4I2OA

The structure of fixk2 from bradyrhizobium japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
b'LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAMTAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDIGDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FixK2 protein
publication title The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transcription regulator/dna
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i2oA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i2oA01
4IXAA 5K8SA 2VBYA 3EETA 3FX3A 3V4GA 1FBSA 4OIOF 2A6HF 5BPIA 1XRUA 4MGKE 1RGSA 1BI3A 3H3ZA 3CF6E 3NKTA 4DNCA 3GZ5A 5FDBA 3GF2A 3BPZA 4MTDA 2KIMA 5FQ0B 1KU9A 1Q43A 3C7JA 4IEVA 5C8WA 5E8GA 3R0AA 4CICA 4R1HA 2P5KA 5CADA 2CV6A 3FZ3A 2XAQA 3LWFA 1EPZA 2GIVA 3K9TA 2BBYA 4YFNF 3ZDSA 4YIIA 2GU9A 2P5VA 1KQ9A 1ZG3A 4KFCA 1TQMA 4G7HF 4IESA 4M72A 2VT3A 4BAYA 4ZU7A 3WTYC 1Y9QA 4MGYE 1A04A 5HS9A 3KFWX 1FPQA 5FGMA 1YO5C 5CYVA 3E5XA 5T3NA 2GA2A 2CWEA 3F22A 2XKOA 3I64A 3I54A 5BUVA 2A5YB 4AQ6A 1ZZBA 3O6BB 5K5QA 1D8JA 1S7OA 5LHHA 3M9AA 4ONUA 1ZZCA 3ZP5A 2RV8A 1H9TA 3GUDA 5DUIA 1DZTA 1BI1A 3M8FA 3TDZC 4BXUA 2IJLA 3H7YA 4ESBA 3F8CA 3E6CC 3SHFA 3G73A 2D40A 4EM0B 3DXJF 2UYAA 3WGGA 2V79A 5FD6A 2OU2A 1YFWA 5ILVA 1D3YA 2OD5A 2JTVA 4HA8A 3LZZA 3I5UA 4QWQA 1STZA 5AVPA 3E97A 4Q48A 2DO7A 1FXZA 2VECA 4HLXA 3D5LA 3V8KA 2IRFG 3W6KB 4JTNA 2F5FA 4Z2YA 2V9VA 3KETA 4KUMA 1CGPA 1FLIA 4Z82A 2COMA 1ZGAA 1T98A 4MZUA 3LSTA 2DI3A 3S2WA 3BALA 4ETSA 3ZN0A 2RVCA 5D6FA 3GZ6A 4F8AA 3DFGA 5DEQA 3BROA 3E6MA 1SQ4A 1LDDA 3M7GA 5BOXA 4PIZA 4ZU5A 2IA1A 3MZYA 4IHSA 1ONVA 1XGOA 1RL3A 1G3WA 5LHGA 1IN7A 2Z3YA 3M70A 4AVCA 2QBYB 3QU6A 1K79A 1Q3EA 3BCWA 3NSTA 4LA2A 4LLOA 5BY5A 5LGNA 2PFWA 3BOQA 4OIQF 1R5GA 2G7HA 3RPQA 1EYBA 5KK1A 3R4KA 2IXLA 4WF2A 4XFHA 2X0LA 1O5LA 4IF4A 3HOTA 4M6YA 4IERA 2D1HA 5FFXA 4N0BA 1QQIA 4XF0A 1TLHB 3GBFA 3MAJA 5I0SA 2XLFA 3I53A 4FBFA 2DFIA 5ICCA 5IT3A 2UZKA 5I93A 1IRFA 3BWGA 4QMAA 3GFLA 4M71A 3ELNA 2PLYA 4FAHA 4XFFA 3E6BA 3U11A 1YG2A 5ICEA 3HRSA 3ZN1A 1ZZ8A 2HJIA 3LAJA 4XFGA 2OQRA 1IXRC 2I45A 4L11A 4KDPA 5A2QZ 2IA2A 1G6NA 2HZTA 4G6QA 3DN7A 1H1MA 4LGWA 4L0ZB 4IETA 3U0ZA 1O7LA 2O8QA 3MEXA 5E16A 2FMLA 2QQ9A 1DUXC 2L4MA 2KJBA 1R1UA 1X3UA 2L54A 2B5HA 3I71A 3GVAA 4KIBA 1IRGA 2MBFA 2QVOA 1ZVFA 5E1RA 1RZ4A 3JAMK 4R8HA 4DINB 3KLNA 5J7MA 1ZX5A 4KU8A 4GO1A 2GQQA 1QXRA 1SD7A 4EROA 1Z6RA 1GXQA 3R61A 4ENJA 1FC3A 5KHHA 4WBBA 4RB1A 1J75A 1VR3A 3HTSB 1ZGJA 5HS8A 4U7DA 1G3YA 4BNCA 1QBJA 2DQRA 3WTWC 1E17A 1HKSA 3S7EA 2RQPA 4HX7A 1BIAA 3TKYA 4NVPA 4D7TA 4KT5C 4LG0B 1V70A 4G6DA 4CO8A 1ZYRF 4Z07A 5F64A 3EHKA 2CQKA 3OCPA 3SXWA 2CSOA 5ERIA 1BIBA 3ABTA 1LDJA 4Q29A 5I8TA 4QX5A 3I59A 3JSPA 4U88A 4EM2A 4MTEA 1S3JA 4UXAA 3TO7A 1YS6A 4META 4KIGA 4EJVA 3IHUA 5I0RA 2HS5A 1XCVA 4EJWA 5CVVA 1I1GA 3IBMA 1OMIA 3R6SA 1NYWA 3KP3A 3EBRA 2ZNZA 4OOIA 3HIFA 3ZMDA 1MZBA 2ELHA 2JPBA 2ZBKA 2O6GE 4MX3A 4QM9A 3V8LA 3BY6A 2UYBA 3REOA 4Q4ZF 2XHKA 5L3DA 2KJCA 4OU0A 1ODDA 1FX7A 4L9TA 5H6QA 1J5YA 2GC1A 2OA4A 2HYGD 4A5NA 3VODA 2FA5A 2A6EF 1YUDA 4Q0PA 2ZNYA 1ZLJA 3WGIA 4XBFA 2FQPA 4A0YA 2H6CA 1IXSB 4WXDA 4ZYHA 2Z69A 1BM9A 2WFPA 2ISYA 1VP6A 1U2WA 1UHMA 4S05A 4RB2C 3R0JA 3K0LA 4IVNA 2EAAA 1ZRRA 1XMAA 2KIFA 3H50A 5FLXK 5J3UA 1UHWA 2M30A 2ZKZA 2DTRA 5D1IA 1X82A 5E20A 1CAUB 1FBQA 2MC3A 1HW2A 2XRNA 1OPCA 2VOOA 3I58A 2CAUA 5JI6A 3BU7A 3IDCB 5DYMA 2E9QA 3BZ6A 2X4HA 4I01A 2P7CB 4F7ZA 2FU4A 1SFNA 4NHJA 1IN4A 1J7KA 2CGPA 3MFKA 2EV0A 3HUGA 2A68F 4GYIA 4WVZA 3DV8A 4RAYA 3ES4A 3CO7C 3QACA 3TNQA 3ELKA 1REPC 1VJ2A 4HN1A 2JZYA 3QRFF 2EVXA 4A2UA 2C0ZA 4AVAA 4OIRF 1IN5A 3J80Z 4X6QB 1Z6TA 1E2XA 1LQ1A 1TQPA 2RDPA 1I5ZA 3KP7A 2DLLA 3JW4A 4YG2F 2EFQA 2FRHA 2KIUA 2JPCA 2FQ3A 5KBFA 1S6LA 2HGCA 3PLQA 1XD7A 2F5CA 4D7SA 2DW4A 4PIYA 1DPRA 1ZRFA 3CJNA 1JE8A 2NAZA 5I0UA 4Q47A 2CO5A 2NRAC 4B09A 2VC1A 1AOYA 2D2WA 1F9NA 5CU1A 3KE2A 5JVTA 1KQ8A 4IEOA 3P9IA 3IWFA 2R7DA 3F3XA 2MPFA 2D45A 1CAWA 1DPUA 3QU3A 2DK5A 3ACLA 4X6RB 2BEOA 4Q0VA 4EWDA 1W7PD 3WE2A 3HYIA 4IRGA 4UHTA 2A69F 5HS7A 5E8IA 1H1IA 1B1BA 5DCFA 3GW2A 1LVAA 4OMZA 5KHKA 4AVBA 1K78A 1FY7A 3J81K 2V1DA 3C18A 1YS7A 4HX4A 3DPTA 1MJ9A 3KLOA 3KGZA 1IW7F 4PDKA 2P8TA 4HQMA 4E2SA 3FMQA 3NL1A 2PI0A 4YIFA 4HOBA 2UY9A 4JTOA 5BV6A 3L09A 1OD5A 3H92A 4PCQA 2QLZA 2RKHA 2V09A 4P9FA 3IWZA 3TNPB 2E7WA 4ENNA 3PFIA 3RIRA 2PEXA 3CUQA 2VE9A 3H9AA 2ZCWA 3NQOA 3DF8A 5ILUA 1IF1A 4OIPF 4G9YA 2GC0A 1UIKA 2PMUA 2XL9A 5I0TA 3ZPLA 1ZRDA 2G9WA 2MH9A 1KYZA 1PP8F 4ENMA 1HSJA 1ON2A 4I3PA 1YFXA 5BS6A 5ED4A 2IT0A 5HDNA 2XASA 3NW4A 1TTYA 1SFUA 2ZKLA 3W6JB 4ON0A 3D0SA 2Q8KA 1CF7A 3SZTA 4LK1F 1TQIA 5J8FA 4O6JA 3U2RA 4ENKA 2XAJA 4KIFA 4BH9A 3IC7A 4HF1A 3F8BA 4FT8A 4AIKA 1NZCA 2L01A 2PG4A 1UCRA 2D93A 2MD5A 4WZCA 4RGRA 5J6XA 3T5XA 3RTRA 3LAPA 1Z1DA 5LRRA 2B9UA 1FZPB 4EVIA 1U3EM 4ESFA 1G4DA 1JXSA 2BV6A 2VONA 3EYIA 4MHGA 1TNSA 2WWYA 3JSOA 2RGVA 4HAMA 4ZZLA 3ZMVA 3BPVA 2YSRA 4KN4X 1U5TC 1YHFA 4U7BA 2FXAA 5DCMA 1FOKA 1W5TA 3FMRA 4FX4A 2EJRA 1USTA 3VEPA 3ZQ7A 1FT9A 2IA0A 3RI4A 1BJAA 1S29A 2LF8A 2XIGA 2NNYA 1P2FA 1JHHA 1RC6A 1XB4A 4GGGA 