4I2OA

The structure of fixk2 from bradyrhizobium japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
b'LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAMTAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDIGDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FixK2 protein
publication title The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transcription regulator/dna
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i2oA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i2oA01
5JVTA 2GXBA 1O3RA 4XFIA 4R79A 4LB6B 1YFWA 1PP8F 2QQ9A 2QENA 2HQNA 1FXZA 2DPUA 3J80K 2IJLA 4HSLA 5KHKA 3UKVA 4XF3A 2XAFA 5I8YA 1FNNA 3B73A 4HDVA 3WGGA 1RC6A 3E3VA 2XL7A 4UVBA 3H9AA 5BPXA 2ELHA 2BGCA 4LLNA 1WKMA 5BS6A 5LGUA 2IT0A 1ZX5A 5EFUA 4M74A 1TNTA 2FRHA 5BY5A 4KL1A 1DGWA 4L11A 5D6EA 2OZ6A 1X8MA 2WWYA 5E1ZB 1ZG5A 3D0SA 2GZWA 2OZJA 4LK1F 3W6KB 4G9YA 1C0WA 1P2FA 5KK1A 2MLGA 3HRSA 1B1BA 4ORFA 3RTRA 4G6DA 2OZUA 3ECHA 3SZTA 3KZZA 3HSEA 1UFMA 3ZN1A 4KICA 2P8TA 2CFXA 2IW5A 3M70A 3GYHX 2V6CA 3IIAA 1LQ1A 2XLFA 5LEJA 3V8KA 1H1IA 2ZMEB 2J5OA 4OIQF 4B8XA 4WXCA 1J0RA 1XDUA 3GYDA 3LOIA 3WTZA 1U12A 5E20A 4MUVA 1J3QA 4PIXA 3MAJA 4I7HA 1YWKA 1MJAA 2W57A 3CJXA 3OCPA 2CO5A 2MC3A 1ON1A 1G3TA 2JT1A 2PG4A 3WU0A 2GC2A 3SXWA 2F5FA 1RUOA 4CZZA 5HOOA 4YFXF 2AS5F 3BPZA 5HVQC 5ILSA 1AOYA 4E2QA 2F5CA 3LA2A 1IRFA 4BQAA 2CW0F 1XDSA 4M9XA 2L02A 4EJUA 2UYBA 2G9WA 4B29A 2QJVA 5D5VB 1YW8A 3R60A 1BN5A 1MZBA 2YPRA 3BROA 2IA0A 1YLFA 4LA3A 3MQ0A 1FYMA 3LWCA 4NB5A 2KIFA 4KN4X 3CUQA 1YUDA 1A04A 2HZTA 4RGSA 2EK5A 2XAQA 1FX7A 1U5TB 2O03A 3ULQB 2HWVA 2DU9A 2O3FA 5E8IA 3H50A 4HN1A 5JSRA 1CX4A 2Q1ZB 1K7AA 2PAMA 1SD6A 1YYVA 1GXQA 4IEOA 5JAXA 1YW7A 2PTMA 4F8AA 2P6SA 1P4AA 3L09A 4LLLA 2M1BA 2A07F 2V79A 1SD7A 3KFWX 3TOBA 3L7WA 3H7YA 3VEPA 1QO0D 4QGLA 2M8EA 2QUFA 3Q5FA 2JRTA 3LA3A 2H0VA 5HLGA 1MJ9A 4LLOA 4L0YB 2EA4A 2FBKA 3QP6A 1TBXA 4HLYA 5I0UA 3C1DA 1Z91A 3CTAA 3FXUA 3ZMVA 4HF0A 2A6HF 4I0AA 1O3TA 4Q0SA 4LTAA 5EZWA 3P9KA 4M9SA 2VE9A 2WV0A 1J1LA 2B9UA 1OYWA 5K5RA 2PLYA 5HDKA 3FHIB 1O3QA 2DI3A 2R3SA 1G3YA 3HRUA 3FE5A 1E17A 4KYWA 2PJPA 5FO5A 1LEBA 3RYRA 4Q48A 4P9FA 1CAVB 2GC3A 2FOKA 2KIMA 1DP7P 3G73A 3RKWA 1CAUA 4O5VA 3TO9A 1MDMB 4EGZA 5LHIA 3HT1A 1IN7A 1P92A 4AXOA 2EVXA 4YIFA 2EFNA 4GULA 4JBAA 3NQOA 1KQ0A 2QZ8A 3DN7A 4UV9A 5L3DA 4FAGA 3T1BA 1ULYA 1O7LA 3I7DA 1D5VA 2MBFA 5CYVA 2QQBA 3C3WA 5AIQA 5CVVA 3GFLA 5FLXK 3WE2A 5D5UB 3SCHA 5K5OA 3WTTC 3GW2A 4GYIA 2K0GA 1B9MA 1EH8A 1KA8A 3BOQA 3N4MA 4RAZA 2WFPA 2EB7A 2VQAA 3E97A 1O7FA 4KT5C 2FEZA 2LNBA 3V8LA 2AXLA 1IW7F 4EVIA 4RB1A 4AD9A 1XE7A 2MPFA 4PGHA 3RYPA 1NE6A 4ZYDA 1IUYA 4U7BA 4ENMA 1D8KA 3MYXA 1CAWB 3F21A 5HLIA 4KIBA 1I1GA 1LB2A 5HDNA 5BPIA 4HOBA 1R23A 5ILUA 2VT2A 4YYOA 3NEUA 5DCMB 1SFNA 1HBXG 1FZPB 2FBIA 4GXOA 5E16A 4BHPA 3ZPLA 3FM3A 1DZRA 1W5SA 2VOOA 2IPQX 4KIGA 4TV7A 1XD7A 3JAMK 1BBYA 3EBRA 4PCQA 4HX8A 2O0YA 1MKMA 4JQFA 3WW4A 2BE5F 5D6FA 1FWZA 5AVPA 4EM2A 4ESFA 3TKYA 4P9UA 4O3MA 2DLLA 3RIRA 4IEVA 5CVRA 1BJAA 2UWMA 3ETQA 4BIFA 4G6QA 2HJIA 4HW0A 1XE8A 2IA2A 4ENNA 4DNCA 2JSCA 2JTVA 1FYLA 1VTNC 2HFHA 4L9JA 1BI0A 4ZZLA 2NS0A 3KP4A 2IXKA 2OD5A 1X3UA 1JHHA 4IERA 1PDNC 1LKNA 2YSRA 4ESJA 4FAHA 5FQ0A 3SHRA 4D0PA 4IF4A 3OF1A 3NJZA 1MJBA 2L01A 3FXRA 1KU7A 3PNAA 2W85A 4HDUA 5L3FA 1BI2A 3ZMZA 1J3RA 3P7NA 4XFHA 1Z6RA 3UKNA 3RKXA 1STZA 2XL9A 2Q2EA 2KJCA 1ZGAA 2ZKZA 4EJWA 5HLHA 4YG2F 4LB5A 3F22A 3WTXC 2RQPA 4EQQA 1USTA 1JUHA 3MZYA 3HQXA 3WE3A 1RL3A 1MD0A 4HF2A 4Q47A 1UIJA 4UVCA 1R58A 4ENJA 1XMKA 3H7JA 1R22A 4WF2A 2VBWA 5DEQA 1LEAA 2Q30A 4JTNA 4MQ9F 4G7ZF 2B5HA 3H1WA 1PUEE 4HVOA 4O9EA 1Z9CA 2OBPA 4XSXF 2COMA 3ZDSA 2PMHA 5CADA 1V3FA 2D40A 2FMLA 4YFKF 2P5KA 1ZLJA 5CVJA 5D8LB 4QMAA 1LDJA 3FZ3A 4HA8A 3WW3A 3DQVC 2VE8A 2DTRA 4MH0E 2X0LA 4HLXA 3S2WA 2IXHA 3T5XA 3HRTA 1J75A 1IPJA 2CV6A 4OIOF 2XUBA 1EV7A 3L00A 5E8GA 1EP0A 4N9HA 4LUMA 2Y0MA 2GQQA 3ML6A 5F64A 1HSTA 3SCGA 2K9ZA 1YS6A 3T8RA 3I0TA 3HOTA 3LSTA 3DXJF 1SAXA 3B02A 4XFBA 4HQMA 3IWFA 5KVRA 4J1WA 2P4WA 3VODA 5A2QZ 3HTUA 3DPLC 4WBBA 3OD0A 5J3UA 4OMZA 3HTSB 3D5LA 4WXDA 4R52A 1VJ2A 4E70A 2H09A 3CL1A 4Q29A 5IT3A 3LAPA 4MEXF 4IETA 5LRRA 2ET1A 3IHUA 3QOPA 4AIJA 2PHLA 4KMUX 1ONVA 4WXHA 3EO6A 1S7OA 2ZMEA 3T8TA 2MNGA 1DPUA 3IWZA 2CAUA 1J2XA 4RB3C 2IXIA 1ON2A 1RZ4A 4LGWA 3KEOA 2EFQA 3ES1A 4QWQA 2EA2A 1IN5A 4IHSA 1QZYA 3EHKA 3SCFA 2GC0A 1DPRA 2CSOA 3H3UA 1U2WA 4IEWA 3K1NA 5FPXA 3USSA 3ERED 1NYWA 1IF1A 2OQRA 1USSA 2ZNYA 5CVIA 2CWEA 1LNWA 1AWCA 1IZ1A 1Q5OA 2BYVE 2P7CB 1FSEA 4YARA 1ZZCA 2RV8A 5D4RA 2A69F 1U8RA 4Z82A 3GZ5A 2F5EA 2KKOA 5K5QA 4PIZA 3W6JB 5I0RA 5FGMA 4AIKA 3I59B 3GX4X 4CDGA 2HKXA 5DV5A 1IXRC 1LDDA 4LMYA 5FLJA 2M30A 2MH9A 3K9TA 5LRSA 4A12A 3MFKA 3TDZC 3GXOA 2VBYA 5BMZA 1K78B 3F6VA 1PMIA 2ETHA 3HT2A 3QPTA 2MH2A 2BEOA 1I6XA 4EMSA 5D8KB 1U5TA 2OAZA 1TQPA 2XKPA 3GZ6A 1K6OA 1U6GA 3E6MA 4U88A 2UZKA 3P9CA 3JZVA 3WTUC 4AVBA 2JPBA 2GA1A 2QDRA 5DUIA 4G7OF 1YW9A 2X4HA 3SXYA 3K0LA 4A5NA 2DQLA 1L3LA 2E1CA 3I71A 3F8MA 1ZAOA 1ZG3A 1T2KA 4ZYEA 5H20A 3RJPA 1ZHFA 1RIOH 4EM1A 1XGMA 4FHTA 5K1YA 2CAVA 5AONA 2DO7A 