4QU2A

The structure of jmjd7 with alpha-kg
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
318
structure length
318
Chain Sequence
GSMAEAALEAVRRALQEFPAAARDLNVPRVVPYLDEPPSPLCFYRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTELPQLLSDIESHVPWASESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLLHPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWYDMEYDLKYSYFQLMDTLTRATGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords JmjC domain-containing protein 7
publication title The structure of JMJD7 with alpha-KG
rcsb
source organism Mus musculus
total genus 86
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qu2A00
1H2LA 1YCIA 2YC0A 2ILMA 4QU2A 1MZEA 2CGNA 4B7EA 4Z2WA 3OD4A 1H2NA 2YDEA 2CGOA 3D8CA 1IZ3A 4JAAA 4AI8A 1H2KA 1MZFA 2Y0IA 2WA3A 3KCXA 3P3NA 2W0XA 5JWPA 4NR1A 1H2MA 3P3PA 4BIOA 4Z1VA 2XUMA 3KCYA 2WA4A 4B7KA
chains in the Genus database with same CATH superfamily
2R7EB 4AFCA 1TME1 1DFQA 2VUDA 3MYXA 3UJQA 1RUC1 2CGPA 3DKQA 3ZOIA 1W3VA 5GKAC 2A1XA 4QX5A 1C5HA 4WM7C 5JZGC 1DGLA 1W2NA 3O1VA 2QVSB 2VMHA 2BJSA 4OHVA 1JXNA 4TXWA 1WMFA 1ZZ8A 4C0HA 1CAUA 3W5NA 4GH4C 2RDNA 3AMPA 1HRV3 1W6PA 1W6MA 4LJHA 1VBD2 4CCLA 1Q5OA 1DQ0A 4ZXEA 5BNPA 1MS9A 4C8DA 1AR71 3O14A 4CDUA 3IAQA 3OPWA 3LWCA 5A3OA 3LIHA 3T2QA 2E7QA 4XFAA 5DG2A 2W46A 3A22A 3OGGA 3GZTB 3LOIA 3VBFB 1U5XA 4QPIB 3QH6A 5ERLA 4YM0A 1R082 3ETPA 2C9AA 2QZ3A 3MHZA 3OGJA 4AEDC 4Z2WA 5FOBB 5GZCA 1I1EA 5IK8A 3V0AA 4JGZB 4D7TA 1NQJA 4XAAA 5M0TA 1V6KA 4CUAA 2J1SA 3ZPOA 1W8HA 1JODA 1RGSA 4QU1A 4C0BA 3PHMA 3SNMA 4YW4A 4WM8C 5L9BA 5FY9A 3CHXA 4SBVA 2E7AA 5FV3A 1MVQA 4CVUA 1HQWA 1IQAA 2VZ3A 2W39A 1S4CA 2Z69A 1VBD3 3U10A 3WHUA 4AFBA 1RUH3 1OH3A 2XJRA 3O1SA 3ME2A 1ONAA 1N1SA 1UY1A 4XFHA 4XMAA 2RM21 2XVLA 5F6KA 2VVFA 4LLOA 4BLIA 5FY1A 2MHFA 4Y5TA 3ZO0B 3KSCA 3DECA 1JZ3A 1PNFA 5BPXA 4A41A 4CCDA 4AK3A 2GNMA 4BK5A 2E9QA 1SPPA 2XWBB 2YFUA 2CYFA 1R083 1O7FA 1XNBA 2ZGSA 4GWMA 4QB2A 5DUUA 4NAOA 2JG8A 5FP9A 5GZGA 3MLJA 5K0UC 3GJBA 1YFUA 2XGXA 3I8TA 1U5ZA 4JQRA 1QQP1 1VRH3 3OY8B 3SLIA 3AVSA 1DBNA 2IXJA 3AL6A 1VMHA 4R4ZA 1RUJ1 3S7EA 4CTEA 5KXCA 1ZBA2 4LBJA 3VBOB 5L9VA 2E6VA 2R063 1NAEA 1JYXA 4AEMA 2WUHA 5C9AA 3RMYA 3KWVA 5FYZA 3VDDA 5JMCA 3B69A 3SHRA 1I5PA 1OPMA 4CEYB 1Z7S1 3CZUA 4FPYA 1FMD1 3PURA 3T30A 4EN7B 3POYA 1HB4A 2VCBA 3I2FA 3PVOA 3RZGA 4PLOA 2W1QA 2XHNA 4UW4A 4I09A 3CMGA 3UYJA 1GV9A 2DVDA 2MEV1 1MS5A 4V1PA 1BKZA 2J1AA 5FP4A 4E8CA 4EWAA 3POBA 3SEEA 1QU0A 1MQTA 2V72A 1VBE1 1DP0A 2WZEA 2PN5A 1AXYA 2JDNA 1MS8A 1RVF2 1RC6A 1R092 1W9TA 1JUHA 1AJKA 1R64A 2JDMA 1VAVA 2P5BA 3ZX7A 2RV9A 2XB6C 4Q4V2 1A78A 2ZBJA 3VBRB 3N9NA 4QQPA 4RHV2 4Y1XA 4FSJA 2CY6A 2BWAA 1RITA 4HL0A 2P6HA 1SZBA 1UL9A 1TG7A 4Q0SA 5BV6A 1QJEA 1Y9QA 1LOAA 3MIGA 1NZCA 3WP6A 3ZXKA 3K4AA 1WWYA 4WV8A 3BU0A 4ES8A 5B4NA 1RHI1 3R05A 4IEOA 4HVRA 1W8WA 2JICA 1W0PA 2A6XA 2YYOA 4D6RA 2VZOA 4IETA 4MGIE 1BQPA 4LITA 5I0SA 4A42A 4M3CF 2VO5A 1TQ5A 4IGOA 5FZ0A 1AX0A 1W04A 1UYZA 1JU3A 1ZZ6A 3K2OA 1WMXA 4RR3A 5F6LB 3EHKA 4LO6B 2W68A 1ULDA 4HBNA 5G05L 1XQNA 4P9XA 1BK1A 5CKNA 5FZHA 2D98A 2EALA 4QPWA 3VBFC 3WP5A 3I2DA 3HNYM 4UF0A 2D40A 4GA9A 4MGZE 4QPIC 5EPAA 2ZGKA 1OOPA 4RHV3 2ID4A 1ZVFA 4GMP3 4JGZC 3KV9A 3WDUA 3KHBA 3E6DA 4JHTA 1NZIA 1UY2A 3CF6E 4UFLA 5CFDA 4CZSA 4DQAA 1QH7A 1QNWA 2F4PA 4JTOA 1XNDA 1Q43A 4XJUA 4QD2A 4NMIA 1Y4WA 4NIDA 5BNNA 1I9RA 1OQ1A 4YGCA 1W39A 4XBNA 2HWF3 2BW8A 1OA2A 2P34A 2R071 4O9GA 3RWKX 1V6LA 3ZPYA 3AMMA 1OQEA 2RS12 2VNVA 5FYTA 5CFCA 2Y34A 4A7ZA 3WG4A 3KCYA 4GWNA 3LEMA 4B7KA 2ETEA 2W92A 2B46X 3GDBA 3NNLA 4KWLA 1C3HA 1LU1A 1ZZ7A 2PHTA 4FO9A 2I2SA 2ADEA 2RG4A 1SMVA 2A70A 5A3TA 5FFOC 3K3NA 1EPWA 3DV8A 4QKBA 3WNLA 1CJDA 3VKNA 3VBRC 1UMHA 4ASLA 4LE4A 4Z2AA 3I59A 1NOVA 1SBDA 3HR9A 4MXVA 3H8RA 1ZZBA 3JBG3 1DDLA 3IT8A 1NUKA 2UYAA 1H30A 3ST7A 3BI3A 1CPMA 2RVAA 3ZYRA 4NN0A 3ES1A 4LORA 3WNNA 5FP3A 3WW1A 3FUOA 3GYDA 1L3JA 1W6QA 2E63A 3VBOC 1J84A 4GAZA 1JS9A 4CCNA 2WRAA 5JOZA 3I3MA 5IVVA 3KHCA 2ET1A 5FZAA 4AEKA 4LO7A 4CEYC 3ZFFB 2RS13 4RS5A 1LJ7A 5C8WA 5LA2A 3H0OA 3PUHA 4LBNA 5FR3A 2XOMA 2VW2A 5CADA 4FPHA 2GSYA 1CN1A 4AHYA 1PIV1 3N7LA 3LIGA 2XPJA 5HCFA 4XBQA 3OSDA 5FYSA 2D93A 5DABA 3ZXGA 2WR9A 4CXYA 3A0NA 3CJIB 3JZVA 5LK5A 4BYYA 2XLFA 4IV3A 4DXZA 2P3IA 2BUKA 2WLPA 2JD4A 1PGL2 2J1RA 1ODNA 5F37A 1JYTA 5IVCA 2YB7A 2QQUA 3E6BA 4LK7A 4XQ4A 4ISRA 1UY3A 1SDWA 5EJZB 1VB4A 5LRSA 4R52A 4UFIA 2WZR1 3WG1A 4MH0E 3ZMNA 5ISLA 3POWA 2WQ8A 1KXGA 