4I2OA

The structure of fixk2 from bradyrhizobium japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAMTAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDIGDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FixK2 protein
publication title The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transcription regulator/dna
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i2oA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i2oA01
2Z5UA 5BPIA 1KYWA 1TW3A 3ZMDA 3DEUA 5CADA 1P92A 4IEQA 4I01A 3CL1A 5DUKA 3WTUC 2FBKA 3E5UA 4I0AA 4XETA 4IEVA 3I59A 5HDNA 2LDUA 3KP3A 4JTNA 1K7AA 3H8UA 4NVPA 2GWRA 4O9EA 1FP1D 3CTAA 2CFXA 3I53A 4LLNA 5HI0A 2JPBA 2IRFG 1UHWA 1LJ9A 1LDDA 4G94A 5AVPA 3BCWA 1QGPA 2FMYA 3ECOA 2Z33A 1YFYA 3ZMSA 5H6RA 2LF7A 5ILSA 4X6QB 2Q30A 3DQVC 1QY4A 3LWCA 2KXLA 2PAKA 4LULA 4D7TA 1IN4A 1XGSA 4QGLA 1EPZA 1WQ2A 3CO6C 4M9SA 2FE3A 3D0SA 3LFKA 5J8CA 1G4DA 4B29A 1ZREA 3JSOA 4ZZDA 2VBWA 4L11A 2IT0A 5JR7B 2DK8A 4XFIA 1R5HA 3HSFA 1ZX5A 4HW0A 1ZH5A 1STZA 3C7JA 4A0YA 2F2EA 2HGCA 5E8IA 1HSJA 4ESBA 3WU0A 3I64A 3ZMZA 1J58A 3HUGA 3M7GA 3VFZA 4LK0F 3HYIA 2O1QA 1J59A 1X8MA 2GC0A 3BZ6A 3K1NA 5HS7A 2CAVA 1IXCA 1J3PA 2PG4A 3U11A 4MTDA 1PMIA 2J5OA 1I1SA 4L2NA 1ZNPA 2VOOA 4M9ZA 4I09A 4Q0VA 3GZ5A 4HV5A 1Y0UA 3V7CA 3FX3A 1LB2A 2L54A 4EGZA 3IRRA 1LDJA 4META 4IRHA 1UCXA 5FO5A 2P5LC 1O3RA 2B5HA 5ERIA 3IKVA 1SD6A 2IXKA 3BDDA 5BPXA 2OU2A 4HDUA 4XFFA 2IA2A 4YFKF 2Z2SB 1HXDA 4ORFA 3Q9VA 4XF1A 4XSXF 2GXBA 3H50A 2UXNA 3ZDSA 4KL1A 4O5VA 3L7WA 3CLPA 3TOBA 3K9TA 2DBBA 5JHUA 1SFXA 3CF6E 1XRUA 5A2QK 1YFHA 4LUKA 3EETA 4J1WA 2D40A 1WRJA 2BBYA 4WVZA 4AVAA 2X4HA 3QU6A 5L3GA 4KFCA 2DPDA 4MZUA 4IHSA 2XLGA 3I4PA 1FC3A 3S7EA 2TDXA 3BB6A 2DPUA 4BHPA 2LF8A 1PP7U 3GBFA 2BNNA 1LNWA 5K1YA 2L3DA 3GEZA 4UHTA 2W25A 2M1BA 4EWDA 4U0WA 2K4BA 3S2WA 3WE3A 1UPIA 3I71A 1EP0A 1G3SA 3MFKA 1I6XA 2IVMA 4I98B 5FLXK 4LA2A 4MGKE 4PGHA 1G6NA 4HX4A 4LLLA 1TTYA 5FQ0A 4OIQF 3Q9SA 2ZNYA 2GIVA 4LLGF 2IXIA 1BI0A 5KHJA 4LTAA 4JK1X 2YPRA 3PQJA 2XAQA 5D5WB 2ISYA 4RGXA 2K4JA 3KE2A 5JSOA 5E20A 5KHGA 2Y75A 4XLPF 4IXAA 1Z91A 1FT9A 4HN1A 3WE2A 2BNOA 5L3CA 2HYFA 4EJUA 3KGLA 1EYBA 5F64A 3V8LA 3TNQA 1SFUA 4OFGA 1QXJA 3FXUA 4Q0SA 4KIGA 2OA4A 3M9AA 4KN7X 5ICEA 3F72A 4OOIA 3WGHA 4EQQA 4KNYA 4MNUA 2KJCA 1KYZA 1DGWA 4L9JA 3P9IA 4EJOA 3O14A 3JZVA 2Q0OA 2ZO4A 1ZN2A 2V1DA 4ENMA 4OMYA 1U3EM 1QZZA 5E1XA 2EV0A 3DFGA 2NNYA 2V09A 5JAXA 1QQIA 2FU4A 4HAMA 4K8FA 4XFAA 3BALA 1Z05A 3WTSC 4HOBA 2M30A 4Q29A 1Q1HA 5L3BA 1R1UA 1RIOH 2XL7A 3I7DA 2HTSA 1ZLJA 1AWCA 3FWEA 4XF9A 2FNAA 2OQRA 3BROA 4CICA 3TDZC 4IJAA 1BI1A 1USSA 2HFHA 1ZG5A 2DAOA 1UD1A 5I91A 2ZNZA 3ST7A 3M1EA 4UVBA 5KK1A 3M3IA 1RTVA 5I8TA 1ZG3A 2K02A 3RPUA 5BS6A 4U88A 2XRNA 2O0YA 4HLYA 2V79A 2D1VA 2E7WA 3DXJF 2O6GE 1Z6RA 3L2HA 2PYTA 4YFNF 2A3SA 3GXOA 1L3LA 1U2WA 3FZVA 2VOPA 3V8JA 4IEPA 2R3SA 1ZZ7A 4WX9A 2MLKA 3WTTC 2VONA 2VC0A 3RTRA 1K78B 4BNCA 2Z3YA 2Q4SA 2R7DA 4Y17A 4RS8A 3FJSA 3BJ6A 3KP5A 4AVCA 1WGPA 3FMRA 2NS0A 2WWYA 4HDVA 3IKTA 1HW2A 1U12A 1YIOA 1DGRA 3I0TA 2XKPA 4UV8A 4ENNA 1J9IA 1X7NA 4XFHA 5FLHA 4YFXF 3G7DA 5I0UA 1SFNA 1P2FA 2YU3A 3QOPA 5FCCA 2EVXA 5EEHA 2V1UA 2VN2A 5FB2A 1SAXA 5DYMA 2FA5A 3BU7A 4IPAA 4GYIA 5D5UB 2DI3A 3GWZA 1CAUB 3WW4A 4HSJA 1IW7F 1QXRA 1U8RA 5HVQC 5I0TA 4M72A 1O4TA 4E2GA 3EUHA 2HQNA 4LUMA 4BYYA 4GCVA 3U2RA 1NHAA 4LD5A 1KU2A 2PBIA 4WXHA 4UBGA 5AIPA 3EYYA 5TJJA 4MUVA 3UKTA 2L01A 3RKXA 2MHFA 1YFWA 3NKTA 1SD4A 2EK5A 4IEUA 2YR2A 2H09A 3CUOA 4P9FA 5DD4A 2XUBA 1S7AA 4P9UA 2JSCA 5J8FA 3QACA 5K5OA 2A07F 5TRDA 5I8SA 3I59B 3BOQA 2CAUA 2EV5A 1I27A 2D2WA 4JQFA 1YW9A 3K1PA 3OD0A 1MJAA 2EA4A 5LHGA 4G7OF 1IN5A 2DT5A 4E2SA 5LBQA 2ELHA 4CGZA 1UHMA 2P5VA 3VODA 2CW0F 5ICGA 5CU1A 2A61A 5CVJA 2F5DA 1VR3A 2N7GA 3GW2A 3HHHA 1U5TC 6PAXA 2E1NA 3VB2A 1CAWA 2VBYA 3U1DA 5EFUA 5LEJA 2AXLA 1XE7A 1YS6A 1W5SA 1Z6TA 4MQ9F 1E17A 1IN8A 1AOYA 4YIIA 5H20A 3JTGA 1ZHFA 5FD5A 1ZZCA 1KU7A 3DPLC 1R22A 2P6TA 2VT3A 2BNMA 3K0LA 4HQMA 1PUEE 1EV7A 3HIFA 3WW2A 4DINB 1WSUA 4Q0PA 5I93A 1QO0D 2Y48A 4A12A 3R4KA 2XIGA 2JPCA 1LQ1A 3E6DA 2BYVE 1D8JA 4YSFA 4Z2YA 3D82A 4M9XA 1BIAA 3DKWA 1H9GA 5LGTA 4ZYEA 2ISZA 4PIZA 2GH2A 4MGZE 1CAUA 4WXDA 5IT9K 2EJRA 1W4MA 1OD5A 3OF1A 3MZHA 1O7LA 5CJ9A 4OU0A 3GO5A 4MEYF 2A6HF 4OIPF 4L9VA 3GVAA 1TLHB 3DP7A 1UB9A 3J7AO 1ONVA 3OOPA 5FLXZ 4WXCA 4BHBA 3H92A 3ZMTA 2V1XA 1NYWA 3R0JA 3D5LA 1K6OA 4GGGA 1R23A 4AQ6A 1O5LA 4Z07A 4MX3A 1MJBA 4WF2A 2VPVA 4IETA 4G6QA 2ZKLA 2ETHA 4G7HF 2ATFA 4IESA 4G7ZF 1Z1DA 2H6BA 2QLZA 4UVCA 3NSTA 1I1GA 5KHHA 5FFZA 3M8EA 3ZP5A 1FI2A 4H7LA 3FZ3A 2PA7A 4ENKA 1OPCA 1R00A 4ZYHA 1T0FA 3V7RA 2QBYA 1OYWA 3IHUA 5LGNA 1DZTA 3SHRA 3F8NA 1LEAA 4LA3A 4X6RB 4HF1A 3JAMK 4IEYA 1JHHA 2GC3A 3ML6A 4BHCA 4PGGA 4DNCA 1OR7A 2EV6A 5ICCA 1XMAA 1TBXA 2E7XA 4OINF 5FPXA 2D93A 3F6OA 3TOAA 1IPJA 4F7ZA 4XFBA 3RYPA 1B9MA 1R1TA 2W24A 1Q3EA 3VHRA 4KUMA 3FM3A 2EFPA 3BPXA 4QGMA 3QU3A 1IN6A 2P6SA 3HOTA 1B6AA 4A0XA 4E2QA 4EWAA 1IAWA 2HKXA 3E6MA 2PQ8A 3ABTA 5ILVA 2M8EA 3F8CA 3MDPA 3E5XA 3KETA 1IRGA 4RGRA 2QVSB 5L3FA 5FQ0B 3Q5FA 2DW4A 2AS5F 4H0EA 5CVIA 