5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
3PUAA 2YU2A 4QU1A 3KV5A 3K3OA 4UF0B 5FWEA 3ZPOA 5FUPA 5LY1A 5F3GA 5A7SA 4LIVA 5FP9A 5A7PA 5A3TA 4D6QA 4QX7A 5KR7A 3N9PA 4IGOA 3DXTA 5A1LA 3K2OA 5IWFA 2Q8CA 3PUSA 5F2SA 5A7WB 5A7QA 5FY9A 5FZOA 4IGQA 5FZ3A 5A80A 5FZ9A 5FWJA 4CCLA 4LITA 5CEHA 2VD7A 5FXVA 5FPAA 5FYBA 1VRBA 2XXZA 5FZAA 4HOOA 5IVBA 3LD8A 5F37A 2XDVA 3N9QA 5FZ8A 4AI9A 5FYMA 5FXWA 5FP7A 4QWNA 5A3WA 4UF0A 2P5BA 2YPDA 4NUBA 2PXJA 5FYCA 5IVEA 2XMLA 4CCKA 3N9LA 5FZMA 2OS2A 5F5AA 2WWJA 5FZKA 4HONA 4XDPA 4D6RA 4V2VA 3K3NA 5FZFA 5LWBA 4EZ4A 4CCJA 3U78A 5FZGA 4BXFA 5FY4A 2GP5A 2Q8EA 5IW0A 5A7NA 5FYZA 5FY7A 5LW9A 4AAPA 4DIQA 5F3EA 3KVAA 4E4HA 5FY1A 5FJHA 4CCNA 3PUQA 5IVVA 3PU3A 4GJZA 2OX0A 5LY2A 3U4SA 3AL6A 4CSWA 4C8DA 4EZHA 5ISLA 5FY8A 5A1FA 3N9MA 4QXHA 3PU8A 4GJYA 5F39A 4IGPA 4CUGA 3KV9A 5FBJA 5A3PA 4GD4A 4LXLA 5FJKA 2YU1A 5FPVA 5FZIA 3OPTA 4TN7A 4EYUA 5FZEA 5A3NA 5E6HA 5F2WA 5FV3A 2XUEA 5K4LA 4CCMA 2OQ7A 4LIUA 5FZOB 2YBPA 5FZ4A 2YBKA 5FZ0A 5FZBA 5FP4A 4URAA 4QXCA 4CCOA 5IVJA 2WWUA 2YBSA 3KV4A 5F3CA 5FZ7A 4Y4RA 3RVHA 3OPWA 2W2IA 4QX8A 3ZLIA 4ASKA 3AVSA 3PURA 2GP3A 5F5IA 5FYTA 5FZLA 5FZHA 5FY0A 4Y33A 4V2WA 4QXBA 5FUNA 5FXZA 3PTRB 5FXXA 3UYJA 5FYVA 3NJYA 3AVRA 5FYIA 2OQ6A 5FYHA 3KV6A 2Q8DA 5FPLA 3DXUA 5IVFA 3KVBA 4Y3OA 4BISA 4DO0A 5FP8A 5F5CA 5IVCA 2OT7A 4GAZA 5IVYA 5A7OA 4XDOA 5ANQA 3N9OA 3N9NA 5FZDA 5FZ1A 3LDBA 5A7WA 3AL5A 3PDQA 4D6SA 5FYUA 5F32A 5FP3A 5FPBA 5FPUA 5FZCA 5F3IA 5FYSA 5FY5A 4BU2A 5FZ6A 5FYYA
chains in the Genus database with same CATH superfamily
1GQHA 1ND3B 1W8TA 2A6XA 2WS93 3TB0A 5IATA 4COVA 3WDXA 1Y9QA 1OOPB 3SLIA 3IWZA 1LU1A 2ARXA 4WM8B 1IQAA 5JPMB 4XCBA 3V0AB 2IC1A 4GWIA 5EWSA 1BBT3 3JZVA 3AM2A 5A1LA 5C5UA 2JDPA 1HV1A 3HT1A 4BE3A 4JCKA 4P9JA 1G9CA 2UYBA 2VMHA 4IE5A 1PVC2 3HNBM 1POQA 4CEYC 1N1YA 1MEC3 3J8F2 4RA0A 1GZ9A 3E6CC 2VD7A 5B2GB 1DHKB 2E51A 1XE8A 1XNCA 4CVUA 1C8NA 4P5HA 2QDRA 1NQDA 1SDWA 1WW7A 5JOZA 3ZR6A 3ETPA 4M3CA 1UMZA 2P5BA 2IXCA 1LGCA 4MADA 3BALA 4DXTA 2DV9A 3NRUA 4URTA 3A22A 2MPFA 5J1XA 2PHUA 4JKMA 3J8F3 3HPNA 1H9WA 4IEPA 1DGRA 3WF4A 4HONA 5DDJ1 4BZ4A 2CNAA 5JWPA 5FZGA 2B9UA 1VB4A 5H9RA 3ZXDA 1LHOA 1ZZCA 3M3QA 5F1RA 3WP3A 5CFCC 3W59A 5T55A 2O0OA 4BM8A 1RYYA 3I2HA 3MIFA 1LESA 4OI0A 3LSDA 3LA3A 3PVEA 4QAWA 4COUA 4BOWA 1DF0A 3AXDA 4XMAA 3APBA 4LBQB 5I8YA 3N9MA 4LORA 4XAEA 1VBC1 4E2SA 1UY3A 3ZFGC 2R041 4UW6A 4QM9A 4K7JA 2DFBA 4AHYA 1MS9A 1NUKA 4Z1VA 4KL1A 5C9AA 3HR9A 2NP0A 4K20A 2JWPA 2Y34A 4U2AA 2Y64A 5J37A 2JE7A 3BPZA 2ZGUA 4OMDA 3DV8A 1JMUB 4FAGA 2KD7A 4R4ZA 4L9BA 2RS13 3ZN6A 1FPN2 1Q8VA 4FOVA 4GULA 4LBNA 3NV3A 5L9VA 1SDDB 1OBNA 5FY0A 5IHRA 2OKXA 1C8M3 1MEC1 1NXMA 3ZSEA 1F15A 1UU4A 1WUVA 2XJVA 3GM8A 3OGVA 3ZXEA 2WSVA 3OG2A 4FPFA 3AKRA 3OBAA 4AVAA 2Q4SA 4B29A 1PX4A 1PM4A 4K8FA 2BEOA 1S2KA 5KWRA 1XXNA 4B3NA 2ZA9A 1TME3 4JKKA 4JTOA 3KV6A 5FO8B 4ITCA 4Y24A 2VZOA 1VBE2 2AREA 3C8XA 4PI2A 1BHGA 1RUH2 2W46A 3GBGA 3N9NA 1W04A 2ZX3A 1LGNA 5CFCB 1PO11 3KQRA 1MZEA 3T3YA 5KHKA 4IDZA 4Y1UA 1LHWA 1W2TA 4PF5A 2PELA 3MHZA 1O3SA 1US2A 4ZU4A 2X5IB 4CZSA 1WCSA 2X53S 4QDQA 2A6YA 5A33B 3AZVA 3Q8CA 4BXSV 1D7PM 1S0BA 2B7YA 2XUMA 2VZ3A 3VHOA 1QNWA 2VQTA 3U14A 4XFAA 3H1WA 3SH3A 1C28A 2LRPA 4Q0VA 1O4YA 1RUI1 4AF9A 1OVPA 2VXRA 2ZGPA 4RQPB 4DMIA 1RL3A 2G19A 5T3NA 1QJEA 1DP0A 2QNKA 1H2NA 1PVXA 3ZXFA 5ABJC 1MVQA 1KFXL 5FIXA 2R32A 2XXZA 4MYEA 1CN1A 4B4RA 2ZS6B 3B01A 1AX1A 4A45A 1SHWB 4JDMA 2XDVA 5JAXA 2EXKA 2P34A 1S0JA 4QHOA 3WSOA 1R1A3 1AR91 4DFSA 1CAVB 5LASA 3ZXJA 1ULFA 4LKEA 4P9YA 2R042 2D43A 1GLHA 4OMCA 1QKQA 5APAA 2HBUA 1GKBA 2B46X 4I3GA 2R1DA 3H1YA 3O0WA 3CEWA 2YC0A 2VY0A 4Q4V3 3WNOA 4OHZA 2JENA 5LWBA 4L2NA 4PIXA 4M00A 4WBBA 1RVF3 5JIUA 1UPIA 3T2OA 3NJVA 4FPKA 4IEOA 1LEMA 3DPRB 3GJBA 3JBG1 5C9AC 4XCAA 5IW0A 3D82A 1QNYA 4L99A 1MACA 5CVRA 1AXZA 1IPKA 1FATA 5F3EA 5IAVA 3TEXA 4D7TA 4E4HA 2GU9A 3F2ZA 3I7DA 4MO3M 2OXBA 3TN92 1XC6A 1UMHA 1JYCA 2CY6A 4RSUA 4NAMA 3NAPA 3WHUA 1MS0A 2K46A 2WN2A 2FDHA 2WDBA 5KHHA 2VUCA 4BA6A 1XU1A 2ZGNA 1JZ3A 1G9DA 3RRDA 2G9GA 1PO13 2BJSA 1KQRA 2RMU1 2QQNA 2VVEA 5DXDA 4CPBA 1QEXA 2QQVA 1O8PA 2W47A 4O61A 1XYNA 4Y4YA 5FV3A 3ZO0B 5EJZB 5IK5A 2XWBB 1UZYA 2VTFA 3MW3A 5ABJB 1SLBA 4JHZA 1RUI3 4XETA 3U1XA 3WP4A 1ZBA3 4LULA 5FZLA 3ASIA 3H7JA 1SLIA 1U0AA 2DBIA 4FPCA 4OUEA 2Y60A 4YYOA 3AC0A 4PLOA 4CUAA 1TQ5A 2PN5A 2FCUA 4E4DX 4F83A 4FTBA 1VBE3 1QH7A 4AI1A 3JCIA 1COV3 3RWKX 2ARCA 4F8AA 1TMF2 5C4WC 2DUQA 1KITA 2GMPA 1HN0A 2ZZQA 4FT8A 5DZGA 2CDPA 5FOBB 5IVFA 4I30A 3WD5A 1OC1A 4X8NA 4AHZA 2XPJA 1PNGA 2YGLA 2NYYA 5A7OA 3O1RA 3N9OA 4RR3C 1RUJ1 3VKOA 1TME2 1HV0A 1WBFA 5K0UC 3FHIB 1BK0A 1OT5A 5LEKA 3OUIA 2CGOA 3RS6A 3ELNA 3HQRA 3RZHA 5JOXA 1RJ8A 3O0XA 3OYWB 2ZAAA 1V00A 2VU9A 2YMZA 4IEUA 4XUTA 1L3JA 5T5LA 4AI8A 3OJBA 4QU1A 4XBNA 5JPNB 4J1XA 4WZCA 4Y5TA 2NQYA 4CCEA 2WN3A 1QIQA 3O0VA 5CISA 2TUNA 5HI0A 3ZFFB 3VZKA 2NN8A 3TYJA 5C71A 5LBCA 4CE8A 1ALYA 4H3WA 1NZCA 3E5QA 5CG9A 2D5HA 4D69A 1N3OA 4XYXA 2XWJB 4AGRA 2I07B 2V09A 5IAXA 3LPGA 2PHRA 1CAVA 4IEYA 5FFOC 1VRBA 5DZEA 5I8TA 3EQEA 2WKKA 4NWVA 3AYEA 4HKWA 1LEDA 1DQ0A 1RMU1 1QU0A 2O1QA 5CFDC 3OGSA 2B45X 1GQPA 1ZNPA 1SPPB 2RS51 3PUHA 4LBJA 1QOTA 5FZMA 5JOYA 1ENRA 1NX9A 3M1HA 4JRAA 1ZZBA 2BGPA 1H2KA 2XVKA 3N3HA 4I09A 4R9DA 1K42A 3POGA 4EWAA 2QQLA 2R043 4YGBA 2GC0A 5LA9A 3MUZ1 3UJQA 2C5DA 4LO5B 4YPJA 5K7PA 4E27A 4LQRA 1NE6A 2DDUA 2NM1A 4AAPA 5C33A 4LLFA 1W9YA 4R8HA 4E2GA 3VBUB 4CU6A 4F3JA 5T5OA 3VD7A 1YJKA 4P08A 2WZR1 3RQ0A 5C3SA 3WQBA 4D7SA 3LCPA 1OLRA 2IFRA 5A70A 2EXHA 4KG8A 4QX5A 5LA2A 3RMYA 5A1FA 1CX4A 5J09A 1W9FA 2HWE2 4L92A 3HOBA 4NR1A 1Q5OA 3WNPA 1CPMA 3AP6A 3BTYA 1PMIA 3IDBB 1IKQA 1GSLA 1COV1 2H0VA 4K21A 3RGBA 3RZJA 2KXLA 2OZJA 2WQ8A 3JU9A 4B4PA 2Y0OA 2Z2SB 3I2GA 1GBGA 2VBPA 3NV1A 1UY0A 2B39A 4LBMA 3VD5A 1FI2A 1E5IA 3VZMA 3FLRA 3M3EA 3WF2A 3BUCA 1JYIA 1OUXA 1XNKA 1YC61 4Q4V1 4XTPA 4XUQA 1MS5A 3ZPYA 1OF4A 1AL0G 4XVHA 4YSFA 2W0XA 3MICA 1GU3A 3SXWA 1YI9A 2YBSA 2ZTNA 1QGLA 1F2NA 1W6MA 5FZ7A 1I9RA 5GZFA 1Z7S1 2IUWA 5J98B 5BNNB 1RHI3 4Y33A 1D4VB 3OD0A 3NO8A 1RHI1 1VBA2 3OB8A 1NZIA 4IV1A 1RGSA 3KGZA 5G05L 4QDSA 4EE2A 1PZ7A 4KBZA 4AW7A 3IN9A 2ZKLA 1EV12 5FKBA 1AL21 1DQ4A 4G9SB 2P1BA 4QXKA 1S2BA 1RTVA 1CIWA 3KVBA 4K1ZA 4Y3OA 3LEGA 3AK0A 2GC1A 4MXWA 5FP8A 5C70A 1XNDA 5ANQA 4TZDA 3U37A 2QQOA 4YM3A 2AEZA 3IAQA 3DF0A 5FYSA 5FY5A 3VBUC 4CXXA 3C7HA 4QQ2A 2XJTA 5FZ6A 1BEV1 2JEMA 4LA3A 1H4GA 2W1SA 1W8UA 1EP0A 2W1UA 3SH5A 1WW4A 4A7KA 4Z2WA 1O3RA 4ZZ5A 5KHGA 1Y9GA 2C9KA 1VBD1 2JG8B 4BMBA 5JI9A 1HRV1 3WNMA 4KWKA 4D6QA 1MEC2 4JV4A 2Q1MA 2RE9A 4IGOA 4M4PA 3J7NA 3JD71 4FXGB 3MPPG 4PBOA 1PX3A 2CHHA 3BIEA 1MS8A 1R092 3ME2A 2VQUA 1JW6A 4DNYA 5J3UA 4XXAA 3USUA 2DCZA 4Q2FA 5H9SA 2BOIA 3MIEA 3V56A 1JOBA 2P2KA 4MGSA 1QJX2 4H7MA 3UT0A 1BVP1 5C5TA 4W6YA 4NAOA 3W21A 2DF7A 2XBO2 3LD8A 1UZZA 5E1RA 4CEWA 4AAXA 4AI3A 3BU0A 4DY3A 3LOBA 2VMIA 4CDXC 4C90A 3S5AA 5FYCA 2P6CA 3R6SA 5A7NA 2Y6GA 1LOFA 1WA4A 1R093 2PAKA 1C3HA 3AKSA 3AP4A 4QB1A 5BNPC 1VMFA 2IWGB 4XTMA 1GMMA 1ZA7A 2PLV1 2WWJA 2LTNA 3B94A 4YM1A 5LBEA 5BY5A 2XJPA 4MGIE 3L2HA 1YCIA 3H8UA 1AUYA 3K4DA 2IXHA 3M3CA 3VUOA 2OPWA 3Q8EA 4Y1XA 2BNMA 1YEWA 3VBOA 1W39A 4UAPA 2BBAA 3W5MA 2Q8EA 3D4KA 4HN0A 1QOSA 4XURA 3UV9A 4A3ZA 2D6LX 4KU8A 4W50A 2WZEA 1CZVA 3H8RA 2ZBJA 3ZMOA 4COYA 2WFPA 1X50A 4CSWA 1K5MC 2J1UA 4QPYA 3VBSC 3BODA 4EZHA 3I54A 1H6XA 1UNBA 3VKNA 4BQYA 1KS4A 2WWSA 4AWDA 4UYBA 4IGPA 3U10A 4CUGA 2OW4A 1EAH1 1DYOA 1WMDA 2JIJA 2VPVA 3WG2A 3ZFEC 4FPEA 2BDRA 3OEBA 3WF3A 1V6LA 2CU5A 2ET7A 4EV0A 1RUJ3 1HIXA 2VZSA 4BQ4A 1QJFA 5K4LA 1NA1C 2XUEA 3UKTA 1NKGA 2YBPA 1J59A 5BPXA 4EROA 2IXIA 2YBKA 1O7FA 3N35A 1DZTA 2DCTA 3TNPB 3JBG2 4DEQA 3M4FA 3C7GA 4CDWC 5BXXA 5LZ6A 1DGWA 3T30A 4ORFA 1LR5A 2EICA 3ZSJA 4LHSA 3ZN4A 3VDCA 1L7RA 2ZEYA 1IS5A 3KSCA 3WR0A 4YZ5A 1G7YA 4AL9A 1JZ2A 2WRAA 5F6KA 5ACA3 1HRV2 3R4DB 1O6UA 3FZ3A 4DPNA 3NQHA 2ZXQA 4I02A 5I91A 4P5YA 1VLNA 4YZ3A 4I0BA 3ZKYA 3C7EA 4ATFA 2GN3A 5DG1A 2XKPA 4DB5A 3HQXA 1VBB3 2CSGA 4DZGA 1CVNA 5IVYA 1O5UA 1FOD3 3ACHA 3R4SA 3W5NA 1URXA 1C5HA 1NCRB 2OZ6A 4ZS2A 1ZRDA 5FYUA 4PQQA 4KU7A 3WDYA 4OHWA 1CGPA 1JN2P 3VB9A 2O14A 4HT1T 4CDUA 2VVDA 1AX2A 2WYSA 4E8DA 1UYYA 3MIHA 2V4AA 3MGUA 3E6BA 2XONA 4UW5A 4C91A 4OCTA 4JHTA 2DUPA 2K2SA 1REDA 1VALA 1XE7A 4KMQA 1H8TA 2PYTA 1JYWA 4AFDA 2QVSB 4IE6A 4QGLA 3K2OA 3LDKA 3FFQA 3FHAA 4Q29A 4IL7A 5IWFA 3WUDA 4LMFA 2QZ3A 3LDRA 2RDQA 4JAAA 5F2SA 2B42B 2RS53 5D1IA 3PUIA 3CLPA 4GH4A 5TSWA 4MHUA 4LBKA 1HW5A 2FDFA 1LU2A 3POFA 3VL8A 3VKFC 1CWPA 3FUQA 3IZOA 3N7JA 2VXJA 3JB8A 1DIWA 3AMHA 4P9XA 1EUUA 5FZ8A 1QH6A 4HK8A 4LK7A 4CEYB 3PJYA 1M06G 2IXLA 2VJXA 1BMV2 1WW6A 3UKNA 4FTEA 4CU7A 3HT2A 3N9LA 5EZWA 4AEDB 4CCKA 2VM9A 2A6VA 4BJ0A 2CWMA 3I2JA 5IK7A 1LOAA 3VBHC 4DXZA 4XDPA 5FKCA 4V2VA 2VE1A 3I4IA 3K3NA 2E7AA 4O9GA 2VOTA 2E26A 4INDA 5GLTA 3WY6A 2WQ4A 1GOFA 4MXWB 3OOXA 5GM0A 1CAWA 2OPKA 2J22A 4NJ4A 5FMOL 3H3ZA 3ZXKA 1NE4A 5LA0A 2GNDA 4YWAA 3MFCA 4YNIA 2A1XA 3ILFA 4WVWA 3RG0A 3PNAA 1JYTA 2W68A 3PU3A 3PIJA 3SEEA 4ZU5A 4A44A 1JHJA 3UGGA 1QHDA 1O4TA 5FY8A 3U4XA 1SCRA 3QH6A 1QXJA 3IDEA 1PO23 3PU8A 2PQQA 1I1EA 2W39A 1J3QA 3GYDA 3IBMA 1OOPC 1ULOA 1YFUA 1S0EA 4KQ7A 2FZ2A 2XJQA 4EN9B 