4I2OA

The structure of fixk2 from bradyrhizobium japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAMTAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDIGDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords FixK2 protein
publication title The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i2oA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i2oA01
2J5OA 2DU9A 2F5CA 2B0LA 3ZMVA 5CU1A 3FXQA 3KP3A 1FP2A 4IPAA 4RB1A 4L9NA 3H7YA 5JI6A 4H7LA 2P7VB 3USSA 5ILUA 2A3SA 3U10A 4EJOA 3CTAA 3ZMTA 2NRAC 4AIHA 4LEJA 1J9IA 4G7OF 2ZNZA 4MHGA 2NAZA 3L09A 3EETA 1T2KA 3LWCA 2OA4A 4CDGA 4QX5A 2XASA 1B4AA 2RNJA 1YWKA 3GYHX 4FX4A 5K1YA 1K78A 1HW5A 4ZYGA 4I98B 1SFUA 3K1MA 1PP8F 3D0JA 5KHHA 4WWCA 4MQ9F 4OIRF 1YUDA 2GQQA 4MGYE 4WVZA 2MBFA 3OCPA 4Y13A 3R4KA 4Y15A 1WWXA 1GQGA 4LLLA 1J1LA 1ONVA 3ELNA 1ZZCA 4R52A 5AONA 3MPBA 2HGCA 2F5FA 2H94A 3IDBB 3M7GA 3VFZA 1XGMA 4QMAA 2RGVA 1R36A 3BJ6A 1CF7A 1SFXA 4ON0A 2VBYA 3ZMSA 1LDJA 3IC7A 2CFXA 1TBXA 2G9WA 1YFUA 1SMTA 4EJWA 1HSTA 2CAVA 1W7PB 5ERIA 4IF4A 2VT2A 3H1WA 3RKXA 3MWMA 5E16A 2FOKA 3F21A 1J0RA 2XAGA 3GFMA 3KEOA 5FB2A 4MGIE 5CLSA 2OAZA 1LB2A 4Q48A 1IAWA 1ON1A 2RV8A 3TNPB 4FAGA 5DCFA 4IEZA 4MQVA 4LUMA 1FX7A 3WTTC 2RVCA 1XE8A 2W84A 2BEOA 1S6LA 1ZRCA 3Q9SA 1KA8A 4R79A 2P6SA 1OPCA 2P6TA 2YX4A 2KIUA 1HXDA 4KMFA 3PFIA 2O61A 5CADA 3WE3A 5LGUA 4KA4A 3SHFA 1RC6A 2Z33A 3GFIA 2Q30A 1RTVA 1FY7A 4HQEA 3VHRA 1QZYA 4XSXF 3QP5A 3ZP5A 4RS8A 4A5MA 2DQRA 5T3NA 2V1UA 2PA7A 3GUDA 1BI3A 3I5UA 2IXJA 2R7DA 1ZGAA 4IERA 2FU4A 4XF1A 3F23A 1J2XA 1R22A 2LKPA 1JHFA 3PQJA 4XF3A 3J80K 2HR3A 1MGTA 1RUOA 1Z1DA 1EH7A 3S7IA 4LLNA 2HYFA 4P9FA 1FZPB 4L5JA 3HYIA 2VQAA 3P7NA 3FMSA 3LAPA 4LLGF 2EA4A 1PMIA 2DI3A 2HKOA 1KQ0A 4L9TA 1QXJA 2MNGA 5F1RA 3BDDA 2KJCA 2M1BA 1U2WA 2IP2A 4I0AA 3MZHA 2FBKA 4LA3A 3ES4A 4XFAA 1UCRA 3FM5A 1UB9A 1T0FA 4WZCA 3K69A 3KETA 5HS7A 3MDPA 4AVCA 3I54A 3WE2A 3BALA 2B8MA 2VT3A 2L4MA 4XSZF 3KCCA 1FI2A 1MD0A 2IRFG 1Q1HA 3ES1A 4PDKA 6PAXA 2P8TA 5DCMA 5D4RA 1FYMA 3W6KB 1P4AA 5K5RA 3ZN1A 1WQ2A 5LGNA 5DYMA 4IRGA 1NE6A 4M71A 4AIKA 3HQXA 3FZ3A 4L9JA 3J81K 5BXXA 4KYWA 1G3WA 2GC0A 2FNAA 3LA2A 3FHIB 4I0BA 1J58A 4D0PA 5LHIA 3CJNA 3C1DA 3T1BA 4MGZE 3H92A 4PIYA 1YLFA 4RGRA 3H7JA 1HKSA 1TQPA 1J75A 5KHKA 3FWEA 3UKNA 5DD4A 3R60A 3GO5A 4P5OA 2EB7A 4Z82A 4HBNA 1QBJA 4IEYA 4PIXA 1SFNA 3EJKA 4RB0A 3EQLF 4RD7A 1JXSA 2BNMA 3LA7A 1Q5OA 2YSRA 1B9NA 2PN6A 1NHAA 2K7LA 4L9VA 3E97A 2GXGA 2BBYA 4LK0F 1GHCA 2A68F 3HRSA 1F5TA 2OZUA 2G7UA 2QZ8A 4LB6B 1PM7A 2N7GA 4HX4A 3J80Z 1QWRA 3KP7A 2A6EF 2OQRA 2DPDA 2GIVA 2VBZA 2UYAA 2QYOA 5FD5A 3JTGA 3ZMZA 3ZQ7A 1USTA 3RPUA 3I58A 3V4GA 3BROA 5DUIA 2DPUA 2GA1A 2WV0A 3WW3A 2Z9OA 2C0ZA 1SD5A 1J3RA 2VBXA 1KU2A 3NQOA 2NYXA 3EO6A 4WXHA 1O4TA 2YR2A 1ZRDA 1IRGA 3U9GA 2KKOA 1H1IA 2FSWA 5L3GA 3M9AA 4O3MA 5EZWA 3DF8A 2A07F 5JFRA 2EV0A 1IUYA 1I6XA 3IWFA 1XDSA 2L3DA 2VBWA 1CX4A 3EDPA 3R0AA 2QCSB 2E7WA 1U78A 3IDCB 3J81Z 2HKXA 4CGZA 2ETHA 2XLFA 2PFBA 3IKVA 4HX7A 1IPJA 3AAFA 1FXZA 1EY2A 2OPKA 3TOBA 4MX3A 4XFIA 4WF2A 1XRUA 3SXWA 5J6XA 1CAWB 4RGUA 5J8CA 3HTUA 3LWFA 1U5TC 1BJAA 1H0MA 3WU0A 3QP6A 4MTDA 2Z69A 4XFBA 4WXDA 5IT9K 1U6GA 2V1XA 3KEQA 1QNTA 1B1BA 4D7SA 2TDXA 3C7JA 4MGKE 1ZVFA 5CYVA 3HHGA 3IIAA 3U11A 1O7FA 4Q0PA 2H6BA 1O3TA 4GGGA 4IHTA 5ICCA 5L3FA 2K9ZA 1LVAA 2O8QA 4BIFA 1IN5A 2XV4S 1FWZA 1I5ZA 2IXIA 2QENA 3J7AO 1NYWA 4KL1A 3LFKA 1DZRA 1U12A 1FSHA 5FLIA 1YW9A 2JTVA 3EQEA 2H09A 4HN1A 2P5VA 2IA1A 4R1HA 3HHHA 1B9MA 4CXFA 2HEOA 1YQAA 5DD8A 1ZZBA 3BPVA 5LGTA 3ABTA 1PUEE 1KYWA 5F64A 1ON2A 3LZZA 1CAVA 1OI6A 3I4PA 2GC1A 4LFUA 3QRFF 4AQ2A 4KT5C 5FPXA 1Z05A 3MQ0A 5CVJA 1S8NA 4ZYDA 5HDNA 4HV6A 4HVOA 3R61A 4I7HA 4WXCA 2F5EA 3RIRA 3ROUA 3E5XA 1WSUA 4UVAA 4XFFA 1TW2A 1KYZA 1RNLA 1UW8A 1GQHA 2Z2SB 2UXXA 3KFWX 4M9SA 3F22A 1J7KA 1T98A 5KK1A 3I71A 2EFNA 4HF0A 1SFEA 2PMUA 1X8EA 3WTXC 1L0OC 1K78B 4L0ZB 2OBPA 1K6OA 4DINB 4DQ2A 5J48A 3L2CA 3IKTA 4KU8A 3S2WA 4HDVA 2RDPA 1SMYF 5JR3A 2F2EA 4EQQA 4HF2A 3ZMUA 1SD6A 3FM3A 5FLXK 4MUVA 2UY8A 5KBFA 1J3PA 4A2UA 3JW4A 1LJ9A 4CZZA 1WGPA 4LUKA 1NZCA 1CGPA 3F6OA 2HQNA 1XN7A 1TW3A 2XLGA 1YFWA 1XSDA 3FX3A 3K9TA 4XRFA 5IT9Z 3ML6A 3TDUC 1ZHFA 1CF7B 2D2WA 3D82A 1UHWA 3F3XA 4X6QB 5TJJA 5FQ0A 2W25A 4G6QA 3E3VA 1XCVA 5D5VB 3DFGA 1RL3A 2V6CA 1O5LA 2CSOA 2ACJA 3KGZA 1C0WA 1ZAOA 4RAZA 1IXRC 4J1WA 3C3WA 2EFPA 3IWZA 4Y17A 4P55A 4IEQA 2HJIA 3V8LA 4OLLA 4Q0QA 3M70A 2Q0AA 1LKNA 5DDGA 2Q1ZB 2K4BA 3EHKA 3CUQC 1BBYA 5LHGA 5D5UB 3KLOA 5E1RA 4KMUX 3RKWA 3B02A 2Z99A 3LOIA 4M9XA 2GU9A 2STTA 5HLGA 3RNSA 2KIMA 3RPQA 3WU1B 3QPTA 5IT3A 2X4HA 4RGSA 1TNTA 2GXBA 1W4MA 4LD5A 4KWKA 1NXMA 1IRFA 3OD0A 2K4JA 3JAMK 3SXYA 1W5TA 3FMRA 1P4XA 2DW4A 4KNYA 4EWAA 4UBGA 1OR7A 4UVBA 5E18F 4OIPF 4HAMA 3H8UA 3SFZA 3N4MA 4GO1A 1CAUB 3E6BA 3DP7A 3H1YA 3HRUA 3WW1A 4EGYA 1G6NA 1CAXA 1BC8C 2A6HF 4BNCA 2D45A 1HSJA 3E6CC 4HSJA 2JRTA 3HOTA 5FGMA 1YIOA 2WTEA 1XMKA 5EFUA 2V79A 2ZKZA 2EAAA 4O5VA 3PVBB 4A6EA 3K1NA 3C3VA 4P96A 3KMHA 3HUGA 2COMA 1XGNA 2HZTA 1UIJA 3JZVA 2B9UA 4AD9A 4IEPA 1DGRA 4AQ6A 2DTRA 2YPRA 5CVUA 2K0GA 1BM9A 