1X82A 3WTYC 3WTVC 3ETQA 1KGSA 5J7MA 2ZCWA 3HTUA 4AQ2A 1J1LA 2HYGD 1R1VA 1KQ8A 2RKHA 2XGXA 2YX7A 1RI7A 1O5UA 3EYIA 2K86A 2B9UA 4HVQA 2GA1A 3SZTA 4BIFA 3L9FA 1UW8A 4KMUX 2Y0MA 4EROA 3I54A 4L5JA 3U9GA 3U10A 1U5TA 5KHIA 1QZYA 1YQAA 3VOEA 1BC7C 1YYVA 4Z82A 1FPQA 2JZYA 1S7OA 3B02A 3E6BA 1KQ0A 1L0OC 2C6YA 2DTRA 4L9TA 3TQNA 1X8EA 1I5ZA 3CLOA 5D1IA 3KCCA 2QJVA 2B0LA 3SZPA 4LJZF 2ESNA 4FHTA 2QZ8A 2ZKZA 3KP6A 4CO8A 3S0MA 5BV6A 4HA8A 2O61A 1YTYA 1JUHA 5D4RA 4FT8A 4L0YB 2P5KA 2PHLA 5HLGA 2QNKA 3NQOA 3WODF 5LRRA 4LK1F 3NRVA 2EFOA 2JRTA 4FX4A 4RD7A 4MQVA 1HSTA 2MD5A 4HF2A 1IUYA 4ZYDA 3R0AA 3B73A 2CQKA 2OD5A 4JVAA 2QQ9A 2QVOA 2XASA 3OV8A 2OAZA 3BP8A 1WI9A 4M6YA 4EJWA 5KBFA 3TKYA 3UKNA 2QCSB 4ESFA 1JE8A 3LWFA 1BI3A 2Y0OA 5D5XB 3L09A 2QQBA 2VODA 1TNSA 1ZARA 2H94A 1ULYA 2ZBKA 1NE6A 4XLNF 1XSDA 2KIFA 2D5HA 2XV4S 3V4GA 2PLYA 4I0BA 5HLIA 2F5FA 3QP5A 1GXPA 2F4PA 3FM5A 5FFXA 2PN6A 5IT3A 4HVOA 1G3YA 2HKOA 1NE4A 1IF1A 5HS8A 3T8RA 5EZWA 4R8HA 4I3PA 1FXZA 2IPQX 1HKTA 1SMTA 1SFEA 3VEPA 3R60A 1LKNA 2K27A 3TO6A 3EDPA 1ODDA 2EB7A 2HJIA 3E5QA 3LOIA 3HSRA 5JI6A 3KLNA 3RI4A 1LR5A 3I58A 1W7PA 2Q0AA 3RYKA 3PFIA 1IN7A 5EEGA 3MAJA 2WC2A 1KA8A 2ZXJA 3KZYA 5T3NA 1JXSA 1CAXA 5E17F 3RDIA 4GULA 2QYOA 2UY8A 4MTEA 5LEKA 3ECHA 5H6QA 4R79A 2W84A 5ED4A 1F4KA 2CSOA 2RN7A 5DCMA 5BMZA 5CYVA 3RPQA 2VECA 3USSA 3JW4A 4N0BA 2B8MA 4A6DA 2KIUA 3QAHA 1OFNA 4B09A 3U0ZA 2XLFA 5HDKA 1U6GA 3GZ6A 2Z69A 2RQPA 4YARA 4JBAA 1SD7A 4JTOA 5FLIA 1W7PD 2NAZA 4M73A 3ISPA 3OCPA 1BJAA 3ULQB 2KJBA 2KKOA 3EQLF 1XGOA 1R58A 3CO2A 3TDUC 4HV6A 1DPRA 5IT9Z 1F5TA 3J80K 4OLLA 2M5WA 4IVNA 5JSPA 4HYEA 2FBHA 2PJPA 1VTNC 3IDBB 1OYYA 3F21A 3ES1A 1BBYA 3WTWC 2F5EA 2V6CA 4RAYA 4HMZA 1GHCA 5HDGA 1YW8A 1OKRA 2BGCA 3RIRA 4AD9A 1H1IA 2IXCA 3E6CC 1P6RA 3L00A 4MEXF 3FXQA 3RKYA 4Q48A 1OMIA 4U0YA 3E97A 4HBLA 5BY5A 3DF8A 2I45A 1UCRA 1IRFA 2EA7A 4ZU5A 2CG4A 4AIHA 1CX4A 1XDSA 1CAWB 4FX0A 4ZU7A 3RKWA 3SCHA 4AVBA 4XFGA 1T6SA 3JAMZ 2IA1A 2MBFA 4HZFA 4LG0A 1GVJA 1BC8C 4R52A 5C6CA 1O57A 2ETEA 3DV8A 3H1MA 4LMYA 4UBHA 1BIBA 3KGZA 2MH2A 2DFIA 4HX7A 4L18B 1FYLA 1O3SA 1F1ZA 2FOKA 2C0ZA 3GYDA 2GXGA 2KRFA 3BY6A 4RB1A 5FDBA 4TV7A 5JCTA 2L4MA 1YG2A 3QP6A 3LZZA 2K0GA 5FLJA 5JR3A 1FSEA 1XMKA 1B59A 4J1XA 1JHFA 1TQMA 5D8LB 2H0VA 5AIQA 3IWFA 5F1RA 1FP2A 2ACJA 3OGJA 4HN0A 5C8WA 1B9NA 3LSTA 1LRHA 1RUOA 3O2PE 1RGSA 3WW1A 4XSZF 1HKQA 3COAC 3SXYA 4YRDA 1KU9A 1Q5OA 2QM3A 1J75A 2FNPA 2WV0A 4UXAA 3TO7A 1MDMB 5JSRA 2EA2A 4I02A 3T1BA 2H27A 3GUDA 5FPZA 2BE5F 3PQKA 2VQAA 2V9VA 3E3VA 2QBYB 4OIRF 4YIFA 1DDNA 2HEOA 3BPZA 1QBJA 5DEQA 4U7DA 3ZMVA 1NXMA 2QDRA 3M70A 2QWWA 4XF3A 1TW2A 3UKVA 3TO9A 4MGYE 5D5VB 3MZYA 2O03A 2L4AA 3KSCA 2A68F 2EAAA 4HF0A 2Q1ZB 3RZZA 3V8KA 2FEZA 4MGRA 1ZGJA 1CF7A 1IPKA 4WBBA 4KT5C 1BM9A 4L5IA 1MJ9A 3H1WA 1HW5A 4KU8A 2CWEA 4IRIA 3MYXA 1Z7UA 1DZRA 1YHFA 2GU9A 4IRGA 1ZG1A 4BXUA 1W5TA 4B8XA 4I7HA 3CUQC 3H3ZA 4QXKA 1USTA 4KDPA 4ZU4A 3C3WA 2X0LA 1JGSA 3HSEA 4KWKA 4PIXA 3ROUA 1BN5A 4RB2C 1LDKB 2K7LA 4PZJA 3CJNA 2VBXA 3WW3A 2A69F 5D6FA 1NZCA 1LEBA 2WFPA 5E18F 2RC4A 4KICA 2IJLA 5L3DA 1PM7A 3MPBA 3EHKA 4I2OA 3ZQ7A 4D0PA 3IIAA 4S04A 4WK8F 2COMA 1ZGAA 3F8MA 3LAGA 4U0VA 2OPKA 3OTFA 2FBIA 2FXAA 2M45A 5LGUA 3IDCB 3KEOA 1ZRFA 1U5TB 4HSLA 2D1HA 4QM8A 3WTXC 2K9ZA 2MH9A 4DQ2A 2IP2A 3KP2A 1MGTA 2LSOA 1YLLA 1B1BA 3HOSA 3T5XA 3HQXA 1YFUA 2OYZA 3CUQB 3MWMA 3F8FA 2IXJA 4Q47A 4A0ZA 1FBUA 1MDMA 2G7HA 3ZPLA 1GXQA 5FD6A 3GLXA 2XAFA 3NL1A 1T98A 2A5YB 3J81Z 4IEXA 1ZZ8A 4KYWA 2PEXA 1YUDA 3GFMA 3RNSA 2GC1A 2IA0A 3ELKA 3CEWA 2F5CA 2MPFA 4XFCA 5F6FA 3M8FA 1IXSB 4GXOA 2LNBA 4FAHA 1V4RA 3NJZA 2E1CA 1PP8F 3BJOA 2BEOA 5DV5A 5HLHA 4R1HA 1ZVFA 2PI0A 2XAGA 4KWLA 3FHZA 5LHIA 5BOXA 5BPDA 1X3UA 2ZMEA 4PCQA 4HBNA 4QLCU 3LQQA 1G3TA 4IERA 3EJKA 5D4SA 3IC7A 1ZAOA 5LLQA 4M71A 4RB3C 1FY7A 1J2XA 1MKMA 5I8YA 3F22A 3PVBB 4Y15A 3C3VA 2JT1A 2ZFWA 1H0MA 3ELNA 2IXLA 3ZN0A 3TNPB 3WGGA 3ES4A 2HQRA 2OZJA 1B4AA 4RGSA 4LB6B 3J80Z 3PNAA 3GF2A 1H1MA 3G73A 2O8XA 1REPC 4N9HA 1MZBA 1XB4A 4ZYGA 4M6XA 3DL3A 4QGNA 1DP7P 3FHIB 3G3ZA 3H9AA 1KU3A 2EFNA 1V3FA 5JFRA 2DK5A 2DU9A 4A5MA 5HOOA 5L3EA 3HTSB 1W7PB 5E8GA 5DD8A 1ZRDA 2RNJA 4P96A 4O3MA 4IEZA 3FMQA 3CO7C 3KLOA 5E16A 1CAXB 4HX8A 3CUQA 4MH0E 4KWJA 5LRSA 1FLIA 1ZYRF 3HT2A 4RB0A 4YYOA 1XE8A 4OMZA 4O9GA 4RAZA 4FAGA 3O6BB 1IXRC 2GAUA 5DCMB 4PIYA 2UZKA 1XCVA 4CDGA 3D0JA 4ON0A 2BV6A 2PMUA 1S3JA 1XD7A 3LA7A 3IRQA 3WGIA 4LEJA 4AWXB 4KIBA 4QWQA 2MNGA 2HDCA 2A6EF 1HKSA 3QPHA 4EM2A 1A04A 1SMYF 2EWNA 4Q0QA 4D7SA 1D5VA 2CGPA 3EQEA 3LA2A 2IC1A 2OA2A 2LKPA 2OZUA 4M74A 4EV0A 2IW5A 2PMHA 3NVCA 4A2UA 2O3FA 2E9QA 4ONUA 2H6CA 2STTA 2QQAA 1K79A 4NQWA 4Q5SF 1SEFA 3W6JB 4UVAA 1T39A 2D45A 4G6DA 5JVTA 2QENA 4G9YA 1Z9CA 4KN4X 2G9WA 4AIKA 5BXXA 5AONA 2VE9A 1Q43A 4N9IA 1TQ5A 1T38A 3IBMA 1S6LA 2XL9A 3IL2A 4CZZA 4ZZLA 4NB5A 1EY2A 4KA4A 5D8KB 1OYIA 2ZJ2A 3KZZA 1VP6A 4UNOA 1J3QA 5KVRA 3J81K 4O6JA 1BI2A 2OQGA 4YG2F 3JSPA 5DDGA 4GO1A 2NNNA 1XSVA 3SCFA 2NRAC 4QX5A 3LA3A 2Q8KA 1Y3TA 3LAPA 4LG0B 3SXWA 3K1MA 1BOAA 2XHKA 5BUVA 4EM0B 3TGNA 5K5QA 1RL3A 1XDUA 3HHGA 2GC2A 1C0WA 1VJ2A 