5A80A

Crystal structure of human jmjd2a in complex with compound 40
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
351
Chain Sequence
b'ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a80A01
5FZLA 5FYZA 3K2OA 5FYYA 5A1FA 4LIVA 5FY7A 2WWJA 5FZDA 4CCLA 2P5BA 4LITA 5A3WA 2XDVA 5FZ7A 3PU3A 5IWFA 5A7SA 4DO0A 4XDPA 5A7NA 5FZKA 5FYUA 4LIUA 5IW0A 5FPUA 4GAZA 4QX8A 5FUNA 5FPBA 5FZOA 5ANQA 5A7QA 4GJZA 5F5CA 5FP4A 2OX0A 2Q8EA 4EYUA 3PU8A 3AL6A 5FYCA 3KV9A 5A1LA 5FYHA 5F3CA 3AVRA 5FY8A 5LY2A 3KV6A 4CCJA 4EZ4A 3LD8A 3PURA 3K3NA 2XXZA 5FXXA 2W2IA 5LWBA 4TN7A 4QU1A 5LW9A 2GP5A 3KV4A 4V2VA 5FXVA 4CCMA 5FPLA 5FXZA 4NUBA 5FP9A 2WWUA 5IVJA 5FP7A 3N9NA 1VRBA 4QXHA 5FYSA 5ISLA 5FZIA 2YPDA 3N9PA 4UF0B 4URAA 4XDOA 5IVFA 2VD7A 4HONA 5FPAA 5FZ4A 2OQ6A 5A7OA 5FY4A 2OT7A 4Y33A 4EZHA 4QWNA 5A7WA 4GD4A 4IGQA 2XMLA 5FWJA 5FZAA 4BISA 4D6SA 5FZ8A 3N9OA 2Q8CA 2YU1A 5FZGA 2GP3A 5FZOB 3KVAA 4BU2A 5FZFA 5IVBA 4D6QA 5FZ3A 2XUEA 3AL5A 3DXTA 5FYVA 5FZBA 4C8DA 4E4HA 5A80A 5A7PA 5FUPA 3PTRB 5F3IA 5FY9A 5FJKA 5IVEA 5F2SA 3U78A 5FXWA 3ZPOA 4QXCA 5IVVA 4AAPA 2OS2A 5F2WA 5FP3A 5F5AA 2PXJA 5FYIA 5FZMA 5KR7A 5FY1A 5F5IA 4CCKA 5F3EA 3NJYA 2Q8DA 4QX7A 5FP8A 3U4SA 3OPTA 3ZLIA 4UF0A 3PUSA 2YU2A 5FZ6A 5FYBA 5FYMA 5F32A 3PUAA 5IVYA 3N9LA 5K4LA 5CEHA 4LXLA 5F37A 5FZ9A 4GJYA 5FZEA 5FY0A 3KV5A 3DXUA 5A7WB 5IVCA 2YBKA 4HOOA 4ASKA 4CUGA 3RVHA 4IGPA 4CCNA 4IGOA 4DIQA 4BXFA 3K3OA 5FYTA 4V2WA 5LY1A 3PUQA 5FZCA 4CSWA 3N9MA 4QXBA 2YBSA 3AVSA 4CCOA 5F39A 5FZ0A 5FBJA 5FY5A 4AI9A 5FZHA 5A3PA 5FV3A 5A3NA 2OQ7A 3KVBA 3PDQA 5E6HA 5FZ1A 4Y3OA 4Y4RA 3OPWA 2YBPA 5FWEA 5FPVA 3UYJA 4D6RA 5A3TA 5F3GA 5FJHA 3LDBA 3N9QA
chains in the Genus database with same CATH superfamily
1LJ7A 1GZTA 2Y6GA 2XKPA 5FTTC 4DB5A 1AJKA 1I5PA 5H9QA 1KEXA 2VNGA 3E6CC 2WABA 3EHKA 2WZR3 1TQ5A 1RVF3 4MXWB 3LZZA 2CWMA 4E9KA 2PAKA 3P3NA 3H7YA 4XJ8A 5EHDA 2GZWA 3EJKA 3LSDA 5FPUA 5E16A 2EAKA 5FUNA 3FLTA 1R082 4HETA 2RMU1 4GWJA 4CZSA 4Q4Y2 1NKGA 5KHIA 4A6SA 1WLTA 3KV9A 2CDOA 4J6GA 3HBZA 1ULDA 2D6NA 2EXKA 3ATGA 3SISA 4P14A 5CFCA 3ZYFA 4ZXEA 1X33A 1ULOA 3VKLA 1EAH3 2JDYA 4NUBA 4AVCA 1L7QA 1QDCA 1CAXA 1OLME 3AP4A 1F8VA 1DGRA 3K75B 1LODA 5DAXA 1O5UA 2EIGA 2IVJA 1AR71 3D82A 3HR9A 3OGGA 5FZ4A 4QPIB 4SBVA 1W0NA 4FFIA 2HWC2 4YYOA 2D93A 1CPMA 3OF1A 3WV6A 2JE7A 1YXWA 1N3PA 5FLIA 4XBNA 1NT0A 5J1XA 4IESA 1AF9A 4AQSA 5IFPA 4YWAA 1W9FA 2AACA 1SLCA 2J1TA 3VDBA 3QH6A 3SQOA 2QE3A 4O7XA 4D6QA 3K4AA 4H3WA 4A7YA 2GH8A 2UYBA 4JTOA 4K6BA 4RR3C 4YVSC 1XNDA 2ZGKA 3ZR5A 2IWGB 5FUPA 3HEIA 3NWKA 1ODMA 5FUIA 3WDXA 2IZWA 4C91A 3CL1A 2C1FA 2YG0A 5IVEA 4MGQA 1UOFA 3NNLA 5EXOA 5A32B 3T2TA 4M3CE 2QJVA 2VCAA 1QJX2 4AK3A 3IZOA 3KT4A 4JDNA 1CQ9A 4UFKA 4MHUA 3BI3A 3B9CA 3QBQA 1LKNA 2PAEA 1PVC1 4MLOA 1QOOA 4ZXKA 1US3A 3U1XA 4BZ4A 2HJIA 2VMFA 2VW2A 2DVAA 2KM2A 1VBE3 3OPTA 1LHWA 1DQ6A 1LRHA 2R041 3R4DB 1ZREA 3X29B 4IEZA 3MBWA 4Q4V2 2VJXA 4MUVA 3RYPA 3ZN5A 4CP1A 2W46A 2R1BA 1U5YA 2DCKA 3BODA 5DUUA 5LB6A 1DFQA 4XUQA 2YGLA 2ZX2A 4AEDC 1NLQA 1YHFA 2W5FA 4YZ2A 1WCUA 3LOBA 1O91A 4P00B 5C4WA 1X36A 4IGOA 1KRIA 1HJGA 1V70A 4CUAA 2WT2A 3R6SA 2ZX0A 2YDEA 4DFSA 1B09A 1RJ8A 4X8NA 3THDA 3UKNA 4AGRA 4CEWC 3O0XA 4XIKA 2ZMKA 1XC6A 4YGEA 3SCFA 1B35B 4MGIE 3WY6A 4QPGB 1U5XA 2VUAA 1VMFA 2A73B 3E5QA 2RJ2A 2ZGSA 2QDNA 5FZ1A 3UGHA 2AEYA 4L0PA 5FPXA 3IWZA 1DG6A 4AVTA 3KWVA 4I09A 2WQ4A 4XFAA 1YQ2A 2ATFA 4JZRA 1AR72 1LOAA 1NA1B 2JG8B 5FZLA 4JX0A 1L7LA 4Y1VA 4ZU4A 1GQHA 2D97A 4C0HA 1W9YA 4AVSA 2WIIB 4KBBA 1F2NA 1HRV1 1YNAA 3I54A 4NRMA 1W6NB 5K0UA 1XE0A 1GU3A 4KGGA 3V0BA 1BLZA 2Q1ZB 3KQRA 1W39A 3SXWA 1RINA 2C4XA 5LEJA 2D44A 2DTWA 2DWRA 4GJZA 5JVVA 4WVVA 2Y64A 4I01A 3USUA 4EYUA 1MS8A 4PIYA 1RIRA 4YVWC 1J58A 2VZ1A 3LPGA 1QXPA 1XYOA 2ZPXA 5FO8B 1FT9A 3KGZA 1PO21 3WD5A 1VB4A 3KMHA 2BBVA 1OOPC 1RMU1 4UFHA 4XFIA 2XWJB 2ZEZA 1ENSA 1OQDA 3DKQA 1PVC2 2WWUA 4B1MA 1O8PA 4OI1A 1ONAA 1UXZA 3LA2A 3ROUA 3WUCA 4TWTA 2ZGUA 1JZ5A 4XJZA 1RITA 4LBJA 4URAA 1JZ4A 2HLEA 3VBRB 4Y20A 5KHJA 2H0BA 4A3ZA 5JWPA 4NRQA 3KQ4B 5JUVA 2CY6A 3J7MA 2ORXA 3ASIA 3V56A 1Q8OA 1UD1A 1UN1A 2R32A 2RR13 5FWJA 5J96B 3OSDA 5FZ8A 2B46X 4AEJA 4RFRB 2VZVA 1W6OB 4FTSA 1LGCA 5J37A 2XUEA 5KBFA 1W8TA 3VBSB 4K8RB 3IMNA 1RUOA 4BMEA 3U10A 4CDQA 5FBZA 1LHOA 5FY9A 2BZDA 3HQRA 1V6IA 5FXWA 3ZXJA 1YJKA 5BNOB 4A7ZA 3RFRA 3MLJA 4HFSA 2UURA 2DYCA 1C8M1 4JVAA 5F2WA 3ZDSA 1MS9A 2DCZA 1YRZA 2ET1A 1RHI2 1VBB1 3M3OA 4DY3A 5JXHA 4GH4B 3VBUC 2G4IA 2Y0IA 3TYJA 4LO4B 4Q27A 2JDMA 4LHKA 4XIOA 1H0BA 5EP9A 3VBHA 4AI0A 4RQPC 5BNPB 2YMZA 4S2FA 1RYYA 3PUSA 5FYMA 3RDIA 3PUAA 3P6BA 1KJRA 2H6BA 5A7WB 2O0OA 1YLLA 4NJ4A 4LORA 1VP6A 4BLIA 4DS0A 2E7QA 4IGPA 2XVKA 4KWLA 3R05A 5FKBA 5I8YA 3O1TA 4Q29A 4Y22B 1JU3A 5JOXA 4CSWA 3N9MA 1VBC1 1OF3A 1XXNA 2FD8A 2E6VA 1GZCA 3IDAA 2YC2A 4K7JA 4CCEA 5CBLA 1JYVA 3OY8B 4Q8LA 1PO22 4JDMA 1NYWA 1POV0 1CAWB 2XJTA 1JH5A 1SLIA 3D0SA 3O14A 3ZYJB 4DINB 4E4ZA 5EV7A 4GMP0 4MZUA 2ZEWA 2CWSA 1Q8SA 4Y3OA 1RMU2 1SMVA 3FBMA 2YBPA 2C6SA 1OD5A 1W2UA 4D6RA 3ZFGA 1Z0HA 3M3EA 4O65A 3WNOA 3ZFFC 4ES9A 2ZMNA 2VBDA 4DQAA 4QHOA 3I2IA 3D4KA 3IN9A 3ACLA 3T0BA 4LIVA 4R4XA 4Q1PA 4OHZA 5KWRA 2VNRA 4IE6A 4MV2A 1MZFA 5JI9A 2FBEA 2Z5WA 1A34A 5J98B 3DYPA 4TTGA 2NPIA 4QX1A 5A7SA 1C4RA 4IV3C 4YG6A 3KHCA 1AR81 1C1FA 3KD4A 5IW0A 4N43C 2DF7A 4LQRA 3H3LA 1UKGA 5A7QA 4CEYA 1CX4A 5FP4A 2DFCA 2XVLA 1NXD1 5G05L 3LOIA 3D3AA 2I2SA 4LTAA 1LOGA 4Y5SA 2OUHA 2YYOA 3KV6A 4AFDA 5FOJB 5KC5A 4Z92B 1ZBE2 1H2MA 2RS53 4IV1C 3MV01 4F3JA 4TN7A 1UF2C 4NHMA 4RS5B 2NLRA 5GZDA 4MYEA 3PVBB 1VBB2 1X82A 2CU5A 1S0JA 2VMEA 5L19A 1H30A 1D4M2 3SITA 1W0OA 5CYYA 1G6NA 1W04A 2DUOA 4BDVB 4KNCA 3TEYA 4KMQA 3J9SA 4D94A 1W2TA 4ZPIA 5EWSA 4CU8A 1DLLA 3ECQA 4OHVA 4YARA 2VQAA 2VNVA 3CJIB 4WM7A 5EJ1B 4A4AA 4WV8A 5I91A 2NZ9A 3BIEA 3WNNA 1QJY1 4BISA 1CR7A 1E5HA 4JHTA 1WLCA 5E8AA 2FDKA 1XNTA 2WNUC 2VBBA 3C7FA 1DQ5A 2FCVA 4JQRA 1NCQA 5IVBA 2IVIB 3OCPA 4CU9A 2VVEA 1CAUB 5FZBA 1F9KA 1H9PA 1R083 1W8FA 3WF3A 4LNVA 5GZGA 4E8CA 4LE4A 1ND3B 2X05A 4TLFA 2XJRA 4EN7B 3O1VA 3FHAA 3ST7A 4QX5A 2UY8A 5FP3A 5FYIA 2JWPA 2V4AA 1WW5A 1WMEA 4JGYC 2E32A 1QHDA 4XPVA 5JOWA 3AKTA 4HKWA 3DEMA 2WC2A 3NJYA 5F3EA 1ASJ1 1DBNA 5B4XA 5T5JA 5J09A 1RUE3 4RHV2 1SLLA 4U36A 3WNKA 1R091 2PHFA 1LB2A 1IS3A 3RGBA 1YFXA 1PM7A 2D6PA 5AC91 4IE5A 4GZ9A 1Q8VA 1PK6A 2GMMA 5I8SA 4PHZA 5CFDB 2HWC3 1AR82 1V6LA 4HSLA 4LEJA 4KG0A 2R1DA 4CCNA 4MG2A 1RUC2 3HNYM 1O5LA 3ZO0B 1AVBA 2KA3A 5CFCB 2GMEA 1V6MA 2EVXA 1UYPA 3AZYA 1AX0A 1O4ZA 2ZGTA 4M4RA 1Y9MA 2YV8A 4B3NA 2B42B 4UFJA 3ZYIB 1MACA 4G4FA 2LRPA 5FZHA 1POQA 2VQUA 3BN6A 3CNAA 4CP9B 1BXHA 1EPWA 4N90A 5C71A 1K5MB 2VMHA 3MO4A 1W8NA 1A3KA 3OJBA 2QQUA 3N9QA 2AENA 4YZ1A 1AYN3 1OA4A 4QPIA 5DDJ2 5J7MA 4DPNA 1PIV1 4CCLA 2P5BA 1RUH1 3E5UA 1OF4A 2E53A 2XVGA 4W50A 3S7IA 4DOUA 1I6XA 1UY3A 3MLLA 2ET7A 3PU3A 1QJY2 4Q4V3 3CF6E 1MEC1 1LTEA 4HBNA 2EAAA 4L92A 3UGFA 3OD0A 1W90A 1WBFA 3HWJA 1V9U1 3NL1A 4UYBA 4BQ2A 3IPVB 5I0RA 5IAXA 1UOBA 2CHHA 3FHIB 3M7AA 3JBG1 5BNPA 4F8AA 2W47A 4S2HA 4NIHA 2OXBA 2WZ8A 1H4HA 1MVEA 4EJRA 1CZVA 2JDNA 4UW5A 2YY1A 3Q8BA 4I02A 5FXXA 1JUIA 3RJRA 3S30A 3WQ1A 5A32A 1JBCA 5E1RA 3H3UA 2PHRA 4FXGB 4LOSA 1MPXA 5FPLA 5FXZA 3RYRA 5FYSA 2Y26A 3WQBA 3DECA 1SFNA 2HWE1 1CZTA 2PLV2 3CMGA 1JMUB 3LSEA 5GLTA 1HIXA 4ATFA 2BW8A 3AMQA 4C1XA 4HK8A 1AR73 3ZXGA 3D0JA 4K40A 3FFZA 2Z4FA 4Y33A 3ZMOA 2W52A 5C4WB 2ZS6B 1XE8A 3R0RA 4CDXB 5CG9A 4EN8B 1JZ7A 1LEMA 1QIQA 4QQPA 1ND2B 3N9OA 2Q8CA 2XH6A 4ISQA 3GDBA 4AQ2A 1Q8PA 1K45A 2V4VA 2ZJCA 3KVAA 3NSTA 4P9WA 3KT1A 4QDSA 3T1LA 4D7TA 4XCAA 4ZZ5A 3MIGA 2OUJA 5TSWA 5ABJB 4LLFA 4DUVA 1H2KA 5DN2A 1AR62 1CIYA 5ACA2 4KWJA 3ZPOA 1UU6A 1DF0A 1Q43A 4QPGA 5JMOA 2ETEA 5CZKA 2PXJA 5I93A 1GWMA 3UESA 1X9TA 3TB0A 3USSA 2ZHLA 1NA1A 1VBA1 3I3MA 1BVVA 3E97A 4GMP1 4XACA 1PVC3 3SCHA 3MICA 2Y6JA 1ZYBA 3B01A 3VZKA 1RUH2 2BFUL 3ZLIA 4XJ9A 3W58A 2PTMA 3O7OA 3W5NA 3KM5A 5CEHA 1YFUA 3AMNA 1W6NA 2DDUA 3I3DA 4IE4A 5DUVA 3I2OA 2IC1A 5JZGC 2H6CA 4HLTA 2D6LX 2YBKA 3VD7A 5FO9B 5L7OB 5JLVA 4JKLA 2BNMA 4DIQA 3UKTA 1MQTB 5BNQA 4QAWA 2ILMA 4DZGA 5D8AA 5C3SA 2EIDA 1S0DA 5C8CC 1STMA 3ILNA 4N53B 4K3UA 4AOCA 3OEAA 3ON7A 3PVNA 3U14A 5E6HA 1PMHX 1OQ1A 1QJFA 1W8WA 5GLVA 1QJZA 1H8TC 4A42A 4CDWA 1S0GA 1C3HA 3LQCA 5H9SA 5L9VA 4W4ZA 3H7JA 2A6WA 1VRH2 3BOPA 2LROA 1COV2 4WBBA 3GBGA 3LPFA 1RHI3 3WQ0A 5IK5A 2DTYA 5CG8A 1WMDA 1V6NA 4GWNA 4N7UA 2VNOA 5KXDA 2W91A 4XF9A 2BGPA 2CL2A 3WF0A 1JYNA 1H9WA 2JDKA 2XJSA 3J7LA 2HEYF 1JUHA 2PQQA 4M0NA 1LNSA 5JCTA 2F17A 4TLGA 1RUJ1 4IEOA 2W1UA 1PGSA 1W6OA 4B4RA 4NWVA 4B7KA 3LE0A 1O3SA 1A78A 1H2NA 2VCBA 3AL6A 2W87A 3ENRA 3ETQA 3N35A 4NO4A 1CJDA 3HNMA 4FOQA 4P9IA 2WFF3 3B93A 1D2SA 4PI2A 1QKQA 4YW5A 1YWKA 5FO7B 3U11A 5BNOA 2VTXJ 4LKSA 3LD8A 3VB9A 4IEXA 1TNRA 5E89A 5KXCA 5IK8A 2FDGA 4YM2A 5LW9A 2HKXA 1KJLA 2Q8OA 4EN0A 5KHKA 3H9AA 4LUMA 1TG7A 4ZU5A 1BBT2 3AFKA 4GH4A 4K1YA 4AR2A 1SDWA 2ZHNA 2BNNA 1I5ZA 4C0BA 1RMU3 2VQTA 3RZGA 1EYBA 2MHFA 5FFOC 2D6OX 3NJXA 1S2EA 4RN5A 1LECA 5A1AA 1O7FA 5A6YA 3TEWA 4AQ6A 4EZHA 1URXA 3ILFA 1TME2 2UWAA 4JV4A 1PO13 5A7WA 3UJOA 1W9TA 1MR5A 2XQXA 3RZLA 5H9RA 1JI6A 2FHRA 2XL9A 1GANA 2BDRA 5B4NA 1GP4A 1CZSA 1FPN1 1IPJA 1ZZBA 4Y22A 3OTFA 3T08A 5FYVA 1REDA 3OY8A 4R9DA 2FZ2A 1TMF1 