1RITA

Crystal structure of peanut lectin in complex with meso-tetrasulphonatophenylporphyrin and lactose
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ritA00
1C57A 4PQ9A 5DUWA 1V6OA 5SV8A 1GKBA 1JXNA 3BTAA 1LODA 1LOFA 1Z78A 1AJKA 3AYDA 5DUUA 3T1LA 4M01A 4YW3A 4M3CB 2ZGTA 2WLQA 1F31A 2EALA 3SISA 3A0NA 3AYCA 3B3QE 4FPCA 4YM3A 1DQ1A 2RHPA 4NOTA 1AX1A 2YROA 3HN1A 3SITA 2PHXA 5JDBA 1MVQA 4TZDA 2UWCA 4AWDA 1FV2A 5H9SA 4DRRA 1DHKB 3IMNA 1FAYA 1S0IA 5T54A 2DU0A 3SH5A 3WDUA 3TB0A 5E89A 4GWMA 1UZZA 3N36A 3AP6A 3WCRA 1KJLA 2VXRA 4XMIA 1LHUA 1SBEA 1BYHA 5DZEA 1GNZA 2VY0A 4FPGA 1FATA 2ZGRA 4XBNA 3MEPA 1CIWA 1R1ZA 2CNAA 1SLLA 2VH9A 1LOGA 2A70A 1YYNA 3OYWA 3FUOA 4ZXKA 3ZXJA 3V0AA 1LOFC 1F5FA 1MS0A 4ATEA 1MS4A 2D6MA 4ISRA 5IK8A 3ZSJA 1KRIA 3N35A 5GZGA 3N7JA 3AZZA 4XIOA 1KITA 3UJOA 2GMEA 3N7MA 5IUQA 3FLRA 4FOYA 1URXA 1X50A 1I1EA 2W39A 2I2SA 2HYKA 2WT0A 2E7QA 2C9AA 1O4ZA 5CA6A 4C1WA 4XOGA 2ZGUA 2DYCA 1PZ8A 1N1TA 3PVNA 4FQ4A 2A6XA 5JOYA 4CTEA 1UAIA 1LGCA 5KXBA 1EPWA 4GWNA 1DFQA 2ZACA 1MVEA 4YGDA 4ATFA 2GMMA 1KQRA 2EAKA 3IM0A 3VKFC 3WOGA 3KM5A 4LBQA 1F9KA 2WT2A 1SLIA 3WNXA 5GM0A 1SLBA 4YW2A 2ZGSA 4Q1RA 3ZSKA 4DRVA 1AZDA 3ATGA 4FP2A 5GZFA 1N3PA 1W6PB 4LBKA 2ZGPA 1QDOA 1ULEA 2VW0A 3DGTA 3FBYA 4XTMA 5CAZA 1AXZA 2KM2A 3B9CA 2UWBA 1MS3A 1VIWB 1D0HA 2A6ZA 2ZGLA 2PHUA 1MR5A 3T1MA 1UX6A 3AP7A 1IKPA 4DQAA 5L73A 3OY8B 1AJOA 3VUOA 1WD3A 2ZGNA 3N7KA 1DQ0A 2D43A 1QMJA 2LALA 3AZVA 1RINA 1MS9A 2ZMNA 1LESA 1MZ5A 1AVBA 2D3PA 4K1YA 4U2AA 2CWSA 3WDVA 2ZBJA 3IPVB 1QOOA 2ZABA 3POSA 4R9CA 1N3OA 5CB7A 1CPNA 4XJ8A 1S0BA 2A5ZA 2JKBA 4XMAA 3LSEA 2FHRA 1W6OA 4Q2FA 1LEMA 4Y24A 3UL2A 2NMNA 1SBDA 1DQ2A 2JJ6A 2P2KA 1V6NA 3AJYA 4AGVA 1LHOA 4YLZA 4CRQA 4YGBA 1G9DA 4DS0A 4WZFA 4AGRA 4Q8KA 5EWSA 4XYXA 2VW1A 4XJZA 4YM0A 5DZFA 5JOZA 1GYKA 4P9WA 1WD4A 4Y20A 5DG1A 4BPZA 1LULA 1JUIA 1WLDA 4ASMB 3D6EA 5AVAA 4FPLA 1GICA 2SBAA 3VKLA 4BMEA 2ZHLA 2DVGA 3APBA 1IS5A 1ZM1A 1DQ5A 2W52A 3M1HA 4MYEA 1JW6A 3PJQA 2ENRA 4YM2A 3WG3A 3L2YA 1NXD1 3HMYA 2WJSA 4FPEA 4YZ2A 1C4RA 1KDMA 5GZDA 3N3HA 4JCKA 1G9AA 1O4YA 2NN8A 3RRDA 1WLCA 4Y1UA 2OW4A 2A6YA 2UWAA 4XHBA 5JMCA 2WT1A 5IT6A 2D3SA 4XXPA 2CWMA 4AVTA 2VU9A 4FP3A 1AX0A 1QF3A 3D5OA 1UZYA 3MW2A 2A71A 2A6WA 2ZGOA 4XBLA 2GNBA 3FLTA 2A3YA 4BOWA 2EF6A 3BODA 1H9PA 1CJPA 1QGLA 3MW3A 3ZXFA 3AP4A 3WVJA 4R9AA 3POWA 3R4UA 2ZAAA 3FUQA 4BM8A 3OPZA 4FPYA 3C2UA 4ISQA 2UURA 2P34A 3RG0A 1DYPA 1G8WA 1Q8QA 1UPSA 2D6KA 4K20A 4YM1A 2OVUA 1LU1A 1KJRA 3ZSLA 5HCFA 1APNA 1N1VA 4GKXA 5IK4A 2JECA 3V0AB 2AENA 1BKZA 3OYWB 1JHNA 3FLPA 5KXEA 2W68A 4YW5A 5HCBA 2V5YA 1C1LA 1GBGA 1PZ9A 1Z0HA 1A8DA 1PZ7A 1SCSA 3SH4A 4YG3A 4BQ1A 2EXJA 4PBPA 3WV6A 3GALA 2DUOA 1W6MA 2EXIA 3AYAA 1HKDA 3B69A 1LEDA 2EXKA 2NMOA 5GZCA 2AH2A 3NV3A 3RS6A 4GA9A 1LOEA 1MS1A 3AP5A 5FREA 1QNYA 4Y1YA 2C5DA 2DWRA 1D2SA 2DTYA 2ZA9A 3N7LA 3ILNA 3PVOA 1G9CA 2AGSA 1GANA 4FOVA 3PVEA 1JYCA 4L8QA 1JOJA 3O12A 1S1AA 1G7YA 4FPHA 3T2TA 3WLUA 3D4KA 1Q56A 2D7FA 4M3CE 2E51A 4YW4A 4PF5A 1BXHA 1IS3A 2ARXA 3WDTA 1LHWA 2V73A 1Q8VA 3AXDA 4XDQA 1ONAA 2DV9A 4R9DA 2D6LX 3M2MA 4LBNA 4Y22A 4XE9A 2DUPA 2AUYA 2R0HA 5E88A 2B7YA 2ZHNA 3NWKA 3LCPA 1DGLA 3R05A 4LBJA 4GKYA 2R16A 2XB6C 1BJQA 3AX4A 3CNAA 1W6NA 2GNTA 3MPPG 4YG6A 5T5OA 2DURA 1UKGA 4FOQA 2D6PA 3WDXA 1ULDA 1YI7A 1S0EA 2CL2A 2LTNA 2Q5TA 3UK9A 2NP0A 3ENRA 1OKQA 5CNAA 1VAVA 4FPFA 1QNWA 1FV3A 3ZYPA 3BOPA 4TYSA 1W0PA 2AR6A 2ES3A 2G4IA 1N47A 2P37A 2EXHA 3BIWE 1V6JA 1FNZA 2ZHKA 3WDWA 1W6OB 3ILFA 4P9XA 4WVWA 1YO8A 1W6QB 4FPOB 5T5PA 4UW4A 4AVVA 3QCWA 1QDCA 1ULCA 2ZGQA 1NLSA 5H9PA 4D69A 1WW4A 3FFZA 3VKNA 1Q8PA 3ZYRA 1LGNA 1I3HA 1S0JA 3OBTA 2AYHA 4DPNA 5GLUA 2YY1A 3WUCA 1N3QA 3WG1A 4I30A 1ENQA 4Y20B 5KXCA 2VW2A 1SFYA 5GALA 1XQNA 2ZMLA 5IK7A 3USUA 1GZWA 4Q1PA 1GSLA 1CONA 2SLIA 4WV8A 2NZ9A 2GDFA 1S0DA 4W65A 3DUIA 4GXLA 4XJ9A 3V64A 4Y1VA 2DVFA 5T52A 1DQ6A 2ZKNA 3NV2A 4XIKA 2ZZJA 1LOCA 1HQLA 1SLTA 1ULGA 1V6MA 3NV4A 3O0WA 2WNEA 2P3JA 3WDYA 4LBLA 1VAMA 4HANA 1V6LA 1N1YA 4BLIA 5IK5A 2A3XA 4UW6A 1VLNA 1V6KA 1WLWA 3ZXEA 3NV1A 5GLVA 1LJ7A 2JD4A 2GN3A 3M3QA 1A78A 1G86A 2UU8A 4RA0A 4P9YA 4WVVA 3AJZA 2DVAA 3RQ0A 1LTEA 4PCRA 1MS5A 1OQ1A 2P3KA 1JN2P 1W0OA 4XXAA 2VUAA 1BQPA 3ZXKA 4KBBA 3KQRA 4GALA 1H30A 2DUQA 1C1FA 1TEIA 1V6IA 2PHWA 1YXWA 4JC1A 3ZVXA 1LECA 4Y1ZA 3V0BA 3VKOA 2AREA 1KDKA 5EYYA 5H9RA 2Z42A 3GNEA 2FMDA 5EYXA 4AGGA 3ZPYA 2E7TA 3LSDA 4FQZA 5T50A 4FPJA 5GLTA 2GNDA 2A7AA 1SCRA 3M3CA 1IS4A 2E53A 3M3OA 3SLIA 3WHTA 2WSUA 2YV8A 2ZHMA 1AXYA 4PBOA 2PELA 4M3CA 4XHXA 3WHUA 4XJWA 2JE7A 2YXSA 5LK5A 4F83A 1WBFA 3AZWA 4YGCA 3TAYA 5GLZA 3OGGA 3HR9A 2H0BA 1GZ9A 5DUXA 2ZGMA 3O0XA 4YGEA 4JRAA 1YRZA 1B09A 4YZ4A 1W6MB 1QOSA 2CY6A 3WG4A 1G9BA 1A3KA 1LGBA 1GLHA 3UJQA 1WW6A 1GV9A 2CYFA 2GALA 1CR7A 4ITCA 4P14A 5CBLA 1HDKA 2OUJA 2NYYA 1FYUA 1Y7BA 2ZMKA 1WCSA 1AF9A 1CESA 1ZA4A 2CTVA 2D6OX 2DVDA 2ERFA 2R49A 4FOWA 4Y26A 5T5JA 5BYNA 3W59A 1DIWA 2DVBA 3AP9A 1G9FA 4YG0A 2D44A 3ILRA 4K21A 2OUHA 4Q26A 5JVVA 4OZXA 4RL7A 1DBNA 4HL0A 4UW5A 4FPKA 3AFKA 2E6VA 4SLIA 1QU0A 3O0VA 3M3EA 4LBQB 4LBMA 5HCAA 