5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
3N9PA 5IVJA 5FZOB 5FZGA 4GJYA 5FYVA 3OPWA 4GAZA 3PDQA 4LITA 5F32A 5FY7A 5A80A 3DXUA 4QWNA 5F3IA 5FZIA 4NUBA 4UF0B 5IW0A 3PU8A 5FZMA 3KV5A 4QXHA 2Q8EA 4CCLA 4CCJA 5CEHA 5ANQA 5FYIA 5FY9A 5FZ0A 3AL6A 4IGPA 3N9QA 2P5BA 3DXTA 5F2SA 5FP4A 5FYYA 5IVYA 5A7PA 4AI9A 5FZAA 5A7WB 5A3WA 5KR7A 3OPTA 5A3TA 5IVEA 4BXFA 3PUSA 3U4SA 5FP3A 5FZ6A 5LY1A 5FPLA 3PUAA 2YPDA 3K3NA 5FYHA 5FZHA 5A3NA 4UF0A 4HOOA 4ASKA 4DO0A 5IVVA 5FYBA 2W2IA 5FZLA 5FPBA 4D6QA 5FPVA 3LDBA 4IGOA 5A1LA 3AVSA 5A7QA 5FZ1A 4V2VA 5F2WA 2VD7A 4GJZA 5FZ9A 3KV4A 3LD8A 4QX7A 3ZLIA 5FZ7A 4QU1A 2YBKA 5FZKA 5FZCA 5FP9A 3UYJA 4LIUA 3U78A 5LWBA 4Y33A 5IVBA 5A1FA 5FP7A 5IVFA 2YU1A 5FYUA 4CCOA 5FZ4A 5A7SA 4CUGA 5FY1A 4LIVA 5FWEA 4C8DA 4D6RA 4D6SA 5F3GA 4EZHA 3KVAA 3N9LA 3KV9A 2YBSA 4CSWA 5A7WA 5F5IA 4BU2A 2GP3A 5A7NA 5FXZA 3K2OA 5F39A 5FUPA 3N9NA 2XMLA 3N9MA 5K4LA 5IVCA 2OS2A 5FUNA 5FZBA 4LXLA 4XDPA 3PUQA 5FYZA 4EYUA 5FPAA 5FY0A 5FZ8A 5FXWA 2XDVA 4Y4RA 5FYSA 4E4HA 4QXCA 2WWJA 4CCKA 5LW9A 5ISLA 4XDOA 5FZOA 4QX8A 3PURA 5FPUA 2OQ7A 5FJHA 4GD4A 3AVRA 5FY5A 4TN7A 4QXBA 3AL5A 3PTRB 2Q8DA 3RVHA 5F5AA 2OQ6A 5FZFA 3NJYA 4HONA 3ZPOA 4URAA 2XUEA 5F37A 3N9OA 4IGQA 4CCMA 5FJKA 5F3CA 4CCNA 5A3PA 2YBPA 5A7OA 2YU2A 5F5CA 4BISA 3K3OA 4EZ4A 3KVBA 4Y3OA 2WWUA 5FBJA 5FXVA 5FP8A 3KV6A 5FZEA 1VRBA 5FYMA 5IWFA 5FXXA 2GP5A 5FZDA 2PXJA 5F3EA 2OX0A 5FV3A 5FZ3A 4DIQA 5E6HA 2XXZA 5FY8A 2OT7A 5FYCA 5FYTA 2Q8CA 5FWJA 5LY2A 5FY4A 4V2WA 4AAPA 3PU3A
chains in the Genus database with same CATH superfamily
1AR91 1N1VA 4XZUG 2LUWA 3URFA 2D98A 4XUNA 5IFTA 3I2HA 2DVGA 4K20A 1JZ7A 4IE0A 5FZMA 2XJPA 1QNWA 1W2NA 3ZFEC 2UY9A 5EP9A 3ACFA 3G6JB 2J1SA 2XOMA 1PK6B 4N43B 3B9CA 5F2SA 5BNOB 1PZ7A 1E5RA 4O61A 3BTXA 5KC5A 4OUMA 1SCSA 1AYN3 4FVVA 1OLME 5IVEA 3LDKA 4CDUC 5CVRA 2AH2A 3VD4A 3FMGA 1YFWA 1XYNA 3OUJA 2PYTA 5GALA 1C1FA 3ZDVA 3R6SA 4COWA 3DPRA 1VLNA 2VBDA 1REFA 3NV4A 4QDRA 3SCFA 1W0PA 2QBXA 1B35B 3JQXA 2YC2A 3JQWA 2B46X 2XG3A 1SLIA 2R49A 4HL0A 2J22A 2Q0AA 4LHNA 4QB2A 4V2VA 5FZ1A 1XJAA 5GKAC 5JOXA 2VC9A 3C7EA 4TLGA 2YBKA 5AVAA 1DQ0A 3J7NA 3WINE 5LWBA 4GB31 3EHKA 1QQP3 3CJXA 1OF4A 4QQPA 2WO2A 4AVCA 5ACA2 4I0BA 3WT3A 1XQNA 4A7ZA 3FN9A 3WG1A 3EQEA 4KBBA 1ULEA 4A44A 4FTBA 1JZ2A 2HWD2 4QAWA 2QQLA 5FOBB 5D21A 4JTNA 1KDMA 2DBNA 5GM0A 2E7AA 1VBE1 2ID4A 1COV3 2VOKA 1IGOA 3HN3A 3IZOA 3SLIA 4MSVA 3WUDA 3AK0A 1N3PA 3LFMA 3FC0A 2O8QA 1V9U2 1PGW1 2Y6FA 5I93A 4KG8A 2FMDA 1GKBA 1KS5A 1UL9A 4YG3A 4E4HA 4UXAA 2WFPA 3LEGA 4OVEA 2R061 3PTYA 1WUVA 5FCCA 1PVC3 3P5BA 2D43A 3C3VA 5A70A 1GBGA 3LFIA 4PI2A 3VKMA 4XJ8A 2G9GA 1DBNA 5A6ZA 2RM22 3ZSLA 3KT1A 1JZ3A 4V1PA 2NZ9A 4TN7A 3OEAA 2Y6HA 3ACIA 1H9WA 3AL5A 1RUI3 4LOSA 1WMEA 2A71A 3HEIA 1F15A 2QTWB 5G04L 4UFIA 1ND2A 2NM1A 2JG9A 5LRSA 1S2BA 3KGZA 4XF0A 1H2NA 2E26A 3C7HA 1VBC2 4N53C 4OFGA 4P02B 4YRDA 4CCNA 4QQHA 2P3JA 2VZ1A 4FPHA 1RB8G 4AHYA 1O7FA 1JYNA 1JUIA 2C1FA 2X09A 4FOVA 4Y5Z0 1PMHX 3C8XA 4P9WA 3OD4A 4D7SA 5I91A 5J7MA 2ARBA 2BV4A 2HWC2 1XC6A 2G19A 2OX0A 1SBFA 5CZKA 2FMYA 2WSVA 1POV3 2JWPA 2R0FA 1LEDA 1LB2A 3ILNA 1Y9GA 2TEPA 1NOVA 4J25A 1CGPA 1OKOA 1C5IA 2K0GA 4MX3A 1BVVA 1H2LA 5K7PA 1VB2A 2WFF2 2Z5WA 4LBKA 1UY4A 2WN2A 3FWEA 5CEHA 2FCVA 1QOSA 1DFQA 3Q8FA 3WW2A 3OY8B 4M3CE 1OH4A 1OOPA 2XJQA 4U2AA 5FZ0A 3RMXA 3VBFB 1YO8A 3MEPA 1J1TA 4OI4A 3I97A 4ORFA 1LOBA 4QGMA 4QT6A 1XYPA 3CBNA 4B8EA 5J37A 2C4XA 1RJ8A 4RS5C 1LU2A 3WUCA 4MYEA 1ULDA 4Y4YA 1IS4A 2J1EA 2OPKA 4Q4W2 1ZRFA 5FYHA 4KGQA 3WF2A 1ZZ7A 1QXPA 3FL7A 2QVSB 1URXA 3ASIA 4W6WA 3T1LA 4DMIA 1GMMA 4NRMA 1OA3A 1W8NA 4IEWA 5FZ9A 1MQTA 2BQPA 3PVBB 1VIWB 3W9AA 2V72A 3KHCA 4FPYA 3D6EA 1HQWA 4G3YC 4LIUA 3LF7A 3DGTA 3AZXA 2L9LA 4D0QA 5IAVA 1A8MA 4Q4X3 4AEDB 4CUAA 3SC7X 2YU1A 5FYUA 1QJU3 1DGRA 2V5YA 3H0OA 3ZN4A 1LGNA 1LENA 2XHKA 2WQ4A 3O12A 4JKLA 4OMDA 4CP1A 1PO22 1K5MC 2QQOA 2FZ1A 4N53B 3I2KA 4N7IA 4C0HA 2W87A 4KWJA 1W39A 2WO3A 3AP5A 3N7MA 5CKMA 4IV3B 4BDVB 5IUQA 1S0FA 5FUPA 5JOYA 4HVRA 5A3MA 1OOPB 4DUXA 1UKGA 1LGBA 1UPIA 1GP4A 4AFDA 1CAVB 3GHMA 4JQTA 3TEWA 2RS31 3LSEA 4FPGA 1OFNA 4AZZA 2WDBA 3E5XA 2ZX0A 4W8JA 3KF5A 4MADA 4QHBA 4IV3A 4BMEA 5APAA 3J4UH 4YZ2A 5FPUA 2BWAA 3MIGA 1JHJA 4GD4A 1O3RA 3VV1A 1CX1A 3VDDA 1PGW2 3AXEA 4JGYA 5CG9A 3DEMA 1YQCA 1J3QA 2Y26A 4YG6A 2RJ2A 3I8TA 4MHUA 5L9BA 1J83A 1VBE2 1RXFA 3ZPOA 2XPJA 3CHXA 1JBCA 4CUCA 2E7TA 2XONA 4YVSC 2B45X 4RS5B 4AGVA 3RYPA 1QJY1 2VOTA 5C3RA 1DLLA 3WNKA 1LOAA 1FI2A 4CEWC 1CN1A 4XETA 2W5FA 4OLLA 3U0ZA 3WHTA 3B02A 1OD3A 2IXLA 2JD9A 2RMU1 3HT1A 2VZVA 5FLHA 2JDUA 4MGTA 4R4XA 3N3HA 4CU9A 4XXPA 1WW7A 5F3EA 4QHOA 2OXBA 1GOHA 5DPNA 4LLOA 2R062 3POEA 5HXMA 5FY8A 1F35A 2JDHA 2W1QA 2DF7A 4AFMA 1VBC1 1MQTB 3KD4A 2B5HA 5E16A 4UW6A 1D2SA 1N1SA 3P3NA 1FPN1 2CL2A 4R4ZA 3VBOC 3WDYA 2Y6GA 5JMOA 4OYUA 2EVXA 1NA1A 3CF6E 1VBD1 3GBWA 3S5AA 2ETEA 4JC1A 1G7YA 3R4SA 1ONAA 1LJ7A 3D4KA 1JH5A 4LKDA 1W3XA 3I3QA 3SCHA 1W6OA 5KC6A 2I2SA 1OUXA 5KR7A 2WINB 1ZVFA 4ZS3A 5H9PA 2VMHA 1TZOA 3USUB 3PUAA 4H7MA 3WHUA 1Q5OA 4OMCA 4RHV3 1JS9A 1J84A 2C26A 4RQPC 3T2OA 2R041 5FZLA 2FDGA 3RRDA 3ZO0B 5LA1A 2ZX4A 5FPVA 1QOTA 4F83A 3EBRA 4XFAA 4LO8A 2FDHA 1FV3A 5EXOA 3VBUB 2MEV1 2XKPA 4QDQA 5IK8A 2Z79A 1LULA 3EXUA 3NJXA 4HZFA 1YIPA 1SLBA 4P9XA 5CKQA 3U78A 3NKGA 4UAPA 3ZFGA 4LBLA 4E8CA 3I54A 5HCHA 1RIRA 3E6BA 4CCOA 1W0OA 2VMEA 3UGHA 4D6SA 1DQ2A 1RVF3 5F3GA 2WAOA 3AZWA 5HCFA 3KVAA 1E5HA 1AYM3 1POV0 1SDDB 2ZXQA 3GJBA 3HR9A 4RL7A 3RI8A 4LBMA 5DDJ2 2UURA 3TN92 3W59A 3N9NA 1UW8A 3I3DA 1UMZA 3WX5A 3AMQA 3RQ0A 4QPIB 1U5IA 4DUVA 2AREA 4CEYB 3WNLA 1W06A 1RHI1 3HNBM 3S6PA 1PGL1 1NYWA 4Q4Y2 3ZYIB 4WM7A 1AR63 1V9U1 4XTMA 4XDOA 1V6NA 5LATA 3ALQA 5KXEA 3WNXA 5ABJB 2UY8A 2W3JA 3RWNA 4AYUA 3AZVA 3LDRA 4QM9A 5SV8A 4OHXA 1QJFA 4I0AA 1LESA 4YVWB 4RGGA 4MVTA 1PGSA 1VPHA 4IETA 1CZVA 2JDPA 1F5JA 1TMF1 3APBA 3ECQA 4HETA 5EWSA 3KM5A 5LK7B 2G9ZA 3DYMA 3B7MA 4AVSA 2D93A 5DAXA 1UZ0A 1JZ6A 5BXXA 2KM2A 3H8XA 5KHIA 2WS93 3ZSMA 2XLFA 3CIHA 2MPFA 4XYXA 5JXJA 2Y34A 3K3OA 3CU7A 2JG8A 4XHXA 3UKTA 3ZFEB 4YGDA 2XQRA 1RMU2 2PN5A 3K51A 1RUC2 1O5LA 2JJ6A 1HN0A 2ZGKA 5FZ3A 1PX4A 1HW5A 3ATGA 4Q26A 5H9SA 4P5YA 2WS91 5KXCA 1CX4A 2NMNA 4XTPA 2R6QA 2HBTA 2DTYA 2PHFA 4L97A 4P9IA 1F8VA 2CGOA 4I09A 4L2NA 4YVSA 2GNMA 5T5OA 1HRI3 5I0UA 3BCWA 4QGLA 3GNEA 3PDQA 5F32A 4YFWA 4A6OA 4ZZ8A 1O8PA 3DXUA 3NSTA 1SQ4A 4UF0B 4HPKA 1ZA7A 2DVAA 3AMPA 4LHSA 4Q0QA 1W8TA 2XBO2 5FY9A 1RUF2 1VE0A 3AL6A 3LEKA 3OBAA 4DY3A 4DRVA 3GM8A 1CQ9A 3WDTA 5ERLA 4PDWC 2BERA 1PM4A 2WNUA 3OCPA 5A3WA 2XJUA 5A7WB 2JDNA 4AQTA 1ULPA 3OPTA 1H4HA 3PIJA 4RGKA 5C3QA 1SMVA 1LECA 4OZOA 4QX2A 1VBD3 1DZQA 3ST7A 4UFKA 5A3NA 4DXSA 1Y9MA 3E5UA 3ELNA 3UJQA 4BIFA 4BK5A 4JKMA 4R9BA 2NMOA 5FYBA 3BIWE 2WNVC 1W8OA 4OQ9A 3LDBA 5CIRA 1ZRDA 1ZYBA 4Q4W1 3AB0A 5JIUA 2GNDA 3W21A 5K8SA 3LD8A 4QX7A 2J1RA 4PLOA 5FREA 1W0NA 2VCAA 1W8ZA 4Y20A 2OA2A 4JGZA 2FZ2A 3IWZA 1D4M1 5C4WA 3WW1A 4BQ2A 3LKJA 4DXRA 2B9UA 2PLV2 3WG2A 3NV3A 1CVNA 3ZFFC 1UOBA 1CJPA 5KHJA 4F7ZA 4MXWB 4AHZA 1QF3A 2C9KA 4BZ4A 5JZGC 2NN8A 4CUGA 2D6KA 4J1WA 2F6BA 3J7LA 3JBG3 1QDCA 4RA0A 3N9LA 1M4WA 4QU2A 3TOJA 2GP3A 3ENRA 2ERFA 3H1YA 1TE1B 3QACA 4LHKA 4NOTA 1SPPB 4AEMA 4CDXA 3HD8B 4Q4X1 1W28A 4BB3A 1ND3C 1JYXA 1T2XA 1R1ZA 2OS2A 4XJWA 2P17A 3GZEA 1R1A3 3CL1A 3PUQA 2VW0A 1OVPA 2IXKA 1UYZA 4MZUA 4XXAA 5FPAA 5GLUA 4EN0A 4ZHNA 4YZ1A 2VMGA 1MZ6A 4DUWA 2XL7A 4JGZB 1RUH1 3VHPA 2OUJA 4EJRA 1L3JA 4FTEA 4XIKA 3H1MA 2RDSA 1LHWA 2GH8A 2HYXA 2OZ6A 2VW2A 3IBMA 3POSA 3AP9A 2HEYF 4AR2A 1X50A 2B42B 2D6NA 2EXKA 2BP6A 3G7DA 1OLRA 4MOAA 5CADA 2G9FA 3USSA 2SBAA 5C3SA 2XR4A 1W8WA 2VNOA 3ZYPA 4R9AA 1NE4A 1BEV3 3H42B 4Y26A 2W39A 5D8AC 4Y5SA 5A32A 3WVJA 5A3OA 2Y38A 4BK4A 3OD0A 3TN91 4CU8A 3JUUA 4PDWA 1XPWA 4AVTA 3D5OA 3PJQA 4SLIA 3ROUA 4CDUB 3AMNA 2HJIA 4JRAA 1D4VB 2HWC3 4XURA 5GLZA 1JZ8A 1TMF3 2DCJA 1M06G 4ASLA 3MIHA 3IDBB 2F4PA 4QX5A 4YNIA 2PHRA 3FUQA 2HH9A 3LE0A 2IFRA 3ZFGC 4W50A 1UNBA 2QFEA 2HYKA 3HVDA 2ZKLA 3H8UA 1B35C 1U0AA 3LA2A 3MGUA 2XXZA 3MHZA 4AEJA 2LROA 2IZWA 4PBPA 2EXIA 3OTFA 1ENQA 4GXLA 2CGNA 4V2WA 1JYVA 3VD7A 3WDVA 1TNRA 2GH2A 5EYXA 2RM21 1V70A 2XJRA 3ABZA 3BGAA 5KHGA 4BYYA 1ND2C 4NIGA 4KU8A 4Q2FA 4YM1A 3NW4A 1US2A 3H8RA 2PHLA 3KB5A 1UOFA 2A70A 4FOWA 4H7LA 4M3CB 1RUG3 5JDBA 2ZX2A 4WVZA 3FHIB 2W91A 2JG8C 1AR72 5C9AA 4O9GA 2BGPA 1R64A 1O8SA 3IPVB 2VMIA 4I0WB 3GXUA 3I4IA 4MG2A 5A3TA 1X9PA 2FQPA 5FK7A 5I8SA 4XE9A 2ZEZA 1H2KA 3ITQA 3OGJA 1UQXA 5DG1A 4Y5TA 3N36A 3Q8AA 4XFIA 4FFFA 3M3IA 4MXWA 4WZCA 5TSWA 4GH4C 2PQSA 4AAXA 2LS6A 2VVDA 2PLV1 1J3PA 4AXOA 1J59A 3QBQA 1MEC2 3AC0A 5LBFA 3KT7A 5A7QA 4DEVA 5C4WB 3BN6A 4IQPA 2JDAA 4UW3A 1XE7A 1ASJ1 1C5HA 1HN1A 2ENRA 4FPEA 2DURA 3KCXA 2QQIA 3UYJA 2ET1A 2ZABA 4ISQA 3VD5A 5K0UC 1SLCA 1HXS3 3BALA 2HWC1 1WCKA 4Q4X2 3VL9A 4EN9B 5L9VA 4AGGA 1X82A 1RITA 2YROA 2EIDA 4Z82A 3DL3A 3GF6A 3U1XA 2VZPA 4JV4A 1WZXA 2ORXA 1AXYA 1LU1A 4JVAA 4CEYA 2VUCA 4CPBA 5CNAA 5KXBA 2CU5A 4Z2AA 2FBEA 4FQ4A 2ZHMA 4X8NA 3SH4A 1DZTA 2QJVA 4E4SA 2WNOA 2R043 3BUCA 4H2AA 2XJSA 3UKNA 4EN8B 1WW5A 2E31A 2XMLA 1W99A 1FPN2 1DQ5A 2VZUA 4N7UA 4TXWA 4FPOB 4MUVA 3WNNA 3N4MA 4YM2A 4JGYC 1GWMA 4EYUA 1S2EA 1LHNA 3RZGA 2ZX1A 4JKKA 4BHPA 4W4ZA 1RUJ1 3CJIC 1U5XA 