5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
5FYVA 3NJYA 4UF0B 3RVHA 4CCJA 2OS2A 4V2WA 4BISA 4CCKA 5FZ8A 4HONA 2XMLA 5F37A 5FWEA 5FPBA 3PU3A 3AVRA 5FYYA 5FYIA 4QX8A 2Q8EA 5FWJA 4AAPA 2OX0A 3OPWA 4HOOA 5E6HA 5FY7A 5FUPA 5FZLA 5FZ7A 5FP3A 3AL5A 5FZ3A 4IGQA 4XDPA 5FZ6A 5IVYA 3KV9A 2GP5A 5A80A 3KVAA 2YBKA 5FZDA 5ANQA 4TN7A 3K2OA 4GJZA 3KV4A 5FPAA 3UYJA 4LIUA 4D6RA 5FPUA 5FYMA 2OQ6A 4XDOA 5FY1A 5FZEA 5FZKA 2XUEA 3PU8A 5KR7A 5FZFA 5A3TA 5LW9A 3N9QA 5FP8A 4QX7A 2Q8DA 4Y4RA 5IWFA 5FP7A 5FXZA 2PXJA 5FPVA 5IVVA 4GJYA 4BXFA 5F3GA 5CEHA 1VRBA 4DO0A 5IW0A 5F5IA 3DXUA 3N9MA 4IGOA 3ZPOA 2YPDA 4NUBA 4CCLA 5A3NA 3KVBA 3OPTA 4ASKA 4IGPA 5F3CA 5FV3A 4QXHA 5FPLA 5A7SA 2YBPA 3N9NA 5IVEA 4QWNA 4Y3OA 5FZCA 3N9LA 4QXBA 5F2WA 5FBJA 5LY2A 5FXWA 5LWBA 5A1FA 3AVSA 5A7OA 5FZ9A 5A7NA 5F5CA 5FZGA 3U78A 5FYCA 4LIVA 5F32A 5F5AA 5FZMA 4URAA 3LDBA 4E4HA 2GP3A 3K3OA 3N9PA 3PUQA 5FYBA 5FZIA 5A7WA 5A3PA 5F2SA 4C8DA 4D6QA 5FXVA 5FYHA 2VD7A 5FZBA 5A7PA 4D6SA 2XXZA 4CUGA 5A1LA 3DXTA 4QU1A 5FZAA 5K4LA 5IVBA 3KV5A 2WWJA 4CCNA 4Y33A 3PUSA 5FP9A 4DIQA 5FY9A 2Q8CA 4CSWA 5FYTA 5A7WB 4AI9A 4CCMA 5FZOA 4GAZA 5F3IA 2WWUA 4QXCA 4LITA 5FY8A 2W2IA 5IVCA 4UF0A 2YU2A 4GD4A 5FJKA 5FY0A 5FZ1A 2YU1A 5FJHA 5LY1A 2XDVA 5FY5A 2OT7A 5FUNA 4LXLA 2P5BA 5FXXA 2YBSA 4EZ4A 5FZHA 3AL6A 5FYSA 4BU2A 4V2VA 3KV6A 3N9OA 3U4SA 5FZ4A 5FYUA 5IVFA 5ISLA 5FY4A 4CCOA 5FZ0A 5F3EA 4EYUA 4EZHA 3PTRB 2OQ7A 5F39A 3LD8A 5FP4A 3K3NA 5FZOB 5A3WA 5A7QA 3PURA 5IVJA 5FYZA 3ZLIA 3PDQA 3PUAA
chains in the Genus database with same CATH superfamily
2JDHA 3DKQA 1O3SA 2XHKA 4LK6A 4BQ3A 4B4PA 5CFCA 3I4IA 4MGTA 2X10A 1WCSA 4AGVA 4FPHA 5E6HA 2DCZA 5IK4A 3R05A 5FZLA 2Z69A 4Y4YA 4MHRA 3WEZA 5C8CC 4RQPA 5JR2A 1TME2 3AM2A 3LEMA 1OKQA 3PVEA 4QPYA 5I0UA 2CGPA 3SLIA 1XPWA 2HWF3 3ES4A 1GFF2 2NM1A 3I2DA 3RS6A 4C1WA 4PDWB 4Y1XA 1FOD2 3RSJA 3P3PA 4M01A 5H9RA 4AHXA 4TN7A 1C8M3 2VZRA 5FPAA 2AENA 2BWAA 2UWAA 5F8PA 4M4RA 4YVWB 1CAVB 1OVSA 1ZYBA 2GNDA 1W9SA 1LCLA 3UKTA 4I09A 4EWDA 1ND2B 1XBFA 4AYUA 2TNFA 4CCEA 4CE8A 1F5FA 4YW7A 2BERA 5C5TA 2G4IA 1U5IA 3B9IA 4G9SB 5JPMB 1YWKA 4ISQA 2E51A 3D5OA 4H7LA 3QLQA 1XRUA 2LW8A 4KG0A 4ET7A 3H8XA 2YPDA 4NUBA 1AR82 2TUNA 3ZYBA 3H8UA 5LASA 1R1A2 2YROA 2JB4A 3WHTA 1OQEA 1RXFA 1ALYA 1OLQA 4GKXA 2FHRA 1J83A 3AP9A 4UFHA 2P3IA 5DDJ2 3FE5A 1C5IA 2DCKA 1UWWA 2OZ6A 5C3RA 2PAMA 3GALA 1RJ7A 1GOGA 4URAA 1OH4A 4CDXB 2BP6A 3LCPA 5GZGA 1OD5A 1SACA 4LE4A 1PK6C 1QJFA 2B4KA 3QACA 4QKDA 5A3PA 2A3YA 3B00A 1LOAA 4H2AA 3WNMA 3LA7A 4LLOA 5E88A 2HWE3 4LBQB 1RUNA 1GU3A 1BJQA 4CP9A 5K4LA 2XJSA 3SCGA 3MI8A 4CUBA 3KHBA 2QKDA 1PM7A 4H55A 2PMWB 4QPIC 2ENRA 2AEYA 4LHKA 4CDWC 1KFXL 3DL3A 3TN92 4QKNA 3BU0A 2R0HA 5BUVA 2WZEA 3TEZA 3SH4A 1GZWB 3SKJE 1SLAA 2J1TA 1OPOA 3P1IA 1BEV1 1UKGA 4AL9A 4AI2A 1DQ4A 1Q8OA 1UY3A 3GZAA 3LFMA 1M4WA 3H1MA 4TYSA 3VZJA 4QHZA 4EZ4A 4YARA 3H3LA 4CU7A 1SDDB 3C7OA 3PVNA 3KV6A 1VAVA 2NMNA 4NVPA 3KB5A 4XXAA 2RR13 4FVVA 3OBAA 2WDBA 5IK7A 3LD8A 5LBFA 4EWAA 5BY5A 3KMHA 2P1BA 4OMCA 4KGQA 3IB3A 3TWIA 1URXA 2RE9A 4Q2FA 2D5FA 1FPN2 2W08A 3UGHA 2MEV1 2IXKA 2K46A 1BKZA 5FLJA 4BISA 5CADA 3OBZA 3MHZA 2WIIB 4RD7A 5GM0A 1CR7A 4R9CA 1UZYA 1OA4A 5K0UB 1Q5OA 3MYXA 4GMP0 1W9TA 1ZNPA 4YNIA 2ATFA 2XBO2 2K0GA 5BPXA 4XDPA 4M3CA 3WSOA 1W9FA 2J1EA 4MVTA 1WW5A 3HNYM 3POFA 3VBSA 4ASMB 2WNVA 1VMHA 4I0AA 4LO6B 1UZZA 3O1UA 1XE7A 3HEIA 5KXCA 3VBOB 3VKLA 5SV5A 1WCDJ 4XDOA 3HPNA 3W5NA 3JD73 5ACA3 4MGZE 3W58A 2QQOA 4J1XA 1RUJ1 4J6GA 2YDEA 1SLCA 3I3QA 5KR7A 1W6OA 2XVGA 1UNBA 1ZRRA 1MS1A 1KS4A 4KI5M 3C8XA 1LHUA 4EN6B 2ZACA 3K4AA 3RMXA 1TVGA 2OKXA 3A0NA 4K7JA 1YIFA 1ASJ3 2LROA 4AHYA 1BEV2 4XUNA 2GC1A 3KT1A 4NR1A 4OZOA 3AMMA 3CJIA 1MQTC 3KD4A 2JDMA 4Y5SA 3D0JA 3TBDA 5FMCA 1ZZ6A 4HSLA 2W94A 2GN7A 3WF3A 4W6XA 2VZPA 4YVWC 5JOZA 3O1OA 4CEYA 4JTOA 3WNLA 3NKTA 4BPZA 1H2MA 1PGW1 3IAPA 5T5OA 2GALA 4XJZA 3VDDC 4A45A 2LRPA 1PO11 4QB6A 1TZOA 1DZRA 4XYXA 5GLWA 4AE2A 2JEMA 1MS3A 1H1MA 3LSDA 4YM0A 2QZ2A 1GQPA 5L9RA 1PNFA 2C9KA 5T5PA 2MEV2 1JYCA 1GSLA 3B5LB 3RPQA 4RN5A 1SLLA 1US3A 3FBYA 1O4TA 2E9QA 2VD7A 2WINB 2VG9A 3LWCA 4A6SA 4J25A 4Q0VA 3VHRA 5HBAA 2ZKLA 2MHFA 4JGZB 5DAXA 3MIEA 5KHIA 2VU9A 3VD3A 5CKNA 1ZZ8A 4HXCA 1NT0A 1YEWA 3KHCA 2WWJA 2LS6A 2VUJA 4WBBA 3AJYA 1CONA 3DYOA 5IJRA 1IS5A 2W95A 3ZXLA 2VO5A 4XVHA 4Q0PA 4CEWB 3L2YA 5FY9A 4XDQA 4D0QA 4ZZ8A 2XJUA 1NCQB 4Y20A 3JZVA 4JDMA 2I2SA 3AZWA 4NAMA 4XUTA 4RA0A 1CVNA 3WCRA 4XF9A 3ZVXA 5D1IA 2F6BA 1PM4A 2ES3A 4K8FA 5FPXA 5IVCA 1KFUL 2ZHNA 3IN9A 1AR63 2YC2A 2GH8A 2XDVA 4I0BA 4LKSA 5FUNA 3F2ZA 2R073 2PHWA 1NE4A 5C4WA 4CU9A 1DGRN 3RWNA 5JZGC 2EXIA 3ZIXA 4W6WA 2HBUA 3SEPA 1R093 3AZZA 3VKMA 3C7EA 3IDCB 3VDCA 5IVJA 1W99A 5CKMA 1WA6X 4FTSA 2CGNA 2AREA 2IZWA 3SISA 2BDRA 1G9CA 4NRMA 5A33B 1NXMA 1PX4A 1A78A 1WKYA 2J1RA 3ILNA 5F37A 5FWEA 2Q8EA 4XTPA 3Q8CA 1PO12 4LBJA 1SFNA 2ARBA 1DG6A 2W68A 2XB6C 4BQXA 4CP1A 3PL0A 5FQ0A 3EXUA 1DQ2A 1G6NA 2IFWA 4NPRA 3J4UH 4ARXA 4B3NA 3ZDVA 2BNNA 4LULA 3M3QA 4P00B 1BVVA 3S5QA 1DP0A 2Y38A 3FX3A 4NROA 3MIBA 4M4PA 4LNVA 3ZYJB 1NZCA 3POSA 4EROA 3WQ0A 4HK9A 5D8AB 2VGDA 4UXAA 4OZXA 4L92A 4BH9A 3BPZA 3T1MA 3BOWA 4QX7A 4FPOB 4BK5A 1Z0HA 1F31A 1BBT1 1H6YA 4GJYA 5C9AB 1UAIA 4N9IA 4BQ5A 4ITCA 4XBNA 3WNKA 3LF7A 4XF0A 1MZ5A 1UZVA 3WQBA 2D97A 1LHNA 4WVMB 5KHGA 4ZU5A 1JYTA 2ZS6B 5DZEA 4CCLA 1CIWA 1Y9MA 2BGPA 3USUA 2B9UA 2ZPXA 3O1VA 5C9AA 1LOFC 1UMHA 4JKMA 2HWD1 3VBOC 3WINE 5HV4A 5J96B 5A1FA 3H3ZA 3DYPA 3JB8A 5C33A 2DVBA 4LHSA 4XUQA 4Y5TA 2WABA 3POWA 1U5XA 2XLGA 3N9PA 1COV3 4YW6A 5FIXA 4JGYB 2TBVA 5BNOB 4WM7C 5LRSA 3IAQA 3OBRA 5A7PA 2YC0A 3HJRA 5JSOA 1NYWA 4MGKE 4ATFA 2RMU3 4V1PA 2E63A 3I8TA 2VBBA 4FPFA 4NRQA 4IEXA 2VZ1A 3KT4A 4QPGB 2CAVA 2A71A 2JG9C 2W1WA 2E32A 4E27A 1W8NA 2C6SA 3BALA 4KWJA 2ZJCA 4FTEA 4QDRA 1REEA 4FPYA 3WF4A 3VDBA 5C3SA 1ULCA 5FYTA 5CG8A 4K6BA 3ZXDA 1S2BA 1POQA 3ZFFA 2FD8A 2UURA 4Q4V3 5ABJA 5F3IA 4BDVB 1N1TA 3MUZ1 5CYYA 5FY8A 2GC0A 4CTEA 1UY0A 2YGLA 3MDPA 2YU1A 4QQOA 2ERFA 4Z2AA 2JIJA 5H9PA 2D43A 1FV3A 1GP5A 1RUE3 4KWUA 2DU0A 2FCTA 4Q4W2 1GNZA 1KEXA 4RR3A 4YW5A 2Y6HA 3ASIA 1RUD2 1QJEA 2HWB2 5F3EA 4HKOA 5HCAA 3PTRB 4CEWC 4JQTA 1OMIA 4XACA 5A3WA 4AWDA 4BHPA 1TMF1 4Q4X3 2JG8A 3KQRA 5IT6A 1ZREA 3DECA 2W1SA 5DUVA 4EV0A 2Z5WA 4QAWA 4KWLA 1PVC1 1B35B 3E6DA 3HQUA 2RM22 3RQ0A 2HWD2 3J8F3 4CCKA 1JZ4A 1LU2A 1RVF2 1MS9A 2AGSA 3ZSLA 5FPBA 4Z92B 4F7ZA 3O1PA 5FYIA 1O4YA 1QY4A 1RUG1 4KL1A 4BQ1A 1QGLA 4XHBA 4AQ6A 1RHI1 2PHTA 5FKBA 4FOYA 2VPVA 4AVBA 1RUC2 3WP5A 4AG4A 2ZEYA 4UT5A 1JTZX 3RZMA 4AQ2A 1VRH3 5GLVA 2GP5A 1AF9A 2I74A 3T3YA 2VE1A 4WZFA 1YNAA 5A80A 1NE6A 1W6NB 1VALA 4FFHA 3OBTA 5FZDA 1AYN3 3PMSA 4K8RB 4XBQA 3CJXA 3I2FA 1QQP3 3FFQA 2WA3A 3QOPA 4FPJA 4BMBA 2XUMA 2R49A 4PIZA 5EPAA 2XVKA 2BNOA 3JUUA 4YYOA 3WY6A 4BMEA 2KXLA 1GNYA 5A3TA 4P9YA 4Y22B 3CKHA 5SV8A 2WO7A 3TOJA 2CU5A 2Y64A 3D8CA 2CY6A 3S57A 2Q5TA 4NRPA 5DQ0A 1W6PA 4RGGA 2VCMA 1MEC2 4DUXA 1BMV2 5HV0A 1H8TC 4SBVA 1V0AA 4LHNA 4XQWA 1Z7S2 3BI3A 1UQXA 2XQRA 4FOQA 1YQ6A 4A6OA 1G8WA 5EP9A 3H9AA 1GWKA 3VL9A 3I7DA 5F3CA 2R1DA 4YG6A 1AL23 2O0OA 3AJZA 3AKTA 5A7SA 3N9NA 3VKFC 2ZGLA 1NY71 2DVGA 3VD5A 2A6WA 5FBJA 1H6XA 4JHZA 5D8AC 1C3HA 1KQRA 1H2KA 4AZZA 2VR4A 2KA3A 2YXSA 3RZHA 2DUQA 2V5DA 4L9BA 2WNUA 2DCJA 5E1RA 5JIAA 2GP3A 1PO21 3HAGA 5KXBA 3VD4A 5GLZA 1AR72 2ZGPA 5A6QA 2XLAA 1OOPA 4DB5A 1W0OA 3AXDA 4Q0UA 4C8DA 3BIEA 1SCSA 1QJX1 3E97A 4XAAA 2GN3A 1RUG2 2PHRA 2VUAA 2YYOA 1RINA 3B93A 4UW6A 2YUEA 1ZBA3 4YM2A 1X9PA 1L7LA 1TME3 3V0BA 1POV1 3OUIA 2D6PA 2JE7A 2R063 3LKJA 3T4VA 3BPSA 4QM9A 1RUH3 5J48A 1N3OA 2OZJA 3N35A 1ENSA 4F83A 1LECA 3OJBA 3THCA 3O0VA 5IFPA 2DYCA 4EN8B 2UWBA 1VBB2 2JD4A 3GYDA 1EP0A 1OD3A 1YFXA 1IKPA 1ZVFA 3BTAA 3J7MA 4JGYC 1EAH2 1VBE1 1YI9A 5GJ6A 3WP3A 4BK4A 5BNOC 2VOTA 5C6CA 1NLRA 1NA1A 3KCCA 5KWRA 4CDUA 1OH3A 2RS51 4AI0A 4A2UA 2VMHA 1S0EA 5FLIA 2EAAA 1DQ0A 1AJKA 2W5FA 3ZOIA 4ES8A 4XABA 1KRIA 1UOFA 2Y33A 2F4LA 5G04L 2FDKA 1WLTA 4INDA 2QQMA 1HXS2 3EQEA 3JBG1 4YG3A 4Y1VA 3SH3A 4BJ0A 5A7QA 1YO8A 5FBZA 2IC1A 2QFEA 1A3KA 5L7OA 3AP4A 2RS31 2JDAA 4AAPA 1R1A3 2DU1A 4P14A 4YGCA 3I2GA 1GQGA 3MIGA 1G7YA 2P37A 1D2QA 2R041 4L8QA 3NWKA 3Q9OA 2W3JA 1NY72 2XJTA 2VVFA 1OHFA 1X8MA 2EIGA 4O9GA 4HONA 4Q1RA 5DDJ3 4EN9B 5KBFA 4QD2A 1I1EA 2OPWA 4Q26A 5I8TA 4BE3A 4E4DX 1ULEA 1W9WA 2BTVC 4B4RA 1O8PA 4OUSA 1KD7A 4GMP3 4I30A 4XFCA 1WBLA 1Y3TA 5FZ3A 2IXJA 2VOVA 2XJQA 4ASLA 1PO22 3CO2A 3HQRA 3OGVA 5ANNA 4C1XA 5CKQA 1SLTA 4RGKA 5BNPA 1FV2A 1UO9A 5CFDB 1J1LA 1W90A 1JYIA 1VBC1 1CWPA 5DAQA 1SMVA 3ZFEB 4E8DA 4HZFA 1CN1A 3DGTA 1RUE1 3K2OA 4IEYA 3UESA 1GUIA 1B35C 4LIUA 4D6RA 4COZA 1D4VB 4MG2A 2W9XA 4FP2A 4LBMA 2O1QA 4YG0A 5FY1A 2X05A 5T52A 4NPLA 1ND3A 3TN93 4H3WA 4EJRA 3B9CA 5I0SA 2LM3A 1W2UA 3EBRA 1VRBA 5FMOS 4DO0A 3SCHA 3OY8B 3WDYA 5F5IA 2IXHA 3MLJA 4MLOA 4N53C 2R16A 1SBFA 3IPVA 1O7FA 4BIOA 3NAPB 5FPLA 2RS52 1X50A 1HRV2 1UU6A 2ZMKA 1VIWB 1W3VA 2IWGB 3ORJA 1K12A 1S0DA 3T09A 1GKBA 5LA9A 2AR6A 3WZ1A 5DG2A 1ONAA 3K4DA 1AR91 1WMXA 4P08A 2WZPP 1IHMA 4DXZA 3JBG2 2CNAA 2WSVA 3POJA 1H4GA 3AX4A 3NAPA 4N9HA 4XFAA 3U78A 1W6QA 2RS32 5F32A 5EJ1B 3MW4A 4QU2A 3LDBA 1WUVA 3PUQA 3I3BA 2FDGA 5FZIA 4PHZA 1GZ9A 1WMEA 4ZS2A 3RZLA 3NNGA 2JX9A 5D2AA 1W06A 2DDUA 