2IXJA 1OFNA 4HZFA 3CUQC 4LULA 3IDCB 3C18A 5I93A 4H7LA 5I8SA 2MA3A 1B59A 3M3IA 1QZZA 5H6RA 2VONA 1RUNA 4ETSA 1XGOA 3V4GA 2HYGD 2YU3A 2FBHA 5ICCA 4UUVA 4K8FA 3DKWA 4I02A 2Z69A 1X8EA 2FNPA 4XFFA 3ABUA 3VHRA 4OIRF 4LK0F 2Z3YA 1LVAA 1GXPA 2W24A 4JV4A 5FDBA 2ZBKA 5ERIA 4HN0A 5J7MA 1MDMA 4UHTA 3JTGA 5FFZA 2RNJA 5F6FA 3J81Z 5IT9K 1V70A 4IRIA 1ZH5A 1F1ZA 2F5DA 4MQVA 4RGRA 2D5FA 1IRGA 3NL1A 4N9IA 3WG9A 4XEZA 4H0EA 1OYIA 1KYZA 3BWGA 2XROA 1R7JA 5ICFA 1S6LA 2V09A 5ICGA 2NAZA 3AAFA 4EJOA 4UBGA 2M87A 5HS9A 4RGUA 1MGTA 2P6TA 3V7RA 4AWXB 4XSZF 2B0LA 3ZMUA 4QGMA 3E6CC 3CUOA 3NW4A 5CU1A 3ZN0A 4Q0UA 3I58A 3R61A 1TLHB 3OGJA 3SFZA 4Q0PA 1ODDA 3LQQA 4HLTA 2HYFA 4QLCU 4UXNA 1T39A 3HIFA 5FD5A 4S04A 1QY4A 1JGSA 5FFXA 2KJBA 3IKTA 1HQCA 3CEWA 1FBUA 2FU4A 1NE4A 4GYGA 4HV5A 2QLZA 3RZZA 3Q9SA 4DINB 1CAWA 4CO8A 1EPZA 3DV8A 3L2HA 2P17A 1Q3EA 4AIHA 2G7UA 5DCMA 4L5JA 3M7GA 2L3DA 3CF6E 4E2SA 1ZRFA 1SEFA 3G7DA 1XGNA 2HGCA 1FPQA 2Q4SA 1ZREA 1X82A 4R8HA 2HOEA 3CO6C 2STWA 1H0MA 1W7PB 3L9FA 2QQAA 2EAAA 2PN6A 4WVZA 4Z2YA 1YLLA 4L9VA 3DP7A 2A61A 2BNMA 3RPQA 1QWRA 3TO7A 3M8EA 3LWFA 2DQRA 3GFIA 2Y48A 1SFEA 3R6SA 2VXZA 4G8XA 3R0JA 3D0JA 4FX0A 4NQWA 4OOIA 4EWAA 1OKRA 4Y15A 1H9GA 2XRNA 1WQ2A 2XAGA 3IRRA 5I91A 1G3WA 3BB6A 4U0YA 3IKVA 2ETEA 3RPUA 4FBFA 2DK8A 3J81K 3HHGA 4YSFA 1QQIA 4N0BA 3JTHA 3NRVA 3RI4A 4PGGA 3GEZA 1L0OC 3H8UA 2V1XA 1V4RA 5FLIA 1LRHA 4LJZF 4KWJA 1FP1D 3P9IA 5JFRA 4M6XA 4KUMA 3VFZA 2TDXA 2PFBA 3Q9VA 1SMTA 1DDNA 5JI6A 2EFWA 4EJVA 4CYDA 4KWKA 5I8TA 3KP2A 3VB2A 1HSJA 3WTWC 2UY8A 1JXSA 2BNNA 1Y0UA 3LAJA 3PQJA 5J6XA 3HOSA 4YRDA 2DAOA 2HQRA 5KHHA 3WGIA 5ED4A 3QACA 1GVJA 5E18F 1S8NA 3E5XA 2PI0A 2D45A 3H3ZA 4ZH4F 3HYIA 3PFIA 1EYBA 3CO2A 2ACJA 2H6CA 4HVRA 4HVQA 5DYMA 3TNPB 4IEPA 3ECOA 1B9NA 4BHBA 4A2UA 1LR5A 1G6NA 1ZRDA 1YIOA 3OTFA 1YG2A 2Q0OA 3KETA 4PIYA 4RS8A 5BV6A 3KLOA 1BC8C 4LA2A 4FT8A 3EYYA 5L3CA 4KU7A 1WI9A 2RGVA 4ZYHA 4BYYA 4Y13A 1DZTA 1ZRRA 1XB4A 1ZYRF 2CQKA 1F4KA 2D93A 3U0ZA 5LEKA 2B8MA 1LJ9A 2UXXA 2P7VB 4HAMA 1FOKA 2CGPA 2QYOA 3F23A 1ZN2A 5EEHA 1OI6A 4EGYA 1FBQA 3FM5A 1J59A 4JK1X 2DBBA 2V1UA 2W84A 4HX4A 3OV8A 3WGHA 4HMZA 3C7JA 3FMRA 3FFQA 1IAWA 2GXGA 3R0AA 3U1DA 4KNYA 3SMHA 2A5YB 3QP5A 4ZU7A 3GFMA 1I1SA 3L2CA 4I01A 1OYYA 2ISYA 2QWWA 1TQMA 3KP7A 5JR3A 5LHHA 1ZVFA 1OR7A 4L0ZB 4ZU5A 3LQRA 3BPVA 3MCZA 4MNUA 1GQHA 4IJAA 2UY9A 4EWEA 5L3GA 4LD5A 2K02A 3MDPA 4RB0A 1YQAA 3KP5A 2MHFA 1Z05A 2HR3A 4XLNF 3KGZA 3KE2A 2O8XA 5HS7A 1BOAA 3EQLF 5DDGA 3K1PA 1XSDA 2O8QA 3BP8A 1X7NA 4GCVA 4LLGF 1KGSA 1IN8A 1OPCA 3R4KA 5CVUA 2Z99A 1O5UA 1JHFA 4I2OA 2Q0AA 2XLAA 4LEJA 5EEGA 1Q1HA 3BU7A 3I59A 2WC2A 1R1UA 2KXLA 3FX3A 2K4JA 3BCWA 2DW4A 4G94A 3FXQA 1K78A 1G4DA 4IEXA 3KZYA 1IXSB 5TJJA 4A0XA 3HSRA 3QAHA 4I0BA 4P9GA 2Z33A 4MTDA 3EETA 1W4MA 1R00A 4BNCA 4F7ZA 4OMYA 4LUKA 3CJNA 4O6JA 1B6AA 4Y17A 4UNOA 1RGSA 3GWZA 4MHGA 4OINF 3O3KA 5JSPA 2R7FA 2LF7A 3PQKA 5JR7B 3ES4A 3E6BA 1R5GA 3I4PA 4CHUA 3BDDA 4ON0A 4XF1A 3K1MA 4M9ZA 1BI3A 4L9TA 3S7IA 3GFJA 2RC4A 1UW8A 5D1IA 1JE8A 2EV6A 2VC0A 4O9GA 2QM3A 2FMYA 2PMUA 1XRUA 4QXKA 4CICA 1FT9A 4YNIA 4QM8A 2E7XA 3I54A 3MPBA 2H6BA 4MZUA 3M8FA 2XV4S 3BPXA 4UBHA 3DL3A 5JCTA 3WODF 1SFUA 2JZYA 1U5TC 3TDUC 2OYZA 3LFKA 1EH7A 2EV5A 2GWRA 1OMIA 2OQGA 3ABTA 2M5WA 1R1TA 4I09A 1L3JA 1ZZ8A 2Z2SB 5FQ0B 1W5TA 2EJRA 2ADUA 3FF5A 2CG4A 5HDGA 3SQNA 2STTA 4OU0A 4EWDA 3E6DA 1QXRA 2IC1A 3BJ6A 2PHDA 3H1YA 4G7HF 2PQ8A 4EROA 2VBZA 4AVPA 1Z7UA 5D5XB 4K2EA 1R1VA 4XBFA 4U0WA 2ESHA 3FZVA 5LBQA 4WWCA 3FHZA 4QGNA 3KCCA 1CF7B 2PFWA 4GGGA 2HKOA 1TW2A 2I45A 3WTYC 4I3PA 1XN7A 2DPDA 2ZCWA 1BI1A 1DGRA 1EY2A 2A3SA 1TNSA 3GLXA 2ESNA 2HTSA 3U2RA 4IPAA 4PDKA 1J9IA 4KFCA 4XF0A 1PM7A 2ZNZA 3U9GA 4AQ2A 5L3BA 5HS8A 1KU3A 1J3PA 4D7SA 4P55A 1J5YA 1P4XA 3FWEA 1KU9A 4KDPA 2E9QA 5C6CA 2P5LC 3ACLA 3KMHA 4EM0B 1NHAA 4KWLA 3WTVC 2A6EF 2QBYB 4AVAA 1ZZ9A 1IN6A 3HRMA 1XSVA 2OA2A 4IRHA 4MGRA 1P6RA 4NVPA 1Y3TA 5BQTA 2XGXA 1KQ8A 3V7CA 3QU3A 4RGXA 3ZQ7A 4HV6A 2EWNA 2L4AA 5KHGA 5A2QK 2GC1A 4MX3A 5DD4A 4HX7A 3WW2A 4IEZA 1T98A 5LGNA 1UIKA 4KN7X 2ZJ2A 2BV6A 3DFGA 2GU9A 2XHKA 4XF4A 1NZCA 4L9NA 2V1DA 2OPKA 3NVCA 4A6DA 2QNKA 2H27A 1HKQA 1W7PA 5ICEA 2HS5A 2HEOA 2PBIA 3WTSC 1XMAA 4X6QB 5C8WA 2XKOA 3TNQA 4LG0B 1ZGJA 2XIGA 3S0MA 5BOXA 4UXAA 1H1MA 1CAVA 1HKSA 2O1QA 1TQIA 1CAXB 3PVBB 1YFUA 3QPHA 1GHCA 3U10A 2K86A 1F9NA 1WLTA 5E1WA 4P5OA 3I5UA 1Q43A 1FYKA 2YX4A 3M1EA 1Z6TA 1P4WA 3F8FA 4IEQA 4EJTA 4WX9A 3ISPA 1CGPA 4KU8A 1RTVA 1UHMA 1T38A 2V9VA 1YO5C 3GF2A 3RDIA 4BH9A 3F8NA 5KHJA 5D4SA 4MV2A 2HDCA 1OD5A 1FLIA 4M73A 3LZZA 3K69A 3DEUA 1TW3A 1UCRA 1F5TA 4IESA 4MGZE 1I5ZA 1XCBA 1QNTA 3M9AA 1HXDA 2F4PA 2RDPA 1WA4A 5FLXZ 2NNYA 4KMFA 4QM9A 1XSXA 2F2EA 4XFAA 4Q4ZF 1REPC 5K8SA 1SD4A 1QXJA 5BXXA 3KP3A 2OU2A 2EV0A 2GA2A 1FI2A 2NNNA 2ZXJA 2EFPA 3TOAA 1TQ5A 2R7DA 3ZP5A 4ZZDA 1UPIA 2PYTA 3IC7A 2XLGA 2QVOA 1ZRCA 1S3JA 2KRFA 3KEQA 2ET7A 2D1VA 1ZZBA 1S29A 2XAJA 3GVAA 1SQ4A 4HSJA 3F8BA 2EA7A 4IEYA 4XFCA 2GH2A 2YX7A 2WTEA 4WCGA 1W7PD 2DFIA 3H92A 2MD5A 2VPVA 5CLSA 5TRDA 1UB9A 2PAEA 1KQ9A 4I98B 5E1RA 3EUHA 2ZO4A 1HW2A 1LDKB 1WSUA 2FE3A 4S05A 