1NOVA 4EYUA 1RB8G 1CAUB 1V6IA 4B1MA 2VMEA 4NPRA 4HVRA 4XJ8A 1PK6C 3FMGA 1CR7A 4LK6A 3P3PA 2J7MA 3I3QA 4DUWA 5FZ0A 1Q43A 4Q4X2 3FE5A 3FJSA 5LCWL 2MHFA 3DPRC 3N36A 1LAJA 2FDKA 5AFEA 2MEV1 4NRPA 2PLV3 1YI7A 1YIFA 2HBTA 4H7LA 4BIFA 4YVSA 3MW2A 1PIV3 2P37A 3KT4A 3LZZA 1ACCA 2RS31 4LUMA 5CG8A 3FWEA 1FT9A 4YGDA 4HK9A 1UKRA 2VQ0A 2GNMA 2CTVA 1D4M1 1YWKA 5I8SA 1LULA 4JGYA 4AEDC 2RMU3 1RUD2 5EV7A 3VBFB 1FOD2 1AR81 5FYHA 2Q8OA 4CEWB 4ISRA 5CYYA 3WLUA 2ORXA 3FLTA 3GZEA 4Q5OA 4F7ZA 4CEYA 2RJLA 3DL3A 4YARA 1KFUL 4JQTA 2JG8C 2YGMA 1RXFA 4GWMA 3JD73 2VZPA 2E53A 2RR12 2ZAHA 4A6SA 4BYYA 2C26A 3WW3A 4N7UA 3D8CA 4WZFA 4XE9A 4MVTA 4YM0A 4RL7A 1OH3A 2X8KA 3GBWA 5SV8A 1HRI1 4FP3A 3RJRA 4IE7A 5F3GA 4ZU7A 2EIEA 1A78A 2ZOEB 3N9PA 1R1A2 2HWF3 3THDA 1U5YA 1JHNA 1N1VA 2UWAA 5L73A 2PAEA 5CNAA 2FD8A 5A32B 1DCSA 1GNHA 1S0FA 1HB1A 2DVGA 1LTEA 5CKMA 3KZ4C 4CDUB 3WHTA 1MVEA 5FZAA 1IG3A 5HCBA 1AX0A 3J8F1 2PMWB 3MLLA 1UYZA 5J96B 1JBCA 1S0CA 1FXZA 4HZFA 5LA1A 4LHKA 4JRLA 1LGBA 2HEVF 2JDHA 2PXJA 4E8CA 5AC93 1W6QB 3AMQA 4GH4B 1RUF3 3AMPA 4EN0A 5I0DA 1CX1A 4XF3A 1ULGA 2OS2A 3WG3A 5AVAA 1HXS2 1ZVFA 5DAWA 3RNSA 1DQ5A 5FZFA 4FO9A 3WW1A 3NL1A 3SH4A 4EZ4A 5KHIA 1VRH3 1WD4A 3KT1A 3O5SA 2FDGA 3ZYHA 4MH0E 4PF1A 5FAXA 3DPRA 3ZYJB 3TEWA 1F4AA 1B09A 5D2AA 2E7TA 1EUTA 2FMYA 2R1BA 2VZRA 4QKFA 3IAPA 4Q4W2 2CYFA 2C9AA 5CA6A 2BVBA 4XQWA 1E5RA 1ND3C 4FQZA 2R061 2BV4A 1RUG3 1WKYA 4UWDA 2Y8KA 4LE4A 4Z2AA 2JB4A 4X6QB 4ZHNA 4QT6A 4S2HA 3ZOIA 2FHRA 3POWA 3GDBA 5IT6A 2HEYF 3CNAA 3GZTB 4JQRA 3NWKA 3HNMA 4LXLA 1TNRA 2LALA 4Q0PA 3IT8A 5JI7A 2ES3A 3WG4A 2J1VA 5LB6A 1VP6A 1ENQA 3MIBA 2SLIA 3U07A 4CCMA 3PMEA 4AR2A 2WT0A 3CZUA 3H9AA 3VBHA 1J3PA 3K4AA 1UKGA 5FZ4A 1OPOA 1G9FA 4Z92B 2VR4A 3AKQA 5F9TA 3ZR5A 2A6WA 4AQ6A 2IFWA 4GMP0 5DQ0A 2ZGOA 3D0SA 1PGW2 2WBKA 4ATEA 4B1LA 4CPBD 2ZMNA 2WAAA 1PO21 3IMMA 1AYN2 1HJGA 3RMXA 3GCXA 4AFMA 3THCA 1Z78A 2JKBA 1ULPA 3PTRB 2WFF1 1RMU3 4GB31 4GXLA 2JD4A 3AVRA 5DAPA 1YFXA 1SACA 3WNXA 5KC5A 3FBMA 3I97A 2P3YA 4B7KA 1KDMA 1XU2A 2GAUA 2BRTA 2WA4A 4MGZE 4YGCA 3WP5A 2WSUA 5D8AA 4Q1PA 3CO2A 3KCXA 5F5CA 4N8MA 3MF6A 1DGLA 2VCMA 3WW2A 2ADEA 4EQVA 5HCFA 2PHLA 2RJKA 1W8FA 3M2MA 2QKDA 3ZKUA 1OA2A 5FZCA 2W94A 3OGRA 2XVLA 1W8HA 1O91A 2ARBA 3IMNA 3MDPA 3ZSKA 4JX0A 1XNAA 4A2UA 4XJAA 1AR92 1NAEA 2YU2A 5FO7B 3WINE 4CDQA 4FPHA 4LKDA 4W4ZA 2RR13 3O12A 2JE9A 1W8ZA 1GWLA 5CFDA 4HLTA 1UYPA 3TAYA 3KWVA 2BZDA 3WQ1A 1LOFC 3U0ZA 3AP5A 4EWEA 3AZWA 4QKDA 3T2TA 5L36A 3WDVA 3H8OA 1NY72 2WQZC 3POJA 4Y1VA 2ARAA 4IESA 1XB9A 3WCSA 1DG6A 1Y3TA 2BW8A 1H2LA 1DZRA 5A80A 1ZREA 4LITA 2DCKA 5FXVA 5FPAA 4P9GA 2WR9A 1KEXA 4UFIA 3A21A 3CIHA 3L2YA 1PMJX 4CYDA 3BI3A 4FPOB 2VG9A 1K5MB 3AYAA 3MUY1 3T1MA 2QFEA 5FLJA 1W6PB 1EPZA 1R081 4OI1A 3RDIA 2YPDA 1JZ6A 3NV2A 1BYHA 4FOYA 3P1IA 4P9IA 1PVC3 4OUSA 1N1TA 1ULCA 1TG7A 2DYCA 2A70A 2JDAA 3ACGA 3LGRA 3W9AA 4AGGA 1X9TA 5BNOB 1HQWA 2J1AA 3J4UH 1MS3A 4HBNA 4JDOA 4LTAA 1IHMA 2PAMA 5FBZA 1VAVA 1NA1A 4CP1A 4IV1B 1OA4A 3U78A 5ABJA 3S57A 1N3QA 2UY8A 5BNNA 4I2OA 4IXLA 4NIDA 3VGIA 4AVCA 5BNOC 1RUOA 2WJSA 1FV3A 1W6MB 2R073 2VZQA 2WC2A 3HEIA 2B5HA 1RUG2 1VIWB 2GALA 2LROA 2Y6LA 3SISA 3I3BA 5L9BA 1PGL1 5JZGB 4BDVB 5A3UA 1RVF2 4Q4Y2 2WNOA 2RM22 3UJOA 2L9LA 1HX6A 1WW5A 2VC9A 3MIGA 5HCHA 5FMCA 3SMHA 3OD4A 1LODA 1RUF1 1F5FA 3LQCA 3T0DA 2VZVA 2WO2A 2VQAA 4KWJA 4PBPA 1ASJ1 4QXHA 4XBQA 1XYPA 4GB32 2W87A 5F39A 5FBJA 1QF3A 1HB4A 4XOGA 2NMNA 2VCBA 5I0TA 1AZDA 1US3A 2BTVC 1POV1 4XILA 4X8PA 5A6QA 4OZOA 4RGAA 1GZWB 4PDWB 1W99A 2RM23 4M3CF 3ACLA 5E6HA 3ZDVA 4GALA 2C4XA 1EV13 1D0HA 1DQ1A 1SG3A 3OBTA 5JZGC 3NV4A 4UFLA 3LPFA 1MQTA 4K9SA 5FQ0A 1AYN3 2HWD2 3WZ1A 2ERFA 2JDYA 1QXPA 5HXVA 4XFGA 1WLDA 1GZTA 4QXCA 2ZPXA 3S7IA 1RMU2 1AYM1 3RVHA 3OPWA 5FYTA 1ZBE1 3ZDSA 1OOPA 3BOPA 4W8JA 1GANA 4XDQA 1R1A1 1X33A 2PTMA 5CBLA 5I0UA 2EA7A 3RZZA 5CKQA 1GP4A 1ND2C 2VMDA 4BQ5A 2QUOA 1YQ6A 3IIIA 1T6BX 1BK1A 1ZZ7A 2IXJA 5GLWA 4HSJA 2R071 1J1LA 4CDWA 2WZPP 2OT7A 5T5JA 3KD4A 1V6MA 3URFA 4XDOA 3KHCA 4HPKB 3RZGA 1XSQA 5FZ1A 5I93A 4LOSA 4DXSA 1SFNA 1KS5A 3AP9A 5EXOA 4AI2A 3POSA 2OA2A 4N9IA 3VBRC 2VTXJ 2VOXA 3FL7A 5F3IA 2R0HA 4M4RA 4UOJA 1UAIA 5HV0A 5E16A 5FUIA 5FWEA 4DUVA 1HXS1 2W3JA 3CU7A 1UF2C 4B8EA 5A7PA 4XUOA 1OQEA 4HSLA 3O1MA 2VNOA 3USSA 2HWC1 5FDBA 3JQWA 1G8WA 5AFBA 3VZNA 3BTAA 3FLPA 3KT7A 3OTFA 4CP2A 3ACIA 4OZXA 1WZXA 5CFCA 1FOD1 1XBFA 2JD9A 4GQ7A 3T4VA 3WP6A 4EWDA 3ACFA 4IUGA 4BLJA 4OHVA 1GR3A 2YZ4A 5LBFA 1AYM3 5DABA 2QJVA 3UKVA 1XNBA 2SBAA 2Y33A 5CFDB 3V0AA 1JXNA 1YO8A 2R7EB 3K75B 4YG3A 4HANA 1RIRA 4CDQB 3VZOA 1I6XA 5FMBA 1W2OA 3ST7A 1N1SA 1BEV3 2FCVA 1OUSA 1PK6A 5EIYB 5A6XA 1AR71 3NJZA 2RG4A 1RUC2 1ENXA 3K46A 3PMSA 5L7OA 2VW1A 4CEWC 5D8AB 2BGCA 3GXUA 3OBZA 3WVJA 4XW3A 2HH9A 2Y26A 5FY7A 2HKXA 4A4AA 2HWD1 4DIQA 3PHMA 3VDDA 4FPGA 2E63A 5IYYA 1AR73 1PO22 5EPAA 3OYWA 5CZKA 3VZLA 4A7YA 1NCQB 1CAWB 1FMD1 1XSRA 1Z7S2 2J1SA 3D0JA 3MO4A 1UL9A 2R16A 4JKLA 1HLCA 1R1ZA 2EIBA 1ZZ6A 1YJLA 4FI9A 4Z82A 5DAXA 2JDMA 4CP0A 2P3KA 4ES8A 4NIAA 3SC7X 2XLFA 4GD4A 4IEZA 2QE3A 3T4HB 1S0IA 2VOWA 2YU1A 4OI4A 4XF0A 4Q8KA 2BVVA 4QDRA 4HPKA 4FFHA 3FC0A 2B8MA 2FMDA 1PVC1 1Z0HA 3NAPB 4IW3A 2A71A 2IVJA 3CJIC 5DUVA 1SZBA 1COV2 5F2WA 1AR63 3WQ7A 1ZZ8A 4KWLA 1QDOA 3DEMA 2XQRA 4G4FA 5FZBA 5DDJ3 4IV3A 4URAA 2WWUA 3AKTA 4IE4A 3VBSA 5FOJB 5JR7B 4EN8B 4AQ2A 5LRRA 4TTGA 4Y20B 1OD3A 3VBUA 2QCSB 3M3OA 3IM0A 4QXBA 2TBVA 1UY4A 2RS12 4HFSA 4MOAA 4XBLA 5FUNA 4C1XA 1W6PA 2PLV2 3IIAA 4XIOA 3UETA 1JZ4A 1KD7A 4N90A 4YVSC 1CQ9A 1ZRRA 3LWCA 1UD1A 1RUH1 3T0BA 1OLMA 1O8SA 1MQTB 3BYWA 5GALA 5DDJ2 2Q8DA 2ENRA 5BUVA 3O1SA 4NRQA 5DN2A 5IVCA 4HETA 4GAZA 4P9LA 2HEWF 1QJX1 1HQLA 1F8VA 1AXYA 2VNVA 3JXSA 3PVOA 2VECA 1NYWA 3AMMA 4K40A 5FP3A 2CGPA 1LOGA 3OUHA 3RZKA 1HRV3 1AHSA 4BU2A 4YM2A 2VTXA 3WNKA 1V9U2 3TOJA 4WM8A 1SFYA 1W6QA 2GNBA 2HWF2 3KS7A 3KV5A 3ZFFC 4AOCA 3K3OA 1GFF2 1XNTA 5DUXA 1EAH2 3ZIXA 1V0AA 2D3RA 1E5SA 1V70A 3QLQA 2YYOA 2KM2A 1YHFA 2WYFA 4WM7A 4CP9A 1W2NA 4LHNA 2GH8A 2ZEWA 3KLSA 4YG6A 1PGL2 1W8NA 1RVF1 4Q4Y1 1H1AA 2A73B 2Y38A 5T52A 2AACA 5KBFA 1LJ7A 2O8QA 2A3XA 1K3IA 5M0TA 3X29B 1RUF2 1UU6A 3OUJA 3I2OA 4PDWC 1KGYA 1YNAA 2JDUA 3MV01 4UI9L 4YVWC 1PGSA 5FXWA 3ZFGA 4XHBA 1O3QA 1C5IA 4LO7A 2F4PA 4SLIA 3L9JT 2XL9A 1LNSA 3VBRB 3QACA 2XBO3 2Y6KA 4UXAA 2XMLA 4UW4A 1QJY3 3O1VA 1V6NA 4YW4A 1K5MA 4AQTA 2ZX0A 4RQPA 5F5AA 3RFRA 1UY1A 4LA2A 1U12A 4RS5B 5F6LB 4BMEA 4CTEA 5JR2A 2RV9A 5FTTC 3WDTA 3NNGA 2Q30A 2X05A 4ASLA 2I74A 1WCKA 4ZXEA 4OUMA 4XJWA 4HKLA 3VBHB 4BXFA 1VAMA 4XC9A 4E4ZA 4BK4A 3KHBA 2VL4A 5C3QA 1B35A 2ZZJA 1UZ0A 4LR4A 1YIPA 3ZN6B 3KVAA 2E6VA 2LS6A 4YW6A 4D3WA 2VBDA 4N43B 4TYSA 3VLBB 4BQ2A 2OX0A 3M8LA 3TNQA 1SLTA 4CCCA 1UWWA 5IVVA 4OI2A 4MGTA 4NRMA 1GUIA 5F8PA 1LENA 4QPIA 2KR2A 1APNA 5JXGA 3KF3A 1REEA 4RHV1 4YVWA 1NLRA 4R9BA 4XFCA 2VOVA 4CDXA 4BQ1A 3GGLA 1WLWA 4XFFA 2R072 1YQ8A 3WW4A 3OPTA 4XJUA 1RUI2 5FZEA 1QWRA 1BZWA 1GNZA 1RUD3 4LIUA 4XACA 5LATA 2A7AA 1OFSA 2W92A 4W65A 4CCDA 1ODNA 2VVFA 2XB6C 4QMAA 2FDIA 2V5DA 3KV4A 1PM7A 3F95A 4YW7A 4AVVA 5F3CA 2WLQA 3RJ2X 4XFBA 5C4WA 4A7ZA 4N53A 4FAHA 1KJLA 4KI5M 2ETEA 2YY1A 3K77A 4W6WA 4S2FA 4XZPA 3Q8BA 1OKOA 1X7NA 1NLQA 1BXHA 2CV6A 1SQ4A 1G9BA 2JG8A 1UZWA 4P02B 1MQTC 3WT3A 3GJAA 4BISA 4GZ9A 1ZM1A 4M3CB 3VD9A 1XQNA 4OVEA 2GH2A 4WVMB 3H0OA 5EP9A 2ZGSA 1GICA 3H1MA 4UFMA 3AL5A 4D6SA 1D2SA 1V6KA 2A3YA 3V65A 1W6NB 1H0BA 4D94A 3OGGA 4XF9A 3EXUA 3K4ZA 3SEPA 2D3PA 4JGYC 4AEDA 5E88A 5C3RA 1OQ1A 2WNEA 1PZ8A 3HMYA 5B4NA 4EN6B 1AYM2 4LE3A 4H2AA 4H14A 4UF0B 3DKQA 4DRRA 1P8JA 3USUB 1S55A 4QX7A 1BLZA 3I59A 1RUH3 2X5IC 3G6JB 1H1MA 2UYAA 1JODA 3MI8A 2WO7A 3B00A 1KJRA 3R0RA 3ITQA 4FP2A 3LB9A 5DUWA 4PIZA 2W9XA 1LOBA 2RHPA 3MLKA 1I5ZA 2BOJA 2DVDA 2BERA 3FX3A 1RUE1 4S2GA 1OQDA 4HOOA 4YFWA 5IVBA 3LEMA 2Z69A 3ZN5A 3CL1A 2ZACA 2EIGA 2ZGTA 3B02A 1W6NA 2R6QA 4KWUA 2RS32 5D21A 5FLIA 1JI6A 4A41A 2YDEA 1IS6A 5IVEA 2ZGLA 4TXWA 3PL0A 1QY4A 2PA7A 2ZJCA 5H9QA 1BVVA 5IK8A 2BGOA 2ADDA 4TLGA 4Z07A 2HYXA 1W9TA 2G1MA 2NPIA 2ZKNA 5LK7B 1IQDC 2Y0IA 1OSGA 4LKFA 2YPJA 4ZPIA 2EXIA 3BN6A 3GF6A 4K1YA 4OYUA 4ZKTB 2HWC2 4XAAA 4Q0UA 2ZGQA 2DVBA 1GQGA 1G86A 2QDNA 2ZEZA 4LJHA 4WV8A 2CGNA 1VBB1 1PO12 2GNTA 3ETQA 5LW9A 3O7OA 3UESA 4MGQA 4FBFA 2H6BA 1W3XA 1TME1 4DUXA 3ZSLA 1OFNA 1STMA 3I2KA 3VHRA 2VZ1A 4RYDA 4UBHA 4XF4A 4I3PA 1NXD1 4GJZA 3U4SA 5CIRA 3SHRA 2P4EA 1N47A 3LEIA 5DAQA 2VW2A 4LO8A 1OH4A 4C8DA 1GWKA 1K5JA 3B3QE 3J7MA 3MW4A 1SLLA 2PHDA 1D4M2 2A75A 3ZXLA 1XPWA 2RVAA 3GHNA 3KV9A 3LA2A 3OEAA 4FPLA 5A3PA 3FN9A 3RZMA 4L11A 4JGZA 1SPPA 1AR72 5A3NA 1RUC1 4NPMA 5DZFA 3POIA 2WO3A 1V6OA 2WAOA 1EPWA 3PTYA 5JXHA 2D5FA 3MLJA 1X36A 1CJPA 3QOPA 2VZTA 1QQP3 4H55A 1V9U1 4FPJA 3CF6E 4DXRA 5IVJA 3NAPC 4GMP1 2X09A 1C57A 1JOPA 1H8TC 2W2IA 1MS4A 1FNYA 4QHZA 4IEWA 1EV11 5E8AA 1VJ2A 3BKZA 3ES4A 5EJ3A 4XPVA 3BTXA 2TNFA 1YXWA 5BNPB 5A1AA 2QTWB 1LB2A 4Q8LA 3HNYM 3UGHA 2K0GA 1GYKA 2JX9A 2WZ8A 3MZHA 4X6RB 3ZSMA 4E2QA 5K8SA 3Q9OA 2OUHA 2JB8A 5JIAA 1MPXA 3R4UA 2O8OA 4QPGA 2A3WA 1J84A 4WVVA 3SNMA 1RUNA 1RUD1 2DCJA 1REFA 1AR82 3HVDA 4HN1A 4JTNA 4IETA 2XLGA 2F6BA 4Q4W1 1RUE2 3QD6A 1RITA 4AG4A 3MBWA 4MGYE 4ONUA 4OHXA 5K9YA 4OULA 1H30A 2R062 2ZHKA 1CESA 3ZXGA 3JD72 4AHWA 4AYUA 2YC2A 