4ZZDA 1MDMA 5DCMB 2MD5A 5D5XB 1JE8A 4HA8A 2VODA 2Y75A 3CL1A 3SCGA 3TDZC 4IEOA 2NNYA 1FC3A 1H1MA 5HDKA 3GYDA 3CO2A 5ICEA 5AIPA 4ONUA 5K8SA 2IXHA 2ESHA 2VOOA 1BI2A 4RB3C 4F7ZA 1RGSA 3E6MA 5KHIA 2JPBA 2UWMA 4OIOF 2K27A 3KE2A 4OMYA 4HZFA 3M8FA 1LEAA 4B09A 4ZZLA 1JHHA 3DPLC 1O3QA 2W85A 2AXLA 1IN6A 2PQQA 1B59A 4MTEA 4BHCA 2IVMA 4E2SA 1TQ5A 4LGWA 5F6FA 2ZO4A 2UXNA 1YFXA 4ZH4F 1IZ1A 4Q0VA 4NQWA 1R1VA 3V8JA 4FAHA 3JAMZ 1VTNC 5D8LB 3TNQA 3L2HA 1W5SA 3H9AA 1L3LA 1EH8A 2PLYA 1SQ4A 3TQNA 2DQLA 1R58A 1Z91A 1FSEA 1PDNC 2QBYA 2VC0A 2VE8A 3EBRA 4ENJA 2EV5A 2F4PA 3I0TA 4EV0A 1YYVA 4BH9A 4I3PA 4QM9A 2L54A 4A0XA 5LRSA 2ET1A 4YNIA 3MAJA 1DPUA 4Z2YA 2CG4A 2DBBA 4HLYA 2QQBA 2Q0OA 2KXLA 1Z9CA 4E2QA 4XFCA 3H3ZA 1R1UA 1YFYA 2XAQA 4BHPA 1XMAA 2PAMA 3P9CA 3LQRA 5I0SA 3HRTA 4CICA 2OD5A 4YIFA 3P9KA 1FBUA 4HSLA 1EPZA 4EROA 4WCGA 3GZ5A 5E8GA 1HW1A 3NEUA 4BXUA 5L3BA 1E2XA 3DL3A 3OF1A 3H50A 3G73A 4KU7A 1ZZ9A 3U2RA 3I53A 2XKOA 4WK8F 2XVCA 2IJLA 1ZH5A 4HDUA 3NRVA 5HI0A 4Q0SA 2EK5A 4L5IA 1HBXG 3ELKA 3WW4A 4G9YA 2QVOA 2ELHA 5BS6A 5L3CA 1OYIA 1GXQA 4K8FA 1KGSA 4KICA 1TTYA 3G3ZA 4IEUA 1HQCA 1XGOA 4M9ZA 5I93A 4M74A 5ICFA 3T8TA 3S0MA 1ZZ6A 2A61A 5E1WA 1WLTA 4O6JA 4PZJA 3GFJA 4GYGA 2DK5A 1ODDA 1EH6A 4YFNF 1ZZ8A 1BC7C 4EVIA 1S7OA 3IBMA 1A04A 4UXAA 2ATFA 4EM0B 1REPC 1F9NA 1ZG3A 1PP7U 2XL9A 5CVRA 4A12A 1Z6RA 2IA0A 1ZRFA 2XIGA 2D5FA 3I7DA 2AS5F 1ZG5A 5FDBA 3FXUA 4FX0A 2ZJ2A 4KIBA 1HKQA 3DEUA 5LBQA 1YLLA 5AVPA 4ESFA 4IETA 1XGSA 4HX8A 1D5VA 5CVVA 3ACLA 5CVIA 3BJOA 3DKWA 3L00A 4ESJA 1X3UA 2G7HA 3WW2A 2UYBA 5KHGA 4A0ZA 3I59A 2QDRA 3FE5A 2IPQX 5D1IA 1FBSA 4MH0E 4IHSA 2DAOA 2Z5UA 4AVAA 4YFXF 4RB2C 4ENKA 3V7SA 3FZVA 4AVPA 3WGHA 2XGXA 2ZFWA 2Y0MA 4BAYA 4O9GA 2GC2A 4ZU4A 2EFOA 1CAVB 3JSPA 3EYIA 5DEQA 4ZU7A 5LEJA 1Q43A 5DV5A 4G7HF 1VR3A 5C8WA 1ZN2A 1ZLJA 2ZBKA 2CW0F 4U7DA 1GXPA 2RC4A 3U0ZA 3F8FA 1U5TA 1IF1A 5D8KB 2OZ6A 4IVNA 3C18A 1EP0A 2HQRA 5FLJA 2XRNA 2JSCA 2PHLA 4L0YB 1OD5A 3TGNA 4ENNA 1VJ2A 1WKMA 4LJZF 2O0YA 2PMHA 4QGMA 3RTRA 4IRIA 3M3IA 1FNNA 1S3JA 3R0JA 3F8BA 4LG0A 1TQIA 1IXSB 4GYIA 5HLIA 4QWQA 2Y48A 4ZU5A 1IPKA 4L18B 3NSTA 5FFZA 2ZMEA 3HT1A 1V4RA 5HS8A 4HOBA 2OYZA 1ZG1A 2BYVE 1I1SA 2RKHA 4L2NA 3LAGA 4FT8A 2BGCA 4N0BA 4HF1A 1BI1A 3TO7A 4LMYA 2MPFA 4MEXF 2KJBA 2H6CA 4MGRA 2HWVA 2B5HA 2O03A 3SHRA 1WI9A 4LTAA 4K2EA 3V7RA 1KU3A 5FQ0B 5FFXA 3WGGA 3E6DA 3KP2A 4QGNA 3SMHA 3N97A 2PQ8A 4OINF 3GF2A 3DN7A 4I01A 3NW4A 3KP6A 2VPVA 4BQAA 2PFWA 2VN2A 2V09A 5I0UA 4CYDA 3S7EA 4BYYA 3WODF 4GXOA 4AVBA 3BPXA 3L9FA 2C6YA 3ZN0A 1OFNA 1I27A 3KLNA 3OGJA 5JSOA 4LLOA 3V7CA 4X6RB 3IHUA 4PJYA 3OOPA 3CEWA 1D3YA 2MHFA 1DP7P 1D8KA 1LNWA 5EEHA 2D1VA 1MZBA 4CHUA 4HBLA 2IXCA 3WTVC 3T5XA 4CO8A 3JSOA 5LEKA 3K2ZA 1YS7A 4BHBA 4OIQF 1P2FA 1E17A 5BPXA 1BIAA 2QVSB 1Z6TA 4XF9A 5K5OA 1GVJA 3F8MA 5CJ9A 4M72A 1MJ9A 2W24A 3GEZA 1W7PD 2O3FA 5KHJA 1ZARA 2ISZA 3CO6C 4KIFA 5EEGA 4UBHA 2EJRA 1XD7A 2XROA 1Q3EA 4Q0UA 2XAFA 1QY4A 4MV2A 3NKTA 3CUOA 5K5QA 1AOYA 4ASNA 2PBIA 4AIJA 2LF8A 3E5UA 5FO5A 2R7FA 4META 2PYTA 2XKPA 3IRRA 4PGGA 2ISYA 3WTWC 3LA3A 4IEWA 1O3RA 4ZYEA 3BOQA 4PIZA 2QJVA 2IC1A 4PCQA 1S7AA 1IN4A 1G4DA 3RYPA 4J1XA 2F5DA 2LF7A 1QO0D 4MNUA 3KGLA 4AXOA 1K79A 4D7TA 1TNSA 4ZYHA 4UXNA 4FBFA 5H20A 2Q2EA 4I2OA 2XUBA 2FEZA 3QAHA 3CUQA 4ORFA 1KU9A 3F8NA 3MZYA 1FLIA 1J59A 1R23A 4KDPA 2OQGA 1IN8A 3RI4A 3QOPA 2EVXA 1KQ9A 3RZZA 5H6RA 5I0RA 3FHZA 2HYGD 3NVCA 1D8JA 2IT0A 1MDMB 4WBBA 2J5PA 2PHDA 2MA3A 1LQ1A 3GXOA 5BPDA 5E1XA 2VC1A 3R6SA 4P9UA 1LRHA 2M87A 2O8XA 3G7DA 2P5KA 2WWYA 1WA4A 4UNOA 3ZPLA 3EYYA 1SEFA 3ZDSA 2WFPA 2V9VA 4KFCA 5E1ZB 4YSFA 4UVCA 1AWCA 3KZYA 1UFMA 1G3SA 2UY9A 3FMQA 4KWJA 1O57A 2HFHA 2ZKLA 3F6VA 4IEVA 3MEXA 4KIGA 3ISPA 1DDNA 2ADUA 4EJTA 2BE5F 4HV5A 4XF4A 2QNKA 1DUXC 4JK1X 1XDUA 1RZ4A 4M6YA 4JTOA 2PTMA 3HT2A 3KZZA 4XLPF 3QACA 2DO7A 1UPIA 3DQVC 2P5LC 4JQFA 2FBHA 5E20A 3H1MA 3KP4A 3LQQA 2K02A 3WGIA 2L01A 3ZMDA 1ZX5A 5FLXZ 2GAUA 2D1HA 1F1ZA 4G6DA 4ENMA 1YS6A 1XB4A 4EM2A 3QU3A 4MEYF 1KQ8A 4EJVA 2QBYB 2JPCA 3L7WA 1JGSA 2A5YB 3RDIA 2FQPA 1FP1D 3IRQA 4YRDA 1UD1A 3E5QA 2MLKA 3BWGA 5ILSA 2EA2A 3CF6E 1R1TA 3T8RA 1IN7A 2ZCWA 1P6RA 2D93A 2XAJA 2ET7A 4N9IA 4XEZA 2QQAA 1YTYA 3TOAA 1RI7A 1HKTA 1YG2A 1QXRA 1P92A 4F8AA 1R7JA 2MH2A 3OV8A 2M45A 4JTNA 4OMZA 1G3TA 3BP8A 1Y0UA 3CLPA 4HQMA 3KSCA 2FF4A 5JHUA 1NE4A 3PQKA 2NS0A 4H0EA 2FBIA 2NNNA 4EGZA 4E70A 2EFWA 3MYXA 3HOSA 3ST7A 4XFGA 4GULA 4GCVA 3SCHA 3M1EA 3RJPA 1TLHB 3ETQA 1ZYRF 2CQKA 1T6SA 2HTJA 3PLQA 1DGWA 4EWEA 1J5YA 3COAC 1P4WA 1ZNPA 2YX7A 1DZTA 3SZPA 5LLQA 3SZTA 3RYKA 1O3SA 1MJBA 2K86A 3IL2A 3TO6A 4U0YA 2E1CA 1CAUA 2ZNYA 1SD7A 5L3EA 2KRFA 3D0SA 3GW2A 4KWLA 1QPMA 2W57A 1QZZA 1OMIA 2LSOA 2GWRA 1R5HA 3CDHA 2VE9A 4YG2F 5BMZA 4I09A 4U0VA 4LK1F 1YW7A 4RGXA 2VECA 1W7PA 4UV8A 4XETA 4A6DA 2CO5A 3P9IA 3RKYA 3DPTA 5J3UA 2XLAA 1O7LA 1LDKB 4ESBA 5FPZA 1EV7A 2FMYA 2OU2A 1FT9A 1IW7F 2XHKA 2QLZA 3DXJF 3WTZA 2MH9A 1O5UA 3I59B 3UKTA 4JBAA 5BUVA 1ZREA 4L11A 3W6JB 4IEXA 2YU3A 4B8XA 1BOAA 1UIKA 4N9HA 3DV8A 5L3DA 3HSRA 2JZYA 1MKMA 1JUHA 2QUFA 2LDUA 2A69F 3Q9VA 4LA2A 4U7BA 5BY5A 2E1NA 