4I2OA

The structure of fixk2 from bradyrhizobium japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAMTAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDIGDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transcription regulator/dna
molecule keywords FixK2 protein
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i2oA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i2oA01
5LHHA 3ACLA 2RGVA 3FFQA 2XUBA 2O1QA 1W5SA 1R58A 1K78A 4CO8A 1IXSB 1F5TA 4HN1A 1MDMB 2P5VA 1ZHFA 1LJ9A 4IRIA 2GA1A 5BPXA 1VR3A 3RNSA 5I0SA 3HRUA 3BB6A 3KE2A 4ONUA 2M87A 2EA2A 3BOQA 2H6CA 2CAUA 2M5WA 2MHFA 4BXUA 4TLFA 1K7AA 4ENNA 4HLTA 1P4WA 3U0ZA 2EFQA 3GO5A 4OIPF 4Y15A 2QUFA 3WTVC 3RPUA 2GWRA 1FPQA 2OQGA 3UKNA 5I0TA 2QYOA 3PFIA 1BC8C 2O0YA 3QAHA 3TDZC 3KCCA 1G3WA 2EV5A 1RUNA 3GYDA 4AIHA 4PIXA 3LA7A 2OZ6A 4XF4A 1HW5A 2DK5A 5HLIA 4G7ZF 3ST7A 4P5OA 4Q5SF 3R61A 4PJYA 2V1UA 1QXRA 4XFFA 1K78B 1WWXA 3R6SA 1ZZ9A 2IP2A 5JAXA 4MZUA 1XCBA 3CJXA 5D1IA 2VE9A 3REOA 3F6VA 3VODA 1IXCA 1IN7A 4A6DA 2D2WA 2IXHA 3VB2A 5FLJA 3E5UA 2NRAC 1YYVA 5I8TA 3GFJA 5D6EA 4IEVA 2FE3A 4M74A 1GVJA 3WTUC 6PAXA 1UD1A 4OINF 1EY2A 1FI2A 4PIZA 3C3VA 4U88A 1SFUA 2PJPA 3MAJA 3WTYC 1P4XA 5BPDA 2VODA 4IRGA 1YWKA 4U7BA 1TNSA 3TO9A 1DPUA 1Z05A 2EFWA 4IESA 4KWKA 2ESNA 2EV0A 2EA7A 3F3XA 2G9WA 1HQCA 2P6SA 5FQ0B 2YR2A 2P6TA 4KU8A 3FMSA 4Y13A 5L3BA 5DUIA 4E2SA 1CF7A 1Y9QA 1I1GA 2A68F 2IC1A 4CGZA 3H1YA 2VT3A 3CO6C 3JZVA 1FBUA 1V70A 4E2QA 2E7XA 4MUVA 1ZVFA 1JHFA 4I98B 4ZZDA 2WV0A 2XRNA 5D5WB 4XF9A 4FBFA 4GO1A 3M70A 1HSJA 5DD4A 2X0LA 2QJVA 2KKOA 4HSJA 3EO6A 1W4MA 4BHBA 3B73A 4EQQA 1XSVA 5HDGA 5DCFA 3SHRA 1OKRA 4BHPA 5IT3A 5ILVA 3BPVA 5K8SA 1U6GA 2FQPA 2Z33A 5JSOA 4LUKA 2HDCA 4L2NA 4A0ZA 5CADA 4M9SA 1LQ1A 4ESBA 3WW4A 4PDKA 3CF6E 1HKQA 2XL9A 2DK8A 3F8MA 3EQLF 3K1MA 3EYIA 3L09A 4AXOA 4G7OF 4UUVA 3O6BB 2ETHA 2H6BA 4O6JA 1ZLKA 3U11A 4H0EA 1TW3A 4CDGA 1XGNA 1LDKB 2ISZA 3CDHA 1BOAA 3ZP5A 3EUHA 1MJAA 5E20A 2YX7A 2DTRA 3NW4A 4NQWA 2JTVA 4R52A 4AVAA 1YW7A 2FNAA 2Q30A 3SXYA 3E5QA 4ZU7A 5J8FA 4PGHA 1OR7A 3U1DA 5HLGA 3H7JA 3KETA 3GLXA 2Q2EA 3MZYA 3PLQA 5JVTA 4HLXA 5LRSA 2OYZA 4LGWA 3H1MA 2DQLA 1JUHA 1YS7A 4OOIA 4HYEA 3DP7A 1E17A 3NRVA 3CTAA 1EYBA 4PZJA 4N0BA 3BPXA 2IJLA 4QM8A 4HVQA 1RI7A 2JSCA 3BALA 4EGZA 1FYKA 2Q1ZB 1RNLA 3GZ5A 3JSOA 4IJAA 3QP5A 3T0YA 3HRSA 1U3EM 3VEPA 4IERA 5BV6A 4NHJA 3U2RA 1BI0A 3DQVC 2IXIA 4XFCA 3KP2A 4RB3C 5C8WA 1ZX5A 3GW2A 2CV6A 5FCCA 4WXDA 2VECA 3ISPA 5F64A 4LG0B 2K0GA 1YFXA 2P7VB 5JSPA 1SD6A 3RKXA 4ESFA 1YG2A 3MQ0A 2JPCA 2ZNYA 1CAUA 1JHHA 3LA2A 3HOSA 4AQ2A 2F5FA 1J5YA 4EM0B 3F8BA 2P17A 4FAGA 1NHAA 4FX4A 5FLXZ 2ETEA 1J75A 1HKTA 2QWWA 4ZU4A 3C3WA 1Z91A 1BI2A 4ZYDA 3ZMTA 3OD0A 1TW2A 2X4HA 5IT9K 3FMRA 4L9VA 1FSHA 2EA4A 1GQHA 1MJBA 1H0MA 3ETQA 3ML6A 5IT9Z 4D0PA 2ZNZA 4X6RB 3WTTC 1KQ8A 1B59A 1IUYA 2V09A 1R1TA 4UXNA 5DEQA 2BNOA 4JVAA 2O8XA 2BNNA 5HVQC 4UV8A 3ZQ7A 1FX7A 2Q8KA 4HBNA 2FMLA 1U78A 4LFUA 2A3SA 4MX3A 1PP7U 4IHTA 5K5OA 1J58A 1BI1A 2V6CA 3GXOA 1S8NA 2ZXJA 2UY9A 1WGPA 2FOKA 2OZJA 1ZAOA 5ICCA 1XMKA 2H09A 3ZMSA 5LBQA 3BWGA 2MH2A 2HWVA 4JBAA 4AIKA 2KIUA 4J1WA 2MLKA 1O3TA 3K2ZA 5FPZA 2RVCA 3WE2A 4G7HF 3ABUA 4UXAA 2H27A 2DW4A 1FXZA 1S7AA 3DFGA 3V7RA 3OGJA 4KYWA 1BBYA 5J48A 3CJNA 3BY6A 3IWFA 1YTYA 3EJKA 4IXAA 4WF2A 3K0LA 4S05A 2IT0A 5CVVA 3H7YA 3SZTA 2OPKA 4HN0A 3D82A 3ULQB 2H94A 2XKOA 5CVJA 4LTAA 2WWYA 4I7HA 3VHRA 3KEQA 4ETSA 4XFBA 1R36A 4IEZA 4L11A 2FMYA 3WGHA 2M30A 5LEJA 3GWZA 3G3ZA 4N9HA 5JHUA 1DUXC 1B9NA 1ZZ6A 4H7LA 4D7SA 2QBYA 3FWEA 4YG2F 2OAZA 5J8CA 4MGYE 5D8LB 3HTUA 4KIFA 1QXJA 3S7IA 3F8NA 4OMYA 2VQAA 4RB2C 4LK0F 5E8IA 1NE4A 1PP8F 1YUDA 2HFHA 1DZTA 1YS6A 3GUDA 4HF1A 1D3YA 4N9IA 1REPC 4I02A 2JZYA 4GYGA 1X8MA 3IHUA 2VPVA 1LRHA 1D8JA 4RS8A 1P92A 3HUGA 4KICA 1Q5OA 5CU1A 2C6YA 3ELNA 1OD5A 4LLOA 3F8CA 2QENA 3PVBB 1SFXA 2OBPA 1XSDA 2GC0A 5EFUA 4MQ9F 3T8RA 4IEXA 3QU6A 2DPUA 4YIFA 1FLIA 1YFUA 1J3QA 4YNIA 2O03A 5D5VB 3NJZA 2A61A 3DEUA 3E5XA 2HEOA 4Q0SA 4HV6A 3KP6A 2ET7A 4L5IA 2QQBA 5I8SA 3KP7A 2ATFA 4EJWA 1WLTA 4WZCA 4QXKA 2NS0A 5AONA 3CEWA 4QWQA 1XGOA 5ERIA 1EH7A 2ZKLA 4DNCA 4P55A 2CW0F 4ORFA 1H9TA 3FF5A 4JK1X 3HRTA 2VE8A 2IXCA 1JE8A 5TJJA 4OIRF 1X7NA 4P9UA 3C18A 4XF0A 1SQ4A 2CSOA 1LR5A 3SMHA 1W5TA 2W57A 2VONA 2DO7A 1B1BA 4IPAA 1KGSA 1I6XA 4QM9A 4YARA 1B6AA 4O9EA 5I8YA 2DBBA 4UBGA 2JT1A 3LOIA 2Z3YA 2AXLA 2XIGA 3TO7A 4QGMA 3FXRA 1VP6A 3E6MA 3GFMA 3O14A 4L5JA 1ZG1A 1QNTA 3FXUA 4HAMA 2A6HF 1YW8A 5CVIA 4LLNA 4EJUA 1FNNA 1BM9A 5CVUA 3J80Z 3GYHX 3I58A 1UIKA 2P7CB 3BU7A 2RDPA 1FWZA 3ELKA 5HS7A 3H92A 2KIFA 1SD7A 1LDDA 2VOOA 3L7WA 2FF4A 1JXSA 1F1ZA 1FBQA 4YYOA 5J7MA 2PEXA 1OYIA 4Q0PA 5FFXA 3KGZA 3HRMA 3F23A 5ILSA 1T0FA 5LEKA 2E7WA 4KIGA 3MDPA 3Q9SA 2ISYA 3F8FA 3GFIA 1R5GA 4KUMA 1OFNA 1O3SA 5E16A 4ESJA 2XL7A 3R0AA 1RTVA 1IW7F 1YW9A 2MBFA 4L0ZB 3RIRA 2VT2A 4L9NA 4Q0QA 1HXDA 1KU3A 1J59A 5HOOA 4HX8A 3DXJF 3BP8A 5LGUA 4MEXF 2LSOA 1FZPB 1EP0A 1PMIA 5KHHA 4AVCA 1LEBA 1O7FA 1A04A 2ZMEA 3P9IA 1SMTA 4KWJA 2PG4A 2PTMA 2EAAA 2GXGA 1O3RA 1ZG5A 3V8JA 1H1IA 5I93A 2VBWA 4NVPA 3KEOA 2DT5A 