1VBD2

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
266
Chain Sequence
CGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
total genus 60
structure length 266
sequence length 266
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vbd200
5CFDB 3JD71 2BUKA 5CFDC 1R1A2 1PGW2 4GMP3 5AC92 1QJY1 4Q4X2 1WCDJ 3JBG2 2WS92 2WFF2 2GSYA 4PDWA 1D4M1 2WZR3 1NCRB 1PO21 1NCRC 1OOPC 2RMU2 3ZFFA 1RUG2 2HWD3 1MEC3 1VB2A 2HWF1 4CDUB 1RUE1 5K0UB 1AR83 1VBA3 2FZ2A 1RUI3 2RR12 4QPGB 1V9U1 2HWC2 3J8F2 5C8CB 4FTSA 4QPGC 1ND3B 5C8CC 2MEV3 1QJU2 1ND3C 1HXS1 5ACA1 2XPJA 1VBA2 2ZZQA 1NY72 4Q4Y1 4GB33 5C4WB 1ZBA2 5C4WC 4GH4B 3JD73 1AR62 2XBO2 5BNNC 4N53B 1RMU1 2X5IB 4IV1A 5BNPB 4N53C 2X5IC 1QJY3 5BNPC 1B35C 1POV3 3VBHB 3ZFEA 5JZGB 3VBHC 5JZGC 2R062 1D4M3 2HWB2 3VBRA 2VQ0A 4YVWA 1COV1 1PO12 1Z7S1 1AL23 1AR91 2HWE2 3VBUB 1DDLA 5CFCA 1NG0A 4PDWB 2IZWA 4AEDA 1PIV3 1ZBE2 1C8M1 4PDWC 2HWF3 1AR71 2RM23 1VBD2 3ZFFB 1X36A 2R043 5DDJ2 3ZFFC 1TMF1 1PIV2 4RQPB 1AYN2 1RUH2 1HXS3 5ACA3 1RUC1 1RUD2 4Q4Y3 5AC91 3TN93 4WM8B 1HRI3 1VBE3 5ABJA 1FOD1 4RHV2 5LK7B 1RHI3 5BNOA 1VBB1 5A33A 2RMU1 1HRV3 1ASJ1 1VRH2 4IV1B 1OPOA 1AYM1 1RUG1 1PGL2 4IV1C 1BEV1 1F8VA 3ZFEB 1RVF3 3ZFEC 1EV12 2RS33 2RR11 1AR73 3VBRB 4YVWB 1QJX3 3VBRC 1QQP2 4YVWC 1QJU1 2RS11 1VBC2 1NY71 5CFCB 4AEDB 1RUF1 1BBT3 1ND2A 1ZBA1 1R081 5CFCC 4AEDC 1RUJ3 1AR61 2XBO1 1RUC3 1OOPB 1BBT2 1FPN1 4Q4V1 2WZR2 4FTBA 2R061 4Y5Z0 1FOD3 5D8AA 4SBVA 1VBB3 1PO11 1EAH3 1FMD1 3CJIA 1TME3 1M06G 2HWE1 1NA1A 2HWD2 3VBFA 1MEC2 1AYM3 1BMV2 5ABJC 1ZBE1 4QPIA 1A6CA 1BEV3 1CD3G 5BNOB 5A33B 1R093 5C9AA 4Q4W3 1AR82 5BNOC 1RUI2 4RFT0 4JGYA 1FMD3 4Y4YA 4IV3A 5BNNB 3DPRA 2ZTNA 1RUH1 2MEV2 2BBVA 1B35B 4GB32 4JGZA 2RS13 3LOBA 4FSJA 1RUF3 1R083 3JD72 2R071 1QJY2 2RS51 2DF7A 4CDXA 1PO23 3FBMA 1FPN3 1D4M2 1PVC1 1ND2C 3JB4C 1VRH1 1AL22 2BFUS 1RUE3 3HAGA 1MQTA 2QQPA 1V9U3 1F2NA 2PLV1 2HWF2 4CDQA 2RM22 2R042 5D8AC 4NWVA 1QQP1 3CJIB 1HQNA 1R1A1 4RS5A 1PGW1 1V9U2 3CJIC 4YVSA 4Q4X1 1NA1C 3VBFC 3JBG1 2WS91 4QPIB 1HXS2 1RMU3 2WFF1 1NCQA 5ACA2 4QPIC 4Q4Y2 4GMP1 3TN92 5C9AC 4JGYB 1HRI2 1VBE2 2BFUL 2R073 4JGYC 3DPRB 4IV3C 2WZR1 3DPRC 1E57A 1RHI2 4JGZB 1COV3 1Z7S3 4CDUA 1HRV2 3JB8A 1AR93 4JGZC 5K0UA 4CEWA 1PVC3 3S6PA 4FTEA 2HWD1 1MEC1 1C8M3 3M8LA 5J96B 1BMV1 4CDXB 2HWC1 3J8F1 3VDDA 3NAPA 4CDXC 1K5MA 1RVF2 5J98B 1TMF3 1AR81 1VBA1 2Y26A 2RS32 1RUI1 1AR72 2GH8A 4GH4A 1RB8G 2BPA2 1QJX2 2MEV1 3VBOA 1NOVA 4GB31 5AC93 1MQTB 4Q4X3 1MQTC 4CDQB 3JBG3 1RUJ2 2WS93 2WFF3 4N43A 1RUC2 4CDQC 4RR3A 1VAKA 2HWB1 4RS5B 1POV1 3VBUA 4YVSB 5A32A 2RMU3 4RS5C 2ZAHA 1ASJ3 4YVSC 1AL0G 1FOD2 3ZFGA 4GMP0 1NCQB 4BCUA 5ABJB 5L7OA 1RUG3 1NCQC 1VBB2 1EAH2 1AL21 1TME2 1ASJ2 1VBD1 3VBSA 4WM7A 4CDWA 4RQPA 5DDJ1 5FOJB 1AYM2 1HX6A 1PIV1 2RR13 2HWC3 1BEV2 3J8F3 2RM21 1AYN1 4LLFA 1R092 2R041 4Q4W2 1QJU3 4CEWB 5GKAC 4CDUC 1RUD1 1FMD2 4WM8A 4CEWC 5K0UC 1ZBA3 3VDDB 1AR63 2XBO3 1W39A 3NAPB 2RS12 1QJZA 3VDDC 1K5MB 3NAPC 1GFF2 4NWWA 1OHFA 3TN91 4RHV1 1K5MC 1RUF2 4CEYA 1R082 1HRI1 1ND2B 1VBE1 4Q4V3 4GH4C 2R063 1PO22 3VBOB 1H8TA 2HWB3 1RHI1 1PGL1 3VBOC 1FPN2 1PO13 1HRV1 4Q4V2 2HWE3 4Z92B 4N43B 2FZ1A 1POV0 4N43C 5CFDA 1EV11 1ZBE3 5D8AB 4RR3B 1RUE2 1C8NA 1VBD3 4RR3C 5A32B 1RVF1 5FMOS 3VBUC 1X33A 1NA1B 5DDJ3 1VBC1 3VBFB 1CJDA 2RS31 3ZFGB 5L7OB 3ZFGC 1AYN3 1RUH3 5L7OC 1QJX1 3IDEA 1NCRA 1IHMA 1OOPA 3VBSB 4WM7B 4CDWB 5C9AB 1RUD3 3VBSC 4WM7C 4CDWC 5JZGA 1BBT1 4RQPC 4IV3B 4EJRA 1RMU2 2TBVA 1AUYA 1RUJ1 2RS53 1VB4A 4RHV3 2R072 2WLPA 4WM8C 4QPGA 2RS52 5FMOL 1VRH3 5C8CA 1COV2 1ND3A 1Z7S2 1AR92 1EAH1 4CEYB 1TME1 5C4WA 1PVC2 4CEYC 1C8M2 5BNNA 2PLV3 3ZXAC 2WWSA 1EV13 4N53A 1H8TB 2X5IA 5BNPA 1B35A 1H8TC 1R091 4Q4W1 1QQP3 1SMVA 1TMF2 1R1A3 2PLV2 1VBC3 3VBHA
chains in the Genus database with same CATH superfamily
4URTA 5JSRA 4IGPA 3WF0A 4GKXA 4HVOA 2BEOA 2BYVE 2OZJA 4LLOA 4JRAA 5JCTA 1JZ7A 5B4XA 4JHTA 2BNMA 4HXCA 3WQ0A 2KM2A 2VBBA 3N9LA 2A71A 4EWAA 3APBA 5FP3A 3VZOA 5AC92 3PUQA 5CKNA 4PJYA 4Q4X2 2B4KA 2PHTA 4FVVA 4S2FA 4XTMA 1ZZ6A 1ZA4A 1H2MA 1YI7A 2ZHMA 5C5TA 2D6KA 3H8UA 2GSYA 4PDWA 1Q8OA 2PHXA 4MVTA 5CKQA 2ENRA 2WZR3 3OGJA 4QXHA 4D8MA 2VVFA 3WQ7A 3ZXEA 1CGPA 2ARCA 3PIJA 4NIIA 3AZXA 2XXZA 1NCRC 3WR0A 4YSFA 4LEJA 4PIZA 2YY1A 3GXUA 3T2TA 2AZ5A 4DMIA 3MICA 1L7RA 1VALA 1HJFA 1STMA 3NMBA 4P08A 4AGVA 1XXNA 5CAZA 2CV6A 3FHAA 2ARAA 1VB2A 2JDMA 2W52A 3I97A 1CZSA 2J1SA 5C33A 3NNGA 2V4VA 2A5ZA 3M70A 2JDKA 3WNMA 2IC1A 3PJQA 4Z8BA 2JG9A 1AR83 1PM4A 2ZX4A 3P1IA 2DDUA 2FCVA 1S0GA 3J8F2 1JOPA 4MGYE 5HPOA 4QPGC 2E51A 2PAEA 3ZXJA 1UIJA 2OPWA 4FO9A 3VZKA 1D0HA 4URAA 4QQOA 4BOWA 2OQ7A 1ND3C 4IEZA 4K1ZA 4COUA 2YFZA 4DY5A 4XDQA 1J1LA 2W08A 5FZBA 2RDNA 2Y6HA 2Z42A 3U75A 3WD5A 2PAKA 2W5FA 2Y6LA 3UK9A 4NJ4A 4N53C 1QNWA 1W3XA 2X5IC 3ES1A 3KWVA 1IS4A 2JG8C 2QZ2A 1POV3 1QXPA 1S55A 4N9IA 4QGLA 2QUOA 1NE6A 3ZFEA 2C9KA 3LD8A 3EXUA 2EAKA 2YBKA 5KHKA 1UF2C 4BQ3A 4B1LA 2I2SA 4NHXA 1ZVFA 3V56A 1X9PA 5F5AA 2HWB2 4IEVA 4JC1A 1OKQA 2JDZA 1TNFA 1COV1 2C26A 2Y33A 3LEKA 4IQPA 4QHBA 3ZSLA 4B29A 3SQOA 5L73A 2QFEA 4BIFA 5CFCA 