2VXZA 5JSPA 5BV6A 3K0LA 5LRRA 2STWA 2QM3A 3Q5FA 4YARA 5HDGA 4TLFA 2GA2A 2R3SA 3VEPA 5ILVA 3F72A 1LDDA 2M8EA 3VB2A 1R5GA 4XBFA 2QWWA 3ULQB 2XAHA 5A2QK 5FD6A 1U5TB 1U3EM 3O3KA 3HTSB 4OU0A 4NVPA 2IXLA 2D40A 1OKRA 5JR7B 1BIBA 3QPHA 2LNBA 2IA2A 1YHFA 4M73A 5J8FA 4UHTA 1TQMA 5TRDA 3BU7A 3LSTA 2VOPA 2HS5A 4WX9A 2PI0A 3CO7C 1OYWA 3FF5A 1DPRA 3VODA 4XF0A 4LG0B 4LB5A 4Q29A 2ESNA 2IW5A 4MZUA 5KVRA 1FOKA 1T38A 3OTFA 4EMSA 5LHHA 3VOEA 1HW2A 4AWXB 2ZMEB 5DUKA 2VONA 1QQIA 2BNNA 4I02A 1Y3TA 4EWDA 2CAUA 2XL7A 2HTSA 3BJAA 3BB6A 5BOXA 4RAYA 1STZA 4M6XA 4Z07A 4NHJA 2EA7A 4QM8A 1FBQA 4XFHA 1FYKA 3K1PA 2P17A 5JAXA 4HW0A 3O2PE 2QQ9A 4UV9A 1XSVA 3HRMA 4YFKF 2EFQA 5FCCA 2HDCA 1Z7UA 1K7AA 1MJAA 3WTUC 2V1DA 1VP6A 1X7NA 4HVRA 3SQNA 2GH2A 2FXAA 3F8CA 5E17F 5BPIA 4QGLA 1RUNA 5JSRA 2RN7A 3PNAA 4A5NA 4G8XA 4KN7X 1J3QA 4B29A 2Q8KA 1H9TA 3EUHA 2DFIA 3TO9A 1L3JA 1U8RA 2L4AA 1X8MA 1FYLA 2FNPA 4HLXA 1UHMA 4QLCU 3SCFA 2CGPA 2M30A 2MLGA 4O9EA 1LR5A 1FPQA 1G3YA 2MC3A 4YIIA 1UCXA 1EYBA 5I91A 1IXCA 2PG4A 3GLXA 4S04A 2O1QA 5E8IA 3O14A 5D6EA 2GC3A 2P4WA 4OOIA 2D5HA 2CV6A 1YW8A 3MFKA 4G7ZF 5ICGA 3FFQA 2E7XA 1Y9QA 4IJAA 5A2QZ 2DCTA 1V70A 2EV6A 2E9QA 3WTSC 5D4SA 1XCBA 1R00A 3TKYA 3BPZA 3WG9A 2DLLA 1SD4A 4HLTA 2FA5A 4XLNF 3T0YA 3H3UA 3KP5A 3ABUA 4HVQA 1ZGJA 4R8HA 5FLHA 1YFHA 3GX4X 3BY6A 3FJSA 4ETSA 3GBFA 2L02A 4U0WA 2OZJA 2O6GE 2JT1A 1ZRRA 5I0TA 1ULYA 3B73A 1T39A 3D5LA 5I8TA 2PEXA 2WC2A 5BQTA 2I45A 3ECHA 2PAKA 2IXKA 4G94A 2PAEA 3U1DA 3GWZA 3WTYC 5ED4A 1XE7A 4A0YA 3NL1A 1BN5A 2DT5A 3QU6A 4HN0A 5J7MA 5HS9A 5I8YA 3CUQB 3JTHA 4LULA 5HVQC 3O6BB 5HOOA 3LAJA 3GVAA 3GZ6A 2UZKA 2ZXJA 3MCZA 4Q47A 2P7CB 4Q4ZF 2ETEA 3NJZA 1S29A 2Q4SA 4EM1A 3M8EA 4IXAA 4HYEA 3BCWA 3UKVA 4NB5A 5JVTA 1F4KA 4KUMA 4JV4A 2H27A 3ERED 4OFGA 1QGPA 3BZ6A 4S05A 4PGHA 4YYOA 1KU7A 4HMZA 3RYRA 2GZWA 1CAWA 2EWNA 1B6AA 1YO5C 3HIFA 4P9GA 2CYYA 2KIFA 2FQ3A 4E2GA 1V3FA 1WRJA 4TV7A 4QXKA 3HSEA 4UUVA 5JCTA 2CWEA 2FMLA 4KN4X 2X0LA 3HSFA 3ECOA 2OA2A 2DK8A 4EJUA 5D5WB 1H9GA 1X82A 3I64A 1CAXB 4IRHA 1OYYA 4DNCA 5AIQA 4IESA 2PJPA 2H0VA 4JVAA 1ZZ7A 5I8SA 5D6FA 3V8KA 4Q5SF 1SAXA 2Y0OA 2BV6A 2RQPA 3FXRA 1LEBA 1BI0A 1USSA 2Z3YA 5H6QA 1RIOH 2BNOA 2FRHA 5C6CA 1XSXA 2FE3A 2M5WA 4FHTA 3REOA 2HOEA 3CLOA 4U88A 5HLHA 1ZLKA 3CJXA 1I1GA 3GFLA
chains in the Genus database with same CATH superfamily
3LFMA 1IRXA 3HAGA 4IPAA 4YZ3A 4RB1A 1UAAA 1QVTA 3H7YA 4PJLA 1IKQA 2VMIA 2XPWA 2R7RA 1VFCA 2OUJA 2A3SA 3H0DA 4C2UA 1ZBE1 4W6XA 4AFMA 5FP3A 2LTNA 2R5ZB 2ZB9A 3ZMTA 4FOYA 1SEUA 2E60A 2X85A 4AIHA 2ZNZA 4MHGA 3L09A 1FV3A 1IG7A 3J7HA 3RRDA 4CDGA 5AFEA 1OCZH 4RQPB 1QMJA 4FFGA 4XTMA 3VBRB 5E88A 3S30A 2ZAHA 5A7NA 3ZXGA 1J84A 1YUDA 4MGYE 4WVZA 3OCPA 4Y13A 2A5ZA 3JD72 3ELNA 5FREA 4LK6A 2VI6A 2X6YA 2HGCA 1KDKA 2F5FA 5F9TA 3SNMA 3M7GA 2W52A 1W39A 2JDZA 3GTLJ 1XGMA 2LW8A 1V6IA 3MUY1 4D6RA 1CF7A 4ON0A 1YI9A 3ZMSA 1W8OA 2Q1FA 2G9WA 4LQRA 2CAVA 5ERIA 5JZGB 1Y6IA 4CZSA 1E5RA 2D6LX 1OFSA 1CVNA 3NAUA 3CKHA 5F0CA 1WI3A 2LM3A 4M01A 3GFMA 3HEIA 1U8BA 3GHMA 4LOSA 4NWVA 5H2FC 2FQ4A 2OAZA 5IOYA 4N8MA 4Q48A 4KG0A 4FAGA 2BFUL 4IEZA 1LJ7A 1EV11 1D4M1 2FDGA 1XE8A 5IFTA 1S6LA 3LSMA 1ZQ3P 4R79A 3LSGA 5IK8A 4YG6A 2P6SA 2P6TA 4KMFA 2IS2A 1X4PA 4GA9A 4BQ4A 4A3IJ 1RC6A 1QU0A 3U4SA 4YW3A 1KZHA 3FISA 3Q8BA 4DGWB 3PHMA 4HQEA 4CPBA 5ABJB 1C57A 4XUPA 4HL0A 4R9CA 5KNLA 1H8VA 1QZYA 3ZP5A 3QP5A 4RHV2 4G9SB 2PA7A 2L7MP 1BI3A 1W9YA 1QOTA 1RUC2 2ZOEB 2PLV3 1PZ7A 1O8SA 1BVVA 3EMRA 3N9PA 2FU4A 2WKKA 2LKPA 1JHFA 3J80K 4YGCA 1MGTA 1LOGA 1RUOA 1EH7A 1UELB 5K7HA 3A4CA 4LLNA 4WM8B 2B39A 1FZPB 4L5JA 3HYIA 2E33A 2Y6KA 2JE8A 4CTEA 3H8OA 1ETQA 4LLGF 4XJ9A 1R091 1PMIA 5CPRB 1UG2A 4AEDB 1XSQA 3DEEA 1MVEA 5HV0A 1N1YA 4KG8A 4GRIA 1AZDA 2M1BA 3CDZB 4CE8A 4ET7A 1CZVA 3KF5A 2IP2A 3MZHA 1PVXA 1MQTB 1VBE3 1PO21 1T0FA 2WO1A 1M1EB 3K69A 4GAZA 3I54A 3WE2A 2VT3A 2L4MA 4XSZF 4YZ5A 3PIPF 3B9IA 3IM0A 4IUGA 3O0VA 4DIQA 3LOCA 1Q1HA 4PDKA 3LEKA 2P8TA 2EPFA 5D4RA 1FYMA 3W6KB 4ISQA 4WVMA 1P4AA 2R5YB 4ZS3A 4H55A 3KV5A 5LGNA 2WIIB 4OUSA 1QJU3 3CMYA 2JDKA 4UWDA 1W0PA 3OUJA 3FZ3A 3X2QH 4YVWA 4PBOA 2GC0A 2FNAA 2QSGX 3WNKA 4OQ9A 1XS9A 1LE8A 3CJNA 3ZRGA 2GOMA 3T1BA 3PUIA 3BZKA 1TQPA 2OQ7A 2RS13 1G9AA 4QDSA 3RFRA 2CGOA 2X1EA 3TEWA 3VBOC 1J75A 1E3HA 4AM3A 4GWMA 3GO5A 3HJEA 2EB7A 1QBJA 2VBDA 1US3A 3S16J 1B35B 1Y1WJ 1COV2 3HVDA 4LBLA 1XG1A 1DGRN 1XNDA 1JT6A 3N05A 1PNGA 2KRCA 3RWNA 5ACA3 1B9NA 2PN6A 4CH7A 5C9AB 5J3LA 3E97A 3MLJA 5A33A 2BBYA 1BK0A 3ME2A 4AE2A 2WAOA 2VZTA 3HRSA 2WNUA 1QJU1 2OZUA 4JGYA 1X50A 3WF2A 4PDWA 2N7GA 3S1NJ 4H2AA 4W4ZA 1MMDA 5FLMJ 1Z3XA 2DPDA 2UYAA 1SLTA 3BOWA 2QYOA 1ZM1A 2RS11 3JTGA 5F5AA 4B47A 3I2IA 2CS3A 5CNAA 5DDJ2 4OHYA 5FYHA 2A1XA 3V4GA 1A5JA 1UMHA 5DUIA 2FX0A 4H7MA 2WV0A 3OY9A 2HNHA 1PK6A 4QKBA 5FY1A 2IS6A 5IVJA 1PJRA 1YRZA 3EO6A 4GH4B 2ZSIB 3DXTA 4YPJA 1ZRDA 2DMUA 3O0WA 4NPMA 3TEYA 2EIEA 3GZAA 1RKWA 3IKWA 1H1IA 1LU1A 2FSWA 5L3GA 3AMHA 3AP9A 2E7AA 3VZJA 3UT0A 2A07F 2DCEA 2ILMA 1APLC 3IWFA 5FTTC 1OLMA 3LKJA 1NCRA 3MW4A 3ACIA 1SCRA 1ENQA 3S3NA 4FFHA 2VTXA 1IPJA 2JDPA 2OPKA 4XFIA 3WV6A 