA 2NPIA 2BW8A 2EXIA 2VZOA 4GH4A 4GWMA 3H7JA 4QX0A 1DGLA 3MF6A 4XF3A 4PBOA 5FBJA 3I49A 1TQ5A 2WN3A 1HLCA 1RTVA 3ZYFA 4AEJA 1NE6A 4QWNA 2ATFA 1HW5A 2ZX1A 3SISA 1QF3A 1REDA 1F4AA 3PUAA 1ALYA 5A6ZA 2R061 3WP5A 3K4AA 4ZXKA 4XABA 4YVSC 4YVWC 3WDVA 4QX3A 2EIGA 3GBFA 3VD9A 2WAOA 3AP5A 4CEWB 4EYUA 1NY71 3NNLA 3ENRA 4IV3A 3LIHA 3E5QA 4A6SA 4IV1C 1FI2A 3CIHA 2QDNA 1GQPA 1QXPA 2P4EA 4Q2FA 3W5MA 2ZGQA 2B4KA 1GMMA 3PL0A 3RQ0A 1W90A 3ES1A 3B9CA 4JTOA 5AVPA 3ZYIB 1GANA 1L7LA 2XJTA 2XWJB 4LO5B 3PJQA 4FPGA 4WVMB 5A7SA 3RPQA 2DDUA 5FY5A 3I7DA 1W9WA 3I2OA 3B5LB 2GC2A 2XWBB 2QVSB 4AFAA 1GZ9A 4F8AA 2XBO1 2VNRA 2VVDA 3MV11 4BIFA 5IK8A 1S1AA 1E5IA 4XF1A 2XBO3 1LOFA 2EIDA 3T2QA 4AK3A 2JD4A 4AVSA 3DKQA 4LPLA 1B35A 3IDAA 3M3CA 3OB8A 3H8RA 1DIWA 1QDOA 2PFWA 5FZMA 2PAMA 2X53S 3USUB 4LO4B 4M0NA 2JDKA 3SQOA 1S2EA 4NHLA 5K7PA 1OKOA 4HFSA 1AYN2 2DURA 5BNOA 4NRPA 1OLME 4Q8LA 4PHZA 3N9PA 4RR3A 1HQWA 1UU6A 1LR5A 3H3LA 3RRDA 1QWRA 1CONA 3T4VA 3ZYBA 3AJYA 4AI9A 1Z0HA 3O14A 2LALA 4BH9A 1CJDA 1J1TA 1YWKA 4E2QA 1QU0A 4RFT0 2BOJA 4LO6B 2HEWF 4KL1A 1HV0A 1YYNA 4L92A 5ERLA 2A3YA 4WBBA 1V6OA 2JDYA 1UMHA 1HXS2 1AXZA 2VL4A 4UF0B 1D0HA 2E26A 2HWD2 1YRZA 2YC2A 3BVCA 3POJA 1DZQA 3ZXFA 4PI0A 1G86A 4RHV1 4YZ2A 3V64A 3KS7A 4JDMA 4TN7A 2PMWB 2VVFA 4AQ2A 4HKLA 4Z82A 4EWDA 4PCRA 3ON7A 5ACA2 3BKZA 1XNKA 1H2KA 3LQCA 4LKDA 4JRAA 1PO22 4HETA 4WM7B 4UBHA 4OHZA 4OZOA 1PM4A 3ETQA 4XJUA 1CPNA 4L8QA 2XKPA 2B42B 5LK5A 2CHHA 3BTZA 4UWDA 5GZDA 4R9BA 5A3WA 1H8TB 1GZTA 1NAEA 3T30A 3PVOA 4NHYA 1WMXA 1OUSA 1JUIA
chains in the Genus database with same CATH topology