1OHFA 1J3QA 2JDHA 4LR4A 5F3IA 3UT0A 1DZRA 1AJOA 1IPSA 2G9ZA 2L9LA 4NWWA 5F2SA 1W05A 4PF5A 3ZFGB 3NAPB 1D2QA 1QMJA 1JTZX 4XUOA 2XQRA 3WUDA 3ZSMA 1XJAA 4XYXA 4PJYA 1ZBE3 4XTMA 1JOPA 1X7NA 4P02B 4WVWA 4BCUA 4CCKA 4OQ8A 1ZBA1 4YNIA 1VBB3 4BM8A 3DPRC 2EIBA 2ZX1A 1D4M3 3I97A 4FPKA 2P6HA 1SCSA 3C7EA 4RFT0 2GC2A 5FZ9A 4GJYA 3H1YA 4XUTA 1RUJ2 1FOD2 3TN91 1UX7A 3KSCA 1PX3A 4FOVA 1QWRA 1WLWA 2X5IB 4Q4X1 1AYM1 1CESA 2BWAA 2WJSA 3J7NA 3BPSA 2WKKA 4AVVA 5GZEA 2XB6C 3ZSLA 4QT6A 1PNFA 2YFZA 4XFCA 2K2SA 5BPXA 4CP2A 1PZ8A 4MGKE 3CHXA 4XDQA 3C2UA 1J1TA 4AGGA 2OQ7A 2BU9A 2WNVB 1GP6A 1AXZA 1BQPA 1TNFA 4FP3A 4LO6B 4PI0A 2QFEA 3S7EA 3B3QE 2B39A 4AHWA 2VCCA 3H42B 4ISRA 4WM7B 2VCMA 1KGYA 5FMOL 2QCSB 1ENXA 3AYEA 5A1FA 1YEWA 2Y8KA 4QPWA 3CJIA 2IFRA 3GNEA 1T6GC 5BUVA 4RHV3 5K9YA 4H55A 1DQ1A 2DCJA 4YW3A 2Q1FA 2R0FA 2P2KA 4LIUA 5JXGA 1LOCA 4DEVA 1G86A 4CU6A 1GWKA 2XJQA 4XURA 1AR83 5FR3A 1OURA 3ZIWA 3B5LB 4C90A 1DIWA 3BGAA 2Q8EA 1RJ7A 1RGSA 3H1WA 4HANA 4HPKB 4OUSA 3HT1A 1RUC3 3AJYA 2C9KA 1TMF2 1UXXX 2QQLA 1WW4A 2DU0A 1WA4A 2BYVE 1G9FA 1QQP1 1ND3A 4EZ4A 3PURA 4I3GA 1ZM1A 2VTFA 3FLPA 3K3NA 5J36A 1AX1A 4KI5M 4RSUA 4AI3A 2BFUS 4QKBA 3GXUA 2HYXA 2WS91 3TBDA 4S2DA 5GLWA 3GCXA 5ISLA 1LULA 5FMBA 3TEZA 1ZZ6A 1KS4A 1SPPA 2J1SA 1QXRA 1HQLA 1PK6B 1LGBA 3AJZA 3LF7A 2PHTA 1AR92 1GOFA 3RSJA 2OQ6A 4QGLA 3Q8AA 1VBD2 5CFDA 2YROA 1X8EA 5DDJ3 2HBUA 1PZ9A 5LBEA 1V0AA 5G04L 1DQ4A 1BEV1 1QOSA 2WSVA 5C6CA 3KHBA 5I0TA 1GYKA 4FPYA 4Y26A 1AYM2 2WN2A 3CBNA 1QJY3 1PMIA 3IB3A 3W59A 3S57A 1VALA 1UY0A 2JJ6A 3ACGA 3I2FA 3MYXA 5C4WC 2E26A 4X6RB 3LCPA 4EV0A 3NJZA 3K48A 2O14A 4FFFA 5GZCA 4N9IA 5GJ6A 3URFA 3WCSA 1RUF3 3LEMA 2RS11 3HPNA 2SBAA 4XUPA 4CP9A 2VTXA 1RUD1 2PAMA 3CDZB 1K5MA 2VQ0A 4O61A 4XQ4A 5GM0A 2WYSA 2VG9A 2VOKA 3HAGA 4N7IA 2TBVA 1VMHA 4XILA 4BHPA 4CXYA 2HYKA 4Q2FA 3VL8A 3U4SA 4GB32 4WVZA 5AVPA 1CPNA 2P17A 2PQSA 3UK9A 2WT1A 2PLV3 3J8F1 4R9BA 5A33A 4COZA 2FCTA 2RV9A 3OPZA 4JTNA 4B4QA 3P1IA 5DAVA 5F37A 4AAXA 2RM21 5D21A 2GC3A 1PGW1 4AFCA 4XE9A 1XU1A 2CDPA 1US2A 2R071 4HG6B 5K0UC 2GDFA 3IPVA 4PDWC 1W2NA 4DY5A 1R1A3 1F4HA 2VUJA 2ZGRA 4Q4W3 3U0ZA 1CX1A 2B4KA 3S6PA 1ACCA 1ZA7A 4KG8A 3S5QA 1Q56A 1OT5A 3Q9OA 4IEWA 5CB7A 4WM8B 1G9DA 3VBOB 4D69A 3I3QA 5FY5A 1J59A 1JYCA 2OYZA 2Y6FA 1HB3A 1AR63 4AVBA 5ACA3 4COYA 2WS92 2A3XA 4INDA 4OHWA 1OD3A 4E4DX 1DCSA 3BUCA 1HX6A 2HWF1 2VR4A 2JG9B 2ZZJA 3PUHA 4HK9A 5FYZA 1PGL1 3AYDA 2GNDA 3K2OA 2DVBA 5DAQA 1H2LA 3I3BA 5FY7A 5FZDA 1DYPA 4CPBA 1YIPA 1O4YA 4LK6A 1J3RA 2RMU2 4CU7A 2ZEYA 4QHBA 4CDXA 1RUH3 5JXIA 4O9EA 1KITA 1YC61 2RG4A 1Y9QA 4CRQA 2VBPA 1ND2A 1O6UA 1UWWA 2PMWB 4GAZA 1CIWA 4K1ZA 4KU7A 1LOFA 2ZBJA 4CE8A 4BK4A 2VMDA 3SH3A 4EROA 5AFBA 5T52A 2VOVA 3BTZA 3JB8A 3PNAA 3O1RA 3EMRA 4L11A 3RG0A 3AXDA 5ABJA 3H3ZA 1ZRCA 2P3JA 1DYKA 1VLNA 3LA7A 4YW4A 4BQXA 4OLLA 4CDQC 4A7KA 2JDPA 2WFPA 3B69A 1JODA 3G7DA 3BTYA 1FNZA 2C26A 2RS33 1YYNA 4MGTA 3NNFA 5ERLA 3WDWA 4BYYA 3UETA 4CCMA 4NOTA 1VRBA 4ASLA 3BPZA 3MV11 1RUG1 2D98A 3AX4A 2X8KA 2VH9A 4ZY9A 3KB5A 2JXAA 1OLRA 4HONA 3WDUA 5A3UA 1VRH3 1COV3 2ARBA 2RJLA 3RNSA 4FBFA 5BNNB 3VBHC 4JKKA 4LBQB 1NG0A 2XMLA 3IBMA 1GQPA 2R072 5DQ0A 3ZXEA 5L7OA 3LEGA 1O3QA 3ME2A 1LOBA 1X50A 5D8AB 2CGOA 2JICA 1MQTA 3L9JT 1FYUA 2GU9A 1FX5A 2GP3A 3WXPA 1OMIA 4FPGA 1ZRFA 1IQDC 1QGLA 1QJU1 1XNAA 5FZ3A 3THPA 1V00A 2QZ2A 2XL7A 4LK7A 3OBZA 2VW0A 4N53A 3CKHA 1WUVA 5DG2A 2AR6A 4ITCA 2ZGPA 4CDWB 4RR3A 5IVVA 2Q1MA 3BYWA 1OUSA 2AEZA 2ZEXA 4M3CF 4RL7A 5FMOS 5A3LA 2R042 3MPPG 5FY1A 2AGSA 2HWF2 4YG3A 4LKEA 1SFPA 4JRLA 3ZFGC 1KDKA 2BEOA 1BBT3 3J4UH 1POV3 3SKVA 3JQWA 4GMP3 1YI9A 2OW4A 2FDHA 4UF0A 2YU2A 4PQ9A 1IKPA 1IZ3A 1GBGA 1W3VA 5HBAA 5C33A 2XR4A 4UFLA 4CDUB 1RTVA 1VIWB 4KL1A 4M01A 3ZFEC 5F1RA 1S2BA 3AZVA 1XU2A 1TME3 3AP7A 3HOBA 4FPLA 4MXVA 4AHZA 3H8XA 3O1OA 4LHLA 1EUUA 2HBTA 2BWCA 1W8ZA 3U75A 4V2WA 5HV4A 2PYTA 3DKWA 3PUQA 4CEYC 5L9BA 2JDZA 4RYDA 4QPYA 1IS5A 1NX9A 1RUI1 2CAVA 2LW8A 3VD3A 3AFGA 3WDVA 1YFWA 1QF3A 1TVGA 3OPWA 3DN7A 1JZ2A 1W6QA 4UT5A 3FUQA 5L36A 3ZSEA 1EY2A 1HRV2 3JQXA 3PL0A 1O3RA 1DGWX 2WZPP 2BOIA 2AZ5A 3ES1A 1OA2A 5KHHA 4XAEA 1I3HA 3M1HA 3ZKUA 2BV4A 2MEV3 1WCQA 2VVDA 2WDBA 1XBFA 5IAVA 4B8EA 3SMHA 4YW6A 3GF6A 4HVOA 4WM7C 4TSVA 5BV6A 4LO8A 3CJXA 1OPMA 2GN3A 4L97A 5F5CA 1FOD3 3WDYA 2OX0A 3PU8A 1HRI1 1V6JA 3QH7A 4PBPA 1CD3G 1GZ9A 1NCQC 4XFFA 5F3CA 3AVRA 4YVWA 3I49A 2G1MA 3NAPA 2W68A 1LENA 2R7EB 4NE9A 1SACA 2W2IA 4QU2A 4F83A 4QU1A 5A3MA 2D3RA 5C9AB 4XMAA 3PJYA 4BQ4A 4W6WA 1UMHA 1O3TA 3WP5A 2PHDA 5FXVA 1H1MA 1OKOA 3SLIA 3ZYBA 5FP9A 1LHNA 5IT6A 3VDDB 4OI2A 2EXIA 1OVSA 3VBFB 4B4PA 2SLIA 1XB9A 2WO3A 1GOGA 1BMV1 1JU4A 5IVFA 4QKFA 3OEBA 3TOJA 3I4IA 3OBTA 2MNGA 3WOGA 4I2OA 3T4VA 3GZUC 5I0UA 2OZJA 2W95A 5A6XA 3SEEA 1YQ6A 1QNYA 2B8MA 2UWBA 3QLQA 1Z7S3 1AL21 2YC4A 2X5IA 4NVPA 3KLSA 4B7EA 1UZYA 1ZZ7A 2CNAA 1XOYA 2VZTA 1HB4A 1VE0A 2UWCA 1C8M2 3AL5A 2BJSA 4C8DA 2V73A 1RUI2 4D7SA 3DYOA 2X53S 4AE2A 4XBLA 3PVEA 5T55A 4NN0A 3WP6A 3OG2A 3WNXA 3ZYHA 2WNVA 4QXKA 1S0FA 3VDAA 1C28A 4HN0A 4RA0A 3E1F1 3O0WA 1FMD3 2A6XA 3LFMA 2WINB 4P9LA 4FVVA 3F2ZA 2DUPA 2Q8DA 4MSVA 4KWUA 5K8SA 2ADDA 2OIIA 5LK5A 1W6PB 1EUTA 2HWD1 1XNBA 4QPIC 5JIUA 1K42A 2JKBA 2W1WA 5FZ6A 2G9FA 5K4LA 4AW7A 4IUGA 4DXRA 4PQQA 5FLHA 4ONUA 4HXCA 1AR93 5FZEA 2OKXA 2ENRA 2A7AA 3SH4A 2WZR1 1VBC2 1RVF1 2XWBB 1VBD3 4FFHA 4HOOA 4ASKA 4CXWA 3RVHA 5D2AA 2EIEA 4EWDA 1Q3EA 1BKZA 1TEIA 4Q4Y3 1HRI2 3I3EA 4HPKA 4L99A 3T3YA 1DLCA 1UIKA 1QU0A 3L2HA 2W92A 4ZHNA 5JMCA 2VE1A 3DCQA 5IFTA 1J1LA 1NCRB 3AZZA 1AHSA 2W94A 3AK0A 5BNPC 2BRTA 5KXEA 3C7OA 3IKWA 3E5XA 2CYFA 2EA7A 1F35A 2DCTA 4AF9A 3VD5A 2R061 1IG3A 4MOAA 1SPPB 3OD4A 1W2AX 3E6BA 4EWAA 1UMIA 3LA3A 3ALQA 4XFBA 2AH2A 1S1AA 1ODNA 3KF3A 4YM1A 3M3CA 2WSUA 1NLSA 3D8CA 4JGZB 1GKBA 4DRVA 2VO5A 3GHNA 2QQOA 4FXKB 4GB33 5FREA 3T0AA 1CGPA 2VZOA 5CIRA 5F7UA 5GLZA 4TZDA 4Z2WA 1AL22 4RGGA 1DP0A 3POFA 4P5YA 3WW2A 3M3IA 4S2GA 2QVSB 1OLMA 1QXJA 1A8MA 1H4GA 4I0BA 4IEVA 4UOJA 5C3OA 3OOXA 2CAUA 4SLIA 4P9XA 2GN7A 1LOEA 5FY8A 1UYXA 3JB4C 2GH2A 5C3PA 2DVFA 2VZ3A 1QJX3 2E33A 5BYNA 1B35C 4EN6B 1YCIA 4QPGC 3SNMA 4IV1A 5FAXA 3ZXDA 2Y34A 1GR3A 2E63A 4PCRA 4NIAA 4HKOA 2YPDA 2BTVC 3ACFA 5A33B 2WS93 2Z42A 2R0HA 2XBO1 2VD7A 3OB8A 4A3XA 4D0QA 1NA1C 2D43A 2JG8C 4A41A 1G7YA 1RXGA 2WNEA 1VBE1 3BU0A 1W2OA 3POJA 1DGLA 4AWDA 3T4HB 2WZR2 2Q5TA 1UU5A 1M4WA 1PVXA 2IXJA 3ZX7A 4M3CA 4D6SA 2RMU3 2D6MA 1GWLA 2PELA 4Q0VA 4AI1A 5DZFA 4LBMA 2XUMA 3JUUA 3WW1A 4WVMA 2F4PA 2QUOA 4R9CA 3H8RA 3MFAA 4DEQA 3RMYA 4WM8A 3VBOA 1SFYA 3KCCA 5JSOA 1KQRA 1ZX5A 3AMMA 2QQJA 2VY0A 1YUDA 4BWOA 1ASJ2 4D3WA 2R062 4AAPA 5EYYA 1FAYA 1GFF2 3BIWE 3CQOA 3MF6A 4NHLA 4XF3A 2MPFA 3GYDA 4ZU7A 1R092 5C70A 1GNYA 2QQNA 2JG9A 3I8TA 5BXXA 5AC92 4V1PA 5DPNA 2ORZA 2WA4A 3U07A 2AYHA 5C5TA 3GCWA 3VBRC 4GALA 3BKZA 2JENA 3RWNA 1E57A 1N3OA 4FTBA 5IVYA 4XZUG 1GICA 4YLZA 1WA6X 2WN3A 2KD7A 3Q8CA 2JEMA 3MPBA 5J48A 3IDCB 5CKMA 1WWYA 4WZCA 3OBRA 4M00A 1A6CA 3N7KA 2R073 1ZRIA 1JN2P 3WX5A 4ZONA 5FRAA 2IUWA 3H50A 1IPKA 2WO7A 3A0NA 4FSJA 4TYSA 2GNTA 1MZ5A 4QXBA 3VBSC 4XUNA 2JB8A 3WEZA 5DXDA 5FBJA 3VZJA 4OMCA 4I30A 1K12A 3VZMA 5FV3A 3NNJA 5BNOC 4HVRA 2IXKA 1LCLA 4Y1YA 2QDRA 4Y4RA 1IS6A 5FWEA 1PIV2 3UYJA 4CCDA 3ILRA 2JB4A 4LA3A 1ZRDA 1K3IA 2LTNA 2VUCA 4LO7A 4P5HA 2R043 2XBO2 4GH4C 4XTPA 1RUNA 4AI2A 5L73A 4R52A 3O1MA 4QDRA 1XE7A 1MEC2 4JQTA 4YW1A 2Z79A 3NV2A 1K5JA 5BNNA 1WW6A 2A6VA 1V9U2 4LBQA 3AKPA 3THCA 1ULEA 4LE3A 1PX4A 1ZRRA 2F4LA 1Y4WA 2J1AA 5A7NA 3JBG2 2E51A 2VOTA 5FYUA 5JR7B 1XNKA 1JYIA 1Y43B 2RR11 5ANQA 4H2AA 3LAGA 3FBYA 2Q0AA 4QD2A 5FYCA 4RR3B 4BA6A 1HXS1 1F5FA 1OFNA 2A6YA 1YO8A 4YGDA 3VKOA 2W39A 2D5HA 2HWE2 5JSRA 2EALA 2GP5A 1OC1A 4AHYA 1N1YA 2A3YA 2XPJA 3VUOA 1EP0A 5HXVA 2A75A 1QJEA 1ZVFA 3LIHA 1SLAA 1NQDA 4UF0B 5DZEA 5IYYA 3O0VA 3INAA 4NMIA 1HRV3 1WCDJ 3MUY1 4GXLA 4Y24A 4X6QB 2VC9A 5EJ3A 4E2GA 1S55A 2QQVA 4AEDB 4W8JA 4CDUA 5DUXA 3ZXFA 2VMGA 2XKOA 2GNBA 3M8LA 4J1XA 1W6MB 4MGSA 4DXTA 4FCAA 4YFWA 2GC0A 4Y4YA 3F95A 4JRAA 4BU2A 1D4VB 2QNKA 4BQWA 2ZAAA 5T5LA 3AP6A 4CEWB 2XJVA 3DXTA 1GNHA 1PO23 4QX2A 1S0IA 2G19A 4OQ9A 2JIGA 3DV8A 5CISA 5JDBA 1H6YA 3M2MA 1W6QB 3ES4A 2ID4A 1VBA2 2BBAA 2J42A 2B9VA 3IT8A 4L8QA 4GWMA 2RDQA 1OVPA 4ORFA 4YM0A 3IIIA 4RS5C 1APNA 4XMIA 1CAVB 4A6OA 5KXBA 3FFQA 1D0GA 1MS3A 4NIGA 1FNYA 3O1PA 1XYPA 1HDKA 2VXRA 2YUEA 4AYUA 4IETA 1FXZA 2BGCA 3CZUA 3GHMA 4R9AA 3CJIC 2ZMLA 5FY0A 3KV5A 3OGVA 4FPJA 3VN4A 4NHYA 3A21A 4AFMA 4AXOA 1UX6A 2RR12 4E8DA 5JZGA 1ULPA 1IG0A 3KGLA 3AM2A 3GALA 3PHMA 4G3YC 3J26N 3SHRA 4YVWB 2NM1A 1SBDA 1LR5A 1HXS2 3K46A 5FZCA 5CU1A 3VDCA 2C9AA 2XLFA 4GULA 5FOBB 3AVSA 3WT3A 3K4DA 1YIFA 3ZXKA 1C8M3 2VULA 3DL3A 4FFGA 3N7MA 3WF4A 5C9AA 3VZNA 5C8CA 4QQHA 1ND3C 1C5HA 5LA1A 1OOPB 2RS51 3ZM8A 3PMSA 4XBQA 5FPVA 3VDDA 4NRPA 3VBFA 4XJUA 2XG3A 1QY4A 3WHUA 1EPZA 2C0ZA 3SEPA 1A8DA 3WNPA 1ZZ8A 3AP9A 4IL7A 4BIOA 1PMJX 3AB0A 3EB7A 2OZ6A 1FI2A 5GKAC 1BYHA 3K51A 3MIEA 4LITA 2GNMA 1Q8QA 1TZOA 2BP6A 1WCSA 2A6ZA 2JE9A 3I2DA 3UNPA 3R4SA 4CA9A 4ASMB 2C24A 4Y1XA 1QH7A 4ZS2A 5CFDC 2ARAA 5FZKA 2DURA 4LBOA 3MIFA 2A71A 1VAMA 3VZLA 2ZABA 4QQ2A 5LBFA 2ZTNA 3FX3A 3CIHA 2FDFA 1VBC3 2DCYA 1N47A 2XOMA 3HQXA 4MVTA 2NMNA 1GZWB 4UWDA 2WLQA 2WO1A 1C8NA 3WHTA 5CFCC 