2FD8A 4GA9A 3O1UA 3V0BA 3WG3A 1REEA 2P3IA 1LGCA 2DWRA 3PHMA 1ZNPA 4URTA 4NE9A 5FJHA 4BM8A 3BTYA 2FCUA 2VECA 3O1VA 5GLTA 3BB6A 1GZTA 2PAMA 1Y3TA 1WA4A 5IK5A 1VBE3 2YY1A 1ZM1A 3NNGA 3RVHA 4ET7A 4LO5B 4GALA 3AM2A 3SEPA 4YFZA 2OKXA 1RUH2 1N1YA 4IGQA 4P9GA 4QXKA 2BEOA 5BPXA 4YPJA 4DFSA 1T6BX 4FPFA 4HK8A 4XZPA 5H9QA 2MEV3 2P6CA 1W3VA 1KQRA 3RJ2X 5CFDB 4QQ2A 1QXJA 4QPGA 3GGLA 1IPJA 4GWMA 3J8F3 5G05L 2JX9A 5JWPA 5FZEA 1S0DA 3GHNA 5JR7B 1HKDA 2GN7A 2VCBA 2PXJA 3BVCA 1NA1C 5FV3A 1ND3A 5I0DA 2HWF3 4GQ7A 3ZXKA 1US3A 3BPZA 5A6QA 3J8F1 4QX0A 1JOJA 4IDZA 4DNYA 4LBQD 1BQPA 4SBVA 3T0BA 4XFGA 4JHZA 3IAQA 4L9BA 1HRV3 1GLHA 3K4ZA 1OC1A 2Q1MA 2WA4A 1WCQA 2YUEA 4QGNA 2WLPA 4QWNA 3JCIA 4XMAA 1OD5A 4AHXA 5IK7A 1T6GC 3VBRC 5T50A 2XVKA 1MS8A 1OF3A 1LAJA 2R32A 5IATA 1R1A1 1G8WA 2DBIA 1G9CA 3N9QA 3DXTA 1H2MA 2X53S 3C7OA 2RS33 3ZXGA 3KZ4C 4XFCA 1H8TC 4MGYE 4NHXA 4BQWA 3LEIA 3WQ7A 1UCXA 3NL1A 4NIAA 5DABA 5LBCA 2KD7A 3NNJA 4UFLA 4GH4A 1YI7A 1LR5A 1GP5A 2X8KA 3BOPA 4RGAA 2HWF1 5DXDA 4CDWC 1JU3A 1RUE3 4DO0A 4FPLA 2BWCA 1H8TA 2G4IA 2MNGA 3U4XA 1HV1A 1AR71 3EMRA 2VM9A 3OBTA 4NHLA 3RGBA 5F2WA 2CDOA 2P4EA 2CV6A 2PHDA 4XW3A 1JN2P 1A3KA 1V00A 4UW4A 1JZ4A 5FPZA 1ODMA 1KD7A 5C3OA 4AI8A 2A6YA 2E33A 2F17A 3N35A 1CAWB 3WF1A 1WBLA 1AXKA 2CAUA 1W2UA 1D0GA 1C3HA 4E27A 1UO9A 5IVFA 4TSVA 1RMU1 3VN4A 1FT9A 3TNQA 1FATA 4YYOA 1XSRA 5FKCA 3WP5A 1VMFA 4OHWA 2W9XA 3BTAA 3R0RA 4KH9A 1HXS1 5FRAA 4FP2A 4JRLA 4CU6A 3A0KA 2R1DA 1KJLA 1EUUA 4QM8A 3WF0A 2C24A 3AKQA 3GJAA 4IUGA 4FPCA 1LKNA 3PVEA 3KT4A 2EAKA 5LASA 1ZBE3 2TBVA 3ZN6B 1VR3A 3IDEA 2VH9A 2RR12 4XEZA 4LT5A 1NA1B 1UMIA 1YEWA 2R0HA 2XBO1 2BRTA 5J48A 4O9EA 1PK6A 2YMZA 4N43A 1JYCA 3CKHA 3FJSA 1TME3 4RR3A 5DAPA 4AF9A 5DG2A 1EAH3 2RR11 2VXJA 1HJGA 5BY5A 4YZ5A 2WN3A 1OA4A 1YWKA 3VKFC 3VKLA 5FY5A 3H7JA 4TTGA 2JKXA 1ND3B 1ENXA 5DUXA 5BUVA 3MPPG 5JPNB 3OYWB 3MI8A 4UWDA 3AJYA 4AI0A 3B01A 1AL0G 1FXZA 1NUKA 4OI2A 1W8FA 3S0MA 5F3CA 4C1XA 3CLPA 1W9WA 2CY6A 4ISRA 5A3PA 2RS13 3HQUA 3ZXJA 4Y3OA 2ZEXA 4L92A 4EN6B 4P08A 4YLZA 5CBLA 2WBKA 4XPVA 5L9RA 3O0VA 2GC3A 1ULFA 5FXXA 1NXD1 1SLLA 3OPZA 4YM0A 1RXGA 1UX7A 1Z78A 3AP6A 3D0SA 5FYTA 4C91A 1UXZA 4LTAA 1ZBA3 4MO3M 3IPVA 3BOWA 2DCKA 4JZRA 5J98B 2DVBA 3KSCA 2Y8KA 5FYVA 3THTA 4CYDA 1N3OA 1VAMA 2WQZC 3VBUC 3AZYA 4K40A 5A80A 3ZFFA 3JD72 3MLJA 3I3MA 1EV13 3W58A 3H8OA 2OIIA 5GLVA 1DGRN 1BZWA 1DGLA 3DPRC 3AXDA 2R073 3ES1A 5A7PA 1PMIA 1OA2A 3O1RA 2VY0A 2VJXA 2OYZA 3RJRA 2ZGQA 5B2GB 1BLZA 1MS4A 2ZGPA 3NO8A 1TQ5A 1DYKA 2YV8A 4BXFA 3ZN5A 4UOJA 5FP3A 3I59A 5HV4A 5FPLA 2DCTA 2DV9A 3H3LA 4P9YA 2JEMA 1UYPA 3ZDSA 5C5UA 3MF6A 1QDOA 4FXGB 4LUKA 3OGVA 2PHUA 2HLEA 2W2IA 4GWIA 2ZGRA 3S57A 2Q30A 5FPBA 4NVPA 4AVVA 1R081 3K4DA 2ZOEB 4CCCA 1G9FA 2ZMLA 2A75A 2D40A 4FTSA 1S2KA 1AUYA 1IKQA 1BBT2 3DYPA 4WM8C 2BYVE 4FSJA 3FLRA 3PVNA 2CYFA 5T54A 3SISA 3ZYBA 2EXJA 4QU1A 1UU6A 2NYYA 2PLV3 5FZCA 1LOCA 2NPIA 4AEKA 3MO4A 4PI0A 4QHZA 4YGBA 1NCRB 2WNEA 3T08A 3PVOA 4C1WA 1UD1A 1CIYA 1NLRA 2ZHKA 4I01A 3ON7A 2WFF3 4OZXA 4S2DA 3EJKA 5A7SA 1UY0A 1C28A 3AKRA 5DMYA 2VZ3A 5J09A 4EZHA 4GB33 3VZNA 1D4M3 3ZXAC 2JB8A 1RL3A 2QQMA 3Q8CA 2VBPA 4NPMA 5F5IA 1JZ5A 1XSQA 4LMFA 5FBZA 2BDRA 3ZYHA 3V0BB 3J9SA 3OUHA 2A73B 1OI6A 2O1QA 1U5ZA 4RD7A 2RS52 1JHNA 5C9AB 3ZMNA 4EE2A 2EALA 4AQ2A 3CZUA 5BNNB 2OW4A 1NZIA 2ZHNA 4BQYA 3VDBA 4HBNA 2WZEA 5DZGA 4CPBD 4CCKA 1LEMA 1Y4WA 4ITCA 1VALA 1GYKA 5LEKA 1N47A 1RJ7A 2WZR2 1QJZA 5EHDA 1JYWA 3NQHA 1JXNA 4INDA 4W65A 3HN1A 1ULCA 3S30A 5I0SA 1ZZ9A 4Q0UA 2ZGMA 2ORZA 4IL7A 2JG9B 1HB1A 2ZGNA 1OQDA 1HB4A 2HWE2 4YW3A 4IV3C 4GIQA 2Y60A 3MF9A 4CDQB 1SCRA 3NV1A 1UY3A 3M7AA 3TEXA 2VTFA 1J1LA 1AR93 3VZLA 3VZKA 5BNOA 1D2QA 3UGFA 1V6MA 1O6UA 2O8OA 3ZIWA 2BTVC 2A6WA 4JTOA 4COYA 3WF3A 2BNNA 2O14A 3LZZA 1NQJA 4BLJA 4DIQA 5FO9B 4KMQA 4X8PA 2Q8CA 3SMHA 5DN2A 4XVHA 4I30A 3A4UA 1Z7S1 1UZVA 2PAKA 5FMCA 5GZCA 1WWYA 4GJYA 4HSLA 1W6NB 3WW4A 1W9TA 4BOWA 1C8M2 2XVLA 3DKWA 4KI5M 3T30A 1JU4A 4L0PA 1IKPA 1DLCA 2D97A 1MACA 1X33A 2BOIA 4ZPIA 4B7KA 4EN7B 3TEZA 2VMDA 1HB2A 3GZAA 4IGPA 4YARA 3MIBA 4ATEA 3MPBA 1R082 4J1XA 3I2IA 4XQWA 2V5DA 4AI9A 1QH6A 4AVBA 4L99A 1BBT1 1A8DA 3VL8A 1W04A 1SZBA 1ZA4A 3Q8BA 2VOWA 3E97A 1QEXA 1XRUA 5LEJA 1WLDA 3UKVA 1NE6A 4XDQA 2DUQA 1PIV3 4LNVA 1SFYA 3V64A 1O4TA 1IPKA 2LALA 5T55A 2RJLA 1SDWA 4FOYA 4XJAA 4N8MA 1QJY2 1DU3D 2I45A 2WIIB 4AEDA 4HVQA 1VMJA 2E6VA 1GNYA 4XUTA 3RSJA 5GZGA 2JXAA 2ZGSA 3VZJA 4PCRA 1BJQA 1DYOA 3KS7A 4Y22B 5L7OA 2CDPA 1W6PA 5DAVA 2P2KA 1FYUA 4XUOA 1Q8OA 3ZSEA 1AXZA 4AHWA 4LBQB 1PZ8A 1WKYA 3WP6A 3O14A 4D6RA 3S7EA 2ES3A 3GDBA 3NAPC 1OXCA 3PIGA 2X29A 1FMD3 3HBZA 4K1ZA 4RSUA 3TWIA 3OJBA 1V9U3 3OG2A 3K46A 4JCKA 5HI0A 4K21A 3RZHA 2ZAHA 5T5JA 5K4LA 2PELA 3K48A 5IVCA 1AX1A 1D0HA 1YXWA 2GMPA 3ORJA 1MZEA 4LR4A 4LBQA 5FZBA 5SV5A 3RFRA 1C57A 3U37A 3ZSKA 3EB7A 1XE8A 5FY0A 1A6CA 1JI6A 4PIXA 3V0AA 1CWPA 1ASJ2 4MH0E 3TBDA 2BUKA 3WNMA 4LK7A 1VBB1 4DS0A 5D1IA 3IMNA 4UT5A 3T0DA 4B29A 4DINB 4XF9A 4XAAA 1FOD3 1S4CA 2DUOA 5FOJB 5JI7A 2OQ7A 3WQ0A 1VAKA 3NNLA 1VBA2 2HEVF 1W6QA 2E51A 4OI1A 5HPOA 1BK1A 3FX3A 2AZ5A 1UYXA 1RUH3 3T3YA 3MDPA 1MVQA 1PHMA 2AENA 1OHFA 3M3QA 2AEZA 1QWRA 4EWEA 2A3YA 1RC6A 5E1RA 1QY4A 2YBPA 3VGIA 4CRQA 2GMMA 1AL22 4E2SA 2VZQA 3FFZA 4JAAA 1N1TA 3PL0A 1BXHA 3OBZA 4WVVA 1VRH1 1CR7A 4XMIA 2ZZQA 1CPNA 1MS5A 3WD5A 4EV0A 2CTVA 2EF6A 3A23A 4EWAA 3MYXA 2VNRA 4AGRA 4K9SA 2QQVA 2WRAA 4AOCA 5C71A 5JPMB 4ES9A 2OT7A 3AP4A 4M3CF 2GN3A 3MUY1 5LY2A 5KXDA 2IWGB 4PBOA 3VBHA 5JXGA 1HRV2 5CAZA 1WCDJ 5FMDA 4K3UA 2VCMA 2N7GA 4WM7B 1NXMA 1OSGA 1QXRA 2ZCWA 5DAQA 1R093 3ZVXA 1KFXL 3WR0A 4XQ4A 1RHI2 3I49A 4GZ9A 4TLFA 2DYCA 3KV5A 5JVVA 2EAAA 4IERA 4KBZA 4QQOA 1GNHA 3KWVA 4FQZA 1YJLA 4W6YA 4XBLA 2Q1ZB 1Z7S2 4XFHA 2O0OA 5FZAA 3WLUA 3Q9OA 2P3YA 5K0UB 3QD6A 2JB4A 4LPLA 4Q4W3 5JAXA 3PLQA 1C1LA 4L11A 1KEXA 1RUE2 4Y22A 3VBFC 1W8HA 1RUD3 5T3NA 3HQRA 4NAMA 1AYM1 4NHMA 1ULGA 5LZ6A 1FX5A 3RMYA 1UU4A 4DOUA 1XBFA 1UOGA 5F6KA 4MGSA 4RS5A 1OQEA 1OQ1A 3VDDB 4JX0A 1UY2A 2C5DA 1CZSA 2WSUA 5DUVA 1NCQC 4AQSA 4O7XA 4B4PA 2V09A 2AGSA 3MIFA 2FDIA 3GBFA 4CEYC 4TYSA 1PMJX 4JGYB 1GV9A 1CAVA 3C2UA 4WBBA 2JG8B 3MFCA 5IVBA 2PAEA 5E88A 1SLTA 3VBSC 5JZGA 1ZBE1 4UFJA 5I8YA 1PO23 4RYDA 1CPMA 3OGSA 2LRPA 4NRPA 3WG4A 4WM8B 2XBO3 3I2DA 4CSWA 2KA3A 1YFUA 1NLQA 4LBJA 5A7NA 1DF0A 5BV6A 2GC1A 1PGL2 2YZ4A 2AR6A 3LWCA 3T1MA 4DEQA 4GH4B 2VCCA 3ETPA 3N9MA 5IFPA 1QH7A 4PIYA 4UBGA 1UIKA 3RI9A 1IHMA 1NCRC 2DTWA 2ZGLA 3AZZA 1NAEA 3T2PA 5L36A 2WQ8A 1TME2 1U5YA 1YQ8A 5FYZA 5KHKA 4GWJA 4BQ1A 3BKZA 2ZJCA 4QXCA 3K75B 3MLLA 1DDLA 1BK0A 1I3HA 2E7QA 2VQAA 1DQ1A 3PURA 5LB6A 1PO11 4M0HA 1PK6C 4N43C 5BNOC 3HMYA 3M2MA 5C8CC 1NT0A 4A4AA 4N9HA 3GALA 4XAEA 1IQAA 4FPKA 1PO12 1C8NA 1H8VA 2YFUA 3AJZA 1XNCA 4CCDA 1EAH1 3IKWA 1HJFA 1W6PB 2XKOA 4A3ZA 2LTNA 3ACGA 3MUZ1 3H7YA 4QDSA 3I59B 3BU7A 1HDKA 1G9BA 5I0TA 2D7FA 3A7QA 1K5MA 1MVEA 5IYYA 1C4RA 2ZTNA 3TRSB 3HQXA 1IS5A 4E2QA 2PQQA 1DIWA 2W1UA 3P3PA 4CP9A 5EV7A 2E9QA 5C70A 1ZBA2 3AYAA 3IDAA 2WFF1 1VBB2 5JOZA 3BIEA 1FNYA 3K4AA 5IK4A 2RG4A 1IS3A 1EUTA 3UNPA 2PTMA 2TUNA 3HWJA 3JD73 1V6JA 1CESA 1WLTA 2C9AA 4Q4V3 1ZRRA 5FY7A 1NZCA 4EROA 1IG3A 3OBRA 2X5IB 5A6YA 4IEOA 4NUBA 3TEYA 1RUNA 4M0NA 1AYM2 2YPJA 1WW4A 3M4FA 4LO7A 4PLNA 1I1EA 2VZSA 1JTZX 4A2UA 1QJX3 4HVOA 4XHBA 3UL2A 3IIIA 1V6IA 4AQ6A 4YGEA 4BIOA 4Y1ZA 2EA7A 4CTEA 5D2AA 1AYN2 4W6XA 1RUJ2 3IIAA 5CG8A 1HIXA 1ZZCA 4LOTA 4LQRA 5LY1A 5LK5A 1KGYA 1VP6A 4Q4Y3 5BNPC 4NN0A 4Y20B 1WCSA 4A7KA 2QQUA 1SBDA 5CA6A 1E57A 4Y1VA 4HKOA 4D6QA 1GWKA 4ARXA 4CDUA 1GZ9A 5M0TA 2BFUL 1G6NA 3WDXA 5FQ0B 4CDWB 2JIGA 2WZPP 4GJZA 1ACCA 1CONA 4XJZA 4K8FA 2CHHA 1RUE1 5GZDA 1PX3A 5FZ7A 3WDWA 4BPZA 2QCSB 1GANA 2AUYA 4Z2WA 5L7OB 4XOGA 2FDFA 4ATFA 4Y33A 5IHRA 4E9KA 2V4VA 4MGKE 2W92A 4IW3A 2H0BA 2WAAA 1RVF2 2EICA 1PNGA 3LCPA 1H6XA 4JDOA 3QLQA 2DU1A 4IEYA 3FLTA 4XIOA 1LHUA 4QPYA 5DDJ3 1RUG2 4NO4A 3JD71 4ONUA 4K8RB 2RS53 4KWUA 4DXZA 4HT1T 1WBFA 1S1AA 2VZTA 4RQPB 4B4RA 4NHKA 1FAYA 3E6DA 4BWOA 5JXIA 1DQ4A 2ARAA 1UMHA 2JG9C 1AF9A 3JBG1 1KFUL 5LW9A 1YNAA 4IE6A 2QDNA 1UKRA 1FMD1 1QJEA 2ARCA 1KJRA 4Y4RA 3UETA 2LW8A 5ISLA 5A33A 4QPIC 2WZR3 3LAGA 3S7IA 2FDKA 2WR9A 5CU1A 4QX8A 4HN1A 1STMA 4U36A 1RUF3 1YI9A 4DQAA 5JUVA 3IAPA 3LOIA 2BFUS 4LBNA 1BKZA 1Q43A 3ES4A 1Q8VA 2X5IC 1QU0A 3VBOB 3OGGA 4WVMB 1O91A 2VTXJ 4LHLA 1TME1 4OHYA 1I5PA 2HWE3 1YIFA 3T0AA 1K5MB 1RUI2 3IB3A 5GLWA 2VGDA 1ZRIA 2WO1A 1AJKA 2WS92 2RMU2 4YWAA 5ACA3 4QB1A 4B1MA 4FP3A 3TNPB 1Q56A 5A7OA 1G9AA 5T5LA 4BISA 3T4HB 2BGCA 1RUC3 2HWD3 2EXHA 4UFMA 4NIHA 3KV6A 2BNOA 5FYMA 3OYWA 3NJVA 2IVIB 1EPZA 5FZDA 3U10A 1LCLA 5E6HA 4ZU7A 3PJYA 4LKEA 3B9IA 1WMXA 4B3NA 2BZDA 1AR82 4BQ3A 2FCTA 1GUIA 1W2AX 3D3AA 1C8M3 5AVPA 3VHNA 5IVJA 2E53A 5J96B 1NY72 2YYOA 5FZGA 1XYOA 4GAZA 1AYN1 1L7RA 3EO6A 4BJ0A 1UZZA 4UFHA 2Q8EA 4CCJA 3C7GA 5E8AA 1K42A 4QXHA 5J3UA 1ZBA1 3WSOA 4NR1A 4R8HA 3QCWA 2RM23 4JDMA 4QPGC 4LULA 4CCEA 4CDXB 4AEDC 5F8PA 3ZR6A 1DZRA 1RINA 2A7AA 3LB9A 4CEWB 2QQPA 1G86A 2VO5A 4HKWA 4ZONA 2RHPA 5CFDA 1AHSA 3VBFA 3FUOA 1W2TA 1UWWA 4WM7C 1XE0A 2QNKA 3FE5A 2I07B 4RN5A 4IXLA 3AMMA 4WVWA 5C8CA 3RDIA 1VBC3 3POYA 2MEV2 1UN1A 2YGMA 4KNCA 2B39A 1AX2A 2Y6KA 4CXWA 3JXSA 1PZ9A 1WMDA 1WMFA 4DRRA 