4QU2A

The structure of jmjd7 with alpha-kg
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
318
structure length
318
Chain Sequence
GSMAEAALEAVRRALQEFPAAARDLNVPRVVPYLDEPPSPLCFYRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTELPQLLSDIESHVPWASESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLLHPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWYDMEYDLKYSYFQLMDTLTRATGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of JMJD7 with alpha-KG
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords JmjC domain-containing protein 7
total genus 86
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qu2A00
2Y0IA 1IZ3A 2CGOA 1H2NA 2YDEA 3D8CA 2YC0A 2CGNA 3KCYA 3KCXA 4NR1A 4Z1VA 1YCIA 2WA4A 4BIOA 4JAAA 1H2KA 1H2MA 2ILMA 2XUMA 1H2LA 4QU2A 4B7KA 1MZEA 3OD4A 1MZFA 4Z2WA 5JWPA 4B7EA 2W0XA 2WA3A 3P3NA 4AI8A 3P3PA
chains in the Genus database with same CATH superfamily
5CAZA 2VVDA 5FYVA 4CU8A 1HN0A 1J83A 2DURA 4QHBA 3VKNA 3JBG1 1O8SA 2XOMA 5LB6A 5J1XA 4XABA 2XONA 1VLNA 3OJBA 3VBFA 1XYNA 3RYRA 1JZ6A 4QPGB 4NJ4A 5DUUA 3WR0A 3I2OA 1GP6A 2W5FA 5K4LA 5LRSA 2IVJA 2PHRA 3J7HA 5EZWA 1O6UA 1GOGA 2FBEA 4PIXA 1BEV3 1WCQA 3LD8A 1VMJA 5SV8A 5EFUA 4OUMA 2XBO1 3VDAA 1VRBA 1Z7S1 2VMGA 4I30A 5C8CA 5F9TA 3PU3A 1ND3C 4D0QA 2NP0A 5JSPA 4LBMA 1HRI2 1NE6A 5FZ0A 3RI9A 2A75A 4OHXA 1ZBE2 2PMWB 3H3LA 3H7JA 4RGAA 4Y22A 4OQ9A 2CV6A 4R4XA 4PF1A 1RIRA 1N1TA 4J6GA 5FYHA 1AXZA 4MOAA 2QQIA 1A3KA 5LA2A 2FZ2A 2ZXQA 2NPIA 2DVDA 2ZA9A 1HV0A 1WMXA 2MEV2 4AR2A 5B2GB 1REFA 2ZHMA 4JDOA 1QMJA 3IIIA 3MLLA 2E51A 3GM8A 3JBG3 1AYM3 3ALQA 1OKOA 5F8PA 3H7YA 1WLTA 2PLV2 2YBKA 5GZFA 1S0JA 3CO2A 1Q5OA 2QE3A 4HN1A 4SBVA 4P02B 5JI7A 4FXGB 5FZEA 4NO4A 4E4SA 4QX3A 4B4QA 2VW0A 4QU1A 3KVAA 1LGCA 1WLWA 1H8VA 3H1MA 1GWLA 1RUC1 4YFWA 4YZ5A 3O1TA 1PO22 2GMPA 1AYN1 3VBUA 1RUH3 3E97A 1Z7S2 4XUTA 4E4DX 1P8JA 2YXSA 1UQXA 2WR9A 4Q4W1 3U10A 3OUIA 5BNPC 1VBC1 3I3BA 3WCRA 1VRH2 1VBB3 2NQYA 3X29B 2IFRA 2WFF2 2D6OX 5A33B 1W99A 2X29A 4YGDA 3HVDA 5APAA 2UYBA 5CIRA 4FPEA 4BOWA 1MPXA 4YPJA 3MIHA 4N7UA 4INDA 2RS52 4WM8A 5L9BA 3OUJA 3JBG2 3OBZA 2HWF1 2WZPP 2I07B 2YZ4A 2WWUA 3PIJA 3TB0A 5IJRA 4YZ1A 3BTXA 3NNMA 2ORZA 1H30A 1S0GA 1IS5A 1UW8A 4H14A 1DGRN 3WQBA 3T09A 4AI1A 1QJU2 1KS5A 1LRHA 1YUDA 1LOAA 2OPKA 2QQPA 4GB31 5LATA 3VD5A 3NJXA 4CDUC 4AYUA 2RMU2 5D8AB 2EIDA 3KWVA 3HAGA 3U4SA 4N90A 2F17A 1JZ7A 4Y24A 5EJZB 4YWAA 1IKPA 4Q0SA 1RUI2 4MV2A 1JYWA 4YW3A 4D6RA 4META 2PHFA 5L7OC 4PF5A 2XLGA 1VBE2 2DYCA 2GC0A 2GH8A 2LTNA 4XJ9A 4YLZA 4URAA 1QJU1 4O61A 3EJKA 1PIV1 1S4CA 4O9GA 4J1WA 1OKQA 1AL21 2XKOA 2VNRA 4Y22B 2E7TA 5BUVA 1BQPA 1RXFA 1W04A 2RS51 3MV01 3P5BA 4FFHA 3UKNA 3GBWA 1W6OA 1OMIA 2IZWA 4JGYA 4QPIB 1BHGA 3ZFGC 4BQ5A 5FPUA 3A4UA 5F7UA 3JCIA 5F3GA 1VRH1 4IETA 3ZR5A 1H6YA 2VM9A 1GFF2 1IS6A 4BXFA 1PK6B 1H4HA 4V2VA 2VBPA 4CDUB 3IPVB 1QY4A 4Y26A 1W8HA 3WDVA 1SFPA 1T6GC 2VMEA 3VLBB 1JU4A 1X33A 4NOTA 1FMD3 1LHWA 2OX0A 3ZYGA 5LBBA 3I3QA 2Z4FA 5CYYA 5FMBA 3WG4A 3LF7A 1OVSA 1JYVA 1RMU3 1LU2A 1NYWA 2NM1A 2DWRA 2VQTA 3AMPA 3KV9A 4IV3A 2VE1A 1XSRA 1AR91 3CEWA 1A34A 5CKQA 1F15A 3O5SA 5BNNB 3VBSB 5GZEA 1RUG3 2B39A 2X53S 1N1VA 1RINA 1COV3 3B02A 1AR73 3ZDSA 4L2NA 1W2AX 1REDA 2VW2A 1POV3 2WO2A 4EN0A 2VMCA 3NJZA 4QKFA 1F5JA 5FREA 2NZ9A 1LOCA 1UX7A 1VRH3 4BQ4A 1M06G 1PM4A 1YQCA 2WNUA 3LFMA 5HPOA 5A80A 1HB2A 2WIIB 3SNMA 3UETA 1RUNA 4XJUA 1C5IA 1HRI1 2XHNA 2LRPA 1ULFA 4COWA 4R52A 1G9FA 4CU6A 4JTNA 1TZOA 2J1VA 4P14A 4A4AA 4B7EA 1DHKB 4M3CF 1HRV2 4TSVA 4XTMA 4MSVA 1GKBA 2EIEA 1AR61 4ZPIA 5C3SA 4OZOA 4Y1UA 2A6ZA 5FYYA 1WGPA 1ULPA 5C8CB 4LKSA 3BTYA 1N3QA 4DRVA 4N7IA 4LBQA 2FMDA 4RSUA 5FO8B 3VD9A 4CA9A 4RQPB 5EHDA 5IFTA 4OHWA 2AH2A 1WW7A 3E6DA 1XOYA 2PHWA 4FPOB 5A70A 1JHJA 5FDBA 5M0TA 4A6OA 2C26A 4FCAA 5DMYA 4JGZC 1WD3A 3MW2A 2W91A 4TLGA 5FBJA 1B35C 2WS91 3JU9A 3KHBA 2BFUS 3IDBB 1RITA 2CYFA 2R0HA 1F4AA 2VMDA 2Y6JA 2XQXA 4N8MA 3ZXEA 3ACLA 5IATA 1UIJA 1RHI2 2XGXA 2YPDA 3N9PA 4CEWC 1L7RA 1PZ7A 3BI3A 4QKBA 4K1YA 1G7YA 5JLVA 2BQPA 1UOJA 3H1WA 4RHV1 1RL3A 3R0RA 4JKLA 2CSGA 4LUMA 4XMAA 3RMXA 4AEMA 1NY72 4MXWB 4L97A 4Q4X3 1J3RA 3OGGA 4MGTA 4IEZA 2RS13 4QPYA 3RDIA 5D8AC 2ZTNA 5ANNA 1W8FA 4AAPA 1QGLA 4EYUA 3B9IA 1ENRA 1GNYA 1HV1A 1V0AA 2R062 1Q8SA 2VCAA 1NA1C 2LS6A 3OCPA 5IW0A 1XBFA 3POWA 3PL0A 5A32B 3VKMA 2W1QA 4BQXA 5A3LA 4QD2A 1JZ8A 2ZCWA 1H9PA 5DZGA 5DAQA 3ZYRA 5CFCB 1QOSA 4C1WA 4ZS3A 4C0HA 4AWDA 3O1OA 3MHZA 2IXHA 3T4HB 5L9VA 4KMQA 2OS2A 2CDPA 5FCCA 4NR1A 1CX4A 2YB7A 4YW1A 1R1A3 2BYVE 3FZ3A 2OZ6A 2Q1ZB 1XNAA 2ET1A 4XC9A 4YG3A 2XVKA 3RGBA 2XJPA 2RJKA 1NCQC 4JAAA 4LBQB 1YFYA 3ZSLA 3CU7A 1V9U3 5BNPA 4DRRA 3CJIB 5H9RA 1SLBA 3VBUC 1NCRC 4A44A 5A3UA 3LIHA 3VGIA 2C9KA 1CVNA 4XDOA 3WNPA 5IVFA 4XFBA 3WDTA 3AP9A 4CXXA 1RMU2 1AUYA 3E1F1 5JZGB 4IE4A 4DXSA 4QGLA 1DZRA 2ZGNA 4NAOA 2WN3A 3B7MA 4LITA 3HBZA 3M3CA 2WKKA 4AHZA 2FDIA 2ZX4A 5JIUA 1FPN1 3BIEA 1D4M3 1OUXA 2RG4A 5AC93 5IT6A 3MUY1 4Q0UA 3FLPA 4JDNA 4FPJA 1AX1A 2BW8A 5FR3A 5LA0A 3T0BA 2O8OA 5DG1A 2DVFA 2ZEWA 2WINB 1RYYA 3S6PA 1BVP1 1D0HA 2VBBA 2NN8A 4FFGA 4IESA 3ZXFA 1X50A 3ZMNA 4MX3A 1Y9QA 2HLEA 2GAUA 