3JAMZ 1J58A 2IRFG 1VP6A 4Z07A 5E17F 4IXAA 2QCSB 1QBJA 2G7HA 3NSTA 4HYEA 1U3EM 4XFGA 1QPMA 2HTJA 3F72A 1FY7A 4Q0VA 3CO7C 5LLQA 3JSOA 1RI7A 2MLKA 2RKHA 3KLNA 2QVSB 1YFXA 2Z9OA 3V8JA 1XGSA 3BJOA 4PZJA 4OFGA 4META 3GO5A 5H6QA 2BBYA 3NKTA 3LA7A 2DT5A 5F1RA 5J8CA 2FQPA 2OA4A 3WU1B 3IL2A 4J1XA 1O4TA 1ZG1A 1YS7A 1O3SA 3J7AO 4R1HA 1ZARA 4Q0QA 3RYKA 4WZCA 5ILVA 1D8JA 2DCTA 2FSWA 4XRFA 3FMQA 4DQ2A 5DUKA 2XVCA 5AIPA 2VODA 2VC1A 4IVNA 4L2NA 2FF4A 3I53A 4LFUA 4M6YA 2PAKA 3U11A 3CUQB 4JTOA 3E5QA 2VBXA 2ISZA 4MGKE 5J48A 1NXMA 4M71A 4MEYF 1Y9QA 3IBMA 3REOA 2ZKLA 3F6OA 4XF9A 2UYAA 5BPDA 2IA1A 4UVAA 1UHWA 1XCVA 1YTYA 3TO6A 3DF8A 4BXUA 2Z5UA 2VECA 2Y75A 1HW1A 3RNSA 2UXNA 1FBSA 1J7KA 2IP2A 2L54A 3ZMTA 3H1MA 4TLFA 3F8CA 4XLPF 4FX4A 3BALA 2D5HA 3QU6A 3ZMDA 4BHCA 1IPKA 3HSFA 3MWMA 5FCCA 3K2ZA 3GBFA 2EFOA 5KHIA 4M72A 5E1XA 2LKPA 5JSOA 2JPCA 5I0SA 6PAXA 3DPTA 3C3VA 4L5IA 2XASA 3BY6A 1WWXA 3WW1A 1U78A 3VOEA 1S7AA 3IDBB 1FC3A 4HF1A 1WGPA 5FPZA 2H94A 5D5WB 3EYIA 3ELKA 4ASNA 2IVMA 2PQQA 2FNAA 1D3YA 5FD6A 2K7LA 3BZ6A 2NRAC 4U7DA 5DCFA 1CAUB 1ZNPA 2J5PA 4MTEA 1FP2A 1FSHA 2XAHA 5KBFA 5FB2A 3F3XA 4GO1A 3PLQA 4MGYE 2C0ZA 1RNLA 4AVCA 4ONUA 3JSPA 1BM9A 1B4AA 1VR3A 3CLOA 2PA7A 1HKTA 2A68F 1HW5A 2O6GE 3TQNA 2D1HA 4X6RB 1IN4A 5FLHA 1ZZ6A 1EH6A 3JW4A 4EV0A 2FXAA 3TGNA 5L3EA 2KIUA 2IXCA 3EQEA 1KYWA 5JHUA 4UV8A 1K79A 2VN2A 2LSOA 2Q8KA 5LHGA 4YIIA 1CF7A 4QX5A 1G3SA 1BIBA 2RN7A 4KA4A 1I27A 2IXLA 1IXCA 1E2XA 3ZMSA 1R5HA 2YR2A 1YHFA 3O2PE 4IEUA 4NHJA 2C6YA 3HHHA 4AQ6A 1T6SA 5HI0A 1O57A 4Q5SF 3E5UA 2K4BA 2PEXA 3G3ZA 4E2GA 5I0TA 3J80Z 3N97A 1DUXC 4U0VA 3MZHA 3CLPA 2E1NA 1KU2A 3UKTA 2QBYA 1YFHA 2BNOA 3EDPA 4HQEA 3FJSA 4IRGA 1TTYA 2RVCA 4RD7A 3RKYA 4ZYGA 3SHFA 3KP6A 1ZLKA 1Z1DA 3T0YA 2W25A 2NYXA 4B09A 3OOPA 4HBNA 5T3NA 3V7SA 5DD8A 3ELNA 2L4MA 1YFYA 2P5VA 4ESBA 3KGLA 3ROUA 4A0ZA 2DK5A 1H9TA 1SMYF 2O61A 2FA5A 5CJ9A 1QGPA 4ZU4A 4HBLA 2E7WA 4A6EA 1UD1A 2Y0OA 3D82A 1SFXA 3MEXA 4KIFA 2N7GA 3QRFF 2GAUA 2M45A 1T0FA 2D2WA 5J8FA 3O14A 3COAC 3SZPA 3S7EA 2ATFA 2VOPA 2FQ3A 3O6BB 4BAYA 1ZZ7A 1R36A 4LG0A 4OIPF 4IHTA 4RAYA 1O5LA 2K27A 4D7TA 3GUDA 1BIAA 1UCXA 4JVAA 4ENKA 4RB2C 1SD5A 4L18B 4PJYA 3HUGA 4OLLA 1CAXA 3BJAA 3CDHA 2LF8A 3I64A 2ZFWA 3KSCA 1BC7C 5LGTA 3EJKA 1PP7U 3IRQA 4XETA 3FMSA 4MGIE 2LDUA 4YFNF 2GIVA 1WRJA 5BUVA 3ST7A 1GQGA 4CGZA 2CYYA 4CXFA 5IT9Z 4A5MA 3LAGA 2VT3A 4WK8F 4A0YA 4P96A
chains in the Genus database with same CATH superfamily
2GXBA 2ZB9A 1A78A 2VQ0A 5G05L 5J1XA 1KXGA 4F91B 1QJX1 2K2SA 1DQ0A 1A3KA 4M4PA 4YG0A 2QKDA 1UPSA 3POEA 3AZYA 3RKQA 3UKVA 4BZ4A 3E3VA 3WG4A 4OZOA 1VBB1 4UVBA 3H9AA 2ZJPF 4M3CF 2BDRA 1ZX5A 3PUIA 2FRHA 4KL1A 1LCLA 1UN1A 5D6EA 2Y8KA 5E1ZB 4XURA 1ZG5A 1RC9A 2PHTA 4LJHA 2HXIA 2LRDA 2P3YA 5KK1A 1DCSA 2MLGA 3HRSA 1S0EA 4ORFA 3RTRA 2VBDA 4NIGA 4YWAA 5FZCA 4G6DA 2OZUA 2VO5A 3SZTA 3KZZA 4R9DA 3LOCA 3CC2I 2CFXA 2IW5A 1X36A 1QU0A 3GYHX 4CE8A 4II3A 2IS2A 4Y22A 3IIAA 4IEJA 5LEJA 5DTDA 1VBC1 1H8TC 4P08A 2ZMEB 2RJ2A 3AX4A 1J0RA 3LOIA 2JWTA 3DTEA 1QJFA 4MUVA 2WB1A 2J22A 1RUI1 5EJ3A 2GXAA 5A3WA 5DZGA 3ZOBA 2BHYA 3W9AA 2JT1A 2PG4A 2GC2A 2F5FA 5C9AC 3JB8A 5IOZA 5HOOA 4N7IA 4QAWA 3W3CA 1GVDA 4K3UA 2ZXIA 1ULGA 3ZYFA 3WXPA 4IZZA 4E2QA 1SVMA 1RVF1 1IRFA 4BQAA 3I2GA 1RKWA 2CW0F 3KT1A 3VBRC 1XDSA 3AG3H 2IUWA 2L02A 2UYBA 2DF7A 3VB9A 1RXFA 1SLCA 4AFAA 2DYRH 4B3XA 1A31A 1BN5A 4D9JA 1DGWY 4BOWA 1ZBA3 2XGCA 4B43A 1WD3A 5JMCA 1YLFA 3KT4A 4LA3A 2NP0A 2CHHA 4NB5A 1YUDA 4RGSA 1TMF2 3M1HA 2XAQA 1WUVA 3WEZA 1FX7A 2QQMA 2O03A 2F4IA 3CCJI 2JRMA 3C2GA 2LR8A 4YZ3A 4C2UA 3QLQA 5E8IA 9ANTA 2Q1ZB 2VNVA 3ZVXA 4HKOA 1QJZA 1GXQA 2XVKA 4IEOA 1JN2P 1YW7A 2VQLA 2BY0A 5C44J 5CKNA 5FPBA 4F8AA 2HWF1 3L09A 4A3FJ 2M1BA 2V79A 1W2AX 1SD7A 2A6VA 2O8OA 1PNGA 1VAKA 3VEPA 2JIJA 4GB33 1ZBA2 4QQHA 3HOXJ 1BVP1 3LFUA 3VZNA 5GKAC 1YJ9I 2WAOA 3QYEA 1AL22 2FBKA 3QP6A 4V2FA 2BBAA 4HLYA 5I0UA 3C1DA 3RCOA 3T08A 1Z3XA 5T5LA 4Q0SA 4LTAA 3WNPA 2H8WA 2DVBA 3DCFA 4AEMA 4ZDOA 4YM1A 1E17A 5FO5A 3M8JA 3RYRA 4P9FA 1BEV1 2XUMA 3RZDJ 2WABA 5ERLA 3MF9A 3TO9A 2XJSA 5CBLA 4B7EA 3S17J 4NPMA 4GB32 4HSRA 3FFZA 4ZDPA 4Y5SA 1YJKA 1ULYA 4RDUA 3CLQA 4S2GA 2QQBA 3CCEI 3C3WA 5CVVA 1D0ZA 2Z5WA 5HBAA 3WE2A 4WM7C 5M5YJ 1HRV1 1IG3A 2K0GA 1EH8A 1KA8A 3BOQA 3PUHA 2WFPA 2WT1A 2EB7A 4WV8A 3E97A 4O65A 2B42B 3NQHA 3JRFA 3TP0A 1RUD2 3WY6A 1TZOA 1ZM1A 4I0WB 2LNBA 2ZSHB 3V8LA 4FOYA 2NVYJ 5FPLA 3M07A 4L9BA 4UOJA 1XE7A 5L7OB 2MPFA 4PGHA 1NE6A 4ENMA 1YOVB 1VBB3 3OGSA 3MYXA 4XJWA 1CAWB 5HLIA 2X1CA 1DQUA 4KIBA 2PMZN 1BOBA 1X2MA 1LB2A 4HOBA 2WNVB 2PX9A 4N43A 1QVTA 2AREA 5FR3A 5DCMB 5K7HA 4GXOA 5E16A 1GZTA 3ZPLA 4LO6B 5FZ6A 5T54A 3S1MJ 1WLWA 1DZRA 4QHBA 1MPXA 4KIGA 2E1MC 2BGPA 4CDQB 2ZS6B 5GZCA 4CCLA 2ARXA 2K9QA 3VKNA 2FD8A 2FX0A 3WW4A 4CCJA 5D6FA 1JU4A 3VBFC 3WDTA 4Q26A 4BEHB 4IEVA 2MC4A 4ZPIA 1UMZA 2DDUA 1BJAA 2DVFA 3ETQA 1BKZA 4BIFA 4CA0A 3LSJA 4DNCA 4UFKA 1HA8A 2KR2A 2PHFA 1AZDA 4LXLA 2HFHA 1BI0A 1U9NA 1LNSA 1U0AA 2VQGA 2EXHA 3KP4A 1SBDA 1S0FA 1YCIA 3JBG1 3U1XA 1OVSA 1LKNA 1SDWA 4P9WA 4LT5A 4DZPA 4FAHA 2ZAHA 3OYJA 4D0PA 2ZGOA 4C0BA 2L01A 2EIJH 3KZIC 