4Y1VA 4P02B 4D6SA 4CDWA 1VBA1 5IAXA 1WCUA 3M70A 1BK0A 1FXZA 4MHRA 2J7MA 4BH9A 2V09A 1Q8OA 1VBB2 4JKLA 4PIZA 1J1LA 3WW4A 1DQ1A 1FATA 1HRI1 1ND2C 2JKBA 3HMYA 4GB32 4NWWA 5A7QA 2OYZA 5ABJB 1V6MA 5FMDA 1O6UA 3M4FA 4N53A 4ARYA 3I3EA 5T5LA 3LFMA 3PMEA 2PAKA 4L92A 4YW5A 3OOXA 4WZFA 3GALA 4W6WA 5T5OA 3KT4A 3P5BA 3VKOA 3C3VA 3CDZB 1LOCA 5ACA1 5F39A 4HVOA 5LBBA 1PVC2 4GWJA 4CP9B 1UX6A 4N43A 2VECA 4AE2A 5FXZA 4AVSA 1LU2A 1LOFC 5C3PA 2IXCA 1V9U1 1WMEA 1OPOA 2TEPA 1ZM1A 3LGRA 3FZ3A 4UT5A 5A7WB 2HWC1 4IEVA 4LK6A 4HKOA 4KNCA 4CA9A 4WVZA 2R041 1POV3 1OF3A 3MIEA 3ACHA 5D1IA 5FZDA 3BTYA 1WCQA 4LUKA 2PAEA 2PHRA 5FWEA 3U0ZA 5G04L 1K5JA 1YQCA 5FYVA 3CEWA 1AYM1 3RI9A 4Y20A 4R9DA 2P3KA 5J3UA 3ZXEA 3BALA 4V2WA 2WDBA 4K1ZA 3I49A 5IK5A 1RUG1 4AI8A 1AL21 3AKSA 1HXS1 5LWBA 2C1FA 2FMDA 4XJ8A 5AC91 2VY0A 2WQ4A 1IKQA 3JXSA 3D6EA 1XSRA 1O3TA 2DCYA 2GN7A 4MYEA 1L7RA 4XCAA 5A6ZA 4N7UA 5HPOA 2PMWB 2AUYA 2ZMLA 2V73A 4GKXA 2SLIA 1PVC3 2QQIA 5HCBA 4A6SA 5KHGA 1UOJA 4K3UA 1LHUA 5T5PA 1AR81 2G9FA 2IC1A 1GSLA 5FZMA 1H2LA 4YW2A 2P4EA 1QJX3 1MZEA 2RDSA 2VPVA 2XUEA 3NJVA 4RA0A 5A33B 4BK4A 5KBFA 4ATEA 2WZ8A 1OXCA 1YC61 5LY2A 3RMXA 3ZFFC 4ZU7A 3HQRA 1YO8A 4JHZA 4NAMA 4FFHA 4YW1A 1W8ZA 5IFTA 1W8FA 4KG0A 3VUOA 1YLLA 4DPNA 4M3CE 2P2KA 1CD3G 4YYOA 5I0DA 2BGPA 4P08A 5DAVA 1QDCA 4LUMA 5CVRA 3T2TA 2PHWA 2WS92 2GMEA 1SLCA 3AYCA 2XKOA 4P9IA 3LKJA 3ZSLA 5F2WA 4GQ7A 4LLFA 4EYUA 2VMGA 5AFBA 3CJIC 3F2ZA 1ASJ1 3IDCB 4COVA 1WW7A 3W59A 2PA7A 2CGNA 4XXAA 2H0BA 2HYKA 2UY9A 3S5QA 5JXJA 2BBVA 1NX9A 3M7AA 4YVWB 1XNAA 3HPNA 4LPLA 4EN8B 3VDAA 3M3CA 1GZCA 3J9SA 2BRTA 4XETA 1WLWA 4PDWA 2OIIA 4FQZA 4GXLA 5FXWA 4N7IA 2GC1A 1IPSA 1H4GA 2DBIA 2YMZA 3LSEA 5LY1A 3H42B 3FFZA 4QHBA 4BOWA 4XJ9A 4Z8BA 5KHKA 1QIQA 3DL3A 4JGYA 3WSOA 5JOXA 2P1BA 1FNYA 3TN92 4C1XA 4F3JA 5ABJC 2PHFA 2TNFA 2V5DA 2EAAA 2ARAA 3KF5A 2JIGA 3VBSC 4Y1YA 2FZ1A 4AAPA 4U36A 1O59A 4CDQA 4N8MA 2WS93 3LB9A 3B00A 2XJQA 3SQOA 3LAGA 1VE0A 1LODA 5TSWA 4D69A 5DDJ1 4XHBA 2RS52 3AYAA 1I6XA 1O91A 3OGVA 3ZFGA 4JC1A 4FI9A 3R4DB 2VMCA 4IQPA 4UW5A 5FYMA 1AF9A 2JE9A 2W0XA 2XKPA 3USUA 3NWKA 4GALA 2LS6A 2OUHA 1JN2P 2V5YA 2P17A 1FPN2 3HIFA 2QJVA 1W8TA 3T09A 4DRRA 5L7OC 2WO7A 2ZEZA 5K9YA 2XL7A 1CAUB 1YFXA 2DWRA 3Q9OA 4D7SA 3O5SA 1QXJA 4COWA 1W6PB 1JYCA 2CAUA 2JXAA 1LOEA 3ZYJB 5BNPB 3BKZA 2D6LX 1TVGA 4AHWA 1JZ2A 1XE8A 3TN93 1DLCA 3JQWA 3M3EA 3NV2A 4XJAA 4CDUB 2IFWA 2PYTA 2IXLA 1ULPA 5DXDA 5LATA 4NRQA 2OPKA 1ZRDA 4S2HA 3N36A 3D5OA 2FCVA 3IM0A 4MOAA 1W9FA 4Q0PA 5A6XA 1EP0A 3S0MA 5C71A 2RS53 3K75B 3O1UA 4XUQA 2BDRA 2Y6KA 3C7OA 1BEV1 3V0AB 1VB2A 2W94A 1OA4A 3J8F2 5GZEA 5LB6A 1GQHA 2PAMA 1W2TA 3GGLA 1F15A 2VQAA 1D4M2 3DGTA 4YG6A 3CQOA 4HXCA 4HLTA 4E9KA 1GOFA 1FPN3 1WLDA 3RDIA 3QBQA 4J6GA 3GZAA 3AMQA 1W3XA 4AW7A 4MXWA 4FAGA 2ZOEB 2WAOA 4M4PA 3U4SA 3EO6A 2FZ2A 1RMU3 1ZX5A 2YROA 3FJSA 1J83A 1PVXA 2VQ0A 4Q4X2 4Y24A 1PO12 2TUNA 2B45X 2W52A 5FZCA 2CL2A 3MW3A 3WDWA 1GWLA 3VZMA 2W1SA 3ZFEA 4UYBA 1OLMA 3DPRB 3NAPA 1KS4A 4BZ4A 1RB8G 4LKDA 2AR6A 3H8UA 4KI5M 1ZBE3 4XQDA 3ZSEA 1Y9GA 5JIUA 3J8F3 5T50A 4OZOA 1VALA 2DCTA 3GCXA 3OJBA 1D4M3 2EIGA 4SLIA 3POFA 1K5MB 2VE1A 4YVWC 5EZWA 3NKTA 3HD8B 3H1MA 4ZZ5A 5D8AA 1MZFA 2NMOA 3PTYA 4G9SB 4QX8A 2WKKA 2QQJA 2XVKA 4M4RA 2JDZA 5EYXA 5C9AB 4IV1A 1H8TA 3VDDB 3LOBA 2YBPA 1QJZA 1UMZA 3ZN6A 2R0FA 4FOYA 4QPGA 5JOYA 3ZSKA 2XONA 4MO3M 2DUPA 2W95A 1KDMA 4XFBA 5IJRA 4AFMA 4BIOA 2X5IA 1TME3 5JXIA 2DTYA 4QXKA 5IW0A 1WZXA 1EAH1 3N9QA 2W91A 2EVXA 3BYWA 1MQTB 4LKFA 3ZR6A 3GZUC 4OUEA 1OH4A 2EA7A 1FOD1 1LKNA 2L9LA 4WM7B 4TZDA 1H6YA 1RUNA 3GM8A 2A6VA 1PO22 2XVGA 1LOBA 1OSGA 3RJ2X 3NJZA 2BFUL 4JAAA 4XUNA 4EWEA 4CPBD 3P6BA 2XLGA 2WA3A 4YPJA 3POGA 4ARXA 4L11A 4EZ4A 5JUVA 1UF2C 2RR12 1AR73 3NSTA 1AX2A 2Z79A 1URXA 4CP0A 2GMPA 3WQ0A 2DV9A 3VDCA 4YW6A 1MEC2 2ZMNA 1GZWA 2PELA 2W47A 1HQNA 1OF4A 4XFIA 2RS32 4IE6A 4LHNA 1HN0A 1O4YA 5F5CA 3RZHA 1DIWA 3NNFA 2VOVA 1ULGA 1RUE2 3N9MA 1QJFA 5BNPC 5C8CA 3WCRA 4RR3B 3LQCA 5JR2A 3WNKA 2G1MA 4CDUC 2W9XA 4LIUA 1PMIA 1VAKA 1CX4A 4OHYA 2BP6A 4MADA 2CNAA 1RUJ2 3ITQA 3LA2A 2YPDA 1ULCA 2SBAA 3EB7A 3OPZA 3PUAA 3RRDA 4UF0B 4Q8KA 2J42A 4META 1TZOA 1UU4A 2DURA 2JEMA 4WM8B 1PO23 5F9TA 5FZIA 5H9SA 1BLZA 2VJXA 5KC5A 1GWMA 1S0EA 2ZXQA 3I3QA 2P3YA 4FCAA 4QM9A 2ZGNA 3APBA 3CKHA 4Y22A 1GUIA 1G8WA 1C4RA 1W8UA 2KXLA 4Y5SA 5CFDB 5IVJA 1W9YA 3I7DA 2RM23 3ZDVA 1QKQA 3SH5A 3O1PA 2YV8A 4AI2A 1OURA 3KZ4C 1QJY1 5BNNB 4HSLA 4Q4W1 2RS33 1G86A 1LHVA 2VZTA 1OBNA 