2KXLA 1F1ZA 1WLTA 4OFGA 3PQJA 1ZREA 3K1MA 2W57A 3WTSC 2LNBA 1YFUA 5J8CA 3UKNA 2VN2A 3IL2A 4JV4A 3V7SA 3HHGA 3RJPA 1L3JA 3KCCA 2KRFA 1W5SA 2H94A 5IT9Z 1SD6A 1XGNA 3SMHA 3DPLC 5JR3A 4IEYA 1BC8C 3H3UA 1IN8A 5CJ9A 4MEYF 4Q5SF 3RKWA 1I27A 4L18B 4KU7A 3FZVA 3RYKA 2HR3A 1WRJA 1YFYA 3H8UA 1DDNA 4LULA 1GXPA 4UXNA 3C3VA 3FXUA 2HFHA 4HV5A 1PUEE 2JSCA 1LKNA 1XSDA 1CAVB 3I59B 5D6EA 2OZ6A 3IRQA 1WQ2A 3H1WA 3L2HA 4RAZA 2ISZA 1SMYF 4P9UA 2K4JA 3CO2A 5TRDA 4BIFA 3U1DA 2LSOA 3T8RA 3SHRA 1LR5A 2P5LC 4JBAA 4LMYA 3O2PE 3WODF 4TV7A 1NE6A 1RIOH 4LA3A 4E70A 5FCCA 2H0VA 3OGJA 1J3QA 1OKRA 2ESNA 1TW3A 1HKQA 1O3RA 2IXJA 4HDUA 3BPXA 1BI0A 5E17F 2IXHA 5K1YA 1T39A 2M45A 3DKWA 4LB5A 4HYEA 2O1QA 3AAFA 1JGSA 5CVRA 2MH2A 4AIHA 1H0MA 4XLNF 2PAEA 2O3FA 3F23A 3DQVC 1T6SA 5FFZA 2K7LA 1J2XA 3ROUA 3COAC 1FI2A 4LEJA 2J5OA 3VOEA 1K7AA 1SD5A 4EJUA 2GC3A 5A2QK 3VHRA 1U12A 1FYKA 5JFRA 5JSRA 1QXJA 3H1MA 1T0FA 3K1PA 4RB0A 2XROA 1L3LA 2JRTA 2Z5UA 1XE8A 3WTUC 3V7RA 4AQ2A 5AIPA 3P9KA 1CX4A 3JTGA 3F8FA 3WU1B 3CLPA 1J9IA 5ICFA 2CFXA 2N7GA 5D4RA 2PAMA 5DUKA 2R7FA 2QWWA 3B02A 4MV2A 4O9GA 2QQAA 2EA4A 1RUNA 3LA3A 3T0YA 5LEKA 3LA7A 3GO5A 1IPJA 4RGUA 3TOBA 1ZZ9A 4QGMA 1WGPA 1SMTA 4M74A 1ZARA 5BPDA 2BNMA 2CG4A 2FBIA 5DDGA 2STTA 2HOEA 1MDMA 1X8MA 2KKOA 3BP8A 2DAOA 1O3TA 4EGZA 2BYVE 2HWVA 1XCBA 1RTVA 4J1XA 4XFIA 3MCZA 2ACJA 3KP5A 2E1CA 4AVPA 3FXRA 3M3IA 5FLJA 1G3SA 2YPRA 4XLPF 3H7JA 1O7FA 4QXKA 2IXIA 4AD9A 1H9GA 2Z2SB 1EH7A 2Q2EA 5DV5A 2PFBA 4HV6A 5BMZA 1P4WA 2QNKA 4Y15A 1LRHA 3HSFA 2QM3A 1XSVA 2H27A 1J59A 3WW4A 3BJOA 2XAGA 3CLOA 3HHHA 3E3VA 4I09A 3FM5A 4UBGA 1QZZA 3HSEA 3O14A 2XL7A 3GFJA 3EUHA 1K78B 2FOKA 2O03A 4MQ9F 3C1DA 3ZMZA 2XV4S 1FBUA 3KGLA 3G7DA 5LGTA 1R58A 1MKMA 4HDVA 1WWXA 5F6FA 4AXOA 2K27A 4U0YA 4BYYA 1U78A 3SCHA 4MUVA 2ZFWA 3H1YA 4G7ZF 1P6RA 5K5RA 2K9ZA 5J48A 3L7WA 4EV0A 2LF7A 3IDBB 5F1RA 1YTYA 2V6CA 1JHFA 2OPKA 3WGHA 5D5VB 2VT2A 3EO6A 2FSWA 3CUQB 2E1NA 2F4PA 3DP7A 4HMZA 4FX0A 2QBYA 1YWKA 3QOPA 3EYYA 1YW8A 1EH8A 2MLGA 3WG9A 2Q0AA 2A07F 3U10A 4GULA 3BB6A 1BBYA 4HX8A 3ABUA 2K02A 1ZNPA 3FHZA 2D5HA 4I0BA 5LHIA 1D8KA 1EP0A 1XDSA 1W7PA 2JT1A 3DL3A 2RNJA 5HLGA 2DBBA 3PVBB 4KICA 2Y0OA 1CF7B 5HLHA 4L2NA 3F21A 4WCGA 3N97A 2AS5F 1MJBA 2BNOA 1J0RA 2A61A 5E18F 2YX4A 3BJAA 1R1VA 3G3ZA 4UV9A 5CVIA 1ULYA 1D5VA 1GQGA 1P92A 4O3MA 4I98B 4IEPA 4O5VA 2XUBA 5HDGA 1X8EA 2IW5A 3F6OA 3CJXA 2WV0A 2DT5A 2Y0MA 2VXZA 5FB2A 3RYPA 2EFWA 2PJPA 2ZJ2A 1UPIA 5DCMB 4KWJA 3TDUC 1B9NA 3GLXA 3KZYA 4MQVA 4IRHA 4QGNA 3L00A 4YSFA 5FLXZ 4HLTA 5KHJA 1RI7A 2XKPA 3ZMUA 5DD8A 3GWZA 2XAHA 1PDNC 4YFXF 2PHDA 3S7IA 2GWRA 3MPBA 1KA8A 2O8XA 1FWZA 1KQ0A 2QCSB 3GFIA 2D1VA 5E1XA 5JSOA 3U9GA 1F5TA 3I0TA 4EWAA 4BQAA 5BQTA 1GQHA 2P17A 1W4MA 3ECOA 1QPMA 3F6VA 3L9FA 4QM8A 3Q9SA 2L02A 4EQQA 1RUOA 3DEUA 3I4PA 2PTMA 5L3GA 2M5WA 1FNNA 1GHCA 3ZMSA 3KSCA 2FF4A 3SXYA 5D8KB 3VB2A 2GXBA 1XGSA 2P4WA 4EJOA 2A3SA 4LLLA 1R36A 1O3QA 2J5PA 4CYDA 3FF5A 3FXQA 5EEGA 4O9EA 1T2KA 1UB9A 4XFCA 4IHTA 3FWEA 1BN5A 5H20A 5HVQC 3QP5A 4RS8A 3FHIB 1EY2A 5I91A 5HOOA 3EQLF 3V7CA 1WKMA 4HVOA 1LEAA 1MJAA 4UUVA 1SD4A 2P6TA 3USSA 4IPAA 2CYYA 4B8XA 1NE4A 2OZJA 1O3SA 3TQNA 5L3BA 4S04A 1YW9A 1U6GA 3GFMA 1QY4A 1AWCA 1LEBA 3EJKA 3KP6A 4LK0F 4NQWA 1R22A 2QUFA 3RDIA 3LQRA 4P96A 3WU0A 4RB3C 1LNWA 4JVAA 4HLYA 2XLAA 2RC4A 1BC7C 1DGWA 1PM7A 3ISPA 1B6AA 1ZHFA 4HQEA 3GEZA 3OV8A 1QWRA 3F8NA 1UCXA 1ZZ7A 1MGTA 2HKOA 5AONA 2MLKA 4FHTA 2MA3A 4HVRA 4WWCA 1WSUA 1XDUA 4HBLA 3JZVA 3ST7A 3GXOA 5HLIA 1P4XA 3J81Z 4U0VA 4LLNA 4XF3A 2L3DA 5I8YA 3RKYA 4KWLA 2F2EA 2FBKA 2DU9A 2LDUA 3ECHA 1HBXG 4L9NA 2QJVA 4N9HA 2EA7A 3ERED 3C3WA 2MHFA 4UVAA 4UVBA 2VBXA 5EEHA 3CDHA 1L0OC 3BJ6A 5L3FA 5LLQA 3FJSA 4A6EA 4TLFA 1Z05A 2GA1A 3QPHA 3D0JA 4E2QA 1HKTA 4KL1A 4MGZE 4PIXA 3FE5A 3J7AO 1R00A 2F5EA 5D5UB 4J1WA 1CAXA 4M9ZA 6PAXA 4XFBA 1WA4A 5LBQA 4P55A 4QGLA 4ZU4A 4EGYA 4GCVA 4G8XA 4PGGA 1CAUA 1I6XA 2L4AA 4LB6B 4P9GA 2DK8A 3LWCA 4KA4A 2OYZA 2STWA 4AIJA 4ZYEA 4P5OA 5IT9K 1Z91A 1ZZ6A 2PQQA 1MDMB 2DPDA 4UNOA 5CVJA 2XVCA 3WTZA 4XRFA 1QO0D 4HVQA 3CL1A 2ZXJA 4EM1A 4IEXA 1X7NA 2Z99A 2K0GA 2MNGA 3L2CA 1KYWA 2R3SA 4G7OF 2Y48A 4UV8A 1S7AA 4MGIE 3HT2A 2QVSB 2HQRA 1TBXA 3SZPA 4GXOA 2FEZA 2EV6A 2UY8A 1DP7P 1IUYA 4K8FA 1O4TA 4A0ZA 4LD5A 4Y13A 5ILSA 2YR2A 4CZZA 1J3RA 1G3TA 3HTUA 1KU7A 2PHLA 3MDPA 3E5QA 3FM3A 3GYDA 4WXCA 5CLSA 3RNSA 1QGPA 3FFQA 3WTVC 3EQEA 2GXGA 5E1ZB 3R60A 5FO5A 3WW2A 1R1TA 2YX7A 3ZMTA 3LAGA 4JQFA 2UXXA 4RGSA 4KN7X 5FPZA 5EZWA 1V3FA 1KGSA 1Y0UA 3CTAA 3OD0A 2K86A 2ZMEA 3Q9VA 2O61A 4D0PA 3OF1A 2IXKA 3UKTA 3NJZA 2LKPA 1EH6A 3MWMA 3ES1A 4XFAA 4H7LA 1KU3A 4XF1A 4HSLA 3B73A 1IN6A 3M1EA 1HSTA 1K6OA 4MGRA 3QPTA 4MNUA 4AWXB 1O5UA 1SEFA 2OQGA 2NS0A 3TO6A 4L9VA 2OA2A 3MZHA 1C0WA 5FD5A 1PMIA 4EWEA 4YYOA 5KVRA 4YFKF 5FLIA 3F72A 3ML6A 1U5TA 2EWNA 4CHUA 1ON1A 1QNTA 3JTHA 4L9JA 5JHUA 4LTAA 3E6DA 4HZFA 4RD7A 4WXHA 2C6YA 4XETA 1FYMA 2HTSA 2PA7A 1W7PB 1FP1D 5K5OA 1XGMA 4A5MA 4IEWA 1ZN2A 4Y17A 4XF9A 5EFUA 4BHPA 4IRIA 1EV7A 1ZG1A 5JR7B 2EFNA 2EFPA 2Q4SA 4ORFA 3HOSA 3M8EA 1Z9CA 2PMHA 4A0XA 2Z33A 2WC2A 1B4AA 1YW7A 2RN7A 4ZYDA 