2WIIB 1ONAA 4MX3A 4NR1A 2IZWA 3OGRA 3THPA 2ZEXA 4PDWC 3ATGA 4FP2A 3LEIA 1LHNA 1AR71 2VTXA 5GLUA 2W68A 3KM5A 5KC6A 1IGOA 3U78A 3ZFFB 1X36A 2R043 4R9CA 3U11A 4NIHA 3SLIA 5IK8A 2AACA 3M3IA 3WF4A 5DDJ2 4XXAA 1TMF1 2J22A 2BVBA 4RQPB 3CMGA 3K51A 3QLQA 2VMCA 3PLQA 1VIWB 5FYTA 3AJYA 2DBIA 3PMEA 1UWWA 2D3PA 1CX4A 5F3EA 3VV1A 3QD6A 1RUC1 2DVGA 1SHWB 2YDEA 2R6QA 1F31A 1XQNA 1VLNA 2IXJA 3AMNA 4DUXA 1DQ6A 4UOJA 2JG9C 1WBLA 2ZKNA 2K0GA 1HRI3 4DRRA 4E8CA 2O1QA 5IFTA 1U12A 3U0ZA 5LRSA 4QKNA 3NRUA 3JZVA 3KVAA 4LIVA 5FKBA 1H4GA 3C7OA 5A3MA 1JZ5A 1OBNA 3AKQA 3B9CA 3SISA 1RHI3 3MF9A 3C7EA 2UWAA 1KFUL 5A33A 5FZ3A 1WLCA 1HRV3 3ZN4A 1ASJ1 2VM9A 2NQYA 4CCOA 3ZN6A 2CTVA 1VRH2 2FCTA 4IDZA 3WP6A 5C71A 4FOWA 2H6CA 4HPKA 1RUG1 4C91A 1U5ZA 3ZYRA 5CG9A 2I74A 1S2EA 5FUNA 1XNBA 4LPLA 1ZM1A 2VNRA 3I2GA 4MO3M 1W9SA 1OQDA 4HVRA 1W8HA 3ZFEC 4CXYA 2FCUA 2XHNA 4WZFA 4LO8A 3ZSJA 1W3VA 1AR73 3AP4A 3VBRB 3I3QA 1LECA 2ZHLA 5ISLA 4PLOA 4IE0A 1KDMA 3WDVA 1CIWA 2DU1A 4UFLA 4HFSA 1ND2A 5CFCC 1I3HA 4YG3A 2A7AA 4EZHA 4BQ5A 1UX7A 5IUQA 3RQ0A 1RUJ3 2YHJA 1AR61 1RUC3 1UOGA 2EAAA 4IUGA 5FZEA 4K1YA 4CCEA 1S2KA 4OHYA 3G6JB 3I59A 1HB2A 1XYOA 4I01A 5C3RA 4Y22A 4M4PA 3GGLA 4HKLA 3WX5A 1UY3A 1NZIA 3RYRA 1I9RA 3I54A 2R061 5AVAA 2IXKA 2W1WA 5FXVA 2BDRA 2BGCA 3MEPA 2PHLA 2HYXA 4QX2A 2XH6A 2JKXA 5EJ1B 4JX0A 1UYYA 5F9TA 5L19A 1EAH3 1W2OA 2VZQA 2JE9A 2W2IA 4AFCA 4I2OA 5IATA 1CQ9A 1NA1A 4YWAA 5FP9A 1OSGA 3VBFA 1MEC2 2QDNA 2Y0OA 5JI7A 1LTEA 5JPNB 4LOSA 4ZU5A 1WCQA 3CQOA 2J1TA 5L9BA 3TRSB 5BNOB 1XSRA 1DBNA 2VUDA 1AX0A 4HOOA 4TLGA 4COZA 2CU5A 3WW3A 5C9AA 2GAUA 1EUUA 1LOFA 5F5IA 4GWJA 1LOGA 5JOWA 4JGYA 2Y6KA 2WNVB 4Y4YA 4CRQA 1U5YA 1QIQA 4IV3A 5IVFA 3B94A 3DPRA 4UW6A 1W0PA 2V5DA 1O4TA 2BGOA 4GB32 5DQ0A 5A3UA 5LA0A 2GNDA 4Q27A 3LDKA 4FFIA 5JIUA 3LOBA 4E9KA 5AFBA 2KA3A 5FZOA 3S0MA 4NMIA 5A6ZA 2PN5A 3P6BA 3SEEA 2VZSA 4W6YA 5F2SA 1XYNA 4N90A 2ZGKA 5EPAA 1NX9A 4FBFA 1UU6A 4CDXA 1T2XA 3LPFA 1H2NA 5FXWA 4XBQA 2O14A 3R0RA 4DXZA 2D6NA 4BH9A 1Y9MA 5T54A 1U5XA 1D4M2 2JDNA 3MIHA 4LBQA 1C1FA 3ECQA 1ND2C 3JB4C 2J1VA 1MVQA 1UMZA 2OUJA 4QX1A 3GM8A 3SITA 1ZYBA 2X53S 3WDYA 2Z4FA 2XONA 1V6IA 5H9QA 5JR2A 5L9RA 2BFUS 4XHBA 3KF3A 1DGWX 1LGNA 2E26A 3AJZA 5FZMA 2XVGA 1W6NA 4C0HA 2UWBA 2QQPA 2VMGA 2CWSA 4LXLA 3ILNA 3MIGA 1V9U3 1JZ2A 1UKRA 4W65A 1JYTA 5FPBA 3OUJA 3IBMA 2TEPA 1LHVA 1WW7A 2HH9A 3HN3A 1DGWA 5E16A 3CZUA 4NPMA 5LA1A 1JOJA 1QQP1 4RS5A 1UX6A 3O0VA 4AVVA 5LY1A 2VGDA 5F37A 1V9U2 4UWDA 1W6PA 3O1RA 1O4ZA 1W03A 3O0XA 1NA1C 2Z5WA 2LM3A 3NO8A 3VBFC 3W20A 3PNAA 3LDBA 3RG0A 1TQ5A 5FJKA 1RMU3 2WFF1 1NCQA 3NJZA 3WF2A 1YWKA 3LFMA 4GIQA 3MDPA 3OY8A 3J7LA 2EIGA 2QQUA 4B4QA 4PLMA 4Q2FA 5C9AC 1LOFC 1JZ6A 1VBE2 1VMJA 4JGYC 3HNMA 4Z82A 1IPSA 3KV9A 4IV3C 4QX0A 1Q8VA 1XBFA 3POBA 3IM0A 4PQQA 1NAEA 3DPRC 1E57A 3LAGA 4XEZA 3I49A 4W50A 1IS5A 1G9CA 1PMJX 4XURA 3RVHA 2ES3A 1ZZCA 2YBSA 3VD9A 1IOAA 4OQ9A 4CEWA 1W8NA 2D6LX 5FZLA 4QQLA 4CCKA 5T5LA 1MS9A 2G9FA 2HWD1 4EE2A 5A6XA 2ZGOA 2D3SA 2WO1A 2DCZA 4J1XA 3AMHA 3ST7A 4BA6A 3KT7A 3NSTA 3UT0A 2BGPA 5JR7B 1W0NA 3LF7A 2CL2A 5T3NA 1ENXA 4CDXC 2XJPA 1NZCA 2DUQA 1ZNPA 2FMDA 2O8OA 3BODA 1CAWA 3BPSA 3A0KA 4NRPA 2GMEA 3E97A 2IVIB 4QX5A 2GALA 2XKOA 4WBBA 2R0HA 4LKSA 4Q0VA 3N4MA 1JYWA 2P17A 4QU2A 1QJX2 2WA3A 5FPVA 2QQIA 3NJYA 4LITA 1GICA 3VBOA 2EXKA 1VPHA 2UY9A 1MVEA 3WNXA 2P6HA 2I07B 3MV01 1GUIA 2H0VA 4CDQB 1OPMA 2WZPP 3BTAA 1Q8SA 1FYUA 1IQDC 2XMLA 2BERA 2WFF3 1YQ5A 3CLPA 4FPFA 2PAMA 2HEVF 3A22A 4N43A 3T0AA 4AG4A 4L99A 4XJAA 1UMHA 2A3WA 3EB7A 3ILFA 4GKYA 4RR3A 2E33A 3ZPYA 1BJQA 3ZR6A 1XPWA 2RMU3 2ZAHA 1XNAA 2J1RA 2ZCWA 3Q8BA 4RS5C 4E2QA 2PELA 3MW2A 1JU3A 2XDVA 1K3IA 3FC0A 3N9NA 2OYZA 1FOD2 5KHJA 4AQ2A 2DVDA 2X10A 3KT4A 2AC1A 4FPJA 1NCQC 1GQPA 5CB7A 2DU0A 1SPPA 3KZ4C 4LUMA 1AL21 5DN2A 3RNSA 3KGLA 4OUSA 2VG9A 4QM8A 2ZA9A 5LASA 2WN2A 1D0GA 5LATA 3HNBM 4RQPA 4Z2AA 2DCKA 5LB6A 4UF0A 1HX6A 3FBYA 3GALA 2RR13 2XHKA 5FP8A 3I8TA 1SCRA 2RM21 1OA4A 1R092 3FLTA 1JI6A 4KGQA 3DKQA 4QKBA 3FHIB 4X8PA 5F7UA 5GKAC 5F3GA 1RUD1 3ROUA 3LPGA 2E9QA 4XFIA 2WN3A 4K20A 4CEWC 2R1DA 1ZBA3 3WUCA 4PIXA 4AK3A 3C3VA 3HPNA 4NROA 4AVAA 1CR7A 3DEMA 1UOJA 2G4IA 3FHQA 2XBO3 2VOKA 2WL1A 1G9FA 2RS12 4XXPA 1DP0A 1K5MB 4PBOA 1IS3A 1YYNA 2Q4SA 2ZBJA 1LESA 4NWWA 4QX8A 1G9AA 4AF9A 4LR4A 3M4FA 4DEVA 2WZEA 4CP1A 4Q4V3 5GLZA 1E5IA 3H42B 2VNGA 1K45A 1PO22 1Q43A 1OC1A 5FP4A 4K9SA 4PT6A 4E4ZA 3S57A 4PLNA 3WCSA 1PGL1 3VBOC 1FPN2 4MZUA 3ZSEA 3G7DA 4ZKTB 3UJOA 1ULEA 4YFZA 2XLFA 1EY2A 3H1WA 1DQ5A 2A73B 4Q4V2 2HWE3 3HJRA 4ASKA 4LKFA 5G05L 4B3NA 1PZ9A 2O0OA 2XJUA 4FOQA 4IE6A 2ZACA 2CYFA 2F4LA 2P3YA 1D2SA 3LZZA 2VZPA 3OOXA 4FFGA 5CNAA 4N43C 1JS9A 1QH7A 3V65A 3IPVB 4PI0A 3WDWA 1WGPA 4YYOA 2LALA 3FLPA 1S0CA 1C8NA 1HIXA 3H7YA 4RR3C 5FAXA 2VJXA 3W21A 4D6SA 1D4VB 1RVF1 3OPTA 5FMOS 4A6SA 1NLQA 4LMFA 5DZEA 1RTVA 2HEWF 4BE3A 3ZFGB 2OIIA 4DO0A 5DAXA 3H1MA 2DTYA 3ABZA 2JXAA 4AAXA 3V64A 1IHMA 4CDWB 4AL9A 3RSJA 1RUD3 3BGAA 4XUTA 1S0EA 2W47A 3I2FA 3DXTA 4YW3A 5FCCA 4KQ7A 1GZTA 4RQPC 1O8PA 4L11A 1C4RA 3CKHA 5GZFA 4QXKA 2RS53 1DZTA 1VB4A 5E6HA 