3QPTA 1RUNA 2ADUA 1GQGA 4E70A 1YWKA 1WLTA 1XN7A 1P4WA 2PFBA 5FGMA 1QWRA 1TQPA 2UXXA 1FZPB 2UWMA 3H3UA 1HW1A 3I5UA 5DCFA 1E2XA 5K5RA 2RDPA 1FNNA 1RZ4A 3KP7A 5I0SA 1YLFA 4RGUA 1O3QA 2OBPA 1U78A 4HLTA 4PJYA 3WU1B 1Y9QA 5CLSA 3H1YA 4WWCA 4QMAA 2XAJA 4WCGA 2DCTA 4HVRA 3FFQA 1FYMA 4XRFA 2EFWA 4MGIE 2P7VB 2FMLA 4OIOF 3KEQA 1FYKA 3QRFF 1UFMA 3N97A 2L02A 4XBFA 2XLAA 1FOKA 2ESHA 1UIKA 4YNIA 4FBFA 3KP4A 1DPUA 3L2CA 2CO5A 3DPTA 4A6EA 2HS5A 4ASNA 4UXNA 1CGPA 2FSWA 2MC3A 2HTJA 2VXZA 2GZWA 1O3TA 1KQ9A 3C18A 1WKMA 3WTZA 4EJTA 1D3YA 3RYRA 1ZZ6A 3PLQA 2DQLA 1GQHA 1J3RA 3F3XA 5CVRA 2YSRA 4MV2A 1V70A 3WG9A 4S05A 2QUFA 1DUXC 3SQNA 3FE5A 4BQAA 4CHUA 3O3KA 5I0RA 1J0RA 2PAEA 1EH6A 1HBXG 1IZ1A 5E1WA 1CAVB 1F9NA 5ILUA 4P5OA 3F23A 3K69A 1XSXA 4EWEA 3REOA 3RJPA 2GA2A 1CF7B 4Y13A 3SMHA 4UV9A 1P4AA 3HRUA 1SQ4A 3DN7A 3W6KB 2Z9OA 1SD5A 2P17A 2NYXA 4AIJA 4ENJA 2VE8A 1YS7A 4EVIA 4UUVA 1FWZA 2RGVA 3EBRA 4XF4A 2YX4A 4AVPA 5E1RA 1FBSA 4EJVA 2VT2A 3GFLA 3BWGA 1OI6A 5DUIA 3S7IA 1O7FA 1R7JA 5KHKA 3K2ZA 3ACLA 2HWVA 4L9NA 5ICFA 4Q4ZF 3AAFA 2CYYA 3MQ0A 2P4WA 1RC6A 2MA3A 1L3JA 3JTHA 4CYDA 4KU7A 4JV4A 1G3WA 1LVAA 5BQTA 2UYAA 2RVCA 1WWXA 1EH8A 2P8TA 1XCBA 1EH7A 5J48A 3SFZA 3CDHA 2DO7A 2Q2EA 1S29A 1ZRRA 3H7JA 4A5NA 5CVUA 4HLXA 4G8XA 3LAJA 3FMSA 1FSHA 1R36A 4ESJA 3MCZA 2XKOA 5E1ZB 1YW7A 4AXOA 3N4MA 2GQQA 4NHJA 1R5GA 2EFQA 1T2KA 2XROA 3CJXA 2PTMA 2MLGA 2PQQA 2HOEA 4IF4A 1PDNC 4U7BA 1H9TA 2J5PA 2PAMA 2VC1A 4F8AA 4BAYA 2R7FA 4L0ZB 3LQRA 1D8KA 4K2EA 1FBQA 2IXHA 1ON1A 3EO6A 3HRTA 3GFJA 3SCGA 1ZZ9A 3HRSA 3BPVA 4EMSA 3ABUA 2PHDA 4EM1A 4IEWA 4P55A 1FX7A 1CAVA 2W57A 3GX4X 2RV8A 3NW4A 2CV6A 3C1DA 3KMHA 2FRHA 4ETSA 4BH9A 4PDKA 2FQ3A 3GYHX 2G7UA 1ZRCA 1ZZBA 1TQIA 2ZMEB 3HRMA 3NEUA 3ZN1A 3H7YA 1ON2A 1QNTA 3P9CA 4TLFA 4WZCA 1YO5C 1UIJA 4IEOA 1QPMA 1K78A 4MHGA 2ET1A 1MD0A 2XAHA 2WTEA 4EGYA 2OZ6A 1ZLKA 3GFIA 3KFWX 4KMFA 1HQCA 2KIMA 4QM9A 3IWZA 4KIFA 5A2QZ 3R6SA 4LLOA 3ERED 2UY9A 3V7SA 1TNTA 3BJAA 5D6EA 2P7CB 5J3UA 1XGMA 5J6XA 3P7NA 4HQEA 3T0YA 2VBZA 4P9GA 1J5YA 4LB5A 1YFXA 2STWA 2HZTA 3F8BA 2O8QA 2UYBA 1RNLA 3ZMUA 2W85A 3T8TA 2JTVA 2D5FA 4ZH4F 2HR3A 3FXRA 4XF0A 5CVVA 4Q0UA 4GYGA 2PFWA 4IHTA 3MEXA 2ET7A 2Z99A 4LFUA 3SHFA 4CXFA 1S8NA 4LGWA 2M87A 3FF5A 1J7KA 5K8SA 3R61A 5HS9A 3P9KA 1WA4A 3F6VA 2DLLA 5LHHA 1XGNA 2FF4A 1P4XA 2DQRA 2XVCA 3HT1A 2FQPA 4XEZA
chains in the Genus database with same CATH superfamily
2Z5UA 5GAGJ 4QB6A 1KYWA 1PMJX 5CADA 4CU6A 3ZFGA 3HDDA 4LORA 4W97A 4C8DA 3E5UA 2RR12 3ZXDA 1D1CA 2WNEA 1RUH1 3GCMA 3H8UA 1POGA 1G59A 4NVPA 2GWRA 3KT7A 3O1MA 3SEEA 4O9EA 3KV6A 1TMF3 1Y4WA 3ZMOA 3I53A 4LLNA 5IHRA 5H9PA 1UHWA 2LFBA 4G94A 3VZLA 5F7UA 1RMU3 2WZEA 4RR3A 4FXKB 3ECOA 5JVVA 2VNVA 3TOJA 3FDYA 4NQWB 2KMUA 1QY4A 2ZKNA 4E4ZA 4W65A 1TVGA 3LWCA 3LIGA 2PAKA 3THTA 1IN4A 1XGSA 2V5YA 4QGLA 1EPZA 3MIGA 5IVCA 1PZ9A 4HETA 5J8CA 1ZREA 2JDNA 4ZZDA 5BNNA 5DAPA 1LE8B 3RZJA 4YM0A 2DK8A 1J1TA 5H2FC 4NC7A 3GLLA 4HW0A 1ZH5A 1RUD1 1STZA 4A0YA 5IJRA 5FJ8J 1F15A 2HWB3 3LMMA 2XWJB 4HANA 1AJOA 1QHGA 4R4ZA 3HYIA 4WM8A 2Y26A 4S2FA 1IOAA 3RGBA 3DTEA 4C30A 3N9QA 1J3PA 3U11A 1JJ6C 1PMIA 3L2VA 1ULEA 4L2NA 1HB4A 1QHHD 5DZGA 4A3FJ 4CEYB 3LGRA 3GZ5A 1VRH3 5A3OA 3USUB 3V7CA 3MW2A 1Z0HA 3AVRA 5LY2A 1W04A 5IWFA 3GTKJ 3URFA 3VDAA 1XNDA 5FO5A 1WCSA 2B5HA 5ERIA 3IKVA 3LCPA 4FPJA 5AFBA 2OU2A 4IGPA 4YFKF 1ENRA 1HXDA 3Q9VA 2E71A 2CDPA 4N43A 2YB7A 3H50A 5M0TA 1GZ9A 4JC1A 4KL1A 4I6ZA 4O5VA 3L7WA 4EEFG 4Y1XA 5DDJ2 1ZQ3P 1BR1A 5DZEA 2MD0A 2DBBA 4IE7A 2E34A 4W1UA 4YELA 1VQ8I 3OUHA 4DBRA 2TCTA 4LUKA 2WNOA 5JLXA 1REDA 2BBYA 5C4WC 4MZUA 3GGLA 2ZMKA 4EZ4A 1UZZA 1JKOC 1GP5A 5CKMA 1FC3A 4ZZ8A 5IY5H 2OQ6A 2M4KA 1PP7U 1LNSA 2D6OX 3GBFA 5F3IA 1COV1 1M06G 2R0FA 5HNHA 3SQOA 3QPLA 2VXDA 1LU1A 2LD5A 2M1BA 2GNBA 1D2SA 3T1MA 1UPIA 2IVMA 1PM4A 3ZQGA 2HXIA 3S14J 4LLLA 1XYNA 3WDUA 2DN0A 4AHXA 5FQ0A 1OVSA 2CS3A 3Q9SA 4NDLA 1GDTA 1OVPA 2GIVA 4LLGF 4EE2A 3CF5F 1BI0A 4FTBA 2KFDA 2AQEA 2COBA 5E3OA 2P37A 3M3EA 3ZQLA 5C4WB 5BNPA 1A6QA 4YEJA 3MEPA 4IXAA 2WKKA 1VBA3 4HN1A 3HNBM 3WE2A 1OT5A 1ND3A 2E2JJ 2AYHA 1TL8A 3VN4A 5IVEA 1HJFA 3KGLA 3ZIXA 1R082 1QXJA 2HXOA 4KIGA 3CZ6A 3WU2C 3WGHA 1Y1VJ 2FZ1A 2FHRA 5KXBA 1DGWA 2CYFA 3RI8A 1OOPC 1JKQC 3JQXA 1QOTA 5IYYA 4EN8B 1VIWB 3K4KA 2V4AA 2Y6HA 4YVWA 4BZ4A 2RS51 2CDOA 3AZXA 5FY5A 5FAXA 2JDPA 2EV0A 1XC6A 4W4ZA 1FNZA 4K8FA 1Y9MA 2Y38A 4XFAA 1Z05A 2M30A 2WS92 1TT0A 3OBZA 4P1WA 3FHQA 5L3BA 2XL7A 3I7DA 1WW4A 3AFGA 4AAXA 4F3JA 5B4XA 5T5LA 2VPRA 1AWCA 3AP6A 2ZZJA 3BROA 3TDZC 4ISQA 1X2NA 1JU4A 4GH4C 4RGAA 1WLDA 3C8XA 3LEIA 1USSA 4DXSA 2ZNZA 3ST7A 2HDWA 3M1EA 1UY0A 2BW8A 4RA2A 3I2JA 1UNBA 5BS6A 4EYUA 1OOPB 2EAKA 5JLWA 3U37A 1W05A 2PYTA 1W8TA 2A3SA 1L3LA 4RFT0 1U2WA 1LJ7A 2VOPA 5F5AA 2VQGA 4BEHB 2C9AA 1LHWA 1R091 4QB2A 3S16J 2MLKA 2VONA 2WL1A 2RS13 5DAVA 4BNCA 4Y17A 4I99C 1UWWA 2BY3A 2LMDA 1WGPA 3AXEA 3IKTA 2ELKA 4GH4B 1U12A 1YIOA 1X50A 4UV8A 4BJ6C 4ENNA 1W2TA 2YROA 2VUJA 1VB4A 1KDKA 2VKVA 1X7NA 5ABJC 3PIJA 1XU1A 1W6PB 4NAMA 1P7JA 5L7OB 5FKBA 1VLNA 4EATA 4G6TB 3MLLA 3GZNB 2V1UA 1YI7A 3I4MJ 4Q4Y1 3HOYJ 5T5OA 1Y8RB 