1XRUA 2Q5TA 3DYOA 1LCLA 3VN4A 1RUE3 4R9AA 1FI2A 4CP1A 4A2UA 1PZ9A 2YPJA 4GWIA 4D3WA 2C5DA 5B2GB 5DAQA 2WN3A 4MX3A 4NROA 3T0DA 3UNPA 1UIJA 1WGPA 2ZA9A 1KJRA 4LBOA 5FPZA 1RUJ3 2OKXA 3V0BA 4B4PA 3PNAA 2XJVA 2PXJA 1RXFA 5H9QA 2IXHA 1MVEA 1RUD1 3C8XA 2GZWA 4HSJA 3I59B 5CKQA 3U75A 1O5LA 5L73A 4BQ3A 2VVEA 5FDBA 1FMD3 1SCSA 2JG8C 4FXGB 4JDOA 4CU8A 4UBHA 4FQ4A 4FPLA 3EXUA 4E8DA 3IMMA 2JB4A 1O5UA 3MPPG 1TE1B 4X6RB 1N3QA 2MEV3 3WNMA 4DY3A 4CCCA 2DVFA 4LBMA 2VH9A 1TMF1 4NUBA 1W6QB 2GU9A 1IS6A 1VBE3 2VZSA 3GBWA 4IGQA 5C3SA 5KHJA 1D0HA 4P9YA 5C9AC 3VDDC 2QQOA 2QFEA 4AVTA 2K9ZA 3TEYA 4QX0A 1BMV1 3SISA 2ZGPA 5C3RA 4QQ2A 3MLKA 3I2JA 4KL1A 3AXDA 1COV2 4QM8A 1JZ5A 2WYFA 3B01A 2HWE1 3FL7A 1MQTC 1QDOA 3THDA 4C91A 2Y6GA 1RHI3 2PLV1 3QD6A 3LFIA 5CA6A 4YFZA 3NNGA 4XEZA 3OGSA 1IZ3A 3WF4A 1WW5A 4XAEA 5IVFA 2HWD1 1NLRA 1LECA 2B39A 3BOPA 1YHFA 1W0NA 3HWJA 4IV3B 4R8HA 1PGSA 2VMEA 1GMMA 1RUH2 4BM8A 1EY2A 3BUCA 2Y6LA 4BMEA 3Q8FA 3ON7A 4H14A 3VKLA 3CNAA 2GC2A 3H9AA 3RYRA 1LGNA 5JOWA 1TNRA 5C5TA 3VV1A 5K4LA 4JRAA 4XZPA 3PVEA 3WDVA 1SLLA 1RUI2 2ZX2A 1CAXA 4N9HA 3NKGA 1VP6A 1AR92 4QWNA 2LTNA 4RR3C 2WFF1 4JRLA 4AQ2A 5DUXA 2D3SA 1COV3 5SV5A 4YW3A 1VRH2 3IWZA 4LA2A 4PQ9A 3PMSA 4Y5Z0 2QQKA 4ZONA 2D43A 2ES3A 5EWSA 4MHUA 3IBMA 2G19A 2R062 5DPNA 5E1RA 4PBPA 1R1A2 3B93A 2ARBA 2C26A 4XBLA 2QQNA 1OOPC 2OVUA 1F35A 3SMHA 4CDXA 1SFPA 2XH6A 1AYN2 3R0RA 4XCBA 3X29B 1IQDC 1DYKA 1NY72 1V6OA 2ORXA 2OX0A 2BGCA 2X09A 4KWUA 5CFDC 3MIDA 5K7PA 4N43B 4G3YC 3HJRA 2D7FA 3ECQA 2JD9A 4O61A 4XF1A 1XE0A 1JBCA 4HG6B 2F4LA 5BNNC 2QBXA 3OTFA 4DXRA 3RVHA 1YIFA 4GJZA 3CIHA 4Q27A 3WW2A 2DTWA 1RUI3 1AR61 1HJGA 2JDKA 3GJAA 1I3HA 3OPTA 4KGQA 1BZWA 2AYHA 5FY0A 5JIAA 3K4ZA 1AR93 4E4DX 3WUCA 5CG9A 1GOHA 1LTEA 3JUUA 2OW4A 4H2AA 2CAVA 1UX7A 4OULA 4BQ4A 1T6BX 3LCPA 2Q30A 5A3MA 5J37A 3J7MA 1ZNPA 4XDOA 5CBLA 1GANA 2XBO1 4KU7A 4U2AA 4JTNA 3UL2A 3RPQA 5FYCA 3SCFA 4AG4A 1R1A3 4UW3A 4URAA 1XC6A 1S2KA 1JHJA 4LBLA 1AYN3 2CSGA 1PHMA 2DU0A 4QHZA 3U37A 2KM2A 2Q8CA 3UKNA 4Z07A 5F3CA 1Q3EA 3IDEA 4D94A 3RYKA 5GLUA 4AHXA 2DCZA 5FIXA 5LZ6A 4Q1RA 4RS5C 1RTVA 4S2GA 4MGQA 4Z1VA 5AFEA 3ZXLA 4Q0UA 3NO8A 3POSA 1JZ7A 1OUXA 3VD5A 5IT6A 1HQLA 1PX4A 4XMIA 3TEXA 1XU2A 2PTMA 3LA7A 4QQLA 3PVBB 1UZZA 1QWRA 3AKPA 3LD8A 3B9CA 3M2MA 4DINB 2R042 3WDTA 3AMHA 2NQYA 2NYYA 2WINB 1VBC1 2HWF2 3I2HA 4OFGA 4ZS3A 1OFNA 3H8XA 4BIFA 4IV3C 4AFAA 4RN5A 3W21A 2ARXA 1OMIA 4BISA 4O7XA 2J1UA 2VZVA 3ZXDA 3N7KA 1MS1A 4YG0A 1W6NA 2BGOA 2A3YA 1ND2B 2A71A 2GH8A 3I54A 4P9JA 1HJFA 1PX3A 1JI6A 1KFXL 3BIEA 1CZSA 3MBWA 4CDWC 5FUIA 4PDWB 1RUOA 1DLLA 2D6MA 1LB2A 2HEVF 3S7IA 1UOFA 3BIWE 4A7KA 1FNZA 4YZ5A 4QX1A 5ACA3 3JBG2 5C7GA 3TEZA 5LW9A 2O14A 2CU5A 4JGYB 4ORFA 1O3SA 2VCMA 1D2SA 1RIRA 4HZFA 4BQ1A 4N53C 1GNHA 2I07B 3AZZA 4BQ2A 1J3PA 3N9PA 1HRV1 1NE6A 3AP6A 3K3OA 1YFWA 1GOGA 5E88A 2OT7A 3TNQA 3B02A 2AC1A 2R043 1US2A 2A5ZA 2PHLA 2Q8OA 5FP7A 5HCAA 4DIQA 3MIFA 5FZLA 3HQUA 3MLLA 2Z5WA 3ZFGB 5I93A 4UI9L 1C8M2 1MZ5A 3O12A 4BWOA 4CE8A 4IDZA 1AYM3 4N43C 2E51A 1AL0G 2RE9A 3USUB 3WX5A 1QJU2 3HT2A 3T3YA 2FDHA 5L19A 1VIWB 1RJ8A 2VXJA 1QOSA 4JZRA 1H4HA 2HBUA 3UGGA 5AC93 5F5AA 3MZHA 5EP9A 1HB2A 5KC6A 2EICA 2E53A 5LA1A 2XJTA 1W99A 1W2OA 2BFUS 4XF3A 1RXGA 1J3QA 1YEWA 2ZZJA 1GFF2 4CSWA 2BYVE 3J7NA 1SHWB 1AR83 2V4VA 1NQDA 3ETQA 3MFCA 2R16A 5A3PA 4S2DA 2W87A 2Q1FA 5FK7A 4OI1A 3T4VA 1K42A 5DZGA 4HPKA 1C8M3 2ORZA 2XJUA 2D6OX 2GDFA 3NVCA 3TAYA 2IUWA 2FBEA 4FOQA 5DN2A 1JUIA 4AF9A 1WUVA 3C7EA 3OBTA 4PBOA 1YQ2A 1GNYA 1QJU3 1R081 2ZGOA 4MGKE 1LAJA 1WCKA 2RHPA 1G9FA 2J1EA 5JWPA 3M8LA 3UKTA 4DMIA 1S0IA 1C1LA 3GNEA 3LE0A 3E6CC 1W6OA 2BVVA 3OEAA 1A8MA 3A0KA 3KV5A 3AFGA 3G7DA 1ASJ3 3PTRB 2X29A 2A6YA 3I2OA 4ZS2A 4Q2FA 5CZKA 3RYPA 2VTXA 4BXFA 1UKRA 3PU3A 2CV6A 2ZAAA 2F17A 3J7LA 1YUDA 4KWJA 3RZMA 4CU9A 4A4AA 4QU2A 2KR2A 3AL5A 2MPFA 2VZUA 1NCQA 1DZRA 5L36A 1PK6A 1DZQA 4CCJA 5AVAA 2P3JA 3NAPB 4LBQD 4LO4B 1TNFA 3VHOA 1VLNA 4B29A 2GAUA 3O1TA 1ZRFA 1CIYA 1W0OA 5A3UA 3WINE 4B8EA 5T52A 4L97A 1OKOA 2QZ2A 5GM0A 4UFKA 3EYPA 4FP3A 4XF4A 1DHKB 4OQ9A 1GZ9A 1HN1A 1WBLA 5FZ8A 4IW3A 4LHSA 3BOWA 1F31A 5EHDA 1XYOA 3HAGA 3S5AA 4W6XA 4FT8A 4BE3A 3VBSB 1LEMA 1DQ2A 3WNXA 4NOTA 1GZTA 1YCIA 3AP9A 4C1WA 2BNMA 1H8TB 5A1FA 4PDWC 1W9SA 3ZN6B 1MPXA 3PUQA 2D6PA 3EMRA 3ILRA 1ZBA1 3NW4A 4QPGB 1S2EA 1F2NA 3UT0A 1LGCA 1S2BA 3VZOA 4JGYC 2YBSA 1WA6X 2X5IB 5HXMA 3JB8A 3M3OA 4NWVA 4OUSA 4BJ0A 2ZX3A 3O0XA 1UZWA 4JX0A 3WD5A 2WN2A 1E5SA 2GH2A 1APNA 2C4XA 