5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
3DXTA 3PUQA 5F32A 5FY0A 4LIUA 5A3WA 3K3OA 5FZ0A 5FYVA 3KV6A 3LDBA 3N9OA 3PURA 5F5CA 5FZHA 5FYMA 2WWUA 4LIVA 2Q8DA 3U78A 5A7SA 3AVRA 5FP4A 1VRBA 4BU2A 3PUSA 5FUNA 5FV3A 4CCKA 5FY9A 5FPLA 3KV9A 4QWNA 2YBSA 4V2WA 2W2IA 4LITA 5FZ1A 3AL5A 5FZAA 5FZMA 5FZBA 3N9PA 5CEHA 2XDVA 5FZEA 2GP5A 5F39A 5IVFA 3KVAA 5F5AA 4C8DA 5FZ8A 4EYUA 4AI9A 5FZCA 4HOOA 5FPBA 2OT7A 4IGOA 5IW0A 5ANQA 5ISLA 4DO0A 5FP8A 5A1LA 3PDQA 3N9NA 4HONA 5FYYA 5FZ4A 3OPWA 5A7PA 5FZGA 5FP7A 5A7WA 4QX7A 4GJZA 3PTRB 5A7WB 5IVCA 4EZHA 5FY8A 4CSWA 5F3EA 4CCMA 2P5BA 5FP3A 5FY1A 5A80A 4BISA 2OQ6A 5FXVA 4CUGA 3KV5A 5IVYA 3ZPOA 4D6SA 5LY2A 2WWJA 4AAPA 5F3CA 4ASKA 2YU1A 5FY4A 5E6HA 5FZIA 3DXUA 2OQ7A 5FZDA 2OS2A 5FZOA 5FZOB 3K2OA 5F37A 4GJYA 5FUPA 4IGPA 5FZFA 5A3TA 4CCOA 3N9MA 4IGQA 3PU3A 4E4HA 5LWBA 5FJHA 5FYZA 5FZ7A 2PXJA 2XUEA 5FYHA 4V2VA 2Q8CA 3RVHA 4Y33A 5FYCA 5IVBA 5IVVA 4D6RA 3U4SA 4Y3OA 4CCJA 5FYUA 5A3PA 4UF0A 2VD7A 2YBKA 4UF0B 5F3IA 2YBPA 3NJYA 4Y4RA 3PU8A 4BXFA 5FPUA 5FZ3A 3N9QA 2GP3A 4GD4A 4XDPA 5FPVA 4QX8A 5FZKA 5FXZA 4QXBA 3PUAA 5FP9A 5FYTA 5FY7A 4CCNA 5FZLA 5A7NA 3ZLIA 5A1FA 3LD8A 5FYBA 5IVEA 2XXZA 5FYSA 5IVJA 3OPTA 3AL6A 4QXHA 5F3GA 3N9LA 4LXLA 5F2SA 5FXWA 4XDOA 5LW9A 2XMLA 4CCLA 4QU1A 5A7QA 4DIQA 2Q8EA 2OX0A 4URAA 3AVSA 4QXCA 5FWEA 4TN7A 5FWJA 5F5IA 4EZ4A 5F2WA 5FXXA 3K3NA 5IWFA 5A7OA 3KV4A 5K4LA 5FZ6A 3UYJA 3KVBA 5FYIA 4D6QA 5FJKA 2YU2A 5FY5A 5KR7A 5LY1A 4NUBA 5FBJA 5FZ9A 5A3NA 5FPAA 4GAZA 2YPDA
chains in the Genus database with same CATH superfamily
4CUAA 5JPMB 1VBB2 4CEYA 3H7JA 1EAH1 2IXJA 2PAEA 2QZ3A 2VUAA 3D8CA 1OKQA 5A3WA 3WOGA 5LBBA 1W3VA 3ZR6A 4MHRA 4S2DA 1W2OA 4AVTA 1SLAA 1HRV1 2B4KA 4JHZA 1LB2A 5BNPB 2JG9B 4HT1T 1VMHA 1J83A 5GZFA 1JYVA 2EALA 3EXUA 4LUKA 4HKLA 4QHZA 5I0UA 3W5MA 1W6PB 1ND2B 5JSPA 1EV12 3WDUA 1W6NB 2QCSB 2VH9A 3N9PA 1QEXA 4HLTA 4LHLA 3E97A 5CEHA 4CDWC 1GP5A 3UESA 1OD3A 3AKQA 1OBNA 3T08A 1J3PA 2WAAA 1DGWX 2VQUA 3WP6A 1ZRIA 3N35A 4HOOA 4COZA 2PN5A 3CL1A 4RQPC 5D8AA 1LODA 4JRAA 5DMYA 3RPQA 2K9ZA 2XLGA 2R49A 5HV4A 3TNPB 5FYYA 1S0IA 2WA3A 3RJ2X 2WZR1 4B7KA 4QX5A 2PA7A 2VNGA 4OZXA 4SLIA 5C3SA 1ULPA 3C2UA 1BBT2 4HETA 4MSVA 3WDYA 1JBCA 2D3RA 3DL3A 2QVSB 3HBKA 1L3JA 4JKLA 5C8CB 2P5BA 2YHJA 1ULCA 3IDBB 3TNQA 1VBD2 4AEJA 3LEGA 4NIDA 4AAPA 5F3CA 1UMHA 2PAKA 2PTMA 5BY5A 4WVZA 3O1PA 4KBBA 3GJAA 2BVVA 2E26A 1WCQA 3E6CC 3IDCB 1POV0 1YI9A 2VZ3A 2WSVA 4OFGA 5FO9B 2BFUL 4QX3A 5I0DA 2VG9A 1PGW2 4MXWA 3E5UA 2J1RA 3OEAA 3VZOA 2RJKA 4CYDA 1EPZA 2NQYA 4W8JA 4KWKA 4CXWA 2Q8CA 2ZZQA 4YW7A 2AEZA 2ZZJA 2W1QA 1AUYA 1RUE3 4CCJA 4RR3B 3KB5A 5C7GA 2VD7A 1R091 1UY2A 2EXKA 5FBZA 1QJY3 4P08A 2WS92 3M2MA 2FDIA 2YGLA 4QKFA 1MVQA 1Q56A 1DF0A 4HKOA 4I01A 4LUMA 4YZ3A 4FPHA 3VD5A 4QPWA 4CDQA 1RUG1 4CCCA 5L36A 5DDJ1 5FY7A 3O1TA 3S30A 2RM23 3LD8A 1SEFA 1DYOA 3K51A 3K4DA 4N9IA 2W52A 1QKQA 3T2PA 1NKGA 1O8SA 1GNHA 2GH8A 1OUXA 1X33A 3WF0A 5JXJA 1W2UA 2Q4SA 4G9SB 2XUMA 3O0XA 5DUVA 3JQXA 3T2TA 4ZU7A 2HWF3 2JDAA 2VXRA 3I2GA 3ZSMA 3FHIB 4GIQA 4CXXA 2C1FA 1N3QA 1OOPA 1YC61 1VRH3 3F95A 5F2WA 4Q1RA 1YEWA 3WG1A 1KS4A 2VW1A 5A7OA 3FWEA 3VBFA 4Q4W3 4AVSA 2R32A 4BZ4A 4DEQA 4H2AA 1AL22 5EYYA 3UKVA 2FDHA 1UOBA 5FY5A 3H8OA 3HT1A 2XR4A 2ZKNA 4P14A 4P02B 3ZR5A 4M0NA 5FPAA 5L9RA 4XOGA 1BVP1 2D3SA 1YLLA 3R0RA 1W9SA 3HWJA 5FYMA 1V9U1 5C9AB 4ES8A 3L9JT 5J36A 1NX9A 2PFWA 3AMMA 5FV3A 1WA4A 4MLOA 4QKNA 1POV3 1ENQA 5FPLA 4PDWB 4QB1A 5T5LA 2FD8A 4BCUA 3AXDA 2IFWA 4FPEA 4XJ8A 5K0UA 1JZ3A 1F5JA 1YQ8A 1RMU3 4LJHA 1RITA 4XXAA 4GMP0 4XFIA 4LO6B 2NP0A 1LHUA 4CP0A 5DAXA 3VZMA 4OMDA 4CP9A 2DUPA 3KMHA 4D0QA 4LLFA 4NROA 3WD5A 1S0EA 4W65A 1TZOA 5JIUA 3C7OA 2FBEA 2R16A 3PDQA 3V0BA 2D6OX 1LGCA 3POFA 1GKBA 1J3RA 4OLLA 1UKGA 1MS3A 2P3KA 3POEA 3R05A 2GC3A 2BPA2 3PTRB 4JKMA 3ILNA 2WZPP 4ISQA 1YFUA 2F4LA 5A33A 2RHPA 4IV3A 4RSUA 5C3OA 4UBGA 1BMV1 3HVDA 3DV8A 1LU2A 3KV5A 1FNYA 3ACHA 3RRDA 2WWJA 1OF4A 1T6BX 4XF4A 1Z78A 2R063 3DEMA 5CU1A 1MS9A 5FZIA 2BU9A 1KJLA 4ATFA 2BOJA 2VTXJ 2QQOA 3AJZA 4YM1A 1WW4A 2WIIB 3ZXFA 1BJQA 2RR12 3RNSA 4Y1YA 4FPLA 3WW3A 4YZ1A 3J8F1 3FE5A 3CMGA 3PU3A 4K40A 3FBYA 4KNCA 3BGAA 2A5ZA 4TSVA 3WG2A 1MS4A 1NA1B 5DG1A 1O4YA 4M3CA 1MVEA 2PHXA 3IPVA 1VPHA 2GMPA 1PX3A 4DXSA 3W59A 1X9PA 2HEYF 3BU7A 4LEJA 3POIA 5GKAC 3SEPA 3BOWA 3K75B 3N9QA 5FPUA 4GD4A 2W46A 1O3TA 1WBLA 3H42B 4ZU4A 3OUJA 1NCRB 1MEC2 2V73A 4QXBA 5BNQA 4RQPA 5A7NA 3ZLIA 4YGCA 3VD4A 1S2KA 1SLLA 2VU9A 2FDFA 4GB32 4FOYA 4HZFA 2IFRA 2Z79A 1BQPA 1B35B 1ZVFA 1ZYBA 2D98A 4ZONA 1UKRA 3OYWA 4ITCA 5H9QA 1JZ5A 2IVJA 4QQPA 1F4HA 5FK7A 2SLIA 4XJWA 2AENA 3KS7A 3MIHA 2DFCA 4YG6A 3CKHA 1DGLA 2ZHLA 1QIQA 1KGYA 2ZOEB 3FC0A 1QH7A 5AFEA 5ACA3 1YFXA 1LHNA 2YXSA 2WNVA 2PHFA 2DFBA 2YU2A 1D0HA 2HEVF 3OSDA 2DUOA 3KZ4C 4MHUA 2V72A 4PJYA 2X05A 3WNKA 5IK7A 4RHV1 2YPDA 4KG8A 2MHFA 3IWZA 4OI4A 2Y6JA 3RYRA 5FY0A 1UD1A 3T4HB 3UGGA 5A70A 4CXYA 3C7HA 4L92A 1CVNA 1CWPA 2ERFA 3B5LB 4Y24A 1U5IA 1CAUB 1D4M2 1G9DA 3AZWA 1RUJ2 5FP4A 1VRBA 2HWD1 2VBBA 1W99A 1ZBA2 3MUY1 3J7MA 3MLJA 2VXJA 4BQ1A 2Z2SB 5J1XA 4N90A 1FT9A 1H2NA 2AH2A 4Y5SA 2WJSA 2CWSA 3G6JB 4L9BA 4EWAA 2UU8A 5LA9A 1C1FA 2R1DA 5FZMA 5FZBA 3WF3A 3ZYGA 1WLCA 1PNFA 4XFGA 3A7QA 4Q1PA 5CBLA 3CJXA 1DQ1A 1R081 3ZYPA 4DXZA 2BV4A 1OKOA 4QPYA 5LA0A 1Z7S1 1YFYA 1M4WA 1RUD1 2WBKA 4AI9A 2BWAA 1MQTC 4NPLA 2D6PA 4AHWA 1UWWA 2ARAA 1OUSA 2QQMA 2FMYA 3POJA 2VUCA 2WO1A 2Z5WA 1XSQA 4WZCA 2HWE1 1GWMA 2A6YA 1OHFA 2JJ6A 1PO13 1W8NA 2WO7A 1IG3A 3ATGA 4FPCA 5FZ4A 4F83A 1LHWA 5FP7A 2D3PA 1BLZA 1XSRA 1STMA 2VR4A 1JOJA 1MS8A 3CJIC 1OFNA 2XKOA 3OGJA 4WVMB 2HWB2 2FZ1A 1HIXA 1W90A 3LQCA 4QD2A 1NCQC 1Y7BA 3POGA 2EIDA 1W8WA 3ZPOA 4DINB 3MEPA 4JGZB 3MIDA 4AI2A 3OB8A 2VZSA 3Q8CA 5FFOC 1OI6A 2BJSA 1HXS3 2G1MA 5LBCA 1C28A 4QX0A 4EN0A 1F8VA 5JPNB 1PVC2 5FUPA 4CUBA 3RYKA 2ES3A 5H9RA 2KM2A 2B42B 4E4HA 4EROA 3QD6A 2MNGA 1JW6A 1KD7A 1YO8A 2CGPA 1AF9A 4XUOA 1PO22 4R4XA 5APAA 5L19A 1ZM1A 5F5QA 4RFT0 1GMMA 4Q0PA 3B9CA 1TMF3 3ZVXA 1LOEA 1AX2A 5F9TA 1QJZA 1W05A 4Q0VA 2GZWA 3WNOA 3VHNA 2VVEA 3AYDA 4KQ7A 2YDEA 1PMIA 3THTA 1DDLA 1DQ0A 4Q4X2 5A6YA 3PL0A 2RS13 3SMHA 1BKZA 4BQYA 3QLQA 4PLOA 4GH4C 1O5UA 3DPRB 2HYKA 2CL2A 4QDSA 3DECA 4KWUA 2BFUS 1LNSA 4D3WA 1GU3A 5BNNC 4NHYA 5CYYA 1COV1 2X29A 1AYM1 4M3CF 4A4AA 4EN8B 1CX4A 3VZLA 3IDEA 3MLKA 1TNRA 2CNAA 3SH3A 4PQQA 3VBSB 3ZFGB 5CVRA 4I0BA 4PI0A 5JI7A 2LW8A 3AMHA 2OZ6A 4AI0A 1Y4WA 2C4XA 3LIGA 4GWMA 3UK9A 3VB9A 1SBEA 1D0GA 1V6NA 4PF1A 5JI9A 1QXPA 1YWKA 1C5HA 4OQ8A 1IS6A 2NN8A 2TNFA 1QQP1 2WYFA 1SHWB 1BK0A 4QXKA 1JOBA 1H4HA 1D4VB 1VLNA 2ZGUA 4MGKE 3KQ4B 3DN7A 1CIYA 1D2SA 4UW4A 4XTPA 1K5MB 1WMXA 1RVF2 1AVBA 2VECA 2YBSA 4Z8BA 2CU5A 3MIBA 2A6WA 5FZAA 1NZCA 4CU7A 5CADA 1JI6A 5K7PA 2VZOA 1J1TA 3T09A 2BWCA 2BP6A 4AE2A 1VR3A 2VMCA 2R0HA 2K2SA 5FCCA 2EXHA 2ZGLA 1N1SA 1W6OA 2O8OA 1CAWB 1JH5A 4ES9A 4IGOA 3WW4A 1O5LA 2P3JA 4QHOA 3EJKA 5FP8A 4WVVA 4H55A 3T3YA 4DO0A 3TEZA 4JHTA 3SQOA 4LR4A 1RUI3 4Q4Y2 1RUC1 3BTXA 2BDRA 3TAYA 3I2IA 3ZN6B 1VIWB 2BBAA 5DUUA 2G19A 2WFF3 3E6DA 5A7WA 5DAPA 5L9BA 5EHDA 5FKCA 1DBNA 4ZZ8A 5F3EA 4KH9A 4O7XA 1KS5A 4INDA 2RS31 4LHNA 2QE3A 1VP6A 3AM2A 4CCMA 2E7QA 4YSFA 1VALA 1G7YA 4N43C 2J1VA 2J1UA 1YIPA 5CKMA 5DZFA 4FTBA 2WC2A 4D6SA 2GNBA 2Y0OA 1KEXA 2TEPA 2XJRA 5LBEA 3LA7A 4JC1A 5A3UA 3BTYA 2P34A 2ZX2A 3LA3A 4FOWA 2OKXA 1RXGA 1F4AA 1R1A3 2WZR2 2BNNA 1VBA3 3NV4A 4BHPA 1QJX1 2H0BA 1C4RA 1S0JA 3I2HA 3TB0A 2QQKA 3J4UH 1UN1A 4OHVA 5I0SA 1GQHA 2ZX3A 4RYDA 4WM7C 1E5SA 1Y9GA 2PYTA 1G9FA 2JE9A 4JRLA 3K77A 5HXVA 5FPZA 4D7YA 2IXIA 1L7LA 3GXUA 3OY8A 3CLPA 4KI5M 4D8MA 1UY0A 2D43A 1FMD1 2TUNA 1RHI1 3WUCA 4YARA 3R4SA 2JIJA 5CISA 2VMIA 3HOBA 1OFSA 4LQRA 5EJ3A 1UIKA 3KT7A 2VQTA 1S1AA 1DIWA 1EV13 2AYHA 4NWWA 3MYXA 5ERLA 3B69A 2JXAA 1MZ6A 3MV11 4Z1VA 1MQTA 5CB7A 4Y20A 3N9LA 1GR3A 4K9SA 4N8MA 1TVGA 4NPRA 2ARCA 2RDRA 5ANNA 3I4IA 4BLJA 1K12A 2E31A 4RGAA 4S2FA 5LW9A 4C0BA 3I7DA 3CJIA 5A7QA 1S0BA 4DIQA 3W5NA 1OURA 4RN5A 2WN3A 4XZUG 1DGRA 1I6XA 1NCQA 5IAXA 3K3NA 1W9TA 1AJOA 1BBT3 1ODMA 4XE9A 4XC9A 2DTWA 5FR3A 1RUG2 3SLIA 3UETA 4XACA 4R4ZA 1O6UA 3T2QA 1T6GC 3ZSKA 3VDBA 1FPN3 2VOTA 3ZFFC 3J26N 4D94A 3PJYA 2P6HA 1W2AX 2RMU1 3ACLA 4IEQA 4HN1A 4RD7A 5FQ0A 2Q1ZB 1HQNA 2CDOA 2V5DA 4JCKA 5JMOA 1WLDA 2BERA 4E4SA 2Q8DA 4H14A 5A7SA 3WHUA 3FL7A 5KXEA 1QU0A 1YHFA 4EN6B 3WSOA 4CCKA 1DU3D 2LROA 3W20A 2XL9A 2DCZA 2XONA 1W9YA 3USSA 2Y26A 3VL8A 3VBUC 2GMMA 4R9BA 2XQXA 1X36A 1T2XA 2GDFA 1CJDA 4PIXA 3Q8BA 4QAWA 4YW4A 3VKLA 2KR2A 4HMZA 2YYOA 2OIIA 4XUQA 4JAAA 3POSA 5IVFA 1W6QB 3SKVA 3NNFA 2XVKA 1H1AA 3HN1A 4RS5C 1V9U2 3ZXDA 4YW2A 1PM7A 2C9AA 4GH4A 3K48A 4YW6A 3I2DA 3AKRA 1CAXA 4FPYA 5IJRA 1FNZA 1DQ6A 2FHRA 4DEVA 1PZ9A 2EXJA 4FTEA 5BNNA 4M00A 2GN7A 2QZ2A 3KCYA 4P9GA 1AR92 2AREA 2WL1A 3B02A 2KXLA 4PCRA 4CCEA 2JDZA 3GZEA 2XB6C 2Z4FA 4UYBA 5FY8A 4YVSC 5G05L 3I3QA 2J1SA 3H1WA 1REDA 1UOJA 3AYAA 4ZHNA 2GNTA 4FXKB 5CFDB 1QJFA 4GKXA 1ZRDA 1F5FA 3BCWA 3KCXA 3INAA 4B8EA 3RZMA 1ZREA 1XNDA 2K46A 1YJLA 4LA2A 4FFGA 1UYXA 5FZOA 2FCVA 2E33A 3AJYA 2QQLA 1YIFA 2E9QA 4YM0A 5E1RA 1JYIA 4M0HA 1GWLA 3WNNA 5E88A 2WO3A 3IMMA 4YLZA 3RYPA 2J22A 5FYHA 3UGFA 3VV1A 4OHXA 1BMV2 4IDZA 4IUGA 4W6XA 3ZXLA 1VBE2 4LBMA 1AR82 1RUE1 