4CDQB 4HFSA 4K1ZA 3AZVA 3SNMA 3IIAA 1C28A 2DVDA 2WN3A 1WMDA 3CLPA 3T0DA 3HNMA 1S0CA 1QEXA 2XJPA 4P9GA 1LNSA 3ZSEA 4OFGA 1EUUA 4NHKA 4IL7A 1TQ5A 2HWC3 1HRI1 4NHLA 5JXIA 1UN1A 4CSWA 4QGLA 3TRSB 1VBC2 3MIHA 2XJVA 3OSDA 5JMOA 5LCWL 3WP6A 2WFF3 1VB2A 1O3TA 3MV01 1SDWA 5FZOA 1SFYA 5DUXA 3QD6A 4YW2A 3FL7A 4QXCA 3EO6A 2YU2A 3GM8A 4GD4A 3VZLA 3OEAA 4N43B 4D7SA 2P5BA 3NV3A 5A6XA 3THPA 5FZ4A 4ARYA 5FYUA 4CCOA 2VAUA 4RFRB 1WMFA 1AZDA 3H7YA 3ZXJA 1YI7A 1KJRA 5GALA 5FP4A 1NCRB 2WNOA 2WZR3 3PDQA 4OULA 5JXGA 4KGGA 2H0BA 2SLIA 5AVPA 4AFMA 1IS3A 4JQRA 4YLZA 5JOYA 2W1UA 1VBA1 1WWYA 1ZBE3 2RS13 1S0GA 4QPIA 5FYYA 4AQTA 1RUH1 1AR92 4CDWA 4E4ZA 5FAXA 3V64A 3VBFB 3O5SA 2VMGA 3VBUC 3RYKA 1QJY1 4TXWA 2ILMA 1S0FA 1GZCA 1W8OA 2JIGA 5IK8A 5GZEA 3KWVA 2NLRA 5G05L 2G9GA 3WW4A 2Q4SA 4ZU7A 1VBD1 4UWDA 3WD5A 4BYYA 5CFCB 5IK5A 1ZA4A 4I01A 3TAYA 3ZFGA 2Y6KA 4PBOA 1WCQA 1F4HA 1GWLA 2ARAA 2HKXA 2IFRA 2PQSA 2X09A 3ELNA 4XZPA 1HB3A 1I6XA 5LA2A 2Y0IA 4K40A 3R6SA 2N7GA 2VZUA 5T3NA 2JDZA 2JDYA 4MYEA 4RQPB 2WLQA 1DGWA 1ULGA 3MLLA 3OF1A 4AEDC 2B8MA 2PLV1 3N4MA 1HRI2 2EIBA 1RUF1 3RYRA 1V00A 5DABA 2FQPA 3FC0A 4D3WA 1KITA 1UXXX 2B39A 5J7MA 4NWWA 5IW0A 2DTYA 2IXCA 3QH7A 3M70A 4IW3A 5BNQA 3ZPOA 5A3NA 1FX5A 3ILFA 4RS5B 4DRRA 2WL1A 4GMP1 5IVEA 1A8MA 1A8DA 3W9AA 2BQPA 4W50A 3CBNA 1WLDA 1GBGA 2EF6A 5LY2A 5LA0A 5DG1A 1XC6A 5FO8B 3ZO0B 4RS5A 5FZGA 2J1VA 5FYCA 4LBKA 5FZMA 3HOBA 4AXOA 2D6OX 3FLPA 4FQZA 3KCYA 1XE0A 1ODMA 4GWNA 5FYBA 2UY9A 4WVWA 3WCSA 3NJVA 1GMMA 4HN0A 4JRAA 3ACLA 4FP3A 5A6YA 2B9VA 5C8WA 1OKOA 4Y1ZA 4FPEA 1N1VA 5AVAA 3C3VA 5A1LA 2E7TA 2LTNA 2JICA 4NWVA 1RGSA 2AEZA 2QBXA 4FFFA 4R9DA 1Z78A 5IATA 1QJY2 2R32A 5KXEA 1GP4A 3O1MA 1C57A 1JOBA 4CUAA 3PUSA 4FFGA 1PMHX 2A75A 4LR4A 3BODA 1MQTA 3WW3A 2ZEWA 1R081 1VBD2 2OUHA 3BN6A 3GJAA 1PX3A 1NQJA 1JW6A 1LESA 2YV8A 2VVEA 3PIJA 3URFA 1DGLA 1REFA 1V6OA 4QGNA 1QDOA 2VH9A 3VDDA 3GBGA 1YQ5A 1YYNA 4CP9B 3I3DA 4Q4Y3 1SQ4A 2IVIB 4AFCA 2PLV2 1NZIA 2WO1A 4V2VA 1RUF2 2R1BA 4LKFA 4YWAA 5EJZB 4BQ2A 4BCUA 2HEYF 1GANA 2EIDA 4FT8A 1OUXA 5HCFA 4A7YA 2VXJA 4EYUA 4QDSA 3DKWA 4MGQA 2RDRA 1ACCA 1OQ1A 3ZPYA 2BEOA 4IV1C 1LEDA 1BZWA 4QX5A 2ZAHA 2P17A 3KV9A 3POYA 1CAXA 4YZ4A 3IMMA 1U5ZA 4DEVA 1UX6A 4AEKA 1G9AA 2ZGTA 1EPWA 4OLLA 2C5DA 3HBZA 5F6LB 1AYM1 1MS0A 1YQ8A 4CCCA 3F95A 5FWJA 4P9WA 2HWC1 4YW3A 5LBCA 4DS0A 4E9KA 1LB2A 2XLFA 2VNRA 5FOJB 2WN2A 3UGFA 2RHPA 1H8VA 4WV8A 1UPSA 1F4AA 1CJPA 2AC1A 4OQ9A 2R0FA 3BB6A 4PIXA 3OYWA 2O8OA 3RWKX 3PUHA 2DURA 4PF1A 3KZ4C 2Y6LA 3NKGA 4CP2A 3OGRA 4BZ4A 5HI0A 2DCYA 5ANQA 1OLME 5JZGA 3B01A 4Z07A 1MS4A 3C7FA 5FPUA 1RUI1 5FREA 3BOPA 3T1LA 3K51A 3VBRB 2H0VA 4GWMA 3CZUA 1O3RA 4QGMA 1NG0A 2EALA 1DZQA 3H8OA 5FZFA 3UKVA 4ZZ5A 2BYVE 3DF0A 1WZXA 5T55A 3VBFC 2XOMA 2VNVA 4PCRA 3DPRC 1GWMA 4M3CB 5FR3A 5JSPA 2QQJA 5CVRA 1XQNA 1R082 4XFFA 5DZGA 1CD3G 1W8WA 5IVVA 2WRAA 3IZOA 3VBRA 1PIV1 5J98B 1FMD1 3T0AA 1ZRIA 3VBSB 4MV2A 1W2AX 1J58A 3CL1A 2X29A 2WNVB 4NIAA 1PMJX 1F9KA 3VBHA 5CBLA 3D3AA 1UYPA 3AB0A 3ZMNA 4LPLA 3WT3A 1XNBA 2BNMA 1D0HA 4FPKA 4ZONA 1YHFA 2YBPA 4Q4W3 5C7GA 1K5MA 1W6OB 3ZX7A 1IPJA 3ITQA 3I2JA 3LGRA 2Z2SB 3MICA 2HWB3 3POBA 1HV0A 5LWBA 4QHBA 3O0XA 4RQPC 5LZ6A 3GF6A 4RHV3 3K4ZA 1AJOA 2I07B 1XOYA 3D6EA 4AQSA 4IE7A 1OC1A 2ET1A 3ME2A 4R52A 4YM3A 3CJIB 5C3QA 2GNBA 1H9PA 3ACIA 3ZSMA 3LOIA 3OGJA 1RVF3 3NW4A 1AYM2 2PN5A 1S0JA 1WW6A 4CUGA 4CEYB 4RYDA 2VECA 3B02A 5DMYA 1RUC3 4PDWC 4XZUG 4MHUA 4ZXEA 2FDFA 5FK8A 4BWOA 4DXSA 1S4CA 5CU1A 3ZN6A 5HXMA 1QXRA 2ZXQA 4AFDA 1DDLA 2AYHA 2ZOEB 2Q8CA 4I3PA 5FFOC 4I2OA 2HWF1 2QZ3A 5HCBA 4RSUA 1Q56A 1ND2C 3HD8B 4CCMA 4GAZA 2W46A 2A3WA 4OMDA 5AC93 3B94A 1C8M1 2WKKA 4IERA 3POGA 4YVSA 5FY5A 4KU8A 4DQAA 4IESA 4LXLA 5FKCA 4QQLA 2Z4FA 4BU2A 3VUOA 1MEC3 1LJ7A 2X8KA 1GOFA 4HANA 3TYJA 1IPKA 4E8CA 3FLTA 3L2HA 4XXPA 1OURA 1PIV2 1Z7S3 1FMD2 5FZ0A 2TEPA 4EZHA 4WM7A 1HKDA 4Y20B 3NV1A 3ZMOA 3VHNA 2X5IA 2C4XA 4CCJA 2OS2A 4ZHNA 5LRRA 2C9AA 2GDFA 1JU3A 1VMFA 2JB8A 2DBIA 4IQPA 4WVVA 5EZWA 4CDXC 5C4WB 1S2EA 5E8AA 2JG9A 1JZ7A 2XJRA 3E5XA 1BCXA 2W92A 2HJIA 2FCVA 5FY7A 3K75B 1NX9A 1RUJ2 3ZYRA 4TTGA 1JZ8A 4K21A 4IV3A 3ENRA 1AR73 1KDMA 1Q43A 1V9U3 2JDNA 4UFIA 4E2QA 4CVUA 4CUCA 1ULDA 3ACFA 3WDXA 5GZDA 1FXZA 1LGNA 2UY8A 4SLIA 3WNXA 1AX1A 1DQ6A 3AYDA 4DY5A 4WM8A 5FMOL 1STMA 5DZFA 5FYMA 2JKBA 3OGGA 2HWE1 5L36A 5FZKA 1G9BA 5JXJA 1W9YA 3RMYA 3N9QA 4S2GA 1PGW2 1MACA 5EFUA 2VMCA 3LEKA 5FQ0B 2HWF2 2QQVA 2AZ5A 5JSRA 1VBB3 4PI2A 4A7KA 3CIHA 1VJ2A 4AVAA 2ARCA 1C8M2 2ADDA 4XJUA 1DLLA 1E5HA 1D4M3 1V6LA 4YGBA 4AR2A 1UIJA 3N36A 2F17A 5LATA 3NJXA 1JZ5A 1Y9GA 1W03A 1YLLA 4Y3OA 1OFSA 4M00A 2VZQA 3ZXGA 1HXS3 1UX7A 2R30A 2V09A 3AC0A 4NAOA 1IG3A 4Y24A 3OCPA 4PI0A 2VZVA 1XYNA 3MO4A 2RR11 3QH6A 4JDNA 3H1WA 3BU7A 1RXGA 5J36A 2IXLA 2VOXA 4AGGA 5K0UC 1LGCA 3O1SA 4L2NA 3USUB 3U75A 3VBSC 4F8AA 3GBWA 4D6SA 3BCWA 2FBEA 3IMNA 4QMAA 2E6VA 2GAUA 1Q8PA 2BGCA 2PFWA 3ACHA 3AYAA 4H7MA 4AVTA 5EJ3A 4P9IA 1H8TA 5IHRA 1BYHA 1UW8A 3AMNA 4JRLA 1W8FA 3WG4A 4Y5Z0 1I5PA 2AACA 3AP6A 1ULFA 3WX5A 1SBEA 1UU5A 4UBHA 3U07A 3JB4C 2XH6A 3LA3A 3PMEA 3CJIC 4BIFA 4META 4UFKA 3VDAA 4UBGA 1E5RA 5JVVA 4CU8A 2Z42A 4PQ9A 3BTZA 1FATA 4LHLA 2NZ9A 1AXZA 5I0TA 2AUYA 4XFHA 5L9VA 5FLHA 1E57A 1ULPA 3JD71 4CEYC 5ACA1 2YB7A 2A3XA 1APNA 2W87A 2HH9A 4COWA 2UYAA 1N47A 2WFPA 2BBVA 3SHRA 3ACGA 3P3NA 3ZFFB 3N7LA 1LODA 3ZM8A 1ASJ1 5LEKA 5ABJB 3PURA 4JAAA 4HLTA 2YPJA 3ZSKA 2DBNA 3A4UA 2PHLA 4BM8A 4Z82A 3IKWA 4LEJA 1NLSA 2DVFA 4PT6A 2J1UA 3B7MA 4GB33 4IEUA 4URTA 5EYXA 3H0OA 3RI9A 4LBOA 4YZ5A 1W2TA 5L73A 5DN2A 3OUJA 1W8UA 1JZ6A 5A70A 1CESA 4RR3B 4UW3A 3OGSA 1IG0A 2ETEA 1DBNA 3NL1A 1J3QA 2CDPA 1VLNA 3M3IA 3SC7X 4NIDA 5FZ6A 5IVYA 4JGZC 2JG8B 2XL9A 2UYBA 1RMU3 2WT2A 4N8MA 1BBT2 1XU1A 4IETA 4GH4A 2A6YA 2RDQA 1ZRDA 2WS93 5GZFA 1WCKA 3FN9A 2QVSB 1S0BA 1LENA 2Y6JA 4IEWA 3VKOA 4D69A 1NCQC 5C4WC 5JXHA 2P4EA 2A5ZA 3M4FA 3E6CC 5I8SA 1Y7BA 1MS5A 2BVBA 1BK0A 1SCRA 3FWEA 4FPGA 1W6MA 5KHHA 3M3OA 4HVQA 5BNNA 5LBBA 2PXJA 4KNCA 5A1AA 4ES9A 2XGXA 5FUIA 4R9BA 1HB2A 2ZMNA 4IGOA 3ZXAC 1L7QA 4HPKA 3W5MA 4QT6A 1W04A 4X8PA 4N90A 4QKFA 4XJ8A 3B69A 3WDUA 5LEJA 5A6ZA 5ACA2 4ZY9A 1DYPA 1AR61 2XL7A 2LALA 4M3CF 2R071 1UL9A 1UY1A 2VZ3A 3MPBA 4XIKA 1W6PB 2PHDA 1XNAA 1R64A 3OUHA 1R091 4FPLA 4X8NA 5A7NA 4CXYA 5A3LA 2D6NA 5A3UA 4HETA 2CV6A 4QX3A 3C7GA 4LO4B 5FCCA 1NAEA 3ZR5A 3JQWA 4Q27A 3K3OA 2GC3A 3PTYA 1EV13 4E2GA 1D2SA 5EHDA 1GR3A 1ZM1A 5A7WA 4DZGA 4LUKA 2FZ2A 3MV11 4OUMA 1PNGA 1SBDA 4DUVA 2DF7A 1QWRA 4BQ4A 2FDJA 1NOVA 2NMOA 2E33A 3M8LA 1QJU3 1JI6A 3V0AA 5A3OA 4OI0A 5IUQA 2WNUB 1DYOA 4JX0A 4N53A 1PGSA 2XQXA 3LEIA 2ZX2A 3N7MA 3GZUC 4K9SA 4XHXA 1OOPB 2QQLA 2W1QA 1TMF2 4E4SA 1CJDA 3W20A 1MR5A 3UGGA 4OVEA 5C9AC 3FBMA 4ZPIA 1PVC2 1MVQA 3V0BB 2C24A 5LY1A 1W8ZA 3EYPA 5EV7A 2GSYA 5HCHA 4B8EA 1ZZBA 1X82A 2VNOA 3AL6A 4IE0A 1KGYA 4YZ1A 1M06G 1YFYA 4YRDA 2ZX3A 5B4NA 1RHI2 2R6QA 3C2UA 4Z1VA 1IGOA 2OQ7A 1QOOA 3GXUA 1CIYA 3AKSA 1AHSA 1IPSA 1K5JA 2CDOA 2JKXA 4W6YA 4NHYA 2JE9A 5H9SA 1GICA 3PUAA 3ZFGB 5FYVA 3T2PA 1HN1A 4DXRA 1FOD3 1NA1B 1GNHA 1TNRA 1WD4A 1JH5A 2BZDA 2YHJA 2VZSA 3G6JB 4FI9A 2R072 3WF2A 1CAUA 4CDUB 1UD1A 3OB8A 3GNEA 3SMHA 1REDA 4OQ8A 2VCCA 3FJSA 3ZIWA 3AKRA 2J1SA 4B1LA 5FZ7A 1Y43B 4OCTA 2W39A 1IS6A 1RJ8A 2B46X 1PZ7A 3MW2A 5L7OB 5J37A 4XUOA 1LOGA 1LOEA 3LFIA 1XB9A 3ZFFC 1C1FA 1COV1 1ODNA 4QPGC 2JDPA 3TEWA 5CISA 4MGIE 5BXXA 1AR83 4LE3A 1AX2A 2EXHA 2OQ6A 1D7PM 4HVRA 2PHXA 4QX0A 2RMU1 3I2IA 3LAGA 5C5UA 5GLUA 1XU2A 3VGIA 2ZTNA 2YFZA 4JCKA 3O1RA 2VQUA 2OUJA 2WYFA 2VCBA 3D0SA 2ET7A 1JUIA 3HIFA 2V4VA 4Z8BA 5FXZA 3Q8AA 5BNPB 5JI9A 5JUVA 3RDIA 4P5HA 5M0TA 4RL7A 1U12A 1QOSA 4XIOA 5C3PA 2RVAA 2VMEA 3CZJA 4Q4V1 1P8JA 4W8JA 3WUCA 1SPPA 4F3JA 1QIQA 4GULA 1U5YA 4C91A 3VZKA 3LPFA 2OA2A 4IGPA 4AK3A 2FCUA 4S2DA 3WQ7A 3VBUA 5JWPA 1QJX2 5KXDA 1MZ6A 3N9LA 1OUSA 3I2KA 4DNYA 1ND3B 3TNPB 1UOGA 2G9ZA 2XKPA 5I0DA 1ENXA 1RMU1 4FAHA 4YSFA 5LB6A 5LBEA 3LPGA 3CQOA 5K8SA 4ONUA 2XR4A 2WQZC 4GIQA 5F5AA 2WNEA 2R7EB 4XQ4A 3ETPA 4G4FA 4Q4X1 1ZZ7A 3CF6E 4GKYA 3O14A 1LTEA 3MIFA 3APBA 3V56A 4XMAA 1BK1A 1C8NA 1OA2A 1XYOA 3IPVB 2A70A 2DUPA 3NV4A 3O1TA 1O5UA 1QU0A 2EXKA 5FZBA 3VKNA 4BOWA 3J8F1 2B45X 3IM0A 2GC2A 4AEJA 4AEDA 4COVA 1FYUA 1N3PA 1VBE2 3AKPA 4XJ9A 5JR7B 1OVPA 4LKEA 1F8VA 1TEIA 3VN4A 5C8CA 1J1TA 1W6QB 1K45A 1LULA 2JD9A 2ZEXA 4CU6A 1WGPA 1WD3A 4NO4A 1VRH1 2P3YA 5JDBA 1COV2 3L9JT 1YJKA 1QOTA 1S2KA 4J1WA 4LO7A 1W0PA 4GWIA 3GZTB 1AYN1 3RZJA 3ZYPA 1WW4A 4UF0A 1FPN3 4QX1A 1QQP1 5I91A 3JCIA 3U14A 2R042 5FJHA 4CXXA 3ZXKA 2JJ6A 4DOUA 4AHZA 1F35A 4MXWA 1AXKA 3PIGA 2VXRA 4FCAA 3S6PA 4MH0E 1GP6A 4JKLA 3FUOA 5KHKA 1DIWA 1W39A 1GZTA 2XBO3 2A6XA 5C3OA 5FZOB 1OFNA 5FYZA 1G9FA 2VL4A 5GKAC 1ZA7A 4U36A 1HB4A 2P34A 3NJYA 2MNGA 4LBQD 4B1MA 5CA6A 4V2WA 4CCDA 4JV4A 4PBPA 5K9YA 1AL21 4KH9A 1RUE2 2VMIA 2ZGMA 2CHHA 3IIIA 5TSWA 1KJLA 4QX8A 1POV0 3FHQA 1ZZ9A 2O8QA 3HWJA 3OPWA 4XUPA 5EIYB 1J59A 1PK6B 1H1IA 3HQXA 3KSCA 1E5SA 2Q30A 1SLBA 1SEFA 2KM2A 3K46A 4IGQA 5ERLA 1KDKA 4Q4X2 4B4QA 4XW3A 5A32A 3VV1A 1DHKB 3RJRA 4D7YA 1PK6A 1BEV3 1CAWA 3ZFGC 3IDBB 3J8F2 1DU3D 4C0HA 4QPIB 4JVAA 4OHVA 2GZWA 4CDWB 2O14A 2PHUA 2WSUA 3BIWE 3JXSA 4YGEA 1JZ2A 1ZBA1 1V6KA 2ZCWA 1TME1 3LB9A 1IKQA 4BB3A 