3WE3A 2TDXA 4BHCA 2EK5A 4YARA 2IXCA 5D5WB 2W25A 5L3CA 1VTNC 2QDRA 5FQ0A 4EMSA 5BXXA 2DPUA 1FP2A 1YYVA 2H6BA 4MEXF 1XMKA 3UKVA 4M6XA 4H0EA 4G94A 2BE5F 2IC1A 3IKVA 1V4RA 4A12A 2IP2A 2BGCA 4BHBA 2GC2A 5ICGA 3QP6A 1ZAOA 2D5FA 4KYWA 1OYIA 2ZO4A 2UXNA 2V1UA 1Q1HA 4CDGA 3I7DA 4KMFA 4B29A 2HQNA 5CVUA 1IXCA 4CXFA 3EDPA 2G7UA 1YQAA 4KNYA 3BDDA 2ET7A 4M73A 5L3EA 2HTJA 1FSEA 3SCFA 5D5XB 2CAVA 2VODA 1NXMA 1F4KA 4I7HA 4LUMA 2QYOA 2Z9OA 4K2EA 3HSRA 2H09A 2OZUA 3LOIA 3KP4A 4L5IA 3K2ZA 4R52A 2DCTA 2W24A 3LQQA 2FE3A 4QLCU 4UVCA 1B59A 1OR7A 2FMYA 4DQ2A 4IEUA 1HW1A 2VPVA 5HI0A 1CAWB 2ETEA 1DGRA 1MD0A 3PQKA 4ZZDA 3ETQA 4I02A 3JAMZ 5TJJA 1HW5A 4FAGA 2WTEA 2PBIA 1JUHA 3LA2A 4Q0QA 1Q5OA 2O0YA 3KZZA 4HF2A 1J58A 1I1SA 5AIQA 4ZYGA 3CO6C 5H6RA 5E1WA 3KMHA 1FYLA 5I8SA 2GZWA 2B0LA 2IPQX 1HQCA 3HRUA 2ATFA 4I0AA 2ETHA 1CAVA 3V8JA 3P7NA 1BOAA 2PAKA 4YRDA 4I2OA 5LGUA 3WTTC 3GX4X 4HW0A 1J1LA 1YLFA 1UD1A 4EJTA 1O57A 1IPKA 1XN7A 4HN0A 5DD4A 4IEQA 2E7XA 3RYRA 1Y3TA 2QENA 1USSA 5BPXA 1ZLKA 3ULQB 1TNTA 3SQNA 5FPXA 1TW2A 3IKTA 1BI2A 1S8NA 3D82A 3MYXA 3KEQA 4A6DA 2OAZA 1FSHA 5HDKA 4UBHA 2P7VB 4RGXA 4WX9A 2NYXA 2VBWA 5JSPA 4OLLA 1IAWA 4Q0UA 2FBHA 1XE7A 4KWKA 3KEOA 1T38A 2VOPA 3NVCA 1U8RA 2FNAA 5FLHA 2UWMA 3IIAA 2BNNA 3RZZA 1UFMA 2AXLA 1OYWA 1R5HA 2GH2A 4Q0SA 4XF4A 3P9CA 3WW1A 3J80K 3E5UA 3VFZA 1UW8A 2CW0F 5LRSA 1CAXB 3TOAA 1RNLA 2FNPA 4XSZF 4L5JA 3MQ0A 2GAUA 1SFXA 2ET1A 1TQ5A 4XSXF 2VC0A 5D4SA 3TGNA 3FMSA 4ASNA 4U0WA 1ZH5A 2HKXA 3RPUA 1YIOA 3NRVA 4LLGF 2HEOA 4XEZA 2EB7A 4MH0E 1R7JA 3CUQC 4PJYA 3RKXA 2QZ8A 4R79A 3T8TA 3PNAA 1QZYA 2V1XA 2Q0OA 1P4AA 1Z7UA 1IZ1A 2DQLA 3K1NA 5D8LB 2YU3A 1LB2A 3TO9A 1NHAA 2HYFA 4OMYA 1WI9A 2PYTA 2ESHA 2EFOA 2HDCA 3KP2A 3WTXC 1ZG5A 2M8EA 3Q5FA 2M1BA 1SAXA 4LUKA 3SFZA 1OFNA 2VBZA 3WW3A 4JK1X 5JAXA 1R23A 4KMUX 4LFUA 4PZJA 2B8MA 3F8MA 1ZRCA 3CEWA 2Y75A 1PP7U 1GVJA 2PN6A 3N4MA 4N9IA 1KU2A 3SCGA 4LG0A 1DZRA 4ZH4F 2XGXA 2ZMEB 2K4BA 3HRTA 2PQ8A 1B9MA 4LJZF 1J3PA 4HBNA 4NB5A 4ESJA 4PGHA 2XLGA 2F5DA 3O3KA 4IEZA 4HF0A 5C6CA 4M9SA 4M9XA 2VE8A 1LDKB 5KHIA 3CUOA 3HRMA 4IJAA 4WK8F 2EV5A 4OINF 2W85A 4HSJA 3HT1A 4L0YB 2ADUA 2Q30A 5LEJA 2P6SA 3GYHX 3LFKA 1UIJA 3IRRA 2QQBA 1HXDA 4GYGA 2OBPA 1YFHA 1XSXA 2XAFA 2NNNA 1OYYA 1U5TB 2VQAA 1SFEA 3QAHA 4E2GA 3S0MA 1LJ9A 2M87A 2IVMA 5KHGA 3T1BA 1YLLA 5JCTA 2W84A 2Q1ZB 3OOPA 4YNIA 4CGZA 3HQXA 3OTFA 2EA2A 3NEUA 3K69A 1OI6A
chains in the Genus database with same CATH superfamily
1MH4A 4IXAA 3AP4A 5K8SA 3EETA 1WFXA 3E1SA 4X0GA 4OIOF 1DBNA 3LFIA 5BPIA 1RKTA 3FXJA 1BI3A 4NRPA 3TEXA 3H3ZA 1DP3A 3K77A 3GZ5A 5HXVA 3BPZA 4MTDA 2N8GA 2HWF3 3C7JA 4XIKA 2Q8CA 1OCCH 3R0AA 2F4LA 3C2BA 4GH4B 3CC4I 4GWJA 2DYCA 3FZ3A 4I99C 2IS1A 4Q4W2 1EPZA 2XPUA 3N9PA 2BBYA 4CCCA 2VW2A 2A3WA 4DW6A 1PX4A 1CX1A 4IKFA 5HBAA 1TQMA 3AP6A 3NAPC 4BACA 4G7HF 2QSHX 1IJWC 1VBD1 4M72A 3LEGA 1RR7A 4BAYA 3IH3A 3WTYC 1YITI 3OBTA 4MGYE 2WAQN 5GM0A 1QHHD 2A71A 1FPQA 1YO5C 2X5IB 5CYVA 5FUIA 1DGWY 5C3PA 3E5XA 2GA2A 2CWEA 1IQDC 3DYMA 2VQ0A 3ZN5A 4JRLA 3KV4A 2FBEA 4DOUA 2WT1A 5EGOB 2NOGA 4XJZA 5LHHA 2KZGA 1ZZCA 1BR4A 4LHLA 3FISA 1DZTA 5DUIA 4D6QA 3LSGA 1RVF2 1PK6A 2NM1A 3W5NA 3B01A 3TDZC 3KYLA 3OYDA 2JRMA 4KBBA 1D0HA 4Q4X1 3H7YA 2MEV2 4IX7A 3SHFA 3DEMA 1T0FC 2V79A 1S0IA 5DXDA 3AL6A 4OUEA 1D3YA 4DXSA 3LZZA 5AVPA 3O12A 4YVWB 1HF0A 3AYAA 2X9DA 3BR6A 2KD7A 2YYOA 3CDZB 1FXZA 2VUDA 1PGL1 3V8KA 2IRFG 3W6KB 2QSGX 4CDQA 1T08B 4NPLA 2RR13 2V9VA 5C8CA 2PHUA 1S0FA 5FZ6A 1ZGAA 1T98A 1V5FA 4JDNA 4MZUA 4XRMA 2E35A 3O1PA 3ZQHA 4XICA 3BALA 3I3MA 1AR62 5DEQA 3BROA 5CKMA 5BOXA 4GAZA 2AACA 2OVUA 4KQ7A 1ONVA 2D6LX 3NWKA 1XGOA 4UUTA 5LHGA 2O8KA 4LO4B 1IN7A 3DEWA 2JDPA 4AHYA 4ZXEA 1FTTA 1Q3EA 5F39A 2HLEA 4I3GA 3VDBA 2PFWA 3BOQA 4OIQF 5GAGJ 2G7HA 3RPQA 5KK1A 1LHNA 3DU6A 2IXLA 3I8TA 4PSWA 2HWE3 2Y6JA 4PT6A 3H9GA 4N0BA 1TZOA 4XUTA 2D6OX 4C30A 4E7JA 4HSTA 1S4CA 4FBFA 4F55A 4ES9A 1R5ID 4NJ4A 2UZKA 3DCFA 5I93A 3A1YA 2AEYA 4M71A 3ELNA 2PLYA 1SDWA 1SFOJ 1EV11 2YU2A 2DURA 1SPPB 3J7ZI 3MFAA 1YG2A 1RR8C 3ZN1A 4KGQA 2HJIA 4L11A 2V26A 2ZGUA 1G6NA 1AYM1 5C9AC 3S3MA 1VNDA 2DMNA 4G6QA 2ZHKA 1ZR2A 1RINA 1BLZA 1GOHA 1O7LA 1UNBA 4XW3A 5E16A 3S5AA 3AP5A 2L4MA 2KJBA 3HOZJ 3K2OA 1R1UA 1X3UA 2L54A 2B5HA 1QOOA 1DLCA 3BTXA 4KIBA 1QF3A 3J8F2 2QVOA 5E1RA 3SEEA 2WN3A 1JUIA 2PMZA 3S3NA 1L7LA 1ZX5A 2EAKA 2P3JA 3G1LA 2GQQA 1GMMA 4Q4X2 1AR93 1D0GA 1J75A 3ZQGA 1GV2A 3CCVI 3RGBA 4QPIB 2RMU3 3O7OA 1JYVA 1UY4A 3N9QA 1PVC3 4PBPA 3ZQQA 4EN0A 1G3YA 4BNCA 2DQRA 1GANA 1PGL2 5HXMA 1BIAA 2MW8A 3AKSA 5C3OA 4CO8A 5KC6A 2ORXA 1DU3D 1AXKA 1HB4A 4IGQA 2NMOA 4P5YA 1WCUA 2F48A 5I8TA 3TEZA 2XR4A 2DU0A 1W99A 3T2OA 2O14A 2CW8A 4MTEA 4NN0A 4NO4A 2LM3A 1NG6A 1X9TA 2GH8A 4URAA 1XCVA 4BE1A 1I1GA 5JXHA 1OMIA 2DDBA 1R1ZA 5ABJA 4BCUA 3ZXFA 4RGKA 3GTOJ 2ZBKA 2O6GE 3V8LA 2JG9C 2UYBA 3REOA 2CQXA 1RUC3 3ZYJB 5L3DA 2KJCA 3S8PA 4DYRA 1TT5B 4L9TA 5F6LB 5A3UA 2W91A 2QCOA 5H6QA 2ZZJA 1JYXA 2OA4A 1AJKA 3VODA 2FA5A 5IFPA 4PLMA 3CMAI 5BNGA 3VBOC 1PO12 4WXDA 1OC1A 1BM9A 5EPAA 3N7KA 1UHMA 2JUCA 4QPQA 3TP0A 3R0JA 3K0LA 4IVNA 1XMAA 5FZFA 5FLXK 5FBJA 5CA6A 1W3VA 