4R4XA 3WNLA 2E31A 5I0SA 3AZYA 2D7FA 2I2SA 2CWSA 5A3TA 3OPZA 2HWE1 2TEPA 2VNRA 1J83A 1R64A 1MZFA 1NQJA 1CZSA 2XL7A 1UX6A 3B9IA 3KQ4B 4M3CE 4XJ9A 3ZFFA 3QH7A 4QHBA 2YB7A 3KMHA 4FQ4A 3S7EA 1L7QA 1C1FA 3PUSA 1NCRA 1WWYA 3DKWA 3QBQA 4FXKB 3HN1A 4R9CA 4RFT0 1K45A 1OLQA 2XBO1 3I2IA 5FQ0B 5JSPA 4IGQA 1VAKA 5L7OC 4AK3A 3B69A 3DYOA 1W9SA 3J26N 4DEVA 2X10A 2CL2A 4JGZC 4IV3B 3T2PA 2PQSA 2VUJA 4CUBA 3Q8AA 2J42A 1AYN1 5A3WA 4I0WB 3IPVA 1BQPA 4NIGA 4COWA 4NHLA 1AVBA 4XZUG 3BCWA 3GZAA 4JVAA 3EB7A 1VRH2 2WT1A 2LW8A 5K0UB 2ZCWA 3NMBA 2XJSA 3AZXA 2UWBA 4AQSA 5DG2A 1QQP1 4FOQA 2XKOA 3UL2A 3AZZA 4MLOA 4IEVA 4CCJA 1U5IA 2RDSA 3LAGA 1LKNA 3SQOA 3RWNA 2ZMLA 5C4WB 3TEZA 5FYZA 3E5UA 5JSOA 5FJHA 4UW3A 4LBOA 3CJIA 3KM5A 1PGW1 3VHNA 3UK9A 1TE1B 3BGAA 2R0FA 4IEXA 2Z79A 3KCYA 5JDBA 5ISLA 1T6GC 3B5LB 1G6NA 2WFF2 3KGLA 2VULA 4GJYA 4WVMA 4RGKA 3BU7A 2AGSA 3HD8B 3I49A 4AHXA 2V5YA 4N53C 5BV6A 1YQ2A 5FPVA 5FREA 5FZIA 2GSYA 1POV0 4YVWB 2W1WA 1Y7BA 3LA7A 4Q4Y3 1R091 5FK8A 4LBQD 1DGRN 1PHMA 1E5HA 5FZOB 4I0AA 5IFTA 1SMVA 1F35A 3M70A 1DQ2A 2JIGA 4XEZA 2VAUA 3O1UA 3KF5A 1IZ3A 1HKDA 4LO6B 5FK7A 4K8RB 3HJRA 3N4MA 1GP5A 4HKOA 3GNEA 4MXVA 4MSVA 4ASKA 1WCDJ 1YFWA 2GP3A 1TMF3 4Q26A 4YW1A 5FPZA 2JKXA 1YQ5A 2BPA2 4O65A 1UO9A 3J9SA 3WNNA 4YFZA 1E57A 1UYXA 1ZBA2 1W03A 4QPIC 5FYIA 5L7OB 3WOGA 3M7AA 4E4SA 3WF1A 3VHPA 1BKZA 5ACA2 3LKJA 2X5IA 3EBRA 2WINB 1LHNA 2AUYA 3BB6A 5IFPA 2VCCA 1SBDA 2OIIA 1ZYBA 4NHXA 1GOGA 1PIV2 5A7WA 2WS92 5GZCA 3S5QA 1ZA4A 3TBDA 3C2UA 3AFKA 2D6NA 3KCCA 3NNJA 4FVVA 3SKVA 1WCQA 5BNNC 1ULDA 1BBT2 2AR6A 2XH6A 4QQPA 3DYMA 3VKMA 2B4KA 2WNUA 3PUAA 1OHFA 4QX1A 3V0BB 2RDRA 5JVVA 4ZONA 3ZPOA 1W6OB 2WIIB 2F4LA 1VRH1 1FMD3 1Y43B 5EJ1B 5FP9A 3C7OA 2BUKA 2D6OX 3IB3A 5LK5A 2J1EA 3LOIA 2WT2A 1H4HA 2BFUL 2JDZA 1H9PA 1F9KA 4CA9A 1IS3A 2DU1A 2PHXA 2VH9A 2R30A 4Q0QA 1RC6A 3ZYIB 3VDDC 2I45A 1SLCA 5A33A 2XOMA 3ALQA 4Q4V2 3VZJA 4BQXA 5C6CA 3SCHA 3JQXA 4KGQA 2QQWA 4QD2A 1YFYA 4IEQA 2HJIA 1X82A 2FDJA 4PIYA 4AI9A 4IERA 3GALA 3I3EA 2D93A 3NJXA 4NUBA 1GZWA 1QJU3 1HJFA 3MF9A 5EYXA 5KXCA 2VUDA 3OF1A 4WM7B 4XFHA 1CONA 1NG0A 4QKNA 4Y1ZA 4BPZA 4YRDA 2W95A 3BIWE 2VCAA 2VMCA 3MIDA 5FCCA 4E9KA 1CD3G 4Z8BA 2BBVA 1DZQA 4L97A 4DQAA 2HLEA 1HN1A 2QQUA 2FCTA 5JZGA 3ROUA 1RINA 3POYA 2HWE3 1BEV2 4FFIA 5KHJA 3R05A 2YV8A 5J7MA 1ZBE2 1AF9A 4NHYA 4AEKA 4BB3A 5GLUA 4NOTA 4HMZA 1ZBA1 5LBBA 3CKHA 4CDUC 1AJKA 3BTZA 3D6EA 2DTYA 3N7LA 1A6CA 1O59A 2D6MA 3HAGA 1HB3A 4TN7A 5ERLA 4Q4W3 3ZX7A 4Q0SA 5ACA1 3S6PA 1SLAA 3ENRA 4M0NA 3CMGA 2WLPA 4RS5C 2E32A 1O3TA 1H1IA 1ZBE3 4QGMA 4C0BA 4DOUA 4AI0A 3CZJA 4JC1A 5AVPA 4LHLA 4CCOA 1VBB2 3P3NA 3VBSB 2YFZA 3A7QA 4RGGA 3RI8A 1BBT1 1S2EA 4QQOA 1QJU1 4QQHA 2D97A 4QU2A 4L0PA 5FO9B 4Q4X3 5A3OA 4R52A 3O1OA 3A4UA 1D2QA 1JH5A 2AZ5A 3GBFA 2Y6JA 2WUHA 2R063 5FYVA 1UN1A 4WM8C 4RR3B 3NJYA 1OXCA 3V0BA 4NIHA 3DN7A 1KXGA 1TVGA 1JTZX 2D3SA 1VBA1 1RHI2 4KNCA 1UPSA 1LECA 2OUJA 3B9CA 3ILRA 2QQJA 5FPLA 3RPQA 1V6JA 4FFGA 4I01A 4A3XA 1SBEA 1JZ7A 3THTA 2H6CA 5LRSA 1AL22 4LLOA 1ULEA 1JS9A 1IPSA 2DFCA 3HIFA 5DUUA 2C6SA 3SITA 1WMXA 1IG0A 5GZEA 5B4XA 4MUVA 2VOKA 4YLZA 1S0DA 4AE2A 4AVBA 4BIOA 4MG2A 2JE8A 4COZA 5FPUA 4CDXB 3ZFEA 4BQWA 4JGYB 3E6DA 3HBZA 5A3MA 1FV2A 3I8TA 4HXCA 4YZ4A 4UFHA 4A42A 2EALA 2WNVA 2WNVB 4YW5A 1KDKA 5FUPA 4CRQA 4NHKA 3VD3A 1VBC2 2DWRA 4N43A 1CIYA 2A5ZA 1AL23 3B7MA 1VE0A 3DXTA 3QCWA 1JYXA 2QQIA 2JICA 1F31A 1VPHA 3H3LA 2Q8CA 1DDLA 2VZUA 4Y26A 2VMGA 3CHXA 1VBE1 3I2FA 1OURA 3WEZA 4QM8A 1M4WA 5FZOA 5FY9A 4KG0A 3VBFC 1OF3A 3C7FA 2FZ1A 1IKPA 2JJ6A 5CEHA 1CZTA 2JDNA 4ZXKA 5C3PA 4ARXA 1IOAA 2YFUA 3E97A 1OD5A 5F37A 4MHRA 4BHPA 4AVTA 2YHJA 3N9QA 4ZZ8A 2VUAA 2VGDA 1GOHA 5FYMA 2QBXA 1W0NA 3LIHA 3PVNA 1W6OA 3VDBA 3VBRA 1RUC3 2C1FA 4IV3C 4LKSA 2DUOA 4U36A 2JECA 4JDNA 3ZM8A 2GC2A 4Y1YA 1LOCA 2JG9C 2ZX2A 5FZKA 3E5XA 3CJIB 1U5ZA 2DTWA 4QX3A 5LEJA 3KB5A 3BPSA 4FPYA 1DFQA 5GZDA 2IZWA 4GWNA 3JB4C 3JUUA 2W52A 4RHV3 4XQDA 4XXPA 3BVCA 4CP9B 4O9EA 4Y5Z0 4CU9A 3W20A 3OY8B 2K9ZA 2XHNA 2VNGA 1OVSA 2ET1A 2OYZA 1F4HA 4ISQA 5C8CC 2QQKA 5FY1A 2AEYA 4CCNA 3NW4A 3HWJA 1H6YA 3PUQA 4LO4B 1RXGA 1W0OA 2ZGKA 2PHWA 2GMMA 3S0MA 2XJRA 1RJ7A 5JSRA 5IUQA 1G9AA 1PNFA 3O1PA 2YG0A 3NVCA 2ZHMA 3VL9A 3WDWA 1A8MA 3POBA 1OMIA 3FFZA 1B35C 1QQP2 1QJY1 1SEFA 1UY2A 1WLCA 3ON7A 5AC91 3LIGA 2OQ7A 4GA9A 3UNPA 5C8CB 5HCAA 2H0BA 4HG6B 2BWCA 2Y6HA 5EYYA 1QDCA 5FP4A 2Z42A 3TWIA 1XE0A 2IVIB 4Y22A 3I3MA 3OY8A 3ZXAC 1AR61 1H8TB 2MNGA 3PURA 4ES9A 5HXMA 1VR3A 5A32A 2IXKA 2V72A 4Y20A 3WX5A 3LFIA 1IGOA 2G4IA 5FXZA 5JUVA 1UXXX 2W5FA 4PHZA 4GMP3 4PDWA 4QB2A 2DCYA 5BNOA 3NKTA 2B9VA 2OQ6A 5T54A 5C3OA 2AC1A 3DCQA 2W91A 3I2DA 1BCXA 2ZMKA 4M0HA 2KA3A 1A3KA 4WM7C 1LHVA 3U11A 3ZYFA 4WVZA 5DAVA 1WLTA 3LDBA 3LE0A 4P9WA 1WD3A 2J1TA 4XABA 4TWTA 1ENSA 1FNZA 5BNPA 1CAXB 4FSJA 1QJX3 3AMNA 4LEJA 3IPVB 1QXRA 1IS4A 2BYVE 4LIVA 3D3AA 3H8XA 1HDKA 1IPJA 2GN7A 3MYXA 4K3UA 3CBNA 3LFMA 3U75A 3G7DA 1NA1B 2D98A 4Y5SA 3VDDB 3WDUA 2EXJA 4LOTA 2D44A 5EHDA 5A7WB 5A7QA 2E33A 1OKQA 1R083 3N7MA 4YVSB 4UT5A 3ZYRA 1ZX5A 3ZFEB 2JG9B 4CCLA 1FAYA 4FTSA 2BNNA 1VB2A 4GWJA 1UIJA 4MV2A 4ARYA 3N7KA 2UWCA 4TLFA 4C1WA 1CJDA 3ZIWA 4NN0A 2YXSA 2EIDA 2VO5A 3NKGA 4NO4A 5FRAA 1GZCA 4QWNA 1WBLA 1CAUA 1ND3A 3E1F1 2F17A 4AFAA 4SBVA 2GMEA 5CADA 5IJRA 5FMDA 4OQ8A 1JUIA 3K48A 1X8MA 1I3HA 3POEA 4B7EA 4XF1A 4V1PA 4OFGA 2LM3A 4CDQC 4HVOA 1BMV1 4PI0A 4MZUA 3VBFA 1QJY2 1D0GA 3GZUC 3LSEA 4XHXA 2NZ9A 2Z4FA 3WG1A 5FY4A 2YROA 2RM21 4NE9A 1UW8A 1ZZ9A 5C7GA 2NMOA 1DYKA 1WMFA 2AH2A 1NCRC 2FBEA 3ECQA 3Q8FA 5BYNA 1RUJ2 4QPWA 2XHKA 4N7IA 5C9AB 1QJU2 1MZ6A 3ATGA 3EYPA 3RYKA 1OPMA 5A3LA 5HBAA 2R49A 1HRI2 2WO1A 3AL6A 4S2DA 1AR62 3K51A 3H42B 4AGVA 1MZ5A 3H50A 3I3DA 2E7QA 4P00B 1LHUA 5EQUA 1ZRIA 4FFFA 1XJAA 4N9HA 2QQMA 1GV9A 4LUKA 5J36A 4PJYA 1PMHX 5JMOA 2N7GA 2WFF3 4GB33 5GLVA 3AP7A 1NY71 1WGPA 4RR3A 4CDWB 4ET7A 3T08A 4DY5A 2UU8A 4QPGC 1QMJA 4MGKE 3MFAA 1VBA3 2AENA 4OQ9A 1Q3EA 2CAVA 5A6ZA 3I59B 5G04L 2WZR2 1ND2A 4QX8A 4RN5A 3ZLIA 3HQUA 4YW2A 3HN3A 4PT6A 4XQ4A 5T5PA 4Q4X1 4XMIA 4V2WA 1SFPA 4BQ3A 1A34A 1WA6X 1YYNA 2ID4A 1W9WA 1YLLA 1J58A 3OBRA 2BNOA 2GC3A 3ABZA 1CPNA 2MEV3 4J1WA 3RYRA 3A23A 1Q56A 2XG3A 1W90A 2YUEA 4AFCA 3DXUA 4BCUA 4AXOA 4L8QA 1ASJ3 3FUOA 4PQ9A 3T1LA 1DQ6A 4DO0A 1AXKA 5CKNA 1J3RA 5FZDA 2Q0AA 3SCGA 5CU1A 3LF7A 3AKPA 5J48A 5C8WA 3NSTA 3VBOC 3RZLA 1W28A 2EVXA 5A6YA 1UMIA 1EY2A 1NCQC 4IV1C 3DYPA 2DBNA 4LBQA 3WXPA 1W0PA 3T09A 2QQPA 1GNYA 3P5BA 3H7YA 3LEKA 1ASJ2 2VBBA 3OCPA 5KR7A 1AR83 2DVAA 1Q8SA 3MV11 5D8AC 3ORJA 3NNMA 2XGXA 3UGFA 3AFGA 4KBBA 4AFBA 1DGWX 3J7HA 1Y4WA 2XLAA 2XJUA 1C8M1 4CXWA 2WNUB 4XUPA 5FZ3A 5KXDA 1ND2B 2BU9A 2RS33 1I5PA 3AYCA 2ZHNA 1SBFA 1AR93 2EAAA 5FZ9A 3ZVXA 2VW0A 4QPGB 5FYBA 4W6XA 1GP6A 5KC6A 3FBYA 3PJQA 4HL0A 4NVPA 4D0QA 2E9QA 2BWAA 1Q8QA 4MX3A 4UF0A 3AB0A 4QPIB 1PZ9A 5H9PA 3RI9A 2G9ZA 4O7XA 4UFKA 3CQOA 3RSJA 3CJXA 4NWWA 3AX4A 3OGJA 4D6RA 4YW3A 5AC92 4RD7A 3T0AA 1L7LA 2YC4A 2NLRA 1DYPA 1WCUA 4D7YA 1HRI3 2W1QA 1DU3D 1FPN1 4Q27A 1S0GA 3WQ0A 1JYNA 1O4ZA 3VV1A 1LOEA 1X8EA 2HWC3 5SV5A 1DLLA 1O5LA 1UQXA 4QKBA 4RS5A 5GZGA 1UIKA 2A6ZA 1UOJA 3EMRA 1TEIA 1FYUA 4OHYA 2XR4A 3C3VA 1LRHA 4N53B 1A8DA 4BWOA 1F5JA 4GKYA 1GWMA 1MR5A 2XVGA 1H2MA 3ES1A 1VBD2 3DECA 4EN7B 3ZYGA 3A0NA 3BOWA 5FJKA 1HB2A 5JMCA 3D5OA 2RJ2A 2VMFA 3PLQA 1UU5A 4Q1RA 1D4M3 1OLME 4CU8A 4LBLA 5GJ6A 3WF0A 5JXIA 4LPLA 1UX7A 2XQXA 3HBKA 3PIGA 4XJZA 4KH9A 3S30A 4NROA 1Q8OA 2BFUS 4A6OA 3RYPA 1UZVA 2RS11 4K6BA 4CUCA 2PHTA 4Y4RA 5FWJA 2ZGRA 4CXYA 4XUNA 1KRIA 5GLZA 5FZHA 2CDOA 4PLNA 4AVSA 3O1TA 3MEPA 4B4QA 5JXJA 5FXXA 2Y6FA 3W58A 4M01A 4IQPA 4OLLA 2WZR3 3J7LA 4AEMA 1W2UA 5L9RA 2WABA 1EYBA 3INAA 5K0UA 3NNLA 1RUE3 4PLMA 5IK4A 4G3YC 2ZGMA 4D8MA 2BP6A 2HWB2 5FLHA 1FPN3 1W06A 3ZMNA 1ZRCA 3GHMA 2D40A 4QQLA 4RFRB 4ASMB 4R9AA 4AZZA 1DBNA 1RUG1 1QOOA 2GZWA 2ZHLA 1AJOA 3ILNA 3P6BA 3WCRA 1JZ5A 5KXBA 4J25A 1ST8A 5EFUA 3PDQA 4BK5A 2HWF1 2EAKA 3PVBB 4QX2A 1U5XA 1J1TA 1VMJA 3CDZB 5FPBA 5FYYA 3VKLA 1UXZA 2ZX1A 2Q5TA 2RDNA 2JG9A 4QX0A 5LY1A 1UOGA 4YG0A 2Q1FA 5A7SA 4YZ1A 3VD4A 5JOWA 3DGTA 1VMHA 5JCTA 4QB6A 4GH4C 3WV6A 1S4CA 2AYHA 2WL1A 3OSDA 4C0HA 2PFWA 1FX5A 1W3VA 2ZX4A 1BJQA 1W8WA 2X29A 4TSVA 4XFIA 1YQCA 2D6KA 2OVUA 2DU0A 5JLVA 4GKXA 2JDKA 2C24A 4YZ2A 2Q1ZB 4Y22B 1CAXA 1T2XA 2WNVC 2PHFA 1XRUA 1DLCA 4P14A 1XOYA 2ATFA 4UBGA 5L19A 5F7UA 4RQPC 2C0ZA 2D6PA 4DRVA 4LNVA 5FP7A 1K12A 1TZOA 2P3JA 1TNFA 2GDFA 3NNFA 3TRSB 1HQNA 2ORZA 3IDAA 1R082 1NLSA 1ZRFA 3AJZA 5ANNA 3ZYBA 1X9PA 1SCSA 3V64A 2GP5A 5I0RA 5CAZA 4BH9A 1N3PA 1H8VA 2WS91 2P17A 1UCXA 3T2QA 4HVQA 2UY9A 3DUIA 4RHV2 3TEYA 3M3IA 3MPBA 5LY2A 1VBD3 2P3IA 1HXS3 2DVFA 4GIQA 4UFJA 3GCWA 3SKJE 5BNQA 3EJKA 3JBG3 2BQPA 5C8CA 4JGZB 3O14A 1TMF1 3AXEA 4KGGA 4LT5A 1C4RA 1JU4A 1NT0A 1Q8PA 2UURA 2V4VA 1MS1A 3IKWA 2WNUC 3H3UA 1JUHA 2Z5WA 4DINB 2HWD3 4PCRA 5E89A 2FQPA 2JXAA 1B35B 1WMEA 1OA3A 2HWB1 2ZEXA 1JU3A 2MEV2 1JOJA 3EO6A 3TN93 1UOFA 1Y9MA 2QZ2A 3EHKA 1PIV1 3WUCA 4EJRA 1XYOA 1Z7S3 1W05A 3AJYA 2P6HA 1UOBA 1W8OA 5T50A 2J1RA 2HYKA 2EF6A 4NPLA 2CAUA 2W08A 3A0KA 3VN4A 5CB7A 5FMOS 4QGNA 4IE0A 3AVSA 5F5IA 4N43C 3VBOB 3TN91 3VDAA 2ILMA 2ZABA 1JZ8A 4NIIA 1ONAA 1YRZA 4FCAA 4META 1NCQA 4JZRA 2HWB3 4ZY9A 3UYJA 2G9FA 3SCFA 5FPXA 5DMYA 2WA3A 3IDCB 3ZFGB 1POV3 1V9U3 4DS0A 3THPA 2DURA 3B93A 1OI6A 1LCLA 1C8M2 1QJZA 4NHMA 1JYVA 5GKAC 1ODMA 1EAH3 5HPOA 1C1LA 5HV4A 5F5QA 1VBC3 2RR11 5DPNA 5KXEA 2V73A 2RMU2 4BLIA 1S1AA 4J6GA 4YGEA 4AEJA 5FR3A 4ZS3A 3AYDA 1W2AX 4XIKA 3ZYPA 1PK6B 5F32A 3FHQA 4FOWA 1FMD2 2RS52 4NMIA 1YUDA 2LUWA