5LW9A 1KS5A 4XE9A 3I59A 3U11A 2R061 1IZ3A 1VRH2 4IV1A 2XONA 4TLFA 2VMFA 2Y6GA 5C71A 2ZHKA 3THTA 1S55A 1O5LA 1UY2A 1LAJA 1C1LA 1YFUA 2WWSA 2ZKNA 3PUIA 3ZR6A 1YCIA 1PGL1 5J09A 1QQP2 2MEV3 4R8HA 3KVBA 4Q0QA 4YGDA 2ZABA 4KMQA 4QXHA 3AMQA 2D5HA 4ISRA 4MZUA 2IXIA 1CX4A 4LK7A 2VC9A 1G9DA 2VJXA 2IUWA 1QHDA 1WW7A 4EQVA 3N3HA 1XJAA 5T5LA 4I02A 2D40A 2YGMA 3KLSA 1R1A1 1LHWA 2BOIA 1W3XA 2CGOA 1AL22 5FXVA 2BFUS 2VBDA 3RRDA 2XPJA 1QXPA 5E16A 3DPRA 4P5YA 5DDJ1 4UFJA 2YFUA 5CNAA 5FZAA 5CFDC 3MBWA 5IVBA 1RUJ3 3I2OA 3GHMA 4PQQA 1IS4A 1ND3C 4LA3A 5JI7A 3ZFEC 1W8HA 1ST8A 2FZ1A 1OF3A 3LE0A 4B29A 3ZYIB 2W0XA 3RZGA 4XF1A 1X7NA 4KG8A 2G9FA 2E53A 1H9WA 3LZZA 1O4ZA 3V65A 4QKBA 4GA9A 5CZKA 2WJSA 5FJKA 1QNWA 4EE2A 1ZBA2 2VBPA 4R4ZA 4XTMA 3T4HB 1VBA2 2R062 1UKRA 2WT0A 3FMGA 1FNZA 1RUH2 2D6LX 3PVOA 3U4SA 1PO13 3TN91 1HJGA 1MQTB 1UOBA 3NAPC 5LA1A 3ZXFA 4L99A 1QH7A 4QX2A 5F39A 4OHYA 3U0ZA 1PGL2 1ZZCA 1Y9QA 4XMIA 1EPZA 3W59A 3VDDB 2EAKA 4L97A 4PDWA 1AL0G 2QQWA 1UYXA 2DWRA 2ID4A 3KCXA 1OI6A 4PLOA 1RYYA 5T50A 2PELA 3ILRA 5FOBB 3FZ3A 4YVWA 1DZTA 1CAVA 2VZTA 4FPCA 3FFZA 1ENQA 5FUPA 2WQ8A 3WUDA 4CDQC 2EVXA 1ND2A 4R9AA 1RITA 1UU4A 2YMZA 3SKVA 3B3QE 1OSGA 4XEZA 2J42A 1CAXB 1HQNA 3NMBA 1QNYA 1FPN1 3M3EA 4EN7B 3T2TA 5L19A 5JLVA 3RG0A 1MPXA 4IE5A 4O61A 3RJ2X 1HN0A 4FO9A 5IAVA 5CAZA 3KV4A 3HT1A 1A34A 3R4DB 2XKOA 4TZDA 1OLMA 3AP7A 4ATEA 3INAA 1RTVA 1YQ2A 1L3JA 2XUEA 1J3RA 2HEWF 1FAYA 2XBO1 4R4XA 1OQDA 4XOGA 1N3QA 3AXEA 4LO8A 3FLRA 3OYWB 3R4UA 4NHMA 2VNGA 2A6ZA 4BXFA 4LBNA 4N43C 5CEHA 1T2XA 1YXWA 2D3PA 2QQIA 1LHOA 1QXJA 4P9LA 3OD4A 4CDXA 1B09A 2WFF1 3J7NA 5JZGB 1AVBA 1TG7A 4NJ4A 3NJZA 3WNOA 1JOPA 4ASKA 3ATGA 5FV3A 4AVCA 1DQ5A 1U0AA 2J7MA 1NCRC 3LEGA 5FZCA 3PVBB 4QXBA 5JIUA 1SLIA 3GDBA 2WR9A 4LBQA 3WR0A 2P2KA 5APAA 3WW2A 4OI1A 1UOJA 1YRZA 1V6IA 2DV9A 2ARXA 1ULOA 3Q8FA 4QHOA 1OLRA 2RJLA 3AZXA 1CGPA 3VBHB 1N1YA 2Q1ZB 4Q0SA 2QQKA 1XSRA 1XNCA 2Q1FA 5BYNA 2WZR1 2QDRA 3AMHA 3HVDA 5DUUA 2DTWA 3SXWA 4GQ7A 4HKLA 1OT5A 1GZWA 2QQPA 3LOBA 1PVXA 1ZRFA 4QXKA 1K5MB 2B7YA 1ZBE1 2RJ2A 2RS11 4B7EA 3J9SA 4QU1A 3MF9A 3HNBM 1Q3EA 2Y60A 5CFCC 2WBKA 3WW1A 3T08A 1XNKA 3QCWA 3NRUA 4LO5B 2CTVA 2JXAA 3CU7A 2H6CA 1SG3A 3MPPG 1QKQA 5FP9A 4IEVA 1BBT3 4MO3M 1RUD3 5F6KA 4AW7A 3KF3A 5FTTC 2W47A 3VB9A 2RDNA 5J3UA 3WF0A 2BBAA 4LITA 3MF6A 2V5YA 3MUY1 3H50A 2ORZA 4QB1A 2RM23 4AFBA 2HWD3 2Q8OA 4AI8A 4Q8KA 3ZN6B 5CB7A 4NMIA 4IXLA 1UZ0A 1RUOA 1BVP1 1GV9A 1R1ZA 4K3UA 4RS5C 2HWC2 5K0UA 1BHGA 2ZMLA 1S1AA 1VPHA 5K7PA 4XCAA 2WFF2 4UW4A 2Y6FA 1H30A 4LORA 4PJYA 1LEMA 1WCUA 3IWZA 3NQHA 3E5QA 4CP0A 2XWJB 2WUHA 3PLQA 1CQ9A 4YVSB 3IDEA 2FDIA 5FZ8A 3PJQA 1LOFA 2VM9A 1O6UA 2XMLA 5KHJA 3HR9A 1OPMA 3PU3A 4LBLA 3FHIB 3VBOA 4ZS3A 4XFBA 1RUI2 4BQWA 2OX0A 3C7HA 5KC6A 1O3QA 3AP5A 2WLPA 4XC9A 1X33A 2X53S 3TNQA 3AK0A 4GWJA 3VHOA 3AL5A 4DINB 1MS8A 2E31A 2Y34A 3KGZA 3ETQA 1HB1A 4L0PA 4M3CE 1N1SA 4WM7B 2WZR2 3S30A 4XQDA 4NOTA 5B4XA 1OXCA 2W52A 2X5IB 2RG4A 4OI2A 1LGBA 2ORXA 2YC4A 2EIEA 4DRVA 1ZBE2 2RS12 1UXZA 2A73B 2JG9B 4UI9L 4YZ2A 1YFWA 5LK7B 3RZKA 1X8EA 3AFKA 1X9TA 3VD7A 4E2SA 4W65A 1YQCA 1HIXA 4FOWA 3RNSA 4NIHA 5FP8A 4IV3B 4GZ9A 2BUKA 2JWPA 4Y4RA 1VAMA 3VLBB 3ZXEA 1JYVA 5FP7A 3MW3A 2RV9A 1JMUB 5FPVA 2VW1A 1RIRA 2V4AA 5CIRA 2B42B 5DAVA 1H0BA 5F3GA 3I2HA 2WO3A 3OOXA 1TMF3 3POEA 5I8YA 3J26N 4LOSA 5H9QA 1QDCA 2RDSA 3VL8A 4M0NA 1PVC3 2OVUA 4WM8B 2OYZA 1C4RA 5AFEA 2HLEA 3LSEA 4LUMA 1W8TA 2OPKA 3KGLA 1UYYA 3NNJA 4P9XA 3RFRA 2VUCA 4FSJA 2ZHLA 4DMIA 4IEPA 1W2OA 2ZGOA 4Q4Y1 3K48A 3SH5A 1RUG3 3PHMA 2C1FA 4MSVA 5F2WA 4LT5A 2JECA 4JGZA 1RHI3 4KBZA 4YPJA 1E5IA 2VY0A 3O12A 5EXOA 3M1HA 1J3PA 1UZWA 2XHNA 2BOJA 4CEWA 3OPZA 4NIGA 1MZFA 4GXLA 1NQDA 3AFGA 1QF3A 3BKZA 1RB8G 1NCQA 3W21A 3KF5A 2HEVF 4UYBA 4LLFA 1T6GC 3HBKA 5FO9B 1GLHA 2ZGQA 5EYYA 3I3MA 1EAH3 1JHJA 2DFCA 3DXTA 2A6VA 4A7ZA 3JQXA 2QDNA 2QCSB 5B2GB 2CAUA 2NPIA 1Y4WA 4HK8A 3VD9A 3ZDSA 4MOAA 5GLTA 4AVVA 1O59A 2OXBA 2EICA 3VBRC 1LOCA 2Q1MA 3WQ1A 5FMBA 4M0HA 4O9EA 5FO7B 1VAKA 1DYKA 4AI9A 3VBHC 5L9BA 4CZSA 4ORFA 4IDZA 4DPNA 3E1F1 5GZCA 4U2AA 3D82A 4AFAA 5JOWA 3H8RA 2QJVA 2VULA 3T30A 4PLMA 5A33A 3I3EA 4A41A 3ZYGA 1K5MC 1H8TB 2WNVC 5C70A 5FXXA 2SBAA 2YBSA 3FUQA 5DPNA 4I3GA 1MVEA 2VZOA 4HVOA 3N9OA 1JHNA 2GU9A 1X36A 1KXGA 1PMIA 3I54A 4XF4A 3K3NA 4MX3A 1PO23 4K1YA 5DXDA 3K77A 5DUWA 3RVHA 4W4ZA 1QJX3 4Q4Y2 4QB2A 2ZX0A 3P6BA 4ZKTB 1O8SA 3O0WA 5EWSA 4Q4W1 2Q0AA 4XFIA 1POV3 4OHWA 4CPBD 4FTBA 2HWE2 5D8AA 1DCSA 1RUD1 2HWB1 3ZYHA 1UYZA 3MGUA 5FP3A 4GALA 4LA2A 4LOTA 4RHV1 3HT2A 2VTXA 1UY4A 2PQQA 1JYXA 1JBCA 3H1YA 2BW8A 2A7AA 2HYKA 1IQDC 3KVAA 2RM21 1RC6A 3DV8A 2WO2A 4NE9A 1WBFA 5JOXA 1RVF1 3ZKUA 2ZGNA 1VBE3 2YY1A 4WVMA 4GJZA 1ZX5A 1V70A 2WA4A 1DGWX 3ZN5A 4A3ZA 2BPA2 2YZ4A 1UPIA 4YVSC 2VMDA 4AF9A 1TNFA 3SQOA 2RS53 3WNNA 1HRV3 2OW4A 2VUDA 1RUC1 3PU8A 5JPNB 5I0RA 2GNTA 4RFT0 2MPFA 1HW5A 3JU9A 1SFPA 4DY3A 4Y1YA 3UJOA 3GGLA 3JBG3 4TSVA 4XURA 2ZX4A 4P02B 4ZXKA 4HG6B 4GH4B 2RS33 2RR12 2NYYA 5I93A 1HV1A 1H2NA 3N7KA 4KU7A 2FMDA 4DXTA 2FDHA 2XWBB 3NO8A 1US2A 4WVZA 3J7HA 2X5IC 4QM8A 5CG9A 4O65A 2R043 3ES1A 5AC91 4JGYA 5BNOA 1V6NA 2ZBJA 3TEYA 3PJYA 1I5ZA 2JENA 3NVCA 1BMV1 1W6MB 2BFUL 1MEC1 5A7OA 2C26A 5BNNB 2EXJA 2CWMA 1CZVA 5FZ9A 3UJQA 1XE8A 5F5CA 4QPGA 4IV3C 5D21A 1Z7S1 4LIVA 2BVVA 2OIIA 4OI4A 3BVCA 4PIYA 5FPZA 2PAEA 1XSQA 3WDWA 3WDTA 1VBC3 2CSGA 4HPKB 1FT9A 4B7KA 3OTFA 2ZA9A 4YW4A 3CNAA 4WM8C 3LA2A 3CEWA 1JS9A 5F7UA 4IUGA 1HJFA 1CZTA 1NLQA 1WLWA 4AOCA 1YIPA 2BGOA 1FNYA 1UF2C 2XG3A 4OYUA 2Z79A 4HBNA 4RHV2 4C90A 3JD72 3WF1A 4UFMA 3DCQA 2VQ0A 2H6BA 3KS7A 4LJHA 2L9LA 3KM5A 1OBNA 3WXPA 2WQ4A 4KWKA 1L7RA 2C0ZA 2ZGSA 1F5JA 3S5AA 2WYSA 1AR71 1V9U1 3PNAA 2AH2A 2ADEA 1J84A 5A7WB 1H1AA 3UETA 5T54A 4XF3A 3S7EA 5FMDA 1ASJ2 2ZX1A 3CDZB 4UOJA 1XXNA 4YM1A 4MXVA 2VTXJ 2W2IA 2XVLA 2LUWA 2QTWB 3LDRA 3M7AA 1B35A 3ZN4A 1PZ8A 1H2LA 3DUIA 3LDKA 2WZ8A 4YFWA 3V0AB 3A23A 1K42A 4JHTA 1LRHA 1F2NA 4MGYE 1JN2P 1AR93 1YUDA 1JUHA 3SCFA 2GMPA 2P3JA 3BTXA 4N53B 5IVFA 1K3IA 3WLUA 3E5UA 4XPVA 4IE6A 4XJAA 3T2OA 3ROUA 3VHPA 3ECQA 4ZU4A 4S2HA 4JZRA 1AX0A 5IFTA 1OA3A 1VBB1 2G19A 1UCXA 3ZLIA 1BLZA 3UL2A 1BXHA 1EAH1 4D7TA 5AC92 2ZGKA 1W6NA 5DAPA 3H42B 2D6KA 3EHKA 3QBQA 1D4M1 2Y26A 2CWSA 4AHWA 2A1XA 3AYCA 3GJBA 2E26A 3AVRA 3RGBA 2ZAAA 2WAOA 2GMEA 4A44A 2P3KA 4H14A 1HXS1 4X6QB 4P9JA 4Y22A 1ZRCA 1HRI3 2P6CA 3EB7A 1WLCA 1W2NA 4FBFA 1QH6A 2JE8A 3DN7A 2ZHMA 2G1MA 3GZEA 4XAEA 1W28A 3DEMA 5E89A 3RZZA 4UAPA 3H7JA 1CAUB 3BTYA 2UU8A 3UYJA 4AI1A 5F9TA 1YC61 5JMCA 2DUOA 5T5JA 5IYYA 4BLJA 1ENRA 4MUVA 2IVJA 4D8MA 3MFCA 4MGSA 2VQAA 1VP6A 3AMPA 4HN1A 1NXD1 4N7UA 5F5QA 3CHXA 5IWFA 1DF0A 1V9U2 4AVSA 4G3YC 4XBLA 1R092 1CPNA 1UMZA 1PHMA 1I9RA 3T2QA 1D0GA 4AI3A 2QUOA 2VTFA 3THDA 3EJKA 1HQLA 3DXUA 2PYTA 1VE0A 4BLIA 1JYWA 3X29B 3MEPA 5F1RA 3BUCA 3ZSJA 1VBA3 2GNMA 4LTAA 2P6HA 5EQUA 4BXSV 5A3MA 5ABJC 3R0RA 5LK5A 3LQCA 4QWNA 1F15A 4JTNA 3OD0A 4NHXA 4LKDA 4YFZA 3UK9A 3WG3A 3WG2A 4EWEA 1CZSA 1JU4A 2J22A 5FXWA 3WVJA 1JYNA 4QQPA 1QJY3 1YJLA 2VQTA 3HMYA 1BQPA 3WNPA 3OG2A 1C5HA 1HX6A 4Y1UA 1DLCA 1VMJA 2D44A 1FI2A 1HLCA 4FQ4A 4JDOA 4QQ2A 1MZEA 4RR3C 3WG1A 4CPBA 2D98A 2GH2A 4QPWA 5FRAA 1SPPB 1VBD3 1V6JA 2NN8A 1D4M2 2BRTA 2PHFA 4GH4C 1JZ3A 1HRV1 4HL0A 4GB31 5FYHA 3U10A 3M2MA 3VBUB 2JG8C 4D6QA 3UNPA 2DCTA 2XXZA 4NN0A 5HXVA 4NPMA 1W0NA 3KQ4B 5FDBA 2VVDA 3KV5A 3Q8BA 4EN0A 1JOJA 3WOGA 4C0BA 2EA7A 2PLV3 4JKKA 4Q29A 3NSTA 1GQHA 5BNNC 3HN1A 4DIQA 1RUF3 4XILA 4IEOA 2VOWA 4UFLA 4BQYA 3BGAA 3IDAA 4CYDA 2UWCA 5J1XA 2B5HA 2VW2A 4Z2WA 4AAXA 3O7OA 3IT8A 1I3HA 1A6CA 2VCAA 1QJZA 5DAWA 2WS91 3VZMA 1DFQA 4AEDB 2YG0A 3FHAA 4HMZA 3RI8A 3VZNA 3OEBA 4A42A 2WC2A 4IEZA 4I0WB 4YW1A 5FZ1A 5FY0A 1IOAA 2QQUA 3MFAA 3UV9A 5C8CB 5FYSA 1V6MA 2BV4A 5FK7A 1O91A 3A22A 4LMFA 4N7IA 4AGRA 3GCWA 4RGAA 4Q5OA 2I45A 3LIHA 5CFDA 4UF0B 2ZEZA 1T6BX 3R4SA 2KR2A 2V72A 3E6BA 3ZFEA 3AKQA 3TEXA 4MXWB 2WAAA 4MADA 1QMJA 1AXYA 2CL2A 4O7XA 1SZBA 3BYWA 4HOOA 2RMU2 4CRQA 3POIA 4BA6A 2E7AA 2DFBA 1JXNA 3ZKYA 4HKWA 2D7FA 4DEQA 1DQ1A 1RL3A 4LQRA 1R083 2GMMA 2QQNA 2JDUA 4CA9A 2YBKA 1EV11 4GB32 3GBFA 1H4HA 3OY8A 4OUEA 3UT0A 3ALQA 2WNUC 5AFBA 4XCBA 2ZZQA 4Q4V2 5JCTA 2BU9A 3A0KA 3S0MA 1SHWB 3M3CA 3NNMA 1GOHA 1LHVA 3I97A 3KT7A 5FZEA 1OOPC 3SEEA 1NUKA 3D4KA 4DUWA 5IAXA 1HQWA 2RJKA 1EY2A 1QJU1 4DFSA 2HYXA 4FXKB 3T0BA 2Q8DA 3USSA 1W05A 4CXWA 1UMIA 1XNTA 2J1AA 4HSJA 4PLNA 2NQYA 4YZ3A 5A32B 4A3XA 3WDVA 1RMU2 4OHXA 4IEQA 2ZGRA 2KD7A 3NNLA 3WV6A 4FOVA 2QNKA 1UIKA 3Q8EA 1CAWB 4K20A 2WS92 3N9MA 4A4AA 1EYBA 3U37A 3VZOA 4IE4A 4XETA 2PTMA 1G86A 3A7QA 1PZ9A 3UKNA 3OPTA 1NKGA 1AYM3 3NV2A 1LKNA 4CDQA 3NNFA 4NIIA 2D93A 3N7JA 5KC5A 1LU1A 3I59B 2DVAA 4X6RB 3U1XA 4D94A 4IV1B 2W91A 1VB4A 4Y26A 3GCXA 3AVSA 1NA1C 2D3RA 1OF4A 2Y8KA 2F4PA 3EMRA 1Q8SA 1XNDA 1XYPA 4Q8LA 4QQHA 4CDUC 2Y0OA 3AYEA 4S2FA 4E4HA 1CPMA 4QDQA 4HT1T 3WP4A 5BV6A 1TE1B 1VR3A 2VW0A 3MIDA 3HN3A 3AZYA 2JDKA 3IBMA 1WA4A 2K2SA 2BJSA 5F2SA 3I49A 4XJWA 1DGRA 5L7OC 3A21A 1FOD1 3LIGA 1RUI3 2ZZJA 3ST7A 1AYN2 3MLKA 2V73A 3GHNA 4L11A 1JODA 4PF5A 2D3SA 5JAXA 4XFGA 3MZHA 1HDKA 3WHUA 4N43A 1EUTA 3ZYFA 4CCNA 4FFIA 2E7QA 4Y33A 1CX1A 1AUYA 4KBBA 2ZGUA 2QE3A 4COUA 2VOKA 1PIV3 2K9ZA 1FMD3 1EV12 4JC1A 3ABZA 4OHZA 2NP0A 1GYKA 3RYPA 2WT1A 3CMGA 1NCRA 4TWTA 3U4XA 2WWUA 3H3UA 3P5BA 5BNPC 3DPRB 4KQ7A 4WZCA 3J7LA 3S7IA 1AR81 1LR5A 1LOBA 1Q8VA 2OT7A 1QJU2 5FZHA 5HPOA 4COYA 3TB0A 1Q8QA 2D6MA 4Q1PA 3VBFA 2CYFA 2PAKA 3ON7A 1S0IA 2BWCA 4UW5A 3SITA 5ISLA 5FY4A 4AEMA 1IQAA 2PA7A 4FAGA 1AR62 3G7DA 4TLGA 2HBTA 2FMYA 4FXGB 3DYMA