1LNSA 2H0BA 1W28A 2YPJA 1O91A 2WA4A 2ILMA 2XWBB 3V0BB 3FFZA 4QM9A 3FMGA 5A7SA 1GV9A 1HQLA 2XLAA 2XL9A 4XF3A 4R8HA 2RS52 3HQXA 4PCRA 5FP7A 4EWDA 5C8CA 1DGRN 1J3QA 2ZGLA 1OH4A 4RA0A 2NMOA 1KFXL 5LA9A 1XE7A 2ZKLA 3VUOA 4AI0A 2PHFA 1AR92 1GP6A 2X05A 4XACA 5F39A 4MUVA 5JIAA 1TME1 2FBEA 1JTZX 1PVC2 1UY2A 4GAZA 4X8NA 5C4WA 3EBRA 1J59A 3GBGA 1H2KA 4KU7A 5GJ6A 2VTXJ 5FZCA 3UGHA 4LK7A 4XF9A 4DXTA 3ZPOA 4UBGA 1GNYA 3ZXFA 5GLWA 1YO8A 3ZYGA 4XZUG 1R1A3 1W6MB 2YYOA 1FMD1 4H14A 5JZGA 4QHOA 1OUSA 2WQ8A 3U07A 3WLUA 1FI2A 2GMPA 5CFDB 4FPCA 3I3MA 3K4DA 4AHZA 4KG8A 5E1RA 1R1A2 4BPZA 4R4ZA 1ZRFA 1PGW2 4GMP3 2Y38A 5FWJA 3HR9A 3R4SA 4UFKA 3RZHA 3GBWA 1WCDJ 2H6BA 1IG0A 5ERLA 2WS92 1GOHA 4M3CB 4CPBA 5GLVA 3VKLA 3AKPA 1DZRA 4A41A 2TUNA 1H1MA 4RYDA 3KCXA 2WRAA 4LHKA 4P9WA 2W87A 2B9UA 3AZYA 2LTNA 4RL7A 3IDCB 3AYEA 3VLBB 3MFAA 3RJ2X 3VD4A 4HT1T 3RZKA 4ZU4A 5I0UA 3ZIXA 2RDRA 3BU7A 2Z69A 4D7YA 2VMFA 3K3NA 1DGLA 1UYZA 4KWUA 5FYHA 4RN5A 1LHOA 4W6WA 5HCAA 1XYPA 2HWF1 4H3WA 5DG1A 5DZFA 2IWGB 1EYBA 1V0AA 1RUE1 3DCQA 3O5SA 1CIYA 4PBPA 4YLZA 5HV4A 2XJQA 4LNVA 1VBA3 4AAPA 1RUI3 3W59A 3B02A 4A7YA 2RG4A 2ID4A 2HWC2 2XL7A 5FYBA 3UGFA 3RPQA 1Q8QA 1REFA 5C8CC 5FBZA 2RHPA 2MEV3 5F3CA 1QJU2 1HXS1 2OT7A 1WMXA 1H6YA 1VBA2 2OW4A 2ZZQA 3Q8CA 4PQ9A 4Q4Y1 1HLCA 3HVDA 1QOSA 3J9SA 4Y1YA 3VKFC 5C4WC 1GNZA 3ZYJB 5I8YA 1BCXA 4GH4B 5BXXA 2RDQA 5I0SA 4TZDA 3OG2A 5FZ8A 2W92A 4I0WB 4UFMA 4IV1A 5BNPB 4P9XA 2W1SA 4LA3A 4KWLA 4XCAA 1HB4A 2C0ZA 2YU2A 3SCHA 1OLQA 4R4XA 5KXBA 1U0AA 1V6NA 3VBHB 5SV8A 2PA7A 4FI9A 3TNQA 2VOVA 4JAAA 4Y20B 4JRLA 5JZGC 4OHWA 1N3QA 3POIA 3GF6A 4LBMA 5J96B 4YVWA 1PO12 3T2OA 3R05A 1Z7S1 2JJ6A 5GM0A 1A8DA 4ZY9A 4C8DA 3O1VA 4DFSA 2VUAA 3I2KA 3ZN5A 2AH2A 4AEDA 4DUWA 3ZXLA 5JXHA 3S5AA 5JSOA 1PIV3 1ZBE2 1C8M1 3POWA 2XQXA 3MZHA 1DQ0A 2HWF3 4JHZA 1W0OA 2WFPA 4BB3A 3NWKA 4Q8LA 5FQ0B 1PNFA 1E5RA 1LOCA 3VGIA 4JCKA 3VKNA 2C5DA 1PIV2 3C7HA 1YFYA 2WABA 4YNIA 3N7MA 1AYN2 1RUH2 4MSVA 4E8DA 1ENSA 3UV9A 4DEQA 5CG8A 2ZPXA 3IAPA 1C3HA 3SKVA 3ZYPA 3CU7A 1CX1A 1HXS3 4J25A 4QX7A 4BDVB 1Y3TA 1UZYA 1S4CA 3AFGA 4Q4Y3 5AC91 3TN93 1XE8A 1NLSA 3MIEA 3L2HA 1MS1A 1N1YA 4OLLA 1JXNA 4MXWB 3D8CA 2B9VA 4AI2A 3R4UA 5FYVA 2JIJA 3I7DA 2W1UA 3EHKA 1KQRA 2B46X 4JKLA 4RHV2 2EALA 4M4RA 1HN0A 1WMEA 4OCTA 4CP9B 4M00A 3N35A 2KR2A 1ZZ8A 2ZHKA 4AE2A 2WSUA 1OQEA 4FQZA 4ITCA 2WR9A 1LR5A 1AYM1 3RGBA 4OMCA 1UXXX 4IV1C 4MGQA 3WUDA 2YC0A 1BEV1 2J1EA 3WQ1A 3OEAA 1F8VA 1OQ1A 4LHSA 2RJLA 4KL1A 1CAXB 5DG2A 2XB6C 1WLDA 3ENRA 4D7SA 5I0RA 5FPZA 2ZJCA 1WCUA 2HBTA 2RS33 4COYA 4HONA 2YMZA 4LHNA 3I2OA 3VHPA 4YRDA 4TXWA 2HJIA 1CPNA 4YVWC 5B4NA 4M0NA 3BIWE 1NUKA 4AQ6A 1VBC2 4XQ4A 5C3SA 1XU1A 3LIGA 4AEKA 1RUF1 1BBT3 1R081 4AEDC 1NQDA 2VOWA 3UJQA 1GZWA 2G1MA 3X29B 2P3JA 5I8TA 2QQMA 4E4HA 1QY4A 1OFNA 3LCPA 1I5ZA 2E6VA 2GP5A 1QGLA 5A70A 1BBT2 5FZFA 3N9QA 4XVHA 3AFKA 2W3JA 3INAA 1YXWA 2WZR2 5IWFA 4FTBA 3ZMOA 1W8FA 3MIDA 1O6UA 4K6BA 3WNOA 1OF3A 2ZGNA 3L2YA 3OPWA 4OYUA 4A44A 3D4KA 3MPBA 5CZKA 4I02A 4YZ5A 1GSLA 3MPPG 2IXIA 3WW2A 3B3QE 4BMEA 4JQTA 1RYYA 1AYM3 4NO4A 1BVVA 4QPIA 4TSVA 2XUMA 1W9TA 1BEV3 5JWPA 5IHRA 5EV7A 1S2BA 4XPVA 5C8WA 2DFCA 1UL9A 4Z07A 1SBEA 4Q4W3 5H9PA 1AR82 2BNOA 4BISA 3H0OA 4RFT0 3RZLA 4YGEA 5BNNB 3MLKA 1QJEA 5KXCA 2BBVA 1E5HA 1WMFA 3A4UA 1AF9A 5E8AA 4DQAA 2VQAA 1OLRA 3AZVA 3C7FA 1H0BA 3FLRA 1RUF3 1DFQA 4J6GA 3O1OA 1R083 1UYPA 1CZVA 1WMDA 2WO3A 5FY0A 2R071 4XMAA 3GBFA 5IVCA 5T5JA 3SH3A 1NKGA 5FLIA 1ACCA 3AVSA 4D7TA 3THDA 3POJA 3A0NA 1YQCA 2FDGA 4Q0UA 3FBMA 1W05A 2VMHA 3ACHA 4NPLA 4DXSA 3C7GA 5HCHA 1OLMA 3PDQA 4MH0E 2BQPA 3ZDSA 3QBQA 1W6OA 1HV1A 1OFSA 4DRVA 4AFAA 4NAOA 1VMHA 1MS5A 3NV2A 1VRH1 2FDIA 2ZGUA 5JUVA 3KCYA 3O1UA 3DUIA 3IZOA 2G9ZA 4YW6A 1W6MA 5FYYA 1HDKA 5FK8A 1MQTA 5FBJA 5M0TA 1LRHA 2VPVA 3PVOA 4ZU7A 3AL5A 1F2NA 2PLV1 4LA2A 3OUHA 3B7MA 3AP5A 2B5HA 2R042 1W2TA 5HCBA 3O7OA 4PF1A 1L7QA 2WYFA 1UZZA 3CJIB 1PX3A 3ZXDA 5J09A 3ZM8A 2WO2A 2HKXA 4FOYA 4YVSA 4NUBA 3CL1A 4M3CA 4NIAA 4F83A 3SMHA 4YZ2A 3JBG1 2ZX2A 1ENRA 2WNUB 4G3YC 4QPIC 4ZS2A 5LBBA 4DUVA 3ACLA 1Y4WA 5LRRA 2AUYA 3PIGA 5A7NA 1HRI2 1IKPA 5EYXA 5A3LA 2BFUL 2R073 4H7LA 5JDBA 1OLME 3AMMA 2JKBA 4WVVA 1GP4A 3PHMA 5FY5A 1GANA 3OPZA 1RHI2 4JGZB 1COV3 4LBQD 1FNZA 2A70A 4H7MA 4QDQA 5IK4A 5IVVA 1HRV2 3JB8A 1W99A 1BK1A 3EMRA 3POYA 4BJ0A 4XQDA 1F35A 4LOTA 5A6YA 4EYUA 1SCSA 2B39A 2Q0AA 3HEIA 5IK5A 2R32A 4FAGA 2WINB 2LRPA 1MEC1 5FY8A 1A78A 2PFWA 4BXFA 5I93A 5H9SA 2WJSA 4QX3A 2ADDA 1W9WA 4P00B 3NAPA 5F1RA 3LFIA 5ANQA 5J98B 2ZX1A 1TMF3 4G9SB 1XNTA 4GULA 1XU2A 3OYWA 5LBFA 4C1WA 2HYKA 3ES4A 3EJKA 1AR72 4GH4A 5CADA 3LWCA 1X50A 1Y43B 4JVAA 1V6MA 3BN6A 3IN9A 1RB8G 2ZOEB 1TG7A 2IXLA 3RYKA 2VH9A 5KHHA 3BOWA 3JUUA 1Y7BA 3GDBA 4UFIA 4B7EA 1GKBA 4FPOB 4GB31 2QQVA 3KLSA 3OB8A 4ISQA 2P2KA 4NRMA 4J1WA 5BNQA 1MQTC 5J3UA 2ZX0A 3GHMA 4Y20A 3CNAA 3JBG3 4MOAA 1RUJ2 5K8SA 4O9GA 4QQHA 1UPSA 1RUC2 1BHGA 3ZYBA 4AFBA 3LKJA 3C2UA 3IKWA 4CSWA 1QMJA 4AZZA 4Y5TA 2K9ZA 5A32A 2DUOA 1OH3A 3RZZA 1ASJ3 4FCAA 4YVSC 2EXHA 1CPMA 1KS4A 5FZGA 4AWDA 2AENA 4XFFA 3LEMA 3I4IA 3HN1A 5DUWA 