2EIGA 4AVSA 1CN1A 1LOAA 3VV1A 3I4IA 2A3WA 4XILA 1MS8A 4Y22B 1YIFA 1J1TA 4XJAA 3I8TA 2YMZA 3O5SA 5FRAA 1UL9A 4LBOA 5DXDA 1V00A 1LENA 3IN9A 4LBQD 3IKWA 1Q8SA 3B01A 1LOBA 4XBQA 1UN1A 1W6NB 4M00A 1BZWA 5EXOA 1LCLA 5DZGA 3U4XA 4U36A 1HLCA 3VKMA 2WSVA 3JU9A 1OFSA 4H55A 1JYIA 1VALA 4Y1XA 4C1XA 1QKQA 3SNMA 5DG2A 2D6NA 3SH3A 4UW3A 3JUUA 1FNYA 2P3IA 1S0CA 1CVNA 1FX5A 2WKKA 1CQ9A 3WUDA 1DZQA 1W6PA 5DUVA 1WW5A 1CPMA 2GN7A 1RIRA 5E8AA 4ZKTB 5GJ6A 4YZ5A 2PHTA 3MW4A 4XZPA 1LHVA 1JBCA 2PHFA 5JLVA 2GMPA 2D3RA 4BMBA 2GNMA 3A4UA 3QLQA 5T5LA 3OY8A 3WZ1A 1RITA 1AX2A 1LHNA 1U0AA 4YFZA 1SLAA 3INAA 4AYUA 4BLJA 1IOAA 2R1BA 1GNHA 1SLCA 1WUVA 1GZWB 3USUB 1MZ6A 1SACA 4IQPA 3W58A 3ZSMA 5JOWA 3OBRA 3IPVA 1DYKA 1WBLA 3RMXA 2TEPA 2DU1A 5H9QA 2R0FA 1Q8OA 1WW7A 2NM1A 3OJBA 3PMEA 3WG2A 1ULFA 4YZ1A 5F9TA 1W6QA 1LU2A 2A6VA 4YFWA 4DFSA 4NO4A 3AZYA 1ENRA 4XJUA 2YZ4A 2DTWA 1UMZA 5GZEA 3Q9OA 3AK0A 3A0KA 3ZXLA 1N1SA 4Q8LA 4XTPA 2ZGKA 1H9WA 3RMYA 1S0FA 1SBFA 2ARBA 5KXDA 1HQWA 3ASIA 4M3CF 4CZSA 1IKQA 3R4SA 2XG3A 3RSJA 3WCSA 3B00A 4YW1A 4K1ZA 2JDZA 1IS6A 2WQZC 5T55A 4R9BA 4FVVA 2W08A 2R1DA 1DLLA 3V0BB 4YZ3A 2A75A 1DQ4A 1QOTA 2PHRA 1MACA 5JOXA 1GZCA 4Z8BA 2BQPA 2JE9A 3AYEA 1S0GA 4Q27A 1AXKA 3POYA 5GLWA 3V65A 5F5QA 1ENSA 3AXEA 3H0OA 3AZXA
chains in the Genus database with same CATH superfamily
2CDOA 1SPPB 1LKNA 1YQ2A 4I09A 2MEV2 4WBBA 1GKBA 5FV3A 5SV8A 3W21A 3LEMA 4AG4A 3Q8AA 5LY1A 4ZZ8A 1CIYA 3O1VA 1AJKA 1PO13 1W2TA 5BUVA 2IVJA 1OH4A 4WM7B 4YW3A 2HWD2 5FZ7A 3U10A 5C6CA 4UBHA 3SISA 1VRBA 4FPCA 1J1LA 2RHPA 1W2NA 4L99A 1BBT3 3RVHA 5A32B 5FYZA 1AX1A 3ZFGB 4A45A 5JDBA 2JG9A 2UWCA 2XQRA 2J1VA 4JV4A 1COV2 1FAYA 2Z79A 4LO7A 2UY8A 4XVHA 2FDJA 3WDUA 5AFEA 2DF7A 1ZZ7A 5E89A 4CEYC 4XUPA 3AP6A 5D1IA 4A3XA 5FZIA 5DZEA 3LOIA 4YVWB 1FI2A 3X29B 4FPGA 1FATA 4E4HA 2CNAA 1RUF3 4MXWB 3VL8A 4EJRA 2VBPA 1LOGA 3KF3A 3ZXJA 5FYYA 4A6SA 3ACHA 2QQPA 5C5TA 1DLCA 3I3MA 3NW4A 5FPVA 2VNOA 1J59A 1JYXA 2JDUA 5LK7B 1XNCA 3N7JA 1TMF3 2ZEXA 3AZZA 4L2NA 4I01A 4XIOA 2CAVA 2GMEA 5ABJA 2HJIA 3FLRA 2E63A 4FOYA 2JIJA 5CG9A 5A7SA 3ZDSA 5CFCA 2C9AA 1O4ZA 2YGLA 4C1WA 2BVVA 2X5IB 3MV01 4Z92B 5LBEA 2DYCA 1AYM3 3K3NA 4TSVA 2ZEWA 4Q4V1 4ZHNA 1B35B 1LGCA 5KBFA 1RUC3 4GWNA 1PNFA 2ZACA 2CV6A 5D8AB 3N9MA 2VCBA 3ZMOA 5EQUA 3LB9A 1Y4WA 2O0OA 3N9OA 1E57A 2VZPA 3UYJA 1F9KA 5HBAA 2XJRA 3N9LA 3WQBA 1KEXA 4YNIA 3T4VA 4DRVA 3VDBA 2VOXA 4I0WB 1XPWA 2J42A 2Q1MA 3JBG2 1W6PB 4FP2A 2VZ3A 2HWC2 3LDKA 4YW7A 3UKVA 3WW4A 2PA7A 1C8M3 2RJKA 2W2IA 5ABJC 3TNQA 1RUG3 3GBWA 3B9CA 3HT2A 3VHRA 5CFCC 2ZGLA 3T1MA 4N8MA 3NRUA 4H7MA 3AP7A 2VQ0A 4ZU5A 2XJPA 1AR61 2BDRA 4DEQA 3VUOA 3VBFA 2LM3A 3KLSA 3OD4A 3E6BA 5ACA1 1OLME 2X8KA 3N7KA 2Z4FA 3UNPA 3AZVA 1VBC2 3RYKA 2XLAA 4RQPB 5C5UA 3MUY1 2WL1A 4CEWA 1V9U1 4DUVA 3GHNA 2WO1A 1OVSA 3OUHA 3MYXA 4CE8A 2CWSA 2EICA 3DPRA 1QEXA 1HJFA 4QM8A 4NJ4A 2ZX3A 3VL9A 2B9VA 4QWNA 4CDQA 2OPWA 3CF6E 2D97A 4AOCA 1VB2A 3N4MA 4Y24A 2R062 4CP1A 1Y3TA 1NCQC 4ONUA 4AVAA 1CX4A 5FP9A 1JZ6A 1HN1A 2AZ5A 1LHOA 1D4M3 2ARCA 3C3VA 3J9SA 4KWUA 4YGBA 1NAEA 5K9YA 4Q8KA 1GFF2 2B9UA 4NIDA 1BVP1 2R073 3ZN6A 1R1A1 3ITQA 4S2GA 3VBFC 4BPZA 2OKXA 1RXFA 1M06G 4ASMB 2BV4A 3OEAA 1IPJA 4FPLA 5JCTA 1NOVA 4FTBA 5DAQA 3RYRA 5AC91 1HV0A 2OQ6A 4BISA 2DVGA 1KXGA 3VBRB 4B4QA 4IEOA 2Q0AA 4HKOA 4N53A 4D7TA 3DPRC 1DQ5A 4BQ5A 5I8TA 3BVCA 1OOPA 2VMIA 3WG3A 3CZJA 3FL7A 2XVGA 3A22A 3NNFA 4A7KA 3HQRA 3NNJA 2RS13 4YZ2A 1KDMA 5FZOB 4XFCA 1YQ5A 1CAUB 3IT8A 3H7YA 1G9AA 5J09A 3O1SA 3NJYA 4XDPA 4A7YA 4LKDA 3IDBB 4MOAA 2F17A 1XU2A 4XHBA 1CAWB 3GZUC 1UIKA 4XXPA 4FP3A 5A33B 1ACCA 1W8TA 4I0BA 3JB4C 4XACA 2QE3A 2W1UA 2ZGOA 4XBLA 2WO2A 4BOWA 5JUVA 3B7MA 3BODA 3POIA 1H9PA 3B02A 2RV9A 4R9AA 3POWA 3IDEA 3R4UA 2RM23 3MLJA 4NIGA 3DV8A 4ISQA 3BB6A 1Q8QA 4K20A 4OVEA 3H3LA 5BNNB 4BXSV 1UY0A 5CIRA 4XFIA 4E4ZA 1BLZA 3BN6A 2JECA 4XZUG 5IYYA 3V0AB 3OYWB 4LJHA 4IEYA 5FWJA 5KXEA 3K51A 3IDCB 1EPZA 1PZ7A 1PNGA 1WA6X 4IV1C 1SQ4A 4YG3A 1FOD3 4ZONA 4AQTA 4LA2A 1L7RA 1QQP2 3AYAA 1LEDA 2EXKA 2PFWA 3NV3A 4KG8A 3RS6A 3THCA 4LKFA 1F8VA 2K9ZA 1IG0A 3AP5A 1QNYA 4MSVA 4OHXA 4Y1YA 3QD6A 4QX5A 5FLJA 1ND2A 2DTYA 3OOXA 3RI9A 2XBO1 2Y38A 2J1RA 3ILNA 1RJ7A 1GANA 1OI6A 4FOVA 4K8RB 3PVEA 4UT5A 5A6XA 4LHSA 4D6RA 1ZRFA 3O12A 4FPHA 1S1AA 2VZRA 4LLOA 5EPAA 3Q8CA 4LO6B 1CAVA 3VHPA 4AE2A 1Q56A 5AFBA 2A73B 3CQOA 5IFTA 2PXJA 4IL7A 4YW4A 1GQHA 1NA1B 1ASJ3 1E5RA 1VBA1 1VE0A 4O61A 4OUEA 2ARXA 4LEJA 3WDTA 5K0UA 4RHV3 2BGCA 2FCTA 4AAPA 5KR7A 4XDQA 4FTSA 5I93A 1UZ0A 1DCSA 4LBNA 4XE9A 1MEC1 2DUPA 3C7HA 3U11A 2WFF3 3NWKA 2ZHNA 1PO22 4LOTA 1PK6B 1DF0A 3WW1A 3ZYGA 1XB9A 1OKOA 4MUVA 4YVSA 3R05A 1DGWA 3VD7A 3WF2A 2GC2A 4LBJA 4BYYA 5A3UA 2R16A 2RR12 3CNAA 3ZLIA 1CJDA 2H0VA 3AL5A 5J48A 1HB1A 2WS93 4B8EA 1YI7A 5J1XA 3UK9A 4ORFA 4QKBA 4HKWA 5JI9A 2BZDA 1OKQA 3BOPA 2AR6A 2TBVA 5DDJ3 1DYOA 2EXHA 1V6JA 3H8UA 5FYUA 5SV5A 1RMU3 5D2AA 1KS4A 3VD5A 3W9AA 1FNZA 4KH9A 4FFIA 5A3WA 4EZ4A 3GBGA 2W5FA 1W6OB 3ILFA 2RS51 4DEVA 4URTA 3VHOA 5FZ8A 1X8EA 2WAAA 1QDCA 2ZGQA 1BEV3 4GIQA 4K40A 4D69A 4LE4A 4YVSC 4CCDA 5LATA 1I9RA 