1URXA 4L9BA 3DCQA 2JENA 3PLQA 5JXJA 4GA9A 4I0BA 1O4TA 4LBNA 3V56A 1ZRFA 1DDLA 1VBD2 4UFHA 4Y3OA 4ZS2A 2DU0A 1SLCA 2HWE2 2QQWA 3PUQA 1F8VA 2PHXA 1J59A 1RHI3 4JQRA 3OSDA 4Z82A 3W5NA 4PLOA 1VB2A 2BV4A 4M0HA 5E89A 1XJAA 4KGGA 1JZ2A 5FZ8A 2DUPA 4HL0A 2D98A 2LM3A 1JHNA 4CDWA 1W6NB 5F32A 2EXIA 3A22A 1W06A 1V6IA 4BIOA 1G8WA 5I0SA 1H2MA 1LOFA 4XYXA 5GM0A 1AYM2 3N9OA 4UF0B 5HCBA 1TME3 3C7HA 4PI2A 1PNGA 2A7AA 3DPRA 3K75B 5FKBA 5IK5A 1W0OA 2MEV3 1R1ZA 4FOQA 4OFGA 4AVSA 4I2OA 1NXMA 3EMRA 2J42A 1A6CA 5FZGA 3ZSEA 4RQPA 2YFZA 1NAEA 3JQXA 3AJYA 2XUEA 1MQTB 4G9SB 1QWRA 3BTAA 3E6CC 4YW5A 3VBRB 1CZVA 3CBNA 4HSLA 4RS5C 2HWD1 4UOJA 3ZX7A 2WJSA 1VE0A 4DY3A 2YV8A 4Y33A 1JUHA 5FMCA 4Z1VA 1Z7S3 3SCGA 4CU9A 5G04L 3S30A 3O14A 1LU1A 1V6JA 3LCPA 1UXXX 1W05A 2JXAA 3H42B 3L9JT 1POQA 2D40A 1C28A 3TNPB 4S2GA 2QQJA 5JDBA 1ZZ7A 1MS0A 2Q5TA 1GQHA 3TN92 4XF0A 4C8DA 3Q8BA 4F8AA 5GLZA 4AQ2A 4JCKA 1UL9A 1UYXA 2DBIA 1UO9A 3HMYA 3POFA 4GH4C 4UW4A 4JDMA 3R4DB 4H3WA 5IVYA 3T2OA 2IVIB 2B42B 5F1RA 1WD4A 1PGSA 3H8UA 5EYXA 2A6YA 3CNAA 3SH4A 4N9HA 4KQ7A 2RE9A 4NIIA 3WOGA 5EP9A 3WXPA 4C91A 3WHUA 1NXD1 4ONUA 1O3TA 5FZAA 2EALA 2J1UA 3DL3A 5A6XA 3A0KA 4QGMA 4WVWA 2R071 4AVCA 3ZSKA 3USUB 1DQ6A 1XNKA 2BNNA 1WCSA 2Z79A 4RA0A 2UWCA 4OHZA 4CP1A 4FBFA 1EY2A 1RUD1 1UZ0A 1W3VA 4CDXC 3J8F2 4ASMB 2WNVA 4P9LA 2OYZA 2DTYA 3NJYA 3M3IA 1UZVA 3J7MA 5KXBA 2JX9A 2Y6KA 1OT5A 5C9AA 1CAWB 1XE7A 2Q8CA 4BQ3A 5A3MA 5L7OA 1W8TA 5KXCA 1O4ZA 1XRUA 3ME2A 3RZLA 2ZGRA 3UKTA 4LBLA 3VZKA 3HT2A 2PLV1 1D7PM 1ULCA 4YRDA 2D44A 1L3JA 1G9AA 1BBT1 4JGYB 4QPIA 1FAYA 3AFGA 4HXCA 4W6YA 5LASA 1OLRA 4YVSB 1I9RA 3WV6A 5ABJA 1RUH1 4FT8A 4UFIA 1XC6A 1XQNA 2TNFA 4PI0A 1Z0HA 4LEJA 4BLJA 4E2SA 1PHMA 2JD9A 3ZKUA 1RUF2 4EJRA 1BVVA 3I2FA 3ROUA 3PJYA 5A6ZA 1FOD1 4XUPA 5FUNA 3N9LA 4M01A 1SBEA 1RJ7A 4NRMA 5FP9A 3FJSA 4CUCA 1ND2C 4PT6A 2GNTA 3D0JA 3BU0A 4XIOA 4YGBA 4DMIA 1MZ5A 2FCTA 1WCUA 2EXHA 4R4ZA 5G05L 1PNFA 2YYOA 1DYOA 4NPMA 4S2FA 2Q1FA 2WYFA 2VMIA 2RS53 4JV4A 3V0AA 1SCSA 4GB33 3THTA 1CAUA 4NROA 3RRDA 1PO13 1WLCA 1S0DA 4LHKA 2I2SA 1C1LA 1ENXA 1WKYA 3PTYA 2ZX3A 2BPA2 1EV12 2HEVF 3ZO0B 4AEDC 4FO9A 4Y20A 2VOVA 2ZAAA 4LIVA 1NY71 5FYZA 4ASLA 4K40A 2R6QA 3RWKX 3B93A 2VC9A 5FYIA 3AVRA 3SISA 4GMP1 1AL23 1AR81 1GOHA 1ZREA 4CSWA 4AFBA 2QQMA 2JG8C 4HONA 3N7MA 3Q8CA 4FAHA 4AF9A 5JAXA 2XL7A 3C8XA 3PHMA 1CAXB 3EHKA 2W68A 2ZGUA 4RS5B 1UCXA 4GULA 1OLMA 4W6WA 5FP4A 5T55A 1GZWA 1PX4A 4JC1A 4PQQA 2WO3A 5JXGA 4BK4A 4ZU5A 3K2OA 1RUG1 1V70A 2BOJA 2O1QA 3E5QA 3QD6A 5T5JA 2B9UA 3UGHA 4CEYA 5LK7B 4Z2AA 4DUWA 5ACA2 4J1XA 4QAWA 2VNVA 3VBHC 2HKXA 2GMEA 1PVC1 2RVAA 1PO11 2Y0IA 2YU1A 5C5TA 3R05A 3PDQA 4V1PA 1K45A 4Q4W3 1OBNA 2EIBA 2HWC1 2W95A 4XDPA 1DQ2A 5EIYB 3BIWE 4ARYA 4Y4YA 3AB0A 3H8OA 4LNVA 2YGLA 5FO7B 2DFCA 4IV1A 3LPFA 1PMIA 5F5CA 4OYUA 1HRI3 3IM0A 2VL4A 3HJRA 1S0EA 2VW1A 4GMP3 4XXPA 3TRSB 1C4RA 2V5YA 1MEC2 2JJ6A 2R30A 1S55A 2VVEA 5JUVA 3J7LA 4CCJA 1MEC3 4E27A 1TE1B 4QDSA 1FPN2 1DCSA 4M3CA 2GU9A 2HBUA 2W1UA 2X5IC 4E8DA 1GLHA 3HOBA 3M8LA 4RGKA 2AEYA 2O8QA 4DXZA 4DXRA 3LQCA 2C4XA 3GJAA 3MPPG 4CTEA 4EN6B 5JOZA 4P5HA 4YG0A 5FZ4A 3B5LB 2FCUA 1C3HA 3I3DA 3V64A 2VR4A 1WBFA 1OUSA 4IE0A 4QT6A 4MZUA 5K7PA 2QJVA 2RM23 1W8NA 2QUOA 2VAUA 2ZHNA 4CCEA 1OLQA 1QU0A 5L73A 2V72A 3C2UA 3ZIWA 2WNUC 2BWCA 3S5AA 1DGRA 2WNUB 3AKRA 3JD71 2BP6A 1YI9A 5KR7A 3FHQA 1CAXA 4NVPA 5F3EA 4I0AA 4EZHA 3KB5A 1ASJ2 2VZSA 4C0BA 2XBO2 1J3PA 3GZAA 1MEC1 3I7DA 3MO4A 4YM1A 4LPLA 1UU5A 1US3A 3K77A 3MW4A 3HT1A 4R9CA 2HEWF 2A73B 5KXDA 3UV9A 2ZMKA 2XJRA 2R061 3OY8A 1IPKA 1SLLA 2ZGPA 2P4EA 2BFUL 1O59A 3ZM8A 1HB4A 2Y8KA 1RUOA 2WC2A 3H0OA 2YROA 4QQLA 4RFT0 2WO1A 4DOUA 4UW3A 3I49A 2YBPA 3I3EA 4I01A 3IMNA 3T3YA 3T08A 5FXVA 4URTA 1MZEA 4AVBA 1OA4A 2PELA 5GKAC 5JWPA 2RJ2A 4AAXA 5HCHA 4QX8A 2JB4A 3IN9A 4MH0E 2W47A 1HJFA 2JICA 3AMQA 4I0WB 5FBZA 4CE8A 2YC4A 5GZCA 1EUUA 5H9PA 2H0VA 5JSRA 3J7NA 3B69A 4RD7A 4LO7A 5J96B 4DS0A 4XMIA 4D69A 4DY5A 3NJVA 2GC2A 2ORXA 4ES9A 3T1MA 1FV3A 3A7QA 5C9AC 1CZSA 5JI9A 4HSJA 5FIXA 5JXIA 4YVWC 4JKKA 1UOGA 2D7FA 1YQ8A 2PN5A 4IW3A 2EICA 3TOJA 4ZHNA 3DXUA 2R32A 1YEWA 4M4PA 2C5DA 1CJPA 2Y6HA 1NA1B 2AREA 2RR13 1YIPA 3TBDA 4YGCA 3VDDB 5FOBB 2GNBA 2DCJA 3HQRA 5LK5A 1OH3A 4K8RB 2D6MA 2B7YA 1DQ1A 4QQOA 1XNTA 4B1LA 2JDKA 2XMLA 4AFAA 2DVBA 4MHUA 5A3TA 4A7KA 3DXTA 3KCYA 3VZJA 2P3JA 4O9EA 5CFCA 4KBZA 5DDJ3 3AZWA 3KCCA 4FQ4A 3WP3A 4YM2A 5F2SA 4A7ZA 4MGYE 1DYPA 2WA4A 4CPBD 3VBRC 4CCLA 4DQAA 4QMAA 2VUJA 4MYEA 2RMU3 1QXRA 4MADA 3CKHA 3S5QA 2FDKA 2XJQA 4EZ4A 3B94A 5HCAA 5H9SA 5DABA 2W1SA 3ES4A 5LBEA 1WUVA 2XPJA 5CISA 2F4LA 3PVOA 3SITA 2B4KA 1WZXA 5T5PA 2OKXA 1S0IA 1SG3A 1UMZA 1OQ1A 2P3IA 5DUWA 5BNOA 2N7GA 2FDFA 5IWFA 1Y3TA 2WAOA 2UYAA 1AR92 3KT1A 3LDRA 3KCXA 4BYYA 1JXNA 2OVUA 1W39A 3CJXA 2Y0OA 3LWCA 4AEDA 4NAMA 2ARAA 2BGOA 3OD0A 1W6MB 1KQRA 1VBD3 4WVZA 4XFGA 1Y43B 3HR9A 2J7MA 2EAKA 1Q8PA 1QQP2 5B4XA 4XQ4A 3MBWA 1G9DA 1DP0A 2VZTA 5JMOA 4NRQA 4S2DA 2BGPA 2WZEA 1R082 4R9BA 2WL1A 4XEZA 5FY5A 3VN4A 4QQPA 3QLQA 4BQYA 5A3NA 2A1XA 2HEYF 3VV1A 1HX6A 4QPGA 3M3EA 1O3SA 4M4RA 3JZVA 3O0WA 4XIKA 1RUE3 4D7YA 4A45A 2BDRA 3N9MA 1WMEA 3ZYBA 