5CG8A 2X6YA 4RBOA 3RZKA 4HDUA 5L3FA 1BI2A 3ZMZA 5A32A 3P7NA 4A45A 1Z6RA 3RKXA 1STZA 4A6SA 2Q2EA 2KJCA 1ZGAA 5FXWA 3KS7A 4YG2F 3VZOA 3F22A 1USTA 1JUHA 5CZKA 3HQXA 2VL4A 1R58A 1XMKA 4WF2A 2WDBA 3RJ2X 2X6WA 3AYCA 4GMP3 1VE0A 4JTNA 3AXEA 4MQ9F 4G7ZF 5A7WB 3MGUA 3CCQI 4QB1A 4BXSV 1PUEE 5FY4A 2OBPA 1Z0HA 5L19A 3ZDSA 1ETWA 4ATFA 1W0UA 2WIIB 4QMAA 1T6GC 4P1WA 1Q8QA 5ABJB 2HBUA 4HA8A 1Y7BA 1JODA 2DTRA 2VE1A 2WA4A 1QU3A 3T5XA 2ZGLA 3RI9A 4DBQA 4QQOA 5FZLA 3LSGA 4AC0A 3CQOA 4N9HA 2WFF1 2Y0MA 5CFCB 3WDUA 3HM5A 1HSTA 3SCGA 2QQJA 3ZDVA 1G9AA 1MR5A 3U75A 3DXJF 1ZBE3 3B02A 4HQMA 2NN8A 4RQPC 2P4WA 3VODA 3HTUA 3NAPA 4M3FA 3JU9A 4OMZA 3D5LA 2R071 4FPGA 4WVMB 4MEXF 5GAEJ 3GTJJ 4XQWA 4OI0A 5LW9A 3THPA 3NV1A 4CDWB 5EEAA 2IBDA 1VAMA 5C4WB 2CRGA 1Z7S1 2MNGA 5FOJB 1R1A3 3K51A 5KXCA 3N9QA 4UW5A 3AKPA 2JX9A 5GALA 3KEOA 2WZPP 2EA2A 4IHSA 1MNEA 3EHKA 2GC0A 1DPRA 1REDA 4AHZA 4DOZA 4KG0A 3K1NA 3USSA 3ERED 1CONA 3S2HJ 2ARAA 4FE7A 2R7SA 3W58A 2ZNYA 1ZBE2 3I2HA 3DEMA 3H9JA 1FSEA 4NBQA 2VJ5A 5D4RA 4RFT0 3JRIA 2E1MB 5K5QA 4QT6A 5I0RA 4NHKA 2JG9C 4CDGA 2Z42A 1DLCA 5DV5A 4A4AA 1MIJA 2CL2A 4RL7A 5ACA1 2RMU3 1BA5A 4LMYA 2MH9A 1R1A2 1TC3C 4Q2FA 3F6VA 2HOAA 1WCSA 4QX2A 4TN7A 2MH2A 5IVEA 2FMDA 1ITYA 1U5TA 5C3SA 2OAZA 4KWUA 1TQPA 2XKPA 4CZCA 2D98A 4OCTA 1GV2A 3Q0UA 4BWOA 3MEPA 2QDRA 3UETA 3IAS2 3SXYA 3DTIA 4PT6A 3K0LA 2XJTA 2EXJA 2E1CA 4NPLA 4MGQA 2ECCA 1ZG3A 3WHCA 3RJPA 4IV1C 3SH4A 1DGLA 4FHTA 3SKJE 5AONA 2DO7A 3HGYA 2RMU2 1E0EA 1RUH3 4LLFA 4LULA 4IE4A 2DA7A 3C18A 5I93A 1MBHA 5H6RA 2VONA 1IGNA 3LOBA 2NMNA 1VQ6I 4ETSA 5HODA 2YBKA 5H9SA 3ZYGA 4P9IA 3SZGA 3V56A 1AU7A 2VMIA 3ZN4A 4AW7A 5AC91 3IAQA 1LHOA 3VSLA 3PUBA 3O1UA 4YGBA 4EN6B 5LA9A 3NV4A 4B1MA 4OIRF 3RSNA 2Z3YA 4RA2A 1PUFB 1GXPA 3M3CA 4CP1A 2ZBKA 4MVTA 5J7MA 4UHTA 3JTGA 3M3EA 4YGDA 2CH0A 4IRIA 4FOWA 1BR4A 2F5DA 4MQVA 2ADDA 1IRGA 4N9IA 1RUH2 4NROA 3K6GA 1AR93 4GJZA 1KYZA 3O0WA 2XROA 1MSFC 5ICFA 4R9AA 1S6LA 2M87A 2A6YA 3WQ0A 4N4OB 3MVPA 2P6TA 1PZ8A 3L2QA 2V5DA 3E6CC 4FPHA 1HLCA 1UYYA 2NM1A 3I58A 3WDXA 1TLHB 2BQPA 2P1BA 2YUSA 2RS13 2C6SA 1O59A 4ARXA 3S93A 4FCYA 3IKTA 4V1PA 1S9HA 1S2EA 4AVZA 2FU4A 1Q1VA 5FZKA 4BQ4A 4XQFA 3S2DJ 1EPZA 1M06G 2VMHA 5DN2A 2W0XA 1AR92 2G4IA 3FBYA 3G6EI 1Q3EA 2C9KA 3FLPA 2VD7A 2VKHA 5C3QA 3DBHB 3SEQA 2FZ2A 4CEWC 2VKEA 2Q4SA 1DU6A 4PCRA 2ME0A 1X33A 2GOXB 4B4PA 4R8HA 3ZQLA 2HOEA 3KF3A 4D5FA 2WNUB 1OOPA 1W7PB 2PN6A 3M3OA 3HOYJ 3DP7A 4V2WA 4DMIA 1OHFA 3ACHA 4K1YA 3SJMA 2RS12 3ZQCA 3NMBA 4D7NA 1OISA 4UW4A 1HDPA 3CC7I 3WNOA 1CWPA 4LHKA 5ANNA 2AH2A 3ZXEA 3R6SA 4XYXA 4EWAA 2Q1MA 1ULCA 1N78A 5I91A 1U5IA 4YW4A 3IKVA 5JXJA 2XQXA 4YSFA 1QQIA 4N0BA 2NYYA 1IQDC 4PJMA 5IT6A 1B8IA 3G1OA 3H8UA 4HETA 1NQDA 2DUPA 4LJZF 4JGYC 5D2AA 1FP1D 5JFRA 4KUMA 4G6TB 3ZFFB 3I3QA 2WRAA 5GTHC 1SMTA 2HBTA 2EFWA 5FYVA 4CYDA 3KLSA 2AUYA 3CCYA 3VYSB 4CP0A 2P0WA 3WDWA 1JXSA 1Y0UA 3LAJA 4PSWA 5J6XA 3EUAA 1VMFA 3HOSA 4HG2A 4MGSA 2E33A 4AI8A 1GVJA 4RGGA 3AVRA 1S8NA 3E5XA 1SZBA 4ASKA 3HYIA 3GBGA 1QOSA 1EYBA 2DU0A 3I2KA 4JX0A 1BMV1 1AYN3 4H7MA 2H6CA 1E5HA 5G04L 5DYMA 4IEPA 5F5CA 1T8IA 3DGTA 4A2UA 5CISA 5K4LA 4BQOA 1EV13 1G6NA 1ZRDA 1PYVA 2Q0OA 3KETA 5BV6A 2LP0A 3KLOA 1BC8C 4X8PA 3N7MA 3LIHA 1UOFA 1VBD3 4ZYHA 4Y13A 1DZTA 1OCPA 4CPBD 4NIDA 2H0BA 4AI0A 1DZQA 2HH9A 2CGPA 1OI6A 4V2VA 1QHDA 4EGYA 1FBQA 1QPIA 5DM6F 5FJ8J 3OBZA 1H8VA 2ZEZA 3OGVA 5HCAA 3WGHA 3C7JA 3FMRA 1AYN2 5K9YA 1IAWA 3R0AA 2FOWA 4YG3A 1FIAA 4AGGA 2A5YB 3L2CA 5GPAA 2XVGA 1S1AA 4ISRA 1TQMA 2R1DA 1RESA 1EV12 2A1XA 4MLOA 1OR7A 2DDBA 3MCZA 2XPJA 3NJVA 5L3GA 2A3XA 1VBD2 1SPPA 2WYSA 4A3ZA 1YQAA 4FQZA 2X5IA 4XLNF 3KGZA 2CV2A 2CQQA 1YC61 1F4AA 1MQTA 2O8QA 1XSDA 3BP8A 4LLGF 1I39A 5FK7A 3FXKA 5EV7A 1W6MA 3ORJA 2Z99A 2JB4A 4C2TA 2P5BA 2EQRA 2EZKA 3MLLA 2FCVA 2UURA 5FPVA 4I2OA 4FSJA 2XLAA 4FPCA 2E36A 3IH4A 3BU7A 3I59A 5KAIC 4CXXA 3FX3A 3I3MA 2DBIA 3NNLA 4XDPA 1Y4WA 1H1AA 2PHWA 1K78A 2D97A 4DXRA 5LY2A 4P9GA 1C57A 4MTDA 5FUNA 3UK9A 1GZWA 3A0BC 3OY8B 4LK7A 5FY8A 1W4MA 2ME6A 5GTIC 5BYNA 1C5IA 3PDQA 4XUOA 4OMYA 4K1ZA 3ZMNA 1I3QJ 2XF7A 2FD5A 4Y17A 2VXJA 1HN0A 4DUWA 1RGSA 5HCBA 4YVSC 3AC0A 5BNNB 5JSPA 2WQ4A 1OA2A 2K5CA 4A3XA 3J9SA 3BDDA 2OPTA 4XF1A 3S7IA 1CIYA 3H5RA 3B94A 2XPVA 3IZOA 1JE8A 3GTGJ 2VC0A 1QHGA 2XJRA 2QM3A 1HB3A 3VSKA 2LH9A 4CICA 2E53A 4YNIA 4NHXA 3KV4A 4OZXA 2E60A 4L5EA 3GLLA 2UWCA 5C4XJ 1SFUA 3FDYA 2X05A 2ILMA 3TDUC 2OYZA 3LFKA 1AR71 1FYUA 1X3ZB 4UB8C 4BGDA 3LSIA 3DUIA 1KRIA 2RM23 4HONA 2WLPA 1S0IA 3K10A 4QPGC 2ADUA 3S1RJ 2CG4A 3ERMA 2B45X 3SQNA 1NA1C 2HEVF 2STTA 5M5WJ 3E6DA 3BJ6A 4AVPA 3N9PA 4BMBA 3QODA 3I2JA 2ZEYA 4K2EA 1R1VA 3AG4H 1LGBA 2ESHA 3FHZA 4WWCA 3G71I 1CF7B 2PFWA 4WVWA 2HWC1 4IUGA 1PJRA 2YS9A 1XG1A 3AL0C 1PX4A 2ESNA 2OUHA 1YE9A 4IPAA 5A6QA 2Y2ZA 2ZNZA 3U9GA 4UUSA 3MIEA 4XACA 3FKIJ 1J3PA 2RM22 4BB3A 4EN0A 1IPSA 3WNKA 5FO7B 1HLVA 4P00B 5EZHA 4KWLA 2A6EF 1IN6A 1QJU1 3UV9A 1D0XA 1PK6A 1ETKA 2DMNA 3B69A 1YITI 3GM8A 2OA2A 4AFCA 1P6RA 5KC6A 5DDJ1 3IM0A 2QGUA 3C7GA 1OKQA 1P8JA 4RGXA 5BNPC 3ZKYA 3GTPJ 3I2IA 1Q8SA 4D6SA 4KNCA 5A2QK 2D3SA 1ZA7A 5DD4A 1X1AA 1WZ2A 2B9VA 5FZIA 