chains in the Genus database with same CATH topology
5FYVA 3NJYA 4UF0B 3RVHA 4CCJA 2OS2A 4V2WA 4BISA 4CCKA 5FZ8A 4HONA 2XMLA 5F37A 5FWEA 5FPBA 3PU3A 3AVRA 5FYYA 5FYIA 4QX8A 2Q8EA 5FWJA 4AAPA 2OX0A 3OPWA 4HOOA 5E6HA 5FY7A 5FUPA 5FZLA 5FZ7A 5FP3A 3AL5A 5FZ3A 4IGQA 4XDPA 5FZ6A 5IVYA 3KV9A 2GP5A 5A80A 3KVAA 2YBKA 5FZDA 5ANQA 4TN7A 3K2OA 4GJZA 3KV4A 5FPAA 3UYJA 4LIUA 4D6RA 5FPUA 5FYMA 2OQ6A 4XDOA 5FY1A 5FZEA 5FZKA 2XUEA 3PU8A 5KR7A 5FZFA 5A3TA 5LW9A 3N9QA 5FP8A 4QX7A 2Q8DA 4Y4RA 5IWFA 5FP7A 5FXZA 2PXJA 5FPVA 5IVVA 4GJYA 4BXFA 5F3GA 5CEHA 1VRBA 4DO0A 5IW0A 5F5IA 3DXUA 3N9MA 4IGOA 3ZPOA 2YPDA 4NUBA 4CCLA 5A3NA 3KVBA 3OPTA 4ASKA 4IGPA 5F3CA 5FV3A 4QXHA 5FPLA 5A7SA 2YBPA 3N9NA 5IVEA 4QWNA 4Y3OA 5FZCA 3N9LA 4QXBA 5F2WA 5FBJA 5LY2A 5FXWA 5LWBA 5A1FA 3AVSA 5A7OA 5FZ9A 5A7NA 5F5CA 5FZGA 3U78A 5FYCA 4LIVA 5F32A 5F5AA 5FZMA 4URAA 3LDBA 4E4HA 2GP3A 3K3OA 3N9PA 3PUQA 5FYBA 5FZIA 5A7WA 5A3PA 5F2SA 4C8DA 4D6QA 5FXVA 5FYHA 2VD7A 5FZBA 5A7PA 4D6SA 2XXZA 4CUGA 5A1LA 3DXTA 4QU1A 5FZAA 5K4LA 5IVBA 3KV5A 2WWJA 4CCNA 4Y33A 3PUSA 5FP9A 4DIQA 5FY9A 2Q8CA 4CSWA 5FYTA 5A7WB 4AI9A 4CCMA 5FZOA 4GAZA 5F3IA 2WWUA 4QXCA 4LITA 5FY8A 2W2IA 5IVCA 4UF0A 2YU2A 4GD4A 5FJKA 5FY0A 5FZ1A 2YU1A 5FJHA 5LY1A 2XDVA 5FY5A 2OT7A 5FUNA 4LXLA 2P5BA 5FXXA 2YBSA 4EZ4A 5FZHA 3AL6A 5FYSA 4BU2A 4V2VA 3KV6A 3N9OA 3U4SA 5FZ4A 5FYUA 5IVFA 5ISLA 5FY4A 4CCOA 5FZ0A 5F3EA 4EYUA 4EZHA 3PTRB 2OQ7A 5F39A 3LD8A 5FP4A 3K3NA 5FZOB 5A3WA 5A7QA 3PURA 5IVJA 5FYZA 3ZLIA 3PDQA 3PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYV A;  3NJY A;  4UF0 B;  3RVH A;  4CCJ A;  2OS2 A;  4V2W A;  4BIS A;  4CCK A;  5FZ8 A;  4HON A;  2XML A;  5F37 A;  5FWE A;  5FPB A;  3PU3 A;  3AVR A;  5FYY A;  5FYI A;  4QX8 A;  2Q8E A;  5FWJ A;  4AAP A;  2OX0 A;  3OPW A;  4HOO A;  5E6H A;  5FY7 A;  5FUP A;  5FZL A;  5FZ7 A;  5FP3 A;  3AL5 A;  5FZ3 A;  4IGQ A;  4XDP A;  5FZ6 A;  5IVY A;  3KV9 A;  2GP5 A;  5A80 A;  3KVA A;  2YBK A;  5FZD A;  5ANQ A;  4TN7 A;  3K2O A;  4GJZ A;  3KV4 A;  5FPA A;  3UYJ A;  4LIU A;  4D6R A;  5FPU A;  5FYM A;  2OQ6 A;  4XDO A;  5FY1 A;  5FZE A;  5FZK A;  2XUE A;  3PU8 A;  5KR7 A;  5FZF A;  5A3T A;  5LW9 A;  3N9Q A;  5FP8 A;  4QX7 A;  2Q8D A;  4Y4R A;  5IWF A;  5FP7 A;  5FXZ A;  2PXJ A;  5FPV A;  5IVV A;  4GJY A;  4BXF A;  5F3G A;  5CEH A;  1VRB A;  4DO0 A;  5IW0 A;  5F5I A;  3DXU A;  3N9M A;  4IGO A;  3ZPO A;  2YPD A;  4NUB A;  4CCL A;  5A3N A;  3KVB A;  3OPT A;  4ASK A;  4IGP A;  5F3C A;  5FV3 A;  4QXH A;  5FPL A;  5A7S A;  2YBP A;  3N9N A;  5IVE A;  4QWN A;  4Y3O A;  5FZC A;  3N9L A;  4QXB A;  5F2W A;  5FBJ A;  5LY2 A;  5FXW A;  5LWB A;  5A1F A;  3AVS A;  5A7O A;  5FZ9 A;  5A7N A;  5F5C A;  5FZG A;  3U78 A;  5FYC A;  4LIV A;  5F32 A;  5F5A A;  5FZM A;  4URA A;  3LDB A;  4E4H A;  2GP3 A;  3K3O A;  3N9P A;  3PUQ A;  5FYB A;  5FZI A;  5A7W A;  5A3P A;  5F2S A;  4C8D A;  4D6Q A;  5FXV A;  5FYH A;  2VD7 A;  5FZB A;  5A7P A;  4D6S A;  2XXZ A;  4CUG A;  5A1L A;  3DXT A;  4QU1 A;  5FZA A;  5K4L A;  5IVB A;  3KV5 A;  2WWJ A;  4CCN A;  4Y33 A;  3PUS A;  5FP9 A;  4DIQ A;  5FY9 A;  2Q8C A;  4CSW A;  5FYT A;  5A7W B;  4AI9 A;  4CCM A;  5FZO A;  4GAZ A;  5F3I A;  2WWU A;  4QXC A;  4LIT A;  5FY8 A;  2W2I A;  5IVC A;  4UF0 A;  2YU2 A;  4GD4 A;  5FJK A;  5FY0 A;  5FZ1 A;  2YU1 A;  5FJH A;  5LY1 A;  2XDV A;  5FY5 A;  2OT7 A;  5FUN A;  4LXL A;  2P5B A;  5FXX A;  2YBS A;  4EZ4 A;  5FZH A;  3AL6 A;  5FYS A;  4BU2 A;  4V2V A;  3KV6 A;  3N9O A;  3U4S A;  5FZ4 A;  5FYU A;  5IVF A;  5ISL A;  5FY4 A;  4CCO A;  5FZ0 A;  5F3E A;  4EYU A;  4EZH A;  3PTR B;  2OQ7 A;  5F39 A;  3LD8 A;  5FP4 A;  3K3N A;  5FZO B;  5A3W A;  5A7Q A;  3PUR A;  5IVJ A;  5FYZ A;  3ZLI A;  3PDQ A;  3PUA A; 
#chains in the Genus database with same CATH topology
 2JDH A;  3DKQ A;  1O3S A;  2XHK A;  4LK6 A;  4BQ3 A;  4B4P A;  5CFC A;  3I4I A;  4MGT A;  2X10 A;  1WCS A;  4AGV A;  4FPH A;  5E6H A;  2DCZ A;  5IK4 A;  3R05 A;  5FZL A;  2Z69 A;  4Y4Y A;  4MHR A;  3WEZ A;  5C8C C;  4RQP A;  5JR2 A;  1TME 2;  3AM2 A;  3LEM A;  1OKQ A;  3PVE A;  4QPY A;  5I0U A;  2CGP A;  3SLI A;  1XPW A;  2HWF 3;  3ES4 A;  1GFF 2;  2NM1 A;  3I2D A;  3RS6 A;  4C1W A;  4PDW B;  4Y1X A;  1FOD 2;  3RSJ A;  3P3P A;  4M01 A;  5H9R A;  4AHX A;  4TN7 A;  1C8M 3;  2VZR A;  5FPA A;  2AEN A;  2BWA A;  2UWA A;  5F8P A;  4M4R A;  4YVW B;  1CAV B;  1OVS A;  1ZYB A;  2GND A;  1W9S A;  1LCL A;  3UKT A;  4I09 A;  4EWD A;  1ND2 B;  1XBF A;  4AYU A;  2TNF A;  4CCE A;  4CE8 A;  1F5F A;  4YW7 A;  2BER A;  5C5T A;  2G4I A;  1U5I A;  3B9I A;  4G9S B;  5JPM B;  1YWK A;  4ISQ A;  2E51 A;  3D5O A;  4H7L A;  3QLQ A;  1XRU A;  2LW8 A;  4KG0 A;  4ET7 A;  3H8X A;  2YPD A;  4NUB A;  1AR8 2;  2TUN A;  3ZYB A;  3H8U A;  5LAS A;  1R1A 2;  2YRO A;  2JB4 A;  3WHT A;  1OQE A;  1RXF A;  1ALY A;  1OLQ A;  4GKX A;  2FHR A;  1J83 A;  3AP9 A;  4UFH A;  2P3I A;  5DDJ 2;  3FE5 A;  1C5I A;  2DCK A;  1UWW A;  2OZ6 A;  5C3R A;  2PAM A;  3GAL A;  1RJ7 A;  1GOG A;  4URA A;  1OH4 A;  4CDX B;  2BP6 A;  3LCP A;  5GZG A;  1OD5 A;  1SAC A;  4LE4 A;  1PK6 C;  1QJF A;  2B4K A;  3QAC A;  4QKD A;  5A3P A;  2A3Y A;  3B00 A;  1LOA A;  4H2A A;  3WNM A;  3LA7 A;  4LLO A;  5E88 A;  2HWE 3;  4LBQ B;  1RUN A;  1GU3 A;  1BJQ A;  4CP9 A;  5K4L A;  2XJS A;  3SCG A;  3MI8 A;  4CUB A;  3KHB A;  2QKD A;  1PM7 A;  4H55 A;  2PMW B;  4QPI C;  2ENR A;  2AEY A;  4LHK A;  4CDW C;  1KFX L;  3DL3 A;  3TN9 2;  4QKN A;  3BU0 A;  2R0H A;  5BUV A;  2WZE A;  3TEZ A;  3SH4 A;  1GZW B;  3SKJ E;  1SLA A;  2J1T A;  1OPO A;  3P1I A;  1BEV 1;  1UKG A;  4AL9 A;  4AI2 A;  1DQ4 A;  1Q8O A;  1UY3 A;  3GZA A;  3LFM A;  1M4W A;  3H1M A;  4TYS A;  3VZJ A;  4QHZ A;  4EZ4 A;  4YAR A;  3H3L A;  4CU7 A;  1SDD B;  3C7O A;  3PVN A;  3KV6 A;  1VAV A;  2NMN A;  4NVP A;  3KB5 A;  4XXA A;  2RR1 3;  4FVV A;  3OBA A;  2WDB A;  5IK7 A;  3LD8 A;  5LBF A;  4EWA A;  5BY5 A;  3KMH A;  2P1B A;  4OMC A;  4KGQ A;  3IB3 A;  3TWI A;  1URX A;  2RE9 A;  4Q2F A;  2D5F A;  1FPN 2;  2W08 A;  3UGH A;  2MEV 1;  2IXK A;  2K46 A;  1BKZ A;  5FLJ A;  4BIS A;  5CAD A;  3OBZ A;  3MHZ A;  2WII B;  4RD7 A;  5GM0 A;  1CR7 A;  4R9C A;  1UZY A;  1OA4 A;  5K0U B;  1Q5O A;  3MYX A;  4GMP 0;  1W9T A;  1ZNP A;  4YNI A;  2ATF A;  2XBO 2;  2K0G A;  5BPX A;  4XDP A;  4M3C A;  3WSO A;  1W9F A;  2J1E A;  4MVT A;  1WW5 A;  3HNY M;  3POF A;  3VBS A;  4ASM B;  2WNV A;  1VMH A;  4I0A A;  4LO6 B;  1UZZ A;  3O1U A;  1XE7 A;  3HEI A;  5KXC A;  3VBO B;  3VKL A;  5SV5 A;  1WCD J;  4XDO A;  3HPN A;  3W5N A;  3JD7 3;  5ACA 3;  4MGZ E;  3W58 A;  2QQO A;  4J1X A;  1RUJ 1;  4J6G A;  2YDE A;  1SLC A;  3I3Q A;  5KR7 A;  1W6O A;  2XVG A;  1UNB A;  1ZRR A;  1MS1 A;  1KS4 A;  4KI5 M;  3C8X A;  1LHU A;  4EN6 B;  2ZAC A;  3K4A A;  3RMX A;  1TVG A;  2OKX A;  3A0N A;  4K7J A;  1YIF A;  1ASJ 3;  2LRO A;  4AHY A;  1BEV 2;  4XUN A;  2GC1 A;  3KT1 A;  4NR1 A;  4OZO A;  3AMM A;  3CJI A;  1MQT C;  3KD4 A;  2JDM A;  4Y5S A;  3D0J A;  3TBD A;  5FMC A;  1ZZ6 A;  4HSL A;  2W94 A;  2GN7 A;  3WF3 A;  4W6X A;  2VZP A;  4YVW C;  5JOZ A;  3O1O A;  4CEY A;  4JTO A;  3WNL A;  3NKT A;  4BPZ A;  1H2M A;  1PGW 1;  3IAP A;  5T5O A;  2GAL A;  4XJZ A;  3VDD C;  4A45 A;  2LRP A;  1PO1 1;  4QB6 A;  1TZO A;  1DZR A;  4XYX A;  5GLW A;  4AE2 A;  2JEM A;  1MS3 A;  1H1M A;  3LSD A;  4YM0 A;  2QZ2 A;  1GQP A;  5L9R A;  1PNF A;  2C9K A;  5T5P A;  2MEV 2;  1JYC A;  1GSL A;  3B5L B;  3RPQ A;  4RN5 A;  1SLL A;  1US3 A;  3FBY A;  1O4T A;  2E9Q A;  2VD7 A;  2WIN B;  2VG9 A;  3LWC A;  4A6S A;  4J25 A;  4Q0V A;  3VHR A;  5HBA A;  2ZKL A;  2MHF A;  4JGZ B;  5DAX A;  3MIE A;  5KHI A;  2VU9 A;  3VD3 A;  5CKN A;  1ZZ8 A;  4HXC A;  1NT0 A;  1YEW A;  3KHC A;  2WWJ A;  2LS6 A;  2VUJ A;  4WBB A;  3AJY A;  1CON A;  3DYO A;  5IJR A;  1IS5 A;  2W95 A;  3ZXL A;  2VO5 A;  4XVH A;  4Q0P A;  4CEW B;  3L2Y A;  5FY9 A;  4XDQ A;  4D0Q A;  4ZZ8 A;  2XJU A;  1NCQ B;  4Y20 A;  3JZV A;  4JDM A;  2I2S A;  3AZW A;  4NAM A;  4XUT A;  4RA0 A;  1CVN A;  3WCR A;  4XF9 A;  3ZVX A;  5D1I A;  2F6B A;  1PM4 A;  2ES3 A;  4K8F A;  5FPX A;  5IVC A;  1KFU L;  2ZHN A;  3IN9 A;  1AR6 3;  2YC2 A;  2GH8 A;  2XDV A;  4I0B A;  4LKS A;  5FUN A;  3F2Z A;  2R07 3;  2PHW A;  1NE4 A;  5C4W A;  4CU9 A;  1DGR N;  3RWN A;  5JZG C;  2EXI A;  3ZIX A;  4W6W A;  2HBU A;  3SEP A;  1R09 3;  3AZZ A;  3VKM A;  3C7E A;  3IDC B;  3VDC A;  5IVJ A;  1W99 A;  5CKM A;  1WA6 X;  4FTS A;  2CGN A;  2ARE A;  2IZW A;  3SIS A;  2BDR A;  1G9C A;  4NRM A;  5A33 B;  1NXM A;  1PX4 A;  1A78 A;  1WKY A;  2J1R A;  3ILN A;  5F37 A;  5FWE A;  2Q8E A;  4XTP A;  3Q8C A;  1PO1 2;  4LBJ A;  1SFN A;  2ARB A;  1DG6 A;  2W68 A;  2XB6 C;  4BQX A;  4CP1 A;  3PL0 A;  5FQ0 A;  3EXU A;  1DQ2 A;  1G6N A;  2IFW A;  4NPR A;  3J4U H;  