5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
2YU1A 3KV5A 5A7SA 5A7PA 4NUBA 3KV6A 5FZOA 4CCLA 5F3EA 5F2SA 5FYZA 5A3PA 3K2OA 3OPTA 4QXBA 5LW9A 5F3GA 2VD7A 5FY9A 5A1FA 2GP5A 5FY4A 5A80A 5A7QA 4TN7A 2Q8DA 5IVBA 5LWBA 2OQ7A 3N9MA 5FUNA 5IVVA 4EZ4A 2YBPA 2YPDA 3ZLIA 5A1LA 3AVSA 5FP9A 5FYCA 4V2VA 3OPWA 3PUQA 5FZ9A 3PDQA 4XDOA 2OQ6A 5FZDA 5A7OA 5IW0A 3KV9A 5FYUA 3KVAA 5FYMA 5F5AA 2XMLA 4GD4A 5FZOB 5FXZA 5A7WA 3UYJA 5FPBA 5FZIA 3PU3A 3N9OA 5F39A 3N9QA 4GAZA 2OS2A 5FJHA 4IGOA 2OT7A 5FBJA 3U4SA 5FYBA 5FUPA 4UF0B 4BISA 2P5BA 5FPLA 3PTRB 5FXXA 5FPAA 4LITA 4URAA 2WWUA 3U78A 4E4HA 3KV4A 4IGPA 2YBSA 2GP3A 3PUAA 4CCNA 3AL6A 5FYSA 5FZ6A 5FY1A 5F3CA 2WWJA 5F37A 5FY0A 5FZGA 5FZ1A 5FZLA 5FPVA 4QX7A 5FP8A 5CEHA 5FZAA 3RVHA 3KVBA 2YBKA 5FPUA 3NJYA 4BXFA 5FZ3A 2XXZA 5FZ4A 5IWFA 3PUSA 4UF0A 5F5CA 5IVYA 5FZMA 2Q8EA 2Q8CA 5FZKA 5LY1A 4EYUA 5IVJA 4D6SA 5A3NA 5FYTA 2YU2A 5F3IA 5FYVA 4BU2A 4V2WA 4GJZA 5FP3A 4CCMA 1VRBA 4QU1A 5FXVA 5FWEA 5FY7A 3N9NA 3LDBA 4HOOA 5FP4A 5FZCA 5FYIA 5FYHA 4DIQA 5IVCA 5IVFA 5ANQA 5A3TA 5FXWA 4ASKA 5F5IA 4LIUA 4C8DA 5FWJA 5A7NA 4Y33A 5ISLA 3AL5A 3LD8A 5FY8A 5IVEA 4D6RA 4DO0A 5F32A 3AVRA 2XDVA 3PURA 3DXUA 4QWNA 4QXCA 3ZPOA 5FZ0A 5A3WA 4XDPA 4Y4RA 5FZFA 2W2IA 5E6HA 4QXHA 4CSWA 3PU8A 5FZBA 5FZ7A 5FV3A 5FY5A 5FZHA 5KR7A 5FP7A 4CUGA 4AI9A 2OX0A 3K3OA 4QX8A 5A7WB 4EZHA 3N9PA 4IGQA 4D6QA 5FZEA 4AAPA 5K4LA 4GJYA 3K3NA 3N9LA 5F2WA 4Y3OA 5FYYA 3DXTA 4CCJA 5FZ8A 4HONA 4LXLA 4LIVA 5FJKA 5LY2A 4CCKA 2PXJA 4CCOA 2XUEA
chains in the Genus database with same CATH superfamily
1LOCA 3R4UA 1RUC1 5B4NA 3ES4A 4NUBA 1BLZA 1COV2 1KFUL 2XVLA 3JQXA 4LE4A 1E5HA 2PAKA 3VD7A 3I2OA 1N3PA 3HAGA 4XJWA 4H55A 3WG2A 2YC2A 4LHLA 5A32A 2QQMA 2DTWA 2XVKA 4FPEA 3N7LA 2ZOEB 1U5YA 2X53S 4TN7A 2B42B 3O1OA 4RR3C 1SHWB 1RUF1 1CX1A 1QOSA 3IAQA 4FTSA 1JUIA 3GYDA 1DF0A 3VBFC 1NCRA 5E16A 5BNPC 3KCCA 5FZ9A 4UAPA 2ILMA 2WN3A 2BDRA 3TN91 1AR61 2VUDA 1UYZA 2FQPA 4GD4A 5J09A 3E5UA 4GWIA 2E51A 1YQ6A 4IEXA 4GMP0 4ASMB 1MEC1 2JE9A 2PQSA 3CHXA 1G9BA 2VVDA 4XFHA 4IGOA 5DUWA 5T3NA 4P5YA 4E9KA 2P5BA 1GNYA 4LK7A 4QX2A 5FPAA 3ZYRA 3OBZA 2BGOA 3HNBM 3T0BA 1Z7S3 2JWPA 4FO9A 3IPVB 1W9WA 4Q4Y3 4OUMA 5JZGA 2BWCA 3OGJA 5FP8A 3TBDA 3THTA 5FDBA 3FZ3A 2Y6LA 1CZVA 3KHCA 5CFDA 2RS52 3RDIA 3UT0A 2DVFA 3JB8A 1OOPC 3NJYA 2IFRA 2EAAA 2X5IB 1VMHA 1CN1A 2Q0AA 3AZVA 3HQRA 2HEYF 4ZPIA 2Q8CA 1ZREA 1I3HA 4CCEA 1O8PA 4YRDA 4AQSA 1RUD3 3LPGA 4ISQA 5A3NA 3GBFA 1COV3 4XFIA 2Q30A 1MR5A 1U5XA 2AEZA 3Q8EA 2W1SA 4EWAA 4YVSC 2JIGA 1W6OB 1UIKA 2VULA 2D93A 2XVGA 2PYTA 4LO4B 1OXCA 3ABZA 4B7KA 3QCWA 1OQ1A 3M7AA 4YWAA 1R092 4A2UA 2VUCA 4M00A 1AL0G 1GU3A 2CTVA 2A3XA 3O1UA 1EP0A 2GMMA 2DUQA 5DAWA 3TNQA 2OYZA 4DNYA 5L7OA 3UETA 4FAGA 4NOTA 1W0OA 2Y6KA 5T55A 4GB32 1ZRFA 1OF4A 5CFDC 2J1EA 3J8F3 4LO6B 4JVAA 4S2GA 1R1ZA 2P1BA 5AVPA 3IIIA 3N35A 3AKPA 3PU8A 1CPMA 2TUNA 2WS91 4RA0A 3W21A 3VHPA 1UKGA 1S2KA 4XF1A 5FZHA 1Q8OA 4LPLA 3OGGA 3MI8A 4NJ4A 2PHUA 4QX8A 5KHHA 2R073 2ZGOA 2V72A 4CDWC 1LESA 2ET7A 4W6XA 5ANNA 3NW4A 4PQQA 3FC0A 2EXKA 4GKXA 2LALA 1UCXA 3AX4A 1R091 3MUY1 3NJXA 4OYUA 4P9WA 3H7YA 4TZDA 3P6BA 4CCOA 3O14A 3WCRA 4YGCA 3RGBA 1JODA 1QXRA 4FI9A 2PMWB 5FK7A 1J3PA 5FQ0A 1CAUB 4EJRA 3CQOA 3IMNA 4MZUA 1YFWA 2QDNA 4IL7A 1JXNA 3WQBA 2D6PA 4J1WA 1PGL1 4W8JA 2BU9A 4Y1YA 1PMIA 5FY9A 2D3SA 5IK8A 5DDJ1 3ZKUA 4WM7A 1B35B 1R1A2 1S0IA 3LEMA 4QX1A 4RQPC 1VBA3 4XJAA 2OQ7A 4YNIA 1XE8A 4UFKA 3LIGA 3VKOA 5JXGA 1I6XA 1A6CA 2IXHA 1BEV2 2HWF3 4UFLA 5JDBA 1H4GA 1XQNA 3AXEA 3GDBA 4XDOA 4XC9A 5I93A 5FYUA 1PX3A 3WHUA 2YGLA 3CZUA 5HV0A 1QQP2 1URXA 3WHTA 5FPBA 1OMIA 5EJZB 5FRAA 4D0QA 4XJUA 1AR82 1F9KA 1KXGA 1NE6A 4Q8LA 3J8F2 5FUPA 1CGPA 1MS8A 4DB5A 3WDYA 2MNGA 1JOJA 2DVBA 1S0CA 1UL9A 3FLPA 1HB4A 4QKBA 3VZLA 1Q8QA 1HRI2 1PO22 3A0NA 4AWDA 5FZ6A 4X8NA 1BEV3 2P3JA 4RQPA 1WMEA 1OBNA 1PGSA 2VUAA 5FPVA 4QX7A 4GKYA 1QJY1 5HCFA 2I74A 5BXXA 3GBGA 4QB2A 3T1MA 5L36A 3VBRB 2WZEA 4QAWA 4BXFA 1UOBA 3TB0A 4UF0A 4XTMA 5FZKA 1C8M3 1LTEA 2YY1A 3MW2A 4IV3C 2XGXA 4LKEA 3C7FA 3H1MA 3AFKA 1W6PB 4DXZA 3EYPA 4YW1A 3USSA 4FXGB 1AYM2 1WLTA 1D4M1 2HWD1 4XFAA 2IVJA 2J1AA 1GP6A 2PHTA 3H50A 5FYIA 4XOGA 1SFYA 5A1AA 1K5MA 2BNMA 2DU0A 4L97A 1RUJ3 4IERA 1GLHA 3LA3A 3NJVA 1E5RA 2DUPA 1KS4A 1PO11 1W2OA 2DCZA 1VALA 5C6CA 4A44A 1LECA 2Y64A 4ISRA 5DZGA 1YFUA 5ISLA 1MQTC 3L2YA 3N3HA 3WDVA 1RUNA 1QU0A 4B1LA 4DO0A 5EZWA 1Q56A 1ULOA 2PA7A 5E8AA 1DZQA 3ZFFA 2BVVA 4Y1XA 1GOFA 3N7MA 5CB7A 1NXMA 2FHRA 5H9PA 1JZ2A 4ZXKA 2YZ4A 1W0PA 2ZX1A 3J7NA 1RL3A 2WZR1 1OVSA 4HETA 2O0OA 3J7HA 4FP3A 1YQ5A 2VVFA 4LJHA 4GQ7A 4K40A 1HXS3 5I8YA 3M4FA 3GZAA 5EHDA 1RUI1 2HWD2 4RGAA 4V1PA 3WF0A 1UY4A 4IGQA 1AR72 2ZGUA 4RS5B 4Y22A 3SHRA 4KG0A 4Y5SA 4I2OA 4JDMA 4E8CA 4OHVA 2WQZC 3N9LA 3GJAA 1CAVB 1SLAA 5B4XA 2AACA 3WQ0A 2R071 4I3GA 1OPMA 2DFBA 3A21A 2D43A 3VBSC 4B4QA 2OUHA 1RUC3 5BNNC 3EMRA 2WQ4A 4ZU7A 1YIPA 4FOQA 1QH7A 1G9CA 1WWYA 3ACHA 2WA4A 4NAMA 2VNGA 1IPSA 3ACFA 3AP9A 1DZRA 2WO3A 3HBKA 1LGCA 2VXJA 2LM3A 1K12A 5FBZA 4YM1A 1CIYA 3BOWA 5A7QA 3NKTA 2PQQA 5F9TA 2CGPA 1OA3A 4LUMA 1DP0A 1TMF3 1VBE1 3WUCA 1G9FA 4IEOA 3ZYIB 3VD9A 2YPDA 4MHUA 3ZSMA 1LU2A 4AFDA 1JZ5A 2CU5A 4PQ9A 3E5QA 4EWDA 1AR93 1FPN1 1SFNA 3MBWA 1XB9A 5BYNA 5IK7A 4R4ZA 2P34A 4XUQA 1RUE2 2HBUA 5GLTA 4FTEA 3THPA 2VCAA 1DQ5A 2E31A 3ZYPA 2E9QA 2VMIA 5I0RA 2D98A 3ORJA 3V64A 3ZN4A 3PIGA 4IEPA 3U4SA 4ZS2A 3R6SA 1J3QA 4CPBA 1IPKA 2QVSB 3BKZA 1PGW2 4HK8A 4XUPA 1TMF1 1FT9A 1EUTA 1ZYBA 2J1VA 3KGZA 3TEXA 5J7MA 1CAWA 2VBDA 3TEZA 2Y38A 5T52A 2XG3A 3HNMA 2R30A 3ZXGA 3JXSA 2UWCA 2EIGA 3NNGA 5FY1A 4E8DA 5FO8B 2JG8A 1PO21 1L7RA 4CRQA 5EFUA 3RWNA 4L2NA 1WBLA 4M3CE 5FMCA 2X5IC 1GBGA 5FZAA 3VDAA 3THDA 5GZEA 3ZXDA 3RVHA 2KXLA 4B8EA 4DMIA 2Y33A 1CD3G 2MEV1 3MIHA 4SLIA 1XNTA 5FPUA 4P5HA 1Y9GA 5FPZA 5IWFA 4WM7B 3N4MA 2B46X 4TWTA 2BPA2 5IVJA 4I3PA 3VDCA 4D6SA 1W0NA 1XBFA 2IXLA 4V2WA 3BTXA 1K45A 3SKJE 3N9NA 1VRH2 2E7TA 1W8ZA 4HPKB 2QCSB 2BFUS 1QKQA 1IGOA 1UOJA 4M4RA 5HCBA 2A75A 3Q8FA 1BJQA 3VBUB 1JW6A 1QF3A 2VBBA 2JE7A 3MO4A 4I0WB 1OUXA 4N53C 4MOAA 2SLIA 1W06A 1XE7A 3OUHA 4PIZA 3BU7A 1I1EA 2VCBA 4YVSA 4P00B 1YC61 1DQ1A 1MS4A 1NZIA 4LR4A 1REDA 4OCTA 1B35C 4NMIA 3ZPOA 4CVUA 5A3WA 2AC1A 1DG6A 3OY8B 1VBB2 2GALA 4IETA 4P14A 3NV4A 1KITA 4QHZA 3RI9A 2W0XA 4D94A 1DBNA 4C0BA 1NT0A 3J26N 4QB1A 5FMBA 3K3OA 4IEZA 4HSJA 5A7WB 1AJOA 1UXZA 1W03A 4K8FA 2O8OA 3AZWA 1VBD1 5HBAA 5EWSA 1XNKA 1H9WA 1QHDA 4OI2A 3WNMA 3HIFA 4AQTA 1CJPA 4HONA 4C90A 1FXZA 3WG1A 2YU1A 5JSPA 3LQCA 5FQ0B 2B45X 1YXWA 3AK0A 3H1WA 4N43A 4Q4X1 2DURA 4H3WA 1LOAA 4MYEA 1MZEA 3R05A 1WW5A 3F95A 3U75A 2WC2A 1ULFA 3WW3A 4CEWA 5JPNB 4ITCA 3WF2A 3OTFA 2TBVA 3GZTB 4RFT0 1JMUB 4IE5A 3RMXA 1VRH3 2RMU2 3RZHA 1UU5A 1LHUA 5JWPA 2OA2A 3AVSA 1DGLA 2ARAA 3I59B 4MO3M 4CDQC 3VDDC 4YPJA 3W58A 4AGGA 3KWVA 4XETA 4YYOA 4TXWA 1W28A 2FCVA 3JBG1 4YGEA 4LBQA 4GB31 4HLTA 5KHIA 4BQXA 3ZPYA 1IOAA 1RUE1 5C8WA 1H8TB 4PDWA 3PU3A 3LE0A 5B2GB 1UZZA 5KBFA 2RDQA 2VZPA 2W95A 3WEZA 3B01A 1O7FA 4Y24A 2P17A 4QT6A 1VRH1 1HQWA 1GICA 3LGRA 4LHSA 2AENA 2H6CA 1GQHA 3AMPA 5BNQA 5FOBB 1JZ8A 1BMV2 2C9KA 4M01A 4Q0SA 2YBSA 4L99A 1JU4A 1ZBA3 3C7OA 1WLCA 1YIFA 5EPAA 4CDXC 5HCHA 2FDKA 5IK4A 5F3CA 2IXJA 3BODA 1APNA 3A0KA 4JAAA 4UBHA 4XURA 5FZ1A 2ZX0A 5C4WC 5JSOA 3C3VA 2Y34A 4OHWA 3ASIA 4MX3A 3ZN6B 4OQ8A 4INDA 4AVAA 1O8SA 3E97A 3OPZA 3VDBA 3OGVA 1FMD3 1O6UA 1AR81 1AYN2 1KS5A 5IVYA 1W2TA 4OQ9A 1LR5A 3VBHC 1R093 1CIWA 3R0RA 1S0DA 4QDSA 3AYEA 1VBE3 3AMHA 3MPPG 4I30A 2QNKA 5H9SA 1EY2A 2XJRA 1NA1C 5FXVA 4KU8A 3T1LA 4AEMA 5FY7A 4B7EA 4LKDA 5JZGB 4BQ2A 4HOOA 1QXJA 1UYPA 1A3KA 3MW4A 4RGKA 5FMOL 2LS6A 5T50A 2PELA 5FYHA 3JBG3 4BQ5A 3HN1A 1HDKA 3NWKA 2RMU3 2C6SA 2FMDA 4YLZA 4D7SA 1SQ4A 4RD7A 1STMA 1AL21 1W9TA 2VMHA 2VMEA 3OJBA 4OUSA 4BQ1A 2RG4A 4KWUA 3RPQA 1C4RA 3GF6A 2NM1A 3PJYA 4XQDA 5C3PA 1T6BX 4QHOA 1U12A 1SLBA 5F32A 3EBRA 3M3IA 4MVTA 4WVZA 2XHKA 2XBO1 2HWF1 4P9LA 5KXCA 3DXUA 3K4AA 1YCIA 4QMAA 4NPLA 2F6BA 4E2GA 3W5NA 4PLOA 1QH6A 1PMHX 3WNKA 1S0FA 4LULA 3WR0A 2F4LA 2DDUA 1CZSA 3D0SA 4QPIB 5LEKA 5FP7A 1RUF2 1L7LA 2ZABA 3UV9A 4FOYA 3ZFEA 1HQNA 2ZGLA 3VKNA 4AVBA 3I2HA 1G6NA 3ZXJA 1N1SA 1FATA 2RM23 3SMHA 4GJYA 3KD4A 3VGIA 3WDWA 1WMFA 4NHKA 4CCJA 4JRAA 2WO2A 1Z7S2 2VL4A 2RDRA 4D7YA 4H7MA 2WO7A 3M2MA 3T4VA 3AP5A 3SQOA 4E4ZA 3KV6A 5FZOA 4B1MA 4LA3A 3MIBA 5FYZA 2GMPA 4YGDA 3JD72 4BOWA 5DDJ2 3ACIA 4FPYA 1OQEA 1RHI3 2I07B 5CYYA 4AFCA 1TG7A 2J1TA 4I02A 4MGZE 2ETEA 2Q8DA 3WDTA 2NMOA 5BNNA 1UX7A 2XKOA 2YBPA 2A3YA 4KWKA 1JZ7A 1LOEA 1W8UA 3B7MA 3GXUA 4YARA 3BVCA 4MH0E 5EYYA 5A7OA 3VV1A 5F8PA 4DZGA 4B29A 2ADDA 2WAOA 2Y6HA 3OF1A 4FPCA 4HVOA 4KMQA 1OHFA 2RS32 5JIAA 5K9YA 2P4EA 5FZIA 1ND3B 2RV9A 2VM9A 2VZTA 1UZYA 2PFWA 2C5DA 2OS2A 1U5IA 4FFFA 1FNZA 4COUA 5J37A 1KJLA 3VD4A 1AX1A 3LA2A 4BDVB 5CFCA 5LA1A 4JX0A 1MS3A 2WT0A 3Q8AA 2WR9A 4OI0A 1RUI2 4E4SA 1BBT3 1RUG3 3WNPA 3J7MA 2ZMNA 3KQ4B 1ULGA 4BZ4A 3ILNA 4Q1RA 4XJZA 3WLUA 1VB4A 1VAKA 4FPKA 4RR3A 2ZHLA 1MS0A 5CIRA 3P1IA 2WIIB 3O0XA 3KT1A 3VBSA 5IT6A 1GR3A 3SXWA 1W9FA 1N1YA 2WQ8A 3K48A 1NUKA 1NCRC 3CKHA 2DV9A 3K46A 2ZZJA 5CFCB 5A6QA 2BGPA 1VJ2A 4K21A 5DAQA 2JE8A 3AP4A 3PLQA 2VW0A 2K0GA 3BCWA 3I2JA 2W46A 5AVAA 4CDUC 5T5LA 1XNAA 2YU2A 