1VBD2

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
266
Chain Sequence
CGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 60
structure length 266
sequence length 266
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vbd200
1PGW2 2R072 3DPRA 5C4WC 1NCQB 4Q4V3 2PLV2 5ACA1 1NY72 2R071 5LK7B 3M8LA 3VBHA 1NY71 3ZFGC 4CDXA 1POV3 1RVF2 1HXS3 5FMOL 1ND3C 5A33A 1RUF3 1VBC2 1Z7S2 2RR12 4QPIA 1X33A 1W39A 4EJRA 4RS5C 1Z7S1 1H8TC 2XBO2 1BMV1 1OOPC 1PIV2 4AEDB 1AR73 3VBRC 5C9AB 1BBT3 4GB31 2BBVA 2R042 1V9U3 1PGL2 1AYN3 1C8NA 1RUD3 4WM8C 1FMD2 5C8CA 4WM7A 3CJIC 1QQP1 1NCRA 4Q4V1 4WM7B 5BNPA 3JBG2 3DPRB 1VBE3 2FZ2A 2MEV2 1AR62 3VBHB 3ZFFC 4CDXB 1AR61 5A33B 4Q4Y2 4QPIB 3JD73 3VBFC 3VBOA 3NAPC 4Q4Y1 4NWVA 1BEV1 4N43A 1POV0 2IZWA 1QJU2 1RMU2 2WS93 1VRH1 1AUYA 4CEYA 1V9U1 1MQTA 1NA1A 1R1A2 1RUD1 2HWD2 2RS13 5C8CB 2HWC3 1RUI3 3VBUA 1RHI1 3ZFEC 4PDWA 1NCRB 5FMOS 1VBE1 5K0UC 2R063 5BNPB 1AR93 1AL23 2HWF2 4FTEA 4IV3C 1RUG2 1EV12 2HWF1 1RB8G 1D4M3 2WLPA 3VBOB 1PO11 4N53C 2RS53 4N43B 1AR83 1TMF3 2X5IA 1ASJ2 2HWE3 2RS11 4CEYB 3LOBA 1MQTB 2R073 1NA1B 2BFUS 2PLV3 4RR3B 1RUI1 1COV2 1K5MA 1COV1 3VBSA 1QJX1 1VBC3 1Z7S3 2RR13 1AR91 1AL21 2R061 3VBUB 4CDUA 4PDWB 2DF7A 4RQPC 1RUJ1 4CDWA 2XBO3 3ZXAC 1NOVA 4IV1A 1NCQC 1HX6A 4JGZA 4YVSA 1R082 1AR81 4FSJA 3S6PA 1TMF1 2HWE1 1PGW1 2X5IB 2PLV1 3JBG3 2GSYA 1H8TA 4GH4A 5AC92 5C9AC 1RVF1 2MEV3 1FOD2 1VBC1 1AR63 2RR11 3VBRA 1K5MB 1RUC2 1VBA2 3FBMA 3VBSB 2RM22 2XBO1 4CDUB 4Q4Y3 1QJY2 1RUC1 1PIV1 1BEV3 2RM21 4CDWB 1VRH3 1RMU3 4IV1B 3CJIA 3DPRC 1B35A 1NG0A 2R041 4JGYC 4JGZB 1F2NA 1PGL1 3JB4C 1R1A3 4YVSB 2HWD3 4CDXC 1MEC2 1FMD1 2BFUL 1RHI3 1M06G 1CD3G 3ZFFA 3HAGA 3JBG1 3VBFA 5D8AA 1QJZA 2MEV1 3NAPA 5JZGA 1H8TB 2HWB2 2HWF3 4GH4B 1RUG3 1EAH2 1EV13 1ZBA2 3VBRB 1C8M2 4CEWC 1HRI2 4FTSA 1C8M1 2WZR2 1PO13 1HRI1 1QJU1 5CFCC 1HXS2 1RMU1 2RMU2 2RMU1 3CJIB 1B35B 1AYM2 1R1A1 2HWD1 5CFDC 5K0UA 4SBVA 2WFF2 1COV3 5L7OA 5ABJC 1VB4A 1QJX3 3ZFFB 1RUE2 1RUJ3 4Y5Z0 5BNOA 4N43C 1VBD2 3VDDC 1RUG1 3VBFB 5D8AB 1EV11 3NAPB 5JZGB 4RHV2 4CEYC 1MQTC 4CDQA 1NA1C 1HRV2 4RR3C 3J8F2 4Z92B 1VBB2 3J8F1 1R083 2FZ1A 1PO22 3VBUC 1ASJ1 4QPGC 3JD72 1OHFA 4NWWA 5BNNC 2RS32 1RVF3 5K0UB 1E57A 2WS92 1FOD3 5L7OB 1ND2C 2TBVA 5FOJB 1RUC3 1VBA3 3JB8A 1PIV3 2RM23 5BNOB 4Q4W2 4YVWA 1R092 4Q4W1 2R043 2ZTNA 1R091 5C4WA 4CDQB 4RFT0 2ZZQA 3IDEA 4BCUA 1R081 1VAKA 1FMD3 3ZFGA 1FPN2 1MEC3 1ND3A 1ZBE2 3VBSC 4FTBA 1D4M2 4AEDC 1ZBE1 4RS5A 4Y4YA 5J96B 4CDWC 1OOPA 5AC91 2XPJA 1TME2 1SMVA 2RS52 4IV1C 2ZAHA 1RUH2 1FOD1 1TME1 5DDJ2 2HWB3 1VBA1 1RUH1 1ZBA3 5ACA2 1QJY1 1IHMA 1C8M3 4JGYA 4WM7C 1HRI3 1QJU3 4WM8A 1WCDJ 1PVC2 2WZR3 4YVWB 1PVC1 2RMU3 3TN92 3VBHC 1BMV2 5C4WB 4Q4X2 3TN91 4GH4C 1AYM3 1MEC1 4QPIC 4Q4X1 1VB2A 3ZFGB 2WFF3 4GB32 1ND3B 4RS5B 1RUE3 4CEWA 1OOPB 2HWB1 1QQP2 1VBD3 4LLFA 1EAH1 1ZBA1 1B35C 5CFCA 4Q4V2 4RHV3 2BUKA 5C8CC 1DDLA 1HRV3 2WZR1 3J8F3 1NCRC 1RUF2 1POV1 5CFDA 1HXS1 4JGYB 1VBB3 4WM8B 5BNPC 1PO23 1RUF1 1ASJ3 3ZFEA 1AYM1 5ABJA 1AR72 5D8AC 1BEV2 5JZGC 1BBT2 1AR71 4IV3A 2WFF1 2RS33 1VRH2 3VDDA 1BBT1 3VBOC 1V9U2 1AYN2 1RUE1 1RUD2 1AYN1 1VBD1 1X36A 4RR3A 4N53A 4CEWB 4Q4W3 4RHV1 1RHI2 1R093 4GMP3 1VBE2 5CFCB 1HRV1 5A32A 1GFF2 1F8VA 4QPGA 1OPOA 1VBB1 1PO21 4PDWC 5BNNA 5L7OC 5CFDB 1FPN3 2VQ0A 1ZBE3 3JD71 2Y26A 3ZFEB 5BNOC 1ND2A 4RQPA 5AC93 2GH8A 5ABJB 2RS31 1PO12 1TME3 2WS91 4IV3B 1NCQA 3VDDB 4CDQC 5GKAC 1RUH3 5DDJ3 1HQNA 2RS12 1CJDA 1QJY3 5ACA3 2HWC2 1RUI2 2X5IC 2HWC1 4N53B 1PVC3 4GMP1 1QJX2 2R062 1AR92 1AL22 2BPA2 2QQPA 3TN93 1RUJ2 4AEDA 5J98B 5A32B 1K5MC 5C9AA 4Q4X3 4QPGB 1AL0G 4CDUC 1FPN1 5BNNB 1D4M1 4GMP0 4GB33 2WWSA 1ND2B 4RQPB 1AR82 4YVWC 2RS51 1A6CA 1TMF2 4JGZC 5DDJ1 1EAH3 1QQP3 2HWE2 4YVSC
chains in the Genus database with same CATH superfamily
5EYYA 3KMHA 1RUNA 4YFZA 1DZQA 2C0ZA 5D2AA 3OG2A 4Q4V3 4QU1A 2BJSA 3NNLA 3GDBA 2LUWA 5FKBA 1W8TA 3M8LA 2JEMA 1X8MA 2RG4A 5F5IA 3ZFGC 4CDXA 1WLDA 1HXS3 5FMOL 1LOFA 1YLLA 2VZUA 1UMZA 3U4XA 4TXWA 3CKHA 4LJHA 4EJRA 4KU7A 2XBO2 2BGPA 2B4KA 2WYSA 1OOPC 1C1LA 1LKNA 3NJYA 1H1MA 1JOBA 2ARCA 1JUIA 1XJAA 3VBRC 3J7MA 3EHKA 1Y7BA 4LHKA 4QKBA 1XSRA 1MZ5A 2W94A 4EZ4A 3AZZA 4PJYA 2SLIA 4XYXA 5LEKA 1BK1A 3AFGA 5K7PA 1RUD3 1FMD2 4BQ2A 1LULA 2JDZA 2PA7A 3NO8A 1S0CA 4XTPA 2J1AA 2A3WA 4IEVA 5FZCA 5IK5A 1GNZA 2JWPA 4WM7B 3AL6A 1YC61 4DS0A 2YHJA 3JBG2 3ME2A 4HFSA 3BCWA 2ZEWA 3WT3A 4AVCA 2BQPA 3AP4A 5JDBA 3N9OA 4E9KA 3HBKA 3VBHB 1IKPA 2QCSB 3RJRA 1DHKB 2QQLA 5FZ4A 2NQYA 4QQHA 1AR61 3TNPB 4AL9A 4QPIB 1UXXX 2XJUA 3NAPC 4P00B 4BQ3A 4NWVA 2ET7A 2XWBB 2QQIA 1BEV1 1AZDA 5DN2A 4N43A 5GLVA 5JOYA 3AC0A 1AXKA 3FBYA 5A7QA 4Q5OA 1LNSA 4PQ9A 2VZRA 3PUSA 4XACA 3RWKX 3UT0A 4B8EA 1S2EA 2GU9A 3I49A 1ZRCA 4HBNA 1QHDA 3HQRA 1H2NA 1V9U1 4PCRA 1MQTA 1XNAA 3VZNA 1NA1A 5FZGA 3WVJA 3ZR5A 3W5MA 1JYNA 5IVFA 1GANA 3UETA 2YC2A 1LESA 3VHNA 3DKWA 3AK0A 2PHTA 3WNXA 1CAUB 1RUI3 4BXFA 3V0AB 3RYRA 1BLZA 2OS2A 3ETQA 2ZCWA 4Q0SA 1VBE1 4Z82A 1CVNA 3MV01 1AL23 4UT5A 2UWAA 1PGSA 2HWF2 3EO6A 4MOAA 1PK6B 4XHXA 3A22A 5FUNA 1OLRA 2ZX2A 1TVGA 2DVAA 3SQOA 