1Q8PA 4XCBA 3ZYRA 3KV4A 2AYHA 5GLUA 4CXXA 4AI3A 1AR81 3RNSA 3H8OA 4XF0A 5LY2A 5KXCA 3A23A 5GALA 3IAQA 3MFCA 1XQNA 1LRHA 2ZMLA 1GZWA 2HKXA 4B1LA 1OA3A 5LZ6A 1GSLA 4IEQA 1EV11 2NZ9A 4IXLA 3T2OA 1JU3A 2B45X 4GXLA 4XJ9A 2JB4A 4IV3B 4QT6A 5FUPA 4J6GA 3FHAA 2PQQA 3I2HA 4Q4X2 1IGOA 1XJAA 4JAAA 1LOCA 4P08A 3WQ7A 1IPKA 1OBNA 3O0WA 4QMAA 3WDYA 1VAMA 1V6LA 4S2HA 4IEUA 2HEYF 2Q8CA 4FT8A 1W9SA 4R8HA 4D3WA 2YC0A 5IVFA 4PDWA 5FPXA 1JYTA 1VMFA 4LLFA 3POJA 1LJ7A 1ZRIA 3O1MA 2VJXA 3M3QA 1PVC1 1FMD2 2UU8A 1Z7S2 4LQRA 2VPVA 5FUIA 3AJZA 3RQ0A 5IVBA 1GP6A 4UI9L 2LUWA 2ET1A 3PIGA 4CCMA 1W0OA 4V1PA 2FBEA 1AYM2 2HEWF 1HRI3 1WA4A 3AKPA 3KQRA 3OPTA 4GALA 2WNVA 4JC1A 3V0BA 5FP7A 1RUJ3 1YXWA 1EP0A 4X6QB 1RUC2 1RUE1 4CU9A 1WMXA 3LAGA 2UY9A 1XBFA 5F39A 4IEVA 1DU3D 5EYXA 5T50A 4BE3A 5FY0A 2PYTA 1SPPA 2A7AA 1PIV1 2PAEA 1NY72 2VMEA 3KHBA 4LULA 1EAH2 3MUZ1 2R042 1W9FA 3LA7A 2C6SA 4O9EA 3BU7A 3WHTA 4Z1VA 4WM7A 1AL21 3RWNA 1C8M2 1A6CA 1RUI2 5LK5A 1RUG2 1VBB1 1WBFA 5DAXA 3TAYA 1AR63 5GLZA 4CU8A 2K46A 3K77A 1UF2C 3WF4A 3ZFFC 5DUXA 3ZFGA 3KSCA 1YRZA 3IZOA 1UQXA 1KS5A 2YFZA 1V9U3 5CU1A 3WG4A 1JYNA 1G9BA 2WNVC 1QJFA 1LGBA 1O8SA 4JKKA 4HETA 5IAVA 1ULPA 3WNOA 4W6YA 4P9JA 2W92A 1HDKA 2OUJA 2NYYA 3AMHA 2FDHA 1WCSA 2ERFA 4YVWA 2R49A 1AR91 2Q30A 4CVUA 5BYNA 2B5HA 4MXWA 2Y6LA 1VBD1 3BYWA 4K21A 3VBSB 2DCJA 4AF9A 4Q26A 4OZXA 2GC0A 1DBNA 4L0PA 4BU2A 5F7UA 4XQ4A 4C90A 2QVSB 4WM7C 4LKEA 3ME2A 4SLIA 3O0VA 2D98A 1O4TA 4XUTA 1L7QA 3LPFA 4CPBD 2WO3A 4GJYA 5CEHA 4LUMA 4MX3A 5HCAA 3AMPA 3I4IA 2B42B 4TWTA 4QQLA 3VV1A 4CXYA 4CUCA 4OHWA 2VGDA 1MS8A 4OYUA 5FKBA 3DYOA 3I8TA 4AI1A 3O5SA 5FRAA 1UL9A 4MGZE 1QJX2 2GC1A 1PO11 2X5IA 2AC1A 5I0TA 2BWCA 3IKWA 4JGYC 1US2A 3LD8A 1B35A 1W6NB 4QHOA 4RS5C 3GM8A 2XLFA 3ZN5A 4YPJA 1BBT1 5I0UA 1HLCA 2ET7A 1SDDB 2WSVA 1OFSA 1JZ4A 5D8AA 3ZFEB 4W6WA 3HWJA 2XWBB 2HLEA 2W95A 3MF6A 4XPVA 2BNNA 5A7WB 3SH3A 3Q8EA 4P02B 2P3IA 4LPLA 1XC6A 1TZOA 3E1F1 4PLMA 1OHFA 3DCQA 1HXS3 1T2XA 2VO5A 1DZQA 1W6PA 4KGGA 2GN7A 3RZZA 4Q0UA 3LFMA 2H6BA 3ZX7A 4PJYA 3TN93 1LHVA 2L9LA 1RUF1 1GZTA 4UFMA 2VUJA 4Y33A 2ZAHA 1PM4A 1YIPA 3VHNA 2GSYA 2WZPP 2X5IC 1WCDJ 3A4UA 1YFWA 4FAGA 2WN3A 3VDCA 3HNMA 1SMVA 5F5CA 3UGFA 2N7GA 1B35C 2QBXA 5FY8A 1K5MC 1LHNA 5F6LB 1TMF1 5DAVA 4FFGA 4B7KA 4RQPA 4BK5A 2E32A 3JB8A 2R1BA 4BLJA 1GNHA 1SLCA 2FCVA 2JG8B 2Y33A 2XJUA 3T0AA 3W5NA 1VR3A 5D8AC 1ND3B 4UYBA 4ES8A 5F5AA 3RPQA 3OBRA 4FXGB 1WBLA 3RMXA 2TEPA 3ZMNA 4GULA 5I0SA 5H9QA 4OZOA 1AUYA 1AYM1 3OJBA 1VBE1 4GAZA 1UWWA 2E7AA 5F9TA 5FR3A 3IWZA 4PLOA 4KQ7A 1JOBA 1LU2A 2VVEA 4ZXEA 3VBHC 1D0GA 4NO4A 1RUC1 3LA2A 3PU8A 4J25A 4XJUA 3C7GA 2BW8A 2DTWA 5GZEA 3ZIWA 1FOD2 2ZEYA 2EIDA 3KHCA 1S0FA 1SBFA 1VMHA 1FXZA 1W05A 1OUSA 4GB33 3WCSA 1J58A 2O8QA 4RQPC 1C8M1 1W2OA 1OF3A 1IS6A 1GOGA 2EIEA 5T55A 4R9BA 3VBRA 5A3NA 5FJKA 1GQGA 2PHRA 3VBOB 3HPNA 2Z2SB 3NJXA 1R082 3N9NA 5BPXA 3NSTA 1ENSA 3AXEA 1D4VB 3H0OA 3INAA 3AZXA 3OD0A 1R093 5FZOA 4IEXA 1ZZBA 2Y0IA 4ARYA 1CAUA 3DN7A 2O8OA 3AYDA 1GP5A 2RDSA 5DUUA 3VDAA 3ZDVA 4HN0A 1F31A 1JYVA 2WFF2 4LUKA 2A1XA 1CAWA 3AYCA 3B3QE 1DQ1A 2VCCA 3NAPB 4K3UA 2YBPA 4MO3M 4NOTA 4S2FA 5A33A 5FP4A 3HN1A 3SITA 2PHXA 3N9PA 4FTEA 3NKTA 5L9RA 4P00B 4QKNA 4AWDA 4YSFA 5FPAA 1DHKB 4ZZ5A 4BQ4A 1D4M1 1S0IA 5BY5A 5L36A 2WS92 1U12A 4CP0A 3MZHA 4R4XA 3TB0A 2R071 1PGSA 2ID4A 2ZKLA 2Y6GA 3N36A 5EIYB 4NRMA 2XH6A 1TME3 1NZIA 2VXRA 4L97A 3I2GA 1SBEA 1BYHA 1SZBA 4P9LA 2VY0A 1G9DA 5BNNA 5FYCA 1R1ZA 3MBWA 5FLHA 4LK7A 2VH9A 2QQKA 5CG8A 3V0AA 3OYWA 3FUOA 1NG0A 1GOHA 2HEVF 1MS0A 4DNYA 4CDWA 2BBAA 4ATEA 3H1WA 3DL3A 1MS4A 4ISRA 4PIYA 5IK8A 3ZSJA 2W9XA 5DABA 3H3UA 3N35A 2FD8A 3ZKUA 1U5YA 2ARAA 2W91A 4AFDA 2QQUA 4MGIE 4COWA 3UJOA 3N7MA 2RS11 4UFJA 1URXA 2WT0A 2HYKA 2VG9A 2VOTA 1EV13 5CA6A 2OX0A 2ZGUA 4BQWA 4AQ6A 3PNAA 1U5XA 2O1QA 5FYSA 3T0BA 5E6HA 1EY2A 3GBFA 2WIIB 3MIDA 3WNKA 5A6ZA 5B2GB 4CTEA 4OQ8A 5JPNB 2IXLA 5BNNC 4HT1T 1PMHX 1KFXL 5ERLA 3MIEA 1MVEA 4GD4A 1H2MA 1ZZ8A 2JDAA 3WOGA 4QXKA 4DB5A 5A7OA 4LBQA 3MI8A 1NA1A 3OTFA 1SLBA 3DYMA 2RM21 2ZGSA 4Q1RA 5D21A 5JSRA 1AZDA 2BGPA 4IE5A 5FZ1A 2BWAA 1ULEA 3FBYA 3LEGA 2KM2A 2VMCA 1WMFA 2UWBA 1PK6A 1QWRA 4Q4V2 1CX1A 2PHUA 1UO9A 2RVAA 2IZWA 5L73A 3OY8B 2PLV3 4N9IA 2WQ8A 2ZGNA 4FO9A 1RL3A 4OMDA 1C3HA 4BZ4A 1QMJA 5HI0A 1MS9A 4HSJA 1MZ5A 2HYXA 2R32A 3H1YA 2WYFA 4JGZC 4K1YA 4URAA 2C4XA 4E4DX 3KCYA 1XE8A 4ZU7A 1S0BA 4FSJA 1K5JA 1GU3A 3LSEA 1J83A 2FHRA 4QDSA 1W6OA 2MPFA 1VP6A 3POEA 4OMCA 1MQTC 3JD73 4MZUA 3S57A 1CAXB 3AJYA 1AR62 1PK6C 5FMDA 4CRQA 3WNNA 1V0AA 5DPNA 2IFRA 4AI9A 5APAA 5EWSA 5ACA2 1RHI3 5CKQA 5BV6A 4YM0A 5T3NA 4NUBA 1ASJ1 1RC6A 3IIIA 2E26A 4KU8A 5DZFA 1V9U2 1WD4A 1LULA 1JUIA 2VAUA 4RHV1 4Q0PA 1P8JA 5FYMA 3D6EA 4WM8B 2XKOA 2SBAA 2WZR3 4RN5A 3VKLA 2G9FA 3H1MA 2WFF1 2HH9A 3B93A 4QHZA 5LA1A 3APBA 3TNPB 4IV3A 1ZM1A 4CXWA 5KC6A 3AKQA 4XAEA 1E5HA 4DMIA 2XMLA 3M1HA 3O1TA 1YEWA 2WS91 4DUWA 3GJBA 2XVLA 4L9BA 4OI4A 4BWOA 4HVOA 4FPEA 5M0TA 1C4RA 1R1A2 2RDNA 1WCQA 2WNOA 3N3HA 4E2SA 4KL1A 1C5HA 5DDJ1 4D94A 5C8CB 4CCLA 1JMUB 3N9QA 1RMU1 5AC92 2D3SA 2CWMA 