2CY6A 4JGZB 1QJX2 2XGEA 2DI3A 1CZSA 1E5IA 1CAUB 4OI1A 3M7AA 1EV13 4GZ9A 5HVQC 2CSGA 4KGGA 3HKZN 4M72A 1O4TA 4G3YC 3LDBA 4E7LA 1ZBA1 3EUHA 2HQNA 4BDZA 5HXMA 3CCYA 1KQRA 1UZVA 4GCVA 4OHZA 5IVJA 4LD5A 3WLUA 2WAQA 2HI3A 4BL0B 4XCAA 4PK4A 5F32A 1HB2A 3CDLA 2V73A 2L01A 2FJ1A 3RKXA 1RUE2 3JRHA 4IEUA 3SDBA 2YR2A 4P9FA 2ZA9A 1APLC 5GLWA 2XUBA 4M0HA 2R7SA 2VJ5A 2KDZA 1PX3A 5FIXA 3BOQA 4ZC3A 2D2WA 4JQFA 3K1PA 5GJ6A 2ZSIB 4CCCA 2EA4A 1DHKB 1IN5A 3DBHB 2OPWA 4AIDA 2JN6A 2JICA 4E2SA 2ELHA 3U07A 4CGZA 1UHMA 4AF9A 2P5VA 1PUFA 5ICGA 1PO23 3O0XA 4MVTA 4YW5A 3OGSA 4XIOA 1EPWA 1ULOA 4QX7A 3IAPA 1VR3A 2N7GA 3GW2A 4CRQA 4XR6A 4QKFA 5F3GA 6PAXA 2L5QA 5EYRA 3KVBA 3UJOA 1CAWA 3I9V2 3U1DA 5LEJA 3S3MA 3G4SI 3WF4A 1W5SA 1Z6TA 3K48A 3GZAA 1ZK8A 1HRV2 3UV9A 2A1XA 5H20A 4DUWA 1FMD2 3JTGA 1ZZCA 3NAPA 3CMMA 1BEV3 3MICA 3HIFA 1NY71 3WW2A 1WSUA 2RS31 1QO0D 5FZ9A 3V65A 3VDBA 2XIGA 1JOBA 2DMPA 3E6DA 2BYVE 4Z2YA 1W8NA 3IAM2 3M8LA 4XLFA 1SPPB 5IT9K 3TEXA 4QDQA 4OIPF 4E8CA 3GVAA 1MVQA 1TLHB 4HNUA 2VQTA 3I2GA 3KT4A 1UXXX 5FLXZ 3CCMI 2HQ5A 2WZPP 3BG6A 1KGYA 1NYWA 2WB1N 5FWJA 4NHLA 4HPKB 2QE3A 1MJBA 4IETA 2QZ2A 2ETHA 1D1AA 1Z1DA 4UVCA 3UJQA 3ZQIA 3ZP5A 4H7LA 2TEPA 1TNRA 1GLHA 1POQA 4ZYHA 1LFBA 3D3AA 2QBYA 1V9U1 5C3SA 2WYSA 2BOJA 2ZJCA 3F8NA 4CDWC 1RVF3 1VBE2 2HWC3 4X6RB 1YRNA 3G6JB 1JYIA 3ML6A 3CCVI 3BODA 2ZJRF 4BHCA 4PGGA 4RHV1 1YIPA 2B39A 3IKWA 5IFTA 2E7XA 1YJLA 1HXS1 1WUVA 2HOTA 2D93A 5LBCA 4Y7NJ 5KC6A 1PGW2 5LCWL 1B9MA 1R1TA 2W24A 4KUMA 2EFPA 1GV2A 3SFIA 4UW4A 2KRHA 3OY8A 2R7OA 2VNRA 5F8PA 1IN6A 1HRI2 3HOTA 4E2QA 1IAWA 1ZRIA 2DDAA 1RUF1 2M8EA 1REEA 1UYYA 2CQNA 3MDPA 5FBJA 1UZWA 4LOCA 2NVUB 4E7KA 4QPGB 4CDWB 3T30A 2RREA 2AS5F 1VRBA 4YVSC 3K4ZA 4YG3A 3HTUA 2M34A 5F0FA 1WJ5A 1RI7A 3UETA 3EYIA 3VBRA 2B9UA 2GDFA 2GA1A 3TW6A 4A7YA 4C1WA 3SZTA 1DFQA 1IS3A 3L9FA 1UW8A 2DVDA 2Y0MA 4EROA 3WP5A 3NV1A 4L5JA 1OJLA 3U10A 2PHWA 3WUDA 1U5TA 5KHIA 1ETQA 2R1BA 3NV2A 1W0UA 1W03A 1QZYA 3B02A 1S7OA 4L9TA 4UUTA 2D5VA 1AYM2 1AA7A 3CLOA 5D1IA 3HR9A 3KCCA 2LK2A 2Y6GA 3L9JT 3WXPA 1H88C 2WNUA 4Y52J 4BLIA 3J8F2 3P5JA 4DXRA 4HA8A 2X85A 3LEMA 3AMMA 3ACFA 4QU1A 2YGMA 3O1TA 2QNKA 3GDBA 2EFOA 2JRTA 2WYFA 4XDOA 2MD5A 4CCJA 1VBD3 3R0AA 1PHMA 3LSGA 3DGTA 2QVOA 2XJSA 2XASA 3PTRB 2CQ7A 4MHRA 5J1XA 1MEC3 2BWCA 5D8AB 2GALA 4K40A 3UKNA 1IPSA 2YBKA 2WY8Q 3LWFA 1D4M2 1OISA 2H94A 4FFIA 4QXCA 1PGSA 2J1RA 4SLIA 4EN7B 4XLNF 5A7WA 1XSDA 2KIFA 2XV4S 5JDBA 2VCCA 1DQ6A 1KS5A 3RSJA 2QKLB 3WSOA 3IMNA 3J7YJ 1NKGA 3H8XA 5A70A 5CISA 4FTEA 2PQSA 2YU1A 4BA6A 2HKOA 1JYCA 4P9LA 2IPQX 3C2GA 1HKTA 1E5SA 4K6BA 1LHNA 3BVCA 5GADJ 4LE3A 5C3PA 1JHJA 4V2GA 2HJIA 3E5QA 2HBTA 3LOIA 3KLNA 2R5YA 2Q0AA 1ETKA 1U5IA 3B9IA 1H8TA 4PJNA 3PFIA 4HG6B 2R063 5EEGA 4Y1ZA 1QNYA 3WX5A 1CAXA 5E17F 4BK4A 2DFBA 3HWJA 3WG1A 4QQOA 1ACCA 1VQOI 1PMHX 2WO7A 1AZDA 1X1CA 2CSOA 2YDEA 1TEIA 3JW4A 2P3IA 3AXDA 2WO1A 2B8MA 2R7WA 1NCQC 5EZHA 3QAHA 1ENSA 2N8GA 3PU3A 3BTXA 2XLFA 4CCEA 5GZDA 1SFPA 3ACGA 1JZ7A 1Z7LA 1SD7A 1MQTC 2P0WA 2JIGA 3ULQB 4PQQA 1TNFA 5FBZA 1W0NA 3TDUC 4AU7A 3S3NA 1HV1A 5A6QA 3MV11 4OLLA 5T5JA 4HG2A 5JSPA 1W90A 2FBHA 2PJPA 3NARA 1VTNC 1BA5A 4RM2A 4ASLA 1OYYA 3NKGA 2VZ3A 1AR91 3JCIA 1BBYA 4W6XA 3MIDA 4Y4YA 5GZGA 3N3HA 1TMF1 4RAYA 4LKFA 4FP3A 1MZ6A 1JBCA 5FY1A 3KPHA 3RIRA 4Q2FA 2BU9A 3PVEA 5JOZA 2VMEA 3BOPA 1OMIA 4YM1A 2ZX2A 2GBYA 2IS2A 2B9VA 1MQTB 4BY1J 1IRFA 2EA7A 4YGEA 4ZU5A 3LB9A 1GZWA 3OG2A 3FXMA 3VD7A 1MBKA 4CEWC 3GM8A 3A0NA 4FX0A 1EAH2 2ZEWA 5F04A 2CWMA 3AL0C 3JAMZ 4QPOA 3RMXA 3FBYA 1NX9A 3ZQCA 2VMIA 1Z21A 1BC8C 2L9LA 5BYNA 1O57A 1CIYA 1U8BA 5GLTA 2R7EB 4UBHA 1BIBA 4RMNA 3WINE 4HX7A 4QU2A 1O3SA 5H9SA 1F1ZA 5KAIC 2W39A 1T0FC 3BLYA 2K3FA 2DFFA 1P9QC 3OYFA 3TL4X 5J47A 5IP9J 2L4MA 3AP7A 2CH0A 1PO12 1CQ9A 1VRH1 5C4JJ 2K0GA 5FLJA 4D5FA 2NN8A 1BZWA 2E26A 1BL0A 2VCAA 4J1XA 1IHMA 1GNZA 4CEWB 5AIQA 3RQIA 1NA1C 3IWFA 2ACJA 5C8WA 1RUOA 4MXWB 3O2PE 1RGSA 3WW1A 4XSZF 3COAC 4XLCA 4CVUA 3AL0B 1UY2A 3OOXA 2QUOA 1MS9A 1MSFC 2QM3A 2FNPA 4UXAA 3KYCB 3TO7A 2JJ7A 4I02A 3T1BA 1WCDJ 2GOMA 1PIV2 1AL23 3GUDA 3AMNA 4MO7A 2BE5F 3K4LA 2HNHA 2DA1A 1SC7A 4XQWA 2RMU1 1CN1A 2M4GA 2KM2A 3V64A 3A0BC 1NG6A 4OIRF 1DDNA 3BPZA 4MO3M 4U7DA 3ILFA 2WUHA 2ZHKA 4OZXA 1GKBA 4XBNA 1AHSA 4XF3A 5JZGC 4JDOA 1B09A 3MZYA 3RQ4A 5C3QA 1U0JA 1CPMA 3VD9A 1ENQA 2A68F 2Q1ZB 3A4UA 3V8KA 3PFYA 4MGRA 4WBBA 4KT5C 4J00A 4Y20A 4B4QA 5F9TA 2M8GX 1HW5A 3IT8A 2M2EA 1FOD2 4PBPA 2VOTA 3THDA 1ZG1A 1QJY3 5CKTA 4DIQA 3LNQA 4QXKA 1USTA 4S2GA 4KDPA 1MS1A 1X58A 3IH2A 3HSEA 3ROUA 1UAAA 1VI0A 4PZJA 4XILA 5D6FA 1H9WA 2WFPA 2VQHA 4GWNA 1PM7A 1IG7A 3K51A 3MPBA 4P5HA 1QQP2 3N7LA 1BMV1 1WA6X 4S04A 5BNOA 4Y1UA 5EG0A 3LAGA 4U0VA 4C91A 2OPKA 4LBKA 3A23A 4HSRA 1VBA1 4QHOA 3IDCB 2EZHA 4W6WA 4HSLA 2A6YA 3PMSA 1W3VA 2OV7A 4DQ2A 4XHBA 4B3NA 2IP2A 3WHCA 3HQXA 3T5XA 2RR13 5CZKA 4XL9A 3VKNA 1FIAA 4BUPA 4OUEA 5HODA 4Q47A 4A0ZA 3QYBA 3ZPLA 1GXQA 5FD6A 3GLXA 5A1AA 4QX3A 3NL1A 4HOOA 1QH6A 1T98A 1O4YA 2ME6A 1E5RA 2DTWA 4IEXA 1OUSA 4O61A 4AK3A 3GFMA 3CEWA 1GWKA 2F5CA 3I4NJ 2A3XA 2MPFA 4P14A 3THCA 2ZPXA 3S15J 1JZ5A 1BR4A 