1VBD2

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
266
Chain Sequence
CGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 60
structure length 266
sequence length 266
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vbd200
1AR91 1VBB1 4CEYA 2WZR3 1FPN1 1RHI3 1COV3 1WCDJ 2RMU1 1RUG2 4Q4X3 3VBRA 4CDUA 1AR61 2IZWA 3ZFGB 3ZFFB 2RS33 1EAH1 3VDDB 1RUF2 4YVSB 1QJY2 1A6CA 2HWE2 4NWVA 1NOVA 4GH4C 5A32B 5K0UC 1AYN3 5J96B 4Q4W3 1RB8G 1RUI2 1GFF2 3JBG2 4Y4YA 3NAPC 1HRI2 1PVC3 2XBO1 1RUG3 1PO22 1VBD1 3M8LA 1ZBE3 5C4WB 4CDXB 4EJRA 4Z92B 2X5IC 1TME2 1VBC1 1AYM1 1D4M1 1RUF3 1QJY3 5CFCB 1X36A 4RFT0 4QPIA 1MQTC 4WM7B 5ABJC 4RR3B 1QJX2 3VBFC 1RUI3 2HWC2 4AEDB 1OOPC 5GKAC 3JBG3 4N53C 1RUE2 4CDQB 1HRI3 1RMU2 5C8CC 3ZFEC 1NG0A 2WWSA 1PO23 3CJIB 3VBUB 2RR11 1VBA2 1TME3 3VBOB 5LK7B 2BFUL 3DPRA 3VBSC 1HRV1 1B35C 2HWB1 1RUJ1 2HWC3 1MEC1 4IV1B 1RUE3 4SBVA 4YVWC 3VBFA 5ABJA 1RMU3 1K5MB 1RUD1 4JGYB 1OOPA 4JGZB 1PGW2 1FMD2 4RS5A 5CFDB 1VBA3 5C8CA 3ZFEA 1BEV1 1NCRA 1R081 1OPOA 1BBT2 5AC92 5L7OB 2BFUS 4IV3C 1VRH1 1ND2B 3J8F2 1POV0 3VBSA 1RUH1 2RM22 5D8AB 4RQPB 1EV12 1QQP3 4PDWB 1R091 4LLFA 1VBE3 5BNPA 1AL21 1V9U1 1R1A1 1Z7S2 1FMD3 4CEYB 2HWF2 2HWD2 2RS11 2ZTNA 4CEWB 1AR81 1RVF1 1BBT3 4GB31 4WM8A 5AC93 2RS53 1H8TA 2R072 5J98B 1AL0G 1TMF2 1ASJ2 1F2NA 1FOD1 2RM23 2GSYA 1EV13 2Y26A 4RHV1 1RHI1 3JD72 5ACA2 2HWD3 2WFF3 4CDWC 1ND3A 1ZBA3 2R042 1AR72 1POV1 1RUC2 1AYN1 2R073 1TMF3 4Q4W1 1ASJ3 4QPIB 1AR92 1VBB2 2BBVA 4Q4V3 1FPN2 1PVC1 1VB4A 2RMU2 3TN93 5ACA3 1AR62 1CD3G 1NCQC 5C9AA 1ZBE1 5DDJ1 1NA1A 1EAH2 3JB4C 4GMP3 1OHFA 2R061 3DPRB 3ZFGC 3ZFFC 5JZGB 3VDDC 4YVSC 2WS91 2BPA2 2HWE3 1FPN3 2XBO2 2RMU3 1VBD2 4QPGB 4GH4A 1VBC2 1AYM2 1D4M2 5K0UA 4N43C 4RS5B 3VBHC 5C4WC 4CDXC 1NCRB 5BNNC 3NAPA 1AUYA 5CFCC 2XBO3 3VBSB 5BNOB 4WM7C 2X5IA 1VBD3 4RR3C 2RR12 4AEDC 1QJX3 2PLV1 5A32A 5BNPB 1VBC3 1MQTA 4CDQC 1PGL2 1PIV1 1HRV2 3CJIC 3VBUC 2HWB2 1RUJ2 2FZ2A 1NY71 4N43A 4N53A 3VBHA 3VBOC 4WM8B 1H8TB 1MEC2 1QQP1 3JB8A 4CDXA 1HXS1 3S6PA 4FTEA 1HQNA 1RUD2 1VBE1 5BNNA 5CFCA 5FOJB 2RR13 4IV1C 4WM7A 1PO11 1B35A 1M06G 4RR3A 1R082 1K5MC 4JGYC 1BBT1 4AEDA 1ND3B 4JGZC 3HAGA 2RS51 1VAKA 1RUJ3 2HWB3 5CFDC 2ZZQA 4YVWA 1RUH2 3CJIA 3VBUA 1MEC3 4Q4Y1 3VBRB 1QJU1 4CDUB 1C8M1 1C8NA 4BCUA 1R092 2MEV1 1AL22 1V9U2 1R1A2 1ND2C 2WFF1 3J8F3 5D8AC 4RQPC 2RS12 1ZBA1 4FSJA 4IV3A 1AR82 1RVF2 5C9AB 4PDWC 1R083 2FZ1A 2WZR1 4GB32 1NA1B 1COV1 4Q4X1 4CEYC 1Z7S3 2TBVA 1K5MA 4JGYA 2HWF3 1FOD2 1RUH3 2RS31 4JGZA 5A33A 4CEWC 4RHV2 4Q4V1 1R093 1RHI2 1BMV1 3TN91 1R1A3 2BUKA 1CJDA 2RS13 2GH8A 1ND2A 1AR83 1RVF3 4GB33 5D8AA 4GH4B 1IHMA 3JD73 1AYN2 1RUG1 1X33A 1SMVA 5K0UB 4FTSA 4PDWA 4Q4W2 1FOD3 2WLPA 1RUF1 2R043 4RHV3 1QJY1 2HWE1 1AR73 1PVC2 3NAPB 4CDWA 2QQPA 4CEWA 1RUC3 1ZBE2 5DDJ2 1RUI1 4QPIC 2X5IB 3JBG1 1AR93 1VBB3 1POV3 1HRI1 1PO21 2R062 1AR63 1MQTB 5ABJB 3VBFB 1TME1 2WS92 1EAH3 4NWWA 1OOPB 1NCQA 4N43B 4N53B 3VBHB 5C8CB 3DPRC 3ZFEB 5JZGC 1QJX1 5DDJ3 5BNNB 2HWC1 1RUE1 3ZFGA 3ZFFA 1RMU1 3VDDA 2R063 4QPGC 4YVSA 1B35B 1VBA1 2WS93 1AYM3 1D4M3 4RS5C 2ZAHA 4YVWB 1NCRC 2DF7A 2PLV2 1PGL1 5C4WA 5JZGA 5BNOC 1PIV2 1VB2A 4FTBA 1PGW1 4Y5Z0 4IV3B 1NY72 1FMD1 5BNPC 1QQP2 4QPGA 1BEV2 1HXS2 1VBE2 5AC91 1HRV3 1E57A 5A33B 5FMOL 1VRH2 4GMP0 3J8F1 4WM8C 4CDQA 1QJZA 2PLV3 1H8TC 2RM21 1PO12 1EV11 1PIV3 5L7OC 1RUD3 2RS52 3VBOA 1Z7S1 2HWF1 2HWD1 5BNOA 4Q4Y2 1QJU2 1BEV3 1C8M2 1HXS3 1ND3C 2MEV2 4IV1A 2R071 1VRH3 1TMF1 2WFF2 3ZXAC 1ASJ1 3VBRC 4CDWB 1ZBA2 4CDUC 1PO13 5FMOS 1F8VA 5CFDA 2WZR2 1HX6A 1COV2 3JD71 1AL23 1V9U3 4Q4X2 5ACA1 1W39A 2RS32 5L7OA 5C9AC 4Q4Y3 1DDLA 3IDEA 1QJU3 2R041 1C8M3 4GMP1 4Q4V2 2XPJA 1AR71 1NA1C 2VQ0A 2MEV3 3TN92 1BMV2 4RQPA 1RUC1 3FBMA 1NCQB 3LOBA
chains in the Genus database with same CATH superfamily
1QNWA 3CU7A 3IZOA 3N9LA 5F6KA 1OXCA 5FZIA 4BDVB 1VBB1 3MO4A 1FPN1 4NIHA 2XXZA 2RMU1 4Q4X3 1NLQA 4CDUA 1Q43A 1AR61 4NHMA 3RWKX 1TVGA 1W2OA 1O7FA 1XU1A 3DXUA 3HBZA 3U10A 3NJXA 1JZ6A 4KL1A 2W1UA 2Z5WA 1A6CA 3WNNA 1GP4A 4AFCA 4COVA 3B94A 4A7KA 5HV4A 1SDDB 2DVDA 2JB4A 5K0UC 1AYN3 4LO5B 1Y9GA 1HDKA 2C6SA 1QGLA 2CAVA 2WYFA 2PXJA 4XYXA 4Q4W3 3WDVA 3RZZA 2SLIA 4N90A 4BQ4A 4R9CA 3WQ0A 3NKGA 3JBG2 3I2KA 4FOYA 3KV5A 1O3QA 4IE0A 1JOPA 5LBEA 3NAPC 1GV9A 1MS9A 1G9CA 4K21A 3R6SA 1V6OA 2ZX1A 1RUG3 2P3KA 3M8LA 5KHJA 1FT9A 4CDXB 5CISA 1ZX5A 4EJRA 4NPLA 1VBC1 1K42A 3MW4A 3LEKA 1GLHA 2ZHKA 1OLMA 4AVBA 5A80A 2ET1A 3W5NA 1PHMA 1SZBA 1PNGA 1X36A 2QQNA 3QACA 4QPIA 1B09A 5AVPA 4WM7B 1Q3EA 5A7WA 1OF3A 4DB5A 4GWIA 4IL7A 3HT1A 2UY8A 1RUI3 2ARXA 4AEDB 3O0WA 3OUJA 3LE0A 3FFQA 3OBAA 5FP4A 1VPHA 3W59A 4DUVA 2DVAA 4N53C 1WCQA 1J3QA 1UX7A 1RMU2 2IVJA 3B9CA 1IPKA 3QBQA 4DOUA 1RTVA 2W39A 2GMMA 3IM0A 1ACCA 5J1XA 1V6LA 2E31A 2RR11 3QCWA 1GP5A 5FZ9A 2XQXA 3FL7A 4DXTA 3SC7X 3VBOB 4RL7A 5FYIA 2BFUL 4BXFA 1CJPA 2VO5A 3CZUA 4I3GA 4B1MA 2QE3A 4JQTA 4PQQA 3AFKA 5LRRA 2QQIA 4DEQA 3PU8A 4QKNA 4QX1A 5JXJA 1B35C 2B7YA 5LA0A 3MV01 1RUJ1 5KXEA 4PF1A 1SPPB 2J1RA 3O7OA 3AMMA 3ILFA 4I3PA 3LB9A 3NNFA 4OULA 4PF5A 2DUQA 4MGZE 4XFFA 1MEC1 3PL0A 