1TEIA 3EHKA 4R4XA 3M70A 5FYVA 4NO4A 3OGRA 3U1XA 3BALA 1RUI3 2QQVA 1VRBA 4CPBD 5DDJ3 1H30A 3NNMA 3OD4A 1TNFA 4QQLA 4A7YA 2IUWA 4HKOA 4BWOA 2HBTA 4LBQB 4UXAA 4AQ6A 2WNVC 2VNOA 4P9GA 4M0HA 5LZ6A 3RWKX 3ETPA 5FXWA 2IC1A 3TYJA 3HBZA 2WNUA 1AL22 1M4WA 1RITA 4IE7A 2HH9A 4YVSB 1J83A 4LUKA 5KXEA 4YW2A 2B9UA 4RYDA 4JGYB 4HL0A 3ZXAC 2CY6A 3H7JA 5FMOS 3GHMA 3I59A 4Y5Z0 3POFA 5BPXA 3FWEA 4MUVA 3CU7A 4Q0UA 2XQXA 3SKVA 1HJGA 2XJTA 1XYPA 2B8MA 2YG0A 3S6PA 4BQ3A 1RUG2 1H0BA 4NAOA 2BTVC 1FMD1 3OD0A 1B09A 2XUMA 4DQAA 5JOXA 1HQLA 3VD3A 4AAPA 3RSJA 1ULCA 1S2EA 1UNBA 2R1BA 4ZHNA 2ZEYA 2ZS6B 4JQRA 3DYPA 5FYYA 1FX5A 1LGNA 4K9SA 1HRI3 3HEIA 5E89A 1FI2A 5CKMA 4NPRA 4XQ4A 2VZQA 3APBA 3WINE 5IATA 1X8MA 1C57A 2WDBA 2ZGTA 4R8HA 5F2SA 5JR7B 3RRDA 4M4PA 5FTTC 1RB8G 2BNOA 3BTAA 1T2XA 4A41A 1EYBA 1HLCA 4O7XA 3AC0A 1RVF2 1VMJA 5C5TA 3NJZA 3E1F1 2WNUB 2WS92 4DY5A 5AC93 3RZLA 3CBNA 1C8M2 4XCBA 2PAMA 1VBC3 3LA7A 2D3RA 1UMIA 4DRVA 3WD5A 2IXCA 3BIEA 1RC6A 1L7QA 1RHI1 2EAKA 3CIHA 1D0GA 3IPVA 4XYXA 5DZFA 4A45A 2XLGA 1A8DA 4LA2A 4XIKA 4ATFA 2A71A 2P3YA 4AHXA 1OI6A 4S2DA 2CL2A 4XZPA 4CDQB 1G86A 2GAUA 1AXYA 5CA6A 4FT8A 4MHRA 3CJIB 2GH2A 1W9SA 3IBMA 4NHXA 2B39A 3RJ2X 4CU8A 1UY3A 2WZ8A 2OT7A 5FBJA 4CCDA 2H0VA 4F83A 2W08A 3PTRB 4HT1T 3HJRA 3L2HA 4JQTA 2HWB2 3U78A 4E4HA 3IT8A 1OFNA 2W52A 2VXRA 3AP7A 2DU1A 3KGLA 3T08A 4S2HA 2NQYA 2E7QA 1SACA 2BVBA 2PHXA 1EPZA 2ZHKA 3OOXA 2VO5A 5LA9A 4A42A 3WNXA 1C8M1 2DCKA 3IM0A 3K75B 1R083 1CAXA 1SPPB 3AJYA 3PVBB 5LASA 4IE4A 2WAAA 2RJKA 3KS7A 1W2AX 2QJVA 4N43C 2HKXA 4QPGB 3TRSB 4BIFA 1JH5A 4MSVA 4R9BA 4DUVA 1VBA2 1YQ8A 2DVDA 4JDNA 4CDXA 2V73A 2JD9A 4LK6A 1F4AA 5FYTA 1REFA 1Q3EA 3QH6A 2JDKA 1FNYA 5C4WA 4A4AA 5J96B 4GALA 2HEVF 4ZU4A 4QKDA 3B93A 2E32A 1N47A 3AP6A 1VPHA 3ZVXA 1D4M2 2VOTA 2BZDA 4QDRA 4CDQA 4OVEA 1W6NB 2VH9A 1LCLA 1LOBA 4YW4A 1G7YA 1ZBE1 3RZJA 5A6YA 2QQJA 3RG0A 4ES8A 1QJU2 5C70A 4ASKA 2ZACA 1AF9A 4YW7A 3BB6A 1C1FA 3N7KA 2OUJA 4P9YA 3IN9A 5I8SA 5M0TA 1H2NA 1NA1A 4AFBA 5C4WB 3HMYA 3VZJA 2NN8A 3T3YA 1POV1 2RDSA 5K0UA 2WLQA 3B69A 3R4SA 1OKOA 1W6QA 3D3AA 3OG2A 3ZSJA 3FBYA 2RR13 1PIV1 4QB6A 1R1A1 2NLRA 5BNOC 1PVXA 1K5MB 1MZ6A 4AI9A 1R081 3FFZA 4BQYA 2XJQA 5EJ3A 2WO1A 3LEKA 4OULA 4EZHA 2ZJCA 4FPOB 5CZKA 3VKMA 1FPN2 5ACA3 4WZCA 4Y4YA 5CNAA 1RUD1 1ND3C 3AMQA 5K4LA 4K1ZA 5FCCA 4K3UA 1PO12 1VMFA 4JKMA 1I5ZA 4UWDA 2LTNA 2LRPA 3O7OA 4XJ9A 2DVAA 5EIYB 4ZONA 3IDCB 5CBLA 2R7EB 1PNGA 3KV5A 3HR9A 5LATA 3HVDA 5A3MA 2FDIA 2XJVA 3MDPA 5F3EA 3WSOA 3BPSA 3O1RA 1CAUA 4XABA 1OLQA 2R0FA 3KLSA 4XACA 4CEYC 3HOBA 5F3GA 4KWLA 5A1FA 2JECA 5A80A 3LF7A 2YGMA 4CXYA 1OLRA 5JUVA 4KU7A 3WW2A 1AHSA 1LHWA 2ENRA 3MLLA 3NL1A 4JCKA 4UFIA 5FREA 4FAHA 4GWJA 3OCPA 5EV7A 5KWRA 4NRPA 5APAA 4NHYA 1S4CA 5FYCA 3T0AA 5CFCC 3GZUC 2WYSA 3LCPA 5T5PA 4KH9A 4BCUA 3AKSA 2Y6JA 3LSEA 4LTAA 4NRQA 1RMU1 3M1HA 3UKVA 4IEUA 2VQTA 1HXS2 4XXAA 1RGSA 1R1A3 5I0TA 4A7ZA 1UW8A 4CP9B 4Z82A 3D8CA 4TTGA 1YFYA 1AZDA 3WQ7A 1ENSA 4GAZA 1G8WA 2PHDA 1OF3A 1PGW1 1WA6X 4BISA 3NAPB 5A3UA 4A6SA 1W8FA 2MPFA 3ZYGA 2VZ3A 3OYWA 3H42B 3O1TA 3U37A 1O3RA 4BK5A 2WFF1 2RMU1 4KWJA 3KV4A 2RE9A 3RYPA 5IAXA 2WABA 1PVC2 3H9AA 1RINA 2OPWA 3D5OA 1EV12 3ALQA 3SITA 5GZDA 1OT5A 1IQDC 4Q0VA 3RQ0A 1US2A 1IG3A 2O14A 2YB7A 4P08A 2LW8A 1QJX1 3I2GA 3Q9OA 4BQ4A 5CG9A 2VMGA 1TVGA 3POGA 4PIYA 1XPWA 1UYYA 3OYWB 5E88A 1W8HA 1RMU2 5FZ3A 4YZ3A 3PUSA 1H6XA 1OH4A 1SCRA 4L9BA 1UD1A 2WSUA 3DPRC 1WLDA 1UX6A 3OEAA 4IV1B 4CE8A 3H0OA 2JEMA 1OFSA 3MW3A 3WW4A 1YYNA 4ZZ8A 1VBC1 1YJLA 3WP4A 4BU2A 1PGL2 2ZMLA 1BKZA 2JENA 2JG9A 2AEYA 4CDUB 2UWAA 2JX9A 4FPHA 5GLWA 4CUBA 1EV13 1DLLA 5EP9A 5FAXA 4UFHA 4AEJA 1IS4A 4DIQA 2XL7A 2DTYA 3ZYFA 4AGVA 5IVFA 1JZ6A 2ZGPA 3WX5A 1DZTA 2ZKLA 3U14A 5FWJA 1UIJA 3I2KA 2ORZA 3FE5A 3KM5A 2JG8C 2QQPA 1MS1A 1MVEA 1AYM3 4W4ZA 4AQ2A 3ELNA 4FP2A 2X8KA 2DF7A 4UOJA 5FKBA 1OUSA 3KF5A 2BUKA 4XE9A 1ONAA 3FUOA 3SC7X 3KZ4C 1I9RA 2W3JA 4H14A 4AW7A 3LZZA 1UY1A 3UGFA 4Y20B 1PX4A 4NIHA 1BQPA 1W8WA 4QGMA 3POBA 4QPGA 2FDJA 2VECA 4YG0A 4BPZA 2VGDA 4KI5M 4XFFA 2WZPP 1TME2 1LAJA 2W39A 5CG8A 1V6LA 2XONA 2GSYA 2ID4A 2Z79A 1LJ7A 2ZMKA 1CJDA 2ZBJA 3LEGA 3HPNA 4HBNA 4PI2A 4D8MA 1PZ8A 1OPOA 2NMNA 3WZ1A 4CDUA 4IE0A 1ENRA 2EVXA 3UKTA 4CEWC 2R49A 2QDRA 2BYVE 4Q4X2 3WG4A 4Q0QA 2CSGA 2ZGNA 3WDUA 1HW5A 3OUIA 3VZNA 4GZ9A 5HXVA 5F1RA 4N9IA 1J84A 4OMCA 3CNAA 4YZ2A 1ACCA 3ZMNA 2RR11 2ZEXA 3N9MA 3ON7A 2UYAA 1X50A 5C33A 5DABA 3D4KA 1HRV3 2WNUC 5C8CA 1OLMA 1Y9QA 3P3PA 4AEDB 1U0AA 2ZGQA 3DL3A 2BP6A 2OQ6A 4XDQA 5L7OC 3H8XA 1WMDA 3KV9A 3MPBA 1O3SA 3UYJA 1QJX2 4LOTA 3BYWA 3K4ZA 1DQ4A 3JBG2 3FHQA 4YW5A 1Z7S1 3D0JA 3FL7A 3BU0A 4XTPA 5DAPA 2VNVA 2WJSA 3CJIC 4AEDC 3I3DA 1AR92 4CU9A 4ES9A 1NY72 3EQEA 3ZR6A 2A5ZA 3MEPA 4EN8B 3DKQA 1GANA 2J22A 1RUG1 2XKPA 1DIWA 4O65A 2I45A 1UAIA 1WD4A 3AL6A 1LB2A 3EB7A 4J25A 1JI6A 3ECQA 1G9AA 5ABJA 2QFEA 3TEYA 3P3NA 4AXOA 1DQ0A 4BJ0A 1CPNA 2V4VA 4Q0PA 3A7QA 4MXVA 3ST7A 4Y26A 3GCXA 2GU9A 5L19A 2GDFA 4XF9A 5E1RA 1JYNA 1ND2C 1V6OA 2PHLA 3FMGA 5D21A 1OOPA 1AL23 2MEV3 1F15A 2ZAHA 1PK6C 2PHRA 4EN6B 4HXCA 5FLJA 2WRAA 1RVF1 3ZXEA 1WUVA 1UN1A 3DGTA 4HK9A 4YVWA 4ZS3A 1IG0A 1W04A 3T2QA 4MLOA 4AVCA 3VBSB 3JD73 5IJRA 3VBUA 1VLNA 4UW6A 1B35A 1NQDA 3UGGA 1O3TA 3B94A 1VBA1 1JTZX 1NA1B 3C7GA 3RFRA 3AVRA 1DHKB 3J7LA 3KB5A 3PMSA 1Y7BA 5C9AC 3VUOA 1HXS1 3ZFFB 4BYYA 2C4XA 4LO8A 5LB6A 1KD7A 1W39A 1XJAA 1N3OA 2Q1FA 2RM21 2W2IA 4Y4RA 3V65A 4Y1VA 1IPJA 4GULA 1NG0A 4IEYA 3VBHA 2RS33 1FV3A 2VBPA 2WL1A 1ZBA1 1NLRA 1LOFA 1UU4A 2HWB1 4NR1A 5T5JA 5C9AB 3G6JB 4Q4W2 1PK6A 2C24A 5A32B 1JYIA 5K0UC 2WSVA 1FOD3 5F2WA 4Y3OA 5SV5A 2GZWA 4M3CA 4K1YA 3WF1A 2EXJA 3OEBA 5LY2A 4CYDA 4DS0A 3T2OA 4IV3A 4Q4Y1 2JDUA 3KMHA 4JTOA 3BOPA 4CUCA 4LT5A 4PF5A 1W8NA 4FBFA 1NY71 3A4UA 5A3PA 1W99A 5J48A 4QQ2A 3KT4A 1OLME 3SCHA 2BW8A 1DYKA 1OVPA 2HYKA 2XJUA 3NQHA 2UY8A 4PLMA 4U2AA 3VZKA 4Q4W3 4XFBA 3ZIWA 4ZXEA 2TEPA 3WUDA 1J1LA 3MICA 5IVVA 2C1FA 3CLPA 4AR2A 3O1MA 1LOFC 3TN92 4V2VA 2UY9A 3PUQA 5DG2A 4G9SB 4GWNA 1D4VB 2EICA 1LODA 2JDPA 2QQUA 2VJXA 3MFAA 1ENXA 4HMZA 1SFPA 1V0AA 2ZGRA 5FZOB 5FXZA 4Q8KA 3ACGA 3NAPC 4OZOA 2XBO3 2CNAA 1DGRN 3N9QA 4NE9A 1NX9A 1HB3A 1YQ2A 2BJSA 4CU7A 2JKBA 2DVGA 5BNPB 5L73A 2GNMA 5D8AA 3WNOA 1ENQA 3ZIXA 4URAA 4UW4A 1NCRB 4NIIA 2GC0A 1GZ9A 2W1UA 1H2MA 1ST8A 4EYUA 1CAWB 2HJIA 2FZ2A 5D1IA 4CEYB 4CCNA 3TOJA 4XHXA 3WT3A 5FY0A 5FZLA 4AHYA 3UK9A 1W6MA 5D2AA 1JOPA 4JHTA 3DYMA 4XFGA 2JDMA 3J4UH 4COWA 2YUEA 4QQPA 4R9AA 2Z5WA 3GJBA 1D4M3 1RXGA 3UGHA 2CDPA 4QQHA 1DCSA 4D7TA 3IAPA 4E4DX 3E6CC 3B9CA 3DYOA 4LBLA 3B00A 3EO6A 4Q4V3 3V0AB 1QEXA 4L11A 1OD5A 2YC0A 5FP3A 2F4PA 4MG2A 3QOPA 2EA7A 3LB9A 4TYSA 5L9RA 4HANA 3T09A 5AC91 4H2AA 1XU2A 4QHBA 3I7DA 1YRZA 2CAVA 3SCGA 4OHXA 3ZR5A 3NV1A 4RR3B 4EN7B 5FPXA 5JI9A 1WW7A 3FFQA 5CFDB 5F5QA 1GP5A 3ZFEB 1F35A 4IEVA 3ZDVA 4OI1A 1V6JA 1C1LA 1GKBA 2ADEA 4LIUA 1GQPA 3TEWA 4WZFA 4BLIA 4MGIE 1UPIA 4WVWA 4PHZA 5KHKA 1YO8A 2XDVA 3NRUA 3I4IA 4J1XA 3RZZA 3LDKA 3KF3A 4NN0A 4ONUA 3ZFEC 1H8VA 4COVA 2A1XA 1QNYA 2WFF2 3J9SA 2W92A 3S5AA 5FV3A 3W5MA 5JMCA 3POEA 3AMMA 5T5OA 4GMP3 1Q8VA 4OLLA 2WINB 1BMV1 4LBMA 3OBTA 1UO9A 4K8RB 4EV0A 1UPSA 5C3RA 4BQWA 3OB8A 2BEOA 2YHJA 1XYOA 3MGUA 2IVIB 3POWA 4XF0A 5F6LB 3DXTA 2HWB3 4OUEA 4IESA 2J42A 2BFUL 2WUHA 4KQ7A 1L3JA 2VOKA 3DPRA 1UOFA 5CKNA 5I8TA 1XNCA 3JB4C 2WBKA 2WZR2 3QLQA 4JDOA 3U07A 4AI1A 1NYWA 1QJY3 2CAUA 2JG9C 1COV1 3MF9A 3K2OA 3ZXKA 1LEMA 4AHWA 4KBBA 1QDCA 1R64A 3SH5A 3IIAA 2IXIA 2DFCA 1QIQA 2JDAA 2R043 1OA2A 3ZDSA 2RS11 2Y26A 1W2NA 3QACA 3JUUA 5A1LA 2P6CA 4M3CF 3OY8A 4AEDA 4ORFA 2GNBA 2R32A 1YNAA 2GMEA 5G04L 5JOYA 1MQTB 4RFRB 1OKQA 4CP0A 2EIEA 1D7PM 2H6BA 4AOCA 5A7WA 3H8OA 1QJFA 3N9OA 1POV0 1H8TA 2JJ6A 4XW3A 3VZMA 2G19A 3PIJA 1ZVFA 3VL9A 5ABJC 4N90A 5FJHA 4YW6A 3KQRA 5KXDA 3WNLA 4RHV2 5I0UA 1EPWA 4XCAA 2XR4A 5T54A 1ZZCA 3SISA 1SDDB 4L0PA 2WFF3 2WWUA 1OSGA 4M3CB 2F17A 5DUXA 2VQ0A 4IXLA 2GP3A 3URFA 1ASJ3 3PVEA 3ZO0B 1HRI1 4CDWB 2OW4A 5FZGA 2B5HA 1RYYA 2VAUA 2GNTA 4PT6A 2E6VA 3BUCA 3CJIA 5FFOC 2WNOA 3VBHB 1RUC2 2W68A 4GA9A 4ATEA 4AVVA 3ZYHA 4WVMB 3O12A 2OZJA 5C7GA 1XNDA 2VE1A 4PI0A 5C71A 5ACA2 1WZXA 1Y43B 1UZ0A 5CVRA 2BOJA 3AFGA 3VHOA 3KCXA 2DYCA 3RZKA 1PO13 1H8TC 4GJZA 4QD2A 2WNVA 4Z2AA 1V6IA 4XZUG 4MXWB 2EIDA 1PO23 2Q5TA 1A78A 1TMF2 3LDBA 3W59A 1SLLA 4LQRA 2PHFA 4I0BA 2XWBB 1CVNA 2BOIA 3AZXA 5C8CC 2EF6A 3AZYA 3VDDA 1SPPA 1UU6A 3FUQA 5A3TA 1UZWA 3WQ1A 2W1QA 3FLRA 5F5IA 4C8DA 4X6QB 1W6PA 4BH9A 4N9HA 5JLVA 2ET1A 5GM0A 5DXDA 2JXAA 4URTA 2V5YA 3KHBA 2IZWA 2RS31 3PL0A 2A6YA 2JDHA 4F3JA 1WW4A 5FZ0A 4UT5A 2JD4A 1MEC2 3AKQA 3PHMA 3MHZA 5FLIA 1CR7A 4CDWA 4CSWA 2D6OX 4C1WA 3B3QE 3IDAA 3LDRA 5GKAC 5FY5A 4LHNA 1H1AA 3ZMOA 1DU3D 2ARCA 1F5JA 2G9ZA 2KA3A 1I5PA 1GYKA 3SH3A 4DXTA 1W2UA 4Q4X3 2VOWA 1LENA 1AR71 3AM2A 5AFBA 5K8SA 3USUB 3I97A 3V56A 3VN4A 2EALA 2XL9A 4CCKA 2RJ2A 5HCAA 5K0UB 1GP4A 3FX3A 2VTXA 3S0MA 2E53A 3RYRA 1W6OA 2YFUA 2D6NA 3ETQA 3NV2A 1QQP1 3K77A 4MXWA 4NPMA 4ET7A 3ITQA 1MACA 4XAAA 2O8QA 2W9XA 3NMBA 4JGZC 3HT2A 3ZYBA 1LHVA 4XUOA 2K46A 1W6MB 2WFPA 3ZM8A 3D82A 3H8RA 1JS9A 4LBJA 2VR4A 4YVWC 3USUA 4KL1A 2BERA 1UWWA 1AR73 2EXIA 4XMIA 5A33A 4EWEA 5C8CB 1WCKA 1U5ZA 1YJKA 3VB9A 1RUJ2 4FFGA 3WV6A 1LOGA 1KDMA 