1G9CA 3KCCA 1VPHA 3WDYA 4CDQC 1H2MA 3ZSMA 4DNYA 4UFHA 4O9EA 3AXEA 4HKLA 1CIWA 1CGPA 1QJX2 4RGKA 5IWFA 5FYHA 5L7OB 3OYWB 4XOGA 5FZ6A 1LGBA 3T1LA 3ZFGC 4ASKA 4EWDA 4MG2A 3OEBA 5D2AA 5FZOA 1LNSA 1QOTA 1QNYA 4OHWA 5A7NA 1ENSA 1RVF1 5K8SA 1R091 4QHOA 1X50A 1CAWA 5FKBA 1GZWB 4Q4V1 5C33A 2CGOA 2EIBA 1HB1A 2YG0A 2RMU2 4RHV1 2XR4A 3FWEA 5CIRA 4BDVB 5F2SA 4QX7A 4ET7A 2XHKA 3KB5A 5J7MA 1UAIA 1BEV3 4YVSA 5C8CB 2ZEYA 4LBKA 1Q8QA 4N90A 2XLAA 4XUTA 1AHSA 4CP2A 3E97A 1JZ8A 4JV4A 4QKFA 4LBQA 2W2IA 1LHNA 1OD3A 5FZ9A 3DXTA 3O7OA 5GLZA 2VCAA 2XQRA 3BB6A 4DEVA 4YSFA 3KF3A 1X7NA 2ZAHA 2H6CA 2QUOA 4G4FA 4Q26A 5D21A 3MEPA 1HDKA 1CPNA 5J98B 5A6QA 1F9KA 3HEIA 5I0TA 4Y22B 4A7YA 1DYOA 2WFPA 3O1MA 3KS7A 2VMIA 4JDNA 2RMU3 4ZKTB 2VZ1A 4D7YA 2Y38A 4K20A 4QMAA 3UGHA 5C70A 2HEWF 2OA2A 3IPVA 4OVEA 3LEKA 4AVVA 4RGAA 4XUPA 5IAVA 3MV01 3O0VA 3OB8A 4NPLA 4OYUA 5FZKA 4I0AA 2RDRA 1SLTA 4RGGA 3FLPA 3F95A 3M3IA 1UW8A 4GMP0 3SKJE 2DF7A 1D4VB 5IK7A 3V0BB 3R4UA 4D0QA 1GP5A 2RS11 1YRZA 4IL7A 4YZ4A 5IUQA 5IVYA 4QKDA 4ZPIA 1UWWA 1MS3A 3KD4A 3ZFEC 3KMHA 3NAPC 3DCQA 1K45A 4AQTA 3MF9A 5FO9B 2CDPA 3VZJA 5LEJA 4LR4A 4B4QA 4AR2A 5IK4A 3KT7A 2JKXA 2WSUA 1SACA 5FJKA 1C28A 4I02A 4B1LA 4CUGA 2VOXA 1SEFA 3LZZA 1YNAA 5HV0A 3NNJA 1CQ9A 1ENQA 1NYWA 2DFBA 3TEWA 4FOWA 4CCEA 3SEPA 5BY5A 3VBUA 3I97A 1PM4A 5D8AC 2W5FA 3OG2A 2ZX4A 2YC0A 1J59A 1OT5A 1WCDJ 4XW3A 2YHJA 4IV1C 1H8TC 1X36A 1IG0A 1X33A 4KG8A 5A7PA 4YGDA 2W08A 1T6GC 4BCUA 4COYA 4QPGC 2ZMKA 3U78A 4BB3A 4PLNA 3A4UA 4XDPA 3AMNA 5EIYB 3ALQA 4IE5A 2GNDA 2X5IC 1UPSA 3PVNA 3AYDA 3UGFA 3WW3A 4M0HA 2AEZA 1ZA7A 4OLLA 2D3PA 2ZS6B 3LEGA 2A6WA 1GBGA 3RFRA 1H6XA 3A7QA 2VQTA 2JDYA 2RJKA 1KGYA 1BBT2 3H3UA 2WO1A 4WVMA 1XOYA 3ACGA 5FXVA 5FY7A 4PJYA 3RWNA 1P8JA 3T1MA 2EXIA 4LOSA 4ASMB 1W6MB 1ACCA 5T55A 1IHMA 5FPLA 1RMU2 2HWB2 2VOWA 5DUWA 2DUQA 5LBEA 3UK9A 5T3NA 3LDRA 4XPVA 3HBKA 1PGL1 1D0GA 2YXSA 3ILNA 1F4HA 4INDA 1AVBA 2RJLA 2WNUA 4PT6A 4OQ8A 1C5IA 1OLQA 3ATGA 4DUXA 1JMUB 3HVDA 4HKWA 4XILA 1CAXB 5J36A 5C6CA 1ZBE2 2HH9A 5C8CC 4O65A 4DOUA 3WEZA 3SKVA 1IOAA 4LTAA 2ZHLA 1O8SA 1TMF2 2XMLA 4FFGA 2FD8A 2ZKLA 2GC3A 3ACIA 5F32A 1QJY3 2Y60A 4ZHNA 1VBB1 2Y33A 4FOVA 1OFSA 4GB31 2W3JA 4M0NA 3UESA 3VHRA 2Q0AA 1BBT3 1VR3A 2X53S 3FMGA 4PIXA 5KHHA 4CDXB 4MLOA 4FPKA 1S0BA 3K51A 4KGGA 1NA1A 1OHFA 4B4RA 5FTTC 1ULFA 4EQVA 1Q8VA 2HWB3 1V70A 3ES4A 3M1HA 1W2AX 3HNBM 3ZFFA 2ZHMA 5FZEA 4NRMA 1TME2 3JD71 1UMIA 1RUC2 5JCTA 4CUCA 1SBFA 2IXIA 4NJ4A 3EBRA 2B42B 1Q56A 4LULA 1PVC1 1BCXA 1NE4A 3CZJA 3LPGA 3MW2A 3ROUA 1SPPB 5LASA 5IVBA 1AZDA 1GICA 1X9PA 4LIVA 1YI7A 2ZGTA 2JG8B 4XZUG 3J26N 5FYIA 4CRQA 2Y8KA 5HV4A 1VRBA 2I74A 1SBEA 3WOGA 4KQ7A 4ZXKA 1B35A 1AR72 5T5JA 2JDAA 4P9LA 1TMF3 1KITA 2ET7A 3RGBA 3RQ0A 3VBHA 4IEWA 4XUOA 4BQWA 3C7FA 4M3CA 3KV6A 2CWMA 3RZLA 1N47A 3CBNA 2NP0A 1V6JA 4FFIA 2XQXA 4P00B 4JKMA 1UZ0A 1XNTA 4TSVA 3WQBA 5IATA 1AX1A 1BYHA 2AREA 3POJA 5FPVA 1KRIA 3USSA 2CTVA 1POV0 2WO2A 3AKQA 3THPA 1H1AA 2VW0A 4AQSA 3N4MA 2FHRA 4QDRA 2BQPA 1O4TA 2WQZC 1IG3A 3AVRA 4BPZA 4RFT0 1ND3A 5LBCA 2WA4A 2Y6FA 4TYSA 2HWE3 1RUC3 4DB5A 2WT2A 4PI0A 4HMZA 2FCTA 3SH4A 4B7EA 1AUYA 1DGWX 3VZNA 3MDPA 2BV4A 3N9OA 4NHLA 2HWD3 3FC0A 1J1TA 4OZXA 5JDBA 1PGW1 2PFWA 3J4UH 4IE4A 1ZRIA 1YWKA 1UO9A 3U07A 2XWJB 3FLRA 3IDAA 4LMFA 4CEWA 2QCSB 3VD4A 3N9LA 4LE3A 1UCXA 2R0HA 4MGTA 5EQUA 2RM22 2E26A 5FQ0A 1US3A 2EXKA 5IVEA 4CXWA 3S57A 2XXZA 2W1WA 4KH9A 4IERA 3NV3A 3O1RA 3NQHA 4HETA 5FLIA 2VU9A 2WS91 3E5UA 2HEYF 5DUVA 3GBGA 4ATFA 1GKBA 1MACA 3WCSA 2HYXA 4H7MA 5EXOA 1QQP2 1H0BA 5KXBA 3I3DA 1FYUA 5L9RA 3TOJA 3T08A 3ASIA 4OI2A 3P1IA 1NLQA 1EV11 4CUBA 1F8VA 2JWPA 3IMNA 3DEMA 3K4DA 4BU2A 1HB3A 1DU3D 3HNMA 1YJKA 5F5IA 5IYYA 4QKNA 3ZXJA 1OOPB 1Z7S2 4NO4A 1FMD2 1QEXA 2D97A 3ILFA 5FKCA 5KR7A 3SH3A 3PIGA 5A3WA 3WV6A 4QGMA 3B94A 3VD9A 1Y3TA 2MEV2 5EJ3A 1OC1A 1BVP1 1HW5A 1SFNA 3KVBA 2E7TA 3SC7X 3ZYHA 1IGOA 5GZDA 4KMQA 4CXXA 5T54A 2Z4FA 4GIQA 1VBE2 1K12A 2VVDA 3TN91 4D6QA 3Q8EA 3CL1A 5GALA 1AR63 2RDQA 2G4IA 4CDXC 5FREA 1RUF1 1YQ6A 3UJOA 2Q1ZB 3HN1A 1KJLA 4BQXA 2GMMA 5CFCB 1JYNA 4XF9A 3CLPA 2VL4A 1N1VA 3QH7A 1U0AA 4HANA 2VM9A 2FMYA 1UPIA 2OQ7A 4W4ZA 1QQP3 1CZTA 2RS51 4W8JA 2GP3A 2ATFA 4XVHA 1R1ZA 5E89A 4A3XA 3SITA 2GN3A 3C7GA 3OUHA 5BNQA 2XBO3 3I2KA 3H3ZA 1DF0A 4HK8A 3VZKA 1RHI2 4YM3A 3D4KA 4LOTA 1H9WA 4L2NA 2D6KA 3WLUA 1CONA 1CJPA 1Z78A 5LA0A 2VUCA 1Z7S3 2O1QA 5FJHA 1JYVA 4H55A 1FPN1 1AJOA 1UY0A 4AOCA 4UOJA 4XXPA 1F5FA 2WO3A 5F3EA 1YIPA 