2QUOA 3M70A 4UF0B 2WT0A 1KITA 2Q5TA 4NN0A 3SXWA 3MFAA 1JMUB 4E2SA 4ORFA 1QJY1 1W6MA 5JXHA 1S0CA 2GP3A 2UYAA 4OI2A 5FPXA 4QX8A 1SFNA 5FXZA 1S2BA 1JU4A 4XJ9A 5CAZA 2RM21 2QQJA 2ZX0A 5AFBA 4CU8A 3I2OA 1FOD2 4AEDB 4BQ4A 1SFPA 4NAMA 3VLBB 4QB2A 3H8XA 1M06G 1RUF3 2CHHA 3ZSJA 2E32A 2HWF1 3H50A 1W8ZA 3LB9A 1UU4A 5LRSA 1DQ2A 3R6SA 3VHPA 2XGXA 2ZS6B 4XHBA 1GUIA 1XE7A 1VRH1 2VZPA 3ETQA 3IKWA 4N43A 5GLVA 5ABJB 4AGGA 1G86A 4Q4W1 5FZ6A 1OD5A 4B4QA 2EICA 1XU1A 4JVAA 4NRPA 1OMIA 4BDVB 4DOUA 2P2KA 4OUEA 5KHJA 2D44A 1MZ5A 1MACA 2RMU3 4X6QB 4LBQA 2VMFA 3OGVA 3JQWA 3VHOA 1VJ2A 1U5XA 4WM7A 1SLTA 4XF0A 3NNLA 5DAVA 1OH3A 3HMYA 3PVNA 5KHHA 4GA9A 2Y6KA 1ASJ2 5BYNA 4OHYA 1R1ZA 3AVRA 5JSRA 3OBRA 4LBKA 1POV1 3GM8A 1JYNA 2ZGNA 1OF3A 3HT2A 4XETA 1ND3C 3AL5A 4NAOA 2VMEA 2D6KA 4FPGA 5BV6A 2AR6A 1RMU1 2W3JA 5F5AA 3ZIWA 3VBRB 4Z2WA 5C4WB 2DF7A 1JHNA 2WO2A 4I30A 3J9SA 3X29B 2JG8C 4N53A 5LASA 5LEJA 3PVOA 4XW3A 4YZ4A 1IQDC 1O7FA 5CFCC 3WG3A 1MEC3 2Q8OA 3CF6E 1V0AA 3ZYFA 4FPOB 1OPOA 4QPIB 1IS4A 2A3XA 3NVCA 2P3IA 4CPBA 3I59A 4FCAA 1C8NA 4CSWA 2XJSA 3B3QE 3LEMA 4GZ9A 1RIRA 5FP3A 3MI8A 5LK7B 4NIGA 5A80A 4PIZA 4CUGA 3U14A 2VL4A 2XBO2 3ZFFA 1CAVA 2JICA 2UWBA 4KGQA 1PK6B 3WNPA 4IEWA 5FY4A 3TWIA 2R061 4FFIA 3T0AA 2PLV2 2VVFA 2HWE2 3H8RA 4WVWA 5FZFA 3H0OA 1LEDA 1OLMA 4QM8A 3WDXA 4MGTA 3HQRA 3M1HA 3N9MA 3LA2A 1UU5A 3MGUA 3VBOB 3LWCA 5C5TA 3RVHA 2G9ZA 4IV1B 1SDDB 3VBUA 1D4M3 2IVIB 1RUJ3 2W1UA 2XVLA 1KQRA 3MICA 3Q9OA 4NE9A 5FYUA 3I3MA 1WD4A 4OUSA 1K45A 4ARXA 4FI9A 3WG4A 4UFJA 3NJYA 4ZKTB 1HX6A 3K4AA 1EUUA 4RS5A 2IXCA 1IPJA 5GLUA 1LULA 4K8FA 3SEEA 3WINE 5JXGA 3NAPB 1PNGA 1EY2A 3M3CA 2H6BA 1OA4A 3SCHA 5IVJA 2WNUB 3MPPG 3N3HA 2B9UA 4CEWC 4PBOA 1OQ1A 2VNVA 4YVWB 5BNOB 4XJZA 4COUA 2G9FA 2ILMA 3ES1A 1CR7A 1H2MA 4YVSA 4Q2FA 2Q8EA 2GC2A 4LBOA 4AR2A 3HEIA 4OZOA 2MEV2 3IBMA 4Q0QA 4CU6A 3D3AA 3AP4A 4JZRA 1SMVA 3SH5A 1GZCA 2PHRA 3ME2A 3VGIA 1CX1A 5E8AA 1V6OA 3MPBA 3AXEA 4XCBA 5ACA1 1G9CA 2VMDA 2IXHA 4M01A 4A7YA 5KR7A 4AFCA 3OOXA 2C26A 1AXYA 3Q8FA 4CDXB 2WQ8A 3ZMNA 3ZYBA 4GAZA 1K3IA 2WLPA 3VUOA 4Y1ZA 4HKWA 5FMCA 2A1XA 2N7GA 4RGKA 1WW5A 2QDNA 3H9AA 1COV2 5J96B 1NY71 1RB8G 4QPGC 3ACFA 5AC93 1IG0A 4H7LA 2XWJB 1TME2 2DU1A 2VNOA 3GGLA 5FY9A 3T4VA 2XJQA 1PMHX 4FT8A 5DPNA 3RMXA 3APBA 4Z92B 1RUH2 2B39A 2W2IA 2ZA9A 5DUWA 4YG3A 3VDCA 2G9GA 4I0WB 5JZGC 1PO23 3K46A 4AEMA 4J25A 1O3RA 2I2SA 3VBHB 2ET1A 1XNBA 5F39A 1H8TB 3GZUC 2XG3A 3WEZA 2CDPA 4L99A 1H0BA 3WP5A 3ZFEA 1OLME 2WYSA 2WQZC 3FLTA 2JDNA 1ZBE2 4XILA 2XVGA 3ASIA 2OT7A 1WMEA 5ANQA 4XEZA 3ACGA 2VE1A 3WZ1A 4XUPA 1OC1A 3RGBA 4C1WA 2IC1A 1HKDA 2B5HA 3HNBM 4HPKA 1PO11 1ONAA 1JHJA 2BTVC 3LOBA 4UI9L 1OSGA 4Q0SA 4B7EA 2C6SA 4CDUB 4P9WA 3JD72 1IHMA 5EJZB 4WM8B 3QBQA 1JTZX 2KD7A 3LEKA 3I97A 5FY1A 1CGPA 3U10A 2A75A 1GNYA 1QXJA 3QH6A 4JGYB 3VZNA 2JKXA 4W50A 4BQXA 1BCXA 1LJ7A 4URTA 4H3WA 5EWSA 4NIAA 2V5YA 1XXNA 3LOIA 4CU9A 4E2GA 2R30A 2ZAHA 3AB0A 3PVEA 4UOJA 3D0SA 3NNJA 2B45X 3BOPA 2PQSA 2GMEA 1LCLA 1RC6A 1HXS1 1TNFA 1RUC2 4JDMA 4L11A 4NR1A 3SNMA 2R6QA 2R071 2VPVA 3WP3A 4MGYE 4MGQA 4YGEA 4GXLA 2DCJA 4IGQA 3MIFA 4IETA 1VBC2 3OF1A 1V00A 2XKPA 2RS32 3FLPA 2PXJA 3I3BA 3OBAA 4V2VA 1LEMA 2X8KA 5BNPC 2JG9C 5LA2A 3TN92 1ND3A 5GALA 3R4UA 3QH7A 3AC0A 1UOFA 4XIKA 4AAXA 1RVF3 1ND2C 1TMF1 1G8WA 2RV9A 4XQ4A 1WCDJ 2JG8A 1PZ7A 5AVAA 2JDMA 2JD4A 3VDDB 5IK4A 5JDBA 2AACA 4NOTA 5CFCA 2GU9A 1QJU2 5HCAA 2RS11 3FMGA 3BIWE 4QHBA 4QXHA 4DZGA 1ZRFA 2OVUA 1UYZA 4E27A 3CQOA 3SISA 1WBFA 3NW4A 5DUXA 2YC2A 4UFIA 1GZWA 3VBOC 1CPNA 4HVOA 1AYN2 1OLQA 2Y6LA 1XQNA 1RHI2 3O12A 1HJFA 5DXDA 1A8MA 4EN9B 4Q4Y3 4AI1A 2QQNA 4LA3A 3IDAA 1RYYA 4UFMA 5FWJA 1HRI2 2NPIA 3DGTA 2A6XA 4E8DA 4YZ5A 2JIGA 5C8CC 2WSUA 4COYA 2E53A 2QTWB 1QF3A 4KU8A 4WBBA 4CDWA 2ZGTA 3WDTA 4D6QA 5B4NA 1QNYA 4BA6A 3SCFA 5LY1A 4BM8A 4H7MA 3WQ0A 1S55A 3MHZA 5A6QA 2V4AA 3BPSA 3GCXA 3POYA 3PLQA 5C5UA 4SBVA 4YG0A 3KV6A 1GQGA 1UX6A 2W39A 1C57A 3FLRA 4XTMA 5A32A 1F15A 2OPKA 2WWUA 3OG2A 4GMP3 3ZXJA 4A7ZA 1PGL1 2BNOA 2CY6A 5EQUA 1SLIA 4AQSA 4IEVA 4QT6A 5CIRA 4B4PA 5IYYA 2EA7A 1C8M2 2D7FA 4QWNA 5F1RA 1RXFA 3AP9A 4LITA 4ZS3A 2X5IB 4RR3C 4AZZA 3OD4A 4V1PA 1CQ9A 4LBLA 4YYOA 2A3WA 5GLTA 3TBDA 2VQAA 3FJSA 2JENA 3ABZA 2ZGOA 4AF9A 4PHZA 4Z07A 4PLNA 5GJ6A 4EYUA 3EHKA 4LMFA 1NE6A 4C91A 4FSJA 5FZCA 4XFCA 4HN0A 3USUA 4IEXA 1LECA 4CEWA 1NOVA 3GJBA 1AR63 3KWVA 1NAEA 2OUJA 3LDRA 1RUI1 4IW3A 4NRMA 2W0XA 4XURA 4G4FA 1PZ8A 4Y22A 2YMZA 4PBPA 1GOGA 4XYXA 4GKYA 2WFF1 2OUHA 4HK9A 4QX7A 3O7OA 1JUIA 1V6LA 1W2NA 5F7UA 1OVSA 2A71A 4BQWA 2ZEYA 4DY3A 4X8NA 2XJUA 5GZDA 5FKBA 4NVPA 1Y3TA 1DG6A 3HNYM 2PAMA 4CA9A 4DY5A 3S0MA 1XYOA 2A6VA 3GDBA 3GZTB 1KJRA 2W94A 5E6HA 1UL9A 3DXUA 3OD0A 1HB4A 4GWNA 4W6WA 2JDPA 2XLFA 5JCTA 4K3UA 1DLCA 1R1A1 4PIYA 4YGBA 5DN2A 2WINB 4GJYA 1VBA1 2XHKA 3PMEA 1XNTA 4N7UA 4QPGA 1AZDA 2R042 2DU0A 1BYHA 1HB1A 1Q8QA 1QWRA 1SPPA 4ET7A 1DYKA 5C9AC 3GF6A 3VKOA 1YUDA 4Q4V3 3V0AA 2XHNA 4MVTA 3WV6A 4AFDA 4CP2A 4D6RA 1IPKA 1PIV3 4MOAA 5JZGA 3H1YA 4PDWC 1U12A 2P37A 1C1LA 3URFA 1X7NA 4XVHA 3T1LA 5T5PA 1LESA 1EV11 2ZEWA 1ZZ7A 2ZGQA 2VW0A 3HAGA 1O91A 1QOTA 3I54A 1QH6A 3I3EA 3JBG2 3PUAA 1LKNA 2K0GA 1N3PA 3H3LA 4XF3A 3OPZA 5FYSA 5EV7A 2ZMLA 3ZX7A 1V9U3 2TBVA 2GC0A 4XFFA 4XQWA 3AKSA 4OI0A 1WUVA 3NJVA 1RUE2 4BQ5A 2RJ2A 4AFMA 3M3QA 1SLBA 3PMSA 4NRQA 2AUYA 3PUIA 3RMYA 1JZ4A 4LKDA 5KXDA 4A3ZA 1ST8A 1XE8A 2R1BA 1Z0HA 4TN7A 3NNMA 1XOYA 2Z42A 1AR93 1QXRA 4EQVA 1BBT1 4R52A 4RL7A 5DAQA 2EVXA 2VCBA 1FAYA 2DBIA 2BRTA 1TE1B 2Q1MA 2RM22 3ACIA 5FRAA 3UYJA 5DQ0A 5FJKA 2EIBA 3LAGA 1BHGA 1FPN1 4JKKA 1E5HA 2BOIA 3ZXEA 1ZA4A 3IB3A 4UFKA 5A3NA 3M4FA 1ODNA 3A0KA 1UU6A 3I2FA 2F17A 3VD3A 1YI7A 4CEYB 1AR72 4XFBA 5D21A 2D6NA 5GZGA 3LEIA 4HSJA 2HWF2 5IAVA 4DRRA 2PMWB 5BPXA 4JDNA 2RS51 3LPFA 5BNPA 2JG9A 5EP9A 5FO7B 1PGSA 2CWMA 1IQAA 4XF1A 1BEV3 1XU2A 3AZXA 5H9SA 2OYZA 2HYXA 2C0ZA 3ELNA 2DURA 1NA1C 3D82A 4HL0A 1J59A 3JUUA 1W6PA 1ND2A 1JYTA 1VBE3 3ZO0B 2XPJA 1AR83 1W6NA 4XBQA 1XJAA 1LHOA 3HJRA 2OXBA 4CP1A 4QMAA 2BQPA 1CD3G 1WLTA 1WWYA 4X6RB 3E5XA 1NCRC 1JU3A 3LE0A 3N7MA 4A45A 5D8AB 4YZ2A 2R7EB 1PX4A 4FP3A 5IATA 1BXHA 5LK5A 2CSGA 3IM0A 3O5SA 4XBNA 4OMCA 1FOD3 1B35C 3NWKA 5BUVA 4OQ9A 5IHRA 2ZEZA 2W68A 1UPIA 2DVBA 5C8CA 4R9AA 2DUQA 1I5ZA 1AXZA 2GNMA 3THDA 1ULEA 4E4ZA 2BGOA 2W47A 5J7MA 2WNEA 2VCAA 3DUIA 4P00B 2YROA 1UY1A 1EAH2 3AYEA 1UIJA 4K21A 3Q8EA 1HV1A 3CBNA 1SZBA 2LRPA 3LIHA 4ONUA 2BGCA 1U0AA 3PVBB 2VBDA 1HRV2 2D6LX 5FIXA 5LEKA 1B09A 4MXWB 1L7RA 1POQA 4KGGA 3W21A 4E2QA 4I2OA 2D93A 5LWBA 3WNLA 5FYZA 1X82A 3EBRA 2DTYA 1OQDA 1W8OA 4XHXA 2BBVA 1ASJ3 5CZKA 1YQ6A 2JB4A 4QX2A 1LGBA 2DBNA 1YQ5A 2GH2A 2Y60A 4RR3A 4W4ZA 3U4SA 3PIGA 3ZYRA 4BXSV 2UURA 1CPMA 4XQDA 3FZ3A 1XNAA 4AXOA 2I74A 4BIOA 3AZYA 2HWC3 5A3OA 1WLWA 2Y0IA 1AX1A 1V6MA 2VOXA 1WD3A 3I2JA 5FPVA 5FTTC 2WUHA 4CDQB 5L7OB 4P9YA 2YFUA 2JDKA 3AMPA 4ISRA 5KHIA 5JOXA 5IVEA 1RGSA 2QQPA 4QU2A 2Y6HA 2EF6A 4XJUA 2XXZA 3B93A 3WF4A 4C0HA 5F3GA 4CCDA 1REEA 3B01A 5M0TA 5JXIA 4DS0A 5IUQA 1VBB3 5LB6A 1QHDA 2XMLA 3ZYHA 1RUF1 2ZX4A 4UWDA 1NZIA 5B2GB 2JE7A 2P1BA 5BXXA 2CV6A 5C33A 3THCA 1OOPB 3THPA 1ACCA 4XFHA 3ES4A 3VBFB 1MZFA 4FQ4A 4QGLA 1QMJA 2HBTA 3WW1A 1V6KA 2ZGMA 4Y5Z0 2ZMKA 4NUBA 5FBJA 2XBO3 4Y4YA 2VGDA 4COWA 4JGZC 3MF9A 1NE4A 3L2HA 5I0RA 4IEOA 5F32A 2ZX1A 1CZVA 2J1TA 4FPJA 4J1WA 5FYVA 1ULFA 2P3YA 2PLV3 4OULA 1Q5OA 4WZFA 2W9XA 5C9AA 2D6MA 5IK8A 2ZGRA 3KGZA 1UQXA 4YFWA 3WF1A 5L7OA 2UWAA 1R092 3VKFC 5A3LA 4PDWA 3OGRA 2VY0A 3P3PA 2X09A 3FUQA 4Z82A 1NXD1 4FAGA 4FAHA 2UY8A 1CONA 5K0UB 4I3GA 1QGLA 1FYUA 1DQ4A 4O9GA 5DDJ2 5FMOS 5C71A 4A6SA 2FDJA 2GP5A 1Q43A 3ZXKA 1VB4A 3FX3A 3VKNA 4OI1A 1OPMA 5HCBA 2IZWA 1IKPA 1NXMA 3AX4A 3B7MA 3HN3A 1VBD3 4CP9B 4TYSA 4ZXKA 1Q8VA 1H6XA 1PVXA 1UZYA 3ITQA 1W2TA 4BH9A 3LGRA 5IW0A 3NV2A 1G9BA 2LM3A 2PHWA 5HI0A 4OCTA 3HBZA 3V0BB 1Q8PA 4HVQA 2D5HA 3ZIXA 1O3SA 5FDBA 3DPRC 5EPAA 4K7JA 5FO8B 4BPZA 3OPWA 1N1YA 5A7PA 3DYMA 1NQJA 5J3UA 1MZEA 1CZSA 4L0PA 1W8FA 4EZHA 3VZJA 1A6CA 4X8PA 5KXCA 5J09A 4COVA 1UPSA 5A33B 4IV3B 3AFKA 5C6CA 3V56A 2ZGKA 3RJRA 2MEV3 2YC0A 1NT0A 4KU7A 2QBXA 4PLMA 5LY2A 3VBSC 3ZFGC 4DXRA 3WP4A 2WQ4A 5HV0A 5GLWA 3AP6A 3MO4A 4BE3A 4HVRA 2OQ7A 3HIFA 5HXMA 2WS93 5F37A 4YM3A 1ULDA 5T52A 5A3TA 4IGPA 4YRDA 4S2HA 2JECA 5D8AC 1NLSA 2FQPA 2W95A 1V6JA 3RG0A 4XIOA 1K42A 2J1AA 2DDUA 1GANA 3WQ7A 3U11A 1DZQA 3S5AA 1NA1A 1D4M1 3KSCA 2W87A 1RINA 5IVVA 1RUJ1 1W0NA 4M3CB 1W0OA 4N7IA 3IPVB 2O0OA 1TME3 3NKGA 5JOZA 3UT0A 1K5MC 5A6ZA 5F3IA 1XB9A 4P5HA 1ENRA 3WCSA 2E7TA 1RUH3 1TQ5A 2R072 2XWBB 3A4UA 2VZTA 3N7JA 4R9CA 3ZPYA 3D6EA 3FHQA 1NCRA 3S7IA 4A7KA 4RQPB 3JU9A 4J6GA 4UAPA 4HG6B 1AL23 5EJ1B 2WT2A 3POBA 1E5IA 4CTEA 4G3YC 2QQWA 1GNZA 1ZBE3 4OUMA 1B35A 3LSDA 3P3NA 3ZXAC 5HPOA 2CAUA 3OYWB 3RZKA 2ADDA 2ZBJA 5J37A 2ORZA 2V09A 3SKJE 1TMF2 5FWEA 3M3IA 4E4DX 4P9LA 5J98B 1ULOA 4B3NA 4NJ4A 1DYPA 3JD73 3NMBA 1AHSA 3U4XA 1YCIA 2RS12 1QDOA 1I3HA 2VZRA 2WNVB 3WNMA 3OCPA 2DCYA 3CU7A 1HN1A 3OUIA 4CDQC 4L8QA 3SHRA 1MPXA 3J8F2 1W8HA 2D5FA 5AVPA 2WZEA 4LIUA 3VZKA 4BWOA 5FZ0A 1KXGA 1U5YA 4ATEA 5F5CA 4JDOA 3J7NA 4LHKA 2VNRA 1CAUA 1SDWA 2W92A 2J7MA 3LFMA 1QY4A 4I02A 4NO4A 3Q8AA 4BU2A 4IE0A 1A8DA 4AVAA 5AC91 2X53S 1GLHA 5FUNA 2UWCA 3I49A 