5FYUA 2XGXA 1RUE3 2QZ3A 4HKLA 3AYEA 4P00B 5EYXA 3WF3A 3HPNA 4JGYB 3J9SA 4JGZB 3GJAA 1HN0A 1L7LA 3I59A 1NQJA 3B01A 1Q8OA 2TNFA 3IN9A 3LCPA 4CP1A 4RS5A 1IPJA 2Y0OA 1VBA3 2QQVA 3M3IA 4K6BA 3AMNA 1BJQA 2W46A 2VC9A 3AMHA 4P5HA 4UAPA 4Z07A 4IEYA 5FY8A 3U07A 3GYDA 4B8EA 1W6QB 2XUMA 5JI9A 1W06A 2G9ZA 1DQ0A 4QX5A 4RGKA 3RG0A 1O8PA 5HI0A 5L7OB 2BFUS 1OQ1A 3PU3A 2GDFA 2ZKLA 5IK8A 4OLLA 2XJQA 4F3JA 3FUQA 1RUH1 2RM22 5D8AB 3FBYA 2BYVE 3I2DA 1PX3A 3THTA 5J36A 2ILMA 4PDWB 4YFWA 2UU8A 5BNPA 4IQPA 4O9EA 3ZSKA 1J1LA 1R1A1 3CO2A 5C3OA 3T08A 1FMD3 4CEYB 4LXLA 1WMDA 1FV3A 2HWD2 4B4QA 2P3IA 4XC9A 2RVAA 2RS11 1W6PA 2D44A 2KXLA 4CEWB 1RVF1 3OCPA 5JIAA 2VM9A 1BBT3 3T0AA 5DXDA 4WM8A 4A45A 2VCCA 5L19A 1UY3A 5J48A 3DKQA 4NO4A 1H8TA 3D6EA 1AL0G 2E7AA 4MO3M 1AXKA 3W21A 4FPYA 2R0FA 1ASJ2 1ULPA 5A7QA 3N9NA 3LA3A 3KCCA 1EV13 2MHFA 4META 5FYSA 3TNQA 1US3A 2Y26A 4QXBA 4XDPA 4Y22B 3SHRA 3WQ1A 2LW8A 4CCLA 5IT6A 2Y6JA 3FE5A 5CYYA 5ACA2 4NR1A 1ZRIA 4Y1ZA 2D3RA 4J6GA 4S2GA 2DVBA 5IK5A 4QGNA 5DAVA 4AE2A 3LDRA 2WNVC 5A3WA 2VZRA 2RJKA 2WFPA 4H3WA 2E7TA 4N8MA 3GCXA 1ZRCA 1CQ9A 1RUC2 1W9FA 1AYN1 3BKZA 3MW3A 2QQUA 4ZHNA 1P8JA 1TMF3 3W9AA 5C7GA 1ZA4A 1MS3A 4Q4W1 5CA6A 1PMJX 3T2TA 1T2XA 2IXKA 2VZ3A 3GDBA 4A42A 4TN7A 3IDCB 5LY1A 3KMHA 4KWKA 4P9LA 3IPVA 4AW7A 4G9SB 4IGPA 5T3NA 3THPA 4NROA 4QGMA 5EIYB 1S0CA 5C9AA 3N36A 5GLVA 1D2SA 5F6LB 5A7OA 2WT2A 4YM2A 2Y34A 1W9TA 1EAH2 2OZ6A 2VZVA 2G1MA 3AP5A 1BXHA 4Y3OA 3E6DA 1W99A 1LODA 3BTXA 1O3SA 2Y6HA 5A1LA 5FZ6A 1S55A 1LAJA 4CCNA 1O4TA 4X6QB 2WL1A 2UYAA 2WNVA 3DPRB 3ZFFC 3VDDC 1OVPA 4AG4A 4AK3A 4NHXA 5AVAA 3ABZA 4JHZA 2BPA2 1ZREA 1YQ8A 3IIAA 1LOGA 4FPGA 4N9IA 5FREA 5SV8A 1ZZCA 4QPGB 3WVJA 3L9JT 4B7EA 4XUQA 2W95A 3DECA 4ASLA 5JPMB 5I0TA 4Z82A 1N1SA 2OYZA 3PDQA 3SH5A 1SCSA 2X05A 5HCHA 3AKRA 3WUDA 4Y5TA 1CN1A 2ZX2A 4BPZA 3CNAA 4NOTA 2ZGNA 4D6QA 2RV9A 4JKMA 1EUUA 1NCRB 3BALA 1PK6C 5FZMA 2JDKA 5FPBA 1W9SA 3N9PA 5C3QA 2AGSA 5JR2A 1BCXA 5A3NA 1UOJA 1OA4A 2JE8A 2FDFA 4DFSA 4ONUA 3PJQA 2XBO3 2VMIA 1MACA 2EXHA 1UMIA 1VBD3 5FYBA 1W8NA 4RR3C 4BIOA 1J84A 4Z2AA 4FCAA 4DRRA 3UKVA 2VNGA 2PLV1 3L2HA 4HKOA 1TQ5A 3MDPA 3FJSA 1AX1A 1XBFA 3FN9A 4XILA 1MQTA 3HNYM 4CDQC 2N7GA 1PGL2 3T0DA 4LBQB 4K1ZA 3CL1A 5IK4A 1F5JA 1RJ8A 1HRV2 4QT6A 1YFWA 2GNMA 1XE8A 1QHDA 1IQDC 3WNLA 4AVSA 5GZDA 3B9IA 2W92A 3ZYBA 3H1MA 1XNAA 5FIXA 3B93A 4MSVA 1ZRRA 1KFUL 3NNLA 3WW4A 5KXDA 2KR2A 5FMCA 1HXS1 4PLMA 3A23A 3S6PA 4FTEA 4YPJA 5IVBA 2BQPA 4R9DA 3RSJA 5C3PA 1YIPA 4Y1VA 4ZXKA 4MHUA 2UWAA 5FKBA 5IWFA 4IV1C 4NE9A 5CNAA 1PO11 3H3ZA 2Q1FA 3VZLA 3WHUA 5K9YA 4RR3A 4AQTA 1AJKA 1DHKB 1W6MA 1BBT1 2ZEXA 4K1YA 5IFTA 3HAGA 3LFMA 2PHRA 4QQPA 1VAKA 2HWB3 4U36A 2JG8C 5CU1A 5CFDC 1OMIA 2VL4A 3OSDA 3VKMA 4YVWA 3MZHA 2EIDA 3VBRB 4NUBA 2YZ4A 2WNOA 3BCWA 3T09A 5T5PA 1C8NA 3CEWA 2XQRA 4EYUA 3C7GA 2H0VA 1R092 3NV1A 1LNSA 3EQEA 1AL22 3JZVA 4QXCA 4FPOB 1UMHA 1ND2C 1EUTA 1VMFA 2OPKA 4HK9A 1UOBA 3K4AA 2O0OA 4CP0A 2VMDA 5FKCA 5FFOC 1NLSA 1AR82 2Z42A 1DZQA 5C8WA 2WZR1 4MGIE 4HVOA 2YFUA 1JYVA 4FPHA 4LOSA 1COV1 1Y4WA 3MUY1 1MZ6A 4XJ8A 1DU3D 5FQ0A 2PHTA 2P4EA 5A6QA 2NMOA 2RS31 4AL9A 4JCKA 1NXMA 2XLAA 1D0GA 3HOBA 4RHV2 4CCKA 2CV6A 1RXGA 1BMV1 1UYXA 1UAIA 3LSEA 2BUKA 4OUMA 1WMFA 2ADDA 1GZTA 2PN5A 1DLCA 3J7NA 1UY2A 1G6NA 4NRQA 1DGLA 3N3HA 3M3QA 2QUOA 4QX2A 5DAWA 2VUJA 3AP7A 3AP6A 1ND2A 2V73A 1BK1A 3DEMA 1J59A 5LBFA 2VOVA 4GB33 1QMJA 4KI5M 3UETA 3WNOA 4GH4B 1YC61 5FBZA 5IFPA 1Y9QA 3T4VA 5CEHA 3S0MA 3Q8BA 2BZDA 3DGTA 1FOD3 3PHMA 5LEKA 5B2GB 5E89A 5F5AA 4QB6A 1AR73 4MGKE 4BZ4A 3ILNA 2OKXA 1QXRA 2H0BA 4AVVA 3KT4A 4DUWA 4JKKA 4LIVA 4ATEA 4Q1PA 2ZX0A 4FFGA 1PMIA 1WCKA 5DDJ2 3AKTA 2VQTA 4AFDA 1AR93 1POV3 4LIUA 3ZYRA 4AWDA 1HRI1 2WA4A 3M70A 2WBKA 1PO21 4QQOA 3F95A 3UKNA 4DS0A 4M4PA 5FY4A 2WT1A 3AJYA 4XDOA 4ARYA 1IZ3A 5I0UA 1OOPB 3GBWA 1JYWA 2ZBJA 4AQ2A 4K9SA 1E5HA 3I2JA 4Y26A 3VBHB 5FZBA 4LBLA 5C8CB 4AAXA 3POSA 5FZAA 1ULGA 3IMMA 3OF1A 1ZNPA 2JXAA 4OCTA 5FZ3A 2CNAA 3RYKA 1J83A 2HWC1 2VVFA 4IEVA 1UQXA 1WLTA 3KD4A 4UBGA 3VDCA 4Q0QA 5ERLA 3RZJA 1UZWA 3S7EA 2VZTA 5F2WA 3S5QA 3SCGA 3ZFGA 1UN1A 3IAPA 3WY6A 3V0AA 2R063 3USSA 4AFAA 4BQ2A 1W8FA 2VZPA 4MLOA 2EXIA 3TEWA 3VB9A 1UKGA 4B1LA 3WEZA 4DXRA 3D4KA 1AYM3 1D4M3 1GNHA 1WD4A 2ETEA 2YROA 3ZN4A 4P9JA 1UL9A 2AEZA 5F3EA 1N1YA 4JTNA 3A0KA 2ES3A 4RGAA 5E6HA 4YW6A 3RZGA 3RWNA 4OI1A 1S0GA 1CAXA 4Q8LA 1C5IA 2DF7A 2WDBA 3BGAA 3FFZA 1WKYA 2DUPA 3W20A 3AM2A 4AOCA 4E27A 4F83A 5C3SA 5KWRA 1WLDA 2QQLA 3AK0A 4H2AA 2B5HA 1G8WA 3P3PA 2WRAA 5C4WA 1H2NA 4DIQA 2WWUA 2OA2A 1F9KA 1PIV2 4UFMA 5EV7A 3UK9A 2IFWA 1WD3A 1JUIA 4LBOA 1H9PA 4IV3B 4Y5Z0 4YG3A 4Q27A 4V2VA 5IATA 4Y1YA 3O0VA 2QFEA 4HETA 4YM3A 4COUA 1UOFA 3UV9A 1JS9A 3SCHA 3KS7A 5EP9A 4E2GA 3B02A 4XJ9A 1EY2A 1SLLA 5GZFA 5AC91 3IKWA 4E4HA 5A33B 3I3EA 5DAPA 2W68A 5FY0A 4YFZA 4QX8A 5LRSA 1H0BA 2PFWA 4FPJA 4XIKA 2VMCA 1PNFA 4NHYA 3USUA 2WABA 5FCCA 3RYRA 2DU1A 5FK7A 2W52A 2XLFA 4XUTA 2K9ZA 4QMAA 3T2OA 4CU6A 1S1AA 2DVGA 2J1UA 2GNDA 1XJAA 4ZY9A 4Q8KA 5FYYA 3SEEA 3H50A 3LPGA 5JOWA 1JYNA 2J1AA 4MXWA 1TNRA 4KNCA 4BK4A 5HPOA 1RGSA 