3ZYBA 4AVTA 3I49A 2PHDA 2RDQA 2P1BA 1QF3A 4MLOA 3SEEA 4E27A 2YBKA 3FE5A 1TNRA 2A71A 2GH8A 3LE0A 3MW2A 4XDOA 1PHMA 1W04A 1SHWB 2DFCA 3FLTA 1BEV1 1UY1A 3NL1A 1W8ZA 5BNOC 1QH7A 5IVCA 1QGLA 3PMSA 4IV3C 3TEXA 3DEMA 1FPN3 4A3ZA 4RSUA 5FY4A 4I02A 5LBCA 2UURA 4MV2A 2JDYA 4XF1A 1G8WA 1XXNA 4YM1A 2D6KA 1D7PM 5JZGB 4GKXA 4MGQA 3FJSA 4UFIA 5IK4A 3U1XA 5C3PA 4GMP0 3POBA 2WA3A 2W68A 5HCBA 2VBBA 2V5YA 1C1LA 2WABA 3WT3A 2HWB3 2BTVC 2CGPA 3JZVA 3SH4A 4BQ1A 2JB8A 4FI9A 2EXJA 3GGLA 4PBPA 3GALA 1H8TB 2Y6HA 4YWAA 3GHMA 3RZKA 1A8MA 1ZBE3 1XNBA 2ORZA 1GR3A 2EXIA 2ZOEB 1HKDA 3B69A 3CDZB 3D0JA 3VZOA 2JG9C 2V72A 5EV7A 2FDGA 4GA9A 1NLRA 2V5DA 2C5DA 2X10A 2DCKA 4RFT0 3PVOA 5F2WA 4AHZA 2XPJA 1VBE3 2ADDA 1DGRN 5BXXA 4LMFA 2QNKA 4WVMB 2LW8A 1KD7A 2XJVA 3VBSA 1AR73 5K4LA 3ST7A 1G7YA 3T2TA 1HRI1 2MNGA 2X09A 3D4KA 1XNKA 4QPGB 5FTTC 4M3CE 3IBMA 1RUJ1 4GZ9A 3KV9A 4BIOA 4EN9B 5JPMB 5K7PA 2VZVA 2X05A 1BXHA 1MZFA 5IWFA 1CD3G 1MZEA 1Y9QA 5FP8A 2VUDA 1ONAA 2XJTA 3HQXA 4OHZA 1JI6A 2D6LX 4TTGA 1IPSA 1UOGA 4CCCA 5A6YA 2R0HA 2B7YA 1RUD3 5FY7A 2QQNA 4CCJA 2XBO2 3S30A 1VRH3 2I07B 3G7DA 2BFUS 5C3RA 4MVTA 3H50A 3TWIA 3LDRA 2XB6C 1BJQA 3GJAA 1W6NA 5F5IA 4GMP3 4FOQA 3MIFA 3WDXA 1AHSA 1PMJX 3LIHA 4KWJA 1I5PA 1O5LA 2JDMA 3ZFEA 3QH7A 4N43B 1VAVA 1VBA2 1QNWA 5A7WA 2G4IA 2J1SA 5I8SA 4XUOA 2UYAA 4BQ2A 3ACIA 2BNOA 1YQ8A 1MEC2 4JDOA 3LKJA 4RGGA 3E5QA 2BOIA 3U0ZA 1K3IA 1RUNA 4UF0A 4WVWA 3P6BA 3P5BA 5IJRA 2WR9A 2ZPXA 4IGOA 1ULCA 5LA0A 1NLSA 3IDAA 3NMBA 1LGNA 3KCXA 2LRPA 5IFPA 4F7ZA 3WINE 4I30A 1OXCA 4MXVA 5IK7A 2JG8A 1ZBA3 3C7FA 3KVBA 1ND3A 2SLIA 4NE9A 4WV8A 4W65A 4CYDA 4CEWC 3V64A 4QX0A 1XRUA 3I7DA 4Y1VA 4CUAA 1S55A 4CP9B 1W0NA 5T52A 1DQ6A 1EYBA 4XIKA 2RS52 2TUNA 3PTRB 5L9VA 3E5UA 2Z69A 4W6XA 2NPIA 1JOPA 1ULGA 1V6MA 4NR1A 4TLGA 4C0BA 4CDQC 1KFUL 2P3JA 2AACA 1N1YA 4BLIA 5IAXA 2A3XA 3PUIA 5KC5A 4G9SB 4HKLA 4AK3A 1WLWA 2QZ3A 3I54A 4RR3B 2VQAA 1AR82 5FCCA 2D5HA 2ILMA 3NV1A 3WX5A 5EZWA 5GLVA 5A3MA 2WN2A 4UAPA 3M7AA 3RI8A 1UXXX 3J8F3 4SBVA 1HXS1 3UT0A 5I0DA 1BK0A 1O91A 3NQHA 1EV12 1YQ6A 1LTEA 3MHZA 2W87A 4Y4YA 1MS5A 1OQ1A 2P3KA 1JN2P 4XXAA 2WA4A 1ODMA 3H42B 3HT1A 3TN91 3AM2A 4X8NA 3P3NA 1ND3C 1UMIA 4QGLA 1YCIA 1H30A 1C1FA 1OSGA 1TEIA 1V6IA 3VKOA 3VBOA 1C28A 2VXJA 2AREA 3LFIA 4N53C 5FMOL 5CFDB 5B4NA 1NLQA 1I5ZA 4HN1A 1W8HA 2E7TA 3ABZA 3ZXGA 4AEDB 1W28A 5GLTA 1OOPC 1GWLA 4LK6A 3SLIA 2DCYA 4J1WA 1PVC2 2VCMA 2EA7A 3RJRA 2WSUA 2YV8A 3CHXA 3CJIB 3QOPA 5FDBA 1RGSA 2YXSA 4NIAA 1H4HA 4CDWB 3NAPA 1YJLA 3OGGA 3HR9A 3U4SA 2YYOA 1GZ9A 3C7OA 1F2NA 1YLLA 1J3RA 1ZRRA 4Q4Y1 4COUA 5IVEA 1B09A 1OQDA 4YZ4A 1RUE2 5BNPB 1X36A 5JSOA 1W6MB 4OUSA 5JXIA 2VMFA 3SQOA 5A3LA 3OPWA 4TXWA 2W3JA 2GALA 1H4GA 1TE1B 1CR7A 4P14A 3VBOC 4AI2A 1PIV2 1OLQA 5CKMA 3KT1A 1Y7BA 3HD8B 1AF9A 1CESA 5T5JA 2DVDA 1OQEA 4G3YC 4HK8A 4GB31 3I3BA 2QQJA 4BJ0A 3W59A 3ZM8A 1AL22 1UW8A 5A1LA 1G9FA 3ECQA 1AL0G 2IXJA 3WNMA 3ZYIB 5JVVA 4IE0A 1VBB2 4UW5A 2P17A 4HL0A 4Q5OA 4PHZA 1EUTA 2VD7A 1AYN1 1JODA 2BEOA 3RDIA 4M4PA 4YW6A 1RB8G 1W39A 4LBQB 4LBMA 4DXZA 5FZFA 2BBVA 3NAPC 5L9BA 5A1AA 2JDNA 3I3DA 5FMCA 4LTAA 3KVAA 1W2AX 1YNAA 1QJU3 1GWMA 1R091 1YIFA 4XJAA 2YMZA 2QQOA 5DXDA 5FZ6A 3ES1A 1E5IA 1V00A 2QQLA 4IESA 3IN9A 4HLTA 1AR92 4XF9A 1Q8SA 3B01A 1LOBA 1UN1A 1VBD2 3UGHA 4CA9A 4QDQA 1X7NA 5DZGA 2Q1ZB 1ND2C 4Q0QA 3ZYJB 5L7OA 3K4AA 3OGRA 3HBKA 3WR0A 1VALA 4LORA 3HIFA 4ZS3A 3SNMA 5DG2A 4M0HA 2D6NA 3PURA 4RGKA 4UW3A 1FNYA 5JWPA 5F3CA 1S0CA 4PI0A 3MGUA 1CQ9A 3DXTA 3S5QA 4KI5M 1TME1 4XAAA 5DUVA 4H14A 1CPMA 3DXUA 3ACFA 1RIRA 5K0UC 1OFNA 4Q0VA 1IZ3A 1PO12 1ZRCA 2WRAA 2G9ZA 1W9YA 1JBCA 5FZ4A 1RVF3 2ZJCA 1ZA7A 2ETEA 2FZ2A 1HN0A 2D3RA 2VMDA 4PQQA 1BBT2 3QLQA 4Y5SA 3OY8A 5T5LA 4EN8B 1DP0A 2C1FA 3WZ1A 2BGOA 1I6XA 1AX2A 4LHLA 1XNAA 2WZ8A 1UY2A 3EHKA 3PVBB 4HK9A 1Q5OA 2Y60A 4OFGA 1IOAA 3MPBA 4DO0A 4GWIA 3THTA 4IQPA 1RUH3 3VZJA 5FWEA 4AI0A 5C4WB 1NZCA 1PX4A 4QKFA 2VNRA 1H6YA 1DYKA 5G05L 1Y43B 4GH4A 3KGZA 4TN7A 2YUEA 1WW7A 3WG2A 1ULFA 1RUF2 1HW5A 1QXRA 1UZWA 1DZRA 1W6QA 3F95A 4DFSA 5JMOA 4Q0SA 4QPYA 1CAXA 2YZ4A 3NO8A 4B4PA 1UMZA 3AK0A 1GWKA 3BU0A 1H9WA 4BQYA 5KXDA 1TMF2 4Z2AA 5C3QA 4IW3A 3K2OA 3TEYA 4BHPA 4M3CF 4O7XA 1IKQA 2XG3A 2YFUA 3D3AA 4WM8A 4YW1A 4K1ZA 2JDZA 2K0GA 3JQXA 4EWEA 1O8PA 5A7NA 1X9TA 2R1DA 1VBE2 2PMWB 1QIQA 1QXPA 2A75A 1QOTA 1RJ8A 3A21A 1S0GA 2PLV1 5GLWA 3V65A 1UYPA 3JQWA 1YUDA 4WZCA 2JXAA 5DUWA 1V6OA 3WNLA 2JX9A 1JXNA 2RJ2A 1LODA 1Z78A 4UFKA 5IW0A 1GNYA 3T1LA 2OXBA 5C8CA 4M01A 4CUBA 1HV1A 4QB2A 1UD1A 1U5IA 2ZGTA 4PDWC 4RGAA 2VOVA 1W3VA 3KD4A 4YM3A 1ZX5A 5DQ0A 2YROA 1HB2A 4LO8A 2F4PA 1LR5A 4QGMA 1MVQA 4WM8C 3JD71 3RYPA 1VPHA 4HBNA 3EQEA 4FFFA 4OCTA 5T54A 4OQ9A 3SH5A 1RHI1 4GWMA 1W8UA 1ULOA 5JIAA 1QXJA 1S2EA 2KR2A 2ZX0A 3WCRA 4XMIA 3ACGA 4OULA 4NHXA 5JZGA 2JICA 2LROA 4YYOA 1OC1A 1CIWA 2BUKA 2IVIB 1SLLA 3AL6A 3CO2A 2WZR1 3GZTB 2VNVA 1YWKA 5KHHA 5JAXA 2A70A 1YYNA 2Y6KA 1NYWA 4XFBA 4IGPA 3I2KA 1ZRDA 4A6OA 5C8CC 1UOFA 4Q4W3 2ATFA 3MO4A 4KWLA 3O1OA 1KRIA 1ALYA 4FBFA 1H8TA 1D4M2 1KITA 1QJY3 2Y0OA 3RZGA 3ZFGC 2R072 1C8NA 1I1EA 1X50A 