5KHKA 1AJKA 4CDXB 2VZPA 4KWLA 5CVRA 1KD7A 4MXWA 2HH9A 2VOWA 1L7QA 3GHMA 4MLOA 4DNYA 2W46A 5AC91 1RC6A 3SEEA 5HV4A 1K3IA 3HN3A 5FPLA 1MR5A 2WWJA 1RUI1 2JE7A 2WQZC 3IAQA 1OC1A 3KQ4B 2QTWB 1CAWA 2WZR1 4XFFA 5BNQA 1MZ6A 2Z69A 1H1IA 4FSJA 1WCDJ 3HPNA 1SACA 3OGRA 4JGYC 4L92A 1W6QA 1D2SA 1SFNA 2VTFA 2XVGA 2P3KA 2XDVA 4FTBA 4PDWB 3BODA 4D94A 3POSA 2VZOA 1YC61 4QPWA 4CCDA 4CEWB 3TNQA 5C3PA 5IK7A 1NG0A 3DYMA 2GC3A 3KV6A 1IG0A 4B29A 3HD8B 5KHJA 2MPFA 3OD4A 1FMD2 1OXCA 3QH7A 3AZZA 4AFCA 1C1FA 2Y6FA 1DQ0A 2K9ZA 2YU2A 3N36A 5F6KA 3JB4C 3RMYA 3WNXA 5FP7A 3WF4A 3CF6E 4PBOA 1G9BA 1RUC2 3ST7A 2TUNA 3AZXA 1UYZA 2C1FA 2GZWA 4FAGA 5CADA 1XU1A 2WZR3 3KVBA 5EJ3A 3K4ZA 1UY3A 4M0NA 1YFXA 3RYPA 4Z92B 3D6EA 4QQHA 5A7QA 3V0AB 1O5LA 4AOCA 4AEDB 3O1PA 1CAUB 2QQKA 3DN7A 5AVAA 1CPMA 3NKGA 1RUD3 3BTZA 1O7FA 1XYPA 4A6SA 4AE2A 4GAZA 3L2HA 1KITA 3ELNA 2QQOA 2JG9A 4CP2A 1LAJA 1ND3B 4FPLA 2XQRA 1DGLA 2G9ZA 3HWJA 4NHLA 3VUOA 1CONA 2VUDA 1UPSA 4AW7A 2Y26A 4FPKA 5HCFA 5HBAA 3MIBA 3HNMA 1V00A 5C33A 1SZBA 1JZ3A 4PIYA 4GWJA 1OLME 1JODA 1HLCA 4Q0VA 4KBBA 4OI0A 1IS3A 3FX3A 2DVGA 1H8TA 4XAAA 4AL9A 2WNEA 4YM3A 5KHGA 4AQTA 3DV8A 2D5HA 3MIDA 4EV0A 1CGPA 2VBDA 4XPVA 3JUUA 3RNSA 1VBB2 4W50A 4LORA 2RS12 3NVCA 4HK8A 4Q4X2 2HWC2 3MIEA 4FQZA 1WCKA 3D5OA 1JH5A 2RDQA 5AFBA 2WYSA 1LEDA 4RR3B 2IXCA 3N9NA 4YW6A 5T5LA 3RZZA 5FO9B 5FP8A 1JZ4A 1MQTA 1YXWA 2G1MA 1PVC2 2BWAA 3LSDA 3NQHA 3QOPA 1X36A 5FJHA 4H7LA 4LIUA 4WM7B 2PHUA 3LIGA 1XU2A 2XH6A 3CMGA 3D82A 3LAGA 4HKLA 4XBNA 3PJQA 3SMHA 3W9AA 1F5FA 2VZVA 3E5XA 1N47A 1POV0 3BALA 1UKRA 5DUVA 4AG4A 3T2QA 2VQ0A 2ETEA 4JHTA 5FFOC 2FHRA 2WBKA 1H6XA 1HW5A 2D5FA 4LOTA 4Q5OA 1GWMA 3GYDA 4OI2A 2XJVA 4XFIA 1VMHA 2G19A 1AR72 5LY1A 1NZCA 1OH4A 5FYCA 4FTEA 1W2UA 1G6NA 1AZDA 1CJDA 3CLPA 4A3XA 2WQ4A 1SLTA 3H3ZA 2FDJA 1ZRRA 3VDCA 1WLDA 3WINE 2JDZA 3IBMA 2GNDA 4AGVA 3MLKA 3IZOA 1RVF1 4XBLA 1JTZX 3GGLA 3IWZA 3LE0A 1LENA 5FK8A 1HRV3 4HK9A 1WWYA 2IFWA 1SHWB 5FKCA 4XUQA 3PVBB 5FZ6A 3WNMA 2E7AA 4LHLA 1NOVA 5LCWL 1Y9GA 3V0BB 1BZWA 2W3JA 4GD4A 5A7OA 1H2KA 3SH5A 4LLOA 1E57A 1UZYA 2GSYA 2XUMA 3SH3A 2VO5A 1W0PA 4YYOA 3MFAA 4WM8C 3SC7X 2ZZQA 2YUEA 3WF1A 3FBMA 2QZ3A 2HWC3 4RQPC 5BNNC 2A70A 4PCRA 1CQ9A 1UXZA 2ZPXA 3I2IA 3POGA 3R4UA 5E88A 3O1SA 3WY6A 1NZIA 4CEYB 4DXTA 1YFWA 4ASKA 2GP5A 4RGGA 1VP6A 2AUYA 2YY1A 4DB5A 5KBFA 3GBGA 2IC1A 3FBYA 4WM7A 1E5HA 1AR83 1W2OA 3KSCA 3NV2A 3VBRA 2P1BA 3WQ7A 1ND2A 5GZGA 4CCKA 1ULDA 2ZMLA 3VZOA 1R64A 5CFDB 2JECA 2O14A 4BK5A 1MZFA 3PMEA 2ZEYA 4QKNA 3OGJA 4FFIA 3FFZA 4A42A 1DLLA 1JOPA 3AL6A 2Y64A 4WVMB 4ZKTB 1CPNA 1LESA 1WW5A 1IZ3A 3VBSA 1UZWA 1CN1A 1DGWA 2W92A 2D3PA 5JOYA 3VDBA 2FQPA 2Y38A 5SV5A 2PAMA 1UN1A 3W5MA 1H8TC 4YVWA 4R9AA 5A6YA 5KXEA 4K8FA 5FOJB 1JMUB 3KF3A 1TMF2 4Y4RA 5LBFA 1H1MA 2V4VA 2G9FA 2WO7A 4FVVA 4RYDA 3ZIXA 2W39A 1IS4A 2JDPA 1HDKA 2VGDA 3NO8A 4MHRA 2AACA 1XNBA 1PO23 2ARCA 3WSOA 3VZLA 4CDXA 1EUTA 4D7SA 4DO0A 1NUKA 2FCVA 2R063 1S2KA 3AL5A 4IE5A 4RN5A 2VTXA 1C8M3 2JIGA 1JYCA 2ZKLA 4ZXKA 5I0UA 4CCMA 2FZ1A 4N53C 3RQ0A 2VOXA 3CZJA 4LJHA 4F7ZA 5FZKA 4CP9B 4CU7A 2BBVA 3M4FA 4XACA 4P9XA 2JG9C 4I3GA 2A6WA 4LBOA 1BK0A 1CAVB 4MGQA 3LDKA 2IWGB 4QX7A 2EXJA 1BXHA 3LEKA 5GLUA 5I91A 3GJBA 1LHNA 4JRAA 4C1XA 2OW4A 5EJ1B 4LQRA 1YNAA 2GC1A 4G4FA 3SCFA 5JOXA 3KGLA 1GZWB 3AK0A 1VBA3 3DKQA 3DKWA 4CP0A 2VY0A 1Q8OA 2JIJA 1HXS2 3RZKA 1RTVA 4BB3A 4YARA 1SMVA 3TYJA 4WZFA 1J3QA 4XCAA 1VBA2 1FXZA 2JDHA 1PIV2 1K5JA 5FPBA 1CESA 5CU1A 4BLIA 5CBLA 3NW4A 4GWNA 4DIQA 3I8TA 1UX6A 4Q0PA 1SPPA 1A8DA 3NV3A 3LGRA 1OPMA 5T3NA 1UIKA 2YC0A 1ZZ8A 1L7LA 3WW1A 1RUE2 4XF4A 2UWAA 1WW4A 3IIAA 5FZHA 2AC1A 2JE9A 2VOKA 1NCRB 5FY9A 3O1MA 4XW3A 3WNLA 1YO8A 1MS1A 2Y6GA 3MF9A 1LOEA 4BJ0A 5KWRA 4EWEA 1VR3A 3MDPA 2PAKA 1JYTA 1A78A 2FDHA 1VBA1 3THDA 1PGW2 1BBT2 3O12A 4GKXA 4UBGA 1KJLA 5DPNA 3PUSA 1RVF2 5KHIA 2RR12 1RGSA 1US2A 1UOFA 2HWD2 4UBHA 4YSFA 5CFCC 4PIZA 2J1RA 4XUOA 3Q9OA 1GICA 3POBA 2VG9A 5EWSA 4X6QB 2ATFA 2ARBA 3MV11 1X9TA 4UI9L 5ANQA 3CDZB 4AFMA 1COV2 3C7FA 1H2LA 3WDYA 4HFSA 3UJQA 4IXLA 1AX2A 1HQLA 4JRLA 1NLRA 1LR5A 2JWPA 3GZEA 5BNPB 3ZXKA 4NIHA 4E9KA 3AZYA 4JKMA 2BVVA 2YMZA 1HQNA 1QH6A 1RMU1 1KXGA 3IDAA 2OT7A 3DGTA 1J58A 2EVXA 4UF0A 1JI6A 1SLAA 4Y5Z0 1U5YA 4OUSA 5LRRA 1QJX1 3DPRB 3VBOC 1LOGA 3ZKYA 5TSWA 2LALA 4RHV3 4TWTA 3DECA 3WD5A 4CEWA 1KS4A 3O0VA 4IL7A 4XQDA 1Q43A 1XE8A 4QM8A 2I74A 2RS11 5JR7B 1C57A 3BYWA 3RPQA 1REEA 2OQ6A 5FMOL 3WHTA 3H8XA 3KLSA 4CDUA 2O0OA 4S2HA 2XHKA 1ZBE1 3E5UA 1OPOA 3TN91 4CCNA 3Q8FA 4J25A 3T0AA 1A8MA 3KM5A 4XFAA 4XVHA 1T2XA 4NUBA 2DTWA 3RWNA 3OB8A 4H55A 1ODMA 1OD5A 4W4ZA 4Y1YA 5T5OA 3W58A 1GZTA 2W1WA 2EAAA 3P6BA 2D97A 4AZZA 4GMP0 2DCTA 3WVJA 1W28A 4UFJA 4FFFA 1RUI3 1XE0A 5C4WC 4XDQA 3N7KA 3N7LA 1FNZA 2VCCA 4FPHA 4COYA 4AXOA 4HOOA 4AHXA 3KF5A 4OCTA 1JS9A 5F3IA 4JGZB 2OPWA 1QJX3 2QQLA 3M1HA 1QXPA 3B00A 4RHV2 1UYPA 1SQ4A 1OD3A 2KD7A 2Y34A 5IVJA 1IHMA 2VUAA 2W0XA 3VKOA 1ZRDA 1GNZA 3N4MA 4LA3A 4XCBA 5FY0A 1CIYA 1NA1A 4DUVA 3P3PA 3RS6A 2Y33A 4RFRB 4IEYA 2DDUA 4OQ8A 2I45A 1LNSA 2IXKA 2JE8A 1GOFA 2VXJA 3OGVA 4Q1RA 2D3SA 1ZRIA 2WS93 3GCWA 3OBTA 5FUIA 1GSLA 3SCHA 3WZ1A 3ZYIB 