chains in the Genus database with same CATH topology
3PUAA 2YU2A 4QU1A 3KV5A 3K3OA 4UF0B 5FWEA 3ZPOA 5FUPA 5LY1A 5F3GA 5A7SA 4LIVA 5FP9A 5A7PA 5A3TA 4D6QA 4QX7A 5KR7A 3N9PA 4IGOA 3DXTA 5A1LA 3K2OA 5IWFA 2Q8CA 3PUSA 5F2SA 5A7WB 5A7QA 5FY9A 5FZOA 4IGQA 5FZ3A 5A80A 5FZ9A 5FWJA 4CCLA 4LITA 5CEHA 2VD7A 5FXVA 5FPAA 5FYBA 1VRBA 2XXZA 5FZAA 4HOOA 5IVBA 3LD8A 5F37A 2XDVA 3N9QA 5FZ8A 4AI9A 5FYMA 5FXWA 5FP7A 4QWNA 5A3WA 4UF0A 2P5BA 2YPDA 4NUBA 2PXJA 5FYCA 5IVEA 2XMLA 4CCKA 3N9LA 5FZMA 2OS2A 5F5AA 2WWJA 5FZKA 4HONA 4XDPA 4D6RA 4V2VA 3K3NA 5FZFA 5LWBA 4EZ4A 4CCJA 3U78A 5FZGA 4BXFA 5FY4A 2GP5A 2Q8EA 5IW0A 5A7NA 5FYZA 5FY7A 5LW9A 4AAPA 4DIQA 5F3EA 3KVAA 4E4HA 5FY1A 5FJHA 4CCNA 3PUQA 5IVVA 3PU3A 4GJZA 2OX0A 5LY2A 3U4SA 3AL6A 4CSWA 4C8DA 4EZHA 5ISLA 5FY8A 5A1FA 3N9MA 4QXHA 3PU8A 4GJYA 5F39A 4IGPA 4CUGA 3KV9A 5FBJA 5A3PA 4GD4A 4LXLA 5FJKA 2YU1A 5FPVA 5FZIA 3OPTA 4TN7A 4EYUA 5FZEA 5A3NA 5E6HA 5F2WA 5FV3A 2XUEA 5K4LA 4CCMA 2OQ7A 4LIUA 5FZOB 2YBPA 5FZ4A 2YBKA 5FZ0A 5FZBA 5FP4A 4URAA 4QXCA 4CCOA 5IVJA 2WWUA 2YBSA 3KV4A 5F3CA 5FZ7A 4Y4RA 3RVHA 3OPWA 2W2IA 4QX8A 3ZLIA 4ASKA 3AVSA 3PURA 2GP3A 5F5IA 5FYTA 5FZLA 5FZHA 5FY0A 4Y33A 4V2WA 4QXBA 5FUNA 5FXZA 3PTRB 5FXXA 3UYJA 5FYVA 3NJYA 3AVRA 5FYIA 2OQ6A 5FYHA 3KV6A 2Q8DA 5FPLA 3DXUA 5IVFA 3KVBA 4Y3OA 4BISA 4DO0A 5FP8A 5F5CA 5IVCA 2OT7A 4GAZA 5IVYA 5A7OA 4XDOA 5ANQA 3N9OA 3N9NA 5FZDA 5FZ1A 3LDBA 5A7WA 3AL5A 3PDQA 4D6SA 5FYUA 5F32A 5FP3A 5FPBA 5FPUA 5FZCA 5F3IA 5FYSA 5FY5A 4BU2A 5FZ6A 5FYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUA A;  2YU2 A;  4QU1 A;  3KV5 A;  3K3O A;  4UF0 B;  5FWE A;  3ZPO A;  5FUP A;  5LY1 A;  5F3G A;  5A7S A;  4LIV A;  5FP9 A;  5A7P A;  5A3T A;  4D6Q A;  4QX7 A;  5KR7 A;  3N9P A;  4IGO A;  3DXT A;  5A1L A;  3K2O A;  5IWF A;  2Q8C A;  3PUS A;  5F2S A;  5A7W B;  5A7Q A;  5FY9 A;  5FZO A;  4IGQ A;  5FZ3 A;  5A80 A;  5FZ9 A;  5FWJ A;  4CCL A;  4LIT A;  5CEH A;  2VD7 A;  5FXV A;  5FPA A;  5FYB A;  1VRB A;  2XXZ A;  5FZA A;  4HOO A;  5IVB A;  3LD8 A;  5F37 A;  2XDV A;  3N9Q A;  5FZ8 A;  4AI9 A;  5FYM A;  5FXW A;  5FP7 A;  4QWN A;  5A3W A;  4UF0 A;  2P5B A;  2YPD A;  4NUB A;  2PXJ A;  5FYC A;  5IVE A;  2XML A;  4CCK A;  3N9L A;  5FZM A;  2OS2 A;  5F5A A;  2WWJ A;  5FZK A;  4HON A;  4XDP A;  4D6R A;  4V2V A;  3K3N A;  5FZF A;  5LWB A;  4EZ4 A;  4CCJ A;  3U78 A;  5FZG A;  4BXF A;  5FY4 A;  2GP5 A;  2Q8E A;  5IW0 A;  5A7N A;  5FYZ A;  5FY7 A;  5LW9 A;  4AAP A;  4DIQ A;  5F3E A;  3KVA A;  4E4H A;  5FY1 A;  5FJH A;  4CCN A;  3PUQ A;  5IVV A;  3PU3 A;  4GJZ A;  2OX0 A;  5LY2 A;  3U4S A;  3AL6 A;  4CSW A;  4C8D A;  4EZH A;  5ISL A;  5FY8 A;  5A1F A;  3N9M A;  4QXH A;  3PU8 A;  4GJY A;  5F39 A;  4IGP A;  4CUG A;  3KV9 A;  5FBJ A;  5A3P A;  4GD4 A;  4LXL A;  5FJK A;  2YU1 A;  5FPV A;  5FZI A;  3OPT A;  4TN7 A;  4EYU A;  5FZE A;  5A3N A;  5E6H A;  5F2W A;  5FV3 A;  2XUE A;  5K4L A;  4CCM A;  2OQ7 A;  4LIU A;  5FZO B;  2YBP A;  5FZ4 A;  2YBK A;  5FZ0 A;  5FZB A;  5FP4 A;  4URA A;  4QXC A;  4CCO A;  5IVJ A;  2WWU A;  2YBS A;  3KV4 A;  5F3C A;  5FZ7 A;  4Y4R A;  3RVH A;  3OPW A;  2W2I A;  4QX8 A;  3ZLI A;  4ASK A;  3AVS A;  3PUR A;  2GP3 A;  5F5I A;  5FYT A;  5FZL A;  5FZH A;  5FY0 A;  4Y33 A;  4V2W A;  4QXB A;  5FUN A;  5FXZ A;  3PTR B;  5FXX A;  3UYJ A;  5FYV A;  3NJY A;  3AVR A;  5FYI A;  2OQ6 A;  5FYH A;  3KV6 A;  2Q8D A;  5FPL A;  3DXU A;  5IVF A;  3KVB A;  4Y3O A;  4BIS A;  4DO0 A;  5FP8 A;  5F5C A;  5IVC A;  2OT7 A;  4GAZ A;  5IVY A;  5A7O A;  4XDO A;  5ANQ A;  3N9O A;  3N9N A;  5FZD A;  5FZ1 A;  3LDB A;  5A7W A;  3AL5 A;  3PDQ A;  4D6S A;  5FYU A;  5F32 A;  5FP3 A;  5FPB A;  5FPU A;  5FZC A;  5F3I A;  5FYS A;  5FY5 A;  4BU2 A;  5FZ6 A;  5FYY A; 
#chains in the Genus database with same CATH topology
 1GQH A;  1ND3 B;  1W8T A;  2A6X A;  2WS9 3;  3TB0 A;  5IAT A;  4COV A;  3WDX A;  1Y9Q A;  1OOP B;  3SLI A;  3IWZ A;  1LU1 A;  2ARX A;  4WM8 B;  1IQA A;  5JPM B;  4XCB A;  3V0A B;  2IC1 A;  4GWI A;  5EWS A;  1BBT 3;  3JZV A;  3AM2 A;  5A1L A;  5C5U A;  2JDP A;  1HV1 A;  3HT1 A;  4BE3 A;  4JCK A;  4P9J A;  1G9C A;  2UYB A;  2VMH A;  4IE5 A;  1PVC 2;  3HNB M;  1POQ A;  4CEY C;  1N1Y A;  1MEC 3;  3J8F 2;  4RA0 A;  1GZ9 A;  3E6C C;  2VD7 A;  5B2G B;  1DHK B;  2E51 A;  1XE8 A;  1XNC A;  4CVU A;  1C8N A;  4P5H A;  2QDR A;  1NQD A;  1SDW A;  1WW7 A;  5JOZ A;  3ZR6 A;  3ETP A;  4M3C A;  1UMZ A;  2P5B A;  2IXC A;  1LGC A;  4MAD A;  3BAL A;  4DXT A;  2DV9 A;  3NRU A;  4URT A;  3A22 A;  2MPF A;  5J1X A;  2PHU A;  4JKM A;  3J8F 3;  3HPN A;  1H9W A;  4IEP A;  1DGR A;  3WF4 A;  4HON A;  5DDJ 1;  4BZ4 A;  2CNA A;  5JWP A;  5FZG A;  2B9U A;  1VB4 A;  5H9R A;  3ZXD A;  1LHO A;  1ZZC A;  3M3Q A;  5F1R A;  3WP3 A;  5CFC C;  3W59 A;  5T55 A;  2O0O A;  4BM8 A;  1RYY A;  3I2H A;  3MIF A;  1LES A;  4OI0 A;  3LSD A;  3LA3 A;  3PVE A;  4QAW A;  4COU A;  4BOW A;  1DF0 A;  3AXD A;  4XMA A;  3APB A;  4LBQ B;  5I8Y A;  3N9M A;  4LOR A;  4XAE A;  1VBC 1;  4E2S A;  1UY3 A;  3ZFG C;  2R04 1;  4UW6 A;  4QM9 A;  4K7J A;  2DFB A;  4AHY A;  1MS9 A;  1NUK A;  4Z1V A;  4KL1 A;  5C9A A;  3HR9 A;  2NP0 A;  4K20 A;  2JWP A;  2Y34 A;  4U2A A;  2Y64 A;  5J37 A;  2JE7 A;  3BPZ A;  2ZGU A;  4OMD A;  3DV8 A;  1JMU B;  4FAG A;  2KD7 A;  4R4Z A;  4L9B A;  2RS1 3;  3ZN6 A;  1FPN 2;  1Q8V A;  4FOV A;  4GUL A;  4LBN A;  3NV3 A;  5L9V A;  1SDD B;  1OBN A;  5FY0 A;  5IHR A;  2OKX A;  1C8M 3;  1MEC 1;  1NXM A;  3ZSE A;  1F15 A;  1UU4 A;  1WUV A;  2XJV A;  3GM8 A;  3OGV A;  3ZXE A;  2WSV A;  3OG2 A;  4FPF A;  3AKR A;  3OBA A;  4AVA A;  2Q4S A;  4B29 A;  1PX4 A;  1PM4 A;  4K8F A;  2BEO A;  1S2K A;  5KWR A;  1XXN A;  4B3N A;  2ZA9 A;  1TME 3;  4JKK A;  4JTO A;  3KV6 A;  5FO8 B;  4ITC A;  4Y24 A;  2VZO A;  1VBE 2;  2ARE A;  3C8X A;  4PI2 A;  1BHG A;  1RUH 2;  2W46 A;  3GBG A;  3N9N A;  1W04 A;  2ZX3 A;  1LGN A;  5CFC B;  1PO1 1;  3KQR A;  1MZE A;  3T3Y A;  5KHK A;  4IDZ A;  4Y1U A;  1LHW A;  1W2T A;  4PF5 A;  2PEL A;  3MHZ A;  1O3S A;  1US2 A;  4ZU4 A;  2X5I B;  4CZS A;  1WCS A;  2X53 S;  4QDQ A;  2A6Y A;  5A33 B;  3AZV A;  3Q8C A;  4BXS V;  1D7P M;  1S0B A;  2B7Y A;  2XUM A;  2VZ3 A;  3VHO A;  1QNW A;  2VQT A;  3U14 A;  4XFA A;  3H1W A;  3SH3 A;  1C28 A;  2LRP A;  4Q0V A;  1O4Y A;  1RUI 1;  4AF9 A;  1OVP A;  2VXR A;  2ZGP A;  4RQP B;  4DMI A;  1RL3 A;  2G19 A;  5T3N A;  1QJE A;  1DP0 A;  2QNK A;  1H2N A;  1PVX A;  3ZXF A;  5ABJ C;  1MVQ A;  1KFX L;  5FIX A;  2R32 A;  2XXZ A;  4MYE A;  1CN1 A;  4B4R A;  2ZS6 B;  3B01 A;  1AX1 A;  4A45 A;  1SHW B;  4JDM A;  2XDV A;  5JAX A;  2EXK A;  2P34 A;  1S0J A;  4QHO A;  3WSO A;  1R1A 3;  1AR9 1;  4DFS A;  1CAV B;  5LAS A;  3ZXJ A;  1ULF A;  4LKE A;  4P9Y A;  2R04 2;  2D43 A;  1GLH A;  4OMC A;  1QKQ A;  5APA A;  2HBU A;  1GKB A;  2B46 X;  4I3G A;  2R1D A;  3H1Y A;  3O0W A;  3CEW A;  2YC0 A;  2VY0 A;  4Q4V 3;  3WNO A;  4OHZ A;  2JEN A;  5LWB A;  4L2N A;  4PIX A;  4M00 A;  4WBB A;  1RVF 3;  5JIU A;  1UPI A;  3T2O A;  3NJV A;  4FPK A;  4IEO A;  1LEM A;  3DPR B;  3GJB A;  3JBG 1;  5C9A C;  4XCA A;  5IW0 A;  3D82 A;  1QNY A;  4L99 A;  1MAC A;  5CVR A;  1AXZ A;  1IPK A;  1FAT A;  5F3E A;  5IAV A;  3TEX A;  4D7T A;  4E4H A;  2GU9 A;  3F2Z A;  3I7D A;  4MO3 M;  2OXB A;  3TN9 2;  1XC6 A;  1UMH A;  1JYC A;  2CY6 A;  4RSU A;  4NAM A;  3NAP A;  3WHU A;  1MS0 A;  2K46 A;  2WN2 A;  2FDH A;  2WDB A;  5KHH A;  2VUC A;  4BA6 A;  1XU1 A;  2ZGN A;  1JZ3 A;  1G9D A;  3RRD A;  2G9G A;  1PO1 3;  2BJS A;  1KQR A;  2RMU 1;  2QQN A;  2VVE A;  5DXD A;  4CPB A;  1QEX A;  2QQV A;  1O8P A;  2W47 A;  4O61 A;  1XYN A;  4Y4Y A;  5FV3 A;  3ZO0 B;  5EJZ B;  5IK5 A;  2XWB B;  1UZY A;  2VTF A;  3MW3 A;  5ABJ B;  1SLB A;  4JHZ A;  1RUI 3;  4XET A;  3U1X A;  3WP4 A;  1ZBA 3;  4LUL A;  5FZL A;  3ASI A;  3H7J A;  1SLI A;  1U0A A;  2DBI A;  4FPC A;  4OUE A;  2Y60 A;  4YYO A;  3AC0 A;  4PLO A;  4CUA A;  1TQ5 A;  2PN5 A;  2FCU A;  4E4D X;  4F83 A;  4FTB A;  1VBE 3;  1QH7 A;  4AI1 A;  3JCI A;  1COV 3;  3RWK X;  2ARC A;  4F8A A;  1TMF 2;  5C4W C;  2DUQ A;  1KIT A;  2GMP A;  1HN0 A;  2ZZQ A;  4FT8 A;  5DZG A;  2CDP A;  5FOB B;  5IVF A;  4I30 A;  3WD5 A;  1OC1 A;  4X8N A;  4AHZ A;  2XPJ A;  1PNG A;  2YGL A;  2NYY A;  5A7O A;  3O1R A;  3N9O A;  4RR3 C;  1RUJ 1;  3VKO A;  1TME 2;  1HV0 A;  1WBF A;  5K0U C;  3FHI B;  1BK0 A;  1OT5 A;  5LEK A;  3OUI A;  2CGO A;  3RS6 A;  3ELN A;  3HQR A;  3RZH A;  5JOX A;  1RJ8 A;  3O0X A;  3OYW B;  2ZAA A;  1V00 A;  2VU9 A;  2YMZ A;  4IEU A;  4XUT A;  1L3J A;  5T5L A;  4AI8 A;  3OJB A;  4QU1 A;  4XBN A;  5JPN B;  4J1X A;  4WZC A;  4Y5T A;  2NQY A;  4CCE A;  2WN3 A;  1QIQ A;  3O0V A;  5CIS A;  2TUN A;  5HI0 A;  3ZFF B;  3VZK A;  2NN8 A;  3TYJ A;  5C71 A;  5LBC A;  4CE8 A;  1ALY A;  4H3W A;  