4ZXEA 1CAWB 1LFPA 2W48A 2VMHA 3PIGA 5FYTA 4JOMA 3ZKYA 4N43A 1UZ0A 2XJTA 4XKBA 4CEYA 1H0MA 3RSJA 3WU0A 1V9U3 4MTDA 4CDXB 4XFBA 2J1UA 3UJQA 1I6HJ 3PU8A 2LFBA 5FLVA 1RESA 2IS4A 4TLGA 2W94A 5A3MA 4D7SA 3C7JA 1PZ9A 3HHGA 3IIAA 4EN7B 4Q0PA 2P3YA 2D44A 2VUCA 5ICCA 5L3FA 3WDYA 3J7LA 1DLCA 1LVAA 4BIFA 1FWZA 4B4CA 3T09A 3VV1A 2L2OA 3BI3A 1FATA 1EUUA 5IWFA 4L97A 1OH4A 2VPRA 4B4PA 1RUI1 2H09A 1T08B 3HDDA 2P5VA 2JDUA 2FZ2A 3IV5A 2FDJA 4UFHA 4R1HA 4YVSC 2WZR3 4CXFA 1WJBA 2VTFA 1VBB3 4IHXA 3ABTA 5FJHA 2YDEA 2L9NA 1UOJA 1G86A 4CUGA 3I4PA 1LPQA 2BRTA 3MF9A 4LFUA 2EINH 3QRFF 4AQ2A 3I4MJ 5FPXA 3MIGA 1D0ZA 2ID4A 1N3PA 4C9YA 5HDNA 3WP3A 4AIDA 5HCFA 2W7NA 2Q5TA 2F5EA 5IVYA 4CYCA 2OC6A 5T5JA 4XFFA 4C8DA 1VQLI 2YGMA 2Z2SB 1MS0A 1X3ZB 4WM7C 4IL7A 4A3LJ 2EFNA 1SFEA 1SCSA 5K9YA 1W8WA 3DCFA 2JSPA 1K6OA 4LJHA 5FFOC 1ZBA2 4IKFA 3L2CA 3IKTA 2WZR1 2CQXA 1X4OA 2QQPA 1HV0A 5JR3A 3D6EA 1NQJA 3KQRA 1N75A 4E7ZA 5FLXK 1J3PA 1MH3A 4A2UA 1VPHA 1WGPA 3C2UA 1NZCA 3F6OA 2R063 2JG9B 2M34A 2OJED 1XSDA 1LTEA 1EAH3 3H9QA 2DTYA 1AYN2 2WA3A 3K9TA 2DCKA 2GNBA 2D2WA 2E71A 2BW3A 3D82A 2W25A 1AR73 3ALQA 5FYMA 1FOD3 3E3VA 1RL3A 2R1BA 4OUEA 3MIHA 1IS6A 3ZFGC 3SJMA 1V5EA 3GBWA 3M4FA 2ACJA 3KGZA 4RAZA 2WWUA 4Q26A 4GJYA 4QX2A 4PLOA 3QCWA 1MSEC 2ARBA 4OLLA 2R042 1BA5A 3WNOA 2K4BA 2KDOA 2ZAAA 3GJBA 5D5UB 3KLOA 5E1RA 1MACA 3OYAA 1AKHB 2NS7A 2Z16A 3ZQLA 2IGOA 3IPVA 3U07A 5A80A 3QPTA 5IT3A 3N9OA 4RGSA 1XNAA 1W4MA 4YW6A 1F15A 1NXMA 4ZHNA 1K61A 4XLHA 3NARA 5GLVA 1R6RA 3VDDB 3FMRA 3K70C 4YFWA 3LSHA 4UVBA 1IZ3A 3ILFA 4OIPF 5FYUA 1XYOA 3SFZA 3RZMA 1JHNA 1PHMA 3IMMA 5FBJA 3WUDA 1AXYA 4I6ZA 1AR81 5FYIA 1CAXA 3ZXSA 1UZCA 2JRTA 3CD6I 1GNHA 1WCDJ 5EFUA 2ZFUA 1ULOA 2V79A 3AG2H 2ZKZA 3GBGA 4O5VA 3PVBB 3U75A 2RNGA 3AZWA 3K1NA 3M07A 4BBSJ 2VBPA 3C3VA 1PMHX 3KMHA 4P00B 1XGNA 1U5IA 1DF0A 1YCIA 1DGRA 1YRNA 4BGDA 2DTRA 2YPRA 3KEYA 1VZ0A 1UO9A 4HK8A 3AKSA 1QVUA 1XNCA 5DCMB 3VGIA 4AGRA 4HA8A 3VWBA 3MICA 2Y75A 3TEZA 2DUOA 3DTIA 1FC3A 3CO2A 3O7OA 5ICEA 3NMBA 5FZCA 5K8SA 1SPPB 2ESHA 1KEXA 4RB3C 1RGSA 4LBJA 3AVSA 4HZFA 1XB9A 3VBHA 3C7FA 3TRSB 2HI3A 4XZPA 4B09A 4CDUC 1VMHA 2EIBA 3JD71 3PTRB 5C3PA 4BL0B 3DPLC 1O3QA 2AXLA 1QDCA 4HANA 3BTJA 2DVDA 1R1ZA 4E2SA 1Z3YA 4J19A 5JMOA 1VBA3 5HNFA 1GWKA 5F6FA 3M3EA 4YW1A 1MNEA 4RGGA 1K4SA 3AC0A 4PQQA 2JEMA 5D8LB 3TNQA 5FY7A 4NC6A 2W95A 5J98B 1JTXA 2PHWA 3TQNA 2ENRA 3NRUA 3O8GA 1R58A 3N9MA 3VZMA 4QX0A 4RHV3 3N7MA 1LHVA 4EV0A 5FZIA 4AF9A 1YQCA 4XXAA 2ET1A 4XJZA 4YNIA 1W6OA 1RUC3 4NN0A 4A4AA 5IT6A 2Q0OA 4A7ZA 5FP7A 4QDQA 1S72I 3H8RA 1E5IA 3GM8A 4A3EJ 3OYGA 1R1UA 4BE3A 3P5JA 2XAQA 5FZ1A 3FBMA 4R9DA 1G59A 2OD5A 3P9KA 4Q5OA 2JKXA 2E1MB 3VBOA 4CDQC 4MADA 1HW1A 3RQ0A 2AUYA 2W82A 3THCA 3H50A 1DQ0A 5FRMA 4JX0A 4D6SA 4BU2A 1YEWA 4Q0SA 3AKRA 3PVOA 3VKNA 2BY1A 4GMP0 1Y8QB 4XHBA 3OYKA 4YGBA 5FKKA 4KGQA 1OYIA 4K8FA 3JCIA 1RUC1 1DGWX 1TE1B 3I3DA 4OHXA 3J7YJ 3G3ZA 5G04L 1QHGA 2FUG2 4M9ZA 3ZYJB 4M74A 2A61A 5B66C 4FP2A 2H1LA 5E8AA 4BUPA 5T54A 4PZJA 2MABA 1A3KA 2QSFX 4GYGA 2VASA 1WZXA 2DK5A 1RUF2 1OT5A 1BC7C 5F08A 1S7OA 3IBMA 1A04A 4E7SA 5IYBJ 2DFFA 1ZG3A 2XL9A 3FUOA 2WAEA 1PGSA 1Z6RA 3ZIWA 3OYWA 2IA0A 2VW1A 5JVVA 1ZRFA 1ZA4A 2D5FA 2AS5F 2XB5A 3RG0A 3I49A 4AYBN 2HOAA 5DMYA 2JK3A 1FPN3 4FX0A 2ZJ2A 1GANA 1HKQA 1FIPA 2NS8A 2ZABA 4XVHA 1XGSA 4CDWB 3WQ7A 3OYDA 2G7HA 2WNOA 5GP9A 1BEV2 3DTEA 1YQ5A 2LP0A 4MH0E 3AXDA 3CMGA 5FZ6A 3MKYB 4YFXF 4UFMA 2ZXQA 4RM3A 1Q8OA 3MLLA 4IV1C 3PUBA 4P08A 2GC2A 5K0UC 4K7JA 2Q1MA 4PSXA 3OGSA 3EYIA 4CCEA 2WZPP 4AHXA 1CIYA 5C8WA 2WNEA 1IO2A 5DDJ3 3ZFFC 4IVNA 3C18A 2HQRA 5FLJA 2EIDA 2P34A 2VGDA 1EKEA 1COV1 4Y20A 2O0YA 2LTPA 4URTA 1DGWY 2ADEA 3C7EA 1MSFC 4D0QA 3HOXJ 4BMEA 4IXLA 1S3JA 1MZ5A 3PJRA 3F8BA 4LG0A 1TQIA 1K45A 2CW7A 2WSVA 4NRPA 3WDUA 3NSTA 5FFZA 4BJTA 4XJWA 4CEWA 2OYZA 5LW9A 5GJ6A 4PUSA 4XONA 4D94A 2FMDA 3LAGA 4UOJA 4HF1A 1KD7A 1R1A1 4YVSA 5FV3A 3JCUC 4MGRA 1DG6A 2BFUS 4UUTA 5LA2A 5K7ZA 5F3GA 1G8XA 3AZXA 3POJA 4FPFA 3E6DA 1WW5A 5EYXA 1OUXA 3SMHA 3OL3A 2PQ8A 1WWYA 1DYPA 1W6PB 4ZONA 1JBCA 4I01A 1TWCJ 1RMU2 1IS3A 1HB2A 4ZY9A 4A7YA 1LFBA 4QQLA 4AVBA 3BPXA 3L9FA 4C0HA 3ZN0A 2XBO2 3FC0A 3AYDA 2VJ5A 3KLNA 4G6TB 3IHUA 4WM7A 4PJYA 4IV3C 4KQ7A 3OOPA 1BR2A 1D3YA 3FMGA 4N53B 1AX2A 1HRI2 2D1VA 1L7RA 2Y0SN 5FK7A 4CHUA 4OIQF 1KFUL 1E17A 4GWJA 4ZXKA 1QHHD 2HOSA 1BIAA 2QVSB 2CWMA 2X53S 1ETOA 5CJ9A 4XBLA 3I9V2 3GEZA 3RSNA 3LMMA 4Y33A 1ZARA 5CG8A 4QB6A 2E2IJ 1U5YA 4WVVA 2EJRA 1YJNI 3O1MA 4Q0UA 3H0GJ 1F4AA 2EIJH 3NKTA 1JI8A 1E0EA 3I2HA 4PLMA 4AIJA 3E5UA 2R7FA 1MBKA 2HWF2 2TNFA 2PYTA 3QPSA 3H5RA 5EV7A 4PGGA 3DU5A 3LA3A 4A3DJ 2VUJA 3OMYA 1W8ZA 3BOQA 4PIZA 5FKLA 4XL9A 4UAPA 1J83A 4PCQA 3P5BA 1ENXA 5E89A 4XYXA 2VCMA 4J1XA 3PMSA 4JKKA 2F5DA 3OYJA 1UZYA 2IVIB 3PNYA 2QGUA 2C6SA 1JZ2A 1YHQI 4GKYA 1D2QA 5FYVA 4ZYHA 1HB4A 4BE0A 3H3LA 1HXS1 2R7SA 1A8MA 3S1MJ 4AI2A 1MZ6A 2DFEA 3EPZA 4BPZA 1KU9A 3MZYA 3VYTB 5GADJ 1HLVA 2RAEA 1W36C 4JAAA 3QOPA 4G12A 2EVXA 2BUKA 1KQ9A 3RZZA 3SDGA 5SV5A 3FHZA 1AYN3 3NVCA 1D8JA 2IT0A 4WBBA 2MFZA 2PHDA 3ASNH 3CCLI 2WFF2 3R6SA 5T55A 1MBGA 4P9UA 3CCMI 