1OH3A 4BLJA 1EKEA 5FKMA 3TBDA 2E1CA 5K0UC 2BEOA 3JBG1 1JH5A 1ZVFA 2CNAA 2XAGA 1G9BA 1WCMJ 4CXXA 2QF7A 3I56I 1WBFA 4QX0A 5BPDA 1ZTRA 4PCQA 2NXNB 2AENA 3U14A 1G3TA 3EJKA 5D4SA 3HJRA 1WMXA 4BJTA 1RUJ1 1J2XA 4LO4B 4QXBA 1MKMA 3A0HC 2XJTA 2W1UA 5DXDA 3ELNA 2K3PA 3T4VA 4CXYA 4BK5A 2E60A 3BUCA 1WZXA 2ARXA 3WGGA 3ES4A 1S2BA 2E7QA 3O1PA 3J80Z 2CGNA 1JZ4A 1W6MA 4NBQA 3U75A 4NR1A 1CPNA 2WAFA 2X5IC 5K0UB 2RS11 4ZYGA 4AC0A 3DL3A 2D97A 5AC92 1DP7P 3K3OA 3GNEA 3H9AA 2EFNA 2DK5A 2DU9A 4CUGA 4MIMA 1ST8A 4LJHA 5G04L 5DD8A 1I9RA 2ARCA 2RNJA 1JW6A 4O3MA 4IEZA 3FMQA 4BBSJ 3KLOA 5DDJ3 3KIOA 4HX8A 5IYCJ 3CUQA 3D6EA 1IG3A 5E79C 4RQPA 1MW7A 3LOBA 4OWRB 2D6MA 1UELB 4RB0A 4QTRA 3SH3A 1XE8A 1IXRC 5DCMB 4PIYA 2UZKA 1XCVA 1KZHA 1AR62 4RAGA 3TYJA 4GAZA 3FLTA 1APNA 1EV11 4QWQA 2ZAAA 1UJ8A 2R072 2X5IB 2P3JA 4GKXA 1HKSA 1SMYF 4M3EA 4D69A 2BWAA 2CGPA 3LA2A 3KHBA 1WGXA 2DVBA 4Y22B 2W91A 1NXD1 2PMHA 5EP9A 3OIPA 2JVGA 4A2UA 2QSFX 3O7OA 2EIKH 3TP0A 1D1BA 3T2PA 1XS9A 2E35A 4NQWA 4Q5SF 2IVIB 2X53S 2FUG2 2VNOA 1T39A 2D45A 1X1DA 3JRIA 3AMQA 5JVTA 1I5PA 2K9NA 2QENA 5B1AH 2QA4I 1BVP1 4DW6A 5AONA 5GAHJ 2WFF2 2VE9A 3LEKA 2YBPA 2K5CA 1Q43A 2BZDA 1TQ5A 2KZGA 1LE8A 3IBMA 4NC6A 3ZN5A 1S6LA 4X8PA 3L1PA 2XL9A 2R041 3E7LA 3KVAA 2EXJA 3J81K 1REFA 1VQ6I 5FP9A 2NNNA 1R083 4A3IJ 3NMBA 4LOSA 4JHZA 1SBFA 3JXSA 5FYZA 1AX2A 4QX5A 1C4RA 4X0GA 1BEV1 3VD3A 3LSHA 2BXZA 4LG0B 2AXTC 4LO7A 2JSPA 4CEYA 4WM7C 3USUA 3CMAI 2EIJH 5L9RA 1BJQA 1F31A 2GC2A 1A8MA 4L92A 1T6GC 1JYNA 1YWKA 3J7HA 4CUBA 5FGMA 1TQPA 1TZLA 2UWMA 3I5UA 3ZM8A 4XJ8A 2GN7A 2WS93 5A7QA 5K5RA 3O1RA 1FNNA 3KP7A 4H2AA 5GLUA 2ECBA 3C7GA 1MNDA 5K7PA 1FOXA 1O4ZA 3KD4A 2YC0A 4PJYA 5CLSA 2JG8B 1JUMA 2DCTA 4HVRA 4D1QA 3FFQA 2PLV1 4B3XA 2GP5A 4XRFA 2ZGLA 4IE4A 2P7VB 3KEQA 3HJEA 2BBAA 4JQTA 2XLAA 4B48A 1UIKA 2IZWA 3MO4A 3KP4A 4BQ3A 3ACHA 1RUG3 1DPUA 2ZGMA 3BR0A 4UY8I 2DU1A 2JE9A 2CO5A 4WM7B 4A6EA 2HS5A 5DG1A 3UGGA 2ZX4A 3C7FA 4ASNA 1CGPA 2FSWA 4FOWA 1FPN1 4XKVA 1K83J 3LSPA 3WTZA 1ZZ6A 4RM3A 1RVF1 2DQLA 3OWTA 2KIQA 1C8M2 1LECA 3WG9A 2TRTA 2VNGA 2AEYA 2D7FA 2NOGA 3LSEA 1HBXG 3MLJA 3F23A 3REOA 3RJPA 4C3JJ 1E3HA 3BTYA 1A35A 1JYTA 5J3LA 2AHQA 3PHMA 2ERFA 3SMHA 5F2WA 1P4AA 1V55H 3AG2H 2AO9A 1SD5A 2BERA 3ABZA 2NYXA 2LYCA 4AIJA 2JIJA 4CDQC 3KYDB 1W28A 2W00A 1VQ5I 3RRDA 3FBIB 4UUVA 1C3HA 5IFPA 2AC1A 4LBQB 1VQNI 3VHOA 4EJVA 3WDXA 1QJX3 3BWGA 1CX1A 1O7FA 5KHKA 3ACLA 1JZ2A 4Q4ZF 4HK9A 3MQ0A 5DS9A 1VNDA 3D4KA 4JV4A 5L19A 1XNCA 2P8TA 4HRIA 4KWUA 1HF0A 3L2UA 1ZM1A 5DN2A 3CDIA 1EH7A 3SFZA 3ERMA 4QKBA 3VPRA 3FBMA 4IEJA 2BBVA 1OQYA 4PSXA 1ZRRA 2GNMA 2W5FA 1RUE3 5BNQA 3LAJA 1N3PA 4CDQB 1JI8A 3OBRA 5DUUA 2OC6A 2VW2A 1YW7A 3KYLA 4AXOA 2EFQA 4ZS2A 2XROA 3ZN4A 2PTMA 4M3CE 2OTJI 2PQQA 1D0YA 2J5PA 2PAMA 4BAYA 5DMYA 4U87A 1BXHA 3OYLA 2XF5A 2IXHA 4JDNA 2MABA 2EF6A 4AEJA 4URAA 2I2SA 3GFJA 5BNNC 2W47A 3ZYBA 3W2WA 1VBD1 5JIAA 3DCFA 1WJFA 1UY3A 1OCCH 5FPVA 1TT5B 4JKLA 4IEWA 1H89C 2DV9A 2A5WA 1CAVA 2GOXB 1MEC1 1W2AX 4BH9A 4TTGA 3H9JA 2G7UA 3GYHX 2PJRB 1HRV3 4CPBA 1UU5A 4LBLA 1FMD3 1ZZBA 4JX6A 4BEHA 1V6MA 3PURA 5IVFA 5F6KA 4WZCA 3K6GA 1VQMI 4CP9B 1YO5C 4NHMA 1QPMA 3I3LA 4H7MA 4FE7A 2ET1A 2HH9A 4BE2A 1ZLKA 3IB3A 4FPLA 2EIMH 2KIMA 4QM9A 2A6WA 4GH4A 4D0QA 1GP6A 3R6SA 5BNNB 4CP0A 4QQ2A 1W6PA 1CQTA 5J6XA 3NRUA 3P7NA 4N43C 5L7OA 5KCMA 2VBZA 4XTPA 3GZTB 2D3SA 3IIIA 2OX0A 3OR2C 2UYBA 5A7NA 4IZZA 3T8TA 1C8NA 1VAVA 1F43A 2WO3A 4JGZA 1W8ZA 1F4AA 2R061 5CVVA 2PFWA 3N9LA 3MEXA 1MZ5A 4EN9B 3H0GJ 1OQ1A 3IAQA 4CXFA 1S8NA 4JGYC 3VSKA 4UFLA 3IPVB 4AGVA 2DLLA 5LHHA 1XGNA 2RAEA 1I3QJ 2DQRA 3HMYA 3Q3SA 4GQ7A 3HT1A 1VBE3 5KHDA 5BPIA 5IK4A 4K21A 3DEUA 1LUJB 2A6XA 1XYPA 2WZR2 3KB5A 2W1QA 5T52A 5DUKA 3WTUC 2FBKA 4I0AA 4BU2A 1ZA4A 5DUXA 1LAJA 1IS5A 4PLOA 4LK7A 1K7AA 3ZYFA 2HYKA 2VJIA 2VUCA 4Y3OA 2DCYA 5AVPA 1LJ9A 1LDDA 3BCWA 2FMYA 3PIPF 4JGYB 3L2QA 1EUUA 5H6RA 1HRI3 3T2OA 1S9HA 5ILSA 4X6QB 2DOAA 1VMHA 2Q30A 1KITA 5HV0A 2GMEA 5BNPC 2KXLA 4OHYA 3KF3A 3ETPA 4LULA 4DUXA 5FO7B 1B8IB 1ND3C 1NTCA 1N77A 3I8TA 5K9YA 3BR3A 4B29A 3JSOA 3FC0A 2VBWA 5JXJA 2TBVA 2IT0A 4KNCA 3HSFA 1ZX5A 3TBIA 5J1RA 2OTLI 5CEHA 3C7JA 2F2EA 4ESBA 3V56A 4JQRA 2W1WA 3I64A 4BQNA 2XXZA 3M7GA 1G9DA 4LK0F 1AYM3 2RDNA 1X8MA 4IKFA 1Y9GA 3AZZA 4YVWC 3LF7A 1SPPA 2D43A 3K1NA 3ILNA 2CAVA 1IXCA 1OLQA 3J8F3 3OS2A 1KD7A 1W5CC 4PJLA 1UG2A 4I09A 4Q0VA 4HV5A 1LB2A 2L54A 3HN1A 1KRIA 3GBWA 4M4RA 4DZPA 3N36A 4CDXC 1W8WA 4A3MJ 3PIGA 4HPKA 5BPXA 1RUC1 5FLVA 3GCXA 2DJNA 4FVVA 1FX5A 2VD7A 4ORFA 4ITCA 3NO8A 4L5EA 4XSXF 3W59A 3BTCA 5FZ6A 1AR72 3LSIA 5L73A 1UG0A 2W1SA 3CLPA 4K1YA 3IM0A 2VQCA 3IMMA 5I0DA 1GWMA 5DM7F 3KQ4B 5LBFA 3A21A 1HLVA 1QNWA 1D4M3 5LA9A 5A2QK 5DQ0A 1RUI2 4QKNA 3EETA 2RJKA 4E7ZA 2BGPA 3EB7A 3PJRA 2JA8J 4PBOA 1AL21 2R7XA 2X4HA 5K4LA 3HOUJ 3QU6A 1HB1A 3MUZ1 1N47A 2DPDA 5KWRA 4XMAA 2W9XA 4LBMA 2F4MB 3I4PA 2ILMA 4A3CJ 4CDXB 3PNYA 3ZYGA 3LPGA 2YU9J 3SC7X 1W8FA 3BQZA 4ABZA 1LNWA 2WRAA 2VOKA 4P9IA 3B94A 2W25A 1MS4A 3FLRA 2K4BA 3S2WA 3WE3A 3I71A 2JDMA 1G3SA 2LUWA 2HWE2 1I6XA 3GF6A 4LA2A 4MGKE 4LR4A 4PGHA 1DDLA 1TTYA 1V6JA 3FIWA 4QPGA 3POBA 