5ABJA 5JLVA 1F31A 4N9HA 4LLOA 4YW4A 3ZFEB 1BCXA 3ILRA 4ORFA 4D7TA 1TME2 2O8QA 3NWKA 1NCQB 1EAH1 3LGRA 3V0AA 1C4RA 2JG9A 2QNKA 1PZ8A 1QJX2 1O4ZA 1JUHA 4EWEA 1CVNA 4JGZA 1UPSA 1BEV1 1EAH3 4EWAA 3IIAA 4C1WA 2I45A 2BFUS 4AWDA 2W68A 4FTSA 3AKRA 1VIWB 3MW3A 2ZMLA 2ZX3A 2ZGSA 4AI2A 2DCJA 2D3RA 2DF7A 1DG6A 4J1WA 2SBAA 1M4WA 4HT1T 2DVDA 5F1RA 3ZN6B 4SBVA 5I91A 1ZREA 4XMIA 1BK1A 2A7AA 2GSYA 3H0OA 1VB2A 3ZSMA 2NMNA 1PO11 3VZKA 2WL1A 3VV1A 4CEWA 2OW4A 1OQDA 3VBRC 3PVEA 4PF5A 4FPFA 1UIKA 1OQEA 3MIHA 1PO13 3MIBA 3J9SA 3EHKA 3HT1A 3TB0A 4WVZA 3MZHA 5T52A 4QPGC 3LSDA 4OZXA 3RYKA 1REFA 1WBFA 2P34A 2OVUA 4WVMA 2A6VA 4W65A 4TSVA 1ND3C 2GN7A 4K1YA 1ULCA 3PNAA 2GDFA 4LBJA 4AYUA 1BJQA 1DBNA 3CF6E 4XJZA 4FO9A 1WW7A 5EV7A 4TWTA 3ZSJA 5HCBA 3N7LA 1IKQA 1UD1A 1HV1A 4XTMA 4TZDA 2E9QA 3K48A 3WDTA 4META 1JOJA 3NV4A 4AFMA 1UKRA 1NXMA 3WVJA 1RUF1 3USUA 2GC3A 2V5YA 1LHWA 1PVC2 3TN91 3JUUA 1WLDA 5IK4A 1D4M1 4NN0A 2Z69A 2AR6A 5I0RA 1RUF3 2IXJA 3TN93 1XRUA 1ND2C 2JICA 1Q5OA 2ZGTA 3POWA 4AQ6A 4M3CE 3AP7A 1I5ZA 2QQPA 1YUDA 1DYPA 2WT2A 2K9ZA 2WZPP 2V09A 2RS11 1H1MA 4Y22B 1DQ1A 5JPMB 2ZHLA 3VBSC 5FQ0B 1QH6A 3OYWA 2DWRA 2RS13 1W6NA 5CB7A 4FTBA 4M3CA 5GZGA 2Z5WA 2JXAA 2KA3A 5L73A 2GC0A 2QFEA 2I74A 3D82A 3MDPA 5T50A 1NQDA 2JJ6A 1ZZ9A 3KCXA 5FO8B 3DGTA 3OBRA 4XIOA 1WW5A 5JZGA 4AVVA 3ZMNA 4Q0VA 1U12A 4Y20A 1SBEA 2PHLA 2QKDA 4YW3A 3H7YA 2FHRA 1DGRA 3H9AA 3BCWA 2VVEA 1ASJ1 2D43A 4IEZA 4YVSB 3WLUA 4PJYA 4M00A 1VR3A 4J6GA 4S2HA 1H8TA 4IQPA 3M1HA 4N43C 1ASJ3 3CU7A 5JI9A 1RB8G 2HWF1 4Q0QA 2A6XA 1H1AA 2R1BA 4IV1B 1ULGA 2RJLA 2BTVC 1YFUA 4ZU4A 2NLRA 5FREA 3WXPA 2HWF3 4IL7A 4AVAA 1H9PA 4GIQA 2FMDA 1QOTA 3IKWA 3MLJA 1NCQA 4I0WB 4A2UA 5BNPC 3B9IA 1RUNA 1W6MB 2PYTA 3DPRC 1ENSA 5GLWA 2ZX4A 3M3QA 1AXYA 1IS3A 2O0OA 4P9GA 2WA4A 5KWRA 4I3PA 5BNQA 4R8HA 3HR9A 1NXD1 1BMV2 2B9UA 1WMFA 4ISQA 3TBDA 1GSLA 1AR93 2GZWA 4PBPA 2WC2A 1RUD1 3GBGA 3NAPB 5JSRA 1COV2 1UKGA 1POV1 2G4IA 5KXBA 2PELA 1FT9A 4K8FA 1PK6C 1QJU2 1RUD3 1ZZ7A 4NOTA 1POV3 1WCKA 2N7GA 1DQ4A 3KT1A 2Y0IA 4P9WA 4QQ2A 5JAXA 5CG8A 4YM3A 1MEC2 1Q43A 3N7JA 3ZXEA 4OI0A 4M0HA 3VBHC 3VDDA 1FX5A 1CAVB 3A0KA 