2JG8C 3OYFA 3G7DA 4A3XA 4MIMA 1D5YA 4UNOA 2NMOA 4KFCA 4YSFA 4UVCA 1G3SA 3FMQA 2W1WA 3F6VA 4IEVA 3MEXA 3VKFC 4M6VA 1DDNA 4F3QA 1ZBA1 5CIRA 4OUMA 4Q4X2 5CFCB 4LKSA 4LHSA 2BE5F 4XF4A 1JZ5A 2QNKA 4GMP1 2DMQA 1XDUA 1RZ4A 4M6YA 1JUMA 2ZHKA 3HT2A 1YOVB 4CP2A 4XBNA 2DO7A 2XVLA 2HXIA 2HWD2 2P5LC 3DLLF 2VH9A 4JGZA 2K02A 3C2HA 3POWA 1RUJ2 1W8FA 2GN3A 1ZX5A 4E8DA 1DZQA 2YBPA 4U87A 2VULA 2XF5A 4ENMA 1YS6A 1XB4A 3QU3A 1Z0XA 2L0KA 4A93J 1FP1D 5C33A 3IRQA 2R49A 5F2WA 1HA8A 1HN1A 1P7IA 2G19A 3BWGA 4KITB 2EA2A 3BR0A 4YM1A 3CF6E 2VAUA 1P6RA 3QYBA 1WJCA 4TTGA 2QQAA 2R041 1ACIA 3ZPOA 3CHXA 1C1FA 1AHSA 2JB4A 1QXRA 3MF6A 3OUHA 4X0GA 3SDBA 1LHOA 1G3TA 3T0BA 1Y0UA 4B4QA 3KSCA 4CDUA 4K1YA 3PQKA 1LE8B 4H0EA 5FZ4A 3M1HA 2FBIA 2M4KA 1VRH2 2NNNA 5CFDB 2I07B 3U1KA 5FPVA 2HDDA 2V4VA 1FMWA 3FXKA 1TWGJ 1UU5A 2ZZQA 4GULA 4XFGA 2JJ7A 1NA1C 3F95A 3M1EA 1MW7A 3ETQA 1ZYRF 2CQKA 4DW6A 1T6SA 3ZXEA 5EGOB 2QQIA 1OCCH 4GZ9A 2DV9A 4EWEA 3COAC 3ZQIA 3W5NA 1WFXA 3OS1A 3SZPA 4M4RA 5LLQA 3RYKA 2Y34A 1MJBA 1BBT3 5BNNB 5A33B 3TB0A 1HN0A 2ZNYA 3LSPA 2LUWA 2WNUB 1Y39A 1QPMA 2M7BA 2IGNA 4JGYB 1ZK8A 4Q4Y2 1R5HA 3CDHA 2VE9A 5DAWA 1ZGWA 1LNSA 3CDIA 2W91A 4FPLA 2XQXA 4I30A 5GPAA 5HCHA 4XN0A 4DXZA 1K12A 3BZCA 5FPZA 1HQWA 3ZLIA 1JUSA 4CDQA 3MIFA 4UW3A 3DXJF 3BKZA 1RR8C 3WTZA 1XPWA 2MC4A 3S57A 3CCSI 1N3QA 3GZNB 2WQ8A 3THPA 3QODA 2XPJA 1LOBA 4B8XA 3DV8A 3Q0VA 5HCAA 3HSRA 5DZGA 1JUHA 5A6YA 1K3IA 3Q9VA 2A69F 3MEPA 5JSPA 3JRIA 1JS9A 1DGLA 3K0LA 3L2VA 2STWA 2VKHA 5HDGA 4XW3A 3BIWE 4LO5B 2M8EA 3VB2A 3BU0A 4XBFA 3ZXKA 2VMEA 2XAHA 4RR3C 2ZHLA 1QJX3 1HC8A 1U3EM 3BR5A 3OIOA 5FMCA 1NXD1 4XDOA 1XX5A 4NVPA 1W0TA 2HVRA 1W8TA 1BIBA 3HWJA 2IA2A 4ABZA 4UHTA 2VOPA 5J96B 4JCKA 2A3YA 3KHBA 1MPXA 4BMBA 2ESNA 4P9YA 2IW5A 1UX6A 4YW4A 4N4OB 3VOEA 4AWXB 4LNVA 4K6BA 2ZMEB 3K4ZA 4C1XA 5EZGA 4FPYA 3SQOA 4MGQA 3NWSA 4UUSB 1YITI 3K4JA 2I8DA 2XSDC 4GDFA 2VXDA 3WF0A 4Q4V2 4NHJA 4IV1A 3ZXFA 4XFHA 5K0UA 3FXJA 4BWOA 2P17A 5JAXA 1LEMA 5BNPC 3HRMA 4YFKF 3ETPA 2ZX0A 1BLZA 2HDCA 2XSJC 2V1DA 1PGL2 5FZBA 4XR6A 1ASJ1 3FL7A 2GH2A 5E17F 3ZFFA 4FPEA 1SAUA 1J3QA 2Q8KA 1D0YA 2DFIA 4BACA 1U8RA 1HCRA 2GIZA 5F5QA 4AZZA 3K2OA 4HLXA 1VQ9I 3SCFA 4LE3A 1BEV3 2MLGA 4O9EA 3L2UA 1KJLA 1FPQA 4XM3A 2PG4A 4E8CA 3WHUA 1CWPA 2GC3A 4OOIA 1RKTA 1UYYA 1Q1VA 4G7ZF 1VBD2 1Y9QA 1RUF1 2DCTA 1V70A 4HRIA 5BYNA 5CYYA 3A22A 3TKYA 2X51A 1WCKA 5BNOC 5L9RA 3PTYA 4HLTA 1ETKA 5CKTA 3RWKX 3F0CA 4XLNF 3H3UA 1YQ8A 3KP5A 3ABUA 4HVQA 3KV9A 3UESA 1ZGJA 2WT0A 2DYCA 1BYHA 3MIEA 3HD8B 3BY6A 1DYKA 2HWB2 4KJZA 1N77A 4ETSA 3GBFA 1S9HA 4Y7NJ 2ZGTA 1T39A 1ETWA 5JOYA 3V0AA 5BQTA 2I45A 3Q8CA 3OG2A 1UOFA 4QHBA 2PAKA 5F39A 5FOBB 4IV3A 4CPBD 2ME0A 1VQ7I 2OPTA 3VYSB 5ED4A 3CZ6A 3DPRC 5HPOA 4BQWA 3NL1A 2DT5A 5GTHC 2DA1A 2BP6A 5IVFA 3HN3A 2R073 5HVQC 3LAJA 3GVAA 1YC61 4TYSA 4Y3OA 2VKDA 1HRV3 4BZ4A 4RS5C 1WMEA 1S29A 5T5LA 4NHXA 3G1OA 3BTXA 3Q3SA 2VOWA 4PI0A 4HNVA 4A3ZA 3VBSB 4MXWB 4A3JJ 2K46A 2EIGA 3UKVA 5JVTA 1UYXA 4EN6B 2YBSA 4RGKA 4OFGA 2R7UA 3IPVB 1G8WA 3SEEA 4XIOA 1QGPA 2F4MB 1KU7A 4ANJA 2EWNA 3FLTA 1JZ7A 4BKXA 3WLUA 2X8KA 2QUOA 2KIFA 2G1MA 2MSYA 4E2GA 3AZYA 2HEWF 1YNAA 1GVDA 1HRI3 3HOZJ 2XHNA 1JW6A 1HQNA 4D1QA 2CUEA 2X0LA 2W1UA 3HSFA 2Y60A 3ECOA 1JU3A 5C8CB 3HPHA 5KWRA 2R0QC 1W9SA 1X82A 2XMLA 1CAXB 5FYCA 2O0OA 4IRHA 4HSTA 1OYYA 4DNCA 2E35A 2AHQA 1QKQA 4W6WA 3ZXJA 1POV3 5E3NA 3WHCA 4Y22B 3LSKA 1QRYA 4ARYA 3P6BA 3HM5A 1SAXA 1HIXA 2DT7B 4EN9B 1RXGA 4BQYA 1BI0A 1RMU1 1RIOH 2HWF3 2YROA 1XSXA 2FE3A 3H36A 1ZELA 4FHTA 2HOEA 4XORA 1ZLKA 4J25A 5EF6A 1I1GA 3GFLA 3PL8A 2JDMA 2JG8A 2J5OA 1T56A 2XBO1 2F5CA 1IG0A 3O1SA 1FP2A 1CN1A 3T1LA 4CU6A 4L9NA 4V2VA 4L0PA 3USSA 5CBLA 1LEDA 1OA4A 4DUWA 4D7NA 4XUQA 5F3CA 2NRAC 2B42B 4G7OF 2NAZA 1QQP3 1AVBA 1SLIA 3LWCA 4KH9A 2EICA 2BBVA 5IK7A 2XASA 5FZOB 1B4AA 5K1YA 1FMD3 1HW5A 4DXSA 4I98B 1SFUA 1PP8F 5KHHA 1JHJA 5FY5A 1GZWA 1SACA 2JKBA 1TMF2 4Y15A 4DY5A 1GQGA 4BLIA 1MIJA 2HWF1 3OBTA 2QQKA 3R4UA 2Q8CA 1PO13 5AONA 4QQOA 3PDQA 3BUCA 3JXSA 2M0MA 2HQ5A 2ECBA 2H94A 3FK7A 1J09A 1LOEA 3TW6A 4QXBA 1Y1VJ 2LREA 5JLWA 2BZDA 3VFZA 2Z79A 4QMAA 1Q8QA 2FZ1A 1OR7C 3POGA 5BNGA 3H5NA 2OTLI 3IC7A 2CFXA 1GOGA 4Q4X3 1PVC2 1YFUA 4EJWA 5GAHJ 1X1CA 1W6OB 2CRGA 3MFCA 1JUPA 1W7PB 4IF4A 1UMIA 2ERFA 3H1WA 3RKXA 3KYCB 3F21A 1AR63 4NUBA 2XAGA 1SG3A 3KEOA 5FB2A 4MGIE 2HQAA 2HWD3 2DUQA 4AG4A 3AG1H 1W28A 1ON1A 2RV8A 5DCFA 3KQ4B 1H4GA 2WFF1 2JN6A 1NA1A 1KA8A 4QU1A 1XYPA 2WY8Q 1O91A 3DU6A 3UJOA 4LO7A 1RUE3 3QBQA 3SHFA 2Z33A 3GFIA 2NQYA 3QH7A 3K4CA 4Q4W1 4NIHA 4CUBA 3NNGA 2AEYA 4BDVB 4NIIA 4XSXF 4RS8A 4QU2A 2DQRA 4DZJA 3I5UA 2IXJA 5A3PA 2ARCA 4ZZ8A 2R7DA 5CQEA 4XK4A 4AVZA 5T5PA 4BBRJ 3ENRA 2ZXHA 1R22A 3FKJA 2W5FA 3PQJA 4XF3A 1GP4A 4IQ4A 1SDWA 1T6GC 1Z1DA 1JOJA 2HYFA 5C4WB 2UWBA 1RUJ1 1P9QC 3UR3C 2DU0A 2VQAA 2WABA 4FTSA 1PIV3 1DP3A 3RI9A 3LAPA 4W1UA 2DI3A 2HKOA 4BQNA 4EZ4A 3DKQA 2MNGA 4V2WA 2BWCA 3AP6A 3MLKA 2BBAA 1OHFA 2Y6JA 4LA3A 2VR4A 1UCRA 2WAQA 3ZM8A 5JDBA 1UB9A 3KETA 2ZHMA 3MDPA 1NK3P 4Q8LA 1HDKA 2B8MA 4UB8C 3V0BA 4PFPA 3AFHA 2WQ4A 4FO9A 5EJCA 2VNGA 4XOTA 3ES1A 1QGLA 