2XDVA 3UETA 3WXPA 1PMHX 1PZ7A 5FUNA 2IFRA 4PQQA 3ZXAC 4AQ6A 4IE7A 4B3NA 5A6YA 4NIHA 5FZ3A 1DQ4A 3V65A 4I2OA 1SCRA 1POQA 1YXWA 4YGEA 5EJ1B 1FAYA 1FT9A 1QH6A 2IVIB 2DFCA 5GJ6A 5FWJA 2ZZQA 4XHXA 3WNPA 4NE9A 4HPKB 5J48A 4OMDA 4I3PA 4RS5B 2UWAA 2X05A 1EUUA 3K48A 1G9BA 3NJXA 3KQRA 5F5QA 1XE7A 1QY4A 1UD1A 1W9WA 3AZWA 4XACA 3S6PA 4A45A 4ONUA 5FLJA 1Q8PA 2E31A 5C4WA 2J1TA 3J8F1 5KXDA 2WWJA 5FUPA 4IEXA 5GLVA 1OA3A 1NT0A 1ST8A 1D4M1 2R072 5DAPA 5ANNA 5DAWA 4DUWA 5LK7B 1W8OA 5HXVA 1UOGA 4OHZA 4GZ9A 1QHDA 1M06G 5E8AA 2FDIA 5FZ4A 1QGLA 1GR3A 3RI8A 3PDQA 5HBAA 1UOBA 4YZ2A 3C7HA 3PUSA 1NCQB 5CYYA 1O8PA 2VCCA 4Q1PA 1PK6B 3AKTA 3VL8A 4FP2A 3GCWA 4XTMA 1G9DA 1UYXA 4Q4X1 3JQXA 1PO11 4AHZA 4LA3A 1HKDA 4CDWB 4TLGA 3JCIA 1Y7BA 4TN7A 2AENA 2C24A 1QOOA 2BU9A 1WKYA 5EV7A 3TBDA 3ZYPA 4NPRA 1OD5A 4AYUA 2H6BA 1UZVA 1A34A 1LHOA 2BNNA 5SV8A 2YGMA 3ZDSA 4C90A 5JXHA 4XYXA 2JG9A 2XL9A 4IESA 4N53B 4FVVA 4F8AA 5C3QA 4KBBA 5BNOA 1GP6A 4UXAA 5A32A 1HV1A 1DZTA 1NXD1 3BPSA 2WC2A 5A1LA 2OUJA 2WLQA 2R073 3LA3A 4L0PA 2LRPA 4HN0A 4W65A 1SQ4A 1JTZX 4Y4YA 5FYUA 3ZYBA 1XBFA 3THCA 4AGGA 4K6BA 4E4SA 1XYPA 5FLHA 4WZCA 2UU8A 2HLEA 5DG1A 3W20A 1ALYA 3IZOA 2VW1A 1CESA 4AGRA 3ABZA 1G7YA 5H9PA 1OKQA 1PIV2 3TWIA 3N35A 4BHPA 5FO8B 5BYNA 1W05A 1J3RA 2QDNA 2NLRA 2ZHNA 3EJKA 3RJRA 4ES9A 3AP7A 3HBZA 3WHTA 4M01A 3LPFA 2ZX1A 2D44A 3WF3A 2ARCA 4QXCA 1QXPA 5FZOB 5CFCC 1LESA 4A3ZA 4AXOA 5JI7A 1JYWA 3ZKYA 5BUVA 1FV2A 3N3HA 2ZTNA 1MR5A 2PHDA 3AM2A 3FLTA 1H8VA 2VMFA 1PO21 1CAWB 1XJAA 4Y20B 4FTEA 1BXHA 2OXBA 1ZRRA 5DQ0A 1EYBA 2WWUA 4NVPA 4YM1A 5A70A 4RQPA 2WZR2 4MGYE 4P5HA 5FMOL 2RR11 2O0OA 3AJZA 4K8FA 1SDDB 4QDQA 3IDBB 5JMOA 2JIJA 1VBA2 2VD7A 2XJPA 1W06A 1MEC1 4MV2A 5FK8A 3VZLA 1NCRA 4YVSB 2AH2A 3DPRA 1H2NA 5FPXA 2RS31 2X8KA 3MUZ1 2BZDA 1HRI2 3ELNA 4LBQB 3U14A 3I3BA 1PIV3 4E4HA 3K77A 4OI4A 2FCUA 1RUE1 1X9TA 3PLQA 4P5YA 5AVPA 4IEZA 5FMCA 1W8NA 2PQSA 2C6SA 3H8OA 4L8QA 1K5MA 1DCSA 4MZUA 3ZXFA 2TBVA 2QQMA 2ZACA 3VKMA 1A6CA 5ACA2 2UWBA 2VZQA 3A23A 1WMDA 3CJXA 2Q4SA 2CDOA 1ZZ9A 1V9U2 3KLSA 2WZR3 3VHPA 3KT1A 3T4HB 2HWC2 2WNVA 3FBYA 1VBA3 3DN7A 3IPVB 3FHIB 1H9PA 2WIIB 3DYPA 1XYNA 4Q4Y1 5BXXA 2Y6HA 4AVBA 4JVAA 3AFKA 4WM7A 5FMBA 5EFUA 5JZGA 4QT6A 1HRI3 1QXRA 1GU3A 2VOTA 1AYM2 1U12A 2YU2A 1IPKA 1NCQC 4GH4A 1PK6C 3MW4A 4AI9A 3CO2A 4B1MA 1RUG2 1AL22 2VTXJ 1IS3A 1HXS2 3NJYA 3NNMA 5EYYA 4OCTA 5AC92 2IXKA 3ACFA 2FDJA 2NN8A 1ZBA3 3T2OA 2BPA2 4W6YA 2VBDA 5GLTA 3VGIA 4HT1T 3OF1A 3BTZA 2GC0A 1JOPA 3D0JA 4XTPA 3W58A 3VBUB 3O1OA 2R49A 2ZABA 3IIIA 1V9U3 1AR82 1ULEA 2LUWA 4AEDA 2D3RA 3INAA 3OD0A 1Y9MA 4CDQB 2HWC3 2VUAA 3C2UA 3OUIA 3Q8CA 4AI3A 4AVAA 1EPZA 2WYSA 1DGWA 4I01A 3WUDA 2VBPA 3QLQA 3RG0A 1I5ZA 3BTXA 3WG2A 3BPZA 1RVF3 3AK0A 1R093 1JU4A 5FPBA 4IGPA 4PLMA 4WM8A 3ZYIB 1WD3A 5CU1A 4Q4V3 2K2SA 5FAXA 2YU1A 4YARA 2X10A 1G6NA 1REEA 3MUY1 2OQ6A 3FUQA 4A6OA 4YG3A 1RUG3 4YGBA 4FTBA 1AL23 2J22A 1COV1 1C1FA 1HXS3 4K7JA 4WVMB 1MZ6A 2R30A 2ZKNA 3URFA 3ZVXA 1J58A 5JLVA 1ASJ2 1V00A 2A75A 2ERFA 3ZSJA 1ZREA 4DUVA 2YBKA 2W1UA 1S0DA 4K21A 5C5UA 4AWDA 3IB3A 4AI1A 4CU6A 1GP4A 1JH5A 2QE3A 4L99A 1BVVA 4XURA 3ZR5A 5J1XA 3HQXA 2AZ5A 5E16A 5I0RA 1VBD1 2K0GA 1RUH1 2WNUB 4OMCA 4XFGA 5K0UA 4BXSV 2FDKA 2R32A 3L9JT 1JOJA 4GKYA 2NM1A 4YVSC 5LBFA 2OS2A 3HOBA 4W50A 4Y3OA 3I2IA 2EAKA 4PHZA 5DZEA 3RNSA 1UY4A 2CWSA 4I3GA 2EXHA 3FHQA 1RUI1 5LEKA 4OUMA 5FOJB 2GNBA 1UN1A 4EV0A 3B7MA 1CAVA 1AR91 3NV4A 2C9KA 1KEXA 3RZKA 4YZ3A 3AX4A 1DQ5A 2HBTA 4QQHA 2KD7A 2VQUA 1GYKA 1VRH1 4MXWB 5DDJ2 3B9IA 5APAA 1NA1B 3ZKUA 5F1RA 4S2FA 2ZCWA 5JAXA 5KWRA 3ORJA 1DG6A 3ZN4A 2R061 1KS5A 1R1A1 3AZVA 5JVVA 1Z0HA 1JW6A 1ODMA 1QMJA 1AYN1 5H9RA 1HV0A 5ANQA 2YGLA 1NY71 5FZ1A 3ZMOA 3FE5A 1N1YA 4X8NA 2J1VA 4ZU4A 2JDHA 4KBZA 3WDXA 3ZFEB 3WF2A 1B09A 5FBZA 2AEYA 4AZZA 3DUIA 1NXMA 4J25A 3GHNA 4ISQA 1IS5A 4Q8LA 1NKGA 4RL7A 4WBBA 1B35B 3E1F1 4LQRA 4MUVA 1UZYA 4MSVA 4HK9A 2QNKA 1SFYA 3VBHB 1C57A 1X8MA 3DXUA 3OGRA 4M3CB 2VULA 1YFYA 5JXGA 3HN3A 5D8AB 2IWGB 2ZGLA 1UXZA 4IV1B 5FY5A 4YW7A 3WT3A 5DDJ3 5FO7B 1UXXX 3OBRA 3PJYA 2ZEXA 2ZGQA 1LRHA 3GF6A 1BEV2 4RD7A 4ZZ8A 5JSPA 3RZJA 4LEJA 1GLHA 3VBFA 4Y1ZA 1ND3B 4GULA 5FY8A 4QPIA 3VBUC 1K3IA 3KGZA 2QQVA 1ENRA 2DVAA 4FTSA 4EROA 2ADDA 4QXBA 1XXNA 5DZFA 4JGZA 3P3PA 4PCRA 1CVNA 2JJ6A 1XNKA 1UQXA 1W2UA 4RYDA 5DAXA 3OBZA 3QCWA 4CEWB 3H7JA 4E4ZA 2B4KA 3I4IA 4YRDA 4YWAA 1ENXA 3MF6A 3WG3A 4YNIA 2JX9A 4FPOB 1JZ6A 4L9BA 4Q29A 4PI2A 1KFUL 3JD72 3DF0A 5FQ0B 5CG8A 2DDUA 