4COUA 4EQVA 4HVQA 5J09A 3R4SA 1OOPA 4CZSA 5ISLA 1R083 1S2BA 2D6LX 2D93A 3EQEA 4YW7A 5I0TA 1Y9MA 1SBDA 2WNVB 2H6CA 3VBSC 3VBHB 2XXZA 1ZA7A 1VBD1 1WA4A 2XR4A 4HLTA 1ZZBA 5ABJB 3KGZA 3EBRA 1DYKA 2JDNA 3M7AA 3KD4A 5A1FA 4BHPA 2P5BA 5KC5A 4JTOA 3K3OA 2C6SA 4CXWA 3NWKA 2DU1A 3LOIA 2ES3A 1R092 4OMDA 1ZZ6A 4Q4X1 4I3PA 3RJ2X 3VHNA 2VNGA 2BU9A 3LA3A 5A7NA 3N35A 3OPWA 4QX2A 3IMMA 4KH9A 3USSA 1JN2P 1YQ2A 2VECA 2W52A 3RSJA 1ZBA2 3BN6A 3L2YA 1H0BA 4OUEA 2ZBJA 5E16A 1N3PA 3HQUA 4KGQA 4QXHA 4BDVB 2NMOA 1EAH3 4QPGC 4ZU4A 4JVAA 3D8CA 4QX0A 3BGAA 3MEPA 1AXKA 1LJ7A 1JOJA 2KA3A 2F6BA 2LROA 4FPYA 5FXWA 3VZNA 3I2HA 1NCQB 1IQDC 2WT0A 4XHBA 4XJWA 4BMEA 3SKVA 3ZFEA 1BK1A 1OHFA 1XYOA 3CJIC 4LKEA 3FLTA 3PVNA 4Y1ZA 3ZN6A 1WMDA 1ULGA 4D8MA 2QCSB 2QNKA 3WX5A 4GWIA 4CCCA 2ZACA 2B9VA 3UYJA 5JIAA 3S57A 3U4XA 4W8JA 4YW2A 1UU6A 2AYHA 2CWSA 3WF0A 4COVA 4C90A 4LK6A 4LR4A 2DCKA 1TME2 4LTAA 1LKNA 2P6CA 3ECQA 4FPFA 4GKYA 2K46A 4BPZA 3U1XA 2ERFA 1B35B 4AEKA 1IOAA 3MPBA 3NV4A 1HXS3 4MGIE 4PLNA 5D1IA 3MIGA 4OI4A 1SLIA 5LEKA 4Q4W2 4E4ZA 2TBVA 4RS5A 1OF3A 4B4RA 4IERA 3HNBM 2HWE3 4DUXA 2ZX1A 3GF6A 4I09A 1NKGA 2A6XA 4Q29A 1FI2A 1I5PA 3ZYFA 3UT0A 4ISRA 2P34A 4GIQA 4YVSC 1U5XA 3FN9A 3MYXA 1HQWA 2ZHKA 1LB2A 4P9YA 1O4YA 2VTXJ 5DN2A 1WW6A 4O65A 3KT7A 5AFEA 1DGWX 5GJ6A 4K7JA 1CX1A 3NAPA 2R072 5L19A 3IT8A 3ZFFA 4JHZA 5E1RA 3I2KA 2P2KA 3CJIA 3I54A 5J7MA 5CG8A 5IVVA 3N3HA 1ACCA 2X05A 4Q26A 1QJFA 3UESA 2BERA 1OVPA 2SLIA 1UZZA 4E2GA 5FPVA 2J1EA 3BKZA 3WP5A 1D4M2 5JVVA 4XBQA 2HWB2 3K4DA 3CZUA 3OBRA 2ZGSA 3H1YA 5FV3A 4K20A 4P9WA 4QU2A 3RZHA 3AC0A 3LEGA 2RS32 3ZXAC 3ZFGB 3O1UA 4Z07A 1TQ5A 5F6LB 4NN0A 2W2IA 1MQTC 1V6NA 1LOBA 1W6MA 4HVOA 4K3UA 1LHOA 4GB32 2WRAA 3BCWA 4LO8A 4QB1A 4CEYC 1ENSA 5CG9A 5F5AA 1UPIA 3I2DA 3A21A 3AXEA 4YVWB 2P6HA 3WW4A 1W8ZA 2CNAA 5LW9A 1UMHA 2IUWA 1U5IA 4P08A 4A3ZA 5J36A 1EPWA 4H2AA 4IV3B 3I2GA 5C3QA 2R042 3ABZA 3PUAA 5DQ0A 2A5ZA 1LHUA 3IKWA 4Z8BA 4IGOA 1O8PA 2CY6A 2ET7A 2HWD3 4AHYA 4F3JA 5F37A 3POEA 2HBTA 5JXHA 3WNKA 1MS5A 5HXVA 4UFLA 4IQPA 1TNFA 5IAVA 1BBT3 2LW8A 1YLLA 3QBQA 1PGL2 4DFSA 3USUA 1AVBA 1D2QA 1GQGA 2WT1A 3GZUC 1VBE1 5IHRA 2VH9A 5FZFA 3ACHA 1GZCA 1AYN2 1VAKA 3F95A 1V6LA 1UF2C 5IK8A 1LTEA 1ZX5A 4W6XA 4LT5A 5FZ9A 2AR6A 1GNHA 1UOBA 2ZEZA 2ZEXA 4OULA 4XZPA 1AR93 2BRTA 4Y1XA 1PMJX 5IAXA 1BJQA 5FY8A 3Q8AA 5DZFA 1MVQA 2BEOA 4A2UA 5CA6A 2PHDA 3WCSA 4XJZA 5CZKA 2HWF2 3ACIA 3GALA 1W9YA 2ARXA 5L36A 1I6XA 1YRZA 4LMFA 1C8M1 3GZTB 5FMDA 2YG0A 5A7PA 3AMHA 2ZS6B 4QXCA 1TG7A 3J4UH 3S7EA 4BXSV 1XB9A 1VBC2 4YGEA 2HJIA 5FY1A 4Q4V3 3DEMA 3LA2A 5FZ7A 1SPPB 3G6JB 5K0UC 5DXDA 2ZAHA 2WSVA 3FWEA 4QXBA 3FL7A 4N43C 1W6PA 3ZN6B 5BNOC 3VZMA 4W65A 1FATA 1GUIA 5ACA3 3B3QE 1QF3A 4OVEA 2WLQA 1RB8G 4L8QA 4IEUA 1OFNA 3VDDC 1ZVFA 2DBNA 2ZJCA 2RDSA 4MGKE 2BZDA 2K2SA 3I3MA 5D21A 3N7JA 4HPKB 3AKQA 3ZDVA 4XF9A 4HZFA 3VHRA 1C8M2 3RYKA 2GALA 3OG2A 5C4WB 2J1AA 4JGZA 5EYYA 1E5RA 1LOFC 3TEXA 4CYDA 5FWJA 2XJTA 2NYYA 3UGFA 1V6MA 1PVC3 5BXXA 4QHZA 3ZFEC 1VIWB 1YFUA 5FPZA 3THPA 4KU7A 4KI5M 3WNNA 4D7TA 1BMV1 5BV6A 3WT3A 5K8SA 1K5MB 1NQDA 5C71A 1K5MC 3BOPA 5J98B 5GZDA 1KFXL 5FTTC 3TEYA 5C7GA 3ETQA 3T2PA 5J37A 2IXJA 1OSGA 1W03A 2CDOA 1CAVA 3IDEA 4LK7A 4AI9A 1OFSA 4WM7C 4AHWA 1SFYA 1K42A 3JQWA 5KHHA 3OF1A 3ZFFB 2HWB3 4NRPA 1Q8QA 2PHTA 2GP3A 5FPXA 3OPZA 5FZMA 2OA2A 4PDWC 1N1SA 1BYHA 3UGGA 5F39A 3W20A 1UYYA 1V6KA 3SEPA 2V4AA 4FOVA 1DF0A 5CKMA 4HETA 5DG2A 3LZZA 4LKDA 1FMD1 1ZYBA 4HBNA 4O7XA 3LKJA 4IEXA 5C8WA 2QQNA 3NV1A 5FZIA 3FE5A 2JG8B 5FY4A 3SKJE 2Z2SB 1S0CA 5C3RA 2OIIA 5FWEA 3LB9A 4IV1B 4NMIA 1GQPA 4WVMA 4LHSA 5DAPA 1S1AA 4ZU7A 3F2ZA 4N43A 1WMFA 3AP4A 1PO21 4OMCA 2PFWA 2QKDA 1ULEA 2OQ7A 3UNPA 1SCRA 1QJZA 3VL9A 4M3CE 2EF6A 1SEFA 5C6CA 4OHYA 1ULOA 1NCQA 3JB8A 2B5HA 3IB3A 4KL1A 4MGZE 4Y5SA 3MZHA 2WUHA 5LBCA 5J48A 5A33A 2KXLA 3JD72 3WUCA 3RJRA 5FY7A 2HWB1 1APNA 2ZGMA 5FJKA 1X9PA 1H2NA 2NMNA 3FHIB 3DPRC 3G7DA 4GWMA 3C7OA 4WM8B 4IEVA 3URFA 1DQ4A 4EWAA 4P9JA 4BZ4A 1VB4A 4ITCA 3J8F3 3K46A 4BU2A 1G86A 2H6BA 4CRQA 3OUHA 2C0ZA 1UNBA 1EV11 1W0NA 3MIFA 4KU8A 2W08A 4ZXEA 4XF1A 4PJYA 1IPJA 2MHFA 1AR63 3NSTA 1QDOA 1STMA 4FOWA 2RJLA 4LOSA 2UU8A 2AENA 1PX3A 1W8UA 5JMCA 1CD3G 2A3YA 3WNOA 2XJUA 4IDZA 1ONAA 4QPIC 1V9U2 1W6NA 1OOPB 1TVGA 1XSQA 5ABJC 2VOTA 1QQP1 4JQTA 4IGPA 4CDQA 4H7MA 4CP9A 4Q8KA 2C24A 1GU3A 3WF2A 2BJSA 2WDBA 3O1RA 3OY8B 2WFF3 4HN0A 3RZGA 1YI7A 3GXUA 1R093 4QWNA 1Q56A 3ETPA 3ITQA 2FDGA 4F83A 2D6KA 3DUIA 4XFCA 1YQ6A 2A71A 1RUH2 4EN9B 1MVEA 5DZEA 1ZZCA 5JOWA 2BNOA 3BU7A 4Q4Y3 2VNOA 5E6HA 3NNGA 4XAEA 2H0BA 2Q4SA 2ZZJA 3UKVA 3A0NA 4UWDA 5CKNA 4BE3A 3APBA 1FT9A 1HJGA 3FUOA 2WLPA 4JX0A 1ZZ9A 4KWJA 2ENRA 3QCWA 3U78A 1UU4A 1ODNA 2B8MA 2E26A 1KRIA 1OF4A 1BCXA 2E33A 2Q0AA 1AL0G 2Q1MA 1KFUL 4BA6A 4AGRA 2DCZA 1W9WA 5FRAA 5FZ3A 3SHRA 4BISA 1X82A 1QQP3 1U5ZA 4EROA 1LEMA 2XLAA 4XFHA 5C4WA 2YBSA 3QH6A 1S0FA 1CWPA 4GH4A 5ERLA 3WW2A 1GV9A 4I02A 3AZVA 4JZRA 1PGL1 4QHOA 2B45X 1JZ5A 1R091 3RFRA 4MGSA 3AJZA 5JR2A 4TN7A 4DINB 1CR7A 1ZBE3 1LGNA 1PO12 3GCXA 2ADDA 4TYSA 5FXXA 5BNNA 2R041 4Q4Y1 3RZMA 1LHVA 5K9YA 1J84A 2X10A 4LE3A 4X8NA 2JEMA 1IKQA 1N3OA 