2JRTA 4RAYA 5FDBA 3J7AO 2CFXA 5DV5A 5J6XA 4HX7A 3QPTA 2CWEA 5AIPA 2IA1A 5H20A 4Q0VA 5L3GA 1MJ9A 3ES4A 4UVAA 3ABTA 3SQNA 2XAHA 3I71A 3I64A 2L4MA 3KP5A 4QGNA 4BIFA 1LVAA 1VJ2A 4RB1A 3IDCB 1O4TA 5FD5A 5KHKA 1Z6TA 4AVPA 1HKSA 4OFGA 3BZ6A 1DP7P 3L2CA 4EVIA 3GZ6A 1TQPA 3M8EA 1S29A 3F72A 4KT5C 3DPLC 3U10A 2HYGD 3TNQA 4XLPF 2M8EA 4LEJA 2FXAA 2Q4SA 4IEOA 2I45A 2XGXA 2EFNA 3L2HA 2H0VA 4META 2KRFA 5DD8A 1Q3EA 3KP3A 2GH2A 1K79A 1CX4A 3H8UA 1BIAA 3J81Z 4P96A 4HLYA 4MQVA 4ZZLA 1LKNA 1U12A 2OD5A 1O5LA 4BQAA 4PCQA 3KGLA 1H1MA 4XBFA 2MLGA 4IHSA 4K8FA 5JSRA 4MH0E 4GXOA 3TQNA 3LWCA 3M9AA 1R7JA 4XLNF 5ED4A 4HOBA 1ZNPA 5ICEA 4HF2A 1ZZ7A 5E1ZB 3MZHA 3WW2A 3TOBA 5JR3A 1UPIA 5BY5A 4OMZA 4IETA 5EZWA 3M1EA 1XD7A 1ZRCA 1XE8A 4E2GA 1WKMA 1QGPA 3QP6A 3AAFA 2Y0MA 2ZBKA 2NNNA 1YFHA 3ZMVA 1CF7B 1IZ1A 1HW1A 2ZJ2A 2QLZA 2UXNA 2ELHA 3OV8A 3R0JA 4RB0A 1IF1A 5D4RA 2CYYA 1UW8A 4Q29A 4KWLA 1W7PD 1ZYRF 3L00A 2OZUA 3SZPA 1YIOA 4GGGA 3R4KA 3DV8A 3ECHA 2QVSB 2KJBA 3RKWA 4RAZA 2QQ9A 2EVXA 3H9AA 3ECOA 3NL1A 3FHIB 3S7EA 3FM5A 2QNKA 5KHJA 2GC1A 2PAEA 1L3LA 4O5VA 4ENMA 5K1YA 1PDNC 2VBXA 2OA2A 3CUQA 5H6RA 1SAXA 3JSPA 4O9GA 5EEHA 4LA3A 1IRGA 5LHGA 1ZREA 1CAVB 3RI4A 4EWAA 2F4PA 1Q43A 4HQEA 1R22A 2V1XA 4IEQA 3L9FA 2PHDA 1KQ0A 5L3DA 1CAVA 4DQ2A 3N97A 4Z07A 2CG4A 2HTJA 4EMSA 2GAUA 3S0MA 4KU7A 2LNBA 2K7LA 2GIVA 1J9IA 2W24A 1LEAA 3ZN1A 1CAWB 2Y48A 4Q48A 4ZYEA 4I2OA 1XN7A 1MGTA 1WSUA 4MGZE 1IAWA 2VBYA 3HSEA 1RZ4A 1X82A 3DPTA 3I0TA 1IN8A 2RC4A 4QMAA 2F5CA 3IRQA 4G6QA 5EEGA 3CO7C 3MYXA 1G3SA 3RTRA 4ZYGA 1G4DA 1P6RA 4X6QB 1QWRA 3JTHA 2IRFG 1QY4A 2BE5F 3E97A 1RUOA 2STTA 2B0LA 4P9GA 5E8GA 1NYWA 4OU0A 3LQRA 2GC3A 2VN2A 3HYIA 4WVZA 3LA3A 1NE6A 1FP1D 2FSWA 4HZFA 3GEZA 3HIFA 1NXMA 1IN5A 3KZYA 5HDKA 3KFWX 4XEZA 4BH9A 3SHFA 4RGSA 4M9ZA 4L9JA 5FFZA 3EHKA 3MWMA 1UIJA 2M45A 2MNGA 4PGGA 5A2QZ 3LAJA 3V8LA 4M6YA 4LD5A 5T3NA 2LKPA 5FB2A 4JTNA 1ZRDA 2GQQA 2J5OA 2BEOA 2ZKZA 2P4WA 4M6XA 3ZMDA 1X3UA 1ZGJA 5E1XA 3CO2A 1KU9A 2FQ3A 2ADUA 2KIMA 1OI6A 4MHGA 1DZRA 1ZN2A 1D8KA 1U5TC 1IXRC 5K5QA 4LB6B 5HS9A 2QBYB 1XDSA 3F21A 2XHKA 2FU4A 1YLFA 3ERED 1Q1HA 4R79A 2EB7A 2P5LC 1TLHB 3FHZA 1WA4A 5L3EA 1R23A 3RKYA 3E6BA 1J3RA 3ZDSA 1BIBA 3N4MA 4FAHA 3F6OA 4ENJA 2R7FA 3FMQA 2COMA 4PIYA 3DF8A 3HSFA 3E6CC 4A2UA 1R1VA 2D40A 1GQGA 2D1VA 2WC2A 3JW4A 3LSTA 3C7JA 3K1PA 1IN6A 1SEFA 3EQEA 4F8AA 2HJIA 5D4SA 1UCRA 5HDNA 3QOPA 2XLGA 5LRRA 1I1SA 3LWFA 1ZLJA 1UHWA 5I0RA 3JTGA 4B29A 3KP4A 3QU3A 4CZZA 3OTFA 3TDUC 2DAOA 4A12A 3LAGA 1LB2A 2Z2SB 2EFPA 3W6JB 2CAVA 1EH6A 1SD5A 4EM1A 3IWZA 1CGPA 3FM3A 4HX4A 5DCMB 3CLOA 1VTNC 4XSZF 1CAXA 1EV7A 3O3KA 3WE3A 1HBXG 2PFWA 3OF1A 4FHTA 4KMUX 4M73A 5F1RA 1T6SA 4NB5A 1MKMA 1X8EA 4XETA 4WBBA 1TQIA 1KYWA 1W7PA 4LB5A 2D5HA 2D5FA 1DGRA 1QPMA 4MGRA 4CYDA 4M71A 2HTSA 2LDUA 1TQMA 4FT8A 1ZGAA 4G8XA 4IF4A 3WTXC 1BC7C 4OLLA 3T1BA 2IW5A 1AOYA 2VXZA 2WFPA 3SCGA 1Z7UA 4YIIA 2QZ8A 4WCGA 1T98A 1ON2A 3GFLA 3CUQC 2HQNA 4Q47A 4KA4A 3G7DA 2YPRA 1GXQA 3SFZA 3KSCA 5K5RA 1FY7A 2PLYA 2HGCA 3IKVA 3PNAA 4I01A 3MFKA 4LK1F 4XF3A 1RC6A 1I5ZA 1USTA 4HDUA 2XROA 4YFKF 5LGNA 3D0SA 3SCFA 3DKWA 5BXXA 5ILUA 3WTZA 2MD5A 3QACA 2TDXA 5A2QK 4WXHA 2DCTA 2O8QA 3BCWA 4BAYA 4UVCA 3BROA 1HSTA 5FGMA 3RDIA 3S2WA 1FP2A 2D45A 3EYYA 2GA2A 2UXXA 4QX5A 2OA4A 3BJAA 2A69F 4LMYA 2QQAA 1T38A 5AVPA 3IBMA 2IXKA 2LF8A 3H1WA 2XLFA 1IPJA 3OOPA 5KHIA 1DPRA 3PQJA 2DPDA 1LNWA 2HYFA 3C1DA 2VOPA 2K02A 3RJPA 3JAMK 3E3VA 2VC0A 2BNMA 1OYWA 2GC2A 3KLNA 2NNYA 2V1DA 4XFGA 1SMYF 1U2WA 1Y0UA 1LDJA 1E2XA 4D7TA 3VFZA 2L3DA 5BPIA 4HA8A 2QVOA 1PUEE 4AIJA 4A5MA 1ZZ8A 4XF1A 3QPHA 2G7UA 1SFEA 2MPFA 3I54A 1R00A 2A6EF 2PAKA 1YFYA 3ES1A 5DCMA 1K6OA 2CO5A 3GVAA 2VC1A 2RQPA 5FLHA 5CVRA 3USSA 4P9FA 5LHIA 1P4AA 1GHCA 2DLLA 1ZG3A 4EJOA 2BBYA 5I0UA 4I3PA 1B4AA 3M3IA 5L3CA 2ACJA 1P2FA 4U0VA 2K4BA 2O61A 4HMZA 4UBHA 2NYXA 3FXQA 1U8RA 2O3FA 3NVCA 1ON1A 1XDUA 2MH9A 4UNOA 1PM7A 1RL3A 2HKXA 1J3PA 1MD0A 3D5LA 4LA2A 3WTSC 1FYMA 4LLGF 3ZMZA 1S6LA 4RD7A 5DDGA 1O7LA 4G94A 1O5UA 2GZWA 4XFHA 4HSLA 3SCHA 3IKTA 1IN4A 3VOEA 2J5PA 2PI0A 3WG9A 2HZTA 3BJ6A 3CUQB 3NSTA 1GXPA 4RGXA 4EROA 1AWCA 1Y3TA 3HT2A 4MGIE 2PA7A 4Z82A 4EGYA 3K69A 1Z1DA 3I5UA 2G7HA 2B9UA 3UKVA 3ZN0A 5KHGA 3Q5FA 2C0ZA 5TRDA 4B8XA 3I4PA 3V7SA 3IL2A 1HW2A 1FBSA 2V79A 5LGTA 4I09A 4MTDA 4MGKE 1ZARA 4KMFA 2F2EA 2ZCWA 2PMUA 5D6FA 3P9CA 1J0RA 2L4AA 4HVRA 2HOEA 1OYYA 3BPZA 5KVRA 3CLPA 2NAZA 5HS8A 4JTOA 3ZMUA 5HLHA 4XRFA 1YFWA 1FC3A 5ICGA 5FO5A 4OIQF 4J1XA 1UHMA 1XSXA 3K1NA 1B9MA 3COAC 1WRJA 1YO5C 4DINB 4KN7X 4U7DA 2HQRA 2PBIA 5L3FA 2BV6A 1EH8A 1USSA 5KBFA 3TOAA 2VBZA 2RNJA 4EJTA 2UYAA 2ZMEB 3OCPA 3QRFF 4ON0A 1D5VA 3ZPLA 2MA3A 4CICA 3FX3A 2XAQA 2PHLA 2PQ8A 3LQQA 4EM2A 2E9QA 4ASNA 2ET1A 4WX9A 4KL1A 1QQIA 1FOKA 1YQAA 1FT9A 5JI6A 3IIAA 1C0WA 3MPBA 3V7CA 2QDRA 4A6EA 2HS5A 3WU1B 5I91A 2K9ZA 4OIOF 2W84A 4HDVA 2F5DA 3MCZA 1J7KA 2FBKA 2OQRA 2FEZA 4S04A 3M7GA 3Q9VA 2N7GA 3P7NA 4AQ6A 3GX4X 2IPQX 3LAPA 4ZH4F 4LULA 1TQ5A 4MNUA 2Y0OA 4JV4A 3WTWC 2KXLA 2EK5A 5FQ0A 3EETA 4RGUA 1TTYA 3FJSA 5ICFA 3JAMZ 1V4RA 2E1NA 1F4KA 5BQTA 3EBRA 4U0WA 1WI9A 