5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
4CCMA 3KVBA 2GP5A 3N9LA 4D6RA 5F5IA 3KV4A 5FZ6A 4BXFA 4V2VA 5IWFA 5A80A 3N9PA 5FZLA 3PUQA 3K3NA 5FP9A 3K2OA 2XUEA 5ANQA 3N9MA 4BU2A 4Y4RA 5FPAA 4LXLA 4BISA 5IVJA 4CCOA 5FZ1A 5FPVA 5FZBA 3DXTA 3LD8A 5FPLA 5FJKA 5A3WA 5FY9A 5FZGA 5A7NA 4Y3OA 5IVFA 5F32A 5FZOB 4C8DA 4Y33A 5FZMA 5FY5A 4XDPA 5FYMA 4HOOA 5FXWA 5F3EA 4URAA 2XDVA 4D6QA 5A3NA 2XXZA 5A7PA 2P5BA 5FXXA 2YPDA 4D6SA 4AAPA 5FZEA 5FZ8A 5F5CA 4CUGA 5FBJA 5FUPA 5FZFA 5LWBA 3PDQA 3RVHA 3AL5A 5FP4A 5FWEA 5FYIA 4QWNA 5FZHA 5LW9A 5FZ3A 4IGOA 2YBPA 2W2IA 5A3TA 4QX8A 4GJYA 4QXCA 4LIUA 2YBSA 3KV9A 4UF0A 2WWJA 3OPWA 3KVAA 5FYVA 5A7QA 4AI9A 5A7OA 4CCNA 4E4HA 5IVCA 5F2WA 2OS2A 3PUAA 5F3CA 5FP7A 5FYHA 5FYBA 4EZHA 2YBKA 5ISLA 5FPBA 3UYJA 5K4LA 2OQ7A 5IVEA 3PURA 5FV3A 5IVVA 4QX7A 4DIQA 5FYZA 2VD7A 3AL6A 5FYTA 5FYUA 4CCKA 5F3GA 3PTRB 4QXHA 4TN7A 5FY7A 5A1FA 4EYUA 3K3OA 5FZ4A 5FZAA 3KV6A 2Q8CA 4CCJA 5FZCA 5FY8A 5F5AA 5FZ9A 5IW0A 5FY0A 5A7WA 5FWJA 4UF0B 3U4SA 3N9NA 5IVYA 5F39A 3PU8A 5FY4A 3AVRA 3NJYA 5FZIA 2Q8EA 4IGQA 4GAZA 5F3IA 5FYSA 2OX0A 5LY1A 2PXJA 4GJZA 4GD4A 3PU3A 5FYCA 5FZDA 5CEHA 3PUSA 2OT7A 5A7SA 2OQ6A 3N9QA 4ASKA 5FY1A 4NUBA 4QXBA 5FZ7A 3ZPOA 2XMLA 3KV5A 5FYYA 5FJHA 5LY2A 3U78A 5FZ0A 5F37A 2YU1A 2YU2A 3N9OA 5F2SA 5FUNA 4DO0A 3DXUA 3OPTA 3AVSA 5FP3A 5A1LA 3LDBA 4LIVA 5FPUA 4CSWA 5A7WB 4LITA 4QU1A 5A3PA 5FZOA 1VRBA 5FXZA 5FP8A 4V2WA 5E6HA 5FZKA 4EZ4A 5KR7A 4CCLA 4IGPA 5IVBA 2Q8DA 4HONA 4XDOA 5FXVA 3ZLIA 2GP3A 2WWUA
chains in the Genus database with same CATH superfamily
1DGWX 3BGAA 1UU5A 3O1PA 1U0AA 4ES8A 1ZZ8A 4CA9A 2J1TA 3V56A 2D93A 4QM8A 4PIZA 3SMHA 3MW2A 3UGFA 5HCAA 3NQHA 3ZYIB 2E32A 2A1XA 3FC0A 4S2HA 5C3RA 4F83A 1H8TC 4Q26A 2RS31 4WM7A 1IOAA 4ONUA 5FREA 4CEWB 4A7YA 4AFMA 2VNGA 3T09A 3T0BA 4GMP3 2Q1FA 4E27A 1PGW2 1KQRA 4L97A 3M8LA 5CFCB 3ZYPA 2V4VA 2RE9A 5I91A 4R9DA 2RS33 1SLAA 2D98A 2QQKA 2XVKA 2ZHLA 4JX0A 3T2TA 4DS0A 2ARAA 3BUCA 1O8PA 4PF1A 4AVAA 3ZYHA 3GZEA 4QB6A 2A6YA 2OUHA 3CZJA 2Z69A 3R4SA 4AEDA 4HANA 4QHBA 5EYYA 4GH4B 1S2BA 2IXCA 2VW2A 1NE6A 2MNGA 4A7KA 3WNXA 3MPPG 2KM2A 4LULA 2EIGA 2B9VA 3K48A 2WZR1 3HQXA 5BPXA 4TLGA 5FO7B 4AQ6A 2VOWA 1ASJ3 2YBPA 2DV9A 3FLRA 1GBGA 1NLSA 3H0OA 1UKRA 3NNLA 3WXPA 1DF0A 1H2KA 2XOMA 3OPWA 3FFZA 1W0PA 1JYIA 2L9LA 1JYXA 1OPMA 3A23A 5CU1A 1GANA 2QDNA 2WO2A 1QOTA 3KQRA 1R091 1ULEA 3SH5A 5EQUA 3VKFC 3SISA 3WX5A 4BH9A 5BNOA 3T0DA 4XBLA 1AX1A 1GKBA 2W1QA 4IL7A 1KEXA 1ZBA3 2RVAA 2FDGA 4J1WA 1UY1A 2EXIA 1HB3A 1MZFA 4CDQC 2ILMA 5C5TA 2EF6A 4XPVA 3VDDB 4DUVA 3K3OA 4RHV2 4BQ2A 4FOVA 4NR1A 4Y22A 1UYXA 2CWMA 1F4HA 1W6OA 4LLFA 2WYFA 4LQRA 5ANNA 3VBRB 4BB3A 4MGYE 1FX5A 4ASLA 2ZXQA 5FKBA 2DCYA 1HRI3 3GJBA 1VAKA 4RQPA 4YG3A 1Q3EA 1EAH2 1VLNA 2FDJA 4X8NA 5A33B 3AVRA 1YJKA 2Q8OA 1VALA 2BW8A 3IIAA 4Y5SA 3ILFA 4IERA 4FFGA 5C8CC 1B35C 1DDLA 5JI7A 3LFIA 5T5OA 2ZHMA 2VNRA 3RWKX 3I2GA 4QXBA 2DYCA 2PHXA 2P34A 4XFFA 3GYDA 1RXFA 2YC0A 4DY5A 1XB9A 1CQ9A 1PO13 4QQ2A 5K0UB 3O1MA 1REDA 1TMF3 1YXWA 2H6CA 1H6YA 2CDPA 3B7MA 5I0UA 3R4DB 1DIWA 1V6JA 2HYKA 3EXUA 3U07A 1J83A 3HNYM 1MEC2 2VVEA 4PJYA 1VB4A 3E5QA 5DXDA 1GWLA 1JMUB 1ZNPA 3FHQA 4HPKB 1VE0A 5EFUA 3CO2A 3V65A 3M3EA 4KU7A 1JOPA 2VOVA 5JZGA 4L99A 4AOCA 4MXWB 2VZSA 3WDYA 1CAWB 2IXLA 1SLIA 1GFF2 4N53B 1OI6A 2WDBA 4G3YC 3GF6A 4PBPA 5FTTC 3SEEA 3RYPA 1JYCA 2XVGA 2JE9A 2B5HA 3VD4A 1RUH3 3KHCA 2AEZA 3KGLA 4LO8A 4FPGA 5IYYA 1H6XA 1JS9A 5FJKA 2D6MA 4WVVA 1MS0A 4S2FA 2ZEYA 1XNAA 1JU4A 1WGPA 3OGJA 3UJOA 3MLLA 2BV4A 2XDVA 1PGW1 3BB6A 3RZZA 2W1UA 2WNOA 3HT2A 3AP4A 4A7ZA 2XLFA 2VUDA 1ENQA 4UOJA 4QQOA 2W3JA 4FPCA 2OW4A 5GLZA 4OZXA 1NOVA 1U5XA 2ATFA 2H0VA 3LA7A 2EIDA 1TG7A 1OLQA 3J7MA 4AZZA 3O0XA 4UT5A 4AGRA 5JI9A 1XRUA 3GZTB 5JXGA 1F5JA 2E7QA 4FOQA 1HB2A 3D0SA 4CUCA 5ACA2 1H1AA 3T4HB 2VUJA 2ZTNA 3ZR5A 2QZ2A 1J3PA 1EV13 2QQUA 1QU0A 3S5QA 3NV1A 1GNYA 5KXCA 2E26A 3MHZA 3PMEA 1SLLA 2LW8A 4QDSA 2A71A 1PZ7A 3ZFFB 3CDZB 3G6JB 4QGMA 4TTGA 4GWMA 3OUHA 1VBD3 3A4UA 2WKKA 3ZN4A 5A32B 4IV3A 4CYDA 2AR6A 1G9BA 1HRV2 4DIQA 5FYZA 3KB5A 3LSEA 1OD3A 2EIEA 2GC2A 4HZFA 3WQ1A 1OF3A 4BLIA 1HX6A 2J1RA 2QQNA 4L11A 5KC6A 1NXMA 3PIJA 4JRAA 4DOUA 1APNA 4UXAA 5FZCA 4E9KA 4IEOA 2WNUA 5F5AA 1WW7A 2AREA 2TBVA 4UF0B 2BWAA 2Y6KA 3RDIA 4HKOA 4YGEA 2ZMKA 4LEJA 4NHXA 1AHSA 2SLIA 2WQ4A 3RWNA 3A0KA 4K40A 4B4RA 2P37A 3OUJA 1K42A 5FYCA 3WSOA 1AYM2 1EAH1 1DQ2A 1UZZA 5A7SA 4XURA 3OBAA 3WLUA 3E97A 2A6ZA 1BVP1 4RYDA 3RYRA 4FTBA 1KRIA 1VPHA 5FZ7A 2B7YA 1Q56A 4BMEA 4DQAA 5FJHA 1EAH3 2IVJA 4GALA 5G04L 4CEWA 1OXCA 2Y26A 5BV6A 1HXS2 1QJEA 3HT1A 1ULFA 3WF4A 1AL21 3MLJA 2JG8B 2A5ZA 4Y5TA 5DAXA 5CFCA 2Y6HA 2D6KA 2DF7A 1YCIA 2J22A 4IQPA 4YNIA 5A3PA 4QAWA 1U12A 3BTXA 4OI0A 2BERA 3LOBA 4LJHA 4JKLA 1AL23 4RS5C 2OZ6A 1YQCA 2I07B 2R073 1EPWA 5GZFA 2DBNA 1EP0A 3AZXA 2QQWA 1JI6A 1MEC1 4GH4A 4ZHNA 3ACFA 4YW7A 1PIV2 3W21A 4D7TA 1QJU3 1AX0A 4IEVA 4AEJA 2XUEA 4MO3M 4NMIA 4C0BA 2VMEA 2R0HA 1SMVA 1MEC3 3OY8B 3I54A 4IV3C 2BUKA 3RJ2X 4DINB 1XNKA 1ND3C 1A8MA 4LKEA 1BMV2 4HK9A 1QJX3 4OFGA 5FPVA 5FZ1A 5FZBA 1W9SA 4P9XA 1IQDC 5JDBA 2J1UA 1EUUA 4XJAA 4OUEA 5FZOB 3AMQA 2QVSB 1KFUL 2AEYA 4UFJA 5FZMA 1CAUB 1BXHA 2PHWA 5GM0A 3ZXKA 2VQTA 1XC6A 5B4NA 1GQHA 4XMIA 2X5IC 4M4PA 4LA2A 1CIWA 3BOWA 1R64A 3GM8A 5FZFA 4P5HA 3RSJA 2V09A 3HR9A 2XB6C 1PX4A 3VDDA 1WA4A 4TYSA 3T3YA 1FPN2 3NNJA 5FWEA 2ZX3A 5EPAA 4AXOA 3I3DA 4LBQD 1LGCA 4LBOA 4U36A 2JDNA 3MEPA 4Y1VA 4AVBA 4O9EA 2LS6A 4PLOA 2NMOA 1NQDA 2WLPA 4UFKA 4XF9A 4YWAA 4QKDA 4YLZA 5A33A 1UPIA 4N43B 3VKOA 1S0IA 2ZCWA 4QT6A 5DG1A 3LDRA 3BYWA 5ACA1 1OLRA 1IS4A 4NO4A 3RZHA 1PM7A 3UYJA 1E5HA 1JU3A 1TVGA 5K4LA 2A70A 4FP3A 5FV3A 5CFDC 1QF3A 2WABA 4RR3B 1HDKA 1MZ5A 1LU2A 3AL6A 4R4ZA 3VZJA 3FZ3A 4LPLA 1XQNA 3VBFB 3WNLA 3O1VA 4LK6A 3ACLA 3O1SA 1A78A 1W28A 5K0UA 5FZAA 2JE7A 1RL3A 1HRV1 1W8OA 1ZZ7A 4D3WA 3U1XA 1VB2A 2D44A 1SG3A 1O3QA 3MIFA 4GZ9A 4GB33 1Q8SA 3M2MA 4W6YA 5C3QA 1X9PA 4XJ8A 4FPJA 2Q8EA 5KHJA 1ST8A 1JW6A 2R32A 3BPZA 1P8JA 4O61A 4Y1UA 3WP3A 1WLCA 3O7OA 2X53S 3AZVA 4XBQA 4MV2A 5EP9A 5I0SA 1COV2 1V6LA 1UYZA 2ADDA 2VTXJ 1WW5A 5J37A 2O8QA 2K2SA 4MXWA 2WQ8A 2AZ5A 1CAWA 1MS8A 3HWJA 4N53A 2ZS6B 4H7MA 4E8DA 5LCWL 1UNBA 2FD8A 3WG1A 1FOD3 2YPJA 4DXRA 2JG9B 4KWLA 1AYM1 4YGCA 1ONAA 2ZEZA 3W59A 2AH2A 2XVLA 1ZA7A 5FZ0A 4CUAA 4J25A 3J4UH 4N7IA 2D6PA 3I3BA 3AMPA 1SCSA 3J26N 3N9OA 4M3CF 4M01A 4WM8B 4GULA 2XJSA 3B9IA 2EXKA 5EYXA 4QDQA 2HYXA 1M06G 1LOAA 1HXS1 1PVC3 2UWBA 4J1XA 1W9FA 1S0GA 4RD7A 5CKQA 3GZUC 3ZYBA 5FOJB 2EAKA 1MS4A 1RUD2 2WLQA 4Q8KA 4YW2A 5F5IA 2Q1MA 2JICA 3JQWA 2XQRA 3AKQA 4W6WA 1UKGA 4B4PA 1BK1A 5T54A 5I0TA 1W9WA 3GXUA 3PUQA 4S2GA 4LTAA 1Y43B 1L3JA 2EXHA 3H7YA 5ANQA 4G4FA 5FP9A 1R082 2IUWA 3TNQA 1AR72 4CU7A 5BNNC 1RUJ3 3THCA 4DEQA 2ZGPA 1PIV1 5ABJB 4MGQA 3FLPA 4JKKA 2WFF2 3VBOB 2ZGKA 4BQYA 3I2KA 4JDMA 4IDZA 3M3CA 1UU6A 1PO22 4LE3A 4KBZA 1BCXA 4FO9A 1IPKA 2DVAA 2UYAA 3ZFFA 4URAA 1D2SA 4TXWA 5LB6A 1DGRN 1V0AA 2R0FA 5HPOA 5A32A 2I74A 1D4M3 1UQXA 4IV1B 4JQTA 2WO1A 2NYYA 3RZKA 5JMOA 1LHWA 2VOTA 1WCKA 1WBLA 4MH0E 1XU1A 4IE4A 4QPIB 5FO8B 2VZOA 3RI9A 4IXLA 2QQPA 3AL5A 5FDBA 2IXKA 4EQVA 4AQTA 1SLTA 3GZAA 2XJVA 3VL8A 2V73A 4XFIA 3SC7X 4UF0A 1GZCA 2EICA 4Y5Z0 3KVAA 4AI9A 5FK8A 3AZYA 1FPN1 5DAVA 4ZZ8A 2Y0OA 2E63A 4NAMA 1WCSA 1UXXX 3TN93 4A45A 2YROA 2GNTA 5FPBA 2JB4A 2W5FA 2D3PA 5F6LB 2ZABA 2BNOA 1XU2A 1S4CA 1H4HA 1WLWA 3NV4A 5FYUA 2HWF3 1RUF1 2VULA 4OHXA 2ZACA 3T1LA 4NPLA 1QQP3 2WAAA 3CEWA 1LOEA 4JTNA 1AF9A 2WC2A 2YUEA 3VD9A 1W90A 2AC1A 1UOJA 2IC1A 3AX4A 4N8MA 1RUF3 4NIAA 4ZPIA 1H9PA 1MPXA 1H9WA 3ZXJA 2JG8A 2Z2SB 4MGIE 4LT5A 1FAYA 3VHOA 2QNKA 4YZ5A 1VBA3 4Q4V2 2VBDA 3IM0A 3I2IA 2UWAA 4COYA 4FVVA 3M3OA 2UY8A 4HN0A 4LKDA 1VAMA 4OULA 2B9UA 4UFMA 1O5UA 1YQ2A 3BU7A 3JQXA 4LUMA 2TUNA 3ZSEA 3UK9A 4HL0A 4YZ3A 1XNTA 3PUSA 5A3UA 2NN8A 2CTVA 2OQ6A 2ZAAA 4Q4W2 3B5LB 2VMHA 2Y64A 1KFXL 5BNPB 4GWJA 3OY8A 1J58A 2YGLA 3VN4A 4XJUA 4BDVB 1W9YA 4ZU7A 3H50A 5M0TA 4JGZC 1OH3A 2YU2A 5FUNA 4AI8A 5FPUA 3OCPA 3OB8A 2ETEA 3O14A 4E8CA 4QU1A 5FZOA 4XFCA 1VR3A 2FBEA 5C8WA 2VZVA 2VUCA 4LBKA 2NZ9A 4JTOA 1CAUA 1D0GA 2Q8DA 2DCJA 2QCSB 2WO3A 2WWUA 3WDUA 3BODA 3Q8AA 4D6RA 1WD4A 1JZ5A 4Y4YA 3KV4A 3POBA 3EQEA 1ZZCA 4Q29A 1GP5A 4YW3A 2BFUS 5FMDA 3VBUC 3WCSA 2D6OX 4NRPA 4PDWC 3BTAA 2JB8A 3JBG3 2BBAA 4NN0A 4QPWA 5H9SA 5BUVA 1RUD1 3UETA 1JZ8A 1OA2A 2D3RA 2EXJA 3DPRB 1G8WA 2RS12 1C3HA 3AMHA 1W2AX 1OLME 3KF5A 3N9MA 1V6OA 1YFUA 2WQZC 1RC6A 4FPOB 1MQTC 4N7UA 1S55A 3POJA 2WAOA 1AX2A 1PM4A 4XF3A 2KA3A 1S0EA 3WF0A 3L9JT 1R081 5DUXA 1AR71 5C4WC 4N43A 5ERLA 4BQ1A 2W87A 3ENRA 1I1EA 2VVDA 3AFKA 2WFF1 4Q1PA 5BY5A 2QKDA 2OPWA 3MBWA 3R4UA 3TYJA 1R083 3BOPA 3SCFA 4D6QA 2JD9A 1RUI2 2VMFA 2XUMA 2VL4A 2P5BA 2XXZA 3I8TA 4RR3A 1OOPC 4CDWB 3ZOIA 1ODNA 5FBZA 5FZ8A 1Y9GA 2PAMA 4D7YA 3VBFA 5EIYB 5FUPA 4Y1YA 5I93A 2K0GA 1HW5A 1ND2A 3AM2A 1TQ5A 2ZOEB 3AZWA 5LW9A 1DP0A 2BNMA 4PLMA 5FZ3A 1DQ6A 3CHXA 5A3TA 3N7KA 4PT6A 4QPYA 1W6QB 4QX8A 3SKJE 2Y0IA 3U11A 3WG3A 4I2OA 5A7QA 2BOJA 3FMGA 1WW6A 3RZMA 1LNSA 2JENA 1URXA 3JB4C 1REFA 3WF1A 2BDRA 5F3CA 1QWRA 4CCEA 4FPEA 2WSVA 1XBFA 3NKGA 4QDRA 2GSYA 1DGLA 2CWSA 5KHIA 1XNCA 2HKXA 2Q30A 1BYHA 3SKVA 3PURA 3T0AA 1U5ZA 1NY71 3TRSB 4U2AA 2Z79A 