4Q1PA 3I49A 2A70A 2BV6A 2Y9ZA 4BQ2A 5CKTA 2AC1A 1RHI3 2V1DA 2OPKA 3NVCA 1ZA4A 2DMUA 2CJJA 4E27A 2JE9A 4PUSA 5ICEA 2R063 3UJQA 1VF9A 2P2KA 3S0MA 4GWNA 4UXAA 4DRRA 4Q4W1 5TSWA 2VVFA 1NX9A 2PLV1 4M0HA 2VZOA 1GHCA 3U10A 3PUAA 2RS31 3WNMA 2VQTA 4CCKA 4IEQA 3GTQJ 4CDUB 4WX9A 2Y60A 3WZ1A 1A6IA 3GF2A 5C8CB 2VW0A 5J1RA 1WH5A 4YVSB 1S5LC 4BH9A 3F8NA 1ENHA 1RHI2 1JKOC 2VZPA 3ZXJA 3ZR5A 4M73A 1VAVA 1F5TA 5J3LA 2W48A 1XCBA 3M9AA 2ZHNA 3RFRA 4EN8B 3GCMA 2R062 2DT7B 2GNDA 2WA0A 4QM9A 1XSXA 1FATA 3UT0A 2ID6A 2JDPA 2X29A 4NIIA 1H8TA 5LBFA 1R083 4XL9A 4IGPA 4Q4Y3 1TQ5A 1JZ6A 2DCZA 2QA4I 1GICA 4GDFA 4DZGA 1DGRN 1LU2A 2XLGA 5CFDC 2ET7A 2DU1A 3OJBA 4F3JA 3GVAA 4GA9A 4R9CA 1LODA 4IEYA 5C9AA 2YX7A 4CSWA 3ILFA 3LFMA 3PNYA 1W7PD 1ULEA 4BDYA 3M7AA 3I4NJ 4EN7B 1UB9A 3OB8A 5J1UA 3GTMJ 3CMYA 3D6EA 5A7OA 2TRTA 2XBO3 4XN0A 1WSUA 5CG9A 5FZBA 4RM2A 3P1IA 4Z07A 1VP6A 4ZJZA 2IRFG 4OUMA 1VMJA 1EKEA 4AIDA 1QBJA 1R082 4CPBA 2HYJA 4Q4Y2 1U5XA 1S4CA 1FY7A 2V6EA 2AENA 2QQKA 3JSOA 2QQNA 3V0AA 4Y20A 2RKHA 3CC4I 1XGSA 3BJOA 4AYUA 3LSEA 4OFGA 4UT5A 1MBEA 1W0OA 1WD4A 3QCWA 5FOBB 1NLRA 3NKTA 3LA7A 3TL4X 5F1RA 1NTCA 1A8MA 3T1LA 1PO13 4J1XA 1ZG1A 3USUA 5HXMA 4Q0QA 3L2YA 2DCJA 3ZN5A 5CKQA 2FSWA 4XRFA 5FXZA 4JGZC 5FZOA 2YDEA 2XBO2 2DA4A 2F4OB 1XYNA 3JRDA 3TOJA 2ARCA 3TYJA 2W1WA 4NIHA 2PAKA 3U11A 2A73B 4JTOA 2ISZA 4MGKE 5J48A 4MEYF 1Y9QA 1AVBA 2QSGX 3TEZA 3RQ4A 2UYAA 2X6XA 2K9SA 1YTYA 2DA1A 2VECA 3ZX7A 3GCWA 3PO2J 1I1EA 2UXNA 1J7KA 1I3HA 5KWRA 3PFYA 4KT6A 2YU9J 3PNVA 3HEFA 3BALA 4CP2A 1QDCA 3CMMA 3MUZ1 1PO12 1OCRH 2G0EA 3HSFA 2N8GA 5FCCA 1JYXA 3K2ZA 1LE8A 3WQBA 2EFOA 3MI8A 2HVRA 4BCUA 3P5JA 3VBUC 4COUA 2E35A 3J4UH 4CEYB 2WV1A 1HF0A 4J19A 4ITVA 2YFZA 5FLVA 2XASA 5FYYA 3OOUA 3IDBB 3Q8EA 3DWLE 4AU7A 1TWFJ 1NQJA 1HXS3 1HB4A 3RRDA 4YIRX 1WGPA 2H94A 5D5WB 4WM7A 3BG5A 5FBJA 5CNAA 4ASNA 4OI2A 4G4FA 1W9FA 2VTXA 3ZSMA 4WVMA 2M9HA 2K7LA 4V2GA 5TGTA 2VY0A 2XJPA 1V6OA 1H4GA 4CDWA 2WBMA 4CRQA 5C4WA 1DQ4A 3WP4A 1XS9A 4FFHA 3DYMA 1MVEA 4XJUA 1W6QA 3ZXLA 3IPVA 2VULA 4UFMA 1FPN2 4QKDA 5KXBA 3F3XA 4GO1A 1PZ7A 3PLQA 4MGYE 1W6NA 4DXZA 1RNLA 3GHNA 4AVCA 3ZQFA 4QB6A 3SNMA 3HQUA 3ZKUA 1B4AA 1VR3A 2D6LX 1HW5A 5IUQA 3TQNA 2D1HA 4X6RB 1IN4A 2L7KA 1HXS2 4XMAA 1JW6A 1IV6A 5FYHA 2B7EA 2Y34A 2Q8KA 4YIIA 3PU3A 1JBCA 3AYDA 4RS5B 5J96B 5FZ7A 3ZPYA 5JZGC 3ZPOA 1G3SA 1BIBA 1XNDA 5GZGA 2IXLA 3MIDA 2OTJI 1IXCA 1VPHA 2YGMA 3VBFA 3WDVA 4XZUG 2VI6A 4F52A 2HWE1 1RB8G 1HRI3 5FMOS 3N35A 4E2GA 1XSRA 1US2A 4IQ4A 3VKFC 1KU2A 3UKTA 3KVBA 1LOFC 1WW6A 1V00A 2Q1FA 1YFHA 1KITA 2A75A 3FJSA 2IFWA 3QH6A 1B72B 1LEMA 2BU9A 3OYEA 4RD7A 3ZSKA 4ZYGA 4FTEA 2W92A 4M3GA 1Z1DA 3T0YA 1GFF2 1F2NA 2WS93 5DZFA 2NYXA 4ZZ8A 1MMDA 1FMD3 3OOPA 4HBNA 4Y33A 3V7SA 1GDTA 2IFRA 1K4TA 3URFA 2ZTNA 1YFYA 2P5VA 4ESBA 3ROUA 5JOYA 2DK5A 1J1TA 3TEWA 1H9TA 2IVJA 2O61A 2FA5A 4M00A 5GAHJ 4HBLA 5FXXA 2E7WA 4RMNA 2YZ4A 2LBFB 4FFFA 2Y0OA 3AM2A 1SFXA 1HRI2 4NN0A 1AR83 1K6YA 4KIFA 1O4YA 3QRFF 2VW2A 2M45A 4IE0A 5J8FA 3COAC 4BUPA 1WJDA 3OEAA 5FMOL 1JJ8C 3A02A 3SFIA 4BBSJ 4YPJA 4ZXEA 1QKQA 2FUG2 4B4RA 3E1F1 4OIPF 4GH4C 2Y33A 4LHLA 5LATA 4RAYA 5JOXA 3GUDA 4S0HB 2LKXA 2WS92 2ENRA 1AX0A 1FMD2 1SD5A 1VQOI 4L18B 1DQ2A 3SISA 1CAXA 3CDHA 1VQNI 3KSCA 4B48A 3IDEA 1FTZA 5LGTA 4XETA 2LDUA 4YFNF 1Y6IA 2GIVA 4UFLA 1MZ6A 4A3JJ 2AEZA 3A21A 5IT9Z 4A5MA 1I6HJ 4B44A 4WK8F 4A0YA 5FYUA 5DXDA 4M3CB 1AR82 5JVTA 4AG4A 2CTVA 2Y0SN 2K9NA 2PHXA 2MSYA 4RQPA 4W6YA 1LOCA 2VG9A 1S55A 2QQ9A 2QENA 5EYXA 2CV0A 2W4SA 1FXZA 4LO8A 4CCCA 3J80K 4MFDA 2E2HJ 5KHKA 1X19A 3B73A 2IVIB 3WGGA 1JUPA 2XL7A 4QXHA 2ELHA 1OLMA 4AVVA 1L7LA 4FI9A 5GLVA 3OSFA 3OS0A 2JDMA 4M74A 1WBLA 2VUAA 1NCQB 1DGWA 4L11A 1RUC3 3ME2A 1X8MA 1MH3A 3LE0A 3I3LA 2R7VA 5F1JA 3W6KB 1S0DA 4G9YA 2E26A 4IHWA 3N7JA 1C5HA 1LTEA 1WGXA 5FKOA 2CUFA 3LKJA 2NVQJ 4LO7A 1UFMA 3OYKA 1D0YA 2V6CA 5A3UA 1LQ1A 2HYKA 3V8KA 3PJQA 4RFRB 5L73A 4B8XA 1XDUA 3GYDA 4YVWC 4GIQA 2FZ1A 1U12A 3K4NA 1W2NA 3LSMA 1J3QA 3QH7A 4JYKA 4I7HA 1YQCA 1YWKA 1W8FA 3CJXA 2MEV1 2MC3A 3OY9A 1RUC2 1Y8QB 5EGOB 4L99A 5CKMA 1YRNB 1C4RA 3PSFA 1RUOA 4CZZA 4YFXF 1R6RA 2V7FA 5ILSA 4W4ZA 4IGOA 1Q8PA 2F5CA 4YG6A 3ZM8A 4LBLA 2VZRA 4M9XA 4EJUA 4B29A 3I4IA 1ORKA 5D5VB 1YW8A 3R60A 2V4VA 1PIV1 4IV1A 5F32A 2YPRA 1YIPA 1FEXA 3ZXAC 4OAYA 4GKXA 3LWCA 1BCXA 3JR9A 3DKQA 3IMMA 4E7JA 3JRHA 2HZTA 2EK5A 2M0CA 4AAXA 1CZVA 1RR8C 3RWKX 4Y52J 3A23A 3ULQB 2HWE3 1CZSA 4XCAA 1CN1A 2IZWA 3A0HC 5JSRA 1RRJA 4CYCB 1CX4A 3HC7A 5JAXA 3VBOB 2PTMA 2P6SA 2X9DA 3OL3A 4B7KA 4LLLA 4TWTA 5B1BH 4N53C 2GP3A 3I3BA 1OCZH 5F7UA 1R093 1UMHA 3H7YA 3ZYBA 1D2QA 5B2GB 2M8EA 3Q5FA 2D6OX 3EYPA 4YGCA 3C2HA 3LA3A 3A01A 2XSJC 1NAEA 3IAPA 1JI8A 1UZWA 5HLGA 4QX3A 3T0DA 2BWCA 5EPAA 3HPHA 1IV8A 2EA4A 1TBXA 4XCBA 3HAGA 2R0QC 1GLNA 4HF0A 4I0AA 1O3TA 2HWE2 2VE9A 1J1LA 2YBPA 3CJIC 2W9XA 5EXOA 2W52A 3ZN6B 2DI3A 3T30A 2R3SA 2JKXA 4AFMA 4RGKA 2PJPA 1LEBA 2HVQA 1IKPA 1IHMA 2DMQA 2ZX3A 1CAVB 2W1UA 2GC3A 2E6VA 1DP7P 3G73A 3BU0A 1MDMB 4CDXC 1NY71 3BI3A 1R092 1P92A 3VD3A 1G8XA 5A7QA 2EVXA 3T0AA 2EFNA 3K4MA 4JBAA 2SBAA 5B66C 2IS1A 2NVTJ 4D7MA 3H35A 3KZ4C 