1O4ZA 1QJU2 4EN0A 2W47A 2JECA 2MEV2 3H42B 4B4RA 3A22A 1H1AA 4FXKB 2VY0A 2R071 4R9BA 2ID4A 2JDUA 4XAAA 5EPAA 3O1UA 4OI4A 3ZXAC 5H9RA 2JB8A 4YZ5A 4FP2A 5FZFA 1S0EA 2VTFA 1W05A 3MV11 4FSJA 1F8VA 4LHKA 2L9LA 1LOEA 3HEIA 4LKDA 3WUCA 2D93A 1WA4A 1X9TA 2NPIA 2D40A 4YZ4A 4B4PA 2FQPA 1C57A 3ECQA 1V9U3 4Y33A 1UY0A 4Q0UA 4E4ZA 3HQXA 4EQVA 4QWNA 1JYIA 1BK0A 3POEA 2GH2A 2YC2A 1O4YA 5LBBA 5H9QA 4JAAA 5EQUA 3DN7A 3WNMA 1C8M3 3AL6A 4Q4V2 1QU0A 1AR71 2GU9A 2V5DA 1NA1C 3INAA 4Q0PA 4W65A 3T2PA 1V6JA 1XU2A 4RQPA 3QH6A 4AQSA 5LEJA 2FHRA 2P6CA 4QQHA 1F5FA 3GZAA 1NCQB 4AI8A 5F2SA 4CP2A 2QQWA 2VMEA 3X29B 3O1MA 5JPNB 2B4KA 1AR91 3POBA 1DBNA 1JHJA 4UBHA 4CCEA 3KCXA 4LORA 1RHI3 3BU7A 3U11A 1UIJA 5APAA 2AREA 4HOOA 2IZWA 4R52A 3S30A 1T6BX 1AHSA 1RUF2 4YVSB 4LBNA 1QJY2 1HB4A 2HWE2 4DXSA 2ZGKA 3FZ3A 4NJ4A 2LALA 4QHBA 4AHZA 3LGRA 5JOXA 5A32B 5JWPA 5DZFA 3NL1A 4JDMA 5J96B 1W6NA 1W0PA 2JDMA 3AKSA 3KCYA 2RHPA 2WQZC 1BZWA 3ZXLA 2KD7A 4LEJA 1S0DA 4ZU7A 4XHBA 1NUKA 1JU3A 4GAZA 2DU0A 5EHDA 2VECA 2WLQA 4WVVA 2Q30A 2A6VA 2W3JA 2X8KA 2W91A 1ZBE3 1FNYA 4IEQA 4WVMB 5FP8A 2X5IC 1TME2 1AYM1 1D4M1 4A6OA 4IEUA 3FHIB 5CFCB 2ZEWA 4GIQA 3DKWA 1XNBA 4R9AA 5FY1A 2BOIA 2DCYA 3AZYA 5C71A 1LEMA 2ZMNA 4UW6A 3WW1A 4UI9L 3VUOA 1QJX2 4Y1UA 5IW0A 1YEWA 2XHNA 4QHOA 5LA2A 1W90A 2CWMA 2LROA 2XHKA 1CAVB 2WWJA 3JBG3 4FO9A 4LE3A 3U4SA 2WR9A 3VKLA 1F15A 3S5AA 5KHGA 2VZOA 3CMGA 3H0OA 5FZCA 5LA1A 3TAYA 3CJIB 4FPCA 3VBUB 4ES8A 2GNBA 1HQLA 2Q8CA 2XONA 4QM8A 5B4XA 5LK7B 2YY1A 1FV2A 3WOGA 3VBSC 1U0AA 2WO7A 4R4ZA 1Q56A 1YJKA 4AVAA 1F4HA 4M3CA 4YM1A 5JXIA 4TSVA 2D6KA 3ZMNA 3LEMA 2DTWA 2ENRA 2R30A 5CVRA 4XMAA 1KD7A 2AR6A 4FFHA 5F3CA 4MX3A 4LO8A 2XVLA 1RMU3 1K5MB 3CKHA 1KRIA 3S57A 5J09A 3K3OA 4AR2A 3DYMA 2XOMA 1PGW2 3T1LA 1GOGA 4M00A 2OT7A 4QXKA 3PUAA 4Y20B 3BIEA 1GP6A 1UNBA 3NNGA 2A6ZA 3VKOA 3WHTA 1IS4A 1CGPA 1IGOA 1CPNA 1Q5OA 5H9SA 3WDWA 4UFIA 1R081 3PVBB 2TUNA 2QBXA 2R7EB 3MF9A 2WAOA 2YXSA 2O8OA 2GAUA 1V00A 2DUOA 4NRPA 4QKDA 2AUYA 1W8HA 4Q0SA 3VBSA 4DQAA 1YXWA 2OS2A 1QQP3 5A6ZA 2BEOA 1PVXA 3E6BA 1IKPA 2RJ2A 5DN2A 3UL2A 2Q1ZB 1VBE3 1V9U1 3POYA 3T3YA 2B8MA 1SLCA 1TEIA 3OYWA 4FOVA 4LNVA 4NIDA 2JG9B 3I3MA 1H6YA 4HANA 2P2KA 2WN3A 1S0JA 3MYXA 4G3YC 1DIWA 1WLWA 2C9AA 4W6WA 4CA9A 3H3UA 3IDBB 1CR7A 3BTZA 4EN9B 4YW1A 4OMDA 2YBPA 4HG6B 4CYDA 5JMCA 2ORXA 2RM23 3TWIA 4N7UA 2GSYA 3I2GA 2VCBA 2Q5TA 3KV9A 1R64A 3ST7A 5FP3A 4QM9A 1RHI1 4B3NA 3JD72 2MPFA 4BQ5A 3U4XA 3NQHA 4AZZA 3V0BA 1V6KA 5A3PA 3BPZA 1AJOA 2HWD3 4CDWC 1ND3A 1UZZA 3UGFA 2VPVA 1W8ZA 1ZBA3 3KSCA 1NE6A 4O9GA 3NV3A 5DUUA 5I0SA 3OBTA 3DYPA 1YQ2A 3SCFA 3POWA 1X8EA 3KQ4B 1APNA 3N7LA 4XIOA 4JTOA 2BW8A 5FP9A 3SH4A 3SXWA 2ZHLA 2E32A 2IXLA 3BVCA 2ZOEB 1UZVA 4NIIA 1ASJ3 1C1LA 1REFA 4W8JA 4EN6B 1W28A 4QPIB 2VUAA 1VBB2 5A7WB 4X6RB 3LOIA 1FPN2 1X8MA 1VB4A 2H6BA 1RITA 2RMU2 1ZYBA 1DGWA 5SV5A 5ACA3 1A3KA 1AR62 3RS6A 3BI3A 2CGOA 1U5IA 1ZBE1 2WJSA 3ZDSA 1MZFA 2D97A 5IVVA 3H8UA 3LEGA 3JB4C 4HBNA 3O1VA 4GMP3 4LHNA 4JRLA 3VZJA 2OIIA 4GALA 3D5OA 3RI8A 1QWRA 1U5XA 1XSRA 4IEXA 2WNUB 4LHLA 4XFCA 3RQ0A 5FDBA 3TEYA 1QJFA 4WZFA 1RUNA 1JW6A 2VU9A 4L2NA 1W8WA 5JZGB 3OY8A 3P3NA 4XFHA 2WS91 4XUOA 5FXXA 1HW5A 3ZO0B 4MUVA 4CU7A 3WT3A 4LJHA 1SLAA 2XG3A 1DGRA 1FXZA 3KF3A 1XC6A 4NRMA 5FZLA 3SKVA 4I0AA 2VR4A 2VBPA 1LJ7A 5EZWA 4ITCA 1JMUB 3ZX7A 5E88A 4TLFA 4KWJA 4DZGA 1L7QA 1KGYA 1VBC2 1LHUA 4LBKA 2YG0A 2DWRA 3GBFA 3FHAA 1TZOA 2I07B 4LPLA 4UF0B 4RS5B 5K0UA 2ATFA 4OHZA 2D6MA 1GKBA 3I3BA 3O12A 3MPPG 4CDXC 2G4IA 2ZPXA 5BNNC 1JYXA 3NAPA 1AUYA 5FY7A 2BGCA 1JZ5A 1SFNA 3N7MA 3JU9A 4KGQA 2E26A 1QNYA 5JXGA 3PJYA 5A7SA 3ZXJA 3C7OA 3LQCA 3G6JB 1YIFA 4WM7C 3KT1A 4NHKA 4E9KA 4F8AA 4CUBA 2EALA 2RR12 1WLCA 2ZS6B 4AEDC 1CZVA 1LR5A 3K46A 5BNPB 2QZ2A 3PIJA 4KU7A 2ZGSA 1NZCA 1V6MA 2BGPA 3I3DA 3LDBA 2CWSA 3OOXA 4BU2A 2HLEA 4E2SA 3RFRA 5FJHA 1RUJ2 1K45A 1I5PA 1PGSA 2CYFA 4N53A 1SBFA 4ZS3A 1OLME 4WM8B 1N3OA 3VBOC 1QOTA 3NNMA 1J58A 4AVTA 4BXSV 1H8TB 1MEC2 1QQP1 1IPSA 1ENRA 1WBFA 1YQ6A 3JB8A 4XVHA 3ZKYA 4URTA 4CDXA 3RZHA 3ZIXA 2ZX3A 5C3RA 5BNNA 1VBE1 5GLZA 3FLPA 4MGSA 3K51A 5FZ8A 1C4RA 2JWPA 3HNBM 5D21A 4K3UA 5FOJB 3CBNA 3LAGA 4OUEA 1YNAA 2YU2A 3J7MA 4YW5A 4WM7A 1B35A 2ZKNA 3B69A 2HJIA 5HXVA 4BISA 2ORZA 4JGYC 2GC3A 5EJ3A 2R32A 4JGZC 5GZEA 4AEDA 4BQYA 1GWMA 3MIDA 5CBLA 5KC6A 3O5SA 4I2OA 2WYSA 1RC6A 1UF2C 2BBAA 2Y8KA 4CP9A 2RDRA 2A75A 1HJGA 1IS6A 1GR3A 1KJLA 1BVP1 1RUH2 2R0HA 4XJWA 5DQ0A 4Q4Y1 4CCCA 5KXCA 2RG4A 2Z79A 2WSUA 1R1A2 1DQ4A 5EWSA 4L99A 4QU2A 4ZZ5A 3GXUA 3IPVB 3HQRA 3KGZA 2ZA9A 3J8F3 5D8AC 3VL9A 5HCAA 3EXUA 2RS12 2IXJA 3D0JA 1ZBA1 3BOPA 3BOWA 3I97A 3PIGA 4GXLA 4S2FA 3MIHA 5C9AB 1RVF2 1SPPA 4PDWC 4XFIA 2FZ1A 5IVCA 3E1F1 5JOYA 4OVEA 2AH2A 3POGA 2G19A 2LS6A 4Q4X1 4CEYC 1JHNA 1W04A 1Z7S3 4LULA 4KBZA 1OUSA 2HWF3 3JQWA 4FPFA 4JGYA 1CVNA 4JGZA 3OB8A 4NHLA 4CEWC 4TXWA 5A1AA 4HXCA 3BUCA 2CSGA 1DYKA 2PHUA 2WSVA 1R093 1SLIA 2DCTA 4FPLA 4YYOA 2XJUA 1W6QA 4A2UA 5F3GA 2EIBA 2VBDA 3BODA 1XQNA 1KEXA 4LR4A 4XJUA 3ZM8A 3WNXA 4CCMA 2HEWF 4GKYA 4WV8A 2GH8A 1AR83 4Q5OA 2DV9A 2IXIA 3WW3A 1O5LA 5FZKA 