4XF1A 2ZKLA 2WZEA 4IEUA 3N4MA 1DHKB 1GMMA 4FP2A 5LY2A 4EE2A 1W8HA 3O12A 1VMJA 3LIGA 3MHZA 1R081 3UV9A 2XXZA 1PM4A 2DFBA 1JYTA 1WLDA 4GQ7A 1GUIA 1VPHA 3SKJE 5FK8A 1K5MC 4AEKA 3N9NA 4MGZE 4COWA 4I0AA 2KXLA 5F9TA 1W6PA 5JI7A 1JXNA 2WNOA 4RQPB 1VB2A 4QKNA 2EF6A 5I8TA 2LALA 5JSPA 1HV0A 4OYUA 4FQ4A 4FT8A 2PHUA 1RUE1 2OT7A 4FPCA 1UZVA 1FPN2 4RGKA 5F8PA 1ZZCA 4BQ1A 2HWC1 2YU1A 4XHBA 4N8MA 5FZGA 1IS4A 3RWKX 4XXAA 3VL9A 4CP0A 3BTXA 2D3SA 1QNWA 4XW3A 4XJAA 1UL9A 5F6KA 1GSLA 1C1LA 4HZFA 3ZN6B 2AC1A 1NCRA 4X8PA 4RGAA 4BOWA 5KHGA 5A7PA 2Y60A 3MIHA 3VD9A 2FQPA 3KS7A 1ZBA2 3ZKYA 5DG1A 1KD7A 3I2KA 2K9ZA 1UCXA 4CUBA 2RS52 4ATEA 1OKQA 2XHNA 1DGWA 1FV2A 2R6QA 4IERA 4QX3A 1N1VA 3ZFFB 1S2KA 2V5DA 3T2OA 2BQPA 1SCRA 2ZGNA 2QTWB 3N36A 4GIQA 2ZX3A 4Z1VA 1NAEA 1Y3TA 2V5YA 5FP8A 3FJSA 1SBFA 4JGZA 4OMDA 3TN92 1YQ5A 3WP3A 3DPRA 1Y7BA 3AMPA 4GKYA 1NLRA 2VU9A 4Q4X2 1UZZA 3AKSA 1AYN1 2WWSA 1ST8A 3FN9A 5CKQA 4YZ3A 3SC7X 4IV3B 3N9LA 2VPVA 2WQ8A 2ZGMA 4LKDA 4N43B 5ANNA 4CDXC 2IXLA 3H1MA 1W8UA 4Q4V1 3WCRA 4Z2AA 4PIXA 1OA3A 5HXMA 2HEWF 1ND2C 1LOFC 4IXLA 1S0CA 1CWPA 2A1XA 4Q26A 1BZWA 2ZA9A 5EYXA 5F39A 2D7FA 2XJPA 1JS9A 5ABJC 1IOAA 1J83A 1BK0A 2F6BA 4IV1B 4Q8KA 5EJZB 1REEA 1CJPA 4UI9L 4D8MA 1EV11 5M0TA 1G9AA 3WVJA 4XVHA 3RZJA 4QGMA 1ASJ3 1U0AA 1DU3D 1XRUA 2E7TA 1LU2A 2R063 3ACHA 1OI6A 2I07B 3G6JB 2TUNA 1R093 2LUWA 5CA6A 2JDAA 5AC93 2PN5A 2PHLA 1RUE2 4M3CB 3POWA 2XDVA 4Q0PA 3ZSKA 5FZ7A 1SQ4A 1LU1A 1W9SA 2I45A 1UZWA 4HT1T 4WVMB 3EO6A 4FO9A 4XDPA 4DMIA 2WNUB 4JCKA 4FTEA 1GV9A 1O8SA 1WMXA 2P1BA 5L7OC 1KFUL 1QQP2 4FAHA 2D6KA 3FHQA 4FOWA 3TEXA 1MQTC 1JZ3A 3ITQA 3MIDA 2TEPA 3WQ7A 5HCFA 3RQ0A 1JZ8A 4COVA 2DVDA 1AUYA 4QKDA 4W6XA 4N53C 2CSGA 3HIFA 4NPLA 2DVGA 2VMIA 5D1IA 1UY2A 1Y9GA 3KV4A 2Q30A 4I0WB 4JGYB 1UYYA 3HBKA 3N7LA 1YQ8A 4CVUA 3H8UA 3ELNA 4KBZA 3WP4A 4JKMA 1PIV3 2VZSA 2WBKA 2ZX4A 1BEV2 4FPHA 4Q1RA 5FPAA 1OH4A 1HW5A 4RD7A 1AYN2 2XBO3 3ZYRA 3AMHA 3AC0A 5LRRA 2HWB1 1OUXA 1MEC3 3NV4A 4AHXA 4BK5A 4IGQA 2YB7A 1WKYA 3WG1A 3RPQA 1V9U3 5FZAA 2B45X 3OGRA 2J1RA 1QOTA 3GJAA 4NPRA 2JX9A 3P3PA 1Q5OA 1VAKA 2RS12 5IJRA 3RI9A 5FZOB 3JBG3 4AFBA 3NKGA 3GZAA 4QM9A 2D3PA 1RUD2 1GOHA 2UU8A 5LK7B 2XGXA 1Z78A 2VMCA 2CGPA 1LESA 3JXSA 4CTEA 2YGMA 3BB6A 4NHXA 1YQCA 1F5JA 3POGA 3RS6A 1BJQA 5SV5A 2LM3A 1EV12 2C5DA 2WAAA 5CKNA 4NPMA 2XJUA 5KR7A 3NV3A 1OH3A 2HWE3 4OULA 2GC1A 3J8F2 4QGNA 1KFXL 5FQ0A 4XFHA 2D5FA 4LBKA 3H8OA 1ZZ9A 3J7HA 2RM22 5EIYB 1GNZA 1PGW2 4ZZ8A 2V72A 5LZ6A 2OPWA 3CO2A 1RHI1 2BUKA 4LHNA 3TRSB 4QB6A 3AZXA 2Y6HA 1H8VA 1IGOA 4XQWA 2A70A 3CZJA 4LLOA 3ZYGA 1HKDA 2W1SA 4XEZA 1S0EA 4KWKA 4BQ3A 1O59A 4IW3A 5LBBA 4COUA 1WBLA 5FDBA 3VKMA 5LRSA 2QQWA 1PNGA 4YVSA 1S0BA 2IFWA 4PDWA 5HV0A 4Z07A 4BE3A 4OZXA 4XXPA 2CTVA 2WFF1 4AI9A 5A3PA 4L9BA 5AVAA 1NY71 3NAPC 1PGL2 4AL9A 3A22A 5I0SA 2YXSA 3HQUA 3EXUA 1VBA3 3CEWA 3T09A 5JOYA 4E4SA 5C3RA 4LBLA 2BGOA 3I59A 2HH9A 3TAYA 2JE8A 4KQ7A 1W06A 2VL4A 3D5OA 5EFUA 1KDMA 2FMDA 2ZHKA 1E5IA 1UPIA 3QCWA 3KF5A 3T2QA 4CYDA 5CVRA 2P4EA 5A3WA 2R16A 2HWB2 3VHPA 1HLCA 2PA7A 4AEDA 2RHPA 3PIGA 5T3NA 5APAA 4DO0A 1DYOA 2XLGA 3WR0A 1W6MA 1SHWB 1UY1A 2OPKA 1PO11 4XCBA 3WLUA 3WG3A 2WAOA 5FPBA 1NZIA 2P6CA 2W08A 4BMBA 1DZTA 3WDTA 2X5IC 1UYZA 2B5HA 4CEWA 2ZCWA 5JPNB 3JZVA 1OFSA 1U12A 5FYHA 5F6LB 1YFYA 4NIDA 2Y0OA 1HXS3 4XQDA 4CCJA 1UY4A 1RUG2 4BPZA 1H1AA 2ZOEB 4XFGA 4AI8A 4FAGA 3MI8A 2E31A 2VOWA 1CVNA 2ARCA 2WNVC 1CAVA 4MADA 3NV1A 4N9HA 2Q4SA 2ZGOA 2JECA 3FUOA 4HKLA 2J1VA 1ZBE1 4QM8A 4YRDA 2ZKNA 3VKNA 4W65A 4XDOA 3JD71 1J3PA 3HN3A 3NJVA 4YM3A 1F4AA 5IUQA 2A3WA 1BCXA 2EXHA 1D4M1 2XONA 1T2XA 5JZGB 4QWNA 1QJU2 1RUJ3 3WNMA 3MGUA 2VOXA 2CV6A 3Q8FA 3NNGA 1FV3A 2XLAA 4XF4A 1XSQA 5EZWA 3ZOIA 1CONA 3MW2A 4ES8A 3PUIA 2CGNA 4CCCA 4ET7A 4UXAA 4CPBD 1C5IA 1E5SA 2VW1A 4E4HA 5C8CB 1L7RA 2I74A 1ENRA 5C7GA 4PLNA 2WR9A 4KU8A 3HVDA 3HMYA 2WFF2 3PTRB 5FJKA 2LS6A 4UBGA 5L9RA 4K9SA 1QH6A 3BVCA 1NY72 1OOPA 3A0KA 3GBFA 5FK7A 3BOWA 3MFCA 1H8TB 3NNMA 5F5AA 2B7YA 3AP5A 4LKFA 3RZMA 3NW4A 5F5IA 2J1EA 5LASA 2NN8A 3O1SA 4CUCA 4K20A 1PK6C 2BERA 2Y38A 3FL7A 4UFMA 4Q0SA 4OUEA 1R64A 3ETPA 3A4UA 1N3QA 2K46A 3JU9A 2JD4A 4OCTA 1JYXA 5A70A 4YGBA 2VVFA 3DXUA 3CLPA 1PO12 4YGCA 2E7AA 2WA3A 4RHV1 4HL0A 1FPN3 3WW3A 3ZFEA 2DV9A 3I2HA 3NMBA 5CADA 4BXFA 1G9BA 1GZWA 3M70A 4OHYA 4PLMA 3Q8EA 5LY1A 1TMF3 3EQEA 2WUHA 4OUMA 5FMDA 4EWEA 4YFZA 3WW4A 2WL1A 2RDNA 2ZXQA 3DF0A 2JDUA 4K8FA 1L3JA 4DXZA 3AKQA 1RUC1 2BPA2 4AZZA 3AYAA 2IXCA 3ZN4A 3PDQA 4IEYA 4P9YA 5A3OA 2DU1A 3VBUA 3NO8A 1ZBA3 3O5SA 3C8XA 3CU7A 4FQZA 1SG3A 3LDKA 4LUKA 3D6EA 3LDBA 3U4XA 1W0PA 2OA2A 4MX3A 5HCHA 2B9UA 3JD72 3QACA 3WINE 4LT5A 2RDSA 4RQPA 2JKXA 3KT7A 3C3VA 2RVAA 1HJFA 5KC6A 2QKDA 4XOGA 3DGTA 5C8WA 4Q0UA 3V0AB 1M06G 1JOJA 3OYWB 2Y6KA 3TN93 3E6DA 1HB2A 5IWFA 4MHRA 4Q4X3 4P9JA 5DDJ1 3S5AA 1AYM3 3B9IA 4GKXA 5LATA 4BLJA 3PIJA 4QX8A 1SLBA 3ZDVA 4DNYA 3K77A 2X29A 1PZ7A 1AXKA 3BTAA 3ZVXA 5T5OA 2O1QA 1V6KA 2J1UA 2TNFA 4F7ZA 5LA0A 4MO3M 4QB2A 1G8WA 3ZN6A 3W21A 5BY5A 1HQWA 3KCYA 3A7QA 1UAIA 3BCWA 4XF0A 1CN1A 4H7LA 2JD9A 4UW3A 3UL2A 1AXYA 2VZQA 1MZ6A 4WM8C 2NP0A 3VBOC 1EAH1 1RUF1 1BMV2 2WRAA 2IXIA 4XC9A 4V2VA 3ZFFA 4BQYA 1VJ2A 3ZIXA 3HT2A 1G9CA 4AG4A 1JZ6A 1JHJA 4IEQA 3PMEA 4JDOA 4DUWA 1DQ2A 3DPRB 3U37A 3M4FA 5FZIA 2G9GA 3ACIA 1WD3A 3C7GA 1UNBA 3N9PA 2FDIA 3VZOA 1ALYA 2JG9C 4Z8BA 2ARXA 1C57A 2R49A 4QX0A 3FLRA 4AGVA 5A6ZA 2VZRA 4IV3A 3HNBM 3VD4A 2GMPA 3POIA 4Y5TA 3RRDA 4YZ4A 4PT6A 4LJHA 4L2NA 2PLV1 2DBIA 4N43A 3W9AA 5I0DA 4OI4A 1D0HA 2EICA 1LEDA 4MXWA 2Y6LA 4XAAA 4YPJA 2OVUA 2FDJA 2J22A 5IK7A 3NQHA 1WGPA 2J7MA 1QQP3 4NIIA 1R1A1 4Q4W1 5JAXA 4AVAA 5IATA 1HN0A 3MIBA 3GBWA 4Y5Z0 4Q0QA 4AFAA 2O8QA 1QDOA 2ZZQA 3IAPA 2FCUA 4LOTA 5FZMA 2HWD2 1N1TA 1NZCA 1AR61 2YHJA 3KZ4C 1MS4A 5ACA1 3W5MA 3MW3A 4DXSA 5JR2A 1CAXB 2XHKA 3KCXA 4ARYA 4EQVA 2W9XA 1GLHA 1NE6A 4OZOA 1RVF2 5LA9A 1XQNA 4XZPA 1NQJA 2RDRA 1SZBA 1BEV3 3IMMA 3GGLA 3WG2A 5H9PA 4DRRA 5BNNC 4HSJA 4GA9A 3FE5A 5FMCA 2WNUA 1JOBA 4IDZA 3T30A 2WQZC 3HN1A 4XHXA 2IXHA 2VM9A 4ZKTB 5D8AC 1U5IA 1UO9A 3ZYPA 3OUHA 3OGSA 4FI9A 2PFWA 2RS13 3O1UA 4NR1A 4CCOA 5AFEA 3P5BA 1RUD3 5E88A 5FKCA 4MGYE 3L2YA 2ZHMA 3MEPA 1EAH2 3ZMNA 1WCKA 1RUF2 2WYFA 5A3NA 3POYA 3S0MA 4JGYA 2Y33A 3KVBA 4CDWC 2GSYA 3MW4A 4LULA 2W3JA 1FATA 2YFUA 1NE4A 3APBA 1NXMA 3N3HA 2RS31 3OGJA 3POEA 1HQNA 5FJHA 1EV13 3SCGA 3THTA 3OUIA 3VV1A 1GQGA 3ORJA 3QOPA 3J8F3 4QMAA 4W6YA 3RJ2X 2UY9A 1ULCA 2WO2A 3VGIA 1OXCA 2O8OA 3UJQA 2QQKA 2RM23 4D7YA 4E27A 2YZ4A 1VRH1 2BVBA 1COV1 4AQTA 4BB3A 3I7DA 4IEPA 3V64A 2ERFA 4HMZA 1MZEA 4YW7A 4CDUC 4NAOA 5DUWA 3K4ZA 3LB9A 5HPOA 2RJKA 5FZOA 3IDEA 5J3UA 1OSGA 1R1A2 5FPZA 1DGRN 4Q4W2 5A1LA 4QB1A 1P8JA 4QDQA 3I2GA 1SDDB 4OFGA 1ZA4A 1NUKA 5LA2A 1O4TA 1WW7A 5FQ0B 2E9QA 4QQOA 3SH5A 4LMFA 2QQMA 3TNQA 2HWF3 2ZGQA 2VUDA 4FPEA 4YW2A 1BVP1 1WZXA 3IAQA 2W0XA 5LBCA 5IVJA 1AX2A 1B35A 1VBE2 3B7MA 3OBAA 4QXHA 5FP7A 2EXJA 4JHZA 3ZR6A 4LA2A 2A5ZA 2P3YA 4B1LA 5LCWL 3NKTA 1UKRA 2DUQA 4R8HA 1V6OA 2VGDA 4OHXA 3LFIA 3B94A 3LKJA 3UGGA 1BBT1 1OQEA 1POV1 5FY4A 3WNLA 1X9PA 2JG8A 2QQPA 5K0UB 2HWB3 5JIAA 3T1MA 3PTYA 4YVSB 4PDWB 3V0BB 4PIZA 4Q5OA 4H7MA 5FZFA 1TME1 2R30A 2K0GA 2BOJA 3USUB 4A45A 1RB8G 5A80A 3BALA 3LEIA 4UFIA 1YJLA 2X10A 1F31A 2ZAHA 3VHOA 3HJRA 4UBHA 3VHRA 4FPFA 4G9SB 3FZ3A 3I59B 5C9AC 1UQXA 3T0DA 1RUG3 2RS32 2FMYA 3VKFC 3EBRA 4CXXA 5HI0A 3VDDC 2VXJA 3VBFC 2PHWA 4QQLA 4QX7A 4A44A 4YZ5A 2P3KA 1UMZA 1W03A 4R4ZA 3FMGA 4Y20B 2WT0A 3M3QA 1OPOA 2PHXA 4UW6A 1RC6A 3BU7A 3LDRA 4URTA 4H14A 5FYBA 4NROA 3VBRA 3GJBA 2UYAA 1MS0A 2X09A 1GP5A 1AL0G 2MEV1 5FIXA 1WMFA 4Z82A 4CUGA 1UU4A 4J1WA 4MH0E 1TE1B 1QJU3 3RZHA 2FZ1A 2KR2A 4DUXA 3K3OA 4FPOB 5FYTA 5GALA 3NVCA 1UOGA 3IIAA 5B2GB 3ABZA 4ARXA 1UW8A 2DBNA 3R4UA 1FOD1 2YBSA 2HEVF 4K21A 1DQ0A 4LHSA 4CDQB 5FZ0A 1U5ZA 1HB1A 1ENQA 1R1ZA 3B00A 3VBSA 5F5QA 2WLPA 3TWIA 4HVQA 5JPMB 2VAUA 1OLQA 5DAWA 3PJQA 5K7PA 1DZQA 3MF9A 4IQPA 4BQ5A 1X8MA 3HD8B 1UIJA 1W3XA 1XYNA 4GWIA 1WD4A 1DDLA 1KS5A 2NYYA 2D40A 3AXEA 2AREA 5FYYA 4PF1A 3VHNA 3RZKA 2P37A 2WWJA 4LPLA 5DAPA 3VBHB 4LBNA 1RL3A 3ZPYA 2YPJA 4UW4A 3RMXA 3AYCA 3WF2A 4AEMA 4M0HA 3RZZA 2BNOA 1JYWA 3FWEA 2P3IA 4P9GA 3AZWA 3MUZ1 1Z7S1 2ZACA 1LAJA 1RUI3 4BJ0A 4B29A 4BIFA 2JIJA 3WG4A 5JXJA 4LO5B 5DABA 5GLUA 3TNPB 3MZHA 3C7HA 1NCRC 3GM8A 4Y1UA 2P34A 4IE7A 5DZGA 1KXGA 3POSA 2GAUA 5LWBA 1H8TA 3T2PA 2V09A 4KGQA 4XETA 1ZNPA 3ZXAC 1CAWA 1E5RA 1VAVA 3I2JA 3IM0A 1HN1A 1H1IA 1H6XA 1SLTA 3N7JA 4FOYA 4HN1A 4XABA 1FMD1 3LEKA 1RXFA 2AUYA 2GALA 3QD6A 1XPWA 1MS1A 2QQIA 3JD73 3H0OA 4JGZC 5A7OA 3GZTB 1MS5A 4KH9A 1SEFA 1JW6A 1AZDA 2MEV2 3DUIA 3GZEA 1IKQA 4GD4A 4NAMA 4WZFA 3PVOA 3ZFEB 1S4CA 4ZS3A 2Z69A 3ZXLA 5IHRA 5HCBA 3JCIA 1UOJA 1NOVA 1BHGA 3LWCA 3RYKA 1AR91 2N7GA 4M4PA 1HRI3 3A23A 1VBD1 3NRUA 4CEYB 2Z2SB 4OVEA 1I9RA 1ULFA 3DYMA 3IDBB 4Q4Y1 2QZ3A 1W28A 1PHMA 2ZGLA 4LBQD 1N1SA 4PBOA 4JC1A 3VBUB 1LHUA 1UPSA 4UAPA 1D7PM 2YC0A 3U78A 4JAAA 2H0VA 1VR3A 4J25A 4QXCA 4E2QA 1W8OA 4NHKA 5T50A 1HV1A 1OBNA 2OS2A 5C5UA 2RE9A 3OUJA 3LGRA 5C3QA 2ES3A 3EYPA 5FCCA 3UKVA 1T6BX 3FC0A 1IQAA 4RS5A 3WSOA 4I3PA 4EN9B 1UZ0A 1QEXA 1LGNA 5IK4A 4U2AA 1REFA 2VZPA 2VECA 5CAZA 3V0AA 3AKRA 1ULGA 1YI7A 3MLKA 2ADEA 3OYWA 3W20A 3MDPA 3PLQA 4YG0A 5EPAA 5F32A 4LXLA 1AL23 1F15A 5JOZA 4GB31 1IHMA 5CNAA 4YSFA 4A2UA 5IVCA 1W9WA 2NQYA 2W1QA 2BVVA 2QBXA 1Z7S2 1XSRA 5T54A 3V65A 4XJWA 3VLBB 4BH9A 3B02A 1W99A 4QHZA 1BK1A 4P08A 4META 5SV8A 4PLOA 1NCQB 4E2SA 1XNCA 5A6QA 5LEKA 3RI8A 1JHNA 1MVQA 4Y1ZA 4TXWA 5GZFA 5HCAA 5T5PA 5FLJA 1I1EA 5DMYA 1CAUA 3POBA 3WF1A 4OI0A 4C1WA 1J84A 3ZSJA 4O9GA 1LHVA 2VZUA 4IE0A 1SBEA 1QJX1 5EQUA 3WZ1A 4BXSV 5A3TA 5F3GA 1FMD2 2NMOA 2HWD3