4FPKA 3I7DA 5CYVA 2WB1N 1RMU3 2KRHA 2BRTA 3GFLA 4W1UA 5F6KA 4AQTA 1PNFA 3UGHA 2CQXA 3BR2A 5D5UB 2P3IA 4RGAA 2BW8A 1VBA1 5IAXA 4CEWA 3N4MA 3SKVA 4QX8A 3GJBA 1UZ0A 1JOJA 1BHGA 1ENSA 1SHWB 2BVMA 1O7FA 1QEXA 3M3QA 5T5OA 1YI2I 4KT5C 3A0NA 3LDBA 2AXLA 5A3LA 4QWNA 3ZR8X 4LOSA 4Q4X1 4EVIA 4RB1A 3RYPA 2WQZC 4ZYDA 5DQ0A 4E4HA 2ZX0A 1PO23 3F21A 5EZGA 5FAXA 3DPRC 1CJDA 1JUIA 5ILUA 3OYLA 3PMEA 4MXVA 4K8RB 1SFNA 2Y6LA 1RMU2 2R7QA 4AVTA 4Z92B 3K77A 5CPRB 4XAAA 1W5SA 3I3DA 1OCTC 3N9NA 4YW3A 3JAMK 4LR4A 2QQVA 4JGYA 4NPRA 2O0YA 5EYRA 2BE5F 1I3AA 5FUPA 4EM2A 1YX3A 4M4RA 5D8AB 4Y5TA 4P9UA 1FOD3 4O3MA 2DLLA 3RIRA 4H3WA 4C8DA 2Y9YA 2UWMA 2D43A 4QPIC 4E8DA 2HJIA 5K0UB 4ENNA 1PO22 2JSCA 1DDLA 1KJLA 3O1MA 2NOJB 2NS0A 3ZXFA 3NV2A 4EEFG 3POWA 1CIWA 1UNBA 5EJ1B 1JHNA 2ZXWH 1SFYA 1JHHA 1OF3A 1UY4A 3K4ZA 1PDNC 1GYKA 1GR3A 4MXWB 3TWIA 2ZGQA 3SHRA 1RITA 4IF4A 3FXRA 3PNAA 4YW2A 1SLIA 4S2DA 1ZR2A 5FZMA 3UKNA 2XL9A 1MNMC 4A93J 4QTRA 2B46X 3BG3A 1N3QA 2QQWA 3QD6A 1FOD2 3BTIA 2VQUA 4SLIA 3C7FA 4XPVA 2F4LA 4HF2A 4Q47A 4ENJA 1R22A 5JXHA 3A4UA 5H9RA 4AI3A 1D0HA 5DEQA 1F35A 2YUEA 1T0FC 4XMYA 2Q30A 1WLDA 1JJ6C 5L9VA 1G9BA 1XNBA 1UG2A 4HVOA 4O9EA 1Z9CA 2LALA 4XSXF 2COMA 4I99C 3WHTA 4RLQA 2D40A 2FMLA 1RUF3 2P5KA 1MBKA 3KV6A 4RN5A 5DUVA 4GWJA 5JWPA 4BDVB 5D8LB 3FZ3A 2AQEA 3WW3A 1XOYA 2G9GA 4Q5OA 4C30A 4KGQA 4LHNA 4MH0E 2IXHA 3S2WA 3HRTA 1J75A 2WAFA 3AFKA 3J7NA 3AYEA 4AEDB 5KCMA 3L00A 5E8GA 1LHWA 1EP0A 2GMPA 2QQPA 2RDNA 2VCAA 1PVEA 1DU0A 3OYHA 2GQQA 4HNVA 5F64A 3KV5A 1YS6A 2R7UA 4B4CA 3I0TA 2WAEA 3LSTA 1SAXA 5FMBA 1F8VA 4P14A 5KVRA 1F4HA 2OF7A 5A3PA 1KZHA 2LVSA 2LS6A 5C4JJ 3Q8CA 1KDMA 2GALA 4YM2A 2MGQA 2V72A 4R52A 3WQ7A 4E70A 1OD3A 2H09A 3CL1A 2W95A 1B35B 4IETA 1RUF2 3QOEA 2PHLA 4KMUX 1ONVA 4WXHA 1S7OA 1OCOH 1BJQA 5HV4A 4AZZA 3KT7A 1ODMA 1NH3A 5T50A 1IN5A 4BKXA 3FMGA 3OUIA 2VOWA 1JYVA 3WF1A 4IEWA 2K40A 2IWGB 3WF3A 4IKFA 1IF1A 4MSVA 2OQRA 4YGEA 5GLTA 3GJAA 1USSA 5FWEA 2IGNA 4PLMA 1ULOA 2CMPA 3FK6A 5C8CA 1LKXA 2HI3A 1ZZCA 4YVSA 2O0OA 5EYYA 4KISA 2F5EA 1AYM3 2KKOA 5CB7A 4E8CA 1VBA3 1Z78A 1WW5A 3GX4X 2JVGA 5FRMA 5FLJA 4E7KA 2M30A 3K9TA 2JG8B 5C71A 3TDZC 3FC0A 4HKLA 1W8TA 2EALA 1PMIA 1M1EB 1VRH3 3FIWA 4A41A 3HT2A 3MN2A 1ULPA 2OV7A 1I6XA 4NE9A 5D8KB 1SC7A 1VIWB 1APLC 1AXYA 2UZKA 4U88A 3VHOA 3ATGA 4W97A 3WTUC 2FDJA 2JPBA 2WWUA 5DUIA 4XLFA 1K3IA 2VOKA 1LFUP 4QPGA 2A71A 1NA1A 4BY7J 3B01A 1ERDA 3VYRB 3PIGA 5JPMB 1ZAOA 1AYM2 3RJRA 1VBA2 5H20A 2RDQA 1IUFA 1ZHFA 5A33B 2E5NA 1HDDC 1REFA 3SDGA 2V9PA 4XXAA 4P9JA 5L9BA 3LEKA 2IXJA 5CEHA 4XIDA 3CUQC 4QD2A 2F6CA 1ST8A 2CUJA 2JJ6A 1AKHA 5I8SA 2MA3A 1R49A 3Q8FA 1VRH2 2PJRA 1XU1A 3M3IA 4PI2A 2CYFA 3GZAA 2HYGD 4ZTFA 5FPUA 5F0FA 2R32A 4K8FA 4NWVA 3S3NA 5GAGJ 2Z69A 1W6PA 2IEKA 2VJJA 4BACA 5KC5A 3MIHA 5J4VA 3H5AA 1PMJX 1AX1A 3CJRB 5FDBA 4FTSA 1UOBA 4HN0A 4YZ5A 2VPLA 5F04A 2RNJA 3V65A 5EP9A 1JUSA 5JHFA 2BVVA 1V70A 4ARYA 1ZH5A 1T56A 1KDKA 5BNPA 3Q3SA 4DXSA 4WM8C 4H0EA 2BFUL 2PMZA 3BWGA 4OQ9A 3LGRA 4IE6A 1R7JA 1RUG3 5ICGA 2IXSA 3AAFA 3H0OA 3OS2A 1ZR4A 1MGTA 4FP3A 2YBSA 3ITQA 3ZMUA 4QGMA 1IRXA 2RREA 2DCYA 5A6XA 2YB7A 5CU1A 3HPGA 2Y6FA 4Q0UA 3OYGA 2GSYA 5LK5A 3NWSA 4IE7A 2WAAA 2BY1A 1NG7A 1T39A 4S04A 3CCRI 2ES3A 4BA6A 5H2FC 1FBUA 2BVBA 3T2TA 4QDQA 4OMDA 4DINB 3Q9SA 4CO8A 2HWD2 3DV8A 2V73A 3VBSB 4QX1A 4H4KC 4RLFA 1RUG2 3ZO0B 2Y6GA 1W39A 4XORA 4L5JA 2VXRA 2EBIA 4JDMA 2DA3A 1ZRFA 4ZZ5A 1OT5A 4IW3A 4BDZA 2HGCA 3K46A 3HGGA 2RQQA 3BGAA 4LKFA 3CO6C 4AF9A 2VC9A 3L9FA 2QQAA 5JR2A 4L9VA 4NRQA 4PBPA 2Y31A 3MW3A 2BNMA 2IS4A 2LFBA 3H8XA 1UU5A 2KL4A 1QWRA 2JD9A 3OYWA 2LM3A 1RUJ1 4UFJA 3LWFA 3O8GA 2KM2A 3O0XA 1IS4A 1GT0C 3GFIA 2Y48A 1SFEA 3V0BA 2R93J 4UUTA 4CTEA 1I50J 4NQWA 3OYAA 4OI1A 4HRIA 1ND3B 4E4ZA 2XAGA 1CZTA 2X09A 3VD5A 3BB6A 4RR3B 3MUY1 4YM0A 4COWA 1K5MB 3J81K 2R7XA 4ZHNA 3JTHA 1ZK8A 2O5RA 1L0OC 3P9IA 2I2SA 4M6XA 3QPLA 3BCAA 3H3VK 2K85A 3THCA 2X1EA 5FKNA 3FK7A 5I8TA 3KP2A 3VB2A 3HNMA 5F0CA 2XWBB 3MV01 1GBGA 1XPWA 1DU3D 1V9U3 3ASNH 3C7EA 1D1CA 3WGIA 3QACA 3GBWA 3E1SA 2PI0A 5FY1A 3V64A 3H3ZA 4ZH4F 5F3CA 3PFIA 5HCHA 1I5PA 4L0PA 2C5DA 4RAFA 3QYBA 1WI3A 1UU4A 1RXGA 4HVRA 1K61A 2VNOA 3VHNA 4CP9B 3TMOA 3ZXKA 5IK5A 3WF2A 4HANA 4PIYA 4RS8A 1Z21A 1RKTA 2ZHMA 3EYYA 4DYRA 3PU8A 3PIPF 3LDRA 4LBQB 3VBHB 3KVAA 1XB4A 2XGEA 2ORXA 1WJAA 2CQKA 3KEYA 1AJKA 1V9U2 4QKBA 1A6QA 5IP9J 3MHZA 1FOKA 3KQRA 4C90A 4JGZA 3UGFA 5FYSA 1JKPC 1UYPA 3ECQA 4XQDA 3KYDB 3GDBA 1H6YA 3WG3A 3WHUA 3FM5A 2DBBA 2V1UA 3KV9A 4BK5A 3RPUD 4II2A 1FMWA 3OV8A 4HMZA 3U4XA 2GXGA 2EILH 4H55A 3K4BA 1DQ6A 2ELKA 1IRZA 1OYYA 2NXNB 2ISYA 2VL8A 2JDAA 3ZFGB 2A3WA 1TMF1 1F31A 3LQRA 1GQHA 4D8MA 2R5YB 1T33A 1HQWA 2K02A 3W2WA 2LRPA 4NAMA 2PHUA 3KP5A 3ZYRA 3GZEA 2MHFA 1Z05A 2HR3A 5FZAA 2O8XA 2R0HA 3VBUA 3K1PA 5FKMA 3HQRA 4GCVA 1NKGA 4QQLA 4XTMA 4JHZA 1KGSA 2VZTA 5CVUA 1J84A 3ZMOA 3VDDB 3WCSA 1F5FA 2BOLA 1O5UA 1JHFA 2GDFA 3AZXA 4LEJA 1Q1HA 2ZMEC 5FZ1A 3HMYA 2KXLA 2K4JA 1AL21 4JDOA 3C8XA 4FPJA 3FXQA 2R041 2HDDA 3HB9A 5TJJA 3RZHA 3QAHA 4I0BA 2FQ4A 2Z33A 4BNCA 1W04A 2K3PA 3N36A 1OUSA 4L8QA 1W36D 2JB8A 3GWZA 4ES8A 4MHGA 4FQ4A 