4DPNA 3OGSA 3O0WA 1VBC3 1XYPA 2ID4A 3JZVA 3KV9A 4HSLA 4AVVA 3ALQA 5CKNA 4XPVA 3IMNA 3ILRA 1UAIA 3JB8A 5FZ1A 3TN93 4CUCA 3V65A 4XZPA 3GYDA 1VMFA 1PO21 2W5FA 2QFEA 3O1MA 1W06A 3MDPA 4MO3M 3NJXA 4ZU5A 2ZEXA 4PF5A 4EJRA 1G9AA 4Q5OA 1HDKA 4QQ2A 4UW6A 4D7TA 1PGL2 1LOFC 1MS1A 2OA2A 2VUJA 5FPBA 4DFSA 2EIEA 2PHDA 3E5QA 1UO9A 1QJU3 3WDVA 3LDKA 1HQWA 1WMDA 2VZ1A 4LULA 2RR13 3V0AB 1UX7A 3VN4A 5IFTA 3ZM8A 3W9AA 4GJZA 3N7KA 3HR9A 3FFZA 1AYN3 1LENA 4HFSA 4QKDA 4WVMA 4XBLA 4Y1VA 1BK1A 4P9JA 4A41A 5SV8A 4AGRA 2OQ6A 3E1F1 3G7DA 5T55A 2B7YA 4BB3A 4CE8A 1HRI3 4ARYA 4RHV2 3GZAA 2DYCA 4BMEA 1GFF2 4JGZA 2YU1A 4B29A 2DVDA 1FI2A 2WA4A 3DF0A 1W3XA 1RUI2 3A21A 4NHMA 4B1LA 2ZABA 3K2OA 4CVUA 2HWD2 3AFGA 1UY3A 4MGIE 1N47A 2ZHNA 3C8XA 3BPZA 1IOAA 2YG0A 3BN6A 4HBNA 5T54A 3WQ1A 4ZY9A 2JWPA 3J7HA 4GB33 4BK5A 4UW3A 1UZWA 1R082 1WGPA 4AGVA 3BB6A 1XNKA 3MUZ1 2WR9A 1Z7S2 1RVF1 1C8M3 1I9RA 5T3NA 1RUD2 2VMHA 2YPJA 4RGGA 5CKQA 1VBA2 3ZDSA 1NG0A 5J48A 3DKQA 4LKEA 5FP9A 4CCNA 5FYTA 1GOHA 4KBZA 3TOJA 3U07A 4EWDA 3I3DA 1YNAA 2O8QA 4BMBA 5F2SA 4Q27A 3ZN4A 1HLCA 5GM0A 3O14A 1ZZ6A 3DPRA 4CZSA 4LOTA 5JSOA 1US2A 4YGDA 2ARXA 2OW4A 4XAEA 5EYXA 4CCLA 3ECQA 4R9DA 4MH0E 2JDYA 2I07B 4Q4Y1 1DHKB 2VJXA 4XCAA 1ULGA 3KF3A 1ZBA3 2AC1A 4IESA 4LK7A 3R4DB 1X8EA 3KV4A 3ORJA 3NRUA 3VBSA 3ZFGA 3ZN5A 2SBAA 5CG9A 4NHXA 3WDWA 5CFDC 3PUHA 1WCSA 3D5OA 4LPLA 2EAKA 5F6LB 2ENRA 2LALA 2ZXQA 4NPMA 4AFBA 1ZZ9A 3MW4A 2RVAA 4ZZ5A 2QQIA 1I5PA 3CHXA 3K3OA 2EAAA 2P4EA 3N9OA 3T30A 1H6YA 1SACA 2Y6GA 4AWDA 5A6XA 1UYYA 3U78A 4AQ2A 4GMP1 1MS5A 4A42A 4BK4A 4TLGA 2R043 3K4ZA 5FUIA 2F4PA 1ENSA 2NYYA 1K5MA 2ETEA 2B46X 3LFIA 1FPN2 2OZJA 3ZKYA 2A70A 3JCIA 3B00A 3H3ZA 4BLIA 2XDVA 3RQ0A 3SC7X 1DZRA 2HWB3 4LHSA 5JR2A 2WNVC 1W8UA 5I8TA 5JLVA 1JN2P 4L2NA 1W6OB 2RJLA 2RS52 1CAWA 2RDQA 3NJZA 4LNVA 3WCRA 5GLZA 4ZXEA 1KDMA 1LOGA 3GBWA 3JBG3 1AR61 1ZX5A 5DABA 1AYM2 1PVC3 3OGGA 4AEDC 4NHKA 3ZN6A 2XQRA 2AEYA 3IIIA 3FBMA 3OBTA 5IFPA 5A7WB 3NV1A 2QNKA 1JOPA 1LOCA 4TLFA 5F8PA 1JYXA 2VM9A 1OLRA 3V64A 2BUKA 3P6BA 5T5OA 1HQLA 3ZYIB 5ABJC 2DVGA 1K5JA 5IVYA 4NMIA 4XAAA 2H6CA 2Y6FA 4FO9A 4ASKA 3ILFA 3B94A 1VMJA 3MZHA 1HV0A 3OEBA 2ZHKA 1QQP2 4F7ZA 3ST7A 1H2KA 3A22A 2BZDA 4QDQA 4AI3A 1C3HA 1DZTA 3PTYA 4XMAA 4K8RB 1W39A 3CNAA 4O61A 4MV2A 4Q4X3 1AR73 4AHXA 4UBHA 1GP6A 4YW5A 4OHZA 1S0DA 1GYKA 1JYCA 1O59A 2A6ZA 2WN2A 4XFAA 3H8UA 4BQ2A 5KBFA 2C5DA 1UOGA 1UMIA 4Q4V1 3WLUA 2Y38A 2ZACA 3OY8B 2E63A 3ROUA 1PIV1 4RA0A 3S6PA 1BZWA 1NLQA 5T5JA 4QM9A 3WY6A 4IE5A 3S7EA 1H8VA 2YBPA 3JB4C 1F2NA 4Y4RA 2GAUA 3PU8A 4QX1A 4Y5TA 3IAQA 3VDAA 3BALA 4JV4A 5B4XA 4Q8LA 1LOFA 3N7LA 1J84A 1MQTB 3F2ZA 3UL2A 3VBRC 3VHRA 5A1FA 5C4WC 1RL3A 2AGSA 3RZZA 5FYBA 3GALA 3HD8B 3PJQA 4Y20B 4A3XA 4LXLA 2XL7A 3LKJA 1CZTA 5JWPA 4UXAA 4AFAA 2DCKA 4CRQA 3WX5A 2JEMA 1US3A 3CJIB 4LE4A 4QDRA 1JXNA 4QPIC 5DG2A 3O1VA 3RZGA 3BODA 5DZEA 4QXCA 3P1IA 1YXWA 5CA6A 4GWJA 4MADA 5E89A 3UKTA 1NCQB 4HANA 1AR91 1UW8A 3KHBA 5IWFA 3ZXGA 3BU0A 4LO7A 1LAJA 2Q0AA 2Y8KA 3KVBA 1UNBA 3C7EA 2YGMA 1TG7A 1WA6X 4Y1XA 2GSYA 4UT5A 3O1SA 1RJ7A 1PK6C 1QJX2 4UW5A 2C9KA 2YC4A 5K8SA 5K9YA 5JAXA 3DXTA 3PUQA 1EAH3 3WUDA 1RUF2 3O1RA 5FQ0B 1ZZ8A 1UZ0A 5TSWA 1UF2C 3O1UA 1P8JA 1FV3A 1HRV3 4YPJA 2BW8A 3PUSA 1FXZA 4LO8A 1FMD2 4K6BA 1BEV1 3L2YA 5KC6A 2ORXA 3A0NA 4JX0A 3ZSEA 1TEIA 2E6VA 4IV1C 1X9TA 2JE8A 2F6BA 2Y33A 5GZCA 4TTGA 4AI8A 5I91A 4DXTA 4V2WA 4AQ6A 5JOYA 2FZ2A 1H2LA 5FMOL 4NIHA 1VBE1 1AR81 2IUWA 1URXA 4OVEA 4ZS2A 1W6QA 2VZVA 1RJ8A 1Y9QA 2A73B 2QQUA 4LKSA 2JDUA 5FREA 5FZ8A 3PHMA 5LA1A 1D2QA 4IE6A 2FDKA 4JTOA 1L7QA 1OVPA 1U5ZA 3MBWA 3NAPC 4GH4B 1O3QA 5I8YA 1CAXB 1RTVA 2DWRA 3HPNA 3BTAA 3ZYJB 2WNUC 1N1TA 4AOCA 4D69A 2WZR3 3LSEA 5IK5A 5BNNB 1FOD1 3NV3A 4YVWC 1QOOA 2HEWF 1KFXL 4W6YA 4Y1UA 5BNOC 1VAVA 3RS6A 1WMFA 3SCGA 5IVCA 2XJPA 2BGPA 4N9HA 4QKBA 3DYOA 3M3OA 3NSTA 2VW2A 3KGLA 3UKNA 4AHYA 4FVVA 4BJ0A 1LR5A 2JB8A 3OJBA 2HH9A 5CFDA 3TEWA 1BVVA 2RMU2 2D40A 1GICA 3RI8A 4MYEA 1OH4A 4FPFA 1S4CA 4META 4CDXC 5FZDA 3AKTA 5FZOB 2G4IA 5KWRA 3T1MA 1SCSA 1XC6A 4YFZA 1KRIA 4Y26A 3BUCA 2VVDA 5KXBA 2WWSA 4PT6A 2QQVA 4Q26A 3GBGA 2C24A 3U75A 3ON7A 5C3PA 2BEOA 5IVBA 3LPGA 3PIJA 4FOVA 5LZ6A 3KF5A 5T50A 5JVVA 1ASJ1 4LT5A 1Q8SA 2IXKA 4Y3OA 3WHTA 3GHNA 3BKZA 1WCUA 2XJVA 4IL7A 4BYYA 4UF0A 4HK8A 1R093 2W08A 4KL1A 4FP2A 1SCRA 1DCSA 2HWC1 5SV5A 3MV01 1W6MB 3MF6A 4Z2AA 5FK8A 1W03A 5I0TA 3VBHC 3RZJA 3OUHA 4ZPIA 1H8TC 1RUG3 2W1SA 5DDJ3 1EYBA 3T2OA 5LBFA 4LKFA 3OPTA 2VZUA 3D4KA 4LE3A 4O65A 2WFPA 1J58A 2ZJCA 3OTFA 2R0FA 5FXWA 4AEDA 1XNCA 4AEKA 4FTSA 5EXOA 1APNA 1Q8OA 1XYNA 1VBB1 2HKXA 2PHUA 2ZGPA 4YM2A 2VOWA 4K1ZA 1DP0A 3H3UA 4IEUA 2VO5A 1NLRA 3UV9A 2W91A 4CDUC 2VOVA 4N43B 2VULA 1UCXA 5EFUA 4DUWA 5ABJA 1H9PA 1WCKA 3NQHA 3WT3A 4WM8C 4DUXA 3U0ZA 3QCWA 3MFCA 1AXKA 1N3OA 4JGYC 3AKPA 2XJTA 1RUNA 2PELA 2Y64A 1J3QA 4LOSA 2XBO1 5E16A 1ZRRA 4E8CA 4LBQB 5JR7B 2XOMA 2ET7A 1CESA 4I0AA 2CAVA 3LDBA 3PURA 4OYUA 4WM7B 5FZHA 2PLV1 4QQHA 5G04L 4M3CE 3S5QA 5LATA 3KT4A 3ZOIA 2UY9A 4LO4B 1JS9A 3RI9A 5D1IA 4F3JA 1GZTA 3UJQA 3PNAA 2P6CA 1QJY2 1H4GA 5FAXA 5FLJA 3AZZA 3NNGA 1JUHA 3FN9A 4K1YA 3WVJA 3IAPA 5FOJB 3WR0A 4C8DA 3VBRA 5C4WA 3S57A 4N53B 5A1AA 4LO5B 1VBD1 2R073 3VDDC 1AJKA 5AC92 3M7AA 1CJPA 1DGWA 1S0FA 3RZHA 4LK6A 2VOKA 4EN7B 5A1LA 2JKBA 3AP7A 3POWA 4A44A 2FDGA 1XBFA 4QPIA 1N1VA 3AP5A 4B1MA 2HJIA 1VRH2 1DQ5A 4WV8A 4M4RA 4XDQA 4P9XA 1PGW1 4Q4W2 1XRUA 3I59B 4P5YA 2J42A 1GOFA 1SBFA 2VBPA 1LGNA 4QB6A 4E9KA 1W28A 4MGZE 2B9VA 3H1MA 2MEV1 2VQ0A 1CAVB 3ZFFB 2LUWA 2ZPXA 1PK6A 4YW3A 3MW3A 2PHLA 1NQDA 4AL9A 2WT1A 3AMQA 3WXPA 4FFFA 3CO2A 4XABA 3EB7A 4A2UA 3W58A 2WS91 5HCFA 3MIEA 1EP0A 4QGNA 1MS0A 1PMJX 1SG3A 1ZZCA 1VB2A 4MGSA 1HJGA 1UZZA 1YQCA 3DYPA 3J8F3 4CCOA 1CIWA 1UXXX 3VBOA 3VD9A 3KHCA 3D0JA 5FJHA 5FZ7A 2VTXA 4IV1A 4Y33A 3VBUB 4C90A 2RDNA 3GBFA 4D7SA 4FBFA 1A78A 1S0GA 3CZJA 5A3PA 1RMU2 1X50A 2LS6A 5KHGA 1TME1 2A3YA 4M4PA 4I3PA 3O0VA 5DZGA 5KC5A 2FCTA 2VC9A 5KHKA 2X5IC 1RUH1 4RS5B 1LOBA 2VMGA 3C3VA 1KFUL 2OPWA 3HNMA 1H1MA 5A3MA 3KT1A 3NAPA 1FATA 5FZLA 3IZOA 1AL21 4GWIA 3BIEA 2FMDA 3RDIA 3TEYA 3KM5A 4BOWA 2WNUA 1UZVA 1ZBE1 4YVWA 5BNOA 3SH4A 1A3KA 1GZ9A 3CEWA 2ZKLA 1DFQA 3WNXA 4YVSB 4GALA 4URAA 1NYWA 4AVBA 4P9IA 4EZ4A 1YQ2A 3WF2A 2FCUA 3H7YA 2DVAA 3EYPA 2R062 3NO8A 3JD71 1MR5A 1JZ7A 1W0PA 3CIHA 2ZCWA 3GCWA 4BQ3A 2CYFA 4AYUA 1UY4A 5FZ9A 1HB2A 1H1IA 2VTFA 4CDXA 4GULA 1S2EA 4RHV3 4YWAA 3A23A 3E6BA 4LBQD 1F35A 4YW1A 3FHAA 4AVCA 5GZEA 2KA3A 3N4MA 1IZ3A 1NUKA 5FOBB 2WRAA 3UNPA 4UFHA 1E57A 4U36A 4Q0UA 4JTNA 3RWKX 2HWD3 3EMRA 5JOWA 2ZMNA 1ZZBA 1IKQA 3U1XA 5CG8A 4J1XA 2PHTA 5I93A 3BI3A 1VBC1 1FV2A 1W8TA 1VAMA 3VD7A 1C5IA 4EV0A 3BVCA 3TN91 2LTNA 4FPKA 1OA3A 1Y43B 1GBGA 2BVBA 3GHMA 1H30A 2O14A 3UJOA 3VBHA 1R083 1H8TA 3KVAA 1ALYA 5EIYB 4XJAA 3ZFEB 5C3QA 1Z7S3 2EIGA 5EZWA 1RUD3 2ZAAA 4QQOA 4NIIA 3ETPA 4GQ7A 4JQTA 2E7AA 2DVFA 3P5BA 5ISLA 4BIFA 1QJU1 3IN9A 1G6NA 2HWE3 2V4VA 2YV8A 4HONA 3N36A 3KLSA 4LORA 4HPKB 1LTEA 4B4RA 2RR11 5FZGA 4CDUA 2WLQA 4CPBD 1JYWA 1YYNA 4AK3A 4WM8A 5ACA2 1AYN1 1OQEA 1W9WA 1GSLA 1Y9MA 3C7GA 4JGYA 4YNIA 4DUVA 1SFYA 2O1QA 3AYCA 5CNAA 1HRI1 1QNWA 1KDKA 3J7LA 4FFHA 2EXIA 1QOSA 1AR62 3IIAA 4MG2A 1DLLA 1NY72 2OS2A 2NLRA 4N53C 3RFRA 1I1EA 2BNMA 2X10A 3MW2A 4DRVA 2JDHA 4R8HA 1AX0A 2D97A 2W1WA 4PI2A 4CEYC 1ZRCA 3C7FA 1MEC1 4KWJA 1Q3EA 4XF9A 1F9KA 5FLHA 4I09A 1WZXA 2IXLA 2Z69A 2XUEA 4A6OA 4GB31 4JQRA 2JD9A 3CDZB 3CZUA 3WW2A 1GP4A 1ND3B 2ZGSA 2WAOA 4DMIA 1LRHA 1IPSA 3KCCA 3GNEA 3B9IA 4DQAA 4NWVA 2H0VA 3M8LA 1QDCA 3KQRA 1XPWA 1C8M1 4AHZA 1QJEA 4BXFA 5FZ3A 4XDPA 2IWGB 2JG8B 3VDDA 4KWLA 2B8MA 4MZUA 4TZDA 3AZVA 1VE0A 3LCPA 3M3EA 5JUVA 5CFCB 1JZ8A 3T0DA 1SQ4A 4U2AA 2YUEA 4XMIA 1PO12 4Q4V2 2RS53 4XDOA 3TEXA 1H9WA 2XLAA 3MLLA 1J1LA 2RE9A 2RDSA 1X8MA 1HW5A 1GZWB 1PIV2 3JXSA 4L97A 3EO6A 3NKTA 5C70A 2CTVA 3O1OA 1D7PM 4LTAA 1COV3 4MUVA 1AYM3 5L9VA 5F5IA 2JX9A 5FXXA 1REFA 1ZBA1 1UXZA 1ZA7A 2ATFA 2WABA 3AMNA 2ZHMA 3I2KA 3FFQA 4LLOA 4TWTA 4CDWB 1HXS2 5C8WA 4IERA 5JMCA 2GNDA 3FUOA 4TXWA 1XE0A 5LCWL 5IT6A 1DGRN 1GWKA 5DAWA 1R64A 2P17A 2HBUA 2DCTA 3RWNA 4FOQA 2YFZA 5L73A 2NZ9A 1QQP3 4FXGB 3ZMOA 3DKWA 4LIVA 5A32B 1W04A 1HB3A 2NM1A 3HQXA 2QKDA 2VCMA 4KG0A 1V6IA 1AL0G 2R041 1VAKA 3EQEA 3I8TA 3IT8A 2HLEA 4HXCA 1PM4A 1WKYA 2X5IA 3LZZA 2RG4A 4IQPA 4Q29A 5FMDA 2E51A 2Q1FA 2CGNA 2Q30A 1EUTA 5FZEA 5I8SA 1A34A 2QJVA 2HWB1 4K20A 4C1XA 1ENXA 1E5RA 5C3RA 5D2AA 1O8PA 4AW7A 4O9EA 5L7OC 1EPWA 3QACA 3USUB 3VL9A 1W9FA 3OBZA 4IE7A 2UYBA 4CEWB 1BEV2 3JBG1 4NHLA 4QGMA 1IS5A 3N9NA 1RUC3 4LBNA 5H9PA 4MX3A 3WQBA 3ZSLA 4EWEA 1PVC1 2VUDA 4XXPA 2CGOA 4XUNA 3SITA 4LBJA 4DB5A 4Y22B 2J1EA 4AG4A 4ASMB 4F8AA 1WW7A 2BYVE 2RS33 2WZ8A 2VCCA 4KMQA 3HQUA 3UGHA 1IGOA 5FLIA 1OOPC 1YRZA 2DV9A 4UFLA 5FXVA 4BISA 2PQQA 3VBFC 2XH6A 1YJKA 3BTZA 1OXCA 2QDRA 4FQZA 3ZFEC 2L9LA 4IE4A 3ZKUA 4IEYA 2NMNA 1OT5A 3MIGA 1ZNPA 4QQLA 2ADEA 1QJX3 5JIAA 2GN3A 2GALA 4QPGB 4RFRB 4Q4X1 1AR71 2WDBA 3U37A 1SPPB 3DCQA 4Q8KA 3KD4A 5FYCA 5LRRA 3T0BA 1FX5A 1FMD3 5JZGB 1F31A 2YB7A 1GQPA 2YBKA 1RHI3 3BYWA 1HN0A 3RZLA 4IEPA 3ZDVA 3QOPA 5K0UC 4S2GA 1RUOA 4AQTA 1CN1A 2A7AA 3TYJA 5FZKA 3TRSB 3LF7A 1LOAA 2WKKA 1LHVA 1LU1A 1JZ6A 3AL6A 5FMBA 1O4TA 3ENRA 3NL1A 1GV9A 1UYPA 1JZ2A 5HBAA 2YY1A 2WFF2 4MXVA 1PHMA 2WNOA 1UMZA 2VAUA 2GC1A 4QU1A 1OA2A 5HCHA 1SLCA 2OX0A 1JODA 2HWC2 2YZ4A 1SBDA 3AK0A 3AVSA 4OHWA 1O4ZA 2VZQA 3VKMA 4DNYA 3RSJA 2I45A 2ARBA 2Y34A 5K4LA 1IS3A 4IV3C 2ZTNA 4IXLA 4EE2A 5FYIA 2AZ5A 4IEZA 4XUTA 1V70A 1R1A2 2MPFA 2NMOA 1YFWA 4ASLA 5F6KA 4PQ9A 1WW6A