3RJRA 1H6XA 3EBRA 4D94A 5D8AA 4URAA 5HV0A 1AYN2 1RUG1 1GQPA 3FUOA 1AXYA 4A3ZA 1AX0A 3P1IA 4PDWA 4Q4W2 5F7UA 1RJ7A 3M7AA 5T5JA 2ARBA 4COZA 2A70A 1S2BA 3WP5A 5LK5A 2WUHA 4K8FA 2R043 4RHV3 1LHNA 5FZOA 4YZ3A 4K40A 2QQPA 5I0RA 1ZRFA 3E5XA 2E6VA 4CEWA 4E8DA 2F17A 5H9PA 3LIHA 5LCWL 1O3TA 4WBBA 4L97A 1RUI1 1SLTA 2IFRA 3KZ4C 4U2AA 1RUOA 1W2NA 3GBGA 4YNIA 3VGIA 3VKFC 1YLLA 3ASIA 1C28A 2YV8A 1URXA 1HV0A 3PMEA 4YZ2A 5E1RA 4P08A 5J3UA 1JZ8A 3T0BA 4P9YA 1MQTB 5CKMA 3V65A 1SDWA 2BV4A 4LHSA 3J4UH 3I2IA 3W58A 2ZGTA 4MGTA 4DINB 5ABJB 1U5ZA 3VBFB 4L92A 2P34A 5GALA 4AEMA 1KDKA 3BU0A 1FYUA 1ALYA 4UW3A 3WZ1A 3FLRA 4TLGA 4NAMA 1XNDA 2YBSA 3WNKA 3DPRC 4JDOA 3ZFEB 1TNFA 1TE1B 2BOJA 1W9YA 1DYOA 5DDJ3 2RE9A 3ZN6B 1US2A 4CVUA 1HKDA 1O91A 2IC1A 1RUE1 3DXTA 3KV4A 1HN1A 1NX9A 3ZFFA 5FPVA 4EWDA 3VDDA 2PA7A 4QPGC 3THCA 4BHPA 1F31A 3TRSB 4B29A 1VBA1 4AFBA 4GZ9A 1LOFC 4Q2FA 1LTEA 1F35A 2E53A 3M3OA 2QNKA 1OVSA 4BA6A 1YQCA 4YZ1A 1OH3A 1ZVFA 2YGLA 4MYEA 3WSOA 2Z69A 3K75B 4YVWB 4J1XA 1NCRC 3R4SA 2VOXA 3H9AA 4BB3A 3ZR5A 1G7YA 3ZMOA 4ZZ8A 2E63A 2JDAA 2PLV2 4BK5A 3ATGA 2ZMLA 2X09A 4Y24A 3UYJA 2GNTA 1PGL1 4JDNA 4DY3A 3AL5A 1GMMA 1NAEA 1PK6A 3NSTA 1QDOA 1LESA 1WW4A 3R05A 2ARCA 4COYA 4IETA 1FMD1 1XYOA 3V64A 3R4DB 3VZMA 3WLUA 4QPGA 1BEV2 1ZZ9A 4O61A 1HXS2 1SBDA 3TYJA 5FQ0B 5KC5A 2SBAA 4P5YA 1DGWX 1LOFA 1W0OA 4IEPA 2Z4FA 1D4VB 4AEJA 3VD5A 3LSDA 2OUHA 4W50A 1VRH2 4LMFA 1WGPA 3J8F1 4CDQA 3LF7A 1OFNA 5F1RA 4UFLA 1UXXX 4AQ6A 2EIEA 5C5TA 2NZ9A 1PO12 1J3RA 2VXRA 1EV11 1W6OA 3G7DA 3SITA 3AMQA 4QXHA 1NE4A 1PIV3 1RUD3 4XURA 5GLUA 1UD1A 1Z7S1 4C90A 2HWF1 4Z1VA 3C7EA 4OZXA 2Y6FA 1OH4A 1A34A 3QLQA 4OQ9A 2H6CA 2XVGA 1GANA 2A6XA 4LBQD 5BYNA 1STMA 3MPBA 4IEZA 4IE4A 2D3SA 2YUEA 3E5QA 4IV1A 4IUGA 2A1XA 1TMF1 2J1SA 4LBQA 1N1VA 1DQ2A 2RDSA 4OHXA 4XOGA 3VBRC 2Y38A 5IVJA 4HPKB 4QX7A 5CFDA 2YC0A 2JG8A 2WZR2 1CAWB 2ZMKA 3KM5A 5T5OA 4EZHA 1RL3A 4LBJA 1COV2 1GUIA 3H8OA 5IAXA 3E97A 5C70A 4TTGA 2E9QA 2DBNA 2RS32 4FOQA 5KR7A 4D7YA 1MZEA 3ZYPA 3O1RA 4AI1A 1DDLA 1QJU3 2BWCA 2R041 3I2HA 3ZSMA 4LUKA 2RDQA 3I8TA 5JIUA 4IEOA 1KS4A 2VQ0A 2MEV3 1BMV2 3B00A 2C4XA 1BLZA 4AF9A 4TZDA 4HMZA 4WVWA 3ZN5A 4PI0A 4LTAA 3H7JA 3LOBA 3PUIA 5DABA 1VJ2A 3DYOA 2FD8A 2WZPP 1WCDJ 3VBRA 1H2LA 4WVZA 1LCLA 3RGBA 3MFCA 4UW5A 2ZZJA 4H7LA 1JZ7A 2EICA 1GQGA 3ZFGB 2O1QA 3JUUA 1QIQA 4I02A 4OI2A 3V0AB 3MBWA 1FAYA 4XTPA 4NWVA 5CAZA 4GH4C 2C0ZA 3DL3A 1RINA 2D5HA 3T30A 4A4AA 3AZWA 5LY2A 1M4WA 2D7FA 2EAAA 4W6XA 4A7ZA 1Q8QA 1KXGA 5I8SA 5F8PA 3OGSA 3H3LA 2W2IA 2HEVF 1D2QA 1AF9A 3EO6A 1LU2A 2BTVC 5FZHA 1HRI2 1PVC3 1LGCA 2XBO1 2WKKA 3I49A 2MNGA 2WO1A 4GJZA 1PO22 1VBD1 1YFXA 4XE9A 5LBCA 4HVRA 2HKXA 5C4WB 3GHNA 3BB6A 4Z92B 1YRZA 1LECA 2RDNA 3VN4A 1RUF3 2ZGMA 1YFYA 2R1BA 1QJY3 3N9OA 1SACA 4EE2A 5JMOA 1YFUA 4WZCA 1XOYA 4RFT0 2XL7A 5FP7A 5T55A 2NMNA 2VMGA 3GZEA 3WF0A 3ZXKA 1JUHA 1RXFA 4YRDA 3GZUC 1GZWA 4KWLA 3ORJA 2QQOA 2HWC2 1GZ9A 5F5QA 1OOPC 3FWEA 4OQ8A 1MS5A 4AHWA 4QDSA 4C91A 1H4HA 4D6SA 5C8CC 3USUB 2ZEZA 1XB9A 4YW4A 2Y6GA 2YMZA 2VW1A 3HNMA 1NYWA 4MZUA 1TME3 1UMZA 1XPWA 2DURA 4XQWA 1W2UA 3AMPA 5L36A 3ACLA 4XZPA 5A7NA 3H1YA 2ZHNA 4NPMA 4RYDA 3WG2A 4E4SA 3GZTB 5A70A 1GWKA 2HWB1 2ERFA 3OTFA 1G9AA 4XXAA 4J25A 5BY5A 1NKGA 1YYNA 3JXSA 4ZPIA 5A7PA 4L0PA 2D6OX 4V1PA 2ZEYA 2VBBA 1N47A 4N7IA 4SBVA 3WXPA 3CHXA 1RUD1 5T54A 2YC4A 3N7KA 1OOPA 1RYYA 1JOJA 3OEBA 3K77A 3ZLIA 1J1TA 3KB5A 2GP5A 2XUEA 1SFPA 5FUPA 4BIFA 2V09A 5C8CA 4CXYA 5JI7A 5M0TA 4FT8A 1C3HA 1Q8SA 3ZOIA 4XTMA 2DDUA 4NMIA 1OPOA 3RMYA 4EZ4A 3MHZA 4PLNA 2J42A 2HBUA 1ENQA 1XE0A 5AC92 5F39A 4IV3C 3ROUA 1LRHA 3RPQA 3ZKUA 1UCXA 1CONA 3RZLA 1ZZ7A 4P14A 2X10A 2F6BA 4RQPB 3NJYA 1CPMA 1GQHA 1Z78A 3BYWA 4X8NA 2ZGOA 4AAPA 3RZKA 1MPXA 3KWVA 2GZWA 4LLFA 1KQRA 1VP6A 4UFKA 5FAXA 2DBIA 1D7PM 4I0BA 4GWMA 1CAUB 1OLRA 1W8TA 1LU1A 4XMIA 2YU1A 3A7QA 2NP0A 5FZEA 1JU4A 2WQ4A 3K2OA 5IVYA 2ZTNA 2A6WA 4E2QA 4EWAA 2FCTA 4QKBA 4ZXEA 2DTYA 3K4ZA 4P9XA 4XZUG 1QXJA 4GB31 4Q0VA 5FY5A 1Y9MA 2RS53 4FQZA 4XF9A 2R072 3PURA 2A73B 2OQ6A 3HN1A 5J98B 2GC2A 1FI2A 3O0XA 1NQDA 3RYPA 3V56A 4DUXA 5IHRA 3TEZA 3B7MA 2AACA 1FOD1 1VMHA 3Q8AA 2AC1A 1LHOA 2P1BA 3MLKA 1ULDA 3PNAA 1I3HA 2Q8EA 3WW2A 4AI0A 3P6BA 3PMSA 4GWNA 1W6NB 5IYYA 2VH9A 3K4DA 1V70A 4P9IA 2YB7A 2EXJA 4D8MA 4PI2A 1QXPA 4DXZA 2WFF3 4W4ZA 4AHXA 4UFHA 2ARAA 3PVEA 2A71A 4ZU4A 4CUAA 4LKFA 1E5IA 1AR72 1G9BA 1REDA 1KS5A 1POV1 3VD9A 2YPJA 3A0NA 4IERA 4KGGA 3VZKA 1PM7A 4XBLA 1AZDA 5FZ7A 1W8OA 1HQWA 1LB2A 3RDIA 2PHXA 1S0IA 1QH6A 1EPZA 2V4VA 1AR92 3N7JA 2BBVA 2JE9A 3ELNA 4MGYE 1PMHX 5A3LA 1BKZA 1PVC1 5JCTA 5FOBB 1ULOA 3TN93 3VLBB 1DCSA 1NCQC 2JX9A 1NZIA 5JR7B 4G4FA 2BNNA 1NA1A 3SMHA 2ADEA 2BWAA 2JKBA 3AB0A 5EJZB 4FOWA 3U14A 4QAWA 2GMEA 3LA7A 4YG6A 4CCJA 1L3JA 1W3VA 4YSFA 2VZUA 2PYTA 1W9WA 1WCUA 1OHFA 2YGMA 3GGLA 2R061 4LT5A 4J1WA 3ZSJA 5FWEA 1YHFA 2NYYA 5F5CA 3WDXA 3N9QA 5F37A 4YVSC 3UGHA 1OURA 3H7YA 2WAAA 2X53S 3N9MA 4M3CB 2Y64A 2XJSA 1FPN3 2LRPA 2Y6LA 5FWJA 1MVQA 1QOOA 2RMU3 5LZ6A 4EV0A 5CIRA 1OQEA 5FPUA 2BDRA 1YI7A 3BPSA 5FJKA 1WW6A 2E7QA 3BTYA 4QD2A 1AYM2 1D4M2 