1RUD1 2IUWA 2D5HA 4KWLA 1OURA 3ZLIA 3ZXDA 4OI0A 2WLQA 3AMHA 3VDAA 2E32A 4FPJA 5FZKA 5C7GA 1RUG1 2JE7A 2RDNA 2YGLA 1I9RA 3USUA 5I8TA 1UZYA 1W6QB 1B35A 4BE3A 3B94A 2QQNA 3D82A 3MIEA 5BNNC 3ZYFA 3ZM8A 3V0AB 5IAXA 1O59A 1OLQA 2VTXA 3O1TA 1VRH2 3MIDA 3VKOA 1A78A 1H8TB 3JBG2 5EIYB 4PDWB 2YC4A 5FZ4A 3CJIB 3H3UA 5FWEA 1W9SA 2Q4SA 1FMD2 3LPGA 3O0WA 3ZYJB 1N3QA 3NVCA 2BBVA 1QJU2 3ILRA 1JMUB 5FLJA 1W9YA 1UPSA 2WNUB 1BCXA 3IN9A 2VMFA 4PQ9A 5A7WA 3IT8A 1OVSA 4OHVA 4AVAA 1AR61 1VJ2A 1EP0A 1GU3A 4YW7A 1RYYA 2HWB2 3MLKA 4RR3B 1MQTC 1WLCA 4A3XA 2VUDA 2W46A 1RVF1 3M8LA 4FFIA 2B4KA 4LXLA 3AKTA 2VQUA 1ENRA 3JZVA 2NP0A 1GQPA 1NCQA 5L73A 4MGIE 4XACA 2ZAAA 4KGGA 4KG0A 3LIGA 4IE7A 4PHZA 1LTEA 1PNFA 1UY1A 4OQ8A 1GOFA 3MV01 3N7KA 3FZ3A 3LQCA 1UIJA 3J7MA 4QMAA 3RYRA 1KS4A 3M3CA 1PIV1 2OPWA 3O0XA 2J42A 5FKBA 1S0EA 1SEFA 2RE9A 3ZSJA 2DDUA 2Q8DA 1YCIA 1OOPC 1QNYA 2WL1A 5FZFA 3BI3A 3QOPA 2WT1A 2XGXA 3RNSA 1AJOA 1X7NA 4XJUA 2A3XA 4XUPA 3AYEA 3UT0A 3ZYRA 2VULA 1OMIA 1TMF2 1OFSA 1MEC3 3LGRA 2D6OX 1NY71 3R4UA 3ZFEA 2ZMKA 4A42A 4E2GA 3LIHA 1OLMA 1SG3A 2WWUA 4Q29A 4AL9A 4EZ4A 1HV0A 3M1HA 4LE3A 1KITA 5FXVA 3GZTB 4LEJA 1VRBA 4B7EA 5IWFA 4BQXA 2A3WA 2VVFA 3I2OA 3DCQA 5CYYA 3O1MA 3SH5A 4ZS2A 4IESA 1EV11 3JU9A 3T09A 4HK9A 1HXS2 2BU9A 2WNVB 4CEWA 5FWJA 1YYNA 1VB4A 3SCGA 1ZBE2 5F5QA 3HBKA 4LA3A 2K9ZA 1ODNA 1VBA1 1XXNA 1YFXA 4MXVA 3UK9A 4GWNA 2R7EB 3ACLA 3NV2A 1I6XA 1L7QA 4ZXEA 4HSJA 5B4NA 3J26N 4Q1RA 3MW4A 4XCBA 4CCLA 1COV2 1DGWA 1LHVA 3LA3A 5FO7B 1IG0A 3PUIA 4Z1VA 3MZHA 3NJZA 4FBFA 3HOBA 4L8QA 1FPN3 1P8JA 5GZFA 1SFNA 5A1AA 4FT8A 2B9VA 5GZEA 2B7YA 1XNBA 4UI9L 4F3JA 2X10A 4CP2A 1RUF1 1HX6A 4QPIA 3B3QE 2D3SA 4CU7A 1NKGA 1OPMA 2ZHLA 5FZHA 3VBHB 1F4HA 3VHRA 4LKSA 1GOGA 4IEVA 4UF0A 4ASKA 5C8WA 3I3EA 3AFKA 1KDKA 3GCWA 1PVC2 1NQDA 3QH6A 2GMEA 3KF3A 1LODA 4CDWA 1Q8QA 4Q4V1 3VZOA 2QE3A 1XOYA 1W03A 2BW8A 2GDFA 3WDUA 4Y1UA 1YQ2A 5JCTA 2VZRA 2ILMA 1HB3A 1Y9QA 4YZ4A 2XQXA 4XFBA 1CAWA 1FV2A 5FTTC 3T4VA 1LNSA 3X29B 5DDJ1 5LBBA 3OEBA 2Q5TA 2D3RA 3DUIA 1MPXA 4S2FA 5A1FA 1SLAA 3M70A 3JB8A 3SH3A 4AW7A 3NAPA 2VZOA 5FY1A 1LRHA 1W05A 4C8DA 4P5HA 1SHWB 5EPAA 1F4AA 4BQ5A 3D0JA 2F4LA 4JQRA 2D44A 4OHZA 2HWE1 3D8CA 4BU2A 1V6OA 5C8CB 2IXJA 2Q8OA 3AKPA 1WW6A 3K2OA 2R072 3ZMOA 1RTVA 5JMCA 1ZX5A 4RFT0 2FHRA 1GWLA 2W68A 3TN93 4Q27A 3THDA 3RYKA 4MLOA 5JSPA 1GP6A 1V6KA 3TAYA 3K77A 2ARXA 1Z0HA 3U75A 2ZA9A 5FYSA 3W5MA 1W6NA 4YVWC 2WWJA 2W08A 2GC0A 2JDZA 2ZX3A 4Q1PA 4ZU4A 3VLBB 4A6SA 2JECA 4CE8A 5JXHA 5FZOA 4B4QA 5JI9A 1AR62 4KU7A 4HFSA 1VMHA 3PUHA 4Y1XA 2JICA 4QXBA 1QGLA 2IVJA 3SHRA 1Y7BA 2BJSA 3VZMA 1LOGA 3PTRB 5FPXA 5A32B 4NPRA 3I2GA 3POJA 4EWDA 4Q0PA 4PF5A 3O1OA 4FO9A 1UXXX 4BQ4A 5FAXA 4QKDA 2VQ0A 4NWVA 4URAA 5F37A 1O4ZA 2WA3A 3N9OA 1O3TA 2OZJA 3CJIA 3J8F2 1O3QA 4G4FA 5F5CA 1S0CA 2JDYA 4AI1A 4FFHA 4NJ4A 1F9KA 2AYHA 3VBHC 2P1BA 5JLVA 2OVUA 4QD2A 4WVMA 2CNAA 4XUQA 2UYAA 1Y43B 3N7LA 1UX6A 2VQTA 2EIBA 2W52A 4PQQA 5FYCA 3L2YA 2VBBA 4WV8A 1XNKA 2DCYA 2VOVA 2QQJA 1ENSA 3CMGA 3HNYM 2BNMA 4LITA 4ARYA 4E4DX 3AFGA 4DZGA 5F3IA 3OSDA 3LOBA 4G9SB 3PU8A 1QJX2 2XHNA 4M4RA 3A21A 3HJRA 5A33B 3VBSB 1IZ3A 2D6PA 3FHQA 4H55A 4M3CA 4YW6A 5IVYA 1HQLA 3RS6A 3WCSA 4GMP3 1SPPA 2XWBB 4I3PA 2I74A 5CFDC 5JZGB 1MZ5A 4IEZA 2CWMA 4HKLA 1H1MA 3H1WA 2RR13 3U4SA 1WA6X 1ZRCA 1J3RA 5KWRA 1W6MB 2B8MA 2VUAA 4QKFA 5IVVA 4XF4A 5CB7A 1NCRA 1UZWA 3W20A 4AFAA 3P6BA 2YFZA 3AVSA 1TEIA 5EJ3A 1BMV1 2XUMA 2H6BA 1Q8SA 3A22A 3RZLA 3INAA 3DECA 1CJDA 2UWBA 3C7FA 2D5FA 3SEEA 2BBAA 2Y33A 3NRUA 1GNZA 1V0AA 5LA0A 1MEC1 3I2JA 4IEPA 3TYJA 2GNBA 4KQ7A 1CAXB 2RJKA 4D7TA 5CFCB 2CSGA 2R071 3VUOA 1PVC1 2Y0OA 4XBQA 4NMIA 2J1UA 1OT5A 1HRI2 4NPLA 5AFBA 3WQBA 4IV1B 2RS12 3BYWA 4LBOA 4R9CA 3NKTA 1FNZA 2W95A 1V6LA 2ZMNA 2QUOA 5AC93 3ZOIA 2DVFA 2ZS6B 2R1BA 5DZEA 3V56A 1W6MA 1OKQA 1SACA 3KCYA 2R063 4XFFA 5FK8A 2YXSA 1R083 2GNTA 4N9IA 4R9DA 2QZ3A 1QJU1 4PF1A 2XWJB 3WP3A 5DUUA 1F2NA 4HPKB 4XDPA 2X5IA 1VBD2 2ZZJA 5EFUA 2A1XA 3ZFFB 4JHTA 2XDVA 4WM8A 1YLLA 4Z8BA 5C3PA 5FR3A 1POQA 2WYFA 3B00A 4PLMA 2VVEA 4M01A 4Q4Y1 1LHOA 3M3EA 2BPA2 1IOAA 5D8AB 1QJY3 1RGSA 4YSFA 4RR3C 5IT6A 3RPQA 1GQHA 2WUHA 2ZACA 4RQPA 3WZ1A 3NWKA 2RMU3 4AFCA 5EQUA 4WZFA 5LA2A 5HV0A 2JDMA 4HONA 4XQDA 2VAUA 1WCUA 4K6BA 4DXTA 4UW5A 2P37A 4YM3A 4CCMA 3WQ1A 2YB7A 1CD3G 2W0XA 1D7PM 2LM3A 3FLPA 4YVWA 3RZKA 1MZFA 3HT2A 5ABJC 5BNQA 5T5PA 4H3WA 3MW3A 1XU2A 3DPRB 4I3GA 4MV2A 2RDRA 2YHJA 2GP5A 4LORA 3TB0A 1I5ZA 5C6CA 1YUDA 5H9RA 3POBA 4LK6A 1WD4A 1ND2B 2ZGTA 4FAHA 1LOFA 4ZKTB 3SXWA 3PU3A 4HLTA 3KQRA 4XABA 4NHYA 2HWD1 5FMOL 5FQ0A 4NRQA 5JOWA 5BNPB 4YW4A 1CZTA 1R1A2 1W90A 2SLIA 3POWA 4ASMB 1RUOA 5J1XA 5HBAA 1ZZ6A 2XB6C 2XLGA 5FZIA 1POV1 1QMJA 4O65A 3CO2A 4GB32 3WNPA 4A41A 5ANQA 5FYIA 2HWB1 1S0BA 1FOD2 4OUSA 1F5FA 2H0VA 3HAGA 4CP0A 5BNPA 3J7HA 4IV1C 1VBA3 2UWCA 3R4DB 3ZXLA 3KLSA 2YC0A 1AR73 2WABA 3WCRA 2Y64A 2AACA 2EIGA 1FOD1 4QX1A 5EZWA 4GULA 3OY8A 2IFWA 3WEZA 4I2OA 4E4ZA 2PFWA 3U07A 1ST8A 1GZWB 2RDQA 3WP4A 3SITA 2RS51 2YG0A 2GZWA 2VNGA 3CQOA 4QQLA 1RUI1 2DVDA 1BBT3 4QPWA 3AKSA 3GZUC 3E6CC 1AL23 5LCWL 1HLCA 3WF4A 4BH9A 3NAPB 3VBRA 5C5TA 2VD7A 3H9AA 4AI3A 3KV4A 1IPSA 1DP0A 4FCAA 2DCZA 3DYOA 5FP9A 4LA2A 5EYYA 3UV9A 1JOPA 1S55A 5AC91 1VRH3 1SBEA 4K1YA 4BLIA 3JB4C 4CXYA 5J36A 5FMOS 4GKXA 1K45A 1QQP2 4XJ9A 4CVUA 2IC1A 2OUHA 5L7OC 2RV9A 3GCXA 1D4M2 1AR92 3O5SA 4LIVA 1RHI3 3GBGA 2JE9A 1NG0A 2NQYA 2VMCA 2YBSA 1W2OA 1W9FA 5FFOC 5KHHA 3SQOA 4P9LA 4CZSA 1J58A 2QKDA 4BA6A 4PT6A 3ZR5A 5F39A 5GJ6A 2WZR1 3ZKUA 1U12A 1H30A 2R042 4J6GA 2PMWB 2WC2A 1TNFA 3IDCB 1YQ5A 3HPNA 2K2SA 1IQDC 2RVAA 2A5ZA 2RS11 3ZYGA 1RUD2 1COV1 2PHWA 2JD4A 3OB8A 5CFCA 5B4XA 3NNMA 1GSLA 1MS9A 5FO8B 4MGQA 5DUWA 2JKBA 4HANA 1GICA 3NMBA 1OPOA 3POGA 3B69A 3E1F1 4XILA 1H1AA 3H50A 1GFF2 1LOEA 3PMSA 3ZN6A 5CKNA 2WZ8A 4YVSB 5FMBA 3RZJA 1CAXA 1QIQA 3LA7A 4MHRA 5FLIA 3KHBA 1R091 2CWSA 3RZZA 4FFGA 1UOJA 4ZZ5A 1K12A 3HNMA 2VU9A 3DF0A 3ME2A 2JIJA 3OGRA 4M4PA 1S0GA 1H1IA 3UGGA 2YU2A 3VBUA 3I3BA 1UYYA 1MS1A 2WYSA 2D3PA 3MFAA 4HMZA 4Q0VA 1L7LA 5FP8A 3DV8A 4NIIA 4ES8A 4DY5A 1JODA 5T52A 4IEQA 4D69A 4CDXC 1XB9A 3CEWA 2XH6A 2GSYA 4JDNA 4YW2A 4CDQC 2VL4A 2C6SA 1G9DA 5F7UA 1XNTA 1GZWA 1YRZA 4IEXA 3O1PA 1EPWA 1LOFC 2P3KA 2WT0A 3V65A 1BHGA 2Y6LA 3P1IA 1X8EA 2C0ZA 2Z69A 3WV6A 4S2HA 3OPWA 4TZDA 3ETQA 4GMP1 5EJ1B 2WKKA 1ZZ8A 5ANNA 5IW0A 3LSDA 4BMBA 2Z4FA 5ABJA 1JYIA 4JGZC 2P34A 4MGZE 4E8DA 1APNA 2UWAA 2BOJA 5FP4A 3F95A 2ZKNA 4RHV1 3QH7A 5FYYA 2GU9A 1H0BA 4ZY9A 4H14A 4N53A 2RS32 3OOXA 4LJHA 3IMMA 1PO13 3PUSA 2WT2A 3B5LB 1PIV2 5JR2A 3B93A 1VAVA 3R05A 2YDEA 5DAWA 2Y6JA 4XF1A 3THPA 4Q8LA 2PHTA 4IGOA 5A1LA 1QQP1 3ZIXA 4QX3A 3A0NA 5A3UA 1H6YA 2WNUC 3T2QA 4LLFA 3AYDA 4HG6B 3HIFA 5ACA1 3LPFA 4X6RB 4CUBA 3WNOA 2ADEA 4LO6B 4FOQA 4D3WA 2HWF2 2P6HA 1BMV2 1BEV2 3FBYA 3DKQA 3KMHA 5FUIA 1RUC1 2VNVA 2IXHA 4DB5A 2BVVA 2IXCA 3H3ZA 5AFEA 4D8MA 1JYTA 2IXIA 2VW1A 2FDJA 3SKVA 5FP7A 4QPGB 1K5JA 1AX0A 3IM0A 2JE8A 4XCAA 2GAUA 1AZDA 3S5QA 4QKBA 2GC2A 3VBOA 4AI2A 2Y0IA 3OUIA 2Z42A 1DCSA 4I02A 1XU1A 3O7OA 1E5SA 4COVA 3RG0A 4Z92B 1BVP1 3L2HA 4Q0SA 1GR3A 1AR81 2QZ2A 1F31A 1K3IA 2XJTA 2ADDA 5FXZA 1PM7A 5HCBA 2D6LX 1TVGA 3MV11 2X05A 3VKNA 1Q3EA 4IE5A 4GMP0 5A6XA 3BU0A 3VBSA 3DN7A 1EY2A 5FUNA 1TG7A 1DHKB 5D8AA 3SNMA 3MW2A 1ASJ3 1MS3A 2WWSA 1W6OB 3ZXEA 1QJX1 2Q1FA 1AVBA 1X9TA 4NAOA 1BYHA 2WJSA 1R092 1DGWX 2JENA 3ZKYA 4BCUA 1OH3A 3VB9A 3I2FA 4FXKB 5E89A 1DG6A 1YC61 1WD3A 2XVGA 1GZCA 1DQ6A 1EAH2 2EIEA 3AVRA 3OF1A 4GKYA 1X8MA 1Z7S3 2V73A 3FHAA 2KR2A 1UF2C 3KQ4B 4LO4B 4PJYA 3ZXFA 4CXXA 4IV1A 3AX4A 4COZA 4IE4A 2PHXA 5FIXA 3O1SA 2XL9A 1HQNA 4K7JA 3FFQA 5F5AA 2R30A 3UJOA 2XUEA 1UU5A 3Q8EA 1SFPA 4DPNA 5L19A 1S0JA 4Y24A 3EYPA 2MHFA 3UESA 2TNFA 4M00A 2ZPXA 1YHFA 3NNFA 4CDQA 4AE2A 1B09A 3WY6A 1ZZBA 2A6VA 2HKXA 1WGPA 4Y1YA 5CISA 1PO21 2K46A 1XNDA 1O5UA 2WO7A 4NROA 4YGCA 5FY4A 4BXSV 1WLWA 3N9PA 5C4WC 1Q8PA 5FZOB 4AK3A 1YFYA 2J1AA 3KCCA 2A6XA 5IJRA 2UU8A 2Z2SB 3E5QA 2XLAA 2ZEWA 2VUJA 3MICA 4UYBA 3SKJE 5BNNA 4YW1A 1ALYA 2GALA 4F8AA 1H4GA 3F2ZA 5C33A 1DYPA 1CAUB 3N7JA 3VD9A 2P5BA 2R16A 1C8M1 4XF3A 4META 2V4AA 2D6MA 5HXVA 5F1RA 2QDRA 3ACHA 1NX9A 1H9PA 2BGOA 2ET7A 1QOOA 3ZPYA 4A45A 5DZFA 1JOBA 1A34A 3FBMA 3BPSA 5CFCC 1KXGA 5KBFA 3POFA 5FZ6A 2VE1A 1CAUA 2QQKA 3RWKX 2YPDA 3K3NA 4LUMA 4HOOA 1YQ6A 2JDKA 1O3SA 5K9YA 4KWKA 3I7DA 4YG0A 1CIWA 1MS0A 2DUPA 4OULA 4D7YA 4RHV2 2VG9A 3VBRB 3LEMA 3PMEA 2H6CA 3AP7A 2QQWA 3CNAA 1E5IA 2UYBA 4LE4A 4B1LA 1JUHA 5LBEA 1MR5A 3T2TA 2VOXA 3THCA 3ZX7A 1PVXA 2A6ZA 4UBHA 4Q8KA 2ZEYA 2VR4A 5A3LA 2NLRA 1AR83 1GQGA 4ZU5A 1NCQB 4FI9A 2ZGOA 3U14A 2J7MA 5DQ0A 4A7YA 2VPVA 4AWDA 4C0BA 4P00B 5AC92 5LRRA 3ILFA 3WOGA 4HXCA 3VDCA 1EV12 5JIAA 3U11A 3BODA 1EYBA 3KV9A 4Q5OA 4OUEA 5K0UA 3W5NA 5JSRA 2DFBA 3RZMA 3POIA 4D94A 1UAIA 1VBB3 1NLSA 4XBNA 2J1VA 1QHDA 4R52A 3CDZB 4FAGA 4HN0A 1XNAA 1YJKA 3MBWA 4S2GA 5I0RA 5F6LB 5BYNA 2BVBA 2ZGUA 4XC9A 5FZ8A 5FXWA 3ZFGB 4AG4A 1QKQA 4IEUA 3PNAA 4OCTA 2W1WA 4QKNA 4NWWA 1BEV1 2CAVA 2W47A 2KXLA 2WNVA 3GYDA 4Z07A 3WXPA 2DU0A 2W94A 2HEWF 3CZJA 3AYCA 4YZ3A 4YW5A 4LKFA 4ZXKA 3KGLA 1KRIA 3VDDC 2CGPA 4X6QB 1ULOA 1W8UA 4P9JA 5LA9A 5HCAA 4EQVA 4P14A 3VHOA 1IS6A 1RUJ3 5C9AC 4C90A 2G1MA 4AFBA 1AL21 1REDA 2ZBJA 2OQ6A 4RFRB 4COUA 3NJYA 4CA9A 4N90A 4QB6A 4NIDA 2DFCA 2PA7A 2AEYA 2VXRA 5EJZB 5FJKA 4CP9B 1ZREA 1OBNA 3VD3A 4KL1A 2AC1A 2XJVA 5F9TA 2W1SA 5JSOA 2J1TA 3KVBA 5FBJA 2HBUA 3WW3A 2ATFA 3BTZA 1HRI1 4PIZA 1O4YA 4TWTA 1HRV1 1S0IA 5FDBA 1RMU3 1OUSA 3M3OA 3L9JT 2HWB3 4AAPA 1X36A 1JW6A 4Q4V2 2E63A