4Z92B 4ZU5A 3L2YA 1AXZA 5FXXA 2B7YA 2MNGA 1FX5A 4H3WA 4LHKA 2VG9A 4GMP1 3RZZA 4XFFA 1D2QA 1S1AA 1LR5A 2JE8A 4K1YA 1F5JA 3IKWA 1WA4A 3POIA 1OQDA 2WNOA 4NR1A 4TWTA 5HI0A 1E57A 2UWCA 4QGNA 1G9AA 5CAZA 3Q8AA 1ZYBA 4FFFA 2F6BA 2ZPXA 4I0BA 2HWF1 3HT1A 3R4SA 3ZM8A 1DQ6A 3K46A 3VBRA 2RJ2A 3MGUA 2VAUA 1VBB3 2WAAA 4GB33 2WNUC 4IEYA 2XG3A 3AYEA 3KV4A 3WVJA 1UKGA 3BVCA 2VGDA 3OY8A 1PZ8A 2B8MA 4CYDA 1ULOA 2VC9A 1FV3A 3VBOA 3E5XA 3W5MA 5I8TA 5KXEA 2BNOA 4XJZA 1PM7A 3ENRA 3AP4A 2BVBA 1HIXA 1SLBA 1EUTA 1UYYA 3JD73 4AEJA 3WY6A 4CEYA 1EAH2 3V64A 1VJ2A 3JBG1 2PHXA 1OVPA 4K8RB 1FOD2 2VR4A 2LROA 5FZFA 1PNGA 2OPWA 5J96B 1PGW2 4Y33A 1OLME 4K9SA 1NA1C 4NHYA 4AI0A 1N3OA 2LALA 4Q0QA 2WNEA 1YQ8A 2G9ZA 4RFRB 2VOKA 5I91A 5A3LA 1V6NA 4GJYA 4E2QA 1L7QA 4QPYA 3UKVA 1UYPA 3WZ1A 4Q0VA 4HONA 4P9WA 4UWDA 1C8M1 3D8CA 3KM5A 5JI9A 3WF1A 1X82A 3N7JA 5CKMA 3H1YA 3BTAA 4LKSA 4WVVA 4FPEA 4RSUA 1QJU1 1DGRN 3S30A 3SXWA 4D8MA 2Y64A 3UV9A 1X8EA 4MVTA 1REDA 3DYMA 2IZWA 4AL9A 3VD3A 1B35C 2VXRA 5F7UA 1E5IA 1STMA 5A7OA 4BMBA 1DGRA 1JOBA 2A3XA 5I0UA 1ZZCA 4FPCA 3VBHC 3H3LA 1EAH3 2ZX0A 4KU8A 3VHNA 2GP5A 5FYYA 2DCJA 3H50A 1EV12 4F83A 4LO5B 4P14A 1U5YA 1FOD3 4NHKA 4HVQA 3OUJA 1ND2A 4URTA 2WJSA 4WVWA 2H0VA 3NL1A 2B5HA 5FMOS 5CEHA 5JPNB 1RYYA 1S55A 4YZ1A 2ZJCA 1KD7A 1O4ZA 3SCHA 2EXJA 1MS0A 4ITCA 4NIAA 3G6JB 5FZGA 4R9CA 2ZGRA 2QQWA 1H1MA 4UW6A 1BHGA 4FBFA 2R6QA 3CU7A 4QX2A 1ND3C 4X8PA 2B9VA 2BTVC 4CU7A 4CCOA 5C3OA 1WBFA 3DKWA 3KGLA 3NRUA 5E6HA 2Y26A 4E2SA 3JU9A 4EN6B 5C4WB 1QJY2 3R6SA 4AGVA 2WL1A 2CHHA 3J7HA 4Q4W2 3VB9A 3AKRA 3PL0A 1RUF2 2A7AA 3AP5A 2AACA 1LOGA 2D5HA 1T2XA 1LOFA 2EIEA 3JB4C 5IHRA 4CEWC 2VBBA 5CNAA 3VLBB 1W28A 1W90A 1E5HA 1L7LA 4EN9B 1BJQA 4V2VA 2WT1A 3D82A 3D0SA 4A44A 3OD4A 1OLRA 1OVSA 2XJSA 3FFQA 3LEIA 4YM2A 1O3QA 5JR7B 3PUIA 5A1AA 1EV13 4LO8A 3GBFA 1V0AA 3KCXA 1HLCA 4QB6A 1E5RA 1RUD2 4BLJA 2VZPA 4HOOA 1N3PA 1A3KA 3TRSB 4AVCA 4J1XA 1V6IA 5JSRA 1LEDA 3AZXA 1GNZA 1M4WA 4NIIA 4XABA 3T2PA 3WP3A 4NPMA 2GALA 4MGSA 2VTFA 2JB8A 4XJWA 3W9AA 4CCKA 2VUJA 3ACLA 1GQPA 2JG9B 1POV1 2OZ6A 4LXLA 3U4XA 4UFMA 2Q8EA 1Y43B 3MFAA 1WLTA 2GNTA 1RL3A 4Q5OA 1IPJA 5BNOB 3VDBA 3TNPB 4QAWA 1SLIA 2EIDA 5A32B 2UURA 3ZYGA 4Q4W3 2A73B 4KWKA 2FDGA 4P9GA 5F3GA 3GZEA 1RUF3 3IN9A 2HKXA 4IEUA 4EE2A 3NV1A 2K46A 2BERA 3WR0A 4BQYA 1BMV2 1A8DA 1H2KA 3MICA 1ZA4A 3Q8BA 3VD7A 5F8PA 1CR7A 3AB0A 3MPBA 4DO0A 2JENA 3OBAA 3MI8A 2HWE2 1XSQA 4XQWA 5CB7A 4H7LA 1CWPA 2PLV2 1UU6A 3NMBA 1RUD3 3LDBA 4OI0A 2ENRA 3ZN5A 2P6CA 2WT0A 2QDRA 2C0ZA 1LHWA 2HWD2 3FBMA 1N1TA 2VNOA 1XU1A 1C8NA 1KQRA 2A6ZA 3B3QE 3BU7A 4YLZA 2QQPA 4M00A 1YQ5A 1QJX1 4HFSA 4R4XA 2VZRA 4DZGA 4FPFA 4EJRA 1IKPA 4AFDA 3LF7A 3CJIA 4BA6A 4RQPB 4E2GA 4J1WA 3ZIWA 4QXHA 2ZGMA 4F7ZA 2P37A 4QDSA 3V56A 2V4AA 4UFJA 4DXTA 2E32A 4JCKA 2BBAA 1NCRB 4JDMA 2RMU1 5KHIA 3MV11 1GQGA 2QTWB 3VL9A 2AGSA 2WFF2 2YY1A 2O8QA 4EN0A 4I30A 1JHNA 3BODA 2LM3A 5CISA 4IEQA 2YC4A 2KA3A 2ZGUA 3RSJA 3B5LB 1OUSA 2WWSA 3FHAA 2WZPP 5DMYA 2DCKA 2Y6JA 2PLV3 3WF0A 1U5IA 3N7MA 5JPMB 4R9BA 3WQ7A 5ABJA 3MIHA 2DVGA 2IVJA 3QACA 3EQEA 3VBSA 4TLFA 4XIOA 2A3WA 2Y0IA 4FAHA 3BCWA 2QKDA 1IS4A 3P3NA 1S0JA 2Q1MA 5HCHA 4NIGA 3MIBA 3ZYFA 4DEQA 4HN1A 4LT5A 1WCSA 1HX6A 3PJQA 2G9GA 4FXKB 4ZY9A 3SCGA 1PMJX 4IXLA 1LENA 2WSVA 5FYBA 5C4WC 1DYPA 1H1IA 4Q4X3 4CCMA 4IE0A 3THTA 1PO13 2JE7A 3IAPA 2DBNA 2ZEWA 4I0WB 2WNVB 1UIKA 3LDKA 5LRRA 1SG3A 1VMFA 3FN9A 4NHXA 3GXUA 5I8SA 1F4AA 4XFCA 3TB0A 4CP9A 4COZA 2E33A 3PU8A 4IEPA 2DUOA 1QF3A 3FX3A 1AR62 2YZ4A 4XIKA 2ILMA 3PIJA 3T0BA 5A7WA 5JZGB 2WFF3 4QQOA 4PF5A 5L7OA 4PF1A 1W6NB 1YJLA 4DY5A 3OYWA 5A7SA 3I2GA 1YYNA 2YUEA 5FY4A 4GH4B 2EF6A 1JZ4A 2JDPA 3POEA 4QX3A 1VMJA 4COUA 2XBO2 4DXSA 2Q8DA 1VAMA 4JQTA 5J09A 4XF0A 2D5FA 4QGLA 4XE9A 4BQ5A 1S0CA 3BGAA 3AJYA 4GD4A 3AZYA 1UU5A 1JYIA 2JG9C 2LW8A 3O0WA 4DFSA 1XNCA 2NMNA 2YFZA 5BNOC 5FPUA 4E27A 4AEDB 2UY8A 1S0GA 1KDKA 1NLSA 2DU1A 4XC9A 5IFPA 5FZ7A 2FQPA 2D6NA 2Y0OA 3RS6A 4DS0A 2FDFA 2VNRA 5B4XA 5LA9A 1CZVA 2DVBA 4UAPA 1NG0A 2O8OA 4XDQA 2BEOA 1MS4A 4Z82A 5A33A 1GWKA 5FP8A 2NPIA 1SLAA 5A3NA 3KQ4B 3VKFC 3MO4A 2RR13 3QOPA 3IIAA 2VNGA 5FCCA 5F3IA 5I8YA 1OI6A 3KVAA 2XUMA 5FPAA 1MEC3 1VBC2 3BN6A 4LHLA 2UYBA 4Q4Y2 4Y1UA 5LCWL 2WBKA 1WLCA 3U1XA 5FRAA 1W03A 2HJIA 3D3AA 1BBT1 3AC0A 3M3QA 1Q8SA 1REFA 3WQ1A 4RQPC 1O3RA 1LULA 3H7YA 1RMU1 2HWB1 5K0UB 4LNVA 3GHMA 2YC2A 1RINA 2BOJA 2DYCA 3H1WA 1S0FA 2R1BA 4TTGA 4EZHA 1NCRC 3OCPA 5GLWA 4JKKA 4YVWA 2N7GA 2PQQA 3DPRC 1D7PM 2I45A 2B9UA 4CPBA 5FZBA 4PIYA 2Z42A 3A21A 2Z2SB 5JSOA 3WNOA 4K40A 2WABA 4NRPA 1CAVB 1ZBE1 4UBGA 1HRV2 4YFWA 4FPGA 4N9IA 3WP4A 3L2HA 3LSDA 2YDEA 4QB1A 5FBJA 1TEIA 1K5MC 1W6OB 4FPJA 4IUGA 1VBC3 2R1DA 4X6QB 1WW6A 4Q4Y3 1WD4A 1UNBA 1ZRCA 3T0AA 2QQLA 2NZ9A 1YI9A 4LKEA 5A80A 2BWCA 1XB9A 2BOIA 2VMDA 3ZLIA 3E5QA 5GZFA 3ZIXA 4NHMA 2ZHKA 3TYJA 4AAXA 2JECA 1CX1A 1WW4A 2OZJA 1AXKA 4Y4RA 4DRVA 1XPWA 2WNVC 3U11A 4OHXA 1RJ7A 4Y26A 2JDUA 2PHUA