1O59A 2W39A 2I2SA 3BUCA 4XOGA 2VR4A 1BHGA 1CZTA 3UGGA 5HCHA 5CKNA 1PZ8A 4NAOA 3T0DA 1N1TA 1NX9A 2D5FA 4CPBA 5JOYA 1WCKA 5KXBA 4NHLA 3LGRA 1JHJA 2IXCA 2J1UA 3U37A 4WVMA 4YVWC 5FOBB 5JZGC 1W03A 4Y3OA 4ATFA 2GMMA 1KQRA 2EAKA 5HXMA 5LW9A 4QPGA 3VD4A 3S0MA 2CU5A 3KM5A 2MEV3 2R7EB 4JKMA 1SLIA 4DY5A 1UYYA 3WNXA 1S4CA 1T6BX 3PLQA 1FPN1 4YW2A 3LPGA 5FP3A 3ZSKA 3J7MA 4AFBA 2KXLA 2RS12 1XE0A 3WQ1A 3ZYFA 2IWGB 5GZFA 4LBKA 2ZGPA 1GP4A 1QHDA 2HWD3 3OGJA 1J3PA 1H8TC 1NCQB 2V4VA 2VW0A 2XQXA 4XTMA 4C0HA 3S7EA 1AXZA 2QDNA 3LA3A 1MS3A 4UF0B 4A2UA 1YFUA 1GMMA 2A6ZA 3WP5A 2BVBA 4FCAA 1IKPA 1DGRA 1COV3 2HWB1 1AJOA 2W47A 2HWE1 5A6QA 1WD3A 3RZLA 1QJEA 3BI3A 3Q8BA 1DQ0A 3OGVA 2LALA 1RINA 4LA3A 4NHYA 2ADEA 4N43A 1ZBE1 1LESA 2D3PA 1AVBA 1W3XA 3LF7A 2RM22 5KHIA 3PUAA 2CAUA 2ZBJA 3WDVA 1H6XA 4I2OA 2ZABA 1O3SA 4AHWA 1N3OA 5CB7A 4R52A 4XJ8A 1REFA 2A5ZA 3HOBA 2OPKA 3M8LA 3ZYHA 2EIBA 4Q2FA 3UL2A 3GYDA 4HMZA 3GZEA 5A1FA 1DQ2A 4OLLA 4Q4Y3 1CGPA 1X8MA 1AR71 1V6NA 3MDPA 1UU5A 4AGVA 4YLZA 4QPWA 3UESA 4EN0A 2RE9A 4CDXB 5K8SA 1ODNA 2JE8A 2PTMA 3CL1A 3KMHA 4XC9A 4AGRA 4AW7A 4XEZA 4XJZA 1PMIA 1OD3A 3VBUB 4H2AA 4RFRB 1GYKA 4P9WA 3ZSEA 5DG1A 4YARA 1PVXA 1WLDA 5A3TA 3CJXA 4N43C 1VJ2A 1RUD1 2BOJA 2ZHLA 2J7MA 3TOJA 2XOMA 1IS5A 1VRH1 3J26N 4D7SA 4CP9A 3K4ZA 1SG3A 3KB5A 1ZREA 2W52A 4AEKA 1AYN3 4MYEA 3EJKA 3ETPA 3AB0A 3PJQA 3KCCA 2ENRA 4YM2A 4GMP1 2WWJA 2WO7A 3T4HB 4AVCA 3L2YA 3SEPA 1NXD1 1F4HA 3POFA 2WJSA 2IFWA 2W1WA 3JBG3 4RR3A 5EJZB 2HWC3 1DDLA 1ASJ2 2D93A 5FQ0B 3WSOA 4JCKA 1UOJA 4RHV2 2GC3A 4Y1UA 2OW4A 2XVKA 5FZGA 1POV0 2A6YA 4IV1B 4N7IA 2UWAA 2FDKA 3WW2A 5FO8B 3AFGA 4H3WA 5FK7A 5JR7B 4NWWA 4NWVA 5IT6A 4CU6A 2VU9A 3WP6A 1HIXA 3D5OA 3LEKA 1UZYA 3MIBA 4BCUA 2NLRA 2GNBA 1VMJA 1VBC3 1CJPA 4M0NA 1PGL1 3MW3A 3AP4A 3EBRA 1H8VA 3VBRC 5F32A 1BVVA 2ZAAA 5CFDA 3FUQA 3VZNA 4BM8A 4AEDA 3OPZA 1F15A 1PGW1 3NJVA 2WAOA 1DYPA 1NE4A 1KJRA 2OS2A 1ZBA1 1APNA 5DDJ2 4D0QA 5LWBA 1W06A 2AENA 1BKZA 1RMU2 2GP3A 2BYVE 3CJIA 5C70A 3VD9A 1UYZA 2ORXA 1PM7A 5J98B 1PZ9A 1Z0HA 1A8DA 1SCSA 4CP2A 4W4ZA 1BEV2 4B7EA 3HN3A 5BNPA 3ROUA 1HQNA 1W6MA 4N7UA 2IXHA 1XSQA 2Z5WA 2AH2A 4JZRA 3WXPA 4IETA 3O1UA 1TQ5A 4IDZA 5C3SA 1LOEA 1MS1A 2VZTA 5E1RA 3PIJA 2DWRA 2ZA9A 3J8F1 2OA2A 2VECA 4AEDC 1SFPA 2QUOA 3K75B 4DZGA 1YI9A 3K46A 5JI7A 3O1PA 5KHJA 1JYCA 1POV3 4XETA 4L8QA 1JOJA 5L7OB 3J7NA 5FOJB 3WLUA 1OLRA 4A42A 1POQA 3QH6A 2D7FA 2WWSA 1QY4A 4E4SA 2E51A 2PHLA 2YPJA 4PF5A 2WWUA 1IS3A 3T2PA 4CDWC 1GUIA 4QGNA 3H9AA 2PQSA 1Q8VA 2HWF1 2DV9A 4R9DA 4ASKA 1ZZCA 5BNPC 5FYHA 5E88A 3UKNA 1DGLA 1WZXA 5FXXA 1XYOA 2XONA 4IEWA 1VAKA 4XCAA 3RZHA 1SFNA 2YG0A 3OSDA 2YBSA 3ES4A 2W0XA 3AX4A 3O7OA 3J7HA 3MPPG 5T5OA 3CMGA 1UKGA 5L19A 5J37A 5EJ1B 4CCNA 1HRI2 2CDPA 1JUHA 2Q5TA 5LA9A 1RUJ2 4J1XA 2NP0A 3ENRA 3OUIA 5I0RA 1BK1A 4FPFA 4EWDA 4UWDA 5ISLA 1FV3A 3ZYPA 3SCHA 1W0PA 5CADA 3LQCA 2EAAA 4QXBA 2P37A 3BIWE 2VE1A 3HBZA 4GH4B 4MGYE 2XL7A 4ES9A 1NA1C 1OPMA 2HBUA 5FIXA 5G04L 1OT5A 2ZHKA 3BTYA 3WF1A 4AFMA 2E9QA 4P9XA 4QD2A 1W6QB 3ACLA 4FPOB 3L2HA 4C8DA 1IHMA 3QCWA 2Q8OA 2BPA2 2FZ1A 3AMQA 3I2OA 4P9GA 2W1SA 5H9PA 4MHRA 1WW4A 1X82A 2RS33 3FFZA 1QQP3 3VKNA 2VTFA 3WUCA 1N3QA 2KD7A 1ENQA 4Y20B 1SFYA 2V4AA 1ENXA 4JHZA 2DDUA 5HV4A 3VDDB 1QJU1 5C4WA 2VTXJ 3V56A 5HPOA 3BIEA 2E33A 1S0DA 1F4AA 3DUIA 3ZR5A 2Y6FA 1Q43A 3C8XA 2P5BA 4ZY9A 2C9KA 5E16A 3IAPA 1HQLA 4EN7B 3NV4A 4O65A 1IG3A 2RDRA 3EO6A 4LHNA 2VQUA 3O14A 1VLNA 1DG6A 1V6KA 2PAKA 4P5YA 5KWRA 3HJRA 3ZXEA 3M4FA 2IC1A 3AKSA 3RJ2X 3IB3A 4NHKA 2IUWA 1NE6A 2Q1FA 2CSGA 1PO23 2GN3A 3MLLA 4QQPA 3ZFFB 3R4DB 4P9YA 5IVJA 1UZVA 5C33A 2RR13 4AFAA 2C24A 2E31A 4GQ7A 4IGQA 5FZBA 3ZXKA 4KBBA 3CEWA 3LZZA 1RVF1 4KWKA 4OI1A 1ZVFA 2QCSB 4DXTA 2XWJB 3ZVXA 4EYUA 3I97A 1JU4A 2XHNA 4Y1ZA 3BTXA 3NNGA 4C91A 5EYYA 5H9RA 1W2UA 3GNEA 1UNBA 4AGGA 4HVRA 3ZPYA 4FQZA 4DINB 2QTWB 1US3A 1SCRA 2P4EA 3M3CA 5FXZA 4EQVA 1K42A 2E53A 3M3OA 1RUH1 1H1IA 5F3EA 4HSLA 1HXS2 5FBJA 3BKZA 2ZHMA 3GCWA 4PBOA 2PELA 3OB8A 2OIIA 4XHXA 3WHUA 4XJWA 3MV11 4BQXA 4F83A 4MG2A 1M4WA 2VMHA 1D2QA 3TN92 3P1IA 2HWE3 4JTNA 4LKSA 2H0BA 3TRSB 4COZA 3O0XA 4YGEA 4JRAA 2DFBA 4BH9A 1WWYA 4D6SA 5FPUA 1QOSA 2GZWA 3PL0A 5JXHA 4JGYB 2C0ZA 5LBBA 4MGKE 3UJQA 1WW6A 1GV9A 2WINB 4NN0A 4RS5B 2ZMKA 4PIZA 5FYIA 4AZZA 2CTVA 5F2SA 2DBIA 1ZA4A 2D6OX 2YB7A 2BP6A 1W8WA 4FOWA 4Q4X3 4META 5F37A 2CGNA 2WNUB 1DIWA 4HVQA 1HRV1 4YG0A 4IERA 2D44A 3PUQA 2OUHA 4RL7A 4NIHA 4A4AA 1L7LA 2VBDA 5FY1A 3AMNA 2XJQA 3THDA 3WF3A 1QU0A 5C9AB 4IE6A 5HV0A 4Q4Y2 2JIGA 1UPIA 1GQPA 2QDRA 1H1MA 2EIGA 1LOAA 1UYXA 2VZUA 4IEPA 4NPRA 1FMD3 2JEMA 4Y22B 1Z7S3 1XOYA 4PF1A 3UV9A 3EYPA 5FYVA 3OUJA 4XFHA 3MIHA 4QPIB 1LENA 3T3YA 4GB32 4QHBA 4XBQA 3WP3A 1K5MB 4ET7A 5C7GA 5LEKA 1BZWA 3SCGA 1JZ8A 4KMQA 4XFFA 3CIHA 1NXMA 1W8NA 3KV5A 4U36A 4D7YA 3A7QA 3VKMA 5KHKA 1UCXA 3JU9A 1AYN2 4V2VA 4H55A 4PLNA 4S2DA 1JYIA 1UY4A 4Y1XA 4C1XA 5CVRA 2Y26A 1H0BA 3VBSC 2GAUA 4MGTA 1EAH3 3JUUA 2R043 1CVNA 1TNFA 2WKKA 4JX0A 1R092 2CGOA 4IE4A 3WUDA 4E2GA 3VGIA 3VBHB 2Y34A 4ARXA 1RUI3 3TEZA 1NCQA 5E8AA 3DF0A 2VZOA 3DKWA 5GJ6A 