3PU8A 5J7MA 1IZ3A 5JXJA 4I3PA 5IT6A 3BKZA 1K42A 3K3OA 3DCQA 4NN0A 5B2GB 2VZ3A 4E8CA 4XDPA 3AKTA 2RS53 4AI3A 3CJXA 3GCWA 3ZIWA 2WT2A 4BIFA 1SQ4A 2JD4A 4M4PA 4MH0E 2ZEYA 3LFMA 1ASJ2 3U4SA 1RIRA 3OTFA 3SMHA 4HXCA 4OHXA 3MUY1 2YB7A 3WG1A 4WVVA 2Y38A 2D7FA 3D8CA 1K5MA 3NWKA 3WNPA 1MZ6A 4UXAA 1COV1 4ZY9A 1JZ5A 3MLJA 1QJX1 1BZWA 1HDKA 4DY5A 2GH2A 4QHBA 2VZ1A 1RJ7A 1VAVA 4KBZA 3TB0A 2XBO3 4NHYA 3E6DA 3I4IA 3R05A 3WF4A 5I91A 2PHLA 3MHZA 4PLMA 3QOPA 4COVA 1O3TA 3UYJA 1JZ7A 1XBFA 3T2TA 1STMA 4YVSA 4XILA 1R082 3ZN6A 3RPQA 4DUWA 3RDIA 4M4RA 5F2WA 4CPBA 1UIKA 5CIRA 3POGA 2XOMA 2WKKA 4I09A 3RZZA 2HWE1 2ZGTA 1XOYA 1U5YA 4UFIA 2W1SA 3KGZA 3G6JB 4BYYA 3FLPA 2X5IB 5FMDA 1W99A 5FLIA 3PIGA 3VL9A 5C3RA 5FDBA 5EQUA 3JBG3 4AVSA 1O4ZA 4I01A 1DP0A 1ST8A 3WF3A 5JXHA 1CGPA 4XMIA 3CNAA 5A80A 1WMEA 4MXVA 1BJQA 5APAA 1X50A 4XFBA 1IQAA 1RUC1 2ENRA 2CWSA 4DQAA 5A3MA 1G9BA 2BWAA 2FHRA 4CDWB 3PNAA 3QD6A 4QB1A 3AMHA 2DCYA 1UZZA 1VRH3 3GZAA 3HT2A 3ZX7A 5CEHA 1KDKA 2BV4A 4IV1B 4NIAA 2ZEZA 4B1MA 1AXZA 1SBDA 2R041 2ZX1A 3IM0A 2XJQA 1MVQA 3J9SA 1Z78A 2VQAA 4FPHA 5FZBA 4F7ZA 1L3JA 2JE9A 3FHQA 4PI2A 4LITA 5LATA 1MEC2 1SFYA 2JDYA 2OA2A 1LHUA 4W6XA 5FQ0A 1NT0A 1SLIA 4COYA 1REEA 3ZFFA 3Q8FA 4MX3A 1BK0A 1I5ZA 1SHWB 3RZLA 4W50A 1PZ8A 1H8TB 2HWB2 2HWF3 3NNFA 4GH4B 2EAAA 2CYFA 2E33A 3IIAA 1KD7A 1IOAA 1OLMA 4QWNA 3HJRA 3K4ZA 4QB6A 2E31A 1GV9A 1HV0A 4CEWC 2BBAA 4LULA 5FIXA 4YGDA 3PU3A 1HRI2 5C6CA 4YG3A 5JVVA 1PO13 4L97A 3WNKA 3MV11 4AEJA 4JRLA 1RMU1 1KFUL 2RMU2 5GZEA 4MHRA 3WP5A 4GWNA 2WFPA 1YCIA 2YUEA 1UKRA 4RL7A 1F9KA 3CJIB 3PMSA 3SC7X 1EPZA 1W2NA 2Q1MA 4HL0A 2HWD1 2P5BA 2W87A 5CFDC 3ALQA 1V6JA 4XF0A 4CCEA 4FQZA 1NXMA 2FMYA 5FZAA 1YQCA 3T2QA 3JCIA 3NNGA 4QHZA 2AACA 1JH5A 2WJSA 5L7OA 2BERA 3WY6A 3GM8A 4KG8A 4ZZ5A 4Y22A 4Y5SA 3U0ZA 3E5UA 4Y5Z0 1OKQA 4EWDA 3TWIA 2DDUA 4A2UA 2XKOA 3OY8A 2P3YA 3SH4A 1RUG1 2BNNA 1JHJA 2I07B 3AMNA 3VBFB 3RZMA 5CYYA 5JZGB 4MXWA 3N9QA 1LODA 5CNAA 3V64A 5H9SA 4GJYA 3VZKA 2A73B 3HPNA 3I54A 2X10A 5FREA 4C0BA 4ZPIA 3J8F2 4A41A 2ZMLA 1V00A 3HWJA 2ARAA 5I0TA 5SV8A 4BQXA 5T55A 1PVXA 1R083 1PO22 1WZXA 2FZ1A 2WINB 5FY1A 4NROA 3J7LA 2QZ3A 1JYWA 5A3UA 1C1FA 3AJYA 4Q29A 1NKGA 3POJA 2W1WA 2H6BA 4QMAA 3RRDA 2R16A 3WHUA 3JD72 5FBJA 1OHFA 3VLBB 4NPMA 4NWWA 1ULFA 2JECA 4M3CA 5A6YA 5C33A 3IAQA 3D6EA 5BNNC 3WCSA 1O5LA 1RVF3 2A1XA 4JTNA 4Q0UA 1E57A 2P6HA 5ANNA 2RDQA 4FO9A 1OXCA 2WS92 3O0WA 1WBFA 4ATEA 2Z2SB 2WUHA 4KL1A 4NIDA 5L9RA 5FZEA 1UXZA 2TBVA 4PQQA 1OD3A 1GNHA 1PIV3 5D21A 5LBCA 1GKBA 3O1OA 4A6SA 2NPIA 1I1EA 1KEXA 1LOCA 4XVHA 1H8VA 4XJZA 5C8WA 3QH6A 3LD8A 1VJ2A 3VZLA 1UYZA 2QQNA 1R091 1TE1B 2C24A 3LF7A 3HNMA 1RGSA 4CDQB 4QX5A 3AYCA 3J7NA 4PF5A 2W1UA 5FK7A 4LBQA 3LSEA 2AH2A 3MW4A 4CPBD 5IVBA 1FPN2 1MEC3 4WV8A 2HYKA 1V6OA 1W9FA 2I2SA 4RS5A 5J96B 4QX7A 4X8PA 2A6VA 5F3IA 4CDWC 1WKYA 4FCAA 3I7DA 4QX2A 5F6LB 2IFRA 3B02A 4IV1C 2VQTA 2HWB3 3BOWA 4UFLA 4IETA 2WZ8A 1VBA1 2ADDA 3KLSA 5A3PA 1JOJA 2PHRA 5DUWA 5JIAA 1YIFA 1DZRA 5KC5A 3RG0A 1H1IA 3F2ZA 1HRI3 4WM8A 4NR1A 2E6VA 4FOQA 4JCKA 4RSUA 3AYEA 2RMU3 4FPFA 5FYMA 1XNBA 2J1SA 2DCJA 3Q9OA 2V5DA 4FI9A 3U78A 1ACCA 1XU2A 4CUCA 1S55A 3RZGA 4G3YC 4GA9A 3TN91 4GH4C 5T5JA 1BVP1 1QY4A 1WW7A 1XPWA 5C3QA 3OJBA 5AFEA 1W6MB 4GB32 4BMEA 2EIDA 2XVKA 2Y6LA 3BB6A 4M0NA 4ZU4A 2K46A 2B45X 4CCNA 1E5SA 3AKSA 3KV5A 1DBNA 5EHDA 2VBBA 3ACHA 5GALA 4J25A 1UOJA 4QKNA 1W9SA 1WWYA 3VZJA 2DVBA 1QQP2 1W2OA 1SEFA 4SLIA 5A3NA 1W8WA 5FFOC 1EAH1 4Y20A 5LRSA 5FMBA 5A7PA 4FT8A 5F5QA 1NUKA 2JG9B 2O14A 4D0QA 1PZ9A 3D5OA 1DDLA 2OQ6A 3J8F3 3MIFA 1RUF2 3I8TA 4L0PA 1HXS1 3H3UA 4JGYB 4BQ4A 4D7YA 5BNPC 4GIQA 1PO23 4A45A 4QQOA 3WW2A 5FP8A 1OC1A 5LA9A 2LW8A 1ULPA 3VL8A 4AZZA 3JZVA 5ABJA 1AR72 1UY1A 1CAXB 4QDQA 5JZGC 1BBT2 4AI8A 2WFF1 3VDDA 1WMDA 3NJZA 5IAVA 3VBOC 4YYOA 4XDQA 3APBA 2WA3A 2VD7A 3GHMA 1J83A 2YYOA 3AZXA 3HQXA 3K3NA 1RUE1 3ROUA 2OPWA 2IUWA 3S5AA 3KVBA 3N9LA 3H1YA 3V65A 2ZA9A 5C5TA 3WW4A 1WD4A 3VKFC 5A6QA 1RHI2 2YU2A 2V5YA 4CSWA 2JIJA 5J09A 1JU3A 4TLFA 3T4HB 2VZTA 5CFCB 4B4QA 5FZDA 2ETEA 1OA2A 2CAUA 2K0GA 4P9XA 1DCSA 3KGLA 4QPGA 5F2SA 3UK9A 1VBB1 4LMFA 4YLZA 3UJOA 1LOGA 3ZYIB 4AF9A 5E89A 5AFBA 3GBWA 4OQ8A 1WLTA 2Z42A 3SCHA 1Y9MA 5BY5A 1FPN3 2VQ0A 3CZJA 2WR9A 1IS4A 2W46A 2PQQA 2Y26A 4HKWA 3POBA 3LEGA 1AHSA 3NV3A 3WDXA 2E7QA 1ND2A 4RQPA 3B00A 1MS5A 2B9VA 4AOCA 4AW7A 4BE3A 3TNQA 3U37A 2O8OA 4E4DX 4IV3B 4AFDA 1X9PA 3GHNA 2W68A 3VV1A 1NCQA 2A75A 3POSA 4CDQC 2EXJA 3B7MA 1HQNA 5HCFA 1CJDA 1QJY3 5JOXA 2W08A 3THCA 1OQ1A 1SPPA 1BVVA 3NVCA 4HOOA 2D6OX 4L2NA 2HWC2 4R4XA 1S0FA 4YFWA 1G9CA 2QJVA 2XLGA 1JUHA 5IVVA 4IEOA 1W6OB 2VOTA 4IXLA 1JZ3A 3O1UA 1F15A 1H9WA 3WNLA 1AR92 1ENRA 2EICA 2VE1A 1LHNA 2ES3A 4NIIA 4D7TA 4Q8KA 4N9IA 5FZFA 2LALA 2BPA2 3MO4A 1RUJ2 4AEDA 5J98B 5A32B 2R0HA 3HN3A 1W03A 1ENQA 4LBQD 1IS5A 4CDUC 1S2KA 4AAPA 1S0BA 1I9RA 4GMP0 4GB33 3VHPA 3M3IA 3PUIA 4EN6B 3LKJA 4YW2A 3T08A 4CP9B 5CISA 5FY7A 3HBZA 1OVPA 3CO2A 2PQSA 3ABZA 2VZQA 3BTAA 2RS51 4PT6A 1A6CA 4JGZC 1YQ5A 1S0IA 1W0PA 4NE9A 4YW1A 1QQP3 4NHXA 3R4DB 5LB6A 2C4XA 4WZCA 3DPRA 1K5JA 