chains in the Genus database with same CATH topology
4AFCA 1TME1 1DFQA 3MYXA 3UJQA 2CGPA 1RUC1 5GKAC 4QX5A 1C5HA 4WM7C 5JZGC 1DGLA 2QVSB 2VMHA 4OHVA 1JXNA 1WMFA 1ZZ8A 4C0HA 1CAUA 4GH4C 3AMPA 1HRV3 1W6PA 1W6MA 1VBD2 1Q5OA 1DQ0A 5BNPA 1MS9A 1AR71 3O14A 4CDUA 3LWCA 2E7QA 4XFAA 5DG2A 3OGGA 3GZTB 3LOIA 3VBFB 1U5XA 4QPIB 3QH6A 4YM0A 1R082 2C9AA 2QZ3A 3OGJA 4AEDC 4Z2WA 5FOBB 5GZCA 1I1EA 5IK8A 3V0AA 4JGZB 4D7TA 1NQJA 1V6KA 1RGSA 4C0BA 3PHMA 3SNMA 4YW4A 4WM8C 4SBVA 2E7AA 1MVQA 1HQWA 1IQAA 2W39A 2Z69A 1VBD3 3U10A 3WHUA 4AFBA 1RUH3 2XJRA 3ME2A 1ONAA 1N1SA 4XFHA 4XMAA 2RM21 2XVLA 5F6KA 2VVFA 4LLOA 4BLIA 2MHFA 3ZO0B 3KSCA 1PNFA 5BPXA 4AK3A 2GNMA 2E9QA 2XWBB 2CYFA 1R083 1O7FA 1XNBA 2ZGSA 4GWMA 5DUUA 3WZ1A 2JG8A 5GZGA 3MLJA 5K0UC 1YFUA 2XGXA 3I8TA 1U5ZA 4JQRA 1QQP1 1VRH3 3OY8B 3SLIA 4R4ZA 1DBNA 2IXJA 4CTEA 1RUJ1 3S7EA 5KXCA 1ZBA2 4LBJA 3VBOB 2E6VA 2R063 4AEMA 5C9AA 3RMYA 5JMCA 3VDDA 3B69A 3SHRA 1OPMA 4CEYB 1Z7S1 4FPYA 1FMD1 4EN7B 3POYA 3PVOA 4PLOA 4UW4A 4I09A 1GV9A 2DVDA 2MEV1 1MS5A 4V1PA 1BKZA 4EWAA 1QU0A 1MQTA 1VBE1 2PN5A 1AXYA 1MS8A 1RVF2 1RC6A 1R092 1JUHA 1AJKA 3ZX7A 1VAVA 2XB6C 4Q4V2 1A78A 2ZBJA 4QQPA 4RHV2 4Y1XA 4FSJA 2CY6A 2BWAA 1RITA 4HL0A 1UL9A 4Q0SA 5BV6A 1Y9QA 1LOAA 3MIGA 1NZCA 3WP6A 3ZXKA 4WV8A 4ES8A 1RHI1 3R05A 4IEOA 4HVRA 2JICA 2YYOA 1W0PA 2A6XA 4IETA 4MGIE 1BQPA 5I0SA 4M3CF 1TQ5A 1AX0A 1ZZ6A 4RR3A 5F6LB 3EHKA 4LO6B 2W68A 1ULDA 4HBNA 1XQNA 4P9XA 1BK1A 2D98A 2EALA 3VBFC 3WP5A 3I2DA 2D40A 4GA9A 4MGZE 4QPIC 2ZGKA 1OOPA 4RHV3 1ZVFA 4GMP3 4JGZC 3WDUA 3E6DA 4CZSA 3CF6E 5CFDA 4DQAA 1QH7A 1QNWA 2F4PA 4JTOA 1XNDA 1Q43A 4XJUA 4QD2A 5BNNA 1I9RA 1OQ1A 4YGCA 1W39A 4XBNA 2HWF3 2BW8A 1OA2A 2P34A 2R071 4O9GA 1V6LA 3ZPYA 3AMMA 1OQEA 2RS12 5CFCA 4A7ZA 3WG4A 3KCYA 4GWNA 4B7KA 2ETEA 2B46X 4KWLA 1C3HA 1LU1A 1ZZ7A 2PHTA 4FO9A 2I2SA 1SMVA 2A70A 5FFOC 1EPWA 3DV8A 1CJDA 3VKNA 3VBRC 4ASLA 4LE4A 3I59A 1NOVA 1SBDA 3HR9A 4MXVA 1DDLA 1ZZBA 3JBG3 3IT8A 2UYAA 1H30A 3ST7A 1CPMA 3ZYRA 4NN0A 3ES1A 3WW1A 3FUOA 3GYDA 1L3JA 1W6QA 2E63A 3VBOC 5JOZA 2ET1A 4AEKA 4LO7A 4CEYC 3ZFFB 2RS13 4RS5A 1LJ7A 5C8WA 3H0OA 4LBNA 2VW2A 5CADA 4FPHA 2GSYA 1CN1A 4AHYA 1PIV1 3N7LA 2XPJA 5HCFA 4XBQA 2D93A 3ZXGA 3A0NA 3CJIB 3JZVA 5LK5A 4BYYA 2XLFA 4IV3A 4DXZA 2P3IA 2BUKA 2WLPA 2JD4A 1PGL2 3E6BA 4XQ4A 4ISRA 1SDWA 1VB4A 5LRSA 4R52A 2WZR1 3WG1A 4MH0E 3ZMNA 3POWA 1KXGA 4Y1VA 4CDWA 1VBA1 3M70A 1FXZA 4BH9A 2V09A 1Q8OA 1VBB2 4PIZA 1J1LA 3WW4A 1DQ1A 1FATA 1HRI1 1ND2C 2JKBA 3HMYA 4GB32 4NWWA 2OYZA 5ABJB 1V6MA 4N53A 3M4FA 5T5LA 3PMEA 2PAKA 4L92A 4YW5A 4WZFA 3GALA 4W6WA 5T5OA 3KT4A 3VKOA 3C3VA 1LOCA 5ACA1 4HVOA 1PVC2 1UX6A 4N43A 2VECA 4AE2A 4AVSA 1LU2A 1LOFC 2IXCA 1V9U1 1WMEA 1OPOA 2TEPA 1ZM1A 3LGRA 3FZ3A 2HWC1 4IEVA 4HKOA 4KNCA 4WVZA 2R041 1POV3 3MIEA 5D1IA 4LUKA 2PAEA 2PHRA 3U0ZA 3CEWA 1AYM1 3RI9A 4Y20A 4R9DA 2P3KA 5J3UA 3ZXEA 3BALA 4K1ZA 5IK5A 1RUG1 4AI8A 1AL21 3AKSA 1HXS1 2C1FA 2FMDA 4XJ8A 5AC91 2VY0A 2WQ4A 1IKQA 3D6EA 1O3TA 2DCYA 2GN7A 4MYEA 4N7UA 2AUYA 2ZMLA 2V73A 4GKXA 2SLIA 1PVC3 5HCBA 5KHGA 4K3UA 1LHUA 5T5PA 1AR81 2G9FA 2IC1A 1GSLA 1H2LA 4YW2A 2VPVA 1QJX3 1MZEA 5A33B 4RA0A 5KBFA 4ATEA 3RMXA 3ZFFC 4ZU7A 1YO8A 4YW1A 4KG0A 3VUOA 1YLLA 4DPNA 4M3CE 2P2KA 1CD3G 4YYOA 1QDCA 4LUMA 3T2TA 2PHWA 2WS92 2GMEA 1SLCA 3AYCA 2XKOA 4P9IA 3LKJA 3ZSLA 4GQ7A 4LLFA 5AFBA 2VMGA 3CJIC 1ASJ1 3IDCB 4COVA 1WW7A 3W59A 2PA7A 2CGNA 4XXAA 2H0BA 2HYKA 2UY9A 2BBVA 3M7AA 4YVWB 4EN8B 3M3CA 1GZCA 3J9SA 4XETA 1WLWA 4PDWA 2OIIA 4FQZA 4GXLA 4N7IA 2GC1A 1H4GA 2YMZA 3LSEA 4BOWA 3FFZA 4QHBA 5KHKA 4XJ9A 4Z8BA 3DL3A 4JGYA 5JOXA 1FNYA 3TN92 4C1XA 4F3JA 5ABJC 2PHFA 2TNFA 2EAAA 3VBSC 4Y1YA 2FZ1A 4U36A 4CDQA 2WS93 3LB9A 3B00A 2XJQA 3LAGA 1LODA 5TSWA 4D69A 5DDJ1 4XHBA 2RS52 3AYAA 1I6XA 1O91A 3ZFGA 4JC1A 3R4DB 4IQPA 4UW5A 1AF9A 2JE9A 2W0XA 2XKPA 3USUA 3NWKA 4GALA 2OUHA 1JN2P 2V5YA 2P17A 1FPN2 3HIFA 2QJVA 4DRRA 5L7OC 5K9YA 2XL7A 1CAUB 1YFXA 2DWRA 3Q9OA 4D7SA 3O5SA 1QXJA 4COWA 1W6PB 1JYCA 2CAUA 2JXAA 1LOEA 3ZYJB 5BNPB 