2ZTNA 3HWJA 1ZZ9A 4JV4A 2Q8OA 3V0BA 1AX0A 2I2SA 1S0BA 1ZRCA 4N8MA 3HQXA 1BXHA 1DGRA 5F5AA 4LBNA 3AYCA 1SBDA 3M8LA 2Y0IA 1FV2A 2VVEA 3LEIA 3OUJA 3VKLA 4XF4A 4YG6A 2P37A 1PZ9A 2A6WA 1VBC2 2VZRA 1UQXA 3CL1A 2MHFA 4PF1A 1AR91 1FPN3 3PTYA 2FCUA 1H1MA 3FLTA 5HPOA 1VIWB 1W3XA 4PDWC 4AGRA 4AZZA 4DUXA 2HWC3 1FAYA 5FO7B 4K6BA 2QQNA 4C0HA 1E57A 1LU1A 3O0WA 4YGBA 5FYSA 3IWZA 5GZFA 1F31A 5F37A 2HWD3 1OC1A 3S30A 4KBZA 2CGOA 5F6KA 5CEHA 3OGSA 3OSDA 4PJYA 1XNBA 1RUE3 2G9GA 2GC2A 2MEV2 3I54A 1QJU1 3IMMA 3KVBA 5D8AC 3ACLA 1JYVA 1KDKA 2VG9A 4QX0A 3NNLA 1EAH3 5IYYA 5LY1A 3T4HB 3TNPB 1OOPB 2IXKA 1JYTA 1PZ7A 1NE4A 4LORA 1WCDJ 2DCJA 2EIBA 1E5SA 2VCCA 4CXXA 2J1UA 1V70A 2HWC2 4O61A 1R082 3VD5A 1JYCA 4BM8A 4AVTA 4LE3A 3H3ZA 4UBGA 2PTMA 2WT1A 2NYYA 3K4DA 1VB2A 2GC1A 3AYDA 3LFMA 5KHGA 2A3WA 5A3LA 3DUIA 5C3OA 3PJQA 1J58A 1VR3A 2JKXA 5H9QA 4NIGA 2RJLA 1ULDA 4UFJA 4MGYE 3S57A 2YMZA 1AVBA 1N3QA 4FTBA 3SLIA 1OH3A 3WXPA 4JC1A 2QQIA 4IV1A 2GC3A 2V09A 5JI7A 1LULA 1LGBA 4PIXA 4LNVA 4BMBA 4JGYA 5GJ6A 1HRV2 4SBVA 2D40A 4W50A 1RJ8A 4FPLA 4P02B 1DQ6A 1RJ7A 3EXUA 1DGWA 4AI0A 1CESA 5EXOA 4QXHA 3WY6A 1HKDA 3O1VA 4QU2A 5A70A 1MZ5A 1X9TA 1SLIA 4F8AA 2G9FA 4MGQA 3MLJA 4RGGA 5A3OA 4CUGA 1SLTA 1OQDA 2ARBA 1WKYA 1W9YA 3DN7A 4FFIA 3WNNA 3ZFGC 1HN0A 2YROA 3N9PA 3M3EA 1TE1B 3BTYA 5FKCA 4QQOA 2N7GA 3QBQA 1KFXL 3NV3A 4XUTA 2HWE3 1H6YA 3K3NA 1MPXA 1WLWA 4LMFA 1V6NA 2ZEZA 1ZM1A 5FJKA 3POIA 2PXJA 2WNVB 3C8XA 4UYBA 5A7SA 4IDZA 4XF3A 1W8TA 2AREA 2A6VA 2JICA 1CX4A 4QX5A 1S0EA 2QQOA 2VTXJ 2BBVA 4GIQA 4RQPB 3BPZA 4KGGA 4XILA 2RVAA 4GH4A 4HVQA 4JGYC 4KGQA 3WOGA 2CWSA 4NRMA 4E27A 2VZSA 4FSJA 2A6XA 1UOGA 2ZAAA 4Q4W1 4JRLA 1NZCA 3L9JT 1QXPA 4Q26A 1ZBA2 3I3BA 2DCYA 5LK7B 2SBAA 2JDNA 3ZLIA 1PM4A 1PVC1 4HVRA 4QM9A 2W47A 1BVVA 1GWKA 2ZKNA 3EJKA 4NROA 5C3SA 1NCQB 1O4TA 5J98B 5FZDA 1YFXA 1V9U3 3KVAA 1AUYA 2A7AA 1Q8PA 2X10A 4R52A 1O4YA 5DUVA 1SZBA 1JU3A 5IAVA 1QDOA 2G1MA 3MIFA 1BBT1 5J3UA 3JZVA 2VUJA 1C5HA 2HEWF 2XQRA 4MGSA 4AG4A 3RNSA 2GN3A 5LRRA 4Y1UA 4IW3A 4AE2A 2Y0OA 1Y3TA 5JVVA 4QKFA 4EROA 2XPJA 3LPFA 1UMHA 2RS53 2VMDA 3AJZA 4JKKA 2RS12 2VQUA 1Z78A 3IDEA 4HZFA 1X82A 3I3QA 2HWC1 4IGPA 3RS6A 5I0SA 3DCQA 2JG9B 3PUAA 3FHAA 3W9AA 1NLQA 1RUD2 3OBAA 1S0JA 4FOVA 5H9RA 4QPWA 1MS5A 2WN2A 3KSCA 1ZX5A 1JHJA 4X6RB 4Q4V1 2B7YA 1W8OA 2GNDA 2X29A 5DUUA 1SDWA 2W94A 2H0BA 1GNHA 1QJEA 1US3A 2XXZA 2YV8A 3O5SA 4UI9L 5F5CA 1ZNPA 3V0AA 4N7UA 5A6ZA 3VBRC 2FMYA 3VZOA 4CEWB 4DEQA 1HJFA 2WYFA 2VPVA 4Y22B 1JZ4A 2R1DA 1QGLA 5DPNA 2VZ1A 2CV6A 1CONA 4OFGA 2Z42A 3ZXFA 1QJZA 2XHNA 1SCSA 5FP4A 1NQJA 1CWPA 4N53A 4GB33 2PLV2 4FPJA 4QPIA 1NAEA 1NCQC 4L92A 1YEWA 2Q4SA 4LBOA 2JIJA 2VU9A 1WBFA 1VAMA 2ZGSA 3LD8A 1BK0A 5KXBA 3SNMA 2AUYA 4Q27A 2R072 3HNYM 5K7PA 2CWMA 1IS5A 4JTNA 1F5FA 2WT2A 3MUZ1 1SG3A 2ZX4A 3TN93 1O3QA 5E6HA 1CAXB 3TAYA 1A34A 5FZBA 5EQUA 1UY0A 1AXZA 5FZ7A 1UY2A 3F2ZA 1QOTA 2E33A 1TZOA 3VBFA 1JYXA 4YW3A 3MLKA 1DYPA 2AYHA 4Y1ZA 5LK5A 2WZR3 1S2BA 3VBOC 1H2LA 2ZZQA 2JB8A 4EQVA 4AL9A 1QY4A 1KRIA 2PLV1 2XOMA 5FZ8A 3ZX7A 4LXLA 4QPIC 1SEFA 4P9IA 3INAA 2DBIA 1ZZ6A 2D7FA 1MS9A 1C3HA 2HWE1 1AYN3 4QDQA 2QZ2A 1ZA4A 3IDBB 2CDOA 3H3LA 1V6MA 5BY5A 2WLPA 3I3MA 2BV4A 2VD7A 4CU6A 2GH8A 2UURA 3B5LB 4BMEA 5FY4A 2C9AA 3NNFA 3QD6A 4O9GA 1UZVA 2CYFA 4IUGA 1AYM1 2D6LX 3E5XA 5IVBA 5LWBA 5DAXA 1FOD1 4BIOA 1JUHA 4HG6B 1NOVA 1QNWA 1CQ9A 4HN0A 1QOOA 4MGTA 2Z2SB 3PDQA 4JGZA 1GSLA 1VP6A 5JXJA 3N36A 1GUIA 2XMLA 4ZU5A 2YYOA 4RS5C 4A3XA 4G4FA 3BN6A 4QGNA 2V5DA 4YZ4A 4CP9A 4Z1VA 4Z2WA 3CDZB 1ZZ8A 2IWGB 2BWAA 1H4HA 3CF6E 5FYBA 1ASJ1 1ZZ7A 1EUUA 4MV2A 3ZSEA 2Z4FA 3GM8A 4W65A 5L9VA 5FPLA 5BNNB 1P8JA 3HT1A 4WBBA 5JIUA 1YI9A 4BHPA 2J1RA 3CJXA 4JGZB 4BB3A 2VC9A 1QJX3 1MVQA 3OBRA 1RUH3 2OIIA 3SCFA 5A6XA 4AI3A 3VBOB 5C5UA 5LBFA 4YVWB 4AHZA 1X36A 1ZZBA 2J1SA 3PVOA 1OURA 4AK3A 1ND2A 1IZ3A 1O5UA 2QBXA 5JSRA 3LWCA 1IS6A 3MYXA 3BIWE 4QGLA 3KT7A 1CZTA 3CMGA 3T30A 2NP0A 1AR62 5I91A 3SH4A 1S0GA 5D8AB 4B4RA 3I49A 1IKPA 3ZSLA 5KC5A 1DYOA 1HRV1 1Q8SA 1QMJA 2A6ZA 1VE0A 4NHMA 1C5IA 4LEJA 4C1XA 5LCWL 2ZGMA 3B9IA 3T2TA 3FN9A 4HPKA 2E63A 4XHBA 3RZMA 3VBUC 1EV11 1XU1A 5JOWA 1E5IA 4META 4AEKA 3T0DA 1ZBE2 1ZRRA 4LBKA 1GWMA 1BK1A 2QQLA 1QJY2 2DBNA 1MEC3 1GZWA 2VW1A 5C9AA 5ANQA 3DF0A 3I2DA 1ULPA 2NZ9A 1V00A 2JDZA 1S55A 2XJPA 2R6QA 3AL5A 2YPJA 2G4IA 3WVJA 4F7ZA 1YLLA 3GBWA 4OZXA 5JR2A 3LOBA 2RS51 3GNEA 4MGKE 4PBOA 4QWNA 1UYXA 1W05A 1DGWX 4Q4Y2 4Z8BA 3PUHA 1IKQA 3JD71 3SEEA 2FCTA 1BYHA 1PIV2 2HWF2 4NVPA 4XDPA 1QWRA 2UU8A 4LO5B 4WM8A 5DN2A 4B3NA 4CUAA 4DUWA 2W5FA 4TSVA 1GZWB 3WF3A 5KR7A 1AXKA 5KC6A 1D2SA 3VDDB 1RUH1 3ZYJB 1J1TA 4FCAA 1YI7A 1AR83 2KD7A 2ZA9A 1YUDA 3CEWA 3FBMA 5FZEA 4CTEA 1RUH2 5BNOA 1AX2A 4YZ1A 3ZSKA 1OA4A 4Q4V2 5HI0A 2K2SA 3MFCA 4XJ8A 3MIGA 2VZUA 4YG3A 5LA0A 2YDEA 3PNAA 3POYA 3H8UA 5HV4A 2XH6A 3VLBB 3ROUA 4N7IA 4DFSA 5GALA 4QPYA 2P2KA 4AFAA 1PIV3 1AR63 2BNNA 4IV3B 4CCLA 1C8NA 5F7UA 2ZCWA 2D3PA 4IEQA 3OPTA 1ODMA 3ZKYA 5LW9A 1K3IA 1VAVA 3H3UA 3M3OA 3UL2A 5IK5A 1LRHA 2XJSA 1EAH1 1PNFA 3WP5A 1JBCA 1HN1A 3LFIA 3WP6A 4DXRA 1M06G 1NLSA 4EZ4A 4C91A 2DWRA 5JAXA 5DZEA 5AFEA 1CAVA 1ZBE3 1QJU3 3THCA 4UW3A 2FDGA 3NKGA 3FHIB 3OPWA 2KR2A 2E26A 2VOVA 2ZPXA 4BK4A 4NIDA 4NWVA 4Y20A 4UFMA 4Y5TA 3T2PA 3SEPA 4R9CA 1JYWA 1O4ZA 1XC6A 2BRTA 2D6KA 5F39A 4KNCA 4AI8A 5ERLA 5FOJB 1BVP1 4OI4A 4J6GA 2VW2A 2FBEA 4ZY9A 4UF0B 3JU9A 5L9BA 3A22A 1Z0HA 1K5MC 5FXXA 2J7MA 5FUIA 1UKRA 5EJ1B 1J59A 3ZFGA 4B4PA 5IFPA 1EAH2 2D6MA 2OXBA 4W6YA 2UYBA 1N1VA 2WWJA 1MQTA 3CZJA 3POJA 1J3RA 3N7JA 2RHPA 4LKSA 2QQWA 3V0BB 1V6KA 2Y60A 3IB3A 2VTFA 3WP3A 3GCWA 5GZCA 3H1YA 3E6DA 2YBKA 2NPIA 4AAXA 2R042 3DV8A 1SLCA 5FZ4A 3I3EA 2Q8EA 3U10A 3DKWA 2ORXA 2X5IA 4WV8A 2D5HA 4M0NA 1KEXA 4ZZ5A 3MF6A 3WG3A 3ZN5A 4HKWA 4CEYA 1POQA 4ZKTB 4DEVA 4BA6A 5FZCA 1RVF3 2DUOA 4YM3A 1QQP3 4FPFA 3NVCA 5BV6A 5CADA 2WS93 2EXHA 1LHNA 3GGLA 5AC92 3UNPA 4P9XA 3X29B 4MADA 1D0HA 4COYA 2WWSA 5JCTA 1ZRDA 1TQ5A 4EN0A 4CDXB 3IKWA 1DQ2A 5A7NA 4TLGA 5IVEA 4Z07A 2XWJB 5KHJA 1YHFA 3PURA 1ASJ2 2ZHMA 3LOIA 3I2IA 4QXCA 4DY3A 5ABJB 3BTZA 3BI3A 1HX6A 5ACA1 4I09A 2WA3A 1O91A 3C7EA 1DFQA 4R9DA 5CKQA 4AYUA 1HV1A 3WCSA 3B02A 5DQ0A 1BHGA 1XYNA 1ND2B 2OX0A 4LO7A 3O1SA 1WCSA 1DLCA 3K51A 4XBLA 1RTVA 2BQPA 3UJQA 1RIRA 4D6QA 4FQZA 1WMXA 1GZTA 1H2KA 1PK6B 1N1TA 4BE3A 2XLFA 4XAEA 3E6BA 1K5JA 4WVVA 1UXXX 1Y9MA 2UWBA 3LIHA 3U4XA 1GFF2 5CAZA 4GXLA 4TLFA 4COZA 3R4DB 4ARYA 4OHYA 2R062 3DPRB 4RHV1 2RDNA 1LHOA 1GMMA 1KJRA 4RN5A 4GH4B 3JQWA 4NHLA 3VBOA 3PMEA 1Q5OA 1IHMA 3M3CA 4YM2A 4CCCA 3C2UA 4QXBA 3BGAA 3J8F1 1ZA7A 2ES3A 1PM7A 4XMAA 2W91A 1HV0A 5FUNA 5JPMB 1RXFA 3NSTA 2P3KA 1PVC3 4XXPA 4CA9A 1D2QA 4CXWA 3S7EA 4DXSA 1NCQA 2ZX2A 3RYKA 4NIAA 5JXHA 3ILRA 5GZGA 3S7IA 4PLNA 2JG8B 1S1AA 1BEV1 2WKKA 1LKNA 5FYMA 2ZX3A 3PVNA 1X8EA 4K7JA 5IHRA 3AB0A 3ES1A 2Z69A 2BBAA 3GZEA 3JCIA 4FFHA 4XVHA 2HLEA 2AH2A 3AYAA 3MIDA 4IEWA 4U36A 3HD8B 4AVSA 2C0ZA 2ZGKA 4FVVA 4A7KA 2C26A 3ENRA 4QM8A 4HFSA 3VKFC 5FLHA 4YM0A 2RR12 1ALYA 5DAVA 1X9PA 2VMCA 2XLAA 3LKJA 3C7HA 2R0HA 4DPNA 4P9JA 1XE0A 1KGYA 1JHNA 5J36A 4LKFA 4G3YC 1VBE2 1RUOA 1IS3A 5C3QA 4RHV3 4XIOA 1RUJ1 4WM8B 4BLJA 1HB1A 1OD3A 2AZ5A 4LBQD 4PDWB 2ZEWA 2QKDA 2XUEA 4ARXA 5GLUA 5G05L 3WDXA 3Q8CA 2D5FA 2Y6FA 5BNPA 1LEDA 2FDFA 1ZRIA 5FZMA 4S2FA 2R063 4WVMA 1VBB1 3VL8A 2PLV3 2HWE2 4I0AA 3PUIA 4EN9B 1AJKA 4CCMA 4QXKA 1GOGA 1ODNA 4QU1A 5FWEA 2KM2A 2A70A 2VNRA 2AR6A 2L9LA 2W87A 3I2FA 1XRUA 4LLOA 5LRSA 1GV9A 4WM7C 1PHMA 2QE3A 5JMOA 3DEMA 4LLFA 4PCRA 5DG1A 4ASLA 4QX3A 3AKTA 2XB6C 2Q1MA 3HQUA 4RS5A 4OMDA 4CP2A 3NAPA 4W6WA 2R061 2R16A 1RUF3 4EE2A 5CISA 1HIXA 3ME2A 4BXSV 4FPGA 3ZFGB 4E2SA 5HXMA 1XSRA 2DCTA 4FXKB 4GMP1 2BGCA 5DMYA 2K9ZA 3MV11 3LAGA 1WW6A 4HN1A 1V9U1 5FZFA 4YZ5A 3ATGA 5FR3A 1WGPA 1UMZA 1HB2A 4N53B 3U0ZA 3FJSA 2PN5A 5LBBA 1REEA 3DECA 1FYUA 1LNSA 2OZ6A 2PHWA 3W20A 1UF2C 4HKLA 2OKXA 1WA4A 5A33B 2ZXQA 2E7AA 2X05A 3QH7A 1TME1 3MIEA 4JKLA 1JZ3A 3WF4A 4WM8C 1WCUA 4L8QA 2JDYA 3O1PA 1O5LA 5LBCA 1KQRA 4OHZA 5GLVA 3S5QA 1YWKA 4FQ4A 3O0VA 2O1QA 5A7PA 2HYXA 3IZOA 1RMU3 1WD3A 4JHZA 3M3QA 4D3WA 1NKGA 4IV1C 4Z92B 1DDLA 4Q2FA 4Q5OA 1NXD1 5FIXA 5FO9B 1GWLA 4X8PA 3AZZA 1XSQA 2GP5A 5JZGC 2P3IA 3KCYA 1GQGA 2VMFA 4YSFA 1H1IA 2CGNA 2YC4A 2Q1ZB 4XPVA 5GLZA 4XBQA 5FP9A 2D44A 2W1WA 4UW5A 4XQWA 3RZGA 5IW0A 1W6QB 3UESA 2ZHNA 5J1XA 1AYN1 4XUNA 1BBT2 3GALA 3NO8A 3D6EA 1WCQA 2OVUA 4FOWA 3CO2A 4AF9A 1F8VA 2Y6GA 3VHNA 1W90A 3I8TA 3ILFA 3Q8BA 4Q1PA 1T6GC 2YFZA 4KG8A 4PBPA 5LA2A 2B9VA 4LHKA 1W3VA 3GHNA 4HSLA 5L7OB 1G9DA 4LITA 1H9PA 4NWWA 5BUVA 2VY0A 1TNRA 4E2QA 1BCXA 1FOD2 2JB4A 1GZCA 1SBEA 1TME3 2ARXA 3AXDA 1ULEA 1ND3A 1XOYA 2VZOA 3MV01 2LROA 4H7LA 1MZFA 5LEJA 2A73B 5SV8A 4QKNA 2PAEA 4RL7A 2AGSA 2OPKA 2RM22 2VQAA 2GN7A 4JZRA 4I01A 4AI2A 4K20A 1C28A 5F3IA 4XFCA 3RI8A 5JXIA 1X7NA 1PMJX 1XXNA 3HN3A 1V9U2 3U11A 5I0DA 2ERFA 5IFTA 3A23A 2V4AA 4D69A 1W6NA 1JN2P 5EYXA 4DOUA 3ZN6A 3VBFB 5IVCA 1JOBA 1GNZA 4DRRA 3AKRA 2D97A 1O59A 4A6OA 1IQAA 1VBD2 1YQCA 4LOSA 1RHI2 2QUOA 5FK8A 1X33A 4Y33A 5IUQA 2R041 5FY8A 3POSA 4D6RA 1F4HA 2XBO2 2RS13 3VHRA 3ZXLA 4XBNA 4CZSA 3NNJA 1F2NA 2VCMA 2VZVA 2X09A 3UJOA 2FDHA 4N43B 2YXSA 4QPGC 4A3ZA 5FMDA 3MZHA 2QZ3A 2QTWB 1Y4WA 3RJRA 3RMYA 1K42A 2P6HA 2LUWA 4IQPA 3VBRA 4YFWA 2FD8A 4Q29A 2Y8KA 4YFZA 1BZWA 2VOXA 1A8MA 1POV3 5JOZA 1SMVA 4CP1A 1FMD2 3AMNA 4AFMA 5BNOB 4IE6A 2IFWA 3ZFFC 1GOHA 1Q43A 2FZ1A 1SBFA 3TWIA 3UKNA 2QQKA 4GWMA 4XEZA 2TNFA 1VBD3 4RSUA 4DINB 1VBB3 5CU1A 3P5BA 5TSWA 2B4KA 3ZOIA 2CHHA 4O9EA 3LSDA 2WNEA 4LIVA 5LBEA 3WW1A 3G7DA 4GH4C 2ATFA