3BPSA 1VAVA 4XOGA 3IAPA 4KG8A 4P00B 3ZXLA 3ZOIA 2JB8A 3ILFA 1W6QB 4YFZA 1JYXA 3RI8A 1ST8A 2HYXA 3MUZ1 4R8HA 3VBOA 2R16A 1RUE1 2VJXA 1FYUA 4M00A 2UY9A 3HIFA 1JW6A 4PDWA 4YM0A 3OGSA 1FOD2 4DZGA 5A6QA 3S7IA 3GDBA 1UY1A 2ID4A 4XUNA 5DDJ2 3SXWA 4FTSA 1VMFA 3PUHA 5FYMA 3J9SA 3T2TA 3VKFC 2VULA 1H8TB 5AC92 5IK4A 1X8EA 3NL1A 2JDAA 1D4M1 2XB6C 3MF6A 4L0PA 3HN1A 4XE9A 1CZTA 1CIWA 1W2NA 2YHJA 1NQJA 3NNLA 4NPRA 1HXS1 4TLFA 3OOXA 3U75A 2WABA 3H9AA 3POYA 1JUIA 2JDYA 2R043 2XWBB 2XWJB 4IEOA 2KR2A 3DF0A 1NLQA 2ZGQA 2JKXA 4WBBA 4OI1A 4D3WA 2GN7A 1YWKA 4K9SA 4LO4B 1R081 2GN3A 1VAMA 1IPSA 1OA2A 1PK6C 1QXJA 2GDFA 5DAXA 1QOTA 4HKWA 4UFMA 3ZFGA 2Y6LA 2WQ8A 1RUD2 2XVLA 5FYBA 4NIAA 3OPTA 1AX0A 1R1A2 2X8KA 4LBQD 3O0XA 4A7YA 3OYWB 1UMIA 1M4WA 2ZHLA 5T52A 4WV8A 3I4IA 1RUF1 3KS7A 3M3QA 3ZXJA 3LEMA 4XXAA 2CGOA 2HWE1 4GJZA 3VBFB 5FQ0B 3AXDA 1X8MA 3S0MA 3DYPA 4IE7A 3U37A 2C9AA 3PU8A 2LUWA 3ON7A 1QJY3 5F5QA 2JDUA 1OOPC 1YIFA 3ZXDA 5JCTA 2E7QA 1FOD3 3OEAA 4XJ8A 2DUOA 3WG1A 3TEZA 1K12A 2WZ8A 3MGUA 1W2TA 1ZRCA 3GNEA 3KV4A 1OA3A 1U0AA 3LSEA 3AKSA 4AI8A 5A7WA 1O3RA 3PNAA 3T1LA 2RDRA 2E6VA 2WNOA 3H8RA 1OQDA 4BH9A 3AP7A 1XXNA 1GP4A 1C8NA 4IV3C 3FLRA 4Q1PA 4X8PA 3ZFFC 4AVAA 5I8YA 3I2JA 4LBJA 1ND2B 5EXOA 4UW6A 4NHYA 1NE4A 3UK9A 2XJSA 4GZ9A 2ADEA 1QH7A 2A6VA 2UY8A 5FZDA 1RUJ3 5H9QA 2PXJA 1BEV1 1DU3D 2IXIA 2Z5WA 3HBKA 5CNAA 4ET7A 4LLFA 4PQ9A 1GR3A 3RG0A 1H1AA 1W9TA 4DEQA 3T0DA 1SDDB 4LUKA 1LODA 3ZPOA 4AI0A 2DF7A 4YG6A 3T4VA 3ACFA 4NPLA 2VVFA 1H4GA 1Y7BA 4Q4V2 1B09A 4U36A 4D6SA 3RZJA 4K21A 2OXBA 1F31A 2ZGKA 3I59B 1QEXA 5FMOS 1XNDA 1KDMA 4Q0QA 1DFQA 3KMHA 4MO3M 4YZ3A 2Q8OA 5B4NA 3VD7A 4UW5A 4QB2A 5FZOA 3BUCA 2Q30A 2R0FA 3GHNA 3PTRB 1ZA4A 3AKPA 2SBAA 4IE6A 4Q4Y2 3W21A 4B4PA 4G3YC 4GQ7A 1ZBA3 2QQVA 2QQUA 2J1TA 5EV7A 3AX4A 3V65A 1TMF3 1G9CA 3H50A 4COZA 4FXKB 2UURA 3ZSJA 2WNVC 3ZPYA 4OHVA 1W8OA 3PUIA 3KT4A 5IUQA 3U11A 1YJKA 1GYKA 3AP5A 4CDWB 1RUC3 2E31A 2BGCA 2PLV3 3M3OA 1K5MA 4LBKA 2VMHA 5FYTA 1C5HA 4CDWC 1AYN3 2D43A 1QJY2 3D0SA 1I3HA 2E32A 5D2AA 5L9RA 2JDMA 4NE9A 1AYM1 1B35A 1WA6X 2VZUA 1AHSA 3NRUA 4NWWA 4N9IA 1IGOA 2PTMA 3LOBA 4FI9A 4HT1T 1ASJ1 1FV2A 1UAIA 1UY4A 1W3XA 3INAA 2RDNA 4TXWA 3QACA 2WS92 2PQSA 4Y5TA 1UWWA 4WVVA 2PAEA 3VL8A 4QXKA 3VBHA 1UY0A 4P5YA 5EPAA 3ZYPA 5C9AB 4YZ4A 1HN1A 2RM21 3VHOA 1HB3A 4N53B 4LE4A 3U0ZA 1W6OB 3KHCA 4QGNA 1S0BA 2JG8A 1TMF1 3VD3A 4Q2FA 1QJX2 2YGMA 5KC6A 4GALA 3JD73 4EN7B 1VBB1 1LCLA 1J1LA 2VUCA 2VZ3A 4N43B 1YHFA 3IPVA 1OI6A 1W8WA 2F4PA 3EXUA 1HRV1 5DAWA 1AXYA 1KGYA 3OEBA 4KWKA 3WQ1A 2E63A 2GMMA 2VZRA 1SDWA 2YC2A 1RJ8A 1TEIA 5JZGC 3AFKA 4B3NA 1UD1A 5IYYA 3AKTA 3SQOA 4CXYA 4PLMA 1ZNPA 3ILNA 2CHHA 4XILA 1IQAA 1EP0A 1J1TA 1AJOA 1LGBA 4HMZA 4BQWA 1H9WA 4MVTA 1VBE3 3MI8A 4XURA 4CCOA 4YZ2A 2WA3A 4UT5A 1HIXA 2CAUA 5DUXA 1DIWA 2ZKNA 3FFQA 2D3RA 4HG6B 5A1LA 4AK3A 3ZR6A 5IVBA 1XNCA 5IVEA 2VZ1A 3O7OA 3I59A 1ND3A 3Q8EA 1KDKA 3EO6A 4ZY9A 3IDCB 4NHMA 3ILRA 2V73A 2R49A 2XL9A 4MG2A 3HNYM 1QJU3 4FPGA 5FZBA 2QVSB 2RM22 2EA7A 2DCYA 2A3WA 4P9GA 4QB6A 2V5DA 3LDBA 5ACA1 3FMGA 4LO6B 3K3NA 1MS8A 5BPXA 3A23A 3WDWA 3WW3A 5AVPA 3C7EA 4XETA 1VBC3 4UXAA 2ZMNA 2Z42A 4MUVA 5FP3A 2QBXA 4ARXA 1MACA 1UKGA 5I8SA 1S2EA 3D3AA 5I93A 1PZ8A 4Q4V1 4E2QA 1JBCA 2W9XA 2WWSA 3AVSA 2VU9A 1COV1 5I8TA 4GJYA 1W9FA 2HWF3 5C5UA 5F3CA 2CGPA 4RL7A 5CB7A 1ALYA 3TWIA 4BIFA 1POV1 3ZVXA 5L7OB 5LWBA 1NT0A 2CAVA 3MW3A 3OBAA 3K51A 3EB7A 3WF3A 4IEQA 5IFPA 4HANA 1GANA 3ZMOA 2DVAA 4HVRA 1JYIA 2RR11 5EQUA 4BQ2A 5A7SA 1VJ2A 5DAVA 2ZGTA 3MFCA 1RVF3 1PGW1 4B7KA 4NIDA 2DV9A 1DQ5A 5FZLA 4MXVA 3VKLA 4WZCA 1AR71 1EPZA 1NCRA 3ATGA 3VHPA 4AVTA 2QZ2A 5T54A 1Q8VA 3N9QA 1W6PB 5GLWA 1JYNA 1OQEA 3VD4A 2RV9A 2OUHA 2RMU1 1X7NA 3ORJA 3ZYHA 3K48A 2L9LA 4ZZ5A 1PM7A 5E8AA 1LULA 3LFIA 4TTGA 2RHPA 5FUPA 3P1IA 4M3CB 3JXSA 4IGQA 3RVHA 3ZN5A 2WSUA 1QNWA 2P3YA 2MNGA 1BEV2 1PIV3 4CVUA 4ZONA 1YQ5A 2QDRA 4Z2WA 3LEIA 1E5IA 2WFF1 2HYKA 4ISQA 1I5ZA 3D4KA 1JOBA 5A32A 1AR62 3NKTA 3CQOA 1FX5A 4PHZA 3B9CA 3AMNA 1XPWA 1V6OA 3WQ0A 3ZYJB 1F2NA 3WG2A 3WP4A 2P17A 1QNYA 5HI0A 3WDXA 2OZJA 3VBOB 5D8AA 5FYUA 1T6BX 5GLTA 3ZLIA 2UWBA 3J8F1 3M70A 2QDNA 1DBNA 3FHAA 5F2WA 1GMMA 4AI3A 1I1EA 4UAPA 5J3UA 2BOIA 3I97A 4IEWA 5FLIA 4AI2A 2QFEA 4AQ6A 2AGSA 3R6SA 1PMHX 2FMYA 2V09A 1QDCA 2KM2A 1E5SA 4K1ZA 2XKPA 1AL22 3AMMA 5IVCA 4ZZ8A 4QM9A 3PVEA 1ZM1A 4UYBA 3PIGA 2XG3A 2VPVA 5LZ6A 1TNRA 5DDJ1 2AEZA 1F9KA 3WEZA 4B1MA 1PK6A 1EV13 3KQRA 3ACGA 4QQ2A 1F4HA 2G4IA 3M2MA 4IEPA 4NIGA 1R1A1 2PHLA 2RS33 4QDRA 4BWOA 3ZXGA 3WLUA 5T50A 1JU3A 4BMBA 3VBFC 3BPZA 4NHKA 3B01A 2IXLA 3J26N 3PMSA 3AYEA 1O5UA 1NX9A 1VPHA 2W94A 5LA9A 3WG3A 4TZDA 4OLLA 5FZOB 1BKZA 3NAPC 2ZGOA 2Q8EA 2BNMA 5FQ0A 4AGGA 1HB1A 1YJLA 3NNFA 2VQAA 2BBAA 4Y1VA 3UL2A 5HXMA 3NMBA 4LXLA 2Y60A 4QDQA 5A3OA 2J1SA 4A41A 3TAYA 5C3OA 3CL1A 4DEVA 1DZQA 2DFBA 5CFDC 2CGNA 2JG9B 2X5IB 4LULA 4NWVA 1FPN3 3C3VA 2WFPA 4CUBA 2W87A 1PZ9A 1MS3A 2R1BA 2ZX0A 2G9GA 2FD8A 3HEIA 1PVXA 4CUGA 5K0UB 4E4HA 3OTFA 1Z78A 5LY2A 4KNCA 1GP5A 4BM8A 2PYTA 2RS31 1D4VB 5A7WB 3TN93 2WAAA 1UY2A 2CL2A 3NAPB 5I0DA 4OZXA 3PURA 5FAXA 5JPNB 2VCBA 2XLFA 3H3UA 4CDQB 1LECA 1W9SA 