5L7OA 3TB0A 4QGNA 5HXMA 1RUG3 1DLLA 3CHXA 1EAH2 2VBPA 1NLRA 2W91A 2XLGA 4TWTA 1ASJ2 1UKGA 1VBD1 2ZEZA 1O59A 3VBSA 2IXHA 4QMAA 3UYJA 4LBJA 2ADEA 3I2JA 5BY5A 2BJSA 1FV2A 2PQSA 1YC61 2XOMA 4IESA 1JYXA 1H8VA 1ZRDA 5C3OA 4HKOA 3K75B 4LLFA 4MV2A 5A3WA 4AHWA 4MG2A 4EN0A 1DHKB 2JB8A 5IVBA 2DBNA 2OVUA 2YZ4A 2XUEA 2DFBA 4MXWA 1ZREA 1UYXA 3J7MA 3SC7X 5J36A 4AFMA 4ORFA 4PHZA 2ZAAA 3GYDA 1G7YA 4FQ4A 4OHZA 3VDDB 1AR63 4E4DX 5A3TA 2OKXA 3OBRA 2WNEA 1QJZA 2JECA 2VMIA 4MGSA 3NAPC 3KMHA 4S2DA 1FNYA 1OHFA 3VZLA 4BZ4A 4C90A 4CEYA 4IE5A 3ACFA 4KH9A 1OMIA 1UU5A 2WWUA 3U37A 5FDBA 1VBE1 1XC6A 3N9PA 3HD8B 4GH4C 4CU6A 1ULPA 2GNBA 2R063 4KI5M 4XJWA 2XR4A 4DB5A 3KVBA 3T30A 4LULA 1H8TA 3LE0A 4CUCA 4Q0QA 5A7OA 2WC2A 1AXZA 2ET1A 4GWIA 1ULOA 3K4ZA 1BLZA 3HMYA 1Y9GA 3WNKA 3VZJA 1O4YA 2VCCA 3RMYA 1WLWA 3JQWA 3JCIA 1WA4A 2C6SA 2XGXA 1PK6B 3UKTA 1WD4A 1EV11 1QHDA 4HBNA 3HIFA 4JTNA 4W4ZA 5FRAA 3SHRA 4QAWA 1VBD3 5C3QA 4OVEA 3CIHA 2ZMNA 3ZSMA 2J42A 4AGRA 1JOBA 5FZIA 3SH4A 4NRQA 4ZS3A 3USUB 1NXMA 2TNFA 4Y1XA 3E5QA 2CWMA 4Q1PA 4PIYA 3P5BA 3B5LB 3AXDA 5L7OC 5EJ3A 4FOVA 1QJX1 2BBAA 4XW3A 2VOTA 3NNMA 2VCMA 4WM7B 2JB4A 4OHXA 5FFOC 1VAVA 3N3HA 3S5QA 3U10A 4JKKA 4DXRA 3VBSC 1JN2P 4MLOA 3VDCA 2E7AA 1RMU2 1AUYA 3N7LA 3RZGA 2XG3A 2GZWA 3POSA 1SDDB 5FPUA 3WHUA 4GWMA 2VQTA 4YGCA 1ZZBA 3NQHA 1UY4A 1IPKA 1XRUA 3V0AB 1SLIA 2VXJA 1SBFA 5FUIA 4ZXKA 5FMOL 1GQGA 3AKTA 4A6OA 1GMMA 1IG3A 1WWYA 2CY6A 2QQWA 2VZVA 4QPWA 2VUJA 3I3DA 4QKDA 3SEPA 2UWCA 3WG3A 5FTTC 4LK6A 3TNPB 3UKVA 4IEXA 3VHOA 5IAXA 5DABA 4CEYC 5B2GB 3LSEA 1W2NA 1MS3A 2X29A 5BNNA 3ZXAC 2A6XA 2ZGPA 1EV13 5A1FA 1VMFA 5JPMB 2Q8EA 1GR3A 1X82A 2D5FA 4HSLA 1VE0A 1H8TC 1R091 4UW5A 1QQP3 3GZTB 4CUAA 1LEMA 1KS5A 1UOFA 4FPYA 4P9JA 5DAWA 1G8WA 4XILA 3ZR5A 3JD71 4AXOA 4L9BA 1H2LA 2BUKA 2R30A 5C5UA 3BB6A 3H1YA 3GCXA 1WW6A 5D2AA 3D82A 4GD4A 1QJY1 4TTGA 2ETEA 5T50A 4FPKA 2O8QA 2P5BA 1WW4A 2FD8A 4XJUA 2WFF2 3VDAA 1LOAA 1RJ8A 3WP5A 3NW4A 3S30A 1LAJA 2ZEYA 3S7EA 1NCRB 1ZZ9A 4AR2A 2L9LA 1PO21 1JHJA 2GC0A 1QF3A 3O0WA 2RMU2 2SBAA 3ZFFA 2YGMA 3ZKYA 1PM7A 1DQ2A 1F5JA 3D6EA 2VMDA 3LEGA 1N47A 1IPJA 4HK9A 4HANA 2HWD3 4QPYA 1YNAA 3D0JA 3ZMNA 3WINE 4CDUB 1TE1B 1QXJA 2OQ6A 3DKWA 5AVPA 1WA6X 1OD3A 5K0UB 1X8EA 2Y60A 1N1SA 3WV6A 1SFYA 2A1XA 2FZ2A 3H9AA 4QPGB 1AXKA 2RR12 5A3PA 2YGLA 4A3XA 3M3CA 3B69A 5FMCA 1LHWA 1ND3B 5GZDA 4AI1A 2WQ4A 3NL1A 4NIGA 4K21A 2ATFA 4Q29A 4CP0A 5ACA1 4FPEA 4EN6B 1NY72 4YM1A 5A7PA 3B00A 1ZBA2 2QNKA 5IK7A 2UY8A 2VAUA 3JD73 3J4UH 2XBO2 3WHTA 4N53B 5BNNC 2GC1A 3ZXKA 2X5IB 5HCFA 1W90A 2ZHNA 4QGMA 4BU2A 2W94A 4YZ4A 3RYPA 4CPBD 5CA6A 1QJY3 1NYWA 1XNDA 2GP3A 2GDFA 4S2HA 4UFHA 5IJRA 3WVJA 2BW8A 1W04A 4LHLA 4QU1A 2XKPA 4XF0A 3ORJA 4IEQA 1HB3A 4A4AA 2E63A 5LK5A 1WCKA 4D69A 4MADA 1VRBA 3VBRA 3F2ZA 1RJ7A 3W9AA 4YFWA 1UOBA 3LOIA 4GZ9A 1AL23 1AR91 2IFWA 2HWE2 3P3PA 1G6NA 4L8QA 1NG0A 4Y5SA 4PDWB 3UESA 1T6GC 1W2UA 2BOJA 4OZXA 3K48A 1H1IA 5FYZA 2RM23 4JZRA 5EQUA 1F4HA 4OI2A 1L3JA 2BV4A 2VNVA 1H1AA 3ZFFC 4XFBA 4W6XA 3EQEA 2YC2A 3FN9A 4YZ1A 5FLHA 4TLFA 3ETQA 1C1LA 4XJ8A 4E27A 4AQTA 2EVXA 4P5HA 4YG0A 4FFFA 4QB2A 1E5SA 1WLTA 2LW8A 5ACA3 2JEMA 5FZ6A 1XOYA 1RUD2 3BU0A 2WUHA 2XJSA 3IDAA 4CE8A 1W8UA 5FIXA 2JG9B 3N9OA 2JDPA 3AMQA 3R6SA 1HQWA 2W39A 1CJPA 3AVRA 1GWMA 2WZ8A 4UW3A 3LA3A 4BMBA 1QEXA 5FO7B 4O61A 5I91A 1SLCA 3ME2A 4Q8KA 2KXLA 1GZ9A 2WT2A 1GU3A 5ANNA 1JZ8A 3FUOA 3AZZA 3JQXA 5BNOA 3L9JT 1VBB1 3H8XA 2RDSA 4A42A 1FATA 3AP9A 4BQYA 1ZRCA 4WVWA 2WNVA 5FUPA 3KSCA 5FYCA 3NJXA 3NNJA 4AFDA 4ZZ8A 3K2OA 2OS2A 1O3RA 2VXRA 1PGL2 3ASIA 4KG0A 3VD3A 3T2QA 3T0BA 1YQ6A 2EICA 1CESA 4MGKE 3AX4A 2JE8A 4YW7A 3ZFEB 4NN0A 3WOGA 5BV6A 1RVF3 1QOTA 3CBNA 4XBNA 4M01A 4R9DA 2E53A 2A3XA 1FV3A 3GZAA 3OSDA 1DYOA 4JDMA 1O3TA 5CIRA 2DVFA 1WZXA 4DPNA 3VBRC 4ZPIA 3RS6A 1QJU1 4JV4A 4K40A 3NVCA 2JDAA 1QU0A 3PURA 2Q1ZB 4RSUA 3ZYFA 4HVQA 1BKZA 1IZ3A 4LBOA 1ULDA 1W6QB 5CFCB 5IYYA 4HETA 5A1LA 5T55A 1W9YA 2N7GA 3DYOA 2D93A 4GWNA 2WYSA 5FZ7A 3K4AA 4PF5A 4H2AA 3AKRA 1HKDA 3MIFA 4C0BA 1OOPB 5FXZA 5CBLA 5FY7A 2VO5A 3T08A 2JE7A 1JZ3A 3GCWA 2YXSA 3OD4A 1ULFA 3MIBA 4JKMA 1XSQA 3H50A 2B7YA 2WT0A 4CUGA 4XHXA 4LE4A 2AEYA 4Y5Z0 1GP5A 2QQOA 4Q0PA 4CUBA 1YLLA 2ZGTA 4LQRA 3RDIA 1VBB3 2JX9A 1PO11 4TYSA 3RFRA 2FDFA 1TVGA 1TME3 4AI9A 1M06G 3MV11 3PVBB 1JYVA 3NV3A 4OUEA 4O9EA 1UO9A 4Y24A 3AB0A 2WDBA 4NE9A 1BMV2 1ZBE1 3QH7A 1RUNA 3H3UA 2QTWB 3RRDA 1G9BA 2VY0A 5KHIA 1PHMA 5A33B 5BNOC 1RUI2 2EIBA 3BI3A 3ZN6B 1FMD3 5FZ4A 3CJXA 3KQRA 1UZ0A 4HPKB 2WNVC 2ZZJA 1DIWA 2VZTA 1RUH1 2MEV2 1F9KA 4LBKA 1SDWA 4AVCA 1HW5A 1B35B 4XFCA 2XJTA 2Y6FA 5F5QA 4CCLA 2D40A 2CGPA 4FPGA 3I3BA 5BUVA 2Q1FA 4AEJA 2A6WA 3V0AA 3H3ZA 1DLCA 1ULCA 3ON7A 1X7NA 4KWKA 4YW4A 4O7XA 3WNLA 4LIUA 3PJYA 3RI9A 3KV4A 3AM2A 2DF7A 5JI9A 1NQJA 4GXLA 2QKDA 4BHPA 1DQ1A 1UW8A 5HV0A 1ZRIA 1IQAA 4ET7A 5JOYA 2K2SA 5IVJA 1XE0A 3J7NA 2V4AA 2CAVA 1REDA 2XWJB 4XC9A 4LO4B 1YFWA 3DECA 2QQJA 4ONUA 3A23A 1IKQA 3QCWA 4IERA 4V2WA 5GALA 5EJZB 2Q5TA 2JENA 3I59B 4MYEA 2PXJA 2WBKA 1RUE3 4Y22B 1FAYA 4XJZA 4COVA 2EIEA 4QWNA 3S7IA 1QH6A 2XJRA 2VULA 5A6QA 2XQRA 