3ZFFB 1AR83 1KS4A 1UELB 4ZYAA 2WV1A 2BGOA 5FRAA 2HEYF 1GZWB 4W65A 2MC3A 3O1OA 2L9SA 2VOOA 3I58A 2CAUA 1Q1VA 5DYMA 3PL8A 3BQYA 2E9QA 2I2SA 5FZGA 5EYRA 1JKPC 1TZLA 3VBUB 4NHJA 1IN4A 1J7KA 2CGPA 3ESWB 5EJZB 2XB0X 2A68F 4WVZA 4G12A 1CJDA 4RL7A 4A7KA 3ES4A 4AM3A 3TNQA 1REPC 4EN7B 3QRFF 2EVXA 3IB3A 1BEV3 2XXZA 1OH3A 3ALQA 3OYLA 3J80Z 4U36A 4X6QB 5FO7B 1Z6TA 1LQ1A 2W00A 3KP7A 5IATA 1Z7LA 2DFFA 2V4AA 3VZMA 1QA6A 3RSNA 2FRHA 4HOOA 1S2BA 2JPCA 2FQ3A 2VQTA 5KBFA 5FY8A 4DZPA 3PLQA 2ADDA 3THPA 4CDUC 1YQCA 1H9PA 1WI3A 4PIYA 2NAZA 3FXMA 5J4YA 2I10A 1OA3A 5JLVA 2XMLA 1WGXA 3OJBA 5J96B 2D2WA 1F9NA 3V0AA 1KQ8A 4IEOA 1MZ5A 1BVP1 1MR5A 3WP5A 2QZ3A 3R0RA 1U5ZA 3WQ7A 4XDOA 3DF0A 1YRNB 1UPSA 3H0OA 5GZFA 3S3OA 3C2UA 4ZDPA 4IRGA 2A69F 5HS7A 5L7OA 1PZ9A 1B1BA 5DCFA 3GW2A 4W1UA 4AEKA 1LVAA 1FOXA 1KXGA 4AVBA 4PLOA 2YBPA 4CUCA 3O1RA 2DVGA 1RUG3 3J81K 4YVSA 4HX4A 2VOXA 1MJ9A 3KLOA 4XOPA 3KGZA 1IW7F 2WZR3 2K9LA 4PDKA 3TN93 3WX5A 3FMQA 4HNUA 2E7QA 4YIFA 4HOBA 5IUQA 3P3NA 3H92A 3PUHA 3QCWA 2V09A 3PU8A 1QJU1 2QQVA 2PEXA 3NKGA 3URFA 3CUQA 2VE9A 3RZLA 2VO5A 3H9AA 4Y4YA 3I55I 1XS9A 2VZOA 3X2QH 1IUFA 2GC0A 2YPDA 3POFA 2XL9A 2SLIA 5I0TA 2ERFA 1Y6IA 2MH9A 1KYZA 3MKWB 1PP8F 4RFRB 1F35A 5FR3A 3QQAA 4I3PA 5FYVA 3QLQA 1DGLA 3M3YJ 1ITYA 1T56A 2C9KA 1ACCA 4KJZA 5J47A 2E2IJ 1NY72 3D0SA 1Y7BA 5DAVA 4ENKA 2J1SA 4BLIA 5JI9A 4CCDA 4FT8A 4AIKA 2ZSHB 1NZCA 1UCRA 2MD5A 5J6XA 2RM21 3ZR8X 2B9UA 5EZHA 1FZPB 3O1MA 1JXSA 4EE2A 3BTLA 2BV6A 2XQRA 3AYDA 2FMDA 3EYIA 3OBAA 4W8JA 1JYCA 4ZZLA 2RS53 3ZMVA 1O4YA 2GN3A 3A21A 2E19A 4RS5C 2YSRA 1SLLA 1YHFA 2QQUA 5F2WA 5DCMA 3FMRA 4FX4A 4JX6A 1USTA 5J1YA 1FT9A 1VQ6I 1S29A 1I5PA 1DGRM 1JHHA 3OGGA 1XB4A 3TOJA 4GGGA 1F1ZA 4TXWA 1WLTA 3ZXGA 5A3NA 5CKNA 1BR2A 1TEIA 3ZYFA 3QOEA 3WTSC 2LUWA 3I4IA 2WNVC 1OA2A 4HT1T 3MUZ1 4PF1A 1QHDA 4UF0B 5FZDA 1QH7A 1W6OA 5F3CA 5IT9Z 1XGNA 1WJDA 3DPLC 3HPNA 3ZFEB 3CF2A 5CFDB 4MEYF 2Y26A 3RKWA 4E7ZA 2DVDA 4BQ2A 2BWAA 5DDJ2 4EN6B 3H8UA 1JU3A 1GXPA 3TW6A 1OOPA 1XSDA 5D6EA 3OGSA 2OZ6A 3TYJA 4AEDB 3OGVA 3DEEA 4H3WA 3CO2A 4P9UA 4AE2A 2E7AA 3U1DA 4QIWN 2LSOA 3T8RA 3AG3H 2WA4A 1LR5A 4JBAA 2VAUA 5G05L 4A3DJ 4U87A 3AMPA 5JZGC 3HDDA 1NE6A 3VPRA 4LBQB 4ES8A 1RUE3 3WNXA 4QXBA 4LA3A 1W03A 4E70A 5JXJA 1RRJA 2VQUA 3OGJA 1J3QA 2AHQA 3DTIA 4HXCA 1ZBE1 2IXJA 4HETA 3K4KA 4HDUA 2ZHNA 4QPGB 1K42A 3DKWA 2VXRA 5CVRA 5IY5H 3BIWE 2P2KA 4DZJA 4CZCA 3A01A 2O3FA 3UR3C 3FL7A 2K7LA 3COAC 3H3VK 4LEJA 2J5OA 3ECQA 1PX3A 3V56A 3AMHA 4E27A 2D6PA 3VHRA 3H8XA 4M3BA 1FYKA 5JFRA 2A3YA 2VL4A 2AXTC 4K7JA 2X6OA 3MIBA 1QJFA 3VYSB 1QXJA 2R0QC 2A6ZA 2Q8DA 4RB0A 2XROA 1SCRA 5FYIA 2Z5UA 3CCJI 3V7RA 5AIPA 5EIYB 5GP9A 2XPJA 5FBZA 4AI8A 1V5EA 4WZFA 3JTGA 2J22A 4BZ4A 5ICFA 2CFXA 1VMJA 3ORJA 1H8TB 2QQIA 2R7FA 4MV2A 3WT3A 3ZYHA 2QQAA 2EA4A 1NXD1 5A7QA 5A3PA 3MIGA 3LA7A 1PJRA 1ND2C 1RUD3 2CV2A 2M0MA 1ZZ9A 3C2HA 3ZGKA 1WGPA 3M2MA 3SH5A 3ILFA 1ZARA 1FIPA 4CPBA 3OG2A 2GP3A 3K3OA 2XGEA 2HOEA 5ERLA 1UHSA 3ABLH 3VBFA 3AKTA 2X5IA 2DCZA 4IW3A 2VZTA 4GA9A 4DRRA 1XCBA 2XONA 2BTVC 1RTVA 5A7PA 1ENXA 4GFBA 5CFCB 3KP5A 4Y20B 4KNCA 4AQTA 2TRTA 1B35B 4XLPF 4YZ1A 1SLCA 3KWVA 4AD9A 1H9GA 1B8IB 2QQJA 1YJ9I 2PFBA 1A34A 1CIWA 3K4BA 5FYSA 5A3OA 4N43C 3THCA 4Y15A 1RB8G 1LRHA 3G4SI 1KJRA 3VUOA 1J59A 2HEVF 3Q8EA 1G9BA 4AVVA 3B69A 2LS6A 4I09A 1R1A1 3EPZA 2XL7A 4B7EA 2ICWG 4FFIA 3EUHA 1K78B 4RMNA 3FDYA 1FOYA 2W92A 3KGLA 5K0UB 5JOWA 2GIZA 3I2JA 5K5RA 3AP7A 4N53B 3QYEA 1LU2A 2PJRA 3T09A 5A6YA 4MGSA 4ZZ8A 4Q4Y3 2LF7A 1ENHA 3IDBB 5F1RA 2EIBA 3HQUA 4COWA 2JICA 5BNPB 2VT2A 1HLVA 1QJX3 2DA5A 1VAVA 2AEZA 4BBSJ 3A0NA 4B48A 1YWKA 4UFLA 1YW8A 4IGOA 1EH8A 4QT6A 5C5UA 2MLGA 3BB6A 4HX8A 1XMXA 2K02A 4R9BA 2XRLA 2M0CA 2D5HA 5JIAA 1XDSA 2JT1A 5HLGA 3OSGA 2VE1A 2VCBA 5HLHA 1XXNA 3F21A 1RUJ3 3I4MJ 1ENSA 4NPMA 2BNOA 1J0RA 3BJAA 3G3ZA 5CVIA 2R7EB 1YX5A 3P5JA 2W82A 4E7LA 1T8IA 2Y6HA 2YROA 2RS33 1JU4A 3UL2A 1MPXA 3K7AJ 3GGLA 5HDGA 2IW5A 1QIQA 3RZDJ 2RREA 2HDDA 1I3AA 5FKKA 3FHAA 2VXZA 1GVDA 3MBWA 2Y6LA 4A7YA 1PM4A 4KWJA 2EZKA 2EIDA 1NT0A 4XMIA 4MQVA 4IRHA 4S2HA 3L2QA 1RI7A 3ZMUA 3C7OA 4G4FA 2XAHA 5J37A 2PHDA 2VW1A 2WS92 2O8XA 1PO23 4BISA 2A6XA 2QCSB 4FQGA 5JSOA 5CPRB 3BR5A 1HN1A 2LOOA 3I0TA 3POEA 3CQOA 4BQAA 5FZKA 4UAPA 3VKLA 1OUSA 3WP3A 4YW4A 3PMSA 5JUVA 1YOVB 3F0CA 4EQQA 2H1KA 1DIWA 4XJAA 1UN1A 1AR73 2OJED 3I2DA 1HXS1 2R061 2W1UA 4LK6A 2QTWB 1YYNA 3ZMSA 4PBOA 3KSCA 2FF4A 4NWVA 3TAYA 2RNGA 1V0AA 2A3SA 5EEGA 4LJHA 4S2FA 1R1A2 3DPUA 3WF1A 1AR82 1V6IA 1T2KA 4AVTA 1YQ8A 5JPMB 2PHRA 4JRAA 1A78A 3HNMA 1XC5A 3WV6A 3FHIB 2I74A 1EY2A 2IVIB 2AC1A 3V7CA 1LFPA 1NQJA 4L9BA 1LEAA 4UUVA 1ONAA 1SD4A 4M00A 3NAPB 2P6TA 3USSA 4IPAA 4Y1XA 5FUNA 5IJRA 1LULA 3GFMA 3TRSB 1AYN3 1LEBA 3EJKA 4LK0F 4NQWA 4M3CA 3VZKA 4DB5A 4BB3A 5F0FA 4JYKA 1LNWA 4JVAA 3UGHA 1PK6C 4NDLA 1W5CC 1ZK8A 3ZXJA 1DGWA 2E63A 2AO9A 2WAEA 1ZHFA 3OV8A 1H89C 3HQRA 5M0TA 1UCXA 2XF5A 1MGTA 2WUHA 3OYFA 2WL1A 5FYUA 5J36A 2FUG2 3V42A 1EUUA 4B43A 4FHTA 4J25A 1IRZA 4HVRA 4WWCA 4CUBA 3A0HC 1XDUA 4HBLA 2BGPA 4AK3A 3O0VA 3LSMA 1CPNA 4XF3A 1LEDA 4X8PA 2FBKA 2DU9A 5FK8A 3K4NA 1FATA 4CDQC 