1HB1A 2NM1A 2W1SA 1C4RA 4RN5A 1YIPA 4XDQA 1SDDB 1LB2A 2JG9A 3S57A 4WBBA 4UFIA 3FUOA 1W8ZA 3KV6A 4FBFA 5AC92 3DF0A 4WM8A 4QXKA 4NAOA 1D4VB 4MGKE 4XFBA 5D8AB 1ULDA 2BVVA 2OUJA 2BTVC 5C9AB 3PU8A 1J59A 2GMMA 1Q43A 5JXJA 1JOBA 4Q0QA 2VZQA 2ZGLA 5JXHA 4GAZA 2V5YA 1R1A2 4FOYA 4ISRA 4NHYA 2OIIA 3EMRA 2AUYA 2GH2A 5EV7A 3AFGA 1QJFA 4FFHA 4Q4V1 4NJ4A 1C1FA 2UURA 3J8F2 4XF1A 2A6VA 3NSTA 1XOYA 3ZSKA 3LPGA 4HETA 3A7QA 1NYWA 1UZVA 3NNGA 5JSRA 3ZFEB 1GUIA 1RUG2 1QJY3 2Q5TA 5L7OC 5ABJA 1ZRDA 1M4WA 3VBOA 1BQPA 3UKVA 3P1IA 4AQSA 4E2QA 4Q4W1 5DZGA 3D8CA 3LDBA 1ZRCA 2A73B 2RDNA 1BEV3 1VP6A 2GU9A 3M1HA 5LBCA 3ZXLA 4DB5A 2R30A 3B69A 4LKFA 4LO4B 1ZRFA 5C5UA 1ND2C 5KC5A 3VHNA 3LEIA 1PX3A 5JIAA 1W6PB 1GU3A 2DVBA 3U75A 1Y9QA 1VRH3 4CCMA 3C8XA 5CNAA 1GZ9A 1JUIA 1UZWA 4IV1A 4IEPA 2PHLA 2BVBA 3DV8A 3IZOA 3T08A 3IMNA 4QPIA 2GN7A 2VPVA 3JD71 3K3NA 5I0DA 1CIYA 4HFSA 3ZR6A 3QACA 5J09A 1RJ7A 4P9GA 2ZMLA 4GWNA 3WDVA 1QJZA 3JD73 4JGYC 5J36A 1YI7A 2VY0A 1UF2C 1LR5A 3QCWA 5T3NA 1TZOA 2XHNA 3PVNA 5FR3A 4XHBA 2FCTA 1MZEA 4YVSB 4HOOA 4BLJA 4BCUA 3ZKYA 2BRTA 4WM8C 2P3YA 3A0NA 1K5MB 1LESA 4FFIA 4AAXA 1KDMA 5F8PA 3BI3A 2YPDA 3AJZA 1REEA 4Q4Y1 3CF6E 3VBSC 2WS92 1FMD3 4LHKA 1QIQA 1RUI1 3I97A 1ULOA 4Q4Y3 4XC9A 3S7EA 2F4LA 3WQBA 5HV4A 1X8EA 3ZYRA 2XJUA 1W9TA 5A70A 4CPBD 3D6EA 5LATA 4QPGB 5A7OA 3KS7A 3KM5A 4TSVA 2ZEXA 1OMIA 2CAUA 2YFZA 3AJYA 1JH5A 2ZJCA 1VIWB 2OYZA 1AYN2 4FQ4A 1HJFA 1AR62 1BVVA 1QDOA 1DFQA 4XBNA 1OD5A 3OF1A 1OQEA 3RS6A 3VBHB 4CCKA 3NNMA 1H30A 5EHDA 2R7EB 2JD4A 2HWB1 4RA0A 5BNPA 4C1WA 4M3CA 3VB9A 3X29B 4C0HA 3BPSA 2Y60A 3OOXA 2HWB3 3DKQA 1QH7A 3ABZA 4QPIC 2WZ8A 2ZX0A 2WZR3 1NUKA 3ST7A 4L8QA 5AC91 1GR3A 1VBE2 4IGQA 1YFYA 1RITA 2RMU1 2QQMA 1PK6C 1LTEA 1KS5A 2W91A 4GJZA 4BMBA 3PU3A 1V00A 3CJIC 1G7YA 1POV0 2X09A 4JKMA 2FMYA 2WUHA 5JR2A 4FSJA 2RMU3 4QU2A 1CX1A 4BQXA 1R093 1X82A 3H7JA 1AR82 4R9CA 4ZONA 1DHKB 3VUOA 3TBDA 3AK0A 3DPRA 3E6DA 2FQPA 3J8F1 1KS4A 4P9JA 5FO9B 1U5YA 1DZQA 4KH9A 4XXAA 2Y6JA 4YM1A 1RUG1 1J3RA 1VRBA 3WF2A 2BBVA 1XPWA 4V2WA 1IS6A 4L2NA 4RGAA 4EZ4A 5FY7A 2PAKA 2VAUA 4WM7C 3VHPA 1JOJA 4CDWA 3I2JA 1WKYA 2GC1A 2VCMA 2BNNA 2QUOA 2JXAA 3B01A 1WCDJ 3LA2A 1SLBA 3GJAA 3ZXFA 1ZREA 1NLQA 3HD8B 1W99A 3WW4A 1A8DA 4ZS3A 4XEZA 3TAYA 3ME2A 5L9BA 1W8WA 4ZXEA 2XL7A 4CUBA 1UY4A 1ZZBA 4AI3A 4Z1VA 1DZRA 2PHDA 4O9GA 1W6QA 2HWE2 2RJ2A 3QBQA 3JU9A 4JHZA 1CD3G 3UL2A 4AEDC 5JUVA 2YG0A 1F15A 1HN1A 4Z92B 4META 1EYBA 4JV4A 4Q4X1 2WA3A 5CISA 2VW1A 3FUQA 4GA9A 3RGBA 1BJQA 2MEV2 3WNKA 2WNVB 5GLUA 1AJOA 3WG2A 3GBGA 5F3EA 4K8FA 1V6NA 1C28A 4Q4X3 3OGGA 5A3OA 4C1XA 3AYEA 4E2SA 2JDUA 4MGSA 4AHXA 2ZGRA 3RFRA 4LE4A 4NRMA 4J6GA 5F5CA 4DXTA 1F4AA 1NCQB 2HWD1 4AW7A 1CGPA 1OLMA 1O3RA 5BNOC 4OUMA 4Y1XA 2ZGNA 4K3UA 4BYYA 2HWD3 1SDWA 3AYDA 4WVZA 2R042 2WS91 2XLAA 5D8AA 3RYKA 3SXWA 3WP4A 1JUHA 1MS9A 2WWJA 5C9AA 3K4DA 2OXBA 5JOWA 4UFHA 3ECQA 5F2WA 1X7NA 3MIEA 3OGVA 1RMU2 1IGOA 1WCUA 2A6XA 2WR9A 4OI1A 4QGLA 1JN2P 4M0HA 1T6GC 4BE3A 3KGZA 4IEWA 3EO6A 1JZ7A 1FI2A 4IW3A 4V1PA 3WY6A 4BJ0A 2EALA 2K9ZA 5LEJA 2DTWA 1JBCA 3MUY1 4NWWA 4RQPC 4YG0A 5KHHA 3VZMA 1DCSA 2HBTA 1AYN1 2Y6LA 4QXHA 1Q8QA 2W1WA 2VCAA 1J1LA 1AR61 4RGKA 3Q8FA 3JCIA 4FXGB 2R49A 3ZFEA 5A1FA 5T50A 3S7IA 5FZ4A 3LA3A 4JDNA 1WMDA 2VG9A 1BZWA 4NROA 2ZX4A 3E5XA 4CRQA 4OHVA 4RFRB 4LK7A 4WVWA 4LBMA 4OI2A 3SH4A 3WNPA 1V9U2 1S2EA 4KNCA 3KSCA 1W6PA 2F6BA 1OQ1A 3H1YA 4HLTA 4LO6B 2LM3A 2VUAA 4MHUA 5F3IA 3INAA 3OUIA 4F7ZA 3H1WA 4L92A 2ZGUA 2CV6A 1OPOA 2C6SA 2G9GA 3GCXA 5FZDA 1D2QA 3ZIWA 1A6CA 2VQ0A 4AEKA 1DGRA 3IPVA 3ZPOA 3C7OA 4WZCA 4ARXA 1AXZA 3PJQA 2PHRA 2VBPA 4CXYA 3PLQA 2ZKLA 1AR81 1EPZA 3OBTA 4GMP0 5JZGC 2ERFA 5IK7A 3VZKA 2VJXA 3WW1A 1KJLA 4GXLA 4RHV1 2TNFA 4ZY9A 1ZZ6A 4YVSA 2PQSA 5IK8A 3ZLIA 3ES1A 2BZDA 2AACA 2HH9A 3ORJA 2PN5A 3QH6A 5FMBA 1K5MA 3KVBA 1C8NA 4YM3A 2DU0A 5DDJ2 5JCTA 4RHV3 2QQJA 1F2NA 3AP9A 5JOZA 2ZKNA 4QKFA 1POQA 3SCHA 5A6QA 3L2HA 1DGWA 1VMJA 3IDAA 1RVF2 1CJDA 3ZSMA 2FDIA 4NIIA 1ZBE2 2DWRA 2QQOA 4XFHA 5J7MA 2G9ZA 4XZPA 2IFRA 2UY9A 3W5NA 3ZMNA 4QPGA 5TSWA 4L9BA 5A3WA 2RJLA 4ZS2A 2HEWF 2X29A 1W8NA 1XE7A 1BBT2 4XDPA 1C5IA 2WT2A 3DYPA 2RHPA 3H8RA 2Y38A 3H3ZA 4Q27A 1TE1B 5A3NA 3I3MA 3FLTA 4UW4A 3LWCA 1STMA 3VBHA 5FKCA 1TME2 3FBYA 4I09A 1VMHA 1AVBA 1XSQA 3M70A 1H2LA 4G9SB 1L7LA 4ZU4A 2BGCA 3A22A 1W2TA 1XXNA 3AKTA 1O91A 2FZ1A 4XQDA 4YVWB 3ZFGB 4CDUB 1IPJA 1QH6A 3ETQA 3KV9A 2YMZA 4CCNA 3THTA 4HKLA 1X36A 3LIHA 4LMFA 5F5QA 1YRZA 2OVUA 3OJBA 4Q1RA 3ZMOA 2R041 2W47A 4HVQA 4EWEA 1W6MB 1BKZA 4CP0A 1C5HA 1UIJA 1GNZA 2P2KA 2WNUC 4HSJA 5D21A 2R043 4QX3A 4E4ZA 5EXOA 2VD7A 1RB8G 3KQ4B 4FP2A 3ZXAC 2JDZA 5FRAA 1AXYA 1W05A 4MOAA 3POIA 4MX3A 4HVRA 2C9AA 3EB7A 1RYYA 4N9IA 3K51A 4EE2A 1G6NA 3LEGA 3U4XA 2FDHA 1W2NA 3VBRA 4IE5A 4EN0A 3N9NA 5CYYA 2ZGMA 2GH8A 3ZSLA 2W68A 3HMYA 4PI0A 1O5LA 3TOJA 4AK3A 1TNFA 1AUYA 5LRRA 3NO8A 4UYBA 2QQLA 4CEWC 1MS5A 2W52A 5LRSA 1V9U1 5F7UA 2V5DA 2PHUA 5B2GB 2PELA 1X50A 1Z7S2 3VD5A 2R1BA 5CADA 4CCCA 5E1RA 5CFCC 2BGPA 3CBNA 2WT0A 5ACA3 2ET7A 2WN3A 4BOWA 1NLRA 2RM22 4JAAA 5LK7B 1LGBA 1V9U3 2XGXA 3G7DA 3MIDA 5KXBA 2DUPA 2P6CA 3OD4A 5SV5A 3DYOA 4FFFA 3ZDVA 2AENA 3ZN6B 5F2SA 4DO0A 2GZWA 4YW5A 3OPTA 4AFBA 4KWJA 2BPA2 2NMNA 4GH4C 3FX3A 4N9HA 3LEMA 4ISQA 1G9FA 1RUC2 2WNVA 1HRV3 1PMIA 1DG6A 4URTA 1HV1A 1OFSA 5DUVA 1HN0A 4EN8B 1QEXA 2VGDA 1UY0A 2W46A 4QX5A 3MF6A 3N9LA 2GC0A 3IMMA 4HPKA 5A6ZA 2QFEA 1NCRB 2YGMA 1K3IA 2PQQA 1GP6A 1NCQA 1O6UA 2XWJB 4H55A 2PLV2 2P6HA 2VTXA 4Y20B 5DDJ1 1H1IA 3EJKA 4MGTA 1UY3A 3F2ZA 2Y8KA 4Y4RA 1C8M2 4QQPA 1Q8OA 4M0NA 5GZGA 1AXKA 3HBKA 5IVJA 1JZ6A 4E4SA 3PMSA 3NAPB 4KI5M 4DRRA 1AYM3 3Q8CA 2H6BA 1HB4A 3T2OA 3T4VA 3R6SA 3MGUA 3VDDC 1YLLA 1DZTA 3MV01 2QTWB 5DUUA 3VBRC 3AZZA 1W0NA 1JZ4A 1O3TA 4CEYB 1VBC2 1LOCA 4N90A 5IHRA 3B00A 5FMOS 2PYTA 1BBT1 4PQ9A 5FUIA 1HXS3 2W08A 5CG9A 1QNYA 2BEOA 2NQYA 3HN3A 3WG4A 1HLCA 1UZ0A 2Z5WA 5L9VA 2C5DA 5FYIA 1JYTA 1UW8A 2BJSA 5J3UA 5C7GA 3AMMA 1TME1 4GJYA 4COWA 4P02B 5FYVA 4NPMA 5DZEA 3UT0A 3I59B 5BYNA 2R16A 2AGSA 1SQ4A 1H0BA 3KD4A 1W2OA 2XPJA 1H4GA 1PIV3 3EHKA 3NJVA 3KCCA 3ZX7A 5K0UC 4S2DA 1BMV1 3ETPA 2R062 1H8TB 3LF7A 3OD0A 4XOGA 3UGGA 1JTZX 1K45A 4MUVA 5GLVA 4MSVA 1YO8A 4XFGA 3RG0A 3BKZA 1YQ8A 3KF3A 5HV0A 2P3KA 3MO4A 1NG0A 4TN7A 3LOIA 3O5SA 1UPSA 2IZWA 4K7JA 4OUSA 1I5PA 3P6BA 5FY8A 2DBIA 2B8MA 4EN6B 2WIIB 5FIXA 1V6IA 3AKRA 3AYCA 3IN9A 3OGSA 4XUTA 5FY0A 2ZGOA 1N47A 4KG8A 4N53C 5IVYA 4F3JA 3ASIA 5EZWA 2RR12 3GALA 3WNMA 3E6CC 4XUQA 5GZCA 1OKOA 2VTFA 2RS52 1WLDA 2O0OA 1CONA 1FPN3 1VBB2 3IIIA 1FV2A 1LHOA 3HQRA 4MHRA 4I0BA 1F5FA 3BCWA 3CMGA 4KU8A 4XACA 4FPHA 5FY1A 2EAAA 1FV3A 2K46A 3E6BA 1WMFA 4OZOA 5J48A 4CCDA 1ENRA 1N1SA 3U78A 1A3KA 3ZYJB 4QB1A 1PGL2 4R52A 3S30A 5GZDA 1QMJA 4BM8A 2RM21 1WD3A 4LA3A 5EJZB 5A3LA 1YWKA 4HN1A 4HXCA 1UD1A 3LSDA 2C0ZA 5FZKA 4CDQB 1G9CA 2LRPA 2VH9A 1TEIA 3WINE 1NXD1 3I2HA 1LOFA 2TEPA 3AKSA 4GIQA 3M4FA 2PAEA 2Q4SA 1C1LA 3WNNA 5FK7A 1S0JA 4QMAA 3ZFFC 2PHTA 1G9DA 3C7GA 5C70A 3H8UA 1COV1 3KZ4C 4QGNA 3WDTA 4ORFA 2FHRA 2XLGA 1YFWA 2YXSA 3PIGA 1UZYA 5APAA 3ZFGA 4CDUA 1B35B 3HEIA 5C8CB 1SFPA 2R6QA 4BQ5A 2PLV1 1O7FA 2XR4A 3CNAA 5FPLA 1NKGA 1COV3 3PVEA 3VZLA 2B46X 5IVFA 5HCHA 1C8M1 3WZ1A 3WHUA 5L73A 1W6MA 1QXPA 3K4AA 1RUE2 1LULA 3ITQA 5FOBB 3RMXA 1WA6X 1SPPB 5A7PA 4IETA 2HWC2 2B45X 4BPZA 5DN2A 3PVOA 2JIGA 4CU6A 4RSUA 1N3OA 1VBC1 4PQQA 2BQPA 3OTFA 4BHPA 4F8AA 5FP4A 2CYFA 2G1MA 4Y24A 1NX9A 4XMAA 2VNVA 2ZGTA 4QXCA 4YW4A 1LRHA 3GHNA 2AYHA 2EIBA 3FFQA 1HQNA 4XE9A 4XILA 3VL9A 1RUD3 4E4HA 4R9AA 1RHI2 1WWYA 4PF5A 1O8SA 5FYBA 1RUOA 3WDWA 4YZ1A 1MVQA 2XKOA 3O0VA 4IEZA 3LE0A 1US3A 3POFA 4AVVA 1AR73 1PO21 4IEXA 1XSRA 2YV8A 1CZVA 1X33A 2JG8C 2VC9A 4K21A 4IE0A 3VDCA 1FNZA 1YC61 2CSGA 1IKQA 1IS5A 1LGNA 1WBFA 1YYNA 2WFF3 5CB7A 4YFWA 4HBNA 2R061 5KHKA 2N7GA 4NVPA 3MIBA 1PO23 1PVXA 2VVFA 4D0QA 3ZSJA 3MV11 5GZEA 2CAVA 4BQWA 1LCLA 1RUNA 2XHKA 3ZN6A 5CA6A 3MYXA 5F1RA 3UKNA 5IW0A 2GDFA 2O8OA 5KXEA 4OYUA 1ENXA 3IAQA 2E53A 1POV1 4HG6B 4KGQA 4DFSA 3RZLA 3NJYA 1W06A 3F95A 5FZIA 3VZOA 4H7LA 4LHSA 1RINA 4QQLA 2QQIA 3SHRA 4LBLA 2DCTA 3V0AB 1DQ0A 3C7EA 5BXXA 1W8TA 1NCRA 2ORZA 3GDBA 5GALA 3SH3A 1LU1A 3WCRA 3WW3A 2BU9A 3BTYA 2RS32 2RR11 1W8FA 1F35A 2D40A 5DUWA 3IT8A 2RS51 4Y20A 1OKQA 3HNBM 4DEVA 3WP5A 5CKNA 4RL7A 3BN6A 2VBBA 2XQXA 5LK5A 4O7XA 1W6NB 2RG4A 2P3IA 2YU1A 2LALA 2XONA 2JDKA 1SCRA 2PA7A 1E5RA 3DXUA 2OZJA 2X05A 4A6SA 3ZN5A 1J1TA 3N7LA 3NAPA 3WEZA 4EN7B 2FZ2A 4LITA 3B02A 2XJPA 3ZM8A 1NE4A 4DXSA 4AHWA 2ZMNA 1ASJ2 2DFCA 1LOBA 2YC4A 1SEFA 5E8AA 1OA3A 1OQDA 1D7PM 1NA1B 2CNAA 2QDRA 5FXVA 2GP3A 3HN1A 2VECA 3KT7A 3S0MA 3ZO0B 5A6YA 2VR4A 4BZ4A 2KXLA 5DAWA 5FZ6A 2Y6FA 2GNDA 5LBBA 2R1DA 4N43C 3URFA 1GZWB 4K1YA 2IXHA 3Q8BA 4B29A 3VV1A 3WQ7A 1SBDA 1CAVB 4Q4V3 4FAHA 1IQAA 1ZBA2 2HEYF 2VCBA 2ZZQA 1YNAA 4UW6A 3BIEA 2MHFA 1S2KA 4RR3C 2D5HA 4DPNA 3MI8A 4TLFA 3I59A 3DXTA 4Z2AA 3HPNA 4A44A 4YARA 2EA7A 3VBFC 2H0BA 5F32A 4LNVA 4XF4A 1VAVA 2RDSA 5FPZA 4NHKA 5FY5A 4OCTA 4QD2A 4AVTA 1QDCA 4EN9B 4Q4W3 5IT6A 1HRI2 2ARXA 4KG0A 1XJAA 5FXXA 4OHWA 4D6SA 3RJRA 3MLKA 5FZEA 3O1RA 3UV9A 4PIXA 4PI2A 1RUE1 2SBAA 3N36A 5FBJA 2CGOA 1S1AA 2HBUA 4UBGA 5LWBA 5H9RA 5H9QA 3RVHA 2IXIA 4RS5B 3S6PA 3IDCB 4NRQA 