chains in the Genus database with same CATH topology
3DXTA 3PUQA 5F32A 5FY0A 4LIUA 5A3WA 3K3OA 5FZ0A 5FYVA 3KV6A 3LDBA 3N9OA 3PURA 5F5CA 5FZHA 5FYMA 2WWUA 4LIVA 2Q8DA 3U78A 5A7SA 3AVRA 5FP4A 1VRBA 4BU2A 3PUSA 5FUNA 5FV3A 4CCKA 5FY9A 5FPLA 3KV9A 4QWNA 2YBSA 4V2WA 2W2IA 4LITA 5FZ1A 3AL5A 5FZAA 5FZMA 5FZBA 3N9PA 5CEHA 2XDVA 5FZEA 2GP5A 5F39A 5IVFA 3KVAA 5F5AA 4C8DA 5FZ8A 4EYUA 4AI9A 5FZCA 4HOOA 5FPBA 2OT7A 4IGOA 5IW0A 5ANQA 5ISLA 4DO0A 5FP8A 5A1LA 3PDQA 3N9NA 4HONA 5FYYA 5FZ4A 3OPWA 5A7PA 5FZGA 5FP7A 5A7WA 4QX7A 4GJZA 3PTRB 5A7WB 5IVCA 4EZHA 5FY8A 4CSWA 5F3EA 4CCMA 2P5BA 5FP3A 5FY1A 5A80A 4BISA 2OQ6A 5FXVA 4CUGA 3KV5A 5IVYA 3ZPOA 4D6SA 5LY2A 2WWJA 4AAPA 5F3CA 4ASKA 2YU1A 5FY4A 5E6HA 5FZIA 3DXUA 2OQ7A 5FZDA 2OS2A 5FZOA 5FZOB 3K2OA 5F37A 4GJYA 5FUPA 4IGPA 5FZFA 5A3TA 4CCOA 3N9MA 4IGQA 3PU3A 4E4HA 5LWBA 5FJHA 5FYZA 5FZ7A 2PXJA 2XUEA 5FYHA 4V2VA 2Q8CA 3RVHA 4Y33A 5FYCA 5IVBA 5IVVA 4D6RA 3U4SA 4Y3OA 4CCJA 5FYUA 5A3PA 4UF0A 2VD7A 2YBKA 4UF0B 5F3IA 2YBPA 3NJYA 4Y4RA 3PU8A 4BXFA 5FPUA 5FZ3A 3N9QA 2GP3A 4GD4A 4XDPA 5FPVA 4QX8A 5FZKA 5FXZA 4QXBA 3PUAA 5FP9A 5FYTA 5FY7A 4CCNA 5FZLA 5A7NA 3ZLIA 5A1FA 3LD8A 5FYBA 5IVEA 2XXZA 5FYSA 5IVJA 3OPTA 3AL6A 4QXHA 5F3GA 3N9LA 4LXLA 5F2SA 5FXWA 4XDOA 5LW9A 2XMLA 4CCLA 4QU1A 5A7QA 4DIQA 2Q8EA 2OX0A 4URAA 3AVSA 4QXCA 5FWEA 4TN7A 5FWJA 5F5IA 4EZ4A 5F2WA 5FXXA 3K3NA 5IWFA 5A7OA 3KV4A 5K4LA 5FZ6A 3UYJA 3KVBA 5FYIA 4D6QA 5FJKA 2YU2A 5FY5A 5KR7A 5LY1A 4NUBA 5FBJA 5FZ9A 5A3NA 5FPAA 4GAZA 2YPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXT A;  3PUQ A;  5F32 A;  5FY0 A;  4LIU A;  5A3W A;  3K3O A;  5FZ0 A;  5FYV A;  3KV6 A;  3LDB A;  3N9O A;  3PUR A;  5F5C A;  5FZH A;  5FYM A;  2WWU A;  4LIV A;  2Q8D A;  3U78 A;  5A7S A;  3AVR A;  5FP4 A;  1VRB A;  4BU2 A;  3PUS A;  5FUN A;  5FV3 A;  4CCK A;  5FY9 A;  5FPL A;  3KV9 A;  4QWN A;  2YBS A;  4V2W A;  2W2I A;  4LIT A;  5FZ1 A;  3AL5 A;  5FZA A;  5FZM A;  5FZB A;  3N9P A;  5CEH A;  2XDV A;  5FZE A;  2GP5 A;  5F39 A;  5IVF A;  3KVA A;  5F5A A;  4C8D A;  5FZ8 A;  4EYU A;  4AI9 A;  5FZC A;  4HOO A;  5FPB A;  2OT7 A;  4IGO A;  5IW0 A;  5ANQ A;  5ISL A;  4DO0 A;  5FP8 A;  5A1L A;  3PDQ A;  3N9N A;  4HON A;  5FYY A;  5FZ4 A;  3OPW A;  5A7P A;  5FZG A;  5FP7 A;  5A7W A;  4QX7 A;  4GJZ A;  3PTR B;  5A7W B;  5IVC A;  4EZH A;  5FY8 A;  4CSW A;  5F3E A;  4CCM A;  2P5B A;  5FP3 A;  5FY1 A;  5A80 A;  4BIS A;  2OQ6 A;  5FXV A;  4CUG A;  3KV5 A;  5IVY A;  3ZPO A;  4D6S A;  5LY2 A;  2WWJ A;  4AAP A;  5F3C A;  4ASK A;  2YU1 A;  5FY4 A;  5E6H A;  5FZI A;  3DXU A;  2OQ7 A;  5FZD A;  2OS2 A;  5FZO A;  5FZO B;  3K2O A;  5F37 A;  4GJY A;  5FUP A;  4IGP A;  5FZF A;  5A3T A;  4CCO A;  3N9M A;  4IGQ A;  3PU3 A;  4E4H A;  5LWB A;  5FJH A;  5FYZ A;  5FZ7 A;  2PXJ A;  2XUE A;  5FYH A;  4V2V A;  2Q8C A;  3RVH A;  4Y33 A;  5FYC A;  5IVB A;  5IVV A;  4D6R A;  3U4S A;  4Y3O A;  4CCJ A;  5FYU A;  5A3P A;  4UF0 A;  2VD7 A;  2YBK A;  4UF0 B;  5F3I A;  2YBP A;  3NJY A;  4Y4R A;  3PU8 A;  4BXF A;  5FPU A;  5FZ3 A;  3N9Q A;  2GP3 A;  4GD4 A;  4XDP A;  5FPV A;  4QX8 A;  5FZK A;  5FXZ A;  4QXB A;  3PUA A;  5FP9 A;  5FYT A;  5FY7 A;  4CCN A;  5FZL A;  5A7N A;  3ZLI A;  5A1F A;  3LD8 A;  5FYB A;  5IVE A;  2XXZ A;  5FYS A;  5IVJ A;  3OPT A;  3AL6 A;  4QXH A;  5F3G A;  3N9L A;  4LXL A;  5F2S A;  5FXW A;  4XDO A;  5LW9 A;  2XML A;  4CCL A;  4QU1 A;  5A7Q A;  4DIQ A;  2Q8E A;  2OX0 A;  4URA A;  3AVS A;  4QXC A;  5FWE A;  4TN7 A;  5FWJ A;  5F5I A;  4EZ4 A;  5F2W A;  5FXX A;  3K3N A;  5IWF A;  5A7O A;  3KV4 A;  5K4L A;  5FZ6 A;  3UYJ A;  3KVB A;  5FYI A;  4D6Q A;  5FJK A;  2YU2 A;  5FY5 A;  5KR7 A;  5LY1 A;  4NUB A;  5FBJ A;  5FZ9 A;  5A3N A;  5FPA A;  4GAZ A;  2YPD A; 
#chains in the Genus database with same CATH topology
 4CUA A;  5JPM B;  1VBB 2;  4CEY A;  3H7J A;  1EAH 1;  2IXJ A;  2PAE A;  2QZ3 A;  2VUA A;  3D8C A;  1OKQ A;  5A3W A;  3WOG A;  5LBB A;  1W3V A;  3ZR6 A;  4MHR A;  4S2D A;  1W2O A;  4AVT A;  1SLA A;  1HRV 1;  2B4K A;  4JHZ A;  1LB2 A;  5BNP B;  2JG9 B;  4HT1 T;  1VMH A;  1J83 A;  5GZF A;  1JYV A;  2EAL A;  3EXU A;  4LUK A;  4HKL A;  4QHZ A;  5I0U A;  3W5M A;  1W6P B;  1ND2 B;  5JSP A;  1EV1 2;  3WDU A;  1W6N B;  2QCS B;  2VH9 A;  3N9P A;  1QEX A;  4HLT A;  4LHL A;  3E97 A;  5CEH A;  4CDW C;  1GP5 A;  3UES A;  1OD3 A;  3AKQ A;  1OBN A;  3T08 A;  1J3P A;  2WAA A;  1DGW X;  2VQU A;  3WP6 A;  1ZRI A;  3N35 A;  4HOO A;  4COZ A;  2PN5 A;  3CL1 A;  4RQP C;  5D8A A;  1LOD A;  4JRA A;  5DMY A;  3RPQ A;  2K9Z A;  2XLG A;  2R49 A;  5HV4 A;  3TNP B;  5FYY A;  1S0I A;  2WA3 A;  3RJ2 X;  2WZR 1;  4B7K A;  4QX5 A;  2PA7 A;  2VNG A;  4OZX A;  4SLI A;  5C3S A;  1ULP A;  3C2U A;  1BBT 2;  4HET A;  4MSV A;  3WDY A;  1JBC A;  2D3R A;  3DL3 A;  2QVS B;  3HBK A;  1L3J A;  4JKL A;  5C8C B;  2P5B A;  2YHJ A;  1ULC A;  3IDB B;  3TNQ A;  1VBD 2;  4AEJ A;  3LEG A;  4NID A;  4AAP A;  5F3C A;  1UMH A;  2PAK A;  2PTM A;  5BY5 A;  4WVZ A;  3O1P A;  4KBB A;  3GJA A;  2BVV A;  2E26 A;  1WCQ A;  3E6C C;  3IDC B;  1POV 0;  1YI9 A;  2VZ3 A;  2WSV A;  4OFG A;  5FO9 B;  2BFU L;  4QX3 A;  5I0D A;  2VG9 A;  1PGW 2;  4MXW A;  3E5U A;  2J1R A;  3OEA A;  3VZO A;  2RJK A;  4CYD A;  1EPZ A;  2NQY A;  4W8J A;  4KWK A;  4CXW A;  2Q8C A;  2ZZQ A;  4YW7 A;  2AEZ A;  2ZZJ A;  2W1Q A;  1AUY A;  1RUE 3;  4CCJ A;  4RR3 B;  3KB5 A;  5C7G A;  2VD7 A;  1R09 1;  1UY2 A;  2EXK A;  5FBZ A;  1QJY 3;  4P08 A;  2WS9 2;  3M2M A;  2FDI A;  2YGL A;  4QKF A;  1MVQ A;  1Q56 A;  1DF0 A;  4HKO A;  4I01 A;  4LUM A;  4YZ3 A;  4FPH A;  3VD5 A;  4QPW A;  4CDQ A;  1RUG 1;  4CCC A;  5L36 A;  5DDJ 1;  5FY7 A;  3O1T A;  3S30 A;  2RM2 3;  3LD8 A;  1SEF A;  1DYO A;  3K51 A;  3K4D A;  4N9I A;  2W52 A;  1QKQ A;  3T2P A;  1NKG A;  1O8S A;  1GNH A;  2GH8 A;  1OUX A;  1X33 A;  3WF0 A;  5JXJ A;  1W2U A;  2Q4S A;  4G9S B;  2XUM A;  3O0X A;  5DUV A;  3JQX A;  3T2T A;  4ZU7 A;  2HWF 3;  2JDA A;  2VXR A;  3I2G A;  3ZSM A;  3FHI B;  4GIQ A;  4CXX A;  2C1F A;  1N3Q A;  1OOP A;  1YC6 1;  1VRH 3;  3F95 A;  5F2W A;  4Q1R A;  1YEW A;  3WG1 A;  1KS4 A;  2VW1 A;  5A7O A;  3FWE A;  3VBF A;  4Q4W 3;  4AVS A;  2R32 A;  4BZ4 A;  4DEQ A;  4H2A A;  1AL2 2;  5EYY A;  3UKV A;  2FDH A;  1UOB A;  5FY5 A;  3H8O A;  3HT1 A;  2XR4 A;  2ZKN A;  4P14 A;  4P02 B;  3ZR5 A;  4M0N A;  5FPA A;  5L9R A;  4XOG A;  1BVP 1;  2D3S A;  1YLL A;  3R0R A;  1W9S A;  3HWJ A;  5FYM A;  1V9U 1;  5C9A B;  4ES8 A;  3L9J T;  5J36 A;  1NX9 A;  2PFW A;  3AMM A;  5FV3 A;  1WA4 A;  4MLO A;  4QKN A;  1POV 3;  1ENQ A;  5FPL A;  4PDW B;  4QB1 A;  5T5L A;  2FD8 A;  4BCU A;  3AXD A;  2IFW A;  4FPE A;  4XJ8 A;  5K0U A;  1JZ3 A;  1F5J A;  1YQ8 A;  1RMU 3;  4LJH A;  1RIT A;  4XXA A;  4GMP 0;  4XFI A;  4LO6 B;  2NP0 A;  1LHU A;  4CP0 A;  5DAX A;  3VZM A;  4OMD A;  4CP9 A;  2DUP A;  3KMH A;  4D0Q A;  4LLF A;  4NRO A;  3WD5 A;  1S0E A;  4W65 A;  1TZO A;  5JIU A;  3C7O A;  2FBE A;  2R16 A;  3PDQ A;  3V0B A;  2D6O X;  1LGC A;  3POF A;  1GKB A;  1J3R A;  4OLL A;  1UKG A;  1MS3 A;  2P3K A;  3POE A;  3R05 A;  2GC3 A;  2BPA 2;  3PTR B;  4JKM A;  3ILN A;  2WZP P;  4ISQ A;  1YFU A;  2F4L A;  5A33 A;  2RHP A;  4IV3 A;  4RSU A;  5C3O A;  4UBG A;  1BMV 1;  3HVD A;  3DV8 A;  1LU2 A;  3KV5 A;  1FNY A;  3ACH A;  3RRD A;  2WWJ A;  1OF4 A;  1T6B X;  4XF4 A;  1Z78 A;  2R06 3;  3DEM A;  5CU1 A;  1MS9 A;  5FZI A;  2BU9 A;  1KJL A;  4ATF A;  2BOJ A;  2VTX J;  2QQO A;  3AJZ A;  4YM1 A;  1WW4 A;  2WII B;  3ZXF A;  1BJQ A;  2RR1 2;  3RNS A;  4Y1Y A;  4FPL A;  3WW3 A;  4YZ1 A;  3J8F 1;  3FE5 A;  3CMG A;  3PU3 A;  4K40 A;  3FBY A;  4KNC A;  3BGA A;  2A5Z A;  4TSV A;  3WG2 A;  1MS4 A;  1NA1 B;  5DG1 A;  1O4Y A;  4M3C A;  1MVE A;  2PHX A;  3IPV A;  1VPH A;  2GMP A;  1PX3 A;  4DXS A;  3W59 A;  1X9P A;  2HEY F;  3BU7 A;  4LEJ A;  3POI A;  5GKA C;  3SEP A;  3BOW A;  3K75 B;  3N9Q A;  5FPU A;  4GD4 A;  2W46 A;  1O3T A;  1WBL A;  3H42 B;  4ZU4 A;  3OUJ A;  1NCR B;  1MEC 2;  2V73 A;  4QXB A;  5BNQ A;  4RQP A;  5A7N A;  3ZLI A;  4YGC A;  3VD4 A;  1S2K A;  1SLL A;  2VU9 A;  2FDF A;  4GB3 2;  4FOY A;  4HZF A;  2IFR A;  2Z79 A;  1BQP A;  1B35 B;  1ZVF A;  1ZYB A;  2D98 A;  4ZON A;  1UKR A;  3OYW A;  4ITC A;  5H9Q A;  1JZ5 A;  2IVJ A;  4QQP A;  1F4H A;  5FK7 A;  2SLI A;  4XJW A;  2AEN A;  3KS7 A;  3MIH A;  2DFC A;  4YG6 A;  3CKH A;  1DGL A;  2ZHL A;  1QIQ A;  1KGY A;  2ZOE B;  3FC0 A;  1QH7 A;  5AFE A;  5ACA 3;  1YFX A;  1LHN A;  2YXS A;  2WNV A;  2PHF A;  2DFB A;  2YU2 A;  1D0H A;  2HEV F;  3OSD A;  2DUO A;  3KZ4 C;  4MHU A;  2V72 A;  4PJY A;  2X05 A;  3WNK A;  5IK7 A;  4RHV 1;  2YPD A;  4KG8 A;  2MHF A;  3IWZ A;  4OI4 A;  2Y6J A;  3RYR A;  5FY0 A;  1UD1 A;  3T4H B;  3UGG A;  5A70 A;  4CXY A;  3C7H A;  4L92 A;  1CVN A;  1CWP A;  2ERF A;  