chains in the Genus database with same CATH topology
5FZLA 5FYZA 3K2OA 5FYYA 5A1FA 4LIVA 5FY7A 2WWJA 5FZDA 4CCLA 2P5BA 4LITA 5A3WA 2XDVA 5FZ7A 3PU3A 5IWFA 5A7SA 4DO0A 4XDPA 5A7NA 5FZKA 5FYUA 4LIUA 5IW0A 5FPUA 4GAZA 4QX8A 5FUNA 5FPBA 5FZOA 5ANQA 5A7QA 4GJZA 5F5CA 5FP4A 2OX0A 2Q8EA 4EYUA 3PU8A 3AL6A 5FYCA 3KV9A 5A1LA 5FYHA 5F3CA 3AVRA 5FY8A 5LY2A 3KV6A 4CCJA 4EZ4A 3LD8A 3PURA 3K3NA 2XXZA 5FXXA 2W2IA 5LWBA 4TN7A 4QU1A 5LW9A 2GP5A 3KV4A 4V2VA 5FXVA 4CCMA 5FPLA 5FXZA 4NUBA 5FP9A 2WWUA 5IVJA 5FP7A 3N9NA 1VRBA 4QXHA 5FYSA 5ISLA 5FZIA 2YPDA 3N9PA 4UF0B 4URAA 4XDOA 5IVFA 2VD7A 4HONA 5FPAA 5FZ4A 2OQ6A 5A7OA 5FY4A 2OT7A 4Y33A 4EZHA 4QWNA 5A7WA 4GD4A 4IGQA 2XMLA 5FWJA 5FZAA 4BISA 4D6SA 5FZ8A 3N9OA 2Q8CA 2YU1A 5FZGA 2GP3A 5FZOB 3KVAA 4BU2A 5FZFA 5IVBA 4D6QA 5FZ3A 2XUEA 3AL5A 3DXTA 5FYVA 5FZBA 4C8DA 4E4HA 5A80A 5A7PA 5FUPA 3PTRB 5F3IA 5FY9A 5FJKA 5IVEA 5F2SA 3U78A 5FXWA 3ZPOA 4QXCA 5IVVA 4AAPA 2OS2A 5F2WA 5FP3A 5F5AA 2PXJA 5FYIA 5FZMA 5KR7A 5FY1A 5F5IA 4CCKA 5F3EA 3NJYA 2Q8DA 4QX7A 5FP8A 3U4SA 3OPTA 3ZLIA 4UF0A 3PUSA 2YU2A 5FZ6A 5FYBA 5FYMA 5F32A 3PUAA 5IVYA 3N9LA 5K4LA 5CEHA 4LXLA 5F37A 5FZ9A 4GJYA 5FZEA 5FY0A 3KV5A 3DXUA 5A7WB 5IVCA 2YBKA 4HOOA 4ASKA 4CUGA 3RVHA 4IGPA 4CCNA 4IGOA 4DIQA 4BXFA 3K3OA 5FYTA 4V2WA 5LY1A 3PUQA 5FZCA 4CSWA 3N9MA 4QXBA 2YBSA 3AVSA 4CCOA 5F39A 5FZ0A 5FBJA 5FY5A 4AI9A 5FZHA 5A3PA 5FV3A 5A3NA 2OQ7A 3KVBA 3PDQA 5E6HA 5FZ1A 4Y3OA 4Y4RA 3OPWA 2YBPA 5FWEA 5FPVA 3UYJA 4D6RA 5A3TA 5F3GA 5FJHA 3LDBA 3N9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZL A;  5FYZ A;  3K2O A;  5FYY A;  5A1F A;  4LIV A;  5FY7 A;  2WWJ A;  5FZD A;  4CCL A;  2P5B A;  4LIT A;  5A3W A;  2XDV A;  5FZ7 A;  3PU3 A;  5IWF A;  5A7S A;  4DO0 A;  4XDP A;  5A7N A;  5FZK A;  5FYU A;  4LIU A;  5IW0 A;  5FPU A;  4GAZ A;  4QX8 A;  5FUN A;  5FPB A;  5FZO A;  5ANQ A;  5A7Q A;  4GJZ A;  5F5C A;  5FP4 A;  2OX0 A;  2Q8E A;  4EYU A;  3PU8 A;  3AL6 A;  5FYC A;  3KV9 A;  5A1L A;  5FYH A;  5F3C A;  3AVR A;  5FY8 A;  5LY2 A;  3KV6 A;  4CCJ A;  4EZ4 A;  3LD8 A;  3PUR A;  3K3N A;  2XXZ A;  5FXX A;  2W2I A;  5LWB A;  4TN7 A;  4QU1 A;  5LW9 A;  2GP5 A;  3KV4 A;  4V2V A;  5FXV A;  4CCM A;  5FPL A;  5FXZ A;  4NUB A;  5FP9 A;  2WWU A;  5IVJ A;  5FP7 A;  3N9N A;  1VRB A;  4QXH A;  5FYS A;  5ISL A;  5FZI A;  2YPD A;  3N9P A;  4UF0 B;  4URA A;  4XDO A;  5IVF A;  2VD7 A;  4HON A;  5FPA A;  5FZ4 A;  2OQ6 A;  5A7O A;  5FY4 A;  2OT7 A;  4Y33 A;  4EZH A;  4QWN A;  5A7W A;  4GD4 A;  4IGQ A;  2XML A;  5FWJ A;  5FZA A;  4BIS A;  4D6S A;  5FZ8 A;  3N9O A;  2Q8C A;  2YU1 A;  5FZG A;  2GP3 A;  5FZO B;  3KVA A;  4BU2 A;  5FZF A;  5IVB A;  4D6Q A;  5FZ3 A;  2XUE A;  3AL5 A;  3DXT A;  5FYV A;  5FZB A;  4C8D A;  4E4H A;  5A80 A;  5A7P A;  5FUP A;  3PTR B;  5F3I A;  5FY9 A;  5FJK A;  5IVE A;  5F2S A;  3U78 A;  5FXW A;  3ZPO A;  4QXC A;  5IVV A;  4AAP A;  2OS2 A;  5F2W A;  5FP3 A;  5F5A A;  2PXJ A;  5FYI A;  5FZM A;  5KR7 A;  5FY1 A;  5F5I A;  4CCK A;  5F3E A;  3NJY A;  2Q8D A;  4QX7 A;  5FP8 A;  3U4S A;  3OPT A;  3ZLI A;  4UF0 A;  3PUS A;  2YU2 A;  5FZ6 A;  5FYB A;  5FYM A;  5F32 A;  3PUA A;  5IVY A;  3N9L A;  5K4L A;  5CEH A;  4LXL A;  5F37 A;  5FZ9 A;  4GJY A;  5FZE A;  5FY0 A;  3KV5 A;  3DXU A;  5A7W B;  5IVC A;  2YBK A;  4HOO A;  4ASK A;  4CUG A;  3RVH A;  4IGP A;  4CCN A;  4IGO A;  4DIQ A;  4BXF A;  3K3O A;  5FYT A;  4V2W A;  5LY1 A;  3PUQ A;  5FZC A;  4CSW A;  3N9M A;  4QXB A;  2YBS A;  3AVS A;  4CCO A;  5F39 A;  5FZ0 A;  5FBJ A;  5FY5 A;  4AI9 A;  5FZH A;  5A3P A;  5FV3 A;  5A3N A;  2OQ7 A;  3KVB A;  3PDQ A;  5E6H A;  5FZ1 A;  4Y3O A;  4Y4R A;  3OPW A;  2YBP A;  5FWE A;  5FPV A;  3UYJ A;  4D6R A;  5A3T A;  5F3G A;  5FJH A;  3LDB A;  3N9Q A; 
#chains in the Genus database with same CATH topology
 1LJ7 A;  1GZT A;  2Y6G A;  2XKP A;  5FTT C;  4DB5 A;  1AJK A;  1I5P A;  5H9Q A;  1KEX A;  2VNG A;  3E6C C;  2WAB A;  3EHK A;  2WZR 3;  1TQ5 A;  1RVF 3;  4MXW B;  3LZZ A;  2CWM A;  4E9K A;  2PAK A;  3P3N A;  3H7Y A;  4XJ8 A;  5EHD A;  2GZW A;  3EJK A;  3LSD A;  5FPU A;  5E16 A;  2EAK A;  5FUN A;  3FLT A;  1R08 2;  4HET A;  2RMU 1;  4GWJ A;  4CZS A;  4Q4Y 2;  1NKG A;  5KHI A;  4A6S A;  1WLT A;  3KV9 A;  2CDO A;  4J6G A;  3HBZ A;  1ULD A;  2D6N A;  2EXK A;  3ATG A;  3SIS A;  4P14 A;  5CFC A;  3ZYF A;  4ZXE A;  1X33 A;  1ULO A;  3VKL A;  1EAH 3;  2JDY A;  4NUB A;  4AVC A;  1L7Q A;  1QDC A;  1CAX A;  1OLM E;  3AP4 A;  1F8V A;  1DGR A;  3K75 B;  1LOD A;  5DAX A;  1O5U A;  2EIG A;  2IVJ A;  1AR7 1;  3D82 A;  3HR9 A;  3OGG A;  5FZ4 A;  4QPI B;  4SBV A;  1W0N A;  4FFI A;  2HWC 2;  4YYO A;  2D93 A;  1CPM A;  3OF1 A;  3WV6 A;  2JE7 A;  1YXW A;  1N3P A;  5FLI A;  4XBN A;  1NT0 A;  5J1X A;  4IES A;  1AF9 A;  4AQS A;  5IFP A;  4YWA A;  1W9F A;  2AAC A;  1SLC A;  2J1T A;  3VDB A;  3QH6 A;  3SQO A;  2QE3 A;  4O7X A;  4D6Q A;  3K4A A;  4H3W A;  4A7Y A;  2GH8 A;  2UYB A;  4JTO A;  4K6B A;  4RR3 C;  4YVS C;  1XND A;  2ZGK A;  3ZR5 A;  2IWG B;  5FUP A;  3HEI A;  3NWK A;  1ODM A;  5FUI A;  3WDX A;  2IZW A;  4C91 A;  3CL1 A;  2C1F A;  2YG0 A;  5IVE A;  4MGQ A;  1UOF A;  3NNL A;  5EXO A;  5A32 B;  3T2T A;  4M3C E;  2QJV A;  2VCA A;  1QJX 2;  4AK3 A;  3IZO A;  3KT4 A;  4JDN A;  1CQ9 A;  4UFK A;  4MHU A;  3BI3 A;  3B9C A;  3QBQ A;  1LKN A;  2PAE A;  1PVC 1;  4MLO A;  1QOO A;  4ZXK A;  1US3 A;  3U1X A;  4BZ4 A;  2HJI A;  2VMF A;  2VW2 A;  2DVA A;  2KM2 A;  1VBE 3;  3OPT A;  1LHW A;  1DQ6 A;  1LRH A;  2R04 1;  3R4D B;  1ZRE A;  3X29 B;  4IEZ A;  3MBW A;  4Q4V 2;  2VJX A;  4MUV A;  3RYP A;  3ZN5 A;  4CP1 A;  2W46 A;  2R1B A;  1U5Y A;  2DCK A;  3BOD A;  5DUU A;  5LB6 A;  1DFQ A;  4XUQ A;  2YGL A;  2ZX2 A;  4AED C;  1NLQ A;  1YHF A;  2W5F A;  4YZ2 A;  1WCU A;  3LOB A;  1O91 A;  4P00 B;  5C4W A;  1X36 A;  4IGO A;  1KRI A;  1HJG A;  1V70 A;  4CUA A;  2WT2 A;  3R6S A;  2ZX0 A;  2YDE A;  4DFS A;  1B09 A;  1RJ8 A;  4X8N A;  3THD A;  3UKN A;  4AGR A;  4CEW C;  3O0X A;  4XIK A;  2ZMK A;  1XC6 A;  4YGE A;  3SCF A;  1B35 B;  4MGI E;  3WY6 A;  4QPG B;  1U5X A;  2VUA A;  1VMF A;  2A73 B;  3E5Q A;  2RJ2 A;  2ZGS A;  2QDN A;  5FZ1 A;  3UGH A;  2AEY A;  4L0P A;  5FPX A;  3IWZ A;  1DG6 A;  4AVT A;  3KWV A;  4I09 A;  2WQ4 A;  4XFA A;  1YQ2 A;  2ATF A;  4JZR A;  1AR7 2;  1LOA A;  1NA1 B;  2JG8 B;  5FZL A;  4JX0 A;  1L7L A;  4Y1V A;  4ZU4 A;  1GQH A;  2D97 A;  4C0H A;  1W9Y A;  4AVS A;  2WII B;  4KBB A;  1F2N A;  1HRV 1;  1YNA A;  3I54 A;  4NRM A;  1W6N B;  5K0U A;  1XE0 A;  1GU3 A;  4KGG A;  3V0B A;  1BLZ A;  2Q1Z B;  3KQR A;  1W39 A;  3SXW A;  1RIN A;  2C4X A;  5LEJ A;  2D44 A;  2DTW A;  2DWR A;  4GJZ A;  5JVV A;  4WVV A;  2Y64 A;  4I01 A;  3USU A;  4EYU A;  1MS8 A;  4PIY A;  1RIR A;  4YVW C;  1J58 A;  2VZ1 A;  3LPG A;  1QXP A;  1XYO A;  2ZPX A;  5FO8 B;  1FT9 A;  3KGZ A;  1PO2 1;  3WD5 A;  1VB4 A;  3KMH A;  2BBV A;  1OOP C;  1RMU 1;  4UFH A;  4XFI A;  2XWJ B;  2ZEZ A;  1ENS A;  1OQD A;  3DKQ A;  1PVC 2;  2WWU A;  4B1M A;  1O8P A;  4OI1 A;  1ONA A;  1UXZ A;  3LA2 A;  3ROU A;  3WUC A;  4TWT A;  2ZGU A;  1JZ5 A;  4XJZ A;  1RIT A;  4LBJ A;  4URA A;  1JZ4 A;  2HLE A;  3VBR B;  4Y20 A;  5KHJ A;  2H0B A;  4A3Z A;  5JWP A;  4NRQ A;  3KQ4 B;  5JUV A;  2CY6 A;  3J7M A;  2ORX A;  3ASI A;  3V56 A;  1Q8O A;  1UD1 A;  1UN1 A;  2R32 A;  2RR1 3;  5FWJ A;  5J96 B;  3OSD A;  5FZ8 A;  2B46 X;  4AEJ A;  4RFR B;  2VZV A;  1W6O B;  4FTS A;  1LGC A;  5J37 A;  2XUE A;  5KBF A;  1W8T A;  3VBS B;  4K8R B;  3IMN A;  1RUO A;  4BME A;  3U10 A;  4CDQ A;  5FBZ A;  1LHO A;  5FY9 A;  2BZD A;  3HQR A;  1V6I A;  5FXW A;  3ZXJ A;  1YJK A;  5BNO B;  4A7Z A;  3RFR A;  3MLJ A;  4HFS A;  2UUR A;  2DYC A;  1C8M 1;  4JVA A;  5F2W A;  3ZDS A;  1MS9 A;  2DCZ A;  1YRZ A;  2ET1 A;  1RHI 2;  1VBB 1;  3M3O A;  4DY3 A;  5JXH A;  4GH4 B;  3VBU C;  2G4I A;  2Y0I A;  3TYJ A;  4LO4 B;  4Q27 A;  2JDM A;  4LHK A;  4XIO A;  1H0B A;  5EP9 A;  3VBH A;  4AI0 A;  4RQP C;  5BNP B;  2YMZ A;  4S2F A;  1RYY A;  3PUS A;  5FYM A;  3RDI A;  3PUA A;  3P6B A;  1KJR A;  2H6B A;  5A7W B;  2O0O A;  1YLL A;  4NJ4 A;  4LOR A;  1VP6 A;  4BLI A;  4DS0 A;  2E7Q A;  4IGP A;  2XVK A;  4KWL A;  3R05 A;  5FKB A;  5I8Y A;  3O1T A;  4Q29 A;  4Y22 B;  1JU3 A;  5JOX A;  4CSW A;  3N9M A;  1VBC 1;  1OF3 A;  1XXN A;  2FD8 A;  2E6V A;  1GZC A;  3IDA A;  2YC2 A;  4K7J A;  4CCE A;  5CBL A;  1JYV A;  3OY8 B;  4Q8L A;  1PO2 2;  4JDM A;  1NYW A;  1POV 0;  1CAW B;  2XJT A;  1JH5 A;  1SLI A;  3D0S A;  3O14 A;  3ZYJ B;  4DIN B;  4E4Z A;  5EV7 A;  4GMP 0;  4MZU A;  2ZEW A;  2CWS A;  1Q8S A;  4Y3O A;  1RMU 2;  1SMV A;  3FBM A;  2YBP A;  2C6S A;  1OD5 A;  1W2U A;  4D6R A;  3ZFG A;  1Z0H A;  3M3E A;  4O65 A;  3WNO A;  3ZFF