5AFBA 2DVGA 2ZZJA 1N1TA 4A3XA 4CTEA 1PO12 2JE8A 2RS11 4GQ7A 4QM9A 2JG9C 4AFAA 1TMF2 5J96B 2YBKA 2P4EA 4LR4A 3MW4A 1W0OA 2W9XA 4LBQB 4IV3B 1ND3B 2RS13 4W65A 1RHI1 5DAQA 4BIOA 4QX7A 4A42A 4ITCA 2ID4A 3USUB 1IHMA 4R4XA 4AI2A 3PTRB 4FCAA 1QXJA 1XYOA 2DUOA 2JX9A 3EYPA 1UIKA 3W5MA 4RFT0 3GNEA 4OVEA 2JKXA 3HJRA 4LLOA 3NJZA 4XUNA 4ASMB 3TEXA 2X5IB 1JYNA 5HXVA 1LEDA 5K8SA 2WWSA 1RUI3 1ZZ9A 1W8HA 2ZPXA 1SBFA 3GGLA 4CDQA 4K1ZA 4DZGA 5T52A 2Z42A 5A3MA 5IVCA 1PHMA 1PNFA 1RUH2 2VZ3A 3ILRA 2Z4FA 3C2UA 5ABJC 4LORA 3VBOC 3KMHA 3VLBB 3FWEA 3RNSA 2W94A 3ZYFA 3NRUA 2XBO2 1OBNA 1N3PA 3N9QA 5KBFA 4TWTA 4DUWA 2BGOA 2XJTA 4GMP1 3TNPB 3ZIXA 2YYOA 3H1MA 1G9AA 3OG2A 2W0XA 2Y6GA 3BTZA 5LY2A 3T2QA 1LENA 2DCKA 1HIXA 4XABA 1S0FA 1ZM1A 2VZPA 3NV2A 5C8CA 1B35A 4IV1C 1WUVA 4LO7A 4A6OA 5FLHA 1H2MA 3VGIA 1YEWA 2ES3A 4QHOA 4QKBA 5CFDB 1ZA4A 5A7WB 4XFAA 1GNHA 4CE8A 4CZSA 4AG4A 4NIGA 5JPNB 2XL9A 4I0WB 4BIFA 5FPXA 5KR7A 4AWDA 3IDEA 2GMPA 4EV0A 3OSDA 5HXMA 4KGGA 1T6BX 4HKWA 3WR0A 1RJ8A 1SPPA 4O65A 3D4KA 4CVUA 1EV12 5IFPA 1O4TA 1ASJ1 2UU8A 1GICA 4AI1A 5AC93 2CGPA 5IWFA 1UYYA 2W95A 5LEKA 4K20A 4I02A 1R1A1 3HOBA 1VBD2 5FZLA 1HJGA 2RDQA 5JIUA 1H2NA 1OUSA 2LROA 3N7JA 5LBFA 5AVAA 3D5OA 5C3PA 5DQ0A 5FPAA 2VMDA 3SCGA 3K77A 1R1A3 3KT1A 5C3SA 2KR2A 3LD8A 2IWGB 2P1BA 3MZHA 5FY9A 1JYVA 1UOGA 1ZBA1 2J1VA 4SLIA 1SZBA 3J8F3 4X8PA 1YJLA 5FXWA 1Y3TA 1O3SA 3K75B 1JXNA 4XJ9A 1UWWA 5CZKA 1V6MA 1Z0HA 2A3XA 2Q1ZB 2VW0A 3TEWA 3WUDA 1RUG3 1JODA 4DUXA 2PHFA 5I0RA 4FTEA 1DQ5A 1W3VA 5DZFA 1OVSA 4BK4A 4OQ8A 1MS1A 4AFDA 1LKNA 3FL7A 2UYBA 4ES9A 3Q8EA 4H2AA 3TEZA 1AJKA 4DNYA 1HRI1 3HBZA 5EWSA 5FZHA 2VOXA 3NNFA 1PNGA 4FXKB 1CPNA 3WOGA 1W3XA 1H8VA 3Q9OA 4B8EA 3D82A 5T5LA 2WA4A 2ZX2A 1LODA 2JDAA 3AXDA 4MXVA 4W50A 5E16A 2YHJA 5IJRA 1LAJA 1ULCA 2CDOA 5JMCA 2G9FA 4NPRA 2BP6A 1S0DA 2VU9A 3MIGA 3MICA 2QQVA 5BNPC 3I3QA 5IK5A 1IKPA 3T2PA 2ZGQA 2VQAA 5BNNB 3V0AA 1OURA 5FLIA 3NKTA 4P00B 2D3SA 3N35A 4KWKA 5SV8A 3SEPA 3WUCA 1PO11 1LEMA 2ET1A 4AGVA 1DYKA 1TMF1 1UX6A 1CZTA 2BFUL 2GN3A 3OYWB 4LHNA 4AR2A 5HI0A 4PLNA 1AL22 1UAIA 4GWIA 5IUQA 1UOBA 4P5YA 2R072 4K9SA 3GCWA 4QQHA 2RDRA 3HQUA 1R1ZA 3CZUA 5T5JA 3I7DA 1W6NA 2E51A 1YQ5A 1QJU2 3GBFA 1GLHA 1GOGA 2DURA 2VNOA 4XHXA 2CL2A 3KT4A 1ACCA 2XJRA 2FDFA 3SNMA 3ZXEA 4E2GA 5JAXA 3RRDA 4CP1A 1NA1A 3DPRC 4XUPA 5LZ6A 4LUKA 5JR7B 2WS93 1QJX2 3V0BB 2KD7A 4KWUA 2C24A 4H3WA 2VO5A 4MZUA 3NV3A 2V4AA 3RZJA 4OI4A 3B3QE 5CIRA 1GWMA 4CXXA 5CG8A 1RUH1 1GZWA 2VZUA 1PZ9A 1QHDA 2FMDA 3CIHA 3KHBA 1CAVA 1Q8PA 3MDPA 4GKXA 4RGGA 3RZGA 3IAPA 1O4ZA 3I2DA 2XBO1 2JDYA 2E7AA 3T1MA 1LHUA 4P08A 4CDWC 3IKWA 2WL1A 4LIVA 1AYN3 4NHLA 2ARBA 4AEDB 4YSFA 1AR63 1RTVA 2W39A 2XBO3 2JIJA 1I3HA 4IE6A 4XETA 4M00A 3POSA 4NWVA 2DVDA 3MIHA 3WHTA 4H14A 4XW3A 1CAXB 4CP9B 3ZKUA 4ATFA 3FHAA 3J7LA 4FPKA 5AFEA 3K46A 3DEMA 3ROUA 3O0WA 4BXFA 1B09A 1GV9A 1ULPA 1VBE1 1Y7BA 2CHHA 2XWBB 3MFAA 4QX0A 4A3ZA 4AHYA 5L19A 1HQLA 4CDXB 3QLQA 1IS3A 3ZPYA 4ATEA 4B4QA 1EV11 4RS5A 2JEMA 5FMCA 1WCQA 2E7TA 5JOXA 1VBE3 2NLRA 1OHFA 2GALA 4Q2FA 3VKNA 1MR5A 1VBD1 2A7AA 5DMYA 1T2XA 2JWPA 4Q0SA 2WO7A 1KJRA 1L7RA 2WYSA 2Y34A 4NOTA 3LZZA 1AR83 4YM2A 4W8JA 4LBQA 2QJVA 5LA9A 4GB32 2J1EA 2LUWA 1UY2A 1ND3A 1LHVA 2C4XA 4JGZB 3POGA 1SFYA 4GKYA 4UI9L 1WW4A 5D8AC 5C9AC 4UFLA 2WJSA 4AAPA 3C3VA 2VOKA 4XUOA 2WZEA 4XQ4A 3USUA 5C71A 1GMMA 1NA1C 1CWPA 4B1LA 5LASA 3PDQA 2WN2A 4MYEA 2C9KA 4YGDA 1FNYA 3VD7A 5K7PA 1I9RA 3NL1A 3W58A 1EUTA 1MACA 2W2IA 1GQGA 3WDXA 2X5IA 4QHZA 1SACA 3VZNA 4JHTA 1FOD2 4CU8A 3VBUB 2VMCA 5FLJA 5FP7A 4PDWB 1NAEA 1DU3D 4EZHA 3ZFEC 2HWE1 1WZXA 3HNMA 2FCUA 4XJZA 5KXDA 2NP0A 4MG2A 5AVPA 3ACIA 1E57A 1MQTB 3DCQA 4A4AA 5EJ1B 4XIKA 1GZTA 1U5IA 2HWE3 2MEV1 1PVC2 2DTYA 5IAVA 2XH6A 5C4WB 1KDKA 1XE0A 4AQ2A 4JC1A 3I4IA 3WP6A 5JWPA 3OPZA 2VM9A 2MEV3 2Q8CA 3BU0A 2F17A 1CPMA 1UN1A 3ACGA 2R071 5CFDA 1ULGA 2QBXA 3AMNA 5A7WA 5CKMA 1OOPB 3IDBB 4JZRA 5F39A 5LA1A 3FBMA 2G19A 1GSLA 1OT5A 1RUJ2 3KCYA 2C1FA 1CJPA 5HCBA 1CZSA 5J98B 5I8SA 1XYNA 1QJU1 5F6KA 4C91A 4D69A 2A6WA 5KHGA 1RXGA 1PMJX 3J9SA 4JRLA 1MS3A 4YYOA 5C6CA 3LAGA 5T5PA 5BNQA 5C33A 1RMU1 2IVIB 4KMQA 1A34A 4TZDA 4BQ4A 1S0CA 3USSA 1BHGA 4ASKA 1DQ1A 4QB2A 1QJX1 4D7SA 1CR7A 4YVSC 3KV5A 1D4M2 3FN9A 2YY1A 2JDHA 3NVCA 2CGNA 1RMU3 1K5MC 4BQ3A 2D97A 4BWOA 4B7KA 4K6BA 3L2YA 3POWA 3UGHA 4HSLA 1UXZA 1GQPA 1OSGA 1YHFA 2WFPA 4HVOA 5E6HA 1ODMA 4WZFA 3RQ0A 4CCLA 1FXZA 1KGYA 4NE9A 3TB0A 3ZYGA 1CVNA 2JDMA 1HQWA 1F8VA 2I2SA 1OF4A 2ZAHA 3EBRA 3QH7A 1RIRA 4QPGC 1ZVFA 2C26A 1DLLA 2DU1A 5A1AA 3I49A 3TN92 5A6XA 3N9PA 5JSPA 3O1TA 5I8TA 1QNWA 1V6KA 3DYMA 3QD6A 4BU2A 3WNOA 3M3IA 4BK5A 2OA2A 2HWF2 3I3EA 4YM0A 3M7AA 1QQP2 2D7FA 2E6VA 3VBHC 1IPSA 4IEUA 4PHZA 4Y1ZA 4Y3OA 2QE3A 1V70A 1RUF2 2WNEA 5BNNA 3J7NA 3U37A 5DABA 3H8OA 3POYA 4KQ7A 3PTYA 1VBA2 4UW3A 3THDA 5L7OB 1FATA 1DQ4A 1FT9A 2B42B 3OYWA 1I5ZA 1D0HA 3IBMA 2BWCA 2WT1A 4COZA 4CUGA 4GB31 2OKXA 1ND2B 3ELNA 5JLVA 2A3YA 2IXJA 5IFTA 1OA4A 2ZHNA 4FAGA 3U14A 3ZXDA 3LCPA 5JSOA 4XVHA 4OMDA 2VE1A 4LBJA 2GNBA 3H9AA 5DDJ3 3TWIA 1KITA 1RVF1 1X8MA 4CU9A 1ZBE1 3AYAA 5FYHA 2LTNA 3UNPA 4HT1T 3W9AA 1JZ3A 4OHZA 3V0BA 5FQ0B 1IZ3A 2HEVF 1FOD1 3MW3A 3PNAA 5IVEA 1RVF3 2BOIA 1QOSA 1UO9A 1ZBE3 3UESA 4AE2A 3AP5A 4D94A 4JGYB 4XZUG 2QZ3A 4I01A 4P9IA 1G86A 5F3GA 4P9WA 1QGLA 3LKJA 5GLTA 3HAGA 3WVJA 4AHZA 2X8KA 4EROA 4KBBA 4M4RA 2WZPP 2D43A 1GWKA 4WVMB 3KCXA 4XTMA 2PFWA 1BBT3 1PVC1 1NZIA 5IK4A 4PCRA 2WSUA 3DL3A 3JBG2 4R8HA 5FWJA 3PUIA 3PUHA 3U4SA 3AXEA 5FY4A 3VBSB 3V64A 3OEBA 5L9RA 1TME3 1W2UA 3KWVA 1XNDA 3OBRA 2GAUA 2D5FA 1CAXA 4YW6A 4CP9A 4OLLA 5DAPA 3W20A 3NJXA 3WW2A 1JYWA 2VCCA 2OPKA 5CEHA 1RUJ1 1AR92 3D3AA 4INDA 1FYUA 4Z2WA 4FPLA 1W04A 4R9BA 4LBNA 4CDXA 3H8XA 2WNVC 4K8RB 3AB0A 4Q0UA 2W92A 2DUQA 4ZXKA 5LBEA 2ZEWA 3ZDSA 4Z8BA 3A21A 2F4PA 3IWZA 4QKNA 5GLWA 1IG3A 3VDAA 2JECA 3WT3A 1E5IA 2JKBA 2HJIA 4Z07A 4MGZE 4LKSA 3WV6A 1D4M1 1NCQC 1UX7A 5HBAA 3QOPA 2E33A 5DG2A 1ZYBA 2G4IA 5JOYA 1JZ2A 2UWCA 5JPMB 4B1MA 1HV0A 1H1MA 1YQ6A 2GP5A 4JGZA 3J7HA 5J1XA 3P5BA 4V2VA 2VXRA 3O1OA 4Q8LA 3CQOA 4NIDA 2FDKA 2ARCA 3P3NA 5A80A 1UU4A 4AVCA 3B9CA 3K2OA 3AKPA 4XTPA 4AYUA 4DXZA 4FPFA 2J7MA 4M3CE 1PK6B 4QX2A 3B93A 1QY4A 3NWKA 5K9YA 1Z7S1 1W8UA 3TN91 5CBLA 4XCAA 1UMHA 3CJIB 5JVVA 4CCOA 4LHLA 1GOFA 2WINB 3UKTA 1J84A 4KL1A 1ZRRA 3FHIB 1LHNA 1HKDA 3VBUA 1NY72 4L0PA 2DDUA 2E31A 4A41A 2D6LX 4P9YA 4PDWA 1Z7S3 4PIYA 1NQJA 1SBEA 5FYMA 2HWF1 4FPYA 1QQP1 2VZRA 3CJXA 2RM23 1MQTA 1DYOA 4IUGA 3I2FA 4NHMA 4CXWA 3BALA 1RUC1 2WBKA 2ADEA 5C4WA 2B4KA 3D0JA 1VJ2A 5B4XA 1VBA1 1NZCA 4EJRA 3AP6A 1Q8VA 1RUC3 3ACHA 1E5SA 1YIFA 4IGOA 2ZGSA 5E88A 2Y33A 4WM7B 4YFZA 3VD3A 1CX4A 4YVWA 4ZZ5A 2YBSA 4LIUA 1IG0A 1OOPA 1UCXA 4Z82A 4CDXC 3SLIA 1ZX5A 4XXPA 5T55A 2E9QA 1Y4WA 3VKLA 1QJY2 3PUAA 1F9KA 1MVEA 3JUUA 4PBOA 1CESA 5ISLA 2B39A 1UL9A 2PLV3 2YDEA 3DECA 1BEV2 3CU7A 4ZKTB 4W6XA 3K4ZA 3WQ0A 2O14A 2WRAA 2VMGA 4QX1A 4UW5A 1C8M3 1O4YA 3CL1A 1QXRA 3MF9A 5D1IA 4I30A 2Q0AA 3APBA 4P14A 5FYTA 5LA0A 2ZHKA 5HCFA 4Q0VA 1VRH2 2ENRA 3FE5A 1XYPA 3JZVA 4JDOA 4M3CB 1K12A 5EJ3A 4EYUA 5H9PA 5FCCA 5FAXA 4CCJA 2P17A 1ZRIA 1UMZA 2DVFA 1PGL1 1BLZA 3GBWA 4Y26A 5FZ9A 5LA2A 3E5UA 5I8YA 3TEYA 1EY2A 1VBC3 2PMWB 2DCZA 2XG3A 3BVCA 2I45A 5D2AA 5E89A 2IFWA 2XJQA 2VZTA 1F31A 4UWDA 1KXGA 3PL0A 3H3LA 1WMXA 5GJ6A 1GP4A 5FYSA 3LEKA 3JD72 2PXJA 5BNOB 3JBG1 4JCKA 4YW1A 5C3OA 4DY3A 4ZU5A 2EVXA 3WD5A 2OT7A 3N7MA 4XCBA 3PVBB 3FJSA 3B94A 2CU5A 2ORXA 2X10A 3C7FA 4I3PA 1SHWB 4NUBA 4IEQA 4YRDA 1YFXA 4YZ2A 4ET7A 3LFMA 1OC1A 1AR91 3VKMA 1TNRA 3MUZ1 5F37A 3ALQA 1X9TA 1SFNA 4Y22B 1W39A 1J3QA 1LOFC 1W6OB 3O1UA 5A1LA 3LB9A 4XIOA 1OFNA 2R063 5FP3A 1FMD2 1N3QA 1KD7A 4FOWA 4D8MA 1LECA 4OHYA 4WV8A 3HIFA 1AR93 4RQPB 3VDBA 2J1SA 1LOGA 5IAXA 4Q4Y2 1DLCA 2YFUA 2J42A 1QOOA 4HONA 2VQUA 1YI9A 4CSWA 3LPFA 1DBNA 1O59A 4XAEA 4YVWC 3DGTA 1ALYA 3ZFGC 4CDUC 3N3HA 1UOFA 1POV3 1RGSA 5L7OA 2DFBA 1BK0A 3M3QA 2JDPA 2A75A 1L7QA 1N1YA 4UBHA 2ZX1A 4AL9A 1CN1A 3DUIA 4OQ9A 2VZ1A 4LO5B 4YPJA 4AF9A 1GOHA 1VMFA 1VBB1 3ILNA 2GNMA 2O1QA 2RR13 4MVTA 1US2A 4LXLA 4CP2A 4BISA 1JHNA 3AC0A 1W03A 4COVA 5G05L 1NT0A 3OBZA 4A2UA 2RS53 4I0AA 1Z78A 4COUA 5FZGA 3LGRA 4AGGA 1VBB3 5A7NA 4C90A 1JHJA 2P3JA 3U10A 4C8DA 1Y9MA 4Y33A 4IESA 1PGSA 2JJ6A 2NPIA 1AZDA 3PJYA 1LJ7A 5JXIA 5FQ0A 2BYVE 2HWB2 4FT8A 4XQWA 5FFOC 5L36A 3VHRA 1UYPA 2D6NA 4CEYA 2WZR2 4CPBA 4BXSV 2XKPA 4JGYA 1OUXA 1OVPA 4W4ZA 5JZGB 1WLTA 3ZVXA 3RI8A 4AI0A 3N4MA 4FI9A 2J1AA 3WF3A 4EWAA 4WVMA 4QWNA 1UMIA 4B7EA 2GC3A 5KWRA 2RMU2 4X6QB 4AFCA 1R092 3AP7A 4LOSA 2FCVA 4NIHA 5CVRA 3KLSA 3NW4A 1XE8A 1OH4A 4X6RB 4FTSA 3VBSA 3O12A 1GYKA 2OS2A 4IEYA 1I6XA 3SITA 2ZA9A 3MPBA 1DYPA 3CLPA 4JVAA 4OMCA 1S0BA 3JB8A 4ARYA 1H8TA 4DMIA 2OQ7A 1PZ8A 3CKHA 4EWDA 3ES4A 4FQZA 4MADA 1QJY1 2VMIA 1YUDA 3ON7A 4HK8A 4AEMA 5IVVA 3H3UA 4BA6A 2PTMA 3DN7A 4IE7A 3T30A 3H42B 1BEV1 1K5JA 1MZ6A 1QKQA 4Q0PA 3OEAA 3RMYA 3I2OA 2HWC1 1NCRC 3GHMA 4P9LA 5GKAC 3THPA 4YG6A 1RUE3 1SLCA 1WMEA 1VRH1 3LIGA 4UAPA 4B3NA 3S5AA 2RV9A 1AL0G 1PMHX 4LOTA 4SBVA 3C7HA 4YZ4A 2HWC3 1N1VA 4JQRA 2RJKA 3ATGA 4XJWA 2YB7A 3HVDA 2OX0A 5LY1A 3PHMA 4GD4A 3UJQA 3DKWA 2VXJA 2GMEA 2MPFA 5F9TA 5FMOL 3ZXGA 4E4DX 2HLEA 3NAPC 2YZ4A 3E1F1 3MFCA 4Q5OA 3IPVB 4AVSA 1C57A 1ENSA 3P3PA 1Q5OA 3NMBA 5DPNA 4HMZA 2XMLA 4Q4X2 5FYYA 2A3WA 1PK6A 3U0ZA 1RHI3 4CEYC 3RPQA 3IB3A 3CJIA 2YC2A 3BIWE 4I3GA 3R05A 2WNUB 3AVSA 4YGBA 4MLOA 5IATA 5CAZA 2CY6A 3POEA 3R0RA 4DRVA 2V72A 5FXZA 3LQCA 5FP8A 3OGRA 4XF0A 4XYXA 4XAAA 3JXSA 2HWD2 4IGPA 5IVBA 3LDKA 4XDOA 1XNBA 2ZBJA 1FMD1 3SQOA