1NZC A;  3E5Q A;  5CG9 A;  2D5H A;  4D69 A;  1N3O A;  4XYX A;  2XWJ B;  4AGR A;  2I07 B;  2V09 A;  5IAX A;  3LPG A;  2PHR A;  1CAV A;  4IEY A;  5FFO C;  1VRB A;  5DZE A;  5I8T A;  3EQE A;  2WKK A;  4NWV A;  3AYE A;  4HKW A;  1LED A;  1DQ0 A;  1RMU 1;  1QU0 A;  2O1Q A;  5CFD C;  3OGS A;  2B45 X;  1GQP A;  1ZNP A;  1SPP B;  2RS5 1;  3PUH A;  4LBJ A;  1QOT A;  5FZM A;  5JOY A;  1ENR A;  1NX9 A;  3M1H A;  4JRA A;  1ZZB A;  2BGP A;  1H2K A;  2XVK A;  3N3H A;  4I09 A;  4R9D A;  1K42 A;  3POG A;  4EWA A;  2QQL A;  2R04 3;  4YGB A;  2GC0 A;  5LA9 A;  3MUZ 1;  3UJQ A;  2C5D A;  4LO5 B;  4YPJ A;  5K7P A;  4E27 A;  4LQR A;  1NE6 A;  2DDU A;  2NM1 A;  4AAP A;  5C33 A;  4LLF A;  1W9Y A;  4R8H A;  4E2G A;  3VBU B;  4CU6 A;  4F3J A;  5T5O A;  3VD7 A;  1YJK A;  4P08 A;  2WZR 1;  3RQ0 A;  5C3S A;  3WQB A;  4D7S A;  3LCP A;  1OLR A;  2IFR A;  5A70 A;  2EXH A;  4KG8 A;  4QX5 A;  5LA2 A;  3RMY A;  5A1F A;  1CX4 A;  5J09 A;  1W9F A;  2HWE 2;  4L92 A;  3HOB A;  4NR1 A;  1Q5O A;  3WNP A;  1CPM A;  3AP6 A;  3BTY A;  1PMI A;  3IDB B;  1IKQ A;  1GSL A;  1COV 1;  2H0V A;  4K21 A;  3RGB A;  3RZJ A;  2KXL A;  2OZJ A;  2WQ8 A;  3JU9 A;  4B4P A;  2Y0O A;  2Z2S B;  3I2G A;  1GBG A;  2VBP A;  3NV1 A;  1UY0 A;  2B39 A;  4LBM A;  3VD5 A;  1FI2 A;  1E5I A;  3VZM A;  3FLR A;  3M3E A;  3WF2 A;  3BUC A;  1JYI A;  1OUX A;  1XNK A;  1YC6 1;  4Q4V 1;  4XTP A;  4XUQ A;  1MS5 A;  3ZPY A;  1OF4 A;  1AL0 G;  4XVH A;  4YSF A;  2W0X A;  3MIC A;  1GU3 A;  3SXW A;  1YI9 A;  2YBS A;  2ZTN A;  1QGL A;  1F2N A;  1W6M A;  5FZ7 A;  1I9R A;  5GZF A;  1Z7S 1;  2IUW A;  5J98 B;  5BNN B;  1RHI 3;  4Y33 A;  1D4V B;  3OD0 A;  3NO8 A;  1RHI 1;  1VBA 2;  3OB8 A;  1NZI A;  4IV1 A;  1RGS A;  3KGZ A;  5G05 L;  4QDS A;  4EE2 A;  1PZ7 A;  4KBZ A;  4AW7 A;  3IN9 A;  2ZKL A;  1EV1 2;  5FKB A;  1AL2 1;  1DQ4 A;  4G9S B;  2P1B A;  4QXK A;  1S2B A;  1RTV A;  1CIW A;  3KVB A;  4K1Z A;  4Y3O A;  3LEG A;  3AK0 A;  2GC1 A;  4MXW A;  5FP8 A;  5C70 A;  1XND A;  5ANQ A;  4TZD A;  3U37 A;  2QQO A;  4YM3 A;  2AEZ A;  3IAQ A;  3DF0 A;  5FYS A;  5FY5 A;  3VBU C;  4CXX A;  3C7H A;  4QQ2 A;  2XJT A;  5FZ6 A;  1BEV 1;  2JEM A;  4LA3 A;  1H4G A;  2W1S A;  1W8U A;  1EP0 A;  2W1U A;  3SH5 A;  1WW4 A;  4A7K A;  4Z2W A;  1O3R A;  4ZZ5 A;  5KHG A;  1Y9G A;  2C9K A;  1VBD 1;  2JG8 B;  4BMB A;  5JI9 A;  1HRV 1;  3WNM A;  4KWK A;  4D6Q A;  1MEC 2;  4JV4 A;  2Q1M A;  2RE9 A;  4IGO A;  4M4P A;  3J7N A;  3JD7 1;  4FXG B;  3MPP G;  4PBO A;  1PX3 A;  2CHH A;  3BIE A;  1MS8 A;  1R09 2;  3ME2 A;  2VQU A;  1JW6 A;  4DNY A;  5J3U A;  4XXA A;  3USU A;  2DCZ A;  4Q2F A;  5H9S A;  2BOI A;  3MIE A;  3V56 A;  1JOB A;  2P2K A;  4MGS A;  1QJX 2;  4H7M A;  3UT0 A;  1BVP 1;  5C5T A;  4W6Y A;  4NAO A;  3W21 A;  2DF7 A;  2XBO 2;  3LD8 A;  1UZZ A;  5E1R A;  4CEW A;  4AAX A;  4AI3 A;  3BU0 A;  4DY3 A;  3LOB A;  2VMI A;  4CDX C;  4C90 A;  3S5A A;  5FYC A;  2P6C A;  3R6S A;  5A7N A;  2Y6G A;  1LOF A;  1WA4 A;  1R09 3;  2PAK A;  1C3H A;  3AKS A;  3AP4 A;  4QB1 A;  5BNP C;  1VMF A;  2IWG B;  4XTM A;  1GMM A;  1ZA7 A;  2PLV 1;  2WWJ A;  2LTN A;  3B94 A;  4YM1 A;  5LBE A;  5BY5 A;  2XJP A;  4MGI E;  3L2H A;  1YCI A;  3H8U A;  1AUY A;  3K4D A;  2IXH A;  3M3C A;  3VUO A;  2OPW A;  3Q8E A;  4Y1X A;  2BNM A;  1YEW A;  3VBO A;  1W39 A;  4UAP A;  2BBA A;  3W5M A;  2Q8E A;  3D4K A;  4HN0 A;  1QOS A;  4XUR A;  3UV9 A;  4A3Z A;  2D6L X;  4KU8 A;  4W50 A;  2WZE A;  1CZV A;  3H8R A;  2ZBJ A;  3ZMO A;  4COY A;  2WFP A;  1X50 A;  4CSW A;  1K5M C;  2J1U A;  4QPY A;  3VBS C;  3BOD A;  4EZH A;  3I54 A;  1H6X A;  1UNB A;  3VKN A;  4BQY A;  1KS4 A;  2WWS A;  4AWD A;  4UYB A;  4IGP A;  3U10 A;  4CUG A;  2OW4 A;  1EAH 1;  1DYO A;  1WMD A;  2JIJ A;  2VPV A;  3WG2 A;  3ZFE C;  4FPE A;  2BDR A;  3OEB A;  3WF3 A;  1V6L A;  2CU5 A;  2ET7 A;  4EV0 A;  1RUJ 3;  1HIX A;  2VZS A;  4BQ4 A;  1QJF A;  5K4L A;  1NA1 C;  2XUE A;  3UKT A;  1NKG A;  2YBP A;  1J59 A;  5BPX A;  4ERO A;  2IXI A;  2YBK A;  1O7F A;  3N35 A;  1DZT A;  2DCT A;  3TNP B;  3JBG 2;  4DEQ A;  3M4F A;  3C7G A;  4CDW C;  5BXX A;  5LZ6 A;  1DGW A;  3T30 A;  4ORF A;  1LR5 A;  2EIC A;  3ZSJ A;  4LHS A;  3ZN4 A;  3VDC A;  1L7R A;  2ZEY A;  1IS5 A;  3KSC A;  3WR0 A;  4YZ5 A;  1G7Y A;  4AL9 A;  1JZ2 A;  2WRA A;  5F6K A;  5ACA 3;  1HRV 2;  3R4D B;  1O6U A;  3FZ3 A;  4DPN A;  3NQH A;  2ZXQ A;  4I02 A;  5I91 A;  4P5Y A;  1VLN A;  4YZ3 A;  4I0B A;  3ZKY A;  3C7E A;  4ATF A;  2GN3 A;  5DG1 A;  2XKP A;  4DB5 A;  3HQX A;  1VBB 3;  2CSG A;  4DZG A;  1CVN A;  5IVY A;  1O5U A;  1FOD 3;  3ACH A;  3R4S A;  3W5N A;  1URX A;  1C5H A;  1NCR B;  2OZ6 A;  4ZS2 A;  1ZRD A;  5FYU A;  4PQQ A;  4KU7 A;  3WDY A;  4OHW A;  1CGP A;  1JN2 P;  3VB9 A;  2O14 A;  4HT1 T;  4CDU A;  2VVD A;  1AX2 A;  2WYS A;  4E8D A;  1UYY A;  3MIH A;  2V4A A;  3MGU A;  3E6B A;  2XON A;  4UW5 A;  4C91 A;  4OCT A;  4JHT A;  2DUP A;  2K2S A;  1RED A;  1VAL A;  1XE7 A;  4KMQ A;  1H8T A;  2PYT A;  1JYW A;  4AFD A;  2QVS B;  4IE6 A;  4QGL A;  3K2O A;  3LDK A;  3FFQ A;  3FHA A;  4Q29 A;  4IL7 A;  5IWF A;  3WUD A;  4LMF A;  2QZ3 A;  3LDR A;  2RDQ A;  4JAA A;  5F2S A;  2B42 B;  2RS5 3;  5D1I A;  3PUI A;  3CLP A;  4GH4 A;  5TSW A;  4MHU A;  4LBK A;  1HW5 A;  2FDF A;  1LU2 A;  3POF A;  3VL8 A;  3VKF C;  1CWP A;  3FUQ A;  3IZO A;  3N7J A;  2VXJ A;  3JB8 A;  1DIW A;  3AMH A;  4P9X A;  1EUU A;  5FZ8 A;  1QH6 A;  4HK8 A;  4LK7 A;  4CEY B;  3PJY A;  1M06 G;  2IXL A;  2VJX A;  1BMV 2;  1WW6 A;  3UKN A;  4FTE A;  4CU7 A;  3HT2 A;  3N9L A;  5EZW A;  4AED B;  4CCK A;  2VM9 A;  2A6V A;  4BJ0 A;  2CWM A;  3I2J A;  5IK7 A;  1LOA A;  3VBH C;  4DXZ A;  4XDP A;  5FKC A;  4V2V A;  2VE1 A;  3I4I A;  3K3N A;  2E7A A;  4O9G A;  2VOT A;  2E26 A;  4IND A;  5GLT A;  3WY6 A;  2WQ4 A;  1GOF A;  4MXW B;  3OOX A;  5GM0 A;  1CAW A;  2OPK A;  2J22 A;  4NJ4 A;  5FMO L;  3H3Z A;  3ZXK A;  1NE4 A;  5LA0 A;  2GND A;  4YWA A;  3MFC A;  4YNI A;  2A1X A;  3ILF A;  4WVW A;  3RG0 A;  3PNA A;  1JYT A;  2W68 A;  3PU3 A;  3PIJ A;  3SEE A;  4ZU5 A;  4A44 A;  1JHJ A;  3UGG A;  1QHD A;  1O4T A;  5FY8 A;  3U4X A;  1SCR A;  3QH6 A;  1QXJ A;  3IDE A;  1PO2 3;  3PU8 A;  2PQQ A;  1I1E A;  2W39 A;  1J3Q A;  3GYD A;  3IBM A;  1OOP C;  1ULO A;  1YFU A;  1S0E A;  4KQ7 A;  2FZ2 A;  2XJQ A;  4EN9 B;  1NOV A;  4EYU A;  1RB8 G;  1CAU B;  1V6I A;  4B1M A;  2VME A;  4NPR A;  4HVR A;  4XJ8 A;  1PK6 C;  3FMG A;  1CR7 A;  4LK6 A;  3P3P A;  2J7M A;  3I3Q A;  4DUW A;  5FZ0 A;  1Q43 A;  4Q4X 2;  3FE5 A;  3FJS A;  5LCW L;  2MHF A;  3DPR C;  3N36 A;  1LAJ A;  2FDK A;  5AFE A;  2MEV 1;  4NRP A;  2PLV 3;  1YI7 A;  1YIF A;  2HBT A;  4H7L A;  4BIF A;  4YVS A;  3MW2 A;  1PIV 3;  2P37 A;  3KT4 A;  3LZZ A;  1ACC A;  2RS3 1;  4LUM A;  5CG8 A;  3FWE A;  1FT9 A;  4YGD A;  4HK9 A;  1UKR A;  2VQ0 A;  2GNM A;  2CTV A;  1D4M 1;  1YWK A;  5I8S A;  1LUL A;  4JGY A;  4AED C;  2RMU 3;  1RUD 2;  5EV7 A;  3VBF B;  1FOD 2;  1AR8 1;  5FYH A;  2Q8O A;  4CEW B;  4ISR A;  5CYY A;  3WLU A;  2ORX A;  3FLT A;  3GZE A;  4Q5O A;  4F7Z A;  4CEY A;  2RJL A;  3DL3 A;  4YAR A;  1KFU L;  4JQT A;  2JG8 C;  2YGM A;  1RXF A;  4GWM A;  3JD7 3;  2VZP A;  2E53 A;  2RR1 2;  2ZAH A;  4A6S A;  4BYY A;  2C26 A;  3WW3 A;  4N7U A;  3D8C A;  4WZF A;  4XE9 A;  4MVT A;  4YM0 A;  4RL7 A;  1OH3 A;  2X8K A;  3GBW A;  5SV8 A;  1HRI 1;  4FP3 A;  3RJR A;  4IE7 A;  5F3G A;  4ZU7 A;  2EIE A;  1A78 A;  2ZOE B;  3N9P A;  1R1A 2;  2HWF 3;  3THD A;  1U5Y A;  1JHN A;  1N1V A;  2UWA A;  5L73 A;  2PAE A;  5CNA A;  2FD8 A;  5A32 B;  1DCS A;  1GNH A;  1S0F A;  1HB1 A;  2DVG A;  1LTE A;  5CKM A;  3KZ4 C;  4CDU B;  3WHT A;  1MVE A;  5FZA A;  1IG3 A;  5HCB A;  1AX0 A;  3J8F 1;  2PMW B;  3MLL A;  1UYZ A;  5J96 B;  1JBC A;  1S0C A;  1FXZ A;  4HZF A;  5LA1 A;  4LHK A;  4JRL A;  1LGB A;  2HEV F;  2JDH A;  2PXJ A;  4E8C A;  5AC9 3;  1W6Q B;  3AMQ A;  4GH4 B;  1RUF 3;  3AMP A;  4EN0 A;  5I0D A;  1CX1 A;  4XF3 A;  1ULG A;  2OS2 A;  3WG3 A;  5AVA A;  1HXS 2;  1ZVF A;  5DAW A;  3RNS A;  1DQ5 A;  5FZF A;  4FO9 A;  3WW1 A;  3NL1 A;  3SH4 A;  4EZ4 A;  5KHI A;  1VRH 3;  1WD4 A;  3KT1 A;  3O5S A;  2FDG A;  3ZYH A;  4MH0 E;  4PF1 A;  5FAX A;  3DPR A;  3ZYJ B;  3TEW A;  1F4A A;  1B09 A;  5D2A A;  2E7T A;  1EUT A;  2FMY A;  2R1B A;  2VZR A;  4QKF A;  3IAP A;  4Q4W 2;  2CYF A;  2C9A A;  5CA6 A;  2BVB A;  4XQW A;  1E5R A;  1ND3 C;  4FQZ A;  2R06 1;  2BV4 A;  1RUG 3;  1WKY A;  4UWD A;  2Y8K A;  4LE4 A;  4Z2A A;  2JB4 A;  4X6Q B;  4ZHN A;  4QT6 A;  4S2H A;  3ZOI A;  2FHR A;  3POW A;  3GDB A;  5IT6 A;  2HEY F;  3CNA A;  3GZT B;  4JQR A;  3NWK A;  3HNM A;  4LXL A;  1TNR A;  2LAL A;  4Q0P A;  3IT8 A;  5JI7 A;  2ES3 A;  3WG4 A;  2J1V A;  5LB6 A;  1VP6 A;  1ENQ A;  3MIB A;  2SLI A;  3U07 A;  4CCM A;  3PME A;  4AR2 A;  2WT0 A;  3CZU A;  3H9A A;  3VBH A;  1J3P A;  3K4A A;  1UKG A;  5FZ4 A;  1OPO A;  1G9F A;  4Z92 B;  2VR4 A;  3AKQ A;  5F9T A;  3ZR5 A;  2A6W A;  4AQ6 A;  2IFW A;  4GMP 0;  5DQ0 A;  2ZGO A;  3D0S A;  1PGW 2;  2WBK A;  4ATE A;  4B1L A;  4CPB D;  2ZMN A;  2WAA A;  1PO2 1;  3IMM A;  1AYN 2;  1HJG