1GQHA 3UV9A 3ENRA 2YFUA 2PLV2 5ACA1 1J1LA 1RUOA 3AP7A 1K3IA 2OPKA 3LDBA 4GJZA 2G9GA 2QFEA 3J7HA 2CL2A 2ZHLA 5EFUA 2R0FA 2VMEA 3H3ZA 4AQSA 2DVFA 2EIBA 2OUJA 2VULA 5A33A 1DFQA 1RUF3 2RR12 4AXOA 4B3NA 1X33A 1W39A 5FXXA 4LPLA 3ZVXA 3MIEA 2YZ4A 2A3YA 4EROA 1BMV1 1WCUA 2PHUA 2D43A 2VM9A 1SLCA 1AR73 5KC6A 2NYYA 5LW9A 3MF9A 5C9AB 1BBT3 1X82A 1ZX5A 1DGRA 5FXWA 5A7NA 3JXSA 2JG9C 2BBVA 3MPPG 3AP9A 3BU7A 4GWJA 1C8NA 2X09A 3WDWA 5C8CA 2J1UA 1DLLA 1E5IA 5GZDA 2GMEA 3KT4A 3I3MA 5IW0A 1NCRA 4S2HA 2RE9A 4AG4A 5IFTA 1XNDA 3RNSA 2NZ9A 2WYFA 3FZ3A 3VDAA 5I8TA 5T50A 2FZ2A 1JW6A 4EN9B 1QXJA 3LPFA 2MEV2 3MIBA 3B5LB 5IFPA 4GWIA 3LQCA 2Y6GA 4CDXB 4GAZA 3VKOA 5F8PA 2RJKA 4Q4Y2 1VR3A 4W6YA 1ZRDA 1K12A 2XMLA 3AZVA 4EYUA 1HW5A 4IUGA 4LT5A 5F32A 5J37A 2ERFA 3BU0A 4V1PA 3M3OA 3T30A 2PAEA 1POV0 2IZWA 2P3JA 4NJ4A 1QJU2 4H2AA 1VMFA 4QT6A 3ACFA 4CCDA 1VRH1 1GZ9A 2V4VA 5DMYA 4CEYA 4OHZA 2D98A 5LK5A 1GP4A 4NIHA 4XJ9A 5FR3A 4GXLA 1R1A2 4DUVA 4UOJA 2GN3A 3WG4A 4AFCA 2AEZA 4QPYA 4LKSA 2ZHNA 3O5SA 1DQ6A 1X8EA 4BZ4A 2GC2A 2VBDA 2HWC3 3JQXA 4TSVA 2N7GA 3VBUA 2WO7A 1CJPA 4PDWA 3GGLA 4XABA 2BZDA 2VOXA 5GJ6A 2BEOA 4Q1PA 3TBDA 3C7EA 3WLUA 4NHLA 5K0UC 3BIEA 1DZTA 4C91A 2BNOA 1OMIA 1AR93 1WA4A 2XHNA 3A4UA 2KR2A 4IV3C 1EV12 2HWF1 3WQ1A 5FP3A 5J1XA 1ZRFA 5LA0A 5JR2A 1RB8G 1L7QA 1W0OA 5L9BA 2VCAA 4L92A 2GDFA 2QQUA 2V73A 5FZIA 1J3QA 2JX9A 4E2SA 4Q8LA 1FNZA 4CZSA 1NLSA 2C9KA 1QNWA 4QXCA 1ODNA 4S2DA 1APNA 1WBLA 1PO11 2XQRA 5FLHA 2W5FA 4N43B 1PMJX 5HI0A 2CGPA 5FPLA 4GULA 1QEXA 2A7AA 5CZKA 1ZZ6A 3WP3A 1GWKA 1UWWA 2WQZC 2RS11 4I02A 3LOBA 3DEMA 1W6NA 2ZGKA 1MQTB 2VUJA 2UY9A 1NA1B 4YW3A 5LRRA 1GOGA 4KG0A 4ASLA 2PLV3 1OSGA 4RR3B 5A70A 3V0BA 2KD7A 2VVFA 4IL7A 1N47A 1FT9A 1GWMA 2WNVC 1OH3A 1FV2A 4FPYA 3VBSA 2R061 2RR13 4OUSA 3BTYA 4XCBA 5KHIA 2RDNA 1QOOA 2DF7A 1W28A 3E6CC 2ZGLA 4HONA 1FAYA 3C7GA 3ZXAC 1NOVA 1QDOA 5CAZA 4FPLA 3BPZA 3DGTA 4PBOA 4GWMA 3SCFA 3VZOA 1OBNA 4C0HA 2VNVA 4PIYA 1QKQA 1HX6A 4CCCA 4V2WA 2WZPP 5EJ1B 1QH6A 4XURA 1REDA 4BH9A 2OT7A 3GF6A 3USUA 4D3WA 1D0GA 1XSQA 3AX4A 4IE5A 1AR81 1S0JA 3PIJA 2BU9A 2VECA 2J1TA 1TMF1 4P5YA 5F5AA 5FPVA 1ZZ7A 2HJIA 2EA7A 4LIVA 1T6BX 1PGW1 5KR7A 2DCTA 3OF1A 4LO6B 4A7KA 2QNKA 2YBSA 1GP5A 5IJRA 4QB2A 2C9AA 2VOWA 3HNBM 5C9AC 4Y5TA 5AC92 3CQOA 3ZXEA 4Z8BA 2FQPA 1RVF1 4I0AA 5BYNA 5H9RA 2JE8A 5L36A 4C1XA 2MEV3 2YMZA 3OYWA 1VBC1 4FOVA 5DZEA 3M3EA 4IE0A 1V6KA 4KBBA 3VBRA 1K5MB 2LM3A 4RGGA 1HV1A 2Z5WA 5T52A 4Q4Y3 1Z0HA 4CCLA 1PIV1 4LXLA 1OKOA 2WNUC 2XXZA 2P37A 2P34A 2OUHA 2VW1A 3ZSEA 3N36A 4MG2A 4P9JA 3DYOA 4QPWA 4YM3A 2V72A 5A1AA 4LBKA 4BU2A 1B35A 3AVSA 2JE7A 1IPSA 1F2NA 3IMMA 1PGL1 1WA6X 3JB4C 1R1A3 4YVSB 4CDXC 2YU1A 3ATGA 2H0VA 1LOFC 3EMRA 5GLZA 2BFUL 3ZN6B 2A6XA 1LCLA 5C70A 4BLIA 3JU9A 1UY4A 5KBFA 4KWLA 1A3KA 2VNRA 3NAPA 4KGQA 3RJ2X 5K8SA 3D0JA 4UYBA 3O1PA 2R30A 2WL1A 2Y33A 4K3UA 1D2QA 5H9PA 1O3SA 2Y6FA 1EV13 1ZBA2 4X8NA 5FZ0A 3ZN5A 2LRPA 3NKGA 3GXUA 1NQJA 1MS9A 4JX0A 4M3CF 4HVOA 4FTSA 2EXHA 4LBJA 2JDAA 2WZR2 1W8FA 4ORFA 4AI0A 1H2KA 1A78A 1HRI1 5FZHA 1AVBA 4CA9A 2AZ5A 4LA3A 3URFA 3L2YA 2RMU1 5C5UA 1GOHA 4CP2A 3E1F1 5I0SA 4P9GA 4AI9A 1CZTA 4Q27A 5EWSA 4SBVA 3PMEA 4QM9A 4WVWA 2R49A 4Q2FA 4OHYA 2X05A 5HXVA 2ATFA 5FP7A 3X29B 4XUPA 5FQ0B 5FBZA 2IXJA 2VZPA 1OF3A 4Y24A 3ZFFB 2Q30A 4L9BA 4N43C 1VBD2 1Y3TA 3AKQA 3K51A 3A23A 4XBNA 2DUOA 4RHV2 5FPZA 1HN0A 4CCMA 2ZGPA 2VY0A 3SXWA 5CKNA 1MQTC 1YFXA 2JG8A 1NA1C 5F3CA 1S4CA 2FDFA 1HRV2 2VR4A 4RR3C 2SBAA 4BB3A 1VMJA 4Y1XA 4NPLA 4O65A 1C28A 2Z4FA 3HT1A 3J8F1 5F9TA 3TEWA 4XCAA 3MGUA 2ZS6B 1CQ9A 3WUCA 5KXBA 3EB7A 3VD3A 3LAGA 3WUDA 3IPVA 3AP6A 5E1RA 1H30A 1W2UA 1F5FA 3BODA 4UFHA 2YG0A 2WBKA 1MS0A 4GALA 4B4PA 3KWVA 5JAXA 1G9DA 1I5PA 3KHCA 2XLFA 4XMAA 3O1MA 4KWJA 3ZDSA 3MLKA 3WHTA 2VZSA 3PDQA 4YW6A 4LHSA 1JI6A 2WAOA 5L7OB 1UL9A 3OPWA 4QGLA 1V70A 2XL7A 4Y26A 4Y22B 3ST7A 2RHPA 4B7EA 4DNYA 1DQ2A 2ID4A 4Q4W2 1J1TA 4LE3A 1F31A 3OY8B 1UY2A 3MIDA 2W9XA 3PUQA 4H14A 4MGSA 4YW7A 2BTVC 2OZJA 4MXWB 4P9WA 2ZTNA 4XHBA 5CKQA 5C4WA 3SKVA 1MS1A 4FFHA 3RSJA 3WDTA 3IDEA 4BCUA 2A3XA 1Q56A 2ZGNA 4LLOA 4ARYA 2PN5A 2XKPA 1VAKA 2Q4SA 3N9NA 3GZUC 3OEAA 1FMD3 1H0BA 2JXAA 4GD4A 4Q26A 5HV4A 2KA3A 2P17A 1PM7A 1ND3A 5AVAA 2VGDA 1AF9A 4H7MA 2CNAA 4Z2WA 4KMQA 1D4M2 4D6RA 1CPMA 2GALA 3LA2A 5FWJA 3N7KA 1VLNA 3O14A 4AQTA 1UAIA 4AVAA 2Z79A 1YQ2A 2BYVE 1LRHA 2FBEA 1JN2P 3GZEA 3WDUA 1J58A 3J4UH 3SITA 2MNGA 3MIHA 4M3CB 1HB1A 4LBOA 4JQTA 3IDCB 4LKDA 5LEJA 2D40A 1FOD1 4JV4A 1J3PA 1CWPA 1XRUA 2IFWA 3WP4A 1NAEA 1ZBA3 2D5HA 1DYPA 4AGGA 1QJY1 2AR6A 1IHMA 3LEKA 2R1BA 4JDNA 2YBKA 2ZOEB 4OUEA 3ZYJB 4WM7C 1WCDJ 1TEIA 2WZR3 2YC4A 2ARBA 1LOEA 5JOZA 3E6BA 4A4AA 1UOGA 2W92A 3VBHC 1LENA 2IXLA 3THPA 5IVJA 1OA3A 1A8DA 1CONA 1HIXA 1K45A 4D94A 3QACA 2WRAA 4OZOA 2XLAA 3CL1A 3D0SA 4QPIC 4R52A 1DLCA 5FLJA 2FCVA 3MPBA 3RZJA 1VB2A 1W9WA 4LBQB 3W21A 5ISLA 3WNMA 1DGWX 1US3A 2TNFA 4RD7A 4AR2A 3EJKA 5IATA 4WVMA 2Y60A 1F4AA 4FP2A 1RJ8A 2PAKA 1YRZA 2WO2A 4RS5B 1C4RA 4AWDA 2D6KA 3BALA 4MO3M 2G19A 3FFQA 3KCXA 4O9GA 4CEWA 3BGAA 1IG0A 1VBD3 1W6QA 2MHFA 1OPMA 4LLFA 