3QH7A 3H8RA 1MS4A 4N43C 1H30A 4LKSA 5KHHA 1JOBA 4F7ZA 2OXBA 5JVVA 5ISLA 1W0NA 1OC1A 2HYXA 1I9RA 3WP6A 2ZHMA 3HVDA 4IGQA 2PAEA 3KV6A 4E8CA 2XJVA 3VV1A 5CFCC 5FO8B 3APBA 1UO9A 3KHCA 2BNOA 2OUJA 3VBSB 5BNOB 2RJLA 2X5IA 4AXOA 4C0BA 1DF0A 1O6UA 1Y7BA 3B5LB 4QDRA 4C1XA 1UYPA 3DV8A 1I1EA 3O14A 3MGUA 2J1TA 1MVEA 5A32A 1VBC3 3AC0A 1W3XA 4BQXA 3VDBA 3ZPYA 1DYPA 3ACHA 3OYWB 4Y1XA 4QU1A 3CJIC 1EYBA 4GJYA 3VBUC 5L9RA 3M3EA 1AXZA 1NY71 2V5YA 4Q26A 4N43A 5CZKA 4BJ0A 1T6GC 1GZCA 1KITA 4H55A 4D7TA 1SHWB 3LKJA 2D43A 1Y43B 5BPXA 3D8CA 2WQ8A 3IB3A 2Y0IA 2ZGPA 5CFCA 2RR13 2P3YA 5J7MA 3SKJE 4Z2WA 4LA2A 4D7SA 3V0BB 1BVVA 1QJEA 5FZ1A 1R082 1K5MC 2BVVA 2XJPA 1ND3B 1QOSA 3KLSA 3KT7A 2RS51 4PCRA 3VD3A 1UZ0A 1RUJ3 5FZ4A 1G86A 2ZZQA 2CAUA 1X7NA 2VTXA 2HYKA 2XWJB 3IAQA 1HB1A 2XJRA 3K48A 3KVBA 3CJIA 3NWKA 2R6QA 2J1EA 4XHXA 1MEC3 3VBUA 2VMFA 3NRUA 4CDUB 1C8M1 2HH9A 2NLRA 2QDRA 1JZ2A 4MG2A 2K46A 5K8SA 2GP3A 1V9U2 3WQBA 5GZGA 2WN2A 3VDAA 3WV6A 5FYVA 3I4IA 4EWEA 2WFF1 2IXCA 2XKOA 4XFAA 5I91A 3ITQA 4YGCA 4FFFA 5F3IA 1EPWA 5FLHA 3GHMA 2PHWA 1SLBA 2ZACA 4UT5A 2F4PA 5FO9B 5DAQA 4UYBA 2DFCA 4OUSA 3UKTA 4YWAA 2I45A 2TBVA 2JG9C 3LFIA 5AFBA 1K5MA 2OQ7A 3KHBA 1RUH3 3D3AA 4D69A 3ACIA 2VVEA 4ISQA 4H14A 3AVRA 2BJSA 1OA3A 2JEMA 1RHI2 3TN91 3WG4A 1R1A3 3HMYA 3NMBA 3R0RA 3EB7A 4ASKA 4BQ1A 1QF3A 5ANNA 4SLIA 2VAUA 4NIAA 2R16A 1JTZX 2PAKA 1PX4A 2RS13 3RRDA 1H2KA 1DFQA 4N9HA 2ZGUA 3ZYIB 2VNRA 1RVF3 3WCSA 2OX0A 3RNSA 3UJOA 1IHMA 1XYPA 2Q8DA 4IDZA 3F2ZA 5K0UB 2VGDA 4AEKA 1UW8A 1OBNA 3TEXA 3AZZA 2JG9A 3ETQA 1UY4A 3NAPB 4CDWA 1RUC3 4KBBA 3VZNA 1ZBE2 4QDQA 1O5UA 4RSUA 4CTEA 1HV1A 2PMWB 4GKXA 2DFBA 2QTWB 4QPIC 3M4FA 4PBOA 2X29A 3JBG1 2VQAA 1VIWB 4ORFA 1GICA 1JYTA 3WNPA 3NKTA 1UY1A 2WT0A 1LOCA 4CPBA 2CDOA 1WCSA 1WZXA 4ET7A 2WS92 1EAH3 2A5ZA 4MOAA 4NWWA 5FMBA 3I59B 5GZCA 2QDNA 4QQLA 3WF4A 5KXBA 4IW3A 4N53B 1G9FA 1ZZBA 2WNUC 1N3QA 4XUPA 3ZYJB 2F4LA 3IMNA 3M2MA 2QQJA 4D0QA 1OA2A 3VHRA 4KH9A 5JZGC 3AKPA 2EAKA 1BYHA 5BNNB 5LW9A 1HIXA 1LULA 4H7MA 3VHOA 2VUDA 2ZJCA 4NPRA 1RMU1 2EA7A 4O7XA 1OUXA 2C24A 4GULA 4JV4A 4LOTA 5LB6A 4BQWA 1O59A 1B35B 2PHLA 4ZU5A 2UY9A 2XH6A 3OGRA 4JHTA 1ZM1A 4CCDA 1A78A 1VMJA 4JX0A 3O1OA 3HWJA 3GALA 3LPFA 2PHDA 4HKWA 4COWA 4RS5C 3E6CC 2VNVA 4CP9B 2FDKA 1VLNA 3VD4A 2WA3A 5K7PA 1MR5A 5K4LA 3RMXA 1W6PB 1I6XA 3RI9A 3AYCA 3Q8FA 2W87A 2WNUA 2W1QA 3OGJA 1WBLA 2E51A 2WO2A 2XMLA 1VE0A 4XF1A 3WG1A 4DNYA 5JZGA 5J37A 3ENRA 4FXGB 4XPVA 1VB2A 3KQRA 4FTBA 5JDBA 1JODA 3SNMA 5JUVA 5DZEA 2YYOA 2XLGA 3AXEA 5FO7B 2DCKA 1ZZ8A 3ZXEA 5L73A 5BNPC 3NW4A 2K0GA 1E5RA 4XACA 1UOGA 4B7KA 1QQP2 4FFIA 1GOFA 4R4XA 3R4UA 1S0BA 2WZEA 5AFEA 3M1HA 2Q8OA 5FYTA 3ES4A 1VBE2 4I01A 4HK8A 1HRV3 1JYCA 3OJBA 4PQ9A 1U5YA 3FC0A 2OZJA 3AYDA 4MHRA 4UF0A 1YQ5A 3J7LA 5FMOL 4WM8C 4D6RA 2JIJA 1L7RA 2PLV3 4OI0A 1H8TC 1X82A 2RM21 4FQ4A 3MIFA 4XETA 3C2UA 3FMGA 1S4CA 4R8HA 4ASMB 1S2KA 4AI2A 2IVIB 1JBCA 5KHIA 5L7OC 3VBOA 3GM8A 3ZPOA 1MS0A 1OLQA 3OUHA 5FUNA 5FLIA 2D6PA 2HWD1 4XQDA 4XUNA 4QKFA 2JJ6A 3T4HB 4AGRA 2VOWA 4AYUA 1GYKA 3WDTA 4Q4Y2 1BEV3 1OI6A 1VRBA 4HT1T 1DZRA 1HXS3 4HL0A 2P17A 2VQUA 2GN3A 4OHVA 3RVHA 1IS5A 4OYUA 4JZRA 3OUIA 5IK7A 1VRH3 3WDUA 5FZOB 3IT8A 1Q8VA 3I54A 3KGLA 4M0HA 1ASJ1 3Q9OA 1G9DA 1ZBA2 1PO13 5FMOS 1KJRA 3H8XA 2PQQA 2WNVB 4XF3A 4ISRA 1ENXA 1LGBA 1AL23 1XYNA 2VD7A 1ZZ6A 4Q4X2 5ACA1 1W39A 1JI6A 5FZDA 1NT0A 4KG0A 5F32A 1YWKA 2CL2A 5L7OA 4LUMA 5C9AC 3WG3A 4A3XA 3IDEA 5FMDA 3C7FA 4GMP1 4Q1RA 2XPJA 3UJQA 3AP9A 4OFGA 3LA2A 4HONA 3BIWE 4JQRA 1RUC1 4YARA 1MS1A 1XE7A 3ACGA 2JDNA 2C9KA 4UOJA 1RIRA 4DPNA 2VW0A 4M01A 1H8VA 4PIXA 4XDQA 4HN0A 2WIIB 5CKQA 3AYAA 3VZOA 2WZR3 4CEYA 5FPLA 3P5BA 1COV3 3QD6A 1RUG2 3DUIA 1A8DA 3Q8CA 3KF5A 5DUWA 4QGLA 5IVFA 4K20A 1LHWA 3ZFFB 2RS33 3ILRA 4FPKA 1EAH1 4AI9A 5EJ1B 2JD9A 3VDDB 1S0FA 3POIA 2ZGQA 2XKPA 2B46X 5CKNA 2A3YA 4ATFA 1NOVA 5DG1A 4GWJA 5DUXA 3U0ZA 5FV3A 2XVKA 2EF6A 2DCZA 4I09A 4KU8A 4Y22A 1RB8G 1GU3A 1RUI2 5FPZA 3GJBA 1GFF2 2PQSA 4Y4YA 4QX0A 4CE8A 3WX5A 1CX1A 1UWWA 4EN8B 1CX4A 2PTMA 2C26A 3ZR6A 2WZ8A 3RJ2X 1GSLA 3M3CA 1JZ4A 4MV2A 1LKNA 1WA6X 2GC0A 4KMQA 5FYHA 4M0NA 4LO4B 1PK6B 2EVXA 4LBMA 4HVQA 4M3CF 4O65A 4FAHA 3HT2A 1OF4A 4A41A 2BVBA 1HLCA 5DMYA 2PAMA 2R49A 4KWUA 5DUVA 2PELA 3CDZB 1MQTC 3KVAA 5EXOA 1GOHA 3MEPA 2IWGB 5ABJC 4RR3B 5LATA 3VBFC 4CXWA 1W6MB 2HEYF 3OPZA 4RN5A 1JN2P 5GKAC 2TEPA 1CIYA 3PUSA 5JLVA 4GQ7A 1RUE2 5F5IA 5FZ0A 5CG8A 3MIGA 4CDQB 1HRI3 4OZOA 3U1XA 3ZFEC 1NG0A 2WWSA 1HB2A 1PO23 2E33A 2R1DA 4C0HA 3QOPA 4JVAA 1W6OB 4YW7A 1VAMA 1FX5A 1VBA2 1F4AA 1SBEA 3CF6E 4JC1A 2QKDA 1WW5A 3WF2A 1X9PA 3ZDVA 5FBJA 3DPRA 2JDPA 5FR3A 4LO7A 4YGBA 1XRUA 3IDAA 1HRV1 1FNZA 2KM2A 5FZGA 2C5DA 1UYYA 1MZ5A 1H1MA 3AKQA 1YJLA 2CU5A 2VNOA 2HWC3 3Q8EA 4LITA 4XABA 4PBPA 4IV1B 2FDGA 5FLJA 2D6NA 4NN0A 2VCMA 4L8QA 1U12A 1V6IA 4YVWC 3VBFA 5ABJA 4M4RA 1DG6A 1AVBA 4CUGA 2C1FA 5GM0A 1UXZA 1FMD2 5G05L 5CFDB 2JG8B 4PLOA 1IKQA 4AGGA 3AP4A 4IESA 3ZFEA 5EYYA 2QQMA 1BEV1 1NCRA 5FYZA 3J7HA 1SQ4A 4P9WA 2B9UA 4ES9A 1BBT2 1CZSA 2B42B 3TNPB 3MW2A 3ZN6A 1QEXA 5I0DA 4A44A 2VTXJ 3OPWA 