2E9QA 4LHNA 5JSOA 2NLRA 2VZQA 4KG0A 4UFKA 3U07A 4N53A 4B8EA 1KJRA 4RR3A 4SLIA 5FZCA 5C70A 2VQUA 4GXLA 4XJAA 2CU5A 4XQWA 1MS9A 4FP3A 4X6RB 1N1YA 1AF9A 5BYNA 2VCMA 3DYOA 3LPGA 4XHXA 3CIHA 4LO5B 5FLJA 3THCA 4XZUG 3HQXA 4CUAA 1Y4WA 5FPAA 5C8CC 4EE2A 2GH2A 4Q8LA 3VB9A 3EYPA 3NNJA 5JPMB 1KEXA 5FXZA 2ZX2A 1EAH2 2D6PA 2E53A 1D0GA 3GBFA 3BB6A 1WBLA 4BQ1A 1V9U1 1VALA 2P37A 2PA7A 3AM2A 4Q27A 1DZTA 1F35A 1RUJ2 4EN8B 3O1VA 1SBFA 2DUQA 4KWUA 1DLCA 4AVVA 4CDQC 4QKDA 1OURA 4LA2A 2X09A 5BY5A 2D6NA 2JD4A 1BLZA 2VXRA 3ASIA 2ZOEB 3SLIA 1MS4A 4FPCA 4YNIA 3VDDA 1BMV2 3ENRA 3UJOA 1TME1 1QJEA 2ZGLA 2GNMA 2MEV1 2R1DA 2YFUA 1IG3A 3C7GA 3BOWA 1QOOA 2A3XA 2X5IA 3FUQA 1EYBA 1O91A 4YW4A 1DG6A 4V2WA 5K0UA 2YPJA 4ORFA 5FZ1A 3E6BA 4EWDA 4AEJA 4XTPA 1HKDA 4IV1C 4RR3C 4AQSA 3ZN4A 3KZ4C 5F5IA 3K4AA 1QHDA 4L99A 3W59A 3V0BA 1RUJ1 4XF3A 2BTVC 2EXKA 4E8CA 1GZ9A 1RUF3 4BCUA 3WUDA 3FC0A 2JKBA 2PQQA 4U2AA 5GALA 3WP6A 1EAH1 5FK7A 3T30A 4ATEA 1ZBA1 3BVCA 2AZ5A 3POJA 4NHXA 4QX5A 3LA7A 2VD7A 5I0RA 2WN2A 1QJY1 4HKOA 4DPNA 4ES8A 2R7EB 4LKFA 5BNOB 3AP6A 1Q3EA 1QIQA 4R9DA 4YVSA 2Q8DA 5A1AA 2K0GA 4FOYA 1YYNA 3AYCA 2OUJA 4IUGA 5HV0A 3AYAA 2VMFA 2YDEA 5CFDA 4K6BA 1RUG2 2WT2A 2J22A 3VBUB 2XBO3 5FYSA 5JZGA 1U12A 1QKQA 2CTVA 1RXGA 5A3WA 1ASJ3 1GWKA 3ES1A 3KV5A 2BVBA 3POIA 1RHI1 1YCIA 2BUKA 4L11A 4PBPA 2WZR2 4P9IA 2R073 1GBGA 2EIGA 1ENQA 1W90A 3ZFEB 2TEPA 3ZSMA 5LEJA 4HPKA 4D6QA 1O3QA 2B46X 3U14A 2ILMA 5FLHA 3WDUA 1NLSA 4CPBA 1AR82 3AYDA 3MLJA 5GLVA 5LA1A 4QX1A 4ATFA 3TEWA 5CEHA 5A3PA 4AFDA 2ZABA 4Y20B 4GH4B 3OYWA 3CHXA 1FNYA 2CWMA 3P3NA 4FP2A 3MICA
chains in the Genus database with same CATH topology
5CAZA 2VVDA 3VKNA 2DURA 4QHBA 3JBG1 1VLNA 3OJBA 3VBFA 1XYNA 3RYRA 4QPGB 3WR0A 5DUUA 5LRSA 2PHRA 5EZWA 2FBEA 4PIXA 1BEV3 5SV8A 5EFUA 4OUMA 2XBO1 5C8CA 1Z7S1 2VMGA 4I30A 5F9TA 1ND3C 2NP0A 5JSPA 4LBMA 1HRI2 1NE6A 3RI9A 2A75A 4OHXA 1ZBE2 3H7JA 4RGAA 4Y22A 2CV6A 4R4XA 1RIRA 1N1TA 4J6GA 1AXZA 1A3KA 2FZ2A 2NPIA 2DVDA 2ZA9A 1HV0A 5B2GB 2MEV2 1REFA 2ZHMA 4JDOA 1QMJA 3MLLA 2E51A 3JBG3 1AYM3 3ALQA 3H7YA 1WLTA 2PLV2 5GZFA 1S0JA 3CO2A 1Q5OA 2QE3A 4HN1A 4SBVA 5JI7A 4FXGB 4NO4A 4E4SA 4B4QA 2VW0A 1LGCA 1WLWA 1H8VA 3H1MA 1RUC1 4YFWA 4YZ5A 1PO22 2GMPA 1AYN1 3VBUA 1RUH3 3E97A 1Z7S2 4E4DX 2YXSA 4Q4W1 3U10A 5BNPC 1VBC1 3WCRA 1VRH2 1VBB3 2NQYA 3X29B 2IFRA 2WFF2 2D6OX 5A33B 2X29A 4YGDA 2UYBA 5CIRA 4FPEA 4BOWA 3MIHA 4N7UA 4INDA 2RS52 4WM8A 2WZPP 3JBG2 2HWF1 3TB0A 2I07B 2YZ4A 4YZ1A 1H30A 1S0GA 1IS5A 1UW8A 4H14A 1DGRN 4AI1A 1QJU2 1KS5A 1LRHA 1YUDA 1LOAA 2OPKA 2QQPA 4GB31 4CDUC 4AYUA 2RMU2 5D8AB 3HAGA 4N90A 4Y24A 1IKPA 4Q0SA 1RUI2 4MV2A 4YW3A 4META 2PHFA 5L7OC 4PF5A 2XLGA 1VBE2 2DYCA 2GC0A 2GH8A 2LTNA 4XJ9A 4YLZA 1QJU1 3EJKA 1PIV1 4O9GA 4J1WA 1OKQA 1AL21 2XKOA 2VNRA 4Y22B 2E7TA 5BUVA 1BQPA 2RS51 3UKNA 3GBWA 1W6OA 1OMIA 2IZWA 4JGYA 4QPIB 3ZFGC 3A4UA 3JCIA 1VRH1 4IETA 1GFF2 1IS6A 1PK6B 1H4HA 4CDUB 3IPVB 1QY4A 4Y26A 3WDVA 1T6GC 3VLBB 1X33A 4NOTA 1FMD3 1LHWA 3ZYGA 3WG4A 1RMU3 1LU2A 1NYWA 2NM1A 2DWRA 3AMPA 4IV3A 1AR91 3CEWA 3O5SA 5BNNB 3VBSB 5GZEA 1RUG3 2B39A 2X53S 1N1VA 1RINA 1COV3 3B02A 1AR73 3ZDSA 4L2NA 1REDA 2VW2A 1POV3 4EN0A 3NJZA 1F5JA 5FREA 2NZ9A 1LOCA 1VRH3 1M06G 2WNUA 2WIIB 3SNMA 1RUNA 4XJUA 1C5IA 1HRI1 4COWA 1ULFA 4R52A 1G9FA 4JTNA 4P14A 4B7EA 1DHKB 4M3CF 1HRV2 4TSVA 4XTMA 4MSVA 1GKBA 1AR61 4Y1UA 2A6ZA 1WGPA 5C8CB 1N3QA 4DRVA 4N7IA 4LBQA 2FMDA 4RSUA 5FO8B 4RQPB 4OHWA 2AH2A 1WW7A 3E6DA 2PHWA 4FPOB 5FDBA 4FCAA 4JGZC 1WD3A 3MW2A 1B35C 2WS91 3JU9A 2BFUS 3IDBB 1RITA 2CYFA 2R0HA 3ZXEA 3ACLA 1UIJA 1RHI2 2XGXA 4CEWC 1PZ7A 4K1YA 1G7YA 5JLVA 2BQPA 3H1WA 4RHV1 1RL3A 3R0RA 4LUMA 4XMAA 3RMXA 4AEMA 1NY72 4MXWB 4L97A 4Q4X3 1J3RA 3OGGA 4IEZA 2RS13 4QPYA 3RDIA 5D8AC 2ZTNA 1QGLA 3B9IA 1ENRA 1HV1A 2R062 1Q8SA 1NA1C 3OCPA 3POWA 5A32B 3VKMA 5A3LA 4QD2A 2ZCWA 1H9PA 5DZGA 3ZYRA 5CFCB 1QOSA 4C1WA 4C0HA 4AWDA 2IXHA 5FCCA 4NR1A 1CX4A 4YW1A 1R1A3 2BYVE 3FZ3A 2OZ6A 2Q1ZB 2ET1A 4YG3A 2XVKA 2XJPA 2RJKA 1NCQC 4JAAA 4LBQB 1YFYA 3ZSLA 3CU7A 1V9U3 5BNPA 4DRRA 3CJIB 5H9RA 1SLBA 3VBUC 1NCRC 3VGIA 1CVNA 4XFBA 3WDTA 3AP9A 1RMU2 1AUYA 5JZGB 4QGLA 1DZRA 2ZGNA 3B7MA 3HBZA 3M3CA 2WKKA 4AHZA 2ZX4A 5JIUA 1FPN1 1D4M3 5IT6A 5AC93 4Q0UA 3FLPA 4JDNA 4FPJA 1AX1A 2BW8A 2O8OA 5DG1A 2DVFA 2WINB 3S6PA 1BVP1 1D0HA 2NN8A 4IESA 3ZXFA 1X50A 3ZMNA 4MX3A 1Y9QA 4L9BA 2GAUA 1URXA 2JENA 3PLQA 4GA9A 4I0BA 1O4TA 4LBNA 3V56A 1ZRFA 1DDLA 1VBD2 2DU0A 1SLCA 2HWE2 1F8VA 2PHXA 1J59A 1RHI3 4JQRA 4Z82A 4PLOA 1VB2A 4M0HA 5E89A 4KGGA 2DUPA 4HL0A 2D98A 2LM3A 1JHNA 4CDWA 1W6NB 2EXIA 4BIOA 1V6IA 1G8WA 5I0SA 1H2MA 1LOFA 4XYXA 5GM0A 1AYM2 5HCBA 1TME3 1PNGA 2A7AA 3DPRA 5IK5A 1W0OA 1R1ZA 2MEV3 4FOQA 4OFGA 4AVSA 4I2OA 1NXMA 1A6CA 3ZSEA 4RQPA 3JQXA 3AJYA 1MQTB 4G9SB 1QWRA 3BTAA 3E6CC 4YW5A 3VBRB 4HSLA 3ZX7A 4RS5C 2HWD1 2WJSA 4DY3A 2YV8A 1JUHA 4Z1VA 1Z7S3 3SCGA 3S30A 3O14A 1LU1A 1V6JA 3LCPA 2JXAA 3L9JT 3TNPB 2D40A 1C28A 4S2GA 5JDBA 1ZZ7A 1MS0A 2Q5TA 1GQHA 3TN92 4XF0A 4F8AA 5GLZA 4AQ2A 4JCKA 1UL9A 3HMYA 4GH4C 4UW4A 4JDMA 3R4DB 4H3WA 2B42B 5F1RA 1WD4A 1PGSA 3H8UA 5EYXA 2A6YA 3CNAA 3SH4A 4N9HA 4KQ7A 2RE9A 3WOGA 