C;  4ES9 A;  2ZMN A;  2VBD A;  4DQA A;  4QHO A;  3I2I A;  3D4K A;  3IN9 A;  3ACL A;  3T0B A;  4LIV A;  4R4X A;  4Q1P A;  4OHZ A;  5KWR A;  2VNR A;  4IE6 A;  4MV2 A;  1MZF A;  5JI9 A;  2FBE A;  2Z5W A;  1A34 A;  5J98 B;  3DYP A;  4TTG A;  2NPI A;  4QX1 A;  5A7S A;  1C4R A;  4IV3 C;  4YG6 A;  3KHC A;  1AR8 1;  1C1F A;  3KD4 A;  5IW0 A;  4N43 C;  2DF7 A;  4LQR A;  3H3L A;  1UKG A;  5A7Q A;  4CEY A;  1CX4 A;  5FP4 A;  2DFC A;  2XVL A;  1NXD 1;  5G05 L;  3LOI A;  3D3A A;  2I2S A;  4LTA A;  1LOG A;  4Y5S A;  2OUH A;  2YYO A;  3KV6 A;  4AFD A;  5FOJ B;  5KC5 A;  4Z92 B;  1ZBE 2;  1H2M A;  2RS5 3;  4IV1 C;  3MV0 1;  4F3J A;  4TN7 A;  1UF2 C;  4NHM A;  4RS5 B;  2NLR A;  5GZD A;  4MYE A;  3PVB B;  1VBB 2;  1X82 A;  2CU5 A;  1S0J A;  2VME A;  5L19 A;  1H30 A;  1D4M 2;  3SIT A;  1W0O A;  5CYY A;  1G6N A;  1W04 A;  2DUO A;  4BDV B;  4KNC A;  3TEY A;  4KMQ A;  3J9S A;  4D94 A;  1W2T A;  4ZPI A;  5EWS A;  4CU8 A;  1DLL A;  3ECQ A;  4OHV A;  4YAR A;  2VQA A;  2VNV A;  3CJI B;  4WM7 A;  5EJ1 B;  4A4A A;  4WV8 A;  5I91 A;  2NZ9 A;  3BIE A;  3WNN A;  1QJY 1;  4BIS A;  1CR7 A;  1E5H A;  4JHT A;  1WLC A;  5E8A A;  2FDK A;  1XNT A;  2WNU C;  2VBB A;  3C7F A;  1DQ5 A;  2FCV A;  4JQR A;  1NCQ A;  5IVB A;  2IVI B;  3OCP A;  4CU9 A;  2VVE A;  1CAU B;  5FZB A;  1F9K A;  1H9P A;  1R08 3;  1W8F A;  3WF3 A;  4LNV A;  5GZG A;  4E8C A;  4LE4 A;  1ND3 B;  2X05 A;  4TLF A;  2XJR A;  4EN7 B;  3O1V A;  3FHA A;  3ST7 A;  4QX5 A;  2UY8 A;  5FP3 A;  5FYI A;  2JWP A;  2V4A A;  1WW5 A;  1WME A;  4JGY C;  2E32 A;  1QHD A;  4XPV A;  5JOW A;  3AKT A;  4HKW A;  3DEM A;  2WC2 A;  3NJY A;  5F3E A;  1ASJ 1;  1DBN A;  5B4X A;  5T5J A;  5J09 A;  1RUE 3;  4RHV 2;  1SLL A;  4U36 A;  3WNK A;  1R09 1;  2PHF A;  1LB2 A;  1IS3 A;  3RGB A;  1YFX A;  1PM7 A;  2D6P A;  5AC9 1;  4IE5 A;  4GZ9 A;  1Q8V A;  1PK6 A;  2GMM A;  5I8S A;  4PHZ A;  5CFD B;  2HWC 3;  1AR8 2;  1V6L A;  4HSL A;  4LEJ A;  4KG0 A;  2R1D A;  4CCN A;  4MG2 A;  1RUC 2;  3HNY M;  1O5L A;  3ZO0 B;  1AVB A;  2KA3 A;  5CFC B;  2GME A;  1V6M A;  2EVX A;  1UYP A;  3AZY A;  1AX0 A;  1O4Z A;  2ZGT A;  4M4R A;  1Y9M A;  2YV8 A;  4B3N A;  2B42 B;  4UFJ A;  3ZYI B;  1MAC A;  4G4F A;  2LRP A;  5FZH A;  1POQ A;  2VQU A;  3BN6 A;  3CNA A;  4CP9 B;  1BXH A;  1EPW A;  4N90 A;  5C71 A;  1K5M B;  2VMH A;  3MO4 A;  1W8N A;  1A3K A;  3OJB A;  2QQU A;  3N9Q A;  2AEN A;  4YZ1 A;  1AYN 3;  1OA4 A;  4QPI A;  5DDJ 2;  5J7M A;  4DPN A;  1PIV 1;  4CCL A;  2P5B A;  1RUH 1;  3E5U A;  1OF4 A;  2E53 A;  2XVG A;  4W50 A;  3S7I A;  4DOU A;  1I6X A;  1UY3 A;  3MLL A;  2ET7 A;  3PU3 A;  1QJY 2;  4Q4V 3;  3CF6 E;  1MEC 1;  1LTE A;  4HBN A;  2EAA A;  4L92 A;  3UGF A;  3OD0 A;  1W90 A;  1WBF A;  3HWJ A;  1V9U 1;  3NL1 A;  4UYB A;  4BQ2 A;  3IPV B;  5I0R A;  5IAX A;  1UOB A;  2CHH A;  3FHI B;  3M7A A;  3JBG 1;  5BNP A;  4F8A A;  2W47 A;  4S2H A;  4NIH A;  2OXB A;  2WZ8 A;  1H4H A;  1MVE A;  4EJR A;  1CZV A;  2JDN A;  4UW5 A;  2YY1 A;  3Q8B A;  4I02 A;  5FXX A;  1JUI A;  3RJR A;  3S30 A;  3WQ1 A;  5A32 A;  1JBC A;  5E1R A;  3H3U A;  2PHR A;  4FXG B;  4LOS A;  1MPX A;  5FPL A;  5FXZ A;  3RYR A;  5FYS A;  2Y26 A;  3WQB A;  3DEC A;  1SFN A;  2HWE 1;  1CZT A;  2PLV 2;  3CMG A;  1JMU B;  3LSE A;  5GLT A;  1HIX A;  4ATF A;  2BW8 A;  3AMQ A;  4C1X A;  4HK8 A;  1AR7 3;  3ZXG A;  3D0J A;  4K40 A;  3FFZ A;  2Z4F A;  4Y33 A;  3ZMO A;  2W52 A;  5C4W B;  2ZS6 B;  1XE8 A;  3R0R A;  4CDX B;  5CG9 A;  4EN8 B;  1JZ7 A;  1LEM A;  1QIQ A;  4QQP A;  1ND2 B;  3N9O A;  2Q8C A;  2XH6 A;  4ISQ A;  3GDB A;  4AQ2 A;  1Q8P A;  1K45 A;  2V4V A;  2ZJC A;  3KVA A;  3NST A;  4P9W A;  3KT1 A;  4QDS A;  3T1L A;  4D7T A;  4XCA A;  4ZZ5 A;  3MIG A;  2OUJ A;  5TSW A;  5ABJ B;  4LLF A;  4DUV A;  1H2K A;  5DN2 A;  1AR6 2;  1CIY A;  5ACA 2;  4KWJ A;  3ZPO A;  1UU6 A;  1DF0 A;  1Q43 A;  4QPG A;  5JMO A;  2ETE A;  5CZK A;  2PXJ A;  5I93 A;  1GWM A;  3UES A;  1X9T A;  3TB0 A;  3USS A;  2ZHL A;  1NA1 A;  1VBA 1;  3I3M A;  1BVV A;  3E97 A;  4GMP 1;  4XAC A;  1PVC 3;  3SCH A;  3MIC A;  2Y6J A;  1ZYB A;  3B01 A;  3VZK A;  1RUH 2;  2BFU L;  3ZLI A;  4XJ9 A;  3W58 A;  2PTM A;  3O7O A;  3W5N A;  3KM5 A;  5CEH A;  1YFU A;  3AMN A;  1W6N A;  2DDU A;  3I3D A;  4IE4 A;  5DUV A;  3I2O A;  2IC1 A;  5JZG C;  2H6C A;  4HLT A;  2D6L X;  2YBK A;  3VD7 A;  5FO9 B;  5L7O B;  5JLV A;  4JKL A;  2BNM A;  4DIQ A;  3UKT A;  1MQT B;  5BNQ A;  4QAW A;  2ILM A;  4DZG A;  5D8A A;  5C3S A;  2EID A;  1S0D A;  5C8C C;  1STM A;  3ILN A;  4N53 B;  4K3U A;  4AOC A;  3OEA A;  3ON7 A;  3PVN A;  3U14 A;  5E6H A;  1PMH X;  1OQ1 A;  1QJF A;  1W8W A;  5GLV A;  1QJZ A;  1H8T C;  4A42 A;  4CDW A;  1S0G A;  1C3H A;  3LQC A;  5H9S A;  5L9V A;  4W4Z A;  3H7J A;  2A6W A;  1VRH 2;  3BOP A;  2LRO A;  1COV 2;  4WBB A;  3GBG A;  3LPF A;  1RHI 3;  3WQ0 A;  5IK5 A;  2DTY A;  5CG8 A;  1WMD A;  1V6N A;  4GWN A;  4N7U A;  2VNO A;  5KXD A;  2W91 A;  4XF9 A;  2BGP A;  2CL2 A;  3WF0 A;  1JYN A;  1H9W A;  2JDK A;  2XJS A;  3J7L A;  2HEY F;  1JUH A;  2PQQ A;  4M0N A;  1LNS A;  5JCT A;  2F17 A;  4TLG A;  1RUJ 1;  4IEO A;  2W1U A;  1PGS A;  1W6O A;  4B4R A;  4NWV A;  4B7K A;  3LE0 A;  1O3S A;  1A78 A;  1H2N A;  2VCB A;  3AL6 A;  2W87 A;  3ENR A;  3ETQ A;  3N35 A;  4NO4 A;  1CJD A;  3HNM A;  4FOQ A;  4P9I A;  2WFF 3;  3B93 A;  1D2S A;  4PI2 A;  1QKQ A;  4YW5 A;  1YWK A;  5FO7 B;  3U11 A;  5BNO A;  2VTX J;  4LKS A;  3LD8 A;  3VB9 A;  4IEX A;  1TNR A;  5E89 A;  5KXC A;  5IK8 A;  2FDG A;  4YM2 A;  5LW9 A;  2HKX A;  1KJL A;  2Q8O A;  4EN0 A;  5KHK A;  3H9A A;  4LUM A;  1TG7 A;  4ZU5 A;  1BBT 2;  3AFK A;  4GH4 A;  4K1Y A;  4AR2 A;  1SDW A;  2ZHN A;  2BNN A;  1I5Z A;  4C0B A;  1RMU 3;  2VQT A;  3RZG A;  1EYB A;  2MHF A;  5FFO C;  2D6O X;  3NJX A;  1S2E A;  4RN5 A;  1LEC A;  5A1A A;  1O7F A;  5A6Y A;  3TEW A;  4AQ6 A;  4EZH A;  1URX A;  3ILF A;  1TME 2;  2UWA A;  4JV4 A;  1PO1 3;  5A7W A;  3UJO A;  1W9T A;  1MR5 A;  2XQX A;  3RZL A;  5H9R A;  1JI6 A;  2FHR A;  2XL9 A;  1GAN A;  2BDR A;  5B4N A;  1GP4 A;  1CZS A;  1FPN 1;  1IPJ A;  1ZZB A;  4Y22 A;  3OTF A;  3T08 A;  5FYV A;  1RED A;  3OY8 A;  4R9D A;  2FZ2 A;  1TMF 1;  1OHF A;  1J3Q A;  2JDH A;  4LR4 A;  5F3I A;  3UT0 A;  1DZR A;  1AJO A;  1IPS A;  2G9Z A;  2L9L A;  4NWW A;  5F2S A;  1W05 A;  4PF5 A;  3ZFG B;  3NAP B;  1D2Q A;  1QMJ A;  1JTZ X;  4XUO A;  2XQR A;  3WUD A;  3ZSM A;  1XJA A;  4XYX A;  4PJY A;  1ZBE 3;  4XTM A;  1JOP A;  1X7N A;  4P02 B;  4WVW A;  4BCU A;  4CCK A;  4OQ8 A;  1ZBA 1;  4YNI A;  1VBB 3;  4BM8 A;  3DPR C;  2EIB A;  2ZX1 A;  1D4M 3;  3I97 A;  4FPK A;  2P6H A;  1SCS A;  3C7E A;  4RFT 0;  2GC2 A;  5FZ9 A;  4GJY A;  3H1Y A;  4XUT A;  1RUJ 2;  1FOD 2;  3TN9 1;  1UX7 A;  3KSC A;  1PX3 A;  4FOV A;  1QWR A;  1WLW A;  2X5I B;  4Q4X 1;  1AYM 1;  1CES A;  2BWA A;  2WJS A;  3J7N A;  3BPS A;  2WKK A;  4AVV A;  5GZE A;  2XB6 C;  3ZSL A;  4QT6 A;  1PNF A;  2YFZ A;  4XFC A;  2K2S A;  5BPX A;  4CP2 A;  1PZ8 A;  4MGK E;  3CHX A;  4XDQ A;  3C2U A;  1J1T A;  4AGG A;  2OQ7 A;  2BU9 A;  2WNV B;  1GP6 A;  1AXZ A;  1BQP A;  1TNF A;  4FP3 A;  4LO6 B;  4PI0 A;  2QFE A;  3S7E A;  3B3Q E;  2B39 A;  4AHW A;  2VCC A;  3H42 B;  4ISR A;  4WM7 B;  2VCM A;  1KGY A;  5FMO L;  2QCS B;  1ENX A;  3AYE A;  5A1F A;  1YEW A;  2Y8K A;  4QPW A;  3CJI A;  2IFR A;  3GNE A;  1T6G C;  5BUV A;  4RHV 3;  5K9Y A;  4H55 A;  1DQ1 A;  2DCJ A;  4YW3 A;  2Q1F A;  2R0F A;  2P2K A;  4LIU A;  5JXG A;  1LOC A;  4DEV A;  1G86 A;  4CU6 A;  1GWK A;  2XJQ A;  4XUR A;  1AR8 3;  5FR3 A;  1OUR A;  3ZIW A;  3B5L B;  4C90 A;  1DIW A;  3BGA A;  2Q8E A;  1RJ7 A;  1RGS A;  3H1W A;  4HAN A;  4HPK B;  4OUS A;  3HT1 A;  1RUC 3;  3AJY A;  2C9K A;  1TMF 2;  1UXX X;  2QQL A;  1WW4 A;  2DU0 A;  1WA4 A;  2BYV E;  1G9F A;  1QQP 1;  1ND3 A;  4EZ4 A;  3PUR A;  4I3G A;  1ZM1 A;  2VTF A;  3FLP A;  3K3N A;  5J36 A;  1AX1 A;  4KI5 M;  4RSU A;  4AI3 A;  2BFU S;  4QKB A;  3GXU A;  2HYX A;  2WS9 1;  3TBD A;  4S2D A;  5GLW A;  3GCX A;  5ISL A;  1LUL A;  5FMB A;  3TEZ A;  1ZZ6 A;  1KS4 A;  1SPP A;  2J1S A;  1QXR A;  1HQL A;  1PK6 B;  1LGB A;  3AJZ A;  3LF7 A;  2PHT A;  1AR9 2;  1GOF A;  3RSJ A;  2OQ6 A;  4QGL A;  3Q8A A;  1VBD 2;  5CFD A;  2YRO A;  1X8E A;  5DDJ 3;  2HBU A;  1PZ9 A;  5LBE A;  1V0A A;  5G04 L;  1DQ4 A;  1BEV 1;  1QOS A;  2WSV A;  5C6C A;  3KHB A;  5I0T A;  1GYK A;  4FPY A;  4Y26 A;  1AYM 2;  2WN2 A;  3CBN A;  1QJY 3;  1PMI A;  3IB3 A;  3W59 A;  3S57 A;  1VAL A;  1UY0 A;  2JJ6 A;  3ACG A;  3I2F A;  3MYX A;  5C4W C;  2E26 A;  4X6R B;  3LCP A;  4EV0 A;  3NJZ A;  3K48 A;  2O14 A;  4FFF A;  5GZC A;  4N9I A;  5GJ6 A;  3URF A;  3WCS A;  1RUF 3;  3LEM A;  2RS1 1;  3HPN A;  2SBA A;  4XUP A;  4CP9 A;  2VTX A;  1RUD 1;  2PAM A;  3CDZ B;  1K5M A;  2VQ0 A;  4O61 A;  4XQ4 A;  5GM0 A;  2WYS A;  2VG9 A;  2VOK A;  3HAG A;  4N7I A;  2TBV A;  1VMH A;  4XIL A;  4BHP A;  4CXY A;  2HYK A;  4Q2F A;  3VL8 A;  3U4S A;  4GB3 2;  4WVZ A;  5AVP A;  1CPN A;  2P17 A;  2PQS A;  3UK9 A;  2WT1 A;  2PLV 3;  3J8F 1;  4R9B A;  5A33 A;  4COZ A;  2FCT A;  2RV9 A;  3OPZ A;  4JTN A;  4B4Q A;  