3B5L B;  4Y24 A;  1U5I A;  1CAU B;  1D4M 2;  1G9D A;  3AZW A;  1RUJ 2;  5FP4 A;  1VRB A;  2HWD 1;  2VBB A;  1W99 A;  1ZBA 2;  3MUY 1;  3J7M A;  3MLJ A;  2VXJ A;  4BQ1 A;  2Z2S B;  5J1X A;  4N90 A;  1FT9 A;  1H2N A;  2AH2 A;  4Y5S A;  2WJS A;  2CWS A;  3G6J B;  4L9B A;  4EWA A;  2UU8 A;  5LA9 A;  1C1F A;  2R1D A;  5FZM A;  5FZB A;  3WF3 A;  3ZYG A;  1WLC A;  1PNF A;  4XFG A;  3A7Q A;  4Q1P A;  5CBL A;  3CJX A;  1DQ1 A;  1R08 1;  3ZYP A;  4DXZ A;  2BV4 A;  1OKO A;  4QPY A;  5LA0 A;  1Z7S 1;  1YFY A;  1M4W A;  1RUD 1;  2WBK A;  4AI9 A;  2BWA A;  1MQT C;  4NPL A;  2D6P A;  4AHW A;  1UWW A;  2ARA A;  1OUS A;  2QQM A;  2FMY A;  3POJ A;  2VUC A;  2WO1 A;  2Z5W A;  1XSQ A;  4WZC A;  2HWE 1;  1GWM A;  2A6Y A;  1OHF A;  2JJ6 A;  1PO1 3;  1W8N A;  2WO7 A;  1IG3 A;  3ATG A;  4FPC A;  5FZ4 A;  4F83 A;  1LHW A;  5FP7 A;  2D3P A;  1BLZ A;  1XSR A;  1STM A;  2VR4 A;  1JOJ A;  1MS8 A;  3CJI C;  1OFN A;  2XKO A;  3OGJ A;  4WVM B;  2HWB 2;  2FZ1 A;  1HIX A;  1W90 A;  3LQC A;  4QD2 A;  1NCQ C;  1Y7B A;  3POG A;  2EID A;  1W8W A;  3ZPO A;  4DIN B;  3MEP A;  4JGZ B;  3MID A;  4AI2 A;  3OB8 A;  2VZS A;  3Q8C A;  5FFO C;  1OI6 A;  2BJS A;  1HXS 3;  2G1M A;  5LBC A;  1C28 A;  4QX0 A;  4EN0 A;  1F8V A;  5JPN B;  1PVC 2;  5FUP A;  4CUB A;  3RYK A;  2ES3 A;  5H9R A;  2KM2 A;  2B42 B;  4E4H A;  4ERO A;  3QD6 A;  2MNG A;  1JW6 A;  1KD7 A;  1YO8 A;  2CGP A;  1AF9 A;  4XUO A;  1PO2 2;  4R4X A;  5APA A;  5L19 A;  1ZM1 A;  5F5Q A;  4RFT 0;  1GMM A;  4Q0P A;  3B9C A;  1TMF 3;  3ZVX A;  1LOE A;  1AX2 A;  5F9T A;  1QJZ A;  1W05 A;  4Q0V A;  2GZW A;  3WNO A;  3VHN A;  2VVE A;  3AYD A;  4KQ7 A;  2YDE A;  1PMI A;  3THT A;  1DDL A;  1DQ0 A;  4Q4X 2;  5A6Y A;  3PL0 A;  2RS1 3;  3SMH A;  1BKZ A;  4BQY A;  3QLQ A;  4PLO A;  4GH4 C;  1O5U A;  3DPR B;  2HYK A;  2CL2 A;  4QDS A;  3DEC A;  4KWU A;  2BFU S;  1LNS A;  4D3W A;  1GU3 A;  5BNN C;  4NHY A;  5CYY A;  1COV 1;  2X29 A;  1AYM 1;  4M3C F;  4A4A A;  4EN8 B;  1CX4 A;  3VZL A;  3IDE A;  3MLK A;  1TNR A;  2CNA A;  3SH3 A;  4PQQ A;  3VBS B;  3ZFG B;  5CVR A;  4I0B A;  4PI0 A;  5JI7 A;  2LW8 A;  3AMH A;  2OZ6 A;  4AI0 A;  1Y4W A;  2C4X A;  3LIG A;  4GWM A;  3UK9 A;  3VB9 A;  1SBE A;  1D0G A;  1V6N A;  4PF1 A;  5JI9 A;  1QXP A;  1YWK A;  1C5H A;  4OQ8 A;  1IS6 A;  2NN8 A;  2TNF A;  1QQP 1;  2WYF A;  1SHW B;  1BK0 A;  4QXK A;  1JOB A;  1H4H A;  1D4V B;  1VLN A;  2ZGU A;  4MGK E;  3KQ4 B;  3DN7 A;  1CIY A;  1D2S A;  4UW4 A;  4XTP A;  1K5M B;  1WMX A;  1RVF 2;  1AVB A;  2VEC A;  2YBS A;  4Z8B A;  2CU5 A;  3MIB A;  2A6W A;  5FZA A;  1NZC A;  4CU7 A;  5CAD A;  1JI6 A;  5K7P A;  2VZO A;  1J1T A;  3T09 A;  2BWC A;  2BP6 A;  4AE2 A;  1VR3 A;  2VMC A;  2R0H A;  2K2S A;  5FCC A;  2EXH A;  2ZGL A;  1N1S A;  1W6O A;  2O8O A;  1CAW B;  1JH5 A;  4ES9 A;  4IGO A;  3WW4 A;  1O5L A;  2P3J A;  4QHO A;  3EJK A;  5FP8 A;  4WVV A;  4H55 A;  3T3Y A;  4DO0 A;  3TEZ A;  4JHT A;  3SQO A;  4LR4 A;  1RUI 3;  4Q4Y 2;  1RUC 1;  3BTX A;  2BDR A;  3TAY A;  3I2I A;  3ZN6 B;  1VIW B;  2BBA A;  5DUU A;  2G19 A;  2WFF 3;  3E6D A;  5A7W A;  5DAP A;  5L9B A;  5EHD A;  5FKC A;  1DBN A;  4ZZ8 A;  5F3E A;  4KH9 A;  4O7X A;  1KS5 A;  4IND A;  2RS3 1;  4LHN A;  2QE3 A;  1VP6 A;  3AM2 A;  4CCM A;  2E7Q A;  4YSF A;  1VAL A;  1G7Y A;  4N43 C;  2J1V A;  2J1U A;  1YIP A;  5CKM A;  5DZF A;  4FTB A;  2WC2 A;  4D6S A;  2GNB A;  2Y0O A;  1KEX A;  2TEP A;  2XJR A;  5LBE A;  3LA7 A;  4JC1 A;  5A3U A;  3BTY A;  2P34 A;  2ZX2 A;  3LA3 A;  4FOW A;  2OKX A;  1RXG A;  1F4A A;  1R1A 3;  2WZR 2;  2BNN A;  1VBA 3;  3NV4 A;  4BHP A;  1QJX 1;  2H0B A;  1C4R A;  1S0J A;  3I2H A;  3TB0 A;  2QQK A;  3J4U H;  1UN1 A;  4OHV A;  5I0S A;  1GQH A;  2ZX3 A;  4RYD A;  4WM7 C;  1E5S A;  1Y9G A;  2PYT A;  1G9F A;  2JE9 A;  4JRL A;  3K77 A;  5HXV A;  5FPZ A;  4D7Y A;  2IXI A;  1L7L A;  3GXU A;  3OY8 A;  3CLP A;  4KI5 M;  4D8M A;  1UY0 A;  2D43 A;  1FMD 1;  2TUN A;  1RHI 1;  3WUC A;  4YAR A;  3R4S A;  2JIJ A;  5CIS A;  2VMI A;  3HOB A;  1OFS A;  4LQR A;  5EJ3 A;  1UIK A;  3KT7 A;  2VQT A;  1S1A A;  1DIW A;  1EV1 3;  2AYH A;  4NWW A;  3MYX A;  5ERL A;  3B69 A;  2JXA A;  1MZ6 A;  3MV1 1;  4Z1V A;  1MQT A;  5CB7 A;  4Y20 A;  3N9L A;  1GR3 A;  4K9S A;  4N8M A;  1TVG A;  4NPR A;  2ARC A;  2RDR A;  5ANN A;  3I4I A;  4BLJ A;  1K12 A;  2E31 A;  4RGA A;  4S2F A;  5LW9 A;  4C0B A;  3I7D A;  3CJI A;  5A7Q A;  1S0B A;  4DIQ A;  3W5N A;  1OUR A;  4RN5 A;  2WN3 A;  4XZU G;  1DGR A;  1I6X A;  1NCQ A;  5IAX A;  3K3N A;  1W9T A;  1AJO A;  1BBT 3;  1ODM A;  4XE9 A;  4XC9 A;  2DTW A;  5FR3 A;  1RUG 2;  3SLI A;  3UET A;  4XAC A;  4R4Z A;  1O6U A;  3T2Q A;  1T6G C;  3ZSK A;  3VDB A;  1FPN 3;  2VOT A;  3ZFF C;  3J26 N;  4D94 A;  3PJY A;  2P6H A;  1W2A X;  2RMU 1;  3ACL A;  4IEQ A;  4HN1 A;  4RD7 A;  5FQ0 A;  2Q1Z B;  1HQN A;  2CDO A;  2V5D A;  4JCK A;  5JMO A;  1WLD A;  2BER A;  4E4S A;  2Q8D A;  4H14 A;  5A7S A;  3WHU A;  3FL7 A;  5KXE A;  1QU0 A;  1YHF A;  4EN6 B;  3WSO A;  4CCK A;  1DU3 D;  2LRO A;  3W20 A;  2XL9 A;  2DCZ A;  2XON A;  1W9Y A;  3USS A;  2Y26 A;  3VL8 A;  3VBU C;  2GMM A;  4R9B A;  2XQX A;  1X36 A;  1T2X A;  2GDF A;  1CJD A;  4PIX A;  3Q8B A;  4QAW A;  4YW4 A;  3VKL A;  2KR2 A;  4HMZ A;  2YYO A;  2OII A;  4XUQ A;  4JAA A;  3POS A;  5IVF A;  1W6Q B;  3SKV A;  3NNF A;  2XVK A;  1H1A A;  3HN1 A;  4RS5 C;  1V9U 2;  3ZXD A;  4YW2 A;  1PM7 A;  2C9A A;  4GH4 A;  3K48 A;  4YW6 A;  3I2D A;  3AKR A;  1CAX A;  4FPY A;  5IJR A;  1FNZ A;  1DQ6 A;  2FHR A;  4DEV A;  1PZ9 A;  2EXJ A;  4FTE A;  5BNN A;  4M00 A;  2GN7 A;  2QZ2 A;  3KCY A;  4P9G A;  1AR9 2;  2ARE A;  2WL1 A;  3B02 A;  2KXL A;  4PCR A;  4CCE A;  2JDZ A;  3GZE A;  2XB6 C;  2Z4F A;  4UYB A;  5FY8 A;  4YVS C;  5G05 L;  3I3Q A;  2J1S A;  3H1W A;  1RED A;  1UOJ A;  3AYA A;  4ZHN A;  2GNT A;  4FXK B;  5CFD B;  1QJF A;  4GKX A;  1ZRD A;  1F5F A;  3BCW A;  3KCX A;  3INA A;  4B8E A;  3RZM A;  1ZRE A;  1XND A;  2K46 A;  1YJL A;  4LA2 A;  4FFG A;  1UYX A;  5FZO A;  2FCV A;  2E33 A;  3AJY A;  2QQL A;  1YIF A;  2E9Q A;  4YM0 A;  5E1R A;  1JYI A;  4M0H A;  1GWL A;  3WNN A;  5E88 A;  2WO3 A;  3IMM A;  4YLZ A;  3RYP A;  2J22 A;  5FYH A;  3UGF A;  3VV1 A;  4OHX A;  1BMV 2;  4IDZ A;  4IUG A;  4W6X A;  3ZXL A;  1VBE 2;  4LBM A;  1AR8 2;  1RUE 1;  2QUO A;  3M70 A;  4UF0 B;  2WT0 A;  1KIT A;  2Q5T A;  4NN0 A;  3SXW A;  3MFA A;  1JMU B;  4E2S A;  4ORF A;  1QJY 1;  1W6M A;  5JXH A;  1S0C A;  2GP3 A;  2UYA A;  4OI2 A;  5FPX A;  4QX8 A;  1SFN A;  5FXZ A;  1S2B A;  1JU4 A;  4XJ9 A;  5CAZ A;  2RM2 1;  2QQJ A;  2ZX0 A;  5AFB A;  4CU8 A;  3I2O A;  1FOD 2;  4AED B;  4BQ4 A;  1SFP A;  4NAM A;  3VLB B;  4QB2 A;  3H8X A;  1M06 G;  1RUF 3;  2CHH A;  3ZSJ A;  2E32 A;  2HWF 1;  3H50 A;  1W8Z A;  3LB9 A;  1UU4 A;  5LRS A;  1DQ2 A;  3R6S A;  3VHP A;  2XGX A;  2ZS6 B;  4XHB A;  1GUI A;  1XE7 A;  1VRH 1;  2VZP A;  3ETQ A;  3IKW A;  4N43 A;  5GLV A;  5ABJ B;  4AGG A;  1G86 A;  4Q4W 1;  5FZ6 A;  1OD5 A;  4B4Q A;  2EIC A;  1XU1 A;  4JVA A;  4NRP A;  1OMI A;  4BDV B;  4DOU A;  2P2K A;  4OUE A;  5KHJ A;  2D44 A;  1MZ5 A;  1MAC A;  2RMU 3;  4X6Q B;  4LBQ A;  2VMF A;  3OGV A;  3JQW A;  3VHO A;  1VJ2 A;  1U5X A;  4WM7 A;  1SLT A;  4XF0 A;  3NNL A;  5DAV A;  1OH3 A;  3HMY A;  3PVN A;  5KHH A;  4GA9 A;  2Y6K A;  1ASJ 2;  5BYN A;  4OHY A;  1R1Z A;  3AVR A;  5JSR A;  3OBR A;  4LBK A;  1POV 1;  3GM8 A;  1JYN A;  2ZGN A;  1OF3 A;  3HT2 A;  4XET A;  1ND3 C;  3AL5 A;  4NAO A;  2VME A;  2D6K A;  4FPG A;  5BV6 A;  2AR6 A;  1RMU 1;  2W3J A;  5F5A A;  3ZIW A;  3VBR B;  4Z2W A;  5C4W B;  2DF7 A;  1JHN A;  2WO2 A;  4I30 A;  3J9S A;  3X29 B;  2JG8 C;  4N53 A;  5LAS A;  5LEJ A;  3PVO A;  4XW3 A;  4YZ4 A;  1IQD C;  1O7F A;  5CFC C;  3WG3 A;  1MEC 3;  2Q8O A;  3CF6 E;  1V0A A;  3ZYF A;  4FPO B;  1OPO A;  4QPI B;  1IS4 A;  2A3X A;  3NVC A;  2P3I A;  4CPB A;  3I59 A;  4FCA A;  1C8N A;  4CSW A;  2XJS A;  3B3Q E;  3LEM A;  4GZ9 A;  1RIR A;  5FP3 A;  3MI8 A;  5LK7 B;  4NIG A;  5A80 A;  4PIZ A;  4CUG A;  3U14 A;  2VL4 A;  2XBO 2;  3ZFF A;  1CAV A;  2JIC A;  2UWB A;  4KGQ A;  1PK6 B;  3WNP A;  4IEW A;  5FY4 A;  3TWI A;  2R06 1;  4FFI A;  3T0A A;  2PLV 2;  2VVF A;  2HWE 2;  3H8R A;  4WVW A;  5FZF A;  3H0O A;  1LED A;  1OLM A;  4QM8 A;  3WDX A;  4MGT A;  3HQR A;  3M1H A;  3N9M A;  3LA2 A;  1UU5 A;  3MGU A;  3VBO B;  3LWC A;  5C5T A;  3RVH A;  2G9Z A;  4IV1 B;  1SDD B;  3VBU A;  1D4M 3;  2IVI B;  1RUJ 3;  2W1U A;  2XVL A;  1KQR A;  3MIC A;  3Q9O A;  4NE9 A;  5FYU A;  3I3M A;  1WD4 A;  4OUS A;  1K45 A;  4ARX A;  4FI9 A;  3WG4 A;  4UFJ A;  3NJY A;  4ZKT B;  1HX6 A;  3K4A A;  1EUU A;  4RS5 A;  2IXC A;  1IPJ A;  5GLU A;  1LUL A;  4K8F A;  3SEE A;  3WIN E;  5JXG A;  3NAP B;  1PNG A;  1EY2 A;  3M3C A;  2H6B A;  1OA4 A;  3SCH A;  5IVJ A;  2WNU B;  3MPP G;  3N3H A;  2B9U A;  4CEW C;  4PBO A;  1OQ1 A;  2VNV A;  4YVW B;  5BNO B;  4XJZ A;  4COU A;  2G9F A;  2ILM A;  3ES1 A;  1CR7 A;  1H2M A;  4YVS A;  4Q2F A;  2Q8E A;  2GC2 A;  4LBO A;  4AR2 A;  3HEI A;  4OZO A;  2MEV 2;  3IBM A;  4Q0Q A;  4CU6 A;  3D3A A;  3AP4 