A;  3RMX A;  3GCX A;  4AFM A;  3THC A;  1Z78 A;  2JKB A;  1ULP A;  3PTR B;  2WFF 1;  1RMU 3;  4GB3 1;  4GXL A;  2JD4 A;  3AVR A;  5DAP A;  1YFX A;  1SAC A;  3WNX A;  5KC5 A;  3FBM A;  3I97 A;  2P3Y A;  4B7K A;  1KDM A;  1XU2 A;  2GAU A;  2BRT A;  2WA4 A;  4MGZ E;  4YGC A;  3WP5 A;  2WSU A;  5D8A A;  4Q1P A;  3CO2 A;  3KCX A;  5F5C A;  4N8M A;  3MF6 A;  1DGL A;  2VCM A;  3WW2 A;  2ADE A;  4EQV A;  5HCF A;  2PHL A;  2RJK A;  1W8F A;  3M2M A;  2QKD A;  3ZKU A;  1OA2 A;  5FZC A;  2W94 A;  3OGR A;  2XVL A;  1W8H A;  1O91 A;  2ARB A;  3IMN A;  3MDP A;  3ZSK A;  4JX0 A;  1XNA A;  4A2U A;  4XJA A;  1AR9 2;  1NAE A;  2YU2 A;  5FO7 B;  3WIN E;  4CDQ A;  4FPH A;  4LKD A;  4W4Z A;  2RR1 3;  3O12 A;  2JE9 A;  1W8Z A;  1GWL A;  5CFD A;  4HLT A;  1UYP A;  3TAY A;  3KWV A;  2BZD A;  3WQ1 A;  1LOF C;  3U0Z A;  3AP5 A;  4EWE A;  3AZW A;  4QKD A;  3T2T A;  5L36 A;  3WDV A;  3H8O A;  1NY7 2;  2WQZ C;  3POJ A;  4Y1V A;  2ARA A;  4IES A;  1XB9 A;  3WCS A;  1DG6 A;  1Y3T A;  2BW8 A;  1H2L A;  1DZR A;  5A80 A;  1ZRE A;  4LIT A;  2DCK A;  5FXV A;  5FPA A;  4P9G A;  2WR9 A;  1KEX A;  4UFI A;  3A21 A;  3CIH A;  3L2Y A;  1PMJ X;  4CYD A;  3BI3 A;  4FPO B;  2VG9 A;  1K5M B;  3AYA A;  3MUY 1;  3T1M A;  2QFE A;  5FLJ A;  1W6P B;  1EPZ A;  1R08 1;  4OI1 A;  3RDI A;  2YPD A;  1JZ6 A;  3NV2 A;  1BYH A;  4FOY A;  3P1I A;  4P9I A;  1PVC 3;  4OUS A;  1N1T A;  1ULC A;  1TG7 A;  2DYC A;  2A70 A;  2JDA A;  3ACG A;  3LGR A;  3W9A A;  4AGG A;  1X9T A;  5BNO B;  1HQW A;  2J1A A;  3J4U H;  1MS3 A;  4HBN A;  4JDO A;  4LTA A;  1IHM A;  2PAM A;  5FBZ A;  1VAV A;  1NA1 A;  4CP1 A;  4IV1 B;  1OA4 A;  3U78 A;  5ABJ A;  3S57 A;  1N3Q A;  2UY8 A;  5BNN A;  4I2O A;  4IXL A;  4NID A;  3VGI A;  4AVC A;  5BNO C;  1RUO A;  2WJS A;  1FV3 A;  1W6M B;  2R07 3;  2VZQ A;  2WC2 A;  3HEI A;  2B5H A;  1RUG 2;  1VIW B;  2GAL A;  2LRO A;  2Y6L A;  3SIS A;  3I3B A;  5L9B A;  1PGL 1;  5JZG B;  4BDV B;  5A3U A;  1RVF 2;  4Q4Y 2;  2WNO A;  2RM2 2;  3UJO A;  2L9L A;  1HX6 A;  1WW5 A;  2VC9 A;  3MIG A;  5HCH A;  5FMC A;  3SMH A;  3OD4 A;  1LOD A;  1RUF 1;  1F5F A;  3LQC A;  3T0D A;  2VZV A;  2WO2 A;  2VQA A;  4KWJ A;  4PBP A;  1ASJ 1;  4QXH A;  4XBQ A;  1XYP A;  4GB3 2;  2W87 A;  5F39 A;  5FBJ A;  1QF3 A;  1HB4 A;  4XOG A;  2NMN A;  2VCB A;  5I0T A;  1AZD A;  1US3 A;  2BTV C;  1POV 1;  4XIL A;  4X8P A;  5A6Q A;  4OZO A;  4RGA A;  1GZW B;  4PDW B;  1W99 A;  2RM2 3;  4M3C F;  3ACL A;  5E6H A;  3ZDV A;  4GAL A;  2C4X A;  1EV1 3;  1D0H A;  1DQ1 A;  1SG3 A;  3OBT A;  5JZG C;  3NV4 A;  4UFL A;  3LPF A;  1MQT A;  4K9S A;  5FQ0 A;  1AYN 3;  2HWD 2;  3WZ1 A;  2ERF A;  2JDY A;  1QXP A;  5HXV A;  4XFG A;  1WLD A;  1GZT A;  4QXC A;  2ZPX A;  3S7I A;  1RMU 2;  1AYM 1;  3RVH A;  3OPW A;  5FYT A;  1ZBE 1;  3ZDS A;  1OOP A;  3BOP A;  4W8J A;  1GAN A;  4XDQ A;  1R1A 1;  1X33 A;  2PTM A;  5CBL A;  5I0U A;  2EA7 A;  3RZZ A;  5CKQ A;  1GP4 A;  1ND2 C;  2VMD A;  4BQ5 A;  2QUO A;  1YQ6 A;  3III A;  1T6B X;  1BK1 A;  1ZZ7 A;  2IXJ A;  5GLW A;  4HSJ A;  2R07 1;  1J1L A;  4CDW A;  2WZP P;  2OT7 A;  5T5J A;  3KD4 A;  1V6M A;  3URF A;  4XDO A;  3KHC A;  4HPK B;  3RZG A;  1XSQ A;  5FZ1 A;  5I93 A;  4LOS A;  4DXS A;  1SFN A;  1KS5 A;  3AP9 A;  5EXO A;  4AI2 A;  3POS A;  2OA2 A;  4N9I A;  3VBR C;  2VTX J;  2VOX A;  3FL7 A;  5F3I A;  2R0H A;  4M4R A;  4UOJ A;  1UAI A;  5HV0 A;  5E16 A;  5FUI A;  5FWE A;  4DUV A;  1HXS 1;  2W3J A;  3CU7 A;  1UF2 C;  4B8E A;  5A7P A;  4XUO A;  1OQE A;  4HSL A;  3O1M A;  2VNO A;  3USS A;  2HWC 1;  5FDB A;  3JQW A;  1G8W A;  5AFB A;  3VZN A;  3BTA A;  3FLP A;  3KT7 A;  3OTF A;  4CP2 A;  3ACI A;  4OZX A;  1WZX A;  5CFC A;  1FOD 1;  1XBF A;  2JD9 A;  4GQ7 A;  3T4V A;  3WP6 A;  4EWD A;  3ACF A;  4IUG A;  4BLJ A;  4OHV A;  1GR3 A;  2YZ4 A;  5LBF A;  1AYM 3;  5DAB A;  2QJV A;  3UKV A;  1XNB A;  2SBA A;  2Y33 A;  5CFD B;  3V0A A;  1JXN A;  1YO8 A;  2R7E B;  3K75 B;  4YG3 A;  4HAN A;  1RIR A;  4CDQ B;  3VZO A;  1I6X A;  5FMB A;  1W2O A;  3ST7 A;  1N1S A;  1BEV 3;  2FCV A;  1OUS A;  1PK6 A;  5EIY B;  5A6X A;  1AR7 1;  3NJZ A;  2RG4 A;  1RUC 2;  1ENX A;  3K46 A;  3PMS A;  5L7O A;  2VW1 A;  4CEW C;  5D8A B;  2BGC A;  3GXU A;  3OBZ A;  3WVJ A;  4XW3 A;  2HH9 A;  2Y26 A;  5FY7 A;  2HKX A;  4A4A A;  2HWD 1;  4DIQ A;  3PHM A;  3VDD A;  4FPG A;  2E63 A;  5IYY A;  1AR7 3;  1PO2 2;  5EPA A;  3OYW A;  5CZK A;  3VZL A;  4A7Y A;  1NCQ B;  1CAW B;  1FMD 1;  1XSR A;  1Z7S 2;  2J1S A;  3D0J A;  3MO4 A;  1UL9 A;  2R16 A;  4JKL A;  1HLC A;  1R1Z A;  2EIB A;  1ZZ6 A;  1YJL A;  4FI9 A;  4Z82 A;  5DAX A;  2JDM A;  4CP0 A;  2P3K A;  4ES8 A;  4NIA A;  3SC7 X;  2XLF A;  4GD4 A;  4IEZ A;  2QE3 A;  3T4H B;  1S0I A;  2VOW A;  2YU1 A;  4OI4 A;  4XF0 A;  4Q8K A;  2BVV A;  4QDR A;  4HPK A;  4FFH A;  3FC0 A;  2B8M A;  2FMD A;  1PVC 1;  1Z0H A;  3NAP B;  4IW3 A;  2A71 A;  2IVJ A;  3CJI C;  5DUV A;  1SZB A;  1COV 2;  5F2W A;  1AR6 3;  3WQ7 A;  1ZZ8 A;  4KWL A;  1QDO A;  3DEM A;  2XQR A;  4G4F A;  5FZB A;  5DDJ 3;  4IV3 A;  4URA A;  2WWU A;  3AKT A;  4IE4 A;  3VBS A;  5FOJ B;  5JR7 B;  4EN8 B;  4AQ2 A;  5LRR A;  4TTG A;  4Y20 B;  1OD3 A;  3VBU A;  2QCS B;  3M3O A;  3IM0 A;  4QXB A;  2TBV A;  1UY4 A;  2RS1 2;  4HFS A;  4MOA A;  4XBL A;  5FUN A;  4C1X A;  1W6P A;  2PLV 2;  3IIA A;  4XIO A;  3UET A;  1JZ4 A;  1KD7 A;  4N90 A;  4YVS C;  1CQ9 A;  1ZRR A;  3LWC A;  1UD1 A;  1RUH 1;  3T0B A;  1OLM A;  1O8S A;  1MQT B;  3BYW A;  5GAL A;  5DDJ 2;  2Q8D A;  2ENR A;  5BUV A;  3O1S A;  4NRQ A;  5DN2 A;  5IVC A;  4HET A;  4GAZ A;  4P9L A;  2HEW F;  1QJX 1;  1HQL A;  1F8V A;  1AXY A;  2VNV A;  3JXS A;  3PVO A;  2VEC A;  1NYW A;  3AMM A;  4K40 A;  5FP3 A;  2CGP A;  1LOG A;  3OUH A;  3RZK A;  1HRV 3;  1AHS A;  4BU2 A;  4YM2 A;  2VTX A;  3WNK A;  1V9U 2;  3TOJ A;  4WM8 A;  1SFY A;  1W6Q A;  2GNB A;  2HWF 2;  3KS7 A;  3KV5 A;  3ZFF C;  4AOC A;  3K3O A;  1GFF 2;  1XNT A;  5DUX A;  1EAH 2;  3ZIX A;  1V0A A;  2D3R A;  1E5S A;  1V70 A;  3QLQ A;  2YYO A;  2KM2 A;  1YHF A;  2WYF A;  4WM7 A;  4CP9 A;  1W2N A;  4LHN A;  2GH8 A;  2ZEW A;  3KLS A;  4YG6 A;  1PGL 2;  1W8N A;  1RVF 1;  4Q4Y 1;  1H1A A;  2A73 B;  2Y38 A;  5T52 A;  2AAC A;  5KBF A;  1LJ7 A;  2O8Q A;  2A3X A;  1K3I A;  5M0T A;  3X29 B;  1RUF 2;  1UU6 A;  3OUJ A;  3I2O A;  4PDW C;  1KGY A;  1YNA A;  2JDU A;  3MV0 1;  4UI9 L;  4YVW C;  1PGS A;  5FXW A;  3ZFG A;  4XHB A;  1O3Q A;  1C5I A;  4LO7 A;  2F4P A;  4SLI A;  3L9J T;  2XL9 A;  1LNS A;  3VBR B;  3QAC A;  2XBO 3;  2Y6K A;  4UXA A;  2XML A;  4UW4 A;  1QJY 3;  3O1V A;  1V6N A;  4YW4 A;  1K5M A;  4AQT A;  2ZX0 A;  4RQP A;  5F5A A;  3RFR A;  1UY1 A;  4LA2 A;  1U12 A;  4RS5 B;  5F6L B;  4BME A;  4CTE A;  5JR2 A;  2RV9 A;  5FTT C;  3WDT A;  3NNG A;  2Q30 A;  2X05 A;  4ASL A;  2I74 A;  1WCK A;  4ZXE A;  4OUM A;  4XJW A;  4HKL A;  3VBH B;  4BXF A;  1VAM A;  4XC9 A;  4E4Z A;  4BK4 A;  3KHB A;  2VL4 A;  5C3Q A;  1B35 A;  2ZZJ A;  1UZ0 A;  4LR4 A;  1YIP A;  3ZN6 B;  3KVA A;  2E6V A;  2LS6 A;  4YW6 A;  4D3W A;  2VBD A;  4N43 B;  4TYS A;  3VLB B;  4BQ2 A;  2OX0 A;  3M8L A;  3TNQ A;  1SLT A;  4CCC A;  1UWW A;  5IVV A;  4OI2 A;  4MGT A;  4NRM A;  1GUI A;  5F8P A;  1LEN A;  4QPI A;  2KR2 A;  1APN A;  5JXG A;  3KF3 A;  1REE A;  4RHV 1;  4YVW A;  1NLR A;  4R9B A;  4XFC A;  2VOV A;  4CDX A;  4BQ1 A;  3GGL A;  1WLW A;  4XFF A;  2R07 2;  1YQ8 A;  3WW4 A;  3OPT A;  4XJU A;  1RUI 2;  5FZE A;  1QWR A;  1BZW A;  1GNZ A;  1RUD 3;  4LIU A;  4XAC A;  5LAT A;  2A7A A;  1OFS A;  2W92 A;  4W65 A;  4CCD A;  1ODN A;  2VVF A;  2XB6 C;  4QMA A;  2FDI A;  2V5D A;  3KV4 A;  1PM7 A;  3F95 A;  4YW7 A;  4AVV A;  5F3C A;  2WLQ A;  3RJ2 X;  4XFB A;  5C4W A;  4A7Z A;  4N53 A;  4FAH A;  1KJL A;  4KI5 M;  2ETE A;  2YY1 A;  3K77 A;  4W6W A;  4S2F A;  4XZP A;  3Q8B A;  1OKO A;  1X7N A;  1NLQ A;  1BXH A;  2CV6 A;  1SQ4 A;  1G9B A;  2JG8 A;  1UZW A;  4P02 B;  1MQT C;  3WT3 A;  3GJA A;  4BIS A;  4GZ9 A;  1ZM1 A;  4M3C B;  3VD9 A;  1XQN A;  4OVE A;  2GH2 A;  4WVM B;  3H0O A;  5EP9 A;  2ZGS A;  1GIC A;  3H1M A;  4UFM A;  3AL5 A;  4D6S A;  1D2S A;  1V6K A;  2A3Y A;  3V65 A;  1W6N B;  1H0B A;  4D94 A;  3OGG A;  4XF9 A;  3EXU A;  3K4Z A;  3SEP A;  2D3P A;  4JGY C;  4AED A;  5E88 A;  5C3R A;  1OQ1 A;  2WNE A;  1PZ8 A;  3HMY A;  5B4N A;  4EN6 B;  1AYM 2;  4LE3 A;  4H2A A;  4H14 A;  4UF0 B;  3DKQ A;  4DRR A;  1P8J A;  3USU B;  1S55 A;  4QX7 A;  1BLZ A;  3I59 A;  1RUH 3;  2X5I C;  3G6J B;  1H1M A;  2UYA A;  1JOD A;  3MI8 A;  2WO7 A;  3B00 A;  1KJR A;  3R0R A;  3ITQ A;  4FP2 A;  3LB9 A;  5DUW A;  4PIZ A;  2W9X A;  1LOB A;  2RHP A;  3MLK A;  1I5Z A;  2BOJ A;  2DVD A;  2BER A;  3FX3 A;  1RUE 1;  4S2G A;  1OQD A;  4HOO A;  4YFW A;  5IVB A;  3LEM A;  2Z69 A;  3ZN5 A;  3CL1 A;  2ZAC A;  2EIG A;  2ZGT A;  3B02 A;  1W6N A;  2R6Q A;  4KWU A;  2RS3 2;  5D21 A;  5FLI A;  1JI6 A;  4A41 A;  2YDE A;  1IS6 A;  5IVE A;  2ZGL A;  4TXW A;  3PL0 A;  1QY4 A;  2PA7 A;  2ZJC A;  5H9Q A;  1BVV A;  5IK8 A;  2BGO A;  2ADD A;  4TLG A;  4Z07 A;  2HYX A;  1W9T A;  2G1M A;  2NPI A;  2ZKN A;  5LK7 B;  1IQD