1J84A 1UPSA 1W9YA 4META 1UY0A 1LHOA 1JMUB 2YY1A 4COWA 4RHV3 3PVOA 4UBHA 1QF3A 1HRV3 2DVDA 3IZOA 1YJKA 2BVBA 2PMWB 1QIQA 4GKYA 2W0XA 3B9IA 5FY0A 3T0AA 1JZ6A 5CFDA 1YHFA 3OGVA 3PVBB 4WM8B 4OVEA 1XYNA 1N3QA 1RUF1 1ASJ3 4BQWA 5FYTA 1W3VA 2B5HA 3ZFEA 5FY4A 1PK6C 4R9CA 4WZFA 2QKDA 3RMYA 1AYM1 3K2OA 1AX0A 1AX2A 4U36A 3U11A 1BEV2 1HB2A 4O61A 2OVUA 1AR71 1W06A 3IBMA 5KHGA 3CBNA 4HVRA 2BP6A 1BBT1 3Q8EA 3NV2A 2JDUA 4R4ZA 1G6NA 1SLTA 1V9U2 3SEEA 5KWRA 3HR9A 3TEYA 5FKCA 2W1QA 1OVSA 4UI9L 4XQDA 3NV4A 4W8JA 5EYXA 3ZPOA 3M3QA 3PTRB 1JS9A 1X36A 3KQRA 1GQPA 1SZBA 4ISRA 4N53A 1WW6A 2J1EA 4XIKA 4Q4W3 1PX4A 2DU0A 4CUGA 1AXYA 1W8UA 3ILRA 2E51A 2Q8OA 4GMP3 1U12A 1VBE2 4Y20B 4Y4RA 4M01A 3AKPA 3VB9A 5JPMB 4DEVA 1C57A 1UZVA 1YI7A 4BA6A 4IGOA 1R64A 5BNNA 4K1ZA 5L7OC 1YUDA 5FP9A 4AHWA 3JQWA 2PYTA 3ZSJA 2ZX4A 2W52A 4E4ZA 1NLRA 1UY3A 1WMFA 2VMHA 5FY5A 4M00A 3S0MA 3I2DA 1VE0A 1VPHA 1IQDC 4A3ZA 5ABJB 2Y8KA 2GH8A 2YDEA 2RS31 1I6XA 4DO0A 3SLIA 2GNTA 4N7UA 2JB8A 4QXBA 3MDPA 1SLAA 5F37A 4LORA 3VDDB 2R1DA 3MFCA 2D3PA 3DN7A 3WP6A 3KZ4C 5DZFA 3E5XA 2VZVA 1UO9A 3VDCA 4M0HA 2X5IC 2FCTA 3H0OA 2HWC1 4AHYA 5B4NA 1JBCA 2F4PA 4LNVA 1GUIA 1QJX2 3OB8A 4HPKA 5EP9A 3I2OA 3WQ7A 2A5ZA 4EE2A 3GBFA 4PIZA 4TWTA 2QQPA 2DFCA 4HETA 3VKNA 4R9DA 2ORZA 2BRTA 3L9JT 3WG3A 2EF6A 4QPGB 3GJBA 1YFYA 4IDZA 4JHZA 5A7WB 3FHAA 1LU2A 2HEWF 3FX3A 5J48A 1V6MA 1O7FA 4XZUG 5FPXA 4KQ7A 1D4VB 2EIEA 4AHXA 3AXEA 3MFAA 4JZRA 4WVZA 5BUVA 1ND2B 1U5IA 2VTXA 4RQPB 1PMHX 1XYOA 4HK9A 5DDJ1 1BKZA 2HWE2 3POYA 2YPJA 1SDWA 2R072 5KXDA 1NCQB 2ZGRA 2X8KA 1NY72 3M4FA 4GQ7A 3IIIA 4U2AA 3CHXA 5DUUA 1SPPB 5FYIA 3A7QA 2F4LA 2CAVA 1NE6A 1POV3 3R4UA 1CZSA 1TG7A 3KS7A 4IE6A 4XETA 1Z7S2 3K48A 2WC2A 1SBEA 1UNBA 1ULEA 4RS5C 3AB0A 1H8TC 4FVVA 1UN1A 2XJPA 4FP3A 3RI8A 5FZOA 4N90A 3G7DA 2JKXA 2HEVF 4AEDB 2VW2A 1WUVA 4E4HA 2HYXA 3ILNA 4R9AA 5DAVA 1SLBA 3WF1A 3PLQA 2VUAA 1JODA 1GZWA 4UFKA 1EPWA 4LHLA 2R042 3N7LA 3ZYHA 3NV1A 1AJKA 1V9U3 2E7TA 5BNQA 3CLPA 1P8JA 1JZ8A 2KM2A 1SFPA 4WM8C 1JYXA 2GC1A 3CJIC 3M7AA 4QX1A 1GYKA 4KNCA 4Q4V1 3ZSKA 3ZLIA 4TN7A 5BNPA 3KB5A 5CG8A 1WGPA 3DPRB 1IS6A 2ZGOA 1VBE3 4P9IA 5DZGA 4JKLA 3ZYPA 1NX9A 1JZ4A 2R32A 5JXGA 5JSRA 1O8PA 2W47A 2ZACA 2Y6HA 2P3KA 3HIFA 2RJ2A 4MGQA 2VPVA 3IKWA 3LB9A 3I3QA 5A33B 4LKFA 1PX3A 3S7IA 5FPBA 3JD73 3VBFC 3EXUA 3VBOA 1C3HA 2ZXQA 4AI1A 4BHPA 2WT1A 4Q4Y1 5KHKA 2J1VA 5I0RA 1E5HA 4XDOA 5DAWA 5JIUA 4DUXA 4ZHNA 1RMU2 1XE8A 2WS93 3R6SA 4LHNA 5FRAA 3MW2A 4BOWA 1AUYA 5JLVA 3LWCA 2OQ7A 2Q5TA 2RVAA 3UGHA 5JSOA 4LOTA 4BK4A 1JYVA 1WMXA 1RUD1 2HWD2 2H0BA 1SDDB 2QDRA 1XU1A 1DIWA 1O4TA 2UYBA 3T2PA 5KHJA 4XBLA 4H55A 4A7YA 5C8CB 3MZHA 3E97A 2QDNA 4A3XA 2ZKNA 2O8QA 3TEZA 2QQKA 4DY3A 1NCRB 2BOIA 1S0EA 4LOSA 4IERA 3VD4A 4QX3A 5LBEA 1HB3A 3ZKUA 4CE8A 5GLUA 1RUG2 4RA0A 3H8RA 1CZVA 3IMNA 1VP6A 2KXLA 4G4FA 4QKDA 4DZGA 4HZFA 2HKXA 1ZZCA 3WW3A 3V56A 3ZN4A 5FYCA 2AUYA 3LGRA 3AFKA 5EZWA 3P1IA 5IAXA 4K8FA 1CX1A 1XC6A 1XB9A 5A1FA 2DWRA 4XJWA 3O7OA 3QLQA 4LUMA 1O59A 3NMBA 4A44A 2Y6JA 4NAOA 4FPCA 3ECQA 4HT1T 5EJZB 2Y6KA 4LA2A 4E8DA 1LHWA 2QQOA 1QXRA 4DB5A 1LEMA 4B1LA 2HWE3 4CEYB 1OA4A 2XVGA 2WO1A 2R073 3GYDA 4AEMA 5FYBA 3ZYGA 2XVLA 5L9VA 1YQ6A 4WBBA 5F7UA 1RUI1 3HEIA 3H8OA 2GN7A 5A7WA 5IHRA 5KXEA 1GWLA 2DU1A 2GC0A 2I74A 5FO7B 4YZ5A 1Z7S3 3VBUB 4CDUA 3ZIXA 1AL21 3VUOA 3N9MA 1ULCA 4PDWB 4DRVA 1WW5A 5A3LA 4GKXA 4N9HA 3GNEA 4RQPC 1A34A 1GZCA 4XXAA 2PFWA 4CRQA 2O0OA 4CU6A 1ONAA 1NCQC 1QU0A 3B3QE 1HJGA 1QWRA 4JGZA 1OFSA 4P9YA 4OCTA 2TUNA 3ZM8A 3POEA 3QBQA 2CY6A 2P6CA 2WQ4A 5FYHA 5K9YA 3OEBA 3MUZ1 3ASIA 5DUXA 4CCKA 2BDRA 4FSJA 4ARXA 3C7HA 3N35A 3DV8A 4Y3OA 3HMYA 3UGGA 4KH9A 4HSJA 2A70A 4ZXEA 4CXXA 3ZSLA 4IE7A 2VQUA 1W6NB 4E27A 3BTZA 2G9FA 4B29A 3V0BB 4JC1A 1GLHA 1REFA 4BJ0A 2WIIB 3OBTA 5FO8B 4N8MA 1VBA2 1KITA 3FBMA 3VBSB 2GNBA 2RM22 2XBO1 3Q8BA 2JDNA 4NPRA 5BPXA 4YSFA 5FZLA 3H50A 4PLNA 3OD4A 3IAPA 5FYZA 1ALYA 4ZZ8A 5LBBA 2FD8A 5HCBA 4UWDA 4XAEA 1RMU3 3N4MA 3DPRC 4DRRA 4TZDA 1V0AA 5JSPA 1NG0A 3CZUA 3HNYM 3MBWA 1VMHA 2BNMA 3I2FA 3I97A 3LEIA 4JGYC 1O3RA 4HKOA 3A21A 4P5HA 1UD1A 3OUJA 4IESA 3LZZA 3USUB 1CN1A 2EALA 2HWD3 2JB4A 1FMD1 3UESA 5C3OA 3ACIA 1KS4A 3AXDA 1RHI3 3TEXA 1M06G 5FY8A 3MEPA 2NP0A 1CD3G 3JBG1 3GZTB 4XUNA 3RYKA 2AGSA 2DBIA 3WX5A 5D8AA 1QJZA 1IS3A 2YXSA 5T54A 3UKTA 1RUG3 2VMGA 3PJQA 1EAH2 3O1TA 1GP6A 1UKGA 3OYWB 3CEWA 4IEUA 3VBRB 5FYVA 1C8M2 1CIYA 4DXRA 5J36A 2DV9A 4E2GA 3IWZA 2XJSA 3P3NA 1JYTA 4A7ZA 3DECA 3POFA 1GR3A 2ZGMA 2WO3A 5CFCC 1JXNA 1HXS2 2DTWA 2GMPA 2XDVA 5JCTA 3I2GA 3A0NA 5HCHA 1KJLA 4F83A 3LIHA 5FP4A 3EBRA 1J3RA 1B35B 1OURA 5FJKA 4XJAA 1MS8A 5ANQA 4W6WA 1WCSA 5K0UA 3U75A 4CTEA 2YC0A 1PNFA 1KXGA 2WFF2 4ATFA 3I59A 5EXOA 4BXSV 2GC3A 4HN0A 1UYYA 2DUPA 3MLLA 4JVAA 3THDA 1RXFA 2XH6A 1RUE2 2D6MA 1RUJ3 2GMMA 3B93A 3RS6A 3ZXDA 1W2AX 5BNOA 4ZS3A 1OT5A 5HBAA 4OI0A 4K20A 4XW3A 2QQWA 3NAPB 2E63A 2YROA 5DAQA 4NAMA 4XFFA 4AI2A 4CEYC 1GICA 1MACA 1IG3A 3FWEA 1Q8QA 1IPKA 3PHMA 4HVQA 5DUVA 3C7FA 1VBB2 1XE7A 2EXKA 5FWEA 4OZXA 4UF0A 5IK7A 5JXIA 3VBUC 3PL0A 5FZ9A 3RYPA 1ASJ1 2LROA 2VCMA 2E32A 