chains in the Genus database with same CATH topology
2YU1A 3KV5A 5A7SA 5A7PA 4NUBA 3KV6A 5FZOA 4CCLA 5F3EA 5F2SA 5FYZA 5A3PA 3K2OA 3OPTA 4QXBA 5LW9A 5F3GA 2VD7A 5FY9A 5A1FA 2GP5A 5FY4A 5A80A 5A7QA 4TN7A 2Q8DA 5IVBA 5LWBA 2OQ7A 3N9MA 5FUNA 5IVVA 4EZ4A 2YBPA 2YPDA 3ZLIA 5A1LA 3AVSA 5FP9A 5FYCA 4V2VA 3OPWA 3PUQA 5FZ9A 3PDQA 4XDOA 2OQ6A 5FZDA 5A7OA 5IW0A 3KV9A 5FYUA 3KVAA 5FYMA 5F5AA 2XMLA 4GD4A 5FZOB 5FXZA 5A7WA 3UYJA 5FPBA 5FZIA 3PU3A 3N9OA 5F39A 3N9QA 4GAZA 2OS2A 5FJHA 4IGOA 2OT7A 5FBJA 3U4SA 5FYBA 5FUPA 4UF0B 4BISA 2P5BA 5FPLA 3PTRB 5FXXA 5FPAA 4LITA 4URAA 2WWUA 3U78A 4E4HA 3KV4A 4IGPA 2YBSA 2GP3A 3PUAA 4CCNA 3AL6A 5FYSA 5FZ6A 5FY1A 5F3CA 2WWJA 5F37A 5FY0A 5FZGA 5FZ1A 5FZLA 5FPVA 4QX7A 5FP8A 5CEHA 5FZAA 3RVHA 3KVBA 2YBKA 5FPUA 3NJYA 4BXFA 5FZ3A 2XXZA 5FZ4A 5IWFA 3PUSA 4UF0A 5F5CA 5IVYA 5FZMA 2Q8EA 2Q8CA 5FZKA 5LY1A 4EYUA 5IVJA 4D6SA 5A3NA 5FYTA 2YU2A 5F3IA 5FYVA 4BU2A 4V2WA 4GJZA 5FP3A 4CCMA 1VRBA 4QU1A 5FXVA 5FWEA 5FY7A 3N9NA 3LDBA 4HOOA 5FP4A 5FZCA 5FYIA 5FYHA 4DIQA 5IVCA 5IVFA 5ANQA 5A3TA 5FXWA 4ASKA 5F5IA 4LIUA 4C8DA 5FWJA 5A7NA 4Y33A 5ISLA 3AL5A 3LD8A 5FY8A 5IVEA 4D6RA 4DO0A 5F32A 3AVRA 2XDVA 3PURA 3DXUA 4QWNA 4QXCA 3ZPOA 5FZ0A 5A3WA 4XDPA 4Y4RA 5FZFA 2W2IA 5E6HA 4QXHA 4CSWA 3PU8A 5FZBA 5FZ7A 5FV3A 5FY5A 5FZHA 5KR7A 5FP7A 4CUGA 4AI9A 2OX0A 3K3OA 4QX8A 5A7WB 4EZHA 3N9PA 4IGQA 4D6QA 5FZEA 4AAPA 5K4LA 4GJYA 3K3NA 3N9LA 5F2WA 4Y3OA 5FYYA 3DXTA 4CCJA 5FZ8A 4HONA 4LXLA 4LIVA 5FJKA 5LY2A 4CCKA 2PXJA 4CCOA 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU1 A;  3KV5 A;  5A7S A;  5A7P A;  4NUB A;  3KV6 A;  5FZO A;  4CCL A;  5F3E A;  5F2S A;  5FYZ A;  5A3P A;  3K2O A;  3OPT A;  4QXB A;  5LW9 A;  5F3G A;  2VD7 A;  5FY9 A;  5A1F A;  2GP5 A;  5FY4 A;  5A80 A;  5A7Q A;  4TN7 A;  2Q8D A;  5IVB A;  5LWB A;  2OQ7 A;  3N9M A;  5FUN A;  5IVV A;  4EZ4 A;  2YBP A;  2YPD A;  3ZLI A;  5A1L A;  3AVS A;  5FP9 A;  5FYC A;  4V2V A;  3OPW A;  3PUQ A;  5FZ9 A;  3PDQ A;  4XDO A;  2OQ6 A;  5FZD A;  5A7O A;  5IW0 A;  3KV9 A;  5FYU A;  3KVA A;  5FYM A;  5F5A A;  2XML A;  4GD4 A;  5FZO B;  5FXZ A;  5A7W A;  3UYJ A;  5FPB A;  5FZI A;  3PU3 A;  3N9O A;  5F39 A;  3N9Q A;  4GAZ A;  2OS2 A;  5FJH A;  4IGO A;  2OT7 A;  5FBJ A;  3U4S A;  5FYB A;  5FUP A;  4UF0 B;  4BIS A;  2P5B A;  5FPL A;  3PTR B;  5FXX A;  5FPA A;  4LIT A;  4URA A;  2WWU A;  3U78 A;  4E4H A;  3KV4 A;  4IGP A;  2YBS A;  2GP3 A;  3PUA A;  4CCN A;  3AL6 A;  5FYS A;  5FZ6 A;  5FY1 A;  5F3C A;  2WWJ A;  5F37 A;  5FY0 A;  5FZG A;  5FZ1 A;  5FZL A;  5FPV A;  4QX7 A;  5FP8 A;  5CEH A;  5FZA A;  3RVH A;  3KVB A;  2YBK A;  5FPU A;  3NJY A;  4BXF A;  5FZ3 A;  2XXZ A;  5FZ4 A;  5IWF A;  3PUS A;  4UF0 A;  5F5C A;  5IVY A;  5FZM A;  2Q8E A;  2Q8C A;  5FZK A;  5LY1 A;  4EYU A;  5IVJ A;  4D6S A;  5A3N A;  5FYT A;  2YU2 A;  5F3I A;  5FYV A;  4BU2 A;  4V2W A;  4GJZ A;  5FP3 A;  4CCM A;  1VRB A;  4QU1 A;  5FXV A;  5FWE A;  5FY7 A;  3N9N A;  3LDB A;  4HOO A;  5FP4 A;  5FZC A;  5FYI A;  5FYH A;  4DIQ A;  5IVC A;  5IVF A;  5ANQ A;  5A3T A;  5FXW A;  4ASK A;  5F5I A;  4LIU A;  4C8D A;  5FWJ A;  5A7N A;  4Y33 A;  5ISL A;  3AL5 A;  3LD8 A;  5FY8 A;  5IVE A;  4D6R A;  4DO0 A;  5F32 A;  3AVR A;  2XDV A;  3PUR A;  3DXU A;  4QWN A;  4QXC A;  3ZPO A;  5FZ0 A;  5A3W A;  4XDP A;  4Y4R A;  5FZF A;  2W2I A;  5E6H A;  4QXH A;  4CSW A;  3PU8 A;  5FZB A;  5FZ7 A;  5FV3 A;  5FY5 A;  5FZH A;  5KR7 A;  5FP7 A;  4CUG A;  4AI9 A;  2OX0 A;  3K3O A;  4QX8 A;  5A7W B;  4EZH A;  3N9P A;  4IGQ A;  4D6Q A;  5FZE A;  4AAP A;  5K4L A;  4GJY A;  3K3N A;  3N9L A;  5F2W A;  4Y3O A;  5FYY A;  3DXT A;  4CCJ A;  5FZ8 A;  4HON A;  4LXL A;  4LIV A;  5FJK A;  5LY2 A;  4CCK A;  2PXJ A;  4CCO A;  2XUE A; 
#chains in the Genus database with same CATH topology
 1LOC A;  3R4U A;  1RUC 1;  5B4N A;  3ES4 A;  4NUB A;  1BLZ A;  1COV 2;  1KFU L;  2XVL A;  3JQX A;  4LE4 A;  1E5H A;  2PAK A;  3VD7 A;  3I2O A;  1N3P A;  3HAG A;  4XJW A;  4H55 A;  3WG2 A;  2YC2 A;  4LHL A;  5A32 A;  2QQM A;  2DTW A;  2XVK A;  4FPE A;  3N7L A;  2ZOE B;  1U5Y A;  2X53 S;  4TN7 A;  2B42 B;  3O1O A;  4RR3 C;  1SHW B;  1RUF 1;  1CX1 A;  1QOS A;  3IAQ A;  4FTS A;  1JUI A;  3GYD A;  1DF0 A;  3VBF C;  1NCR A;  5E16 A;  5BNP C;  3KCC A;  5FZ9 A;  4UAP A;  2ILM A;  2WN3 A;  2BDR A;  3TN9 1;  1AR6 1;  2VUD A;  1UYZ A;  2FQP A;  4GD4 A;  5J09 A;  3E5U A;  4GWI A;  2E51 A;  1YQ6 A;  4IEX A;  4GMP 0;  4ASM B;  1MEC 1;  2JE9 A;  2PQS A;  3CHX A;  1G9B A;  2VVD A;  4XFH A;  4IGO A;  5DUW A;  5T3N A;  4P5Y A;  4E9K A;  2P5B A;  1GNY A;  4LK7 A;  4QX2 A;  5FPA A;  3ZYR A;  3OBZ A;  2BGO A;  3HNB M;  3T0B A;  1Z7S 3;  2JWP A;  4FO9 A;  3IPV B;  1W9W A;  4Q4Y 3;  4OUM A;  5JZG A;  2BWC A;  3OGJ A;  5FP8 A;  3TBD A;  3THT A;  5FDB A;  3FZ3 A;  2Y6L A;  1CZV A;  3KHC A;  5CFD A;  2RS5 2;  3RDI A;  3UT0 A;  2DVF A;  3JB8 A;  1OOP C;  3NJY A;  2IFR A;  2EAA A;  2X5I B;  1VMH A;  1CN1 A;  2Q0A A;  3AZV A;  3HQR A;  2HEY F;  4ZPI A;  2Q8C A;  1ZRE A;  1I3H A;  4CCE A;  1O8P A;  4YRD A;  4AQS A;  1RUD 3;  3LPG A;  4ISQ A;  5A3N A;  3GBF A;  1COV 3;  4XFI A;  2Q30 A;  1MR5 A;  1U5X A;  2AEZ A;  3Q8E A;  2W1S A;  4EWA A;  4YVS C;  2JIG A;  1W6O B;  1UIK A;  2VUL A;  2D93 A;  2XVG A;  2PYT A;  4LO4 B;  1OXC A;  3ABZ A;  4B7K A;  3QCW A;  1OQ1 A;  3M7A A;  4YWA A;  1R09 2;  4A2U A;  2VUC A;  4M00 A;  1AL0 G;  1GU3 A;  2CTV A;  2A3X A;  3O1U A;  1EP0 A;  2GMM A;  2DUQ A;  5DAW A;  3TNQ A;  2OYZ A;  4DNY A;  5L7O A;  3UET A;  4FAG A;  4NOT A;  1W0O A;  2Y6K A;  5T55 A;  4GB3 2;  1ZRF A;  1OF4 A;  5CFD C;  2J1E A;  3J8F 3;  4LO6 B;  4JVA A;  4S2G A;  1R1Z A;  2P1B A;  5AVP A;  3III A;  3N35 A;  3AKP A;  3PU8 A;  1CPM A;  2TUN A;  2WS9 1;  4RA0 A;  3W21 A;  3VHP A;  1UKG A;  1S2K A;  4XF1 A;  5FZH A;  1Q8O A;  4LPL A;  3OGG A;  3MI8 A;  4NJ4 A;  2PHU A;  4QX8 A;  5KHH A;  2R07 3;  2ZGO A;  2V72 A;  4CDW C;  1LES A;  2ET7 A;  4W6X A;  5ANN A;  3NW4 A;  4PQQ A;  3FC0 A;  2EXK A;  4GKX A;  2LAL A;  1UCX A;  3AX4 A;  1R09 1;  3MUY 1;  3NJX A;  4OYU A;  4P9W A;  3H7Y A;  4TZD A;  3P6B A;  4CCO A;  3O14 A;  3WCR A;  4YGC A;  3RGB A;  1JOD A;  1QXR A;  4FI9 A;  2PMW B;  5FK7 A;  1J3P A;  5FQ0 A;  1CAU B;  4EJR A;  3CQO A;  3IMN A;  4MZU A;  1YFW A;  2QDN A;  4IL7 A;  1JXN A;  3WQB A;  2D6P A;  4J1W A;  1PGL 1;  4W8J A;  2BU9 A;  4Y1Y A;  1PMI A;  5FY9 A;  2D3S A;  5IK8 A;  5DDJ 1;  3ZKU A;  4WM7 A;  1B35 B;  1R1A 2;  1S0I A;  3LEM A;  4QX1 A;  4RQP C;  1VBA 3;  4XJA A;  2OQ7 A;  4YNI A;  1XE8 A;  4UFK A;  3LIG A;  3VKO A;  5JXG A;  1I6X A;  1A6C A;  2IXH A;  1BEV 2;  2HWF 3;  4UFL A;  5JDB A;  1H4G A;  1XQN A;  3AXE A;  3GDB A;  4XDO A;  4XC9 A;  5I93 A;  5FYU A;  1PX3 A;  3WHU A;  2YGL A;  3CZU A;  5HV0 A;  1QQP 2;  1URX A;  3WHT A;  5FPB A;  1OMI A;  5EJZ B;  5FRA A;  4D0Q A;  4XJU A;  1AR8 2;  1F9K A;  1KXG A;  1NE6 A;  4Q8L A;  3J8F 2;  5FUP A;  1CGP A;  1MS8 A;  4DB5 A;  3WDY A;  2MNG A;  1JOJ A;  2DVB A;  1S0C A;  1UL9 A;  3FLP A;  1HB4 A;  4QKB A;  3VZL A;  1Q8Q A;  1HRI 2;  1PO2 2;  3A0N A;  4AWD A;  5FZ6 A;  4X8N A;  1BEV 3;  2P3J A;  4RQP A;  1WME A;  1OBN A;  1PGS A;  2VUA A;  5FPV A;  4QX7 A;  4GKY A;  1QJY 1;  5HCF A;  2I74 A;  5BXX A;  3GBG A;  4QB2 A;  3T1M A;  5L36 A;  3VBR B;  2WZE A;  4QAW A;  4BXF A;  1UOB A;  3TB0 A;  4UF0 A;  4XTM A;  5FZK A;  1C8M 3;  1LTE A;  2YY1 A;  3MW2 A;  4IV3 C;  2XGX A;  4LKE A;  3C7F A;  3H1M A;  3AFK A;  1W6P B;  4DXZ A;  3EYP A;  4YW1 A;  3USS A;  4FXG B;  1AYM 2;  1WLT A;  1D4M 1;  2HWD 1;  4XFA A;  2IVJ A;  2J1A A;  1GP6 A;  2PHT A;  3H50 A;  5FYI A;  4XOG A;  1SFY A;  5A1A A;  1K5M A;  2BNM A;  2DU0 A;  4L97 A;  1RUJ 3;  4IER A;  1GLH A;  3LA3 A;  3NJV A;  1E5R A;  2DUP A;  1KS4 A;  1PO1 1;  1W2O A;  2DCZ A;  1VAL A;  5C6C A;  4A44 A;  1LEC A;  2Y64 A;  4ISR A;  5DZG A;  1YFU A;  5ISL A;  1MQT C;  3L2Y A;  3N3H A;  3WDV A;  1RUN A;  1QU0 A;  4B1L A;  4DO0 A;  5EZW A;  1Q56 A;  1ULO A;  2PA7 A;  5E8A A;  1DZQ A;  3ZFF A;  2BVV A;  4Y1X A;  1GOF A;  3N7M A;  5CB7 A;  1NXM A;  2FHR A;  5H9P A;  1JZ2 A;  4ZXK A;  2YZ4 A;  1W0P A;  2ZX1 A;  3J7N A;  1RL3 A;  2WZR 1;  1OVS A;  4HET A;  2O0O A;  3J7H A;  4FP3 A;  1YQ5 A;  2VVF A;  4LJH A;  4GQ7 A;  4K40 A;  1HXS 3;  5I8Y A;  3M4F A;  3GZA A;  5EHD A;  1RUI 1;  2HWD 2;  4RGA A;  4V1P A;  3WF0 A;  1UY4 A;  4IGQ A;  1AR7 2;  2ZGU A;  4RS5 B;  4Y22 A;  3SHR A;  4KG0 A;  4Y5S A;  4I2O A;  4JDM A;  4E8C A;  4OHV A;  2WQZ C;  3N9L A;  3GJA A;  1CAV B;  1SLA A;  5B4X A;  2AAC A;  3WQ0 A;  2R07 1;  4I3G A;  1OPM A;  2DFB A;  3A21 A;  2D43 A;  3VBS C;  4B4Q A;  2OUH A;  1RUC 3;  5BNN C;  3EMR A;  2WQ4 A;  4ZU7 A;  1YIP A;  4FOQ A;  1QH7 A;  1G9C A;  1WWY A;  3ACH A;  2WA4 A;  4NAM A;  2VNG