2WADA 4N9HA 1OJLA 3C3WA 1HRI3 4UVAA 2CJJA 5C8CC 3B6AA 2VBXA 3CDHA 3HWJA 4JAAA 5LLQA 1LTEA 2GA1A 3M4OJ 5B2GB 1Z67A 3KPHA 4LK7A 1QNWA 2IGKA 2IEKA 1TNFA 4PIXA 1JN2P 5SV8A 1R00A 2V5DA 3DWLE 2ARXA 1MMAA 4M0HA 3ZFFA 4TZDA 3WHBA 2F5EA 4RYDA 1C8M1 1POGA 1ETYA 1IV8A 2ARCA 1WA4A 4P55A 1VBB3 1UYZA 3KVBA 1GZWA 1LCLA 1LOAA 2BV4A 1SBFA 2EXJA 3RQ4A 4KA4A 2OTLI 3HNYM 1IC8A 5IT9K 2PX9A 5EYXA 1ZZ6A 2PQQA 3VBUA 2H1LA 3JR9A 4XRFA 5M5YJ 5IPAA 1IOAA 2WZR2 5CZKA 4AEMA 2ZXJA 3EXUA 4IEXA 2OT7A 2MNGA 1HJFA 1BJQA 2Y48A 3D1NI 1WD4A 2QVSB 1TBXA 4P9JA 2FEZA 2J1UA 1NG0A 2BVMA 2EV6A 1DP7P 1IUYA 4K8FA 4LD5A 4KWUA 2D6KA 2M9HA 1MS0A 5DUVA 2EIKH 4XACA 3T0BA 4A3FJ 5FP9A 2R062 1FJLA 2CV0A 3E5QA 4FFFA 5GTHC 3V64A 3U21A 3K48A 1QGPA 4M4PA 3VDDB 3EQEA 4C3HJ 1W8FA 1AL21 3W2AA 4QPOA 2ZGNA 3DKYA 4NHMA 4JQFA 2X53S 1KFXL 2LH9A 1ZR4A 1VQ9I 1UZYA 3AFHA 4FASD 1V3FA 1ZELA 1KGSA 1Y0UA 4D8MA 4HKWA 3Q0VA 4AFDA 2DVBA 4D5FA 3Q9VA 1NK3P 4D0PA 2IXKA 3OYBA 3JREA 1IS5A 5GJ6A 4JGZA 5KXEA 2QA4I 3JU9A 4FFHA 1YRNA 3H35A 1ETQA 4H7LA 1UY3A 1KU3A 4BS9A 1NCQA 4XF1A 2NVYJ 2PMZN 3GTPJ 5C9AB 2GLOA 1IN6A 1JYWA 1K6OA 1QJZA 2OA2A 2L5QA 3AVRA 1RJ7A 3D5SC 1SCSA 4AAPA 3S2HJ 4EWEA 1Z3XA 4YFKF 1A36A 4DJAA 1US2A 4YZ5A 2Y69H 1LOGA 5JHUA 2J1RA 3NJVA 3FXOA 3OR2C 4AAXA 1OR7C 1MMNA 1IV6A 1AUYA 3DLLF 1NA1A 2JEMA 3CCLI 2PA7A 2LYCA 4IE7A 1XSRA 3ZSKA 3ZMOA 1EV7A 1ZG1A 2EFPA 1UOFA 2JE9A 5HV0A 3OD4A 3HOSA 4AVZA 5FXWA 1Z9CA 4AHZA 4A0XA 1OCPA 1WCKA 3MLLA 2FJ1A 4QKFA 4YARA 2IXCA 5D5WB 4RA2A 3ZYIB 2W25A 1VTNC 2QDRA 5FQ0A 5FK7A 1FP2A 1UYPA 5K7FA 4MEXF 2VL8A 1V6JA 3HBKA 4W6XA 1K83J 2F4OB 1AHDP 4M6XA 1OKQA 2GNTA 4K3UA 4ANJA 1ULEA 2IP2A 1WBLA 2V73A 2DN0A 3TEYA 4FE7A 2RS13 3HPGA 4JOMA 2D3RA 4CDGA 3I7DA 3WNPA 3GCXA 4NMIA 3GMEA 3DPRA 1IXCA 4CXFA 3W59A 2VJJA 1ACIA 4CCNA 1QVUA 3VYTB 1X50A 1RUI1 1NXMA 4I7HA 4NAMA 4LUMA 1M4WA 2QYOA 3HSRA 3W5MA 2H09A 2OZUA 3UGFA 2D44A 1DG6A 5KXDA 1QMJA 4IEUA 4DQ2A 3IPVB 1HW1A 5FKOA 1LENA 3JB8A 4LE4A 3VBOB 1CAWB 3KVAA 2XBO2 4INDA 4A42A 1OUXA 3ETQA 4I02A 2CSGA 5TJJA 1HW5A 2Q5TA 3W20A 5IOYA 1JUHA 4Q0QA 1C8NA 4UFJA 5AC91 5IOZA 3I3DA 5CFDA 4HF2A 1J58A 2ZEZA 2V4JC 1U9NA 2QQMA 5E1WA 4UUSB 1BVVA 1YIPA 5I8SA 4X1EA 3ZPOA 2P4EA 1VQ5I 3KYDB 3L2WA 1Y8QB 5LGUA 1D0ZA 4HW0A 4UY8I 1ETXA 2XB5A 1UD1A 3ZIXA 1O57A 2DMPA 2VQGA 4CDXA 2M8GX 5DD4A 4IEQA 4PLNA 3AM2A 1Y3TA 1TVGA 1UXXX 1MMSA 3I4NJ 2VPLA 1O6UA 4D5CA 1Q8SA 4S0HB 4IHVA 4XAAA 2WBKA 2ZGKA 2XUEA 5T5LA 2ZGLA 2CUFA 3IKTA 1BI2A 4RSUA 5CBLA 4LBQA 2OXBA 3D82A 3MYXA 3KEQA 1A8MA 5ACA1 1W6MB 1JTXA 1FSHA 2JDAA 3M7AA 4OUMA 2JA6J 5HDKA 2P7VB 4RGXA 3ZOIA 4SLIA 5A7SA 5CQEA 5CAZA 3BG5A 4URTA 1NZIA 3RFRA 4RDUA 1D0YA 3KEOA 2P3KA 3WNKA 4XE9A 4QX8A 2VOPA 1AX1A 2L9NA 1U8RA 4XPVA 1MS5A 2BNNA 4ITVA 1OYWA 4B44A 4XF4A 5L7OC 4AVSA 2X48A 3DBHB 3B6CA 3E5UA 3VFZA 5LRSA 1CAXB 3TOAA 4Y5Z0 1ENRA 4L5JA 2RG4A 3KQRA 2J42A 4YVSC 2XPVA 2R7RA 4H4KC 4PCRA 4Z2AA 3PIPF 2YGLA 4XSXF 2HXOA 1H2MA 1G9FA 1H8TA 3WDXA 2VQHA 2LROA 1ZH5A 1YQ5A 1EJ9A 3VWBA 4W97A 3NRVA 4XEZA 5E3LA 2CWMA 1RUI2 4Q4Y2 3CUQC 4D6RA 1HV0A 4PJYA 4XURA 4FPJA 1W2TA 1RUF1 5A33B 1W0PA 1P4AA 1PGW2 4ARXA 3GJAA 3JB4C 2DQLA 3R05A 3K1NA 4FOYA 2YU3A 5FY9A 1XNDA 2JDNA 5FY1A 2JB8A 3WR0A 2DA2A 1NHAA 4OMYA 2EFOA 3KP2A 1ZG5A 2M1BA 5C5TA 2ZBJA 3WF2A 3WQ0A 2YBKA 1STMA 4JK1X 4NIAA 2M4KA 5KC5A 3F8MA 2HWF1 4XKBA 2D6MA 1UZ0A 1GVJA 1WMEA 3AL5A 3KM5A 1N1SA 4QB1A 4JX5A 3N4MA 3HG9A 4PSXA 1JMUB 1VBA1 1DYKA 5F5IA 4BY7J 3POSA 3SNMA 2B9VA 1REFA 2HWD1 1BZWA 4IJAA 3GZTB 1F36A 1SBEA 2JJ6A 4HSJA 2IUWA 3KQ4B 2Q30A 1D7PM 1VPHA 3LFKA 5FZ3A 1A3KA 5JXGA 2QQBA 1URXA 1YFHA 3I2IA 4RS5B 2VQAA 1SFEA 1RMU3 1XPXA 3S0MA 3I3QA 3VKMA 2NQYA 5ACA2 5JCTA 2W84A 1XU2A 2JVGA 1PIV3 2V4VA 2Q8EA 1MEC2 4F91B 2WZ8A 2VY0A 4U2AA 2VBYA 2WNVB 3FX3A 5LA0A 3H8RA 3P1IA 5C44J 3D6EA 4RAGA 5LCWL 4GMP3 1YIJI 1OOPC 1F2NA 5FDBA 3A7QA 5C8WA 5E8GA 4R4XA 1W05A 1SG3A 1WPKA 3UKGA 3A0KA 5L9BA 3U14A 4YFNF 1QVTA 2W1OA 5KXCA 1AKHB 4B3XA 1ZG3A 5GLTA 4KFCA 1TMF3 3HXLA 1WLWA 4BWOA 4IESA 4II2A 5DAWA 3I2OA 3A0BC 1Y9QA 5HS9A 4XUNA 4ARYA 3N9MA 5FGMA 3BR3A 2PN5A 3H0DA 2JENA 3QD6A 3WCRA 4AI3A 4B47A 3N9NA 3O6BB 5CISA 5T5PA 2L9LA 4Q1PA 1D8JA 4BJ0A 1S7OA 2CV1A 3BGAA 4ONUA 1ZYBA 2RV8A 2JDUA 1BI1A 4P9WA 2GOMA 2ZXHA 2IFRA 2IJLA 3FBYA 1VIWB 4ESBA 5GAEJ 2HYKA 4NHKA 3WG4A 2HWE1 5AFBA 4SBVA 3BOWA 3WGGA 1YFWA 3H5AA 4AC0A 2OD5A 4HA8A 3E97A 1MBKA 2DOAA 4Q48A 1VBA2 4D94A 2EPFA 3D5LA 1HRI2 1W04A 1YC61 2HWD2 2PQSA 2V9PA 4Z82A 4KUMA 1CGPA 1OPMA 3L2VA 3BG9A 2DI3A 4ETSA 4LIUA 1S2EA 4OCTA 3OUHA 3C7EA 1FIAA 2IA1A 1R71A 3CMMA 3LSRA 3VBFC 2X5IC 3WY6A 3OUJA 3EMRA 2ZMKA 1ND2B 1E5HA 1ND3B 2Z3YA 2Y60A 3VN4A 1UJ8A 2V1NA 4MXVA 2X8KA 5BY5A 2VJ5A 4BE3A 4NIGA 4IL7A 1VQOI 1Q8PA 1R5GA 2Q1FA 4CP9B 3BLYA 2BY0A 1RJ8A 1EYBA 1YX3A 4WF2A 4XFHA 2X0LA 1Z21A 3HOTA 4IERA 4M6YA 3POYA 1TC3C 4JX0A 5FFXA 1QDCA 3ZXAC 2K2SA 5FZ8A 3GBFA 5I0SA 2XLFA 2ZGMA 3I53A 3MHZA 2WZEA 2HNHA 5ICCA 1WVRA 1IRFA 4RGAA 4XL9A 1WD3A 4M3CF 4I76A 3SH3A 4N43B 3EUHC 3LIGA 3R4UA 1DQ2A 5ICEA 2X10A 3HRSA 4XFGA 3N05A 1VB4A 2OQRA 4OULA 1ZA4A 1A35A 2DUPA 2HWC3 1WMDA 3VBRC 5A32B 3BR2A 2EALA 3AXEA 