4A7KA 4FPHA 4CDQA 4DNYA 2HWF2 4EN9B 2LS6A 4L0PA 2BNNA 3AKSA 3BVCA 2PHRA 3E1F1 3K46A 5I8SA 4Y1UA 1BMV1 2GC3A 3VHRA 3NV1A 5T5PA 4MGTA 4OI0A 1RXGA 1W8WA 3IWZA 3PUIA 3Q8FA 1EP0A 1JW6A 4I0AA 5TSWA 5FYSA 2QVSB 2K46A 4Q4X1 2A75A 2ARXA 1SZBA 5A7QA 4B7KA 3URFA 2D6OX 3OF1A 3VKOA 1ODMA 1YJKA 5FKCA 1RUOA 4HMZA 1HXS2 2VZRA 3N36A 4Q4Y2 3MUY1 3TN92 2QQNA 4JGYB 3O1SA 4TN7A 5JLVA 4LE3A 2YB7A 1LU1A 3FFQA 4UAPA 4CCJA 1PMIA 3DPRB 2GMMA 3B93A 2WZR1 1OVPA 1UAIA 2Z2SB 2QQKA 2WNOA 4X6QB 1A34A 4CU7A 4LKEA 1T6BX 4V2VA 1Z7S3 4CDUA 3NNFA 5FPXA 3C8XA 1SLTA 4H55A 1SEFA 5FZOB 4I3GA 5K0UA 3RWKX 1KXGA 1OURA 3O1MA 4KBZA 4M0HA 1Z0HA 3S6PA 3WQBA 5L36A 2ET7A 4FTEA 3T4VA 1N3PA 1C8M3 3FUQA 4CDXB 3J8F1 3T2PA 3A21A 4Y3OA 5HXVA 3UNPA 4AEMA 1K5MA 2IFRA 1UY1A 2NN8A 5DPNA 5LCWL 1A3KA 3AZWA 1AR81 3LA7A 4XDPA 2MHFA 4F7ZA 2Y26A 3HWJA 2RS32 3LSDA 4QD2A 4ASLA 5J7MA 2OZ6A 1O8SA 2R1BA 1AJKA 4CXWA 3T1MA 5LZ6A 1MZ5A 3I2DA 4YZ3A 4D3WA 4BQXA 4QQPA 4I09A 1PMHX 3TAYA 3SXWA 3VDBA 1LKNA 5AC93 1W6NB 1VP6A 1AVBA 4Q4X3 3B9IA 1LJ7A 4UW4A 4OFGA 4CDQC 4QDRA 1QJFA 4N9HA 1AX2A 2B8MA 3AP7A 4IEWA 3IPVA 3M3OA 3MYXA 2EF6A 2HWB1 4RS5B 1POV1 5FZ1A 4OI4A 4KGGA 1W6PB 1JMUB 4UYBA 1GZCA 1BXHA 4D6QA 3AXEA 4BK5A 1H9PA 2YBPA 4L92A 4L2NA 3TYJA 3ZFGA 5ABJB 1NCQB 5EYYA 1SQ4A 5KHGA 1J83A 3FZ3A 5FO8B 2ORZA 3OY8B 2ZGRA 5BPXA 4S2GA 5D21A 1X8MA 4XUQA 1MZ6A 1N3OA 2V72A 4G4FA 3SNMA 2SLIA 4CDWA 3PL0A 5DDJ1 3QOPA 1AYM2 1S0JA 2OUHA 3R4DB 4UFJA 3GJBA 3J8F3 1BEV2 4N8MA 4UBHA 1DGRA 5F3IA 5C70A 1YEWA 2P37A 2R041 2Q1MA 3I2HA 3K77A 3MW3A 4Q4W2 2VNOA 5C3PA 3HBKA 3VKMA 3VZNA 3AMPA 3M1HA 3WG4A 4CDUC 4CEWB 3V0BA 2RVAA 3QH6A 5K0UC 4F3JA 4YARA 4FXKB 2WO7A 4XTPA 4BIOA 5GLTA 3PU8A 2XVKA 2KD7A 5FZKA 1UXZA 1W39A 3OBTA 1LENA 3U4XA 1QNYA 3QACA 5LW9A 1CAWB 4XAEA 3ZYHA 1GFF2 3KF5A 1MR5A 1K5MC 1RUF2 3KGZA 4IETA 5LBCA 1R082 1S0IA 3AP6A 4AYUA 1JBCA 1IS6A 4P02B 2GC2A 1HRI1 1PX4A 1UNBA 1OA2A 4EROA 4MGIE 4R9AA 1DG6A 5FMDA 3H8RA 1K42A 1UZVA 4LO5B 5FPAA 3OGVA 1SLLA 3ZVXA 3OGGA 4AGGA 3VBOB 4CCNA 2HWB3 1RHI1 3OJBA 1A8MA 1MPXA 2IXCA 2VBDA 1OF4A 4WVZA 3BCWA 1HRV1 4IW3A 3WG2A 5FK7A 1J84A 1KDKA 4N7IA 2R16A 5EWSA 3AYDA 3UL2A 4WV8A 4N43B 2HEYF 2FZ1A 2RJKA 1S0FA 5E88A 1POV0 5CFDA 5J37A 5D8AB 2PHDA 2UYAA 4RR3B 1GLHA 1HJGA 4XIKA 5FY1A 3BOPA 2C9AA 4XFAA 4NHLA 4B4RA 4AI8A 2R0FA 5FZHA 2AYHA 4BQWA 5DDJ3 1W6QA 1QDCA 3WW1A 3BPZA 1CJDA 5H9RA 3OUIA 5HBAA 3IMNA 1XNKA 3IIAA 4IE7A 4HK8A 2YUEA 3ZFGC 1SPPB 3TEXA 3IDEA 1OOPA 1WW5A 1JYIA 1D7PM 3LIHA 2W9XA 1CZTA 4P9GA 3ITQA 4CDWC 2GU9A 2Y6GA 2CNAA 4UF0B 4FAHA 1OI6A 2QDRA 1GWKA 4EJRA 4GALA 4IE4A 2TBVA 1LEDA 3MLLA 4ISRA 1RUJ1 1K12A 1RINA 4ARYA 4EWEA 3WY6A 3LGRA 5FYUA 4E4SA 5GZEA 1YFUA 4XMIA 3WP4A 4HZFA 2R072 2ERFA 4CTEA 2BVVA 3RJRA 2X8KA 4X6RB 2BTVC 2VTFA 4ZXEA 2YG0A 5FY4A 1LGCA 4DS0A 1V6KA 2BOIA 4W8JA 1VRH3 2HLEA 1ZZ7A 1GBGA 4JDNA 1COV2 3MUZ1 1V70A 3LQCA 4HG6B 1O5LA 3GZUC 5KXDA 4FXGB 1EAH1 2CDOA 2CSGA 3D3AA 1H4HA 4JTOA 4RFRB 4QDSA 4D0QA 5CU1A 3W5MA 3WNNA 1PZ7A 5LEJA 2E31A 4D94A 2PLV3 3IMMA 2J1AA 2FDKA 2WWSA 5IVYA 2WT1A 2WAOA 1U5IA 1YQ2A 3H8OA 5D1IA 1EPZA 4C1XA 1B35A 4GA9A 4M3CE 4XQWA 1RL3A 5BNPA 1YFXA 1SMVA 1TMF2 4F8AA 4YM3A 2PLV2 4OHVA 5F5CA 3BTXA 3VBHA 1UU4A 3KHCA 3H3LA 1W8TA 1WCSA 2V5YA 4FT8A 5A80A 4N7UA 5CFDC 1LB2A 3THTA 1Q56A 1V6JA 3J26N 4OULA 4ES9A 3BTZA 4IEOA 1O3SA 1YIFA 3JBG2 2RJ2A 2UU8A 3ACIA 2DCTA 2VW0A 4PI2A 2EXJA 1POQA 4XBLA 1D4M1 2WLQA 1MS8A 2YROA 3PTRB 2B45X 1YHFA 2IVJA 4ATEA 1QOOA 2QJVA 3AYAA 5L9VA 3RZJA 1OOPC 1UQXA 5T5OA 5FR3A 3WT3A 5FQ0A 2AR6A 3CDZB 3MFCA 5DAVA 5CEHA 1O5UA 1OT5A 4IEUA 2ZS6B 5I0DA 2JICA 3N9MA 1S0DA 1YRZA 1RUG2 2C24A 1MEC3 4GJYA 1CONA 4HLTA 4A3ZA 1LHUA 1OA3A 5FREA 1F15A 1XNCA 4CYDA 2CDPA 2FHRA 1N1VA 1SBDA 3OCPA 2PYTA 4Q5OA 3WXPA 1OD5A 5HI0A 5J1XA 2NYYA 2MNGA 3OD0A 4XF4A 1V9U1 2P1BA 3MI8A 1FX5A 2OA2A 4FPLA 4WZCA 4ARXA 4CCDA 5C8CB 4I0BA 4FTSA 4BQ4A 3ZKUA 2WWJA 5FXXA 5K9YA 4CU9A 5G04L 1XB9A 2XPJA 3M2MA 5F6KA 1RIRA 4LTAA 2YPDA 4XDOA 4GB33 1ODNA 4KBBA 5C4WB 2AREA 4A7ZA 4CP9A 2CGOA 3TEZA 2ZX3A 1KGYA 2NMNA 4ZONA 2A3YA 4AVSA 1W06A 3HQRA 2ZMLA 1AR62 1RMU1 4CA9A 4XUNA 5E89A 1AJOA 2ZGMA 2A6VA 5BNPC 1B35C 5DUVA 2Y0IA 3U14A 1I5PA 1OKOA 2BP6A 5KR7A 5JZGB 3ZLIA 1G86A 1YJLA 1CAXA 4HN0A 2XVLA 4KMQA 5FWEA 1CAVB 3MGUA 3VBHC 2R062 3OBAA 3POFA 1D4M3 2D5HA 2F17A 2VD7A 4OUMA 5FZ0A 5F8PA 1H6XA 4FP3A 4HL0A 2VQ0A 2BWAA 3HT2A 4LO7A 2Q8CA 1TEIA 2CHHA 4AW7A 5FO9B 5JMCA 2YU1A 3VBUB 1UMIA 3DF0A 5A7WB 4AVBA 1DDLA 1SLBA 4QKFA 3KB5A 4OI1A 5KBFA 3M7AA 5CYYA 1OXCA 4XZPA 4LORA 3TOJA 4A2UA 5CKMA 1P8JA 1VBD2 4ASMB 4CVUA 2JWPA 3ELNA 3PUAA 1US2A 1GNHA 4EZ4A 2G19A 1V6OA 3N7KA 3DYPA 2G9GA 3WP3A 4DY3A 2EIDA 5GZCA 1GWLA 1UN1A 3BTYA 3JXSA 4AHYA 4ATFA 5EFUA 4XABA 3AL6A 3HT1A 1CAUB 5FZAA 1O3QA 5SV5A 2NM1A 4XJ9A 4WM8B 1LULA 2P34A 4CP2A 1VBE3 1URXA 2BWCA 3RI8A 2VQUA 4BXSV 5ABJA 1VJ2A 2D44A 5JXGA 3PUSA 3HNYM 3WW4A 1FOD1 3WCRA 2GH2A 2VCAA 3M3EA 4CCMA 5LK7B 5IW0A 3VN4A 3N7JA 3CF6E 5BYNA 2RMU1 4OQ8A 5FPLA 4Z2WA 3O1PA 1WUVA 3ZX7A 2QZ3A 4QHZA 3E5XA 1LGBA 3GHNA 1C5IA 1OPOA 4IV1B 2V73A 1JZ4A 4NIDA 1SACA 2LROA 5FMBA 4U36A 