4ZKTB 4YZ5A 3CZUA 2VTXA 4BB3A 1TG7A 3ON7A 3USSA 3PHMA 5F3IA 2GMPA 5JLVA 2GNMA 2OYZA 3SHRA 1WGPA 1RITA 4GWJA 4Q4W1 1SLAA 3HAGA 1NCRB 5FZEA 3I3QA 1QJY1 1WUVA 3USUB 3W58A 4P5HA 3ALQA 5JSPA 2DCZA 3ZFEC 1TME2 5LRRA 2J1TA 2DU1A 5LASA 2NM1A 4AQSA 4YZ1A 1JZ5A 2VZQA 3M3IA 1UU4A 3LDBA 5IHRA 2BU9A 2A6VA 4YFWA 1H2LA 1NKGA 4P9IA 1BMV1 3AZYA 3C7EA 3QBQA 4I0AA 4AEMA 4XFAA 3BGAA 3A0KA 4B4RA 4CDXA 4XTPA 4MHUA 3H8RA 1XSRA 1DGWX 2MEV1 2ARBA 2QFEA 1HB3A 3VBUA 5IVYA 3OEBA 4XF4A 1RXGA 1E5SA 3ASIA 1QJX3 1WMDA 5FZCA 3FMGA 3SXWA 4CZSA 3QACA 2OZJA 3RSJA 2HWD1 3VN4A 1NQDA 2DCTA 2ZTNA 2HBTA 2WQZC 2JG8C 2W08A 3JCIA 1DLLA 3RZMA 3PTYA 2BERA 4Y4RA 4YZ3A 5F8PA 5JOXA 2LS6A 1XYPA 2MHFA 1GZCA 2BQPA 2WQ4A 3AYEA 1COV1 1AXKA 3BOWA 3I2JA 3POYA 1S2KA 4KNCA 2WC2A 5F5QA 5FZ3A 4X6RB 5CYYA 4AEJA 1BCXA 5LRSA 2HWF3 1C57A 2JENA 4PQ9A 3D0SA 2WZEA 2C26A 3BTAA 2Q8DA 1O3RA 4UXAA 5FQ0A 4CDXC 1LOFA 1JZ3A 4LNVA 2VCAA 4QX1A 3L9JT 2D40A 2FQPA 4IV1A 4M3CB 2WLQA 3VBUC 2EALA 2VZSA 3EXUA 2XL9A 3A0NA 2XDVA 2G19A 2B39A 3ZPOA 4NMIA 3FFQA 4OI0A 4IEZA 4TZDA 1FV2A 5H9SA 3WEZA 3OF1A 4CDUB 4DRRA 1OURA 1QH6A 3IMNA 2PLV2 2DU0A 4B3NA 2RMU3 5FY5A 3ZKYA 3AVSA 1UZZA 1HX6A 3W20A 1KJLA 4IE7A 1LHUA 1YHFA 3VLBB 1GNZA 4XBNA 4AAXA 2ZGRA 5JIUA 2K2SA 3MEPA 2JDHA 3THPA 4XW3A 3I59B 3I3EA 4ZXKA 3KT7A 1LOFC 3WD5A 1F5FA 1K45A 2W94A 1XNTA 2D6MA 3JD72 4NVPA 1C5IA 5GZGA 5BNQA 2RS32 4AR2A 2QJVA 3I2IA 5FPZA 3TYJA 5IUQA 1RHI2 3LEIA 3JBG1 2HWC1 2E7QA 5DN2A 3JXSA 3RGBA 4FQ4A 3PVNA 1OA4A 2A6XA 2WZR2 3ZR6A 1UAIA 4UFHA 5HXVA 3WNPA 4L11A 5EFUA 1EPWA 1K12A 1DFQA 3GXUA 1T6GC 3HNYM 3NVCA 4JGZB 3IMMA 4YGDA 1R083 5FO9B 3IM0A 4CCOA 4CCEA 1WMEA 3EB7A 3VKFC 2GP5A 4NAMA 1VBC1 2WT2A 3I2FA 5FZ9A 3VZLA 5GM0A 3VD3A 1O7FA 2WLPA 4DXRA 4E9KA 4GJZA 2JKXA 3ATGA 4N9HA 4V2WA 1JYWA 1N3PA 1MQTB 1QDOA 4UOJA 3DGTA 4BK4A 5CAZA 4XFGA 1VIWB 3KV6A 1D0HA 2R061 1MR5A 5FK8A 1UX6A 3BALA 5ANNA 3VZKA 4TLFA 4DQAA 2ZXQA 3NKGA 2QQWA 1OF4A 4D8MA 3UETA 1H1AA 4Z2WA 4COYA 3PDQA 2D43A 4IUGA 4Y5TA 1O6UA 2ZZQA 3AKRA 4DY3A 2ZMNA 5L7OC 1FPN2 1W9TA 4LXLA 4U2AA 3WF0A 3IPVB 3SKJE 1QOOA 3POSA 4R9CA 5I8YA 2AEZA 1CPNA 4JDNA 3T2QA 1OH3A 4K7JA 3BPSA 1REEA 2JKBA 4PIXA 4XMAA 5FXWA 1DZTA 1LEMA 1MPXA 2NMNA 1POV1 3MICA 1SBDA 1IQAA 2JJ6A 3DECA 4JVAA 2P2KA 1O3TA 2HWB2 2PN5A 2HWE2 2JWPA 2BFUL 2OZ6A 4WZFA 4DS0A 4LITA 2QZ2A 5IVVA 4XYXA 1WCUA 2VW1A 3P3PA 2I45A 5FZKA 5JOZA 4Y20A 1ZBE2 5AVPA 2F6BA 5AVAA 1GICA 3DYPA 3VDDA 5BNOB 5C3OA 4F3JA 4BMEA 1HRV3 2VOKA 1H2KA 3H8XA 1KGYA 3OG2A 4CEYB 2ZCWA 1YC61 3FC0A 1XU1A 3FHIB 2G9GA 3BPZA 2QQMA 1SDWA 3FX3A 4GH4C 5GKAC 1JW6A 2WYSA 5F3GA 1AR72 1NUKA 4KU7A 5FZDA 2QQIA 4ZU4A 4HPKB 3HNBM 1UXZA 3HMYA 5FFOC 2Q8EA 3G6JB 4JQRA 5EHDA 5DAPA 5GZDA 3RZJA 4KG0A 1EUUA 1O4YA 2NN8A 3RRDA 1WLCA 3T08A 2IXIA 3MF9A 3Q8FA 4W8JA 4Q4V3 3ZFFA 5JMCA 2WT1A 4LO4B 5DAWA 1RUD2 3ELNA 4RD7A 1AX0A 1FT9A 1VRH2 3CKHA 4Z07A 5DMYA 3VDDC 2JG9B 2A6WA 2A3YA 4MGSA 2EF6A 2YC4A 3ZXFA 2RS31 3WVJA 1OA2A 1QQP1 4X8PA 4JRLA 1ZYBA 4FPYA 3C2UA 3POGA 3CBNA 2P34A 3RG0A 3TEWA 1WKYA 3B9IA 1UPSA 2YGMA 4M4RA 5FYTA 2OVUA 1LU1A 2ZX4A 3ZSLA 3WQ0A 5HCFA 1N1VA 3S6PA 3E5XA 1LB2A 3LOBA 1ST8A 3BTZA 4COVA 1JHNA 3FLPA 2OT7A 4AXOA 1W8OA 4YW5A 1GBGA 2B46X 3J7LA 5A32A 4L92A 4EN6B 5ACA3 5LA2A 4LO5B 1YJKA 3WV6A 2ZEZA 1PGL2 2DUOA 2VULA 3OCPA 5ABJB 3B5LB 5J96B 2VOWA 2NMOA 3IIAA 1UIJA 5GZCA 2H6CA 4I3PA 2YC2A 2GH2A 4JGYA 1PGW2 2Y64A 1HJGA 3E97A 4QDRA 5F6KA 3AVRA 5CFCB 4RS5A 5FREA 4EE2A 1PO21 3J4UH 1D2SA 2J22A 1ZBA2 3N7LA 4NIIA 3KWVA 2AGSA 5FBZA 1G9CA 1QJZA 2X53S 2WNUA 2RR11 3K3OA 4LIVA 1CZVA 4Y5Z0 3TBDA 3U07A 1RUOA 3GF6A 3DKQA 3K4DA 3KS7A 2VC9A 3ZIXA 5C71A 3FHQA 4QX7A 2KA3A 3RFRA 4CSWA 4UBGA 2DBNA 2JDKA 4E8CA 5C9AA 1X9PA 3LWCA 3ZN4A 1R1A3 1W9WA 4LOSA 4CUGA 2EVXA 5FZAA 4N90A 4K6BA 5FPBA 1LHWA 2V73A 3AXDA 5CISA 3UKTA 1VB4A 4Y22A 3M2MA 1RYYA 3KF5A 5FUNA 2AUYA 3VZMA 5AC93 3LCPA 2VUCA 3J8F2 4CU7A 4QPIA 1OVPA 4GKYA 3PUSA 2F4LA 1K5MA 1STMA 2GNTA 2J1EA 2VVFA 4PI2A 4W50A 4YG6A 2DURA 3VBFB 1OD5A 2D6PA 2OQ7A 1ULDA 1S0EA 2CL2A 2LTNA 2WNUC 5A7PA 2YHJA 2G1MA 5J7MA 2WDBA 5CNAA 4BIFA 1Q3EA 4CEWB 4NPLA 5I91A 4TYSA 2WBKA 2ES3A 4JHTA 1OMIA 3DPRB 4QPGC 4EROA 1N47A 2HWF2 2VQTA 1UY3A 3MFAA 4UFLA 3SKVA 5A3PA 4EV0A 4CDQB 3PJYA 1O5UA 4LIUA 3U75A 3VBHA 2FDIA 4XABA 3WDWA 1UKRA 3EMRA 4Q4X1 1YO8A 5T5PA 4UW4A 4AVVA 2XR4A 3AC0A 1HB4A 4QU1A 5FO7B 3MIGA 2VM9A 3U14A 4CCKA 4QPIC 4WVZA 5EJ3A 1S0JA 1I3HA 3OBTA 2ZS6B 4MADA 2YU2A 5A80A 3ZN6B 2YY1A 4DPNA 5J3UA 3WG1A 4MH0E 4Q29A 4QXCA 2VW2A 4DUXA 1NCRA 4R4ZA 2RMU2 5FZHA 1RTVA 3AMMA 1FMD1 3USUA 5JXJA 4Q1PA 1Z7S1 5FZ0A 4AHXA 2R6QA 1CWPA 1CONA 2X29A 2GDFA 3K48A 2VMGA 4FXKB 2XUEA 4N53B 1Y9GA 4QB6A 3LIGA 2DVFA 2ZKNA 3NV2A 4XUNA 5ANQA 5JXGA 2ZZJA 4AHYA 1OOPB 1SLTA 5FXVA 3URFA 2WFPA 3FN9A 2WNEA 4KGQA 3T09A 4LBLA 1A34A 3H3ZA 4HANA 2I74A 4NROA 4UW6A 1G6NA 4AFCA 5IK5A 2JDPA 1YFYA 5LEJA 3WY6A 1Y9MA 1NY71 2GU9A 1EAH1 4QU2A 2JD4A 4G4FA 2R041 3HEIA 5A70A 1A78A 1L3JA 1G86A 4RA0A 2XBO3 1JZ7A 1QJU2 4WVVA 4HOOA 2DVAA 3OBZA 2CHHA 2Y8KA 1RUI1 4LR4A 1NCRC 4K8FA 4E8DA 5C9AC 4PCRA 1RUG1 2BJSA 2R30A 4QQOA 