A;  1IPS A;  3ACF A;  3AP9 A;  1DZR A;  2WO3 A;  3HBK A;  1LGC A;  2VXJ A;  2LM3 A;  1K12 A;  5FBZ A;  4YM1 A;  1CIY A;  3BOW A;  5A7Q A;  3NKT A;  2PQQ A;  5F9T A;  2CGP A;  1OA3 A;  4LUM A;  1DP0 A;  1TMF 3;  1VBE 1;  3WUC A;  1G9F A;  4IEO A;  3ZYI B;  3VD9 A;  2YPD A;  4MHU A;  3ZSM A;  1LU2 A;  4AFD A;  1JZ5 A;  2CU5 A;  4PQ9 A;  3E5Q A;  4EWD A;  1AR9 3;  1FPN 1;  1SFN A;  3MBW A;  1XB9 A;  5BYN A;  5IK7 A;  4R4Z A;  2P34 A;  4XUQ A;  1RUE 2;  2HBU A;  5GLT A;  4FTE A;  3THP A;  2VCA A;  1DQ5 A;  2E31 A;  3ZYP A;  2E9Q A;  2VMI A;  5I0R A;  2D98 A;  3ORJ A;  3V64 A;  3ZN4 A;  3PIG A;  4IEP A;  3U4S A;  4ZS2 A;  3R6S A;  1J3Q A;  4CPB A;  1IPK A;  2QVS B;  3BKZ A;  1PGW 2;  4HK8 A;  4XUP A;  1TMF 1;  1FT9 A;  1EUT A;  1ZYB A;  2J1V A;  3KGZ A;  3TEX A;  5J7M A;  1CAW A;  2VBD A;  3TEZ A;  2Y38 A;  5T52 A;  2XG3 A;  3HNM A;  2R30 A;  3ZXG A;  3JXS A;  2UWC A;  2EIG A;  3NNG A;  5FY1 A;  4E8D A;  5FO8 B;  2JG8 A;  1PO2 1;  1L7R A;  4CRQ A;  5EFU A;  3RWN A;  4L2N A;  1WBL A;  4M3C E;  5FMC A;  2X5I C;  1GBG A;  5FZA A;  3VDA A;  3THD A;  5GZE A;  3ZXD A;  3RVH A;  2KXL A;  4B8E A;  4DMI A;  2Y33 A;  1CD3 G;  2MEV 1;  3MIH A;  4SLI A;  1XNT A;  5FPU A;  4P5H A;  1Y9G A;  5FPZ A;  5IWF A;  4WM7 B;  3N4M A;  2B46 X;  4TWT A;  2BPA 2;  5IVJ A;  4I3P A;  3VDC A;  4D6S A;  1W0N A;  1XBF A;  2IXL A;  4V2W A;  3BTX A;  1K45 A;  3SKJ E;  3N9N A;  1VRH 2;  2E7T A;  1W8Z A;  4HPK B;  2QCS B;  2BFU S;  1QKQ A;  1IGO A;  1UOJ A;  4M4R A;  5HCB A;  2A75 A;  3Q8F A;  1BJQ A;  3VBU B;  1JW6 A;  1QF3 A;  2VBB A;  2JE7 A;  3MO4 A;  4I0W B;  1OUX A;  4N53 C;  4MOA A;  2SLI A;  1W06 A;  1XE7 A;  3OUH A;  4PIZ A;  3BU7 A;  1I1E A;  2VCB A;  4YVS A;  4P00 B;  1YC6 1;  1DQ1 A;  1MS4 A;  1NZI A;  4LR4 A;  1RED A;  4OCT A;  1B35 C;  4NMI A;  3ZPO A;  4CVU A;  5A3W A;  2AC1 A;  1DG6 A;  3OY8 B;  1VBB 2;  2GAL A;  4IET A;  4P14 A;  3NV4 A;  1KIT A;  4QHZ A;  3RI9 A;  2W0X A;  4D94 A;  1DBN A;  4C0B A;  1NT0 A;  3J26 N;  4QB1 A;  5FMB A;  3K3O A;  4IEZ A;  4HSJ A;  5A7W B;  1AJO A;  1UXZ A;  1W03 A;  4K8F A;  2O8O A;  3AZW A;  1VBD 1;  5HBA A;  5EWS A;  1XNK A;  1H9W A;  1QHD A;  4OI2 A;  3WNM A;  3HIF A;  4AQT A;  1CJP A;  4HON A;  4C90 A;  1FXZ A;  3WG1 A;  2YU1 A;  5JSP A;  3LQC A;  5FQ0 B;  2B45 X;  1YXW A;  3AK0 A;  3H1W A;  4N43 A;  4Q4X 1;  2DUR A;  4H3W A;  1LOA A;  4MYE A;  1MZE A;  3R05 A;  1WW5 A;  3F95 A;  3U75 A;  2WC2 A;  1ULF A;  3WW3 A;  4CEW A;  5JPN B;  4ITC A;  3WF2 A;  3OTF A;  2TBV A;  3GZT B;  4RFT 0;  1JMU B;  4IE5 A;  3RMX A;  1VRH 3;  2RMU 2;  3RZH A;  1UU5 A;  1LHU A;  5JWP A;  2OA2 A;  3AVS A;  1DGL A;  2ARA A;  3I59 B;  4MO3 M;  4CDQ C;  3VDD C;  4YPJ A;  3W58 A;  4AGG A;  3KWV A;  4XET A;  4YYO A;  4TXW A;  1W28 A;  2FCV A;  3JBG 1;  4YGE A;  4LBQ A;  4GB3 1;  4HLT A;  5KHI A;  4BQX A;  3ZPY A;  1IOA A;  1RUE 1;  5C8W A;  1H8T B;  4PDW A;  3PU3 A;  3LE0 A;  5B2G B;  1UZZ A;  5KBF A;  2RDQ A;  2VZP A;  2W95 A;  3WEZ A;  3B01 A;  1O7F A;  4Y24 A;  2P17 A;  4QT6 A;  1VRH 1;  1HQW A;  1GIC A;  3LGR A;  4LHS A;  2AEN A;  2H6C A;  1GQH A;  3AMP A;  5BNQ A;  5FOB B;  1JZ8 A;  1BMV 2;  2C9K A;  4M01 A;  4Q0S A;  2YBS A;  4L99 A;  1JU4 A;  1ZBA 3;  3C7O A;  1WLC A;  1YIF A;  5EPA A;  4CDX C;  5HCH A;  2FDK A;  5IK4 A;  5F3C A;  2IXJ A;  3BOD A;  1APN A;  3A0K A;  4JAA A;  4UBH A;  4XUR A;  5FZ1 A;  2ZX0 A;  5C4W C;  5JSO A;  3C3V A;  2Y34 A;  4OHW A;  3ASI A;  4MX3 A;  3ZN6 B;  4OQ8 A;  4IND A;  4AVA A;  1O8S A;  3E97 A;  3OPZ A;  3VDB A;  3OGV A;  1FMD 3;  1O6U A;  1AR8 1;  1AYN 2;  1KS5 A;  5IVY A;  1W2T A;  4OQ9 A;  1LR5 A;  3VBH C;  1R09 3;  1CIW A;  3R0R A;  1S0D A;  4QDS A;  3AYE A;  1VBE 3;  3AMH A;  3MPP G;  4I30 A;  2QNK A;  5H9S A;  1EY2 A;  2XJR A;  1NA1 C;  5FXV A;  4KU8 A;  3T1L A;  4AEM A;  5FY7 A;  4B7E A;  4LKD A;  5JZG B;  4BQ2 A;  4HOO A;  1QXJ A;  1UYP A;  1A3K A;  3MW4 A;  4RGK A;  5FMO L;  2LS6 A;  5T50 A;  2PEL A;  5FYH A;  3JBG 3;  4BQ5 A;  3HN1 A;  1HDK A;  3NWK A;  2RMU 3;  2C6S A;  2FMD A;  4YLZ A;  4D7S A;  1SQ4 A;  4RD7 A;  1STM A;  1AL2 1;  1W9T A;  2VMH A;  2VME A;  3OJB A;  4OUS A;  4BQ1 A;  2RG4 A;  4KWU A;  3RPQ A;  1C4R A;  3GF6 A;  2NM1 A;  3PJY A;  4XQD A;  5C3P A;  1T6B X;  4QHO A;  1U12 A;  1SLB A;  5F32 A;  3EBR A;  3M3I A;  4MVT A;  4WVZ A;  2XHK A;  2XBO 1;  2HWF 1;  4P9L A;  5KXC A;  3DXU A;  3K4A A;  1YCI A;  4QMA A;  4NPL A;  2F6B A;  4E2G A;  3W5N A;  4PLO A;  1QH6 A;  1PMH X;  3WNK A;  1S0F A;  4LUL A;  3WR0 A;  2F4L A;  2DDU A;  1CZS A;  3D0S A;  4QPI B;  5LEK A;  5FP7 A;  1RUF 2;  1L7L A;  2ZAB A;  3UV9 A;  4FOY A;  3ZFE A;  1HQN A;  2ZGL A;  3VKN A;  4AVB A;  3I2H A;  1G6N A;  3ZXJ A;  1N1S A;  1FAT A;  2RM2 3;  3SMH A;  4GJY A;  3KD4 A;  3VGI A;  3WDW A;  1WMF A;  4NHK A;  4CCJ A;  4JRA A;  2WO2 A;  1Z7S 2;  2VL4 A;  2RDR A;  4D7Y A;  4H7M A;  2WO7 A;  3M2M A;  3T4V A;  3AP5 A;  3SQO A;  4E4Z A;  3KV6 A;  5FZO A;  4B1M A;  4LA3 A;  3MIB A;  5FYZ A;  2GMP A;  4YGD A;  3JD7 2;  4BOW A;  5DDJ 2;  3ACI A;  4FPY A;  1OQE A;  1RHI 3;  2I07 B;  5CYY A;  4AFC A;  1TG7 A;  2J1T A;  4I02 A;  4MGZ E;  2ETE A;  2Q8D A;  3WDT A;  2NMO A;  5BNN A;  1UX7 A;  2XKO A;  2YBP A;  2A3Y A;  4KWK A;  1JZ7 A;  1LOE A;  1W8U A;  3B7M A;  3GXU A;  4YAR A;  3BVC A;  4MH0 E;  5EYY A;  5A7O A;  3VV1 A;  5F8P A;  4DZG A;  4B29 A;  2ADD A;  2WAO A;  2Y6H A;  3OF1 A;  4FPC A;  4HVO A;  4KMQ A;  1OHF A;  2RS3 2;  5JIA A;  5K9Y A;  2P4E A;  5FZI A;  1ND3 B;  2RV9 A;  2VM9 A;  2VZT A;  1UZY A;  2PFW A;  2C5D A;  2OS2 A;  1U5I A;  4FFF A;  1FNZ A;  4COU A;  5J37 A;  1KJL A;  3VD4 A;  1AX1 A;  3LA2 A;  4BDV B;  5CFC A;  5LA1 A;  4JX0 A;  1MS3 A;  2WT0 A;  3Q8A A;  2WR9 A;  4OI0 A;  1RUI 2;  4E4S A;  1BBT 3;  1RUG 3;  3WNP A;  3J7M A;  2ZMN A;  3KQ4 B;  1ULG A;  4BZ4 A;  3ILN A;  4Q1R A;  4XJZ A;  3WLU A;  1VB4 A;  1VAK A;  4FPK A;  4RR3 A;  2ZHL A;  1MS0 A;  5CIR A;  3P1I A;  2WII B;  3O0X A;  3KT1 A;  3VBS A;  5IT6 A;  1GR3 A;  3SXW A;  1W9F A;  1N1Y A;  2WQ8 A;  3K48 A;  1NUK A;  1NCR C;  3CKH A;  2DV9 A;  3K46 A;  2ZZJ A;  5CFC B;  5A6Q A;  2BGP A;  1VJ2 A;  4K21 A;  5DAQ A;  2JE8 A;  3AP4 A;  3PLQ A;  2VW0 A;  2K0G A;  3BCW A;  3I2J A;  2W46 A;  5AVA A;  4CDU C;  5T5L A;  1XNA A;  2YU2 A;  1TEI A;  3EHK A;  4R4X A;  3M70 A;  5FYV A;  4NO4 A;  3OGR A;  3U1X A;  3BAL A;  1RUI 3;  2QQV A;  1VRB A;  4CPB D;  5DDJ 3;  1H30 A;  3NNM A;  3OD4 A;  1TNF A;  4QQL A;  4A7Y A;  2IUW A;  4HKO A;  4BWO A;  2HBT A;  4LBQ B;  4UXA A;  4AQ6 A;  2WNV C;  2VNO A;  4P9G A;  4M0H A;  5LZ6 A;  3RWK X;  3ETP A;  5FXW A;  2IC1 A;  3TYJ A;  3HBZ A;  2WNU A;  1AL2 2;  1M4W A;  1RIT A;  4IE7 A;  2HH9 A;  4YVS B;  1J83 A;  4LUK A;  5KXE A;  4YW2 A;  2B9U A;  4RYD A;  4JGY B;  4HL0 A;  3ZXA C;  2CY6 A;  3H7J A;  5FMO S;  3GHM A;  3I59 A;  4Y5Z 0;  3POF A;  5BPX A;  3FWE A;  4MUV A;  3CU7 A;  4Q0U A;  2XQX A;  3SKV A;  1HJG A;  2XJT A;  1XYP A;  2B8M A;  2YG0 A;  3S6P A;  4BQ3 A;  1RUG 2;  1H0B A;  4NAO A;  2BTV C;  1FMD 1;  3OD0 A;  1B09 A;  2XUM A;  4DQA A;  5JOX A;  1HQL A;  3VD3 A;  4AAP A;  3RSJ A;  1ULC A;  1S2E A;  1UNB A;  2R1B A;  4ZHN A;  2ZEY A;  2ZS6 B;  4JQR A;  3DYP A;  5FYY A;  1FX5 A;  1LGN A;  4K9S A;  1HRI 3;  3HEI A;  5E89 A;  1FI2 A;  5CKM A;  4NPR A;  4XQ4 A;  2VZQ A;  3APB A;  3WIN E;  5IAT A;  1X8M A;  1C57 A;  2WDB A;  2ZGT A;  4R8H A;  5F2S A;  5JR7 B;  3RRD A;  4M4P A;  5FTT C;  1RB8 G;  2BNO A;  3BTA A;  1T2X A;  4A41 A;  1EYB A;  1HLC A;  4O7X A;  3AC0 A;  1RVF 2;  1VMJ A;  5C5T A;  3NJZ A;  3E1F 1;  2WNU B;  2WS9 2;  4DY5 A;  5AC9 3;  3RZL A;  3CBN A;  1C8M 2;  4XCB A;  2PAM A;  1VBC 3;  3LA7 A;  2D3R A;  1UMI A;  4DRV A;  3WD5 A;  2IXC A;  3BIE A;  1RC6 A;  1L7Q A;  1RHI 1;  2EAK A;  3CIH A;  1D0G A;  3IPV A;  4XYX A;  5DZF A;  4A45 A;  2XLG A;  1A8D A;  4LA2 A;  4XIK A;  4ATF A;  2A71 A;  2P3Y A;  4AHX A;  1OI6 A;  4S2D A;  2CL2 A;  4XZP A;  4CDQ B;  1G86 A;  2GAU A;  1AXY A;  5CA6 A;  4FT8 A;  4MHR A;  3CJI B;  2GH2 A;  1W9S A;  3IBM A;  4NHX A;  2B39 A;  3RJ2 X;  4CU8 A;  1UY3 A;  2WZ8 A;  2OT7 A;  5FBJ A;  4CCD A;  2H0V A;  4F83 A;  2W08 A;  3PTR B;  4HT1 T;  3HJR A;  3L2H A;  4JQT A;  2HWB 2;  3U78 A;  4E4H A;  3IT8 A;  1OFN A;  2W52 A;  2VXR A;  3AP7 A;  2DU1 A;  3KGL A;  3T08 A;  4S2H A;  2NQY A;  2E7Q A;  1SAC A;  2BVB A;  2PHX A;  1EPZ A;  2ZHK A;  3OOX A;  2VO5 A;  5LA9 A;  4A42 A;  3WNX A;  1C8M 1;  2DCK A;  3IM0 A;  3K75 B;  1R08 3;  1CAX A;  1SPP B;  3AJY A;  3PVB B;  5LAS A;  4IE4 A;  2WAA A;  2RJK A;  3KS7 A;  1W2A X;  2QJV A;  4N43 C;  2HKX A;  4QPG B;  3TRS B;  4BIF A;  1JH5 A;  4MSV A;  4R9B A;  4DUV A;  1VBA 2;  1YQ8 A;  2DVD A;  4JDN A;  4CDX A;  2V73 A;  2JD9 A;  4LK6 A;  1F4A A;  5FYT A;  1REF A;  1Q3E A;  3QH6 A;  2JDK A;  1FNY A;  5C4W A;  4A4A A;  5J96 B;  4GAL A;  2HEV F;  4ZU4 A;  4QKD A;  3B93 A;  2E32 A;  1N47 A;  3AP6 A;  1VPH A;  3ZVX A;  1D4M 2;  2VOT A;  2BZD A;  4QDR A;  4CDQ A;  4OVE A;  1W6N B;  2VH9 A;  1LCL A;  1LOB A;  4YW4 A;  1G7Y A;  1ZBE 1;  