2WNVA 1Y43B 2XJVA 3T2OA 3ETPA 2BGOA 2G9ZA 2XR4A 4P14A 2XQXA 2GNDA 3I3DA 5F5CA 4Y1ZA 1YIPA 3FHIB 2PAMA 1OLME 4K9SA 4CU8A 1HKDA 4LTAA 1JTZX 4Q0QA 4NMIA 2Q8CA 3T1MA 2BOJA 2QE3A 1KFXL 4KWKA 4QXHA 2VNOA 2E53A 2C1FA 2VXJA 2WA4A 3N3HA 4W4ZA 5FOJB 5LY1A 1VBA3 4LBLA 1OQDA 1W9TA 4PIXA 5FZ8A 4ZXKA 2WDBA 1CAVA 2RM23 3WINE 5I0UA 1W8ZA 5L19A 1O5UA 1ZZ8A 3ES4A 1CESA 4UBGA 1D7PM 4UFMA 4YVWA 2UURA 5IVYA 1W8HA 1UOBA 1G7YA 2D5FA 4I0WB 4MSVA 4XEZA 4AGRA 1XYPA 1VALA 4NRMA 4Q4W1 4ZONA 4AGVA 2ILMA 2WAAA 1M4WA 4YG0A 1NZCA 1UX7A 2JD9A 2JG8B 3LIGA 4RFT0 1UIJA 3FLTA 4I0BA 3GCXA 1N3PA 1R081 2NM1A 3B01A 1US2A 4JQRA 5FUIA 2QQMA 3SEPA 2QUOA 3DL3A 1MZFA 3ZFGA 2EVXA 4RFRB 2FDIA 1UU6A 5IWFA 1S0GA 1ZBE2 2WN2A 1UW8A 3I3BA 3OUHA 5DXDA 5EV7A 3U07A 3VBSC 4FTBA 4YM1A 4Y4YA 2EAKA 3IPVB 1D0HA 1H4HA 1U5XA 2LS6A 2TEPA 4HSLA 3AMMA 1OOPA 1RXGA 1T6GC 1URXA 4IEQA 4K8RB 3ACLA 3H1WA 1DU3D 1SMVA 1TME2 2V09A 4KI5M 5GLTA 2RS52 2VOKA 3CMGA 4YZ3A 5CBLA 1L7RA 1RUH2 2WNUA 2WWUA 2HBTA 4XF4A 4O7XA 2Y0OA 3W59A 3O1VA 1Q5OA 4S2FA 5F6KA 4AVVA 5ACA2 4MGIE 1C8M3 5A7OA 1QXPA 4PHZA 4URAA 1QJU3 3S30A 1PVC2 2ZPXA 3SCGA 2RDSA 4Z1VA 1ULDA 3LDRA 2WLQA 4M3CE 2PTMA 1DG6A 1V6IA 4JHTA 4XF9A 4PLOA 4H7LA 4NVPA 3KCYA 3OSDA 4AEKA 5C4WB 1BMV2 5C3SA 4Q4X2 2ZKLA 5A7SA 1YFWA 4IE4A 1MEC1 4JKKA 4IEZA 3FE5A 3EYPA 4TYSA 1H2LA 3SH5A 3P3PA 4E2QA 2ORXA 2WFF3 4QGNA 1ND3B 1PHMA 4V2VA 4CUAA 5C3PA 1BQPA 3GJAA 3OCPA 3HVDA 5FOBB 3HD8B 1LB2A 5IK4A 3I2HA 4UW4A 3FJSA 1SLLA 5DQ0A 1HQWA 1RUE3 3LOIA 1OF4A 4DOUA 1GOFA 1WCKA 2QZ2A 1ZZ9A 2HWB1 2XONA 1XE0A 3E5QA 3DYPA 3H7YA 3KF3A 3Q8AA 4Q1RA 3WD5A 4DXSA 3IN9A 4URTA 3N7JA 1B35C 1BYHA 4LEJA 5F3GA 3KV4A 1Y4WA 2BUKA 4INDA 4ZKTB 2JJ6A 2B8MA 1FXZA 5E6HA 4D6QA 2IXKA 2XB6C 2HH9A 4MV2A 5JI9A 3KT1A 1N1TA 1POV1 4N7IA 4ONUA 1VBB3 3VKMA 1JZ2A 2IC1A 3DXUA 1YWKA 4YZ1A 1UYPA 3NSTA 1QJFA 3K46A 3LSDA 2OX0A 3TOJA 2VU9A 1W3XA 4A6OA 1WLCA 1ULGA 5JMCA 2AEYA 1HQLA 1O8SA 1DGWA 2GP5A 2BVVA 1UPIA 1CAWA 2VG9A 1VRH2 5BXXA 3S5QA 5IK8A 3ZXLA 2GNMA 4YWAA 1O91A 5T5LA 4COZA 2CSGA 1AYN2 4DINB 1DGLA 1PMIA 5EPAA 1D2SA 4WVMB 3ZYBA 5HV0A 4L8QA 3WF0A 2C5DA 5K4LA 2CDPA 4XBQA 5FCCA 3WDVA 4RR3A 1TNFA 3BIWE 2IVJA 3UKVA 4CEWB 1X9TA 2E7AA 2W39A 3INAA 1NE4A 4MLOA 2ZEXA 3WCRA 1W6QB 2D6NA 2GZWA 1MS3A 3WV6A 3VD9A 4MGYE 4FAGA 2ZHKA 4RN5A 5FPUA 4Z07A 5F3EA 1F5JA 4HKLA 1OPOA 1N1VA 3WZ1A 1MPXA 2CDOA 4FQ4A 2P1BA 4L11A 1PO21 5LASA 3ZOIA 1SBFA 2IXHA 2CGNA 2D3SA 4YM0A 3K4DA 5CFDB 1W6PA 3KCCA 2DFBA 3NKTA 4FBFA 1ZBE3 3MW3A 1NZIA 2FDKA 4NHMA 3JD71 4MZUA 4LO5B 3ZFEB 3R4SA 4K7JA 2JENA 5AC93 1LGCA 2F6BA 2JDHA 1PO12 5I93A 2DCZA 1BCXA 1JHNA 5ERLA 1TME3 1ZA4A 2WS91 3IT8A 4K6BA 2VUDA 4AQ6A 3CDZB 4QX0A 2LTNA 2JG8C 5SV5A 5GKAC 1RUH3 2WWJA 4EV0A 2ZMKA 4HANA 2RS12 2CHHA 4HLTA 3AP5A 1V6NA 4XAAA 5FMCA 3RI9A 2WT0A 3AKRA 3BTXA 4HK8A 3N7MA 4Y1VA 1X7NA 4LR4A 3RVHA 3ZXKA 5ACA3 4ASKA 3RMXA 4FPGA 4YGBA 1FNYA 4DIQA 3FMGA 1YXWA 5JUVA 4N53B 1MZEA 1PVC3 2R062 3FLRA 3QCWA 4P02B 3CIHA 3VHRA 4JDOA 3DKQA 5JMOA 3C3VA 4ISQA 1K5MC 1O4YA 1RITA 4Q4X3 1G86A 2WQ8A 2VNGA 4OI4A 3LCPA 1AL0G 3K4AA 1FPN1 4OHVA 3RQ0A 5IVCA 1VIWB 3S57A 2FMDA 4YZ2A 4YGEA 5A3OA 4YPJA 5BNNB 2ZMNA 4EWEA 1QOSA 1OLQA 2WABA 3PUAA 1FV3A 1MVEA 5D1IA 3H8UA 4OFGA 1LR5A 2BWCA 2WWSA 4DMIA 5FZ3A 3SISA 4NOTA 3AMPA 5I8YA 1AR82 4UFJA 1TMF2 5B4XA 2BW8A 2IWGB 5GZGA 2HEYF 4WM7A 1Q8OA 1LAJA 4YVSC 3VD7A 1S2BA 1PGW2 4BIOA 5C4WC 3PTYA 5T3NA 5CA6A 5LCWL 2VBPA 3L2HA 4IGQA 1XNKA 4OMDA 4F3JA 5LK7B 2R071 3NQHA 2EIGA 2JKBA 3DUIA 2VMCA 2YGMA 4H3WA 4K40A 4OUMA 4FFGA 4TTGA 3VBHA 4I3GA 3H42B 1NY71 4QX8A 1RVF2 2VW0A 1ND3C 3ZKYA 2VOVA 2HBUA 1VBC2 5TSWA 4MYEA 4QPIA 4LK7A 4NHKA 4JAAA 1UU5A 1Z7S1 2JIGA 3DYMA 3KD4A 2VAUA 2VUCA 2NN8A 1YNAA 2P3IA 3B69A 4HPKB 2G4IA 3O0VA 5E88A 1PIV2 1UZ0A 3AJZA 3U14A 2NMNA 2G1MA 5FY9A 4C1WA 2AYHA 5JR7B 2EXIA 4GB31 3AYDA 2Q8EA 2VJXA 4E4SA 4HN1A 2C6SA 4J1XA 5FTTC 5DABA 4NO4A 4XFHA 1KRIA 1IGOA 1ODMA 1PGL2 1GQGA 4LO8A 1AYN3 1IPJA 4Z2AA 3KHBA 4CVUA 4ES8A 1CAUA 4AE2A 4PF1A 4YG6A 4R8HA 1QNYA 1QQP1 3V0AA 1H4GA 3BVCA 3AM2A 1SCSA 2VL4A 1F35A 3MYXA 5CKMA 3H1MA 3I2IA 4QM8A 5FO9B 1OQEA 1PK6A 2WSVA 4AFAA 1DYOA 3BPSA 3D4KA 3H7JA 4JDMA 4CUBA 1AR62 1DGRN 3ZFFC 2AC1A 3BUCA 5DG1A 4XPVA 1TQ5A 3Q8CA 1AJOA 2ZGSA 4XUOA 3LDKA 3OGRA 3N9PA 4BLJA 5FZOB 4Q0VA 2C26A 3FL7A 3POWA 3EQEA 4CU7A 2W2IA 2ZZJA 1QJEA 2IXCA 1OUXA 2W3JA 5FPAA 1WCQA 2VXRA 3WQBA 1GZWB 4CYDA 1EUUA 1JYCA 5A6ZA 2NMOA 5HPOA 4QDRA 2RS13 5FZ1A 5FAXA 3AZWA 4LBMA 4LBNA 2AREA 5FUPA 1H1AA 4OMCA 2NLRA 3J26N 1RHI1 5DAXA 2D97A 4MUVA 3ZFEC 4OHWA 1PNGA 1TZOA 2A6WA 5FMOS 1I3HA 3ORJA 4YM2A 2R063 5BNPB 1EYBA 2Q8DA 4FTEA 1NQDA 1OH4A 2VMIA 1U5ZA 1ZA7A 1H6XA 2R6QA 1ZVFA 1D4M3 1LJ7A 5LBFA 2WSUA 3T09A 2VO5A 4FAHA 4XE9A 5A3TA 2WNOA 3MICA 3FUQA 5E8AA 4B7KA 2B7YA 1C5HA 1PM4A 1QGLA 1UZYA 2WLPA 3VBOB 4C90A 4D7SA 4LK6A 2IVIB 1YQ8A 2X53S 2VCBA 3OBZA 4FXKB 2CU5A 4N53C 2OIIA 2FCUA 3OUIA 3FFZA 5G04L 4D69A 1AR83 1KGYA 1Q8SA 1RL3A 1TMF3 2JDKA 2X5IA 3H8XA 5IYYA 1MR5A 1H2MA 3LE0A 2QTWB 2VZOA 2ZBJA 4G9SB 4DXZA 1CR7A 1N1SA 1W04A 4PI0A 2BFUS 1GMMA 4QXKA 4JRAA 1COV2 3ITQA 1W90A 