C;  2Y0I A;  1OSG A;  4LKF A;  2YPJ A;  4ZPI A;  2EXI A;  3BN6 A;  3GF6 A;  4K1Y A;  4OYU A;  4ZKT B;  2HWC 2;  4XAA A;  4Q0U A;  2ZGQ A;  2DVB A;  1GQG A;  1G86 A;  2QDN A;  2ZEZ A;  4LJH A;  4WV8 A;  2CGN A;  1VBB 1;  1PO1 2;  2GNT A;  3ETQ A;  5LW9 A;  3O7O A;  3UES A;  4MGQ A;  4FBF A;  2H6B A;  1W3X A;  1TME 1;  4DUX A;  3ZSL A;  1OFN A;  1STM A;  3I2K A;  3VHR A;  2VZ1 A;  4RYD A;  4UBH A;  4XF4 A;  4I3P A;  1NXD 1;  4GJZ A;  3U4S A;  5CIR A;  3SHR A;  2P4E A;  1N47 A;  3LEI A;  5DAQ A;  2VW2 A;  4LO8 A;  1OH4 A;  4C8D A;  1GWK A;  1K5J A;  3B3Q E;  3J7M A;  3MW4 A;  1SLL A;  2PHD A;  1D4M 2;  2A75 A;  3ZXL A;  1XPW A;  2RVA A;  3GHN A;  3KV9 A;  3LA2 A;  3OEA A;  4FPL A;  5A3P A;  3FN9 A;  3RZM A;  4L11 A;  4JGZ A;  1SPP A;  1AR7 2;  5A3N A;  1RUC 1;  4NPM A;  5DZF A;  3POI A;  2WO3 A;  1V6O A;  2WAO A;  1EPW A;  3PTY A;  5JXH A;  2D5F A;  3MLJ A;  1X36 A;  1CJP A;  3QOP A;  2VZT A;  1QQP 3;  4H55 A;  1V9U 1;  4FPJ A;  3CF6 E;  4DXR A;  5IVJ A;  3NAP C;  4GMP 1;  2X09 A;  1C57 A;  1JOP A;  1H8T C;  2W2I A;  1MS4 A;  1FNY A;  4QHZ A;  4IEW A;  1EV1 1;  5E8A A;  1VJ2 A;  3BKZ A;  3ES4 A;  5EJ3 A;  4XPV A;  3BTX A;  2TNF A;  1YXW A;  5BNP B;  5A1A A;  2QTW B;  1LB2 A;  4Q8L A;  3HNY M;  3UGH A;  2K0G A;  1GYK A;  2JX9 A;  2WZ8 A;  3MZH A;  4X6R B;  3ZSM A;  4E2Q A;  5K8S A;  3Q9O A;  2OUH A;  2JB8 A;  5JIA A;  1MPX A;  3R4U A;  2O8O A;  4QPG A;  2A3W A;  1J84 A;  4WVV A;  3SNM A;  1RUN A;  1RUD 1;  2DCJ A;  1REF A;  1AR8 2;  3HVD A;  4HN1 A;  4JTN A;  4IET A;  2XLG A;  2F6B A;  4Q4W 1;  1RUE 2;  3QD6 A;  1RIT A;  4AG4 A;  3MBW A;  4MGY E;  4ONU A;  4OHX A;  5K9Y A;  4OUL A;  1H30 A;  2R06 2;  2ZHK A;  1CES A;  3ZXG A;  3JD7 2;  4AHW A;  4AYU A;  2YC2 A;  4R4X A;  3WNL A;  2E31 A;  5I0S A;  3AZY A;  2D7F A;  2I2S A;  2CWS A;  5A3T A;  3OPZ A;  2HWE 1;  2TEP A;  2VNR A;  1J83 A;  1R64 A;  1MZF A;  1NQJ A;  1CZS A;  2XL7 A;  1UX6 A;  3B9I A;  3KQ4 B;  4M3C E;  4XJ9 A;  3ZFF A;  3QH7 A;  4QHB A;  2YB7 A;  3KMH A;  4FQ4 A;  3S7E A;  1L7Q A;  1C1F A;  3PUS A;  1NCR A;  1WWY A;  3DKW A;  3QBQ A;  4FXK B;  3HN1 A;  4R9C A;  4RFT 0;  1K45 A;  1OLQ A;  2XBO 1;  3I2I A;  5FQ0 B;  5JSP A;  4IGQ A;  1VAK A;  5L7O C;  4AK3 A;  3B69 A;  3DYO A;  1W9S A;  3J26 N;  4DEV A;  2X10 A;  2CL2 A;  4JGZ C;  4IV3 B;  3T2P A;  2PQS A;  2VUJ A;  4CUB A;  3Q8A A;  2J42 A;  1AYN 1;  5A3W A;  4I0W B;  3IPV A;  1BQP A;  4NIG A;  4COW A;  4NHL A;  1AVB A;  4XZU G;  3BCW A;  3GZA A;  4JVA A;  3EB7 A;  1VRH 2;  2WT1 A;  2LW8 A;  5K0U B;  2ZCW A;  3NMB A;  2XJS A;  3AZX A;  2UWB A;  4AQS A;  5DG2 A;  1QQP 1;  4FOQ A;  2XKO A;  3UL2 A;  3AZZ A;  4MLO A;  4IEV A;  4CCJ A;  1U5I A;  2RDS A;  3LAG A;  1LKN A;  3SQO A;  3RWN A;  2ZML A;  5C4W B;  3TEZ A;  5FYZ A;  3E5U A;  5JSO A;  5FJH A;  4UW3 A;  4LBO A;  3CJI A;  3KM5 A;  1PGW 1;  3VHN A;  3UK9 A;  1TE1 B;  3BGA A;  2R0F A;  4IEX A;  2Z79 A;  3KCY A;  5JDB A;  5ISL A;  1T6G C;  3B5L B;  1G6N A;  2WFF 2;  3KGL A;  2VUL A;  4GJY A;  4WVM A;  4RGK A;  3BU7 A;  2AGS A;  3HD8 B;  3I49 A;  4AHX A;  2V5Y A;  4N53 C;  5BV6 A;  1YQ2 A;  5FPV A;  5FRE A;  5FZI A;  2GSY A;  1POV 0;  4YVW B;  2W1W A;  1Y7B A;  3LA7 A;  4Q4Y 3;  1R09 1;  5FK8 A;  4LBQ D;  1DGR N;  1PHM A;  1E5H A;  5FZO B;  4I0A A;  5IFT A;  1SMV A;  1F35 A;  3M70 A;  1DQ2 A;  2JIG A;  4XEZ A;  2VAU A;  3O1U A;  3KF5 A;  1IZ3 A;  1HKD A;  4LO6 B;  5FK7 A;  4K8R B;  3HJR A;  3N4M A;  1GP5 A;  4HKO A;  3GNE A;  4MXV A;  4MSV A;  4ASK A;  1WCD J;  1YFW A;  2GP3 A;  1TMF 3;  4Q26 A;  4YW1 A;  5FPZ A;  2JKX A;  1YQ5 A;  2BPA 2;  4O65 A;  1UO9 A;  3J9S A;  3WNN A;  4YFZ A;  1E57 A;  1UYX A;  1ZBA 2;  1W03 A;  4QPI C;  5FYI A;  5L7O B;  3WOG A;  3M7A A;  4E4S A;  3WF1 A;  3VHP A;  1BKZ A;  5ACA 2;  3LKJ A;  2X5I A;  3EBR A;  2WIN B;  1LHN A;  2AUY A;  3BB6 A;  5IFP A;  2VCC A;  1SBD A;  2OII A;  1ZYB A;  4NHX A;  1GOG A;  1PIV 2;  5A7W A;  2WS9 2;  5GZC A;  3S5Q A;  1ZA4 A;  3TBD A;  3C2U A;  3AFK A;  2D6N A;  3KCC A;  3NNJ A;  4FVV A;  3SKV A;  1WCQ A;  5BNN C;  1ULD A;  1BBT 2;  2AR6 A;  2XH6 A;  4QQP A;  3DYM A;  3VKM A;  2B4K A;  2WNU A;  3PUA A;  1OHF A;  4QX1 A;  3V0B B;  2RDR A;  5JVV A;  4ZON A;  3ZPO A;  1W6O B;  2WII B;  2F4L A;  1VRH 1;  1FMD 3;  1Y43 B;  5EJ1 B;  5FP9 A;  3C7O A;  2BUK A;  2D6O X;  3IB3 A;  5LK5 A;  2J1E A;  3LOI A;  2WT2 A;  1H4H A;  2BFU L;  2JDZ A;  1H9P A;  1F9K A;  4CA9 A;  1IS3 A;  2DU1 A;  2PHX A;  2VH9 A;  2R30 A;  4Q0Q A;  1RC6 A;  3ZYI B;  3VDD C;  2I45 A;  1SLC A;  5A33 A;  2XOM A;  3ALQ A;  4Q4V 2;  3VZJ A;  4BQX A;  5C6C A;  3SCH A;  3JQX A;  4KGQ A;  2QQW A;  4QD2 A;  1YFY A;  4IEQ A;  2HJI A;  1X82 A;  2FDJ A;  4PIY A;  4AI9 A;  4IER A;  3GAL A;  3I3E A;  2D93 A;  3NJX A;  4NUB A;  1GZW A;  1QJU 3;  1HJF A;  3MF9 A;  5EYX A;  5KXC A;  2VUD A;  3OF1 A;  4WM7 B;  4XFH A;  1CON A;  1NG0 A;  4QKN A;  4Y1Z A;  4BPZ A;  4YRD A;  2W95 A;  3BIW E;  2VCA A;  2VMC A;  3MID A;  5FCC A;  4E9K A;  1CD3 G;  4Z8B A;  2BBV A;  1DZQ A;  4L97 A;  4DQA A;  2HLE A;  1HN1 A;  2QQU A;  2FCT A;  5JZG A;  3ROU A;  1RIN A;  3POY A;  2HWE 3;  1BEV 2;  4FFI A;  5KHJ A;  3R05 A;  2YV8 A;  5J7M A;  1ZBE 2;  1AF9 A;  4NHY A;  4AEK A;  4BB3 A;  5GLU A;  4NOT A;  4HMZ A;  1ZBA 1;  5LBB A;  3CKH A;  4CDU C;  1AJK A;  3BTZ A;  3D6E A;  2DTY A;  3N7L A;  1A6C A;  1O59 A;  2D6M A;  3HAG A;  1HB3 A;  4TN7 A;  5ERL A;  4Q4W 3;  3ZX7 A;  4Q0S A;  5ACA 1;  3S6P A;  1SLA A;  3ENR A;  4M0N A;  3CMG A;  2WLP A;  4RS5 C;  2E32 A;  1O3T A;  1H1I A;  1ZBE 3;  4QGM A;  4C0B A;  4DOU A;  4AI0 A;  3CZJ A;  4JC1 A;  5AVP A;  4LHL A;  4CCO A;  1VBB 2;  3P3N A;  3VBS B;  2YFZ A;  3A7Q A;  4RGG A;  3RI8 A;  1BBT 1;  1S2E A;  4QQO A;  1QJU 1;  4QQH A;  2D97 A;  4QU2 A;  4L0P A;  5FO9 B;  4Q4X 3;  5A3O A;  4R52 A;  3O1O A;  3A4U A;  1D2Q A;  1JH5 A;  2AZ5 A;  3GBF A;  2Y6J A;  2WUH A;  2R06 3;  5FYV A;  1UN1 A;  4WM8 C;  4RR3 B;  3NJY A;  1OXC A;  3V0B A;  4NIH A;  3DN7 A;  1KXG A;  1TVG A;  1JTZ X;  2D3S A;  1VBA 1;  1RHI 2;  4KNC A;  1UPS A;  1LEC A;  2OUJ A;  3B9C A;  3ILR A;  2QQJ A;  5FPL A;  3RPQ A;  1V6J A;  4FFG A;  4I01 A;  4A3X A;  1SBE A;  1JZ7 A;  3THT A;  2H6C A;  5LRS A;  1AL2 2;  4LLO A;  1ULE A;  1JS9 A;  1IPS A;  2DFC A;  3HIF A;  5DUU A;  2C6S A;  3SIT A;  1WMX A;  1IG0 A;  5GZE A;  5B4X A;  4MUV A;  2VOK A;  4YLZ A;  1S0D A;  4AE2 A;  4AVB A;  4BIO A;  4MG2 A;  2JE8 A;  4COZ A;  5FPU A;  4CDX B;  3ZFE A;  4BQW A;  4JGY B;  3E6D A;  3HBZ A;  5A3M A;  1FV2 A;  3I8T A;  4HXC A;  4YZ4 A;  4UFH A;  4A42 A;  2EAL A;  2WNV A;  2WNV B;  4YW5 A;  1KDK A;  5FUP A;  4CRQ A;  4NHK A;  3VD3 A;  1VBC 2;  2DWR A;  4N43 A;  1CIY A;  2A5Z A;  1AL2 3;  3B7M A;  1VE0 A;  3DXT A;  3QCW A;  1JYX A;  2QQI A;  2JIC A;  1F31 A;  1VPH A;  3H3L A;  2Q8C A;  1DDL A;  2VZU A;  4Y26 A;  2VMG A;  3CHX A;  1VBE 1;  3I2F A;  1OUR A;  3WEZ A;  4QM8 A;  1M4W A;  5FZO A;  5FY9 A;  4KG0 A;  3VBF C;  1OF3 A;  3C7F A;  2FZ1 A;  1IKP A;  2JJ6 A;  5CEH A;  1CZT A;  2JDN A;  4ZXK A;  5C3P A;  4ARX A;  1IOA A;  2YFU A;  3E97 A;  1OD5 A;  5F37 A;  4MHR A;  4BHP A;  4AVT A;  2YHJ A;  3N9Q A;  4ZZ8 A;  2VUA A;  2VGD A;  1GOH A;  5FYM A;  2QBX A;  1W0N A;  3LIH A;  3PVN A;  1W6O A;  3VDB A;  3VBR A;  1RUC 3;  2C1F A;  4IV3 C;  4LKS A;  2DUO A;  4U36 A;  2JEC A;  4JDN A;  3ZM8 A;  2GC2 A;  4Y1Y A;  1LOC A;  2JG9 C;  2ZX2 A;  5FZK A;  3E5X A;  3CJI B;  1U5Z A;  2DTW A;  4QX3 A;  5LEJ A;  3KB5 A;  3BPS A;  4FPY A;  1DFQ A;  5GZD A;  2IZW A;  4GWN A;  3JB4 C;  3JUU A;  2W52 A;  4RHV 3;  4XQD A;  4XXP A;  3BVC A;  4CP9 B;  4O9E A;  4Y5Z 0;  4CU9 A;  3W20 A;  3OY8 B;  2K9Z A;  2XHN A;  2VNG A;  1OVS A;  2ET1 A;  2OYZ A;  1F4H A;  4ISQ A;  5C8C C;  2QQK A;  5FY1 A;  2AEY A;  4CCN A;  3NW4 A;  3HWJ A;  1H6Y A;  3PUQ A;  4LO4 B;  1RXG A;  1W0O A;  2ZGK A;  2PHW A;  2GMM A;  3S0M A;  2XJR A;  1RJ7 A;  5JSR A;  5IUQ A;  1G9A A;  1PNF A;  3O1P A;  2YG0 A;  3NVC A;  2ZHM A;  3VL9 A;  3WDW A;  1A8M A;  3POB A;  1OMI A;  3FFZ A;  1B35 C;  1QQP 2;  1QJY 1;  1SEF A;  1UY2 A;  1WLC A;  3ON7 A;  5AC9 1;  3LIG A;  2OQ7 A;  4GA9 A;  3UNP A;  5C8C B;  5HCA A;  2H0B A;  4HG6 B;  2BWC A;  2Y6H A;  5EYY A;  1QDC A;  5FP4 A;  2Z42 A;  3TWI A;  1XE0 A;  2IVI B;  4Y22 A;  3I3M A;  3OY8 A;  3ZXA C;  1AR6 1;  1H8T B;  2MNG A;  3PUR A;  4ES9 A;  5HXM A;  1VR3 A;  5A32 A;  2IXK A;  2V72 A;  4Y20 A;  3WX5 A;  3LFI A;  1IGO A;  2G4I A;  5FXZ A;  5JUV A;  1UXX X;  2W5F A;  4PHZ A;  4GMP 3;  4PDW A;  4QB2 A;  2DCY A;  5BNO A;  3NKT A;  2B9V A;  2OQ6 A;  5T54 A;  5C3O A;  2AC1 A;  3DCQ A;  2W91 A;  3I2D A;  1BCX A;  2ZMK A;  4M0H A;  2KA3 A;  1A3K A;  4WM7 C;  1LHV A;  3U11 A;  3ZYF A;  4WVZ A;  5DAV A;  1WLT A;  3LDB A;  3LE0 A;  4P9W A;  1WD3 A;  2J1T A;  4XAB A;  4TWT A;  1ENS A;  1FNZ A;  5BNP A;  1CAX B;  4FSJ A;  1QJX 3;  3AMN A;  4LEJ A;  3IPV B;  1QXR A;  1IS4 A;  2BYV E;  4LIV A;  3D3A A;  3H8X A;  1HDK A;  1IPJ A;  2GN7 A;  3MYX A;  4K3U A;  3CBN A;  3LFM A;  3U75 A;  3G7D A;  1NA1 B;  2D98 A;  