chains in the Genus database with same CATH topology
4CCMA 3KVBA 2GP5A 3N9LA 4D6RA 5F5IA 3KV4A 5FZ6A 4BXFA 4V2VA 5IWFA 5A80A 3N9PA 5FZLA 3PUQA 3K3NA 5FP9A 3K2OA 2XUEA 5ANQA 3N9MA 4BU2A 4Y4RA 5FPAA 4LXLA 4BISA 5IVJA 4CCOA 5FZ1A 5FPVA 5FZBA 3DXTA 3LD8A 5FPLA 5FJKA 5A3WA 5FY9A 5FZGA 5A7NA 4Y3OA 5IVFA 5F32A 5FZOB 4C8DA 4Y33A 5FZMA 5FY5A 4XDPA 5FYMA 4HOOA 5FXWA 5F3EA 4URAA 2XDVA 4D6QA 5A3NA 2XXZA 5A7PA 2P5BA 5FXXA 2YPDA 4D6SA 4AAPA 5FZEA 5FZ8A 5F5CA 4CUGA 5FBJA 5FUPA 5FZFA 5LWBA 3PDQA 3RVHA 3AL5A 5FP4A 5FWEA 5FYIA 4QWNA 5FZHA 5LW9A 5FZ3A 4IGOA 2YBPA 2W2IA 5A3TA 4QX8A 4GJYA 4QXCA 4LIUA 2YBSA 3KV9A 4UF0A 2WWJA 3OPWA 3KVAA 5FYVA 5A7QA 4AI9A 5A7OA 4CCNA 4E4HA 5IVCA 5F2WA 2OS2A 3PUAA 5F3CA 5FP7A 5FYHA 5FYBA 4EZHA 2YBKA 5ISLA 5FPBA 3UYJA 5K4LA 2OQ7A 5IVEA 3PURA 5FV3A 5IVVA 4QX7A 4DIQA 5FYZA 2VD7A 3AL6A 5FYTA 5FYUA 4CCKA 5F3GA 3PTRB 4QXHA 4TN7A 5FY7A 5A1FA 4EYUA 3K3OA 5FZ4A 5FZAA 3KV6A 2Q8CA 4CCJA 5FZCA 5FY8A 5F5AA 5FZ9A 5IW0A 5FY0A 5A7WA 5FWJA 4UF0B 3U4SA 3N9NA 5IVYA 5F39A 3PU8A 5FY4A 3AVRA 3NJYA 5FZIA 2Q8EA 4IGQA 4GAZA 5F3IA 5FYSA 2OX0A 5LY1A 2PXJA 4GJZA 4GD4A 3PU3A 5FYCA 5FZDA 5CEHA 3PUSA 2OT7A 5A7SA 2OQ6A 3N9QA 4ASKA 5FY1A 4NUBA 4QXBA 5FZ7A 3ZPOA 2XMLA 3KV5A 5FYYA 5FJHA 5LY2A 3U78A 5FZ0A 5F37A 2YU1A 2YU2A 3N9OA 5F2SA 5FUNA 4DO0A 3DXUA 3OPTA 3AVSA 5FP3A 5A1LA 3LDBA 4LIVA 5FPUA 4CSWA 5A7WB 4LITA 4QU1A 5A3PA 5FZOA 1VRBA 5FXZA 5FP8A 4V2WA 5E6HA 5FZKA 4EZ4A 5KR7A 4CCLA 4IGPA 5IVBA 2Q8DA 4HONA 4XDOA 5FXVA 3ZLIA 2GP3A 2WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCM A;  3KVB A;  2GP5 A;  3N9L A;  4D6R A;  5F5I A;  3KV4 A;  5FZ6 A;  4BXF A;  4V2V A;  5IWF A;  5A80 A;  3N9P A;  5FZL A;  3PUQ A;  3K3N A;  5FP9 A;  3K2O A;  2XUE A;  5ANQ A;  3N9M A;  4BU2 A;  4Y4R A;  5FPA A;  4LXL A;  4BIS A;  5IVJ A;  4CCO A;  5FZ1 A;  5FPV A;  5FZB A;  3DXT A;  3LD8 A;  5FPL A;  5FJK A;  5A3W A;  5FY9 A;  5FZG A;  5A7N A;  4Y3O A;  5IVF A;  5F32 A;  5FZO B;  4C8D A;  4Y33 A;  5FZM A;  5FY5 A;  4XDP A;  5FYM A;  4HOO A;  5FXW A;  5F3E A;  4URA A;  2XDV A;  4D6Q A;  5A3N A;  2XXZ A;  5A7P A;  2P5B A;  5FXX A;  2YPD A;  4D6S A;  4AAP A;  5FZE A;  5FZ8 A;  5F5C A;  4CUG A;  5FBJ A;  5FUP A;  5FZF A;  5LWB A;  3PDQ A;  3RVH A;  3AL5 A;  5FP4 A;  5FWE A;  5FYI A;  4QWN A;  5FZH A;  5LW9 A;  5FZ3 A;  4IGO A;  2YBP A;  2W2I A;  5A3T A;  4QX8 A;  4GJY A;  4QXC A;  4LIU A;  2YBS A;  3KV9 A;  4UF0 A;  2WWJ A;  3OPW A;  3KVA A;  5FYV A;  5A7Q A;  4AI9 A;  5A7O A;  4CCN A;  4E4H A;  5IVC A;  5F2W A;  2OS2 A;  3PUA A;  5F3C A;  5FP7 A;  5FYH A;  5FYB A;  4EZH A;  2YBK A;  5ISL A;  5FPB A;  3UYJ A;  5K4L A;  2OQ7 A;  5IVE A;  3PUR A;  5FV3 A;  5IVV A;  4QX7 A;  4DIQ A;  5FYZ A;  2VD7 A;  3AL6 A;  5FYT A;  5FYU A;  4CCK A;  5F3G A;  3PTR B;  4QXH A;  4TN7 A;  5FY7 A;  5A1F A;  4EYU A;  3K3O A;  5FZ4 A;  5FZA A;  3KV6 A;  2Q8C A;  4CCJ A;  5FZC A;  5FY8 A;  5F5A A;  5FZ9 A;  5IW0 A;  5FY0 A;  5A7W A;  5FWJ A;  4UF0 B;  3U4S A;  3N9N A;  5IVY A;  5F39 A;  3PU8 A;  5FY4 A;  3AVR A;  3NJY A;  5FZI A;  2Q8E A;  4IGQ A;  4GAZ A;  5F3I A;  5FYS A;  2OX0 A;  5LY1 A;  2PXJ A;  4GJZ A;  4GD4 A;  3PU3 A;  5FYC A;  5FZD A;  5CEH A;  3PUS A;  2OT7 A;  5A7S A;  2OQ6 A;  3N9Q A;  4ASK A;  5FY1 A;  4NUB A;  4QXB A;  5FZ7 A;  3ZPO A;  2XML A;  3KV5 A;  5FYY A;  5FJH A;  5LY2 A;  3U78 A;  5FZ0 A;  5F37 A;  2YU1 A;  2YU2 A;  3N9O A;  5F2S A;  5FUN A;  4DO0 A;  3DXU A;  3OPT A;  3AVS A;  5FP3 A;  5A1L A;  3LDB A;  4LIV A;  5FPU A;  4CSW A;  5A7W B;  4LIT A;  4QU1 A;  5A3P A;  5FZO A;  1VRB A;  5FXZ A;  5FP8 A;  4V2W A;  5E6H A;  5FZK A;  4EZ4 A;  5KR7 A;  4CCL A;  4IGP A;  5IVB A;  2Q8D A;  4HON A;  4XDO A;  5FXV A;  3ZLI A;  2GP3 A;  2WWU A; 
#chains in the Genus database with same CATH topology
 1DGW X;  3BGA A;  1UU5 A;  3O1P A;  1U0A A;  4ES8 A;  1ZZ8 A;  4CA9 A;  2J1T A;  3V56 A;  2D93 A;  4QM8 A;  4PIZ A;  3SMH A;  3MW2 A;  3UGF A;  5HCA A;  3NQH A;  3ZYI B;  2E32 A;  2A1X A;  3FC0 A;  4S2H A;  5C3R A;  4F83 A;  1H8T C;  4Q26 A;  2RS3 1;  4WM7 A;  1IOA A;  4ONU A;  5FRE A;  4CEW B;  4A7Y A;  4AFM A;  2VNG A;  3T09 A;  3T0B A;  4GMP 3;  2Q1F A;  4E27 A;  1PGW 2;  1KQR A;  4L97 A;  3M8L A;  5CFC B;  3ZYP A;  2V4V A;  2RE9 A;  5I91 A;  4R9D A;  2RS3 3;  1SLA A;  2D98 A;  2QQK A;  2XVK A;  2ZHL A;  4JX0 A;  3T2T A;  4DS0 A;  2ARA A;  3BUC A;  1O8P A;  4PF1 A;  4AVA A;  3ZYH A;  3GZE A;  4QB6 A;  2A6Y A;  2OUH A;  3CZJ A;  2Z69 A;  3R4S A;  4AED A;  4HAN A;  4QHB A;  5EYY A;  4GH4 B;  1S2B A;  2IXC A;  2VW2 A;  1NE6 A;  2MNG A;  4A7K A;  3WNX A;  3MPP G;  2KM2 A;  4LUL A;  2EIG A;  2B9V A;  3K48 A;  2WZR 1;  3HQX A;  5BPX A;  4TLG A;  5FO7 B;  4AQ6 A;  2VOW A;  1ASJ 3;  2YBP A;  2DV9 A;  3FLR A;  1GBG A;  1NLS A;  3H0O A;  1UKR A;  3NNL A;  3WXP A;  1DF0 A;  1H2K A;  2XOM A;  3OPW A;  3FFZ A;  1W0P A;  1JYI A;  2L9L A;  1JYX A;  1OPM A;  3A23 A;  5CU1 A;  1GAN A;  2QDN A;  2WO2 A;  1QOT A;  3KQR A;  1R09 1;  1ULE A;  3SH5 A;  5EQU A;  3VKF C;  3SIS A;  3WX5 A;  4BH9 A;  5BNO A;  3T0D A;  4XBL A;  1AX1 A;  1GKB A;  2W1Q A;  4IL7 A;  1KEX A;  1ZBA 3;  2RVA A;  2FDG A;  4J1W A;  1UY1 A;  2EXI A;  1HB3 A;  1MZF A;  4CDQ C;  2ILM A;  5C5T A;  2EF6 A;  4XPV A;  3VDD B;  4DUV A;  3K3O A;  4RHV 2;  4BQ2 A;  4FOV A;  4NR1 A;  4Y22 A;  1UYX A;  2CWM A;  1F4H A;  1W6O A;  4LLF A;  2WYF A;  4LQR A;  5ANN A;  3VBR B;  4BB3 A;  4MGY E;  1FX5 A;  4ASL A;  2ZXQ A;  5FKB A;  2DCY A;  1HRI 3;  3GJB A;  1VAK A;  4RQP A;  4YG3 A;  1Q3E A;  1EAH 2;  1VLN A;  2FDJ A;  4X8N A;  5A33 B;  3AVR A;  1YJK A;  2Q8O A;  1VAL A;  2BW8 A;  3IIA A;  4Y5S A;  3ILF A;  4IER A;  4FFG A;  5C8C C;  1B35 C;  1DDL A;  5JI7 A;  3LFI A;  5T5O A;  2ZHM A;  2VNR A;  3RWK X;  3I2G A;  4QXB A;  2DYC A;  2PHX A;  2P34 A;  4XFF A;  3GYD A;  1RXF A;  2YC0 A;  4DY5 A;  1XB9 A;  1CQ9 A;  1PO1 3;  4QQ2 A;  5K0U B;  3O1M A;  1RED A;  1TMF 3;  1YXW A;  2H6C A;  1H6Y A;  2CDP A;  3B7M A;  5I0U A;  3R4D B;  1DIW A;  1V6J A;  2HYK A;  3EXU A;  3U07 A;  1J83 A;  3HNY M;  1MEC 2;  2VVE A;  4PJY A;  1VB4 A;  3E5Q A;  5DXD A;  1GWL A;  1JMU B;  1ZNP A;  3FHQ A;  4HPK B;  1VE0 A;  5EFU A;  3CO2 A;  3V65 A;  3M3E A;  4KU7 A;  1JOP A;  2VOV A;  5JZG A;  4L99 A;  4AOC A;  4MXW B;  2VZS A;  3WDY A;  1CAW B;  2IXL A;  1SLI A;  1GFF 2;  4N53 B;  1OI6 A;  2WDB A;  4G3Y C;  3GF6 A;  4PBP A;  5FTT C;  3SEE A;  3RYP A;  1JYC A;  2XVG A;  2JE9 A;  2B5H A;  3VD4 A;  1RUH 3;  3KHC A;  2AEZ A;  3KGL A;  4LO8 A;  4FPG A;  5IYY A;  1H6X A;  1JS9 A;  5FJK A;  2D6M A;  4WVV A;  1MS0 A;  4S2F A;  2ZEY A;  1XNA A;  1JU4 A;  1WGP A;  3OGJ A;  3UJO A;  3MLL A;  2BV4 A;  2XDV A;  1PGW 1;  3BB6 A;  3RZZ A;  2W1U A;  2WNO A;  3HT2 A;  3AP4 A;  4A7Z A;  2XLF A;  2VUD A;  1ENQ A;  4UOJ A;  4QQO A;  2W3J A;  4FPC A;  2OW4 A;  5GLZ A;  4OZX A;  1NOV A;  1U5X A;  2ATF A;  2H0V A;  3LA7 A;  2EID A;  1TG7 A;  1OLQ A;  3J7M A;  4AZZ A;  3O0X A;  4UT5 A;  4AGR A;  5JI9 A;  1XRU A;  3GZT B;  5JXG A;  1F5J A;  2E7Q A;  4FOQ A;  1HB2 A;  3D0S A;  4CUC A;  5ACA 2;  1H1A A;  3T4H B;  2VUJ A;  2ZTN A;  3ZR5 A;  2QZ2 A;  1J3P A;  1EV1 3;  2QQU A;  1QU0 A;  3S5Q A;  3NV1 A;  1GNY A;  5KXC A;  2E26 A;  3MHZ A;  3PME A;  1SLL A;  2LW8 A;  4QDS A;  2A71 A;  1PZ7 A;  3ZFF B;  3CDZ B;  3G6J B;  4QGM A;  4TTG A;  4GWM A;  3OUH A;  1VBD 3;  3A4U A;  2WKK A;  3ZN4 A;  5A32 B;  4IV3 A;  4CYD A;  2AR6 A;  1G9B A;  1HRV 2;  4DIQ A;  5FYZ A;  3KB5 A;  3LSE A;  1OD3 A;  2EIE A;  2GC2 A;  4HZF A;  3WQ1 A;  1OF3 A;  4BLI A;  1HX6 A;  2J1R A;  2QQN A;  4L11 A;  5KC6 A;  1NXM A;  3PIJ A;  4JRA A;  4DOU A;  1APN A;  4UXA A;  5FZC A;  4E9K A;  4IEO A;  2WNU A;  5F5A A;  1WW7 A;  2ARE A;  2TBV A;  4UF0 B;  2BWA A;  2Y6K A;  3RDI A;  4HKO A;  4YGE A;  2ZMK A;  4LEJ A;  4NHX A;  1AHS A;  2SLI A;  2WQ4 A;  3RWN A;  3A0K A;  4K40 A;  4B4R A;  2P37 A;  3OUJ A;  1K42 A;  5FYC A;  3WSO A;  1AYM 2;  1EAH 1;  1DQ2 A;  1UZZ A;  5A7S A;  4XUR A;  3OBA A;  3WLU A;  3E97 A;  2A6Z A;  1BVP 1;  4RYD A;  3RYR A;  4FTB A;  1KRI A;  1VPH A;  5FZ7 A;  2B7Y A;  1Q56 A;  4BME A;  4DQA A;  5FJH A;  1EAH 3;  2IVJ A;  4GAL A;  5G04 L;  4CEW A;  1OXC A;  2Y26 A;  5BV6 A;  1HXS 2;  1QJE A;  3HT1 A;  1ULF A;  3WF4 A;  1AL2 1;  3MLJ A;  2JG8 B;  2A5Z A;  4Y5T A;  5DAX A;  5CFC A;  2Y6H A;  2D6K A;  2DF7 A;  1YCI A;  2J22 A;  4IQP A;  4YNI A;  5A3P A;  4QAW A;  1U12 A;  3BTX A;  4OI0 A;  2BER A;  3LOB A;  4LJH A;  4JKL A;  1AL2 3;  4RS5 C;  2OZ6 A;  1YQC A;  2I07 B;  2R07 3;  1EPW A;  5GZF A;  2DBN A;  1EP0 A;  3AZX A;  2QQW A;  1JI6 A;  1MEC 1;  4GH4 A;  4ZHN A;  3ACF A;  4YW7 A;  1PIV 2;  3W21 A;  4D7T A;  1QJU 3;  1AX0 A;  4IEV A;  4AEJ A;  2XUE A;  4MO3 M;  4NMI A;  4C0B A;  2VME A;  2R0H A;  