2IXIA 1BK0A 2R0HA 2DVGA 1LEDA 1QOOA 1DF0A 3NWKA 4LQRA 5D5WB 1MH3A 4B4PA 1UKRA 4FQZA 4KMQA 2XR4A 2KDOA 5DAWA 4A3BJ 2JUCA 4CYCB 1NH3A 5KHGA 4FXGB 3PUHA 5M5WJ 3S8PA 1QRYA 4MYEA 5L3CA 1OF4A 5IK5A 3S6PA 1NLQA 3C7OA 3K75B 4EJUA 3BG7A 2BQPA 1EYBA 3IV5A 1GNHA 4PI0A 3DYMA 2OA4A 2J1AA 3VZJA 4BJ0A 4BMBA 3VV1A 4CCDA 4OOIA 4EQQA 1LOBA 1RKWA 5ANQA 1V0AA 2NMOA 1HOMA 4MNUA 3IH3A 2QQWA 2KJCA 2Q2EB 4XRMA 1FV3A 3LSKA 4EJOA 3JD72 1V6KA 3JZVA 4OMYA 2J7MA 1U3EM 4NPMA 2W82A 2RR11 2NNYA 5JAXA 1QQIA 3N9PA 3W9AA 2FU4A 2I07B 3BALA 3WTSC 4HOBA 1WLWA 3CHXA 3WG3A 1Q1HA 2ZEXA 1AKHB 5C33A 4QQHA 1SVLA 3CKHA 1DYKA 3H5RA 2JDZA 3DU5A 3FWEA 4XF9A 3OGGA 4ZHNA 5D8AA 1H9PA 4Y5SA 5C70A 1ND2A 2HFHA 2DAOA 5EXOA 1RUH2 3NAPC 1KONA 3WNKA 1GLNA 4O7XA 4DEVA 5I8TA 2E6VA 1OLTA 1ZG3A 3OSDA 3WP4A 1SCSA 4U88A 4BQ4A 2XRNA 4HLYA 1VFCA 3DXJF 2QQ8A 1EAH3 2OQ7A 5EIYB 3VYTB 3GXOA 1LHUA 4BQQA 2IWGB 1S0EA 1DIWA 3GTOJ 1RINA 2VCBA 3OS1A 1ZZ7A 3U4SA 5IATA 1JT6A 4WX9A 3VYUB 3TN91 1KJRA 2B45X 2VM9A 4DY3A 1OFCX 5FREA 3BJ6A 1QVTA 4DYRA 1WBLA 1W39A 2H8RA 4ZDLA 2WWYA 4HDVA 3I0TA 2PHUA 1RUD2 2VZUA 1PO13 2NS7A 1J9IA 3GXUA 4XFHA 5J96B 2JD4A 4XICA 4ITVA 5G05L 4YZ3A 1P2FA 3Q8BA 2K2SA 3LE0A 2EVXA 2KISA 1JS9A 1Y6IA 5FZKA 4BISA 3JREA 1SAXA 5FRAA 1DU6A 5DYMA 2DBIA 3WHTA 2FA5A 3FMGA 4IPAA 2C4XA 5K7ZA 1K5JA 1MS0A 4HSJA 1QXRA 5FZCA 1U8RA 1PIV3 5I0TA 1YC61 2WWJA 5K7FA 2CU5A 4RLQA 3FHAA 5CFDC 4FPCA 1KU2A 3AMPA 4XQFA 4UW5A 4B4CA 1N25A 3BOWA 5AIPA 3EYYA 2NS8A 1PVC3 3ZN6B 3RG0A 1TE1B 4AHWA 1YQ8A 1SD4A 1YCIA 5DD4A 1S7AA 4P9UA 1MR5A 1O8PA 2VW0A 1R1ZA 4W8JA 2EZLA 5K5OA 2O0OA 1TWGJ 2DCZA 1I27A 3G71I 2WINB 4IL6C 2Y31A 2W92A 3RZGA 3OD0A 1G2HA 1MJAA 2G9GA 2ZC2A 3N35A 4PLNA 1YRNB 1S0IA 1LFUP 1MQTA 4FOYA 2VI6A 2ID6A 4BQ2A 2F5DA 2XPJA 4OULA 5CFDB 1U5TC 3TEDA 3CIHA 4Y1YA 5GPAA 1N78A 1E0EA 1QQP3 4LIVA 1AOYA 2ZGRA 2ZZQA 2C26A 2I10A 5B66C 1JOJA 5DM6F 5FD5A 2P6TA 2BNMA 4HQMA 2DFHA 2LKXA 2PX9A 1NK2P 4XURA 2CJJA 1PO22 5TGTA 2Y48A 3BCBA 3AKZA 3R4KA 4B44A 4BBRJ 4PJMA 1LQ1A 1R081 3QQAA 2JG9C 2W08A 3VBUC 1ASJ1 1O91A 1BW6A 1C5HA 3DKWA 1H9GA 5JXIA 5LGTA 2WO2A 4LHLA 4PIZA 4AWDA 2GH2A 4HK8A 4NIGA 5T5PA 1W4MA 4ZYAA 3MZHA 2JX9A 3OUJA 5CYYA 3NWSA 5CJ9A 4UWDA 4OU0A 4MEYF 3H9GA 3MUY1 4XKBA 4BDYA 4GJZA 3I2FA 2VG9A 4NROA 2VC9A 4CEWA 2NLRA 2E63A 3ZMTA 4IOCF 4MXWA 3JRDA 1R23A 3KV9A 2WS91 4Z8BA 2CFOA 2VPVA 1SG3A 1UN1A 1GZCA 2ZKLA 1MPXA 3OEAA 2ATFA 5EYYA 2H6BA 2QLZA 3NSTA 5KHHA 3DKQA 3MMYB 2W48A 2BHYA 2DF7A 4AFAA 2JG9B 3VBUB 4A7ZA 3UR3C 4A41A 1T0FA 3V7RA 3DF0A 5LGNA 1FTZA 1DZTA 3SHRA 2RM22 3JR9A 2IAIA 2WNVC 5KXEA 4HF1A 4WVVA 1JHHA 2GC3A 2PXJA 2E5NA 1AXKA 2BHZA 4XUQA 3OPWA 3HKZA 3NNMA 5LA2A 3K77A 1OR7A 2EV6A 2W1OA 2G9FA 4F92B 1JKPC 1OUXA 2LOOA 3RVHA 4X8NA 4COZA 3W5MA 3SISA 1BKZA 4F7ZA 4KBBA 4G12A 3LSMA 5FYYA 1MMSA 5AC93 2YMZA 3SKVA 3QU3A 2R30A 4ZDOA 1R092 2P6SA 2EQRA 2Y0IA 1X9PA 1HC8A 1YIFA 2DJIA 3H0DA 2D6NA 2PQ8A 3ABTA 5F5IA 4DZGA 4AI1A 3E5XA 1R9TJ 4IQ4A 3SNMA 2DW4A 2XUMA 1OBNA 5A3MA 2L7FP 2WNVB 4EQVA 3WTYC 4M00A 2W0XA 3TAYA 2RKHA 2XGXA 4HVQA 4BIFA 3I54A 2QQPA 1Y8QB 3WCRA 3K7AJ 4Z82A 1FPQA 2DYCA 2C6YA 2DTRA 2R073 1IGOA 5FP4A 3LL7A 4Q4Y2 4MGSA 3PL0A 3S3OA 2QZ8A 4RAFA 3DKXA 5FPBA 3ORJA 3UESA 4AR2A 1RUE1 1YTYA 2Z79A 1QZEA 4GIQA 2DA6A 5D4RA 2QQUA 4FT8A 4L0YB 2QQJA 3IDAA 1Z3YA 1NK3P 2P5KA 3S1NJ 4LK1F 1HIXA 4FX4A 5B3SH 4BQ1A 1IUYA 2MG4A 1ZELA 2ZEZA 2CUZA 2OS2A 2I8DA 4L8QA 2QQ9A 4PSWA 3OV8A 2OAZA 3BP8A 3MW3A 2WFF3 1WI9A 3KV5A 2ENRA 1VMFA 2LG4A 3QYFA 4ESFA 3OYMA 1JE8A 2WB1A 3HAGA 1BI3A 5D5XB 3FHNA 2QQBA 4N7UA 5FYSA 4P02B 4XLEA 4UUSB 3PNTA 4ANJA 4EJRA 2F17A 3L2RA 5J37A 1I6HJ 1HRV1 1EUTA 2PHXA 5HLIA 1FMD1 1XOYA 3B6CA 3QP5A 4XUNA 3UKGA 5FFXA 4BGDA 3OUIA 4LITA 4D94A 2VVDA 5HS8A 3T8RA 1UX6A 3ZYRA 3QODA 5K0UA 2ZXIA 1SFEA 3IN9A 4E27A 1LKNA 3EDPA 1ODDA 2DA7A 1UQXA 3DEEA 4XK4A 1FTTA 1JU3A 4HFSA 2WBKA 4KG0A 2RS32 5FP3A 2DBNA 2WC2A 1QVUA 1F5FA 2WDBA 4GULA 2QYOA 4MTEA 2AUYA 1H6YA 5LEKA 3ECHA 1QU3A 3MFCA 3RCOA 2VJXA 1CR7A 1VBB1 5ED4A 1F4KA 2VJJA 2IGNA 5DCMA 5BMZA 1DLLA 2JKXA 5FZLA 2AEZA 4N0BA 2GIZA 4WVMB 3OB8A 3QH7A 4B09A 1I3HA 2FD8A 5HDKA 1U6GA 2X5IA 4N4NB 4C0BA 3W20A 4JBAA 1D0HA 4OZOA 1LPQA 2ZXHA 3MZ8A 1VBE1 1BJAA 2CV1A 4FPGA 1C8M3 1XGOA 2Y2ZA 4NJ4A 3KHCA 4Y22A 3CF2A 2YPDA 1YEWA 4FO9A 1DPRA 5IT9Z 2MEV3 1F5TA 3BU0A 4IVNA 3ATGA 3MKZA 4HYEA 2QQLA 1V9U2 4XUTA 1C1LA 3IDBB 3A2KA 1PGW1 1ETVA 2V6CA 3AP4A 3ZXLA 1GHCA 3U78A 2EICA 1POV1 1UMZA 4Y1VA 2BGCA 1CESA 2C5DA 1H1IA 2IXCA 1GVDA 4RHV2 3E6CC 1P6RA 3FXQA 4Q48A 1HXS2 5C44J 3LDRA 3VBFC 4Z2WA 1F5JA 4QPIC 2UV1A 4U0YA 5BNOC 4YW1A 4SBVA 3DF8A 1UCRA 2WIIB 2VMFA 2X51A 2R92J 1S0DA 1SFOJ 2MFZA 5AVAA 5FYMA 1VBC2 1HLCA 1IQDC 1LULA 4Y20B 2HDDA 4LBNA 3I3DA 2OUMA 3RKWA 3KF5A 2DMNA 2A3WA 3Q0VA 4AVBA 1OLRA 1T6SA 4KJZA 3ILRA 1PNGA 2ZX1A 2IEKA 4LG0A 1WCQA 3UT0A 1W06A 1UX7A 3DV8A 2Y9ZA 4LMYA 2DFIA 1HQWA 4L18B 1J83A 4J25A 2C0ZA 1MIJA 3GYDA 4YG0A 2RJ2A 4BE1A 5C3OA 2Y6JA 1ULDA 4DOZA 3WNLA 2ZJQF 2BV4A 3M1HA 3VBFB 4QPIB 3EUKL 5BNOB 3OYIA 1OA3A 1FSEA 1B59A 2ZGQA 2JG8A 3PVNA 5D8LB 2XB6C 2R7QA 5F1RA 3O1VA 3OGJA 3LSTA 2HVRA 2LS6A 1V54H 