1VRH1 2D5FA 5T50A 1ND2B 3J8F2 3MF6A 2QCSB 1POV0 2YPDA 4CCOA 4AFMA 1X50A 1NLRA 2FMDA 1EV12 1WUVA 2FDIA 5A3MA 4XF4A 4I0WB 1R091 5KHKA 1W03A 1AL21 2A3XA 1Z7S2 2YHJA 3MIBA 2W5FA 3ZXGA 3MFAA 2HWF2 1KDMA 3PTYA 4IE6A 4PHZA 4P02B 1DQ6A 2AEYA 1AR81 5BXXA 2DCJA 4K8RB 4KG8A 4EROA 4XFGA 5AC93 4FAGA 1DZTA 1YI9A 2B45X 2O8QA 4BE3A 3IIIA 3NV4A 1SG3A 3O1PA 1TMF2 3ES1A 5JSPA 1F2NA 3PVOA 5D1IA 3CJXA 5FXWA 4LA3A 2BERA 2YBKA 4RHV1 5T52A 3I2OA 2UWBA 1A8MA 2I2SA 4K7JA 2GALA 3OGGA 3TB0A 5FPAA 1LOAA 2J1VA 1POQA 1QDCA 2R042 1GWLA 4PJYA 3ZXFA 3U37A 2JDYA 1PZ7A 2R073 2VZQA 2VZSA 1UIKA 2BRTA 3MUZ1 4X8PA 3EJKA 3LIGA 3PUHA 4YGEA 5LASA 3WQ7A 2QJVA 1YUDA 1DP0A 4Q4V3 4CZSA 1GZWB 5L9BA 5LWBA 2IUWA 3LEIA 1OQDA 2AENA 1JH5A 2G9GA 1WWYA 3ZIWA 1CD3G 2Q4SA 4XEZA 5FXZA 5DDJ1 2D6LX 3ON7A 4BH9A 3HD8B 1R1ZA 5JSOA 2ZCWA 1OPMA 1O3RA 4Y5SA 1CAXB 2JDHA 3WR0A 4FP3A 4IEWA 5IAVA 2CHHA 4HPKA 3AZVA 2JE7A 2W9XA 2Y6KA 1CAWA 3AVSA 3LZZA 3ZFGC 5JXHA 5FY9A 4LLOA 1ODMA 2V72A 2VOKA 1N3PA 4XCBA 5ANQA 3E5UA 5JAXA 2FCVA 2LUWA 4IGOA 4BMBA 2XDVA 4MADA 3B3QE 3POJA 1ULCA 1WW7A 2DYCA 2HWE3 4S2HA 5FUIA 1XNTA 5C6CA 3POFA 2XBO2 1V0AA 4NAOA 1VBD2 5IVEA 3MLJA 2Y60A 4XFBA 4UWDA 2VJXA 4XW3A 4BMEA 4GH4A 2A6YA 2P5BA 3URFA 3O1SA 3GCWA 1W8UA 3ZSEA 5JOZA 3MLLA 1ODNA 2FCUA 3VBHC 3ACFA 4XBNA 1QH7A 3OBZA 1IOAA 4L11A 3L2YA 1Q8PA 5C4WC 1KFXL 3JCIA 4FBFA 3BN6A 3OD0A 1V6NA 1VR3A 3D82A 4ZONA 1QKQA 1XXNA 1LENA 4XJAA 3PTRB 3WINE 5DZGA 4C1WA 1SEFA 1REEA 3I2FA 5HCBA 4BWOA 5GLWA 4MXWB 3JQXA 5FYMA 2P3JA 5CB7A 1K5JA 1IQAA 1QJX3 4GA9A 1N1TA 2Z2SB 2W1SA 2CGPA 2XWBB 1VAVA 3ZYHA 4MXVA 4PT6A 1PIV1 4YM0A 3HR9A 2HWB2 1WMXA 3WF1A 5IJRA 2FZ2A 1FATA 3SISA 3VBHA 3C7HA 2LTNA 4HSLA 4RFRB 4DY5A 1J3PA 2Q1MA 5JSRA 3VL8A 1HQNA 1RUD2 2ZGLA 1AX2A 3AFGA 2IXHA 4IXLA 2G9FA 3VD7A 3ZSLA 5A6YA 4NIGA 2W94A 4CXXA 2EXKA 4LQRA 3UT0A 4MGQA 5I93A 1M06G 5FTTC 4ARXA 1XSQA 4CSWA 2ZABA 5A3TA 2Q0AA 1DQ1A 2UURA 1H9WA 3DCQA 4C8DA 4QPYA 3DF0A 1UPIA 1DGRN 2CGNA 3LD8A 5DG2A 3I3QA 3WCRA 5BV6A 1QJU1 5HXMA 1ULEA 1UU5A 4BCUA 4ZKTB 1ZRDA 3SEPA 2MEV1 3IWZA 3TBDA 2YDEA 4P9GA 3I7DA 5FRAA 4OMCA 1LHVA 4I30A 4RQPC 1K3IA 4TWTA 1UPSA 2ZAAA 2JDZA 3HN3A 4IV3A 5LA9A 3K3NA 3EYPA 3OBRA 1DQ5A 1R083 4XJZA 3THDA 3J26N 4GB32 1UKRA 1WMEA 2V4AA 1NA1B 1DLLA 4XAEA 4AVCA 1IS3A 3SH3A 5L9VA 2WO3A 3WP4A 2D98A 1IG0A 1FOD2 4PIYA 2QQKA 3FX3A 4W6YA 4YW3A 5A33A 4YW2A 5B4NA 1UYZA 3N35A 4Q4V1 3NVCA 2I74A 1NXD1 1W2TA 3C3VA 4QQ2A 2BNMA 4DO0A 4RD7A 3CIHA 2W1WA 3OD4A 5IUQA 4LO6B 1CJDA 3ZYFA 4LK7A 4CU9A 3D0SA 4KQ7A 4AHYA 3OG2A 4A7YA 5A1FA 2XR4A 3CLPA 2JD4A 2VUCA 5A6XA 3H1WA 3JD73 3NO8A 3ZVXA 1X33A 3SQOA 1SMVA 4FI9A 5DAXA 3MI8A 3TOJA 4FTSA 4JRAA 2ZXQA 2D3PA 1SFYA 1XNKA 1CAUA 2WLPA 4MH0E 3MICA 2JIGA 2XL9A 1RUF1 4D3WA 5A3UA 3O1TA 1QJY1 2HWE1 4XCAA 1PVC2 5CG9A 4QX3A 2CTVA 4AI3A 3A21A 2P6HA 4LE4A 1BQPA 5EFUA 2ET7A 3HIFA 4CUCA 3HQUA 1OD3A 4DRVA 1OD5A 3OPTA 4QHZA 5F9TA 4MVTA 3ETPA 2X5IB 2W0XA 2KA3A 3UESA 1VBB3 4YGDA 1ZA7A 3FLTA 5HCFA 3MIEA 2GC1A 3U78A 1PZ8A 2JKXA 1Z0HA 5GLTA 3CQOA 4IE5A 2AYHA 1O8SA 1TG7A 2R062 4AGVA 1CWPA 1AR63 2VULA 4HSJA 1ONAA 3RZMA 1OSGA 2EIGA 1TME1 2WNEA 4BLIA 3S7IA 2FMYA 2VE1A 1E5SA 1NCQA 2B39A 2W08A 2XJTA 1W2AX 1XNCA 2VVDA 4N43B 2PHFA 4YG0A 3NNJA 2UWCA 4FPEA 1SCRA 2BGOA 3UGGA 4CRQA 1QJX1 2GMPA 3GF6A 1H4GA 4TYSA 1Y3TA 3N4MA 5FXVA 1IG3A 1GNYA 4QB2A 3ZYGA 5E16A 3ZXDA 2YFZA 5BNQA 3IBMA 3LWCA 4UW4A 5GJ6A 3PLQA 3AZXA 4BM8A 3NV2A 2VOTA 4YVSA 3T1MA 4XXPA 1S2EA 3A4UA 2Y33A 3W5MA 1LOBA 4Y4RA 2WS93 2DVFA 4A6SA 1PZ9A 3LDKA 3NJZA 2ZAHA 2P37A 3VHNA 3AJZA 2GN7A 4HLTA 1EP0A 4UXAA 3U75A 1C5HA 4BQ3A 4RGGA 3WDYA 5C33A 2CY6A 2JICA 1QY4A 2CDPA 4CU8A 4XF0A 5DPNA 2JENA 4INDA 1JXNA 2OVUA 3OGVA 2NQYA 5BNOC 4OHYA 2OPWA 3BTAA 4WVMA 4HZFA 2UYBA 3AX4A 3SLIA 4GD4A 4S2DA 1PGW1 4BYYA 2VCAA 1NY72 4BLJA 5G04L 3HBKA 3OEAA 4FVVA 3T2QA 1H2MA 2VMHA 3PUQA 3UNPA 4QB1A 5FYCA 1UZYA 2VXJA 2ZX4A 4IE7A 1GNZA 1E57A 1CAVA 1D0HA 2QVSB 1MS8A 4L9BA 4ZS2A 1UX6A 1OKQA 2NM1A 4GMP0 4HFSA 1HB3A 5C5UA 1BHGA 1QJZA 4OHWA 5T5LA 4HN1A 4V2WA 2LM3A 2ZGRA 4JKLA 5HBAA 2BU9A 3EHKA 2FDHA 2XB6C 4M3CE 4BOWA 2VZ1A 2RS52 1UU6A 1LGNA 2NN8A 1OT5A 1CZTA 5CADA 1ULFA 4UFJA 5BNOA 4PIZA 5FPXA 4NVPA 2WC2A 2FDJA 4DMIA 3CZJA 1CESA 4QPWA 1GBGA 1C8M2 1UU4A 5D2AA 5E8AA 3VHPA 1H1IA 1ND3C 4XBQA 1JZ3A 3ME2A 3VKNA 2VW2A 4Z8BA 3PVNA 3HJRA 2AZ5A 2VG9A 3GNEA 5FK8A 4RA0A 2WFF2 1YCIA 5I8YA 1ENSA 4CDWB 2J22A 4Q29A 4CDUC 2K2SA 2J7MA 1OFSA 4LKEA 2O14A 4Y20A 1OKOA 1HX6A 2WINB 3JD71 3OY8B 3EMRA 4LK6A 5I8TA 2HBTA 1ST8A 1PM4A 4E4DX 5A3OA 2FBEA 2A3WA 3NJVA 1C1FA 1HJFA 2BP6A 3ALQA 4Q4Y3 1VALA 4XQ4A 3WD5A 5TSWA 4DEVA 1YO8A 1I5ZA 3WP3A 1K12A 3TN92 4YLZA 4CPBD 2OW4A 2A7AA 1CIWA 3FBMA 1LEDA 4EN7B 2B9VA 5BUVA 3FHQA 3C8XA 3AXDA 5KBFA
chains in the Genus database with same CATH topology