2QM3A 3H50A 3LFKA 4E70A 1KA8A 2Z69A 1L0OC 3PQKA 5E1WA 4EV0A 4CXFA 5LLQA 2PAMA 4MV2A 3WU0A 1MDMA 4IVNA 3P9KA 2ZFWA 4WXCA 4O3MA 3IRRA 2D1HA 2PN6A 1ZH5A 2IVMA 1QZZA 2BGCA 2R3SA 3TO6A 3GF2A 2XAFA 1ZZBA 1QO0D 4HW0A 2LF7A 3CUOA 1BN5A 2QCSB 3E6DA 2EFOA 4BHCA 4HVOA 4R1HA 2EJRA 4ZYHA 2PQQA 2XKPA 1F9NA 2M1BA 3NKTA 4L0YB 3J80K 1NZCA 2XAJA 4WK8F 4BNCA 1XGSA 4EWEA 1ULYA 2FNPA 1FYLA 2UWMA 3ROUA 3F22A 4ENKA 1TBXA 1O3QA 3KLOA 5F6FA 4B09A 2GXBA 3WGIA 4LG0A 4L18B 3T5XA 3LZZA 1ZRFA 4IEUA 4L9TA 2MC3A 1U5TA 3WODF 1J1LA 2E1CA 2YSRA 3H3UA 4QGLA 2ESHA 3RZZA 3KMHA 2CQKA 1UCXA 5FD6A 2B5HA 3NEUA 3I7DA 1UFMA 2UY8A 4UV9A 2B8MA 5E18F 4Y17A 1I27A 1DGWA 3M8FA 2HKOA 1XGMA 1QZYA 2K4JA 2P5KA 3HSRA 2YU3A 2RN7A 2DI3A 4I0AA 2KJCA 4IEWA 2XAGA 3MEXA 3RYKA 4UHTA 4IEYA 2IA2A 2L54A 5BUVA 4XSXF 2UZKA 2D93A 4FX0A 5JFRA 5KK1A 2FBHA 1J2XA 1RIOH 4AD9A 4A0XA 4K2EA 4Z2YA 3DN7A 1XB4A 1FSEA 1WQ2A 3T8TA 4R8HA 1YHFA 1ODDA 3SXWA 1G3YA 4AVBA 5C6CA 1V3FA 3RYPA 2PFBA 5HI0A 3O2PE 5D5XB 4QLCU 1KQ9A 2Q0OA 1QBJA 3G73A 4M72A 1UB9A 3IDBB 5JCTA 5H6QA 1Z6RA 4LUMA 2Z99A 5FLIA 2DFIA 1T2KA 2K86A 3D0JA 3R60A 1BJAA 1STZA 5DUKA 2Z5UA 2BYVE 5AIQA 5J3UA 3BDDA 4M9XA 4KDPA 1DDNA 1RGSA 3J81K 5E1RA 2JPBA 1Z9CA 1EPZA 3TNPB 4KNYA 1CAUB 5CYVA 4U0YA 3DL3A 2W85A 2ZO4A 4GULA 1IRFA 1T39A 2Z9OA 3HQXA 4A5NA 3IC7A 4I0BA 3I59A 2A07F 3BJOA 4EJVA 1OPCA 3WW3A 2K27A 2V9VA 5CLSA 1JGSA 4LLLA 1TNTA 1S7OA 4YSFA 4YFNF 2Q0AA 2AS5F 4HBLA 1W7PB 3HTSB 2IA0A 1IPKA 4XFIA 2HR3A 5E17F 1L3JA 4JQFA 2EWNA 2F5EA 4KN4X 2FBIA 2DQRA 3B02A 2P8TA 1XE7A 4RGRA 4GCVA 4Q0UA 5DYMA 3FZVA 4GYIA 2PMHA 4XFAA 4WWCA 2OU2A 3HHHA 5D5UB 5BMZA 1U5TB 4MEYF 2CGPA 2WTEA 2EV6A 5D8KB 2IXJA 3K9TA 1SD4A 5CJ9A 3V4GA 3RYRA 4A0YA 2Y75A 4ZU5A 5BS6A 2IXLA 3CL1A 1SFNA 2O6GE 1G6NA 4CHUA 2YX4A 1MZBA 2XASA 3TGNA 2FRHA 4YRDA 4IRHA 1KYZA 3WGGA 2R7DA 3TKYA 1G3TA 2PYTA 4MTEA 1XMAA 3I59B 1XCVA 1ONVA 3HOTA 2A5YB 2FA5A 1ZZCA 4AWXB 1KU2A 5FPXA 4G6DA 3H3ZA 5BOXA 4TV7A 4HQMA 4BYYA 2UYBA 3FE5A 4KFCA 1CAWA 3RPQA 4KIBA 1O57A 1R1UA 2XLAA 1BI3A 4F7ZA 1S3JA 2XV4S 2L02A 2STWA 3EDPA 1KU7A 3NQOA 4G9YA 3FZ3A 2XVCA 4IEPA 1YLLA 5JR7B 3HT1A 3WW1A 1XRUA 4UVBA 3HHGA 2W25A 3U9GA 4Q4ZF 3I53A 3GBFA 2L01A 2GU9A 4LJZF 3W6KB 1R5HA 4YFXF 4EWDA 3KZZA 1OMIA 5FLXK 2DU9A 1H9GA 4HF0A 4HV5A 1CAXB 3V8KA 1ZRRA 2RV8A 3UKTA 2RKHA
chains in the Genus database with same CATH superfamily
2VQTA 3WHBA 2RGVA 1G9CA 3UGHA 4IV3A 3GCMA 4RS5A 1ULFA 4ARYA 3BR2A 4PQQA 1LJ9A 2PHXA 3MZ8A 1T56A 1TWHJ 4OUMA 2HDDA 2HWB1 3RNSA 3KE2A 3QOEA 2NS7A 1DGLA 2H6CA 1K7AA 1HB3A 3PIJA 3U0ZA 4AGRA 3GO5A 1NCRB 2AQFA 5C4WA 2QUFA 3RPUA 1G9BA 2G1MA 3LEKA 3CNAA 2VOTA 3WNXA 2ID3A 1W6QA 3PFIA 1BC8C 2O0YA 2ZMLA 4CDXA 3BCBA 3UESA 2OS2A 4FQ4A 2CDPA 1HW5A 3MKLA 2CQXA 1QH7A 1GNHA 2JB4A 1Y9GA 1WW7A 1CJPA 1QXRA 3Q9OA 1WMFA 3ZYJB 5F2SA 2VNVA 2CGNA 4L99A 1ZZ9A 4DB5A 4BQNA 1JOPA 5CFDA 3REOA 4BDVB 3J7NA 3VODA 1IXCA 2RS11 4JHZA 2RR13 4LIVA 2NRAC 4CDUB 5A6YA 4IEVA 3CMMA 3HBLA 4M74A 2BBVA 6PAXA 2CU5A 2B9SA 1RVF3 1UO9A 1FOYA 1GYKA 4AHWA 4UUSB 1X33A 5FXVA 4U88A 2JG9B 2PJPA 3WTYC 2TUNA 3AJYA 1P4XA 2GXAA 2WNUC 3GF6A 5C3SA 2VASA 1YWKA 1RUC1 4JRAA 1DPUA 1Z05A 3CD6I 3L2VA 1QHHD 3FN9A 5IUQA 2ESNA 3F3XA 1REFA 5IVYA 4ISQA 5L3BA 3V65A 1FTTA 2HWC1 2A68F 5KXEA 1H30A 3VBRC 3ZYBA 2CWMA 1DFQA 4COUA 1PK6A 1ZVFA 4ZZDA 2XRNA 2IS4A 2ZX3A 1WCKA 2QJVA 3EO6A 3CDIA 4A3FJ 1W4MA 4BHBA 3B73A 3FHAA 5AC92 1XSVA 2CQNA 3KVAA 2YGLA 2MG4A 1ETQA 4XOPA 5EPAA 3BTAA 5D2AA 3L1PA 1OKRA 4BHPA 5IT3A 4LG3A 4YVWB 3BPVA 2FQPA 2JA5J 3AP5A 3O7OA 1ZK8A 4MOAA 4M9SA 1LQ1A 3ALQA 4LBLA 2OTJI 4Y1ZA 3WW4A 3V0AA 1H88C 2VZRA 1HKQA 3EUHC 3BOPA 2VBBA 2DK8A 2K2SA 2DCZA 3K1MA 4H7MA 3O6BB 2V6EA 2H6BA 4RHV3 3W2AA 3CU7A 1X19A 4L8QA 1ZLKA 3JQXA 1TW3A 3ZN5A 3EUHA 4YRVA 1MBGA 2ECBA 2R072 3NW4A 4EEFG 1QJU3 2EIJH 1YW7A 1OLRA 3E1F1 5J8FA 1OR7A 1QVTA 3U1DA 4LKDA 3H7JA 5FPUA 1FMVA 5EYXA 3TN92 1RJ8A 5FUIA 2ZBJA 3K4DA 2DQLA 5F32A 1JUHA 1BMV1 4XRSA 5L9BA 1LFBA 3A22A 4RQPC 1EYBA 1SPPB 5JLVA 3AYAA 4PZJA 1GP5A 2B63J 4ZDPA 4N0BA 5FK7A 2JG9C 3WP6A 4IHVA 3PUIA 3LOCA 5EGOB 4HVQA 1PUFA 2JSCA 4H4KC 1K3IA 1FYKA 3DCFA 3BTZA 2CQ7A 1JTYA 1SFKA 2VCBA 1EA3A 5BV6A 4NHJA 2F6BA 3DQVC 2X1CA 2IXIA 1KRIA 4RB3C 5C8WA 5EXOA 5JOWA 2CMPA 3GW2A 4LKFA 2XGDA 5FCCA 3KWVA 3S30A 2VTXA 1VB4A 3X2QH 4BBRJ 1W2AX 2J1EA 1EPWA 2ZHMA 1BA5A 2BUKA 1E3HA 4ESFA 4XKBA 2YFUA 5GZDA 3D5SC 1AJKA 2NS8A 2ZNYA 4H2AA 1UYPA 4DY3A 5FZ0A 1RR7A 2GOMA 1D2SA 1J5YA 3F8BA 2P17A 1BCXA 4FAGA 1PMHX 1GUUA 1SDDB 1HKTA 1ASJ2 4E4SA 1GBGA 4ZU4A 2CY6A 3ZN4A 1WCUA 5EGOA 3VBSA 5IT9K 4LBQB 4L9VA 1FSHA 3VB9A 2EA4A 4D5FA 1GQHA 1RUI1 1R4MB 2PHWA 3ETQA 3LSRA 3UNPA 3SFIA 3WTTC 2C6SA 2W94A 3POWA 3OYGA 4N4OB 1TWAJ 4XPVA 2CUFA 1YJLA 2RJ2A 1AF9A 3S8PA 3K70C 2A3SA 1UYXA 1PP7U 1YQ5A 4IHTA 4LK6A 1AYM1 1OJLA 1AKHB 2WL1A 5DZFA 1CWPA 4K8RB 1OLMA 1UAIA 2UY9A 2OZJA 5ICCA 2H09A 4N43C 2AHQA 2W1SA 1COV3 1HRI3 3NAPB 4JBAA 4AIKA 3AFGA 1HC8A 3LSHA 4J1WA 1O3TA 5JI9A 5FLVA 2R073 2W87A 5FPZA 2RVCA 3A0BC 1T6GC 5FYYA 2P5BA 3RQ0A 3OGJA 4NROA 3QD6A 3BY6A 3IWFA 2QA4I 4BQ4A 4IXAA 5FMCA 4HANA 2KIQA 1D0HA 2YBKA 1RUH2 