3RZJ A;  5A6Y A;  2QQJ A;  3RG0 A;  4ES8 A;  1QJU 2;  5C70 A;  4ASK A;  2ZAC A;  1AF9 A;  4YW7 A;  3BB6 A;  1C1F A;  3N7K A;  2OUJ A;  4P9Y A;  3IN9 A;  5I8S A;  5M0T A;  1H2N A;  1NA1 A;  4AFB A;  5C4W B;  3HMY A;  3VZJ A;  2NN8 A;  3T3Y A;  1POV 1;  2RDS A;  5K0U A;  2WLQ A;  3B69 A;  3R4S A;  1OKO A;  1W6Q A;  3D3A A;  3OG2 A;  3ZSJ A;  3FBY A;  2RR1 3;  1PIV 1;  4QB6 A;  1R1A 1;  2NLR A;  5BNO C;  1PVX A;  1K5M B;  1MZ6 A;  4AI9 A;  1R08 1;  3FFZ A;  4BQY A;  2XJQ A;  5EJ3 A;  2WO1 A;  3LEK A;  4OUL A;  4EZH A;  2ZJC A;  4FPO B;  5CZK A;  3VKM A;  1FPN 2;  5ACA 3;  4WZC A;  4Y4Y A;  5CNA A;  1RUD 1;  1ND3 C;  3AMQ A;  5K4L A;  4K1Z A;  5FCC A;  4K3U A;  1PO1 2;  1VMF A;  4JKM A;  1I5Z A;  4UWD A;  2LTN A;  2LRP A;  3O7O A;  4XJ9 A;  2DVA A;  5EIY B;  4ZON A;  3IDC B;  5CBL A;  2R7E B;  1PNG A;  3KV5 A;  3HR9 A;  5LAT A;  3HVD A;  5A3M A;  2FDI A;  2XJV A;  3MDP A;  5F3E A;  3WSO A;  3BPS A;  3O1R A;  1CAU A;  4XAB A;  1OLQ A;  2R0F A;  3KLS A;  4XAC A;  4CEY C;  3HOB A;  5F3G A;  4KWL A;  5A1F A;  2JEC A;  5A80 A;  3LF7 A;  2YGM A;  4CXY A;  1OLR A;  5JUV A;  4KU7 A;  3WW2 A;  1AHS A;  1LHW A;  2ENR A;  3MLL A;  3NL1 A;  4JCK A;  4UFI A;  5FRE A;  4FAH A;  4GWJ A;  3OCP A;  5EV7 A;  5KWR A;  4NRP A;  5APA A;  4NHY A;  1S4C A;  5FYC A;  3T0A A;  5CFC C;  3GZU C;  2WYS A;  3LCP A;  5T5P A;  4KH9 A;  4BCU A;  3AKS A;  2Y6J A;  3LSE A;  4LTA A;  4NRQ A;  1RMU 1;  3M1H A;  3UKV A;  4IEU A;  2VQT A;  1HXS 2;  4XXA A;  1RGS A;  1R1A 3;  5I0T A;  4A7Z A;  1UW8 A;  4CP9 B;  4Z82 A;  3D8C A;  4TTG A;  1YFY A;  1AZD A;  3WQ7 A;  1ENS A;  4GAZ A;  1G8W A;  2PHD A;  1OF3 A;  1PGW 1;  1WA6 X;  4BIS A;  3NAP B;  5A3U A;  4A6S A;  1W8F A;  2MPF A;  3ZYG A;  2VZ3 A;  3OYW A;  3H42 B;  3O1T A;  3U37 A;  1O3R A;  4BK5 A;  2WFF 1;  2RMU 1;  4KWJ A;  3KV4 A;  2RE9 A;  3RYP A;  5IAX A;  2WAB A;  1PVC 2;  3H9A A;  1RIN A;  2OPW A;  3D5O A;  1EV1 2;  3ALQ A;  3SIT A;  5GZD A;  1OT5 A;  1IQD C;  4Q0V A;  3RQ0 A;  1US2 A;  1IG3 A;  2O14 A;  2YB7 A;  4P08 A;  2LW8 A;  1QJX 1;  3I2G A;  3Q9O A;  4BQ4 A;  5CG9 A;  2VMG A;  1TVG A;  3POG A;  4PIY A;  1XPW A;  1UYY A;  3OYW B;  5E88 A;  1W8H A;  1RMU 2;  5FZ3 A;  4YZ3 A;  3PUS A;  1H6X A;  1OH4 A;  1SCR A;  4L9B A;  1UD1 A;  2WSU A;  3DPR C;  1WLD A;  1UX6 A;  3OEA A;  4IV1 B;  4CE8 A;  3H0O A;  2JEM A;  1OFS A;  3MW3 A;  3WW4 A;  1YYN A;  4ZZ8 A;  1VBC 1;  1YJL A;  3WP4 A;  4BU2 A;  1PGL 2;  2ZML A;  1BKZ A;  2JEN A;  2JG9 A;  2AEY A;  4CDU B;  2UWA A;  2JX9 A;  4FPH A;  5GLW A;  4CUB A;  1EV1 3;  1DLL A;  5EP9 A;  5FAX A;  4UFH A;  4AEJ A;  1IS4 A;  4DIQ A;  2XL7 A;  2DTY A;  3ZYF A;  4AGV A;  5IVF A;  1JZ6 A;  2ZGP A;  3WX5 A;  1DZT A;  2ZKL A;  3U14 A;  5FWJ A;  1UIJ A;  3I2K A;  2ORZ A;  3FE5 A;  3KM5 A;  2JG8 C;  2QQP A;  1MS1 A;  1MVE A;  1AYM 3;  4W4Z A;  4AQ2 A;  3ELN A;  4FP2 A;  2X8K A;  2DF7 A;  4UOJ A;  5FKB A;  1OUS A;  3KF5 A;  2BUK A;  4XE9 A;  1ONA A;  3FUO A;  3SC7 X;  3KZ4 C;  1I9R A;  2W3J A;  4H14 A;  4AW7 A;  3LZZ A;  1UY1 A;  3UGF A;  4Y20 B;  1PX4 A;  4NIH A;  1BQP A;  1W8W A;  4QGM A;  3POB A;  4QPG A;  2FDJ A;  2VEC A;  4YG0 A;  4BPZ A;  2VGD A;  4KI5 M;  4XFF A;  2WZP P;  1TME 2;  1LAJ A;  2W39 A;  5CG8 A;  1V6L A;  2XON A;  2GSY A;  2ID4 A;  2Z79 A;  1LJ7 A;  2ZMK A;  1CJD A;  2ZBJ A;  3LEG A;  3HPN A;  4HBN A;  4PI2 A;  4D8M A;  1PZ8 A;  1OPO A;  2NMN A;  3WZ1 A;  4CDU A;  4IE0 A;  1ENR A;  2EVX A;  3UKT A;  4CEW C;  2R49 A;  2QDR A;  2BYV E;  4Q4X 2;  3WG4 A;  4Q0Q A;  2CSG A;  2ZGN A;  3WDU A;  1HW5 A;  3OUI A;  3VZN A;  4GZ9 A;  5HXV A;  5F1R A;  4N9I A;  1J84 A;  4OMC A;  3CNA A;  4YZ2 A;  1ACC A;  3ZMN A;  2RR1 1;  2ZEX A;  3N9M A;  3ON7 A;  2UYA A;  1X50 A;  5C33 A;  5DAB A;  3D4K A;  1HRV 3;  2WNU C;  5C8C A;  1OLM A;  1Y9Q A;  3P3P A;  4AED B;  1U0A A;  2ZGQ A;  3DL3 A;  2BP6 A;  2OQ6 A;  4XDQ A;  5L7O C;  3H8X A;  1WMD A;  3KV9 A;  3MPB A;  1O3S A;  3UYJ A;  1QJX 2;  4LOT A;  3BYW A;  3K4Z A;  1DQ4 A;  3JBG 2;  3FHQ A;  4YW5 A;  1Z7S 1;  3D0J A;  3FL7 A;  3BU0 A;  4XTP A;  5DAP A;  2VNV A;  2WJS A;  3CJI C;  4AED C;  3I3D A;  1AR9 2;  4CU9 A;  4ES9 A;  1NY7 2;  3EQE A;  3ZR6 A;  2A5Z A;  3MEP A;  4EN8 B;  3DKQ A;  1GAN A;  2J22 A;  1RUG 1;  2XKP A;  1DIW A;  4O65 A;  2I45 A;  1UAI A;  1WD4 A;  3AL6 A;  1LB2 A;  3EB7 A;  4J25 A;  1JI6 A;  3ECQ A;  1G9A A;  5ABJ A;  2QFE A;  3TEY A;  3P3N A;  4AXO A;  1DQ0 A;  4BJ0 A;  1CPN A;  2V4V A;  4Q0P A;  3A7Q A;  4MXV A;  3ST7 A;  4Y26 A;  3GCX A;  2GU9 A;  5L19 A;  2GDF A;  4XF9 A;  5E1R A;  1JYN A;  1ND2 C;  1V6O A;  2PHL A;  3FMG A;  5D21 A;  1OOP A;  1AL2 3;  2MEV 3;  1F15 A;  2ZAH A;  1PK6 C;  2PHR A;  4EN6 B;  4HXC A;  5FLJ A;  2WRA A;  1RVF 1;  3ZXE A;  1WUV A;  1UN1 A;  3DGT A;  4HK9 A;  4YVW A;  4ZS3 A;  1IG0 A;  1W04 A;  3T2Q A;  4MLO A;  4AVC A;  3VBS B;  3JD7 3;  5IJR A;  3VBU A;  1VLN A;  4UW6 A;  1B35 A;  1NQD A;  3UGG A;  1O3T A;  3B94 A;  1VBA 1;  1JTZ X;  1NA1 B;  3C7G A;  3RFR A;  3AVR A;  1DHK B;  3J7L A;  3KB5 A;  3PMS A;  1Y7B A;  5C9A C;  3VUO A;  1HXS 1;  3ZFF B;  4BYY A;  2C4X A;  4LO8 A;  5LB6 A;  1KD7 A;  1W39 A;  1XJA A;  1N3O A;  2Q1F A;  2RM2 1;  2W2I A;  4Y4R A;  3V65 A;  4Y1V A;  1IPJ A;  4GUL A;  1NG0 A;  4IEY A;  3VBH A;  2RS3 3;  1FV3 A;  2VBP A;  2WL1 A;  1ZBA 1;  1NLR A;  1LOF A;  1UU4 A;  2HWB 1;  4NR1 A;  5T5J A;  5C9A B;  3G6J B;  4Q4W 2;  1PK6 A;  2C24 A;  5A32 B;  1JYI A;  5K0U C;  2WSV A;  1FOD 3;  5F2W A;  4Y3O A;  5SV5 A;  2GZW A;  4M3C A;  4K1Y A;  3WF1 A;  2EXJ A;  3OEB A;  5LY2 A;  4CYD A;  4DS0 A;  3T2O A;  4IV3 A;  4Q4Y 1;  2JDU A;  3KMH A;  4JTO A;  3BOP A;  4CUC A;  4LT5 A;  4PF5 A;  1W8N A;  4FBF A;  1NY7 1;  3A4U A;  5A3P A;  1W99 A;  5J48 A;  4QQ2 A;  3KT4 A;  1OLM E;  3SCH A;  2BW8 A;  1DYK A;  1OVP A;  2HYK A;  2XJU A;  3NQH A;  2UY8 A;  4PLM A;  4U2A A;  3VZK A;  4Q4W 3;  4XFB A;  3ZIW A;  4ZXE A;  2TEP A;  3WUD A;  1J1L A;  3MIC A;  5IVV A;  2C1F A;  3CLP A;  4AR2 A;  3O1M A;  1LOF C;  3TN9 2;  4V2V A;  2UY9 A;  3PUQ A;  5DG2 A;  4G9S B;  4GWN A;  1D4V B;  2EIC A;  1LOD A;  2JDP A;  2QQU A;  2VJX A;  3MFA A;  1ENX A;  4HMZ A;  1SFP A;  1V0A A;  2ZGR A;  5FZO B;  5FXZ A;  4Q8K A;  3ACG A;  3NAP C;  4OZO A;  2XBO 3;  2CNA A;  1DGR N;  3N9Q A;  4NE9 A;  1NX9 A;  1HB3 A;  1YQ2 A;  2BJS A;  4CU7 A;  2JKB A;  2DVG A;  5BNP B;  5L73 A;  2GNM A;  5D8A A;  3WNO A;  1ENQ A;  3ZIX A;  4URA A;  4UW4 A;  1NCR B;  4NII A;  2GC0 A;  1GZ9 A;  2W1U A;  1H2M A;  1ST8 A;  4EYU A;  1CAW B;  2HJI A;  2FZ2 A;  5D1I A;  4CEY B;  4CCN A;  3TOJ A;  4XHX A;  3WT3 A;  5FY0 A;  5FZL A;  4AHY A;  3UK9 A;  1W6M A;  5D2A A;  1JOP A;  4JHT A;  3DYM A;  4XFG A;  2JDM A;  3J4U H;  4COW A;  2YUE A;  4QQP A;  4R9A A;  2Z5W A;  3GJB A;  1D4M 3;  1RXG A;  3UGH A;  2CDP A;  4QQH A;  1DCS A;  4D7T A;  3IAP A;  4E4D X;  3E6C C;  3B9C A;  3DYO A;  4LBL A;  3B00 A;  3EO6 A;  4Q4V 3;  3V0A B;  1QEX A;  4L11 A;  1OD5 A;  2YC0 A;  5FP3 A;  2F4P A;  4MG2 A;  3QOP A;  2EA7 A;  3LB9 A;  4TYS A;  5L9R A;  4HAN A;  3T09 A;  5AC9 1;  4H2A A;  1XU2 A;  4QHB A;  3I7D A;  1YRZ A;  2CAV A;  3SCG A;  4OHX A;  3ZR5 A;  3NV1 A;  4RR3 B;  4EN7 B;  5FPX A;  5JI9 A;  1WW7 A;  3FFQ A;  5CFD B;  5F5Q A;  1GP5 A;  3ZFE B;  1F35 A;  4IEV A;  3ZDV A;  4OI1 A;  1V6J A;  1C1L A;  1GKB A;  2ADE A;  4LIU A;  1GQP A;  3TEW A;  4WZF A;  4BLI A;  4MGI E;  1UPI A;  4WVW A;  4PHZ A;  5KHK A;  1YO8 A;  2XDV A;  3NRU A;  3I4I A;  4J1X A;  3RZZ A;  3LDK A;  3KF3 A;  4NN0 A;  4ONU A;  3ZFE C;  1H8V A;  4COV A;  2A1X A;  1QNY A;  2WFF 2;  3J9S A;  2W92 A;  3S5A A;  5FV3 A;  3W5M A;  5JMC A;  3POE A;  3AMM A;  5T5O A;  4GMP 3;  1Q8V A;  4OLL A;  2WIN B;  1BMV 1;  4LBM A;  3OBT A;  1UO9 A;  4K8R B;  4EV0 A;  1UPS A;  5C3R A;  4BQW A;  3OB8 A;  2BEO A;  2YHJ A;  1XYO A;  3MGU A;  2IVI B;  3POW A;  4XF0 A;  5F6L B;  3DXT A;  2HWB 3;  4OUE A;  4IES A;  2J42 A;  2BFU L;  2WUH A;  4KQ7 A;  1L3J A;  2VOK A;  3DPR A;  1UOF A;  5CKN A;  5I8T A;  1XNC A;  3JB4 C;  2WBK A;  2WZR 2;  3QLQ A;  4JDO A;  3U07 A;  4AI1 A;  1NYW A;  1QJY 3;  2CAU A;  2JG9 C;  1COV 1;  3MF9 A;  3K2O A;  3ZXK A;  1LEM A;  4AHW A;  4KBB A;  1QDC A;  1R64 A;  3SH5 A;  3IIA A;  2IXI A;  2DFC A;  1QIQ A;  2JDA A;  2R04 3;  1OA2 A;  3ZDS A;  2RS1 1;  2Y26 A;  1W2N A;  3QAC A;  3JUU A;  5A1L A;  2P6C A;  4M3C F;  3OY8 A;  4AED A;  4ORF A;  2GNB A;  2R32 A;  1YNA A;  2GME A;  5G04 L;  5JOY A;  1MQT B;  4RFR B;  1OKQ A;  4CP0 A;  2EIE A;  1D7P M;  2H6B A;  4AOC A;  5A7W A;  3H8O A;  1QJF A;  3N9O A;  1POV 0;  1H8T A;  2JJ6 A;  4XW3 A;  3VZM A;  2G19 A;  3PIJ A;  1ZVF A;  3VL9 A;  5ABJ C;  4N90 A;  5FJH A;  4YW6 A;  3KQR A;  5KXD A;  3WNL A;  4RHV 2;  5I0U A;  1EPW A;  4XCA A;  2XR4 A;  5T54 A;  1ZZC A;  3SIS A;  1SDD B;  4L0P A;  2WFF 3;  2WWU A;  1OSG A;  4M3C B;  2F17 A;  5DUX A;  2VQ0 A;  4IXL A;  2GP3 A;  3URF A;  1ASJ 3;  3PVE A;  3ZO0 B;  1HRI 1;  4CDW B;  2OW4 A;  5FZG A;  2B5H A;  1RYY A;  2VAU A;  2GNT A;  4PT6 A;  2E6V A;  3BUC A;  3CJI A;  5FFO C;  2WNO