2VUAA 1BQPA 4PT6A 3MLKA 4QXHA 4H7LA 2DUQA 2XHKA 2AEYA 2PHWA 3KQ4B 3NJZA 4LT5A 1LECA 2Y6JA 1S2BA 3FBMA 3FZ3A 1VBA3 1UMHA 4DOUA 1WLTA 1KDKA 1UU6A 4EWAA 2Z42A 3BCWA 3WW3A 3S5AA 2FMDA 2V09A 1GOFA 3CU7A 3LSDA 1UOBA 4FPJA 2GNDA 3HQUA 1OUXA 3F2ZA 4HXCA 4A41A 1MEC3 1IS4A 4K9SA 4QX2A 3ETQA 5EP9A 4AQ2A 1XYNA 4HONA 1REDA 4HFSA 4RR3C 1AXYA 4QQHA 2R063 4NRQA 4M3CA 2JE7A 4BQ3A 3AZWA 4YGCA 4B29A 2W1QA 2XGXA 2YDEA 3W5MA 3U78A 3E6CC 1RVF2 1LAJA 1UX7A 2ZGMA 4JTOA 4A44A 1YQCA 4HG6B 2RJLA 2Q4SA 2XJSA 3D82A 4CDUA 2CY6A 4I3GA 4FAHA 3E6DA 1A3KA 3D8CA 1J3QA 1GLHA 5FZLA 4QM9A 2CYFA 4ITCA 3FWEA 4AL9A 5CBLA 3O1RA 2YPDA 5A3OA 2W46A 1FYUA 4JDMA 1ND2B 4FFHA 2P6HA 1OPOA 1QJX1 1RUH2 5CFDC 3PU3A 4Y26A 2RS53 1JH5A 2JD9A 3AP9A 2DVBA 4XQWA 5KHGA 1OLMA 3ILRA 3I59A 3SMHA 4DIQA 4XQDA 1CAVB 4OHYA 3AKTA 4FPKA 3R0RA 3AFKA 3ZO0B 2E6VA 4D6QA 1J84A 1SEFA 2PAMA 2UYBA 3CJIC 3OGSA 3M3EA 4Z82A 4B1MA 1AR83 2XLGA 4YRDA 2ZX2A 1CN1A 4AVSA 4KBZA 3KGLA 5K0UB 3H7JA 2A3WA 3HVDA 2RG4A 4XILA 2O14A 3S7IA 3OBAA 1J1TA 4CDUC 4ZS2A 1JS9A 4JQTA 5FY9A 4LBOA 2VVDA 2VZ1A 1NQJA 4QB1A 3T30A 4EZHA 2XKPA 4YVSB 4QX3A 4LBQD 1W90A 1TVGA 4BDVB 5FLIA 2QQVA 4OUMA 1HRV2 3KZ4C 4M00A 5FZMA 3WP4A 5EXOA 1LCLA 3ZXDA 2FMYA 4BXFA 1PX3A 2BRTA 1ZNPA 3U4XA 2QKDA 3NNMA 4JGZA 1F5JA 4AVBA 2B4KA 3ZXAC 3B94A 4QX8A 1QKQA 2FDFA 2WUHA 2RMU1 4RYDA 2YU1A 1PVC3 1FX5A 4O9GA 4LHKA 3ZOIA 2ZX1A 4OHVA 2J1AA 4NHMA 1MQTA 1WW5A 3GZAA 2XUMA 2VL4A 3I2DA 4DXSA 4HZFA 2PHTA 3MW4A 4XZPA 1XNDA 3NNLA 4XUQA 2P6CA 1H2NA 2PHFA 4OI2A 5B4XA 5FMBA 4BMBA 3M70A 1RUE3 4QQ2A 2NQYA 1FOD1 4NPMA 1U0AA 2P3YA 5A7QA 4YFZA 2TNFA 4AYUA 1PIV3 2BNMA 1YFXA 4INDA 5IATA 1GZWB 3ZSMA 1MZ6A 1SACA 5FJHA 4XURA 5JOWA 5F1RA 3GCXA 1X33A 3IPVA 1AL23 1W99A 4BA6A 2IXKA 5FAXA 4ASLA 2R0FA 5LBFA 1VBB3 1Q8OA 4F8AA 3PMEA 1NT0A 5FMOS 3CLPA 4AI8A 4ZPIA 3SCFA 1R64A 3PUHA 1LNSA 3SC7X 1O3QA 1ENRA 1R081 1U5ZA 4JKLA 3RWKX 3Q9OA 3GDBA 3ZXLA 1V70A 1N1SA 4Q8LA 4Q4W2 2ZGKA 1JZ2A 5JR2A 4PDWB 3RMYA 1ZZ6A 5FKCA 1HQWA 2XXZA 4XF3A 1QJY2 1W8FA 1AR93 5FPLA 3R4SA 5LB6A 2VNGA 3ORJA 4LE3A 1ZZ9A 3B00A 1IQDC 3R6SA 5BNOA 1VBD3 1XE7A 3KT4A 2FCUA 5J36A 4QKDA 4FVVA 2B8MA 5C8WA 4NRPA 5C4WC 2WNVB 4E2QA 3V0BB 1JTZX 1DQ4A 4CEYA 1MACA 5CZKA 4Z8BA 1CZSA 2JE9A 4Q27A 3VB9A 5TSWA 1BMV2 4QAWA 1F35A 5FYBA 4A7ZA 4HPKA 5LCWL
chains in the Genus database with same CATH topology
1LKNA 4I09A 5SV8A 2MEV2 4WBBA 1GKBA 4AG4A 1AJKA 1PO13 5BUVA 4WM7B 4YW3A 2HWD2 3U10A 5C6CA 4UBHA 3SISA 4FPCA 1J1LA 2RHPA 4L99A 1BBT3 5A32B 3ZFGB 1AX1A 5JDBA 2JG9A 2UWCA 4JV4A 1COV2 1FAYA 2Z79A 4LO7A 2UY8A 3WDUA 5AFEA 2DF7A 1ZZ7A 5E89A 4CEYC 3AP6A 5D1IA 4A3XA 5DZEA 3LOIA 4YVWB 1FI2A 3X29B 4FPGA 1FATA 2CNAA 1RUF3 4MXWB 3VL8A 4EJRA 1LOGA 3ZXJA 2QQPA 3NW4A 2VNOA 1J59A 5LK7B 1XNCA 3N7JA 1TMF3 3AZZA 4L2NA 4I01A 4XIOA 2CAVA 2GMEA 5ABJA 2HJIA 3FLRA 2E63A 4FOYA 5CG9A 3ZDSA 5CFCA 2C9AA 1O4ZA 2YGLA 4C1WA 2BVVA 2X5IB 4Z92B 2DYCA 1AYM3 4TSVA 4Q4V1 1B35B 1LGCA 5KBFA 1RUC3 4GWNA 1PNFA 2ZACA 2CV6A 5D8AB 3ZMOA 3LB9A 2O0OA 1E57A 1F9KA 5HBAA 2XJRA 4YNIA 4DRVA 2VOXA 4I0WB 4FP2A 2Q1MA 3JBG2 1W6PB 3UKVA 2HWC2 3WW4A 2PA7A 1C8M3 2RJKA 5ABJC 3TNQA 1RUG3 3GBWA 3B9CA 3HT2A 3VHRA 5CFCC 2ZGLA 3T1MA 4H7MA 3AP7A 2VQ0A 4ZU5A 2XJPA 1AR61 3VUOA 3VBFA 2LM3A 3KLSA 3OD4A 3E6BA 5ACA1 2X8KA 3N7KA 3AZVA 1VBC2 3RYKA 2XLAA 4RQPB 2WL1A 4CEWA 1V9U1 3GHNA 3MYXA 2CWSA 3DPRA 4QM8A 2ZX3A 3VL9A 4CDQA 3CF6E 2D97A 1VB2A 3N4MA 4Y24A 2R062 4CP1A 1Y3TA 1NCQC 4ONUA 4AVAA 1CX4A 2AZ5A 1LHOA 1D4M3 3C3VA 3J9SA 4YGBA 5K9YA 4Q8KA 1GFF2 2B9UA 1BVP1 2R073 3ZN6A 1R1A1 4S2GA 3VBFC 4BPZA 1M06G 4ASMB 5JCTA 1IPJA 4FPLA 1NOVA 4FTBA 3RYRA 5AC91 1HV0A 2DVGA 1KXGA 3VBRB 4B4QA 4IEOA 2Q0AA 4HKOA 4N53A 4D7TA 3DPRC 1DQ5A 5I8TA 1OOPA 2VMIA 3WG3A 2XVGA 4A7KA 2RS13 4YZ2A 1KDMA 4XFCA 1CAUB 3IT8A 3H7YA 1G9AA 5J09A 4A7YA 3IDBB 1XU2A 4XHBA 1CAWB 3GZUC 1UIKA 4XXPA 4FP3A 5A33B 4I0BA 3JB4C 2QE3A 4XBLA 2ZGOA 4BOWA 3B7MA 3BODA 1H9PA 3B02A 4R9AA 3POWA 3IDEA 3R4UA 2RM23 3MLJA 3DV8A 4ISQA 3BB6A 1Q8QA 4K20A 4OVEA 5BNNB 5CIRA 4XFIA 4E4ZA 2JECA 3V0AB 3OYWB 4IEYA 5KXEA 3K51A 3IDCB 1EPZA 1PZ7A 1PNGA 4IV1C 1SQ4A 4YG3A 1FOD3 4AQTA 4LA2A 1QQP2 3AYAA 1LEDA 2EXKA 2PFWA 3NV3A 4KG8A 3RS6A 1F8VA 2K9ZA 3AP5A 1QNYA 4MSVA 4OHXA 4Y1YA 3QD6A 4QX5A 5FLJA 1ND2A 2DTYA 3RI9A 2XBO1 2Y38A 3ILNA 1RJ7A 1GANA 1OI6A 4FOVA 3PVEA 1ZRFA 3O12A 4FPHA 1S1AA 4LLOA 4LO6B 4AE2A 1CAVA 3VHPA 1Q56A 5AFBA 2A73B 4YW4A 4IL7A 1GQHA 1NA1B 1ASJ3 1VBA1 2ARXA 4LEJA 3WDTA 5K0UA 4RHV3 2BGCA 4FTSA 4XDQA 5I93A 4LBNA 4XE9A 1MEC1 2DUPA 3U11A 2WFF3 3NWKA 2ZHNA 1PO22 3ZYGA 1PK6B 1DF0A 3WW1A 4MUVA 4YVSA 3R05A 1DGWA 2GC2A 4LBJA 4BYYA 2R16A 2RR12 3CNAA 1CJDA 2H0VA 5J48A 2WS93 4B8EA 1YI7A 3UK9A 4ORFA 5JI9A 4HKWA 1OKQA 3BOPA 2AR6A 2TBVA 5DDJ3 2EXHA 1V6JA 3H8UA 5SV5A 3W9AA 1RMU3 1KS4A 1FNZA 4KH9A 3GBGA 1W6OB 3ILFA 2RS51 4URTA 3VHOA 1X8EA 1QDCA 2ZGQA 1BEV3 4GIQA 4K40A 4D69A 4LE4A 4YVSC 1I9RA 1Q8PA 3ZYRA 2AYHA 5GLUA 4AI3A 1AR81 3RNSA 4XF0A 5KXCA 5GALA 3MFCA 1XQNA 1LRHA 2ZMLA 1GZWA 2HKXA 1OA3A 1GSLA 4IEQA 1EV11 2NZ9A 4IXLA 2B45X 4GXLA 4XJ9A 4IV3B 4QT6A 4J6GA 2PQQA 