1SMV A;  1MEC 3;  3OY8 B;  3I54 A;  4IV3 C;  2BUK A;  3RJ2 X;  4DIN B;  1XNK A;  1ND3 C;  1A8M A;  4LKE A;  1BMV 2;  4HK9 A;  1QJX 3;  4OFG A;  5FPV A;  5FZ1 A;  5FZB A;  1W9S A;  4P9X A;  1IQD C;  5JDB A;  2J1U A;  1EUU A;  4XJA A;  4OUE A;  5FZO B;  3AMQ A;  2QVS B;  1KFU L;  2AEY A;  4UFJ A;  5FZM A;  1CAU B;  1BXH A;  2PHW A;  5GM0 A;  3ZXK A;  2VQT A;  1XC6 A;  5B4N A;  1GQH A;  4XMI A;  2X5I C;  4M4P A;  4LA2 A;  1CIW A;  3BOW A;  1R64 A;  3GM8 A;  5FZF A;  4P5H A;  3RSJ A;  2V09 A;  3HR9 A;  2XB6 C;  1PX4 A;  3VDD A;  1WA4 A;  4TYS A;  3T3Y A;  1FPN 2;  3NNJ A;  5FWE A;  2ZX3 A;  5EPA A;  4AXO A;  3I3D A;  4LBQ D;  1LGC A;  4LBO A;  4U36 A;  2JDN A;  3MEP A;  4Y1V A;  4AVB A;  4O9E A;  2LS6 A;  4PLO A;  2NMO A;  1NQD A;  2WLP A;  4UFK A;  4XF9 A;  4YWA A;  4QKD A;  4YLZ A;  5A33 A;  1UPI A;  4N43 B;  3VKO A;  1S0I A;  2ZCW A;  4QT6 A;  5DG1 A;  3LDR A;  3BYW A;  5ACA 1;  1OLR A;  1IS4 A;  4NO4 A;  3RZH A;  1PM7 A;  3UYJ A;  1E5H A;  1JU3 A;  1TVG A;  5K4L A;  2A70 A;  4FP3 A;  5FV3 A;  5CFD C;  1QF3 A;  2WAB A;  4RR3 B;  1HDK A;  1MZ5 A;  1LU2 A;  3AL6 A;  4R4Z A;  3VZJ A;  3FZ3 A;  4LPL A;  1XQN A;  3VBF B;  3WNL A;  3O1V A;  4LK6 A;  3ACL A;  3O1S A;  1A78 A;  1W28 A;  5K0U A;  5FZA A;  2JE7 A;  1RL3 A;  1HRV 1;  1W8O A;  1ZZ7 A;  4D3W A;  3U1X A;  1VB2 A;  2D44 A;  1SG3 A;  1O3Q A;  3MIF A;  4GZ9 A;  4GB3 3;  1Q8S A;  3M2M A;  4W6Y A;  5C3Q A;  1X9P A;  4XJ8 A;  4FPJ A;  2Q8E A;  5KHJ A;  1ST8 A;  1JW6 A;  2R32 A;  3BPZ A;  1P8J A;  4O61 A;  4Y1U A;  3WP3 A;  1WLC A;  3O7O A;  2X53 S;  3AZV A;  4XBQ A;  4MV2 A;  5EP9 A;  5I0S A;  1COV 2;  1V6L A;  1UYZ A;  2ADD A;  2VTX J;  1WW5 A;  5J37 A;  2O8Q A;  2K2S A;  4MXW A;  2WQ8 A;  2AZ5 A;  1CAW A;  1MS8 A;  3HWJ A;  4N53 A;  2ZS6 B;  4H7M A;  4E8D A;  5LCW L;  1UNB A;  2FD8 A;  3WG1 A;  1FOD 3;  2YPJ A;  4DXR A;  2JG9 B;  4KWL A;  1AYM 1;  4YGC A;  1ONA A;  2ZEZ A;  3W59 A;  2AH2 A;  2XVL A;  1ZA7 A;  5FZ0 A;  4CUA A;  4J25 A;  3J4U H;  4N7I A;  2D6P A;  3I3B A;  3AMP A;  1SCS A;  3J26 N;  3N9O A;  4M3C F;  4M01 A;  4WM8 B;  4GUL A;  2XJS A;  3B9I A;  2EXK A;  5EYX A;  4QDQ A;  2HYX A;  1M06 G;  1LOA A;  1HXS 1;  1PVC 3;  2UWB A;  4J1X A;  1W9F A;  1S0G A;  4RD7 A;  5CKQ A;  3GZU C;  3ZYB A;  5FOJ B;  2EAK A;  1MS4 A;  1RUD 2;  2WLQ A;  4Q8K A;  4YW2 A;  5F5I A;  2Q1M A;  2JIC A;  3JQW A;  2XQR A;  3AKQ A;  4W6W A;  1UKG A;  4B4P A;  1BK1 A;  5T54 A;  5I0T A;  1W9W A;  3GXU A;  3PUQ A;  4S2G A;  4LTA A;  1Y43 B;  1L3J A;  2EXH A;  3H7Y A;  5ANQ A;  4G4F A;  5FP9 A;  1R08 2;  2IUW A;  3TNQ A;  1AR7 2;  4CU7 A;  5BNN C;  1RUJ 3;  3THC A;  4DEQ A;  2ZGP A;  1PIV 1;  5ABJ B;  4MGQ A;  3FLP A;  4JKK A;  2WFF 2;  3VBO B;  2ZGK A;  4BQY A;  3I2K A;  4JDM A;  4IDZ A;  3M3C A;  1UU6 A;  1PO2 2;  4LE3 A;  4KBZ A;  1BCX A;  4FO9 A;  1IPK A;  2DVA A;  2UYA A;  3ZFF A;  4URA A;  1D2S A;  4TXW A;  5LB6 A;  1DGR N;  1V0A A;  2R0F A;  5HPO A;  5A32 A;  2I74 A;  1D4M 3;  1UQX A;  4IV1 B;  4JQT A;  2WO1 A;  2NYY A;  3RZK A;  5JMO A;  1LHW A;  2VOT A;  1WCK A;  1WBL A;  4MH0 E;  1XU1 A;  4IE4 A;  4QPI B;  5FO8 B;  2VZO A;  3RI9 A;  4IXL A;  2QQP A;  3AL5 A;  5FDB A;  2IXK A;  4EQV A;  4AQT A;  1SLT A;  3GZA A;  2XJV A;  3VL8 A;  2V73 A;  4XFI A;  3SC7 X;  4UF0 A;  1GZC A;  2EIC A;  4Y5Z 0;  3KVA A;  4AI9 A;  5FK8 A;  3AZY A;  1FPN 1;  5DAV A;  4ZZ8 A;  2Y0O A;  2E63 A;  4NAM A;  1WCS A;  1UXX X;  3TN9 3;  4A45 A;  2YRO A;  2GNT A;  5FPB A;  2JB4 A;  2W5F A;  2D3P A;  5F6L B;  2ZAB A;  2BNO A;  1XU2 A;  1S4C A;  1H4H A;  1WLW A;  3NV4 A;  5FYU A;  2HWF 3;  1RUF 1;  2VUL A;  4OHX A;  2ZAC A;  3T1L A;  4NPL A;  1QQP 3;  2WAA A;  3CEW A;  1LOE A;  4JTN A;  1AF9 A;  2WC2 A;  2YUE A;  3VD9 A;  1W90 A;  2AC1 A;  1UOJ A;  2IC1 A;  3AX4 A;  4N8M A;  1RUF 3;  4NIA A;  4ZPI A;  1H9P A;  1MPX A;  1H9W A;  3ZXJ A;  2JG8 A;  2Z2S B;  4MGI E;  4LT5 A;  1FAY A;  3VHO A;  2QNK A;  4YZ5 A;  1VBA 3;  4Q4V 2;  2VBD A;  3IM0 A;  3I2I A;  2UWA A;  4COY A;  4FVV A;  3M3O A;  2UY8 A;  4HN0 A;  4LKD A;  1VAM A;  4OUL A;  2B9U A;  4UFM A;  1O5U A;  1YQ2 A;  3BU7 A;  3JQX A;  4LUM A;  2TUN A;  3ZSE A;  3UK9 A;  4HL0 A;  4YZ3 A;  1XNT A;  3PUS A;  5A3U A;  2NN8 A;  2CTV A;  2OQ6 A;  2ZAA A;  4Q4W 2;  3B5L B;  2VMH A;  2Y64 A;  1KFX L;  5BNP B;  4GWJ A;  3OY8 A;  1J58 A;  2YGL A;  3VN4 A;  4XJU A;  4BDV B;  1W9Y A;  4ZU7 A;  3H50 A;  5M0T A;  4JGZ C;  1OH3 A;  2YU2 A;  5FUN A;  4AI8 A;  5FPU A;  3OCP A;  3OB8 A;  2ETE A;  3O14 A;  4E8C A;  4QU1 A;  5FZO A;  4XFC A;  1VR3 A;  2FBE A;  5C8W A;  2VZV A;  2VUC A;  4LBK A;  2NZ9 A;  4JTO A;  1CAU A;  1D0G A;  2Q8D A;  2DCJ A;  2QCS B;  2WO3 A;  2WWU A;  3WDU A;  3BOD A;  3Q8A A;  4D6R A;  1WD4 A;  1JZ5 A;  4Y4Y A;  3KV4 A;  3POB A;  3EQE A;  1ZZC A;  4Q29 A;  1GP5 A;  4YW3 A;  2BFU S;  5FMD A;  3VBU C;  3WCS A;  2D6O X;  4NRP A;  4PDW C;  3BTA A;  2JB8 A;  3JBG 3;  2BBA A;  4NN0 A;  4QPW A;  5H9S A;  5BUV A;  1RUD 1;  3UET A;  1JZ8 A;  1OA2 A;  2D3R A;  2EXJ A;  3DPR B;  1G8W A;  2RS1 2;  1C3H A;  3AMH A;  1W2A X;  1OLM E;  3KF5 A;  3N9M A;  1V6O A;  1YFU A;  2WQZ C;  1RC6 A;  4FPO B;  1MQT C;  4N7U A;  1S55 A;  3POJ A;  2WAO A;  1AX2 A;  1PM4 A;  4XF3 A;  2KA3 A;  1S0E A;  3WF0 A;  3L9J T;  1R08 1;  5DUX A;  1AR7 1;  5C4W C;  4N43 A;  5ERL A;  4BQ1 A;  2W87 A;  3ENR A;  1I1E A;  2VVD A;  3AFK A;  2WFF 1;  4Q1P A;  5BY5 A;  2QKD A;  2OPW A;  3MBW A;  3R4U A;  3TYJ A;  1R08 3;  3BOP A;  3SCF A;  4D6Q A;  2JD9 A;  1RUI 2;  2VMF A;  2XUM A;  2VL4 A;  2P5B A;  2XXZ A;  3I8T A;  4RR3 A;  1OOP C;  4CDW B;  3ZOI A;  1ODN A;  5FBZ A;  5FZ8 A;  1Y9G A;  2PAM A;  4D7Y A;  3VBF A;  5EIY B;  5FUP A;  4Y1Y A;  5I93 A;  2K0G A;  1HW5 A;  1ND2 A;  3AM2 A;  1TQ5 A;  2ZOE B;  3AZW A;  5LW9 A;  1DP0 A;  2BNM A;  4PLM A;  5FZ3 A;  1DQ6 A;  3CHX A;  5A3T A;  3N7K A;  4PT6 A;  4QPY A;  1W6Q B;  4QX8 A;  3SKJ E;  2Y0I A;  3U11 A;  3WG3 A;  4I2O A;  5A7Q A;  2BOJ A;  3FMG A;  1WW6 A;  3RZM A;  1LNS A;  2JEN A;  1URX A;  3JB4 C;  1REF A;  3WF1 A;  2BDR A;  5F3C A;  1QWR A;  4CCE A;  4FPE A;  2WSV A;  1XBF A;  3NKG A;  4QDR A;  2GSY A;  1DGL A;  2CWS A;  5KHI A;  1XNC A;  2HKX A;  2Q30 A;  1BYH A;  3SKV A;  3PUR A;  3T0A A;  1U5Z A;  1NY7 1;  3TRS B;  4U2A A;  2Z79 A;  1HB1 A;  2NM1 A;  2W1S A;  1C4R A;  4RN5 A;  1YIP A;  4XDQ A;  1SDD B;  1LB2 A;  2JG9 A;  3S57 A;  4WBB A;  4UFI A;  3FUO A;  1W8Z A;  3KV6 A;  4FBF A;  5AC9 2;  3DF0 A;  4WM8 A;  4QXK A;  4NAO A;  1D4V B;  4MGK E;  4XFB A;  5D8A B;  1ULD A;  2BVV A;  2OUJ A;  2BTV C;  5C9A B;  3PU8 A;  1J59 A;  2GMM A;  1Q43 A;  5JXJ A;  1JOB A;  4Q0Q A;  2VZQ A;  2ZGL A;  5JXH A;  4GAZ A;  2V5Y A;  1R1A 2;  4FOY A;  4ISR A;  4NHY A;  2OII A;  3EMR A;  2AUY A;  2GH2 A;  5EV7 A;  3AFG A;  1QJF A;  4FFH A;  4Q4V 1;  4NJ4 A;  1C1F A;  2UUR A;  3J8F 2;  4XF1 A;  2A6V A;  3NST A;  1XOY A;  3ZSK A;  3LPG A;  4HET A;  3A7Q A;  1NYW A;  1UZV A;  3NNG A;  5JSR A;  3ZFE B;  1GUI A;  1RUG 2;  1QJY 3;  2Q5T A;  5L7O C;  5ABJ A;  1ZRD A;  1M4W A;  3VBO A;  1BQP A;  3UKV A;  3P1I A;  4AQS A;  4E2Q A;  4Q4W 1;  5DZG A;  3D8C A;  3LDB A;  1ZRC A;  2A73 B;  2RDN A;  1BEV 3;  1VP6 A;  2GU9 A;  3M1H A;  5LBC A;  3ZXL A;  4DB5 A;  2R30 A;  3B69 A;  4LKF A;  4LO4 B;  1ZRF A;  5C5U A;  1ND2 C;  5KC5 A;  3VHN A;  3LEI A;  1PX3 A;  5JIA A;  1W6P B;  1GU3 A;  2DVB A;  3U75 A;  1Y9Q A;  1VRH 3;  4CCM A;  3C8X A;  5CNA A;  1GZ9 A;  1JUI A;  1UZW A;  4IV1 A;  4IEP A;  2PHL A;  2BVB A;  3DV8 A;  3IZO A;  3T08 A;  3IMN A;  4QPI A;  2GN7 A;  2VPV A;  3JD7 1;  3K3N A;  5I0D A;  1CIY A;  4HFS A;  3ZR6 A;  3QAC A;  5J09 A;  1RJ7 A;  4P9G A;  2ZML A;  4GWN A;  3WDV A;  1QJZ A;  3JD7 3;  4JGY C;  5J36 A;  1YI7 A;  2VY0 A;  1UF2 C;  1LR5 A;  3QCW A;  5T3N A;  1TZO A;  2XHN A;  3PVN A;  5FR3 A;  4XHB A;  2FCT A;  1MZE A;  4YVS B;  4HOO A;  4BLJ A;  4BCU A;  3ZKY A;  2BRT A;  4WM8 C;  2P3Y A;  3A0N A;  1K5M B;  1LES A;  4FFI A;  4AAX A;  1KDM A;  5F8P A;  3BI3 A;  2YPD A;  3AJZ A;  1REE A;  4Q4Y 1;  3CF6 E;  3VBS C;  2WS9 2;  1FMD 3;  4LHK A;  1QIQ A;  1RUI 1;  3I97 A;  1ULO A;  4Q4Y 3;  4XC9 A;  3S7E A;  2F4L A;  3WQB A;  5HV4 A;  1X8E A;  3ZYR A;  2XJU A;  1W9T A;  5A70 A;  4CPB D;  3D6E A;  5LAT A;  4QPG B;  5A7O A;  3KS7 A;  3KM5 A;  4TSV A;  2ZEX A;  1OMI A;  2CAU A;  2YFZ A;  3AJY A;  1JH5 A;  2ZJC A;  1VIW B;  2OYZ A;  1AYN 2;  4FQ4 A;  1HJF A;  1AR6 2;  1BVV A;  1QDO A;  1DFQ A;  4XBN A;  1OD5 A;  3OF1 A;  1OQE A;  3RS6 A;  3VBH B;  4CCK A;  3NNM A;  1H30 A;  5EHD A;  2R7E B;  2JD4 A;  2HWB 1;  4RA0 A;  5BNP A;  4C1W A;  4M3C A;  3VB9 A;  3X29 B;  4C0H A;  3BPS A;  2Y60 A;  3OOX A;  2HWB 3;  3DKQ A;  1QH7 A;  3ABZ A;  4QPI C;  2WZ8 A;  2ZX0 A;  2WZR 3;  1NUK A;  3ST7 A;  4L8Q A;  5AC9 1;  1GR3 A;  1VBE 2;  4IGQ A;  1YFY A;  1RIT A;  2RMU 1;  2QQM A;  1PK6 C;  1LTE A;  1KS5 A;  2W91 A;  4GJZ A;  4BMB A;  3PU3 A;  1V00 A;  3CJI C;  1G7Y A;  1POV 0;  2X09 A;  4JKM A;  2FMY A;  2WUH A;  5JR2 A;  4FSJ A;  2RMU 3;  4QU2 A;  1CX1 A;  4BQX A;  1R09 3;  