4ARX A;  4B3N A;  3ZDV A;  2BNN A;  4LUL A;  3M3Q A;  4P00 B;  1BVV A;  3S5Q A;  1DP0 A;  2Y38 A;  3FX3 A;  4NRO A;  3MIB A;  4M4P A;  4LNV A;  3ZYJ B;  1NZC A;  3POS A;  4ERO A;  3WQ0 A;  4HK9 A;  5D8A B;  2VGD A;  4UXA A;  4OZX A;  4L92 A;  4BH9 A;  3BPZ A;  3T1M A;  3BOW A;  4QX7 A;  4FPO B;  4BK5 A;  1Z0H A;  1F31 A;  1BBT 1;  1H6Y A;  4GJY A;  5C9A B;  1UAI A;  4N9I A;  4BQ5 A;  4ITC A;  4XBN A;  3WNK A;  3LF7 A;  4XF0 A;  1MZ5 A;  1UZV A;  3WQB A;  2D97 A;  1LHN A;  4WVM B;  5KHG A;  4ZU5 A;  1JYT A;  2ZS6 B;  5DZE A;  4CCL A;  1CIW A;  1Y9M A;  2BGP A;  3USU A;  2B9U A;  2ZPX A;  3O1V A;  5C9A A;  1LOF C;  1UMH A;  4JKM A;  2HWD 1;  3VBO C;  3WIN E;  5HV4 A;  5J96 B;  5A1F A;  3H3Z A;  3DYP A;  3JB8 A;  5C33 A;  2DVB A;  4LHS A;  4XUQ A;  4Y5T A;  2WAB A;  3POW A;  1U5X A;  2XLG A;  3N9P A;  1COV 3;  4YW6 A;  5FIX A;  4JGY B;  2TBV A;  5BNO B;  4WM7 C;  5LRS A;  3IAQ A;  3OBR A;  5A7P A;  2YC0 A;  3HJR A;  5JSO A;  1NYW A;  4MGK E;  4ATF A;  2RMU 3;  4V1P A;  2E63 A;  3I8T A;  2VBB A;  4FPF A;  4NRQ A;  4IEX A;  2VZ1 A;  3KT4 A;  4QPG B;  2CAV A;  2A71 A;  2JG9 C;  2W1W A;  2E32 A;  4E27 A;  1W8N A;  2C6S A;  3BAL A;  4KWJ A;  2ZJC A;  4FTE A;  4QDR A;  1REE A;  4FPY A;  3WF4 A;  3VDB A;  5C3S A;  1ULC A;  5FYT A;  5CG8 A;  4K6B A;  3ZXD A;  1S2B A;  1POQ A;  3ZFF A;  2FD8 A;  2UUR A;  4Q4V 3;  5ABJ A;  5F3I A;  4BDV B;  1N1T A;  3MUZ 1;  5CYY A;  5FY8 A;  2GC0 A;  4CTE A;  1UY0 A;  2YGL A;  3MDP A;  2YU1 A;  4QQO A;  2ERF A;  4Z2A A;  2JIJ A;  5H9P A;  2D43 A;  1FV3 A;  1GP5 A;  1RUE 3;  4KWU A;  2DU0 A;  2FCT A;  4Q4W 2;  1GNZ A;  1KEX A;  4RR3 A;  4YW5 A;  2Y6H A;  3ASI A;  1RUD 2;  1QJE A;  2HWB 2;  5F3E A;  4HKO A;  5HCA A;  3PTR B;  4CEW C;  4JQT A;  1OMI A;  4XAC A;  5A3W A;  4AWD A;  4BHP A;  1TMF 1;  4Q4X 3;  2JG8 A;  3KQR A;  5IT6 A;  1ZRE A;  3DEC A;  2W1S A;  5DUV A;  4EV0 A;  2Z5W A;  4QAW A;  4KWL A;  1PVC 1;  1B35 B;  3E6D A;  3HQU A;  2RM2 2;  3RQ0 A;  2HWD 2;  3J8F 3;  4CCK A;  1JZ4 A;  1LU2 A;  1RVF 2;  1MS9 A;  2AGS A;  3ZSL A;  5FPB A;  4Z92 B;  4F7Z A;  3O1P A;  5FYI A;  1O4Y A;  1QY4 A;  1RUG 1;  4KL1 A;  4BQ1 A;  1QGL A;  4XHB A;  4AQ6 A;  1RHI 1;  2PHT A;  5FKB A;  4FOY A;  2VPV A;  4AVB A;  1RUC 2;  3WP5 A;  4AG4 A;  2ZEY A;  4UT5 A;  1JTZ X;  3RZM A;  4AQ2 A;  1VRH 3;  5GLV A;  2GP5 A;  1AF9 A;  2I74 A;  3T3Y A;  2VE1 A;  4WZF A;  1YNA A;  5A80 A;  1NE6 A;  1W6N B;  1VAL A;  4FFH A;  3OBT A;  5FZD A;  1AYN 3;  3PMS A;  4K8R B;  4XBQ A;  3CJX A;  3I2F A;  1QQP 3;  3FFQ A;  2WA3 A;  3QOP A;  4FPJ A;  4BMB A;  2XUM A;  2R49 A;  4PIZ A;  5EPA A;  2XVK A;  2BNO A;  3JUU A;  4YYO A;  3WY6 A;  4BME A;  2KXL A;  1GNY A;  5A3T A;  4P9Y A;  4Y22 B;  3CKH A;  5SV8 A;  2WO7 A;  3TOJ A;  2CU5 A;  2Y64 A;  3D8C A;  2CY6 A;  3S57 A;  2Q5T A;  4NRP A;  5DQ0 A;  1W6P A;  4RGG A;  2VCM A;  1MEC 2;  4DUX A;  1BMV 2;  5HV0 A;  1H8T C;  4SBV A;  1V0A A;  4LHN A;  4XQW A;  1Z7S 2;  3BI3 A;  1UQX A;  2XQR A;  4FOQ A;  1YQ6 A;  4A6O A;  1G8W A;  5EP9 A;  3H9A A;  1GWK A;  3VL9 A;  3I7D A;  5F3C A;  2R1D A;  4YG6 A;  1AL2 3;  2O0O A;  3AJZ A;  3AKT A;  5A7S A;  3N9N A;  3VKF C;  2ZGL A;  1NY7 1;  2DVG A;  3VD5 A;  2A6W A;  5FBJ A;  1H6X A;  4JHZ A;  5D8A C;  1C3H A;  1KQR A;  1H2K A;  4AZZ A;  2VR4 A;  2KA3 A;  2YXS A;  3RZH A;  2DUQ A;  2V5D A;  4L9B A;  2WNU A;  2DCJ A;  5E1R A;  5JIA A;  2GP3 A;  1PO2 1;  3HAG A;  5KXB A;  3VD4 A;  5GLZ A;  1AR7 2;  2ZGP A;  5A6Q A;  2XLA A;  1OOP A;  4DB5 A;  1W0O A;  3AXD A;  4Q0U A;  4C8D A;  3BIE A;  1SCS A;  1QJX 1;  3E97 A;  4XAA A;  2GN3 A;  1RUG 2;  2PHR A;  2VUA A;  2YYO A;  1RIN A;  3B93 A;  4UW6 A;  2YUE A;  1ZBA 3;  4YM2 A;  1X9P A;  1L7L A;  1TME 3;  3V0B A;  1POV 1;  3OUI A;  2D6P A;  2JE7 A;  2R06 3;  3LKJ A;  3T4V A;  3BPS A;  4QM9 A;  1RUH 3;  5J48 A;  1N3O A;  2OZJ A;  3N35 A;  1ENS A;  4F83 A;  1LEC A;  3OJB A;  3THC A;  3O0V A;  5IFP A;  2DYC A;  4EN8 B;  2UWB A;  1VBB 2;  2JD4 A;  3GYD A;  1EP0 A;  1OD3 A;  1YFX A;  1IKP A;  1ZVF A;  3BTA A;  3J7M A;  4JGY C;  1EAH 2;  1VBE 1;  1YI9 A;  5GJ6 A;  3WP3 A;  4BK4 A;  5BNO C;  2VOT A;  5C6C A;  1NLR A;  1NA1 A;  3KCC A;  5KWR A;  4CDU A;  1OH3 A;  2RS5 1;  4AI0 A;  4A2U A;  2VMH A;  1S0E A;  5FLI A;  2EAA A;  1DQ0 A;  1AJK A;  2W5F A;  3ZOI A;  4ES8 A;  4XAB A;  1KRI A;  1UOF A;  2Y33 A;  2F4L A;  5G04 L;  2FDK A;  1WLT A;  4IND A;  2QQM A;  1HXS 2;  3EQE A;  3JBG 1;  4YG3 A;  4Y1V A;  3SH3 A;  4BJ0 A;  5A7Q A;  1YO8 A;  5FBZ A;  2IC1 A;  2QFE A;  1A3K A;  5L7O A;  3AP4 A;  2RS3 1;  2JDA A;  4AAP A;  1R1A 3;  2DU1 A;  4P14 A;  4YGC A;  3I2G A;  1GQG A;  3MIG A;  1G7Y A;  2P37 A;  1D2Q A;  2R04 1;  4L8Q A;  3NWK A;  3Q9O A;  2W3J A;  1NY7 2;  2XJT A;  2VVF A;  1OHF A;  1X8M A;  2EIG A;  4O9G A;  4HON A;  4Q1R A;  5DDJ 3;  4EN9 B;  5KBF A;  4QD2 A;  1I1E A;  2OPW A;  4Q26 A;  5I8T A;  4BE3 A;  4E4D X;  1ULE A;  1W9W A;  2BTV C;  4B4R A;  1O8P A;  4OUS A;  1KD7 A;  4GMP 3;  4I30 A;  4XFC A;  1WBL A;  1Y3T A;  5FZ3 A;  2IXJ A;  2VOV A;  2XJQ A;  4ASL A;  1PO2 2;  3CO2 A;  3HQR A;  3OGV A;  5ANN A;  4C1X A;  5CKQ A;  1SLT A;  4RGK A;  5BNP A;  1FV2 A;  1UO9 A;  5CFD B;  1J1L A;  1W90 A;  1JYI A;  1VBC 1;  1CWP A;  5DAQ A;  1SMV A;  3ZFE B;  4E8D A;  4HZF A;  1CN1 A;  3DGT A;  1RUE 1;  3K2O A;  4IEY A;  3UES A;  1GUI A;  1B35 C;  4LIU A;  4D6R A;  4COZ A;  1D4V B;  4MG2 A;  2W9X A;  4FP2 A;  4LBM A;  2O1Q A;  4YG0 A;  5FY1 A;  2X05 A;  5T52 A;  4NPL A;  1ND3 A;  3TN9 3;  4H3W A;  4EJR A;  3B9C A;  5I0S A;  2LM3 A;  1W2U A;  3EBR A;  1VRB A;  5FMO S;  4DO0 A;  3SCH A;  3OY8 B;  3WDY A;  5F5I A;  2IXH A;  3MLJ A;  4MLO A;  4N53 C;  2R16 A;  1SBF A;  3IPV A;  1O7F A;  4BIO A;  3NAP B;  5FPL A;  2RS5 2;  1X50 A;  1HRV 2;  1UU6 A;  2ZMK A;  1VIW B;  1W3V A;  2IWG B;  3ORJ A;  1K12 A;  1S0D A;  3T09 A;  1GKB A;  5LA9 A;  2AR6 A;  3WZ1 A;  5DG2 A;  1ONA A;  3K4D A;  1AR9 1;  1WMX A;  4P08 A;  2WZP P;  1IHM A;  4DXZ A;  3JBG 2;  2CNA A;  2WSV A;  3POJ A;  1H4G A;  3AX4 A;  3NAP A;  4N9H A;  4XFA A;  3U78 A;  1W6Q A;  2RS3 2;  5F32 A;  5EJ1 B;  3MW4 A;  4QU2 A;  3LDB A;  1WUV A;  3PUQ A;  3I3B A;  2FDG A;  5FZI A;  4PHZ A;  1GZ9 A;  1WME A;  4ZS2 A;  3RZL A;  3NNG A;  2JX9 A;  5D2A A;  1W06 A;  2DDU A;  4CDQ B;  4HFS A;  4K1Z A;  3AZV A;  3SNM A;  3IIA A;  1C28 A;  2DVD A;  2WN3 A;  1WMD A;  3CLP A;  3T0D A;  3HNM A;  1S0C A;  1QEX A;  2XJP A;  4P9G A;  1LNS A;  3ZSE A;  4OFG A;  1EUU A;  4NHK A;  4IL7 A;  1TQ5 A;  2HWC 3;  1HRI 1;  4NHL A;  5JXI A;  1UN1 A;  4CSW A;  4QGL A;  3TRS B;  1VBC 2;  3MIH A;  2XJV A;  3OSD A;  5JMO A;  5LCW L;  3WP6 A;  2WFF 3;  1VB2 A;  1O3T A;  3MV0 1;  1SDW A;  5FZO A;  1SFY A;  5DUX A;  3QD6 A;  4YW2 A;  3FL7 A;  4QXC A;  3EO6 A;  2YU2 A;  3GM8 A;  4GD4 A;  3VZL A;  3OEA A;  4N43 B;  4D7S A;  2P5B A;  3NV3 A;  5A6X A;  3THP A;  5FZ4 A;  4ARY A;  5FYU A;  4CCO A;  2VAU A;  4RFR B;  1WMF A;  1AZD A;  3H7Y A;  3ZXJ A;  1YI7 A;  1KJR A;  5GAL A;  5FP4 A;  1NCR B;  2WNO A;  2WZR 3;  3PDQ A;  4OUL A;  5JXG A;  4KGG A;  2H0B A;  2SLI A;  5AVP A;  4AFM A;  1IS3 A;  4JQR A;  4YLZ A;  5JOY A;  2W1U A;  1VBA 1;  1WWY A;  1ZBE 3;  2RS1 3;  1S0G A;  4QPI A;  5FYY A;  4AQT A;  1RUH 1;  1AR9 2;  4CDW A;  4E4Z A;  5FAX A;  3V64 A;  3VBF B;  3O5S A;  2VMG A;  3VBU C;  3RYK A;  1QJY 1;  4TXW A;  2ILM A;  1S0F A;  1GZC A;  1W8O A;  2JIG A;  5IK8 A;  5GZE A;  3KWV A;  2NLR A;  5G05 L;  2G9G A;  3WW4 A;  2Q4S A;  4ZU7 A;  1VBD 1;  4UWD A;  3WD5 A;  4BYY A;  5CFC B;  5IK5 A;  1ZA4 A;  4I01 A;  3TAY A;  3ZFG A;  2Y6K A;  4PBO A;  1WCQ A;  1F4H A;  1GWL A;  2ARA A;  2HKX A;  2IFR A;  2PQS A;  2X09 A;  3ELN A;  4XZP A;  1HB3 A;  1I6X A;  5LA2 A;  2Y0I A;  4K40 A;  3R6S A;  2N7G A;  2VZU A;  5T3N A;  2JDZ A;  2JDY A;  4MYE A;  4RQP B;  2WLQ A;  1DGW A;  1ULG A;  3MLL A;  3OF1 A;  4AED C;  2B8M A;  2PLV 1;  3N4M A;  1HRI 2;  2EIB A;  1RUF 1;  3RYR A;  1V00 A;  5DAB A;  2FQP A;  3FC0 A;  4D3W A;  1KIT A;  1UXX X;  2B39 A;  5J7M A;  4NWW A;  5IW0 A;  2DTY A;  2IXC A;  3QH7 A;  3M70 A;  4IW3 A;  5BNQ A;  3ZPO A;  5A3N A;  1FX5 A;  3ILF A;  4RS5 B;  4DRR A;  2WL1 A;  4GMP 1;  5IVE A;  1A8M A;  1A8D A;  3W9A A;  2BQP A;  4W50 A;  3CBN A;  1WLD A;  1GBG A;  2EF6 A;  5LY2 A;  5LA0 A;  5DG1 A;  1XC6 A;  5FO8 B;  3ZO0 B;  4RS5 A;  5FZG A;  2J1V A;  5FYC A;  4LBK A;  5FZM A;  3HOB A;  4AXO A;  2D6O X;  3FLP A;  4FQZ A;  3KCY A;  1XE0 A;  1ODM A;  4GWN A;  5FYB A;  2UY9 A;  4WVW A;  3WCS A;  3NJV A;  1GMM A;  4HN0 A;  4JRA A;  3ACL A;  4FP3 A;  5A6Y A;  2B9V A;  5C8W A;  1OKO A;  4Y1Z A;  4FPE A;  1N1V A;  5AVA A;  3C3V A;  5A1L A;  2E7T A;  2LTN A;  2JIC A;  4NWV A;  1RGS A;  2AEZ A;  2QBX A;  4FFF A;  4R9D A;  1Z78 A;  5IAT A;  1QJY 2;  2R32 A;  5KXE A;  1GP4 A;  3O1M A;  1C57 A;  1JOB A;  4CUA A;  3PUS A;  4FFG A;  1PMH X;  2A75 A;  4LR4 A;  3BOD A;  1MQT A;  3WW3 A;  2ZEW A;  1R08 1;  1VBD 2;  2OUH A;  3BN6 A;  3GJA A;  1PX3 A;  1NQJ A;  1JW6 A;  1LES A;  2YV8 A;  2VVE A;  3PIJ A;  3URF A;  1DGL A;  