A;  4JZR A;  1SMV A;  3SH5 A;  1GZC A;  2PHR A;  3ME2 A;  3VGI A;  1CX1 A;  5E8A A;  1V6O A;  3MPB A;  3AXE A;  4XCB A;  5ACA 1;  1G9C A;  2VMD A;  2IXH A;  4M01 A;  4A7Y A;  5KR7 A;  4AFC A;  3OOX A;  2C26 A;  1AXY A;  3Q8F A;  4CDX B;  2WQ8 A;  3ZMN A;  3ZYB A;  4GAZ A;  1K3I A;  2WLP A;  3VUO A;  4Y1Z A;  4HKW A;  5FMC A;  2A1X A;  2N7G A;  4RGK A;  1WW5 A;  2QDN A;  3H9A A;  1COV 2;  5J96 B;  1NY7 1;  1RB8 G;  4QPG C;  3ACF A;  5AC9 3;  1IG0 A;  4H7L A;  2XWJ B;  1TME 2;  2DU1 A;  2VNO A;  3GGL A;  5FY9 A;  3T4V A;  2XJQ A;  1PMH X;  4FT8 A;  5DPN A;  3RMX A;  3APB A;  4Z92 B;  1RUH 2;  2B39 A;  2W2I A;  2ZA9 A;  5DUW A;  4YG3 A;  3VDC A;  2G9G A;  4I0W B;  5JZG C;  1PO2 3;  3K46 A;  4AEM A;  4J25 A;  1O3R A;  2I2S A;  3VBH B;  2ET1 A;  1XNB A;  5F39 A;  1H8T B;  3GZU C;  2XG3 A;  3WEZ A;  2CDP A;  4L99 A;  1H0B A;  3WP5 A;  3ZFE A;  1OLM E;  2WYS A;  2WQZ C;  3FLT A;  2JDN A;  1ZBE 2;  4XIL A;  2XVG A;  3ASI A;  2OT7 A;  1WME A;  5ANQ A;  4XEZ A;  3ACG A;  2VE1 A;  3WZ1 A;  4XUP A;  1OC1 A;  3RGB A;  4C1W A;  2IC1 A;  1HKD A;  2B5H A;  3HNB M;  4HPK A;  1PO1 1;  1ONA A;  1JHJ A;  2BTV C;  3LOB A;  4UI9 L;  1OSG A;  4Q0S A;  4B7E A;  2C6S A;  4CDU B;  4P9W A;  3JD7 2;  1IHM A;  5EJZ B;  4WM8 B;  3QBQ A;  1JTZ X;  2KD7 A;  3LEK A;  3I97 A;  5FY1 A;  1CGP A;  3U10 A;  2A75 A;  1GNY A;  1QXJ A;  3QH6 A;  4JGY B;  3VZN A;  2JKX A;  4W50 A;  4BQX A;  1BCX A;  1LJ7 A;  4URT A;  4H3W A;  5EWS A;  4NIA A;  2V5Y A;  1XXN A;  3LOI A;  4CU9 A;  4E2G A;  2R30 A;  2ZAH A;  3AB0 A;  3PVE A;  4UOJ A;  3D0S A;  3NNJ A;  2B45 X;  3BOP A;  2PQS A;  2GME A;  1LCL A;  1RC6 A;  1HXS 1;  1TNF A;  1RUC 2;  4JDM A;  4L11 A;  4NR1 A;  3SNM A;  2R6Q A;  2R07 1;  2VPV A;  3WP3 A;  4MGY E;  4MGQ A;  4YGE A;  4GXL A;  2DCJ A;  4IGQ A;  3MIF A;  4IET A;  1VBC 2;  3OF1 A;  1V00 A;  2XKP A;  2RS3 2;  3FLP A;  2PXJ A;  3I3B A;  3OBA A;  4V2V A;  1LEM A;  2X8K A;  5BNP C;  2JG9 C;  5LA2 A;  3TN9 2;  1ND3 A;  5GAL A;  3R4U A;  3QH7 A;  3AC0 A;  1UOF A;  4XIK A;  4AAX A;  1RVF 3;  1ND2 C;  1TMF 1;  1G8W A;  2RV9 A;  4XQ4 A;  1WCD J;  2JG8 A;  1PZ7 A;  5AVA A;  2JDM A;  2JD4 A;  3VDD B;  5IK4 A;  5JDB A;  2AAC A;  4NOT A;  5CFC A;  2GU9 A;  1QJU 2;  5HCA A;  2RS1 1;  3FMG A;  3BIW E;  4QHB A;  4QXH A;  4DZG A;  1ZRF A;  2OVU A;  1UYZ A;  4E27 A;  3CQO A;  3SIS A;  1WBF A;  3NW4 A;  5DUX A;  2YC2 A;  4UFI A;  1GZW A;  3VBO C;  1CPN A;  4HVO A;  1AYN 2;  1OLQ A;  2Y6L A;  1XQN A;  1RHI 2;  3O12 A;  1HJF A;  5DXD A;  1A8M A;  4EN9 B;  4Q4Y 3;  4AI1 A;  2QQN A;  4LA3 A;  3IDA A;  1RYY A;  4UFM A;  5FWJ A;  1HRI 2;  2NPI A;  3DGT A;  2A6X A;  4E8D A;  4YZ5 A;  2JIG A;  5C8C C;  2WSU A;  4COY A;  2E53 A;  2QTW B;  1QF3 A;  4KU8 A;  4WBB A;  4CDW A;  2ZGT A;  3WDT A;  4D6Q A;  5B4N A;  1QNY A;  4BA6 A;  3SCF A;  5LY1 A;  4BM8 A;  4H7M A;  3WQ0 A;  1S55 A;  3MHZ A;  5A6Q A;  2V4A A;  3BPS A;  3GCX A;  3POY A;  3PLQ A;  5C5U A;  4SBV A;  4YG0 A;  3KV6 A;  1GQG A;  1UX6 A;  2W39 A;  1C57 A;  3FLR A;  4XTM A;  5A32 A;  1F15 A;  2OPK A;  2WWU A;  3OG2 A;  4GMP 3;  3ZXJ A;  4A7Z A;  1PGL 1;  2BNO A;  2CY6 A;  5EQU A;  1SLI A;  4AQS A;  4IEV A;  4QT6 A;  5CIR A;  4B4P A;  5IYY A;  2EA7 A;  1C8M 2;  2D7F A;  4QWN A;  5F1R A;  1RXF A;  3AP9 A;  4LIT A;  4ZS3 A;  2X5I B;  4RR3 C;  4AZZ A;  3OD4 A;  4V1P A;  1CQ9 A;  4LBL A;  4YYO A;  2A3W A;  5GLT A;  3TBD A;  2VQA A;  3FJS A;  2JEN A;  3ABZ A;  2ZGO A;  4AF9 A;  4PHZ A;  4Z07 A;  4PLN A;  5GJ6 A;  4EYU A;  3EHK A;  4LMF A;  1NE6 A;  4C91 A;  4FSJ A;  5FZC A;  4XFC A;  4HN0 A;  3USU A;  4IEX A;  1LEC A;  4CEW A;  1NOV A;  3GJB A;  1AR6 3;  3KWV A;  1NAE A;  2OUJ A;  3LDR A;  1RUI 1;  4IW3 A;  4NRM A;  2W0X A;  4XUR A;  4G4F A;  1PZ8 A;  4Y22 A;  2YMZ A;  4PBP A;  1GOG A;  4XYX A;  4GKY A;  2WFF 1;  2OUH A;  4HK9 A;  4QX7 A;  3O7O A;  1JUI A;  1V6L A;  1W2N A;  5F7U A;  1OVS A;  2A71 A;  4BQW A;  2ZEY A;  4DY3 A;  4X8N A;  2XJU A;  5GZD A;  5FKB A;  4NVP A;  1Y3T A;  1DG6 A;  3HNY M;  2PAM A;  4CA9 A;  4DY5 A;  3S0M A;  1XYO A;  2A6V A;  3GDB A;  3GZT B;  1KJR A;  2W94 A;  5E6H A;  1UL9 A;  3DXU A;  3OD0 A;  1HB4 A;  4GWN A;  4W6W A;  2JDP A;  2XLF A;  5JCT A;  4K3U A;  1DLC A;  1R1A 1;  4PIY A;  4YGB A;  5DN2 A;  2WIN B;  4GJY A;  1VBA 1;  2XHK A;  3PME A;  1XNT A;  4N7U A;  4QPG A;  1AZD A;  2R04 2;  2DU0 A;  1BYH A;  1HB1 A;  1Q8Q A;  1QWR A;  1SPP A;  4ET7 A;  1DYK A;  5C9A C;  3GF6 A;  3VKO A;  1YUD A;  4Q4V 3;  3V0A A;  2XHN A;  4MVT A;  3WV6 A;  4AFD A;  4CP2 A;  4D6R A;  1IPK A;  1PIV 3;  4MOA A;  5JZG A;  3H1Y A;  4PDW C;  1U12 A;  2P37 A;  1C1L A;  3URF A;  1X7N A;  4XVH A;  3T1L A;  5T5P A;  1LES A;  1EV1 1;  2ZEW A;  1ZZ7 A;  2ZGQ A;  2VW0 A;  3HAG A;  1O91 A;  1QOT A;  3I54 A;  1QH6 A;  3I3E A;  3JBG 2;  3PUA A;  1LKN A;  2K0G A;  1N3P A;  3H3L A;  4XF3 A;  3OPZ A;  5FYS A;  5EV7 A;  2ZML A;  3ZX7 A;  1V9U 3;  2TBV A;  2GC0 A;  4XFF A;  4XQW A;  3AKS A;  4OI0 A;  1WUV A;  3NJV A;  1RUE 2;  4BQ5 A;  2RJ2 A;  4AFM A;  3M3Q A;  1SLB A;  3PMS A;  4NRQ A;  2AUY A;  3PUI A;  3RMY A;  1JZ4 A;  4LKD A;  5KXD A;  4A3Z A;  1ST8 A;  1XE8 A;  2R1B A;  1Z0H A;  4TN7 A;  3NNM A;  1XOY A;  2Z42 A;  1AR9 3;  1QXR A;  4EQV A;  1BBT 1;  4R52 A;  4RL7 A;  5DAQ A;  2EVX A;  2VCB A;  1FAY A;  2DBI A;  2BRT A;  1TE1 B;  2Q1M A;  2RM2 2;  3ACI A;  5FRA A;  3UYJ A;  5DQ0 A;  5FJK A;  2EIB A;  3LAG A;  1BHG A;  1FPN 1;  4JKK A;  1E5H A;  2BOI A;  3ZXE A;  1ZA4 A;  3IB3 A;  4UFK A;  5A3N A;  3M4F A;  1ODN A;  3A0K A;  1UU6 A;  3I2F A;  2F17 A;  3VD3 A;  1YI7 A;  4CEY B;  1AR7 2;  4XFB A;  5D21 A;  2D6N A;  5GZG A;  3LEI A;  4HSJ A;  2HWF 2;  5IAV A;  4DRR A;  2PMW B;  5BPX A;  4JDN A;  2RS5 1;  3LPF A;  5BNP A;  2JG9 A;  5EP9 A;  5FO7 B;  1PGS A;  2CWM A;  1IQA A;  4XF1 A;  1BEV 3;  1XU2 A;  3AZX A;  5H9S A;  2OYZ A;  2HYX A;  2C0Z A;  3ELN A;  2DUR A;  1NA1 C;  3D82 A;  4HL0 A;  1J59 A;  3JUU A;  1W6P A;  1ND2 A;  1JYT A;  1VBE 3;  3ZO0 B;  2XPJ A;  1AR8 3;  1W6N A;  4XBQ A;  1XJA A;  1LHO A;  3HJR A;  2OXB A;  4CP1 A;  4QMA A;  2BQP A;  1CD3 G;  1WLT A;  1WWY A;  4X6R B;  3E5X A;  1NCR C;  1JU3 A;  3LE0 A;  3N7M A;  4A45 A;  5D8A B;  4YZ2 A;  2R7E B;  1PX4 A;  4FP3 A;  5IAT A;  1BXH A;  5LK5 A;  2CSG A;  3IM0 A;  3O5S A;  4XBN A;  4OMC A;  1FOD 3;  1B35 C;  3NWK A;  5BUV A;  4OQ9 A;  5IHR A;  2ZEZ A;  2W68 A;  1UPI A;  2DVB A;  5C8C A;  4R9A A;  2DUQ A;  1I5Z A;  1AXZ A;  2GNM A;  3THD A;  1ULE A;  4E4Z A;  2BGO A;  2W47 A;  5J7M A;  2WNE A;  2VCA A;  3DUI A;  4P00 B;  2YRO A;  1UY1 A;  1EAH 2;  3AYE A;  1UIJ A;  4K21 A;  3Q8E A;  1HV1 A;  3CBN A;  1SZB A;  2LRP A;  3LIH A;  4ONU A;  2BGC A;  1U0A A;  3PVB B;  2VBD A;  1HRV 2;  2D6L X;  5FIX A;  5LEK A;  1B09 A;  4MXW B;  1L7R A;  1POQ A;  4KGG A;  3W21 A;  4E2Q A;  4I2O A;  2D93 A;  5LWB A;  3WNL A;  5FYZ A;  1X82 A;  3EBR A;  2DTY A;  1OQD A;  1W8O A;  4XHX A;  2BBV A;  1ASJ 3;  5CZK A;  1YQ6 A;  2JB4 A;  4QX2 A;  1LGB A;  2DBN A;  1YQ5 A;  2GH2 A;  2Y60 A;  4RR3 A;  4W4Z A;  3U4S A;  3PIG A;  3ZYR A;  4BXS V;  2UUR A;  1CPM A;  4XQD A;  3FZ3 A;  1XNA A;  4AXO A;  2I74 A;  4BIO A;  3AZY A;  2HWC 3;  5A3O A;  1WLW A;  2Y0I A;  1AX1 A;  1V6M A;  2VOX A;  1WD3 A;  3I2J A;  5FPV A;  5FTT C;  2WUH A;  4CDQ B;  5L7O B;  4P9Y A;  2YFU A;  2JDK A;  3AMP A;  4ISR A;  5KHI A;  5JOX A;  5IVE A;  1RGS A;  2QQP A;  4QU2 A;  2Y6H A;  2EF6 A;  4XJU A;  2XXZ A;  3B93 A;  3WF4 A;  4C0H A;  5F3G A;  4CCD A;  1REE A;  3B01 A;  5M0T A;  5JXI A;  4DS0 A;  5IUQ A;  1VBB 3;  5LB6 A;  1QHD A;  2XML A;  3ZYH A;  1RUF 1;  2ZX4 A;  4UWD A;  1NZI A;  5B2G B;  2JE7 A;  2P1B A;  5BXX A;  2CV6 A;  5C33 A;  3THC A;  1OOP B;  3THP A;  1ACC A;  4XFH A;  3ES4 A;  3VBF B;  1MZF A;  4FQ4 A;  4QGL A;  1QMJ A;  2HBT A;  3WW1 A;  1V6K A;  2ZGM A;  4Y5Z 0;  2ZMK A;  4NUB A;  5FBJ A;  2XBO 3;  4Y4Y A;  2VGD A;  4COW A;  4JGZ C;  3MF9 A;  1NE4 A;  3L2H A;  5I0R A;  4IEO A;  5F32 A;  2ZX1 A;  1CZV A;  2J1T A;  4FPJ A;  4J1W A;  5FYV A;  1ULF A;  2P3Y A;  2PLV 3;  4OUL A;  1Q5O A;  4WZF A;  2W9X A;  5C9A A;  2D6M A;  5IK8 A;  2ZGR A;  3KGZ A;  1UQX A;  4YFW A;  3WF1 A;  5L7O A;  2UWA A;  1R09 2;  3VKF C;  5A3L A;  4PDW A;  3OGR A;  2VY0 A;  3P3P A;  2X09 A;  3FUQ A;  4Z82 A;  1NXD 1;  4FAG A;  4FAH A;  2UY8 A;  1CON A;  5K0U B;  4I3G A;  1QGL A;  1FYU A;  1DQ4 A;  4O9G A;  5DDJ 2;  5FMO S;  5C71 A;  4A6S A;  2FDJ A;  2GP5 A;  1Q43 A;  3ZXK A;  1VB4 A;  3FX3 A;  3VKN A;  4OI1 A;  1OPM A;  5HCB A;  2IZW A;  1IKP A;  1NXM A;  3AX4 A;  3B7M A;  3HN3 A;  1VBD 3;  4CP9 B;  4TYS A;  4ZXK A;  1Q8V A;  1H6X A;  1PVX A;  1UZY A;  3ITQ A;  1W2T A;  4BH9 A;  3LGR A;  5IW0 A;  3NV2 A;  1G9B A;  2LM3 A;  2PHW A;  5HI0 A;  4OCT A;  3HBZ A;  3V0B B;  1Q8P A;  4HVQ A;  2D5H A;  3ZIX A;  1O3S A;  5FDB A;  3DPR C;  5EPA A;  4K7J A;  5FO8 B;  4BPZ A;  3OPW A;  1N1Y A;  5A7P A;  3DYM A;  1NQJ A;  5J3U A;  1MZE A;  1CZS A;  4L0P A;  1W8F A;  4EZH A;  3VZJ A;  1A6C A;  4X8P A;  5KXC A;  5J09 A;  4COV A;  1UPS A;  5A33 