2OPKA 5F8PA 4IEJA 2XVKA 4I7HA 1CQ9A 3MO4A 1R36A 3RZHA 1RUE2 2FMYA 1RPWA 2BW8A 3WGHA 4FOWA 4YW2A 1TG7A 2DBNA 1DUXC 4EZ4A 1XSRA 3JCUC 1NK2P 1DG6A 3CJIB 3FWEA 4DXSA 4N43B 1NE4A 3IB3A 2BERA 1NY72 2GSYA 3T0BA 2XVLA 1AL23 4PBOA 1QNWA 1ZA4A 4GYGA 2IVJA 1X8MA 3KV5A 1KQRA 1XS9A 1R1A3 2JDMA 1LRHA 2VZVA 2YBPA 4O7XA 2VZPA 2Z79A 2BXYA 4JYKA 1WJCA 3WG1A 2QENA 4JRLA 2DCKA 3WD5A 2RS32 2DURA 2PMZN 5EFUA 1D5YA 2YZ4A 2DPUA 4AUXA 1J3QA 1O8SA 4YNIA 3NJZA 1KONA 3KT4A 3E5XA 2ARXA 4IGOA 2HEOA 1Y39A 4Q0SA 5KC6A 3RZLA 4L5IA 4WZCA 3CEWA 1IJWC 2J1TA 1H8AC 1EH7A 2ZKLA 4DNCA 1V5EA 1H9TA 3AKPA 4JK1X 3HRTA 2VE8A 5DAWA 4CCCA 1BBT1 3AC0A 4CVUA 1MS0A 4K9SA 3C18A 4ITCA 2RVAA 2DO7A 1B1BA 4IPAA 1FPN2 4CYCA 2DBBA 4UBGA 5GLZA 2JT1A 4FXGB 1RB8G 3L9JT 4BU2A 1AYN3 1ZBA2 5CEHA 2PQSA 2JENA 1P7JA 2WS91 3FXUA 2QQOA 1AR82 2Q5TA 1RYYA 4COYA 3S57A 2VJJA 1V9U3 1YW8A 2YC4A 2D97A 1WCSA 4LLNA 4RFT0 1BM9A 2R93J 1GZCA 2W1UA 4QTRA 4INDA 5CVUA 3VDXA 2PHTA 1UIKA 2RDPA 1FWZA 3ELKA 3IDAA 2VQ0A 4QQLA 3H92A 1R082 4ASLA 1MNMC 2HWF1 4DZGA 2DA4A 1W3VA 2VOOA 2W91A 3IZOA 3JBG1 3CP2A 4W65A 4YYOA 1AR92 4Q0PA 1H9WA 4XMAA 5E6HA 3F23A 5LEKA 5GPAA 2E7WA 3MDPA 3WUCA 3Q9SA 2MSYA 3GFIA 2AXTC 1OOPC 4DYCA 3HD8B 3VDDC 1O3SA 5E16A 4FFGA 3J8F1 4Q4X2 3ZN6B 1IW7F 1N47A 1ETWA 1LOAA 4L0ZB 4E8DA 1HXDA 1KU3A 1WLDA 3T09A 2Y69H 1X4PA 5FBZA 2DVDA 3QYFA 1GV5A 3HDDA 1VRH1 1PMIA 5KHHA 3T2OA 2HQ5A 1K83J 3P9IA 3RFRA 3JRDA 2PG4A 2PTMA 3W6VA 3TEXA 5FMOL 2WN2A 4QT6A 5JI7A 2QQKA 2Y38A 3OBZA 3OY8B 3ACGA 3SQOA 1IKQA 4B4QA 5EJZB 5HNFA 1H1IA 1X36A 4NVPA 4JX5A 4Y1YA 2X48A 5DV5A 5DDJ1 2A6XA 2CV2A 2R063 1JT0A 5ABJA 4B3XA 2OIIA 4Q0VA 3OL3A 3SQNA 4QPIB 3I71A 5JXJA 5B4XA 3K2AA 3OSGA 5A3UA 4A3MJ 1LVAA 3N7LA 5JDBA 3N9MA 1HKSA 4OFGA 3H9QA 3WDXA 3BZ6A 1HA8A 1FYUA 3VYTB 1GWLA 3L2CA 1LHWA 3JBG3 4FISA 1TQPA 5AC93 2CWSA 3F72A 2RHPA 2V26A 5C44J 3OR2C 1H1AA 3SH5A 2HXIA 4XLPF 2M8EA 3ZQCA 1SEUA 3BG9A 2RE9A 4IEOA 2I45A 2L9RA 3W20A 2XGXA 2HQAA 5FROA 1W05A 3L2HA 2R043 2WINB 5FY7A 1K79A 5IFTA 1H4GA 1CX4A 4L0PA 3IAS2 1GZTA 3V56A 3TN91 3THPA 1U12A 2J7MA 3OPTA 3LSDA 1A8DA 4B1LA 2JA7J 4M3CF 2MLGA 5JSRA 5A3OA 3LWCA 4HNVA 4M3GA 2R49A 1ZNPA 4NMIA 2IAIA 1QNYA 5FKOA 5ICEA 1MZ5A 2A1XA 1IHMA 2VM9A 5BNGA 2DOEA 3VKLA 4UUTA 3FIWA 3E7LA 3TBIA 1ETKA 3TOBA 4Y22B 2ZGPA 4LOCA 5BY5A 3M1EA 4OZOA 1AXYA 3AFKA 3FLTA 4E2GA 1QGPA 1LNSA 3AAFA 4IL6C 2ZBKA 2LKXA 5ANNA 1YFHA 1CF7B 2ZJ2A 4I99C 3HNMA 2QLZA 4BK5A 1O4XA 4P9LA 2G4IA 2IVIB 2DCJA 3ZYRA 3H8OA 2QKMB 2TCTA 1IF1A 5D4RA 1YX3A 1S72I 4TXWA 1QPIA 2X5IB 2OZUA 2ZGOA 4GGGA 4E7SA 1YQCA 5GJ6A 5IK8A 3ECHA 2QVSB 2A3WA 1S5LC 1R9TJ 2R6QA 4AFBA 3JREA 3ECOA 3JRGA 5FZGA 3FHIB 2VOVA 4HKOA 4EN0A 3KM5A 2X8KA 1UMQA 1L3LA 4ENMA 5K1YA 1PDNC 1S0JA 2OA2A 3DYPA 1JYTA 2VUAA 2P81A 2R7QA 4XXPA 5CNAA 4O9GA 3ZPYA 2BY1A 4EWAA 1SANA 1Y9MA 3AM2A 1H4HA 5LBBA 1ND3A 5L3DA 3N97A 1OA3A 4Z07A 3FKJA 2JE9A 1VAVA 4TSVA 4PK4A 3S0MA 4KU7A 2QZ2A 4DUXA 2LNBA 2K7LA 5C9AA 2GN7A 1AYM2 4SBVA 2W24A 1MBJA 4XAEA 2HVQA 3OGRA 1MGTA 3SH3A 4OYUA 4YZ5A 3I9V2 1ZRIA 4M3CA 2XB5A 4CTEA 2ERFA 2WT2A 4DUWA 3I0TA 2RC4A 4RQPB 1W8FA 4GZ9A 2FUG2 1ODNA 2QCOA 3WP3A 3MYXA 5CFDC 1G3SA 1G4DA 3I8TA 4X6QB 5FYIA 3JTHA 5EEAA 3VDAA 5KHDA 1H89C 2ZJQF 2FBEA 2IRFG 4NC8A 3ATGA 2B46X 2BE5F 3C2UA 4FFHA 5M0TA 2Q8DA 3O1PA 3OS0A 3LQRA 1WW6A 1D4VB 4GWNA 4R9DA 5LCWL 4OAYA 1NE6A 1TVGA 2FSWA 4IHXA 1RUJ1 2QQMA 1NXMA 2IZWA 2ZXQA 2V4JC 2Y30A 3SHFA 4CCJA 5GKAC 4L9JA 4O65A 2M45A 2HWD1 1N3QA 3PM1A 2MNGA 2M9HA 4C30A 1W99A 4LE3A 2D6NA 2A6TA 4AEDC 4LKSA 5FPVA 1FOXA 2LKPA 2NMOA 3MIEA 2GQQA 1VBA1 2P4WA 5E1XA 3VBUB 1NZIA 1KU9A 4XUTA 5AFBA 2TNFA 5GAGJ 1ZN2A 3A02A 1U5YA 1U5TC 4LB6B 2QBYB 2VVFA 2XHKA 1YLFA 4FPLA 1TWCJ 2GBYA 3Q8EA 5E3LA 2P5LC 3FHZA 4B3NA 4QPIC 1FOD3 3I4MJ 1HRI1 1R23A 1LAJA 3OYWB 3DKQA 4MXWB 4S2DA 2VCAA 4X0GA 1YRZA 5BNPA 2FDHA 1D1CA 4ABZA 3FMQA 1JUSA 4G6TB 1W0NA 4GA9A 3VKMA 2COMA 1ENSA 5GLWA 4A69C 1SZBA 1HF0A 3HSFA 1Z0HA 4A2UA 4YZ4A 3O8GA 2WC2A 1JKPC 2JDUA 3JW4A 3LSTA 3AP6A 3K1PA 4Q4Y3 2KDOA 4W6YA 2ZX2A 2HJIA 5HDNA 3PFYA 3GLLA 4GALA 5LRRA 2B7EA 5JPNB 3KP4A 5GTIC 3QU3A 2G0EA 4XNFA 3OTFA 1PVC1 4IGPA 1BBT2 2Z2SB 1LGCA 4BEHB 3I49A 3HOWJ 2CAVA 1SD5A 1D0XA 2ES3A 3IWZA 1CGPA 1XYNA 3DLAA 3ZXDA 3FUQA 2BY3A 3WE3A 4UF0A 3MLJA 1UX6A 4KMUX 4M73A 2LW8A 3WOGA 4KMQA 1W9SA 2X09A 2F17A 4WBBA 1W7PA 2WY8Q 3OS2A 4Q8LA 1BXHA 1QPMA 4MGRA 5FYZA 4MADA 4PQ9A 4IF4A 1XNKA 2V4AA 1MMGA 4B47A 4CEWA 1HIXA 3LPFA 3OYBA 1Z7UA 2LK2A 2EXKA 2BW3B 1OD3A 2F48A 2PLV1 3CUQC 1IDZA 4Q47A 4KA4A 1EAH3 2L7ZA 4GDFA 1R081 3DWLE 2HPIA 2HGCA 5HCFA 4I01A 1S55A 2TEPA 3A4CA 5FYTA 4QDSA 1FOD1 2DMPA 1V6MA 3I3LA 5DABA 5EZHA 4NIGA 3NKGA 1UJ8A 4QQPA 4BEHA 4IUGA 2NVUB 3VSKA 3GCWA 2VD7A 4DZPA 5A2QK 3DYMA 2DCTA 2RAEA 3BCWA 1AYM3 3M3QA 1ZQ3P 4Q4X1 2GMPA 5FGMA 3RDIA 4URAA 1FP2A 1UXZA 1B8IA 4I6ZA 2BVLA 3DTIA 1WH7A 5FZEA 2QQAA 4ATFA 3IBMA 1JYNA 4IQJA 1LOFA 2LF8A 2XLFA 1I9RA 1D4M2 3PQJA 3MLKA 2VOPA 2J1AA 4GH4C 1X1PA 2ZGNA 3E3VA 2VC0A 3BLYA 1OYWA 4A3IJ 2NNYA 1UN1A 1OCCH 3M8JA 2DDAA 2VMEA 1SMYF 3J7HA 3POFA 1E2XA 4D7TA 1VMFA 4AGVA 1N1TA 2L3DA 5BPIA 2KR2A 2VMIA 