5DAVA 2ZHKA 1N3OA 3PQKA 3BT9A 1D5YA 3MIBA 4YW6A 3GTKJ 3E6BA 1R5GA 3I4PA 4DRVA 4CHUA 2XAUA 4M9ZA 4L9TA 3GFJA 4GB31 2YMZA 2JKBA 5D1IA 1QQP2 4E9KA 3BUCA 1A34A 2FMYA 4QXKA 2R5ZA 3MZ8A 2W5FA 4GZ9A 1K45A 4KITB 3BPXA 4UBHA 5JZGA 3WODF 3IUOA 4CCDA 3U78A 3FKJA 3POIA 1PGSA 3A7QA 1R5ID 2DWRA 1RUE3 1OMIA 1JYCA 4AGRA 2M5WA 1L3JA 1ZZ8A 1RUD1 2Z2SB 5FQ0B 5LZ6A 5IPAA 2HNHA 1MS8A 4EWDA 1XNCA 3MKWB 4NHYA 1YRNA 2PQ8A 2JICA 3H9GA 4EROA 3S1QJ 1LOFA 3NWTA 4XBFA 4XAEA 4U0WA 1ONAA 2D6PA 4JKKA 2OQ6A 3TRSB 2R7TA 4GGGA 2HKOA 2AHQA 2I45A 4UB6C 1W6OB 1EY2A 1NG6A 4C2MJ 3FHNA 2HTSA 3AKTA 4PDKA 4KFCA 1YX5A 3VGIA 3WNNA 4AQ2A 5HS8A 1KU3A 1RUE2 5FKCA 4C1XA 3PUSA 4G3YC 3OYBA 3FXJA 4KDPA 1GZCA 3L2UA 5GADJ 4M6VA 2BOJA 2P5LC 4EM0B 1ZTRA 1NHAA 3WTVC 2QBYB 4AVAA 1ZZ9A 3HRMA 4FTHA 4H2AA 3KHBA 2XGXA 1KQ8A 4XMIA 3V7CA 4GH4A 2GP5A 1R4NB 4HPKB 2ZGMA 2EWNA 1AL0G 4HK9A 3WP3A 5KHGA 5IVFA 2GC1A 1KEXA 3UR3C 4XQ4A 1WCQA 1NZIA 4BQ1A 3ABKH 4YZ1A 5IJRA 4XF4A 5GM0A 3AP5A 2R6QA 1ZGWA 5A1FA 1HB1A 2QNKA 4A44A 5J98B 2KDZA 2FCUA 2Q8OA 2HS5A 2HEOA 3S8PA 3WTSC 2RAEA 3IH3A 4S2HA 3DLAA 2XIGA 2ZXHA 5L7OC 2AEYA 4LBMA 4GMP0 3OPWA 2A3YA 1H1MA 1CAVA 2MW8A 4AYBN 4CXWA 2KISA 1TMF3 1SAUA 3W5MA 1QMJA 3HUGB 4N4NB 1W3VA 2WNVC 1YFUA 1F9NA 4LO5B 3I5UA 3ZFEC 2YX4A 1Z6TA 1IS5A 1P4WA 2XB5A 2K46A 4OULA 5A1AA 1CGPA 3KB5A 2W08A 1W8OA 2BXYA 4JOMA 4A6OA 2VLAA 4CDQC 5E8AA 1ZYBA 2VB6A 1TW3A 1F9KA 4PJJA 1XB9A 1KFXL 4MGZE 1I5ZA 2VBBA 1R1ZA 1ZKGA 1O4XA 3FLTA 2CUZA 1WA4A 5FZGA 5FLXZ 2NNYA 5A80A 3MFCA 4GMP1 2F2EA 4BJTA 3OYIA 2D6MA 1QXJA 5IHRA 2VKVA 1AL23 2OU2A 4I3GA 2EV0A 1NCRB 1GUIA 5JOZA 2ZXJA 1NLSA 2R043 3DYPA 4YVWA 1TME3 4DFSA 1EA3A 1GOFA 1Q8VA 4ZZDA 1UPIA 2V5YA 2PYTA 4BLIA 4DGWB 1SFKA 2DUOA 2QVOA 2VUDA 1S3JA 1PMHX 1CX1A 1YEWA 1S29A 2BBVA 2WQ8A 2JQ7A 4HSJA 1H2LA 2EA7A 5LBCA 3A2KA 1JYIA 1PGW2 5C70A 1WH7A 1CQ9A 2WTEA 3CMAI 2MD5A 4ZS3A 5F8PA 4XOTA 4Y22B 5CLSA 3S6PA 1KQ9A 2JECA 2QQ8A 2GM4A 2XG3A 5EG0A 4XLHA 2ZO4A 4SBVA 2ZC2A 4ZXKA 4D3WA 1ZBE1 1SEUA 2YYOA 5I0DA 4M3BA 1OFCX 2GIZA 1FOWA 2W1QA 2ZAAA 2G7HA 2R042 2F17A 3HOVJ 1TME2 2UV1A 4Q0VA 5LLQA 3WV6A 1UG0A 5M3MJ 1V6NA 5FYBA 2QVSB 4AR2A 3V8JA 2ZSIB 4C3HJ 5ABJC 1O91A 4PZJA 1RUD3 3T3YA 5ISLA 4CUAA 2BBYA 2LY2A 1R1A1 3PUFA 2A6XA 2DT5A 5J8CA 2FHRA 1OURA 4MXWA 3L2WA 5JVGF 2OA4A 3WU1B 1O4TA 3JRBA 1O3SA 4R1HA 2LC2A 4TYSA 4F83A 3ZCOA 3RYKA 4PHZA 3NARA 2OIIA 5CFCC 3KCXA 3GXUA 2J1RA 4N53A 1JYNA 3U1KA 2UU8A 4BISA 1WCMJ 4L2NA 3ETPA 1MNDA 4M6YA 2OT7A 4C1WA 5IVBA 1NXMA 3IBMA 2D7FA 5BPDA 3AMPA 4EQVA 1Y56A 2V4AA 3HJEA 1VQ8I 3HOUJ 2WAQA 1OH3A 2Y0IA 2RMU1 1HW1A 4CDWC 5FJKA 2JMWA 2IP2A 2VAUA 3CJIA 1APNA 5C4WC 2W7NA 3H1MA 4TLFA 3F8CA 4UI9L 4FX4A 4PJ0C 4XLEA 4BPZA 3OMYA 1IPKA 5DUUA 3MIFA 3MWMA 4UWDA 2NMOA 2OVUA 4F93B 1MZEA 1FV3A 1SFPA 4LBQD 2ZFUA 5JI9A 5E1XA 1OPMA 2EZLA 4CDXA 3F9KA 4FVVA 3ZFEB 1WVRA 1AJOA 1AUYA 1C8NA 1XPXA 6PAXA 4QDRA 1ASJ1 1W2UA 3DPTA 1OC1A 3BY6A 2COBA 3VOEA 1S7AA 3KYCB 1FC3A 3R4SA 3AG2H 4A3DJ 1HQLA 3UKGA 4Y4RA 3EYIA 1RUH1 2YC0A 2EIBA 5DS9A 2IVMA 3GNEA 3ESWB 4CU7A 4CU8A 1B35A 4ISQA 2AQFA 3OR1C 1IS3A 5FMDA 3QBQA 4MIMA 5DCFA 4CU6A 4HK8A 3B00A 4NNJA 1ZNPA 1YO8A 3KM5A 2CDOA 5HXVA 1FP2A 3EXUA 4AHYA 2W46A 3F95A 1D1BA 2XAHA 4IQPA 1UO9A 1ALYA 4Q4V3 5C3RA 2C0ZA 2V4JC 4FETA 4ONUA 4Y4YA 4W50A 1BM9A 3DPRA 3EUKL 2PA7A 1HKTA 2A68F 5F08A 3U14A 3IN9A 3ZIWA 1D1AA 1UF2C 3Q8AA 5IVVA 1US3A 1ZZ6A 3B3QE 2CU5A 1HX6A 3JW4A 4EV0A 3TGNA 4NWWA 4W8JA 4DUXA 3K70D 3RVHA 4UV8A 1T08B 2MG4A 1D4M3 2NS7A 3HXLA 1AR91 2Y26A 1FTTA 3QYFA 3BPSA 5T5PA 2RN7A 3OBAA 1I27A 1MMAA 3S5AA 4HPQA 2D6NA 2AZ5A 3WVJA 3CP8A 3S15J 1YHFA 4ATEA 3CMEI 4NHJA 3JCIA 1V6JA 1WJ5A 4QPIA 1O57A 4Q5SF 4M0NA 4Q4V2 2Y6KA 4N43B 5IAVA 3OL4A 3G3ZA 3J80Z 3N97A 3S57A 3OPZA 4MO7A 4U0VA 4JRLA 3S3MA 5FV3A 4XILA 2XOMA 4AAPA 2RS11 2M3AA 2V26A 4IOAF 1IDZA 4A7ZA 1H9PA 1Y8RB 2L9SA 4IRGA 4IV3B 1D4M2 2ZEXA 1MVQA 5FZHA 3SHFA 2E71A 1SLLA 2DJNA 4ITCA 3WF4A 4AEJA 1GNHA 4URTA 3HPNA 2WO3A 4OUEA 3KGLA 3BKZA 5M5XJ 4P5YA 4FPYA 1TT0A 4XR6A 4ZU4A 2KFDA 1UL9A 4PJLA 3ENRA 1F5JA 1X1BA 2LW8A 1T0FA 2BVLA 2H8RA 2WKKA 3UNGC 3DF0A 1YQ2A 1WJFA 5FY5A 2W2IA 3H8RA 1EJ9A 3S7EA 1U5YA 2ATFA 2FQ3A 3I2OA 4LG0A 3AL5A 4IHTA 3N05A 1XQNA 3A1YA 5A32B 1IOAA 3KX2A 1UCXA 4JVAA 1K12A 4ENKA 2Q2EB 4RB2C 4IDZA 5B3SH 5FY0A 2VCBA 5E6HA 2E7QA 1BC7C 1W8ZA 3EJKA 1PP7U 3IRQA 1V6KA 1F36A 4MGIE 5F27A 1WRJA 4JDNA 1CJPA 4OMCA 5BUVA 1W90A 3ST7A 2F6BA 2CYYA 3VZJA 3F2ZA 1EUUA 4D94A 4XABA 2P3JA 2XWJB 4P96A 2WNUC 1FNZA 3RGBA 1GWKA 5GLZA 5DAPA 1W8HA 4KMQA 4LB6B 2RS53 1QZEA 1YFWA 1MZFA 1PP8F 2HQNA 4BQWA 5GP9A 1JU3A 1KD7A 1RC6A 2G1MA 2WZ8A 2XHNA 2RJKA 4NIAA 3K4LA 2ZZJA 3BR0A 2Z16A 4LLNA 1WKMA 5LGUA 1TG7A 1RPWA 1C8M3 1TNTA 1AYN1 5BY5A 1Z3YA 4XLCA 5EJCA 2EIKH 1W03A 4OHYA 2WWYA 4R9BA 1G7YA 3D0SA 2OZJA 4LK1F 3VBSA 4BM8A 1EV11 1C0WA 1P2FA 1Y9MA 2JA5J 3R4DB 3JREA 1B1BA 4XJ8A 1ASJ3 3NAPB 3ZFFC 1TWAJ 2ZGTA 4S2FA 3BC8A 1VBD1 3ECHA 1D7PM 3ZN1A 4KICA 2P8TA 4A7KA 2XC7A 2RS52 3M70A 3FUOA 4XDQA 2XLFA 3BR3A 4HNTA 3VKOA 1JOBA 3WTZA 1UOGA 5E20A 4PIXA 1C8M2 2W57A 3LCPA 1ON1A 4C9YA 1G3TA 1FX5A 1TNFA 3O0VA 5IYBJ 2BV4A 4EZ4A 