3CDLA 3GZNB 5LZ6A 1IQAA 2O8QA 3HOBA 3T2PA 1OISA 1OVPA 2XH6A 1ALYA 3GVAA 2MBFA 4E7SA 3WNNA 2AYHA 2DFEA 1RUC1 4R8HA 4DINB 5IK5A 1QNYA 4B1MA 1AXYA 4JKKA 5DMYA 1SD7A 2CU5A 2R7UA 4ENJA 2PLV3 1R092 1FC3A 5A3WA 4WBBA 2YC2A 5EP9A 2Q1MA 4NC7A 1VRBA 5J1XA 2X6WA 3O1SA 3WG2A 2Y64A 1JI6A 3DKQA 1X1PA 1QBJA 2OUMA 3HOWJ 5FZLA 3K70C 2X05A 4YG6A 4HX7A 4NVPA 3TKYA 4LG0B 4G6DA 2VZ3A 2Y6KA 2ENRA 3B94A 1APLC 3VDDA 5F64A 3NO8A 4RHV1 1JODA 2BW8A 3OCPA 1QJY3 3SXWA 4B4QA 3GTLJ 1LDJA 3FUOA 4QX5A 4QKBA 1S3JA 1XYOA 1YS6A 4META 4KIGA 4OUSA 1QOTA 5CIRA 2ILMA 3JRBA 2DCKA 3SKJE 1NLSA 1U0AA 2F5VA 1R64A 5D2AA 1RC9A 3KP3A 5EEAA 2WNOA 4AUXA 2M2EA 4OQ8A 4F3QA 4HK8A 1Z7S1 4QM9A 5JIUA 1BEV1 4Q4ZF 1REDA 1Q8QA 2J7MA 5GAHJ 2R041 2ZHMA 3CJQB 2EF6A 2Y0SN 3H9QA 2AQFA 2A6EF 4YPJA 3WGIA 2E6VA 4DOZA 4XBFA 3OB8A 1JZ8A 1IXSB 1XC6A 3UK9A 4ZYHA 2Z69A 4XUQA 5FWJA 3A2KA 4S05A 3D3AA 2JB4A 1ZRRA 3H50A 3OYGA 3TWIA 3WSOA 2XWJB 4LOCA 5D1IA 2QEXI 1X82A 5A1AA 1V6OA 1K4SA 1DLLA 2LRPA 4OHYA 1HW2A 5FYYA 2XRNA 3WUCA 3Q8FA 1JHJA 1UYYA 3IDCB 5FZ9A 3OR1C 2WO7A 1LE8B 3BZ6A 2X4HA 4I01A 2WA3A 4Y4RA 4E8DA 3K2AA 1T33A 2EV0A 4QKDA 5ISLA 4XMAA 1RUG1 3BTAA 4QDRA 3OEBA 3FK6A 3DV8A 2XSDC 1MNMC 3TN91 3ELKA 1VJ2A 2JZYA 5DPNA 4UFHA 4A2UA 2C0ZA 5CQGA 4AVAA 3PO2J 1IN5A 3IKWA 2QKLB 3PIJA 4XUOA 4XYXA 1E2XA 1SDDB 2VMEA 2GM4A 2WO3A 3DXUA 3UV9A 1PK6B 5F5AA 2WWUA 1OFSA 2DLLA 4IOCF 3QWLA 2KIUA 2EZHA 2GNDA 4H55A 3BIEA 2HGCA 5FMOL 3O8GA 2BFUL 2R7QA 2F5CA 2CL2A 4D7SA 1N25A 3T2QA 4Y1ZA 3H9JA 4X8NA 5I0UA 4Q47A 4XKWA 2NRAC 4AFAA 1R082 2ZTNA 2B45X 4HL0A 4CDQB 4RHV2 3IWFA 3IPVA 3F3XA 2D45A 1CAWA 4ZZ5A 1DPUA 4Q4W3 3QU3A 1HB3A 3POGA 3ACLA 3I3LA 4RFT0 4A3LJ 5LBCA 1W7PD 3GALA 3HYIA 2HWB3 4M4RA 4LPLA 1H1IA 2WNEA 3DTKA 2Y9YA 2KRHA 1U5XA 4COUA 2JSPA 3S16J 3WNLA 3VBUC 4E4DX 5B66C 2DTYA 1M1EB 2XJPA 3K4CA 1K4TA 3I3EA 3DPTA 1UY1A 2WRAA 4LQRA 1Z7S2 4QHBA 3WHTA 3NL1A 1G9AA 2PI0A 1VLNA 2VR4A 2E31A 4BK4A 3WCSA 3VBSA 5BV6A 1OD5A 5J09A 2R042 2YPJA 4PCQA 3TBDA 4FTBA 4LIVA 3TNPB 5GPAA 2E7WA 2DFCA 4ENNA 3TEWA 4V2WA 2OTJI 1T6BX 5EJ3A 1UZWA 1KS5A 1RVF3 4COZA 3THTA 4DEVA 3KT1A 3AMQA 2AENA 4S2DA 3UESA 5JPNB 1IF1A 4JCKA 4IO9F 4G9YA 5DAQA 1ZRDA 2JJ7A 1NLRA 3RMXA 4XJWA 2LW8A 1ON2A 4IEJA 4COVA 1NK2P 5FYZA 2CDOA 5EV7A 2IT0A 2WYSA 5HDNA 3W58A 3NW4A 1TTYA 1GNYA 1SFUA 5DUWA 4IV1A 3W6JB 3SZTA 2GBYA 1TQIA 4LK1F 2ORZA 4O6JA 2WFF1 4BH9A 2YXSA 3AKRA 3IC7A 4JGZC 3F8BA 2EXHA 2PG4A 4TSVA 4Z2WA 1OBNA 1TT0A 1NCQC 3CLQA 3T5XA 4CUAA 1PVXA 4A6SA 3UJQA 4ESFA 3MMYB 4LKEA 3JSOA 1TNSA 2RGVA 1V9U2 1OLME 4XOGA 3Q9OA 4IE4A 3JRGA 3BPVA 4CU7A 4U7BA 1HKDA 2FXAA 2C9AA 1QDOA 3G1MA 1QU0A 2LTPA 1W5TA 4LBOA 2EJRA 3ZQ7A 3RI4A 1P8JA 2IA0A 1HN0A 4BQNA 1BJAA 1C4RA 3POIA 1NA1C 2V6EA 3WUDA 2NNYA 3DGTA 2XOMA 4EQVA 3MICA 4II3A 4XBLA 1I6HJ 3AZZA 1A6IA 3OBRA 2VN2A 3IL2A 4Q1RA 1Y9MA 3HHGA 2V72A 4Z1VA 4NHLA 1JUSA 3HN3A 2VTXJ 2H94A 3GHMA 2WN2A 5JR3A 3ZQLA 1BC8C 1UMIA 1E3HA 2CY6A 1JT0A 1LHUA 2D7FA 2E1MC 1WRJA 3RZMA 1DDNA 3G2BA 2DA4A 4M01A 4LULA 4UXNA 3LPFA 1X33A 2HFHA 3HBLA 3VZJA 2JQ7A 4NOTA 3IRQA 1RETA 4BY1J 3H1WA 1AU7A 4FPHA 4CZSA 4XIDA 1IG0A 2YG0A 4RAZA 1SMYF 2K4JA 3KEYA 1K61A 1TNRA 3JD72 1XQNA 3DPRC 4AI1A 3S2DJ 1YI7A 3SHRA 3RJ2X 3Q3SA 2P5LC 2JMWA 2KMUA 2YUSA 3CF5F 1CWPA 2Y9ZA 1RUD1 3O2PE 2R7TA 2WB1A 3KIOA 4EZHA 1K5MB 5FCCA 4ISRA 2H0VA 3J8F3 2R5YA 1OKRA 2WY7Q 1ULFA 3ZN4A 2VZPA 1VE0A 2VH9A 3BPXA 3RZOJ 3LEIA 4Q4X3 3POBA 4Q5OA 2O1QA 2VASA 5HCFA 2MH2A 5B3SH 4AIHA 1WLDA 1YEWA 3F23A 3PO3J 1T6SA 3FBNB 1S55A 5IYCJ 5T50A 1FI2A 4XR6A 2RHPA 2AREA 1FX5A 4EJUA 1JTZX 1U12A 4IOAF 4QDQA 5CFDC 3RZKA 3I3BA 2X1CA 4NUBA 2Y34A 4O65A 2WFF2 3K1PA 1OH4A 1HIXA 2ZKNA 1K5JA 1UMQA 2JRTA 4AQ2A 2DBIA 1LODA 1CX4A 1X1CA 3VBHA 3PUBA 2IWGB 1OKOA 4CEWA 3L2RA 3OOUA 3JRHA 5FKCA 4K20A 1MSFC 4CDXC 2LMDA 3B02A 5LY2A 4O9GA 1OQ1A 1F5FA 4R4ZA 1RUNA 1X4PA 3LA3A 5IVVA 4W4ZA 5LBBA 1GLHA 1AKHA 3GO5A 1IPJA 1Y8RB 4RGUA 1S72I 2KZVA 3TOBA 3MD2A 1VBE2 1HV1A 4JHTA 4XBNA 1UAIA 3JBG1 4XHXA 3OPWA 2DA3A 2KKOA 2XJUA 2BYVE 2OPTA 1JOJA 4XJ8A 3BPSA 2FD8A 3A4UA 1D5YA 4J1XA 2WO2A 1UU4A 1UF2C 1BBT2 2ACJA 2JG8B 5LA9A 4AVPA 2KR2A 2CNAA 1POV3 4C3JJ 1PO13 3H7JA 2IXIA 3O1TA 1N47A 3V0AB 5DV5A 4BLJA 4HV6A 2SBAA 3WXPA 2MABA 5J4VA 2PHWA 5FP7A 3T3YA 3PL0A 2ZPXA 4Z8BA 5EZGA 3MEPA 4JHZA 4GWMA 4C0BA 3UYJA 4QQPA 1XSVA 5L7OB 1F9KA 3BJOA 1ORKA 2ID3A 1IS4A 2UV1A 2RS31 3CLOA 4OQ9A 1QQP1 3E3VA 3ZSJA 2O9LA 1QZZA 3GFJA 3B9CA 5FRNA 1GQPA 3MIFA 1H8TC 1ULDA 1OCOH 1WCMJ 3ZMZA 2XV4S 1G8XA 2M3AA 3AFKA 1FBUA 4YVSB 1MKMA 4DO0A 3CMYA 4OAYA 4QKNA 4LE3A 3EYPA 4Q8KA 2HWC2 3MV11 1U78A 2ID4A 1FMVA 2DFBA 5J48A 4EV0A 4YM0A 4BQ5A 1UZZA 4QHZA 1YTYA 1JHFA 4QU2A 1OQEA 1ZKGA 2GNMA 3WGHA 5D5VB 1MACA 5CB7A 5CKTA 3ZVXA 2JA5J 1TE1B 2DT6A 2FSWA 3CUQB 2VOWA 1PO21 1ND3A 4P02B 3R4DB 2CYFA 1SLIA 3QOPA 3CP8A 3KT7A 3ME2A 5F5QA 2KLOA 2Q0AA 1T2XA 4FP2A 4FVVA 1GOGA 4CCOA 1BYHA 1W2OA 5JI7A 4I0BA 3SFIA 2PLV2 5A80A 2RDNA 3DYPA 3LSPA 1AR71 2Y0OA 3VHOA 1E3PA 3H1CA 2W1QA 4E8CA 4RAFA 2A61A 1B72B 2BU9A 1ULYA 2W5FA 1S0BA 2EILH 1X58A 1GDTA 4I98B 3WG7H 2HQ5A 2JDYA 2YY1A 4C9YA 2FCUA 5FMBA 3CJXA 4JDOA 2YU1A 3PTRB 3QYFA 