chains in the Genus database with same CATH topology
3N9PA 5IVJA 5FZOB 5FZGA 4GJYA 5FYVA 3OPWA 4GAZA 3PDQA 4LITA 5F32A 5FY7A 5A80A 3DXUA 4QWNA 5F3IA 5FZIA 4NUBA 4UF0B 5IW0A 3PU8A 5FZMA 3KV5A 4QXHA 2Q8EA 4CCLA 4CCJA 5CEHA 5ANQA 5FYIA 5FY9A 5FZ0A 3AL6A 4IGPA 3N9QA 2P5BA 3DXTA 5F2SA 5FP4A 5FYYA 5IVYA 5A7PA 4AI9A 5FZAA 5A7WB 5A3WA 5KR7A 3OPTA 5A3TA 5IVEA 4BXFA 3PUSA 3U4SA 5FP3A 5FZ6A 5LY1A 5FPLA 3PUAA 2YPDA 3K3NA 5FYHA 5FZHA 5A3NA 4UF0A 4HOOA 4ASKA 4DO0A 5IVVA 5FYBA 2W2IA 5FZLA 5FPBA 4D6QA 5FPVA 3LDBA 4IGOA 5A1LA 3AVSA 5A7QA 5FZ1A 4V2VA 5F2WA 2VD7A 4GJZA 5FZ9A 3KV4A 3LD8A 4QX7A 3ZLIA 5FZ7A 4QU1A 2YBKA 5FZKA 5FZCA 5FP9A 3UYJA 4LIUA 3U78A 5LWBA 4Y33A 5IVBA 5A1FA 5FP7A 5IVFA 2YU1A 5FYUA 4CCOA 5FZ4A 5A7SA 4CUGA 5FY1A 4LIVA 5FWEA 4C8DA 4D6RA 4D6SA 5F3GA 4EZHA 3KVAA 3N9LA 3KV9A 2YBSA 4CSWA 5A7WA 5F5IA 4BU2A 2GP3A 5A7NA 5FXZA 3K2OA 5F39A 5FUPA 3N9NA 2XMLA 3N9MA 5K4LA 5IVCA 2OS2A 5FUNA 5FZBA 4LXLA 4XDPA 3PUQA 5FYZA 4EYUA 5FPAA 5FY0A 5FZ8A 5FXWA 2XDVA 4Y4RA 5FYSA 4E4HA 4QXCA 2WWJA 4CCKA 5LW9A 5ISLA 4XDOA 5FZOA 4QX8A 3PURA 5FPUA 2OQ7A 5FJHA 4GD4A 3AVRA 5FY5A 4TN7A 4QXBA 3AL5A 3PTRB 2Q8DA 3RVHA 5F5AA 2OQ6A 5FZFA 3NJYA 4HONA 3ZPOA 4URAA 2XUEA 5F37A 3N9OA 4IGQA 4CCMA 5FJKA 5F3CA 4CCNA 5A3PA 2YBPA 5A7OA 2YU2A 5F5CA 4BISA 3K3OA 4EZ4A 3KVBA 4Y3OA 2WWUA 5FBJA 5FXVA 5FP8A 3KV6A 5FZEA 1VRBA 5FYMA 5IWFA 5FXXA 2GP5A 5FZDA 2PXJA 5F3EA 2OX0A 5FV3A 5FZ3A 4DIQA 5E6HA 2XXZA 5FY8A 2OT7A 5FYCA 5FYTA 2Q8CA 5FWJA 5LY2A 5FY4A 4V2WA 4AAPA 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9P A;  5IVJ A;  5FZO B;  5FZG A;  4GJY A;  5FYV A;  3OPW A;  4GAZ A;  3PDQ A;  4LIT A;  5F32 A;  5FY7 A;  5A80 A;  3DXU A;  4QWN A;  5F3I A;  5FZI A;  4NUB A;  4UF0 B;  5IW0 A;  3PU8 A;  5FZM A;  3KV5 A;  4QXH A;  2Q8E A;  4CCL A;  4CCJ A;  5CEH A;  5ANQ A;  5FYI A;  5FY9 A;  5FZ0 A;  3AL6 A;  4IGP A;  3N9Q A;  2P5B A;  3DXT A;  5F2S A;  5FP4 A;  5FYY A;  5IVY A;  5A7P A;  4AI9 A;  5FZA A;  5A7W B;  5A3W A;  5KR7 A;  3OPT A;  5A3T A;  5IVE A;  4BXF A;  3PUS A;  3U4S A;  5FP3 A;  5FZ6 A;  5LY1 A;  5FPL A;  3PUA A;  2YPD A;  3K3N A;  5FYH A;  5FZH A;  5A3N A;  4UF0 A;  4HOO A;  4ASK A;  4DO0 A;  5IVV A;  5FYB A;  2W2I A;  5FZL A;  5FPB A;  4D6Q A;  5FPV A;  3LDB A;  4IGO A;  5A1L A;  3AVS A;  5A7Q A;  5FZ1 A;  4V2V A;  5F2W A;  2VD7 A;  4GJZ A;  5FZ9 A;  3KV4 A;  3LD8 A;  4QX7 A;  3ZLI A;  5FZ7 A;  4QU1 A;  2YBK A;  5FZK A;  5FZC A;  5FP9 A;  3UYJ A;  4LIU A;  3U78 A;  5LWB A;  4Y33 A;  5IVB A;  5A1F A;  5FP7 A;  5IVF A;  2YU1 A;  5FYU A;  4CCO A;  5FZ4 A;  5A7S A;  4CUG A;  5FY1 A;  4LIV A;  5FWE A;  4C8D A;  4D6R A;  4D6S A;  5F3G A;  4EZH A;  3KVA A;  3N9L A;  3KV9 A;  2YBS A;  4CSW A;  5A7W A;  5F5I A;  4BU2 A;  2GP3 A;  5A7N A;  5FXZ A;  3K2O A;  5F39 A;  5FUP A;  3N9N A;  2XML A;  3N9M A;  5K4L A;  5IVC A;  2OS2 A;  5FUN A;  5FZB A;  4LXL A;  4XDP A;  3PUQ A;  5FYZ A;  4EYU A;  5FPA A;  5FY0 A;  5FZ8 A;  5FXW A;  2XDV A;  4Y4R A;  5FYS A;  4E4H A;  4QXC A;  2WWJ A;  4CCK A;  5LW9 A;  5ISL A;  4XDO A;  5FZO A;  4QX8 A;  3PUR A;  5FPU A;  2OQ7 A;  5FJH A;  4GD4 A;  3AVR A;  5FY5 A;  4TN7 A;  4QXB A;  3AL5 A;  3PTR B;  2Q8D A;  3RVH A;  5F5A A;  2OQ6 A;  5FZF A;  3NJY A;  4HON A;  3ZPO A;  4URA A;  2XUE A;  5F37 A;  3N9O A;  4IGQ A;  4CCM A;  5FJK A;  5F3C A;  4CCN A;  5A3P A;  2YBP A;  5A7O A;  2YU2 A;  5F5C A;  4BIS A;  3K3O A;  4EZ4 A;  3KVB A;  4Y3O A;  2WWU A;  5FBJ A;  5FXV A;  5FP8 A;  3KV6 A;  5FZE A;  1VRB A;  5FYM A;  5IWF A;  5FXX A;  2GP5 A;  5FZD A;  2PXJ A;  5F3E A;  2OX0 A;  5FV3 A;  5FZ3 A;  4DIQ A;  5E6H A;  2XXZ A;  5FY8 A;  2OT7 A;  5FYC A;  5FYT A;  2Q8C A;  5FWJ A;  5LY2 A;  5FY4 A;  4V2W A;  4AAP A;  3PU3 A; 
#chains in the Genus database with same CATH topology
 1AR9 1;  1N1V A;  4XZU G;  2LUW A;  3URF A;  2D98 A;  4XUN A;  5IFT A;  3I2H A;  2DVG A;  4K20 A;  1JZ7 A;  4IE0 A;  5FZM A;  2XJP A;  1QNW A;  1W2N A;  3ZFE C;  2UY9 A;  5EP9 A;  3ACF A;  3G6J B;  2J1S A;  2XOM A;  1PK6 B;  4N43 B;  3B9C A;  5F2S A;  5BNO B;  1PZ7 A;  1E5R A;  4O61 A;  3BTX A;  5KC5 A;  4OUM A;  1SCS A;  1AYN 3;  4FVV A;  1OLM E;  5IVE A;  3LDK A;  4CDU C;  5CVR A;  2AH2 A;  3VD4 A;  3FMG A;  1YFW A;  1XYN A;  3OUJ A;  2PYT A;  5GAL A;  1C1F A;  3ZDV A;  3R6S A;  4COW A;  3DPR A;  1VLN A;  2VBD A;  1REF A;  3NV4 A;  4QDR A;  3SCF A;  1W0P A;  2QBX A;  1B35 B;  3JQX A;  2YC2 A;  3JQW A;  2B46 X;  2XG3 A;  1SLI A;  2R49 A;  4HL0 A;  2J22 A;  2Q0A A;  4LHN A;  4QB2 A;  4V2V A;  5FZ1 A;  1XJA A;  5GKA C;  5JOX A;  2VC9 A;  3C7E A;  4TLG A;  2YBK A;  5AVA A;  1DQ0 A;  3J7N A;  3WIN E;  5LWB A;  4GB3 1;  3EHK A;  1QQP 3;  3CJX A;  1OF4 A;  4QQP A;  2WO2 A;  4AVC A;  5ACA 2;  4I0B A;  3WT3 A;  1XQN A;  4A7Z A;  3FN9 A;  3WG1 A;  3EQE A;  4KBB A;  1ULE A;  4A44 A;  4FTB A;  1JZ2 A;  2HWD 2;  4QAW A;  2QQL A;  5FOB B;  5D21 A;  4JTN A;  1KDM A;  2DBN A;  5GM0 A;  2E7A A;  1VBE 1;  2ID4 A;  1COV 3;  2VOK A;  1IGO A;  3HN3 A;  3IZO A;  3SLI A;  4MSV A;  3WUD A;  3AK0 A;  1N3P A;  3LFM A;  3FC0 A;  2O8Q A;  1V9U 2;  1PGW 1;  2Y6F A;  5I93 A;  4KG8 A;  2FMD A;  1GKB A;  1KS5 A;  1UL9 A;  4YG3 A;  4E4H A;  4UXA A;  2WFP A;  3LEG A;  4OVE A;  2R06 1;  3PTY A;  1WUV A;  5FCC A;  1PVC 3;  3P5B A;  2D43 A;  3C3V A;  5A70 A;  1GBG A;  3LFI A;  4PI2 A;  3VKM A;  4XJ8 A;  2G9G A;  1DBN A;  5A6Z A;  2RM2 2;  3ZSL A;  3KT1 A;  1JZ3 A;  4V1P A;  2NZ9 A;  4TN7 A;  3OEA A;  2Y6H A;  3ACI A;  1H9W A;  3AL5 A;  1RUI 3;  4LOS A;  1WME A;  2A71 A;  3HEI A;  1F15 A;  2QTW B;  5G04 L;  4UFI A;  1ND2 A;  2NM1 A;  2JG9 A;  5LRS A;  1S2B A;  3KGZ A;  4XF0 A;  1H2N A;  2E26 A;  3C7H A;  1VBC 2;  4N53 C;  4OFG A;  4P02 B;  4YRD A;  4CCN A;  4QQH A;  2P3J A;  2VZ1 A;  4FPH A;  1RB8 G;  4AHY A;  1O7F A;  1JYN A;  1JUI A;  2C1F A;  2X09 A;  4FOV A;  4Y5Z 0;  1PMH X;  3C8X A;  4P9W A;  3OD4 A;  4D7S A;  5I91 A;  5J7M A;  2ARB A;  2BV4 A;  2HWC 2;  1XC6 A;  2G19 A;  2OX0 A;  1SBF A;  5CZK A;  2FMY A;  2WSV A;  1POV 3;  2JWP A;  2R0F A;  1LED A;  1LB2 A;  3ILN A;  1Y9G A;  2TEP A;  1NOV A;  4J25 A;  1CGP A;  1OKO A;  1C5I A;  2K0G A;  4MX3 A;  1BVV A;  1H2L A;  5K7P A;  1VB2 A;  2WFF 2;  2Z5W A;  4LBK A;  1UY4 A;  2WN2 A;  3FWE A;  5CEH A;  2FCV A;  1QOS A;  1DFQ A;  3Q8F A;  3WW2 A;  3OY8 B;  4M3C E;  1OH4 A;  1OOP A;  2XJQ A;  4U2A A;  5FZ0 A;  3RMX A;  3VBF B;  1YO8 A;  3MEP A;  1J1T A;  4OI4 A;  3I97 A;  4ORF A;  1LOB A;  4QGM A;  4QT6 A;  1XYP A;  3CBN A;  4B8E A;  5J37 A;  2C4X A;  1RJ8 A;  4RS5 C;  1LU2 A;  3WUC A;  4MYE A;  1ULD A;  4Y4Y A;  1IS4 A;  2J1E A;  2OPK A;  4Q4W 2;  1ZRF A;  5FYH A;  4KGQ A;  3WF2 A;  1ZZ7 A;  1QXP A;  3FL7 A;  2QVS B;  1URX A;  3ASI A;  4W6W A;  3T1L A;  4DMI A;  1GMM A;  4NRM A;  1OA3 A;  1W8N A;  4IEW A;  5FZ9 A;  1MQT A;  2BQP A;  3PVB B;  1VIW B;  3W9A A;  2V72 A;  3KHC A;  4FPY A;  3D6E A;  1HQW A;  4G3Y C;  4LIU A;  3LF7 A;  3DGT A;  3AZX A;  2L9L A;  4D0Q A;  5IAV A;  1A8M A;  4Q4X 3;  4AED B;  4CUA A;  3SC7 X;  2YU1 A;  5FYU A;  1QJU 3;  1DGR A;  2V5Y A;  3H0O A;  3ZN4 A;  1LGN A;  1LEN A;  2XHK A;  2WQ4 A;  3O12 A;  4JKL A;  4OMD A;  4CP1 A;  1PO2 2;  1K5M C;  2QQO A;  2FZ1 A;  4N53 B;  3I2K A;  4N7I A;  4C0H A;  2W87 A;  4KWJ A;  1W39 A;  2WO3 A;  3AP5 A;  3N7M A;  5CKM A;  4IV3 B;  4BDV B;  5IUQ A;  1S0F A;  5FUP A;  5JOY A;  4HVR A;  5A3M A;  1OOP B;  4DUX A;  1UKG A;  1LGB A;  1UPI A;  1GP4 A;  4AFD A;  1CAV B;  3GHM A;  4JQT A;  3TEW A;  2RS3 1;  3LSE A;  4FPG A;  1OFN A;  4AZZ A;  2WDB A;  3E5X A;  2ZX0 A;  4W8J A;  3KF5 A;  4MAD A;  4QHB A;  4IV3 A;  4BME A;  5APA A;  3J4U H;  4YZ2 A;  5FPU A;  2BWA A;  3MIG A;  1JHJ A;  4GD4 A;  1O3R A;  3VV1 A;  1CX1 A;  3VDD A;  1PGW 2;  3AXE A;  4JGY A;  5CG9 A;  3DEM A;  1YQC A;  1J3Q A;  2Y26 A;  4YG6 A;  2RJ2 A;  3I8T A;  4MHU A;  5L9B A;  1J83 A;  1VBE 2;  1RXF A;  3ZPO A;  2XPJ A;  3CHX A;  1JBC A;  4CUC A;  2E7T A;  2XON A;  4YVS C;  2B45 X;  4RS5 B;  4AGV A;  3RYP A;  1QJY 1;  2VOT A;  5C3R A;  1DLL A;  3WNK A;  1LOA A;  1FI2 A;  4CEW C;  1CN1 A;  4XET A;  2W5F A;  4OLL A;  3U0Z A;  3WHT A;  3B02 A;  1OD3 A;  2IXL A;  2JD9 A;  2RMU 1;  3HT1 A;  2VZV A;  5FLH A;  2JDU A;  4MGT A;  4R4X A;  3N3H A;  4CU9 A;  4XXP A;  1WW7 A;  5F3E A;  4QHO A;  2OXB A;  1GOH A;  5DPN A;  4LLO A;  2R06 2;  3POE A;  5HXM A;  5FY8 A;  1F35 A;  2JDH A;  2W1Q A;  2DF7 A;  4AFM A;  1VBC 1;  1MQT B;  3KD4 A;  2B5H A;  5E16 A;  4UW6 A;  1D2S A;  1N1S A;  3P3N A;  1FPN 1;  2CL2 A;  4R4Z A;  3VBO C;  3WDY A;  2Y6G A;  5JMO A;  4OYU A;  2EVX A;  1NA1 A;  3CF6 E;  1VBD 1;  3GBW A;  3S5A A;  2ETE A;  4JC1 A;  1G7Y A;  3R4S A;  1ONA A;  1LJ7 A;  3D4K A;  1JH5 A;  4LKD A;  1W3X A;  3I3Q A;  3SCH A;  1W6O A;  5KC6 