1MZEA 1NT0A 3MO4A 4P14A 1EV12 2RR11 5J48A 4DOUA 5CISA 4YVWB 4LT5A 3I3EA 1M4WA 1DZQA 3ETPA 1QJX3 2Q30A 3I2IA 4NAMA 1QQP2 4LUKA 3VD5A 3BIEA 3WDUA 2RS11 1W9FA 4OZOA 1UZWA 1NY71 3SCFA 3LA2A 2E7QA 1KITA 4AEDB 1ZBA1 3ZSKA 4DINB 4I30A 2W46A 5EP9A 2XBO1 3NJVA 3POEA 1JODA 2P6CA 1J1TA 1CVNA 2VVEA 4UI9L 4XOGA 4YM2A 1V00A 1BYHA 2QE3A 3OGSA 1NE4A 2A6YA 3T0DA 4YW5A 5JAXA 3FWEA 3F95A 4RGAA 1FPN1 4NVPA 4EV0A 4IGOA 1FT9A 4YG6A 2VU9A 1DYKA 1UD1A 4Q4V1 4HN1A 1WKYA 3AC0A 4O65A 1BVP1 4V1PA 4YGBA 3VD7A 2VE1A 2EA7A 1FOD3 2PHWA 5D8AA 3ZDVA 4SBVA 4IEPA 4I3PA 1BZWA 5IVEA 3UETA 2EXIA 3CJIA 3U4SA 2HWE1 1JYNA 3NKGA 5K7PA 4P9LA 1GOGA 2HWD2 3DXUA 1SLAA 2ARBA 5EHDA 5LA2A 4LBNA 3IT8A 5ABJC 1A6CA 3CO2A 2DCJA 1K5JA 4LBLA 4XIOA 1CD3G 2WNUA 1UIKA 5DZGA 3WG1A 1R093 1FXZA 3UKNA 2AEZA 4ES8A 3OTFA 1YI9A 1UCXA 1GYKA 3KS7A 4D6RA 2ZTNA 3Q8AA 3VZMA 4WVMB 1JHNA 5CVRA 2JG8B 4K3UA 4KWJA 5DXDA 4JGZA 2RS13 5LEKA 4FSJA 4XFGA 3JD72 2P3KA 3GJAA 1US3A 2NPIA 3KD4A 5DAQA 1ST8A 3A7QA 2VUCA 3PVEA 5FZ9A 2ZGSA 1QJY2 2RS51 1F4AA 1LOEA 1PO23 3RWNA 1ALYA 3EO6A 4NHMA 3T1LA 1FPN3 4IEYA 1RXFA 3IDBB 4Y1ZA 1ZRRA 4INDA 4DZGA 3WEZA 2YV8A 5EIYB 4EQVA 3VL8A 1F5FA 1PVC1 1Q5OA 3O12A 1GZWB 1SFPA 1TNRA 2GN3A 3D5OA 2I45A 4QXBA 3FJSA 3HQUA 2FDHA 2VW2A 5A3OA 3WF3A 4R52A 1AL22 2LUWA 3USSA 4NPRA 4UT5A 2OPKA 4GJZA 2BU9A 3HAGA 5JXIA 1GOFA 3PUHA 3GNEA 5DMYA 4Y26A 4LO6B 2D7FA 2VVDA 2YC4A 1JU4A 2GNTA 2Y64A 1UY0A 2RM22 2GNMA 2J1UA 2F6BA 4BLJA 1Q8PA 5D8AC 4NWVA 2VW1A 5F2WA 3DN7A 1HQNA 2WAAA 1R1A1 3AYCA 4KU8A 4L97A 4P5YA 4B1MA 4CU8A 1PGW1 3M3QA 3CJIC 1UPIA 1R1ZA 4XF1A 1DF0A 2VZUA 4RGGA 4IL7A 1I1EA 2WS91 4QPIB 3NV4A 4GQ7A 3EYPA 4OMDA 4Z1VA 5ACA2 1VAMA 2W95A 4GMP1 3LDRA 2WNUC 1MS4A 4QQ2A 2R49A 2D43A 1N1TA 2JDYA 3SH5A 1XJAA 1YUDA 4AQSA 2OXBA 3POGA 4YGDA 4YM0A 4Y1VA 2DCYA 4LKDA 1QXRA 4MHUA 1BK0A 2PHUA 4K8FA 4YW1A 5DUXA 2NZ9A 2JDUA 2AGSA 5FOBB 3UGGA 3E6CC 4YPJA 5EZWA 1AR93 4JGZC 3RMXA 4LJHA 1LODA 3WZ1A 5JMOA 4B8EA 2Y6JA 3ILRA 1PVC3 4XUOA 5A1AA 1DU3D 4QB1A 1DYPA 1G9DA 1YQ8A 2DYCA 3MBWA 1C57A 3DL3A 3KT1A 2WQZC 2ZGQA 2HWC1 3M8LA 3MHZA 4JQRA 1W8ZA 2YFUA 4Q0SA 1CN1A 3VDDA 4R9BA 4E2SA 4A45A 2A6ZA 2D3RA 3ACGA 3BALA 1RVF2 2C1FA 1ZX5A 1HN1A 1W6OB 2J7MA 2E7TA 3VHNA 1VBA1 2FMYA 1LU2A 1RUI1 5DUUA 3CEWA 3E6DA 2GH8A 1OUXA 2BPA2 3OBZA 1SG3A 2HBUA 2MEV1 3THCA 1KEXA 1JYCA 4ZHNA 1YIPA 3RZMA 1AHSA 2QCSB 2F4PA 2RV9A 1NOVA 5LY2A 2XJVA 3T09A 1LCLA 1MQTB 1ULGA 2Y34A 5JVVA 3BKZA 4CXXA 1CAVA 4NHYA 1LOBA 2W1QA 2WS93 2ZEWA 4EN7B 1JH5A 1YCIA 2NLRA 3BUCA 1PK6A 3ZOIA 1WBFA 2V09A 1VAKA 2VZ3A 3PU3A 3PVNA 5IFPA 2VZ1A 4FFHA 3VBUA 4YVSB 3MW4A 5A7WA 4AHXA 1RGSA 2R7EB 2X09A 4AOCA 5FYMA 4META 3USUA 1AL0G 4BCUA 4GMP0 3ZO0B 1AXYA 2ZXQA 4MHRA 1MS0A 4M3CF 2IUWA 4BM8A 1VBB2 2BZDA 1DQ4A 1L7LA 3DV8A 3IAQA 4K7JA 1TME2 4XUPA 4COWA 1KRIA 2RE9A 4WM7A 4AI3A 4B4PA 3IIIA 1J58A 1PZ8A 1S1AA 2PQQA 3WDXA 5LBEA 4BK4A 5T52A 4ZZ5A 5FOJB 1D2QA 2QQLA 3MF6A 4Y4RA 1PIV1 3NNLA 3DYMA 1S0BA 2JD4A 5F6LB 5C6CA 1KJRA 2HWC3 4MGZE 1HB1A 4DIQA 1AYN1 4BYYA 1VR3A 5KXEA 2DURA 3MLJA 2Y8KA 3PTYA 1PGSA 1CAUA 1QJU3 5JXJA 1H9WA 1W2AX 5FY9A 1FMD2 4WM8A 4BQ2A 3JU9A 1REEA 3VB9A 1JUIA 4QB6A 1JUHA 1EPWA 5APAA 3WDTA 3ZXGA 5K4LA 2JD9A 1HV0A 3P3NA 4NHKA 4RGKA 1Q3EA 1NXD1 2DV9A 3NAPB 1MACA 2VECA 2CAUA 3E6BA 3VDDC 3BYWA 3O14A 2FQPA 4U2AA 4E2GA 5LWBA 5FYIA 3TN91 4RHV1 3J7HA 3OYWB 5C7GA 5IT6A 1WD3A 2D98A 4QT6A 1DCSA 3SKJE 1ND2B 4XAAA 1R64A 4CCCA 5KWRA 4BQ1A 1X9TA 4BWOA 4IGQA 4Y33A 2CGNA 3NKTA 1V6LA 2C4XA 2DWRA 2MPFA 1PO13 2PMWB 3TEWA 1J3RA 1C5HA 2WSVA 2VOXA 3T4HB 4YW2A 3HBZA 3SCGA 3ZIWA 4KNCA 2Q8OA 4Z92B 1C28A 3AK0A 3T3YA 2P3IA 4IXLA 5FJHA 3KHBA 1ZBE3 3DGTA 3FL7A 3WF1A 1PK6C 4Q26A 1RUE2 1OVSA 1SFNA 5A32B 1GQHA 4XETA 5JOXA 5FV3A 1Z78A 2Q8DA 2D6MA 1RITA 2PTMA 1O7FA 2W0XA 1X33A 1NA1B 2D6PA 2UURA 4P9YA 3VBUC 3E5UA 1EUTA 1I6XA 1VBC1 2FDJA 4XCBA 3VBFB 2RS31 3WNPA 5L7OB 3KV5A 4UXAA 1AYN3 1RUH3 3CZJA 4RD7A 4AVTA 2P4EA 5JOZA 1RC6A 1MZFA 1NCRA 5F32A 3U1XA 2VC9A 2NP0A 3VBSB 1AX1A 3HOBA 4NOTA 5C9AB 3FX3A 1APNA 1KD7A 3KCCA 2BRTA 1QWRA 4WM7C 1QKQA 2D97A 5I0TA 1ZA7A 1BBT1 3IB3A 1KJLA 3GZEA 4IV3B 1TZOA 2VL4A 2VCBA 5GZGA 4EN8B 4CZSA 3TBDA 1BQPA 3K3OA 4BLIA 3O1TA 3H7JA 4HSJA 4XYXA 5A3NA 3W5NA 2ORXA 2QBXA 2JDHA 4RHV3 2DVAA 4Q1RA 1W8OA 2DUPA 3B01A 3Q8EA 5EXOA 2B42B 2WLPA 4WM8C 1CWPA 1ENQA 1B09A 3ALQA 3VL9A 4QPGA 1PVXA 3TEYA 5DAPA 1J3PA 2WKKA 4XFHA 4MXVA 1ND3A 2OX0A 2VMEA 4HKWA 1Z7S2 5FZDA 5IAVA 3WSOA 4QXCA 5JSPA 2Z79A 3LB9A 3PMSA 4CEYB 5KC5A 2UYBA 4XE9A 2E32A 5FLJA 1Y9QA 3FE5A 4K8RB 1C8M2 4LBQB 2GN7A 3TWIA 2DVBA 2DTWA 4WVMA 4N53A 4SLIA 1H8TB 1QDOA 2X5IA 3D0SA 3KV6A 3OEBA 4P9IA 2JG8A 1AZDA 4JDOA 2ZABA 4Q4W1 1H30A 3Q9OA 1PNGA 5AFEA 2JIGA 3W58A 3ZYIB 2VZOA 2ZMKA 1VBC3 2VR4A 3KQ4B
chains in the Genus database with same CATH topology