3JRAA 2QVOA 4EN8B 3AVSA 3GZTB 1G86A 1UU5A 3W5NA 2A6EF 1W8OA 2PAKA 4OHVA 3WVJA 1OLQA 3UV9A 2BY2A 5C70A 2WQZC 3OBAA 2V7FA 5DCMA 5SV8A 3S1NJ 2AYHA 1VNDA 3TAYA 3USSA 4C91A 4QX8A 2A6ZA 2D7FA 1AL22 2BBYA 5I0UA 1V6NA 2R5ZA 1B4AA 3M3IA 4COZA 2ACJA 2O61A 3NVCA 5KXDA 1YC61 1LHUA 1QJZA 1PM7A 4D1QA 1CX1A 3NQHA 3I4IA 1VB2A 2PELA 5CA6A 3USUB 3OIQA 2ZFUA 4LLGF 5DDGA 4G94A 3WQ1A 4DRRA 3S2HJ 2WSVA 4FOYA 4N7IA 1RUF1 3FXOA 3IKTA 3T2TA 3U1XA 2J5PA 4YM1A 1GXPA 2RV9A 4RGXA 1BEV1 4EROA 1K4TA 4II3A 4Z82A 4EGYA 4UYBA 2GM4A 3K69A 2HOSA 1Z1DA 5FRNA 3I5UA 2G7HA 4BJ0A 2VQLA 1VF9A 3H35A 5EQUA 1X1DA 5TRDA 1GWMA 4RLQA 2V79A 4RL7A 4S0HB 5F9TA 3ZLIA 1W36C 4CP1A 2A70A 1NCQC 2RNGA 2LS6A 4AIDA 4IO9F 2ZCWA 2PMUA 4A3XA 2VAUA 3ZCOA 4HVRA 1QH6A 1OYYA 3BPZA 5KVRA 5FMOS 3ABZA 4ZDLA 4XRFA 3GHMA 1DF0A 4NWVA 3GTPJ 4OIQF 1SBFA 2DT6A 4J1XA 1G7YA 4CXWA 1UHMA 1G2HA 1Z21A 3KZ4C 2HEYF 2E32A 3FXJA 2XAUA 1PO13 4DINB 2BV6A 4HNUA 3I55I 2RNJA 5FXXA 4N43A 1V9U1 1XG1A 5F5IA 2L9NA 4CICA 4AI8A 3WQBA 2XAQA 1RINA 2CUEA 2VOWA 3U14A 3SC7X 5J4YA 4KL1A 1DQ2A 1JXNA 5B5EC 1F2NA 3WXPA 4Q26A 4OHWA 3CCRI 4FVVA 2W47A 2LOOA 3MPBA 2OVUA 4QHOA 1W6NA 2WQ8A 2HS5A 3AXEA 1QOSA 1LKXA 2HWE2 3NJVA 2LLKA 4JCKA 1QZEA 1LODA 3RJRA 2DOAA 1WCQA 3IIIA 2IPQX 1ZYBA 4MYEA 4ZY9A 3AMNA 1YXWA 1EV12 5TGTA 2Y0OA 3GMEA 2EK5A 2W1WA 5FQ0A 1OLTA 4RGUA 3FJSA 5ICFA 4Z1VA 2W9XA 2VTFA 3Q0VA 2I07B 5BQTA 3LFKA 1KA8A 1L0OC 4EV0A 4CXFA 2GNDA 5JOZA 3ZSEA 2PHUA 4CPBD 4O3MA 2YBSA 1YEWA 1JH5A 1EUTA 3IRRA 3N36A 1ZH5A 4XJ9A 2O7OA 1HJGA 2DU1A 1A78A 2R7WA 1SBEA 1HN1A 2RDRA 2BGCA 1DQ4A 3NAPA 4N53B 2ARCA 1ZZBA 1W5CC 5LY2A 2LF7A 3NJYA 3NAUA 1GSLA 4AFDA 4BHCA 4HVOA 4GB32 2A6WA 1IQDC 4ZYHA 5DUVA 1F9NA 2M1BA 2GOXB 1YIFA 3J80K 1SLTA 3K4ZA 3WF4A 5IK4A 1XGSA 1VQ5I 3Q8AA 3W2WA 1FYLA 5L7OC 2RM23 4RR3C 3F22A 4XTPA 5EWSA 1OF3A 1O3QA 1MMAA 5F6FA 1REDA 3AZVA 4BB3A 1VBA2 1DIWA 3CC7I 1OCOH 2J1UA 5T52A 3FLRA 4LG0A 3CCMI 3G6JB 3EMRA 4L9TA 2MC3A 3WODF 5IYDJ 2YSRA 3RZZA 4QGLA 3KMHA 1OISA 4P00B 3LPGA 4ZXEA 1U5ZA 3ZRGA 5IJRA 2LVSA 2AQEA 1ULGA 5CIRA 2B8MA 4WM8A 1VMHA 2E51A 3ABKH 2E5ZA 1SVOA 2DI3A 3UL2A 3TN93 4DXRA 3CJIC 4AVZA 1KDKA 5F0CA 2W4SA 4K7JA 2YUEA 3S3MA 1LFPA 2YB7A 3UK9A 4AQTA 4WVMA 1DCSA 2WNVC 4JGYC 1ETXA 1C8NA 2D93A 5DG2A 4FX0A 2FBHA 3ILNA 1J2XA 4XVHA 4NWWA 1KJRA 4A0XA 3CC2I 2NMNA 3GM8A 4IQ4A 1S9HA 2E63A 1XQNA 2NM1A 3UGFA 1OCZH 1MNDA 4AYBN 3POJA 3SXWA 2ZACA 3O2PE 5JLWA 4R4XA 5FZ1A 2VQGA 4IX7A 5HV0A 3AKZA 4LUMA 5FKNA 5FLIA 4HT1T 2EXJA 2DFFA 5L9VA 5ERLA 1BJAA 3K4BA 3JR9A 3BVCA 1STZA 5DUKA 1IS6A 5C71A 2ZC2A 1QHGA 2BYVE 5AIQA 5J3UA 1R64A 1SVLA 3J81K 2JPBA 5FZ9A 5T5LA 3CQZJ 1CAUB 3T0AA 1RVF2 3PL0A 3DL3A 2ZO4A 4GULA 1NCQB 1T39A 2Z9OA 2Z5WA 4LO5B 4PBPA 3WNNA 3CF5F 4L97A 2L9LA 3BJOA 1AX2A 4I3GA 3VZNA 4QHZA 1JODA 5LA9A 2CH0A 1JGSA 4V2GA 1S7OA 4YSFA 2Q0AA 4C2UA 2R32A 4DY5A 1VBC3 2LTNA 1RHI2 4CYCB 3A03A 2JVHA 4JQFA 1BW6A 3BG7A 4XUNA 2P8TA 4IQPA 1PZ9A 4WV8A 4GCVA 3QBQA 1OA4A 3ORJA 3THTA 1MS1A 2AC1A 2LRPA 5HCAA 1YCIA 4XFAA 5H9PA 1NA1B 3HHHA 5D5UB 5BMZA 1U5TB 2RMU2 1W8UA 3K7AJ 2QQIA 4WVVA 2IFWA 5FYHA 2DUPA 1U0AA 1US2A 3K9TA 1SD4A 4MGTA 5LK7B 1BJQA 2WFF3 4M0HA 3CL1A 4M3BA 1MZBA 5F7UA 4HPKB 4XOTA 2K40A 3ZR8X 1Y0NA 1G3TA 5F2WA 1RUH3 5B2GB 2OTLI 1VBB3 3VZLA 1OH4A 2FA5A 2HLEA 4G6DA 1O8PA 3H3ZA 5BOXA 1NH3A 4XAAA 4BYYA 3FE5A 4A7ZA 2Z16A 3PNYA 1R1UA 1HB2A 4F7ZA 3ZM8A 3O5SA 1MR5A 3VBUA 3ZN6A 3R4UA 4Q5OA 4XDQA 3OMYA 5FREA 1AJOA 3N3HA 4GMP1 5IVJA 1RMU3 4UVBA 1XRUA 5FP3A 4NPMA 1YJWI 4YVWA 5EJCA 1ITYA 5LBFA 4Q4ZF 4YFXF 2V9KA 2ZEZA 4B44A 3OY8A 4CRQA 3ILRA 2A73B 1H9GA 1CAXB 1Q1VA 3JRHA 3AL5A 1S0IA 2G19A 1ZRRA 1BOBA 4R9BA 1EJ9A 1AL21 2Y6JA 1QJY2 3ACLA 4AE2A 2CDOA 2OJED 2R5YB 2O1QA 4IL7A 4CO8A 1IXSB 1F5TA 1SLCA 3I3BA 3T4VA 2BOLA 4A4AA 4IE5A 3GZUC 1VR3A 1Y1VJ 4ONUA 5KWRA 3ILFA 1ND3C 2M87A 3O0WA 4QXBA 2BOIA 3PTRB 3VD5A 1RUF2 3O8HA 1N3PA 1WKYA 3LDBA 3ZMOA 2BXZA 2FD8A 3RGBA 4OMCA 4CDXB 1AKHA 3WTVC 2GWRA 3ONQA 4IE4A 3VBUC 3TEWA 3UKNA 5I0TA 4BQYA 3TP3A 5GZEA 2AENA 3TDZC 5HBAA 1BVP1 5C4XJ 3TBDA 5M5WJ 4AIHA 2XBO3 2Q8OA 2RG4A 5FZCA 1X2NA 5HLIA 4M3FA 4A41A 5HXVA 4G7ZF 1MVEA 4LE4A 4XFFA 4XXAA 3PMEA 2VPLA 2NQYA 3POGA 1WWXA 3R6SA 2B9VA 1XCBA 3CJXA 3BC8A 1OFCX 4UFKA 1NAEA 3VD4A 3OYDA 2D2WA 3H9JA 3SNMA 3E5UA 2XONA 2DFCA 3O12A 2P6CA 5D6EA 2DMNA 3HEIA 1G9DA 1M4WA 4OINF 1EY2A 4PIZA 3C3VA 1SFUA 1XX5A 2KISA 3RZMA 3MAJA 1WD3A 2JG8C 3TO9A 5C4JJ 2JJ7A 3SJMA 2EA7A 5IK7A 2HDWA 2YR2A 4KU8A 4A45A 1XYPA 4BQXA 4Y13A 1JYXA 4E2SA 1CF7A 2WY7Q 4JHTA 2IC1A 3AXDA 4QPOA 3CO6C 3OIPA 3W58A 3JUUA 4A42A 3AKSA 4MUVA 3DXTA 4I98B 2HWE1 2D6MA 5T5JA 2CRGA 4XC9A 4XF9A 4FBFA 4GO1A 1HSJA 5DD4A 1LU1A 5A7QA 2JWTA 1S1AA 1H6XA 1LE8A 4EQQA 2A6YA 5DCFA 1W9FA 4QXHA 3AKTA 1HRV3 3RQIA 3DEWA 3OYKA 1VQ6I 5FYUA 3BTYA 4L2NA 3RRDA 4A0ZA 5CADA 4NN0A 1AR72 4OUEA 1A35A 3AL0B 2ADEA 1JUIA 2E35A 4Y4RA 2JQ7A 1Z78A 3JXSA 4PDKA 3LNQA 1WJ5A 1YQ2A 2E36A 2XL9A 4D8MA 3M8LA 3L09A 4DW6A 4G7OF 2EALA 3LIHA 4ZZ8A 2ETHA 4GD4A 2YC2A 1WCMJ 2F4IA 1XGNA 1GZWB 3VBRB 5A1LA 1RKTA 4QDRA 2DTRA 3DKYA 5BNNA 2D6PA 4V1PA 1HN0A 4NQWA 4JGYB 3JRFA 1ASJ3 3E5QA 