4E9KA 1YJLA 2RS32 4JV4A 5A32B 5K0UC 1G6NA 2CGOA 2JE9A 4FOVA 4B8EA 4MLOA 3HAGA 3AMQA 1U0AA 5IT6A 5L19A 1NOVA 1GZWB 4OHWA 4CDWA 4YW1A 1DGWA 5CIRA 4Q4W2 4A7YA 2C0ZA 5DZEA 1RIRA 4RS5B 3JB8A 5KXDA 4CDQA 2OUJA 1RL3A 2XVKA 5DUXA 2ZGLA 4PLOA 4MUVA 3S30A 1IS4A 4EN0A 3GALA 1D0GA 4NVPA 4DRRA 1QNWA 3MPPG 4Y22A 4CDXB 3R05A 3DKWA 1UMZA 2PTMA 1DYKA 4HLTA 4XBLA 1B09A 5JMCA 3MF9A 5H9PA 5JOXA 5FMOL 2DVFA 2UWAA 1C8M1 1RUJ2 2WS92 3KSCA 1CJPA 1J1LA 1VLNA 2B8MA 3WW3A 4RGGA 4COWA 1C8M3 1V6NA 2GMPA 2GC1A 4XQWA 2ZA9A 1JN2P 4YVSA 4YVWA 3VHRA 2DYCA 2Q8OA 2NP0A 1HDKA 1ULEA 1LGNA 1FPN2 2PAEA 3AZVA 4IV1A 4QU2A 3UKNA 2RE9A 4LHLA 2JE7A 3ALQA 4QQHA 1EV12 4QPGB 4IEYA 1RMU1 3PVBB 3QLQA 5C6CA 2CL2A 1BQPA 4F83A 1RMU3 4RA0A 1DQ5A 1MQTB 5KHHA 1VBD1 2XVGA 3H8UA 1C1FA 1W6MA 4C1XA 5LK7B 4S2DA 1ZRDA 3BU7A 4AW7A 1ZBA1 1AL22 4Q4X2 3JZVA 1ZBA3 4BHPA 1QDCA 3V0BB 4K40A 3C2UA 4QMAA 4JCKA 2QZ3A 4R4ZA 1APNA 1PGW1 4IERA 4XJAA 5AFBA 4JQRA 2WLQA 4U2AA 1C1LA 2K2SA 3QCWA 1XYOA 4ZU7A 1JXNA 4K21A 2D5FA 1H4GA 1Y43B 2XLFA 1W0OA 2OZ6A 1PVXA 2C1FA 4FPKA 3VBSB 3JU9A 1UAIA 2ETEA 1LHOA 4LR4A 4FQZA 3WQ7A 2XG3A 4QGNA 4QGMA 3SMHA 2R32A 3IDCB 1Q56A 4AI8A 3IWZA 1EPZA 4PIXA 1H2NA 1NCRB 1O3SA 3NV3A 2ZABA 3MW2A 2VXRA 1LENA 3ES4A 4XTPA 1GKBA 3MLKA 2VGDA 1AX0A 2GH8A 1KS5A 2HWE2 1GZWA 4WZFA 3KT7A 5D1IA 1GBGA 4E2GA 1IGOA 1RUC1 3D6EA 5JSPA 4C90A 2DCZA 4R9CA 2Q0AA 5BNOC 4N43B 1VAMA 4AFCA 1PHMA 1IPKA 1WCDJ 4MVTA 3NSTA 4H14A 1W6QA 1RUC3 1LJ7A 4G3YC 3H3ZA 2A71A 2JX9A 1MZEA 4FOWA 1I3HA 2DU1A 3U10A 1UN1A 2HYKA 1Q8QA 4DMIA 3FUOA 3KCYA 3SHRA 4HN1A 1X36A 3C3VA 5BNPB 1QHDA 3GZTB 1D4VB 2QCSB 1RGSA 5FLHA 1GLHA 4GA9A 4QPIC 4Y1YA 2HKXA 1EPWA 4GXLA 1M06G 1F5FA 3GNEA 4AFBA 4YFWA 4FPCA 5GJ6A 1MACA 2YGLA 3ZFEC 4QQOA 5SV5A 3WD5A 4G4FA 1JYCA 4FXGB 3ZXJA 2ZCWA 4ASLA 3OD4A 2PHDA 2UURA 4HKWA 3L2YA 2IXCA 2YMZA 1FMD1 3HWJA 3ZN4A 2E7AA 2KXLA 