4M3CA 5K5RA 1XE0A 3ZN1A 4RR3A 5DM6F 4F83A 4E4DX 3SKVA 4P14A 1NE6A 3WUCA 4IO9F 4M71A 3HQXA 2F4LA 3J81K 5BXXA 1VRH1 3HEFA 3LA2A 3BCAA 2WN2A 2V4AA 4D0PA 1RUH2 1PM4A 3H92A 3JBG1 1YLFA 4TZDA 4RGRA 1JJ6C 3B94A 3U37A 4LITA 2VXJA 5B3SH 5DD4A 1GLNA 4BOWA 3SEPA 3FLPA 2R6QA 4ZC3A 4P5OA 4NWWA 3PJQA 4Z82A 4HBNA 1UXZA 4PIXA 3O1TA 3HOVJ 5FZLA 3EJKA 3CJTB 4RB0A 3EQLF 4Y5TA 5FMOS 3ABLH 5J37A 4XXPA 2BNMA 4D7YA 2BVBA 2YSRA 2A7AA 1NHAA 4L9VA 3Q8FA 4LK0F 3NNMA 4Q4Y1 1NX9A 2KR2A 1R082 1E3PA 1DQ4A 1F5TA 2H8WA 1MZEA 5A6ZA 4LB6B 4XICA 2Y6LA 4FOWA 4HX4A 1W2UA 5BNPA 3J80Z 1QWRA 2BU9A 3BIEA 2YFUA 5IAVA 2OQRA 4DEVA 2EXJA 3JRGA 1HJFA 3ZMZA 4BEHA 2GSYA 1C8M3 2EH3A 3RPUA 2L9LA 3I58A 4LKEA 2CSGA 3I2FA 1SD5A 3FK6A 3CMMA 1ND2B 3OBZA 1D2SA 2LY1A 3GTKJ 2ZGMA 1LHWA 2YR2A 1IRGA 5JPNB 3WHTA 3DYMA 4K20A 2KKOA 5LBEA 1O59A 1UNBA 1ULPA 2BHZA 2WS93 4Q4V3 5GALA 4QPGC 2EV0A 1IUYA 2CGNA 4HSRA 1A78A 4FPCA 3EDPA 2L5QA 2QCSB 1U78A 4RA2A 3IDCB 2HKXA 3ASIA 3K4KA 4CGZA 1QJY2 2PFBA 5JOZA 4HX7A 4BLJA 5BNOA 4CCJA 1EY2A 1F31A 1LGNA 4KBZA 5FKBA 1BJAA 3ZYGA 5FZ7A 1D0XA 2FOWA 2AYHA 4WXDA 5IT9K 2R30A 3KEQA 2PN5A 4L92A 3CJIC 1B1BA 1AR92 2TDXA 2BY2A 1ZVFA 3MI8A 1KS5A 4DXRA 1O7FA 4BM8A 4II2A 5F1JA 1UY0A 4XJ8A 2H6BA 3ZFGB 2PELA 1POQA 2VTXJ 5IOZA 1Q8VA 3DPRA 2LBFA 2IXIA 2QENA 3J7AO 2B9VA 5AC91 3O1OA 1DGRM 3LFKA 2TUNA 2Y6HA 3T2QA 4FQZA 4D69A 4II3A 2JTVA 1JU4A 1X33A 1PGL1 4MYEA 5DD8A 4RS5A 1NCQB 1KYWA 5FAXA 2YZ4A 1W9WA 2V9PA 1ON2A 4CA0A 3HQUA 3LZZA 1CAVA 3VDXA 2RG4A 5FPLA 4CA9A 2BOJA 4HV6A 4W97A 1YXWA 4QPIC 3S32A 3R61A 2WDBA 3RIRA 4LKDA 3BN6A 1B09A 3A0KA 4PSWA 2EXIA 1B72B 2Y6GA 2UXXA 2EF6A 3KZ4C 2IFRA 5DUWA 3I71A 2QKDA 2YU2A 2PMUA 1VBD1 3IIIA 4CU8A 1L0OC 1K78B 2OBPA 4DQ2A 2RR12 3I2OA 3JREA 1OC1A 3UETA 2WO3A 5EJZB 2XDVA 2RDPA 1RC9A 4CUAA 2VZSA 3ZMUA 4O61A 2UY8A 3JW4A 4C2MJ 4CZZA 1CGPA 2HQNA 4Y52J 2R7QA 2HWB1 5KC5A 2BGOA 4C3IJ 2W1QA 1WCSA 1FV2A 1I3HA 2OX0A 3ML6A 2W2IA 5AVAA 5FXXA 1ZHFA 3B9CA 5TJJA 5FQ0A 1OPOA 2DVAA 4OQ8A 5TGTA 2VVFA 1X58A 4NAOA 1XCVA 4KMQA 5F37A 4AVTA 3T4HB 2DVBA 5J1YA 2Y30A 3R4SA 5ISLA 2K2SA 4KGGA 3THDA 3CP8A 3M1CA 1ZAOA 4J1WA 2FDFA 3AMQA 3C3WA 4L99A 3KWVA 4Y17A 4P55A 2HJIA 1UYPA 1DU3D 2VKEA 1K6YA 3CQOA 3BG3A 3T4VA 3M70A 2P3IA 2Q0AA 4XOGA 4XPVA 4RLQA 1LKNA 2QE3A 2V6EA 1YO8A 3IDAA 3CUQC 1BBYA 5LHGA 4B7EA 2OW4A 1ETYA 4KMUX 3DYOA 1DLLA 2M9HA 3T0DA 1DCSA 3ZX7A 4RGAA 3RNSA 3CC2I 1RIRA 3FUQA 4BQ1A 3PVNA 4LD5A 2BW8A 3HOUJ 3OD0A 1ODNA 1W5TA 3AZVA 1X9TA 5IK4A 4FPOB 4KNYA 4UBGA 2ZGRA 2I10A 1VMJA 2YGLA 2XOMA 1OR7A 4OULA 1SVLA 3U4XA 4HAMA 1FOXA 2W1SA 1Y9GA 3LSDA 4HPKA 3ZYRA 2QA4I 2RVAA 4XTPA 3E6BA 4A6OA 4URAA 5EIYB 3OUIA 1OISA 1RETA 3T2OA 1CR7A 3WW1A 4EGYA 1PMJX 2CQ7A 2QBXA 3O12A 5H9SA 2A6HF 4BNCA 2D45A 2OVUA 2C9KA 3E6CC 4HSJA 1YIOA 2V7FA 3A0HC 1XMKA 4NBQA 2EAAA 5JIUA 3VBUC 3CESA 4A6EA 4P96A 4BE1A 3V56A 2HWC2 1QNYA 2IGMA 3AG4H 5CVUA 2K0GA 1YX3A 2PXJA 3ZQQA 3NV1A 1MDMA 3FBNB 2MD5A 1NG6A 2E5ZA 2VODA 3CL1A 4IEOA 1YJ9I 4FISA 1PVC3 2P6CA 2J22A 3GYDA 4R9AA 3ILRA 2DF7A 3M8JA 1W06A 4YG3A 4C1WA 4F7ZA 3E6MA 2UWMA 1FNYA 2YPDA 3ZSJA 5G05L 1WCUA 1TMF1 1LHNA 5DABA 1UXXX 2YC4A 4F55A 3B7MA 5A7WA 2W85A 2Q8DA 1RUD2 2PQQA 2VNRA 4RQPC 4A44A 1JT0A 2W4SA 1TQ5A 4FVVA 4LGWA 1V6OA 1VRBA 2ZO4A 3VBRC 5FZHA 2UXNA 5L9VA 1VBE2 4NQWA 5GZEA 1BQPA 4OI2A 2JA5J 1RVF2 2VCAA 1VTNC 1W5SA 5L7OB 4PCRA 4OHZA 2BV4A 1EH8A 2YHJA 1SQ4A 2DQLA 1S0DA 1PVC1 1Z91A 4NROA 4CUCA 2QBYA 1WW4A 4JC1A 3EBRA 4EEFG 4ENJA 5A3OA 5KXEA 5TSWA 1YYVA 1JYCA 4I3PA 3BTIA 2A6VA 4LPLA 2I5UA 2CG4A 2DBBA 5I0DA 3IH4A 4JDNA 1GUIA 2KXLA 1OH3A 3RMXA 3HBLA 2WO2A 2KRHA 3H3ZA 5JHFA 5JZGC 3DPUA 4UFKA 3NNJA 1VQOI 4BHPA 5I0SA 3LQRA 2NLRA 1VQ6I 4IW3A 1FBUA 4HSLA 1EPZA 2MEV1 3GGLA 3CQZJ 1WKYA 4EROA 2PJRA 2JA8J 3GZ5A 5E8GA 4FI9A 2R7VA 5L3BA 4BXUA 2QQOA 1E2XA 3VSLA 2HVSA 4L9BA 4KU7A 1ZZ9A 3I53A 5FP9A 4OVEA 3PU3A 4H4KC 1ZH5A 2GDFA 3G1MA 3PVEA 3VHOA 5ACA2 1TP4A 2ARAA 1OQYA 4R4ZA 3BR3A 2OQ6A 2ELHA 5BS6A 4IE7A 4LBQB 4FXGB 5L3CA 3TMOA 4UFIA 1E5SA 3VBFB 2P4EA 2P3JA 4KICA 1TTYA 3WNMA 1XGOA 2ZMKA 5I93A 5J09A 3C7HA 5ABJC 3H1CA 5E1WA 4LG3A 1C1LA 2GALA 1CPMA 2DT6A 4EVIA 2ATFA 3DKXA 1F9NA 1KITA 4B3AA 5IYCJ 4CCDA 2WAFA 4FTEA 4A12A 4BDZA 2XIGA 5GAGJ 4BQOA 3I7DA 1V6KA 2FHRA 1ZG5A 1DBNA 4WM8C 4GD4A 5LBQA 3RGBA 1YLLA 2QQWA 1WD4A 5AVPA 5DTDA 3G6EI 4IETA 2WZEA 4UF0A 1TME3 2NXNB 1XU1A 4OI1A 2UYBA 5FY4A 4A0ZA 4RBOA 5KHGA 1EJ9A 3FE5A 1UL9A 2ZC2A 2ME6A 3H3VK 1MQTC 4LHLA 2VOKA 4ENKA 4QPGA 3V7SA 5EG0B 2W68A 4AVPA 2X6XA 4CXXA 2ZFWA 3ZYHA 4BY7J 1PUFA 3M4OJ 4O9GA 2RJKA 4EATA 4DRVA 2RM22 2Y33A 5DEQA 2VQHA 5LEJA 1RUH1 1VBC3 4S2FA 4G7HF 2ZBKA 1PK6C 1OCTC 2CW0F 1V9U2 1GXPA 2RC4A 3F8FA 3W20A 4ATFA 2DYSH 2OZ6A 1PGW2 4YZ2A 3EUHC 2J7MA 3C2GA 2PHLA 1WKMA 5AFBA 4Y1ZA 3NV2A 3CJIA 1QIQA 3RTRA 4IRIA 2JDAA 3M3IA 1IXSB 4XJAA 4ZU5A 5EPAA 1R081 1FOYA 3FDYA 2IZWA 1HJGA 1B35C 3S1QJ 5HS8A 4HOBA 1ZG1A 3L9JT 2AGSA 3L2YA 1I1SA 3NAPA 2OF7A 2BGCA 1W05A 3EB7A 1BI1A 1QJY3 2FDKA 3THTA 2KJBA 3QH6A 2VE1A 1D1CA 1SVOA 2HWVA 2ECCA 2C1FA 2B5HA 4UW6A 4NDLA 1DFQA 1H30A 4ZTJA 1MBHA 3W2VA 1UAIA 1KU3A 3OYEA 2KZGA 