1X82 A;  3H7J A;  1AR8 2;  4R9C A;  4ZON A;  1DHK B;  3VUO A;  3TBD A;  3AK0 A;  3DPR A;  3E6D A;  2FQP A;  3J8F 1;  1KS4 A;  4P9J A;  5FO9 B;  1U5Y A;  1DZQ A;  4KH9 A;  4XXA A;  2Y6J A;  4YM1 A;  1RUG 1;  1J3R A;  1VRB A;  3WF2 A;  2BBV A;  1XPW A;  4V2W A;  1IS6 A;  4L2N A;  4RGA A;  4EZ4 A;  5FY7 A;  2PAK A;  2VAU A;  4WM7 C;  3VHP A;  1JOJ A;  4CDW A;  3I2J A;  1WKY A;  2GC1 A;  2VCM A;  2BNN A;  2QUO A;  2JXA A;  3B01 A;  1WCD J;  3LA2 A;  1SLB A;  3GJA A;  3ZXF A;  1ZRE A;  1NLQ A;  3HD8 B;  1W99 A;  3WW4 A;  1A8D A;  4ZS3 A;  4XEZ A;  3TAY A;  3ME2 A;  5L9B A;  1W8W A;  4ZXE A;  2XL7 A;  4CUB A;  1UY4 A;  1ZZB A;  4AI3 A;  4Z1V A;  1DZR A;  2PHD A;  4O9G A;  1W6Q A;  2HWE 2;  2RJ2 A;  3QBQ A;  3JU9 A;  4JHZ A;  1CD3 G;  3UL2 A;  4AED C;  5JUV A;  2YG0 A;  1F15 A;  1HN1 A;  4Z92 B;  4MET A;  1EYB A;  4JV4 A;  4Q4X 1;  2WA3 A;  5CIS A;  2VW1 A;  3FUQ A;  4GA9 A;  3RGB A;  1BJQ A;  2MEV 2;  3WNK A;  2WNV B;  5GLU A;  1AJO A;  3WG2 A;  3GBG A;  5F3E A;  4K8F A;  1V6N A;  1C28 A;  4Q4X 3;  3OGG A;  5A3O A;  4C1X A;  3AYE A;  4E2S A;  2JDU A;  4MGS A;  4AHX A;  2ZGR A;  3RFR A;  4LE4 A;  4NRM A;  4J6G A;  5F5C A;  4DXT A;  1F4A A;  1NCQ B;  2HWD 1;  4AW7 A;  1CGP A;  1OLM A;  1O3R A;  5BNO C;  4OUM A;  4Y1X A;  2ZGN A;  4K3U A;  4BYY A;  2HWD 3;  1SDW A;  3AYD A;  4WVZ A;  2R04 2;  2WS9 1;  2XLA A;  5D8A A;  3RYK A;  3SXW A;  3WP4 A;  1JUH A;  1MS9 A;  2WWJ A;  5C9A A;  3K4D A;  2OXB A;  5JOW A;  4UFH A;  3ECQ A;  5F2W A;  1X7N A;  3MIE A;  3OGV A;  1RMU 2;  1IGO A;  1WCU A;  2A6X A;  2WR9 A;  4OI1 A;  4QGL A;  1JN2 P;  4M0H A;  1T6G C;  4BE3 A;  3KGZ A;  4IEW A;  3EO6 A;  1JZ7 A;  1FI2 A;  4IW3 A;  4V1P A;  3WY6 A;  4BJ0 A;  2EAL A;  2K9Z A;  5LEJ A;  2DTW A;  1JBC A;  3MUY 1;  4NWW A;  4RQP C;  4YG0 A;  5KHH A;  3VZM A;  1DCS A;  2HBT A;  1AYN 1;  2Y6L A;  4QXH A;  1Q8Q A;  2W1W A;  2VCA A;  1J1L A;  1AR6 1;  4RGK A;  3Q8F A;  3JCI A;  4FXG B;  2R49 A;  3ZFE A;  5A1F A;  5T50 A;  3S7I A;  5FZ4 A;  3LA3 A;  4JDN A;  1WMD A;  2VG9 A;  1BZW A;  4NRO A;  2ZX4 A;  3E5X A;  4CRQ A;  4OHV A;  4RFR B;  4LK7 A;  4WVW A;  4LBM A;  4OI2 A;  3SH4 A;  3WNP A;  1V9U 2;  1S2E A;  4KNC A;  3KSC A;  1W6P A;  2F6B A;  1OQ1 A;  3H1Y A;  4HLT A;  4LO6 B;  2LM3 A;  2VUA A;  4MHU A;  5F3I A;  3INA A;  3OUI A;  4F7Z A;  3H1W A;  4L92 A;  2ZGU A;  2CV6 A;  1OPO A;  2C6S A;  2G9G A;  3GCX A;  5FZD A;  1D2Q A;  3ZIW A;  1A6C A;  2VQ0 A;  4AEK A;  1DGR A;  3IPV A;  3ZPO A;  3C7O A;  4WZC A;  4ARX A;  1AXZ A;  3PJQ A;  2PHR A;  2VBP A;  4CXY A;  3PLQ A;  2ZKL A;  1AR8 1;  1EPZ A;  3OBT A;  4GMP 0;  5JZG C;  2ERF A;  5IK7 A;  3VZK A;  2VJX A;  3WW1 A;  1KJL A;  4GXL A;  4RHV 1;  2TNF A;  4ZY9 A;  1ZZ6 A;  4YVS A;  2PQS A;  5IK8 A;  3ZLI A;  3ES1 A;  2BZD A;  2AAC A;  2HH9 A;  3ORJ A;  2PN5 A;  3QH6 A;  5FMB A;  1K5M A;  3KVB A;  1C8N A;  4YM3 A;  2DU0 A;  5DDJ 2;  5JCT A;  4RHV 3;  2QQJ A;  1F2N A;  3AP9 A;  5JOZ A;  2ZKN A;  4QKF A;  1POQ A;  3SCH A;  5A6Q A;  3L2H A;  1DGW A;  1VMJ A;  3IDA A;  1RVF 2;  1CJD A;  3ZSM A;  2FDI A;  4NII A;  1ZBE 2;  2DWR A;  2QQO A;  4XFH A;  5J7M A;  2G9Z A;  4XZP A;  2IFR A;  2UY9 A;  3W5N A;  3ZMN A;  4QPG A;  5TSW A;  4L9B A;  5A3W A;  2RJL A;  4ZS2 A;  2HEW F;  2X29 A;  1W8N A;  1XE7 A;  1BBT 2;  4XDP A;  1C5I A;  2WT2 A;  3DYP A;  2RHP A;  3H8R A;  2Y38 A;  3H3Z A;  4Q27 A;  1TE1 B;  5A3N A;  3I3M A;  3FLT A;  4UW4 A;  3LWC A;  1STM A;  3VBH A;  5FKC A;  1TME 2;  3FBY A;  4I09 A;  1VMH A;  1AVB A;  1XSQ A;  3M70 A;  1H2L A;  4G9S B;  1L7L A;  4ZU4 A;  2BGC A;  3A22 A;  1W2T A;  1XXN A;  3AKT A;  1O91 A;  2FZ1 A;  4XQD A;  4YVW B;  3ZFG B;  4CDU B;  1IPJ A;  1QH6 A;  3ETQ A;  3KV9 A;  2YMZ A;  4CCN A;  3THT A;  4HKL A;  1X36 A;  3LIH A;  4LMF A;  5F5Q A;  1YRZ A;  2OVU A;  3OJB A;  4Q1R A;  3ZMO A;  2R04 1;  2W47 A;  4HVQ A;  4EWE A;  1W6M B;  1BKZ A;  4CP0 A;  1C5H A;  1UIJ A;  1GNZ A;  2P2K A;  2WNU C;  4HSJ A;  5D21 A;  2R04 3;  4QX3 A;  4E4Z A;  5EXO A;  2VD7 A;  1RB8 G;  3KQ4 B;  4FP2 A;  3ZXA C;  2JDZ A;  5FRA A;  1AXY A;  1W05 A;  4MOA A;  3POI A;  4MX3 A;  4HVR A;  2C9A A;  3EB7 A;  1RYY A;  4N9I A;  3K51 A;  4EE2 A;  1G6N A;  3LEG A;  3U4X A;  2FDH A;  1W2N A;  3VBR A;  4IE5 A;  4EN0 A;  3N9N A;  5CYY A;  2ZGM A;  2GH8 A;  3ZSL A;  2W68 A;  3HMY A;  4PI0 A;  1O5L A;  3TOJ A;  4AK3 A;  1TNF A;  1AUY A;  5LRR A;  3NO8 A;  4UYB A;  2QQL A;  4CEW C;  1MS5 A;  2W52 A;  5LRS A;  1V9U 1;  5F7U A;  2V5D A;  2PHU A;  5B2G B;  2PEL A;  1X50 A;  1Z7S 2;  3VD5 A;  2R1B A;  5CAD A;  4CCC A;  5E1R A;  5CFC C;  2BGP A;  3CBN A;  2WT0 A;  5ACA 3;  2ET7 A;  2WN3 A;  4BOW A;  1NLR A;  2RM2 2;  4JAA A;  5LK7 B;  1LGB A;  1V9U 3;  2XGX A;  3G7D A;  3MID A;  5KXB A;  2DUP A;  2P6C A;  3OD4 A;  5SV5 A;  3DYO A;  4FFF A;  3ZDV A;  2AEN A;  3ZN6 B;  5F2S A;  4DO0 A;  2GZW A;  4YW5 A;  3OPT A;  4AFB A;  4KWJ A;  2BPA 2;  2NMN A;  4GH4 C;  3FX3 A;  4N9H A;  3LEM A;  4ISQ A;  1G9F A;  1RUC 2;  2WNV A;  1HRV 3;  1PMI A;  1DG6 A;  4URT A;  1HV1 A;  1OFS A;  5DUV A;  1HN0 A;  4EN8 B;  1QEX A;  2VGD A;  1UY0 A;  2W46 A;  4QX5 A;  3MF6 A;  3N9L A;  2GC0 A;  3IMM A;  4HPK A;  5A6Z A;  2QFE A;  1NCR B;  2YGM A;  1K3I A;  2PQQ A;  1GP6 A;  1NCQ A;  1O6U A;  2XWJ B;  4H55 A;  2PLV 2;  2P6H A;  2VTX A;  4Y20 B;  5DDJ 1;  1H1I A;  3EJK A;  4MGT A;  1UY3 A;  3F2Z A;  2Y8K A;  4Y4R A;  1C8M 2;  4QQP A;  1Q8O A;  4M0N A;  5GZG A;  1AXK A;  3HBK A;  5IVJ A;  1JZ6 A;  4E4S A;  3PMS A;  3NAP B;  4KI5 M;  4DRR A;  1AYM 3;  3Q8C A;  2H6B A;  1HB4 A;  3T2O A;  3T4V A;  3R6S A;  3MGU A;  3VDD C;  1YLL A;  1DZT A;  3MV0 1;  2QTW B;  5DUU A;  3VBR C;  3AZZ A;  1W0N A;  1JZ4 A;  1O3T A;  4CEY B;  1VBC 2;  1LOC A;  4N90 A;  5IHR A;  3B00 A;  5FMO S;  2PYT A;  1BBT 1;  4PQ9 A;  5FUI A;  1HXS 3;  2W08 A;  5CG9 A;  1QNY A;  2BEO A;  2NQY A;  3HN3 A;  3WG4 A;  1HLC A;  1UZ0 A;  2Z5W A;  5L9V A;  2C5D A;  5FYI A;  1JYT A;  1UW8 A;  2BJS A;  5J3U A;  5C7G A;  3AMM A;  1TME 1;  4GJY A;  4COW A;  4P02 B;  5FYV A;  4NPM A;  5DZE A;  3UT0 A;  3I59 B;  5BYN A;  2R16 A;  2AGS A;  1SQ4 A;  1H0B A;  3KD4 A;  1W2O A;  2XPJ A;  1H4G A;  1PIV 3;  3EHK A;  3NJV A;  3KCC A;  3ZX7 A;  5K0U C;  4S2D A;  1BMV 1;  3ETP A;  2R06 2;  1H8T B;  3LF7 A;  3OD0 A;  4XOG A;  3UGG A;  1JTZ X;  1K45 A;  4MUV A;  5GLV A;  4MSV A;  1YO8 A;  4XFG A;  3RG0 A;  3BKZ A;  1YQ8 A;  3KF3 A;  5HV0 A;  2P3K A;  3MO4 A;  1NG0 A;  4TN7 A;  3LOI A;  3O5S A;  1UPS A;  2IZW A;  4K7J A;  4OUS A;  1I5P A;  3P6B A;  5FY8 A;  2DBI A;  2B8M A;  4EN6 B;  2WII B;  5FIX A;  1V6I A;  3AKR A;  3AYC A;  3IN9 A;  3OGS A;  4XUT A;  5FY0 A;  2ZGO A;  1N47 A;  4KG8 A;  4N53 C;  5IVY A;  4F3J A;  3ASI A;  5EZW A;  2RR1 2;  3GAL A;  3WNM A;  3E6C C;  4XUQ A;  5GZC A;  1OKO A;  2VTF A;  2RS5 2;  1WLD A;  2O0O A;  1CON A;  1FPN 3;  1VBB 2;  3III A;  1FV2 A;  1LHO A;  3HQR A;  4MHR A;  4I0B A;  1F5F A;  3BCW A;  3CMG A;  4KU8 A;  4XAC A;  4FPH A;  5FY1 A;  2EAA A;  1FV3 A;  2K46 A;  3E6B A;  1WMF A;  4OZO A;  5J48 A;  4CCD A;  1ENR A;  1N1S A;  3U78 A;  1A3K A;  3ZYJ B;  4QB1 A;  1PGL 2;  4R52 A;  3S30 A;  5GZD A;  1QMJ A;  4BM8 A;  2RM2 1;  1WD3 A;  4LA3 A;  5EJZ B;  5A3L A;  1YWK A;  4HN1 A;  4HXC A;  1UD1 A;  3LSD A;  2C0Z A;  5FZK A;  4CDQ B;  1G9C A;  2LRP A;  2VH9 A;  1TEI A;  3WIN E;  1NXD 1;  3I2H A;  1LOF A;  2TEP A;  3AKS A;  4GIQ A;  3M4F A;  2PAE A;  2Q4S A;  1C1L A;  3WNN A;  5FK7 A;  1S0J A;  4QMA A;  3ZFF C;  2PHT A;  1G9D A;  3C7G A;  5C70 A;  3H8U A;  1COV 1;  3KZ4 C;  4QGN A;  3WDT A;  4ORF A;  2FHR A;  2XLG A;  1YFW A;  2YXS A;  3PIG A;  1UZY A;  5APA A;  3ZFG A;  4CDU A;  1B35 B;  3HEI A;  5C8C B;  1SFP A;  2R6Q A;  4BQ5 A;  2PLV 1;  1O7F A;  2XR4 A;  3CNA A;  5FPL A;  1NKG A;  1COV 3;  3PVE A;  3VZL A;  2B46 X;  5IVF A;  5HCH A;  1C8M 1;  3WZ1 A;  3WHU A;  5L73 A;  1W6M A;  1QXP A;  3K4A A;  1RUE 2;  1LUL A;  3ITQ A;  5FOB B;  3RMX A;  1WA6 X;  1SPP B;  5A7P A;  4IET A;  2HWC 2;  2B45 X;  4BPZ A;  5DN2 A;  3PVO A;  2JIG A;  4CU6 A;  4RSU A;  1N3O A;  1VBC 1;  4PQQ A;  2BQP A;  3OTF A;  4BHP A;  4F8A A;  5FP4 A;  2CYF A;  2G1M A;  4Y24 A;  1NX9 A;  4XMA A;  2VNV A;  2ZGT A;  4QXC A;  4YW4 A;  1LRH A;  3GHN A;  2AYH A;  2EIB A;  3FFQ A;  1HQN A;  4XE9 A;  4XIL A;  3VL9 A;  1RUD 3;  4E4H A;  4R9A A;  1RHI 2;  1WWY A;  4PF5 A;  1O8S A;  5FYB A;  1RUO A;  3WDW A;  4YZ1 A;  1MVQ A;  2XKO A;  3O0V A;  4IEZ A;  3LE0 A;  1US3 A;  3POF A;  4AVV A;  1AR7 3;  1PO2 1;  4IEX A;  1XSR A;  2YV8 A;  1CZV A;  1X33 A;  2JG8 C;  2VC9 A;  4K21 A;  4IE0 A;  3VDC A;  1FNZ A;  1YC6 1;  2CSG A;  1IKQ A;  1IS5 A;  1LGN A;  1WBF A;  1YYN A;  2WFF 3;  5CB7 A;  4YFW A;  4HBN A;  2R06 1;  5KHK A;  2N7G A;  4NVP A;  3MIB A;  1PO2 3;  1PVX A;  2VVF A;  4D0Q A;  3ZSJ A;  3MV1 1;  5GZE A;  2CAV A;  4BQW A;  1LCL A;  1RUN A;  2XHK A;  3ZN6 A;  5CA6 A;  3MYX A;  5F1R A;  3UKN A;  5IW0 A;  2GDF A;  2O8O A;  5KXE A;  4OYU A;  1ENX A;  3IAQ A;  2E53 A;  1POV 1;  4HG6 B;  4KGQ A;  4DFS A;  3RZL A;  3NJY A;  1W06 