2OZJA 2JKBA 2ZGRA 3VBRA 2QDRA 4COUA 3MIGA 1A6CA 4XPVA 5HXVA 1S2BA 2MPFA 1FMD3 1Q8SA 2NQYA 3IPVB 2DFCA 1OLQA 1GV9A 4QPGA 4ZKTB 3VBHB 2VOKA 1MS0A 1LRHA 3WHTA 2YDEA 1AL0G 1ONAA 4URTA 3JBG1 1WMDA 2Y0OA 5K0UB 1ND3A 1BBT2 2YV8A 4E4DX 1SQ4A 4XFCA 3JBG3 3HN1A 1NZCA 4YM2A 3WP6A 5LEKA 1AR62 4I02A 1UW8A 4AGGA 4LUMA 1EYBA 4ATEA 4K3UA 5CFDC 4C0HA 2PN5A 3SH3A 3MYXA 4Z1VA 5IUQA 1Y3TA 1NE4A 1MS8A 2XH6A 5AC92 1GZCA 2IC1A 4JTNA 2VG9A 3CJXA 4GMP0 3WCRA 1ND2A 3FLTA 5T5JA 3PJYA 2EXKA 3N7MA 4E4ZA 2ZGUA 2D40A 1VBB2 3L9JT 3S0MA 1AF9A 4COZA 1F9KA 1H4HA 1OLRA 2QE3A 4KNCA 4EN6B 3VBSA 1UZYA 5DZFA 1J59A 5DUUA 2ENRA 3SH4A 1WA4A 2DFBA 5H9RA 4KU7A 2E7TA 2ZGPA 1WCSA 5LRRA 3AYCA 2AZ5A 1DZRA 4S2GA 5ACA1 1RVF2 2TNFA 1VRH2 1XYNA 1VAVA 2HWC2 3MGUA 2GNBA 1IOAA 4XIKA 2WFF2 2BFUL 2PLV1 5FLJA 5LEJA 4U36A 4QHBA 5LRSA 3HIFA 2RM22 4MGKE 2ZKLA 2PLV3 4N43A 1NA1C 5F5QA 3EXUA 1VBC3 3JD71 3BIWE 5E88A 3ZXAC 4AI0A 2RMU1 3M2MA 3POYA 3JD73 3NJZA 1NQJA 3UV9A 1BKZA 4RGAA 3AMHA 4C0BA 2R0FA 2ZHKA 3AM2A 5BNPA 1W0PA 4ISRA 4LBQD 3TRSB 3MFCA 3DPRA 1ULFA 1W6PA 4P9IA 1RUH2 2P3IA 2R063 3D5OA 3NO8A 4FT8A 2BPA2 1YIFA 4EV0A 2W08A 4FTEA 5BY5A 3LAGA 4JRLA 2H6BA 4Q4V2 2P37A 4I30A 1SFYA 2B39A 3IBMA 1QXRA 2JG8B 2DV9A 2K0GA 5KBFA 1TEIA 5CVRA 1FV2A 2A5ZA 1PK6A 2ZJCA 4D3WA 1ZBE1 2R30A 4HZFA 2D6KA 4KGQA 4N9IA 1YXWA 2ZMKA 2IXHA 4GKXA 1Y7BA 3IPVA 1ZBE3 1AR81 3VBHA 1U5IA 3B00A 4JC1A 1LOGA 2A6YA 3SITA 2WNEA 1RHI2 3FMGA 4Q0UA 5BPXA 1AR83 2EA7A 5K0UA 2Y38A 3LA7A 4AHXA 3NAPC 5A33B 5IK7A 2H0BA 4Q4Y2 2VW2A 1EY2A 1QQP1 2WKKA 4MSVA 5DDJ2 5SV8A 4ONUA 3S6PA 5DUWA 3GYDA 2OPKA 3VGIA 3KMHA 5BNOB 1QQP3 4LUKA 3VKFC 3LOBA 1GQHA 2R042 2TEPA 4NWVA 1LU1A 2PHUA 1PIV1 1RUE1 1J3PA 3SNMA 5KXCA 4RHV3 3RNSA 3T1MA 4FOQA 1YHFA 1PIV3 1RUE3 3FUQA 2DTYA 2WT0A 4XJ8A 1SLAA 2ILMA 3OPZA 4K20A 4WVWA 1BYHA 3ZYJB 3OBTA 3Q9OA 4QD2A 1UIJA 1AR72 5KHKA 2XHKA 