A;  2I2S A;  1OUX A;  5KR7 A;  2WIN B;  1ZVF A;  4ZS3 A;  5H9P A;  2VMH A;  1TZO A;  3USU B;  3PUA A;  4H7M A;  3WHU A;  1Q5O A;  4OMC A;  4RHV 3;  1JS9 A;  1J84 A;  2C26 A;  4RQP C;  3T2O A;  2R04 1;  5FZL A;  2FDG A;  3RRD A;  3ZO0 B;  5LA1 A;  2ZX4 A;  5FPV A;  1QOT A;  4F83 A;  3EBR A;  4XFA A;  4LO8 A;  2FDH A;  1FV3 A;  5EXO A;  3VBU B;  2MEV 1;  2XKP A;  4QDQ A;  5IK8 A;  2Z79 A;  1LUL A;  3EXU A;  3NJX A;  4HZF A;  1YIP A;  1SLB A;  4P9X A;  5CKQ A;  3U78 A;  3NKG A;  4UAP A;  3ZFG A;  4LBL A;  4E8C A;  3I54 A;  5HCH A;  1RIR A;  3E6B A;  4CCO A;  1W0O A;  2VME A;  3UGH A;  4D6S A;  1DQ2 A;  1RVF 3;  5F3G A;  2WAO A;  3AZW A;  5HCF A;  3KVA A;  1E5H A;  1AYM 3;  1POV 0;  1SDD B;  2ZXQ A;  3GJB A;  3HR9 A;  4RL7 A;  3RI8 A;  4LBM A;  5DDJ 2;  2UUR A;  3TN9 2;  3W59 A;  3N9N A;  1UW8 A;  3I3D A;  1UMZ A;  3WX5 A;  3AMQ A;  3RQ0 A;  4QPI B;  1U5I A;  4DUV A;  2ARE A;  4CEY B;  3WNL A;  1W06 A;  1RHI 1;  3HNB M;  3S6P A;  1PGL 1;  1NYW A;  4Q4Y 2;  3ZYI B;  4WM7 A;  1AR6 3;  1V9U 1;  4XTM A;  4XDO A;  1V6N A;  5LAT A;  3ALQ A;  5KXE A;  3WNX A;  5ABJ B;  2UY8 A;  2W3J A;  3RWN A;  4AYU A;  3AZV A;  3LDR A;  4QM9 A;  5SV8 A;  4OHX A;  1QJF A;  4I0A A;  1LES A;  4YVW B;  4RGG A;  4MVT A;  1PGS A;  1VPH A;  4IET A;  1CZV A;  2JDP A;  1F5J A;  1TMF 1;  3APB A;  3ECQ A;  4HET A;  5EWS A;  3KM5 A;  5LK7 B;  2G9Z A;  3DYM A;  3B7M A;  4AVS A;  2D93 A;  5DAX A;  1UZ0 A;  1JZ6 A;  5BXX A;  2KM2 A;  3H8X A;  5KHI A;  2WS9 3;  3ZSM A;  2XLF A;  3CIH A;  2MPF A;  4XYX A;  5JXJ A;  2Y34 A;  3K3O A;  3CU7 A;  2JG8 A;  4XHX A;  3UKT A;  3ZFE B;  4YGD A;  2XQR A;  1RMU 2;  2PN5 A;  3K51 A;  1RUC 2;  1O5L A;  2JJ6 A;  1HN0 A;  2ZGK A;  5FZ3 A;  1PX4 A;  1HW5 A;  3ATG A;  4Q26 A;  5H9S A;  4P5Y A;  2WS9 1;  5KXC A;  1CX4 A;  2NMN A;  4XTP A;  2R6Q A;  2HBT A;  2DTY A;  2PHF A;  4L97 A;  4P9I A;  1F8V A;  2CGO A;  4I09 A;  4L2N A;  4YVS A;  2GNM A;  5T5O A;  1HRI 3;  5I0U A;  3BCW A;  4QGL A;  3GNE A;  3PDQ A;  5F32 A;  4YFW A;  4A6O A;  4ZZ8 A;  1O8P A;  3DXU A;  3NST A;  1SQ4 A;  4UF0 B;  4HPK A;  1ZA7 A;  2DVA A;  3AMP A;  4LHS A;  4Q0Q A;  1W8T A;  2XBO 2;  5FY9 A;  1RUF 2;  1VE0 A;  3AL6 A;  3LEK A;  3OBA A;  4DY3 A;  4DRV A;  3GM8 A;  1CQ9 A;  3WDT A;  5ERL A;  4PDW C;  2BER A;  1PM4 A;  2WNU A;  3OCP A;  5A3W A;  2XJU A;  5A7W B;  2JDN A;  4AQT A;  1ULP A;  3OPT A;  1H4H A;  3PIJ A;  4RGK A;  5C3Q A;  1SMV A;  1LEC A;  4OZO A;  4QX2 A;  1VBD 3;  1DZQ A;  3ST7 A;  4UFK A;  5A3N A;  4DXS A;  1Y9M A;  3E5U A;  3ELN A;  3UJQ A;  4BIF A;  4BK5 A;  4JKM A;  4R9B A;  2NMO A;  5FYB A;  3BIW E;  2WNV C;  1W8O A;  4OQ9 A;  3LDB A;  5CIR A;  1ZRD A;  1ZYB A;  4Q4W 1;  3AB0 A;  5JIU A;  2GND A;  3W21 A;  5K8S A;  3LD8 A;  4QX7 A;  2J1R A;  4PLO A;  5FRE A;  1W0N A;  2VCA A;  1W8Z A;  4Y20 A;  2OA2 A;  4JGZ A;  2FZ2 A;  3IWZ A;  1D4M 1;  5C4W A;  3WW1 A;  4BQ2 A;  3LKJ A;  4DXR A;  2B9U A;  2PLV 2;  3WG2 A;  3NV3 A;  1CVN A;  3ZFF C;  1UOB A;  1CJP A;  5KHJ A;  4F7Z A;  4MXW B;  4AHZ A;  1QF3 A;  2C9K A;  4BZ4 A;  5JZG C;  2NN8 A;  4CUG A;  2D6K A;  4J1W A;  2F6B A;  3J7L A;  3JBG 3;  1QDC A;  4RA0 A;  3N9L A;  1M4W A;  4QU2 A;  3TOJ A;  2GP3 A;  3ENR A;  2ERF A;  3H1Y A;  1TE1 B;  3QAC A;  4LHK A;  4NOT A;  1SPP B;  4AEM A;  4CDX A;  3HD8 B;  4Q4X 1;  1W28 A;  4BB3 A;  1ND3 C;  1JYX A;  1T2X A;  1R1Z A;  2OS2 A;  4XJW A;  2P17 A;  3GZE A;  1R1A 3;  3CL1 A;  3PUQ A;  2VW0 A;  1OVP A;  2IXK A;  1UYZ A;  4MZU A;  4XXA A;  5FPA A;  5GLU A;  4EN0 A;  4ZHN A;  4YZ1 A;  2VMG A;  1MZ6 A;  4DUW A;  2XL7 A;  4JGZ B;  1RUH 1;  3VHP A;  2OUJ A;  4EJR A;  1L3J A;  4FTE A;  4XIK A;  3H1M A;  2RDS A;  1LHW A;  2GH8 A;  2HYX A;  2OZ6 A;  2VW2 A;  3IBM A;  3POS A;  3AP9 A;  2HEY F;  4AR2 A;  1X50 A;  2B42 B;  2D6N A;  2EXK A;  2BP6 A;  3G7D A;  1OLR A;  4MOA A;  5CAD A;  2G9F A;  3USS A;  2SBA A;  5C3S A;  2XR4 A;  1W8W A;  2VNO A;  3ZYP A;  4R9A A;  1NE4 A;  1BEV 3;  3H42 B;  4Y26 A;  2W39 A;  5D8A C;  4Y5S A;  5A32 A;  3WVJ A;  5A3O A;  2Y38 A;  4BK4 A;  3OD0 A;  3TN9 1;  4CU8 A;  3JUU A;  4PDW A;  1XPW A;  4AVT A;  3D5O A;  3PJQ A;  4SLI A;  3ROU A;  4CDU B;  3AMN A;  2HJI A;  4JRA A;  1D4V B;  2HWC 3;  4XUR A;  5GLZ A;  1JZ8 A;  1TMF 3;  2DCJ A;  1M06 G;  4ASL A;  3MIH A;  3IDB B;  2F4P A;  4QX5 A;  4YNI A;  2PHR A;  3FUQ A;  2HH9 A;  3LE0 A;  2IFR A;  3ZFG C;  4W50 A;  1UNB A;  2QFE A;  2HYK A;  3HVD A;  2ZKL A;  3H8U A;  1B35 C;  1U0A A;  3LA2 A;  3MGU A;  2XXZ A;  3MHZ A;  4AEJ A;  2LRO A;  2IZW A;  4PBP A;  2EXI A;  3OTF A;  1ENQ A;  4GXL A;  2CGN A;  4V2W A;  1JYV A;  3VD7 A;  3WDV A;  1TNR A;  2GH2 A;  5EYX A;  2RM2 1;  1V70 A;  2XJR A;  3ABZ A;  3BGA A;  5KHG A;  4BYY A;  1ND2 C;  4NIG A;  4KU8 A;  4Q2F A;  4YM1 A;  3NW4 A;  1US2 A;  3H8R A;  2PHL A;  3KB5 A;  1UOF A;  2A70 A;  4FOW A;  4H7L A;  4M3C B;  1RUG 3;  5JDB A;  2ZX2 A;  4WVZ A;  3FHI B;  2W91 A;  2JG8 C;  1AR7 2;  5C9A A;  4O9G A;  2BGP A;  1R64 A;  1O8S A;  3IPV B;  2VMI A;  4I0W B;  3GXU A;  3I4I A;  4MG2 A;  5A3T A;  1X9P A;  2FQP A;  5FK7 A;  5I8S A;  4XE9 A;  2ZEZ A;  1H2K A;  3ITQ A;  3OGJ A;  1UQX A;  5DG1 A;  4Y5T A;  3N36 A;  3Q8A A;  4XFI A;  4FFF A;  3M3I A;  4MXW A;  4WZC A;  5TSW A;  4GH4 C;  2PQS A;  4AAX A;  2LS6 A;  2VVD A;  2PLV 1;  1J3P A;  4AXO A;  1J59 A;  3QBQ A;  1MEC 2;  3AC0 A;  5LBF A;  3KT7 A;  5A7Q A;  4DEV A;  5C4W B;  3BN6 A;  4IQP A;  2JDA A;  4UW3 A;  1XE7 A;  1ASJ 1;  1C5H A;  1HN1 A;  2ENR A;  4FPE A;  2DUR A;  3KCX A;  2QQI A;  3UYJ A;  2ET1 A;  2ZAB A;  4ISQ A;  3VD5 A;  5K0U C;  1SLC A;  1HXS 3;  3BAL A;  2HWC 1;  1WCK A;  4Q4X 2;  3VL9 A;  4EN9 B;  5L9V A;  4AGG A;  1X82 A;  1RIT A;  2YRO A;  2EID A;  4Z82 A;  3DL3 A;  3GF6 A;  3U1X A;  2VZP A;  4JV4 A;  1WZX A;  2ORX A;  1AXY A;  1LU1 A;  4JVA A;  4CEY A;  2VUC A;  4CPB A;  5CNA A;  5KXB A;  2CU5 A;  4Z2A A;  2FBE A;  4FQ4 A;  2ZHM A;  4X8N A;  3SH4 A;  1DZT A;  2QJV A;  4E4S A;  2WNO A;  2R04 3;  3BUC A;  4H2A A;  2XJS A;  3UKN A;  4EN8 B;  1WW5 A;  2E31 A;  2XML A;  1W99 A;  1FPN 2;  1DQ5 A;  2VZU A;  4N7U A;  4TXW A;  4FPO B;  4MUV A;  3WNN A;  3N4M A;  4YM2 A;  4JGY C;  1GWM A;  4EYU A;  1S2E A;  1LHN A;  3RZG A;  2ZX1 A;  4JKK A;  4BHP A;  4W4Z A;  1RUJ 1;  3CJI C;  1U5X A;  2FD8 A;  4GA9 A;  3O1U A;  3V0B A;  3WG3 A;  1REE A;  2P3I A;  1LGC A;  2DWR A;  3PHM A;  1ZNP A;  4URT A;  4NE9 A;  5FJH A;  4BM8 A;  3BTY A;  2FCU A;  2VEC A;  3O1V A;  5GLT A;  3BB6 A;  1GZT A;  2PAM A;  1Y3T A;  1WA4 A;  5IK5 A;  1VBE 3;  2YY1 A;  1ZM1 A;  3NNG A;  3RVH A;  4ET7 A;  4LO5 B;  4GAL A;  3AM2 A;  3SEP A;  4YFZ A;  2OKX A;  1RUH 2;  1N1Y A;  4IGQ A;  4P9G A;  4QXK A;  2BEO A;  5BPX A;  4YPJ A;  4DFS A;  1T6B X;  4FPF A;  4HK8 A;  4XZP A;  5H9Q A;  2MEV 3;  2P6C A;  1W3V A;  1KQR A;  3RJ2 X;  5CFD B;  4QQ2 A;  1QXJ A;  4QPG A;  3GGL A;  1IPJ A;  4GWM A;  3J8F 3;  5G05 L;  2JX9 A;  5JWP A;  5FZE A;  1S0D A;  3GHN A;  5JR7 B;  1HKD A;  2GN7 A;  2VCB A;  2PXJ A;  3BVC A;  1NA1 C;  5FV3 A;  1ND3 A;  5I0D A;  2HWF 3;  4GQ7 A;  3ZXK A;  1US3 A;  3BPZ A;  5A6Q A;  3J8F 1;  4QX0 A;  1JOJ A;  4IDZ A;  4DNY A;  4LBQ D;  1BQP A;  4SBV A;  3T0B A;  4XFG A;  4JHZ A;  3IAQ A;  4L9B A;  1HRV 3;  1GLH A;  3K4Z A;  1OC1 A;  2Q1M A;  2WA4 A;  1WCQ A;  2YUE A;  4QGN A;  2WLP A;  4QWN A;  3JCI A;  4XMA A;  1OD5 A;  4AHX A;  5IK7 A;  1T6G C;  3VBR C;  5T50 A;  2XVK A;  1MS8 A;  1OF3 A;  1LAJ A;  2R32 A;  5IAT A;  1R1A 1;  1G8W A;  2DBI A;  1G9C A;  3N9Q A;  3DXT A;  1H2M A;  2X53 S;  3C7O A;  2RS3 3;  3ZXG A;  3KZ4 C;  4XFC A;  1H8T C;  4MGY E;  4NHX A;  4BQW A;  3LEI A;  3WQ7 A;  1UCX A;  3NL1 A;  4NIA A;  5DAB A;  5LBC A;  2KD7 A;  3NNJ A;  4UFL A;  4GH4 A;  1YI7 A;  1LR5 A;  1GP5 A;  2X8K A;  3BOP A;  4RGA A;  2HWF 1;  5DXD A;  4CDW C;  1JU3 A;  1RUE 3;  4DO0 A;  4FPL A;  2BWC A;  1H8T A;  2G4I A;  2MNG A;  3U4X A;  1HV1 A;  1AR7 1;  3EMR A;  2VM9 A;  3OBT A;  4NHL A;  3RGB A;  5F2W A;  2CDO A;  2P4E A;  2CV6 A;  2PHD A;  4XW3 A;  1JN2 P;  1A3K A;  1V00 A;  4UW4 A;  1JZ4 A;  5FPZ A;  1ODM A;  1KD7 A;  5C3O A;  4AI8 A;  2A6Y A;  2E33 A;  2F17 A;  3N35 A;  1CAW B;  3WF1 A;  1WBL A;  1AXK A;  2CAU A;  1W2U A;  1D0G A;  1C3H A;  4E27 A;  1UO9 A;  5IVF A;  4TSV A;  1RMU 1;  3VN4 A;  1FT9 A;  3TNQ A;  1FAT A;  4YYO A;  1XSR A;  5FKC A;  3WP5 A;  1VMF A;  4OHW A;  2W9X A;  3BTA A;  3R0R A;  4KH9 A;  1HXS 1;  5FRA A;  4FP2 A;  4JRL A;  4CU6 A;  3A0K A;  2R1D A;  1KJL A;  1EUU A;  4QM8 A;  3WF0 A;  2C24 A;  3AKQ A;  3GJA A;  4IUG A;  4FPC A;  1LKN A;  3PVE A;  3KT4 A;  2EAK A;  5LAS A;  1ZBE 3;  2TBV A;  3ZN6 B;  1VR3 A;  3IDE A;  2VH9 A;  2RR1 2;  4XEZ A;  4LT5 A;  1NA1 B;  1UMI A;  1YEW A;  2R0H A;  2XBO 1;  2BRT A;  5J48 A;  4O9E A;  1PK6 A;  2YMZ A;  4N43 A;  1JYC A;  3CKH A;  3FJS A;  1TME 3;  4RR3 A;  5DAP A;  4AF9 A;  5DG2 A;  1EAH 3;  2RR1 1;  2VXJ A;  1HJG A;  5BY5 A;  4YZ5 A;  2WN3 A;  1OA4 A;  1YWK A;  3VKF C;  3VKL A;  5FY5 A;  3H7J A;  4TTG A;  2JKX A;  1ND3 B;  1ENX A;  5DUX A;  5BUV A;  3MPP G;  