2VNGA 3VSKA 4IZZA 2Y0MA 3DKXA 1UOGA 3BC8A 3RYPA 2A75A 2PJPA 1UPIA 2WLPA 5DCMB 3TDUC 4OI1A 4M6VA 3JBG2 2XDVA 4GIQA 2BXYA 5E3NA 3WOGA 1LOFA 1X1DA 5L9VA 3ZFGA 5FLXZ 4LBJA 5KHJA 5FZCA 1P7IA 1PDNC 3BCAA 2CWSA 1I3HA 3AG4H 1HDKA 3S7IA 1E0EA 3GFIA 2D1VA 2PHFA 2DF7A 1F5TA 2FCVA 4XLFA 2WABA 1W6OB 4EWAA 5BQTA 2P17A 1W4MA 3ECOA 2EQRA 2A6TA 1QPMA 3L9FA 1OA4A 3Q9SA 2L02A 1RUOA 2E36A 4Y1VA 4YM2A 1ZTRA 2M5WA 2ECCA 2LKSA 3LOBA 5A6ZA 2LR8A 5GZDA 2F6CA 2WWSA 2VTXA 1OOPB 2ZGPA 1GHCA 5EG0B 1JZ7A 2NVQJ 2YV8A 1XGSA 3C8XA 4YW7A 4JZRA 2J5PA 2VULA 1QQP2 4LG3A 3FF5A 2VUJA 3IV5A 5A1LA 3QP5A 4RS8A 2G19A 5I91A 5E79C 1QPIA 4BXXJ 5D21A 4HVOA 1MJAA 4A69C 4XQDA 4WV8A 2Q8OA 4B8XA 3UNGC 1O3SA 4OMDA 1VZ0A 4AWDA 3KHBA 1AWCA 2ELKA 3KP6A 3DECA 1TWHJ 1OT5A 4D9JA 4FE4A 1BHGA 4HLYA 4WM8A 3V0BA 2B9SA 2RC4A 2VKHA 1YIFA 4MHRA 1XSQA 4D7NA 2HVQA 1QWRA 3RCOA 4AL9A 2PHXA 2BXZA 2HKOA 3ABKH 4TWTA 4QB2A 1KDMA 1N1VA 2EZLA 1WSUA 3ST7A 4QX3A 3CCUI 1DQ6A 3GXOA 3J81Z 4U0VA 4LLNA 1UX7A 2BZDA 2L3DA 1SBDA 3GXUA 5FLVA 1L7RA 2QJVA 5DDJ3 5FJ8J 2EA7A 4BQ1A 2MHFA 2RQQA 1W8WA 4UVBA 4BU2A 5L3FA 1NQDA 1MNEA 4A6EA 3N3HA 4TLFA 4E2QA 1HKTA 4LNVA 2DUQA 5F27A 1SC7A 3MUY1 4LBLA 4J1WA 4M9ZA 3JUUA 4RR3A 5LBQA 2HWB2 1Z0HA 1I6XA 1VBC1 2L4AA 2W08A 4LB6B 4P9GA 4LKSA 2DK8A 3TEDA 1NX9A 2EIMH 4K21A 4D0QA 4P5OA 1LE8A 2KP6A 3VBFB 5CVJA 4LBKA 3AVSA 5C70A 2R5ZA 2ZAHA 1QO0D 3A03A 3ZOBA 1QJU3 1JJ8C 1ASJ2 3K6GA 4N8MA 4D69A 1W8TA 3L2CA 5FY5A 3NJYA 4UV8A 1S7AA 1AA7A 4MGIE 1V6MA 3NNLA 3J7YJ 1WUVA 5EYYA 2NPIA 2R071 2JE7A 1GUUA 1Q8OA 2UY8A 3W2VA 3QPLA 1WH7A 3MIEA 5ILSA 4MVTA 5GLVA 2CQQA 3BTIA 3APBA 3AL0C 3CHXA 4DXRA 1KU7A 4V2FA 1IDZA 3GYDA 5CLSA 2HH9A 4AU7A 3RNSA 3FFQA 2XJSA 3GTMJ 3VYUB 3ZMTA 4QDSA 5M3MJ 2CS3A 2W3JA 4RN5A 3AFGA 3KZIC 5FPZA 5EZWA 4NIHA 4J01A 1LJ7A 3ZR5A 4JKMA 5CG9A 2K86A 3CC7I 2O61A 1IZ3A 3S14J 3HEFA 5C4WB 4DUWA 3UKTA 5M5WJ 3HR9A 5DZFA 2LKPA 1Y39A 3ES1A 3ZO0B 2PJRB 3VBRB 2RS11 1G8WA 3M1EA 3G6JB 4MGRA 2XB6C 4XUPA 3QPTA 1O5UA 1SEFA 2OQGA 2NS0A 3TO6A 3KV9A 1TG7A 3WF0A 4HNVA 3VD7A 3ML6A 5FKBA 3GNEA 2EWNA 5LASA 5BNOB 3JTHA 3GCMA 3Q0UA 1WA6X 4L9JA 5BYNA 4RD7A 4WXHA 5FMOS 1ETKA 2BFUS 2VMDA 2HTSA 4AGVA 3ABZA 1BXHA 1MW7A 5K5OA 4D7YA 4IEWA 4Y17A 4XF9A 2H8WA 2ELJA 4BHPA 4IRIA 4NIDA 2UU8A 1D2SA 3MFCA 4A4AA 3VDDC 3CESA 2PMHA 1QZEA 1CN1A 2B42B 4BHCA 5D8AA 5L3CA 2W52A 4CCLA 5BXXA 2DPUA 4GKXA 1GSLA 4DIQA 5FZOA 1S7EA 2Y6FA 4DFSA 1JGGA 1SLTA 1XMKA 4H0EA 3CCRI 1UOBA 4A12A 1VBC2 4BHBA 5FWEA 3CMEI 2GC2A 5IK8A 1GZTA 1VBD2 2FX0A 3OYCA 4KYWA 1W8HA 2ZO4A 2WWJA 5BNNC 3EDPA 3BDDA 2J1AA 4M73A 1FSEA 3SCFA 2ZJRF 5JR2A 5D5XB 2CAVA 1SLAA 2GNBA 4XZUG 2HPIA 3QBQA 4LMFA 2Z9OA 3ILNA 1U5IA 4GD4A 4K2EA 4XKVA 3LCPA 1XYNA 1EAH1 3LOIA 3KP4A 2W24A 2QKMB 2FE3A 4QLCU 4AI0A 4UVCA 5A7WA 3W3CA 1B59A 1OR7A 4H2AA 1JKOC 5HPOA 3DU5A 2ETEA 1U8BA 3NV2A 2CFOA 4NPRA 3WDUA 3JAMZ 1XE0A 4A3IJ 2PELA 2L7KA 2DYSH 2XSJC 4AR2A 1O91A 4QQ2A 2CGNA 4R9AA 4EN9B 1Q5OA 2ADEA 1Y1VJ 4ASKA 2X51A 1DU6A 5AIQA 2ZSIB 3CO6C 3PUSA 3KMHA 3I2GA 1S5LC 1FYLA 3CCMI 1SFYA 5FZ7A 2XGDA 3HC7A 3PU3A 4QX1A 1FOD1 1KDKA 2IPQX 3CQZJ 4I0AA 2ETHA 4FISA 3V8JA 2PAKA 1VQKI 3WTTC 3GX4X 1J1LA 1YLFA 4NQWB 4M3CB 1IPKA 1XN7A 4HN0A 4AFMA 3M3OA 2E7XA 4ZTJA 2R0HA 1GP6A 2P81A 1UKRA 4RGGA 3DLAA 2QENA 3MGUA 1ZLKA 4CA9A 1AX0A 2ZJPF 1ZBA1 3FLTA 4FPOB 3CZJA 5FPXA 4DYCA 3JRFA 2WS93 3J4UH 4Z6YA 3HN1A 1TW2A 2OS2A 3ACGA 1GZCA 1MBFA 1WJFA 4CVUA 4ZHNA 5IVJA 2XVLA 5A3TA 2G0EA 1K5MA 3GF6A 3ZIWA 4WX9A 2NYXA 3ACHA 4OLLA 2Z79A 3LSDA 5C3SA 2FBHA 5M5XJ 2VVDA 4D7MA 4YELA 1GFF2 4OMCA 1XNBA 2FNAA 1XBFA 2UWMA 5APAA 1W2UA 5FP4A 2X1DA 3RZZA 1UFMA 3ON7A 2AXLA 2QQOA 4EJRA 1R5HA 1EV12 3AKZA 4HKLA 5H9SA 1MZ6A 1R1A3 1UW8A 5KXBA 2CW0F 1F43A 5F0CA 4XSZF 2VKDA 3MQ0A 1X4OA 1K3IA 3S32A 4OHXA 1HLCA 1SFXA 1AYM2 2ET1A 1TQ5A 4DS0A 1HRV1 1VALA 3VBSC 5DAXA 5FZ4A 4U0WA 2W87A 3VLBB 1YIOA 4LLGF 2HEOA 1SHWB 2EB7A 4WM7A 2XC7A 1LESA 2ARBA 3RKXA 4R79A 4Q27A 3T8TA 4ZY9A 4A3JJ 2DODA 1Z7UA 1PIV1 1IZ1A 3M4FA 5D8LB 2K9NA 2COBA 2WIIB 2W95A 4MGTA 5DM6F 2XPWA 2HYFA 1WI9A 2ESHA 1N3QA 4A6OA 1RIRA 1IS3A 3SJMA 1SAXA 5J1UA 1MQTC 2ZXWH 4LUKA 1W36D 1WW6A 2ZEYA 5LATA 1TWGJ 4IV1C 4LBQD 2JG8A 4UB8C 2CHHA 5JAXA 1R23A 4QQHA 2Y75A 2PN6A 1QH6A 2B4KA 4GJYA 2C26A 3WG3A 2E60A 2YGMA 1V6KA 2YS9A 3SCGA 5K7HA 4JGZB 4ESJA 4UYBA 1ZM1A 1ODNA 4HKOA 2L9VA 4B4CA 4YW5A 1NCQB 2HOAA 4M9SA 1TMF1 4M9XA 1V5GA 5KHIA 2NMNA 3O8HA 5CNAA 4WK8F 5GPCA 4IGPA 4QTRA 4AHXA 3GYHX 4YZ2A 3IRRA 5IVCA 1HXDA 4GYGA 2OBPA 1XSXA 1B09A 2XAFA 2NNNA 1OYYA 1ZBA2 4E2GA 4LKFA 2M87A 2WSVA 4AYUA 5KHGA 3T1BA 3SYTA 3PUQA 1WLCA 3L2UA 5G04L 2Q1ZB 1NA1B 4GB31 3POWA 3OTFA 2EA2A 4V19K 1UXZA 5IK4A 5T54A 2XJQA 2EXKA 3NNMA 1LPQA 5M3FJ 1IG7A 4CDWB 3U1KA 2R063 4ZONA 1XRUA 4MGKE 4B1LA 2LBFA 3R4SA 5IVFA 3CF6E 3NKTA 1XNTA 5FQ0B 3MKLA 5IWFA 2P5BA 4R1HA 2NLRA 2CV6A 2V7FA 3N9LA 1HB2A 2VC9A 3FFZA 2E1MB 2R7XA 2XAQA 4YGCA 3J9SA 1GWLA 1SZBA 3ZDSA 4YIIA 2GU9A 2PHTA 2WB1N 1B72A 1JBCA 2DMTA 1HRV2 2MD0A 2XAUA 1H8VA 2DVAA 3JXSA 4AYBA 2VT3A 1R4NB 4ZU7A 1W6NA 1A04A 5JMCA 3DPRB 2DVFA 1GLNA 5T3NA 3NV1A 3F95A 2LRDA 2WAFA 3OEAA 2E32A 4A45A 2XKOA 