1QNWA 3CU7A 5F6KA 1VBB1 1FPN1 2RMU1 4Q4X3 4CDUA 1Q43A 1AR61 4NHMA 1O7FA 1XU1A 3HBZA 3U10A 4KL1A 2Z5WA 4AFCA 1A6CA 4COVA 3B94A 4A7KA 2DVDA 5K0UC 1AYN3 4LO5B 1HDKA 1QGLA 2CAVA 4XYXA 4Q4W3 3WDVA 3RZZA 2SLIA 4N90A 4R9CA 3WQ0A 3NKGA 3JBG2 4FOYA 1O3QA 3NAPC 1GV9A 1MS9A 1G9CA 4K21A 3R6SA 1V6OA 2ZX1A 1RUG3 2P3KA 3M8LA 5KHJA 1FT9A 4CDXB 1ZX5A 4EJRA 1VBC1 3MW4A 1GLHA 2ZHKA 4AVBA 2ET1A 1PHMA 1PNGA 1X36A 3QACA 4QPIA 1B09A 5AVPA 4WM7B 1Q3EA 4DB5A 4IL7A 3HT1A 2UY8A 1RUI3 2ARXA 4AEDB 3O0WA 3FFQA 3W59A 2DVAA 4N53C 1J3QA 4DOUA 1RMU2 3QBQA 3B9CA 1IPKA 1RTVA 2W39A 2GMMA 3IM0A 1V6LA 3QCWA 2RR11 3VBOB 4RL7A 2BFUL 1CJPA 4I3GA 2QE3A 3AFKA 5LRRA 1B35C 2B7YA 1RUJ1 5KXEA 3O7OA 4I3PA 3AMMA 3ILFA 4OULA 3LB9A 4PF5A 2DUQA 4MGZE 4XFFA 1MEC1 2XGXA 1RUE3 2QZ3A 4HKLA 3AYEA 5EYXA 4JGYB 3J9SA 4JGZB 3I59A 4CP1A 1NQJA 3B01A 1Q8OA 2TNFA 3IN9A 3LCPA 4RS5A 1IPJA 2Y0OA 1VBA3 3M3IA 4K6BA 3AMNA 1BJQA 4C0HA 3AMHA 4P5HA 4Z07A 4B8EA 4IEYA 3U07A 3GYDA 1W6QB 2XUMA 5JI9A 1DQ0A 4QX5A 3RG0A 5HI0A 5L7OB 2BFUS 1OQ1A 2GDFA 2ZKLA 5IK8A 4OLLA 2XJQA 4F3JA 3FUQA 1RUH1 2RM22 5D8AB 3FBYA 2BYVE 3I2DA 3THTA 5J36A 2ILMA 4PDWB 4YFWA 2UU8A 5BNPA 4IQPA 4O9EA 3ZSKA 1J1LA 1R1A1 3CO2A 1FMD3 4CEYB 1WMDA 1FV3A 2HWD2 4B4QA 2P3IA 2RS11 1W6PA 2D44A 2KXLA 4CEWB 1RVF1 3OCPA 5JIAA 1BBT3 5DXDA 4WM8A 5L19A 5J48A 4NO4A 1H8TA 3D6EA 1AL0G 2E7AA 1AXKA 4FPYA 2R0FA 1ASJ2 3LA3A 3KCCA 1EV13 2MHFA 4META 3TNQA 2Y26A 4Y22B 3WQ1A 3SHRA 5IT6A 3FE5A 5ACA2 4NR1A 4Y1ZA 2D3RA 4J6GA 4S2GA 2DVBA 5IK5A 4QGNA 4AE2A 2WNVC 2RJKA 2WFPA 4H3WA 2E7TA 1ZRCA 1CQ9A 1RUC2 1AYN1 3MW3A 1TMF3 3W9AA 1ZA4A 1MS3A 4Q4W1 5CA6A 3T2TA 2IXKA 3IDCB 3KMHA 4KWKA 4P9LA 3IPVA 4AW7A 4G9SB 5T3NA 3THPA 4QGMA 1S0CA 5C9AA 3N36A 5GLVA 1D2SA 5F6LB 2WT2A 4YM2A 1EAH2 2OZ6A 3AP5A 1BXHA 3E6DA 1LODA 1O3SA 1S55A 1O4TA 4X6QB 2WL1A 2UYAA 2WNVA 3DPRB 3ZFFC 3VDDC 4AG4A 4AK3A 5AVAA 2BPA2 1ZREA 3IIAA 1LOGA 4FPGA 4N9IA 5FREA 5SV8A 1ZZCA 4QPGB 3WVJA 3L9JT 4ASLA 5JPMB 5I0TA 4Z82A 1N1SA 2OYZA 3SH5A 1SCSA 3AKRA 3WUDA 1CN1A 2ZX2A 4BPZA 3CNAA 4NOTA 2ZGNA 3BALA 1NCRB 1PK6C 2AGSA 1BCXA 1OA4A 4DFSA 4ONUA 3PJQA 2XBO3 2VMIA 1MACA 2EXHA 1VBD3 4RR3C 4BIOA 4FCAA 4DRRA 3UKVA 2VNGA 2PLV1 3L2HA 4HKOA 1TQ5A 3MDPA 3FJSA 1AX1A 4XILA 1MQTA 4CDQC 2N7GA 1PGL2 4LBQB 4K1ZA 3CL1A 5IK4A 1F5JA 1RJ8A 1HRV2 4QT6A 1YFWA 2GNMA 1XE8A 1QHDA 4AVSA 5GZDA 3B9IA 3H1MA 3B93A 4MSVA 1ZRRA 1KFUL 5KXDA 3WW4A 1HXS1 4PLMA 3S6PA 4FTEA 2BQPA 4R9DA 3RSJA 1YIPA 4Y1VA 4ZXKA 2UWAA 4IV1C 5CNAA 1PO11 3H3ZA 5K9YA 3VZLA 3WHUA 4RR3A 4AQTA 1AJKA 1DHKB 1W6MA 1BBT1 4K1YA 3HAGA 2PHRA 4QQPA 1VAKA 2HWB3 4U36A 2JG8C 5CU1A 5CFDC 1OMIA 3VKMA 4YVWA 3MZHA 3VBRB 2YZ4A 3BCWA 5T5PA 1C8NA 3CEWA 2H0VA 1R092 3NV1A 3EQEA 1AL22 3JZVA 4FPOB 1ND2C 2OPKA 4HK9A 2O0OA 4CP0A 5FFOC 1NLSA 1AR82 2Z42A 1DZQA 5C8WA 2WZR1 4MGIE 4HVOA 4FPHA 1COV1 1MZ6A 4XJ8A 1DU3D 5FQ0A 2PHTA 2NMOA 2RS31 4JCKA 1NXMA 2XLAA 1D0GA 4RHV2 2CV6A 1BMV1 1UAIA 3LSEA 2BUKA 4OUMA 1WMFA 2PN5A 1G6NA 1DGLA 3N3HA 3M3QA 2QUOA 2VUJA 3AP7A 3AP6A 1ND2A 2V73A 1BK1A 1J59A 2VOVA 4GB33 1QMJA 4GH4B 5FBZA 1Y9QA 3S0MA 3DGTA 1FOD3 3PHMA 5LEKA 5B2GB 5E89A 4BZ4A 1AR73 4MGKE 3ILNA 1QXRA 2H0BA 4AVVA 3KT4A 4ATEA 4Q1PA 2ZX0A 1PMIA 1WCKA 5DDJ2 3AKTA 4AFDA 1AR93 1POV3 3ZYRA 4AWDA 1HRI1 2WA4A 3M70A 1PO21 4QQOA 3UKNA 4DS0A 2WT1A 3AJYA 1IZ3A 5I0UA 1OOPB 3GBWA 2ZBJA 4K9SA 4Y26A 3VBHB 4LBLA 5C8CB 3POSA 1ULGA 3OF1A 1ZNPA 2JXAA 3RYKA 2CNAA 2HWC1 2VVFA 4IEVA 4UBGA 1WLTA 3KD4A 4Q0QA 3S7EA 3SCGA 3ZFGA 1UN1A 3WY6A 3V0AA 2R063 3USSA 4AFAA 4MLOA 2EXIA 1UKGA 3D4KA 1AYM3 1D4M3 1GNHA 1WD4A 2ETEA 2YROA 3ZN4A 4P9JA 1UL9A 1N1YA 4JTNA 3A0KA 2ES3A 4RGAA 3RWNA 4OI1A 1S0GA 1CAXA 4Q8LA 1C5IA 2DF7A 3FFZA 5KWRA 2DUPA 4F83A 3AM2A 4E27A 1WLDA 3AK0A 2B5HA 1G8WA 3P3PA 5C4WA 1H2NA 2OA2A 1F9KA 1PIV2 5EV7A 3UK9A 2IFWA 1WD3A 1JUIA 4LBOA 1H9PA 4IV3B 4Y5Z0 4YG3A 4Q27A 4Y1YA 3O0VA 2QFEA 4HETA 4YM3A 4COUA 3UV9A 3SCHA 3KS7A 4E2GA 3B02A 4XJ9A 1EY2A 1SLLA 5GZFA 5AC91 3IKWA 5A33B 2W68A 4YFZA 5LRSA 1H0BA 2PFWA 4FPJA 4XIKA 1PNFA 3USUA 5FCCA 3RYRA 2DU1A 2W52A 2XLFA 2K9ZA 4QMAA 1S1AA 2DVGA 2GNDA 4Q8KA 3H50A 5JOWA 4MXWA 1TNRA 4KNCA 1RGSA 1O4ZA 1QJU2 4EN0A 2JECA 2MEV2 4B4RA 1H1AA 4FXKB 2VY0A 2R071 4R9BA 4OI4A 3ZXAC 5H9RA 4YZ5A 4FP2A 1S0EA 1F8VA 4LHKA 1LOEA 3WUCA 2D93A 1WA4A 2NPIA 2D40A 4YZ4A 4B4PA 2FQPA 1C57A 3ECQA 1V9U3 4Q0UA 4E4ZA 3HQXA 1JYIA 2GH2A 1O4YA 5H9QA 4JAAA 3DN7A 1C8M3 4Q4V2 1QU0A 1AR71 2GU9A 3INAA 1NA1C 4W65A 4Q0PA 1V6JA 1XU2A 4RQPA 3QH6A 4AQSA 5LEJA 2FHRA 4QQHA 1F5FA 3GZAA 1NCQB 4AI8A 4CP2A 3X29B 5JPNB 1AR91 1DBNA 4UBHA 3KCXA 1RHI3 3BU7A 3U11A 1UIJA 2AREA 2IZWA 4R52A 3S30A 1AHSA 1RUF2 4YVSB 4LBNA 1QJY2 2HWE2 2ZGKA 3FZ3A 2LALA 4QHBA 4AHZA 3LGRA 5JOXA 5A32B 5JWPA 5DZFA 3NL1A 4JDMA 5J96B 1W6NA 1W0PA 3AKSA 3KCYA 2RHPA 2WQZC 1BZWA 3ZXLA 4LEJA 1S0DA 4ZU7A 4XHBA 2DU0A 2VECA 2WLQA 4WVVA 2Q30A 2A6VA 2X8KA 1ZBE3 1FNYA 4IEQA 4WVMB 2X5IC 1TME2 1AYM1 1D4M1 4IEUA 3FHIB 5CFCB 4GIQA 3DKWA 1XNBA 4R9AA 2DCYA 3AZYA 1LEMA 2ZMNA 4UW6A 3WW1A 3VUOA 1QJX2 4Y1UA 2CWMA 2XHKA 4FO9A 3JBG3 1CAVB 3VKLA 4LE3A 5KHGA 3H0OA 3TAYA 3CJIB 4FPCA 3VBUB 4ES8A 2GNBA 1HQLA 4QM8A 5LK7B 2YY1A 1FV2A 3WOGA 3VBSC 1U0AA 4R4ZA 1Q56A 1YJKA 4AVAA 4M3CA 4YM1A 4TSVA 2D6KA 3ZMNA 2DTWA 2ENRA 2R30A 5CVRA 4XMAA 1KD7A 2AR6A 4MX3A 4LO8A 2XVLA 1RMU3 1K5MB 1KRIA 5J09A 3T1LA 1PGW2 4M00A 4QXKA 4Y20B 2A6ZA 3VKOA 3WHTA 1IS4A 1CGPA 1IGOA 1CPNA 1Q5OA 5H9SA 