5JPN B;  3OYW B;  3MI8 A;  4UWD A;  3AJY A;  4AI0 A;  3B01 A;  1AL0 G;  1FXZ A;  1NUK A;  4OI2 A;  1W8F A;  3S0M A;  5F3C A;  4C1X A;  3CLP A;  1W9W A;  2CY6 A;  4ISR A;  5A3P A;  2RS1 3;  3HQU A;  3ZXJ A;  4Y3O A;  2ZEX A;  4L92 A;  4EN6 B;  4P08 A;  4YLZ A;  5CBL A;  2WBK A;  4XPV A;  5L9R A;  3O0V A;  2GC3 A;  1ULF A;  5FXX A;  1NXD 1;  1SLL A;  3OPZ A;  4YM0 A;  1RXG A;  1UX7 A;  1Z78 A;  3AP6 A;  3D0S A;  5FYT A;  4C91 A;  1UXZ A;  4LTA A;  1ZBA 3;  4MO3 M;  3IPV A;  3BOW A;  2DCK A;  4JZR A;  5J98 B;  2DVB A;  3KSC A;  2Y8K A;  5FYV A;  3THT A;  4CYD A;  1N3O A;  1VAM A;  2WQZ C;  3VBU C;  3AZY A;  4K40 A;  5A80 A;  3ZFF A;  3JD7 2;  3MLJ A;  3I3M A;  1EV1 3;  3W58 A;  3H8O A;  2OII A;  5GLV A;  1DGR N;  1BZW A;  1DGL A;  3DPR C;  3AXD A;  2R07 3;  3ES1 A;  5A7P A;  1PMI A;  1OA2 A;  3O1R A;  2VY0 A;  2VJX A;  2OYZ A;  3RJR A;  2ZGQ A;  5B2G B;  1BLZ A;  1MS4 A;  2ZGP A;  3NO8 A;  1TQ5 A;  1DYK A;  2YV8 A;  4BXF A;  3ZN5 A;  4UOJ A;  5FP3 A;  3I59 A;  5HV4 A;  5FPL A;  2DCT A;  2DV9 A;  3H3L A;  4P9Y A;  2JEM A;  1UYP A;  3ZDS A;  5C5U A;  3MF6 A;  1QDO A;  4FXG B;  4LUK A;  3OGV A;  2PHU A;  2HLE A;  2W2I A;  4GWI A;  2ZGR A;  3S57 A;  2Q30 A;  5FPB A;  4NVP A;  4AVV A;  1R08 1;  3K4D A;  2ZOE B;  4CCC A;  1G9F A;  2ZML A;  2A75 A;  2D40 A;  4FTS A;  1S2K A;  1AUY A;  1IKQ A;  1BBT 2;  3DYP A;  4WM8 C;  2BYV E;  4FSJ A;  3FLR A;  3PVN A;  2CYF A;  5T54 A;  3SIS A;  3ZYB A;  2EXJ A;  4QU1 A;  1UU6 A;  2NYY A;  2PLV 3;  5FZC A;  1LOC A;  2NPI A;  4AEK A;  3MO4 A;  4PI0 A;  4QHZ A;  4YGB A;  1NCR B;  2WNE A;  3T08 A;  3PVO A;  4C1W A;  1UD1 A;  1CIY A;  1NLR A;  2ZHK A;  4I01 A;  3ON7 A;  2WFF 3;  4OZX A;  4S2D A;  3EJK A;  5A7S A;  1UY0 A;  1C28 A;  3AKR A;  5DMY A;  2VZ3 A;  5J09 A;  4EZH A;  4GB3 3;  3VZN A;  1D4M 3;  3ZXA C;  2JB8 A;  1RL3 A;  2QQM A;  3Q8C A;  2VBP A;  4NPM A;  5F5I A;  1JZ5 A;  1XSQ A;  4LMF A;  5FBZ A;  2BDR A;  3ZYH A;  3V0B B;  3J9S A;  3OUH A;  2A73 B;  1OI6 A;  2O1Q A;  1U5Z A;  4RD7 A;  2RS5 2;  1JHN A;  5C9A B;  3ZMN A;  4EE2 A;  2EAL A;  4AQ2 A;  3CZU A;  5BNN B;  2OW4 A;  1NZI A;  2ZHN A;  4BQY A;  3VDB A;  4HBN A;  2WZE A;  5DZG A;  4CPB D;  4CCK A;  1LEM A;  1Y4W A;  4ITC A;  1VAL A;  1GYK A;  5LEK A;  1N47 A;  1RJ7 A;  2WZR 2;  1QJZ A;  5EHD A;  1JYW A;  3NQH A;  1JXN A;  4IND A;  4W65 A;  3HN1 A;  1ULC A;  3S30 A;  5I0S A;  1ZZ9 A;  4Q0U A;  2ZGM A;  2ORZ A;  4IL7 A;  2JG9 B;  1HB1 A;  2ZGN A;  1OQD A;  1HB4 A;  2HWE 2;  4YW3 A;  4IV3 C;  4GIQ A;  2Y60 A;  3MF9 A;  4CDQ B;  1SCR A;  3NV1 A;  1UY3 A;  3M7A A;  3TEX A;  2VTF A;  1J1L A;  1AR9 3;  3VZL A;  3VZK A;  5BNO A;  1D2Q A;  3UGF A;  1V6M A;  1O6U A;  2O8O A;  3ZIW A;  2BTV C;  2A6W A;  4JTO A;  4COY A;  3WF3 A;  2BNN A;  2O14 A;  3LZZ A;  1NQJ A;  4BLJ A;  4DIQ A;  5FO9 B;  4KMQ A;  4X8P A;  2Q8C A;  3SMH A;  5DN2 A;  4XVH A;  4I30 A;  3A4U A;  1Z7S 1;  1UZV A;  2PAK A;  5FMC A;  5GZC A;  1WWY A;  4GJY A;  4HSL A;  1W6N B;  3WW4 A;  1W9T A;  4BOW A;  1C8M 2;  2XVL A;  3DKW A;  4KI5 M;  3T30 A;  1JU4 A;  4L0P A;  1IKP A;  1DLC A;  2D97 A;  1MAC A;  1X33 A;  2BOI A;  4ZPI A;  4B7K A;  4EN7 B;  3TEZ A;  2VMD A;  1HB2 A;  3GZA A;  4IGP A;  4YAR A;  3MIB A;  4ATE A;  3MPB A;  1R08 2;  4J1X A;  3I2I A;  4XQW A;  2V5D A;  4AI9 A;  1QH6 A;  4AVB A;  4L99 A;  1BBT 1;  1A8D A;  3VL8 A;  1W04 A;  1SZB A;  1ZA4 A;  3Q8B A;  2VOW A;  3E97 A;  1QEX A;  1XRU A;  5LEJ A;  1WLD A;  3UKV A;  1NE6 A;  4XDQ A;  2DUQ A;  1PIV 3;  4LNV A;  1SFY A;  3V64 A;  1O4T A;  1IPK A;  2LAL A;  5T55 A;  2RJL A;  1SDW A;  4FOY A;  4XJA A;  4N8M A;  1QJY 2;  1DU3 D;  2I45 A;  2WII B;  4AED A;  4HVQ A;  1VMJ A;  2E6V A;  1GNY A;  4XUT A;  3RSJ A;  5GZG A;  2JXA A;  2ZGS A;  3VZJ A;  4PCR A;  1BJQ A;  1DYO A;  3KS7 A;  4Y22 B;  5L7O A;  2CDP A;  1W6P A;  5DAV A;  2P2K A;  1FYU A;  4XUO A;  1Q8O A;  3ZSE A;  1AXZ A;  4AHW A;  4LBQ B;  1PZ8 A;  1WKY A;  3WP6 A;  3O14 A;  4D6R A;  3S7E A;  2ES3 A;  3GDB A;  3NAP C;  1OXC A;  3PIG A;  2X29 A;  1FMD 3;  3HBZ A;  4K1Z A;  4RSU A;  3TWI A;  3OJB A;  1V9U 3;  3OG2 A;  3K46 A;  4JCK A;  5HI0 A;  4K21 A;  3RZH A;  2ZAH A;  5T5J A;  5K4L A;  2PEL A;  3K48 A;  5IVC A;  1AX1 A;  1D0H A;  1YXW A;  2GMP A;  3ORJ A;  1MZE A;  4LR4 A;  4LBQ A;  5FZB A;  5SV5 A;  3RFR A;  1C57 A;  3U37 A;  3ZSK A;  3EB7 A;  1XE8 A;  5FY0 A;  1A6C A;  1JI6 A;  4PIX A;  3V0A A;  1CWP A;  1ASJ 2;  4MH0 E;  3TBD A;  2BUK A;  3WNM A;  4LK7 A;  1VBB 1;  4DS0 A;  5D1I A;  3IMN A;  4UT5 A;  3T0D A;  4B29 A;  4DIN B;  4XF9 A;  4XAA A;  1FOD 3;  1S4C A;  2DUO A;  5FOJ B;  5JI7 A;  2OQ7 A;  3WQ0 A;  1VAK A;  3NNL A;  1VBA 2;  2HEV F;  1W6Q A;  2E51 A;  4OI1 A;  5HPO A;  1BK1 A;  3FX3 A;  2AZ5 A;  1UYX A;  1RUH 3;  3T3Y A;  3MDP A;  1MVQ A;  1PHM A;  2AEN A;  1OHF A;  3M3Q A;  2AEZ A;  1QWR A;  4EWE A;  2A3Y A;  1RC6 A;  5E1R A;  1QY4 A;  2YBP A;  3VGI A;  4CRQ A;  2GMM A;  1AL2 2;  4E2S A;  2VZQ A;  3FFZ A;  4JAA A;  1N1T A;  3PL0 A;  1BXH A;  3OBZ A;  4WVV A;  1VRH 1;  1CR7 A;  4XMI A;  2ZZQ A;  1CPN A;  1MS5 A;  3WD5 A;  4EV0 A;  2CTV A;  2EF6 A;  3A23 A;  4EWA A;  3MYX A;  2VNR A;  4AGR A;  4K9S A;  2QQV A;  2WRA A;  4AOC A;  5C71 A;  5JPM B;  4ES9 A;  2OT7 A;  3AP4 A;  4M3C F;  2GN3 A;  3MUY 1;  5LY2 A;  5KXD A;  2IWG B;  4PBO A;  3VBH A;  5JXG A;  1HRV 2;  5CAZ A;  1WCD J;  5FMD A;  4K3U A;  2VCM A;  2N7G A;  4WM7 B;  1NXM A;  1OSG A;  1QXR A;  2ZCW A;  5DAQ A;  1R09 3;  3ZVX A;  1KFX L;  3WR0 A;  4XQ4 A;  1RHI 2;  3I49 A;  4GZ9 A;  4TLF A;  2DYC A;  3KV5 A;  5JVV A;  2EAA A;  4IER A;  4KBZ A;  4QQO A;  1GNH A;  3KWV A;  4FQZ A;  1YJL A;  4W6Y A;  4XBL A;  2Q1Z B;  1Z7S 2;  4XFH A;  2O0O A;  5FZA A;  3WLU A;  3Q9O A;  2P3Y A;  5K0U B;  3QD6 A;  2JB4 A;  4LPL A;  4Q4W 3;  5JAX A;  3PLQ A;  1C1L A;  4L11 A;  1KEX A;  1RUE 2;  4Y22 A;  3VBF C;  1W8H A;  1RUD 3;  5T3N A;  3HQR A;  4NAM A;  1AYM 1;  4NHM A;  1ULG A;  5LZ6 A;  1FX5 A;  3RMY A;  1UU4 A;  4DOU A;  1XBF A;  1UOG A;  5F6K A;  4MGS A;  4RS5 A;  1OQE A;  1OQ1 A;  3VDD B;  4JX0 A;  1UY2 A;  2C5D A;  1CZS A;  2WSU A;  5DUV A;  1NCQ C;  4AQS A;  4O7X A;  4B4P A;  2V09 A;  2AGS A;  3MIF A;  2FDI A;  3GBF A;  4CEY C;  4TYS A;  1PMJ X;  4JGY B;  1GV9 A;  1CAV A;  3C2U A;  4WBB A;  2JG8 B;  3MFC A;  5IVB A;  2PAE A;  5E88 A;  1SLT A;  3VBS C;  5JZG A;  1ZBE 1;  4UFJ A;  5I8Y A;  1PO2 3;  4RYD A;  1CPM A;  3OGS A;  2LRP A;  4NRP A;  3WG4 A;  4WM8 B;  2XBO 3;  3I2D A;  4CSW A;  2KA3 A;  1YFU A;  1NLQ A;  4LBJ A;  5A7N A;  1DF0 A;  5BV6 A;  2GC1 A;  1PGL 2;  2YZ4 A;  2AR6 A;  3LWC A;  3T1M A;  4DEQ A;  4GH4 B;  2VCC A;  3ETP A;  3N9M A;  5IFP A;  1QH7 A;  4PIY A;  4UBG A;  1UIK A;  3RI9 A;  1IHM A;  1NCR C;  2DTW A;  2ZGL A;  3AZZ A;  1NAE A;  3T2P A;  5L36 A;  2WQ8 A;  1TME 2;  1U5Y A;  1YQ8 A;  5FYZ A;  5KHK A;  4GWJ A;  4BQ1 A;  3BKZ A;  2ZJC A;  4QXC A;  3K75 B;  3MLL A;  1DDL A;  1BK0 A;  1I3H A;  2E7Q A;  2VQA A;  1DQ1 A;  3PUR A;  5LB6 A;  1PO1 1;  4M0H A;  1PK6 C;  4N43 C;  5BNO C;  3HMY A;  3M2M A;  5C8C C;  1NT0 A;  4A4A A;  4N9H A;  3GAL A;  4XAE A;  1IQA A;  4FPK A;  1PO1 2;  1C8N A;  1H8V A;  2YFU A;  3AJZ A;  1XNC A;  4CCD A;  1EAH 1;  3IKW A;  1HJF A;  1W6P B;  2XKO A;  4A3Z A;  2LTN A;  3ACG A;  3MUZ 1;  3H7Y A;  4QDS A;  3I59 B;  3BU7 A;  1HDK A;  1G9B A;  5I0T A;  2D7F A;  3A7Q A;  1K5M A;  1MVE A;  5IYY A;  1C4R A;  2ZTN A;  3TRS B;  3HQX A;  1IS5 A;  4E2Q A;  2PQQ A;  1DIW A;  2W1U A;  3P3P A;  4CP9 A;  5EV7 A;  2E9Q A;  5C70 A;  1ZBA 2;  3AYA A;  3IDA A;  2WFF 1;  1VBB 2;  5JOZ A;  3BIE A;  1FNY A;  3K4A A;  5IK4 A;  2RG4 A;  1IS3 A;  1EUT A;  3UNP A;  2PTM A;  2TUN A;  3HWJ A;  3JD7 3;  1V6J A;  1CES A;  1WLT A;  2C9A A;  4Q4V 3;  1ZRR A;  5FY7 A;  1NZC A;  4ERO A;  1IG3 A;  3OBR A;  2X5I B;  5A6Y A;  4IEO A;  4NUB A;  3TEY A;  1RUN A;  4M0N A;  1AYM 2;  2YPJ A;  1WW4 A;  3M4F A;  4LO7 A;  4PLN A;  1I1E A;  2VZS A;  1JTZ X;  4A2U A;  1QJX 3;  4HVO A;  4XHB A;  3UL2 A;  3III A;  1V6I A;  4AQ6 A;  4YGE A;  4BIO A;  4Y1Z A;  2EA7 A;  4CTE A;  5D2A A;  1AYN 2;  4W6X A;  1RUJ 2;  3IIA A;  5CG8 A;  1HIX A;  1ZZC A;  4LOT A;  4LQR A;  5LY1 A;  5LK5 A;  1KGY A;  1VP6 A;  4Q4Y 3;  5BNP C;  4NN0 A;  4Y20 B;  1WCS A;  4A7K A;  2QQU A;  1SBD A;  5CA6 A;  1E57 A;  4Y1V A;  4HKO A;  4D6Q A;  1GWK A;  4ARX A;  4CDU A;  1GZ9 A;  5M0T A;  2BFU L;  1G6N A;  3WDX A;  5FQ0 B;  4CDW B;  2JIG A;  2WZP P;  4GJZ A;  1ACC A;  1CON A;  4XJZ A;  4K8F A;  2CHH A;  1RUE 1;  5GZD A;  1PX3 A;  5FZ7 A;  3WDW A;  4BPZ A;  2QCS B;  1GAN A;  2AUY A;  4Z2W A;  5L7O B;  4XOG A;  2FDF A;  4ATF A;  4Y33 A;  5IHR A;  4E9K A;  2V4V A;  4MGK E;  2W92 A;  4IW3 A;  2H0B A;  2WAA A;  1RVF 2;  2EIC A;  1PNG A;  3LCP A;  1H6X A;  4JDO A;  3QLQ A;  2DU1 A;  4IEY A;  3FLT A;  4XIO A;  1LHU A;  4QPY A;  5DDJ 3;  1RUG 2;  4NO4 A;  3JD7 1;  4ONU A;  4K8R B;  2RS5 3;  4KWU A;  4DXZ A;  4HT1 T;  1WBF A;  1S1A A;  2VZT A;  4RQP B;  4B4R A;  4NHK A;  1FAY A;  3E6D A;  4BWO A;  5JXI A;  1DQ4 A;  2ARA A;  1UMH A;  2JG9 