4E4HA 5FFXA 2IUWA 1Z7S2 3N97A 4I0WB 2ZXWH 3VD3A 3SEQA 3DN7A 5L9BA 3WEZA 1UWWA 5F2SA 4QPIA 3KP6A 1AR93 4BQAA 1FTTA 3ZFEB 2JG8B 5I0UA 3S7EA 2JA2A 2JVGA 2CH0A 1BJQA 2PHXA 4BYYA 5HCBA 2YFZA 3WODF 2DA2A 2DDUA 2C6YA 1YIPA 1OFNA 3OGJA 2ZKNA 4X6RB 1AA7A 2DOAA 3CEWA 2MHFA 3I55I 1LNWA 1GDTA 5EEHA 4E9KA 1ONAA 1MZBA 4DRRA 5EWSA 3T5XA 4CO8A 3RQ4A 2Q8OA 3WVJA 1ULDA 1Z6TA 3FBIB 4XF9A 1FEXA 1OFCX 5GLUA 1JOPA 2W24A 2F6BA 1CONA 1AHDP 4DYCA 5EEGA 1XD7A 3Q0WA 3ZN6B 1Q3EA 2H8RA 5K5QA 2HDWA 4PJMA 1AR72 2LF8A 4QPOA 1FOD2 4META 1I3AA 2XKPA 1OCOH 3D4KA 2ISYA 3RZHA 1JODA 4ZYEA 3VD9A 1JJ8C 3WCRA 1AYM2 4CDXC 1IN4A 1REEA 1NLRA 3OEBA 4AAPA 4MO7A 2K40A 2RR13 2I74A 2B46X 3KGLA 1B8IA 3Q0UA 4AXOA 2E5NA 3D5SC 2DWRA 1TNSA 4P9JA 1T2XA 3BCBA 1R4NB 5H20A 2NVXJ 4DEQA 4OAZA 3QAHA 3CUQA 2MG4A 2ZEYA 2Y8KA 4ORFA 3F8NA 2BERA 1R23A 3E7LA 1IN8A 5M5WJ 1X1DA 3JQWA 1JKOC 3KCYA 2HYGD 1LQ1A 1GSLA 3UKGA 3GXOA 3OSFA 5E1XA 1DU0A 1PZ8A 1RJ8A 1LRHA 1XC6A 3JRDA 3DCQA 2VM9A 1WA4A 4TSVA 5H9QA 4SBVA 3ZDSA 2V9VA 4MGSA 5E1ZB 1AWCA 3KZYA 3A23A 2JDNA 2UY9A 3WZ1A 3KD4A 2LROA 1STMA 3ISPA 1S0CA 2IS1A 1N47A 2DTZA 1V6JA 3BQZA 1VAMA 3A01B 2A3WA 3RZLA 3RI8A 4HV5A 5A32B 2W00A 4ZDOA 1DUXC 4QPYA 1S0JA 3CMEI 4XLPF 3W2WA 2N8GA 2R7ZJ 5FRAA 3J4UH 2VQGA 2DYRH 3U78A 1YJKA 2GOXB 3ACHA 4IEJA 2FBHA 2JVHA 3H1MA 4AGGA 3VBUA 5IVEA 1VF9A 4XLFA 3ZMDA 2IWGB 2GAUA 2BY0A 5CA6A 4XKCA 1QJZA 2ZPXA 2EIMH 3WU2C 4OCTA 4MEYF 4EJVA 3WINE 3RDIA 4FSJA 2JG9C 4YRDA 3OS2A 3J26N 4C91A 3SISA 1UD1A 2MLKA 5ILSA 3WDTA 1IN7A 4LBQD 1Z78A 2D93A 2B7YA 2P2KA 2XAJA 2ET7A 3LB9A 1Z0HA 4N9IA 3INAA 1YTYA 4JQTA 3LFUA 1RI7A 3DUIA 2LKXA 1P92A 4F8AA 1R7JA 1V6MA 2MH2A 3OV8A 2M45A 2R5ZA 4JDMA 3BP8A 3IN9A 1LENA 1G9DA 4HQMA 1VBA2 2ZJRF 4RQPA 4XC9A 3BC8A 1JI6A 2EFWA 3VBRA 4GCVA 5B5EC 4OMCA 3SCHA 3QWLA 3RJPA 2HWC3 1Y0NA 1ETVA 2Q8EA 4QPWA 1MS4A 1MVQA 4QB1A 2VUMJ 2AQFA 4B8EA 1OLRA 3SYTA 3TEXA 3T2PA 2X9DA 1J5YA 2X5IB 2RMU3 2ZEZA 3UNPA 4DYQA 4OHVA 4R9BA 2A71A 2XWBB 3VDDC 3R0RA 4U0YA 1CAUA 2E1CA 3VBHC 1H0BA 3WG2A 1MBEA 4NHLA 3GW2A 1H9WA 4KWLA 2W57A 1QZZA 3APBA 2LS6A 3RS6A 1WJDA 4YG2F 5BMZA 2SLIA 3OYHA 2PHRA 4LK1F 2YXSA 1YW7A 2F48A 4YIRX 3ABZA 5JZGA 2NVYJ 3HGGA 1OLQA 1RUD3 1TWAJ 1O7LA 4COUA 4ESBA 3OGRA 1SLCA 3OD4A 5J36A 3D5OA 3WSOA 1OOPB 4HG2A 2W39A 3LEMA 3BODA 1OLME 1RVF3 4WVWA 1H4HA 3I59B 5A70A 5BUVA 1ODMA 3QYFA 2C9AA 4E7IA 3PUQA 1HV1A 2JZYA 2JMWA 2LDUA 2KIQA 3MD2A 3H35A 2PLV1 2VBBA 4TXWA 5LRRA 2VQUA 3I97A 4YARA 2WWJA 4TLFA 5A6QA 1UPSA 2BTVC 2LOOA 3F72A 5D8AC 5EP9A 1G7YA 4IE0A 4ISRA 5ABJA 5C70A 3ULQB 5A2QK 2M3AA 1U5TB 3TAYA 2LMDA 4OU0A 1WJEA 2M8GX 3LQCA 1W36D 3MV01 4PF5A 2LNBA 1JTYA 1FPN2 3EUAA 1VBE1 5TRDA 3BU7A 1GLHA 1EF4A 1US2A 2HS5A 1UU6A 3FF5A 3HR9A 5IHRA 4WM8A 2XF6A 4ZYAA 2B7EA 4XKWA 1WJAA 3OTFA 4EMSA 1SBFA 3PUAA 2CDPA 4UT5A 5DUKA 2FCTA 4AEDA 2CV2A 5KXDA 2BNNA 3BGAA 2JX9A 3B3QE 4KWUA 4B43A 3PMEA 1MQTA 2HTSA 4BK5A 3BJAA 5DG1A 4AHZA 4Z07A 3N3HA 1FBQA 2WNVC 1QPIA 1FYKA 4HW0A 3FXMA 1WMFA 4UV9A 2OT7A 4YW2A 1XSVA 1IRZA 2OCEA 2XJQA 5FCCA 3UK9A 3K46A 2R5YA 5EJ1B 4XAAA 1MJAA 3WTUC 1X7NA 3KIOA 5FY9A 4CP0A 5DM7F 2JDYA 4IDZA 2QQLA 4DQAA 5FYBA 5BPIA 3K77A 1RUNA 4G8XA 4B29A 5FR3A 5JPMB 4BY1J 3EUHA 2O8OA 4XQDA 1L3JA 3OOUA 4E7KA 3J8F2 5ACA1 1C3HA 3HOBA 2FNPA 4U2AA 1JYWA 2CGPA 2E1MC 2M30A 3CDLA 1XYNA 1OUSA 1UCXA 3BLYA 4S04A 2O1QA 5GAEJ 1VQ5I 4P9IA 3O14A 3WP6A 5J4VA 1B35A 5D6EA 2RDSA 2P4WA 4ZDPA 2D5HA 1YW8A 3AZZA 1U0AA 4IOCF 2E7XA 4UW5A 4IJAA 2RM23 1FX5A 2E9QA 5C9AA 3I2GA 3V65A 2ZGKA 1WVRA 2YY1A 2YU1A 3KZIC 4SLIA 5CISA 1WGXA 1OKOA 4BJ5C 1W2OA 4Z2AA 1TC3C 1TT0A 4BA6A 2HPIA 3BR1A 1SLLA 3AB0A 2O6GE 2JT1A 1ZRRA 3B73A 4JKMA 2RQQA 2WC2A 4CEWC 3ECHA 4RM2A 2ZS6B 5FMDA 3PIOF 2VL4A 2EZKA 3M8LA 4G94A 4DMIA 4DS0A 3KYLA 5GTIC 3ZXLA 4CDWC 2UU8A 2Q2EB 4A0YA 3FKIJ 3SH4A 2EZHA 3N9QA 1BN5A 4HN0A 5HS9A 5I8YA 1BOBA 1H8TC 1IC8A 5FJ8J 2UZKA 4B7KA 4CU7A 3MCZA 4Q47A 3GDBA 2P7CB 4V2FA 3S1RJ 4Q4ZF 1MZFA 3NJZA 1V9U1 2OXBA 1S7EA 4EM1A 3M8EA 5DG2A 2XGDA 3AL0B 5JXIA 4Q8KA 3PUFA 4NIGA 1Z7S3 2LK2A 2AC1A 2F4IA 1F4HA 3WHBA 3B93A 3ZQGA 3S2DJ 2XR4A 2YG0A 4MSVA 4W8JA 4PGHA 2X05A 2RS33 4HMZA 3RYRA 2GZWA 1CAWA 4QXCA 2MD0A 3QD6A 3AP5A 3DF0A 3IP4B 1YO5C 2CYYA 2JENA 5A3WA 4CDXA 3K6GA 2KZVA 1V3FA 3OYNA 4TV7A 1GNYA 2NN8A 1S0FA 4HPKB 5L36A 5KAFC 1VBB1 1WHUA 1WH7A 5J4YA 4MFDA 4EJUA 3DGTA 3ZVXA 4ARXA 4Y24A 4NOTA 2E2HJ 2ZGUA 5A3TA 3VD5A 1OSGA 3LDKA 1VAKA 1ZZ7A 5I8SA 5D6FA 5J1XA 4N7UA 2Y0OA 3GCWA 4HKOA 3CF2A 2JUGA 1FTZA 1USSA 2BNOA 2LRPA 4XJUA 5C6CA 1HOMA 4M3FA 3CLOA 4U88A 3ONQA 3CJXA 1S2EA 5GM0A 2DU9A 2EILH 5GLWA 4YFZA 5CU1A 3FXQA 3KP3A 1IS4A 3S93A 1AYM3 1HKDA 1Y9MA 2PQSA 1D4M2 1AX0A 1ND3B 3WDWA 1IPSA 3VKOA 2KP6A 2HH9A 2VOTA 3CTAA 2GM4A 5IAXA 1UOBA 2GMEA 3EETA 1G9CA 1T2KA 2M0CA 3OIQA 1K83J 2R061 1MR5A 3GYHX 4FX4A 2ZGSA 4N53C 1EAH1 3KT4A 4ITVA 3MIBA 4ZYGA 3K1MA 2YV8A 3AP7A 4WWCA 1SZBA 3H9GA 4MQ9F 1OA2A 5A7WB 2GQQA 2MBFA 1AR71 3R4KA 1WWXA 3RPUD 1J1LA 1FOD1 2ZSHB 4KI5M 2PMZN 1ONVA 2NYYA 3QLQA 1OA3A 3O8HA 3B5LB 2WO7A 5EHDA 1J1TA 4R52A 5A7SA 3JUUA 4MVTA 1SANA 2JG9A 1AYM1 3K48A 4DBRA 2VC9A 4I76A 4LK7A 