2F5VA 5HLGA 3KETA 5HLTA 2YUSA 5IVVA 5EJ3A 1X1BA 2Q2EA 3V0BA 3PLQA 1IS5A 1SPPA 5LRSA 4LGWA 3SLIA 4NO4A 1E17A 2VZUA 1N77A 3BPXA 5B3SH 2D43A 4V2WA 4K20A 5T54A 3OYFA 2Q1ZB 1B09A 3GZ5A 4CP9B 4GXLA 1UY0A 5FZIA 1VBB2 3LFMA 3HRSA 2VKHA 3VEPA 3KYLA 3WX5A 3TOJA 4BE1A 4LORA 4IERA 3APBA 5CAZA 5LA0A 3M3YJ 1BI0A 4C1XA 5GLTA 2ZMNA 2R7VA 1ZX5A 2VXJA 1NLQA 1KJLA 1B8IB 2CV6A 4ZPIA 4WXDA 5L7OA 4E27A 2K0GA 1PO22 4XKWA 2LH9A 3ON7A 5GLUA 4P9YA 5FP4A 4GMP0 2YFZA 2VZSA 1YG2A 4E4HA 2LP0A 2MABA 1NA1A 2E5NA 3OBTA 5LK5A 3K10A 1WJFA 2ZX4A 3OYMA 2VB6A 4AQ2A 1CJDA 3SZGA 4EM0B 3WP4A 2HWC3 4W6WA 5FLXZ 2ETEA 3CJRB 2HVRA 5E3NA 2A7AA 1BR1A 3NWSA 4FPHA 3C3WA 5F5CA 4CCNA 4ZYDA 3OD0A 5F6KA 1TW2A 2E60A 3WHCA 3FMRA 5A32B 3AMMA 1TZLA 3ML6A 4D0PA 1W6NB 2ZNZA 3CLQA 5J1YA 3C7HA 4BK4A 1R1TA 1W2NA 4UXNA 1NXD1 5DEQA 4JVAA 1FX7A 1QJFA 2W0XA 4NC6A 5G05L 4LFUA 4MX3A 3TW7A 1IV6A 1BI1A 2HWB2 5H2FC 1WGPA 4Y20B 4OQ9A 1ZAOA 2XJUA 3KT7A 1XMKA 3ZMNA 1UXXX 2KIUA 2CYFA 3K2ZA 3VDCA 3UJQA 4OULA 4G7HF 1QJU2 3S32A 2H27A 4RR3B 2DW4A 1NT0A 4UT5A 1S7AA 5L19A 4KYWA 1IS3A 3EJKA 1JHNA 1GVDA 3QPSA 3H7YA 3HN3A 4YVSB 2HPMA 2E7TA 3D82A 3CCYA 4XORA 5CVJA 2XPJA 4IHYA 2JG8B 4NHLA 4L11A 3HGGA 4PF5A 2RR11 5A3PA 4CA9A 3GWZA 4HNTA 4N9HA 1B9NA 2ICWG 3ZXJA 4QQOA 2XG3A 5JHFA 3RZKA 4MHRA 1BZWA 3FBMA 2PJRB 2OAZA 5J8CA 1W2TA 1ENHA 1JKOC 4GKXA 2VQAA 5E8IA 3MIGA 4H3WA 5HXMA 1YUDA 1E5HA 4CZCA 3MIDA 2HFHA 1YS6A 4RSUA 3TWIA 1REPC 5K7PA 3WQ0A 4JGZB 1RUJ3 1RUC2 2LYCA 2IGOA 1MEC2 4CU7A 4M00A 3IHUA 1MMDA 1D8JA 1MBEA 3HUGA 4KICA 5CU1A 2C6YA 4LLOA 1OD5A 1TWFJ 5IP6A 2GC0A 1XSDA 1H2NA 4GJYA 1OLME 3TEYA 4MQ9F 3SEPA 2XJVA 2OCEA 2W3JA 3GTMJ 4WM8C 2GNBA 1ULEA 1RESA 3ZQIA 5D5VB 4FPOB 2OQ6A 3TW6A 2JDPA 2ZJCA 4HV6A 3KP6A 2QQBA 1UQXA 2ATFA 4EJWA 4LR4A 1F8VA 2NS0A 3UT0A 1FTZA 1ULPA 1XGOA 4BQOA 2IGKA 4ORFA 1PX3A 1W28A 1ZBA3 1XPWA 4PT6A 3KHCA 2IXCA 2GIZA 4FSJA 4TZDA 1X7NA 1Y7BA 1DYKA 1LR5A 3SMHA 1F4HA 2JDYA 1KGSA 1I6XA 4YARA 4MFDA 5I8YA 2KDZA 2WUHA 1TT5B 5C9AB 2V5DA 3TO7A 2XPVA 4K1YA 2WYFA 2X10A 5L9RA 4RS5C 4RA2A 1ZG1A 4N4NB 2DFBA 2E26A 2HBTA 1OQDA 1FMD1 5M5XJ 4LHSA 4D9JA 3HVDA 1FNNA 1LJ7A 2R071 2BVBA 3H5AA 1PX4A 5GPCA 3WZ1A 1FJLA 1ORKA 2DYSH 3I3MA 4FFFA 2KZVA 5HS7A 2DUQA 4YW3A 2VVEA 4AVTA 2JRMA 4B4CA 1FBQA 1VQPI 1YITI 5M5YJ 3P3NA 5ILSA 4XKVA 5KAIC 3PJYA 1POV0 4J19A 2RS12 1UG2A 3OYHA 1OFNA 1I3AA 5A7PA 1GZWA 2XL7A 3AKQA 1AA7A 5JLXA 3WEZA 3RIRA 3A01B 1OQYA 4L9NA 4Q0QA 5FKCA 5HOOA 1R083 2OPWA 2WZ8A 1KITA 3BP8A 3V0BB 3KV4A 2WBMA 5CFCA 2LSOA 1VBC1 1ZKGA 3PVEA 1LEBA 1A04A 3CBNA 1OT5A 4UUSA 2EH3A 4KWJA 4WM8B 1O3RA 1QU0A 2JDHA 1ZG5A 1UY1A 4XTMA 3VYRB 1O6UA 1E57A 3V8JA 2Y0IA 4M3EA 1ND3B 1F15A 1L7RA 5JR2A 4RAYA 1W2UA 5A3LA 1V6IA 5BNQA 2DA3A 3CCJI 2BP6A 3QPTA 2CWEA 5AIPA 1N78A 5L3GA 1MJ9A 1IGOA 3ABTA 4XJZA 2XAHA 3SDBA 3O0VA 1PNFA 4AOCA 4QGNA 2QKDA 4BIFA 2CS3A 1YJKA 1UWWA 2RS53 3FDYA 4RB1A 3PSIA 3J7ZI 1ETOA 3EXUA 4RQPA 1FOWA 1TC3C 1UY4A 1D1BA 2WNOA 4NPRA 4XLHA 3MV11 2JSPA 1HDPA 3GXUA 4C0HA 1S29A 2DUOA 2FDGA 4Q4W1 3POSA 5ISLA 2V72A 4TWTA 3VZOA 4AAPA 3U10A 5IFPA 2HYGD 1MSFC 2X5IC 2M4GA 3P3PA 2ZXIA 2O5RA 1GDTA 4LEJA 4CDWA 1RRJA 1XU2A 5C7GA 1DGWX 4FI9A 5H9SA 1AYN1 3HOZJ 1L7QA 4XJUA 2KRFA 5IVEA 3KP3A 3H8UA 1Q8PA 3J81Z 1MBHA 2R7UA 5KAFC 2IS1A 2P34A 3KGLA 3OJBA 3DXUA 1H1MA 2LY2A 2VZ3A 3TQNA 4Q1RA 2E1OA 2L9VA 2VIXA 2VXDA 1JZ7A 2E6VA 3V64A 1HX6A 5E1ZB 1ND2A 4U87A 1OC1A 4FXKB 5FR3A 3H3VK 1UPIA 4IETA 2Q8EA 4W50A 1S0DA 4F3JA 1XE8A 3O1VA 1UU6A 1WKMA 2LREA 1HRV1 3AYEA 2W1QA 2JD4A 1ODMA 2SLIA 1HW1A 1MH4A 4ZJZA 4UY8I 2JA6J 2WN3A 2FDFA 4HFSA 2DDUA 4JGZC 2CYYA 4CE8A 3ZYFA 1UF2C 2OUJA 2X1DA 1CZTA 2I8DA 2KJBA 3VKOA 1YHQI 2EVXA 3RZGA 3GALA 2VI6A 3NL1A 3AKRA 1DHKB 3OYLA 1ASJ1 1CIYA 2PAEA 2OX0A 2VBXA 1OFSA 1PO11 5H6RA 2HWB3 3JSPA 3HNBM 3PUAA 3FLPA 1JYIA 4LA3A 5FYVA 3ZXFA 1H2KA 1GNYA 3ERMA 3RI4A 1D0ZA 5FYSA 2CUZA 1R22A 2V1XA 5FIXA 3M7AA 3L9FA 4AFCA 1UAAA 2PHDA 4ES8A 1O59A 5FOJB 2H8RA 1KQ0A 2XHNA 3Q3SA 2CG4A 5A3WA 2JVGA 2UV1A 1SLLA 3WDYA 3BIEA 1LGNA 1SACA 2GIVA 1ZA7A 1J9IA 3ZN1A 2Y48A 2YY1A 3IUOA 4EJRA 2AO9A 1IAWA 5D8AB 2VBYA 2JICA 5A70A 5GP9A 4FPYA 2KRCA 3AP7A 2Q8CA 4M6VA 3IRQA 4G6QA 1JYCA 1IV8A 1LPQA 1W8TA 2WS92 2HWE3 4AZZA 3VHOA 2Y8KA 4RBOA 3RWNA 2H1KA 2XWBB 2STTA 4J01A 5E8GA 5FKKA 2VN2A 4NPLA 4BIOA 4HZFA 5E79C 2RM22 1VQLI 1IN5A 2BU9A 5E8AA 2ZTNA 5FJHA 2OC6A 4FPFA 2YDEA 2OUMA 4BH9A 2W5FA 3OYEA 4RGSA 1BEV3 4M9ZA 1TNFA 3EHKA 1CIWA 5A2QZ 3HPGA 1RUC3 5GLVA 3V8LA 4TN7A 3WUDA 1IS4A 3Q8BA 5T3NA 3LFUA 1ZTRA 2J5OA 2WFF2 3S17J 3DBLB 4XIKA 1NY71 1YI7A 1EV13 1TMF2 1OI6A 4MHGA 1ERDA 1A6QA 1IXRC 5HS9A 3LSGA 1A34A 2WQ4A 3OYWA 2EIEA 4YG0A 5BNPB 3ERED 2WA0A 1TLHB 2XJQA 4JX0A 1QVUA 4CDQB 1TWGJ 3RKYA 1AUYA 2WKKA 3E6BA 3ZDSA 1BIBA 4DBQA 1H0BA 3F6OA 2C5DA 2RS31 4PIYA 3HOYJ 5J96B 2G9FA 2DMQA 2D1VA 5KXBA 1C4RA 1AR73 4JDMA 3K4NA 3RI9A 4OQ8A 1LGBA 2E33A 4C8DA 1K45A 3QOPA 5DDJ2 2KRHA 2XLGA 3A7QA 1ZLJA 5I0RA 2EILH 4KT6A 2JMWA 4RHV1 3FBYA 3H0DA 2Y6LA 4A3JJ 3WNLA 3LAGA 1LB2A 4UF0B 1DU0A 2FJ1A 2EFPA 5D8AC 5CQGA 1BL0A 4EM1A 1RIRA 2WB1N 3R4DB 3FM3A 3DEMA 4PLOA 2O14A 3RMYA 1CAXA 