3WXPA 4C91A 3WHUA 1NXD1 4ONUA 1O3TA 2EALA 3DL3A 3A0KA 4QGMA 4WVWA 2R071 4AVCA 3ZSKA 3USUB 1DQ6A 1XNKA 2BNNA 1WCSA 2Z79A 4RA0A 2UWCA 4OHZA 4CP1A 4FBFA 1EY2A 1RUD1 4CDXC 3J8F2 4ASMB 2WNVA 4P9LA 2OYZA 2DTYA 3M3IA 5KXBA 2JX9A 5C9AA 1CAWB 1XE7A 5A3MA 5L7OA 5KXCA 1O4ZA 1XRUA 3ME2A 2ZGRA 3UKTA 4LBLA 3VZKA 3HT2A 2PLV1 1ULCA 4YRDA 2D44A 1L3JA 1G9AA 1BBT1 4JGYB 4QPIA 1FAYA 3AFGA 4W6YA 3ZN5A 3WV6A 1OLRA 4YVSB 1I9RA 5ABJA 1RUH1 4FT8A 1XQNA 2TNFA 1Z0HA 4LEJA 4BLJA 4E2SA 2CWMA 1PHMA 1RUF2 4EJRA 1BVVA 3ROUA 3PJYA 1FOD1 4M01A 1SBEA 1RJ7A 3FJSA 1ND2C 2GNTA 3D0JA 4XIOA 4YGBA 4DMIA 1MZ5A 2EXHA 4R4ZA 1PNFA 2YYOA 4S2FA 2VMIA 2RS53 4JV4A 3V0AA 1SCSA 4GB33 3THTA 1CAUA 3RRDA 1PO13 1WLCA 1S0DA 4LHKA 2I2SA 1C1LA 1ENXA 3PTYA 2ZX3A 2BPA2 1EV12 2HEVF 3ZO0B 4AEDC 4FO9A 4Y20A 2VOVA 2ZAAA 1NY71 4ASLA 4K40A 2R6QA 3B93A 3SISA 4GMP1 1AL23 1AR81 1ZREA 4AFBA 2JG8C 3N7MA 4FAHA 4AF9A 5JAXA 2XL7A 3PHMA 1CAXB 3EHKA 2W68A 2ZGUA 4RS5B 1UCXA 4GULA 4W6WA 5T55A 1GZWA 4JC1A 4ZU5A 1RUG1 1V70A 2O1QA 3E5QA 5T5JA 3QD6A 4CEYA 2B9UA 5LK7B 5ACA2 4J1XA 3VBHC 2HKXA 2GMEA 1PVC1 1PO11 2Y0IA 3R05A 4V1PA 4Q4W3 2HWC1 1DQ2A 3BIWE 4Y4YA 3AB0A 4LNVA 2YGLA 5FO7B 2DFCA 4IV1A 1PMIA 1HRI3 3IM0A 4XXPA 4GMP3 1S0EA 2VW1A 3TRSB 1C4RA 2V5YA 1MEC2 2JJ6A 2R30A 1S55A 2VVEA 1MEC3 4E27A 1TE1B 1FPN2 4M3CA 2GU9A 2X5IC 1GLHA 3M8LA 4DXZA 2O8QA 3MPPG 4CTEA 4EN6B 5JOZA 4P5HA 4YG0A 3B5LB 1C3HA 3V64A 1WBFA 4QT6A 4MZUA 5K7PA 2QJVA 2RM23 2QUOA 2ZHNA 1OLQA 1QU0A 5L73A 3C2UA 3ZIWA 2WNUC 2BWCA 1DGRA 2WNUB 3AKRA 3JD71 1YI9A 1CAXA 4NVPA 4I0AA 3KB5A 1ASJ2 4C0BA 2XBO2 1J3PA 3GZAA 1MEC1 3I7DA 4YM1A 1UU5A 3MW4A 3HT1A 4R9CA 2HEWF 2A73B 2ZMKA 2XJRA 2R061 3OY8A 1IPKA 1SLLA 2ZGPA 2BFUL 1RUOA 2WC2A 3H0OA 2YROA 4QQLA 4RFT0 4DOUA 4UW3A 4I01A 3IMNA 4URTA 1MZEA 4AVBA 1OA4A 2PELA 5GKAC 5JWPA 3IN9A 4MH0E 2JICA 3AMQA 4I0WB 5FBZA 5GZCA 5H9PA 2H0VA 5JSRA 3B69A 4RD7A 4LO7A 5J96B 4DS0A 4XMIA 4D69A 4DY5A 2GC2A 4ES9A 3T1MA 1FV3A 5C9AC 5JI9A 4HSJA 4YVWC 2D7FA 2PN5A 3TOJA 2R32A 2C5DA 1CJPA 1NA1B 2AREA 2RR13 1YIPA 3TBDA 4YGCA 3VDDB 5FOBB 2GNBA 2DCJA 5LK5A 2D6MA 2B7YA 1DQ1A 4QQOA 4AFAA 2DVBA 4A7KA 3KCYA 3VZJA 2P3JA 4O9EA 5CFCA 5DDJ3 3AZWA 3KCCA 4FQ4A 3WP3A 4YM2A 4A7ZA 4MGYE 1DYPA 2WA4A 3VBRC 4DQAA 4QMAA 2VUJA 4MYEA 2RMU3 1QXRA 2XJQA 5HCAA 3B94A 5H9SA 3ES4A 1WUVA 2XPJA 3PVOA 3SITA 5T5PA 1S0IA 1UMZA 1OQ1A 2P3IA 5DUWA 5BNOA 2N7GA 1Y3TA 2UYAA 1AR92 3KT1A 3KCXA 4BYYA 1JXNA 2OVUA 1W39A 3CJXA 2Y0OA 3LWCA 4AEDA 3OD0A 1W6MB 1KQRA 1VBD3 4WVZA 4XFGA 1Y43B 3HR9A 2EAKA 1Q8PA 1QQP2 1G9DA 4XQ4A 4S2DA 4XEZA 1R082 4R9BA 2WL1A 3VN4A 4QQPA 3QLQA 2HEYF 3VV1A 1HX6A 4QPGA 3M3EA 1O3SA 3JZVA 3O0WA 4XIKA 1RUE3 4D7YA 1WMEA 5KHKA 1AJKA 4CDXB 4KWLA 5CVRA 1KD7A 4MXWA 2VOWA 3GHMA 4MLOA 4DNYA 5AC91 1RC6A 1MR5A 1RUI1 2JE7A 2WQZC 1CAWA 2WZR1 4XFFA 5BNQA 1MZ6A 2Z69A 1H1IA 4FSJA 1WCDJ 1SACA 4JGYC 4L92A 1W6QA 1D2SA 1SFNA 2XVGA 2P3KA 4FTBA 4PDWB 3BODA 4D94A 3POSA 4CEWB 3TNQA 5IK7A 1NG0A 2GC3A 4B29A 3HD8B 5KHJA 2MPFA 3OD4A 1FMD2 3QH7A 4AFCA 3AZZA 1C1FA 1DQ0A 2K9ZA 3N36A 5F6KA 3RMYA 3JB4C 3WNXA 3CF6E 4PBOA 1G9BA 1RUC2 3ST7A 2TUNA 3AZXA 2C1FA 2GZWA 4FAGA 5CADA 1XU1A 2WZR3 5EJ3A 3RYPA 4Z92B 4M0NA 1YFXA 3D6EA 4QQHA 3V0AB 1O5LA 4AEDB 1CAUB 3DN7A 5AVAA 1CPMA 3NKGA 1RUD3 1O7FA 1XYPA 4AE2A 3L2HA 1KITA 3ELNA 2JG9A 4CP2A 1ND3B 4FPLA 1DGLA 3HWJA 4NHLA 3VUOA 1CONA 1UPSA 4AW7A 2Y26A 4FPKA 5HCFA 5HBAA 3MIBA 1V00A 5C33A 4PIYA 1HLCA 4Q0VA 4KBBA 4OI0A 1IS3A 3FX3A 2DVGA 1H8TA 2WNEA 4YM3A 5KHGA 4AQTA 3DV8A 2D5HA 3MIDA 4EV0A 1CGPA 4XPVA 3JUUA 3RNSA 1VBB2 2RS12 3NVCA 4HK8A 4Q4X2 2HWC2 3MIEA 4FQZA 1WCKA 3D5OA 1JH5A 5AFBA 3RZZA 1LEDA 4RR3B 2IXCA 5FO9B 5T5LA 1MQTA 1YXWA 3LSDA 1PVC2 2BWAA 3QOPA 5T52A 1X36A 4H7LA 4WM7B 2PHUA 1XU2A 2XH6A 3D82A 3LAGA 4HKLA 4XBNA 3SMHA 3PJQA 3W9AA 1F5FA 3E5XA 1N47A 1POV0 3BALA 1UKRA 5DUVA 4AG4A 2VQ0A 2ETEA 5FFOC 2FHRA 1HW5A 2D5FA 3GYDA 4OI2A 2XJVA 4XFIA 1AR72 1NZCA 4FTEA 1W2UA 1G6NA 1AZDA 1CJDA 3CLPA 4A3XA 2WQ4A 1SLTA 3H3ZA 1ZRRA 1WLDA 3WINE 2JDZA 3IBMA 2GNDA 4AGVA 3MLKA 1RVF1 4XBLA 1JTZX 3IWZA 1LENA 1HRV3 4HK9A 2IFWA 3V0BB 3PVBB 2E7AA 4LHLA 1NOVA 1BZWA 1H2KA 3SH5A 4LLOA 1E57A 1UZYA 2GSYA 2XUMA 3SH3A 1W0PA 4YYOA 3MFAA 4WM8C 2ZZQA 2YUEA 5BNNC 3FBMA 2QZ3A 2HWC3 4RQPC 2A70A 4PCRA 1CQ9A 2ZPXA 3R4UA 5E88A 3WY6A 4CEYB 1YFWA 4RGGA 1VP6A 2AUYA 2YY1A 4DB5A 5KBFA 3GBGA 2IC1A 3FBYA 4WM7A 1AR83 3KSCA 3NV2A 3VBRA 3WQ7A 5GZGA 1ND2A 1ULDA 2ZMLA 3VZOA 5CFDB 2JECA 1MZFA 3PMEA 3OGJA 3FFZA 1DLLA 4WVMB 4ZKTB 1CPNA 1LESA 1WW5A 1IZ3A 3VBSA 1CN1A 1DGWA 2D3PA 5JOYA 2FQPA 2Y38A 5SV5A 2PAMA 1UN1A 1H8TC 4YVWA 4R9AA 5KXEA 4K8FA 5FOJB 1TMF2 1H1MA 2G9FA 4FVVA 3ZIXA 2W39A 1IS4A 1HDKA 2VGDA 3NO8A 1XNBA 1PO23 3VZLA 4CDXA 4D7SA 2R063 1S2KA 1C8M3 2ZKLA 1JYCA 4ZXKA 5I0UA 2FZ1A 4N53C 3RQ0A 2VOXA 4F7ZA 2BBVA 3M4FA 4P9XA 2JG9C 4I3GA 2A6WA 4LBOA 1CAVB 2IWGB 2EXJA 1BXHA 5I91A 5GLUA 1LHNA 4JRAA 4C1XA 2OW4A 1YNAA 2GC1A 4G4FA 3SCFA 5JOXA 3KGLA 1GZWB 3AK0A 1VBA3 3DKWA 4CP0A 2VY0A 1Q8OA 1HXS2 1RTVA 4YARA 1SMVA 3TYJA 4WZFA 1J3QA 1VBA2 1FXZA 1PIV2 4BLIA 1CESA 5CU1A 5CBLA 3NW4A 4GWNA 3I8TA 1UX6A 4Q0PA 1A8DA 3NV3A 3LGRA 1OPMA 5T3NA 1UIKA 2YC0A 1ZZ8A 