3MBWA 4ANJA 3CJQB 4JX5A 2CFOA 3BPZA 5HVQC 2Q8CA 2NLRA 1R64A 1ASJ2 2EAKA 1X9TA 3EPZA 1S0CA 4LE3A 2CWMA 4W65A 1FOXA 3LA2A 3LD8A 4PK4A 2X1DA 4DW6A 4ZTJA 4AI2A 1T6BX 1DLLA 5IK8A 2G9WA 4YEJA 1DQ5A 1W2TA 1VQMI 2QJVA 1MZBA 5FYCA 3BROA 1LOGA 1OSGA 3GCXA 3MQ0A 3H0DA 1BLZA 3BLYA 3CUQA 3UESA 3BTZA 2O9LA 4YM3A 1SLAA 1U5TB 2HWVA 3PTRB 4QX7A 5J09A 3RQ0A 3T1MA 3H50A 4HN1A 1K7AA 2PAMA 3HEIA 1GV9A 4QKFA 1SD6A 2DXIA 2ADEA 1UWWA 5LA2A 4NR1A 1P4AA 1URXA 2WZEA 2OPWA 4WVVA 2A07F 2E19A 1BW6A 4M3CE 3DPUA 2DCKA 1E5RA 1QH7A 2W1SA 5FREA 2I5UA 3S5QA 1SANA 1DIWA 3L7WA 1N77A 2L2OA 4QGLA 1HJGA 1STMA 2JRTA 2VU9A 3L2RA 3J7YJ 4CXYA 4BQXA 1AF9A 1W5CC 2H0VA 3H42B 2VMCA 1MJ9A 3LEMA 1RIRA 1B09A 4WM8A 3FXUA 3ZMVA 2IGMA 2HYXA 4X0GA 2A6HF 2VBPA 5EZWA 3P9KA 5FRAA 3HOWJ 1OYWA 5K5RA 5HDKA 3FHIB 1O3QA 1M4WA 4QPOA 3I97A 2JIGA 1G3YA 3HRUA 3FE5A 2AGSA 2KZVA 1EAH3 4Q48A 4XTPA 1R71A 1XXNA 5FZ8A 2FOKA 4FPOB 2KIMA 1CAUA 3K4AA 4QIWN 4EGZA 2RM21 1EUTA 4FQGA 3SDBA 1IN7A 2WT0A 4AXOA 1O4ZA 2KHMA 4IO9F 4YIFA 5CA6A 5HNFA 2X53S 3NQOA 1KQ0A 2QZ8A 4UV9A 5L3DA 2QE3A 4FAGA 1UKRA 3T1BA 5BNNC 3FXLA 2YFUA 3G6JB 3OYFA 2MBFA 3DEWA 4XHXA 5AIQA 1DGWX 4A42A 4Y1VA 4Q8KA 1CPMA 2F4MB 4KQ7A 2OX0A 2VOVA 3WT3A 3GW2A 4GYIA 3LFIA 3LSPA 1JUMA 4RAZA 2VQAA 1MEC1 2M7BA 1EAH2 1PX3A 1W3XA 2X10A 4NHMA 3TW7A 4BLJA 2BW3A 5IK7A 3IDAA 4HL0A 5FTTC 1JI6A 5ANQA 2L7FP 3RMYA 1I1GA 2EIMH 5HDNA 5BPIA 4FPFA 4I30A 2DURA 4YYOA 3NEUA 4BK4A 1HBXG 4BJ5C 5EHDA 2FBIA 1W28A 4A7YA 4LKDA 1HB2A 2C24A 1HV1A 3J7MA 4URAA 5A1LA 3HD8B 2IPQX 4TV7A 3PNTA 1NT0A 5CAZA 1OOPB 4PCQA 3WNLA 4NC6A 3JQXA 4DEQA 1HV0A 4K20A 2A6TA 4XLAA 3BTAA 5BNOB 4DO0A 2XPUA 1LGNA 5AVPA 2WY7Q 1N1TA 2WO7A 5J37A 3TKYA 2BXZA 3J7ZI 1RHI1 1UX6A 1ND2B 5CVRA 4G6QA 1XE8A 2ZGUA 4QQ2A 1KFUL 3VN4A 2WYFA 2GMEA 3BG9A 2JTVA 2XVLA 1VTNC 4L9JA 1UZYA 4ZZLA 4RHV3 3JUUA 5IYDJ 2R061 1MMNA 2IXKA 1X3UA 4IERA 1XTAA 1PVC3 3VWBA 2NQYA 1E3PA 5FQ0A 4GQ7A 4J00A 1LVKA 3O7OA 1KU7A 3NNJA 3OUHA 2W85A 5F0HA 2GLOA 3FN9A 1J3RA 2EICA 2NS8A 5GPCA 4XFHA 2Y6JA 2VVDA 4AL9A 4EJWA 2YU1A 5HLHA 2H1LA 1GP6A 3WCRA 4BIOA 3JD71 5FPAA 2RQPA 4EQQA 3MZYA 1U8BA 3EB7A 1RL3A 1MD0A 2X48A 3DBRB 3ONQA 1QJY3 1QIQA 2VCCA 3BTLA 1H2KA 1HKDA 1LEAA 4B3NA 3PVEA 1JMUB 4RHV2 4A3BJ 2B5HA 3ZOIA 3MPPG 2TCTA 1UAIA 2BWAA 5CADA 1V3FA 3AKRA 1MMGA 3AYAA 1KQRA 4XRSG 4YFKF 1PVC2 3HNBM 3AJZA 1ZLJA 5CVJA 2J1VA 1LDJA 1JS9A 1XSQA 2XB0X 1R081 3KWVA 3W21A 1POV3 2JWPA 4Q4Y1 2VE8A 2Y38A 4JQTA 2NOGA 2YU2A 2VZUA 3IMNA 5JI7A 1Q56A 1IPJA 2FDIA 2DFBA 4OIOF 3K75B 4CDUC 1EV7A 1UY1A 5DAQA 1G9FA 5FRNA 5C8CC 1FAYA 3DXTA 1OFSA 2DA6A 3T8RA 1QJY2 3HOTA 4ZDLA 4BS9A 2WZR1 4A3GJ 4XFBA 4J1WA 1BBT3 1H9WA 2VH9A 3WF0A 4WBBA 3G4SI 3OD0A 5J3UA 1H30A 4NOTA 4WXDA 3POGA 1GOHA 3SYTA 2XBO1 4Q29A 4TSVA 5LRRA 1COV3 3LSDA 3IHUA 2YXSA 3QOPA 3I4MJ 3U21A 1IQAA 5J36A 3P5BA 5FO8B 4XN3A 1IS6A 1IG0A 2ZMEA 3WR0A 3T8TA 2WT2A 1DPUA 3IWZA 2CAUA 2Y6HA 3DEEA 1ON2A 1SLTA 2EFQA 3K3OA 3C7HA 4GD4A 4PJNA 2P6HA 1SPPB 1GUUA 1QZYA 1VALA 2X5IB 3OS1A 2CQ7A 5FPXA 1NYWA 4J6GA 1MQTB 2KPMA 2RJLA 2DYCA 4XICA 1PO11 5CVIA 3L1PA 1LNWA 2E34A 1IZ1A 4J01A 5JMOA 1Q5OA 2BYVE 1W6MB 1D4VB 1XJAA 1BBT2 1PM4A 3TN92 2R7OA 4PIZA 3W6JB 3R4UA 5FGMA 2YY1A 1VZ0A 4EN9B 1ACCA 3I59B 1COV2 1W06A 2L9LA 5LBEA 5A3MA 1BQPA 1MEC3 1IXRC 2FJ1A 5LRSA 3MFKA 1XNKA 4Y1UA 1DYOA 5BMZA 1K78B 1X1DA 3J7AY 4JZRA 2ETHA 3M1CA 2ZGRA 1GZWB 3QPTA 1NCRA 5A3OA 1JZ7A 4EMSA 4D7YA 3ACIA 1K6OA 2JDUA 4YW1A 1WMFA 1LUJB 3JZVA 4AVBA 5E88A 1IZ3A 3UYJA 2GA1A 5FZFA 1I9RA 4FCAA 2HWB3 2QQIA 2DQLA 1L3LA 2O14A 3I71A 3F8MA 1DF0A 4OHWA 3OYMA 1FPN1 4QU1A 1UYXA 2C26A 1XGMA 5IFTA 2P4EA 2CAVA 3OIOA 2RR13 4A3LJ 1MEC2 3BZKA 2PQSA 5FP3A 2OC6A 3B6CA 4H7LA 1B59A 2JN6A 1HXS1 5LY1A 3FISA 2LK2A 1RUNA 1LOAA 1XGOA 3I2FA 3V4GA 2YU3A 1A6CA 1UMQA 4HT1T 3UJOA 3NV3A 3DKWA 4I02A 1KGYA 1X8EA 2BUKA 2Q8DA 3ABUA 1ZQ3P 2HWB2 2WINB 3VHRA 4K40A 1TP4A 1LVAA 3G1LA 1AR63 2IAIA 5ERIA 1XC6A 1X9PA 4QB2A 4CEYC 2RR12 3J81Z 5IT9K 2CY6A 2ECBA 1OXCA 1F1ZA 1UY3A 2D5FA 5FKBA 1OYIA 3DLLF 3KQ4B 3JD73 2V09A 2NAZA 4UUSB 4PFPA 4UBGA 5HS9A 1XX5A 4RGUA 5CQEA 2DA2A 4XSZF 2B0LA 3S30A 4DY3A 5JIUA 3J8F3 2HOTA 1OQ1A 1BVVA 3VUOA 1GKBA 5AVAA 1PK6B 3SFZA 4MFEA 4QLCU 2O7OA 2PXJA 2DMPA 1QY4A 1AR62 1JGSA 1NUKA 1HRI1 5A7SA 1E3OC 4CCEA 3DU6A 2ZMKA 5L7OA 1LOBA 1UZVA 2BZDA 3CEWA 4GWIA 4GYGA 3RZZA 3N9LA 4NUBA 3AZWA 1CAWA 4LPLA 4C3JJ 3AFGA 3L2HA 1KS5A 2WNVA 2B9SA 3JD72 3ZFEA 3ZR6A 1OF4A 5DCMA 4LIVA 5C5UA 2L3DA 4E2SA 2WS91 3PJRA 1LFBA 1FMD1 5JIAA 2GNTA 2WZR3 3I3EA 4FASD 3WSOA 3CD6I 1Y0NA 2ARBA 3J8F2 4Z2WA 4CDQA 4BXXJ 4RS5C 4RYDA 2EAAA 4Z2YA 1YLLA 2A61A 3BTJA 3RPQA 1XE0A 4PF1A 2HPMA 5FKLA 4BEHA 1AR81 2DQRA 2WADA 1UYZA 3OG2A 4J25A 3B7MA 2VKDA 3MKZA 3N9OA 1OKRA 4O7XA 2XRNA 4Z2AA 2RVAA 1WQ2A 4Z6YA 1G3WA 4U0YA 3DXUA 3ABZA 4FBFA 1A8DA 4GALA 1T95A 4ZYAA 2KD7A 4PGGA 3GEZA 2V1XA 5FLIA 1WZXA 1UHSA 1VBE1 2WZR2 1H0BA 3PTYA 2D6KA 2TDXA 2PFBA 3Q9VA 4D69A 1DDNA 5K7FA 4EJVA 1PGL2 2A5ZA 3WTWC 2UY8A 4CA9A 1BR2A 2VUMJ 3ALQA 2JA6J 1QJX3 3PQJA 5J40A 1IJWC 1H8TB 4YRDA 1OLTA 1X3WB 5KHHA 1IO2A 1LGCA 1S2KA 5ED4A 5E18F 3AKQA 2IGOA 5A7WA 3BR1A 4RAGA 1OQEA