5L7OB 4QXKA 1CAWB 1LOAA 4QPIB 4RS5C 2GAUA 4OHXA 5I8SA 1DQ2A 3WDUA 3M3EA 3QACA 2HJIA 5J48A 3KB5A 2FBEA 1R092 1X7NA 1Q8PA 1H9WA 1QJZA 1S0BA 4FVVA 4JVAA 5BXXA 2IFWA 1O3TA 3OD0A 1ZVFA 1HRI2 5GZFA 2O8OA 1TMF1 3SXWA 5EJ3A 4OULA 1KITA 1S2KA 4CDUB 4EROA 4MX3A 4UW6A 4CDXC 5CBLA 1I1EA 4INDA 5GKAC 5FTTC 1TMF3 4OUMA 5JPNB 4BLIA 5BNNB 1SCSA 1N3PA 1JH5A 4OI4A 1BEV3 3AZXA 3ZYGA 2PHXA 1ENRA 2YUEA 2WZR1 3N4MA 1BXHA 4YNIA 4AHZA 4L2NA 3WT3A 1SCRA 3RS6A 2WZR3 1NG0A 2DVAA 2W52A 1VAKA 3AFGA 3EBRA 1MZFA 3IDBB 4FXKB 1VB4A 3B93A 2ZKNA 4JGYB 3M4FA 3CLPA 3WZ1A 1NY72 4OI1A 2VMIA 2YC0A 5CFDB 2VECA 3I4IA 3ZFGC 2PHRA 3ASIA 3N35A 5C8WA 4PLNA 4GKYA 4FAGA 5FCCA 3VZJA 5KXEA 4I0BA 5GZCA 4LT5A 1MQTC 3OGJA 3PMSA 3J26N 2VW1A 2XBO2 4ES9A 4LHKA 5JIAA 1WD3A 3WX5A 2MEV1 4LULA 4AEMA 3NL1A 1MEC1 1ZX5A 3LWCA 4JDOA 4XETA 1CIWA 3QH7A 4Y24A 2P3JA 1GICA 4EN7B 3ZSEA 5E1RA 1H8VA 2YY1A 2VNGA 4GMP1 1YFXA 1D4M3 4HL0A 1I6XA 1TNRA 4GMP3 4YSFA 2A70A 1V6LA 1V9U1 2VUAA 3KM5A 1IPJA 1G9FA 1V6IA 2E51A 2IWGB 2MNGA 3RJRA 4KWLA 3O12A 3AP4A 3UJOA 1V9U3 4QM9A 1K5MC 5T5PA 5BNOA 1NA1B 1ZZCA 4OUSA 3O5SA 3WP4A 3BPZA 4CEYC 3DV8A 3W59A 4EN8B 1NCRC 2FQPA 4X6QB 4I2OA 3DF0A 2D6NA 3EJKA 1I9RA 3GF6A 3CJIC 3P3NA 2GMEA 2AYHA 3RYRA 4WM7A 2CAVA 3J8F1 3ZSKA 3NV1A 3ZN5A 3WW2A 4YFZA 3NV2A 4LEJA 2VOVA 4RQPB 3ZVXA 4C91A 2RR11 4QPIA 4MGZE 3J8F3 1RUJ1 4IEWA 1MS9A 1ZM1A 1MS4A 2ZAHA 4KWKA 2RR13 3LA3A 3THTA 3ZFEA 3AXEA 4XBQA 4PIYA 3RWNA 3CO2A 4HPKB 4N90A 1HRV1 3ZYRA 2A3XA 4GB31 4GWNA 1EAH2 3AX4A 4GQ7A 3O0XA 2BYVE 5GLUA 3RI8A 4AHYA 1WW4A 1HRV3 2R1DA 4WZCA 4GB33 4EN9B 1CQ9A 1S0GA 2A3WA 2FMYA 3B69A 3RJ2X 3VZLA 1AYM1 3RSJA 3POSA 4BIOA 5I93A 4PQ9A 3ME2A 1FNZA 3WG2A 1XU2A 1CPMA 2FZ1A 3H1MA 1IHMA 1AYM3 1H2MA 1LOCA 2UY8A 4OFGA 4I01A 1VBE1 3ZN6A 4BE3A 2XJQA 4XFIA 1REEA 1VBE3 3GHNA 3BTAA 2VPVA 1PO12 2WT1A 4HANA 2ZX0A 1SEFA 5JOYA 1JTZX 1DU3D 3OGG