3GM8A 1C5HA 3I54A 3B3QE 4FFGA 5K5QA 3IUOA 5B1BH 1VQ4I 2E1OA 1GT0C 3M9AA 1AJOA 1DP0A 3ZP5A 4NBQA 2V5YA 1K6YA 3QPSA 4BXUA 1NUKA 4O61A 3F8CA 3G73A 2D40A 4NROA 4AFBA 5GZCA 4EM0B 4GDFA 3LDRA 5FD6A 2OU2A 4MOAA 1CESA 3I5UA 4C1XA 3WNMA 3S1QJ 1X1AA 4XTMA 3CDIA 2VCMA 3VBHC 2BP6A 2ZJCA 4JGYC 4CEWC 2VECA 4PHZA 4C91A 1FNYA 4JTNA 1C8M3 4KT6A 5EG0A 4B4RA 1FLIA 5J98B 3IMMA 4LXLA 1D2QA 3LSTA 5T52A 3S2WA 3ZN0A 3M07A 2RVCA 3GZ6A 3DFGA 2VIXA 1W9TA 4XM3A 4CDXB 1SQ4A 3AP9A 1LDDA 3M7GA 4ZU5A 2CMPA 3MZYA 3I2HA 2GMPA 4Y26A 4L0PA 4YG3A 4YLZA 3RI9A 2A6WA 1VRH1 1SVLA 1RL3A 1G3WA 1GOFA 3OPZA 3D4KA 4DUVA 2F4MB 2QBYB 5T55A 3QU6A 1WCQA 1SEUA 3NSTA 4GB32 4LA2A 3JQWA 4N4NB 4OZXA 1S0CA 1CZTA 3L9JT 1BCXA 5DUUA 2Y33A 1QJU2 4DXZA 4RM3A 4FTHA 2VOTA 1YQ2A 3R4KA 2DJNA 1GZ9A 5CG8A 1UL9A 4IHWA 1DQ1A 1JZ4A 3FIWA 1O5LA 2D1HA 1TWFJ 1XJAA 2FDIA 2DDAA 4XILA 2XBO3 4XF0A 3MAJA 2DFIA 2ZGTA 2VZVA 4XQ4A 4V1PA 2CU7A 3GFLA 3CU7A 3U11A 2WSUA 1JOPA 3CKHA 2RM22 5CYYA 2I45A 4BQWA 4QXCA 5K7PA 5A2QZ 2IA2A 4B4PA 1PZ8A 2ZGQA 2L2OA 2HZTA 4HG6B 1LHVA 2VZUA 1YNAA 1D4M1 4L0ZB 2R30A 4IETA 3KD4A 4L92A 2FMLA 4IQPA 3GBWA 2XVGA 1MBGA 5LY1A 3ZXSA 1ND3C 1ST8A 3LL7A 3RSJA 1ZVFA 4M3GA 3JAMK 2BQPA 3HJEA 2QZ2A 5FOJB 2HU9A 1Z0XA 1QXRA 4EROA 1H2LA 3FHNA 1GXQA 3R61A 4RQPC 2KT0A 3GLLA 5KHHA 3PUAA 3S15J 2W68A 3MO4A 2ZHLA 1VR3A 3HTSB 5IFTA 5HS8A 9ANTA 1HA8A 3BT9A 3HOVJ 1JZ2A 4U7DA 3MLKA 1I9RA 5FREA 4UI9L 4HEA2 4BQQA 5C3QA 5F6KA 4FCAA 1MS9A 4Z07A 3A02A 3EHKA 2CSOA 4C3IJ 5ERIA 4W50A 3MZ8A 1GYKA 4Q29A 3B7MA 3QH7A 3VDAA 3I59A 4YFWA 1D4VB 4EM2A 3OY9A 4LO7A 4EJVA 4XAEA 1LOFC 5CKQA 3ZFGC 2LC2A 2HS5A 4NNJA 2AR6A 4EJWA 1EPWA 4IL6C 1VRH2 5CVVA 3FBIB 3WD5A 5K9YA 3IBMA 3R6SA 5C4WA 2ZNZA 4OOIA 2VQCA 3HIFA 3ZMDA 1KJLA 2VUCA 1VB2A 2ELHA 2JPBA 1US3A 2WAAA 3VBRA 1RUI3 4MX3A 4BM8A 2XHKA 1NCRA 1ZBE2 1XYPA 4UOJA 1YI2I 2GC1A 3V65A 5A3MA 2QBXA 3LSHA 3RZGA 5DZEA 5L19A 3SH4A 5F04A 1N1YA 5BNOA 4Q0PA 1COV1 2ZNYA 3B00A 4DXTA 4LHKA 3LSKA 2JE8A 2FQPA 2AUYA 1MNDA 4HNTA 2WFPA 1U2WA 1LVKA 4K6BA 4CCEA 3LSIA 3OYWB 2EAAA 3CD6I 1UHWA 2M30A 2DTRA 2LD5A 3ZN6A 5HODA 1W2NA 5E20A 5GZEA 2YZ4A 1FBQA 2VBDA 1PZ7A 1OPCA 3I9V2 3HKZA 1RHI1 3BU7A 1DHKB 1MZFA 2P7CB 1GR3A 4F7ZA 2FU4A 3AKQA 2BUKA 5LK5A 3MFKA 3BKZA 5J1RA 3HUGA 4WM8C 4Q26A 4NC8A 4LO6B 2A3XA 1BMV1 4RAYA 4YRVA 5IHRA 3CO7C 5L9RA 2IBDA 3BN6A 3ZQCA 3CNAA 5ACA3 4EEFG 3ZCOA 4OIRF 1V00A 4IQ4A 1I5ZA 1MEC3 3AZYA 2RJ2A 2BWCA 4L8QA 3JW4A 4IDZA 4ITCA 5FPUA 4NHXA 1XD7A 2AGSA 2MEV1 3OGRA 1DPRA 1VI0A 3ACIA 4N7UA 2JXAA 2P3YA 4BK5A 2GP5A 1QHGA 1C1LA 2VUAA 3CCSI 3LSJA 2CO5A 5B4XA 2VC1A 2G9GA 2XJTA 5T5JA 5CU1A 3PJRA 3D5OA 3OOXA 2Y0SA 4MG2A 1FMD1 4OYUA 3OL3A 3WQBA 4BE2A 4RR3C 2CW7A 1YJWI 4X6RB 1ETVA 2BEOA 3HVDA 1KGYA 3WE2A 5FUPA 2XWBB 4UHTA 2QQKA 5E8IA 1HB1A 3OY8A 2UURA 5IYBJ 2LREA 3OYEA 1J83A 4OMZA 1X3ZB 1AR61 5KHKA 3PVOA 1PMJX 4EYUA 2HYJA 2D5VA 1LHWA 3POJA 2CUZA 2V1DA 1YS7A 1DQ0A 3U4SA 1PHMA 1FPN1 5DZGA 5IAXA 1W0NA 1P7JA 4XDPA 1SACA 4E2SA 4ISQA 2UY9A 1K12A 4DQAA 1RUH1 2QLZA 2RKHA 1JYIA 1QKQA 3NWTA 4XIOA 3SC7X 3PFIA 1COV2 5L36A 1FMWA 1MSEC 1AF9A 2ZCWA 3PSIA 3USUB 4OIPF 2NYYA 3J7NA 1UIKA 4XDQA 5H9RA 1G7YA 3FXKA 4CXYA 1HSJA 1YFXA 3AL0B 4FPCA 4QPWA 4LKDA 3VL8A 1KQRA 2EIJH 2XASA 1ULGA 1VBA3 1LGNA 4OHVA 4ON0A 1CF7A 1SVMA 2Q8KA 3NV4A 3DBLB 5J8FA 3U2RA 1HC8A 5FJHA 2W7NA 3WLUA 3WP6A 3LDBA 4P00B 5E6HA 5KNLA 2L01A 1RHI2 2HWD3 4A3BJ 3NV3A 1W6QA 1TME1 3RTRA 4Q4V1 3LAPA 1Z1DA 5LRRA 1U3EM 3AK0A 5EHDA 2VONA 3ATGA 4KGGA 4MHGA 2WWYA 4V2VA 2VNVA 5A6XA 2R7VA 4HAMA 1LU1A 1BMV2 1DGWX 3B5LB 3IAS2 4XCBA 1IDYA 4AI9A 1FOKA 3NAUA 2ZA9A 2WYFA 1G59A 2NN8A 2A7AA 2LF8A 1PUFB 2XIGA 3J8F1 2B46X 2GALA 2G9FA 2KA3A 5KAIC 2KXLA 4YGDA 5F0HA 4EZ4A 1ZREA 4HG2A 3PNTA 1YHQI 2DWRA 1YFUA 5J8CA 3UKNA 2CUJA 2Y8KA 4N7IA 3V7SA 2NOJB 5HNHA 2WKKA 2KRFA 1W5SA 2K9MA 4H7MA 2P37A 5D8AC 3FBMA 1LGCA 4IEYA 3H3UA 1IN8A 5CJ9A 4EATA 3UT0A 1UMZA 1HXS2 2E26A 4QX0A 1I27A 1GWKA 4L18B 1FMD2 1DDLA 1YFYA 4OAZA 3L1PA 3FXUA 3O0XA 1MBJA 1PUEE 1SFPA 2KIQA 2ECBA 3VYRB 3HJRA 3L2HA 3OSDA 2JX9A 1W1WE 4BIFA 1DQ4A 1DZQA 5TRDA 5EJCA 5EXOA 3IZOA 2YDEA 1FPN2 2Z1DA 3LMMA 2LG4A 2OX0A 4FOQA 2ZAAA 4E7KA 1RIOH 1CONA 1FNZA 1RUH2 4ATFA 5BNNB 2ESNA 4OVEA 1TW3A 2TNFA 3F2ZA 1T6GC 2HVRA 5LBFA 5E17F 3HOUJ 1T39A 1N1TA 3PJYA 3OUIA 4LB5A 4HYEA 1S1AA 3N7MA 1JGSA 4BDZA 1R093 1H0MA 2C4XA 4XLNF 3VKFC 2PAEA 3BZKA 1PMHX 2WAOA 1POV1 3ROUA 2G9ZA 3VOEA 3NNFA 1PO11 1SD5A 2GC3A 5A2QK 4RLFA 2E7TA 4M0NA 1W9SA 1Z77A 2VVFA 5JSRA 3H1MA 4CDWA 3VGIA 2OPWA 5F9TA 3SEQA 3IAM2 1MZEA 2VZQA 1XE8A 2RDRA 4IE6A 2ZGOA 3FN9A 1TME2 2JWPA 3P9KA 4Q4V2 4FOVA 5HCAA 3WDTA 3F8FA 2HXIA 5TGTA 4HRIA 3H5NA 3DUIA 3EB7A 5D4RA 1C8M2 1XB9A 1BK0A 4LITA 3LOCA 2VG9A 2GSYA 4XONA 1X19A 3T0YA 1IG3A 5LEKA 1V54H 4QGMA 4M3CE 1SMTA 4M74A 2BNMA 1K5MC 5DDGA 2STTA 5HNFA 1UOJA 3ILRA 3KF5A 1MDMA 2K40A 2OF7A 2DAOA 1O3TA 4EGZA 4E4SA 2VPRA 3S5QA 2E1CA 2JN6A 1TWAJ 4OHZA 1Y56A 1LOBA 1VMHA 2QFEA 5FXZA 3ZSLA 1JHNA 4XKCA 5LA1A 2E5NA 1AL0G 4QXKA 2W1SA 3MW3A 5LFAA 5AFEA 4XQWA 3N36A 1AL22 2FDFA 2WT0A 2Y2ZA 1JXNA 2BRTA 3HSFA 2EICA 3WW4A 2L7MP 3QYBA 5JOZA 1F15A 2XAGA 3PIOF