4Y5S A;  3VDD B;  3WDU A;  2EXJ A;  4LOT A;  2D44 A;  5EHD A;  5A7W B;  5A7Q A;  2E33 A;  1OKQ A;  1R08 3;  3N7M A;  4YVS B;  4UT5 A;  3ZYR A;  1ZX5 A;  3ZFE B;  2JG9 B;  4CCL A;  1FAY A;  4FTS A;  2BNN A;  1VB2 A;  4GWJ A;  1UIJ A;  4MV2 A;  4ARY A;  3N7K A;  2UWC A;  4TLF A;  4C1W A;  1CJD A;  3ZIW A;  4NN0 A;  2YXS A;  2EID A;  2VO5 A;  3NKG A;  4NO4 A;  5FRA A;  1GZC A;  4QWN A;  1WBL A;  1CAU A;  1ND3 A;  3E1F 1;  2F17 A;  4AFA A;  4SBV A;  2GME A;  5CAD A;  5IJR A;  5FMD A;  4OQ8 A;  1JUI A;  3K48 A;  1X8M A;  1I3H A;  3POE A;  4B7E A;  4XF1 A;  4V1P A;  4OFG A;  2LM3 A;  4CDQ C;  4HVO A;  1BMV 1;  4PI0 A;  4MZU A;  3VBF A;  1QJY 2;  1D0G A;  3GZU C;  3LSE A;  4XHX A;  2NZ9 A;  2Z4F A;  3WG1 A;  5FY4 A;  2YRO A;  2RM2 1;  4NE9 A;  1UW8 A;  1ZZ9 A;  5C7G A;  2NMO A;  1DYK A;  1WMF A;  2AH2 A;  1NCR C;  2FBE A;  3ECQ A;  3Q8F A;  5BYN A;  1RUJ 2;  4QPW A;  2XHK A;  4N7I A;  5C9A B;  1QJU 2;  1MZ6 A;  3ATG A;  3EYP A;  3RYK A;  1OPM A;  5A3L A;  5HBA A;  2R49 A;  1HRI 2;  2WO1 A;  3AL6 A;  4S2D A;  1AR6 2;  3K51 A;  3H42 B;  4AGV A;  1MZ5 A;  3H50 A;  3I3D A;  2E7Q A;  4P00 B;  1LHU A;  5EQU A;  1ZRI A;  4FFF A;  1XJA A;  4N9H A;  2QQM A;  1GV9 A;  4LUK A;  5J36 A;  4PJY A;  1PMH X;  5JMO A;  2N7G A;  2WFF 3;  4GB3 3;  5GLV A;  3AP7 A;  1NY7 1;  1WGP A;  4RR3 A;  4CDW B;  4ET7 A;  3T08 A;  4DY5 A;  2UU8 A;  4QPG C;  1QMJ A;  4MGK E;  3MFA A;  1VBA 3;  2AEN A;  4OQ9 A;  1Q3E A;  2CAV A;  5A6Z A;  3I59 B;  5G04 L;  2WZR 2;  1ND2 A;  4QX8 A;  4RN5 A;  3ZLI A;  3HQU A;  4YW2 A;  3HN3 A;  4PT6 A;  4XQ4 A;  5T5P A;  4Q4X 1;  4XMI A;  4V2W A;  1SFP A;  4BQ3 A;  1A34 A;  1WA6 X;  1YYN A;  2ID4 A;  1W9W A;  1YLL A;  1J58 A;  3OBR A;  2BNO A;  2GC3 A;  3ABZ A;  1CPN A;  2MEV 3;  4J1W A;  3RYR A;  3A23 A;  1Q56 A;  2XG3 A;  1W90 A;  2YUE A;  4AFC A;  3DXU A;  4BCU A;  4AXO A;  4L8Q A;  1ASJ 3;  3FUO A;  4PQ9 A;  3T1L A;  1DQ6 A;  4DO0 A;  1AXK A;  5CKN A;  1J3R A;  5FZD A;  2Q0A A;  3SCG A;  5CU1 A;  3LF7 A;  3AKP A;  5J48 A;  5C8W A;  3NST A;  3VBO C;  3RZL A;  1W28 A;  2EVX A;  5A6Y A;  1UMI A;  1EY2 A;  1NCQ C;  4IV1 C;  3DYP A;  2DBN A;  4LBQ A;  3WXP A;  1W0P A;  3T09 A;  2QQP A;  1GNY A;  3P5B A;  3H7Y A;  3LEK A;  1ASJ 2;  2VBB A;  3OCP A;  5KR7 A;  1AR8 3;  2DVA A;  1Q8S A;  3MV1 1;  5D8A C;  3ORJ A;  3NNM A;  2XGX A;  3UGF A;  3AFG A;  4KBB A;  4AFB A;  1DGW X;  3J7H A;  1Y4W A;  2XLA A;  2XJU A;  1C8M 1;  4CXW A;  2WNU B;  4XUP A;  5FZ3 A;  5KXD A;  1ND2 B;  2BU9 A;  2RS3 3;  1I5P A;  3AYC A;  2ZHN A;  1SBF A;  1AR9 3;  2EAA A;  5FZ9 A;  3ZVX A;  2VW0 A;  4QPG B;  5FYB A;  4W6X A;  1GP6 A;  5KC6 A;  3FBY A;  3PJQ A;  4HL0 A;  4NVP A;  4D0Q A;  2E9Q A;  2BWA A;  1Q8Q A;  4MX3 A;  4UF0 A;  3AB0 A;  4QPI B;  1PZ9 A;  5H9P A;  3RI9 A;  2G9Z A;  4O7X A;  4UFK A;  3CQO A;  3RSJ A;  3CJX A;  4NWW A;  3AX4 A;  3OGJ A;  4D6R A;  4YW3 A;  5AC9 2;  4RD7 A;  3T0A A;  1L7L A;  2YC4 A;  2NLR A;  1DYP A;  1WCU A;  4D7Y A;  1HRI 3;  2W1Q A;  1DU3 D;  1FPN 1;  4Q27 A;  1S0G A;  3WQ0 A;  1JYN A;  1O4Z A;  3VV1 A;  1LOE A;  1X8E A;  2HWC 3;  5SV5 A;  1DLL A;  1O5L A;  1UQX A;  4QKB A;  4RS5 A;  5GZG A;  1UIK A;  2A6Z A;  1UOJ A;  3EMR A;  1TEI A;  1FYU A;  4OHY A;  2XR4 A;  3C3V A;  1LRH A;  4N53 B;  1A8D A;  4BWO A;  1F5J A;  4GKY A;  1GWM A;  1MR5 A;  2XVG A;  1H2M A;  3ES1 A;  1VBD 2;  3DEC A;  4EN7 B;  3ZYG A;  3A0N A;  3BOW A;  5FJK A;  1HB2 A;  5JMC A;  3D5O A;  2RJ2 A;  2VMF A;  3PLQ A;  1UU5 A;  4Q1R A;  1D4M 3;  1OLM E;  4CU8 A;  4LBL A;  5GJ6 A;  3WF0 A;  5JXI A;  4LPL A;  1UX7 A;  2XQX A;  3HBK A;  3PIG A;  4XJZ A;  4KH9 A;  3S30 A;  4NRO A;  1Q8O A;  2BFU S;  4A6O A;  3RYP A;  1UZV A;  2RS1 1;  4K6B A;  4CUC A;  2PHT A;  4Y4R A;  5FWJ A;  2ZGR A;  4CXY A;  4XUN A;  1KRI A;  5GLZ A;  5FZH A;  2CDO A;  4PLN A;  4AVS A;  3O1T A;  3MEP A;  4B4Q A;  5JXJ A;  5FXX A;  2Y6F A;  3W58 A;  4M01 A;  4IQP A;  4OLL A;  2WZR 3;  3J7L A;  4AEM A;  1W2U A;  5L9R A;  2WAB A;  1EYB A;  3INA A;  5K0U A;  3NNL A;  1RUE 3;  4PLM A;  5IK4 A;  4G3Y C;  2ZGM A;  4D8M A;  2BP6 A;  2HWB 2;  5FLH A;  1FPN 3;  1W06 A;  3ZMN A;  1ZRC A;  3GHM A;  2D40 A;  4QQL A;  4RFR B;  4ASM B;  4R9A A;  4AZZ A;  1DBN A;  1RUG 1;  1QOO A;  2GZW A;  2ZHL A;  1AJO A;  3ILN A;  3P6B A;  3WCR A;  1JZ5 A;  5KXB A;  4J25 A;  1ST8 A;  5EFU A;  3PDQ A;  4BK5 A;  2HWF 1;  2EAK A;  3PVB B;  4QX2 A;  1U5X A;  1J1T A;  1VMJ A;  3CDZ B;  5FPB A;  5FYY A;  3VKL A;  1UXZ A;  2ZX1 A;  2Q5T A;  2RDN A;  2JG9 A;  4QX0 A;  5LY1 A;  1UOG A;  4YG0 A;  2Q1F A;  5A7S A;  4YZ1 A;  3VD4 A;  5JOW A;  3DGT A;  1VMH A;  5JCT A;  4QB6 A;  4GH4 C;  3WV6 A;  1S4C A;  2AYH A;  2WL1 A;  3OSD A;  4C0H A;  2PFW A;  1FX5 A;  1W3V A;  2ZX4 A;  1BJQ A;  1W8W A;  2X29 A;  4TSV A;  4XFI A;  1YQC A;  2D6K A;  2OVU A;  2DU0 A;  5JLV A;  4GKX A;  2JDK A;  2C24 A;  4YZ2 A;  2Q1Z B;  4Y22 B;  1CAX A;  1T2X A;  2WNV C;  2PHF A;  1XRU A;  1DLC A;  4P14 A;  1XOY A;  2ATF A;  4UBG A;  5L19 A;  5F7U A;  4RQP C;  2C0Z A;  2D6P A;  4DRV A;  4LNV A;  5FP7 A;  1K12 A;  1TZO A;  2P3J A;  1TNF A;  2GDF A;  3NNF A;  3TRS B;  1HQN A;  2ORZ A;  3IDA A;  1R08 2;  1NLS A;  1ZRF A;  3AJZ A;  5ANN A;  3ZYB A;  1X9P A;  1SCS A;  3V64 A;  2GP5 A;  5I0R A;  5CAZ A;  4BH9 A;  1N3P A;  1H8V A;  2WS9 1;  2P17 A;  1UCX A;  3T2Q A;  4HVQ A;  2UY9 A;  3DUI A;  4RHV 2;  3TEY A;  3M3I A;  3MPB A;  5LY2 A;  1VBD 3;  2P3I A;  1HXS 3;  2DVF A;  4GIQ A;  4UFJ A;  3GCW A;  3SKJ E;  5BNQ A;  3EJK A;  3JBG 3;  2BQP A;  5C8C A;  4JGZ B;  3O14 A;  1TMF 1;  3AXE A;  4KGG A;  4LT5 A;  1C4R A;  1JU4 A;  1NT0 A;  1Q8P A;  2UUR A;  2V4V A;  1MS1 A;  3IKW A;  2WNU C;  3H3U A;  1JUH A;  2Z5W A;  4DIN B;  2HWD 3;  4PCR A;  5E89 A;  2FQP A;  2JXA A;  1B35 B;  1WME A;  1OA3 A;  2HWB 1;  2ZEX A;  1JU3 A;  2MEV 2;  1JOJ A;  3EO6 A;  3TN9 3;  1UOF A;  1Y9M A;  2QZ2 A;  3EHK A;  1PIV 1;  3WUC A;  4EJR A;  1XYO A;  1Z7S 3;  1W05 A;  3AJY A;  2P6H A;  1UOB A;  1W8O A;  5T50 A;  2J1R A;  2HYK A;  2EF6 A;  4NPL A;  2CAU A;  2W08 A;  3A0K A;  3VN4 A;  5CB7 A;  5FMO S;  4QGN A;  4IE0 A;  3AVS A;  5F5I A;  4N43 C;  3VBO B;  3TN9 1;  3VDA A;  2ILM A;  2ZAB A;  1JZ8 A;  4NII A;  1ONA A;  1YRZ A;  4FCA A;  4MET A;  1NCQ A;  4JZR A;  2HWB 3;  4ZY9 A;  3UYJ A;  2G9F A;  3SCF A;  5FPX A;  5DMY A;  2WA3 A;  3IDC B;  3ZFG B;  1POV 3;  1V9U 3;  4DS0 A;  3THP A;  2DUR A;  3B93 A;  1OI6 A;  1LCL A;  1C8M 2;  1QJZ A;  4NHM A;  1JYV A;  5GKA C;  1ODM A;  1EAH 3;  5HPO A;  1C1L A;  5HV4 A;  5F5Q A;  1VBC 3;  2RR1 1;  5DPN A;  5KXE A;  2V73 A;  2RMU 2;  4BLI A;  1S1A A;  4J6G A;  4YGE A;  4AEJ A;  5FR3 A;  4ZS3 A;  3AYD A;  1W2A X;  4XIK A;  3ZYP A;  1PK6 B;  5F32 A;  3FHQ A;  4FOW A;  1FMD 2;  2RS5 2;  4NMI A;  1YUD A;  2LUW A; 
#chains in the Genus database with same CATH homology
 3PUA A;  2YU2 A;  4QU1 A;  3KV5 A;  3K3O A;  4UF0 B;  5FWE A;  3ZPO A;  5FUP A;  5LY1 A;  5F3G A;  5A7S A;  4LIV A;  5FP9 A;  5A7P A;  5A3T A;  4D6Q A;  4QX7 A;  5KR7 A;  3N9P A;  4IGO A;  3DXT A;  5A1L A;  3K2O A;  5IWF A;  2Q8C A;  3PUS A;  5F2S A;  5A7W B;  5A7Q A;  5FY9 A;  5FZO A;  4IGQ A;  5FZ3 A;  5A80 A;  5FZ9 A;  5FWJ A;  4CCL A;  4LIT A;  5CEH A;  2VD7 A;  5FXV A;  5FPA A;  5FYB A;  1VRB A;  2XXZ A;  5FZA A;  4HOO A;  5IVB A;  3LD8 A;  5F37 A;  2XDV A;  3N9Q A;  5FZ8 A;  4AI9 A;  5FYM A;  5FXW A;  5FP7 A;  4QWN A;  5A3W A;  4UF0 A;  2P5B A;  2YPD A;  4NUB A;  2PXJ A;  5FYC A;  5IVE A;  2XML A;  4CCK A;  3N9L A;  5FZM A;  2OS2 A;  5F5A A;  2WWJ A;  5FZK A;  4HON A;  4XDP A;  4D6R A;  4V2V A;  3K3N A;  5FZF A;  5LWB A;  4EZ4 A;  4CCJ A;  3U78 A;  5FZG A;  4BXF A;  5FY4 A;  2GP5 A;  2Q8E A;  5IW0 A;  5A7N A;  5FYZ A;  5FY7 A;  5LW9 A;  4AAP A;  4DIQ A;  5F3E A;  3KVA A;  4E4H A;  5FY1 A;  5FJH A;  4CCN A;  3PUQ A;  5IVV A;  3PU3 A;  4GJZ A;  2OX0 A;  5LY2 A;  3U4S A;  3AL6 A;  4CSW A;  4C8D A;  4EZH A;  5ISL A;  5FY8 A;  5A1F A;  3N9M A;  4QXH A;  3PU8 A;  4GJY A;  5F39 A;  4IGP A;  4CUG A;  3KV9 A;  5FBJ A;  5A3P A;  4GD4 A;  4LXL A;  5FJK A;  2YU1 A;  5FPV A;  5FZI A;  3OPT A;  4TN7 A;  4EYU A;  5FZE A;  5A3N A;  5E6H A;  5F2W A;  5FV3 A;  2XUE A;  5K4L A;  4CCM A;  2OQ7 A;  4LIU A;  5FZO B;  2YBP A;  5FZ4 A;  2YBK A;  5FZ0 A;  5FZB A;  5FP4 A;  4URA A;  4QXC A;  4CCO A;  5IVJ A;  2WWU A;  2YBS A;  3KV4 A;  5F3C A;  5FZ7 A;  4Y4R A;  3RVH A;  3OPW A;  2W2I A;  4QX8 A;  3ZLI A;  4ASK A;  3AVS A;  3PUR A;  2GP3 A;  5F5I A;  5FYT A;  5FZL A;  5FZH A;  5FY0 A;  4Y33 A;  4V2W A;  4QXB A;  5FUN A;  5FXZ A;  3PTR B;  5FXX A;  3UYJ A;  5FYV A;  3NJY A;  3AVR A;  5FYI A;  2OQ6 A;  5FYH A;  3KV6 A;  2Q8D A;  5FPL A;  3DXU A;  5IVF A;  3KVB A;  4Y3O A;  4BIS A;  4DO0 A;  5FP8 A;  5F5C A;  5IVC A;  2OT7 A;  4GAZ A;  5IVY A;  5A7O A;  4XDO A;  5ANQ A;  3N9O A;  3N9N A;  5FZD A;  5FZ1 A;  3LDB A;  5A7W A;  3AL5 A;  3PDQ A;  4D6S A;  5FYU A;  5F32 A;  5FP3 A;  5FPB A;  5FPU A;  5FZC A;  5F3I A;  5FYS A;  5FY5 A;  4BU2 A;  5FZ6 A;  5FYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...