B;  4IV3 B;  3AFK A;  5C6C A;  3V56 A;  2ZGK A;  3RJR A;  2MEV 3;  2YC0 A;  1NT0 A;  4KU7 A;  2QBX A;  4PLM A;  5LY2 A;  3VBS C;  3ZFG C;  4DXR A;  3WP4 A;  2WQ4 A;  5HV0 A;  5GLW A;  3AP6 A;  3MO4 A;  4BE3 A;  4HVR A;  2OQ7 A;  3HIF A;  5HXM A;  2WS9 3;  5F37 A;  4YM3 A;  1ULD A;  5T52 A;  5A3T A;  4IGP A;  4YRD A;  4S2H A;  2JEC A;  5D8A C;  1NLS A;  2FQP A;  2W95 A;  1V6J A;  3RG0 A;  4XIO A;  1K42 A;  2J1A A;  2DDU A;  1GAN A;  3WQ7 A;  3U11 A;  1DZQ A;  3S5A A;  1NA1 A;  1D4M 1;  3KSC A;  2W87 A;  1RIN A;  5IVV A;  1RUJ 1;  1W0N A;  4M3C B;  1W0O A;  4N7I A;  3IPV B;  2O0O A;  1TME 3;  3NKG A;  5JOZ A;  3UT0 A;  1K5M C;  5A6Z A;  5F3I A;  1XB9 A;  4P5H A;  1ENR A;  3WCS A;  2E7T A;  1RUH 3;  1TQ5 A;  2R07 2;  2XWB B;  3A4U A;  2VZT A;  3N7J A;  4R9C A;  3ZPY A;  3D6E A;  3FHQ A;  1NCR A;  3S7I A;  4A7K A;  4RQP B;  3JU9 A;  4J6G A;  4UAP A;  4HG6 B;  1AL2 3;  5EJ1 B;  2WT2 A;  3POB A;  1E5I A;  4CTE A;  4G3Y C;  2QQW A;  1GNZ A;  1ZBE 3;  4OUM A;  1B35 A;  3LSD A;  3P3N A;  3ZXA C;  5HPO A;  2CAU A;  3OYW B;  3RZK A;  2ADD A;  2ZBJ A;  5J37 A;  2ORZ A;  2V09 A;  3SKJ E;  1TMF 2;  5FWE A;  3M3I A;  4E4D X;  4P9L A;  5J98 B;  1ULO A;  4B3N A;  4NJ4 A;  1DYP A;  3JD7 3;  3NMB A;  1AHS A;  3U4X A;  1YCI A;  2RS1 2;  1QDO A;  1I3H A;  2VZR A;  2WNV B;  3WNM A;  3OCP A;  2DCY A;  3CU7 A;  1HN1 A;  3OUI A;  4CDQ C;  4L8Q A;  3SHR A;  1MPX A;  3J8F 2;  1W8H A;  2D5F A;  5AVP A;  2WZE A;  4LIU A;  3VZK A;  4BWO A;  5FZ0 A;  1KXG A;  1U5Y A;  4ATE A;  5F5C A;  4JDO A;  3J7N A;  4LHK A;  2VNR A;  1CAU A;  1SDW A;  2W92 A;  2J7M A;  3LFM A;  1QY4 A;  4I02 A;  4NO4 A;  3Q8A A;  4BU2 A;  4IE0 A;  1A8D A;  4AVA A;  5AC9 1;  2X53 S;  1GLH A;  5FUN A;  2UWC A;  3I49 A;  4DPN A;  3OGS A;  3O0W A;  1VBC 3;  1XYP A;  2ID4 A;  3JZV A;  3KV9 A;  4HSL A;  4AVV A;  3ALQ A;  5CKN A;  4XPV A;  3IMN A;  3ILR A;  1UAI A;  3JB8 A;  5FZ1 A;  3TN9 3;  4CUC A;  3V65 A;  4XZP A;  3GYD A;  1VMF A;  1PO2 1;  2W5F A;  2QFE A;  3O1M A;  1W06 A;  3MDP A;  4MO3 M;  3NJX A;  4ZU5 A;  2ZEX A;  4PF5 A;  4EJR A;  1G9A A;  4Q5O A;  1HDK A;  4QQ2 A;  4UW6 A;  4D7T A;  1PGL 2;  1LOF C;  1MS1 A;  2OA2 A;  2VUJ A;  5FPB A;  4DFS A;  2EIE A;  2PHD A;  3E5Q A;  1UO9 A;  1QJU 3;  3WDV A;  3LDK A;  1HQW A;  1WMD A;  2VZ1 A;  4LUL A;  2RR1 3;  3V0A B;  1UX7 A;  3VN4 A;  5IFT A;  3ZM8 A;  3W9A A;  4GJZ A;  3N7K A;  3HR9 A;  3FFZ A;  1AYN 3;  1LEN A;  4HFS A;  4QKD A;  4WVM A;  4XBL A;  4Y1V A;  1BK1 A;  4P9J A;  4A41 A;  5SV8 A;  4AGR A;  2OQ6 A;  3E1F 1;  3G7D A;  5T55 A;  2B7Y A;  4BB3 A;  4CE8 A;  1HRI 3;  4ARY A;  4RHV 2;  3GZA A;  2DYC A;  4BME A;  1GFF 2;  4JGZ A;  2YU1 A;  4B29 A;  2DVD A;  1FI2 A;  2WA4 A;  3DF0 A;  1W3X A;  1RUI 2;  3A21 A;  4NHM A;  4B1L A;  2ZAB A;  3K2O A;  4CVU A;  2HWD 2;  3AFG A;  1UY3 A;  4MGI E;  1N47 A;  2ZHN A;  3C8X A;  3BPZ A;  1IOA A;  2YG0 A;  3BN6 A;  4HBN A;  5T54 A;  3WQ1 A;  4ZY9 A;  2JWP A;  3J7H A;  4GB3 3;  4BK5 A;  4UW3 A;  1UZW A;  1R08 2;  1WGP A;  4AGV A;  3BB6 A;  1XNK A;  3MUZ 1;  2WR9 A;  1Z7S 2;  1RVF 1;  1C8M 3;  1I9R A;  5T3N A;  1RUD 2;  2VMH A;  2YPJ A;  4RGG A;  5CKQ A;  1VBA 2;  3ZDS A;  1NG0 A;  5J48 A;  3DKQ A;  4LKE A;  5FP9 A;  4CCN A;  5FYT A;  1GOH A;  4KBZ A;  3TOJ A;  3U07 A;  4EWD A;  3I3D A;  1YNA A;  2O8Q A;  4BMB A;  5F2S A;  4Q27 A;  3ZN4 A;  1HLC A;  5GM0 A;  3O14 A;  1ZZ6 A;  3DPR A;  4CZS A;  4LOT A;  5JSO A;  1US2 A;  4YGD A;  2ARX A;  2OW4 A;  4XAE A;  5EYX A;  4CCL A;  3ECQ A;  4R9D A;  4MH0 E;  2JDY A;  2I07 B;  4Q4Y 1;  1DHK B;  2VJX A;  4XCA A;  1ULG A;  3KF3 A;  1ZBA 3;  2AC1 A;  4IES A;  4LK7 A;  3R4D B;  1X8E A;  3KV4 A;  3ORJ A;  3NRU A;  3VBS A;  3ZFG A;  3ZN5 A;  2SBA A;  5CG9 A;  4NHX A;  3WDW A;  5CFD C;  3PUH A;  1WCS A;  3D5O A;  4LPL A;  2EAK A;  5F6L B;  2ENR A;  2LAL A;  2ZXQ A;  4NPM A;  4AFB A;  1ZZ9 A;  3MW4 A;  2RVA A;  4ZZ5 A;  2QQI A;  1I5P A;  3CHX A;  3K3O A;  2EAA A;  2P4E A;  3N9O A;  3T30 A;  1H6Y A;  1SAC A;  2Y6G A;  4AWD A;  5A6X A;  1UYY A;  3U78 A;  4AQ2 A;  4GMP 1;  1MS5 A;  4A42 A;  4BK4 A;  4TLG A;  2R04 3;  3K4Z A;  5FUI A;  2F4P A;  1ENS A;  2NYY A;  1K5M A;  2ETE A;  2B46 X;  3LFI A;  1FPN 2;  2OZJ A;  3ZKY A;  2A70 A;  3JCI A;  3B00 A;  3H3Z A;  4BLI A;  2XDV A;  3RQ0 A;  3SC7 X;  1DZR A;  2HWB 3;  4LHS A;  5JR2 A;  2WNV C;  1W8U A;  5I8T A;  5JLV A;  1JN2 P;  4L2N A;  1W6O B;  2RJL A;  2RS5 2;  1CAW A;  2RDQ A;  3NJZ A;  4LNV A;  3WCR A;  5GLZ A;  4ZXE A;  1KDM A;  1LOG A;  3GBW A;  3JBG 3;  1AR6 1;  1ZX5 A;  5DAB A;  1AYM 2;  1PVC 3;  3OGG A;  4AED C;  4NHK A;  3ZN6 A;  2XQR A;  2AEY A;  3III A;  3FBM A;  3OBT A;  5IFP A;  5A7W B;  3NV1 A;  2QNK A;  1JOP A;  1LOC A;  4TLF A;  5F8P A;  1JYX A;  2VM9 A;  1OLR A;  3V64 A;  2BUK A;  3P6B A;  5T5O A;  1HQL A;  3ZYI B;  5ABJ C;  2DVG A;  1K5J A;  5IVY A;  4NMI A;  4XAA A;  2H6C A;  2Y6F A;  4FO9 A;  4ASK A;  3ILF A;  3B94 A;  1VMJ A;  3MZH A;  1HV0 A;  3OEB A;  2ZHK A;  1QQP 2;  4F7Z A;  3ST7 A;  1H2K A;  3A22 A;  2BZD A;  4QDQ A;  4AI3 A;  1C3H A;  1DZT A;  3PTY A;  4XMA A;  4K8R B;  1W39 A;  3CNA A;  4O61 A;  4MV2 A;  4Q4X 3;  1AR7 3;  4AHX A;  4UBH A;  1GP6 A;  4YW5 A;  4OHZ A;  1S0D A;  1GYK A;  1JYC A;  1O59 A;  2A6Z A;  2WN2 A;  4XFA A;  3H8U A;  4BQ2 A;  5KBF A;  2C5D A;  1UOG A;  1UMI A;  4Q4V 1;  3WLU A;  2Y38 A;  2ZAC A;  3OY8 B;  2E63 A;  3ROU A;  1PIV 1;  4RA0 A;  3S6P A;  1BZW A;  1NLQ A;  5T5J A;  4QM9 A;  3WY6 A;  4IE5 A;  3S7E A;  1H8V A;  2YBP A;  3JB4 C;  1F2N A;  4Y4R A;  2GAU A;  3PU8 A;  4QX1 A;  4Y5T A;  3IAQ A;  3VDA A;  3BAL A;  4JV4 A;  5B4X A;  4Q8L A;  1LOF A;  3N7L A;  1J84 A;  1MQT B;  3F2Z A;  3UL2 A;  3VBR C;  3VHR A;  5A1F A;  5C4W C;  1RL3 A;  2AGS A;  3RZZ A;  5FYB A;  3GAL A;  3HD8 B;  3PJQ A;  4Y20 B;  4A3X A;  4LXL A;  2XL7 A;  3LKJ A;  1CZT A;  5JWP A;  4UXA A;  4AFA A;  2DCK A;  4CRQ A;  3WX5 A;  2JEM A;  1US3 A;  3CJI B;  4LE4 A;  4QDR A;  1JXN A;  4QPI C;  5DG2 A;  3O1V A;  3RZG A;  3BOD A;  5DZE A;  4QXC A;  3P1I A;  1YXW A;  5CA6 A;  4GWJ A;  4MAD A;  5E89 A;  3UKT A;  1NCQ B;  4HAN A;  1AR9 1;  1UW8 A;  3KHB A;  5IWF A;  3ZXG A;  3BU0 A;  4LO7 A;  1LAJ A;  2Q0A A;  2Y8K A;  3KVB A;  1UNB A;  3C7E A;  2YGM A;  1TG7 A;  1WA6 X;  4Y1X A;  2GSY A;  4UT5 A;  3O1S A;  1RJ7 A;  1PK6 C;  1QJX 2;  4UW5 A;  2C9K A;  2YC4 A;  5K8S A;  5K9Y A;  5JAX A;  3DXT A;  3PUQ A;  1EAH 3;  3WUD A;  1RUF 2;  3O1R A;  5FQ0 B;  1ZZ8 A;  1UZ0 A;  5TSW A;  1UF2 C;  3O1U A;  1P8J A;  1FV3 A;  1HRV 3;  4YPJ A;  2BW8 A;  3PUS A;  1FXZ A;  4LO8 A;  1FMD 2;  4K6B A;  1BEV 1;  3L2Y A;  5KC6 A;  2ORX A;  3A0N A;  4JX0 A;  3ZSE A;  1TEI A;  2E6V A;  4IV1 C;  1X9T A;  2JE8 A;  2F6B A;  2Y33 A;  5GZC A;  4TTG A;  4AI8 A;  5I91 A;  4DXT A;  4V2W A;  4AQ6 A;  5JOY A;  2FZ2 A;  1H2L A;  5FMO L;  4NIH A;  1VBE 1;  1AR8 1;  2IUW A;  1URX A;  4OVE A;  4ZS2 A;  1W6Q A;  2VZV A;  1RJ8 A;  1Y9Q A;  2A73 B;  2QQU A;  4LKS A;  2JDU A;  5FRE A;  5FZ8 A;  3PHM A;  5LA1 A;  1D2Q A;  4IE6 A;  2FDK A;  4JTO A;  1L7Q A;  1OVP A;  1U5Z A;  3MBW A;  3NAP C;  4GH4 B;  1O3Q A;  5I8Y A;  1CAX B;  1RTV A;  2DWR A;  3HPN A;  3BTA A;  3ZYJ B;  2WNU C;  1N1T A;  4AOC A;  4D69 A;  2WZR 3;  3LSE A;  5IK5 A;  5BNN B;  1FOD 1;  3NV3 A;  4YVW C;  1QOO A;  2HEW F;  1KFX L;  4W6Y A;  4Y1U A;  5BNO C;  1VAV A;  3RS6 A;  1WMF A;  3SCG A;  5IVC A;  2XJP A;  2BGP A;  4N9H A;  4QKB A;  3DYO A;  3M3O A;  3NST A;  2VW2 A;  3KGL A;  3UKN A;  4AHY A;  4FVV A;  4BJ0 A;  1LR5 A;  2JB8 A;  3OJB A;  2HH9 A;  5CFD A;  3TEW A;  1BVV A;  2RMU 2;  2D40 A;  1GIC A;  3RI8 A;  4MYE A;  1OH4 A;  4FPF A;  1S4C A;  4MET A;  4CDX C;  5FZD A;  3AKT A;  5FZO B;  2G4I A;  5KWR A;  3T1M A;  1SCS A;  1XC6 A;  4YFZ A;  1KRI A;  4Y26 A;  3BUC A;  2VVD A;  5KXB A;  2WWS A;  4PT6 A;  2QQV A;  4Q26 A;  3GBG A;  2C24 A;  3U75 A;  3ON7 A;  5C3P A;  2BEO A;  5IVB A;  3LPG A;  3PIJ A;  4FOV A;  5LZ6 A;  3KF5 A;  5T50 A;  5JVV A;  1ASJ 1;  4LT5 A;  1Q8S A;  2IXK A;  4Y3O A;  3WHT A;  3GHN A;  3BKZ A;  1WCU A;  2XJV A;  4IL7 A;  4BYY A;  4UF0 A;  4HK8 A;  1R09 3;  2W08 A;  4KL1 A;  4FP2 A;  1SCR A;  1DCS A;  2HWC 1;  5SV5 A;  3MV0 1;  1W6M B;  3MF6 A;  4Z2A A;  5FK8 A;  1W03 A;  5I0T A;  3VBH C;  3RZJ A;  3OUH A;  4ZPI A;  1H8T C;  1RUG 3;  2W1S A;  5DDJ 3;  1EYB A;  3T2O A;  5LBF A;  4LKF A;  3OPT A;  2VZU A;  3D4K A;  4LE3 A;  4O65 A;  2WFP A;  1J58 A;  2ZJC A;  3OTF A;  2R0F A;  5FXW A;  4AED A;  1XNC A;  4AEK A;  4FTS A;  5EXO A;  1APN A;  1Q8O A;  1XYN A;  1VBB 1;  2HKX A;  2PHU A;  2ZGP A;  4YM2 A;  2VOW A;  4K1Z A;  1DP0 A;  3H3U A;  4IEU A;  2VO5 A;  1NLR A;  3UV9 A;  2W91 A;  4CDU C;  2VOV A;  4N43 B;  2VUL A;  1UCX A;  5EFU A;  4DUW A;  5ABJ A;  1H9P A;  1WCK A;  3NQH A;  3WT3 A;  4WM8 C;  4DUX A;  3U0Z A;  3QCW A;  3MFC A;  1AXK A;  1N3O A;  4JGY C;  3AKP A;  2XJT A;  1RUN A;  2PEL A;  2Y64 A;  1J3Q A;  4LOS A;  2XBO 1;  5E16 A;  1ZRR A;  4E8C A;  4LBQ B;  5JR7 B;  2XOM A;  2ET7 A;  1CES A;  4I0A A;  2CAV A;  3LDB A;  3PUR A;  4OYU A;  