3AG3H 1F5JA 1TZOA 2RGVA 3WP4A 1R092 3KVBA 1R36A 1N78A 1SHWB 1TBXA 2NMNA 1C5IA 1SMTA 2HYKA 2WN3A 4HKWA 1XMXA 3VYUB 4D5CA 4CVUA 3SH5A 1OURA 5DQ0A 1ZR2A 3MWMA 5E16A 1J0RA 4JGZC 3J7ZI 4FFIA 2CQNA 5F6KA 4IE4A 2D3PA 2AEZA 3TNPB 4M0NA 1NTCA 2W0XA 5B4NA 5DN2A 4NPLA 2RVCA 2W84A 1ZRCA 3Q9SA 1AKHA 1W3XA 5F5CA 3NQHA 1I3QJ 3I3LA 2YX4A 2KIUA 1HXDA 5CADA 2RDQA 1E3OC 3WXPA 3WE3A 5LGUA 4KA4A 3I4IA 3VDCA 1BBT2 3USUA 1XNTA 2DUPA 1WCQA 1GOHA 1RTVA 1FY7A 2ORZA 5K7PA 2Z42A 4NHYA 2AQEA 3VDDA 1MBJA 2VMGA 5T3NA 3SH3A 2V1UA 2TBVA 3N7KA 2DA6A 2ZX1A 2Y9YA 4OZXA 3VLBB 2ZGPA 3UGGA 4IERA 3F23A 1J2XA 2RS53 3CC7I 2JDHA 5CFCC 4CP9B 5IP7J 4P9FA 1UHSA 1RUG3 5GZFA 5CEHA 3P7NA 1UZVA 2ZMLA 3FMSA 2RREA 4OMDA 2EA4A 4YZ1A 3RCOA 1KQ0A 1JYTA 1SBDA 4L9TA 1QXJA 5F1RA 3LD8A 1Q8PA 3D5RC 4I0AA 3ES4A 3TL4X 5C5UA 3R05A 3AXEA 4WZCA 4COYA 5HS7A 4AVCA 1QOOA 3OY8B 3CZJA 3KCCA 3T30A 1U9OA 5A7PA 4ZTFA 4HNUA 1FI2A 1MD0A 1JXNA 1W6NB 6PAXA 5DCMA 4G4FA 1F2NA 1QJX2 1W6MB 3WR0A 1WLWA 5D8AA 2VJIA 5IVVA 2GBYA 5DYMA 5FPUA 1IOAA 3N9LA 1TZLA 1JZ8A 1GP5A 1VBA1 2RV9A 4L9JA 1SPPA 1G3WA 5A7OA 4NHMA 3VHPA 4I0BA 2CW8A 5LHIA 3DWLE 4PIYA 3H7JA 1HKSA 3MVPA 1OF4A 5KHKA 5IW0A 3UKNA 4MG2A 3C7GA 5FIXA 4RHV1 2YB7A 4IEYA 3LEGA 3BTCA 1SFNA 1YI7A 2JIJA 3A7QA 4K3UA 4RD7A 3LA7A 1Q5OA 5B1AH 2PHTA 2Z4FA 2K7LA 2QKMB 4O7XA 2GXGA 4FPHA 1GHCA 2IAIA 2M2EA 2K9MA 5J47A 4IHYA 4A42A 3OGGA 2VQTA 3LSJA 2WNVA 1PM7A 1K5MB 4RLFA 5BNNC 3MFAA 3KP7A 4YM2A 1MNDA 2GIVA 2VMCA 4KNCA 4Z1VA 5JXHA 3ZQ7A 1RUI2 4HPQA 2R7TA 3BROA 2NVUB 2FBEA 3HQRA 2GA1A 3WW3A 2Z9OA 1J3RA 2VBXA 3HPGA 4S2DA 2NYXA 3WG4A 4JP0A 2C5DA 5LCWL 4WXHA 1O4TA 3W3CA 4XCBA 2IXSA 2GP3A 3U9GA 2BXYA 4S0HB 4O3MA 3NKGA 5EZWA 1QH7A 4Y1VA 3DF8A 4LIVA 1C8NA 2L3DA 3R0AA 3I3MA 2E7WA 2DU1A 4DBQA 4AOCA 3J81Z 4Y5Z0 5APAA 2ETHA 2P0WA 2RDNA 1FPN1 3AAFA 3JB8A 4DOZA 3I3BA 4AHWA 3SXWA 4RGUA 4QT6A 3LWFA 4NJ4A 3URFA 3J8F3 4K9SA 4ASKA 2G0EA 5B2GB 4K8RB 3OPTA 1U6GA 3DBLB 3H8XA 4MGKE 5CYVA 3JRBA 3U11A 4FQGA 1AXZA 3KHCA 4GGGA 4IHTA 4X8NA 3TBIA 2R072 1I5ZA 4M3BA 4CDWA 2CV1A 2ZMEC 1V0AA 2ZEXA 4KL1A 1DZRA 1U12A 1H8TA 1HRV2 1SFKA 5DDJ1 3EQEA 2L9VA 5JXGA 4HN1A 3TN93 2IA1A 3ZR5A 1B9MA 2DFBA 4RA0A 1YQAA 1ZZBA 1S0EA 2WADA 3G4SI 5FZDA 1LECA 5F64A 2IFWA 3JB4C 1OI6A 1XBFA 5FYZA 1CQTA 1S8NA 3ZXAC 2A6XA 1XU2A 4AEMA 1LOCA 1GMMA 4LBMA 4I7HA 4WXCA 1GFF2 1QH6A 4UVAA 4YRVA 1KYZA 2XQRA 1RNLA 1UW8A 1S4CA 5FXWA 3KFWX 4M9SA 2AACA 3AYCA 1J7KA 1T98A 4RN5A 5KK1A 1X8EA 4L0ZB 2K5CA 3ZCOA 4DINB 4A7KA 5J48A 5A1FA 1F43A 3S2WA 4O65A 5CKNA 1Y7BA 3AJYA 1ZBE3 1W3VA 3OL4A 1BVP1 4EQQA 2ZJCA 4MUVA 4AVSA 3PFYA 2DA5A 3GZUC 4IOAF 4LUKA 1LUJB 4ITCA 2OS2A 2ORXA 1XN7A 3PO3J 2XLGA 3VD4A 2DA4A 1ZRIA 1VB4A 1Y56A 4XRFA 5IT9Z 3TDUC 1CD3G 3RJRA 5F7UA 1CF7B 2WJSA 3F3XA 4X6QB 5ERLA 2QQJA 4CXWA 4LBKA 5DZFA 1DDLA 5FMOL 1GV9A 2F5VA 4G6QA 1W6PA 4LMFA 2V6CA 1GP6A 1QQP2 1C0WA 1IXRC 3PUSA 3IWZA 1U5ZA 3PSFA 4IEQA 1UZZA 1KJRA 3V8LA 2X48A 1FMD2 4AEJA 2CNAA 3OYLA 5DDGA 2Q1ZB 4TWTA 4N53A 2J1SA 5T5OA 5DAVA 3AX4A 1IDYA 5J1UA 2Z99A 2HEVF 1W8NA 3LOIA 1NLQA 4M9XA 1I50J 1PO12 5C44J 4XIKA 2GU9A 3DYPA 2JECA 1XNBA 1A6CA 4Y4YA 3CCJI 3WU1B 4A3MJ 2GXBA 1TNTA 3VBSC 4NIDA 1A6QA 2K4JA 3JAMK 2HYJA 1EV13 1D4M3 2DW4A 1FAYA 2VW0A 2ZGLA 3VYRB 3N4MA 4GO1A 4LR4A 2VY0A 1GWLA 1CAUB 1AR62 3DP7A 5FOJB 2D98A 1KQRA 1OCRH 1BC8C 3H42B 1HSJA 1AYN1 1GZCA 5LK5A 3BTAA 3HOTA 1LFUP 4UW4A 3A03A 4XRMA 2P6HA 5C8CC 2X09A 3LDRA 1NZIA 4CCNA 1GBGA 4DO0A 2EZLA 2J1AA 4AFAA 9ANTA 3ZO0B 3VZNA 3S17J 3HUGA 1ULGA 2COMA 4P9XA 3J7MA 1RUE2 2B9UA 1AF9A 3K7AJ 4A3BJ 1H2KA 1MS9A 4QXHA 1BM9A 1R093 5D5XB 1UX7A 4PLNA 1JE8A 3WNPA 4WVMB 3PUHA 4XMYA 3PURA 1JZ3A 1R9TJ 2C26A 1ALYA 4ONUA 1PO23 1WUVA 4YVWB 3CZUA 2QZ2A 5KHIA 2OCCH 2JPBA 2WWSA 2R7XA 4AYBA 5IK5A 2HOTA 4ZZ5A 3KE2A 4OMYA 5EJ3A 4IHVA 5FZ0A 1JTZX 3M8FA 2HEYF 4N7IA 3N9NA 2WT2A 5CFCA 1I1EA 3POFA 4QX8A 1PIV2 1UF2C 1JHHA 1X2NA 3AL6A 4NC7A 1IN6A 1KGYA 5E3LA 1B59A 2EIKH 2LH9A 3A21A 4M3GA 4JYKA 2QQMA 1VQKI 2YUSA 4CU9A 1IQAA 2ZX3A 1YFXA 4AEKA 5A1AA 2VIXA 4A3GJ 4COVA 1R1VA 4XQFA 1YJLA 4MGTA 1X3WB 4JX6A 3HBKA 1MH4A 1WCMJ 1JYNA 2ZJPF 3H9AA 4AWDA 1AUYA 1L3LA 5M3FJ 2E19A 2XJRA 5KR7A 1FSEA 2WA0A 4CCKA 2A6YA 2OPWA 4PDWB 2VE8A 3NWKA 2F4PA 3I0TA 4DPNA 3CCEI 2G9FA 4DUVA 5LBCA 4A3KJ 1EPWA 1MBFA 2AENA 4QM9A 2L54A 4A0XA 3MAJA 3MHZA 1DPUA 4EYUA 4HLYA 2QQBA 5C5TA 2DVFA 2Y6FA 1LGBA 1R49A 3B69A 5FZGA 4E2QA 3MIDA 4FPKA 1D1BA 1PK6B 2VMDA 4YEJA 5JI9A 3EYPA 1NOVA 3HRTA 4CICA 4YIFA 3RQIA 3S3MA 1VB2A 1H8AC 5A3UA 3GMEA 2XPUA 3HZJA 2VZPA 2W9XA 4E7HA 4UFLA 5CFDA 3G73A 4QX1A 1BBT1 3DEWA 3F9KA 2XVCA 2XJSA 3OS0A 2JA6J 1JKQC 2UV1A 3NRVA 5HI0A 2EK5A 2QKLB 1POV0 4L5IA 1HBXG 3WW4A 4I99C 4G9YA 1NCRB 5LK7B 5C4JJ 2FCVA 4J00A 5EGOA 1QA6A 5GLTA 4IEUA 4LBOA 5FRNA 5IY5H 5ICFA 3T8TA 1N25A 4D8MA 3OBRA 4D9JA 5BNNA 4O6JA 4N43B 1OBNA 2H0BA 1EH6A 4YFNF 1C8M2 3O1RA 4CEYB 3AVRA 4UXAA 4FCYA 3OR1C 4EM0B 1REPC 5CVRA 1R1A2 2WQZC 3DBHB 2DN0A 3VZOA 5FDBA 5GLZA 5C4WC 2Y0SA 1YIFA 3DEUA 5F6LB 3KV4A 3FXOA 5SV8A 4A41A 4ESFA 4HX8A 1EUTA 5CVVA 3ACLA 3BJOA 3DKWA 1A34A 3L00A 4K40A 5FZ9A 1Z77A 3T08A 3WW2A 5ANQA