A;  3F95 A;  5FZI A;  3VZO A;  4H7L A;  4LHS A;  1RIN A;  4QQL A;  2QQI A;  3SHR A;  4LBL A;  2DCT A;  3V0A B;  1DQ0 A;  3C7E A;  5BXX A;  1W8T A;  1NCR A;  2ORZ A;  3GDB A;  5GAL A;  3SH3 A;  1LU1 A;  3WCR A;  3WW3 A;  2BU9 A;  3BTY A;  2RS3 2;  2RR1 1;  1W8F A;  1F35 A;  2D40 A;  5DUW A;  3IT8 A;  2RS5 1;  4Y20 A;  1OKQ A;  3HNB M;  4DEV A;  3WP5 A;  5CKN A;  4RL7 A;  3BN6 A;  2VBB A;  2XQX A;  5LK5 A;  4O7X A;  1W6N B;  2RG4 A;  2P3I A;  2YU1 A;  2LAL A;  2XON A;  2JDK A;  1SCR A;  2PA7 A;  1E5R A;  3DXU A;  2OZJ A;  2X05 A;  4A6S A;  3ZN5 A;  1J1T A;  3N7L A;  3NAP A;  3WEZ A;  4EN7 B;  2FZ2 A;  4LIT A;  3B02 A;  2XJP A;  3ZM8 A;  1NE4 A;  4DXS A;  4AHW A;  2ZMN A;  1ASJ 2;  2DFC A;  1LOB A;  2YC4 A;  1SEF A;  5E8A A;  1OA3 A;  1OQD A;  1D7P M;  1NA1 B;  2CNA A;  2QDR A;  5FXV A;  2GP3 A;  3HN1 A;  2VEC A;  3KT7 A;  3S0M A;  3ZO0 B;  5A6Y A;  2VR4 A;  4BZ4 A;  2KXL A;  5DAW A;  5FZ6 A;  2Y6F A;  2GND A;  5LBB A;  2R1D A;  4N43 C;  3URF A;  1GZW B;  4K1Y A;  2IXH A;  3Q8B A;  4B29 A;  3VV1 A;  3WQ7 A;  1SBD A;  1CAV B;  4Q4V 3;  4FAH A;  1IQA A;  1ZBA 2;  2HEY F;  2VCB A;  2ZZQ A;  1YNA A;  4UW6 A;  3BIE A;  2MHF A;  1S2K A;  4RR3 C;  2D5H A;  4DPN A;  3MI8 A;  4TLF A;  3I59 A;  3DXT A;  4Z2A A;  3HPN A;  4A44 A;  4YAR A;  2EA7 A;  3VBF C;  2H0B A;  5F32 A;  4LNV A;  4XF4 A;  1VAV A;  2RDS A;  5FPZ A;  4NHK A;  5FY5 A;  4OCT A;  4QD2 A;  4AVT A;  1QDC A;  4EN9 B;  4Q4W 3;  5IT6 A;  1HRI 2;  2ARX A;  4KG0 A;  1XJA A;  5FXX A;  4OHW A;  4D6S A;  3RJR A;  3MLK A;  5FZE A;  3O1R A;  3UV9 A;  4PIX A;  4PI2 A;  1RUE 1;  2SBA A;  3N36 A;  5FBJ A;  2CGO A;  1S1A A;  2HBU A;  4UBG A;  5LWB A;  5H9R A;  5H9Q A;  3RVH A;  2IXI A;  4RS5 B;  3S6P A;  3IDC B;  4NRQ A;  5AFB A;  2DVG A;  2ZZJ A;  1N1T A;  4A3X A;  4CTE A;  1PO1 2;  2JE8 A;  2RS1 1;  4GQ7 A;  4QM9 A;  2JG9 C;  4AFA A;  1TMF 2;  5J96 B;  2YBK A;  2P4E A;  4LR4 A;  3MW4 A;  1W0O A;  2W9X A;  4LBQ B;  4IV3 B;  1ND3 B;  2RS1 3;  4W65 A;  1RHI 1;  5DAQ A;  4BIO A;  4QX7 A;  4A42 A;  4ITC A;  2ID4 A;  3USU B;  1IHM A;  4R4X A;  4AI2 A;  3PTR B;  4FCA A;  1QXJ A;  1XYO A;  2DUO A;  2JX9 A;  3EYP A;  1UIK A;  3W5M A;  4RFT 0;  3GNE A;  4OVE A;  2JKX A;  3HJR A;  4LLO A;  3NJZ A;  4XUN A;  4ASM B;  3TEX A;  2X5I B;  1JYN A;  5HXV A;  1LED A;  5K8S A;  2WWS A;  1RUI 3;  1ZZ9 A;  1W8H A;  2ZPX A;  1SBF A;  3GGL A;  4CDQ A;  4K1Z A;  4DZG A;  5T52 A;  2Z42 A;  5A3M A;  5IVC A;  1PHM A;  1PNF A;  1RUH 2;  2VZ3 A;  3ILR A;  2Z4F A;  3C2U A;  5ABJ C;  4LOR A;  3VBO C;  3KMH A;  3VLB B;  3FWE A;  3RNS A;  2W94 A;  3ZYF A;  3NRU A;  2XBO 2;  1OBN A;  1N3P A;  3N9Q A;  5KBF A;  4TWT A;  4DUW A;  2BGO A;  2XJT A;  4GMP 1;  3TNP B;  3ZIX A;  2YYO A;  3H1M A;  1G9A A;  3OG2 A;  2W0X A;  2Y6G A;  3BTZ A;  5LY2 A;  3T2Q A;  1LEN A;  2DCK A;  1HIX A;  4XAB A;  1S0F A;  1ZM1 A;  2VZP A;  3NV2 A;  5C8C A;  1B35 A;  4IV1 C;  1WUV A;  4LO7 A;  4A6O A;  5FLH A;  1H2M A;  3VGI A;  1YEW A;  2ES3 A;  4QHO A;  4QKB A;  5CFD B;  1ZA4 A;  5A7W B;  4XFA A;  1GNH A;  4CE8 A;  4CZS A;  4AG4 A;  4NIG A;  5JPN B;  2XL9 A;  4I0W B;  4BIF A;  5FPX A;  5KR7 A;  4AWD A;  3IDE A;  2GMP A;  4EV0 A;  3OSD A;  5HXM A;  4KGG A;  1T6B X;  4HKW A;  3WR0 A;  1RJ8 A;  1SPP A;  4O65 A;  3D4K A;  4CVU A;  1EV1 2;  5IFP A;  1O4T A;  1ASJ 1;  2UU8 A;  1GIC A;  4AI1 A;  5AC9 3;  2CGP A;  5IWF A;  1UYY A;  2W95 A;  5LEK A;  4K20 A;  4I02 A;  1R1A 1;  3HOB A;  1VBD 2;  5FZL A;  1HJG A;  2RDQ A;  5JIU A;  1H2N A;  1OUS A;  2LRO A;  3N7J A;  5LBF A;  5AVA A;  3D5O A;  5C3P A;  5DQ0 A;  5FPA A;  2VMD A;  3SCG A;  3K77 A;  1R1A 3;  3KT1 A;  5C3S A;  2KR2 A;  3LD8 A;  2IWG B;  2P1B A;  3MZH A;  5FY9 A;  1JYV A;  1UOG A;  1ZBA 1;  2J1V A;  4SLI A;  1SZB A;  3J8F 3;  4X8P A;  1YJL A;  5FXW A;  1Y3T A;  1O3S A;  3K75 B;  1JXN A;  4XJ9 A;  1UWW A;  5CZK A;  1V6M A;  1Z0H A;  2A3X A;  2Q1Z B;  2VW0 A;  3TEW A;  3WUD A;  1RUG 3;  1JOD A;  4DUX A;  2PHF A;  5I0R A;  4FTE A;  1DQ5 A;  1W3V A;  5DZF A;  1OVS A;  4BK4 A;  4OQ8 A;  1MS1 A;  4AFD A;  1LKN A;  3FL7 A;  2UYB A;  4ES9 A;  3Q8E A;  4H2A A;  3TEZ A;  1AJK A;  4DNY A;  1HRI 1;  3HBZ A;  5EWS A;  5FZH A;  2VOX A;  3NNF A;  1PNG A;  4FXK B;  1CPN A;  3WOG A;  1W3X A;  1H8V A;  3Q9O A;  4B8E A;  3D82 A;  5T5L A;  2WA4 A;  2ZX2 A;  1LOD A;  2JDA A;  3AXD A;  4MXV A;  4W50 A;  5E16 A;  2YHJ A;  5IJR A;  1LAJ A;  1ULC A;  2CDO A;  5JMC A;  2G9F A;  4NPR A;  2BP6 A;  1S0D A;  2VU9 A;  3MIG A;  3MIC A;  2QQV A;  5BNP C;  3I3Q A;  5IK5 A;  1IKP A;  3T2P A;  2ZGQ A;  2VQA A;  5BNN B;  3V0A A;  1OUR A;  5FLI A;  3NKT A;  4P00 B;  2D3S A;  3N35 A;  4KWK A;  5SV8 A;  3SEP A;  3WUC A;  1PO1 1;  1LEM A;  2ET1 A;  4AGV A;  1DYK A;  1TMF 1;  1UX6 A;  1CZT A;  2BFU L;  2GN3 A;  3OYW B;  4LHN A;  4AR2 A;  5HI0 A;  4PLN A;  1AL2 2;  1UAI A;  4GWI A;  5IUQ A;  1UOB A;  4P5Y A;  2R07 2;  4K9S A;  3GCW A;  4QQH A;  2RDR A;  3HQU A;  1R1Z A;  3CZU A;  5T5J A;  3I7D A;  1W6N A;  2E51 A;  1YQ5 A;  1QJU 2;  3GBF A;  1GLH A;  1GOG A;  2DUR A;  2VNO A;  4XHX A;  2CL2 A;  3KT4 A;  1ACC A;  2XJR A;  2FDF A;  3SNM A;  3ZXE A;  4E2G A;  5JAX A;  3RRD A;  4CP1 A;  1NA1 A;  3DPR C;  4XUP A;  5LZ6 A;  4LUK A;  5JR7 B;  2WS9 3;  1QJX 2;  3V0B B;  2KD7 A;  4KWU A;  2C24 A;  4H3W A;  2VO5 A;  4MZU A;  3NV3 A;  2V4A A;  3RZJ A;  4OI4 A;  3B3Q E;  5CIR A;  1GWM A;  4CXX A;  5CG8 A;  1RUH 1;  1GZW A;  2VZU A;  1PZ9 A;  1QHD A;  2FMD A;  3CIH A;  3KHB A;  1CAV A;  1Q8P A;  3MDP A;  4GKX A;  4RGG A;  3RZG A;  3IAP A;  1O4Z A;  3I2D A;  2XBO 1;  2JDY A;  2E7A A;  3T1M A;  1LHU A;  4P08 A;  4CDW C;  3IKW A;  2WL1 A;  4LIV A;  1AYN 3;  4NHL A;  2ARB A;  4AED B;  4YSF A;  1AR6 3;  1RTV A;  2W39 A;  2XBO 3;  2JIJ A;  1I3H A;  4IE6 A;  4XET A;  4M00 A;  3POS A;  4NWV A;  2DVD A;  3MIH A;  3WHT A;  4H14 A;  4XW3 A;  1CAX B;  4CP9 B;  3ZKU A;  4ATF A;  3FHA A;  3J7L A;  4FPK A;  5AFE A;  3K46 A;  3DEM A;  3ROU A;  3O0W A;  4BXF A;  1B09 A;  1GV9 A;  1ULP A;  1VBE 1;  1Y7B A;  2CHH A;  2XWB B;  3MFA A;  4QX0 A;  4A3Z A;  4AHY A;  5L19 A;  1HQL A;  4CDX B;  3QLQ A;  1IS3 A;  3ZPY A;  4ATE A;  4B4Q A;  1EV1 1;  4RS5 A;  2JEM A;  5FMC A;  1WCQ A;  2E7T A;  5JOX A;  1VBE 3;  2NLR A;  1OHF A;  2GAL A;  4Q2F A;  3VKN A;  1MR5 A;  1VBD 1;  2A7A A;  5DMY A;  1T2X A;  2JWP A;  4Q0S A;  2WO7 A;  1KJR A;  1L7R A;  2WYS A;  2Y34 A;  4NOT A;  3LZZ A;  1AR8 3;  4YM2 A;  4W8J A;  4LBQ A;  2QJV A;  5LA9 A;  4GB3 2;  2J1E A;  2LUW A;  1UY2 A;  1ND3 A;  1LHV A;  2C4X A;  4JGZ B;  3POG A;  1SFY A;  4GKY A;  4UI9 L;  1WW4 A;  5D8A C;  5C9A C;  4UFL A;  2WJS A;  4AAP A;  3C3V A;  2VOK A;  4XUO A;  2WZE A;  4XQ4 A;  3USU A;  5C71 A;  1GMM A;  1NA1 C;  1CWP A;  4B1L A;  5LAS A;  3PDQ A;  2WN2 A;  4MYE A;  2C9K A;  4YGD A;  1FNY A;  3VD7 A;  5K7P A;  1I9R A;  3NL1 A;  3W58 A;  1EUT A;  1MAC A;  2W2I A;  1GQG A;  3WDX A;  2X5I A;  4QHZ A;  1SAC A;  3VZN A;  4JHT A;  1FOD 2;  4CU8 A;  3VBU B;  2VMC A;  5FLJ A;  5FP7 A;  4PDW B;  1NAE A;  1DU3 D;  4EZH A;  3ZFE C;  2HWE 1;  1WZX A;  3HNM A;  2FCU A;  4XJZ A;  5KXD A;  2NP0 A;  4MG2 A;  5AVP A;  3ACI A;  1E57 A;  1MQT B;  3DCQ A;  4A4A A;  5EJ1 B;  4XIK A;  1GZT A;  1U5I A;  2HWE 3;  2MEV 1;  1PVC 2;  2DTY A;  5IAV A;  2XH6 A;  5C4W B;  1KDK A;  1XE0 A;  4AQ2 A;  4JC1 A;  3I4I A;  3WP6 A;  5JWP A;  3OPZ A;  2VM9 A;  2MEV 3;  2Q8C A;  3BU0 A;  2F17 A;  1CPM A;  1UN1 A;  3ACG A;  2R07 1;  5CFD A;  1ULG A;  2QBX A;  3AMN A;  5A7W A;  5CKM A;  1OOP B;  3IDB B;  4JZR A;  5F39 A;  5LA1 A;  3FBM A;  2G19 A;  1GSL A;  1OT5 A;  1RUJ 2;  3KCY A;  2C1F A;  1CJP A;  5HCB A;  1CZS A;  5J98 B;  5I8S A;  1XYN A;  1QJU 1;  5F6K A;  4C91 A;  4D69 A;  2A6W A;  5KHG A;  1RXG A;  1PMJ X;  3J9S A;  4JRL A;  1MS3 A;  4YYO A;  5C6C A;  3LAG A;  5T5P A;  5BNQ A;  5C33 A;  1RMU 1;  2IVI B;  4KMQ A;  1A34 A;  4TZD A;  4BQ4 A;  1S0C A;  3USS A;  1BHG A;  4ASK A;  1DQ1 A;  4QB2 A;  1QJX 1;  4D7S A;  1CR7 A;  4YVS C;  3KV5 A;  1D4M 2;  3FN9 A;  2YY1 A;  2JDH A;  3NVC A;  2CGN A;  1RMU 3;  1K5M C;  4BQ3 A;  2D97 A;  4BWO A;  4B7K A;  4K6B A;  3L2Y A;  3POW A;  3UGH A;  4HSL A;  1UXZ A;  1GQP A;  1OSG A;  1YHF A;  2WFP A;  4HVO A;  5E6H A;  1ODM A;  4WZF A;  3RQ0 A;  4CCL A;  1FXZ A;  1KGY A;  4NE9 A;  3TB0 A;  3ZYG A;  1CVN A;  2JDM A;  1HQW A;  1F8V A;  2I2S A;  1OF4 A;  2ZAH A;  3EBR A;  3QH7 A;  1RIR A;  4QPG C;  1ZVF A;  2C26 A;  1DLL A;  2DU1 A;  5A1A A;  3I49 A;  3TN9 2;  5A6X A;  3N9P A;  5JSP A;  3O1T A;  5I8T A;  1QNW A;  1V6K A;  3DYM A;  3QD6 A;  4BU2 A;  3WNO A;  3M3I A;  4BK5 A;  2OA2 A;  2HWF 2;  3I3E A;  4YM0 A;  3M7A A;  1QQP 2;  2D7F A;  2E6V A;  3VBH C;  1IPS A;  4IEU A;  4PHZ A;  4Y1Z A;  4Y3O A;  2QE3 A;  1V70 A;  1RUF 2;  2WNE A;  5BNN A;  3J7N A;  3U37 A;  5DAB A;  3H8O A;  3POY A;  4KQ7 A;  3PTY A;  1VBA 2;  4UW3 A;  3THD A;  5L7O B;  1FAT A;  1DQ4 A;  1FT9 A;  2B42 B;  3OYW A;  1I5Z A;  1D0H A;  3IBM A;  2BWC A;  2WT1 A;  4COZ A;  4CUG A;  4GB3 1;  2OKX A;  1ND2 B;  3ELN A;  5JLV A;  2A3Y A;  