A;  3VBH B;  1RUC 2;  2W68 A;  4GA9 A;  4ATE A;  4AVV A;  3ZYH A;  4WVM B;  3O12 A;  2OZJ A;  5C7G A;  1XND A;  2VE1 A;  4PI0 A;  5C71 A;  5ACA 2;  1WZX A;  1Y43 B;  1UZ0 A;  5CVR A;  2BOJ A;  3AFG A;  3VHO A;  3KCX A;  2DYC A;  3RZK A;  1PO1 3;  1H8T C;  4GJZ A;  4QD2 A;  2WNV A;  4Z2A A;  1V6I A;  4XZU G;  4MXW B;  2EID A;  1PO2 3;  2Q5T A;  1A78 A;  1TMF 2;  3LDB A;  3W59 A;  1SLL A;  4LQR A;  2PHF A;  4I0B A;  2XWB B;  1CVN A;  2BOI A;  3AZX A;  5C8C C;  2EF6 A;  3AZY A;  3VDD A;  1SPP A;  1UU6 A;  3FUQ A;  5A3T A;  1UZW A;  3WQ1 A;  2W1Q A;  3FLR A;  5F5I A;  4C8D A;  4X6Q B;  1W6P A;  4BH9 A;  4N9H A;  5JLV A;  2ET1 A;  5GM0 A;  5DXD A;  2JXA A;  4URT A;  2V5Y A;  3KHB A;  2IZW A;  2RS3 1;  3PL0 A;  2A6Y A;  2JDH A;  4F3J A;  1WW4 A;  5FZ0 A;  4UT5 A;  2JD4 A;  1MEC 2;  3AKQ A;  3PHM A;  3MHZ A;  5FLI A;  1CR7 A;  4CDW A;  4CSW A;  2D6O X;  4C1W A;  3B3Q E;  3IDA A;  3LDR A;  5GKA C;  5FY5 A;  4LHN A;  1H1A A;  3ZMO A;  1DU3 D;  2ARC A;  1F5J A;  2G9Z A;  2KA3 A;  1I5P A;  1GYK A;  3SH3 A;  4DXT A;  1W2U A;  4Q4X 3;  2VOW A;  1LEN A;  1AR7 1;  3AM2 A;  5AFB A;  5K8S A;  3USU B;  3I97 A;  3V56 A;  3VN4 A;  2EAL A;  2XL9 A;  4CCK A;  2RJ2 A;  5HCA A;  5K0U B;  1GP4 A;  3FX3 A;  2VTX A;  3S0M A;  2E53 A;  3RYR A;  1W6O A;  2YFU A;  2D6N A;  3ETQ A;  3NV2 A;  1QQP 1;  3K77 A;  4MXW A;  4NPM A;  4ET7 A;  3ITQ A;  1MAC A;  4XAA A;  2O8Q A;  2W9X A;  3NMB A;  4JGZ C;  3HT2 A;  3ZYB A;  1LHV A;  4XUO A;  2K46 A;  1W6M B;  2WFP A;  3ZM8 A;  3D82 A;  3H8R A;  1JS9 A;  4LBJ A;  2VR4 A;  4YVW C;  3USU A;  4KL1 A;  2BER A;  1UWW A;  1AR7 3;  2EXI A;  4XMI A;  5A33 A;  4EWE A;  5C8C B;  1WCK A;  1U5Z A;  1YJK A;  3VB9 A;  1RUJ 2;  4FFG A;  3WV6 A;  1LOG A;  1KDM A;  2ZTN A;  3HWJ A;  1ZZ9 A;  4JV4 A;  2Q8O A;  3V0B A;  1AX0 A;  2I2S A;  1S0B A;  1ZRC A;  4N8M A;  3HQX A;  1BXH A;  1DGR A;  5F5A A;  4LBN A;  3AYC A;  1SBD A;  3M8L A;  2Y0I A;  1FV2 A;  2VVE A;  3LEI A;  3OUJ A;  3VKL A;  4XF4 A;  4YG6 A;  2P37 A;  1PZ9 A;  2A6W A;  1VBC 2;  2VZR A;  1UQX A;  3CL1 A;  2MHF A;  4PF1 A;  1AR9 1;  1FPN 3;  3PTY A;  2FCU A;  1H1M A;  3FLT A;  5HPO A;  1VIW B;  1W3X A;  4PDW C;  4AGR A;  4AZZ A;  4DUX A;  2HWC 3;  1FAY A;  5FO7 B;  4K6B A;  2QQN A;  4C0H A;  1E57 A;  1LU1 A;  3O0W A;  4YGB A;  5FYS A;  3IWZ A;  5GZF A;  1F31 A;  5F37 A;  2HWD 3;  1OC1 A;  3S30 A;  4KBZ A;  2CGO A;  5F6K A;  5CEH A;  3OGS A;  3OSD A;  4PJY A;  1XNB A;  1RUE 3;  2G9G A;  2GC2 A;  2MEV 2;  3I54 A;  1QJU 1;  3IMM A;  3KVB A;  5D8A C;  3ACL A;  1JYV A;  1KDK A;  2VG9 A;  4QX0 A;  3NNL A;  1EAH 3;  5IYY A;  5LY1 A;  3T4H B;  3TNP B;  1OOP B;  2IXK A;  1JYT A;  1PZ7 A;  1NE4 A;  4LOR A;  1WCD J;  2DCJ A;  2EIB A;  1E5S A;  2VCC A;  4CXX A;  2J1U A;  1V70 A;  2HWC 2;  4O61 A;  1R08 2;  3VD5 A;  1JYC A;  4BM8 A;  4AVT A;  4LE3 A;  3H3Z A;  4UBG A;  2PTM A;  2WT1 A;  2NYY A;  3K4D A;  1VB2 A;  2GC1 A;  3AYD A;  3LFM A;  5KHG A;  2A3W A;  5A3L A;  3DUI A;  5C3O A;  3PJQ A;  1J58 A;  1VR3 A;  2JKX A;  5H9Q A;  4NIG A;  2RJL A;  1ULD A;  4UFJ A;  4MGY E;  3S57 A;  2YMZ A;  1AVB A;  1N3Q A;  4FTB A;  3SLI A;  1OH3 A;  3WXP A;  4JC1 A;  2QQI A;  4IV1 A;  2GC3 A;  2V09 A;  5JI7 A;  1LUL A;  1LGB A;  4PIX A;  4LNV A;  4BMB A;  4JGY A;  5GJ6 A;  1HRV 2;  4SBV A;  2D40 A;  4W50 A;  1RJ8 A;  4FPL A;  4P02 B;  1DQ6 A;  1RJ7 A;  3EXU A;  1DGW A;  4AI0 A;  1CES A;  5EXO A;  4QXH A;  3WY6 A;  1HKD A;  3O1V A;  4QU2 A;  5A70 A;  1MZ5 A;  1X9T A;  1SLI A;  4F8A A;  2G9F A;  4MGQ A;  3MLJ A;  4RGG A;  5A3O A;  4CUG A;  1SLT A;  1OQD A;  2ARB A;  1WKY A;  1W9Y A;  3DN7 A;  4FFI A;  3WNN A;  3ZFG C;  1HN0 A;  2YRO A;  3N9P A;  3M3E A;  1TE1 B;  3BTY A;  5FKC A;  4QQO A;  2N7G A;  3QBQ A;  1KFX L;  3NV3 A;  4XUT A;  2HWE 3;  1H6Y A;  3K3N A;  1MPX A;  1WLW A;  4LMF A;  1V6N A;  2ZEZ A;  1ZM1 A;  5FJK A;  3POI A;  2PXJ A;  2WNV B;  3C8X A;  4UYB A;  5A7S A;  4IDZ A;  4XF3 A;  1W8T A;  2ARE A;  2A6V A;  2JIC A;  1CX4 A;  4QX5 A;  1S0E A;  2QQO A;  2VTX J;  2BBV A;  4GIQ A;  4RQP B;  3BPZ A;  4KGG A;  4XIL A;  2RVA A;  4GH4 A;  4HVQ A;  4JGY C;  4KGQ A;  3WOG A;  2CWS A;  4NRM A;  4E27 A;  2VZS A;  4FSJ A;  2A6X A;  1UOG A;  2ZAA A;  4Q4W 1;  4JRL A;  1NZC A;  3L9J T;  1QXP A;  4Q26 A;  1ZBA 2;  3I3B A;  2DCY A;  5LK7 B;  2SBA A;  2JDN A;  3ZLI A;  1PM4 A;  1PVC 1;  4HVR A;  4QM9 A;  2W47 A;  1BVV A;  1GWK A;  2ZKN A;  3EJK A;  4NRO A;  5C3S A;  1NCQ B;  1O4T A;  5J98 B;  5FZD A;  1YFX A;  1V9U 3;  3KVA A;  1AUY A;  2A7A A;  1Q8P A;  2X10 A;  4R52 A;  1O4Y A;  5DUV A;  1SZB A;  1JU3 A;  5IAV A;  1QDO A;  2G1M A;  3MIF A;  1BBT 1;  5J3U A;  3JZV A;  2VUJ A;  1C5H A;  2HEW F;  2XQR A;  4MGS A;  4AG4 A;  3RNS A;  2GN3 A;  5LRR A;  4Y1U A;  4IW3 A;  4AE2 A;  2Y0O A;  1Y3T A;  5JVV A;  4QKF A;  4ERO A;  2XPJ A;  3LPF A;  1UMH A;  2RS5 3;  2VMD A;  3AJZ A;  4JKK A;  2RS1 2;  2VQU A;  1Z78 A;  3IDE A;  4HZF A;  1X82 A;  3I3Q A;  2HWC 1;  4IGP A;  3RS6 A;  5I0S A;  3DCQ A;  2JG9 B;  3PUA A;  3FHA A;  3W9A A;  1NLQ A;  1RUD 2;  3OBA A;  1S0J A;  4FOV A;  5H9R A;  4QPW A;  1MS5 A;  2WN2 A;  3KSC A;  1ZX5 A;  1JHJ A;  4X6R B;  4Q4V 1;  2B7Y A;  1W8O A;  2GND A;  2X29 A;  5DUU A;  1SDW A;  2W94 A;  2H0B A;  1GNH A;  1QJE A;  1US3 A;  2XXZ A;  2YV8 A;  3O5S A;  4UI9 L;  5F5C A;  1ZNP A;  3V0A A;  4N7U A;  5A6Z A;  3VBR C;  2FMY A;  3VZO A;  4CEW B;  4DEQ A;  1HJF A;  2WYF A;  2VPV A;  4Y22 B;  1JZ4 A;  2R1D A;  1QGL A;  5DPN A;  2VZ1 A;  2CV6 A;  1CON A;  4OFG A;  2Z42 A;  3ZXF A;  1QJZ A;  2XHN A;  1SCS A;  5FP4 A;  1NQJ A;  1CWP A;  4N53 A;  4GB3 3;  2PLV 2;  4FPJ A;  4QPI A;  1NAE A;  1NCQ C;  4L92 A;  1YEW A;  2Q4S A;  4LBO A;  2JIJ A;  2VU9 A;  1WBF A;  1VAM A;  2ZGS A;  3LD8 A;  1BK0 A;  5KXB A;  3SNM A;  2AUY A;  4Q27 A;  2R07 2;  3HNY M;  5K7P A;  2CWM A;  1IS5 A;  4JTN A;  1F5F A;  2WT2 A;  3MUZ 1;  1SG3 A;  2ZX4 A;  3TN9 3;  1O3Q A;  5E6H A;  1CAX B;  3TAY A;  1A34 A;  5FZB A;  5EQU A;  1UY0 A;  1AXZ A;  5FZ7 A;  1UY2 A;  3F2Z A;  1QOT A;  2E33 A;  1TZO A;  3VBF A;  1JYX A;  4YW3 A;  3MLK A;  1DYP A;  2AYH A;  4Y1Z A;  5LK5 A;  2WZR 3;  1S2B A;  3VBO C;  1H2L A;  2ZZQ A;  2JB8 A;  4EQV A;  4AL9 A;  1QY4 A;  1KRI A;  2PLV 1;  2XOM A;  5FZ8 A;  3ZX7 A;  4LXL A;  4QPI C;  1SEF A;  4P9I A;  3INA A;  2DBI A;  1ZZ6 A;  2D7F A;  1MS9 A;  1C3H A;  2HWE 1;  1AYN 3;  4QDQ A;  2QZ2 A;  1ZA4 A;  3IDB B;  2CDO A;  3H3L A;  1V6M A;  5BY5 A;  2WLP A;  3I3M A;  2BV4 A;  2VD7 A;  4CU6 A;  2GH8 A;  2UUR A;  3B5L B;  4BME A;  5FY4 A;  2C9A A;  3NNF A;  3QD6 A;  4O9G A;  1UZV A;  2CYF A;  4IUG A;  1AYM 1;  2D6L X;  3E5X A;  5IVB A;  5LWB A;  5DAX A;  1FOD 1;  4BIO A;  1JUH A;  4HG6 B;  1NOV A;  1QNW A;  1CQ9 A;  4HN0 A;  1QOO A;  4MGT A;  2Z2S B;  3PDQ A;  4JGZ A;  1GSL A;  1VP6 A;  5JXJ A;  3N36 A;  1GUI A;  2XML A;  4ZU5 A;  2YYO A;  4RS5 C;  4A3X A;  4G4F A;  3BN6 A;  4QGN A;  2V5D A;  4YZ4 A;  4CP9 A;  4Z1V A;  4Z2W A;  3CDZ B;  1ZZ8 A;  2IWG B;  2BWA A;  1H4H A;  3CF6 E;  5FYB A;  1ASJ 1;  1ZZ7 A;  1EUU A;  4MV2 A;  3ZSE A;  2Z4F A;  3GM8 A;  4W65 A;  5L9V A;  5FPL A;  5BNN B;  1P8J A;  3HT1 A;  4WBB A;  5JIU A;  1YI9 A;  4BHP A;  2J1R A;  3CJX A;  4JGZ B;  4BB3 A;  2VC9 A;  1QJX 3;  1MVQ A;  3OBR A;  1RUH 3;  2OII A;  3SCF A;  5A6X A;  4AI3 A;  3VBO B;  5C5U A;  5LBF A;  4YVW B;  4AHZ A;  1X36 A;  1ZZB A;  2J1S A;  3PVO A;  1OUR A;  4AK3 A;  1ND2 A;  1IZ3 A;  1O5U A;  2QBX A;  5JSR A;  3LWC A;  1IS6 A;  3MYX A;  3BIW E;  4QGL A;  3KT7 A;  1CZT A;  3CMG A;  3T30 A;  2NP0 A;  1AR6 2;  5I91 A;  3SH4 A;  1S0G A;  5D8A B;  4B4R A;  3I49 A;  1IKP A;  3ZSL A;  5KC5 A;  1DYO A;  1HRV 1;  1Q8S A;  1QMJ A;  2A6Z A;  1VE0 A;  4NHM A;  1C5I A;  4LEJ A;  4C1X A;  5LCW L;  2ZGM A;  3B9I A;  3T2T A;  3FN9 A;  4HPK A;  2E63 A;  4XHB A;  3RZM A;  3VBU C;  1EV1 1;  1XU1 A;  5JOW A;  1E5I A;  4MET A;  4AEK A;  3T0D A;  1ZBE 2;  1ZRR A;  4LBK A;  1GWM A;  1BK1 A;  2QQL A;  1QJY 2;  2DBN A;  1MEC 3;  1GZW A;  2VW1 A;  5C9A A;  5ANQ A;  3DF0 A;  3I2D A;  1ULP A;  2NZ9 A;  1V00 A;  2JDZ A;  1S55 A;  2XJP A;  2R6Q A;  3AL5 A;  2YPJ A;  2G4I A;  3WVJ A;  4F7Z A;  1YLL A;  3GBW A;  4OZX A;  5JR2 A;  3LOB A;  2RS5 1;  3GNE A;  4MGK E;  4PBO A;  4QWN A;  1UYX A;  1W05 A;  1DGW X;  4Q4Y 2;  4Z8B A;  3PUH A;  1IKQ A;  3JD7 1;  3SEE A;  2FCT A;  1BYH A;  1PIV 2;  2HWF 2;  4NVP A;  4XDP A;  1QWR A;  2UU8 A;  4LO5 B;  4WM8 A;  5DN2 A;  4B3N A;  4CUA A;  4DUW A;  2W5F A;  4TSV A;  1GZW B;  3WF3 A;  5KR7 A;  1AXK A;  5KC6 A;  1D2S A;  3VDD B;  1RUH 1;  3ZYJ B;  1J1T A;  4FCA A;  1YI7 A;  1AR8 3;  2KD7 A;  2ZA9 A;  1YUD A;  3CEW A;  3FBM A;  5FZE A;  4CTE A;  1RUH 2;  5BNO A;  1AX2 A;  4YZ1 A;  3ZSK A;  1OA4 A;  4Q4V 2;  5HI0 A;  2K2S A;  3MFC A;  4XJ8 A;  3MIG A;  2VZU A;  4YG3 A;  5LA0 A;  2YDE A;  3PNA A;  3POY A;  3H8U A;  5HV4 A;  2XH6 A;  3VLB B;  3ROU A;  4N7I A;  4DFS A;  5GAL A;  4QPY A;  2P2K A;  4AFA A;  1PIV 3;  1AR6 3;  2BNN A;  4IV3 B;  4CCL A;  1C8N A;  5F7U A;  2ZCW A;  2D3P A;  4IEQ A;  3OPT