3WW1A 1RUE2 4XF4A 2UWAA 1WW4A 3IIAA 2JE9A 2VOKA 1NCRB 4XW3A 1YO8A 1MS1A 3MF9A 5KWRA 1LOEA 4EWEA 1VR3A 3MDPA 2PAKA 1A78A 1VBA1 1PGW2 1BBT2 3O12A 4GKXA 4UBGA 1KJLA 1RVF2 5KHIA 2RR12 1RGSA 2HWD2 4UBHA 4YSFA 5CFCC 4PIZA 3Q9OA 1GICA 2VG9A 5EWSA 4X6QB 2ATFA 2ARBA 4AFMA 1COV2 1H2LA 3WDYA 4HFSA 3UJQA 4IXLA 1AX2A 1HQLA 4JRLA 1NLRA 1LR5A 5BNPB 3ZXKA 4E9KA 3AZYA 2BVVA 2YMZA 1HQNA 1QH6A 1RMU1 1KXGA 3DGTA 1J58A 2EVXA 1SLAA 4Y5Z0 1U5YA 4OUSA 5LRRA 1QJX1 3DPRB 3VBOC 1LOGA 5TSWA 2LALA 4RHV3 4TWTA 3WD5A 4CEWA 1KS4A 3O0VA 4IL7A 4XQDA 1Q43A 1XE8A 4QM8A 2I74A 2RS11 5JR7B 1C57A 3RPQA 1REEA 5FMOL 3WHTA 3KLSA 4CDUA 2O0OA 4S2HA 2XHKA 1ZBE1 3E5UA 1OPOA 3TN91 1A8MA 3KM5A 4XFAA 3RWNA 2DTWA 4H55A 1OD5A 4Y1YA 5T5OA 3W58A 2EAAA 2D97A 4GMP0 2DCTA 3WVJA 1RUI3 5C4WC 4XDQA 3N7KA 3N7LA 1FNZA 4FPHA 4COYA 4AXOA 4AHXA 4JGZB 1QJX3 3M1HA 1QXPA 3B00A 4RHV2 1SQ4A 1ZRDA 1IHMA 2VUAA 2W0XA 3VKOA 1GNZA 3N4MA 4LA3A 1NA1A 3P3PA 3RS6A 4IEYA 2I45A 2IXKA 4Q1RA 2D3SA 2WS93 3OBTA 3ZYIB 3WZ1A 1GSLA 3SCHA 4COUA 4HVQA 5J09A 3R4SA 1OOPA 4CZSA 1R083 1S2BA 2D6LX 2D93A 3EQEA 5I0TA 2WNVB 1SBDA 2H6CA 3VBSC 3VBHB 1VBD1 1WA4A 4HLTA 1ZZBA 5ABJB 3KGZA 3EBRA 1DYKA 3M7AA 3KD4A 5KC5A 4JTOA 3NWKA 2DU1A 3LOIA 2ES3A 1R092 3VHNA 1ZZ6A 4Q4X1 4I3PA 3RJ2X 2VNGA 3LA3A 3N35A 4KH9A 3USSA 1JN2P 2W52A 2VECA 3RSJA 1ZBA2 3L2YA 1H0BA 2ZBJA 5E16A 1N3PA 4KGQA 2NMOA 1EAH3 4QPGC 4ZU4A 4JVAA 3D8CA 3MEPA 1AXKA 1LJ7A 1JOJA 2KA3A 2F6BA 4FPYA 3VZNA 4BMEA 1NCQB 2WT0A 4XHBA 4XJWA 3ZFEA 1BK1A 1OHFA 1XYOA 3CJIC 3FLTA 3PVNA 4Y1ZA 3ZN6A 1WMDA 1ULGA 2QCSB 2QNKA 3WX5A 2ZACA 5JIAA 3U4XA 4YW2A 1UU6A 2AYHA 2CWSA 4COVA 4C90A 4LR4A 2DCKA 1TME2 4LTAA 1LKNA 3ECQA 4FPFA 4GKYA 4BPZA 2ERFA 1B35B 4AEKA 1IOAA 3MPBA 3NV4A 1HXS3 4MGIE 4PLNA 5D1IA 3MIGA 4OI4A 1SLIA 5LEKA 4Q4W2 4E4ZA 2TBVA 4RS5A 4B4RA 4IERA 2HWE3 2ZX1A 3GF6A 4I09A 4Q29A 2A6XA 1FI2A 4ISRA 2P34A 4GIQA 4YVSC 1U5XA 3MYXA 1HQWA 2ZHKA 1LB2A 4P9YA 1O4YA 1WW6A 3KT7A 5AFEA 1DGWX 5GJ6A 4K7JA 3NAPA 2R072 5L19A 3IT8A 3ZFFA 5E1RA 2P2KA 3CJIA 3I54A 5J7MA 5CG8A 3N3HA 4Q26A 2SLIA 4E2GA 1UZZA 3WP5A 1D4M2 5JVVA 4XBQA 2HWB2 3OBRA 2ZGSA 3H1YA 4K20A 4P9WA 4QU2A 2RS32 3ZXAC 3ZFGB 4Z07A 1TQ5A 5F6LB 4NN0A 4HVOA 1MQTC 1V6NA 1LOBA 1W6MA 4K3UA 4LO8A 1LHOA 4GB32 4CEYC 3BCWA 1ENSA 5CG9A 1UPIA 3I2DA 3AXEA 4YVWB 3WW4A 2CNAA 1U5IA 5J36A 1EPWA 4IV3B 2R042 2A5ZA 1LHUA 3IKWA 4Z8BA 4AHYA 2CY6A 4F3JA 2ET7A 2HWD3 1MS5A 5HXVA 4IQPA 1TNFA 1BBT3 1YLLA 3QBQA 1PGL2 4DFSA 3USUA 1AVBA 1D2QA 1GQGA 2WT1A 3GZUC 1VBE1 2VH9A 1GZCA 1AYN2 1VAKA 1V6LA 1UF2C 5IK8A 1LTEA 1ZX5A 4W6XA 4LT5A 2AR6A 1GNHA 4OULA 4XZPA 1AR93 4Y1XA 1BJQA 5DZFA 1MVQA 2BEOA 4A2UA 5CA6A 2PHDA 3WCSA 4XJZA 2HWF2 3GALA 2ARXA 5L36A 1I6XA 1YRZA 1C8M1 3GZTB 3AMHA 2ZS6B 3S7EA 3J4UH 1VBC2 4YGEA 2HJIA 4Q4V3 5K0UC 3LA2A 3G6JB 5DXDA 2ZAHA 2WSVA 3FWEA 4N43C 1W6PA 3ZN6B 5BNOC 3VZMA 4W65A 1FATA 5ACA3 3B3QE 1QF3A 4OVEA 2WLQA 1RB8G 4L8QA 4IEUA 1OFNA 3VDDC 1ZVFA 2ZJCA 4MGKE 2K2SA 3N7JA 4HPKB 3AKQA 4XF9A 4HZFA 3VHRA 1C8M2 3RYKA 2GALA 5C4WB 4JGZA 5EYYA 1LOFC 4CYDA 2XJTA 2NYYA 1V6MA 1PVC3 5BXXA 3ZFEC 1VIWB 1YFUA 5FPZA 3THPA 4KU7A 4D7TA 1BMV1 5BV6A 3WT3A 5K8SA 1K5MB 1NQDA 1K5MC 3BOPA 5J98B 5GZDA 1KFXL 5FTTC 3ETQA 5J37A 1OSGA 2IXJA 3IDEA 1CAVA 1OFSA 4WM7C 4AHWA 1SFYA 3JQWA 5KHHA 3OF1A 3ZFFB 2HWB3 1Q8QA 2PHTA 5FPXA 3OPZA 2OA2A 4PDWC 1N1SA 1BYHA 1V6KA 4FOVA 1DF0A 4HETA 5DG2A 3LZZA 1FMD1 1ZYBA 4HBNA 3LKJA 4IEXA 5C8WA 3NV1A 3FE5A 2JG8B 2Z2SB 1S0CA 2OIIA 3LB9A 4IV1B 4ZU7A 1S1AA 4N43A 1WMFA 3AP4A 1PO21 2QKDA 2PFWA 1ULEA 1SCRA 1QJZA 3VL9A 4M3CE 2EF6A 1SEFA 5C6CA 4OHYA 1NCQA 3JB8A 2B5HA 4KL1A 4MGZE 3MZHA 5J48A 5A33A 2KXLA 3JD72 3WUCA 3RJRA 2HWB1 1APNA 2ZGMA 5KXDA 3G7DA 1H2NA 2NMNA 3FHIB 3DPRC 4GWMA 4WM8B 3URFA 3UV9A 4IEVA 4EWAA 1DQ4A 4P9JA 4BZ4A 1VB4A 4ITCA 3J8F3 1G86A 2H6BA 4CRQA 2C0ZA 1EV11 3MIFA 4KU8A 2W08A 4XF1A 4PJYA 1IPJA 2MHFA 1AR63 3NSTA 1QDOA 4FOWA 2RJLA 2UU8A 2AENA 5JMCA 1CD3G 2A3YA 2XJUA 1ONAA 4QPIC 1V9U2 1W6NA 1OOPB 5ABJC 1QQP1 4CDQA 4H7MA 4Q8KA 3OY8B 2WFF3 4HN0A 1YI7A 1R093 1Q56A 4F83A 2D6KA 3DUIA 4XFCA 2A71A 1RUH2 4EN9B 1MVEA 5DZEA 1ZZCA 5JOWA 3BU7A 2BNOA 4Q4Y3 2VNOA 2H0BA 2Q4SA 2ZZJA 3UKVA 3A0NA 4BE3A 3APBA 1FT9A 3FUOA 2WLPA 1ZZ9A 4KWJA 2ENRA 3QCWA 1UU4A 1KRIA 2B8MA 1BCXA 2Q0AA 1AL0G 2Q1MA 1KFUL 4BA6A 4AGRA 2DCZA 5FRAA 3SHRA 1X82A 1QQP3 1U5ZA 4EROA 1LEMA 2XLAA 4XFHA 5C4WA 3QH6A 1S0FA 4GH4A 3WW2A 1GV9A 4I02A 3AZVA 1PGL1 2B45X 1R091 3AJZA 4DINB 1CR7A 1ZBE3 1LGNA 1PO12 4TYSA 5BNNA 2R041 4Q4Y1 1LHVA 5K9YA 4LE3A 4X8NA 2JEMA 1IKQA 1N3OA 1VAVA 4XOGA 3ZXLA 4KG8A 3ILFA 1W6QB 4YFZA 3RI8A 4R8HA 3VBOA 2R16A 1RUE1 1FYUA 4M00A 2UY9A 3HIFA 1JW6A 4PDWA 4YM0A 1FOD2 4DZGA 3S7IA 5DDJ2 3SXWA 3J9SA 3T2TA 3VKFC 2VULA 1H8TB 5AC92 5IK4A 1X8EA 3NL1A 1D4M1 2XB6C 3MF6A 3HN1A 4XE9A 2YHJA 1CIWA 4NPRA 1NQJA 1HXS1 4TLFA 3POYA 3H9AA 1JUIA 2R043 2XWBB 2XWJB 4IEOA 3DF0A 2ZGQA 4WBBA 4OI1A 4D3WA 2GN7A 1YWKA 4K9SA 4LO4B 1R081 2GN3A 1VAMA 1OA2A 1PK6C 1QXJA 2GDFA 1QOTA 4HKWA 3ZFGA 1RUD2 2XVLA 1AX0A 1R1A2 2X8KA 4LBQD 3O0XA 4A7YA 3OYWB 1M4WA 2ZHLA 4WV8A 3I4IA 1RUF1 3KS7A 3M3QA 3ZXJA 4XXAA 2CGOA 2HWE1 3VBFB 5FQ0B 3AXDA 1X8MA 3S0MA