4WM7 B;  5FZH A;  2PLV 1;  4QQH A;  5G04 L;  4M3C E;  3S5Q A;  5LAT A;  3KT4 A;  3ZOI A;  2UY9 A;  4LO4 B;  1JS9 A;  3RI9 A;  5D1I A;  4F3J A;  1GZT A;  3UJQ A;  3PNA A;  2P6C A;  1QJY 2;  1H4G A;  5FAX A;  5FLJ A;  3AZZ A;  3NNG A;  1JUH A;  3FN9 A;  4K1Y A;  3WVJ A;  3IAP A;  5FOJ B;  3WR0 A;  4C8D A;  3VBR A;  5C4W A;  3S57 A;  4N53 B;  5A1A A;  4LO5 B;  1VBD 1;  2R07 3;  3VDD C;  1AJK A;  5AC9 2;  3M7A A;  1CJP A;  1DGW A;  1S0F A;  3RZH A;  4LK6 A;  2VOK A;  4EN7 B;  5A1L A;  2JKB A;  3AP7 A;  3POW A;  4A44 A;  2FDG A;  1XBF A;  4QPI A;  1N1V A;  3AP5 A;  4B1M A;  2HJI A;  1VRH 2;  1DQ5 A;  4WV8 A;  4M4R A;  4XDQ A;  4P9X A;  1PGW 1;  4Q4W 2;  1XRU A;  3I59 B;  4P5Y A;  2J42 A;  1GOF A;  1SBF A;  2VBP A;  1LGN A;  4QB6 A;  4E9K A;  1W28 A;  4MGZ E;  2B9V A;  3H1M A;  2MEV 1;  2VQ0 A;  1CAV B;  3ZFF B;  2LUW A;  2ZPX A;  1PK6 A;  4YW3 A;  3MW3 A;  2PHL A;  1NQD A;  4AL9 A;  2WT1 A;  3AMQ A;  3WXP A;  4FFF A;  3CO2 A;  4XAB A;  3EB7 A;  4A2U A;  3W58 A;  2WS9 1;  5HCF A;  3MIE A;  1EP0 A;  4QGN A;  1MS0 A;  1PMJ X;  1SG3 A;  1ZZC A;  1VB2 A;  4MGS A;  1HJG A;  1UZZ A;  1YQC A;  3DYP A;  3J8F 3;  4CCO A;  1CIW A;  1UXX X;  3VBO A;  3VD9 A;  3KHC A;  3D0J A;  5FJH A;  5FZ7 A;  2VTX A;  4IV1 A;  4Y33 A;  3VBU B;  4C90 A;  2RDN A;  3GBF A;  4D7S A;  4FBF A;  1A78 A;  1S0G A;  3CZJ A;  5A3P A;  1RMU 2;  1X50 A;  2LS6 A;  5KHG A;  1TME 1;  2A3Y A;  4M4P A;  4I3P A;  3O0V A;  5DZG A;  5KC5 A;  2FCT A;  2VC9 A;  5KHK A;  2X5I C;  1RUH 1;  4RS5 B;  1LOB A;  2VMG A;  3C3V A;  1KFU L;  2OPW A;  3HNM A;  1H1M A;  5A3M A;  3KT1 A;  3NAP A;  1FAT A;  5FZL A;  3IZO A;  1AL2 1;  4GWI A;  3BIE A;  2FMD A;  3RDI A;  3TEY A;  3KM5 A;  4BOW A;  2WNU A;  1UZV A;  1ZBE 1;  4YVW A;  5BNO A;  3SH4 A;  1A3K A;  1GZ9 A;  3CEW A;  2ZKL A;  1DFQ A;  3WNX A;  4YVS B;  4GAL A;  4URA A;  1NYW A;  4AVB A;  4P9I A;  4EZ4 A;  1YQ2 A;  3WF2 A;  2FCU A;  3H7Y A;  2DVA A;  3EYP A;  2R06 2;  3NO8 A;  3JD7 1;  1MR5 A;  1JZ7 A;  1W0P A;  3CIH A;  2ZCW A;  3GCW A;  4BQ3 A;  2CYF A;  4AYU A;  1UY4 A;  5FZ9 A;  1HB2 A;  1H1I A;  2VTF A;  4CDX A;  4GUL A;  1S2E A;  4RHV 3;  4YWA A;  3A23 A;  3E6B A;  4LBQ D;  1F35 A;  4YW1 A;  3FHA A;  4AVC A;  5GZE A;  2KA3 A;  3N4M A;  1IZ3 A;  1NUK A;  5FOB B;  2WRA A;  3UNP A;  4UFH A;  1E57 A;  4U36 A;  4Q0U A;  4JTN A;  3RWK X;  2HWD 3;  3EMR A;  5JOW A;  2ZMN A;  1ZZB A;  1IKQ A;  3U1X A;  5CG8 A;  4J1X A;  2PHT A;  5I93 A;  3BI3 A;  1VBC 1;  1FV2 A;  1W8T A;  1VAM A;  3VD7 A;  1C5I A;  4EV0 A;  3BVC A;  3TN9 1;  2LTN A;  4FPK A;  1OA3 A;  1Y43 B;  1GBG A;  2BVB A;  3GHM A;  1H30 A;  2O14 A;  3UJO A;  3VBH A;  1R08 3;  1H8T A;  3KVA A;  1ALY A;  5EIY B;  4XJA A;  3ZFE B;  5C3Q A;  1Z7S 3;  2EIG A;  5EZW A;  1RUD 3;  2ZAA A;  4QQO A;  4NII A;  3ETP A;  4GQ7 A;  4JQT A;  2E7A A;  2DVF A;  3P5B A;  5ISL A;  4BIF A;  1QJU 1;  3IN9 A;  1G6N A;  2HWE 3;  2V4V A;  2YV8 A;  4HON A;  3N36 A;  3KLS A;  4LOR A;  4HPK B;  1LTE A;  4B4R A;  2RR1 1;  5FZG A;  4CDU A;  2WLQ A;  4CPB D;  1JYW A;  1YYN A;  4AK3 A;  4WM8 A;  5ACA 2;  1AYN 1;  1OQE A;  1W9W A;  1GSL A;  1Y9M A;  3C7G A;  4JGY A;  4YNI A;  4DUV A;  1SFY A;  2O1Q A;  3AYC A;  5CNA A;  1HRI 1;  1QNW A;  1KDK A;  3J7L A;  4FFH A;  2EXI A;  1QOS A;  1AR6 2;  3IIA A;  4MG2 A;  1DLL A;  1NY7 2;  2OS2 A;  2NLR A;  4N53 C;  3RFR A;  1I1E A;  2BNM A;  2X10 A;  3MW2 A;  4DRV A;  2JDH A;  4R8H A;  1AX0 A;  2D97 A;  2W1W A;  4PI2 A;  4CEY C;  1ZRC A;  3C7F A;  1MEC 1;  4KWJ A;  1Q3E A;  4XF9 A;  1F9K A;  5FLH A;  4I09 A;  1WZX A;  2IXL A;  2Z69 A;  2XUE A;  4A6O A;  4GB3 1;  4JQR A;  2JD9 A;  3CDZ B;  3CZU A;  3WW2 A;  1GP4 A;  1ND3 B;  2ZGS A;  2WAO A;  4DMI A;  1LRH A;  1IPS A;  3KCC A;  3GNE A;  3B9I A;  4DQA A;  4NWV A;  2H0V A;  3M8L A;  1QDC A;  3KQR A;  1XPW A;  1C8M 1;  4AHZ A;  1QJE A;  4BXF A;  5FZ3 A;  4XDP A;  2IWG B;  2JG8 B;  3VDD A;  4KWL A;  2B8M A;  4MZU A;  4TZD A;  3AZV A;  1VE0 A;  3LCP A;  3M3E A;  5JUV A;  5CFC B;  1JZ8 A;  3T0D A;  1SQ4 A;  4U2A A;  2YUE A;  4XMI A;  1PO1 2;  4Q4V 2;  2RS5 3;  4XDO A;  3TEX A;  1H9W A;  2XLA A;  3MLL A;  1J1L A;  2RE9 A;  2RDS A;  1X8M A;  1HW5 A;  1GZW B;  1PIV 2;  3JXS A;  4L97 A;  3EO6 A;  3NKT A;  5C70 A;  2CTV A;  3O1O A;  1D7P M;  4LTA A;  1COV 3;  4MUV A;  1AYM 3;  5L9V A;  5F5I A;  2JX9 A;  5FXX A;  1REF A;  1ZBA 1;  1UXZ A;  1ZA7 A;  2ATF A;  2WAB A;  3AMN A;  2ZHM A;  3I2K A;  3FFQ A;  4LLO A;  4TWT A;  4CDW B;  1HXS 2;  5C8W A;  4IER A;  5JMC A;  2GND A;  3FUO A;  4TXW A;  1XE0 A;  5LCW L;  5IT6 A;  1DGR N;  1GWK A;  5DAW A;  1R64 A;  2P17 A;  2HBU A;  2DCT A;  3RWN A;  4FOQ A;  2YFZ A;  5L73 A;  2NZ9 A;  1QQP 3;  4FXG B;  3ZMO A;  3DKW A;  4LIV A;  5A32 B;  1W04 A;  1HB3 A;  2NM1 A;  3HQX A;  2QKD A;  2VCM A;  4KG0 A;  1V6I A;  1AL0 G;  2R04 1;  1VAK A;  3EQE A;  3I8T A;  3IT8 A;  2HLE A;  4HXC A;  1PM4 A;  1WKY A;  2X5I A;  3LZZ A;  2RG4 A;  4IQP A;  4Q29 A;  5FMD A;  2E51 A;  2Q1F A;  2CGN A;  2Q30 A;  1EUT A;  5FZE A;  5I8S A;  1A34 A;  2QJV A;  2HWB 1;  4K20 A;  4C1X A;  1ENX A;  1E5R A;  5C3R A;  5D2A A;  1O8P A;  4AW7 A;  4O9E A;  5L7O C;  1EPW A;  3QAC A;  3USU B;  3VL9 A;  1W9F A;  3OBZ A;  4IE7 A;  2UYB A;  4CEW B;  1BEV 2;  3JBG 1;  4NHL A;  4QGM A;  1IS5 A;  3N9N A;  1RUC 3;  4LBN A;  5H9P A;  4MX3 A;  3WQB A;  3ZSL A;  4EWE A;  1PVC 1;  2VUD A;  4XXP A;  2CGO A;  4XUN A;  3SIT A;  4LBJ A;  4DB5 A;  4Y22 B;  2J1E A;  4AG4 A;  4ASM B;  4F8A A;  1WW7 A;  2BYV E;  2RS3 3;  2WZ8 A;  2VCC A;  4KMQ A;  3HQU A;  3UGH A;  1IGO A;  5FLI A;  1OOP C;  1YRZ A;  2DV9 A;  4UFL A;  5FXV A;  4BIS A;  2PQQ A;  3VBF C;  2XH6 A;  1YJK A;  3BTZ A;  1OXC A;  2QDR A;  4FQZ A;  3ZFE C;  2L9L A;  4IE4 A;  3ZKU A;  4IEY A;  2NMN A;  1OT5 A;  3MIG A;  1ZNP A;  4QQL A;  2ADE A;  1QJX 3;  5JIA A;  2GN3 A;  2GAL A;  4QPG B;  4RFR B;  4Q4X 1;  1AR7 1;  2WDB A;  3U37 A;  1SPP B;  3DCQ A;  4Q8K A;  3KD4 A;  5FYC A;  5LRR A;  3T0B A;  1FX5 A;  1FMD 3;  5JZG B;  1F31 A;  2YB7 A;  1GQP A;  2YBK A;  1RHI 3;  3BYW A;  1HN0 A;  3RZL A;  4IEP A;  3ZDV A;  3QOP A;  5K0U C;  4S2G A;  1RUO A;  4AQT A;  1CN1 A;  2A7A A;  3TYJ A;  5FZK A;  3TRS B;  3LF7 A;  1LOA A;  2WKK A;  1LHV A;  1LU1 A;  1JZ6 A;  3AL6 A;  5FMB A;  1O4T A;  3ENR A;  3NL1 A;  1GV9 A;  1UYP A;  1JZ2 A;  5HBA A;  2YY1 A;  2WFF 2;  4MXV A;  1PHM A;  2WNO A;  1UMZ A;  2VAU A;  2GC1 A;  4QU1 A;  1OA2 A;  5HCH A;  1SLC A;  2OX0 A;  1JOD A;  2HWC 2;  2YZ4 A;  1SBD A;  3AK0 A;  3AVS A;  4OHW A;  1O4Z A;  2VZQ A;  3VKM A;  4DNY A;  3RSJ A;  2I45 A;  2ARB A;  2Y34 A;  5K4L A;  1IS3 A;  4IV3 C;  2ZTN A;  4IXL A;  4EE2 A;  5FYI A;  2AZ5 A;  4IEZ A;  4XUT A;  1V70 A;  1R1A 2;  2MPF A;  2NMO A;  1YFW A;  4ASL A;  5F6K A;  4PQ9 A;  1WW6 A; 
#chains in the Genus database with same CATH homology
 3DXT A;  3PUQ A;  5F32 A;  5FY0 A;  4LIU A;  5A3W A;  3K3O A;  5FZ0 A;  5FYV A;  3KV6 A;  3LDB A;  3N9O A;  3PUR A;  5F5C A;  5FZH A;  5FYM A;  2WWU A;  4LIV A;  2Q8D A;  3U78 A;  5A7S A;  3AVR A;  5FP4 A;  1VRB A;  4BU2 A;  3PUS A;  5FUN A;  5FV3 A;  4CCK A;  5FY9 A;  5FPL A;  3KV9 A;  4QWN A;  2YBS A;  4V2W A;  2W2I A;  4LIT A;  5FZ1 A;  3AL5 A;  5FZA A;  5FZM A;  5FZB A;  3N9P A;  5CEH A;  2XDV A;  5FZE A;  2GP5 A;  5F39 A;  5IVF A;  3KVA A;  5F5A A;  4C8D A;  5FZ8 A;  4EYU A;  4AI9 A;  5FZC A;  4HOO A;  5FPB A;  2OT7 A;  4IGO A;  5IW0 A;  5ANQ A;  5ISL A;  4DO0 A;  5FP8 A;  5A1L A;  3PDQ A;  3N9N A;  4HON A;  5FYY A;  5FZ4 A;  3OPW A;  5A7P A;  5FZG A;  5FP7 A;  5A7W A;  4QX7 A;  4GJZ A;  3PTR B;  5A7W B;  5IVC A;  4EZH A;  5FY8 A;  4CSW A;  5F3E A;  4CCM A;  2P5B A;  5FP3 A;  5FY1 A;  5A80 A;  4BIS A;  2OQ6 A;  5FXV A;  4CUG A;  3KV5 A;  5IVY A;  3ZPO A;  4D6S A;  5LY2 A;  2WWJ A;  4AAP A;  5F3C A;  4ASK A;  2YU1 A;  5FY4 A;  5E6H A;  5FZI A;  3DXU A;  2OQ7 A;  5FZD A;  2OS2 A;  5FZO A;  5FZO B;  3K2O A;  5F37 A;  4GJY A;  5FUP A;  4IGP A;  5FZF A;  5A3T A;  4CCO A;  3N9M A;  4IGQ A;  3PU3 A;  4E4H A;  5LWB A;  5FJH A;  5FYZ A;  5FZ7 A;  2PXJ A;  2XUE A;  5FYH A;  4V2V A;  2Q8C A;  3RVH A;  4Y33 A;  5FYC A;  5IVB A;  5IVV A;  4D6R A;  3U4S A;  4Y3O A;  4CCJ A;  5FYU A;  5A3P A;  4UF0 A;  2VD7 A;  2YBK A;  4UF0 B;  5F3I A;  2YBP A;  3NJY A;  4Y4R A;  3PU8 A;  4BXF A;  5FPU A;  5FZ3 A;  3N9Q A;  2GP3 A;  4GD4 A;  4XDP A;  5FPV A;  4QX8 A;  5FZK A;  5FXZ A;  4QXB A;  3PUA A;  5FP9 A;  5FYT A;  5FY7 A;  4CCN A;  5FZL A;  5A7N A;  3ZLI A;  5A1F A;  3LD8 A;  5FYB A;  5IVE A;  2XXZ A;  5FYS A;  5IVJ A;  3OPT A;  3AL6 A;  4QXH A;  5F3G A;  3N9L A;  4LXL A;  5F2S A;  5FXW A;  4XDO A;  5LW9 A;  2XML A;  4CCL A;  4QU1 A;  5A7Q A;  4DIQ A;  2Q8E A;  2OX0 A;  4URA A;  3AVS A;  4QXC A;  5FWE A;  4TN7 A;  5FWJ A;  5F5I A;  4EZ4 A;  5F2W A;  5FXX A;  3K3N A;  5IWF A;  5A7O A;  3KV4 A;  5K4L A;  5FZ6 A;  3UYJ A;  3KVB A;  5FYI A;  4D6Q A;  5FJK A;  2YU2 A;  5FY5 A;  5KR7 A;  5LY1 A;  4NUB A;  5FBJ A;  5FZ9 A;  5A3N A;  5FPA A;  4GAZ A;  2YPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...