4URTA 5JSRA 4GKXA 4HVOA 2BEOA 2BYVE 2OZJA 4LLOA 4JRAA 5JCTA 2BNMA 3WQ0A 2KM2A 4EWAA 2A71A 3APBA 3VZOA 5AC92 4PJYA 4Q4X2 2PHTA 4FVVA 4S2FA 4XTMA 1ZZ6A 1ZA4A 1H2MA 1YI7A 2ZHMA 2D6KA 3H8UA 2GSYA 4PDWA 1Q8OA 2PHXA 4MVTA 2ENRA 2WZR3 3OGJA 2VVFA 3WQ7A 3ZXEA 1CGPA 3AZXA 3WR0A 1NCRC 4YSFA 4LEJA 4PIZA 2YY1A 3T2TA 4DMIA 2AZ5A 3MICA 1VALA 4AGVA 1XXNA 5CAZA 2CV6A 1VB2A 2W52A 5C33A 2A5ZA 3M70A 2IC1A 3PJQA 4Z8BA 2JG9A 1AR83 2ZX4A 4MGYE 1S0GA 3J8F2 4QPGC 2E51A 2PAEA 3ZXJA 1UIJA 4FO9A 3VZKA 1D0HA 4QQOA 4BOWA 1ND3C 4IEZA 4K1ZA 4COUA 4DY5A 4XDQA 1J1LA 2W08A 3WD5A 2Z42A 2PAKA 3UK9A 4N53C 1QNWA 2X5IC 3ES1A 1IS4A 2JG8C 2QZ2A 1POV3 1QXPA 1S55A 4N9IA 4QGLA 2QUOA 1NE6A 3ZFEA 3EXUA 2EAKA 5KHKA 1UF2C 2I2SA 1ZVFA 3V56A 2HWB2 4IEVA 4JC1A 1OKQA 2JDZA 1TNFA 1COV1 4IQPA 4QHBA 4B29A 1G9CA 3ZSLA 5L73A 2QFEA 4BIFA 5CFCA 2WIIB 1ONAA 4MX3A 4NR1A 2IZWA 3THPA 4PDWC 3ATGA 4FP2A 1LHNA 1AR71 5GLUA 2W68A 3KM5A 5KC6A 1IGOA 3ZFFB 1X36A 2R043 4R9CA 3U11A 3SLIA 5IK8A 3M3IA 5DDJ2 4XXAA 1TMF1 2BVBA 4RQPB 3K51A 3QLQA 3PLQA 1VIWB 3AJYA 3PMEA 2D3PA 1CX4A 3VV1A 3QD6A 1RUC1 2DVGA 2YDEA 2R6QA 1F31A 1XQNA 1VLNA 2IXJA 3AMNA 1DQ6A 2JG9C 1WBLA 2ZKNA 2K0GA 1HRI3 4DRRA 3U0ZA 2O1QA 5LRSA 1U12A 3JZVA 1H4GA 5A3MA 3AKQA 3B9CA 3SISA 1RHI3 3MF9A 2UWAA 1KFUL 5A33A 1WLCA 1HRV3 3ZN4A 1ASJ1 2NQYA 3ZN6A 2CTVA 1VRH2 3WP6A 4FOWA 2H6CA 4HPKA 1RUG1 4C91A 1U5ZA 3ZYRA 5CG9A 2I74A 1XNBA 1ZM1A 2VNRA 1OQDA 4HVRA 3ZFEC 4WZFA 4LO8A 3ZSJA 1AR73 3AP4A 3VBRB 1LECA 2ZHLA 4PLOA 1KDMA 3WDVA 1CIWA 2DU1A 4HFSA 1ND2A 5CFCC 1I3HA 4YG3A 2A7AA 5IUQA 3RQ0A 1RUJ3 2YHJA 1AR61 1RUC3 2EAAA 4K1YA 1S2KA 4OHYA 3G6JB 3I59A 1XYOA 4I01A 4Y22A 3WX5A 4HKLA 3RYRA 1I9RA 3I54A 2R061 5AVAA 2IXKA 2BGCA 3MEPA 2PHLA 2XH6A 5F9TA 5L19A 1EAH3 4AFCA 2JE9A 4I2OA 1CQ9A 1NA1A 1OSGA 3VBFA 1MEC2 2QDNA 2Y0OA 5JI7A 1LTEA 5JPNB 4ZU5A 3TRSB 5BNOB 1DBNA 1AX0A 4COZA 5C9AA 3WW3A 2GAUA 1LOFA 1LOGA 5JOWA 4JGYA 4CRQA 2WNVB 4Y4YA 1U5YA 4IV3A 3B94A 3DPRA 4UW6A 1W0PA 1O4TA 4GB32 2GNDA 4Q27A 5JIUA 3LOBA 4E9KA 5AFBA 2KA3A 3S0MA 2PN5A 4W6YA 1XYNA 4N90A 2ZGKA 4FBFA 1UU6A 4CDXA 1H2NA 4XBQA 3R0RA 4DXZA 2D6NA 4BH9A 5T54A 1U5XA 1D4M2 3MIHA 4LBQA 1C1FA 3ECQA 1ND2C 3JB4C 1MVQA 1UMZA 2OUJA 3SITA 1ZYBA 2X53S 3WDYA 5H9QA 1V6IA 2BFUS 4XHBA 1DGWX 1LGNA 3AJZA 2XVGA 1W6NA 4C0HA 2UWBA 2QQPA 2VMGA 2CWSA 3ILNA 3MIGA 1V9U3 1UKRA 4W65A 3IBMA 2TEPA 1LHVA 1WW7A 1DGWA 5E16A 1JOJA 1QQP1 4RS5A 1UX6A 3O0VA 4AVVA 2VGDA 1V9U2 1W6PA 1O4ZA 3O0XA 1NA1C 2Z5WA 2LM3A 3NO8A 3VBFC 3PNAA 3RG0A 1TQ5A 1RMU3 2WFF1 1NCQA 3NJZA 1YWKA 4GIQA 3MDPA 3OY8A 4B4QA 2EIGA 4PLMA 4Q2FA 5C9AC 1LOFC 1VBE2 4JGYC 4Z82A 4IV3C 1Q8VA 3IM0A 3DPRC 1E57A 3LAGA 4XEZA 1IS5A 2ES3A 1ZZCA 1IOAA 4CEWA 2D6LX 4QQLA 5T5LA 1MS9A 2G9FA 2HWD1 2ZGOA 2D3SA 4J1XA 2DCZA 3AMHA 3ST7A 4BA6A 3KT7A 3NSTA 5JR7B 2CL2A 5T3NA 1ENXA 4CDXC 2XJPA 1NZCA 2DUQA 1ZNPA 2FMDA 2O8OA 3BODA 1CAWA 3A0KA 2GMEA 3E97A 4QX5A 2GALA 2XKOA 4WBBA 2R0HA 4Q0VA 3N4MA 2P17A 4QU2A 1QJX2 2WA3A 1GICA 3VBOA 2EXKA 2UY9A 1MVEA 3WNXA 2I07B 2H0VA 4CDQB 1OPMA 2WZPP 3BTAA 1Q8SA 1FYUA 3CLPA 4FPFA 2WFF3 4N43A 2PAMA 2HEVF 4AG4A 4L99A 4XJAA 2A3WA 3ILFA 4GKYA 4RR3A 3ZPYA 1BJQA 2RMU3 4RS5C 2ZAHA 2ZCWA 4E2QA 2PELA 3MW2A 3FC0A 2OYZA 1FOD2 5KHJA 4AQ2A 2DVDA 3KT4A 4FPJA 1NCQC 5CB7A 2DU0A 3KZ4C 4LUMA 1AL21 3RNSA 3KGLA 4OUSA 2VG9A 4QM8A 2ZA9A 1D0GA 4RQPA 2DCKA 1HX6A 3FBYA 3GALA 2RR13 2XHKA 3I8TA 1SCRA 2RM21 1OA4A 1R092 3FLTA 4KGQA 3FHIB 4X8PA 5GKAC 1RUD1 3ROUA 2E9QA 4XFIA 4K20A 4CEWC 2R1DA 1ZBA3 3WUCA 4PIXA 4AK3A 3C3VA 4AVAA 1CR7A 2G4IA 2XBO3 2VOKA 2WL1A 1G9FA 2RS12 4XXPA 1K5MB 4PBOA 1IS3A 1YYNA 2Q4SA 2ZBJA 1LESA 4NWWA 1G9AA 4AF9A 4LR4A 3M4FA 4CP1A 4Q4V3 5GLZA 2VNGA 1PO22 1Q43A 4E4ZA 4K9SA 4PLNA 3WCSA 1PGL1 3VBOC 1FPN2 4MZUA 3ZSEA 3G7DA 4ZKTB 3UJOA 1ULEA 4YFZA 2XLFA 1EY2A 3H1WA 1DQ5A 2A73B 4Q4V2 2HWE3 4B3NA 1PZ9A 2O0OA 2XJUA 4FOQA 2ZACA 2CYFA 1D2SA 3LZZA 5CNAA 3V65A 3WDWA 4N43C 1QH7A 3IPVB 1WGPA 4YYOA 2LALA 3FLPA 1S0CA 1C8NA 1HIXA 3H7YA 4RR3C 5FAXA 1D4VB 1RVF1 5FMOS 5DZEA 1RTVA 2HEWF 4BE3A 3ZFGB 2OIIA 3H1MA 2DTYA 2JXAA 3V64A 1IHMA 4CDWB 3RSJA 1RUD3 1S0EA 4YW3A 5FCCA 4KQ7A 4RQPC 4L11A 1C4RA 5GZFA 4QXKA 2RS53 1DZTA 1VB4A 2H0BA 2YPJA 1O91A 2WA4A 2ILMA 2XWBB 3V0BB 3FFZA 4QM9A 3FMGA 1GV9A 1HQLA 2XLAA 2XL9A 4XF3A 4R8HA 2RS52 3HQXA 4PCRA 4EWDA 5C8CA 1DGRN 1J3QA 2ZGLA 4RA0A 2NMOA 1KFXL 3VUOA 1XE7A 2ZKLA 4AI0A 2PHFA 1AR92 4MUVA 5JIAA 1TME1 2FBEA 1JTZX 1PVC2 4X8NA 5C4WA 3EBRA 1J59A 3GBGA 1H2KA 4KU7A 5GJ6A 4XF9A 4UBGA 3ZXFA 5GLWA 1YO8A 3ZYGA 1R1A3 1W6MB 2YYOA 1FMD1 4H14A 5JZGA 3WLUA 3U07A 5CFDB 1FI2A 2GMPA 4FPCA 4AHZA 4KG8A 5E1RA 1R1A2 4BPZA 4R4ZA 1ZRFA 1PGW2 4GMP3 2Y38A 3HR9A 3R4SA 3GBWA 1WCDJ 2H6BA 2WS92 4M3CB 5GLVA 3VKLA 3AKPA 1DZRA 2TUNA 1H1MA 3KCXA 4LHKA 4P9WA 2B9UA 3AZYA 2LTNA 4RL7A 3IDCB 3AYEA 3VLBB 3MFAA 3RJ2X 4HT1T 4ZU4A 5I0UA 3ZIXA 3BU7A 2Z69A 4D7YA 1DGLA 1LHOA 4W6WA 5HCAA 1XYPA 2HWF1 4H3WA 5DG1A 5DZFA 2IWGB 1EYBA 1RUE1 3O5SA 4PBPA 4YLZA 2XJQA 4LNVA 1VBA3 1RUI3 3W59A 3B02A 4A7YA 2HWC2 2XL7A 3RPQA 1Q8QA 1REFA 5C8CC 5FBZA 2RHPA 2MEV3 1QJU2 1HXS1 1VBA2 2OW4A 2ZZQA 4PQ9A 4Q4Y1 1HLCA 1QOSA 3J9SA 4Y1YA 3VKFC 5C4WC 1GNZA 3ZYJB 5I8YA 1BCXA 4GH4B 5BXXA 5I0SA 4TZDA 4I0WB 4IV1A 5BNPB 4P9XA 4LA3A 4KWLA 2C0ZA 3SCHA 1OLQA 4R4XA 5KXBA 1U0AA 1V6NA 3VBHB 5SV8A 2PA7A 3TNQA 2VOVA 4JAAA 4Y20B 4JRLA 5JZGC 4OHWA 1N3QA 3GF6A 4LBMA 4YVWA 1PO12 3R05A 1Z7S1 2JJ6A 5GM0A 