3O0XA 3UGFA 1BXHA 2D3RA 2A71A 4ZU5A 2AENA 1OD5A 4FXGB 3T0DA 2L9LA 2XUEA 1VBC3 2J7MA 3OGJA 1AR91 3T1LA 1UMIA 4XZPA 1CPNA 4KGGA 4QQ2A 1RUJ1 4CDWA 1QDCA 3WSOA 4BQYA 2D6LX 4IV1A 1VAMA 2B42B 1YI9A 3ELNA 4XUTA 4BMBA 3W58A 3WW1A 5EIYB 2JDMA 2CV6A 1V6LA 5EJ3A 4XF3A 3VHOA 5FK8A 3VDBA 1QMJA 2ZJCA 4OULA 3I2JA 2Z69A 4XIOA 3B9CA 4W65A 4AHZA 3M1HA 1CX4A 1ZNPA 4JTOA 2YFZA 4FFFA 1NLQA 2BGCA 1OUSA 3S6PA 4NRQA 1L7LA 4TLGA 3ZPYA 2UY8A 1T2XA 4XFIA 1UQXA 2ZGQA 2PLV1 3I3EA 3WQ0A 4CU9A 4MGTA 3IDBB 3KM5A 4AFBA 2GSYA 1DQ5A 1H8TA 3OPZA 4GH4A 4JKMA 4FFIA 2WNEA 1FOD2 3AMQA 4FOWA 4QU2A 1AR63 2RR11 2W95A 4UW3A 2VTFA 2PHFA 5CU1A 1RUC2 3WG2A 4BPZA 3NL1A 3WR0A 4OQ9A 1UU4A 4CDUB 4DPNA 1QJY2 2PXJA 1BEV3 2RM21 3WEZA 2DCKA 1G9AA 5LY2A 3CF6E 2YBPA 4RYDA 3H3LA 3ZR6A 2Y0IA 4F8AA 2RV9A 4XFAA 1LGBA 1EY2A 1HB4A 3K77A 4EWAA 2WN3A 3CJIA 3CU7A 4JGZB 3ZDVA 4RGKA 4CXYA 3IDAA 3OGSA 1LGNA 4DFSA 4IEPA 1XXNA 3KF5A 3OPTA 4FPJA 4Y33A 4HMZA 1SFNA 1JOPA 1RC6A 3D82A 1UYXA 3MF6A 4K21A 4XF1A 3F95A 1JYIA 5T5OA 4CXWA 4IQPA 2PHWA 2UWBA 3HAGA 5M0TA 3UNPA 3ZMNA 5FZMA 4IEXA 3POIA 2R7EB 1J59A 3BOPA 5JWPA 5LWBA 2ADEA 3NNJA 3VGIA 4MADA 3VBFA 3KV6A 2MEV1 1DF0A 5JZGA 2UYAA 4XJUA 2H6CA 1TNRA 2DTYA 2XJTA 5LA2A 4AFMA 3OD0A 5GZFA 3RWNA 1C8M1 1ULOA 1LOBA 2DBNA 2XWJB 1QJU1 4XXPA 5FXVA 4LUKA 3KVAA 5DG2A 1DQ4A 2I45A 3T3YA 1R1A1 1AYM2 1FATA 1XQNA 1EP0A 3D3AA 4QAWA 4IEWA 2F17A 4YGCA 3A0KA 3PJYA 3TAYA 4CCJA 5BV6A 5CADA 2X29A 1W2TA 2ZABA 1YEWA 4AQ2A 1COV3 1ZREA 5ABJC 1VB4A 1QJX3 3WOGA 3W9AA 2QVSB 1W8OA 1Q8PA 1HJFA 3ES1A 4B4RA 3FC0A 3RZHA 2Y64A 2P4EA 5FYYA 5J3UA 3VDDC 3WF2A 1R1ZA 3U1XA 4MHUA 3BI3A 5D8AB 1EV11 2Q1ZB 5CG9A 4XTMA 1U0AA 4BISA 4AVTA 3BYWA 1LEDA 4IW3A 5A3WA 3P6BA 4YRDA 2ZGUA 3KV9A 1UZWA 3PVEA 4CDQA 4D8MA 3O1SA 2OXBA 3WDYA 5F39A 1F4HA 1H9PA 1EUTA 1N3OA 2VVDA 4ITCA 2QBXA 4UW6A 4Z92B 4ASMB 1QH7A 5A1LA 1RINA 2FDGA 4X6RB 4YZ4A 1BHGA 1S1AA 4BWOA 3HOBA 4XUQA 4J6GA 4ZS2A 3QH7A 1SACA 2CTVA 4QPGC 1YYNA 5FZKA 5IVEA 3GBGA 2DYCA 3W5NA 2RS32 5E16A 3VKLA 1ZZBA 1S0DA 1W8NA 4NRPA 5K0UB 4O9EA 4OLLA 2FDJA 2J1RA 3UKNA 4R9BA 3ZXJA 1RTVA 2QQVA 3RFRA 4BQ1A 2J42A 3THTA 2OKXA 4D6SA 1FOD3 3I59B 1ND2C 3MI8A 1RUC3 3JB8A 2PHDA 2Q0AA 4OI1A 4K1YA 4L99A 2Y34A 3RZKA 3O12A 4COUA 5BNOB 2O1QA 2K2SA 1NXD1 1FX5A 4FPKA 1Q8VA 1YJLA 1R092 4LO4B 3OBAA 1FYUA 1O3QA 2R043 4OYUA 3UJQA 4ZU7A 1WD3A 1UMHA 4RGAA 1KS5A 2RDRA 2ZZQA 3IB3A 1PZ7A 5GM0A 3KT7A 1SCRA 4QQLA 1UX6A 2HLEA 3M3CA 1HN1A 2A6ZA 3SHRA 1W6MA 3ZXFA 3BN6A 3KQ4B 5CVRA 5GLWA 4UF0B 2D44A 2D6PA 1ZM1A 2OZ6A 4AEDC 1ZBE1 3KSCA 4P08A 2WNVB 4AVBA 2DVGA 3NJVA 3UL2A 3W20A 3T0BA 1UCXA 3MIGA 5FXZA 1YO8A 5AC91 2XPJA 5G05L 5I0DA 2ZAHA 5DDJ2 1TME1 3HQUA 3FUOA 3LA7A 1DQ1A 3ACGA 5C7GA 1RUH1 1HLCA 1IKQA 2JG9A 3S7EA 5JPNB 2OW4A 3LEMA 1G8WA 4XOGA 3PVNA 1LTEA 3AL5A 1Q43A 3ZYFA 4NIGA 3M70A 1CAVB 4JGYA 5JI7A 2VVEA 3DF0A 3I2KA 4UW5A 3AVRA 5KHHA 3JUUA 4YVWB 3H9AA 4A42A 1G9FA 2YV8A 1PVC1 4IGPA 4YARA 4KWUA 5CB7A 4BDVB 3TN92 4ET7A 4DEQA 5C71A 3ZSMA 2UWCA 4I30A 2CWMA 3OOXA 1CAXA 1KJRA 5HXMA 1AYM3 3AYAA 4IEYA 5IUQA 1ENXA 3U10A 4Q4X1 3K75B 2DUQA 3ZFGB 3NJXA 2W91A 1GSLA 4QGMA 1UOFA 1Y9QA 4OI2A 1QOTA 2ARXA 2JDPA 5DAPA 4KU8A 3LA3A 4LIUA 3GALA 1OOPB 4MGZE 4EZHA 3ZXGA 4XC9A 4YW4A 4GZ9A 5KXCA 4AYUA 1H6YA 1VRBA 1ZBA1 1NYWA 2B46X 2WNUB 3C7OA 2P2KA 4Q0PA 4Q4V2 3C2UA 5CFCA 3WXPA 1WW4A 2VTXJ 2XGXA 4BM8A 4FOYA 1W0NA 5C8CC 3NNMA 4QDSA 2YPDA 2WZR1 3B94A 1NCRC 4AK3A 5H9QA 4FPEA 5FZ6A 1DYKA 2QQJA 3FN9A 3T4VA 2E9QA 2PHXA 3AZYA 1LHVA 4ES9A 2K9ZA 1POQA 1WLWA 3NRUA 3ZO0B 2FDHA 1UF2C 4XFCA 3DXTA 5FV3A 3OGGA 1FI2A 2V4AA 2CGOA 4BK5A 1CIWA 5D8AC 3R0RA 3SKJE 1N1YA 4IV3A 1C5IA 2RS33 1JU4A 4MVTA 3PUHA 3TYJA 3ON7A 5FZ7A 5A6XA 2ZAAA 4PBPA 1Y9GA 2J22A 4Y1YA 2XUMA 3WNOA 4C8DA 4EN8B 4FPOB 4EN7B 4XJ8A 2JICA 3LPGA 2XL9A 1RUD2 4YNIA 5FJHA 2UU8A 4EQVA 1AYN1 2PELA 3HN1A 1VBD1 4QKFA 4AAXA 2VCCA 4Y1UA 1ZYBA 1E5RA 1YFUA 1W6OA 2E26A 2XG3A 4I2OA 5AVPA 4RHV1 1LU1A 1AX1A 1SG3A 1R093 3NW4A 1HRV1 2ZX0A 5A32A 4LE4A 4QQPA 4CP1A 5JOWA 4XQWA 1GFF2 4P9LA 1F8VA 5I8SA 1KQRA 1W05A 4PDWC 4HG6B 3O1RA 1GBGA 4XQ4A 1GU3A 2OYZA 3SH3A 3USSA 4CP9A 5BNOC 4QHOA 5T5PA 1Q3EA 2VC9A 3VN4A 2B39A 4XFGA 1RYYA 2ZHMA 3M2MA 1B09A 4J1WA 5LA1A 1CAWB 5DDJ3 3ZMOA 4LKEA 1XNTA 4CP0A 5GZCA 2WZEA 3WNNA 4MGKE 2VMFA 4X6QB 1DQ0A 3VD5A 1A8MA 1MS4A 1RUI2 3SNMA 4QD2A 1OI6A 2MPFA 1OFNA 2Q1FA 5HCAA 1KDMA 4UAPA 1LOAA 4GMP1 3TRSB 4DXTA 5L73A 2GP3A 1AL22 4CCOA 4EN0A 2VH9A 5FYSA 4YW5A 3TN93 2ET1A 1ENSA 1ZRIA 4S2GA 3PURA 5C9AA 3VZMA 2RJLA 1O6UA 3RGBA 2XJRA 3P5BA 5F1RA 3ZYRA 1XNCA 2IXIA 3ILFA 2B9UA 2YGLA 3LFIA 4NUBA 4BQ5A 1D4M1 2GAUA 1W6PB 5LZ6A 5DPNA 1GNYA 1ZRRA 2DURA 2VMDA 4LO7A 2ZX3A 3OBRA 4LQRA 5FYUA 2XHKA 4YVWC 2D93A 1GZTA 2A6YA 1EAH3 1LECA 3C8XA
chains in the Genus database with same CATH topology
5EYYA 3KMHA 1RUNA 4YFZA 1DZQA 2C0ZA 4Q4V3 2LUWA 3M8LA 2JEMA 1X8MA 3ZFGC 4CDXA 1WLDA 1HXS3 5FMOL 1LOFA 1YLLA 1UMZA 3U4XA 4EJRA 4KU7A 2XBO2 1OOPC 1C1LA 1LKNA 1H1MA 1JUIA 3VBRC 3EHKA 1Y7BA 4LHKA 1MZ5A 3AZZA 4PJYA 2SLIA 4XYXA 5LEKA 1BK1A 3AFGA 5K7PA 1RUD3 1FMD2 1LULA 2JDZA 2PA7A 3NO8A 1S0CA 4XTPA 2A3WA 4IEVA 5IK5A 1GNZA 4WM7B 4DS0A 2YHJA 3JBG2 3ME2A 4HFSA 3BCWA 3WT3A 4AVCA 2BQPA 3AP4A 5JDBA 4E9KA 3VBHB 1IKPA 2QCSB 3RJRA 1DHKB 2NQYA 4QQHA 1AR61 3TNPB 4QPIB 2XJUA 3NAPC 4NWVA 2ET7A 2XWBB 1BEV1 1AZDA 4N43A 5GLVA 5JOYA 1AXKA 3FBYA 4PQ9A 4B8EA 1ZRCA 2GU9A 4HBNA 1QHDA 1H2NA 1V9U1 4PCRA 1MQTA 3VZNA 3WVJA 1NA1A 1GANA 1LESA 3VHNA 3DKWA 3AK0A 2PHTA 3WNXA 1CAUB 1RUI3 3V0AB 3RYRA 3ETQA 2ZCWA 4Q0SA 1VBE1 4Z82A 1CVNA 1AL23 2UWAA 1PGSA 2HWF2 3EO6A 1PK6B 4XHXA 1OLRA 2ZX2A 2DVAA 5J7MA 1IZ3A 4I3PA 5IT6A 4NN0A 5B2GB 3AKTA 2RS53 4AI3A 3CJXA 4BIFA 3ZIWA 2WT2A 1SQ4A 2JD4A 4MH0E 1ASJ2 1RIRA 3OTFA 3SMHA 4OHXA 3WG1A 4WVVA 2Y38A 2D7FA 3D8CA 1K5MA 3NWKA 1MZ6A 4UXAA 1COV1 3MLJA 1QJX1 1BZWA 1HDKA 4DY5A 2GH2A 4QHBA 1RJ7A 1VAVA 3TB0A 2XBO3 3E6DA 3I4IA 3R05A 5I91A 2PHLA 4PLMA 3QOPA 4COVA 1O3TA 3T2TA 4YVSA 4XILA 1R082 3ZN6A 3RPQA 3RDIA 1UIKA 5CIRA 2WKKA 4I09A 3RZZA 2HWE1 2ZGTA 1U5YA 3KGZA 3G6JB 4BYYA 3FLPA 2X5IB 5FLIA 5FDBA 3VL9A 3JBG3 4AVSA 1O4ZA 4I01A 1CGPA 4XMIA 3CNAA 1WMEA 4MXVA 1BJQA 1X50A 4XFBA 1IQAA 1RUC1 2ENRA 2CWSA 4DQAA 5A3MA 1G9BA 2BWAA 2FHRA 4CDWB 3PNAA 3QD6A 3AMHA 2DCYA 1UZZA 1VRH3 3GZAA 3HT2A 3ZX7A 1KDKA 4IV1B 1AXZA 1SBDA 2R041 2ZX1A 3IM0A 2XJQA 1MVQA 3J9SA 1Z78A 2VQAA 4FPHA 4F7ZA 1L3JA 2JE9A 1MEC2 1SFYA 2OA2A 1LHUA 4W6XA 5FQ0A 1SLIA 4COYA 1REEA 3ZFFA 4MX3A 1I5ZA 1PZ8A 1H8TB 2HWB2 2HWF3 4GH4B 2EAAA 2CYFA 3IIAA 1KD7A 1IOAA 4CEWC 1GV9A 1HV0A 4LULA 4YGDA 1HRI2 5C6CA 4YG3A 5JVVA 1PO13 4L97A 4AEJA 4JRLA 1RMU1 1KFUL 2RMU2 5GZEA 3WP5A 4GWNA 2WFPA 1YCIA 2YUEA 1UKRA 4RL7A 1F9KA 3CJIB 3PMSA 1EPZA 2Q1MA 4HL0A 2HWD1 5CFDC 3ALQA 1V6JA 4XF0A 4FQZA 1NXMA 2FMYA 3JCIA 1JH5A 2WJSA 5L7OA 3WY6A 4KG8A 4Y22A 3U0ZA 3E5UA 4Y5Z0 1OKQA 4EWDA 3TWIA 4A2UA 2XKOA 3OY8A 3SH4A 1RUG1 2BNNA 2I07B 3AMNA 3VBFB 5JZGB 4MXWA 1LODA 5CNAA 3V64A 5H9SA 3VZKA 2A73B 3I54A 5FREA 4C0BA 3J8F2 2ZMLA 1V00A 3HWJA 5I0TA 5SV8A 5T55A 1PVXA 1R083 1PO22 2FZ1A 2WINB 2QZ3A 1C1FA 3AJYA 4Q29A 4QMAA 3RRDA 2H6BA 2R16A 3WHUA 3JD72 1OHFA 3VLBB 4NWWA 1ULFA 2JECA 4M3CA 5C33A 3D6EA 5BNNC 3WCSA 1O5LA 1RVF3 4JTNA 1E57A 4FO9A 2WS92 3O0WA 1WBFA 4ATEA 2Z2SB 4KL1A 2TBVA 1GNHA 1PIV3 1GKBA 2NPIA 1I1EA 1LOCA 5C8WA 1H8VA 4XJZA 3QH6A 1VJ2A 3VZLA 1R091 1TE1B 1RGSA 4CDQB 4QX5A 3AYCA 4PF5A 4LBQA 3LSEA 2AH2A 3MW4A 1FPN2 1MEC3 4WV8A 2HYKA 1V6OA 2I2SA 4RS5A 5J96B 4X8PA 2A6VA 4CDWC 4FCAA 3I7DA 5F6LB 2IFRA 3B02A 4IV1C 2HWB3 3BOWA 4IETA 1VBA1 3KLSA 1JOJA 2PHRA 5DUWA 5JIAA 1YIFA 1DZRA 5KC5A 3RG0A 1H1IA 1HRI3 4WM8A 4NR1A 2E6VA 4FOQA 4JCKA 4RSUA 3AYEA 2RMU3 4FPFA 1XNBA 2DCJA 3Q9OA 1XU2A 1S55A 4G3YC 4GA9A 3TN91 4GH4C 5T5JA 1BVP1 1QY4A 1WW7A 3OJBA 5AFEA 1W6MB 4GB32 4BMEA 2XVKA 3BB6A 4M0NA 4ZU4A 2B45X 3AKSA 1DBNA 5GALA 3VZJA 2DVBA 1QQP2 1SEFA 4SLIA 5FFOC 1EAH1 4Y20A 5LRSA 4FT8A 5F5QA 2JG9B 1PZ9A 3D5OA 1DDLA 3J8F3 3MIFA 1RUF2 3I8TA 1HXS1 3H3UA 4JGYB 4D7YA 5BNPC 4GIQA 1PO23 4QQOA 3WW2A 3VL8A 5ABJA 3JZVA 1AR72 1CAXB 5JZGC 1BBT2 4AI8A 2WFF1 3VDDA 1WMDA 3NJZA 3VBOC 4YYOA 4XDQA 3APBA 2WA3A 3GHMA 2YYOA 3AZXA 3HQXA 1RUE1 3ROUA 3V65A 3H1YA 2ZA9A 3WW4A 1WD4A 3VKFC 1RHI2 2V5YA 5J09A 4TLFA 5CFCB 4B4QA 2ETEA 1OA2A 2CAUA 2K0GA 4P9XA 3KGLA 4QPGA 3UK9A 3ZYIB 1VBB1 4YLZA 3UJOA 4AF9A 1LOGA 5E89A 3GBWA 1WLTA 2Z42A 3SCHA 5BY5A 1FPN3 2VQ0A 1IS4A 2PQQA 2Y26A 4HKWA 1AHSA 3NV3A 3WDXA 2E7QA 1ND2A 4RQPA 3B00A 1MS5A 4AW7A 4BE3A 3TNQA 2O8OA 4E4DX 4IV3B 4AFDA 3VV1A 3GHNA 2W68A 1NCQA 2A75A 3POSA 4CDQC 2EXJA 3B7MA 1HQNA 5HCFA 1CJDA 1QJY3 5JOXA 2W08A 1OQ1A 1BVVA 3NVCA 2D6OX 4L2NA 2HWC2 4R4XA 1S0FA 4YFWA 1G9CA 2QJVA 2XLGA 1JUHA 4IEOA 1W6OB 4IXLA 1H9WA 1AR92 1ENRA 4D7TA 5KHKA 1LHNA 2ES3A 4Q8KA 2BPA2 4N9IA 2LALA 1RUJ2 4AEDA 5J98B 5A32B 2R0HA 1ENQA 4LBQD 1IS5A 4CDUC 1S2KA 1S0BA 1I9RA 4GMP0 4GB33 3VHPA 3M3IA 4EN6B 3LKJA 4YW2A 3HBZA 3CO2A 3BTAA 2RS51 1A6CA 4JGZC 1S0IA 1W0PA 4YW1A 1QQP3 3R4DB 4WZCA 3DPRA 1GQHA 3UV9A 3ENRA 2PLV2 5ACA1 1J1LA 1RUOA 3AP7A 2OPKA 2G9GA 2QFEA 2CL2A 2ZHLA 5EFUA 2R0FA 3H3ZA 4AQSA 2DVFA 2OUJA 4AXOA 2VULA 5A33A 1DFQA 1RUF3 2RR12 4B3NA 1X33A 1W39A 3ZVXA 3MIEA 2YZ4A 2A3YA 4EROA 1BMV1 2PHUA 2D43A 1SLCA 1AR73 5KC6A 2NYYA 3MF9A 5C9AB 1BBT3 1X82A 1ZX5A 1DGRA 2JG9C 2BBVA 3MPPG 3AP9A 3BU7A 1C8NA 3WDWA 5C8CA 1DLLA 5GZDA 2GMEA 3KT4A 1NCRA 4S2HA 2RE9A 4AG4A 1XNDA 3RNSA 2NZ9A 3FZ3A 5I8TA 5T50A 2FZ2A 1JW6A 4EN9B 1QXJA 3MIBA 2MEV2 3B5LB 4CDXB 3VKOA 2RJKA 4Q4Y2 1VR3A 4W6YA 1ZRDA 4LT5A 3AZVA 1HW5A 5J37A 2ERFA 4V1PA 3M3OA 2PAEA 1POV0 2IZWA 2P3JA 1QJU2 4QT6A 1VRH1 1GZ9A 4CEYA 4OHZA 2D98A 5LK5A 4XJ9A 4GXLA 1R1A2 2GN3A 3WG4A 4AFCA 4QPYA 2ZHNA 3O5SA 1DQ6A 1X8EA 4BZ4A 2GC2A 2HWC3 3JQXA 4TSVA 2N7GA 3VBUA 1CJPA 4PDWA 5GJ6A 3TBDA 3WLUA 2VOXA 2BEOA 4Q1PA 5K0UC 4NHLA 1DZTA 4C91A 2BNOA 1OMIA 1AR93 1WA4A 3A4UA 4IV3C 1EV12 2HWF1 3WQ1A 1RB8G 1W0OA 4L92A 2GDFA 2V73A 1J3QA 2JX9A 4E2SA 4Q8LA 1FNZA 4CZSA 1NLSA 1QNWA 4S2DA 1APNA 1WBLA 1PO11 5FLHA 4N43B 5HI0A 2CGPA 4GULA 2A7AA 1ZZ6A 3WP3A 2WQZC 2RS11 4I02A 3LOBA 1W6NA 2ZGKA 1MQTB 2VUJA 2UY9A 1NA1B 4YW3A 5LRRA 4KG0A 4ASLA 2PLV3 1OSGA 4RR3B 3V0BA 2VVFA 4IL7A 1N47A 1FT9A 2WNVC 1FV2A 4FPYA 3VBSA 