C;  1AF9 A;  3JBG 1;  1KFU L;  5LW9 A;  1YNA A;  4IE6 A;  2QDN A;  1UKR A;  1FMD 1;  1QJE A;  2ARC A;  1KJR A;  4Y4R A;  3UET A;  2LW8 A;  5ISL A;  5A33 A;  4QPI C;  2WZR 3;  3LAG A;  3S7I A;  2FDK A;  2WR9 A;  5CU1 A;  4QX8 A;  4HN1 A;  1STM A;  4U36 A;  1RUF 3;  1YI9 A;  4DQA A;  5JUV A;  3IAP A;  3LOI A;  2BFU S;  4LBN A;  1BKZ A;  1Q43 A;  3ES4 A;  1Q8V A;  2X5I C;  1QU0 A;  3VBO B;  3OGG A;  4WVM B;  1O91 A;  2VTX J;  4LHL A;  1TME 1;  4OHY A;  1I5P A;  2HWE 3;  1YIF A;  3T0A A;  1K5M B;  1RUI 2;  3IB3 A;  5GLW A;  2VGD A;  1ZRI A;  2WO1 A;  1AJK A;  2WS9 2;  2RMU 2;  4YWA A;  5ACA 3;  4QB1 A;  4B1M A;  4FP3 A;  3TNP B;  1Q56 A;  5A7O A;  1G9A A;  5T5L A;  4BIS A;  3T4H B;  2BGC A;  1RUC 3;  2HWD 3;  2EXH A;  4UFM A;  4NIH A;  3KV6 A;  2BNO A;  5FYM A;  3OYW A;  3NJV A;  2IVI B;  1EPZ A;  5FZD A;  3U10 A;  1LCL A;  5E6H A;  4ZU7 A;  3PJY A;  4LKE A;  3B9I A;  1WMX A;  4B3N A;  2BZD A;  1AR8 2;  4BQ3 A;  2FCT A;  1GUI A;  1W2A X;  3D3A A;  1C8M 3;  5AVP A;  3VHN A;  5IVJ A;  2E53 A;  5J96 B;  1NY7 2;  2YYO A;  5FZG A;  1XYO A;  4GAZ A;  1AYN 1;  1L7R A;  3EO6 A;  4BJ0 A;  1UZZ A;  4UFH A;  2Q8E A;  4CCJ A;  3C7G A;  5E8A A;  1K42 A;  4QXH A;  5J3U A;  1ZBA 1;  3WSO A;  4NR1 A;  4R8H A;  3QCW A;  2RM2 3;  4JDM A;  4QPG C;  4LUL A;  4CCE A;  4CDX B;  4AED C;  5F8P A;  3ZR6 A;  1DZR A;  1RIN A;  2A7A A;  3LB9 A;  4CEW B;  2QQP A;  1G86 A;  2VO5 A;  4HKW A;  4ZON A;  2RHP A;  5CFD A;  1AHS A;  3VBF A;  3FUO A;  1W2T A;  1UWW A;  4WM7 C;  1XE0 A;  2QNK A;  3FE5 A;  2I07 B;  4RN5 A;  4IXL A;  3AMM A;  4WVW A;  5C8C A;  3RDI A;  1VBC 3;  3POY A;  2MEV 2;  1UN1 A;  2YGM A;  4KNC A;  2B39 A;  1AX2 A;  2Y6K A;  4CXW A;  3JXS A;  1PZ9 A;  1WMD A;  1WMF A;  4DRR A;  1RUD 1;  2IUW A;  2D5H A;  4KWL A;  1OUR A;  3ZLI A;  3ZXD A;  4OI0 A;  2WLQ A;  3AMH A;  3VDA A;  2E32 A;  4FPJ A;  5FZK A;  5C7G A;  1RUG 1;  2JE7 A;  2RDN A;  2YGL A;  1I9R A;  3USU A;  5I8T A;  1UZY A;  1W6Q B;  1B35 A;  4BE3 A;  3B94 A;  2QQN A;  3D82 A;  3MIE A;  5BNN C;  3ZYF A;  3ZM8 A;  3V0A B;  5IAX A;  1O59 A;  1OLQ A;  2VTX A;  3O1T A;  1VRH 2;  3MID A;  3VKO A;  1A78 A;  1H8T B;  3JBG 2;  5EIY B;  4PDW B;  2YC4 A;  5FZ4 A;  3CJI B;  3H3U A;  5FWE A;  1W9S A;  2Q4S A;  1FMD 2;  3LPG A;  3O0W A;  3ZYJ B;  1N3Q A;  3NVC A;  2BBV A;  1QJU 2;  3ILR A;  1JMU B;  5FLJ A;  1W9Y A;  1UPS A;  2WNU B;  1BCX A;  3IN9 A;  2VMF A;  4PQ9 A;  5A7W A;  3IT8 A;  1OVS A;  4OHV A;  4AVA A;  1AR6 1;  1VJ2 A;  1EP0 A;  1GU3 A;  4YW7 A;  1RYY A;  2HWB 2;  3MLK A;  4RR3 B;  1MQT C;  1WLC A;  4A3X A;  2VUD A;  2W46 A;  1RVF 1;  3M8L A;  4FFI A;  2B4K A;  4LXL A;  3AKT A;  2VQU A;  1ENR A;  3JZV A;  2NP0 A;  1GQP A;  1NCQ A;  5L73 A;  4MGI E;  4XAC A;  2ZAA A;  4KGG A;  4KG0 A;  3LIG A;  4IE7 A;  4PHZ A;  1LTE A;  1PNF A;  1UY1 A;  4OQ8 A;  1GOF A;  3MV0 1;  3N7K A;  3FZ3 A;  3LQC A;  1UIJ A;  3J7M A;  4QMA A;  3RYR A;  1KS4 A;  3M3C A;  1PIV 1;  2OPW A;  3O0X A;  2J42 A;  5FKB A;  1S0E A;  1SEF A;  2RE9 A;  3ZSJ A;  2DDU A;  2Q8D A;  1YCI A;  1OOP C;  1QNY A;  2WL1 A;  5FZF A;  3BI3 A;  3QOP A;  2WT1 A;  2XGX A;  3RNS A;  1AJO A;  1X7N A;  4XJU A;  2A3X A;  4XUP A;  3AYE A;  3UT0 A;  3ZYR A;  2VUL A;  1OMI A;  1TMF 2;  1OFS A;  1MEC 3;  3LGR A;  2D6O X;  1NY7 1;  3R4U A;  3ZFE A;  2ZMK A;  4A42 A;  4E2G A;  3LIH A;  1OLM A;  1SG3 A;  2WWU A;  4Q29 A;  4AL9 A;  4EZ4 A;  1HV0 A;  3M1H A;  4LE3 A;  1KIT A;  5FXV A;  3GZT B;  4LEJ A;  1VRB A;  4B7E A;  5IWF A;  4BQX A;  2A3W A;  2VVF A;  3I2O A;  3DCQ A;  5CYY A;  3O1M A;  3SH5 A;  4ZS2 A;  4IES A;  1EV1 1;  3JU9 A;  3T09 A;  4HK9 A;  1HXS 2;  2BU9 A;  2WNV B;  4CEW A;  5FWJ A;  1YYN A;  1VB4 A;  3SCG A;  1ZBE 2;  5F5Q A;  3HBK A;  4LA3 A;  2K9Z A;  1ODN A;  1VBA 1;  1XXN A;  1YFX A;  4MXV A;  3UK9 A;  4GWN A;  2R7E B;  3ACL A;  3NV2 A;  1I6X A;  1L7Q A;  4ZXE A;  4HSJ A;  5B4N A;  3J26 N;  4Q1R A;  3MW4 A;  4XCB A;  4CCL A;  1COV 2;  1DGW A;  1LHV A;  3LA3 A;  5FO7 B;  1IG0 A;  3PUI A;  4Z1V A;  3MZH A;  3NJZ A;  4FBF A;  3HOB A;  4L8Q A;  1FPN 3;  1P8J A;  5GZF A;  1SFN A;  5A1A A;  4FT8 A;  2B9V A;  5GZE A;  2B7Y A;  1XNB A;  4UI9 L;  4F3J A;  2X10 A;  4CP2 A;  1RUF 1;  1HX6 A;  4QPI A;  3B3Q E;  2D3S A;  4CU7 A;  1NKG A;  1OPM A;  2ZHL A;  5FZH A;  3VBH B;  1F4H A;  3VHR A;  4LKS A;  1GOG A;  4IEV A;  4UF0 A;  4ASK A;  5C8W A;  3I3E A;  3AFK A;  1KDK A;  3GCW A;  1PVC 2;  1NQD A;  3QH6 A;  2GME A;  3KF3 A;  1LOD A;  4CDW A;  1Q8Q A;  4Q4V 1;  3VZO A;  2QE3 A;  1XOY A;  1W03 A;  2BW8 A;  2GDF A;  3WDU A;  4Y1U A;  1YQ2 A;  5JCT A;  2VZR A;  2ILM A;  1HB3 A;  1Y9Q A;  4YZ4 A;  2XQX A;  4XFB A;  1CAW A;  1FV2 A;  5FTT C;  3T4V A;  1LNS A;  3X29 B;  5DDJ 1;  5LBB A;  3OEB A;  2Q5T A;  2D3R A;  3DUI A;  1MPX A;  4S2F A;  5A1F A;  1SLA A;  3M70 A;  3JB8 A;  3SH3 A;  4AW7 A;  3NAP A;  2VZO A;  5FY1 A;  1LRH A;  1W05 A;  4C8D A;  4P5H A;  1SHW B;  5EPA A;  1F4A A;  4BQ5 A;  3D0J A;  2F4L A;  4JQR A;  2D44 A;  4OHZ A;  2HWE 1;  3D8C A;  4BU2 A;  1V6O A;  5C8C B;  2IXJ A;  2Q8O A;  3AKP A;  1WW6 A;  3K2O A;  2R07 2;  3ZMO A;  1RTV A;  5JMC A;  1ZX5 A;  4RFT 0;  2FHR A;  1GWL A;  2W68 A;  3TN9 3;  4Q27 A;  3THD A;  3RYK A;  4MLO A;  5JSP A;  1GP6 A;  1V6K A;  3TAY A;  3K77 A;  2ARX A;  1Z0H A;  3U75 A;  2ZA9 A;  5FYS A;  3W5M A;  1W6N A;  4YVW C;  2WWJ A;  2W08 A;  2GC0 A;  2JDZ A;  2ZX3 A;  4Q1P A;  4ZU4 A;  3VLB B;  4A6S A;  2JEC A;  4CE8 A;  5JXH A;  5FZO A;  4B4Q A;  5JI9 A;  1AR6 2;  4KU7 A;  4HFS A;  1VMH A;  3PUH A;  4Y1X A;  2JIC A;  4QXB A;  1QGL A;  2IVJ A;  3SHR A;  1Y7B A;  2BJS A;  3VZM A;  1LOG A;  3PTR B;  5FPX A;  5A32 B;  4NPR A;  3I2G A;  3POJ A;  4EWD A;  4Q0P A;  4PF5 A;  3O1O A;  4FO9 A;  1UXX X;  4BQ4 A;  5FAX A;  4QKD A;  2VQ0 A;  4NWV A;  4URA A;  5F37 A;  1O4Z A;  2WA3 A;  3N9O A;  1O3T A;  2OZJ A;  3CJI A;  3J8F 2;  1O3Q A;  4G4F A;  5F5C A;  1S0C A;  2JDY A;  4AI1 A;  4FFH A;  4NJ4 A;  1F9K A;  2AYH A;  3VBH C;  2P1B A;  5JLV A;  2OVU A;  4QD2 A;  4WVM A;  2CNA A;  4XUQ A;  2UYA A;  1Y43 B;  3N7L A;  1UX6 A;  2VQT A;  2EIB A;  2W52 A;  4PQQ A;  5FYC A;  3L2Y A;  2VBB A;  4WV8 A;  1XNK A;  2DCY A;  2VOV A;  2QQJ A;  1ENS A;  3CMG A;  3HNY M;  2BNM A;  4LIT A;  4ARY A;  4E4D X;  3AFG A;  4DZG A;  5F3I A;  3OSD A;  3LOB A;  4G9S B;  3PU8 A;  1QJX 2;  2XHN A;  4M4R A;  3A21 A;  3HJR A;  5A33 B;  3VBS B;  1IZ3 A;  2D6P A;  3FHQ A;  4H55 A;  4M3C A;  4YW6 A;  5IVY A;  1HQL A;  3RS6 A;  3WCS A;  4GMP 3;  1SPP A;  2XWB B;  4I3P A;  2I74 A;  5CFD C;  5JZG B;  1MZ5 A;  4IEZ A;  2CWM A;  4HKL A;  1H1M A;  3H1W A;  2RR1 3;  3U4S A;  1WA6 X;  1ZRC A;  1J3R A;  5KWR A;  1W6M B;  2B8M A;  2VUA A;  4QKF A;  5IVV A;  4XF4 A;  5CB7 A;  1NCR A;  1UZW A;  3W20 A;  4AFA A;  3P6B A;  2YFZ A;  3AVS A;  1TEI A;  5EJ3 A;  1BMV 1;  2XUM A;  2H6B A;  1Q8S A;  3A22 A;  3RZL A;  3INA A;  3DEC A;  1CJD A;  2UWB A;  3C7F A;  2D5F A;  3SEE A;  2BBA A;  2Y33 A;  3NRU A;  1GNZ A;  1V0A A;  5LA0 A;  1MEC 1;  3I2J A;  4IEP A;  3TYJ A;  2GNB A;  4KQ7 A;  1CAX B;  2RJK A;  4D7T A;  5CFC B;  2CSG A;  2R07 1;  3VUO A;  1PVC 1;  2Y0O A;  4XBQ A;  4NMI A;  2J1U A;  1OT5 A;  1HRI 2;  4NPL A;  5AFB A;  3WQB A;  4IV1 B;  2RS1 2;  3BYW A;  4LBO A;  4R9C A;  3NKT A;  1FNZ A;  2W95 A;  1V6L A;  2ZMN A;  2QUO A;  5AC9 3;  3ZOI A;  2DVF A;  2ZS6 B;  2R1B A;  5DZE A;  3V56 A;  1W6M A;  1OKQ A;  1SAC A;  3KCY A;  2R06 3;  4XFF A;  5FK8 A;  2YXS A;  1R08 3;  2GNT A;  4N9I A;  4R9D A;  2QZ3 A;  1QJU 1;  4PF1 A;  2XWJ B;  3WP3 A;  5DUU A;  1F2N A;  4HPK B;  4XDP A;  2X5I A;  1VBD 2;  2ZZJ A;  5EFU A;  2A1X A;  3ZFF B;  4JHT A;  2XDV A;  4WM8 A;  1YLL A;  4Z8B A;  5C3P A;  5FR3 A;  1POQ A;  2WYF A;  3B00 A;  4PLM A;  2VVE A;  4M01 A;  4Q4Y 1;  1LHO A;  3M3E A;  2BPA 2;  1IOA A;  5D8A B;  1QJY 3;  1RGS A;  4YSF A;  4RR3 C;  5IT6 A;  3RPQ A;  1GQH A;  2WUH A;  2ZAC A;  4RQP A;  3WZ1 A;  3NWK A;  2RMU 3;  4AFC A;  5EQU A;  4WZF A;  5LA2 A;  5HV0 A;  2JDM A;  4HON A;  4XQD A;  2VAU A;  1WCU A;  4K6B A;  4DXT A;  4UW5 A;  2P37 A;  4YM3 A;  4CCM A;  3WQ1 A;  2YB7 A;  1CD3 G;  2W0X A;  1D7P M;  2LM3 A;  3FLP A;  4YVW A;  3RZK A;  1MZF A;  3HT2 A;  5ABJ C;  5BNQ A;  5T5P A;  4H3W A;  3MW3 A;  1XU2 A;  3DPR B;  4I3G A;  4MV2 A;  2RDR A;  2YHJ A;  2GP5 A;  4LOR A;  3TB0 A;  1I5Z A;  5C6C A;  1YUD A;  5H9R A;  3POB A;  4LK6 A;  1WD4 A;  1ND2 B;  2ZGT A;  4FAH A;  1LOF A;  4ZKT B;  3SXW A;  3PU3 A;  4HLT A;  3KQR A;  4XAB A;  4NHY A;  2HWD 1;  5FMO L;  5FQ0 A;  4NRQ A;  5JOW A;  5BNP B;  4YW4 A;  1CZT A;  1R1A 2;  1W90 A;  2SLI A;  3POW A;  4ASM B;  1RUO A;  5J1X A;  5HBA A;  1ZZ6 A;  2XB6 C;  2XLG A;  5FZI A;  1POV 1;  1QMJ A;  4O65 A;  3CO2 A;  4GB3 2;  3WNP A;  4A41 A;  5ANQ A;  5FYI A;  2HWB 1;  1S0B A;  1FOD 2;  4OUS A;  1F5F A;  2H0V A;  3HAG A;  4CP0 A;  5BNP A;  3J7H A;  4IV1 C;  1VBA 3;  2UWC A;  3R4D B;  3ZXL A;  3KLS A;  2YC0 A;  1AR7 3;  2WAB A;  3WCR A;  2Y64 A;  2AAC A;  2EIG A;  1FOD 1;  4QX1 A;  5EZW A;  4GUL A;  3OY8 A;  2IFW A;  3WEZ A;  4I2O A;  4E4Z A;  2PFW A;  3U07 A;  1ST8 A;  1GZW B;  2RDQ A;  3WP4 A;  3SIT A;  2RS5 1;  2YG0 A;  2GZW A;  2VNG A;  3CQO A;  4QQL A;  1RUI 1;  2DVD A;  1BBT 3;  4QPW A;  3AKS A;  3GZU C;  3E6C C;  1AL2 3;  5LCW L;  1HLC A;  3WF4 A;  4BH9 A;  3NAP B;  3VBR A;  5C5T A;  2VD7 A;  3H9A A;  4AI3 A;  3KV4 A;  1IPS A;  1DP0 A;  4FCA A;  2DCZ A;  3DYO A;  5FP9 A;  4LA2 A;  5EYY A;  3UV9 A;  1JOP A;  1S55 A;  5AC9 1;  1VRH 3;  1SBE A;  4K1Y A;  4BLI A;  3JB4 C;  4CXY A;  5J36 A;  5FMO S;  4GKX A;  1K45 A;  1QQP 2;  4XJ9 A;  4CVU A;  2IC1 A;  2OUH A;  5L7O C;  2RV9 A;  3GCX A;  1D4M 2;  1AR9 2;  3O5S A;  4LIV A;  1RHI 3;  3GBG A;  2JE9 A;  1NG0 A;  2NQY A;  2VMC A;  2YBS A;  1W2O A;  1W9F A;  5FFO C;  5KHH A;  3SQO A;  4P9L A;  4CZS A;  1J58 A;  2QKD A;  4BA6 A;  4PT6 A;  3ZR5 A;  5F39 A;  5GJ6 A;  2WZR 1;  3ZKU A;  1U12 A;  1H30 A;  2R04 2;  4J6G A;  2PMW B;  2WC2 A;  1TNF A;  3IDC B;  1YQ5 A;  3HPN A;  2K2S A;  1IQD C;  2RVA A;  2A5Z A;  2RS1 1;  3ZYG A;  1RUD 2;  1COV 1;  2PHW A;  2JD4 A;  3OB8 A;  5CFC A;  5B4X A;  3NNM A;  1GSL A;  1MS9 A;  5FO8 B;  4MGQ A;  5DUW A;  2JKB A;  4HAN A;  1GIC A;  3NMB A;  1OPO A;  3POG A;  3B69 A;  3E1F 1;  4XIL A;  1H1A A;  3H50 A;  1GFF 2;  1LOE A;  3PMS A;  3ZN6 A;  5CKN A;  2WZ8 A;  4YVS B;  5FMB A;  3RZJ A;  1CAX A;  1QIQ A;  3LA7 A;  4MHR A;  5FLI A;  3KHB A;  1R09 1;  2CWS A;  3RZZ A;  4FFG A;  1UOJ A;  4ZZ5 A;  1K12 A;  3HNM A;  2VU9 A;  3DF0 A;  3ME2 A;  2JIJ A;  3OGR A;  4M4P A;  1S0G A;  1H1I A;  3UGG A;  2YU2 A;  3VBU A;  3I3B A;  1UYY A;  1MS1 A;  2WYS A;  2D3P A;  3MFA A;  4HMZ A;  4Q0V A;  1L7L A;  5FP8 A;  3DV8 A;  4NII A;  4ES8 A;  4DY5 A;  1JOD A;  5T52 A;  4IEQ A;  4D69 A;  4CDX C;  1XB9 A;  3CEW A;  2XH6 A;  2GSY A;  4JDN A;  4YW2 A;  4CDQ C;  2VL4 A;  2C6S A;  1G9D A;  5F7U A;  1XNT A;  1GZW A;  1YRZ A;  4IEX A;  3O1P A;  1EPW A;  1LOF C;  2P3K A;  2WT0 A;  3V65 A;  1BHG A;  2Y6L A;  3P1I A;  1X8E A;  2C0Z A;  2Z69 A;  3WV6 A;  4S2H A;  3OPW A;  4TZD A;  3ETQ A;  4GMP 1;  5EJ1 B;  2WKK A;  1ZZ8 A;  5ANN A;  5IW0 A;  3LSD A;  4BMB A;  2Z4F A;  5ABJ A;  1JYI A;  4JGZ C;  2P34 A;  4MGZ E;  4E8D A;  1APN A;  2UWA A;  2BOJ A;  5FP4 A;  3F95 A;  2ZKN A;  4RHV 1;  3QH7 A;  5FYY A;  2GU9 A;  1H0B A;  4ZY9 A;  4H14 A;  4N53 A;  2RS3 2;  3OOX A;  4LJH A;  3IMM A;  1PO1 3;  3PUS A;  2WT2 A;  3B5L B;  1PIV 2;  5JR2 A;  3B93 A;  1VAV A;  3R05 A;  2YDE A;  5DAW A;  2Y6J A;  4XF1 A;  3THP A;  4Q8L A;  2PHT A;  4IGO A;  5A1L A;  1QQP 1;  3ZIX A;  4QX3 A;  3A0N A;  5A3U A;  1H6Y A;  2WNU C;  3T2Q A;  4LLF A;  3AYD A;  4HG6 B;  3HIF A;  5ACA 1;  3LPF A;  4X6R B;  4CUB A;  3WNO A;  2ADE A;  4LO6 B;  4FOQ A;  4D3W A;  2HWF 2;  2P6H A;  1BMV 2;  1BEV 2;  3FBY A;  3DKQ A;  3KMH A;  5FUI A;  1RUC 1;  2VNV A;  2IXH A;  4DB5 A;  2BVV A;  2IXC A;  3H3Z A;  5AFE A;  4D8M A;  1JYT A;  2IXI A;  2VW1 A;  2FDJ A;  3SKV A;  5FP7 A;  4QPG B;  1K5J A;  1AX0 A;  3IM0 A;  2JE8 A;  4XCA A;  2GAU A;  1AZD A;  3S5Q A;  4QKB A;  2GC2 A;  3VBO A;  4AI2 A;  2Y0I A;  3OUI A;  2Z42 A;  1DCS A;  4I02 A;  1XU1 A;  3O7O A;  1E5S A;  4COV A;  3RG0 A;  4Z92 B;  1BVP 1;  3L2H A;  4Q0S A;  1GR3 A;  1AR8 1;  2QZ2 A;  1F31 A;  1K3I A;  2XJT A;  2ADD A;  5FXZ A;  1PM7 A;  5HCB A;  2D6L X;  1TVG A;  3MV1 1;  2X05 A;  3VKN A;  1Q3E A;  4IE5 A;  4GMP 0;  5A6X A;  3BU0 A;  3VBS A;  3DN7 A;  1EY2 A;  5FUN A;  1TG7 A;  1DHK B;  5D8A A;  3SNM A;  3MW2 A;  1ASJ 3;  1MS3 A;  2WWS A;  1W6O B;  3ZXE A;  1QJX 1;  2Q1F A;  1AVB A;  1X9T A;  4NAO A;  1BYH A;  2WJS A;  1R09 2;  1DGW X;  2JEN A;  3ZKY A;  4BCU A;  1OH3 A;  3VB9 A;  3I2F A;  4FXK B;  5E89 A;  1DG6 A;  1YC6 1;  1WD3 A;  2XVG A;  1GZC A;  1DQ6 A;  1EAH 2;  2EIE A;  3AVR A;  3OF1 A;  4GKY A;  1X8M A;  1Z7S 3;  2V73 A;  3FHA A;  2KR2 A;  1UF2 C;  3KQ4 B;  4LO4 B;  4PJY A;  3ZXF A;  4CXX A;  4IV1 A;  3AX4 A;  4COZ A;  4IE4 A;  2PHX A;  5FIX A;  3O1S A;  2XL9 A;  1HQN A;  4K7J A;  3FFQ A;  5F5A A;  2R30 A;  3UJO A;  2XUE A;  1UU5 A;  3Q8E A;  1SFP A;  4DPN A;  5L19 A;  1S0J A;  4Y24 A;  3EYP A;  2MHF A;  3UES A;  2TNF A;  4M00 A;  2ZPX A;  1YHF A;  3NNF A;  4CDQ A;  4AE2 A;  1B09 A;  3WY6 A;  1ZZB A;  2A6V A;  2HKX A;  1WGP A;  4Y1Y A;  5CIS A;  1PO2 1;  2K46 A;  1XND A;  1O5U A;  2WO7 A;  4NRO A;  4YGC A;  5FY4 A;  4BXS V;  1WLW A;  3N9P A;  5C4W C;  1Q8P A;  5FZO B;  4AK3 A;  1YFY A;  2J1A A;  3KCC A;  2A6X A;  5IJR A;  2UU8 A;  2Z2S B;  3E5Q A;  2XLA A;  2ZEW A;  2VUJ A;  3MIC A;  4UYB A;  3SKJ E;  5BNN A;  4YW1 A;  1ALY A;  2GAL A;  4F8A A;  1H4G A;  3F2Z A;  5C33 A;  1DYP A;  1CAU B;  3N7J A;  3VD9 A;  2P5B A;  2R16 A;  1C8M 1;  4XF3 A;  4MET A;  2V4A A;  2D6M A;  5HXV A;  5F1R A;  2QDR A;  3ACH A;  1NX9 A;  1H9P A;  2BGO A;  2ET7 A;  1QOO A;  3ZPY A;  4A45 A;  5DZF A;  1JOB A;  1A34 A;  3FBM A;  3BPS A;  5CFC C;  1KXG A;  5KBF A;  3POF A;  5FZ6 A;  2VE1 A;  1CAU A;  2QQK A;  3RWK X;  2YPD A;  3K3N A;  4LUM A;  4HOO A;  1YQ6 A;  2JDK A;  1O3S A;  5K9Y A;  4KWK A;  3I7D A;  4YG0 A;  1CIW A;  1MS0 A;  2DUP A;  4OUL A;  4D7Y A;  4RHV 2;  2VG9 A;  3VBR B;  3LEM A;  3PME A;  2H6C A;  3AP7 A;  2QQW A;  3CNA A;  1E5I A;  2UYB A;  4LE4 A;  4B1L A;  1JUH A;  5LBE A;  1MR5 A;  3T2T A;  2VOX A;  3THC A;  3ZX7 A;  1PVX A;  2A6Z A;  4UBH A;  4Q8K A;  2ZEY A;  2VR4 A;  5A3L A;  2NLR A;  1AR8 3;  1GQG A;  4ZU5 A;  1NCQ B;  4FI9 A;  2ZGO A;  3U14 A;  2J7M A;  5DQ0 A;  4A7Y A;  2VPV A;  4AWD A;  4C0B A;  4P00 B;  5AC9 2;  5LRR A;  3ILF A;  3WOG A;  4HXC A;  3VDC A;  1EV1 2;  5JIA A;  3U11 A;  3BOD A;  1EYB A;  3KV9 A;  4Q5O A;  4OUE A;  5K0U A;  3W5N A;  5JSR A;  2DFB A;  3RZM A;  3POI A;  4D94 A;  1UAI A;  1VBB 3;  1NLS A;  4XBN A;  2J1V A;  1QHD A;  4R52 A;  3CDZ B;  4FAG A;  4HN0 A;  1XNA A;  1YJK A;  3MBW A;  4S2G A;  5I0R A;  5F6L B;  5BYN A;  2BVB A;  2ZGU A;  4XC9 A;  5FZ8 A;  5FXW A;  3ZFG B;  4AG4 A;  1QKQ A;  4IEU A;  3PNA A;  4OCT A;  2W1W A;  4QKN A;  4NWW A;  1BEV 1;  2CAV A;  2W47 A;  2KXL A;  2WNV A;  3GYD A;  4Z07 A;  3WXP A;  2DU0 A;  2W94 A;  2HEW F;  3CZJ A;  3AYC A;  4YZ3 A;  4YW5 A;  4LKF A;  4ZXK A;  3KGL A;  1KRI A;  3VDD C;  2CGP A;  4X6Q B;  1ULO A;  1W8U A;  4P9J A;  5LA9 A;  5HCA A;  4EQV A;  4P14 A;  3VHO A;  1IS6 A;  1RUJ 3;  5C9A C;  4C90 A;  2G1M A;  4AFB A;  1AL2 1;  1RED A;  2ZBJ A;  2OQ6 A;  4RFR B;  4COU A;  3NJY A;  4CA9 A;  4N90 A;  4QB6 A;  4NID A;  2DFC A;  2PA7 A;  2AEY A;  2VXR A;  5EJZ B;  5FJK A;  4CP9 B;  1ZRE A;  1OBN A;  3VD3 A;  4KL1 A;  2AC1 A;  2XJV A;  5F9T A;  2W1S A;  5JSO A;  2J1T A;  3KVB A;  5FBJ A;  2HBU A;  3WW3 A;  2ATF A;  3BTZ A;  1HRI 1;  4PIZ A;  1O4Y A;  4TWT A;  1HRV 1;  1S0I A;  5FDB A;  1RMU 3;  1OUS A;  3M3O A;  3L9J T;  2HWB 3;  4AAP A;  1X36 A;  1JW6 A;  4Q4V 2;  2E63 A; 
#chains in the Genus database with same CATH homology
 3N9P A;  5IVJ A;  5FZO B;  5FZG A;  4GJY A;  5FYV A;  3OPW A;  4GAZ A;  3PDQ A;  4LIT A;  5F32 A;  5FY7 A;  5A80 A;  3DXU A;  4QWN A;  5F3I A;  5FZI A;  4NUB A;  4UF0 B;  5IW0 A;  3PU8 A;  5FZM A;  3KV5 A;  4QXH A;  2Q8E A;  4CCL A;  4CCJ A;  5CEH A;  5ANQ A;  5FYI A;  5FY9 A;  5FZ0 A;  3AL6 A;  4IGP A;  3N9Q A;  2P5B A;  3DXT A;  5F2S A;  5FP4 A;  5FYY A;  5IVY A;  5A7P A;  4AI9 A;  5FZA A;  5A7W B;  5A3W A;  5KR7 A;  3OPT A;  5A3T A;  5IVE A;  4BXF A;  3PUS A;  3U4S A;  5FP3 A;  5FZ6 A;  5LY1 A;  5FPL A;  3PUA A;  2YPD A;  3K3N A;  5FYH A;  5FZH A;  5A3N A;  4UF0 A;  4HOO A;  4ASK A;  4DO0 A;  5IVV A;  5FYB A;  2W2I A;  5FZL A;  5FPB A;  4D6Q A;  5FPV A;  3LDB A;  4IGO A;  5A1L A;  3AVS A;  5A7Q A;  5FZ1 A;  4V2V A;  5F2W A;  2VD7 A;  4GJZ A;  5FZ9 A;  3KV4 A;  3LD8 A;  4QX7 A;  3ZLI A;  5FZ7 A;  4QU1 A;  2YBK A;  5FZK A;  5FZC A;  5FP9 A;  3UYJ A;  4LIU A;  3U78 A;  5LWB A;  4Y33 A;  5IVB A;  5A1F A;  5FP7 A;  5IVF A;  2YU1 A;  5FYU A;  4CCO A;  5FZ4 A;  5A7S A;  4CUG A;  5FY1 A;  4LIV A;  5FWE A;  4C8D A;  4D6R A;  4D6S A;  5F3G A;  4EZH A;  3KVA A;  3N9L A;  3KV9 A;  2YBS A;  4CSW A;  5A7W A;  5F5I A;  4BU2 A;  2GP3 A;  5A7N A;  5FXZ A;  3K2O A;  5F39 A;  5FUP A;  3N9N A;  2XML A;  3N9M A;  5K4L A;  5IVC A;  2OS2 A;  5FUN A;  5FZB A;  4LXL A;  4XDP A;  3PUQ A;  5FYZ A;  4EYU A;  5FPA A;  5FY0 A;  5FZ8 A;  5FXW A;  2XDV A;  4Y4R A;  5FYS A;  4E4H A;  4QXC A;  2WWJ A;  4CCK A;  5LW9 A;  5ISL A;  4XDO A;  5FZO A;  4QX8 A;  3PUR A;  5FPU A;  2OQ7 A;  5FJH A;  4GD4 A;  3AVR A;  5FY5 A;  4TN7 A;  4QXB A;  3AL5 A;  3PTR B;  2Q8D A;  3RVH A;  5F5A A;  2OQ6 A;  5FZF A;  3NJY A;  4HON A;  3ZPO A;  4URA A;  2XUE A;  5F37 A;  3N9O A;  4IGQ A;  4CCM A;  5FJK A;  5F3C A;  4CCN A;  5A3P A;  2YBP A;  5A7O A;  2YU2 A;  5F5C A;  4BIS A;  3K3O A;  4EZ4 A;  3KVB A;  4Y3O A;  2WWU A;  5FBJ A;  5FXV A;  5FP8 A;  3KV6 A;  5FZE A;  1VRB A;  5FYM A;  5IWF A;  5FXX A;  2GP5 A;  5FZD A;  2PXJ A;  5F3E A;  2OX0 A;  5FV3 A;  5FZ3 A;  4DIQ A;  5E6H A;  2XXZ A;  5FY8 A;  2OT7 A;  5FYC A;  5FYT A;  2Q8C A;  5FWJ A;  5LY2 A;  5FY4 A;  4V2W A;  4AAP A;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...