2Y6FA 1EV7A 1PM4A 3OF1A 2PFWA 3VV1A 1Z7S2 5DQ0A 4FHTA 1TQIA 1KYWA 2YU1A 2D5FA 3ASIA 4YFWA 2LDUA 1T6BX 5J1XA 2VC9A 4G8XA 4XUPA 3WTXC 3T1BA 1JZ8A 2IW5A 2XWJB 1R6RA 2R7ZJ 2R7EB 4WCGA 2E31A 3GFLA 3DPUA 2I2SA 3O1TA 3G7DA 3KSCA 1WMXA 2WNVB 5F3CA 2PLYA 5C33A 3IMNA 1UMZA 3IKVA 5F3GA 3PNAA 1I5ZA 4HDUA 5EF6A 3KS7A 3M4FA 2FCVA 3VUOA 3SYTA 1RUD3 5BXXA 2WT0A 2D6LX 3WTZA 4QHBA 1UZZA 2MD5A 3ASNH 2B7YA 3W59A 4CH7A 4M4PA 1Z7LA 5C9AC 5BNNC 4XURA 2E19A 4COVA 3BROA 4YVSA 2E1MB 4CDWB 3S2WA 4ARXA 2J42A 3BIWE 1R1A2 4PJLA 4D5CA 4QX5A 5BNPC 3BJAA 3PUQA 4LMYA 4M3DA 5F3EA 2JDZA 2OKXA 1UKRA 2VUJA 4UI9L 3ZDVA 1DPRA 3MW3A 4PI2A 2DPDA 2R7TA 5DM6F 4U36A 3ZXEA 1VRH2 2K02A 4K40A 3RJPA 2GP3A 2BTVC 3SEQA 2WAQN 3OG2A 3WV6A 5EIYB 4XFGA 4ISRA 1RUI3 2LY9A 4FFIA 2BV4A 2HEVF 3JB4C 3VFZA 1YRNB 4LHKA 3ZFFB 1F31A 4HA8A 1NCRC 3CCSI 2YROA 3DPRB 4QIWN 3ZFFC 1OUXA 3R0RA 3QPHA 2VTXJ 4F92B 4S2HA 3PL8A 4OHXA 1R00A 3SDGA 4AFMA 5JOYA 4W97A 3ES1A 1IGNA 2VW1A 2YG0A 2CO5A 4RS5B 2RQPA 5FLHA 2EPFA 4UW3A 5FO9B 1X1CA 4ZZ5A 5LHIA 2WV1A 4NHYA 5B1AH 2ZHLA 2BZDA 2FDJA 5L3CA 2VLAA 1P2FA 4HMZA 4UBHA 4YVSC 2EIGA 1PVC3 2VOXA 1QGLA 4XUQA 4D0QA 1UY3A 2HKXA 1J3PA 1MD0A 4LA2A 4XIOA 3WTSC 4XLEA 1FYMA 3O0XA 2WWJA 3D4KA 2YGMA 3D3AA 3FL7A 4HSLA 4NHMA 3SCHA 3VOEA 4UB6C 2VJIA 1O4YA 4ZS2A 3WG9A 2HZTA 1AYN2 1V6LA 2DTWA 3E1SA 4ZTFA 5J37A 1OVPA 4QB2A 1WJBA 2CU7A 4MGIE 2PA7A 2AEYA 3UKVA 1MMNA 2WZR2 3Q5FA 3INAA 3I4PA 1HW2A 1I3QJ 5LGTA 1DBNA 4MTDA 1Q8SA 4MGKE 1SDWA 1NX9A 2V1NA 1RUJ2 5D6FA 1J0RA 2Y6KA 5EYRA 3BR3A 3HNYM 3P5JA 4RN5A 2Y64A 2EQRA 4MGQA 3ZMUA 5HLHA 4RGGA 2HWD2 1YFWA 1T33A 1FC3A 1WZXA 1HRV2 3T4HB 3K1NA 1B9MA 3COAC 1WRJA 2OW4A 4A93J 5DAQA 1KZHA 2PBIA 5L3FA 1X4OA 3ZQLA 2DV9A 4QD2A 4EJTA 3ZGKA 3S3OA 1N3OA 3QRFF 3G1OA 4X8PA 5J98B 3ZPLA 2MA3A 4S2FA 1UKGA 5CPRB 4AF9A 2PHLA 1PZ7A 3LQQA 4EM2A 4ASNA 2CV1A 4XUOA 3AL0C 1QQIA 1FOKA 4ZDOA 4F55A 4OI2A 3T1LA 4FP3A 3WSOA 1K5MC 2Y6HA 3IIAA 4MXVA 4IV3C 1PGSA 2RDQA 2J1RA 3V7CA 2M7AA 2ZHNA 4HPQA 4PUSA 1UZWA 3B93A 2EF6A 2ZEYA 4OIOF 1ETYA 4S04A 3JD72 4LMFA 2XVGA 3U75A 3RZOJ 3Q9VA 3VWBA 4TTGA 4QU2A 3P7NA 2D98A 4DYRA 3JU9A 2R0FA 3SITA 2ZSIB 2UUZA 1TQ5A 4MNUA 4D7YA 5KNLA 4Y24A 3WTWC 2XPWA 1DQ1A 3PVOA 2KXLA 1TTYA 1ENXA 5K0UC 1V4RA 2E1NA 1QHDA 4FCYA 2B42B 2XMLA 3I2DA 3TEZA 5HNHA 5LLQA 2OF7A 4K3UA 2CTVA 1IZ3A 3P9KA 4WXCA 3H0OA 3WG2A 2Y31A 2D1HA 2PN6A 1XE0A 3KD4A 4BM8A 5FMDA 4AVSA 5E3OA 4JZRA 3TO6A 2O9LA 4XN0A 1YIPA 5FXZA 1KFXL 1EF4A 2GMMA 1GZ9A 3HB9A 3LMMA 3WNKA 3E6DA 3FMGA 4D6RA 4R1HA 2EJRA 2LALA 2K9NA 2W68A 4V2FA 4L0YB 3PUSA 5BNOC 3LSKA 1RUE3 2XAJA 3V0AB 1SMVA 4NIHA 1R4NB 2FNPA 4XOGA 3J7LA 2UWMA 3CKHA 4B1MA 3PIGA 5FRMA 2AZ5A 4CDWC 3HQRA 2K85A 1JHJA 1AR93 1ULOA 5DAVA 3T5XA 3LZZA 3JRBA 3DPRC 1J1LA 2G9ZA 4E7KA 2ESHA 2OPTA 3ASOH 3OWTA 4NIIA 1MPXA 1JI6A 1H8TB 2EZLA 1BHGA 4UV9A 2AR6A 1N75A 2WNVA 1I27A 1US3A 1D4M1 2JB8A 1XGMA 1HRI2 3HSRA 4UAPA 3VBOB 2YU3A 3HXLA 4IEWA 4CCKA 1NLSA 4QKDA 5CFCB 2H8WA 2IA2A 2VCMA 4JKLA 3I2OA 1XC6A 5BUVA 2M34A 3K77A 3PURA 5KK1A 1QOTA 4AI9A 4NDLA 4A7YA 3N9QA 2PN5A 4ZTJA 2R5ZB 4Z2YA 2E7AA 1WQ2A 1JZ4A 5AVAA 4R8HA 2BRTA 2WIIB 3DYOA 1CPMA 3O1OA 5JXGA 5AC91 2W00A 1C57A 1V3FA 2JXAA 3HOXJ 2Q0OA 4AEKA 3BR1A 1B72B 2OUHA 2ZKNA 2LY1A 1UB9A 5JCTA 2RQQA 5H6QA 5FZFA 1Z6RA 2E1MC 1HXS3 1SCSA 3D0JA 1MACA 2QF7A 4UW6A 3MKWB 3O1SA 4Y1VA 2Z5UA 4FTEA 1Z7S1 3GZAA 5LD2C 3BDDA 1DDNA 4KDPA 1RGSA 1UNBA 1Z9CA 1EPZA 1RUF3 3LIGA 2F4LA 3K3OA 3TNPB 1URXA 2ZEXA 2VMFA 4SLIA 5CYVA 4Y1UA 3ECQA 5K7HA 2W85A 2FZ2A 1IRFA 1QU3A 3ZSLA 5K7FA 5A3MA 4I0BA 1AU7A 1LOBA 4CXXA 1OPCA 3HM5A 2ADDA 2M7BA 4C9YA 2DMUA 3ZSKA 1HQWA 4W1UA 2X6XA 3HTSB 5DUUA 2YPJA 1R093 3M3CA 1G9FA 2CNAA 1K5JA 2JWPA 4XFIA 2HR3A 2EWNA 2F5EA 4XZPA 1WMEA 2BVVA 3D5RC 2DQRA 5G04L 2DA2A 5J4VA 5J1RA 3HR9A 3GBWA 3LEMA 3AMQA 3LSJA 1QJY3 2VNOA 1XXNA 1MSEC 2D3SA 1WLWA 3LQCA 1JJ6C 4MEYF 3VGIA 4BXFA 4E8CA 5K7ZA 2CGPA 1D7PM 5D8KB 4GQ7A 5CJ9A 3V4GA 4A0YA 4IXLA 4OHZA 1VE0A 4ZU5A 5BS6A 2IXLA 4PLNA 1SFNA 1G6NA 2YX4A 1QDCA 3QQAA 3TGNA 3HOBA 2P3IA 1CPNA 2XXZA 4XRMA 2PYTA 4UOJA 5FP8A 3KIOA 2VQHA 1ULDA 1PIV3 1XMAA 4YG6A 4FCAA 2KZGA 2XJPA 1XCVA 4XDOA 4HETA 2A5YB 4BJTA 4E9KA 1T08B 1SCRA 4AWXB 5FPXA 3T3YA 4TV7A 2WNEA 4AW7A 4KFCA 3IH4A 2HU9A 4KISA 4P5HA 2E34A 1ZBE2 3T08A 5F27A 2STWA 3NQOA 4AI0A 2XVCA 2RJKA 4C2TA 1Z7S3 4LBOA 1XTAA 3ZQQA 3JB8A 3X29B 4QSHA 4QPGC 3A01A 2DCYA 2W25A 2W2IA 3WF3A 4XLAA 1QF3A 1R5HA 3AZZA 1SG3A 3S5QA 4HV5A 4B1RA 3PJRA 2X6YA 2WO1A 1DQ6A 1SLIA 5E88A 2EIKH 2CQQA 4OI1A 1OUSA 1QEXA 2XUBA 3DEEA 4LQRA 1R58A 1Q56A 1PYVA 1K78A 1EV11 4UFHA 5F37A 4HN1A 1MDMB 5FZBA 2P5VA 1ZHFA 4IRIA 2GA1A 1WCDJ 4Y4YA 2ZJRF 5FY0A 4UFLA 5I0SA 3HRUA 4CCLA 3BB6A 1S2BA 4RYDA 3NNFA 5LASA 3BOQA 2CAUA 4C0BA 4L5EA 4TLFA 1X58A 4LBJA 2YMZA 1MS4A 2VU9A 3N7MA 1P4WA 3PNTA 5D8AA 2EFQA 3MGUA 1KEXA 3PUHA 4OIPF 2FDKA 1QJEA 1FPQA 2OQGA 2JE7A 2HWD3 2QYOA 1CD3G 1PIV1 5FZAA 1VQ7I 3AZWA 5JUVA 3KCCA 1G3WA 1VPHA 3CJQB 1WUVA 2NOJB 3LA7A 2OZ6A 5J3LA 4DPNA 3SH4A 1GP4A 1NUKA 3ZFGA 4P5OA 4Q5SF 3R61A 1DQ5A 4CCOA 1NTCA 1PUFB 5CG8A 3BZCA 4KITB 3IV5A 1K78B 3BI3A 2ZGUA 1GT0C 1UMHA 