3ECQA 1YJWI 1R64A 1SVOA 3SXYA 4YRDA 3ZXKA 1J75A 1YQCA 5IVVA 4WM7A 4Q8LA 4BXSV 3M3YJ 1XPWA 3PDQA 5FPZA 4QX1A 3M3OA 1JGGA 1D4M1 3E3VA 2JD9A 3KV4A 3OYJA 1WLCA 4K7JA 1QBJA 1U5ZA 5DEQA 5IOYA 3ZMVA 1NXMA 2QDRA 5LK5A 1PJRA 2XQRA 1TW2A 2JK3A 5A1LA 3TO9A 5D5VB 3KSCA 3ZR6A 4B1LA 2QQIA 1ZGJA 2LLKA 1DGWX 4LO8A 3VBOB 2BY2A 1Q8SA 5DAQA 1MBGA 4DEQA 3R0RA 4KU8A 4FFHA 3OYWB 2CWEA 3MYXA 1Z7UA 2R7UA 4C1XA 3ZPYA 2JWPA 1YHFA 2GU9A 4IRGA 3ASIA 3VDCA 4LBQA 3CUQC 1MS8A 4AM3A 1DG6A 4XBLA 4ZU4A 5FMOS 3S30A 2KQRA 3RWNA 3CJNA 2VBXA 3AX4A 3WW3A 1GR3A 1NZCA 4PT6A 3WF1A 4TLGA 3RZHA 5E18F 2RC4A 4KICA 2IJLA 5L3DA 2Q8EA 3GZUC 3HEFA 3EHKA 4IV3C 4I2OA 2Q8OA 3IIAA 3WDVA 3ALQA 2WT0A 4LHKA 5FP8A 3F8MA 1QDOA 2VZQA 4JX4A 2FBIA 2E31A 2VMHA 3ZSLA 3CQOA 3P5BA 1ENHA 1ERDA 3MLKA 4R9AA 3CJTB 4QM8A 5KXCA 2FOWA 2JECA 2WZR3 4IGOA 4CDQA 5IAXA 5FJKA 1YLLA 4XUOA 2LSOA 5FXWA 4AGRA 3M1CA 3HOSA 2MW8A 3CUQB 3ZXEA 1G9CA 1LOAA 1YNAA 2QGUA 5ACA1 3W2AA 2XAFA 2F4IA 1VQLI 1UMHA 2AR6A 2DA3A 2C9KA 5DG2A 1D0GA 3RNSA 3ELKA 1VB2A 3B7MA 3KQRA 4XFCA 4CUCA 4IV3B 2LNBA 1W0PA 3Q8AA 2RVAA 4FAHA 4NRQA 3LD8A 2LR8A 1PP8F 2O9LA 5DV5A 2OPTA 3ZSKA 3UYJA 5J09A 2PJRA 4KT6A 2Z42A 3R4UA 4HBNA 2ZEYA 4QLCU 1T8IA 4YG6A 4LE4A 5LLQA 4M71A 1OQDA 4N7IA 4CP9A 3FKIJ 4CEYC 5I8YA 3F22A 3PVBB 1R1A2 1EAH1 1IS4A 4GWIA 2ZFWA 1H0MA 5A33B 2IXLA 1LGCA 1NT0A 4II2A 4KQ7A 4M3DA 3NNGA 3GF2A 3OGVA 1H1MA 3CCEI 2O8XA 1REPC 1FATA 2WAAA 3KT1A 4H14A 1ORKA 2YG0A 1V3FA 1IKPA 1U5XA 4HKLA 3HTSB 1W7PB 5E8GA 3WCSA 1PO11 1NQDA 3APBA 1WMDA 4P96A 3ZYPA 3RQ0A 1AR73 4XJAA 4BWOA 4XOTA 3CO7C 1S2KA 2AQFA 3CZJA 4N53B 3WOGA 3W5NA 2LW8A 1ZYRF 2X1EA 3IPVA 2JE8A 2ADDA 4YYOA 2FDJA 4OMZA 4BIOA 5J98B 3O6BB 3PUIA 2GAUA 4WZFA 3N9OA 1RUI3 4CDGA 3MGUA 4OQ8A 2BV6A 3IRQA 1PIV1 1ULGA 1S1AA 2ARBA 2VMCA 2HDCA 3S2DJ 2BPA2 3QPHA 4EM2A 1BR2A 1A04A 1S0CA 4Y26A 4Q0QA 4D7SA 1E57A 2V9KA 4QIWN 2LKPA 1CWPA 5APAA 3RZDJ 4M74A 4EV0A 2IW5A 2ID3A 4Z2AA 2WR9A 4YZ2A 5FYUA 4RN5A 2E9QA 4JGYA 2RMU2 2H6CA 2QQAA 3K4JA 4QXHA 1Y56A 4XHXA 2HWE3 4LIUA 4HPQA 4BDVB 3W6JB 3AK0A 1MVEA 3WG7H 1FOD1 3I2KA 1B8IA 4KN4X 2ECCA 4A6SA 4XJ9A 5F0CA 4HNTA 4XN0A 1T38A 4YGBA 4HKWA 1W8OA 1UKGA 5B5EC 3ZX7A 5IT6A 2UWBA 4NB5A 1EY2A 5D8KB 2IUWA 2A75A 2QBXA 4P9WA 4M4PA 1ZBE2 3MF6A 1J3QA 1JMUB 2OQGA 1QQP1 1YE9A 1XNBA 3M2MA 3WNPA 2BFUS 3SCFA 2ZHMA 3HNMA 2D6KA 1H2NA 1QXPA 1UF2C 2VZOA 1Y3TA 4AZZA 3SXWA 1FNYA 5C3RA 3K1MA 3OYAA 2XHKA 4EM0B 1RL3A 1FJLA 1I50J 4XACA 3HHGA 2GNDA 5EHDA 3JD73 3IDEA 3QPTA 1RUNA 4D5CA 2DA2A 4XRSG 1WLTA 1P4WA 2PFBA 2F5VA 1ULCA 1HW1A 5GTHC 1SDDB 1R5ID 1ULFA 5LBBA 4RGUA 2LRPA 2OBPA 1H2LA 1HKDA 4HLTA 2O7OA 3WU1B 4JRLA 4WWCA 4NIHA 1TWCJ 4WCGA 5C9AC 4DXZA 2CW8A 5FZ4A 5FMOL 2EFWA 2JA6J 4MGIE 4YW2A 1RUH3 3QRFF 3T2QA 3N97A 2L02A 3GBGA 2ESHA 3BQYA 1VAMA 4V19K 4XQDA 5F3CA 2K46A 5H9QA 1X19A 2L2OA 4AI3A 1S0BA 4UXNA 3VZKA 1FAYA 1QIQA 2MC3A 3LOCA 2GZWA 4CDXA 3C18A 4P9YA 3RYRA 5CBLA 2R16A 3F3XA 2YSRA 4OAZA 4S05A 2QUFA 3SQNA 4BQAA 4CHUA 2DUOA 3O3KA 1J0RA 1QPIA 1EH6A 1F4HA 4AYBN 2VLAA 5L7OC 1IZ1A 2O14A 1CAVB 1YI9A 1LOCA 1H8VA 1RUG2 3KM5A 2G4IA 2GA2A 3BZCA 5FZIA 5C9AB 1CF7B 3MD2A 1RUD3 4JGZC 3HRUA 3DN7A 1AXYA 1X1BA 3W6KB 3INAA 3R4DB 1RKTA 4LBOA 2AGSA 4ENJA 1LCLA 5AC91 2JENA 3CCQI 1FWZA 3S1MJ 1HQNA 4CUAA 1FV2A 5E1RA 2CUJA 1FBSA 4CYCA 1RITA 3GFLA 1HA8A 3DPUA 2DT6A 5EEAA 2W3JA 4A4AA 1UOBA 3S7IA 5A6YA 3ZSEA 3DPRC 1TC3C 5ICFA 3FKJA 2MA3A 3N7JA 1ITYA 1WWXA 1EH8A 2HWD1 1TWFJ 4RYDA 4HKOA 4PJ0C 4JHTA 1AR61 5E89A 2Q2EA 1IG0A 1UL9A 3H5AA 2A05A 4D6RA 4A5NA 5CVUA 4HLXA 4NRMA 2LTPA 1UZYA 1FSHA 2L9NA 2X10A 2R5ZB 4ESJA 5E1ZB 4AVTA 2E7AA 3N4MA 2GQQA 4NHJA 1R5GA 4AI9A 1AKHA 2MLGA 2HOEA 4U7BA 2BOIA 1WH5A 4C2MJ 2IS6A 3LQRA 1D8KA 1FBQA 4GMP0 4F93B 4BKXA 3DPRB 3D5OA 1ZR4A 2YC2A 3HRTA 2HEYF 2JDAA 2WAOA 2JRMA 3BPVA 2B46X 4EMSA 4P55A 3UNGC 2L7MP 1COV3 3VBSC 4FPHA 1UU4A 4PLMA 5DUWA 1ZRCA 5DABA 1TQIA 1FMVA 4A42A 2H1LA 3H7YA 1BBT2 3JRCA 1QNTA 4TLFA 1UIJA 3N9MA 2A5ZA 4IEOA 3I3MA 1D5YA 1F8VA 1MD0A 4NMIA 4NRPA 2WTEA 2YC4A 1Z3XA 3GFIA 3KFWX 3K70C 2R042 4JKMA 3IWZA 5JXGA 3E0JB 4UFHA 3U1KA 4LLOA 3I2IA 3FK6A 3V7SA 3F2ZA 2ZBJA 1XGMA 1JXNA 2WSVA 4HQEA 2CW7A 2L0KA 3F9KA 2B9SA 3VBSB 1J5YA 4CPBD 4HL0A 4E4SA 2ZABA 2XVGA 2AREA 1UU6A 4ZH4F 2XJPA 3FXRA 2ZX0A 4GYGA 4Q0UA 3MKWB 1ODNA 4CCNA 4LFUA 1CZVA 1G86A 4OVEA 2JA7J 1MH4A 2WLQA 3FF5A 1ULPA 5J1YA 3R61A 5KNLA 1SBEA 1P4XA 2XVCA 2RM23 3K3NA 1M1EB 4DZJA 3ZN6A 5FZHA 3ZMDA 2XJQA 2DCKA 3K46A 2RQQA 4LHSA 4CSWA 3CL1A 3T08A 1DQ1A 2PLV2 4K20A 1E3OC 4XETA 2BFUL 2VE1A 4IEVA 5HDNA 2LDUA 3KP3A 1C8M1 4BM8A 4JTNA 3MBWA 1PVXA 2E19A 2O8KA 1QJEA 1VAKA 2CFXA 4QPGC 5HI0A 2JPBA 2IRFG 2ZXWH 2LTNA 5FLMJ 1QGPA 2Z33A 1FPN2 1NOVA 1R093 3W21A 3PU8A 1S0JA 5CFDA 1ETXA 3RZLA 4D7TA 2XBO2 1QMJA 3H1CA 1WCKA 1WQ2A 3CO6C 4M9SA 5LBEA 1H4HA 2FE3A 3D0SA 1MBFA 4NPRA 2VUMJ 1HCRA 1R4NB 2IGOA 4L11A 4AAPA 4XFIA 1BOBA 1A36A 1R5HA 1HX6A 3DTIA 4OHWA 1YX5A 4XOPA 4FPOB 2MGQA 3WU0A 3ZMZA 2V6EA 3UGHA 1J58A 4AYUA 1GBGA 4Q4Y3 3AMHA 1G8WA 3BZ6A 2OT7A 1XTAA 1AYN2 1I1SA 4L9BA 1F36A 1ZNPA 4J19A 4BMEA 5GLZA 5JLVA 3P6BA 4M9ZA 3PUSA 3K4BA 3NJVA 2Y8KA 