A;  1ODM A;  3ZKY A;  5LW9 A;  1K3I A;  1VAV A;  3H3U A;  3M3O A;  3UL2 A;  5IK5 A;  1LRH A;  2XJS A;  1EAH 1;  1PNF A;  3WP5 A;  1JBC A;  1HN1 A;  3LFI A;  3WP6 A;  4DXR A;  1M06 G;  1NLS A;  4EZ4 A;  4C91 A;  2DWR A;  5JAX A;  5DZE A;  5AFE A;  1CAV A;  1ZBE 3;  1QJU 3;  3THC A;  4UW3 A;  2FDG A;  3NKG A;  3FHI B;  3OPW A;  2KR2 A;  2E26 A;  2VOV A;  2ZPX A;  4BK4 A;  4NID A;  4NWV A;  4Y20 A;  4UFM A;  4Y5T A;  3T2P A;  3SEP A;  4R9C A;  1JYW A;  1O4Z A;  1XC6 A;  2BRT A;  2D6K A;  5F39 A;  4KNC A;  4AI8 A;  5ERL A;  5FOJ B;  1BVP 1;  4OI4 A;  4J6G A;  2VW2 A;  2FBE A;  4ZY9 A;  4UF0 B;  3JU9 A;  5L9B A;  3A22 A;  1Z0H A;  1K5M C;  5FXX A;  2J7M A;  5FUI A;  1UKR A;  5EJ1 B;  1J59 A;  3ZFG A;  4B4P A;  5IFP A;  1EAH 2;  2D6M A;  2OXB A;  4W6Y A;  2UYB A;  1N1V A;  2WWJ A;  1MQT A;  3CZJ A;  3POJ A;  1J3R A;  3N7J A;  2RHP A;  4LKS A;  2QQW A;  3V0B B;  1V6K A;  2Y60 A;  3IB3 A;  2VTF A;  3WP3 A;  3GCW A;  5GZC A;  3H1Y A;  3E6D A;  2YBK A;  2NPI A;  4AAX A;  2R04 2;  3DV8 A;  1SLC A;  5FZ4 A;  3I3E A;  2Q8E A;  3U10 A;  3DKW A;  2ORX A;  2X5I A;  4WV8 A;  2D5H A;  4M0N A;  1KEX A;  4ZZ5 A;  3MF6 A;  3WG3 A;  3ZN5 A;  4HKW A;  4CEY A;  1POQ A;  4ZKT B;  4DEV A;  4BA6 A;  5FZC A;  1RVF 3;  2DUO A;  4YM3 A;  1QQP 3;  4FPF A;  3NVC A;  5BV6 A;  5CAD A;  2WS9 3;  2EXH A;  1LHN A;  3GGL A;  5AC9 2;  3UNP A;  4P9X A;  3X29 B;  4MAD A;  1D0H A;  4COY A;  2WWS A;  5JCT A;  1ZRD A;  1TQ5 A;  4EN0 A;  4CDX B;  3IKW A;  1DQ2 A;  5A7N A;  4TLG A;  5IVE A;  4Z07 A;  2XWJ B;  5KHJ A;  1YHF A;  3PUR A;  1ASJ 2;  2ZHM A;  3LOI A;  3I2I A;  4QXC A;  4DY3 A;  5ABJ B;  3BTZ A;  3BI3 A;  1HX6 A;  5ACA 1;  4I09 A;  2WA3 A;  1O91 A;  3C7E A;  1DFQ A;  4R9D A;  5CKQ A;  4AYU A;  1HV1 A;  3WCS A;  3B02 A;  5DQ0 A;  1BHG A;  1XYN A;  1ND2 B;  2OX0 A;  4LO7 A;  3O1S A;  1WCS A;  1DLC A;  3K51 A;  4XBL A;  1RTV A;  2BQP A;  3UJQ A;  1RIR A;  4D6Q A;  4FQZ A;  1WMX A;  1GZT A;  1H2K A;  1PK6 B;  1N1T A;  4BE3 A;  2XLF A;  4XAE A;  3E6B A;  1K5J A;  4WVV A;  1UXX X;  1Y9M A;  2UWB A;  3LIH A;  3U4X A;  1GFF 2;  5CAZ A;  4GXL A;  4TLF A;  4COZ A;  3R4D B;  4ARY A;  4OHY A;  2R06 2;  3DPR B;  4RHV 1;  2RDN A;  1LHO A;  1GMM A;  1KJR A;  4RN5 A;  4GH4 B;  3JQW A;  4NHL A;  3VBO A;  3PME A;  1Q5O A;  1IHM A;  3M3C A;  4YM2 A;  4CCC A;  3C2U A;  4QXB A;  3BGA A;  3J8F 1;  1ZA7 A;  2ES3 A;  1PM7 A;  4XMA A;  2W91 A;  1HV0 A;  5FUN A;  5JPM B;  1RXF A;  3NST A;  2P3K A;  1PVC 3;  4XXP A;  4CA9 A;  1D2Q A;  4CXW A;  3S7E A;  4DXS A;  1NCQ A;  2ZX2 A;  3RYK A;  4NIA A;  5JXH A;  3ILR A;  5GZG A;  3S7I A;  4PLN A;  2JG8 B;  1S1A A;  1BEV 1;  2WKK A;  1LKN A;  5FYM A;  2ZX3 A;  3PVN A;  1X8E A;  4K7J A;  5IHR A;  3AB0 A;  3ES1 A;  2Z69 A;  2BBA A;  3GZE A;  3JCI A;  4FFH A;  4XVH A;  2HLE A;  2AH2 A;  3AYA A;  3MID A;  4IEW A;  4U36 A;  3HD8 B;  4AVS A;  2C0Z A;  2ZGK A;  4FVV A;  4A7K A;  2C26 A;  3ENR A;  4QM8 A;  4HFS A;  3VKF C;  5FLH A;  4YM0 A;  2RR1 2;  1ALY A;  5DAV A;  1X9P A;  2VMC A;  2XLA A;  3LKJ A;  3C7H A;  2R0H A;  4DPN A;  4P9J A;  1XE0 A;  1KGY A;  1JHN A;  5J36 A;  4LKF A;  4G3Y C;  1VBE 2;  1RUO A;  1IS3 A;  5C3Q A;  4RHV 3;  4XIO A;  1RUJ 1;  4WM8 B;  4BLJ A;  1HB1 A;  1OD3 A;  2AZ5 A;  4LBQ D;  4PDW B;  2ZEW A;  2QKD A;  2XUE A;  4ARX A;  5GLU A;  5G05 L;  3WDX A;  3Q8C A;  2D5F A;  2Y6F A;  5BNP A;  1LED A;  2FDF A;  1ZRI A;  5FZM A;  4S2F A;  2R06 3;  4WVM A;  1VBB 1;  3VL8 A;  2PLV 3;  2HWE 2;  4I0A A;  3PUI A;  4EN9 B;  1AJK A;  4CCM A;  4QXK A;  1GOG A;  1ODN A;  4QU1 A;  5FWE A;  2KM2 A;  2A70 A;  2VNR A;  2AR6 A;  2L9L A;  2W87 A;  3I2F A;  1XRU A;  4LLO A;  5LRS A;  1GV9 A;  4WM7 C;  1PHM A;  2QE3 A;  5JMO A;  3DEM A;  4LLF A;  4PCR A;  5DG1 A;  4ASL A;  4QX3 A;  3AKT A;  2XB6 C;  2Q1M A;  3HQU A;  4RS5 A;  4OMD A;  4CP2 A;  3NAP A;  4W6W A;  2R06 1;  2R16 A;  1RUF 3;  4EE2 A;  5CIS A;  1HIX A;  3ME2 A;  4BXS V;  4FPG A;  3ZFG B;  4E2S A;  5HXM A;  1XSR A;  2DCT A;  4FXK B;  4GMP 1;  2BGC A;  5DMY A;  2K9Z A;  3MV1 1;  3LAG A;  1WW6 A;  4HN1 A;  1V9U 1;  5FZF A;  4YZ5 A;  3ATG A;  5FR3 A;  1WGP A;  1UMZ A;  1HB2 A;  4N53 B;  3U0Z A;  3FJS A;  2PN5 A;  5LBB A;  1REE A;  3DEC A;  1FYU A;  1LNS A;  2OZ6 A;  2PHW A;  3W20 A;  1UF2 C;  4HKL A;  2OKX A;  1WA4 A;  5A33 B;  2ZXQ A;  2E7A A;  2X05 A;  3QH7 A;  1TME 1;  3MIE A;  4JKL A;  1JZ3 A;  3WF4 A;  4WM8 C;  1WCU A;  4L8Q A;  2JDY A;  3O1P A;  1O5L A;  5LBC A;  1KQR A;  4OHZ A;  5GLV A;  3S5Q A;  1YWK A;  4FQ4 A;  3O0V A;  2O1Q A;  5A7P A;  2HYX A;  3IZO A;  1RMU 3;  1WD3 A;  4JHZ A;  3M3Q A;  4D3W A;  1NKG A;  4IV1 C;  4Z92 B;  1DDL A;  4Q2F A;  4Q5O A;  1NXD 1;  5FIX A;  5FO9 B;  1GWL A;  4X8P A;  3AZZ A;  1XSQ A;  2GP5 A;  5JZG C;  2P3I A;  3KCY A;  1GQG A;  2VMF A;  4YSF A;  1H1I A;  2CGN A;  2YC4 A;  2Q1Z B;  4XPV A;  5GLZ A;  4XBQ A;  5FP9 A;  2D44 A;  2W1W A;  4UW5 A;  4XQW A;  3RZG A;  5IW0 A;  1W6Q B;  3UES A;  2ZHN A;  5J1X A;  1AYN 1;  4XUN A;  1BBT 2;  3GAL A;  3NO8 A;  3D6E A;  1WCQ A;  2OVU A;  4FOW A;  3CO2 A;  4AF9 A;  1F8V A;  2Y6G A;  3VHN A;  1W90 A;  3I8T A;  3ILF A;  3Q8B A;  4Q1P A;  1T6G C;  2YFZ A;  4KG8 A;  4PBP A;  5LA2 A;  2B9V A;  4LHK A;  1W3V A;  3GHN A;  4HSL A;  5L7O B;  1G9D A;  4LIT A;  1H9P A;  4NWW A;  5BUV A;  2VY0 A;  1TNR A;  4E2Q A;  1BCX A;  1FOD 2;  2JB4 A;  1GZC A;  1SBE A;  1TME 3;  2ARX A;  3AXD A;  1ULE A;  1ND3 A;  1XOY A;  2VZO A;  3MV0 1;  2LRO A;  4H7L A;  1MZF A;  5LEJ A;  2A73 B;  5SV8 A;  4QKN A;  2PAE A;  4RL7 A;  2AGS A;  2OPK A;  2RM2 2;  2VQA A;  2GN7 A;  4JZR A;  4I01 A;  4AI2 A;  4K20 A;  1C28 A;  5F3I A;  4XFC A;  3RI8 A;  5JXI A;  1X7N A;  1PMJ X;  1XXN A;  3HN3 A;  1V9U 2;  3U11 A;  5I0D A;  2ERF A;  5IFT A;  3A23 A;  2V4A A;  4D69 A;  1W6N A;  1JN2 P;  5EYX A;  4DOU A;  3ZN6 A;  3VBF B;  5IVC A;  1JOB A;  1GNZ A;  4DRR A;  3AKR A;  2D97 A;  1O59 A;  4A6O A;  1IQA A;  1VBD 2;  1YQC A;  4LOS A;  1RHI 2;  2QUO A;  5FK8 A;  1X33 A;  4Y33 A;  5IUQ A;  2R04 1;  5FY8 A;  3POS A;  4D6R A;  1F4H A;  2XBO 2;  2RS1 3;  3VHR A;  3ZXL A;  4XBN A;  4CZS A;  3NNJ A;  1F2N A;  2VCM A;  2VZV A;  2X09 A;  3UJO A;  2FDH A;  4N43 B;  2YXS A;  4QPG C;  4A3Z A;  5FMD A;  3MZH A;  2QZ3 A;  2QTW B;  1Y4W A;  3RJR A;  3RMY A;  1K42 A;  2P6H A;  2LUW A;  4IQP A;  3VBR A;  4YFW A;  2FD8 A;  4Q29 A;  2Y8K A;  4YFZ A;  1BZW A;  2VOX A;  1A8M A;  1POV 3;  5JOZ A;  1SMV A;  4CP1 A;  1FMD 2;  3AMN A;  4AFM A;  5BNO B;  4IE6 A;  2IFW A;  3ZFF C;  1GOH A;  1Q43 A;  2FZ1 A;  1SBF A;  3TWI A;  3UKN A;  2QQK A;  4GWM A;  4XEZ A;  2TNF A;  1VBD 3;  4RSU A;  4DIN B;  1VBB 3;  5CU1 A;  3P5B A;  5TSW A;  2B4K A;  3ZOI A;  2CHH A;  4O9E A;  3LSD A;  2WNE A;  4LIV A;  5LBE A;  3WW1 A;  3G7D A;  4GH4 C;  2ATF A; 
#chains in the Genus database with same CATH homology
 2YU1 A;  3KV5 A;  5A7S A;  5A7P A;  4NUB A;  3KV6 A;  5FZO A;  4CCL A;  5F3E A;  5F2S A;  5FYZ A;  5A3P A;  3K2O A;  3OPT A;  4QXB A;  5LW9 A;  5F3G A;  2VD7 A;  5FY9 A;  5A1F A;  2GP5 A;  5FY4 A;  5A80 A;  5A7Q A;  4TN7 A;  2Q8D A;  5IVB A;  5LWB A;  2OQ7 A;  3N9M A;  5FUN A;  5IVV A;  4EZ4 A;  2YBP A;  2YPD A;  3ZLI A;  5A1L A;  3AVS A;  5FP9 A;  5FYC A;  4V2V A;  3OPW A;  3PUQ A;  5FZ9 A;  3PDQ A;  4XDO A;  2OQ6 A;  5FZD A;  5A7O A;  5IW0 A;  3KV9 A;  5FYU A;  3KVA A;  5FYM A;  5F5A A;  2XML A;  4GD4 A;  5FZO B;  5FXZ A;  5A7W A;  3UYJ A;  5FPB A;  5FZI A;  3PU3 A;  3N9O A;  5F39 A;  3N9Q A;  4GAZ A;  2OS2 A;  5FJH A;  4IGO A;  2OT7 A;  5FBJ A;  3U4S A;  5FYB A;  5FUP A;  4UF0 B;  4BIS A;  2P5B A;  5FPL A;  3PTR B;  5FXX A;  5FPA A;  4LIT A;  4URA A;  2WWU A;  3U78 A;  4E4H A;  3KV4 A;  4IGP A;  2YBS A;  2GP3 A;  3PUA A;  4CCN A;  3AL6 A;  5FYS A;  5FZ6 A;  5FY1 A;  5F3C A;  2WWJ A;  5F37 A;  5FY0 A;  5FZG A;  5FZ1 A;  5FZL A;  5FPV A;  4QX7 A;  5FP8 A;  5CEH A;  5FZA A;  3RVH A;  3KVB A;  2YBK A;  5FPU A;  3NJY A;  4BXF A;  5FZ3 A;  2XXZ A;  5FZ4 A;  5IWF A;  3PUS A;  4UF0 A;  5F5C A;  5IVY A;  5FZM A;  2Q8E A;  2Q8C A;  5FZK A;  5LY1 A;  4EYU A;  5IVJ A;  4D6S A;  5A3N A;  5FYT A;  2YU2 A;  5F3I A;  5FYV A;  4BU2 A;  4V2W A;  4GJZ A;  5FP3 A;  4CCM A;  1VRB A;  4QU1 A;  5FXV A;  5FWE A;  5FY7 A;  3N9N A;  3LDB A;  4HOO A;  5FP4 A;  5FZC A;  5FYI A;  5FYH A;  4DIQ A;  5IVC A;  5IVF A;  5ANQ A;  5A3T A;  5FXW A;  4ASK A;  5F5I A;  4LIU A;  4C8D A;  5FWJ A;  5A7N A;  4Y33 A;  5ISL A;  3AL5 A;  3LD8 A;  5FY8 A;  5IVE A;  4D6R A;  4DO0 A;  5F32 A;  3AVR A;  2XDV A;  3PUR A;  3DXU A;  4QWN A;  4QXC A;  3ZPO A;  5FZ0 A;  5A3W A;  4XDP A;  4Y4R A;  5FZF A;  2W2I A;  5E6H A;  4QXH A;  4CSW A;  3PU8 A;  5FZB A;  5FZ7 A;  5FV3 A;  5FY5 A;  5FZH A;  5KR7 A;  5FP7 A;  4CUG A;  4AI9 A;  2OX0 A;  3K3O A;  4QX8 A;  5A7W B;  4EZH A;  3N9P A;  4IGQ A;  4D6Q A;  5FZE A;  4AAP A;  5K4L A;  4GJY A;  3K3N A;  3N9L A;  5F2W A;  4Y3O A;  5FYY A;  3DXT A;  4CCJ A;  5FZ8 A;  4HON A;  4LXL A;  4LIV A;  5FJK A;  5LY2 A;  4CCK A;  2PXJ A;  4CCO A;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...