3OY9A 1MH3A 4MZUA 2LBFA 3RSNA 2EZHA 3DUIA 4QX3A 3AG1H 3F6VA 4NJ4A 4A3BJ 2IXHA 4CZSA 3FK7A 2AREA 1N1VA 3BZKA 1FMD3 1GVJA 4BXSV 1UD1A 1F5FA 4DMIA 1VQKI 5CG9A 4AGGA 1C3HA 3PIOF 5BPDA 4QX0A 1W6OA 2LFBA 1S0GA 4PJJA 1WJDA 3ZIXA 2EFWA 1Z3XA 3J7MA 3DECA 4KWKA 3L2QA 3IAM2 4HXCA 2G9WA 1R71A 1HQCA 2P6SA 4YW1A 2P6TA 5JOXA 1TME3 4XLCA 3FMSA 2ELJA 3PIPF 1I1GA 4XL9A 3H42B 1UX7A 3H1YA 5JXIA 3U37A 3JZVA 3H1CA 2VJXA 5FJKA 2E7XA 5TISC 2WAFA 4ES9A 1JHFA 3K4AA 4D6QA 1I3HA 2HYXA 1WA6X 3M70A 4FQZA 3N35A 2X0LA 3B69A 2ID6A 2KKOA 4HSJA 5DPNA 1C28A 4LT5A 5A7WB 4DEQA 2OT7A 3SHRA 2FCTA 5K8SA 1U6GA 2Z33A 5FY8A 1OPOA 2K9SA 2HDCA 1VBE2 1WH5A 4XE9A 4PDWB 1WBFA 4NHXA 2VOKA 4B7EA 3CF6E 1HQNA 2WO2A 1EAH1 3EQLF 3C8XA 4S2GA 2XF7A 4AXOA 3AZYA 4UUVA 3HKZN 1NG7A 1ZBA1 2V4VA 2QSGX 4JGYA 3BKZA 4CDGA 2ISZA 3CDHA 5APAA 1BOAA 3HQUA 3ZYHA 5IVFA 3ZP5A 1GANA 1MJAA 3GTQJ 1PGL2 9ANTA 4OI0A 2JTVA 4AVAA 5FPBA 1VZ0A 2Q30A 3SXYA 1U9NA 2XBO2 3VSLA 5K9YA 3GTLJ 4CSWA 4B48A 2E7QA 3IPVB 5JVTA 4HLXA 4QX2A 1UOGA 4LHLA 3JBG2 4Q4V1 2K9QA 3NRVA 3CTAA 1TNRA 4KNCA 1AZDA 1YIJI 4IHWA 5FRAA 2RMU1 4QM8A 1GNZA 2VVDA 1SVMA 3H36A 1RI7A 3BALA 3WG4A 2VR4A 4EGZA 1HCRA 3MKYB 1RNLA 1G8WA 3K70D 3T2QA 2YHJA 4IJAA 1Z77A 1U3EM 4Q8KA 5LA1A 4FPEA 3KT1A 4XIDA 2LG4A 3KP2A 2A5WA 5DG1A 1QJX2 3E0JB 2XR4A 3I2IA 2VECA 1PGW2 1ZR2A 4BE3A 4LO6B 5CFCC 1SBDA 2NN8A 1QXPA 3KYDB 1VQMI 1UY2A 3LDKA 5CKNA 2JPCA 1JTXA 1JHHA 1HXS2 4AHXA 3LA2A 1JYWA 3PDQA 3HOSA 4YM0A 4AU7A 1C8M2 2BWAA 4XABA 2QTWB 2E71A 5HPOA 1P7IA 1J75A 1ACCA 5B1BH 2QWWA 2ZEWA 2RDNA 3KYCB 1Z91A 1W0OA 1BI2A 4ZYAA 3MEPA 3A4UA 2X4HA 1LOEA 2KD7A 2LR8A 2J1VA 4RGKA 3ZIWA 3HZJA 3HPHA 1MJBA 2LC2A 3ZQHA 5IT9Z 5FTTC 2X6WA 1B59A 1IUYA 2A05A 1A5JA 3VYUB 5LBCA 2O8XA 2BNNA 2R1DA 4UV8A 3ZQ7A 3BTXA 2Q8KA 1POGA 2FMLA 2JA2A 3BR0A 1JU3A 5FO7B 2F4MB 1VALA 1F4AA 2V6CA 3GXOA 1S8NA 2ZXJA 1W04A 2MD0A 2FOKA 2RS51 2SBAA 2ZGLA 5LBQA 3BWGA 3FC0A 1QQP3 2MH2A 3H8RA 3MIFA 2MLKA 4AL9A 4PF1A 3WE2A 3ABUA 4Y33A 1MS8A 2HXOA 1PZ8A 1GQPA 5GALA 1VI0A 3DFGA 4G4FA 2DMTA 1BBYA 5J48A 3CJNA 4I0WB 3VHPA 4EN7B 3KVBA 2AACA 2IT0A 1QRYA 3SZTA 2H94A 2XKOA 4HKLA 4HOOA 4LTAA 4QB6A 2WWYA 2YV8A 3VHRA 3KEQA 1C1FA 3CDZB 2Y26A 4XFBA 5F3IA 2M30A 1OKOA 5A1AA 2IXSA 3AMPA 3G3ZA 2VJ4A 5GZGA 1W8WA 3S3NA 1I39A 4H7LA 2O8OA 2KM2A 5FZMA 4BY7J 4YG2F 4XCAA 2ZGMA 5FUPA 2VMDA 3EUAA 3HTUA 4KIFA 1D0GA 1QXJA 2ARAA 3F8NA 2OCCH 5EZGA 2COBA 4OMYA 4LK0F 3MUY1 2XF5A 3L2WA 1D0YA 2BPA2 4FE7A 4QPGB 3H0GJ 3GUDA 3HG9A 4HF1A 2VE1A 5CQEA 5IP7J 1CZSA 3HUGB 2ORXA 3G2BA 1MS9A 4BISA 1REEA 3ZPOA 2R062 1Q5OA 2DVGA 1UOBA 2M0CA 3ELNA 3F8CA 1CN1A 3PVBB 3QYBA 1ZELA 2OBPA 3N9LA 2ZGSA 4AYUA 5LW9A 3I2KA 4IEXA 1NK3P 1Y1WJ 3VD9A 3VZJA 4XQDA 1YFUA 1Z67A 4N53A 2W46A 2A61A 3DEUA 4L92A 3VDBA 3PO3J 1QJY1 2ET7A 5I8SA 1WLTA 1YRNA 4QXKA 5AONA 4QWQA 2Y9ZA 1RMU2 1U5XA 4P55A 2RJLA 4AM3A 3OYCA 5K4LA 5J1UA 1IG7A 2C24A 3AZXA 3BUCA 3WHTA 3JQWA 1JE8A 2QEXI 4XF0A 1SQ4A 4AI2A 1BR2A 1FNYA 2VONA 5DUXA 5BNNB 1K5MB 2R042 2K3FA 1F5JA 1B6AA 4O9EA 3VLBB 5GZFA 4R9AA 5FZOA 2VPRA 2XH6A 1DYPA 2Z3YA 2AXLA 2XIGA 4QGMA 3FXRA 1VP6A 2R0HA 2L0KA 3GFMA 1E5SA 3O14A 1MIJA 1QNTA 5FPAA 4HAMA 4GAZA 3BPSA 2A6HF 4CP2A 4LO8A 3ZQFA 2EINH 4MGSA 5IWFA 2M4KA 4BE2A 5BNOA 1ND2B 3GYHX 3I58A 3BU7A 1MS3A 1JT6A 2KIFA 2YS9A 5F1JA 1W0UA 3MICA 3T0DA 1E0EA 1SD7A 1LDDA 1SLAA 2FF4A 3FKIJ 1JXSA 4CUCA 4Y22A 4J25A 2PEXA 4BY1J 2GALA 2B45X 5FFXA 1W8ZA 3B5LB 5EHDA 2VJ5A 3FBIB 1T0FA 1O4ZA 5T50A 2Q1FA 2A6VA 2XSDC 4XM3A 1EKEA 1R5GA 4KUMA 2VMGA 3G6EI 3MIBA 3QLQA 1GR3A 3BGAA 3RI8A 2VKDA 5ACA2 4ESJA 3R0AA 4YIRX 1H8VA 4DQAA 4CEWB 1YW9A 1XNAA 2MBFA 2VT2A 4LKEA 1YI2I 2IGNA 4HX8A 1CZVA 4P1WA 2GP5A 3CMAI 3IPVA 4IDZA 4QPYA 1VIWB 3N9PA 1BYHA 1R091 1VBD2 5DZEA 2W52A 4AVCA 4YGDA 4CU9A 1O7FA 1RUD1 1SMTA 2EAAA 4AI1A 1O91A 1QMJA 5LY1A 2QGUA 3H5NA 2WSUA 3H5RA 1DLCA 2QQWA 3KEOA 2DT5A 4JDOA 1KS5A 3GTOJ 5LA2A 5JVGF 2QQUA 1OF4A 1AXZA 3J7AO 3EUKL 3VL8A 2EZIA 2IA1A 3ZQGA 1X3ZB 3ES4A 4UVAA 1W8NA 3I64A 2L4MA 3KP5A 2DDBA 4IE0A 1AX0A 1VBE1 4Y20A 2JUCA 1O4TA 4C2MJ 3DKXA 3KV9A 1Z6TA 1B72A 1AR71 2WLQA 3VYSB 4MHUA 5A3TA 5JZGC 1LTEA 1DP7P 3DU6A 1NKGA 4EVIA 1LE8B 5AFEA 2M3AA 5C3OA 4YW5A 3THCA 3M8EA 3DTEA 3AP9A 1W6MB 5IAXA 3A0KA 1KS4A 3MIHA 1JI8A 4YW6A 1AVBA 2JEMA 2L2OA 2HYJA 1LOGA 3ZXAC 4CCEA 2FXAA 2Q4SA 3LEIA 4ET7A 4CCMA 2TRTA 2LTPA 1WW4A 3K4MA 2Y34A 1G8XA 2GH2A 5DD8A 1Q3EA 3KQ4B 5FZDA 3FFZA 4R9CA 2A3YA 2UWBA 4FOVA 1V5GA 1LKNA 2OD5A 4BQAA 1FOD2 1LEDA 4BQ5A 4IHSA 3B01A 4K8FA 4MH0E 1RUH1 2CFOA 3CP8A 2PJRA 2BGPA 5C8CC 5A33A 4XLNF 5ED4A 4HOBA 2DTZA 4HF2A 1ZZ7A 3RG0A 2R92J 5FOBB 1GMMA 5EZWA 4YZ3A 1IRXA 1XD7A 5DXDA 3M4OJ 3OD4A 4BQ2A 1KFUL 5KC5A 2XF6A 2Y0MA 4Y5TA 2AH2A 2OV7A 4DOZA 3VDDA 4H55A 3A0HC 1IZ1A 4LBMA 5T55A 2ELHA 1PGW1 3OV8A 3R0JA 5IVBA 5IPAA 2C9AA 5IAVA 4Q29A 1GWKA 4LJHA 1W7PD 4AHYA 4KGQA 1I6HJ 2ZGRA 2WYSA 1MEC1 5FZ8A 1F9KA 4RAZA 3H9AA 5F0FA 4DUVA 3K4KA 3VHNA 2E2JJ 3S7EA 2HI3A 4DXZA 2W1OA 2TBVA 3I2HA 4DJAA 3OB8A 2E2IJ 2QNKA 2WABA 4CUBA 4O5VA 1MW7A 1FIAA 1SAXA 1JZ2A 1BLZA 5F04A 3LSIA 1ZREA 2FMDA 4XCBA 1Q43A 4HQEA 4IEQA 5M3MJ 3HPNA 1B35A