3P1I A;  5DAV A;  5F37 A;  4AAX A;  2RM2 1;  5D21 A;  2GC3 A;  1PGW 1;  4AFC A;  4XE9 A;  1XU1 A;  2CDP A;  1US2 A;  2R07 1;  4HG6 B;  5K0U C;  2GDF A;  3IPV A;  4PDW C;  1W2N A;  4DY5 A;  1R1A 3;  1F4H A;  2VUJ A;  2ZGR A;  4Q4W 3;  3U0Z A;  1CX1 A;  2B4K A;  3S6P A;  1ACC A;  1ZA7 A;  4KG8 A;  3S5Q A;  1Q56 A;  1OT5 A;  3Q9O A;  4IEW A;  5CB7 A;  4WM8 B;  1G9D A;  3VBO B;  4D69 A;  3I3Q A;  5FY5 A;  1J59 A;  1JYC A;  2OYZ A;  2Y6F A;  1HB3 A;  1AR6 3;  4AVB A;  5ACA 3;  4COY A;  2WS9 2;  2A3X A;  4IND A;  4OHW A;  1OD3 A;  4E4D X;  1DCS A;  3BUC A;  1HX6 A;  2HWF 1;  2VR4 A;  2JG9 B;  2ZZJ A;  3PUH A;  4HK9 A;  5FYZ A;  1PGL 1;  3AYD A;  2GND A;  3K2O A;  2DVB A;  5DAQ A;  1H2L A;  3I3B A;  5FY7 A;  5FZD A;  1DYP A;  4CPB A;  1YIP A;  1O4Y A;  4LK6 A;  1J3R A;  2RMU 2;  4CU7 A;  2ZEY A;  4QHB A;  4CDX A;  1RUH 3;  5JXI A;  4O9E A;  1KIT A;  1YC6 1;  2RG4 A;  1Y9Q A;  4CRQ A;  2VBP A;  1ND2 A;  1O6U A;  1UWW A;  2PMW B;  4GAZ A;  1CIW A;  4K1Z A;  4KU7 A;  1LOF A;  2ZBJ A;  4CE8 A;  4BK4 A;  2VMD A;  3SH3 A;  4ERO A;  5AFB A;  5T52 A;  2VOV A;  3BTZ A;  3JB8 A;  3PNA A;  3O1R A;  3EMR A;  4L11 A;  3RG0 A;  3AXD A;  5ABJ A;  3H3Z A;  1ZRC A;  2P3J A;  1DYK A;  1VLN A;  3LA7 A;  4YW4 A;  4BQX A;  4OLL A;  4CDQ C;  4A7K A;  2JDP A;  2WFP A;  3B69 A;  1JOD A;  3G7D A;  3BTY A;  1FNZ A;  2C26 A;  2RS3 3;  1YYN A;  4MGT A;  3NNF A;  5ERL A;  3WDW A;  4BYY A;  3UET A;  4CCM A;  4NOT A;  1VRB A;  4ASL A;  3BPZ A;  3MV1 1;  1RUG 1;  2D98 A;  3AX4 A;  2X8K A;  2VH9 A;  4ZY9 A;  3KB5 A;  2JXA A;  1OLR A;  4HON A;  3WDU A;  5A3U A;  1VRH 3;  1COV 3;  2ARB A;  2RJL A;  3RNS A;  4FBF A;  5BNN B;  3VBH C;  4JKK A;  4LBQ B;  1NG0 A;  2XML A;  3IBM A;  1GQP A;  2R07 2;  5DQ0 A;  3ZXE A;  5L7O A;  3LEG A;  1O3Q A;  3ME2 A;  1LOB A;  1X50 A;  5D8A B;  2CGO A;  2JIC A;  1MQT A;  3L9J T;  1FYU A;  2GU9 A;  1FX5 A;  2GP3 A;  3WXP A;  1OMI A;  4FPG A;  1ZRF A;  1IQD C;  1QGL A;  1QJU 1;  1XNA A;  5FZ3 A;  3THP A;  1V00 A;  2QZ2 A;  2XL7 A;  4LK7 A;  3OBZ A;  2VW0 A;  4N53 A;  3CKH A;  1WUV A;  5DG2 A;  2AR6 A;  4ITC A;  2ZGP A;  4CDW B;  4RR3 A;  5IVV A;  2Q1M A;  3BYW A;  1OUS A;  2AEZ A;  2ZEX A;  4M3C F;  4RL7 A;  5FMO S;  5A3L A;  2R04 2;  3MPP G;  5FY1 A;  2AGS A;  2HWF 2;  4YG3 A;  4LKE A;  1SFP A;  4JRL A;  3ZFG C;  1KDK A;  2BEO A;  1BBT 3;  3J4U H;  1POV 3;  3SKV A;  3JQW A;  4GMP 3;  1YI9 A;  2OW4 A;  2FDH A;  4UF0 A;  2YU2 A;  4PQ9 A;  1IKP A;  1IZ3 A;  1GBG A;  1W3V A;  5HBA A;  5C33 A;  2XR4 A;  4UFL A;  4CDU B;  1RTV A;  1VIW B;  4KL1 A;  4M01 A;  3ZFE C;  5F1R A;  1S2B A;  3AZV A;  1XU2 A;  1TME 3;  3AP7 A;  3HOB A;  4FPL A;  4MXV A;  4AHZ A;  3H8X A;  3O1O A;  4LHL A;  1EUU A;  2HBT A;  2BWC A;  1W8Z A;  3U75 A;  4V2W A;  5HV4 A;  2PYT A;  3DKW A;  3PUQ A;  4CEY C;  5L9B A;  2JDZ A;  4RYD A;  4QPY A;  1IS5 A;  1NX9 A;  1RUI 1;  2CAV A;  2LW8 A;  3VD3 A;  3AFG A;  3WDV A;  1YFW A;  1QF3 A;  1TVG A;  3OPW A;  3DN7 A;  1JZ2 A;  1W6Q A;  4UT5 A;  3FUQ A;  5L36 A;  3ZSE A;  1EY2 A;  1HRV 2;  3JQX A;  3PL0 A;  1O3R A;  1DGW X;  2WZP P;  2BOI A;  2AZ5 A;  3ES1 A;  1OA2 A;  5KHH A;  4XAE A;  1I3H A;  3M1H A;  3ZKU A;  2BV4 A;  2MEV 3;  1WCQ A;  2VVD A;  2WDB A;  1XBF A;  5IAV A;  4B8E A;  3SMH A;  4YW6 A;  3GF6 A;  4HVO A;  4WM7 C;  4TSV A;  5BV6 A;  4LO8 A;  3CJX A;  1OPM A;  2GN3 A;  4L97 A;  5F5C A;  1FOD 3;  3WDY A;  2OX0 A;  3PU8 A;  1HRI 1;  1V6J A;  3QH7 A;  4PBP A;  1CD3 G;  1GZ9 A;  1NCQ C;  4XFF A;  5F3C A;  3AVR A;  4YVW A;  3I49 A;  2G1M A;  3NAP A;  2W68 A;  1LEN A;  2R7E B;  4NE9 A;  1SAC A;  2W2I A;  4QU2 A;  4F83 A;  4QU1 A;  5A3M A;  2D3R A;  5C9A B;  4XMA A;  3PJY A;  4BQ4 A;  4W6W A;  1UMH A;  1O3T A;  3WP5 A;  2PHD A;  5FXV A;  1H1M A;  1OKO A;  3SLI A;  3ZYB A;  5FP9 A;  1LHN A;  5IT6 A;  3VDD B;  4OI2 A;  2EXI A;  1OVS A;  3VBF B;  4B4P A;  2SLI A;  1XB9 A;  2WO3 A;  1GOG A;  1BMV 1;  1JU4 A;  5IVF A;  4QKF A;  3OEB A;  3TOJ A;  3I4I A;  3OBT A;  2MNG A;  3WOG A;  4I2O A;  3T4V A;  3GZU C;  5I0U A;  2OZJ A;  2W95 A;  5A6X A;  3SEE A;  1YQ6 A;  1QNY A;  2B8M A;  2UWB A;  3QLQ A;  1Z7S 3;  1AL2 1;  2YC4 A;  2X5I A;  4NVP A;  3KLS A;  4B7E A;  1UZY A;  1ZZ7 A;  2CNA A;  1XOY A;  2VZT A;  1HB4 A;  1VE0 A;  2UWC A;  1C8M 2;  3AL5 A;  2BJS A;  4C8D A;  2V73 A;  1RUI 2;  4D7S A;  3DYO A;  2X53 S;  4AE2 A;  4XBL A;  3PVE A;  5T55 A;  4NN0 A;  3WP6 A;  3OG2 A;  3WNX A;  3ZYH A;  2WNV A;  4QXK A;  1S0F A;  3VDA A;  1C28 A;  4HN0 A;  4RA0 A;  3E1F 1;  3O0W A;  1FMD 3;  2A6X A;  3LFM A;  2WIN B;  4P9L A;  4FVV A;  3F2Z A;  2DUP A;  2Q8D A;  4MSV A;  4KWU A;  5K8S A;  2ADD A;  2OII A;  5LK5 A;  1W6P B;  1EUT A;  2HWD 1;  1XNB A;  4QPI C;  5JIU A;  1K42 A;  2JKB A;  2W1W A;  5FZ6 A;  2G9F A;  5K4L A;  4AW7 A;  4IUG A;  4DXR A;  4PQQ A;  5FLH A;  4ONU A;  4HXC A;  1AR9 3;  5FZE A;  2OKX A;  2ENR A;  2A7A A;  3SH4 A;  2WZR 1;  1VBC 2;  1RVF 1;  2XWB B;  1VBD 3;  4FFH A;  4HOO A;  4ASK A;  4CXW A;  3RVH A;  5D2A A;  2EIE A;  4EWD A;  1Q3E A;  1BKZ A;  1TEI A;  4Q4Y 3;  1HRI 2;  3I3E A;  4HPK A;  4L99 A;  3T3Y A;  1DLC A;  1UIK A;  1QU0 A;  3L2H A;  2W92 A;  4ZHN A;  5JMC A;  2VE1 A;  3DCQ A;  5IFT A;  1J1L A;  1NCR B;  3AZZ A;  1AHS A;  2W94 A;  3AK0 A;  5BNP C;  2BRT A;  5KXE A;  3C7O A;  3IKW A;  3E5X A;  2CYF A;  2EA7 A;  1F35 A;  2DCT A;  4AF9 A;  3VD5 A;  2R06 1;  1IG3 A;  4MOA A;  1SPP B;  3OD4 A;  1W2A X;  3E6B A;  4EWA A;  1UMI A;  3LA3 A;  3ALQ A;  4XFB A;  2AH2 A;  1S1A A;  1ODN A;  3KF3 A;  4YM1 A;  3M3C A;  2WSU A;  1NLS A;  3D8C A;  4JGZ B;  1GKB A;  4DRV A;  2VO5 A;  3GHN A;  2QQO A;  4FXK B;  4GB3 3;  5FRE A;  3T0A A;  1CGP A;  2VZO A;  5CIR A;  5F7U A;  5GLZ A;  4TZD A;  4Z2W A;  1AL2 2;  4RGG A;  1DP0 A;  3POF A;  4P5Y A;  3WW2 A;  3M3I A;  4S2G A;  2QVS B;  1OLM A;  1QXJ A;  1A8M A;  1H4G A;  4I0B A;  4IEV A;  4UOJ A;  5C3O A;  3OOX A;  2CAU A;  4SLI A;  4P9X A;  2GN7 A;  1LOE A;  5FY8 A;  1UYX A;  3JB4 C;  2GH2 A;  5C3P A;  2DVF A;  2VZ3 A;  1QJX 3;  2E33 A;  5BYN A;  1B35 C;  4EN6 B;  1YCI A;  4QPG C;  3SNM A;  4IV1 A;  5FAX A;  3ZXD A;  2Y34 A;  1GR3 A;  2E63 A;  4PCR A;  4NIA A;  4HKO A;  2YPD A;  2BTV C;  3ACF A;  5A33 B;  2WS9 3;  2Z42 A;  2R0H A;  2XBO 1;  2VD7 A;  3OB8 A;  4A3X A;  4D0Q A;  1NA1 C;  2D43 A;  2JG8 C;  4A41 A;  1G7Y A;  1RXG A;  2WNE A;  1VBE 1;  3BU0 A;  1W2O A;  3POJ A;  1DGL A;  4AWD A;  3T4H B;  2WZR 2;  2Q5T A;  1UU5 A;  1M4W A;  1PVX A;  2IXJ A;  3ZX7 A;  4M3C A;  4D6S A;  2RMU 3;  2D6M A;  1GWL A;  2PEL A;  4Q0V A;  4AI1 A;  5DZF A;  4LBM A;  2XUM A;  3JUU A;  3WW1 A;  4WVM A;  2F4P A;  2QUO A;  4R9C A;  3H8R A;  3MFA A;  4DEQ A;  3RMY A;  4WM8 A;  3VBO A;  1SFY A;  3KCC A;  5JSO A;  1KQR A;  1ZX5 A;  3AMM A;  2QQJ A;  2VY0 A;  1YUD A;  4BWO A;  1ASJ 2;  4D3W A;  2R06 2;  4AAP A;  5EYY A;  1FAY A;  1GFF 2;  3BIW E;  3CQO A;  3MF6 A;  4NHL A;  4XF3 A;  2MPF A;  3GYD A;  4ZU7 A;  1R09 2;  5C70 A;  1GNY A;  2QQN A;  2JG9 A;  3I8T A;  5BXX A;  5AC9 2;  4V1P A;  5DPN A;  2ORZ A;  2WA4 A;  3U07 A;  2AYH A;  5C5T A;  3GCW A;  3VBR C;  4GAL A;  3BKZ A;  2JEN A;  3RWN A;  1E57 A;  1N3O A;  4FTB A;  5IVY A;  4XZU G;  1GIC A;  4YLZ A;  1WA6 X;  2WN3 A;  2KD7 A;  3Q8C A;  2JEM A;  3MPB A;  5J48 A;  3IDC B;  5CKM A;  1WWY A;  4WZC A;  3OBR A;  4M00 A;  1A6C A;  3N7K A;  2R07 3;  1ZRI A;  1JN2 P;  3WX5 A;  4ZON A;  5FRA A;  2IUW A;  3H50 A;  1IPK A;  2WO7 A;  3A0N A;  4FSJ A;  4TYS A;  2GNT A;  1MZ5 A;  4QXB A;  3VBS C;  4XUN A;  2JB8 A;  3WEZ A;  5DXD A;  5FBJ A;  3VZJ A;  4OMC A;  4I30 A;  1K12 A;  3VZM A;  5FV3 A;  3NNJ A;  5BNO C;  4HVR A;  2IXK A;  1LCL A;  4Y1Y A;  2QDR A;  4Y4R A;  1IS6 A;  5FWE A;  1PIV 2;  3UYJ A;  4CCD A;  3ILR A;  2JB4 A;  4LA3 A;  1ZRD A;  1K3I A;  2LTN A;  2VUC A;  4LO7 A;  4P5H A;  2R04 3;  2XBO 2;  4GH4 C;  4XTP A;  1RUN A;  4AI2 A;  5L73 A;  4R52 A;  3O1M A;  4QDR A;  1XE7 A;  1MEC 2;  4JQT A;  4YW1 A;  2Z79 A;  3NV2 A;  1K5J A;  5BNN A;  1WW6 A;  2A6V A;  1V9U 2;  4LBQ A;  3AKP A;  3THC A;  1ULE A;  4LE3 A;  1PX4 A;  1ZRR A;  2F4L A;  1Y4W A;  2J1A A;  5A7N A;  3JBG 2;  2E51 A;  2VOT A;  5FYU A;  5JR7 B;  1XNK A;  1JYI A;  1Y43 B;  2RR1 1;  5ANQ A;  4H2A A;  3LAG A;  3FBY A;  2Q0A A;  4QD2 A;  5FYC A;  4RR3 B;  4BA6 A;  1HXS 1;  1F5F A;  1OFN A;  2A6Y A;  1YO8 A;  4YGD A;  3VKO A;  2W39 A;  2D5H A;  2HWE 2;  5JSR A;  2EAL A;  2GP5 A;  1OC1 A;  4AHY A;  1N1Y A;  2A3Y A;  2XPJ A;  3VUO A;  1EP0 A;  5HXV A;  2A75 A;  1QJE A;  1ZVF A;  3LIH A;  1SLA A;  1NQD A;  4UF0 B;  5DZE A;  5IYY A;  3O0V A;  3INA A;  4NMI A;  1HRV 3;  1WCD J;  3MUY 1;  4GXL A;  4Y24 A;  4X6Q B;  2VC9 A;  5EJ3 A;  4E2G A;  1S55 A;  2QQV A;  4AED B;  4W8J A;  4CDU A;  5DUX A;  3ZXF A;  2VMG A;  2XKO A;  2GNB A;  3M8L A;  4J1X A;  1W6M B;  4MGS A;  4DXT A;  4FCA A;  4YFW A;  2GC0 A;  4Y4Y A;  3F95 A;  4JRA A;  4BU2 A;  1D4V B;  2QNK A;  4BQW A;  2ZAA A;  5T5L A;  3AP6 A;  4CEW B;  2XJV A;  3DXT A;  1GNH A;  1PO2 3;  4QX2 A;  1S0I A;  2G19 A;  4OQ9 A;  2JIG A;  3DV8 A;  5CIS A;  5JDB A;  1H6Y