2R061 2RR13 4OUSA 5KHIA 1QOOA 2DF7A 3E6CC 2ZGLA 1FAYA 3ZXAC 1NOVA 1QDOA 5CAZA 4FPLA 3BPZA 3DGTA 4PBOA 4GWMA 3SCFA 3VZOA 4C0HA 4PIYA 1QKQA 1HX6A 2WZPP 1QH6A 1REDA 4BH9A 3GF6A 3USUA 4D3WA 1D0GA 3AX4A 1AR81 1S0JA 2VECA 1TMF1 1ZZ7A 2HJIA 2EA7A 1PGW1 2DCTA 3OF1A 4LO6B 4A7KA 2QNKA 2C9AA 2VOWA 5C9AC 5AC92 3ZXEA 4Z8BA 2FQPA 1RVF1 4I0AA 5BYNA 5H9RA 5L36A 4C1XA 2MEV3 2YMZA 3OYWA 1VBC1 4FOVA 5DZEA 3M3EA 1V6KA 4KBBA 3VBRA 1K5MB 2LM3A 4RGGA 1HV1A 2Z5WA 5T52A 4Q4Y3 1Z0HA 1PIV1 2WNUC 2P37A 2P34A 2OUHA 2VW1A 3ZSEA 3N36A 4P9JA 4YM3A 4LBKA 1B35A 2JE7A 1F2NA 1PGL1 3JB4C 1R1A3 4YVSB 4CDXC 3ATGA 2H0VA 1LOFC 5GLZA 2BFUL 3ZN6B 2A6XA 1LCLA 4BLIA 3JU9A 5KBFA 4KWLA 1A3KA 2VNRA 3NAPA 4KGQA 3RJ2X 5K8SA 3D0JA 2R30A 2WL1A 4K3UA 1D2QA 5H9PA 1O3SA 1EV13 1ZBA2 4X8NA 3ZN5A 3NKGA 1NQJA 1MS9A 4M3CF 4HVOA 4FTSA 2EXHA 4LBJA 2WZR2 4ORFA 4AI0A 1H2KA 1A78A 1HRI1 1AVBA 2AZ5A 4LA3A 3URFA 3L2YA 2RMU1 4CP2A 5I0SA 4P9GA 4Q27A 5EWSA 4SBVA 3PMEA 4QM9A 4WVWA 2R49A 4Q2FA 4OHYA 5HXVA 2ATFA 3X29B 5FQ0B 5FBZA 2IXJA 3ZFFB 4Y24A 2Q30A 4L9BA 4N43C 1VBD2 1Y3TA 3AKQA 3K51A 4XBNA 2DUOA 4RHV2 5FPZA 2ZGPA 2VY0A 3SXWA 1MQTC 1YFXA 2JG8A 1NA1C 1HRV2 4RR3C 2SBAA 4Y1XA 1C28A 3HT1A 3J8F1 3MGUA 2ZS6B 1CQ9A 3WUCA 5KXBA 3WUDA 3LAGA 3IPVA 3AP6A 5E1RA 1H30A 1W2UA 1F5FA 3BODA 1MS0A 4GALA 4B4PA 5JAXA 1G9DA 2XLFA 4XMAA 4KWJA 3ZDSA 3MLKA 3WHTA 5L7OB 1UL9A 4QGLA 1V70A 2XL7A 4Y26A 4Y22B 2RHPA 4B7EA 4DNYA 1DQ2A 4Q4W2 1J1TA 4LE3A 1F31A 3OY8B 3ST7A 3MIDA 4H14A 2BTVC 2OZJA 4MXWB 4P9WA 2ZTNA 4XHBA 5C4WA 1MS1A 3RSJA 3WDTA 3IDEA 4BCUA 2A3XA 1Q56A 2ZGNA 4LLOA 2PN5A 2XKPA 1VAKA 2Q4SA 4Q0UA 3GZUC 1FMD3 1H0BA 2JXAA 4Q26A 2KA3A 2P17A 1PM7A 1ND3A 5AVAA 2VGDA 1AF9A 4H7MA 2CNAA 4Z2WA 1D4M2 1CPMA 2GALA 3LA2A 3N7KA 1VLNA 3O14A 4AQTA 1UAIA 4AVAA 2Z79A 2BYVE 1LRHA 2FBEA 1JN2P 3WDUA 1J58A 3J4UH 3SITA 2MNGA 3MIHA 4M3CB 4LBOA 5LEJA 3IDCB 2D40A 1FOD1 4JV4A 1J3PA 1XRUA 2IFWA 3WP4A 1ZBA3 2D5HA 1DYPA 4AGGA 1QJY1 2AR6A 1IHMA 2R1BA 4JDNA 2ZOEB 3ZYJB 4WM7C 1WCDJ 1TEIA 2WZR3 2ARBA 1LOEA 5JOZA 3E6BA 3VBHC 1LENA 2IXLA 3THPA 1OA3A 1A8DA 1CONA 1HIXA 4D94A 3QACA 2XLAA 3CL1A 3D0SA 4QPIC 4R52A 5FLJA 3MPBA 1VB2A 4LBQB 1DGWX 2TNFA 4RD7A 3EJKA 4WVMA 4FP2A 1RJ8A 2PAKA 1YRZA 4RS5B 1C4RA 4AWDA 2D6KA 3BALA 4O9GA 3KCXA 3FFQA 4CEWA 1VBD3 1W6QA 2MHFA 1OPMA 4LLFA 1UPSA 4META 1LHOA 2YY1A 4COWA 4RHV3 3PVOA 4UBHA 1QF3A 1HRV3 2DVDA 5KHGA 1YJKA 2BVBA 4GKYA 2W0XA 3B9IA 5CFDA 1YHFA 3PVBB 4WM8B 4OVEA 1XYNA 1N3QA 1RUF1 1ASJ3 2B5HA 3ZFEA 1PK6C 4R9CA 4WZFA 2QKDA 3RMYA 1AYM1 1AX0A 1AX2A 4U36A 3U11A 1BEV2 2OVUA 1AR71 3IBMA 4HVRA 1BBT1 3NV2A 4R4ZA 1G6NA 1SLTA 1V9U2 5KWRA 3HR9A 4XQDA 3NV4A 5EYXA 3M3QA 1X36A 3KQRA 4ISRA 4N53A 1WW6A 4XIKA 4Q4W3 2DU0A 1AXYA 3ILRA 2E51A 2Q8OA 4GMP3 1U12A 1VBE2 4Y20B 4M01A 3AKPA 5JPMB 1C57A 4BA6A 1YI7A 5BNNA 4K1ZA 5L7OC 1YUDA 4AHWA 3JQWA 2PYTA 3ZSJA 2ZX4A 2W52A 4E4ZA 1NLRA 1WMFA 2VMHA 4M00A 3S0MA 3I2DA 5ABJB 2YDEA 2GH8A 2RS31 1I6XA 3SLIA 2GNTA 4N7UA 3MDPA 1SLAA 3VDDB 2R1DA 3MFCA 2D3PA 3DN7A 3WP6A 3KZ4C 5DZFA 3E5XA 4M0HA 2X5IC 3H0OA 2HWC1 4AHYA 1JBCA 2F4PA 4LNVA 1QJX2 4HPKA 3WQ7A 2A5ZA 3GBFA 4PIZA 4TWTA 2QQPA 2DFCA 4HETA 3VKNA 4R9DA 3L9JT 3WG3A 2EF6A 4QPGB 1YFYA 1LU2A 2HEWF 3FX3A 5J48A 1V6MA 1O7FA 5FPXA 4KQ7A 1D4VB 4AHXA 3AXEA 3MFAA 4WVZA 5BUVA 1ND2B 1U5IA 4RQPB 1XYOA 4HK9A 5DDJ1 1BKZA 2HWE2 3POYA 2YPJA 1SDWA 2R072 5KXDA 1NCQB 2ZGRA 2X8KA 1NY72 3M4FA 4GQ7A 4U2AA 5DUUA 2CAVA 1NE6A 1POV3 3R4UA 3KS7A 4XETA 1Z7S2 3K48A 2WC2A 1SBEA 1ULEA 4RS5C 3AB0A 1H8TC 4FVVA 1UN1A 2XJPA 4FP3A 3RI8A 4N90A 3G7DA 2HEVF 4AEDB 2VW2A 1WUVA 4R9AA 3ILNA 1SLBA 3PLQA 2VUAA 1GZWA 1EPWA 4LHLA 2R042 3N7LA 3NV1A 1AJKA 1V9U3 2E7TA 5BNQA 3CLPA 2KM2A 4WM8C 2GC1A 3CJIC 3M7AA 1GYKA 4KNCA 4Q4V1 3ZSKA 5BNPA 3KB5A 5CG8A 1WGPA 3DPRB 1IS6A 2ZGOA 1VBE3 4P9IA 5DZGA 3ZYPA 2R32A 5JSRA 3HIFA 2ZACA 2P3KA 2VPVA 3IKWA 3LB9A 5A33B 3S7IA 3JD73 3VBFC 3EXUA 3VBOA 1C3HA 4AI1A 4BHPA 2WT1A 4Q4Y1 5I0RA 5JIUA 1RMU2 1XE8A 2WS93 3R6SA 4LHNA 5FRAA 3MW2A 4BOWA 1AUYA 5JLVA 3LWCA 2Q5TA 5JSOA 1RUD1 2HWD2 2H0BA 2QDRA 1XU1A 1DIWA 1O4TA 2UYBA 5KHJA 4XBLA 4H55A 4A7YA 5C8CB 3MZHA 3E97A 2QDNA 4A3XA 2ZKNA 2O8QA 4DY3A 1NCRB 1S0EA 4IERA 5GLUA 1RUG2 4RA0A 3IMNA 1VP6A 2KXLA 4G4FA 4DZGA 4HZFA 2HKXA 1ZZCA 3WW3A 3V56A 3ZN4A 2AUYA 3LGRA 3AFKA 5EZWA 4K8FA 2DWRA 4XJWA 3O7OA 3QLQA 4LUMA 4FPCA 3ECQA 4HT1T 4LA2A 1LHWA 1QXRA 4DB5A 1LEMA 2HWE3 4CEYB 1OA4A 2XVGA 2R073 3GYDA 4AEMA 3ZYGA 2XVLA 4WBBA 1RUI1 2GN7A 5KXEA 2DU1A 2GC0A 2I74A 5FO7B 4YZ5A 1Z7S3 3VBUB 4CDUA 3ZIXA 1AL21 3VUOA 1ULCA 4PDWB 4DRVA 1WW5A 5A3LA 4GKXA 4N9HA 3GNEA 4RQPC 1GZCA 4XXAA 2PFWA 4CRQA 2O0OA 1ONAA 1NCQC 1QU0A 3B3QE 1QWRA 4P9YA 4JGZA 1OFSA 2TUNA 3QBQA 2CY6A 2WQ4A 5K9YA 3ASIA 5DUXA 4FSJA 3N35A 3DV8A 3HMYA 4KH9A 4HSJA 2A70A 3ZSLA 1W6NB 4E27A 2G9FA 4B29A 3V0BB 4JC1A 1GLHA 1REFA 2WIIB 3OBTA 5FO8B 1VBA2 1KITA 3FBMA 3VBSB 2GNBA 2RM22 2XBO1 4NPRA 5BPXA 4YSFA 3H50A 4PLNA 3OD4A 1ALYA 5HCBA 1RMU3 3N4MA 3DPRC 4DRRA 4TZDA 1NG0A 2BNMA 4JGYC 1O3RA 4HKOA 4P5HA 1UD1A 4IESA 3LZZA 3USUB 1CN1A 2EALA 2HWD3 1FMD1 1KS4A 3AXDA 1RHI3 1M06G 2NP0A 3MEPA