2IXJ A;  5IFT A;  1OA4 A;  2ZHN A;  4FAG A;  3U14 A;  3ZXD A;  3LCP A;  5JSO A;  4XVH A;  4OMD A;  2VE1 A;  4LBJ A;  2GNB A;  3H9A A;  5DDJ 3;  3TWI A;  1KIT A;  1RVF 1;  1X8M A;  4CU9 A;  1ZBE 1;  3AYA A;  5FYH A;  2LTN A;  3UNP A;  4HT1 T;  3W9A A;  1JZ3 A;  4OHZ A;  3V0B A;  5FQ0 B;  1IZ3 A;  2HEV F;  1FOD 1;  3MW3 A;  3PNA A;  5IVE A;  1RVF 3;  2BOI A;  1QOS A;  1UO9 A;  1ZBE 3;  3UES A;  4AE2 A;  3AP5 A;  4D94 A;  4JGY B;  4XZU G;  2QZ3 A;  4I01 A;  4P9I A;  1G86 A;  5F3G A;  4P9W A;  1QGL A;  3LKJ A;  5GLT A;  3HAG A;  3WVJ A;  4AHZ A;  2X8K A;  4ERO A;  4KBB A;  4M4R A;  2WZP P;  2D43 A;  1GWK A;  4WVM B;  3KCX A;  4XTM A;  2PFW A;  1BBT 3;  1PVC 1;  1NZI A;  5IK4 A;  4PCR A;  2WSU A;  3DL3 A;  3JBG 2;  4R8H A;  5FWJ A;  3PUI A;  3PUH A;  3U4S A;  3AXE A;  5FY4 A;  3VBS B;  3V64 A;  3OEB A;  5L9R A;  1TME 3;  1W2U A;  3KWV A;  1XND A;  3OBR A;  2GAU A;  2D5F A;  1CAX A;  4YW6 A;  4CP9 A;  4OLL A;  5DAP A;  3W20 A;  3NJX A;  3WW2 A;  1JYW A;  2VCC A;  2OPK A;  5CEH A;  1RUJ 1;  1AR9 2;  3D3A A;  4IND A;  1FYU A;  4Z2W A;  4FPL A;  1W04 A;  4R9B A;  4LBN A;  4CDX A;  3H8X A;  2WNV C;  4K8R B;  3AB0 A;  4Q0U A;  2W92 A;  2DUQ A;  4ZXK A;  5LBE A;  2ZEW A;  3ZDS A;  4Z8B A;  3A21 A;  2F4P A;  3IWZ A;  4QKN A;  5GLW A;  1IG3 A;  3VDA A;  2JEC A;  3WT3 A;  1E5I A;  2JKB A;  2HJI A;  4Z07 A;  4MGZ E;  4LKS A;  3WV6 A;  1D4M 1;  1NCQ C;  1UX7 A;  5HBA A;  3QOP A;  2E33 A;  5DG2 A;  1ZYB A;  2G4I A;  5JOY A;  1JZ2 A;  2UWC A;  5JPM B;  4B1M A;  1HV0 A;  1H1M A;  1YQ6 A;  2GP5 A;  4JGZ A;  3J7H A;  5J1X A;  3P5B A;  4V2V A;  2VXR A;  3O1O A;  4Q8L A;  3CQO A;  4NID A;  2FDK A;  2ARC A;  3P3N A;  5A80 A;  1UU4 A;  4AVC A;  3B9C A;  3K2O A;  3AKP A;  4XTP A;  4AYU A;  4DXZ A;  4FPF A;  2J7M A;  4M3C E;  1PK6 B;  4QX2 A;  3B93 A;  1QY4 A;  3NWK A;  5K9Y A;  1Z7S 1;  1W8U A;  3TN9 1;  5CBL A;  4XCA A;  1UMH A;  3CJI B;  5JVV A;  4CCO A;  4LHL A;  1GOF A;  2WIN B;  3UKT A;  1J84 A;  4KL1 A;  1ZRR A;  3FHI B;  1LHN A;  1HKD A;  3VBU A;  1NY7 2;  4L0P A;  2DDU A;  2E31 A;  4A41 A;  2D6L X;  4P9Y A;  4PDW A;  1Z7S 3;  4PIY A;  1NQJ A;  1SBE A;  5FYM A;  2HWF 1;  4FPY A;  1QQP 1;  2VZR A;  3CJX A;  2RM2 3;  1MQT A;  1DYO A;  4IUG A;  3I2F A;  4NHM A;  4CXW A;  3BAL A;  1RUC 1;  2WBK A;  2ADE A;  5C4W A;  2B4K A;  3D0J A;  1VJ2 A;  5B4X A;  1VBA 1;  1NZC A;  4EJR A;  3AP6 A;  1Q8V A;  1RUC 3;  3ACH A;  1E5S A;  1YIF A;  4IGO A;  2ZGS A;  5E88 A;  2Y33 A;  4WM7 B;  4YFZ A;  3VD3 A;  1CX4 A;  4YVW A;  4ZZ5 A;  2YBS A;  4LIU A;  1IG0 A;  1OOP A;  1UCX A;  4Z82 A;  4CDX C;  3SLI A;  1ZX5 A;  4XXP A;  5T55 A;  2E9Q A;  1Y4W A;  3VKL A;  1QJY 2;  3PUA A;  1F9K A;  1MVE A;  3JUU A;  4PBO A;  1CES A;  5ISL A;  2B39 A;  1UL9 A;  2PLV 3;  2YDE A;  3DEC A;  1BEV 2;  3CU7 A;  4ZKT B;  4W6X A;  3K4Z A;  3WQ0 A;  2O14 A;  2WRA A;  2VMG A;  4QX1 A;  4UW5 A;  1C8M 3;  1O4Y A;  3CL1 A;  1QXR A;  3MF9 A;  5D1I A;  4I30 A;  2Q0A A;  3APB A;  4P14 A;  5FYT A;  5LA0 A;  2ZHK A;  5HCF A;  4Q0V A;  1VRH 2;  2ENR A;  3FE5 A;  1XYP A;  3JZV A;  4JDO A;  4M3C B;  1K12 A;  5EJ3 A;  4EYU A;  5H9P A;  5FCC A;  5FAX A;  4CCJ A;  2P17 A;  1ZRI A;  1UMZ A;  2DVF A;  1PGL 1;  1BLZ A;  3GBW A;  4Y26 A;  5FZ9 A;  5LA2 A;  3E5U A;  5I8Y A;  3TEY A;  1EY2 A;  1VBC 3;  2PMW B;  2DCZ A;  2XG3 A;  3BVC A;  2I45 A;  5D2A A;  5E89 A;  2IFW A;  2XJQ A;  2VZT A;  1F31 A;  4UWD A;  1KXG A;  3PL0 A;  3H3L A;  1WMX A;  5GJ6 A;  1GP4 A;  5FYS A;  3LEK A;  3JD7 2;  2PXJ A;  5BNO B;  3JBG 1;  4JCK A;  4YW1 A;  5C3O A;  4DY3 A;  4ZU5 A;  2EVX A;  3WD5 A;  2OT7 A;  3N7M A;  4XCB A;  3PVB B;  3FJS A;  3B94 A;  2CU5 A;  2ORX A;  2X10 A;  3C7F A;  4I3P A;  1SHW B;  4NUB A;  4IEQ A;  4YRD A;  1YFX A;  4YZ2 A;  4ET7 A;  3LFM A;  1OC1 A;  1AR9 1;  3VKM A;  1TNR A;  3MUZ 1;  5F37 A;  3ALQ A;  1X9T A;  1SFN A;  4Y22 B;  1W39 A;  1J3Q A;  1LOF C;  1W6O B;  3O1U A;  5A1L A;  3LB9 A;  4XIO A;  1OFN A;  2R06 3;  5FP3 A;  1FMD 2;  1N3Q A;  1KD7 A;  4FOW A;  4D8M A;  1LEC A;  4OHY A;  4WV8 A;  3HIF A;  1AR9 3;  4RQP B;  3VDB A;  2J1S A;  1LOG A;  5IAX A;  4Q4Y 2;  1DLC A;  2YFU A;  2J42 A;  1QOO A;  4HON A;  2VQU A;  1YI9 A;  4CSW A;  3LPF A;  1DBN A;  1O59 A;  4XAE A;  4YVW C;  3DGT A;  1ALY A;  3ZFG C;  4CDU C;  3N3H A;  1UOF A;  1POV 3;  1RGS A;  5L7O A;  2DFB A;  1BK0 A;  3M3Q A;  2JDP A;  2A75 A;  1L7Q A;  1N1Y A;  4UBH A;  2ZX1 A;  4AL9 A;  1CN1 A;  3DUI A;  4OQ9 A;  2VZ1 A;  4LO5 B;  4YPJ A;  4AF9 A;  1GOH A;  1VMF A;  1VBB 1;  3ILN A;  2GNM A;  2O1Q A;  2RR1 3;  4MVT A;  1US2 A;  4LXL A;  4CP2 A;  4BIS A;  1JHN A;  3AC0 A;  1W03 A;  4COV A;  5G05 L;  1NT0 A;  3OBZ A;  4A2U A;  2RS5 3;  4I0A A;  1Z78 A;  4COU A;  5FZG A;  3LGR A;  4AGG A;  1VBB 3;  5A7N A;  4C90 A;  1JHJ A;  2P3J A;  3U10 A;  4C8D A;  1Y9M A;  4Y33 A;  4IES A;  1PGS A;  2JJ6 A;  2NPI A;  1AZD A;  3PJY A;  1LJ7 A;  5JXI A;  5FQ0 A;  2BYV E;  2HWB 2;  4FT8 A;  4XQW A;  5FFO C;  5L36 A;  3VHR A;  1UYP A;  2D6N A;  4CEY A;  2WZR 2;  4CPB A;  4BXS V;  2XKP A;  4JGY A;  1OUX A;  1OVP A;  4W4Z A;  5JZG B;  1WLT A;  3ZVX A;  3RI8 A;  4AI0 A;  3N4M A;  4FI9 A;  2J1A A;  3WF3 A;  4EWA A;  4WVM A;  4QWN A;  1UMI A;  4B7E A;  2GC3 A;  5KWR A;  2RMU 2;  4X6Q B;  4AFC A;  1R09 2;  3AP7 A;  4LOS A;  2FCV A;  4NIH A;  5CVR A;  3KLS A;  3NW4 A;  1XE8 A;  1OH4 A;  4X6R B;  4FTS A;  3VBS A;  3O12 A;  1GYK A;  2OS2 A;  4IEY A;  1I6X A;  3SIT A;  2ZA9 A;  3MPB A;  1DYP A;  3CLP A;  4JVA A;  4OMC A;  1S0B A;  3JB8 A;  4ARY A;  1H8T A;  4DMI A;  2OQ7 A;  1PZ8 A;  3CKH A;  4EWD A;  3ES4 A;  4FQZ A;  4MAD A;  1QJY 1;  2VMI A;  1YUD A;  3ON7 A;  4HK8 A;  4AEM A;  5IVV A;  3H3U A;  4BA6 A;  2PTM A;  3DN7 A;  4IE7 A;  3T30 A;  3H42 B;  1BEV 1;  1K5J A;  1MZ6 A;  1QKQ A;  4Q0P A;  3OEA A;  3RMY A;  3I2O A;  2HWC 1;  1NCR C;  3GHM A;  4P9L A;  5GKA C;  3THP A;  4YG6 A;  1RUE 3;  1SLC A;  1WME A;  1VRH 1;  3LIG A;  4UAP A;  4B3N A;  3S5A A;  2RV9 A;  1AL0 G;  1PMH X;  4LOT A;  4SBV A;  3C7H A;  4YZ4 A;  2HWC 3;  1N1V A;  4JQR A;  2RJK A;  3ATG A;  4XJW A;  2YB7 A;  3HVD A;  2OX0 A;  5LY1 A;  3PHM A;  4GD4 A;  3UJQ A;  3DKW A;  2VXJ A;  2GME A;  2MPF A;  5F9T A;  5FMO L;  3ZXG A;  4E4D X;  2HLE A;  3NAP C;  2YZ4 A;  3E1F 1;  3MFC A;  4Q5O A;  3IPV B;  4AVS A;  1C57 A;  1ENS A;  3P3P A;  1Q5O A;  3NMB A;  5DPN A;  4HMZ A;  2XML A;  4Q4X 2;  5FYY A;  2A3W A;  1PK6 A;  3U0Z A;  1RHI 3;  4CEY C;  3RPQ A;  3IB3 A;  3CJI A;  2YC2 A;  3BIW E;  4I3G A;  3R05 A;  2WNU B;  3AVS A;  4YGB A;  4MLO A;  5IAT A;  5CAZ A;  2CY6 A;  3POE A;  3R0R A;  4DRV A;  2V72 A;  5FXZ A;  3LQC A;  5FP8 A;  3OGR A;  4XF0 A;  4XYX A;  4XAA A;  3JXS A;  2HWD 2;  4IGP A;  5IVB A;  3LDK A;  4XDO A;  1XNB A;  2ZBJ A;  1FMD 1;  3SQO A; 
#chains in the Genus database with same CATH homology
 4CCM A;  3KVB A;  2GP5 A;  3N9L A;  4D6R A;  5F5I A;  3KV4 A;  5FZ6 A;  4BXF A;  4V2V A;  5IWF A;  5A80 A;  3N9P A;  5FZL A;  3PUQ A;  3K3N A;  5FP9 A;  3K2O A;  2XUE A;  5ANQ A;  3N9M A;  4BU2 A;  4Y4R A;  5FPA A;  4LXL A;  4BIS A;  5IVJ A;  4CCO A;  5FZ1 A;  5FPV A;  5FZB A;  3DXT A;  3LD8 A;  5FPL A;  5FJK A;  5A3W A;  5FY9 A;  5FZG A;  5A7N A;  4Y3O A;  5IVF A;  5F32 A;  5FZO B;  4C8D A;  4Y33 A;  5FZM A;  5FY5 A;  4XDP A;  5FYM A;  4HOO A;  5FXW A;  5F3E A;  4URA A;  2XDV A;  4D6Q A;  5A3N A;  2XXZ A;  5A7P A;  2P5B A;  5FXX A;  2YPD A;  4D6S A;  4AAP A;  5FZE A;  5FZ8 A;  5F5C A;  4CUG A;  5FBJ A;  5FUP A;  5FZF A;  5LWB A;  3PDQ A;  3RVH A;  3AL5 A;  5FP4 A;  5FWE A;  5FYI A;  4QWN A;  5FZH A;  5LW9 A;  5FZ3 A;  4IGO A;  2YBP A;  2W2I A;  5A3T A;  4QX8 A;  4GJY A;  4QXC A;  4LIU A;  2YBS A;  3KV9 A;  4UF0 A;  2WWJ A;  3OPW A;  3KVA A;  5FYV A;  5A7Q A;  4AI9 A;  5A7O A;  4CCN A;  4E4H A;  5IVC A;  5F2W A;  2OS2 A;  3PUA A;  5F3C A;  5FP7 A;  5FYH A;  5FYB A;  4EZH A;  2YBK A;  5ISL A;  5FPB A;  3UYJ A;  5K4L A;  2OQ7 A;  5IVE A;  3PUR A;  5FV3 A;  5IVV A;  4QX7 A;  4DIQ A;  5FYZ A;  2VD7 A;  3AL6 A;  5FYT A;  5FYU A;  4CCK A;  5F3G A;  3PTR B;  4QXH A;  4TN7 A;  5FY7 A;  5A1F A;  4EYU A;  3K3O A;  5FZ4 A;  5FZA A;  3KV6 A;  2Q8C A;  4CCJ A;  5FZC A;  5FY8 A;  5F5A A;  5FZ9 A;  5IW0 A;  5FY0 A;  5A7W A;  5FWJ A;  4UF0 B;  3U4S A;  3N9N A;  5IVY A;  5F39 A;  3PU8 A;  5FY4 A;  3AVR A;  3NJY A;  5FZI A;  2Q8E A;  4IGQ A;  4GAZ A;  5F3I A;  5FYS A;  2OX0 A;  5LY1 A;  2PXJ A;  4GJZ A;  4GD4 A;  3PU3 A;  5FYC A;  5FZD A;  5CEH A;  3PUS A;  2OT7 A;  5A7S A;  2OQ6 A;  3N9Q A;  4ASK A;  5FY1 A;  4NUB A;  4QXB A;  5FZ7 A;  3ZPO A;  2XML A;  3KV5 A;  5FYY A;  5FJH A;  5LY2 A;  3U78 A;  5FZ0 A;  5F37 A;  2YU1 A;  2YU2 A;  3N9O A;  5F2S A;  5FUN A;  4DO0 A;  3DXU A;  3OPT A;  3AVS A;  5FP3 A;  5A1L A;  3LDB A;  4LIV A;  5FPU A;  4CSW A;  5A7W B;  4LIT A;  4QU1 A;  5A3P A;  5FZO A;  1VRB A;  5FXZ A;  5FP8 A;  4V2W A;  5E6H A;  5FZK A;  4EZ4 A;  5KR7 A;  4CCL A;  4IGP A;  5IVB A;  2Q8D A;  4HON A;  4XDO A;  5FXV A;  3ZLI A;  2GP3 A;  2WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...