1A8DA 4DFSA 2VUAA 3ZN5A 2AH2A 4AEDA 3ZXLA 5JSOA 1PIV3 1ZBE2 1C8M1 3POWA 3MZHA 1DQ0A 2HWF3 1W0OA 2WFPA 3NWKA 4Q8LA 5FQ0B 1PNFA 1LOCA 3VGIA 4JCKA 3VKNA 2C5DA 1PIV2 1YFYA 4YNIA 3N7MA 1AYN2 1RUH2 4MSVA 5CG8A 1ENSA 3UV9A 2ZPXA 1C3HA 3ZYPA 3CU7A 1HXS3 1Y3TA 1UZYA 3AFGA 4Q4Y3 5AC91 3TN93 1XE8A 1NLSA 3MIEA 3L2HA 1MS1A 1N1YA 4OLLA 1JXNA 4MXWB 3D8CA 4AI2A 3R4UA 3I7DA 3EHKA 1KQRA 2B46X 4RHV2 2EALA 1WMEA 4M00A 3N35A 1ZZ8A 2ZHKA 4AE2A 2WSUA 1OQEA 4FQZA 4ITCA 1LR5A 1AYM1 4IV1C 3WUDA 2YC0A 1BEV1 3WQ1A 1F8VA 1OQ1A 2RJLA 4KL1A 1CAXB 5DG2A 2XB6C 1WLDA 3ENRA 4D7SA 5I0RA 5FPZA 2ZJCA 4COYA 2RS33 2YMZA 4LHNA 3VHPA 4YRDA 2HJIA 1CPNA 4YVWC 4M0NA 3BIWE 4AQ6A 1VBC2 4XQ4A 1XU1A 4AEKA 1RUF1 1BBT3 1R081 4AEDC 1NQDA 2VOWA 3UJQA 1GZWA 3X29B 2P3JA 5I8TA 1QY4A 1OFNA 3LCPA 1I5ZA 2E6VA 1QGLA 1BBT2 3AFKA 3INAA 1YXWA 2WZR2 4FTBA 3ZMOA 3MIDA 4K6BA 2ZGNA 3L2YA 3D4KA 3MPBA 4I02A 4YZ5A 1GSLA 3MPPG 2IXIA 3WW2A 3B3QE 4BMEA 1AYM3 4NO4A 1BVVA 4QPIA 4TSVA 2XUMA 1BEV3 5JWPA 5EV7A 1S2BA 4XPVA 5C8WA 2DFCA 1UL9A 4Z07A 1SBEA 4Q4W3 5H9PA 1AR82 2BNOA 3H0OA 4RFT0 4YGEA 5BNNB 3MLKA 5KXCA 2BBVA 1WMFA 3A4UA 1AF9A 5E8AA 4DQAA 2VQAA 1OLRA 3AZVA 3FLRA 1H0BA 1RUF3 1DFQA 4J6GA 1R083 1WMDA 2R071 4XMAA 3GBFA 5T5JA 3SH3A 5FLIA 4D7TA 3A0NA 4Q0UA 3FBMA 2VMHA 4MH0E 2BQPA 3ZDSA 3QBQA 1W6OA 1HV1A 1OFSA 4DRVA 4AFAA 1MS5A 3NV2A 1VRH1 2ZGUA 3KCYA 3DUIA 1W6MA 1HDKA 1MQTA 1LRHA 2VPVA 3PVOA 4ZU7A 1F2NA 2PLV1 4LA2A 3B7MA 3AP5A 2B5HA 2R042 5HCBA 3O7OA 1UZZA 3CJIB 3ZXDA 5J09A 2HKXA 4FOYA 4YVSA 3CL1A 4M3CA 4F83A 4YZ2A 3SMHA 3JBG1 2ZX2A 1ENRA 2WNUB 4G3YC 4QPIC 3ACLA 5LRRA 2AUYA 1HRI2 1IKPA 5EYXA 5A3LA 2BFUL 2R073 4H7LA 5JDBA 3AMMA 2JKBA 4WVVA 3PHMA 1GANA 3OPZA 1RHI2 4JGZB 1COV3 4LBQD 1FNZA 2A70A 4H7MA 5IK4A 1HRV2 3JB8A 3POYA 1BK1A 4XQDA 1SCSA 2B39A 2Q0AA 5IK5A 2R32A 4FAGA 2WINB 1MEC1 1A78A 2PFWA 5I93A 5H9SA 2WJSA 3NAPA 5F1RA 5J98B 2ZX1A 1TMF3 4G9SB 4GULA 1XU2A 3OYWA 4C1WA 2HYKA 3ES4A 3EJKA 1AR72 4GH4A 5CADA 3LWCA 1X50A 1Y43B 4JVAA 1V6MA 3IN9A 1RB8G 2ZOEB 2IXLA 3RYKA 2VH9A 5KHHA 3BOWA 3JUUA 1Y7BA 4B7EA 1GKBA 4FPOB 4GB31 3KLSA 4ISQA 2P2KA 5BNQA 4J1WA 5J3UA 1MQTC 2ZX0A 3GHMA 4Y20A 3CNAA 3JBG3 1RUJ2 5K8SA 4O9GA 4QQHA 1UPSA 1RUC2 4AFBA 3LKJA 3C2UA 3IKWA 1QMJA 2K9ZA 5A32A 2DUOA 3RZZA 1ASJ3 4FCAA 4YVSC 2EXHA 1CPMA 1KS4A 4AWDA 2AENA 4XFFA 3I4IA 3HN1A 5DUWA 5L7OA 3TB0A 4QGNA 1RUG3 1DLLA 1EAH2 1NLRA 2XLGA 4TWTA 1ASJ2 1UKGA 1VBD1 3VBSA 2IXHA 4QMAA 4LBJA 5BY5A 1FV2A 4IESA 1H8VA 1ZRDA 4HKOA 4LLFA 4MV2A 4AHWA 4EN0A 1DHKB 2OVUA 2YZ4A 2DFBA 4MXWA 1ZREA 5J36A 4AFMA 4ORFA 2ZAAA 3GYDA 1G7YA 4FQ4A 4OHZA 3VDDB 1AR63 4E4DX 3OBRA 2WNEA 1QJZA 2JECA 2VMIA 3NAPC 3KMHA 4S2DA 1FNYA 1OHFA 3VZLA 4BZ4A 4C90A 4CEYA 4KH9A 1OMIA 1UU5A 5FDBA 1VBE1 3HD8B 4GH4C 2GNBA 2R063 4DB5A 4XJWA 4LULA 1H8TA 4Q0QA 2WC2A 1AXZA 2ET1A 3HMYA 3VZJA 1O4YA 3RMYA 1WLWA 3JQWA 3JCIA 1WA4A 2XGXA 1PK6B 3UKTA 1WD4A 1EV11 1QHDA 4HBNA 3HIFA 4JTNA 5FRAA 3SHRA 1VBD3 4OVEA 2ZMNA 3ZSMA 4AGRA 3SH4A 3USUB 1NXMA 2TNFA 4Y1XA 3E5QA 2CWMA 4Q1PA 4PIYA 3B5LB 3AXDA 5L7OC 5EJ3A 4FOVA 1QJX1 4XW3A 4WM7B 4OHXA 5FFOC 1VAVA 3N3HA 3U10A 3VBSC 1JN2P 4MLOA 2E7AA 1RMU2 1AUYA 3N7LA 2XG3A 2GZWA 3POSA 3WHUA 4GWMA 4YGCA 1ZZBA 1IPKA 1XRUA 3V0AB 1SLIA 1SBFA 4ZXKA 5FMOL 1GQGA 3AKTA 2CY6A 2VUJA 3WG3A 2UWCA 5FTTC 3UKVA 3TNPB 3VHOA 4IEXA 4CEYC 5B2GB 3LSEA 1MS3A 2X29A 5BNNA 3ZXAC 2A6XA 2ZGPA 1EV13 5JPMB 1GR3A 1X82A 2D5FA 4HSLA 1H8TC 1R091 4UW5A 1QQP3 3GZTB 1LEMA 1KS5A 4FPYA 4P9JA 1G8WA 4XILA 3JD71 4AXOA 4L9BA 1H2LA 2BUKA 2R30A 3BB6A 3H1YA 1WW6A 3D82A 1QJY1 2ETEA 5T50A 4FPKA 2O8QA 1WW4A 4XJUA 2WFF2 1LOAA 1RJ8A 3WP5A 3NW4A 3S30A 3S7EA 1NCRB 1ZZ9A 1PO21 2GC0A 1QF3A 3O0WA 2RMU2 2SBAA 3ZFFA 2YGMA 1PM7A 1DQ2A 1F5JA 3D6EA 1N47A 1IPJA 4HK9A 4HANA 2HWD3 4QPYA 1YNAA 3D0JA 3ZMNA 3WINE 4CDUB 1TE1B 1QXJA 3DKWA 5AVPA 5K0UB 1X8EA 3WV6A 1N1SA 1SFYA 2FZ2A 3H9AA 4QPGB 1AXKA 2RR12 2YGLA 4A3XA 3M3CA 3B69A 5GZDA 1LHWA 1ND3B 4AI1A 2WQ4A 3NL1A 4K21A 2ATFA 4Q29A 4CP0A 5ACA1 4FPEA 4EN6B 1NY72 4YM1A 3B00A 1ZBA2 2QNKA 5IK7A 2UY8A 3JD73 3J4UH 2XBO2 3WHTA 4N53B 5BNNC 2GC1A 3ZXKA 2X5IB 5HCFA 2ZHNA 4QGMA 4YZ4A 3RYPA 5CA6A 1QJY3 1NYWA 1XNDA 4S2HA 2GDFA 3WVJA 2BW8A 4LHLA 2XKPA 4XF0A 4IEQA 2E63A 5LK5A 1WCKA 4D69A 3VBRA 1RJ7A 3W9AA 4YFWA 3LOIA 1AL23 1AR91 2IFWA 2HWE2 3P3PA 1G6NA 4L8QA 1NG0A 4PDWB 1T6GC 1W2UA 4OZXA 3K48A 1H1IA 2RM23 4OI2A 1L3JA 1H1AA 3ZFFC 4XFBA 4W6XA 3EQEA 4YZ1A 5FLHA 4TLFA 3ETQA 1C1LA 4XJ8A 4E27A 4AQTA 2EVXA 4P5HA 4YG0A 1WLTA 5ACA3 2JEMA 1RUD2 2XJSA 2JG9B 3AMQA 3R6SA 1HQWA 2W39A 1CJPA 4UW3A 3LA3A 4BMBA 5FO7B 5I91A 1SLCA 3ME2A 4Q8KA 2KXLA 1GZ9A 2WT2A 3FUOA 3AZZA 3JQXA 5BNOA 3L9JT 1VBB1 1FATA 3AP9A 1ZRCA 4WVWA 2WNVA 3KSCA 4AFDA 1O3RA 2VXRA 1PGL2 3ASIA 4KG0A 1CESA 4MGKE 3AX4A 5BV6A 3ZFEB 4NN0A 3WOGA 1RVF3 1QOTA 4XBNA 4M01A 4R9DA 2E53A 2A3XA 1FV3A 3GZAA 4JDMA 1O3TA 5CIRA 2DVFA 4DPNA 3VBRC 3RS6A 1QJU1 4JV4A 4K40A 3NVCA 1QU0A 2Q1ZB 4RSUA 5CFCB 4HVQA 1BKZA 1IZ3A 4LBOA 1ULDA 1W6QB 4HETA 5T55A 2N7GA 2D93A 4GWNA 4PF5A 3AKRA 1HKDA 3MIFA 4C0BA 1OOPB 5CBLA 2JE7A 3OD4A 2YXSA 1ULFA 3MIBA 3H50A 2B7YA 2WT0A