5LZ6A 3FX3A 4EGZA 2XJVA 4CA9A 1LENA 2JKBA 2OUHA 2FMDA 3POFA 1LDJA 5D8AC 5DTDA 4IRHA 2P5LC 1O3RA 1SD6A 1ND2C 4HDUA 4XFFA 2IA2A 2KHMA 1HN1A 4XF1A 2FCUA 2XQXA 2UXNA 3AYEA 2ZFUA 3DECA 1T08B 3BG5A 2JG9A 1JUIA 3VBUA 4GWJA 5JHUA 2WA0A 2GMMA 1GOGA 4CU7A 3F0CA 1XRUA 2DURA 2BVBA 4FI9A 1WW6A 4GRIA 1UAIA 4J1WA 2P4EA 3AP5A 3CBNA 3K70D 5L3GA 4KFCA 5KR7A 3VD5A 4AW7A 4IHSA 1CJDA 4TN7A 3ZMNA 4DOUA 2X9DA 2TDXA 4LMFA 1ND2B 4B8EA 3BB6A 3OYHA 4M01A 2HWF2 1JTYA 2QKMB 4PDWC 2GNTA 2BNNA 2VUAA 3J26N 2WQZC 1FMWA 1PZ7A 4M3CB 5K1YA 1X9TA 2V4VA 1LOGA 3GEZA 4U0WA 1WPKA 3OY9A 1Q8OA 2DMTA 1EP0A 2J22A 4I98B 2RS33 4COWA 9ANTA 2NMNA 4XXAA 1QKQA 2ZNYA 3Q0UA 2WNVA 1WJEA 2BY1A 4MSVA 1XXNA 5CA6A 1QA6A 2YPRA 3PQJA 3HBZA 2XAQA 1AR82 1B35C 2CQXA 2ISYA 5IK7A 2K4JA 3X29B 4JZRA 3KE2A 5E20A 2Y75A 4IV1B 1Z91A 1FT9A 2VTFA 4XMIA 2BVLA 4BY7J 1T95A 1YO8A 1WW5A 3TNQA 4OFGA 4PDWB 3FXUA 2YFUA 3M9AA 4OAYA 4OHVA 5ICEA 3F72A 1VQ4I 5IP6A 2UURA 4KNYA 1Q8QA 4ARYA 1XNAA 3EXUA 1SACA 2WZR1 2L9RA 5FPUA 3O14A 4A3DJ 2Q0OA 2ZO4A 1ZN2A 2DFCA 1QZZA 3H0OA 3BTJA 5E1XA 2ZGPA 5B1BH 1POV0 3DFGA 3IH4A 1V9U3 2V09A 2W46A 4YW6A 1TME1 4PQ9A 3ZYJB 2RDQA 1B35B 4M3CF 1RIOH 1JYWA 2FQ4A 2HTSA 1GWLA 3VBHC 1DQ5A 1UO9A 2VB6A 2FNAA 4ZTFA 2OQRA 2K40A 4RHV3 4M0NA 3V0AA 1DLCA 3OIOA 1HXS3 1ZG5A 2A70A 4GFBA 5LFAA 1UD1A 1W9SA 5I91A 4UVBA 1N3OA 4P5YA 5JMOA 3L2YA 5F27A 4M6VA 2K02A 4UUSA 3RPUA 1VBC3 1RPWA 1W8UA 2LY1A 2V79A 2D1VA 2E7WA 5T54A 1DQ4A 2O6GE 3ENRA 1Z6RA 4IQJA 3L2HA 4CE8A 2VKEA 1RMU1 1G9FA 3FZVA 2M0CA 4P9JA 3V8JA 4IEPA 1XG1A 2PHRA 4YLZA 2HLEA 1J09A 2YV8A 2IBDA 3IAS2 1D2QA 2CTVA 3RTRA 3AL6A 1K78B 2EH3A 1PK6A 2AACA 2IGMA 2Q4SA 2R7DA 3VBHB 4Q4X2 4DB5A 3FJSA 3KP5A 2OCEA 3TEWA 1IO2A 3ZXGA 2Y0SA 2NS0A 3FMRA 4F3QA 1HW2A 1DGRA 2XKPA 3SEZA 1PGL2 3SKJE 5I0UA 2NOJB 4KI5M 3ZXFA 1SFNA 5L9BA 2YU3A 3QOPA 5FCCA 2HWB1 3THPA 3HOXJ 3QCWA 5FB2A 3SYTA 2X05A 2KT0A 4Q4V2 3ZFFB 3BU7A 1AR71 4WVMA 5D5UB 1IV8A 2KRCA 3N05A 3WW4A 3MN2A 1UHSA 5IPAA 3HPNA 4E2GA 1LOFA 5FYTA 4IE6A 2P1BA 1RUC2 1P7IA 1GQPA 4BYYA 1XQNA 1RXFA 2R32A 3AG1H 1OR7C 2ZGOA 3U2RA 4JOMA 4RA0A 1JYVA 4WXHA 1RUI1 1NCRA 2DCEA 3VYSB 1UY1A 4UBGA 2A3YA 3OYNA 4QKDA 5TJJA 4E8DA 3AB0A 2MHFA 1YFWA 4CA0A 4JKKA 3NKTA 2VBDA 2H09A 3CUOA 3S93A 5GLVA 4LG3A 2ZMLA 3QOEA 3DU6A 1SFKA 2JSCA 5J8FA 3E1SA 4COUA 2A07F 3SDGA 5FYBA 2Y6KA 3I59B 2CAUA 4BE0A 4DYCA 2NVQJ 4JCKA 2BGOA 4XJZA 5LHGA 3B5LB 1Z78A 3RSNA 2DT5A 2V26A 2CL2A 5LBQA 1PVC2 4MHUA 4H55A 4G9SB 2HWE1 5CU1A 3GTMJ 5CVJA 4FTSA 2VR4A 1URXA 4OI2A 1QJFA 3A4CA 2D3PA 2E1NA 3VB2A 2W95A 2VBYA 5EFUA 4NC8A 2M7AA 2A6VA 2AXLA 4N4OB 1YS6A 3W3CA 1E17A 1IN8A 2F6BA 4YIIA 4UT5A 1ZHFA 1BLZA 2ICWG 1KU7A 3DPLC 1R22A 1W1WE 2VT3A 1PUEE 4IW3A 1AHDP 1EV7A 1P8JA 4AFCA 4A3ZA 4Q0PA 5FZ8A 2RE9A 3AJZA 4A12A 2JPCA 5EYXA 2WT2A 4YSFA 2DVFA 2A6TA 5T55A 1I1EA 3HUGB 4Y5TA 4ZYEA 2ISZA 1GU3A 2XHNA 4MGZE 1Y0NA 3VBFA 3M4OJ 1O7LA 4QPIA 2LREA 5EF6A 3POIA 1AUYA 1L7RA 3DYOA 3JD71 4X6AJ 1IJWC 1UB9A 3OOPA 2R6QA 4NO4A 5A3UA 4BHBA 2LROA 4L0PA 2LRDA 3R0JA 3HB9A 3B9CA 3D5LA 1FYUA 1K6OA 4FQGA 2JE7A 4AQ6A 1VQ9I 4Z07A 4WF2A 3WDWA 4FISA 4EN0A 3BR6A 1I1GA 5FFZA 3M8EA 1K12A 4C3HJ 1FI2A 1N1SA 2BOLA 3FZ3A 2PA7A 4A69C 1MBEA 2WWSA 1OPCA 1R00A 1AR93 3I49A 2BW3B 4LA3A 4K3UA 5JXHA 2GMPA 4IEYA 1R1A3 5FRMA 4YZ1A 3NV4A 4DNCA 4YFWA 1C5IA 3WF2A 5ICCA 4YW3A 1TBXA 4DBQA 3RFRA 1OCTC 1QJZA 3VBOA 2BY0A 3F6OA 4XUPA 1SFYA 3TOAA 1W3XA 4ATFA 3L2WA 1KEXA 3OYWA 3PVOA 3OYDA 1GICA 3HOVJ 4OI0A 3OYBA 2XF7A 4F52A 3VHRA 3FM3A 3BPXA 4GB32 3VGIA 4FTHA 4S0HB 3HEIA 2NZ9A 1B6AA 2R0QC 4EWAA 2HKXA 3E6MA 1RYYA 3TN92 1YJ9I 4OI4A 2HOAA 2LH9A 4XDPA 4RGRA 3J7AY 2D44A 3MIBA 2YXSA 3JRBA 2EILH 5LB6A 1S5LC 4OQ9A 5CVIA 2BVMA 3WTVC 1KGSA 5J7MA 2ZCWA 1K5MC 1J1LA 2HYGD 1KQ8A 2YX7A 4FETA 5FZBA 5JHFA 1C1FA 2EPFA 4KMUX 5GAEJ 4QDSA 3HD8B 1OHFA 1NZIA 4QQPA 1YQAA 1BC7C 2C24A 1KQ0A 3G1MA 4CP1A 1L0OC 3DKYA 1X8EA 1AVBA 1I5ZA 3JUUA 4F55A 3FISA 1CZTA 1U9OA 5J4VA 2QJVA 2E36A 3SZPA 5DZFA 4AG4A 4FHTA 2WA4A 2ZKZA 5A3LA 3KP6A 4CO8A 3S0MA 1D4VB 5BV6A 1D7PM 4Q4W2 1VF9A 3AZYA 2PHLA 3AKQA 3NQOA 2RMU3 1RC9A 5LRRA 1FOWA 3NRVA 4IV3A 4B4RA 3DEWA 4RD7A 4YRVA 1SLIA 4MQVA 1HSTA 2MSYA 1K5MB 4HF2A 1OCRH 1RHI2 2JA2A 5EGOB 2OD5A 4BOWA 1OF3A 4UB6C 2P5BA 5IVBA 1Z7S2 1US2A 1GP4A 3J7MA 2CQQA 4EJWA 5KBFA 2UWCA 3TKYA 2QCSB 2ORXA 3OBTA 2Y0OA 3L09A 3K4AA 2VODA 1ZARA 3HVDA 2JDUA 2PELA 2VQ0A 1NE6A 1ZBE3 4YGDA 1W6NB 5A33A 3BGAA 2SLIA 4FASD 4XC9A 3V4GA 3WT3A 4I0BA 3OPTA 4LHNA 4OUSA 4D6QA 4UF0A 1GXPA 2F4PA 4UB8C 1UYPA 4AEDC 3FM5A 5IT3A 4K8RB 3AYDA 2TUNA 3EUAA 3I55I 3P3PA 5JI9A 3RS6A 3LFUA 1PO21 3ZFEC 5EZWA 4I3PA 1FXZA 5CQEA 1HV0A 2R7TA 3ACIA 4PF5A 3VHPA 3IP4B 1PYVA 3R60A 2K27A 3TO6A 4G4FA 4Q1PA 4AFDA 2JG8C 4FOQA 3KZIC 3JB8A 3HSRA 5JI6A 3AKSA 5JR2A 3RI4A 3I58A 1W7PA 2JJ6A 1HQLA 2J1EA 5E3NA 1IN7A 1X3ZB 5FZOB 2ZXJA 1KA8A 2M9HA 2NVTJ 5T3NA 1ASJ2 1JXSA 3RDIA 1KFUL 3H5NA 4N53A 2Y34A 4IHVA 3OPZA 1UY4A 2CU7A 2RN7A 3O1UA 3ZQFA 4AEDB 5CYVA 3RPQA 2VECA 4UFIA 4QQLA 4A6DA 2KIUA 3ZFEB 1J84A 3U0ZA 1U9NA 1LODA 3DBRB 3BR1A 4H4KC 2RQPA 4YARA 2P6CA 2P3KA 2V9PA 5FLIA 3SZGA 5EDNA 1XNKA 2NAZA 3VDXA