A;  3M2M A;  1W6Q B;  3ES4 A;  2ID4 A;  1VBA 2;  2BBA A;  2J42 A;  2B9V A;  3IT8 A;  4L8Q A;  4GWM A;  2RDQ A;  1OVP A;  4ORF A;  4YM0 A;  3III A;  4RS5 C;  1APN A;  4XMI A;  1CAV B;  4A6O A;  5KXB A;  3FFQ A;  1D0G A;  1MS3 A;  4NIG A;  1FNY A;  3O1P A;  1XYP A;  1HDK A;  2VXR A;  2YUE A;  4AYU A;  4IET A;  1FXZ A;  2BGC A;  3CZU A;  3GHM A;  4R9A A;  3CJI C;  2ZML A;  5FY0 A;  3KV5 A;  3OGV A;  4FPJ A;  3VN4 A;  4NHY A;  3A21 A;  4AFM A;  4AXO A;  1UX6 A;  2RR1 2;  4E8D A;  5JZG A;  1ULP A;  1IG0 A;  3KGL A;  3AM2 A;  3GAL A;  3PHM A;  4G3Y C;  3J26 N;  3SHR A;  4YVW B;  2NM1 A;  1SBD A;  1LR5 A;  1HXS 2;  3K46 A;  5FZC A;  5CU1 A;  3VDC A;  2C9A A;  2XLF A;  4GUL A;  5FOB B;  3AVS A;  3WT3 A;  3K4D A;  1YIF A;  3ZXK A;  1C8M 3;  2VUL A;  3DL3 A;  4FFG A;  3N7M A;  3WF4 A;  5C9A A;  3VZN A;  5C8C A;  4QQH A;  1ND3 C;  1C5H A;  5LA1 A;  1OOP B;  2RS5 1;  3ZM8 A;  3PMS A;  4XBQ A;  5FPV A;  3VDD A;  4NRP A;  3VBF A;  4XJU A;  2XG3 A;  1QY4 A;  3WHU A;  1EPZ A;  2C0Z A;  3SEP A;  1A8D A;  3WNP A;  1ZZ8 A;  3AP9 A;  4IL7 A;  4BIO A;  1PMJ X;  3AB0 A;  3EB7 A;  2OZ6 A;  1FI2 A;  5GKA C;  1BYH A;  3K51 A;  3MIE A;  4LIT A;  2GNM A;  1Q8Q A;  1TZO A;  2BP6 A;  1WCS A;  2A6Z A;  2JE9 A;  3I2D A;  3UNP A;  3R4S A;  4CA9 A;  4ASM B;  2C24 A;  4Y1X A;  1QH7 A;  4ZS2 A;  5CFD C;  2ARA A;  5FZK A;  2DUR A;  4LBO A;  3MIF A;  2A71 A;  1VAM A;  3VZL A;  2ZAB A;  4QQ2 A;  5LBF A;  2ZTN A;  3FX3 A;  3CIH A;  2FDF A;  1VBC 3;  2DCY A;  1N47 A;  2XOM A;  3HQX A;  4MVT A;  2NMN A;  1GZW B;  4UWD A;  2WLQ A;  2WO1 A;  1C8N A;  3WHT A;  5CFC C;  4XF1 A;  2ZKL A;  2WZE A;  4IEU A;  3N4M A;  1DHK B;  1GMM A;  4FP2 A;  5LY2 A;  4EE2 A;  1W8H A;  3O12 A;  1VMJ A;  3LIG A;  3MHZ A;  1R08 1;  3UV9 A;  2XXZ A;  1PM4 A;  2DFB A;  1JYT A;  1WLD A;  4GQ7 A;  1GUI A;  1VPH A;  3SKJ E;  5FK8 A;  1K5M C;  4AEK A;  3N9N A;  4MGZ E;  4COW A;  4I0A A;  2KXL A;  5F9T A;  1W6P A;  5JI7 A;  1JXN A;  2WNO A;  4RQP B;  1VB2 A;  4QKN A;  2EF6 A;  5I8T A;  2LAL A;  5JSP A;  1HV0 A;  4OYU A;  4FQ4 A;  4FT8 A;  2PHU A;  1RUE 1;  2OT7 A;  4FPC A;  1UZV A;  1FPN 2;  4RGK A;  5F8P A;  1ZZC A;  4BQ1 A;  2HWC 1;  2YU1 A;  4XHB A;  4N8M A;  5FZG A;  1IS4 A;  3RWK X;  4XXA A;  3VL9 A;  4CP0 A;  3BTX A;  2D3S A;  1QNW A;  4XW3 A;  4XJA A;  1UL9 A;  5F6K A;  1GSL A;  1C1L A;  4HZF A;  3ZN6 B;  2AC1 A;  1NCR A;  4X8P A;  4RGA A;  4BOW A;  5KHG A;  5A7P A;  2Y60 A;  3MIH A;  3VD9 A;  2FQP A;  3KS7 A;  1ZBA 2;  3ZKY A;  5DG1 A;  1KD7 A;  3I2K A;  2K9Z A;  1UCX A;  4CUB A;  2RS5 2;  4ATE A;  1OKQ A;  2XHN A;  1DGW A;  1FV2 A;  2R6Q A;  4IER A;  4QX3 A;  1N1V A;  3ZFF B;  1S2K A;  2V5D A;  3T2O A;  2BQP A;  1SCR A;  2ZGN A;  2QTW B;  3N36 A;  4GIQ A;  2ZX3 A;  4Z1V A;  1NAE A;  1Y3T A;  2V5Y A;  5FP8 A;  3FJS A;  1SBF A;  4JGZ A;  4OMD A;  3TN9 2;  1YQ5 A;  3WP3 A;  3DPR A;  1Y7B A;  3AMP A;  4GKY A;  1NLR A;  2VU9 A;  4Q4X 2;  1UZZ A;  3AKS A;  1AYN 1;  2WWS A;  1ST8 A;  3FN9 A;  5CKQ A;  4YZ3 A;  3SC7 X;  4IV3 B;  3N9L A;  2VPV A;  2WQ8 A;  2ZGM A;  4LKD A;  4N43 B;  5ANN A;  4CDX C;  2IXL A;  3H1M A;  1W8U A;  4Q4V 1;  3WCR A;  4Z2A A;  4PIX A;  1OA3 A;  5HXM A;  2HEW F;  1ND2 C;  1LOF C;  4IXL A;  1S0C A;  1CWP A;  2A1X A;  4Q26 A;  1BZW A;  2ZA9 A;  5EYX A;  5F39 A;  2D7F A;  2XJP A;  1JS9 A;  5ABJ C;  1IOA A;  1J83 A;  1BK0 A;  2F6B A;  4IV1 B;  4Q8K A;  5EJZ B;  1REE A;  1CJP A;  4UI9 L;  4D8M A;  1EV1 1;  5M0T A;  1G9A A;  3WVJ A;  4XVH A;  3RZJ A;  4QGM A;  1ASJ 3;  1U0A A;  1DU3 D;  1XRU A;  2E7T A;  1LU2 A;  2R06 3;  3ACH A;  1OI6 A;  2I07 B;  3G6J B;  2TUN A;  1R09 3;  2LUW A;  5CA6 A;  2JDA A;  5AC9 3;  2PN5 A;  2PHL A;  1RUE 2;  4M3C B;  3POW A;  2XDV A;  4Q0P A;  3ZSK A;  5FZ7 A;  1SQ4 A;  1LU1 A;  1W9S A;  2I45 A;  1UZW A;  4HT1 T;  4WVM B;  3EO6 A;  4FO9 A;  4XDP A;  4DMI A;  2WNU B;  4JCK A;  4FTE A;  1GV9 A;  1O8S A;  1WMX A;  2P1B A;  5L7O C;  1KFU L;  1QQP 2;  4FAH A;  2D6K A;  3FHQ A;  4FOW A;  3TEX A;  1MQT C;  1JZ3 A;  3ITQ A;  3MID A;  2TEP A;  3WQ7 A;  5HCF A;  3RQ0 A;  1JZ8 A;  4COV A;  2DVD A;  1AUY A;  4QKD A;  4W6X A;  4N53 C;  2CSG A;  3HIF A;  4NPL A;  2DVG A;  2VMI A;  5D1I A;  1UY2 A;  1Y9G A;  3KV4 A;  2Q30 A;  4I0W B;  4JGY B;  1UYY A;  3HBK A;  3N7L A;  1YQ8 A;  4CVU A;  3H8U A;  3ELN A;  4KBZ A;  3WP4 A;  4JKM A;  1PIV 3;  2VZS A;  2WBK A;  2ZX4 A;  1BEV 2;  4FPH A;  4Q1R A;  5FPA A;  1OH4 A;  1HW5 A;  4RD7 A;  1AYN 2;  2XBO 3;  3ZYR A;  3AMH A;  3AC0 A;  5LRR A;  2HWB 1;  1OUX A;  1MEC 3;  3NV4 A;  4AHX A;  4BK5 A;  4IGQ A;  2YB7 A;  1WKY A;  3WG1 A;  3RPQ A;  1V9U 3;  5FZA A;  2B45 X;  3OGR A;  2J1R A;  1QOT A;  3GJA A;  4NPR A;  2JX9 A;  3P3P A;  1Q5O A;  1VAK A;  2RS1 2;  5IJR A;  3RI9 A;  5FZO B;  3JBG 3;  4AFB A;  3NKG A;  3GZA A;  4QM9 A;  2D3P A;  1RUD 2;  1GOH A;  2UU8 A;  5LK7 B;  2XGX A;  1Z78 A;  2VMC A;  2CGP A;  1LES A;  3JXS A;  4CTE A;  2YGM A;  3BB6 A;  4NHX A;  1YQC A;  1F5J A;  3POG A;  3RS6 A;  1BJQ A;  5SV5 A;  2LM3 A;  1EV1 2;  2C5D A;  2WAA A;  5CKN A;  4NPM A;  2XJU A;  5KR7 A;  3NV3 A;  1OH3 A;  2HWE 3;  4OUL A;  2GC1 A;  3J8F 2;  4QGN A;  1KFX L;  5FQ0 A;  4XFH A;  2D5F A;  4LBK A;  3H8O A;  1ZZ9 A;  3J7H A;  2RM2 2;  5EIY B;  1GNZ A;  1PGW 2;  4ZZ8 A;  2V72 A;  5LZ6 A;  2OPW A;  3CO2 A;  1RHI 1;  2BUK A;  4LHN A;  3TRS B;  4QB6 A;  3AZX A;  2Y6H A;  1H8V A;  1IGO A;  4XQW A;  2A70 A;  3CZJ A;  4LLO A;  3ZYG A;  1HKD A;  2W1S A;  4XEZ A;  1S0E A;  4KWK A;  4BQ3 A;  1O59 A;  4IW3 A;  5LBB A;  4COU A;  1WBL A;  5FDB A;  3VKM A;  5LRS A;  2QQW A;  1PNG A;  4YVS A;  1S0B A;  2IFW A;  4PDW A;  5HV0 A;  4Z07 A;  4BE3 A;  4OZX A;  4XXP A;  2CTV A;  2WFF 1;  4AI9 A;  5A3P A;  4L9B A;  5AVA A;  1NY7 1;  3NAP C;  1PGL 2;  4AL9 A;  3A22 A;  5I0S A;  2YXS A;  3HQU A;  3EXU A;  1VBA 3;  3CEW A;  3T09 A;  5JOY A;  4E4S A;  5C3R A;  4LBL A;  2BGO A;  3I59 A;  2HH9 A;  3TAY A;  2JE8 A;  4KQ7 A;  1W06 A;  2VL4 A;  3D5O A;  5EFU A;  1KDM A;  2FMD A;  2ZHK A;  1E5I A;  1UPI A;  3QCW A;  3KF5 A;  3T2Q A;  4CYD A;  5CVR A;  2P4E A;  5A3W A;  2R16 A;  2HWB 2;  3VHP A;  1HLC A;  2PA7 A;  4AED A;  2RHP A;  3PIG A;  5T3N A;  5APA A;  4DO0 A;  1DYO A;  2XLG A;  3WR0 A;  1W6M A;  1SHW B;  1UY1 A;  2OPK A;  1PO1 1;  4XCB A;  3WLU A;  3WG3 A;  2WAO A;  5FPB A;  1NZI A;  2P6C A;  2W08 A;  4BMB A;  1DZT A;  3WDT A;  2X5I C;  1UYZ A;  2B5H A;  4CEW A;  2ZCW A;  5JPN B;  3JZV A;  1OFS A;  1U12 A;  5FYH A;  5F6L B;  1YFY A;  4NID A;  2Y0O A;  1HXS 3;  4XQD A;  4CCJ A;  1UY4 A;  1RUG 2;  4BPZ A;  1H1A A;  2ZOE B;  4XFG A;  4AI8 A;  4FAG A;  3MI8 A;  2E31 A;  2VOW A;  1CVN A;  2ARC A;  2WNV C;  1CAV A;  4MAD A;  3NV1 A;  4N9H A;  2Q4S A;  2ZGO A;  2JEC A;  3FUO A;  4HKL A;  2J1V A;  1ZBE 1;  4QM8 A;  4YRD A;  2ZKN A;  3VKN A;  4W65 A;  4XDO A;  3JD7 1;  1J3P A;  3HN3 A;  3NJV A;  4YM3 A;  1F4A A;  5IUQ A;  2A3W A;  1BCX A;  2EXH A;  1D4M 1;  2XON A;  1T2X A;  5JZG B;  4QWN A;  1QJU 2;  1RUJ 3;  3WNM A;  3MGU A;  2VOX A;  2CV6 A;  3Q8F A;  3NNG A;  1FV3 A;  2XLA A;  4XF4 A;  1XSQ A;  5EZW A;  3ZOI A;  1CON A;  3MW2 A;  4ES8 A;  3PUI A;  2CGN A;  4CCC A;  4ET7 A;  4UXA A;  4CPB D;  1C5I A;  1E5S A;  2VW1 A;  4E4H A;  5C8C B;  1L7R A;  2I74 A;  1ENR A;  5C7G A;  4PLN A;  2WR9 A;  4KU8 A;  3HVD A;  3HMY A;  2WFF 2;  3PTR B;  5FJK A;  2LS6 A;  4UBG A;  5L9R A;  4K9S A;  1QH6 A;  3BVC A;  1NY7 2;  1OOP A;  3A0K A;  3GBF A;  5FK7 A;  3BOW A;  3MFC A;  1H8T B;  3NNM A;  5F5A A;  2B7Y A;  3AP5 A;  4LKF A;  3RZM A;  3NW4 A;  5F5I A;  2J1E A;  5LAS A;  2NN8 A;  3O1S A;  4CUC A;  4K20 A;  1PK6 C;  2BER A;  2Y38 A;  3FL7 A;  4UFM A;  4Q0S A;  4OUE A;  1R64 A;  3ETP A;  3A4U A;  1N3Q A;  2K46 A;  3JU9 A;  2JD4 A;  4OCT A;  1JYX A;  5A70 A;  4YGB A;  2VVF A;  3DXU A;  3CLP A;  1PO1 2;  4YGC A;  2E7A A;  2WA3 A;  4RHV 1;  4HL0 A;  1FPN 3;  3WW3 A;  3ZFE A;  2DV9 A;  3I2H A;  3NMB A;  5CAD A;  4BXF A;  1G9B A;  1GZW A;  3M70 A;  4OHY A;  4PLM A;  3Q8E A;  5LY1 A;  1TMF 3;  3EQE A;  2WUH A;  4OUM A;  5FMD A;  4EWE A;  4YFZ A;  3WW4 A;  2WL1 A;  2RDN A;  2ZXQ A;  3DF0 A;  2JDU A;  4K8F A;  1L3J A;  4DXZ A;  3AKQ A;  1RUC 1;  2BPA 2;  4AZZ A;  3AYA A;  2IXC A;  3ZN4 A;  3PDQ A;  4IEY A;  4P9Y A;  5A3O A;  2DU1 A;  3VBU A;  3NO8 A;  1ZBA 3;  3O5S A;  3C8X A;  3CU7 A;  4FQZ A;  1SG3 A;  3LDK A;  4LUK A;  3D6E A;  3LDB A;  3U4X A;  1W0P A;  2OA2 A;  4MX3 A;  5HCH A;  2B9U A;  3JD7 2;  3QAC A;  3WIN E;  4LT5 A;  2RDS A;  4RQP A;  2JKX A;  3KT7 A;  3C3V A;  2RVA A;  1HJF A;  5KC6 A;  2QKD A;  4XOG A;  3DGT A;  5C8W A;  4Q0U A;  3V0A B;  1M06 G;  1JOJ A;  3OYW B;  2Y6K A;  3TN9 3;  3E6D A;  1HB2 A;  5IWF A;  4MHR A;  4Q4X 3;  4P9J A;  5DDJ 1;  3S5A A;  1AYM 3;  3B9I A;  4GKX A;  5LAT A;  4BLJ A;  3PIJ A;  4QX8 A;  1SLB A;  3ZDV A;  4DNY A;  3K77 A;  2X29 A;  1PZ7 A;  1AXK A;  3BTA A;  3ZVX A;  5T5O A;  2O1Q A;  1V6K A;  2J1U A;  2TNF A;  4F7Z A;  5LA0 A;  4MO3 M;  4QB2 A;  1G8W A;  3ZN6 A;  3W21 A;  5BY5 A;  1HQW A;  3KCY A;  3A7Q A;  1UAI A;  3BCW A;  4XF0 A;  1CN1 A;  