3WDWA 1R081 3PVBB 2TUNA 3MF9A 2YXSA 2O8OA 2GAUA 1V00A 2DUOA 2AUYA 4Q0SA 3VBSA 4DQAA 1YXWA 1QQP3 2BEOA 1PVXA 3E6BA 1IKPA 3UL2A 2Q1ZB 1VBE3 1V9U1 3POYA 2B8MA 1SLCA 1TEIA 3OYWA 4FOVA 4LNVA 2JG9B 4HANA 2P2KA 1S0JA 3MYXA 4G3YC 1DIWA 1WLWA 2C9AA 4W6WA 3H3UA 3IDBB 1CR7A 4EN9B 4YW1A 5JMCA 4CYDA 2RM23 3TWIA 4N7UA 2GSYA 2Q5TA 3ST7A 4B3NA 4QM9A 1RHI1 3JD72 2MPFA 3U4XA 3V0BA 1V6KA 3BPZA 1AJOA 2HWD3 4CDWC 1ND3A 1UZZA 2VPVA 1ZBA3 3KSCA 1NE6A 4O9GA 3NV3A 5DUUA 5I0SA 3OBTA 3SCFA 3POWA 1X8EA 3N7LA 1APNA 3SH4A 4XIOA 4JTOA 2BW8A 3SXWA 2ZHLA 2IXLA 2ZOEB 1ASJ3 1C1LA 1REFA 4EN6B 4QPIB 2VUAA 1VBB2 4X6RB 3LOIA 1FPN2 1X8MA 1VB4A 2H6BA 1RITA 2RMU2 1ZYBA 1DGWA 5SV5A 5ACA3 1A3KA 1AR62 3RS6A 2CGOA 1U5IA 1ZBE1 2WJSA 3ZDSA 1MZFA 2D97A 3H8UA 3JB4C 4HBNA 4GMP3 4LHNA 4JRLA 3VZJA 2OIIA 4GALA 3D5OA 3RI8A 1QWRA 1U5XA 4IEXA 2WNUB 4LHLA 4XFCA 3RQ0A 5FDBA 4WZFA 1RUNA 1JW6A 2VU9A 4L2NA 5JZGB 3OY8A 3P3NA 4XFHA 2WS91 1HW5A 3ZO0B 4MUVA 3WT3A 1SLAA 2XG3A 1DGRA 1FXZA 4AQ2A 4I0AA 5EZWA 1LJ7A 4ITCA 3ZX7A 5E88A 4TLFA 4KWJA 4DZGA 1VBC2 1LHUA 4LBKA 2DWRA 3GBFA 5K0UA 2I07B 4OHZA 4RS5B 2ATFA 2D6MA 1GKBA 3O12A 3MPPG 4CDXC 2G4IA 2ZPXA 5BNNC 3NAPA 1AUYA 2BGCA 1SFNA 3N7MA 3JU9A 4KGQA 1QNYA 3PJYA 3ZXJA 3G6JB 1YIFA 4WM7C 3KT1A 4NHKA 4E9KA 4F8AA 2EALA 2RR12 1WLCA 2ZS6B 4AEDC 1LR5A 5BNPB 2QZ2A 4KU7A 2ZGSA 1NZCA 1V6MA 2CWSA 4E2SA 1RUJ2 1PGSA 2CYFA 4N53A 1SBFA 3VBOC 4WM8B 1N3OA 1QOTA 4AVTA 1J58A 1H8TB 1MEC2 1QQP1 1WBFA 1ENRA 3JB8A 4CDXA 4URTA 3ZIXA 2ZX3A 5BNNA 1VBE1 5GLZA 3FLPA 3K51A 1C4RA 4K3UA 5FOJB 3LAGA 1YNAA 4YW5A 4WM7A 1B35A 2ZKNA 3B69A 2HJIA 5HXVA 4JGYC 2GC3A 5EJ3A 2R32A 4JGZC 5GZEA 4AEDA 5CBLA 3MIDA 5KC6A 3O5SA 4I2OA 1RC6A 1UF2C 2A75A 1IS6A 1GR3A 1KJLA 1BVP1 1RUH2 2R0HA 4XJWA 4Q4Y1 5KXCA 2Z79A 2WSUA 1R1A2 1DQ4A 5EWSA 4L99A 4QU2A 3IPVB 3KGZA 2ZA9A 3J8F3 5D8AC 3VL9A 5HCAA 3EXUA 2RS12 2IXJA 3D0JA 1ZBA1 3BOPA 3BOWA 4GXLA 4S2FA 4FSJA 3MIHA 5C9AB 1RVF2 4XFIA 4PDWC 2FZ1A 5JOYA 4OVEA 2AH2A 4Q4X1 4CEYC 1JHNA 1Z7S3 4LULA 3JQWA 2HWF3 4FPFA 4JGYA 1CVNA 4JGZA 4NHLA 4CEWC 2PHUA 1DYKA 2WSVA 1R093 1SLIA 2DCTA 4FPLA 4YYOA 2XJUA 1W6QA 4A2UA 4B7EA 3BODA 4LR4A 1XQNA 4XJUA 3WNXA 2HEWF 4GKYA 4WV8A 2GH8A 1AR83 2DV9A 2IXIA 3WW3A 1O5LA 3RJRA 3EBRA 4D94A 5D8AA 1AYN2 1RUG1 3FUOA 1AXYA 1AX0A 4PDWA 4Q4W2 1RJ7A 3M7AA 5T5JA 2ARBA 4COZA 2A70A 1S2BA 3WP5A 5LK5A 4K8FA 2R043 4RHV3 1LHNA 4YZ3A 4K40A 2QQPA 5I0RA 1ZRFA 3E5XA 2E6VA 4CEWA 5H9PA 1O3TA 4WBBA 4L97A 1RUI1 1SLTA 2IFRA 3KZ4C 4U2AA 1RUOA 3GBGA 4YNIA 3VGIA 3VKFC 1YLLA 3ASIA 1C28A 2YV8A 1URXA 1HV0A 3PMEA 4YZ2A 5E1RA 5J3UA 3WD5A 4P9YA 1MQTB 3V65A 3W58A 1SDWA 3J4UH 2ZGTA 4DINB 5ABJB 1U5ZA 3VBFB 4L92A 2P34A 5GALA 4AEMA 1KDKA 1FYUA 1ALYA 4UW3A 3WZ1A 3FLRA 1XNDA 3DPRC 4JDOA 3ZFEB 1TNFA 1TE1B 5DDJ3 2RE9A 3ZN6B 1HKDA 1O91A 2IC1A 1RUE1 3ZFFA 4EWDA 3VDDA 2PA7A 4QPGC 4BHPA 1F31A 3TRSB 4B29A 1VBA1 4AFBA 1LOFC 4Q2FA 1LTEA 2E53A 3M3OA 2QNKA 4BA6A 4YZ1A 1ZVFA 2YGLA 4MYEA 2Z69A 4YVWB 4J1XA 1NCRC 3R4SA 2VOXA 3H9AA 1G7YA 3ZMOA 2E63A 2PLV2 3ATGA 2ZMLA 4Y24A 2GNTA 1PGL1 4JDNA 4DY3A 1PK6A 3NSTA 1QDOA 1LESA 1WW4A 3R05A 4COYA 4IETA 1FMD1 1XYOA 3V64A 3R4DB 3VZMA 3WLUA 4QPGA 1BEV2 1ZZ9A 3TYJA 1HXS2 1SBDA 5FQ0B 5KC5A 2SBAA 1LOFA 1DGWX 1W0OA 4IEPA 1D4VB 4AEJA 3LSDA 2OUHA 1VRH2 1WGPA 3J8F1 4CDQA 1OFNA 5F1RA 4AQ6A 2NZ9A 1PO12 1J3RA 2VXRA 1EV11 1W6OA 3G7DA 3SITA 3AMQA 1NE4A 1PIV3 1RUD3 5GLUA 1UD1A 1Z7S1 4C90A 2HWF1 4Z1VA 4OZXA 3QLQA 2H6CA 2XVGA 1GANA 2A6XA 4LBQD 5BYNA 3MPBA 4IEZA 2D3SA 2YUEA 3E5QA 4IV1A 1TMF1 4LBQA 1N1VA 1DQ2A 4OHXA 4XOGA 3VBRC 2Y38A 4HPKB 5CFDA 2YC0A 2JG8A 2WZR2 1CAWB 2ZMKA 3KM5A 5T5OA 1RL3A 4LBJA 1COV2 3E97A 2E9QA 2RS32 4FOQA 4D7YA 1MZEA 3ZYPA 4AI1A 1DDLA 1QJU3 2BWCA 2R041 3ZSMA 4LUKA 3I8TA 5JIUA 4IEOA 1KS4A 2VQ0A 2MEV3 1BMV2 3B00A 4AF9A 4TZDA 4HMZA 4WVWA 3ZN5A 4LTAA 3H7JA 3LOBA 1VJ2A 2WZPP 1WCDJ 3VBRA 1H2LA 4WVZA 1LCLA 3MFCA 4UW5A 2ZZJA 4H7LA 1GQGA 3ZFGB 2O1QA 3JUUA 4I02A 4OI2A 3V0AB 1FAYA 4XTPA 4NWVA 5CAZA 4GH4C 2C0ZA 3DL3A 1RINA 2D5HA 3AZWA 1M4WA 2D7FA 2EAAA 4W6XA 4A7ZA 1Q8QA 1KXGA 5I8SA 2HEVF 1D2QA 1AF9A 3EO6A 1LU2A 2BTVC 1HRI2 1PVC3 1LGCA 2XBO1 2WKKA 2MNGA 4XE9A 1PO22 1VBD1 1YFXA 4HVRA 2HKXA 5C4WB 3GHNA 3BB6A 4Z92B 1YRZA 1LECA 3VN4A 1RUF3 2ZGMA 1YFYA 2R1BA 1QJY3 1SACA 1YFUA 4WZCA 4RFT0 2XL7A 5T55A 3ZXKA 2NMNA 2VMGA 1JUHA 4YRDA 3GZUC 1GZWA 4KWLA 2HWC2 1GZ9A 5F5QA 1OOPC 3FWEA 1MS5A 4AHWA 4C91A 1H4HA 5C8CC 3USUB 4YW4A 2YMZA 2VW1A 1NYWA 4MZUA 1TME3 1UMZA 2DURA 4XQWA 1W2UA 3AMPA 5L36A 3ACLA 4XZPA 3H1YA 2ZHNA 3WG2A 4E4SA 3GZTB 2HWB1 2ERFA 3OTFA 1G9AA 4XXAA 5BY5A 1YYNA 2D6OX 4V1PA 4SBVA 3WXPA 1N47A 4N7IA 5T54A 1RUD1 3N7KA 1OOPA 1JOJA 1J1TA 3KB5A 4BIFA 2V09A 5C8CA 5JI7A 4FT8A 1C3HA 1Q8SA 4XTMA 1OPOA 3RMYA 4PLNA 5AC92 1ENQA 3ROUA 4IV3C 1LRHA 3RPQA 1UCXA 1CONA 1ZZ7A 4P14A 2F6BA 4RQPB 1CPMA 1GQHA 1Z78A 4X8NA 2ZGOA 2GZWA 4LLFA 1KQRA 1VP6A 5FAXA 4I0BA 4GWMA 1CAUB 1OLRA 1LU1A 4XMIA 2NP0A 2WQ4A 2ZTNA 2A6WA 4E2QA 4EWAA 2DTYA 4P9XA 1QXJA 4GB31 4Q0VA 2RS53 4FQZA 4XF9A 2R072 5J98B 2A73B 3HN1A 2GC2A 1FI2A 3O0XA 1NQDA 3RYPA 3V56A 3B7MA 1FOD1 4AI0A 1LHOA 3WW2A