1REF A;  1V6O A;  4QGN A;  1QDO A;  2VH9 A;  3VDD A;  3GBG A;  1YQ5 A;  1YYN A;  4CP9 B;  3I3D A;  4Q4Y 3;  1SQ4 A;  2IVI B;  4AFC A;  2PLV 2;  1NZI A;  2WO1 A;  4V2V A;  1RUF 2;  2R1B A;  4LKF A;  4YWA A;  5EJZ B;  4BQ2 A;  4BCU A;  2HEY F;  1GAN A;  2EID A;  4FT8 A;  1OUX A;  5HCF A;  4A7Y A;  2VXJ A;  4EYU A;  4QDS A;  3DKW A;  4MGQ A;  2RDR A;  1ACC A;  1OQ1 A;  3ZPY A;  2BEO A;  4IV1 C;  1LED A;  1BZW A;  4QX5 A;  2ZAH A;  2P17 A;  3KV9 A;  3POY A;  1CAX A;  4YZ4 A;  3IMM A;  1U5Z A;  4DEV A;  1UX6 A;  4AEK A;  1G9A A;  2ZGT A;  1EPW A;  4OLL A;  2C5D A;  3HBZ A;  5F6L B;  1AYM 1;  1MS0 A;  1YQ8 A;  4CCC A;  3F95 A;  5FWJ A;  4P9W A;  2HWC 1;  4YW3 A;  5LBC A;  4DS0 A;  4E9K A;  1LB2 A;  2XLF A;  2VNR A;  5FOJ B;  2WN2 A;  3UGF A;  2RHP A;  1H8V A;  4WV8 A;  1UPS A;  1F4A A;  1CJP A;  2AC1 A;  4OQ9 A;  2R0F A;  3BB6 A;  4PIX A;  3OYW A;  2O8O A;  3RWK X;  3PUH A;  2DUR A;  4PF1 A;  3KZ4 C;  2Y6L A;  3NKG A;  4CP2 A;  3OGR A;  4BZ4 A;  5HI0 A;  2DCY A;  5ANQ A;  1OLM E;  5JZG A;  3B01 A;  4Z07 A;  1MS4 A;  3C7F A;  5FPU A;  1RUI 1;  5FRE A;  3BOP A;  3T1L A;  3K51 A;  3VBR B;  2H0V A;  4GWM A;  3CZU A;  1O3R A;  4QGM A;  1NG0 A;  2EAL A;  1DZQ A;  3H8O A;  5FZF A;  3UKV A;  4ZZ5 A;  2BYV E;  3DF0 A;  1WZX A;  5T55 A;  3VBF C;  2XOM A;  2VNV A;  4PCR A;  3DPR C;  1GWM A;  4M3C B;  5FR3 A;  5JSP A;  2QQJ A;  5CVR A;  1XQN A;  1R08 2;  4XFF A;  5DZG A;  1CD3 G;  1W8W A;  5IVV A;  2WRA A;  3IZO A;  3VBR A;  1PIV 1;  5J98 B;  1FMD 1;  3T0A A;  1ZRI A;  3VBS B;  4MV2 A;  1W2A X;  1J58 A;  3CL1 A;  2X29 A;  2WNV B;  4NIA A;  1PMJ X;  1F9K A;  3VBH A;  5CBL A;  3D3A A;  1UYP A;  3AB0 A;  3ZMN A;  4LPL A;  3WT3 A;  1XNB A;  2BNM A;  1D0H A;  4FPK A;  4ZON A;  1YHF A;  2YBP A;  4Q4W 3;  5C7G A;  1K5M A;  1W6O B;  3ZX7 A;  1IPJ A;  3ITQ A;  3I2J A;  3LGR A;  2Z2S B;  3MIC A;  2HWB 3;  3POB A;  1HV0 A;  5LWB A;  4QHB A;  3O0X A;  4RQP C;  5LZ6 A;  3GF6 A;  4RHV 3;  3K4Z A;  1AJO A;  2I07 B;  1XOY A;  3D6E A;  4AQS A;  4IE7 A;  1OC1 A;  2ET1 A;  3ME2 A;  4R52 A;  4YM3 A;  3CJI B;  5C3Q A;  2GNB A;  1H9P A;  3ACI A;  3ZSM A;  3LOI A;  3OGJ A;  1RVF 3;  3NW4 A;  1AYM 2;  2PN5 A;  1S0J A;  1WW6 A;  4CUG A;  4CEY B;  4RYD A;  2VEC A;  3B02 A;  5DMY A;  1RUC 3;  4PDW C;  4XZU G;  4MHU A;  4ZXE A;  2FDF A;  5FK8 A;  4BWO A;  4DXS A;  1S4C A;  5CU1 A;  3ZN6 A;  5HXM A;  1QXR A;  2ZXQ A;  4AFD A;  1DDL A;  2AYH A;  2ZOE B;  2Q8C A;  4I3P A;  5FFO C;  4I2O A;  2HWF 1;  2QZ3 A;  5HCB A;  4RSU A;  1Q56 A;  1ND2 C;  3HD8 B;  4CCM A;  4GAZ A;  2W46 A;  2A3W A;  4OMD A;  5AC9 3;  3B94 A;  1C8M 1;  2WKK A;  4IER A;  3POG A;  4YVS A;  5FY5 A;  4KU8 A;  4DQA A;  4IES A;  4LXL A;  5FKC A;  4QQL A;  2Z4F A;  4BU2 A;  3VUO A;  1MEC 3;  1LJ7 A;  2X8K A;  1GOF A;  4HAN A;  3TYJ A;  1IPK A;  4E8C A;  3FLT A;  3L2H A;  4XXP A;  1OUR A;  1PIV 2;  1Z7S 3;  1FMD 2;  5FZ0 A;  2TEP A;  4EZH A;  4WM7 A;  1HKD A;  4Y20 B;  3NV1 A;  3ZMO A;  3VHN A;  2X5I A;  2C4X A;  4CCJ A;  2OS2 A;  4ZHN A;  5LRR A;  2C9A A;  2GDF A;  1JU3 A;  1VMF A;  2JB8 A;  2DBI A;  4IQP A;  4WVV A;  5EZW A;  4CDX C;  5C4W B;  1S2E A;  5E8A A;  2JG9 A;  1JZ7 A;  2XJR A;  3E5X A;  1BCX A;  2W92 A;  2HJI A;  2FCV A;  5FY7 A;  3K75 B;  1NX9 A;  1RUJ 2;  3ZYR A;  4TTG A;  1JZ8 A;  4K21 A;  4IV3 A;  3ENR A;  1AR7 3;  1KDM A;  1Q43 A;  1V9U 3;  2JDN A;  4UFI A;  4E2Q A;  4CVU A;  4CUC A;  1ULD A;  3ACF A;  3WDX A;  5GZD A;  1FXZ A;  1LGN A;  2UY8 A;  4SLI A;  3WNX A;  1AX1 A;  1DQ6 A;  3AYD A;  4DY5 A;  4WM8 A;  5FMO L;  1STM A;  5DZF A;  5FYM A;  2JKB A;  3OGG A;  2HWE 1;  5L36 A;  5FZK A;  1G9B A;  5JXJ A;  1W9Y A;  3RMY A;  3N9Q A;  4S2G A;  1PGW 2;  1MAC A;  5EFU A;  2VMC A;  3LEK A;  5FQ0 B;  2HWF 2;  2QQV A;  2AZ5 A;  5JSR A;  1VBB 3;  4PI2 A;  4A7K A;  3CIH A;  1VJ2 A;  4AVA A;  2ARC A;  1C8M 2;  2ADD A;  4XJU A;  1DLL A;  1E5H A;  1D4M 3;  1V6L A;  4YGB A;  4AR2 A;  1UIJ A;  3N36 A;  2F17 A;  5LAT A;  3NJX A;  1JZ5 A;  1Y9G A;  1W03 A;  1YLL A;  4Y3O A;  1OFS A;  4M00 A;  2VZQ A;  3ZXG A;  1HXS 3;  1UX7 A;  2R30 A;  2V09 A;  3AC0 A;  4NAO A;  1IG3 A;  4Y24 A;  3OCP A;  4PI0 A;  2VZV A;  1XYN A;  3MO4 A;  2RR1 1;  3QH6 A;  4JDN A;  3H1W A;  3BU7 A;  1RXG A;  5J36 A;  2IXL A;  2VOX A;  4AGG A;  5K0U C;  1LGC A;  3O1S A;  4L2N A;  3USU B;  3U75 A;  3VBS C;  4F8A A;  3GBW A;  4D6S A;  3BCW A;  2FBE A;  3IMN A;  4QMA A;  2E6V A;  2GAU A;  1Q8P A;  2BGC A;  2PFW A;  3ACH A;  3AYA A;  4H7M A;  4AVT A;  5EJ3 A;  4P9I A;  1H8T A;  5IHR A;  1BYH A;  1UW8 A;  3AMN A;  4JRL A;  1W8F A;  3WG4 A;  4Y5Z 0;  1I5P A;  2AAC A;  3AP6 A;  1ULF A;  3WX5 A;  1SBE A;  1UU5 A;  4UBH A;  3U07 A;  3JB4 C;  2XH6 A;  3LA3 A;  3PME A;  3CJI C;  4BIF A;  4MET A;  4UFK A;  3VDA A;  4UBG A;  1E5R A;  5JVV A;  4CU8 A;  2Z42 A;  4PQ9 A;  3BTZ A;  1FAT A;  4LHL A;  2NZ9 A;  1AXZ A;  5I0T A;  2AUY A;  4XFH A;  5L9V A;  5FLH A;  1E57 A;  1ULP A;  3JD7 1;  4CEY C;  5ACA 1;  2YB7 A;  2A3X A;  1APN A;  2W87 A;  2HH9 A;  4COW A;  2UYA A;  1N47 A;  2WFP A;  2BBV A;  3SHR A;  3ACG A;  3P3N A;  3ZFF B;  3N7L A;  1LOD A;  3ZM8 A;  1ASJ 1;  5LEK A;  5ABJ B;  3PUR A;  4JAA A;  4HLT A;  2YPJ A;  3ZSK A;  2DBN A;  3A4U A;  2PHL A;  4BM8 A;  4Z82 A;  3IKW A;  4LEJ A;  1NLS A;  2DVF A;  4PT6 A;  2J1U A;  3B7M A;  4GB3 3;  4IEU A;  4URT A;  5EYX A;  3H0O A;  3RI9 A;  4LBO A;  4YZ5 A;  1W2T A;  5L73 A;  5DN2 A;  3OUJ A;  1W8U A;  1JZ6 A;  5A70 A;  1CES A;  4RR3 B;  4UW3 A;  3OGS A;  1IG0 A;  2ETE A;  1DBN A;  3NL1 A;  1J3Q A;  2CDP A;  1VLN A;  3M3I A;  3SC7 X;  4NID A;  5FZ6 A;  5IVY A;  4JGZ C;  2JG8 B;  2XL9 A;  2UYB A;  1RMU 3;  2WT2 A;  4N8M A;  1BBT 2;  1XU1 A;  4IET A;  4GH4 A;  2A6Y A;  2RDQ A;  1ZRD A;  2WS9 3;  5GZF A;  1WCK A;  3FN9 A;  2QVS B;  1S0B A;  1LEN A;  2Y6J A;  4IEW A;  3VKO A;  4D69 A;  1NCQ C;  5C4W C;  5JXH A;  2P4E A;  2A5Z A;  3M4F A;  3E6C C;  5I8S A;  1Y7B A;  1MS5 A;  2BVB A;  1BK0 A;  1SCR A;  3FWE A;  4FPG A;  1W6M A;  5KHH A;  3M3O A;  4HVQ A;  5BNN A;  5LBB A;  2PXJ A;  4KNC A;  5A1A A;  4ES9 A;  2XGX A;  5FUI A;  4R9B A;  1HB2 A;  2ZMN A;  4IGO A;  3ZXA C;  1L7Q A;  4HPK A;  3W5M A;  4QT6 A;  1W04 A;  4X8P A;  4N90 A;  4QKF A;  4XJ8 A;  3B69 A;  3WDU A;  5LEJ A;  5A6Z A;  5ACA 2;  4ZY9 A;  1DYP A;  1AR6 1;  2XL7 A;  2LAL A;  4M3C F;  2R07 1;  1UL9 A;  1UY1 A;  2VZ3 A;  3MPB A;  4XIK A;  1W6P B;  2PHD A;  1XNA A;  1R64 A;  3OUH A;  1R09 1;  4FPL A;  4X8N A;  5A7N A;  4CXY A;  5A3L A;  2D6N A;  5A3U A;  4HET A;  2CV6 A;  4QX3 A;  3C7G A;  4LO4 B;  5FCC A;  1NAE A;  3ZR5 A;  3JQW A;  4Q27 A;  3K3O A;  2GC3 A;  3PTY A;  1EV1 3;  4E2G A;  1D2S A;  5EHD A;  1GR3 A;  1ZM1 A;  5A7W A;  4DZG A;  4LUK A;  2FZ2 A;  3MV1 1;  4OUM A;  1PNG A;  1SBD A;  4DUV A;  2DF7 A;  1QWR A;  4BQ4 A;  2FDJ A;  1NOV A;  2NMO A;  2E33 A;  3M8L A;  1QJU 3;  1JI6 A;  3V0A A;  5A3O A;  4OI0 A;  5IUQ A;  2WNU B;  1DYO A;  4JX0 A;  4N53 A;  1PGS A;  2XQX A;  3LEI A;  2ZX2 A;  3N7M A;  3GZU C;  4K9S A;  4XHX A;  1OOP B;  2QQL A;  2W1Q A;  1TMF 2;  4E4S A;  1CJD A;  3W20 A;  1MR5 A;  3UGG A;  4OVE A;  5C9A C;  3FBM A;  4ZPI A;  1PVC 2;  1MVQ A;  3V0B B;  2C24 A;  5LY1 A;  1W8Z A;  3EYP A;  5EV7 A;  2GSY A;  5HCH A;  4B8E A;  1ZZB A;  1X82 A;  2VNO A;  3AL6 A;  4IE0 A;  1KGY A;  4YZ1 A;  1M06 G;  1YFY A;  4YRD A;  2ZX3 A;  5B4N A;  1RHI 2;  2R6Q A;  3C2U A;  4Z1V A;  1IGO A;  2OQ7 A;  1QOO A;  3GXU A;  1CIY A;  3AKS A;  1AHS A;  1IPS A;  1K5J A;  2CDO A;  2JKX A;  4W6Y A;  4NHY A;  2JE9 A;  5H9S A;  1GIC A;  3PUA A;  3ZFG B;  5FYV A;  3T2P A;  1HN1 A;  4DXR A;  1FOD 3;  1NA1 B;  1GNH A;  1TNR A;  1WD4 A;  1JH5 A;  2BZD A;  2YHJ A;  2VZS A;  3G6J B;  4FI9 A;  2R07 2;  3WF2 A;  1CAU A;  4CDU B;  1UD1 A;  3OB8 A;  3GNE A;  3SMH A;  1RED A;  4OQ8 A;  2VCC A;  3FJS A;  3ZIW A;  3AKR A;  2J1S A;  4B1L A;  5FZ7 A;  1Y43 B;  4OCT A;  2W39 A;  1IS6 A;  1RJ8 A;  2B46 X;  1PZ7 A;  3MW2 A;  5L7O B;  5J37 A;  4XUO A;  1LOG A;  1LOE A;  3LFI A;  1XB9 A;  3ZFF C;  1C1F A;  1COV 1;  1ODN A;  4QPG C;  2JDP A;  3TEW A;  5CIS A;  4MGI E;  5BXX A;  1AR8 3;  4LE3 A;  1AX2 A;  2EXH A;  2OQ6 A;  1D7P M;  4HVR A;  2PHX A;  4QX0 A;  2RMU 1;  3I2I A;  3LAG A;  5C5U A;  5GLU A;  1XU2 A;  3VGI A;  2ZTN A;  2YFZ A;  4JCK A;  3O1R A;  2VQU A;  2OUJ A;  2WYF A;  2VCB A;  3D0S A;  2ET7 A;  1JUI A;  3HIF A;  2V4V A;  4Z8B A;  5FXZ A;  3Q8A A;  5BNP B;  5JI9 A;  5JUV A;  3RDI A;  4P5H A;  5M0T A;  4RL7 A;  1U12 A;  1QOS A;  4XIO A;  5C3P A;  2RVA A;  2VME A;  3CZJ A;  4Q4V 1;  1P8J A;  4W8J A;  3WUC A;  1SPP A;  4F3J A;  1QIQ A;  4GUL A;  1U5Y A;  4C91 A;  3VZK A;  3LPF A;  2OA2 A;  4IGP A;  4AK3 A;  2FCU A;  4S2D A;  3WQ7 A;  3VBU A;  5JWP A;  1QJX 2;  5KXD A;  1MZ6 A;  3N9L A;  1OUS A;  3I2K A;  4DNY A;  1ND3 B;  3TNP B;  1UOG A;  2G9Z A;  2XKP A;  5I0D A;  1ENX A;  1RMU 1;  4FAH A;  4YSF A;  5LB6 A;  5LBE A;  3LPG A;  3CQO A;  5K8S A;  4ONU A;  2XR4 A;  2WQZ C;  4GIQ A;  5F5A A;  2WNE A;  2R7E B;  4XQ4 A;  3ETP A;  4G4F A;  4Q4X 1;  1ZZ7 A;  3CF6 