4Q4X2 1IGOA 4JAAA 1LOCA 3WQ7A 1IPKA 3O0WA 4QMAA 3WDYA 1VAMA 1V6LA 4S2HA 4IEUA 2HEYF 4FT8A 4R8HA 4D3WA 2YC0A 4PDWA 5FPXA 4LLFA 1LJ7A 3M3QA 1PVC1 1FMD2 2UU8A 1Z7S2 2VPVA 3RQ0A 3AJZA 2LUWA 2ET1A 1W0OA 4V1PA 2FBEA 1AYM2 2HEWF 1HRI3 1WA4A 3AKPA 3KQRA 4GALA 4JC1A 2WNVA 3V0BA 1RUJ3 1YXWA 1EP0A 4X6QB 1RUC2 1RUE1 3LAGA 2UY9A 4IEVA 1DU3D 5EYXA 5T50A 4BE3A 2PYTA 2A7AA 4LULA 1PIV1 2PAEA 1NY72 1EAH2 2R042 3LA7A 4O9EA 3WHTA 3BU7A 4Z1VA 4WM7A 1AL21 3RWNA 1C8M2 1A6CA 1RUI2 5LK5A 1RUG2 1VBB1 1WBFA 3TAYA 1AR63 5GLZA 1UF2C 3ZFFC 5DUXA 3ZFGA 3KSCA 1YRZA 1KS5A 1V9U3 5CU1A 3WG4A 1G9BA 2WNVC 1LGBA 4HETA 4W6YA 4P9JA 1HDKA 2OUJA 2NYYA 3AMHA 1WCSA 2ERFA 4YVWA 2R49A 1AR91 2Q30A 5BYNA 2B5HA 4MXWA 1VBD1 4K21A 3VBSB 2DCJA 4AF9A 4Q26A 4OZXA 2GC0A 1DBNA 4XQ4A 4C90A 2QVSB 4WM7C 3ME2A 4SLIA 3O0VA 2D98A 1O4TA 5HCAA 4LUMA 4MX3A 3AMPA 3I4IA 2B42B 4TWTA 4QQLA 3VV1A 4OHWA 2VGDA 1MS8A 3I8TA 4AI1A 3O5SA 5FRAA 1UL9A 4MGZE 1QJX2 2GC1A 1PO11 2X5IA 5I0TA 2BWCA 3IKWA 4JGYC 1B35A 1W6NB 4RS5C 2XLFA 3ZN5A 1BBT1 5I0UA 1HLCA 2ET7A 2WSVA 1OFSA 5D8AA 3ZFEB 4W6WA 3HWJA 2XWBB 3MF6A 4XPVA 2BNNA 3SH3A 2P3IA 4PLMA 1OHFA 1HXS3 1DZQA 1W6PA 4KGGA 2GN7A 3RZZA 4Q0UA 2H6BA 3ZX7A 4PJYA 3TN93 1LHVA 1RUF1 2VUJA 2ZAHA 1YIPA 3VHNA 2GSYA 2WZPP 2X5IC 1WCDJ 3A4UA 1YFWA 4FAGA 1SMVA 2N7GA 1B35C 1K5MC 1LHNA 5F6LB 1TMF1 4B7KA 4RQPA 4BLJA 3JB8A 2R1BA 1GNHA 1SLCA 2JG8B 2XJUA 1VR3A 5D8AC 1ND3B 4ES8A 3RPQA 3OBRA 4FXGB 1WBLA 3RMXA 2TEPA 3ZMNA 4GULA 5I0SA 5H9QA 1AUYA 1AYM1 3OJBA 1VBE1 2E7AA 5F9TA 3IWZA 4PLOA 4KQ7A 2VVEA 1LU2A 3VBHC 1D0GA 4NO4A 1RUC1 3LA2A 4XJUA 2BW8A 2DTWA 5GZEA 3ZIWA 1FOD2 1S0FA 1SBFA 1FXZA 4GB33 3WCSA 1J58A 2O8QA 4RQPC 1C8M1 1IS6A 5T55A 4R9BA 3VBRA 1GQGA 2PHRA 3VBOB 2Z2SB 1R082 5BPXA 3NSTA 1ENSA 3AXEA 1D4VB 3H0OA 3INAA 3AZXA 3OD0A 1R093 4IEXA 1ZZBA 2Y0IA 1CAUA 3DN7A 2O8OA 3AYDA 5DUUA 4HN0A 1F31A 2WFF2 4LUKA 3AYCA 1CAWA 3B3QE 4K3UA 1DQ1A 3NAPB 4S2FA 5A33A 4NOTA 3HN1A 3SITA 2PHXA 4FTEA 3NKTA 4AWDA 4YSFA 1DHKB 1D4M1 1S0IA 5BY5A 5L36A 2WS92 1U12A 4CP0A 3MZHA 4R4XA 3TB0A 2R071 1PGSA 2ZKLA 3N36A 2XH6A 1TME3 2VXRA 4L97A 1SBEA 1BYHA 4P9LA 2VY0A 5BNNA 1R1ZA 5FLHA 2VH9A 5CG8A 3V0AA 3OYWA 3FUOA 1NG0A 2HEVF 1MS0A 4DNYA 4CDWA 4ATEA 3H1WA 3DL3A 1MS4A 4ISRA 4PIYA 5IK8A 3ZSJA 3H3UA 3N35A 1U5YA 4AFDA 4MGIE 4COWA 3UJOA 3N7MA 2RS11 1URXA 2WT0A 2HYKA 2VG9A 1EV13 5CA6A 2ZGUA 4AQ6A 3PNAA 1U5XA 2O1QA 1EY2A 3GBFA 2WIIB 3MIDA 5B2GB 4CTEA 5JPNB 2IXLA 5BNNC 4HT1T 1KFXL 3MIEA 1MVEA 1H2MA 1ZZ8A 3WOGA 4QXKA 4DB5A 4LBQA 3MI8A 1NA1A 3OTFA 1SLBA 2RM21 2ZGSA 4Q1RA 5JSRA 1AZDA 2BWAA 1ULEA 3FBYA 2KM2A 1WMFA 2UWBA 1PK6A 1QWRA 4Q4V2 2PHUA 2IZWA 5L73A 3OY8B 2PLV3 4N9IA 2ZGNA 4FO9A 1RL3A 1C3HA 4BZ4A 1QMJA 5HI0A 1MS9A 4HSJA 1MZ5A 2R32A 3H1YA 4JGZC 4K1YA 4E4DX 3KCYA 1XE8A 4ZU7A 1S0BA 4FSJA 3LSEA 2FHRA 1W6OA 2MPFA 1VP6A 1MQTC 3JD73 4MZUA 1CAXB 3AJYA 1AR62 1PK6C 4CRQA 2IFRA 5EWSA 5ACA2 1RHI3 5BV6A 4YM0A 5T3NA 1ASJ1 1RC6A 4KU8A 5DZFA 1V9U2 1WD4A 1LULA 1JUIA 4RHV1 4Q0PA 3D6EA 4WM8B 2XKOA 2SBAA 2WZR3 3VKLA 2G9FA 3H1MA 2WFF1 3B93A 3APBA 4IV3A 1ZM1A 5KC6A 3AKQA 4DMIA 3M1HA 2WS91 2XVLA 4L9BA 4OI4A 4BWOA 4HVOA 4FPEA 1C4RA 1R1A2 3N3HA 4E2SA 4KL1A 1C5HA 5DDJ1 4D94A 5C8CB 1RMU1 5AC92 2D3SA 2CWMA 4AVTA 2PHDA 4MLOA 1QF3A 4E27A 3FE5A 3MW2A 1TNRA 2A71A 2GH8A 3TNPB 1PHMA 3FLTA 2DFCA 5BNOC 1BEV1 3NL1A 1QH7A 1QGLA 3PMSA 4IV3C 1FPN3 4RSUA 4I02A 2UURA 4MV2A 4XF1A 1G8WA 1XXNA 4YM1A 2D6KA 5JZGB 4GKXA 5IK4A 3FJSA 4GMP0 2WA3A 2W68A 5HCBA 3WT3A 2V5YA 1C1LA 2HWB3 2BTVC 2CGPA 3JZVA 3SH4A 4BQ1A 2EXJA 4PBPA 3GALA 1H8TB 3GHMA 1A8MA 1ZBE3 1XNBA 2ZOEB 1GR3A 2EXIA 3B69A 1HKDA 3VZOA 3D0JA 2JG9C 5EV7A 4GA9A 1NLRA 2C5DA 2DCKA 4RFT0 3PVOA 4AHZA 2XPJA 1VBE3 1DGRN 5BXXA 2QNKA 4WVMB 1KD7A 2XJVA 3VBSA 1AR73 3ST7A 1G7YA 3T2TA 1HRI1 2MNGA 3D4KA 5FTTC 1XNKA 4QPGB 4M3CE 3IBMA 1RUJ1 4BIOA 4EN9B 5JPMB 5K7PA 1BXHA 1MZFA 1CD3G 1MZEA 1Y9QA 2XJTA 1ONAA 3HQXA 4OHZA 2D6LX 2R0HA 2B7YA 1RUD3 2XBO2 3S30A 1VRH3 2I07B 3G7DA 2BFUS 4MVTA 3H50A 3TWIA 2XB6C 1BJQA 1W6NA 4GMP3 4FOQA 3MIFA 3WDXA 1AHSA 4KWJA 1O5LA 3ZFEA 3QH7A 4N43B 1VAVA 1VBA2 1QNWA 2G4IA 5I8SA 2UYAA 2BNOA 4RGGA 1MEC2 4JDOA 3LKJA 3E5QA 3U0ZA 1RUNA 4WVWA 2ZPXA 1ULCA 1NLSA 1LGNA 3KCXA 4F7ZA 3WINE 4I30A 4MXVA 5IK7A 2JG8A 1ZBA3 1ND3A 2SLIA 4WV8A 4W65A 4CYDA 4CEWC 3V64A 1XRUA 3I7DA 4Y1VA 1S55A 5T52A 1DQ6A 1EYBA 4XIKA 2RS52 2TUNA 3E5UA 2Z69A 4W6XA 2NPIA 1ULGA 1V6MA 4NR1A 4C0BA 4CDQC 1KFUL 2P3JA 1N1YA 4BLIA 2A3XA 5KC5A 4G9SB 4HKLA 4AK3A 1WLWA 2QZ3A 3I54A 4RR3B 2VQAA 1AR82 5FCCA 2D5HA 2ILMA 3NV1A 3WX5A 5EZWA 5GLVA 5A3MA 3M7AA 3RI8A 3J8F3 4SBVA 1HXS1 1O91A 1EV12 1LTEA 4Y4YA 1MS5A 1OQ1A 2P3KA 1JN2P 4XXAA 2WA4A 3TN91 3HT1A 3AM2A 4X8NA 3P3NA 1ND3C 4QGLA 1YCIA 1H30A 1C1FA 1OSGA 1TEIA 1V6IA 3VKOA 3VBOA 1C28A 2AREA 4N53C 5FMOL 5CFDB 1I5ZA 4HN1A 2E7TA 3ZXGA 4AEDB 5GLTA 1OOPC 3SLIA 2DCYA 4J1WA 1PVC2 2EA7A 3RJRA 2WSUA 2YV8A 3CJIB 3QOPA 5FDBA 1RGSA 2YXSA 1H4HA 4CDWB 3NAPA 1YJLA 3OGGA 3HR9A 2YYOA 1GZ9A 1F2NA 1YLLA 1J3RA 1ZRRA 4Q4Y1 4COUA 1B09A 1OQDA 4YZ4A 1RUE2 5BNPB 1X36A 5JSOA 1W6MB 4OUSA 5A3LA 2GALA 1H4GA 1TE1B