4H7L A;  2JD9 A;  4UW3 A;  3UL2 A;  1AXY A;  2VZQ A;  1MZ6 A;  4WM8 C;  2NP0 A;  3VBO C;  1EAH 1;  1RUF 1;  1BMV 2;  2WRA A;  2IXI A;  4XC9 A;  4V2V A;  3ZFF A;  4BQY A;  1VJ2 A;  3ZIX A;  3HT2 A;  1G9C A;  4AG4 A;  1JZ6 A;  1JHJ A;  4IEQ A;  3PME A;  4JDO A;  4DUW A;  1DQ2 A;  3DPR B;  3U37 A;  3M4F A;  5FZI A;  2G9G A;  3ACI A;  1WD3 A;  3C7G A;  1UNB A;  3N9P A;  2FDI A;  3VZO A;  1ALY A;  2JG9 C;  4Z8B A;  2ARX A;  1C57 A;  2R49 A;  4QX0 A;  3FLR A;  4AGV A;  5A6Z A;  2VZR A;  4IV3 A;  3HNB M;  3VD4 A;  2GMP A;  3POI A;  4Y5T A;  3RRD A;  4YZ4 A;  4PT6 A;  4LJH A;  4L2N A;  2PLV 1;  2DBI A;  4N43 A;  3W9A A;  5I0D A;  4OI4 A;  1D0H A;  2EIC A;  1LED A;  4MXW A;  2Y6L A;  4XAA A;  4YPJ A;  2OVU A;  2FDJ A;  2J22 A;  5IK7 A;  3NQH A;  1WGP A;  2J7M A;  1QQP 3;  4NII A;  1R1A 1;  4Q4W 1;  5JAX A;  4AVA A;  5IAT A;  1HN0 A;  3MIB A;  3GBW A;  4Y5Z 0;  4Q0Q A;  4AFA A;  2O8Q A;  1QDO A;  2ZZQ A;  3IAP A;  2FCU A;  4LOT A;  5FZM A;  2HWD 2;  1N1T A;  1NZC A;  1AR6 1;  2YHJ A;  3KZ4 C;  1MS4 A;  5ACA 1;  3W5M A;  3MW3 A;  4DXS A;  5JR2 A;  1CAX B;  2XHK A;  3KCX A;  4ARY A;  4EQV A;  2W9X A;  1GLH A;  1NE6 A;  4OZO A;  1RVF 2;  5LA9 A;  1XQN A;  4XZP A;  1NQJ A;  2RDR A;  1SZB A;  1BEV 3;  3IMM A;  3GGL A;  3WG2 A;  5H9P A;  4DRR A;  5BNN C;  4HSJ A;  4GA9 A;  3FE5 A;  5FMC A;  2WNU A;  1JOB A;  4IDZ A;  3T30 A;  2WQZ C;  3HN1 A;  4XHX A;  2IXH A;  2VM9 A;  4ZKT B;  5D8A C;  1U5I A;  1UO9 A;  3ZYP A;  3OUH A;  3OGS A;  4FI9 A;  2PFW A;  2RS1 3;  3O1U A;  4NR1 A;  4CCO A;  5AFE A;  3P5B A;  1RUD 3;  5E88 A;  5FKC A;  4MGY E;  3L2Y A;  2ZHM A;  3MEP A;  1EAH 2;  3ZMN A;  1WCK A;  1RUF 2;  2WYF A;  5A3N A;  3POY A;  3S0M A;  4JGY A;  2Y33 A;  3KVB A;  4CDW C;  2GSY A;  3MW4 A;  4LUL A;  2W3J A;  1FAT A;  2YFU A;  1NE4 A;  3APB A;  1NXM A;  3N3H A;  2RS3 1;  3OGJ A;  3POE A;  1HQN A;  5FJH A;  1EV1 3;  3SCG A;  3THT A;  3OUI A;  3VV1 A;  1GQG A;  3ORJ A;  3QOP A;  3J8F 3;  4QMA A;  4W6Y A;  3RJ2 X;  2UY9 A;  1ULC A;  2WO2 A;  3VGI A;  1OXC A;  2O8O A;  3UJQ A;  2QQK A;  2RM2 3;  4D7Y A;  4E27 A;  2YZ4 A;  1VRH 1;  2BVB A;  1COV 1;  4AQT A;  4BB3 A;  3I7D A;  4IEP A;  3V64 A;  2ERF A;  4HMZ A;  1MZE A;  4YW7 A;  4CDU C;  4NAO A;  5DUW A;  3K4Z A;  3LB9 A;  5HPO A;  2RJK A;  5FZO A;  3IDE A;  5J3U A;  1OSG A;  1R1A 2;  5FPZ A;  1DGR N;  4Q4W 2;  5A1L A;  4QB1 A;  1P8J A;  4QDQ A;  3I2G A;  1SDD B;  4OFG A;  1ZA4 A;  1NUK A;  5LA2 A;  1O4T A;  1WW7 A;  5FQ0 B;  2E9Q A;  4QQO A;  3SH5 A;  4LMF A;  2QQM A;  3TNQ A;  2HWF 3;  2ZGQ A;  2VUD A;  4FPE A;  4YW2 A;  1BVP 1;  1WZX A;  3IAQ A;  2W0X A;  5LBC A;  5IVJ A;  1AX2 A;  1B35 A;  1VBE 2;  3B7M A;  3OBA A;  4QXH A;  5FP7 A;  2EXJ A;  4JHZ A;  3ZR6 A;  4LA2 A;  2A5Z A;  2P3Y A;  4B1L A;  5LCW L;  3NKT A;  1UKR A;  2DUQ A;  4R8H A;  1V6O A;  2VGD A;  4OHX A;  3LFI A;  3B94 A;  3LKJ A;  3UGG A;  1BBT 1;  1OQE A;  1POV 1;  5FY4 A;  3WNL A;  1X9P A;  2JG8 A;  2QQP A;  5K0U B;  2HWB 3;  5JIA A;  3T1M A;  3PTY A;  4YVS B;  4PDW B;  3V0B B;  4PIZ A;  4Q5O A;  4H7M A;  5FZF A;  1TME 1;  2R30 A;  2K0G A;  2BOJ A;  3USU B;  4A45 A;  1RB8 G;  5A80 A;  3BAL A;  3LEI A;  4UFI A;  1YJL A;  2X10 A;  1F31 A;  2ZAH A;  3VHO A;  3HJR A;  4UBH A;  3VHR A;  4FPF A;  4G9S B;  3FZ3 A;  3I59 B;  5C9A C;  1UQX A;  3T0D A;  1RUG 3;  2RS3 2;  2FMY A;  3VKF C;  3EBR A;  4CXX A;  5HI0 A;  3VDD C;  2VXJ A;  3VBF C;  2PHW A;  4QQL A;  4QX7 A;  4A44 A;  4YZ5 A;  2P3K A;  1UMZ A;  1W03 A;  4R4Z A;  3FMG A;  4Y20 B;  2WT0 A;  3M3Q A;  1OPO A;  2PHX A;  4UW6 A;  1RC6 A;  3BU7 A;  3LDR A;  4URT A;  4H14 A;  5FYB A;  4NRO A;  3VBR A;  3GJB A;  2UYA A;  1MS0 A;  2X09 A;  1GP5 A;  1AL0 G;  2MEV 1;  5FIX A;  1WMF A;  4Z82 A;  4CUG A;  1UU4 A;  4J1W A;  4MH0 E;  1TE1 B;  1QJU 3;  3RZH A;  2FZ1 A;  2KR2 A;  4DUX A;  3K3O A;  4FPO B;  5FYT A;  5GAL A;  3NVC A;  1UOG A;  3IIA A;  5B2G B;  3ABZ A;  4ARX A;  1UW8 A;  2DBN A;  3R4U A;  1FOD 1;  2YBS A;  2HEV F;  4K21 A;  1DQ0 A;  4LHS A;  4CDQ B;  5FZ0 A;  1U5Z A;  1HB1 A;  1ENQ A;  1R1Z A;  3B00 A;  3VBS A;  5F5Q A;  2WLP A;  3TWI A;  4HVQ A;  5JPM B;  2VAU A;  1OLQ A;  5DAW A;  3PJQ A;  5K7P A;  1DZQ A;  3MF9 A;  4IQP A;  4BQ5 A;  1X8M A;  3HD8 B;  1UIJ A;  1W3X A;  1XYN A;  4GWI A;  1WD4 A;  1DDL A;  1KS5 A;  2NYY A;  2D40 A;  3AXE A;  2ARE A;  5FYY A;  4PF1 A;  3VHN A;  3RZK A;  2P37 A;  2WWJ A;  4LPL A;  5DAP A;  3VBH B;  4LBN A;  1RL3 A;  3ZPY A;  2YPJ A;  4UW4 A;  3RMX A;  3AYC A;  3WF2 A;  4AEM A;  4M0H A;  3RZZ A;  2BNO A;  1JYW A;  3FWE A;  2P3I A;  4P9G A;  3AZW A;  3MUZ 1;  1Z7S 1;  2ZAC A;  1LAJ A;  1RUI 3;  4BJ0 A;  4B29 A;  4BIF A;  2JIJ A;  3WG4 A;  5JXJ A;  4LO5 B;  5DAB A;  5GLU A;  3TNP B;  3MZH A;  3C7H A;  1NCR C;  3GM8 A;  4Y1U A;  2P34 A;  4IE7 A;  5DZG A;  1KXG A;  3POS A;  2GAU A;  5LWB A;  1H8T A;  3T2P A;  2V09 A;  4KGQ A;  4XET A;  1ZNP A;  3ZXA C;  1CAW A;  1E5R A;  1VAV A;  3I2J A;  3IM0 A;  1HN1 A;  1H1I A;  1H6X A;  1SLT A;  3N7J A;  4FOY A;  4HN1 A;  4XAB A;  1FMD 1;  3LEK A;  1RXF A;  2AUY A;  2GAL A;  3QD6 A;  1XPW A;  1MS1 A;  2QQI A;  3JD7 3;  3H0O A;  4JGZ C;  5A7O A;  3GZT B;  1MS5 A;  4KH9 A;  1SEF A;  1JW6 A;  1AZD A;  2MEV 2;  3DUI A;  3GZE A;  1IKQ A;  4GD4 A;  4NAM A;  4WZF A;  3PVO A;  3ZFE B;  1S4C A;  4ZS3 A;  2Z69 A;  3ZXL A;  5IHR A;  5HCB A;  3JCI A;  1UOJ A;  1NOV A;  1BHG A;  3LWC A;  3RYK A;  1AR9 1;  2N7G A;  4M4P A;  1HRI 3;  3A23 A;  1VBD 1;  3NRU A;  4CEY B;  2Z2S B;  4OVE A;  1I9R A;  1ULF A;  3DYM A;  3IDB B;  4Q4Y 1;  2QZ3 A;  1W28 A;  1PHM A;  2ZGL A;  4LBQ D;  1N1S A;  4PBO A;  4JC1 A;  3VBU B;  1LHU A;  1UPS A;  4UAP A;  1D7P M;  2YC0 A;  3U78 A;  4JAA A;  2H0V A;  1VR3 A;  4J25 A;  4QXC A;  4E2Q A;  1W8O A;  4NHK A;  5T50 A;  1HV1 A;  1OBN A;  2OS2 A;  5C5U A;  2RE9 A;  3OUJ A;  3LGR A;  5C3Q A;  2ES3 A;  3EYP A;  5FCC A;  3UKV A;  1T6B X;  3FC0 A;  1IQA A;  4RS5 A;  3WSO A;  4I3P A;  4EN9 B;  1UZ0 A;  1QEX A;  1LGN A;  5IK4 A;  4U2A A;  1REF A;  2VZP A;  2VEC A;  5CAZ A;  3V0A A;  3AKR A;  1ULG A;  1YI7 A;  3MLK A;  2ADE A;  3OYW A;  3W20 A;  3MDP A;  3PLQ A;  4YG0 A;  5EPA A;  5F32 A;  4LXL A;  1AL2 3;  1F15 A;  5JOZ A;  4GB3 1;  1IHM A;  5CNA A;  4YSF A;  4A2U A;  5IVC A;  1W9W A;  2NQY A;  2W1Q A;  2BVV A;  2QBX A;  1Z7S 2;  1XSR A;  5T54 A;  3V65 A;  4XJW A;  3VLB B;  4BH9 A;  3B02 A;  1W99 A;  4QHZ A;  1BK1 A;  4P08 A;  4MET A;  5SV8 A;  4PLO A;  1NCQ B;  4E2S A;  1XNC A;  5A6Q A;  5LEK A;  3RI8 A;  1JHN A;  1MVQ A;  4Y1Z A;  4TXW A;  5GZF A;  5HCA A;  5T5P A;  5FLJ A;  1I1E A;  5DMY A;  1CAU A;  3POB A;  3WF1 A;  4OI0 A;  4C1W A;  1J84 A;  3ZSJ A;  4O9G A;  1LHV A;  2VZU A;  4IE0 A;  1SBE A;  1QJX 1;  5EQU A;  3WZ1 A;  4BXS V;  5A3T A;  5F3G A;  1FMD 2;  2NMO A;  2HWD 3; 
#chains in the Genus database with same CATH homology
 5FZL A;  5FYZ A;  3K2O A;  5FYY A;  5A1F A;  4LIV A;  5FY7 A;  2WWJ A;  5FZD A;  4CCL A;  2P5B A;  4LIT A;  5A3W A;  2XDV A;  5FZ7 A;  3PU3 A;  5IWF A;  5A7S A;  4DO0 A;  4XDP A;  5A7N A;  5FZK A;  5FYU A;  4LIU A;  5IW0 A;  5FPU A;  4GAZ A;  4QX8 A;  5FUN A;  5FPB A;  5FZO A;  5ANQ A;  5A7Q A;  4GJZ A;  5F5C A;  5FP4 A;  2OX0 A;  2Q8E A;  4EYU A;  3PU8 A;  3AL6 A;  5FYC A;  3KV9 A;  5A1L A;  5FYH A;  5F3C A;  3AVR A;  5FY8 A;  5LY2 A;  3KV6 A;  4CCJ A;  4EZ4 A;  3LD8 A;  3PUR A;  3K3N A;  2XXZ A;  5FXX A;  2W2I A;  5LWB A;  4TN7 A;  4QU1 A;  5LW9 A;  2GP5 A;  3KV4 A;  4V2V A;  5FXV A;  4CCM A;  5FPL A;  5FXZ A;  4NUB A;  5FP9 A;  2WWU A;  5IVJ A;  5FP7 A;  3N9N A;  1VRB A;  4QXH A;  5FYS A;  5ISL A;  5FZI A;  2YPD A;  3N9P A;  4UF0 B;  4URA A;  4XDO A;  5IVF A;  2VD7 A;  4HON A;  5FPA A;  5FZ4 A;  2OQ6 A;  5A7O A;  5FY4 A;  2OT7 A;  4Y33 A;  4EZH A;  4QWN A;  5A7W A;  4GD4 A;  4IGQ A;  2XML A;  5FWJ A;  5FZA A;  4BIS A;  4D6S A;  5FZ8 A;  3N9O A;  2Q8C A;  2YU1 A;  5FZG A;  2GP3 A;  5FZO B;  3KVA A;  4BU2 A;  5FZF A;  5IVB A;  4D6Q A;  5FZ3 A;  2XUE A;  3AL5 A;  3DXT A;  5FYV A;  5FZB A;  4C8D A;  4E4H A;  5A80 A;  5A7P A;  5FUP A;  3PTR B;  5F3I A;  5FY9 A;  5FJK A;  5IVE A;  5F2S A;  3U78 A;  5FXW A;  3ZPO A;  4QXC A;  5IVV A;  4AAP A;  2OS2 A;  5F2W A;  5FP3 A;  5F5A A;  2PXJ A;  5FYI A;  5FZM A;  5KR7 A;  5FY1 A;  5F5I A;  4CCK A;  5F3E A;  3NJY A;  2Q8D A;  4QX7 A;  5FP8 A;  3U4S A;  3OPT A;  3ZLI A;  4UF0 A;  3PUS A;  2YU2 A;  5FZ6 A;  5FYB A;  5FYM A;  5F32 A;  3PUA A;  5IVY A;  3N9L A;  5K4L A;  5CEH A;  4LXL A;  5F37 A;  5FZ9 A;  4GJY A;  5FZE A;  5FY0 A;  3KV5 A;  3DXU A;  5A7W B;  5IVC A;  2YBK A;  4HOO A;  4ASK A;  4CUG A;  3RVH A;  4IGP A;  4CCN A;  4IGO A;  4DIQ A;  4BXF A;  3K3O A;  5FYT A;  4V2W A;  5LY1 A;  3PUQ A;  5FZC A;  4CSW A;  3N9M A;  4QXB A;  2YBS A;  3AVS A;  4CCO A;  5F39 A;  5FZ0 A;  5FBJ A;  5FY5 A;  4AI9 A;  5FZH A;  5A3P A;  5FV3 A;  5A3N A;  2OQ7 A;  3KVB A;  3PDQ A;  5E6H A;  5FZ1 A;  4Y3O A;  4Y4R A;  3OPW A;  2YBP A;  5FWE A;  5FPV A;  3UYJ A;  4D6R A;  5A3T A;  5F3G A;  5FJH A;  3LDB A;  3N9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...