E;  4GKY A;  3O14 A;  1LTE A;  3MIF A;  3APB A;  3V56 A;  4XMA A;  1BK1 A;  1C8N A;  1OA2 A;  1XYO A;  3IPV B;  2A70 A;  2DUP A;  3NV4 A;  3O1T A;  1O5U A;  1QU0 A;  2EXK A;  5FZB A;  3VKN A;  4BOW A;  3J8F 1;  2B45 X;  3IM0 A;  2GC2 A;  4AEJ A;  4AED A;  4COV A;  1FYU A;  1N3P A;  1VBE 2;  3AKP A;  4XJ9 A;  5JR7 B;  1OVP A;  4LKE A;  1F8V A;  1TEI A;  3VN4 A;  5C8C A;  1J1T A;  1W6Q B;  1K45 A;  1LUL A;  2JD9 A;  2ZEX A;  4CU6 A;  1WGP A;  1WD3 A;  4NO4 A;  1VRH 1;  2P3Y A;  5JDB A;  1COV 2;  3L9J T;  1YJK A;  1QOT A;  1S2K A;  4J1W A;  4LO7 A;  1W0P A;  4GWI A;  3GZT B;  1AYN 1;  3RZJ A;  3ZYP A;  1WW4 A;  4UF0 A;  1FPN 3;  4QX1 A;  1QQP 1;  5I91 A;  3JCI A;  3U14 A;  2R04 2;  5FJH A;  4CXX A;  3ZXK A;  2JJ6 A;  4DOU A;  4AHZ A;  1F35 A;  4MXW A;  1AXK A;  3PIG A;  2VXR A;  4FCA A;  3S6P A;  4MH0 E;  1GP6 A;  4JKL A;  3FUO A;  5KHK A;  1DIW A;  1W39 A;  1GZT A;  2XBO 3;  2A6X A;  5C3O A;  5FZO B;  1OFN A;  5FYZ A;  1G9F A;  2VL4 A;  5GKA C;  1ZA7 A;  4U36 A;  1HB4 A;  2P34 A;  3NJY A;  2MNG A;  4LBQ D;  4B1M A;  5CA6 A;  4V2W A;  4CCD A;  4JV4 A;  4PBP A;  5K9Y A;  1AL2 1;  4KH9 A;  1RUE 2;  2VMI A;  2ZGM A;  2CHH A;  3III A;  5TSW A;  1KJL A;  4QX8 A;  1POV 0;  3FHQ A;  1ZZ9 A;  2O8Q A;  3HWJ A;  3OPW A;  4XUP A;  5EIY B;  1J59 A;  1PK6 B;  1H1I A;  3HQX A;  3KSC A;  1E5S A;  2Q30 A;  1SLB A;  1SEF A;  2KM2 A;  3K46 A;  4IGQ A;  5ERL A;  1KDK A;  4Q4X 2;  4B4Q A;  4XW3 A;  5A32 A;  3VV1 A;  1DHK B;  3RJR A;  4D7Y A;  1PK6 A;  1BEV 3;  1CAW A;  3ZFG C;  3IDB B;  3J8F 2;  1DU3 D;  4C0H A;  4QPI B;  4JVA A;  4OHV A;  2GZW A;  4CDW B;  2O14 A;  2PHU A;  2WSU A;  3BIW E;  3JXS A;  4YGE A;  1JZ2 A;  1ZBA 1;  1V6K A;  2ZCW A;  1TME 1;  3LB9 A;  1IKQ A;  4BB3 A;  5LW9 A;  1KS5 A;  4XE9 A;  3I59 A;  3U11 A;  2R06 1;  1IZ3 A;  1VRH 2;  4IV1 A;  2XON A;  4TLF A;  2VMF A;  2Y6G A;  5C71 A;  2ZHK A;  3THT A;  1S55 A;  1O5L A;  1UY2 A;  1LAJ A;  1C1L A;  1YFU A;  2WWS A;  2ZKN A;  3PUI A;  3ZR6 A;  1YCI A;  1PGL 1;  5J09 A;  1QQP 2;  2MEV 3;  4R8H A;  3KVB A;  4Q0Q A;  4YGD A;  2ZAB A;  4KMQ A;  4QXH A;  3AMQ A;  2D5H A;  4ISR A;  4MZU A;  2IXI A;  1CX4 A;  4LK7 A;  2VC9 A;  1G9D A;  2VJX A;  2IUW A;  1QHD A;  1WW7 A;  4EQV A;  3N3H A;  1XJA A;  5T5L A;  4I02 A;  2D40 A;  2YGM A;  3KLS A;  1R1A 1;  1LHW A;  2BOI A;  1W3X A;  2CGO A;  1AL2 2;  5FXV A;  2BFU S;  2VBD A;  3RRD A;  2XPJ A;  1QXP A;  5E16 A;  3DPR A;  4P5Y A;  5DDJ 1;  4UFJ A;  2YFU A;  5CNA A;  5FZA A;  5CFD C;  3MBW A;  5IVB A;  1RUJ 3;  3I2O A;  3GHM A;  4PQQ A;  1IS4 A;  1ND3 C;  4LA3 A;  5JI7 A;  3ZFE C;  1W8H A;  1ST8 A;  2FZ1 A;  1OF3 A;  3LE0 A;  4B29 A;  3ZYI B;  2W0X A;  3RZG A;  4XF1 A;  1X7N A;  4KG8 A;  2G9F A;  2E53 A;  1H9W A;  3LZZ A;  1O4Z A;  3V65 A;  4QKB A;  4GA9 A;  5CZK A;  2WJS A;  5FJK A;  1QNW A;  4EE2 A;  1ZBA 2;  2VBP A;  4R4Z A;  4XTM A;  3T4H B;  1VBA 2;  2R06 2;  1UKR A;  2WT0 A;  3FMG A;  1FNZ A;  1RUH 2;  2D6L X;  3PVO A;  3U4S A;  1PO1 3;  3TN9 1;  1HJG A;  1MQT B;  1UOB A;  3NAP C;  5LA1 A;  3ZXF A;  4L99 A;  1QH7 A;  4QX2 A;  5F39 A;  4OHY A;  3U0Z A;  1PGL 2;  1ZZC A;  1Y9Q A;  4XMI A;  1EPZ A;  3W59 A;  3VDD B;  2EAK A;  4L97 A;  4PDW A;  1AL0 G;  2QQW A;  1UYX A;  2DWR A;  2ID4 A;  3KCX A;  1OI6 A;  4PLO A;  1RYY A;  5T50 A;  2PEL A;  3ILR A;  5FOB B;  3FZ3 A;  4YVW A;  1DZT A;  1CAV A;  2VZT A;  4FPC A;  3FFZ A;  1ENQ A;  5FUP A;  2WQ8 A;  3WUD A;  4CDQ C;  2EVX A;  1ND2 A;  4R9A A;  1RIT A;  1UU4 A;  2YMZ A;  3SKV A;  3B3Q E;  1OSG A;  4XEZ A;  2J42 A;  1CAX B;  1HQN A;  3NMB A;  1QNY A;  1FPN 1;  3M3E A;  4EN7 B;  3T2T A;  5L19 A;  5JLV A;  3RG0 A;  1MPX A;  4IE5 A;  4O61 A;  3RJ2 X;  1HN0 A;  4FO9 A;  5IAV A;  5CAZ A;  3KV4 A;  3HT1 A;  1A34 A;  3R4D B;  2XKO A;  4TZD A;  1OLM A;  3AP7 A;  4ATE A;  3INA A;  1RTV A;  1YQ2 A;  1L3J A;  2XUE A;  1J3R A;  2HEW F;  1FAY A;  2XBO 1;  4R4X A;  1OQD A;  4XOG A;  1N3Q A;  3AXE A;  4LO8 A;  3FLR A;  3OYW B;  3R4U A;  4NHM A;  2VNG A;  2A6Z A;  4BXF A;  4LBN A;  4N43 C;  5CEH A;  1T2X A;  1YXW A;  2D3P A;  2QQI A;  1LHO A;  1QXJ A;  4P9L A;  3OD4 A;  4CDX A;  1B09 A;  2WFF 1;  3J7N A;  5JZG B;  1AVB A;  1TG7 A;  4NJ4 A;  3NJZ A;  3WNO A;  1JOP A;  4ASK A;  3ATG A;  5FV3 A;  4AVC A;  1DQ5 A;  1U0A A;  2J7M A;  1NCR C;  3LEG A;  5FZC A;  3PVB B;  4QXB A;  5JIU A;  1SLI A;  3GDB A;  2WR9 A;  4LBQ A;  3WR0 A;  2P2K A;  5APA A;  3WW2 A;  4OI1 A;  1UOJ A;  1YRZ A;  1V6I A;  2DV9 A;  2ARX A;  1ULO A;  3Q8F A;  4QHO A;  1OLR A;  2RJL A;  3AZX A;  1CGP A;  3VBH B;  1N1Y A;  2Q1Z B;  4Q0S A;  2QQK A;  1XSR A;  1XNC A;  2Q1F A;  5BYN A;  2WZR 1;  2QDR A;  3AMH A;  3HVD A;  5DUU A;  2DTW A;  3SXW A;  4GQ7 A;  4HKL A;  1OT5 A;  1GZW A;  2QQP A;  3LOB A;  1PVX A;  1ZRF A;  4QXK A;  1K5M B;  2B7Y A;  1ZBE 1;  2RJ2 A;  2RS1 1;  4B7E A;  3J9S A;  4QU1 A;  3MF9 A;  3HNB M;  1Q3E A;  2Y60 A;  5CFC C;  2WBK A;  3WW1 A;  3T08 A;  1XNK A;  3QCW A;  3NRU A;  4LO5 B;  2CTV A;  2JXA A;  3CU7 A;  2H6C A;  1SG3 A;  3MPP G;  1QKQ A;  5FP9 A;  4IEV A;  1BBT 3;  4MO3 M;  1RUD 3;  5F6K A;  4AW7 A;  3KF3 A;  5FTT C;  2W47 A;  3VB9 A;  2RDN A;  5J3U A;  3WF0 A;  2BBA A;  4LIT A;  3MF6 A;  2V5Y A;  3MUY 1;  3H50 A;  2ORZ A;  4QB1 A;  2RM2 3;  4AFB A;  2HWD 3;  2Q8O A;  4AI8 A;  4Q8K A;  3ZN6 B;  5CB7 A;  4NMI A;  4IXL A;  1UZ0 A;  1RUO A;  1BVP 1;  1GV9 A;  1R1Z A;  4K3U A;  4RS5 C;  2HWC 2;  5K0U A;  1BHG A;  2ZML A;  1S1A A;  1VPH A;  5K7P A;  4XCA A;  2WFF 2;  4UW4 A;  2Y6F A;  1H30 A;  4LOR A;  4PJY A;  1LEM A;  1WCU A;  3IWZ A;  3NQH A;  3E5Q A;  4CP0 A;  2XWJ B;  2WUH A;  3PLQ A;  1CQ9 A;  4YVS B;  3IDE A;  2FDI A;  5FZ8 A;  3PJQ A;  1LOF A;  2VM9 A;  1O6U A;  2XML A;  5KHJ A;  3HR9 A;  1OPM A;  3PU3 A;  4LBL A;  3FHI B;  3VBO A;  4ZS3 A;  4XFB A;  1RUI 2;  4BQW A;  2OX0 A;  3C7H A;  5KC6 A;  1O3Q A;  3AP5 A;  2WLP A;  4XC9 A;  1X33 A;  2X53 S;  3TNQ A;  3AK0 A;  4GWJ A;  3VHO A;  3AL5 A;  4DIN B;  1MS8 A;  2E31 A;  2Y34 A;  3KGZ A;  3ETQ A;  1HB1 A;  4L0P A;  4M3C E;  1N1S A;  4WM7 B;  2WZR 2;  3S30 A;  4XQD A;  4NOT A;  5B4X A;  1OXC A;  2W52 A;  2X5I B;  2RG4 A;  4OI2 A;  1LGB A;  2ORX A;  2YC4 A;  2EIE A;  4DRV A;  1ZBE 2;  2RS1 2;  1UXZ A;  2A73 B;  2JG9 B;  4UI9 L;  4YZ2 A;  1YFW A;  5LK7 B;  3RZK A;  1X8E A;  3AFK A;  1X9T A;  3VD7 A;  4E2S A;  4W65 A;  1YQC A;  1HIX A;  4FOW A;  3RNS A;  4NIH A;  5FP8 A;  4IV3 B;  4GZ9 A;  2BUK A;  2JWP A;  4Y4R A;  1VAM A;  3VLB B;  3ZXE A;  1JYV A;  5FP7 A;  3MW3 A;  2RV9 A;  1JMU B;  5FPV A;  2VW1 A;  1RIR A;  2V4A A;  5CIR A;  2B42 B;  5DAV A;  1H0B A;  5F3G A;  3I2H A;  2WO3 A;  3OOX A;  1TMF 3;  3POE A;  5I8Y A;  3J26 N;  4LOS A;  5H9Q A;  1QDC A;  2RDS A;  3VL8 A;  4M0N A;  1PVC 3;  2OVU A;  4WM8 B;  2OYZ A;  1C4R A;  5AFE A;  2HLE A;  3LSE A;  4LUM A;  1W8T A;  2OPK A;  3KGL A;  1UYY A;  3NNJ A;  4P9X A;  3RFR A;  2VUC A;  4FSJ A;  2ZHL A;  4DMI A;  4IEP A;  1W2O A;  2ZGO A;  4Q4Y 1;  3K48 A;  3SH5 A;  1RUG 3;  3PHM A;  2C1F A;  4MSV A;  5F2W A;  4LT5 A;  2JEC A;  4JGZ A;  1RHI 3;  4KBZ A;  4YPJ A;  1E5I A;  2VY0 A;  3O12 A;  5EXO A;  3M1H A;  1J3P A;  1UZW A;  2XHN A;  2BOJ A;  4CEW A;  3OPZ A;  4NIG A;  1MZF A;  4GXL A;  1NQD A;  3AFG A;  1QF3 A;  3BKZ A;  1RB8 G;  1NCQ A;  3W21 A;  3KF5 A;  2HEV F;  4UYB A;  4LLF A;  1T6G C;  3HBK A;  5FO9 B;  1GLH A;  2ZGQ A;  5EYY A;  3I3M A;  1EAH 3;  1JHJ A;  2DFC A;  3DXT A;  2A6V A;  4A7Z A;  3JQX A;  2QDN A;  2QCS B;  5B2G B;  2CAU A;  2NPI A;  1Y4W A;  4HK8 A;  3VD9 A;  3ZDS A;  4MOA A;  5GLT A;  4AVV A;  1O59 A;  2OXB A;  2EIC A;  3VBR C;  1LOC A;  2Q1M A;  3WQ1 A;  5FMB A;  4M0H A;  4O9E A;  5FO7 B;  1VAK A;  1DYK A;  4AI9 A;  3VBH C;  5L9B A;  4CZS A;  4ORF A;  4IDZ A;  4DPN A;  3E1F 1;  5GZC A;  4U2A A;  3D82 A;  4AFA A;  5JOW A;  3H8R A;  2QJV A;  2VUL A;  3T30 A;  4PLM A;  5A33 A;  3I3E A;  4A41 A;  3ZYG A;  1K5M C;  1H8T B;  2WNV C;  5C70 A;  5FXX A;  2SBA A;  2YBS A;  3FUQ A;  5DPN A;  4I3G A;  1MVE A;  2VZO A;  4HVO A;  3N9O A;  1JHN A;  2GU9 A;  1X36 A;  1KXG A;  1PMI A;  3I54 A;  4XF4 A;  3K3N A;  4MX3 A;  1PO2 3;  4K1Y A;  5DXD A;  3K77 A;  5DUW A;  3RVH A;  4W4Z A;  1QJX 3;  4Q4Y 2;  4QB2 A;  2ZX0 A;  3P6B A;  4ZKT B;  1O8S A;  3O0W A;  5EWS A;  4Q4W 1;  2Q0A A;  4XFI A;  1POV 3;  4OHW A;  4CPB D;  4FTB A;  2HWE 2;  5D8A A;  1DCS A;  1RUD 1;  2HWB 1;  3ZYH A;  1UYZ A;  3MGU A;  5FP3 A;  4GAL A;  4LA2 A;  4LOT A;  4RHV 1;  3HT2 A;  2VTX A;  1UY4 A;  2PQQ A;  1JYX A;  1JBC A;  3H1Y A;  2BW8 A;  2A7A A;  2HYK A;  1IQD C;  3KVA A;  2RM2 1;  1RC6 A;  3DV8 A;  2WO2 A;  4NE9 A;  1WBF A;  5JOX A;  1RVF 1;  3ZKU A;  2ZGN A;  1VBE 3;  2YY1 A;  4WVM A;  4GJZ A;  1ZX5 A;  1V70 A;  2WA4 A;  1DGW X;  3ZN5 A;  4A3Z A;  2BPA 2;  2YZ4 A;  1UPI A;  4YVS C;  2VMD A;  4AF9 A;  1TNF A;  3SQO A;  2RS5 3;  3WNN A;  1HRV 3;  2OW4 A;  2VUD A;  1RUC 1;  3PU8 A;  5JPN B;  5I0R A;  2GNT A;  4RFT 0;  2MPF A;  1HW5 A;  3JU9 A;  1SFP A;  4DY3 A;  4Y1Y A;  3UJO A;  3GGL A;  3JBG 3;  4TSV A;  4XUR A;  2ZX4 A;  4P02 B;  4ZXK A;  4HG6 B;  4GH4 B;  2RS3 3;  2RR1 2;  2NYY A;  5I93 A;  1HV1 A;  1H2N A;  3N7K A;  4KU7 A;  2FMD A;  4DXT A;  2FDH A;  2XWB B;  3NO8 A;  1US2 A;  4WVZ A;  3J7H A;  2X5I C;  4QM8 A;  5CG9 A;  4O65 A;  2R04 3;  3ES1 A;  5AC9 1;  4JGY A;  5BNO A;  1V6N A;  2ZBJ A;  3TEY A;  3PJY A;  1I5Z A;  2JEN A;  3NVC A;  1BMV 1;  1W6M B;  2BFU L;  1MEC 1;  5A7O A;  2C26 A;  5BNN B;  2EXJ A;  2CWM A;  1CZV A;  5FZ9 A;  3UJQ A;  1XE8 A;  5F5C A;  4QPG A;  4IV3 C;  5D21 A;  1Z7S 1;  4LIV A;  2BVV A;  2OII A;  4OI4 A;  3BVC A;  4PIY A;  5FPZ A;  2PAE A;  1XSQ A;  3WDW A;  3WDT A;  1VBC 3;  2CSG A;  4HPK B;  1FT9 A;  4B7K A;  3OTF A;  2ZA9 A;  4YW4 A;  3CNA A;  4WM8 C;  3LA2 A;  3CEW A;  1JS9 A;  5F7U A;  4IUG A;  1HJF A;  1CZT A;  1NLQ A;  1WLW A;  4AOC A;  1YIP A;  2BGO A;  1FNY A;  1UF2 C;  2XG3 A;  4OYU A;  2Z79 A;  4HBN A;  4RHV 2;  4C90 A;  3JD7 2;  3WF1 A;  4UFM A;  3DCQ A;  2VQ0 A;  2H6B A;  3KS7 A;  4LJH A;  2L9L A;  3KM5 A;  1OBN A;  3WXP A;  2WQ4 A;  4KWK A;  1L7R A;  2C0Z A;  2ZGS A;  1F5J A;  3S5A A;  2WYS A;  1AR7 1;  1V9U 1;  3PNA A;  2AH2 A;  2ADE A;  1J84 A;  5A7W B;  1H1A A;  3UET A;  5T54 A;  4XF3 A;  3S7E A;  5FMD A;  1ASJ 2;  2ZX1 A;  3CDZ B;  4UOJ A;  1XXN A;  4YM1 A;  4MXV A;  2VTX J;  2W2I A;  2XVL A;  2LUW A;  2QTW B;  3LDR A;  3M7A A;  1B35 A;  3ZN4 A;  1PZ8 A;  1H2L A;  3DUI A;  3LDK A;  2WZ8 A;  4YFW A;  3V0A B;  3A23 A;  1K42 A;  4JHT A;  1LRH A;  1F2N A;  4MGY E;  1JN2 P;  1AR9 3;  1YUD A;  1JUH A;  3SCF A;  2GMP A;  2P3J A;  3BTX A;  4N53 B;  5IVF A;  1K3I A;  3WLU A;  3E5U A;  4XPV A;  4IE6 A;  4XJA A;  3T2O A;  3ROU A;  3VHP A;  3ECQ A;  4ZU4 A;  4S2H A;  4JZR A;  1AX0 A;  5IFT A;  1OA3 A;  1VBB 1;  2G19 A;  1UCX A;  3ZLI A;  1BLZ A;  3UL2 A;  1BXH A;  1EAH 1;  4D7T A;  5AC9 2;  2ZGK A;  1W6N A;  5DAP A;  3H42 B;  2D6K A;  3EHK A;  3QBQ A;  1D4M 1;  2Y26 A;  2CWS A;  4AHW A;  2A1X A;  3AYC A;  3GJB A;  2E26 A;  3AVR A;  3RGB A;  2ZAA A;  2WAO A;  2GME A;  4A44 A;  2P3K A;  4H14 A;  1HXS 1;  4X6Q B;  4P9J A;  4Y22 A;  1ZRC A;  1HRI 3;  2P6C A;  3EB7 A;  1WLC A;  1W2N A;  4FBF A;  1QH6 A;  2JE8 A;  3DN7 A;  2ZHM A;  2G1M A;  3GZE A;  4XAE A;  1W28 A;  3DEM A;  5E89 A;  3RZZ A;  4UAP A;  3H7J A;  1CAU B;  3BTY A;  2UU8 A;  3UYJ A;  4AI1 A;  5F9T A;  1YC6 1;  5JMC A;  2DUO A;  5T5J A;  5IYY A;  4BLJ A;  1ENR A;  4MUV A;  2IVJ A;  4D8M A;  3MFC A;  4MGS A;  2VQA A;  1VP6 A;  3AMP A;  4HN1 A;  1NXD 1;  4N7U A;  5F5Q A;  3CHX A;  5IWF A;  1DF0 A;  1V9U 2;  4AVS A;  4G3Y C;  4XBL A;  1R09 2;  1CPN A;  1UMZ A;  1PHM A;  1I9R A;  3T2Q A;  1D0G A;  4AI3 A;  2QUO A;  2VTF A;  3THD A;  3EJK A;  1HQL A;  3DXU A;  2PYT A;  1VE0 A;  4BLI A;  1JYW A;  3X29 B;  3MEP A;  5F1R A;  3BUC A;  3ZSJ A;  1VBA 3;  2GNM A;  4LTA A;  2P6H A;  5EQU A;  4BXS V;  5A3M A;  5ABJ C;  3R0R A;  5LK5 A;  3LQC A;  4QWN A;  1F15 A;  4JTN A;  3OD0 A;  4NHX A;  4LKD A;  4YFZ A;  3UK9 A;  3WG3 A;  3WG2 A;  4EWE A;  1CZS A;  1JU4 A;  2J22 A;  5FXW A;  3WVJ A;  1JYN A;  4QQP A;  1QJY 3;  1YJL A;  2VQT A;  3HMY A;  1BQP A;  3WNP A;  3OG2 A;  1C5H A;  1HX6 A;  4Y1U A;  1DLC A;  1VMJ A;  2D44 A;  1FI2 A;  1HLC A;  4FQ4 A;  4JDO A;  4QQ2 A;  1MZE A;  4RR3 C;  3WG1 A;  4CPB A;  2D98 A;  2GH2 A;  4QPW A;  5FRA A;  1SPP B;  1VBD 3;  1V6J A;  2NN8 A;  1D4M 2;  2BRT A;  2PHF A;  4GH4 C;  1JZ3 A;  1HRV 1;  4HL0 A;  4GB3 1;  5FYH A;  3U10 A;  3M2M A;  3VBU B;  2JG8 C;  4D6Q A;  3UNP A;  2DCT A;  2XXZ A;  4NN0 A;  5HXV A;  4NPM A;  1W0N A;  3KQ4 B;  5FDB A;  2VVD A;  3KV5 A;  3Q8B A;  4EN0 A;  1JOJ A;  3WOG A;  4C0B A;  2EA7 A;  2PLV 3;  4JKK A;  4Q29 A;  3NST A;  1GQH A;  5BNN C;  3HN1 A;  4DIQ A;  1RUF 3;  4XIL A;  4IEO A;  2VOW A;  4UFL A;  4BQY A;  3BGA A;  3IDA A;  4CYD A;  2UWC A;  5J1X A;  2B5H A;  2VW2 A;  4Z2W A;  4AAX A;  3O7O A;  3IT8 A;  1I3H A;  1A6C A;  2VCA A;  1QJZ A;  5DAW A;  2WS9 1;  3VZM A;  1DFQ A;  4AED B;  2YG0 A;  3FHA A;  4HMZ A;  3RI8 A;  3VZN A;  3OEB A;  4A42 A;  2WC2 A;  4IEZ A;  4I0W B;  4YW1 A;  5FZ1 A;  5FY0 A;  1IOA A;  2QQU A;  3MFA A;  3UV9 A;  5C8C B;  5FYS A;  1V6M A;  2BV4 A;  5FK7 A;  1O91 A;  3A22 A;  4LMF A;  4N7I A;  4AGR A;  3GCW A;  4RGA A;  4Q5O A;  2I45 A;  3LIH A;  5CFD A;  4UF0 B;  2ZEZ A;  1T6B X;  3R4S A;  2KR2 A;  2V72 A;  3E6B A;  3ZFE A;  3AKQ A;  3TEX A;  4MXW B;  2WAA A;  4MAD A;  1QMJ A;  1AXY A;  2CL2 A;  4O7X A;  1SZB A;  3BYW A;  4HOO A;  2RMU 2;  4CRQ A;  3POI A;  4BA6 A;  2E7A A;  2DFB A;  1JXN A;  3ZKY A;  4HKW A;  2D7F A;  4DEQ A;  1DQ1 A;  1RL3 A;  4LQR A;  1R08 3;  2GMM A;  2QQN A;  2JDU A;  4CA9 A;  2YBK A;  1EV1 1;  4GB3 2;  3GBF A;  1H4H A;  3OY8 A;  4OUE A;  3UT0 A;  3ALQ A;  2WNU C;  5AFB A;  4XCB A;  2ZZQ A;  4Q4V 2;  5JCT A;  2BU9 A;  3A0K A;  3S0M A;  1SHW B;  3M3C A;  3NNM A;  1GOH A;  1LHV A;  3I97 A;  3KT7 A;  5FZE A;  1OOP C;  3SEE A;  1NUK A;  3D4K A;  4DUW A;  5IAX A;  1HQW A;  2RJK A;  1EY2 A;  1QJU 1;  4DFS A;  2HYX A;  4FXK B;  3T0B A;  2Q8D A;  3USS A;  1W05 A;  4CXW A;  1UMI A;  1XNT A;  2J1A A;  4HSJ A;  4PLN A;  2NQY A;  4YZ3 A;  5A32 B;  4A3X A;  3WDV A;  1RMU 2;  4OHX A;  4IEQ A;  2ZGR A;  2KD7 A;  3NNL A;  3WV6 A;  4FOV A;  2QNK A;  1UIK A;  3Q8E A;  1CAW B;  4K20 A;  2WS9 2;  3N9M A;  4A4A A;  1EYB A;  3U37 A;  3VZO A;  4IE4 A;  4XET A;  2PTM A;  1G86 A;  3A7Q A;  1PZ9 A;  3UKN A;  3OPT A;  1NKG A;  1AYM 3;  3NV2 A;  1LKN A;  4CDQ A;  3NNF A;  4NII A;  2D93 A;  3N7J A;  5KC5 A;  1LU1 A;  3I59 B;  2DVA A;  4X6R B;  3U1X A;  4D94 A;  4IV1 B;  2W91 A;  1VB4 A;  4Y26 A;  3GCX A;  3AVS A;  1NA1 C;  2D3R A;  1OF4 A;  2Y8K A;  2F4P A;  3EMR A;  1Q8S A;  1XND A;  1XYP A;  4Q8L A;  4QQH A;  4CDU C;  2Y0O A;  3AYE A;  4S2F A;  4E4H A;  1CPM A;  4QDQ A;  4HT1 T;  3WP4 A;  5BV6 A;  1TE1 B;  1VR3 A;  2VW0 A;  3MID A;  3HN3 A;  3AZY A;  2JDK A;  3IBM A;  1WA4 A;  2K2S A;  2BJS A;  5F2S A;  3I49 A;  4XJW A;  1DGR A;  5L7O C;  3A21 A;  1FOD 1;  3LIG A;  1RUI 3;  2ZZJ A;  3ST7 A;  1AYN 2;  3MLK A;  2V73 A;  3GHN A;  4L11 A;  1JOD A;  4PF5 A;  2D3S A;  5JAX A;  4XFG A;  3MZH A;  1HDK A;  3WHU A;  4N43 A;  1EUT A;  3ZYF A;  4CCN A;  4FFI A;  2E7Q A;  4Y33 A;  1CX1 A;  1AUY A;  4KBB A;  2ZGU A;  2QE3 A;  4COU A;  2VOK A;  1PIV 3;  2K9Z A;  1FMD 3;  1EV1 2;  4JC1 A;  3ABZ A;  4OHZ A;  2NP0 A;  1GYK A;  3RYP A;  2WT1 A;  3CMG A;  1NCR A;  4TWT A;  3U4X A;  2WWU A;  3H3U A;  3P5B A;  5BNP C;  3DPR B;  4KQ7 A;  4WZC A;  3J7L A;  3S7I A;  1AR8 1;  1LR5 A;  1LOB A;  1Q8V A;  2OT7 A;  1QJU 2;  5FZH A;  5HPO A;  4COY A;  3TB0 A;  1Q8Q A;  2D6M A;  4Q1P A;  3VBF A;  2CYF A;  2PAK A;  3ON7 A;  1S0I A;  2BWC A;  4UW5 A;  3SIT A;  5ISL A;  5FY4 A;  4AEM A;  1IQA A;  2PA7 A;  4FAG A;  1AR6 2;  3G7D A;  4TLG A;  2HBT A;  2FMY A;  4FXG B;  3DYM A; 
#chains in the Genus database with same CATH homology
 5FYV A;  3NJY A;  4UF0 B;  3RVH A;  4CCJ A;  2OS2 A;  4V2W A;  4BIS A;  4CCK A;  5FZ8 A;  4HON A;  2XML A;  5F37 A;  5FWE A;  5FPB A;  3PU3 A;  3AVR A;  5FYY A;  5FYI A;  4QX8 A;  2Q8E A;  5FWJ A;  4AAP A;  2OX0 A;  3OPW A;  4HOO A;  5E6H A;  5FY7 A;  5FUP A;  5FZL A;  5FZ7 A;  5FP3 A;  3AL5 A;  5FZ3 A;  4IGQ A;  4XDP A;  5FZ6 A;  5IVY A;  3KV9 A;  2GP5 A;  5A80 A;  3KVA A;  2YBK A;  5FZD A;  5ANQ A;  4TN7 A;  3K2O A;  4GJZ A;  3KV4 A;  5FPA A;  3UYJ A;  4LIU A;  4D6R A;  5FPU A;  5FYM A;  2OQ6 A;  4XDO A;  5FY1 A;  5FZE A;  5FZK A;  2XUE A;  3PU8 A;  5KR7 A;  5FZF A;  5A3T A;  5LW9 A;  3N9Q A;  5FP8 A;  4QX7 A;  2Q8D A;  4Y4R A;  5IWF A;  5FP7 A;  5FXZ A;  2PXJ A;  5FPV A;  5IVV A;  4GJY A;  4BXF A;  5F3G A;  5CEH A;  1VRB A;  4DO0 A;  5IW0 A;  5F5I A;  3DXU A;  3N9M A;  4IGO A;  3ZPO A;  2YPD A;  4NUB A;  4CCL A;  5A3N A;  3KVB A;  3OPT A;  4ASK A;  4IGP A;  5F3C A;  5FV3 A;  4QXH A;  5FPL A;  5A7S A;  2YBP A;  3N9N A;  5IVE A;  4QWN A;  4Y3O A;  5FZC A;  3N9L A;  4QXB A;  5F2W A;  5FBJ A;  5LY2 A;  5FXW A;  5LWB A;  5A1F A;  3AVS A;  5A7O A;  5FZ9 A;  5A7N A;  5F5C A;  5FZG A;  3U78 A;  5FYC A;  4LIV A;  5F32 A;  5F5A A;  5FZM A;  4URA A;  3LDB A;  4E4H A;  2GP3 A;  3K3O A;  3N9P A;  3PUQ A;  5FYB A;  5FZI A;  5A7W A;  5A3P A;  5F2S A;  4C8D A;  4D6Q A;  5FXV A;  5FYH A;  2VD7 A;  5FZB A;  5A7P A;  4D6S A;  2XXZ A;  4CUG A;  5A1L A;  3DXT A;  4QU1 A;  5FZA A;  5K4L A;  5IVB A;  3KV5 A;  2WWJ A;  4CCN A;  4Y33 A;  3PUS A;  5FP9 A;  4DIQ A;  5FY9 A;  2Q8C A;  4CSW A;  5FYT A;  5A7W B;  4AI9 A;  4CCM A;  5FZO A;  4GAZ A;  5F3I A;  2WWU A;  4QXC A;  4LIT A;  5FY8 A;  2W2I A;  5IVC A;  4UF0 A;  2YU2 A;  4GD4 A;  5FJK A;  5FY0 A;  5FZ1 A;  2YU1 A;  5FJH A;  5LY1 A;  2XDV A;  5FY5 A;  2OT7 A;  5FUN A;  4LXL A;  2P5B A;  5FXX A;  2YBS A;  4EZ4 A;  5FZH A;  3AL6 A;  5FYS A;  4BU2 A;  4V2V A;  3KV6 A;  3N9O A;  3U4S A;  5FZ4 A;  5FYU A;  5IVF A;  5ISL A;  5FY4 A;  4CCO A;  5FZ0 A;  5F3E A;  4EYU A;  4EZH A;  3PTR B;  2OQ7 A;  5F39 A;  3LD8 A;  5FP4 A;  3K3N A;  5FZO B;  5A3W A;  5A7Q A;  3PUR A;  5IVJ A;  5FYZ A;  3ZLI A;  3PDQ A;  3PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...