2D6LX 4AHWA 1XE8A 3TN93 3NV2A 3JQWA 3M3EA 4XJAA 4CDUB 2IFWA 2PYTA 2IXLA 5DXDA 2OPKA 1ZRDA 4S2HA 3N36A 3D5OA 3IM0A 4Q0PA 1EP0A 3S0MA 2RS53 1BEV1 3V0AB 1VB2A 1OA4A 3J8F2 5GZEA 1GQHA 2PAMA 4YG6A 2VQAA 1D4M2 3DGTA 4HLTA 4E9KA 1FPN3 1WLDA 3RDIA 3QBQA 4J6GA 3GZAA 3AMQA 4AW7A 4MXWA 4FAGA 2ZOEB 3EO6A 2FZ2A 1RMU3 1ZX5A 2YROA 3FJSA 4Y24A 1PVXA 2VQ0A 4Q4X2 5CVRA 1PO12 2TUNA 2B45X 2W52A 2CL2A 3MW3A 3WDWA 3VZMA 3ZFEA 3DPRB 3NAPA 1KS4A 4BZ4A 1RB8G 2AR6A 3H8UA 1ZBE3 4XQDA 3ZSEA 5JIUA 3J8F3 5T50A 1VALA 2DCTA 3OJBA 1D4M3 2EIGA 4SLIA 1K5MB 4YVWC 5EZWA 3NKTA 3HD8B 3H1MA 5D8AA 1MZFA 2NMOA 3PTYA 4G9SB 2WKKA 2XVKA 2JDZA 5EYXA 5C9AB 4IV1A 1H8TA 3VDDB 3LOBA 1QJZA 1UMZA 3ZN6A 2R0FA 4FOYA 4QPGA 5JOYA 3ZSKA 2DUPA 4AFMA 1KDMA 4XFBA 4BIOA 2X5IA 1TME3 2DTYA 4QXKA 1EAH1 2EVXA 1MQTB 3GZUC 2EA7A 1FOD1 1LKNA 4WM7B 4TZDA 1RUNA 2A6VA 1PO22 2XVGA 1LOBA 1OSGA 3RJ2X 3NJZA 2BFUL 4JAAA 4EWEA 2XLGA 2WA3A 4L11A 1UF2C 2RR12 1AR73 3NSTA 1AX2A 2Z79A 1URXA 4CP0A 2GMPA 3WQ0A 2DV9A 1MEC2 2ZMNA 1GZWA 2PELA 1HQNA 4XFIA 2RS32 4LHNA 1O4YA 1DIWA 2VOVA 1ULGA 1RUE2 5BNPC 5C8CA 3WCRA 4RR3B 4CDUC 1PMIA 1VAKA 1CX4A 4OHYA 2CNAA 1RUJ2 3LA2A 1ULCA 2SBAA 3OPZA 3RRDA 4Q8KA 4META 1UU4A 2DURA 4WM8B 2JEMA 5F9TA 1PO23 5H9SA 5KC5A 4QM9A 1S0EA 4FCAA 2ZGNA 3APBA 4Y22A 2KXLA 1G8WA 1C4RA 5CFDB 3I7DA 2RM23 1QKQA 3SH5A 2YV8A 4AI2A 3KZ4C 1QJY1 5BNNB 4HSLA 4Q4W1 2RS33 1G86A 1LHVA 1XRUA 2Q5TA 1LCLA 3VN4A 1RUE3 4R9AA 1FI2A 4CP1A 4A2UA 1PZ9A 2YPJA 4D3WA 2C5DA 5B2GB 4MX3A 1UIJA 1WGPA 2ZA9A 1KJRA 4LBOA 5FPZA 1RUJ3 3V0BA 4B4PA 3PNAA 2XJVA 5H9QA 2IXHA 1MVEA 1RUD1 2GZWA 4HSJA 3I59B 5FDBA 1O5LA 5L73A 2VVEA 1FMD3 1SCSA 2JG8C 4FXGB 4JDOA 4UBHA 4FQ4A 4FPLA 3EXUA 4X6RB 1O5UA 3MPPG 1TE1B 1N3QA 2MEV3 4DY3A 2DVFA 4LBMA 2VH9A 1TMF1 1W6QB 2GU9A 1IS6A 1VBE3 5KHJA 3GBWA 1D0HA 4P9YA 5C9AC 3VDDC 2QFEA 4AVTA 2K9ZA 1BMV1 3SISA 2ZGPA 4QQ2A 3MLKA 4KL1A 3AXDA 1COV2 4QM8A 3B01A 2HWE1 1MQTC 1QDOA 4C91A 1RHI3 2PLV1 3QD6A 5CA6A 4YFZA 4XEZA 1IZ3A 1WW5A 2HWD1 1NLRA 1LECA 2B39A 3BOPA 1YHFA 3HWJA 4IV3B 4R8HA 1PGSA 1RUH2 4BM8A 1EY2A 4BMEA 4H14A 3VKLA 3CNAA 2GC2A 3H9AA 3RYRA 1LGNA 5JOWA 1TNRA 3VV1A 4JRAA 4XZPA 3PVEA 3WDVA 1SLLA 1RUI2 2ZX2A 1CAXA 4N9HA 3NKGA 1VP6A 1AR92 2LTNA 4RR3C 2WFF1 4JRLA 4AQ2A 5DUXA 2D3SA 1COV3 5SV5A 4YW3A 1VRH2 3IWZA 4LA2A 4PQ9A 3PMSA 4Y5Z0 2D43A 2ES3A 5EWSA 3IBMA 2R062 5E1RA 4PBPA 1R1A2 3B93A 2ARBA 4XBLA 3SMHA 1OOPC 2OVUA 4CDXA 2XH6A 3R0RA 1AYN2 3X29B 1DYKA 1NY72 1V6OA 5K7PA 2BGCA 5CFDC 3MIDA 4N43B 4G3YC 2D7FA 3ECQA 4XF1A 1JBCA 5BNNC 3OTFA 1YIFA 4Q27A 3WW2A 1RUI3 1AR61 2DTWA 4KGQA 3VBRB 1I3HA 1BZWA 2AYHA 5JIAA 4E4DX 1AR93 3WUCA 5CG9A 1LTEA 3JUUA 2OW4A 2CAVA 4OULA 3LCPA 2Q30A 5A3MA 5J37A 1ZNPA 5CBLA 1GANA 2XBO1 4KU7A 4U2AA 4JTNA 3UL2A 3RPQA 3SCFA 4AG4A 1R1A3 4UW3A 1S2KA 4LBLA 1AYN3 1PHMA 2DU0A 2KM2A 3UKNA 4Z07A 1Q3EA 3IDEA 4D94A 3RYKA 5GLUA 4AHXA 2DCZA 4Q1RA 4RS5C 1RTVA 4S2GA 4Z1VA 5AFEA 3ZXLA 4Q0UA 3NO8A 3POSA 5IT6A 1HQLA 4XMIA 1XU2A 2PTMA 3LA7A 4QQLA 3PVBB 1UZZA 1QWRA 3AKPA 3B9CA 3M2MA 4DINB 2R042 3WDTA 3AMHA 2NQYA 2NYYA 2WINB 1VBC1 2HWF2 4OFGA 1OFNA 4BIFA 4IV3C 4AFAA 2ARXA 1OMIA 3ZXDA 3N7KA 1MS1A 4YG0A 1W6NA 2A3YA 1ND2B 2A71A 2GH8A 3I54A 4P9JA 1KFXL 4CDWC 4PDWB 1RUOA 1DLLA 2D6MA 1LB2A 2HEVF 3S7IA 3BIWE 4A7KA 1FNZA 4YZ5A 5ACA3 3JBG2 4JGYB 4ORFA 1O3SA 4BQ1A 1D2SA 1RIRA 4HZFA 4N53C 1GNHA 2I07B 3AZZA 1J3PA 1HRV1 1NE6A 3AP6A 1YFWA 5E88A 3TNQA 3B02A 2R043 2A5ZA 2Q8OA 2PHLA 5HCAA 3MIFA 3MLLA 2Z5WA 3ZFGB 5I93A 1C8M2 1MZ5A 3O12A 4BWOA 1AYM3 4N43C 2E51A 1AL0G 2RE9A 3USUB 3WX5A 1QJU2 3HT2A 5L19A 1VIWB 1RJ8A 1QOSA 1H4HA 5AC93 3MZHA 5KC6A 2E53A 2XJTA 2BFUS 4XF3A 1J3QA 2ZZJA 1GFF2 2BYVE 1AR83 1NQDA 3ETQA 3MFCA 2R16A 4S2DA 4OI1A 5DZGA 4HPKA 1C8M3 2XJUA 3TAYA 2D6OX 2GDFA 3NVCA 2FBEA 4FOQA 1JUIA 4AF9A 1WUVA 3OBTA 4PBOA 1QJU3 1R081 2ZGOA 4MGKE 1WCKA 2RHPA 1G9FA 5JWPA 3M8LA 3UKTA 4DMIA 1S0IA 1C1LA 3GNEA 3E6CC 1W6OA 2BVVA 1A8MA 3A0KA 3AFGA 3G7DA 1ASJ3 2X29A 2A6YA 4Q2FA 3RYPA 1UKRA 2CV6A 2ZAAA 1YUDA 4KWJA 4QU2A 2MPFA 1NCQA 1DZRA 5L36A 1PK6A 1DZQA 5AVAA 2P3JA 3NAPB 4LBQD 4LO4B 1TNFA 3VHOA 1VLNA 4B29A 2GAUA 1ZRFA 1W0OA 3WINE 4B8EA 5T52A 4L97A 2QZ2A 5GM0A 4FP3A 4XF4A 1DHKB 1GZ9A 1WBLA 3BOWA 1F31A 1XYOA 3HAGA 4W6XA 4FT8A 4BE3A 3VBSB 1LEMA 1DQ2A 3WNXA 4NOTA 1YCIA 3AP9A 4C1WA 2BNMA 1H8TB 4PDWC 3ZN6B 2D6PA 3ILRA 3NW4A 1ZBA1 4QPGB 1F2NA 1LGCA 1S2BA 3VZOA 4JGYC 2X5IB 3JB8A 3M3OA 4NWVA 4OUSA 2ZX3A 3O0XA 3WD5A 2GH2A 1APNA 1G9CA 3KCCA 3WDYA 4CDQC 4DNYA 1H2MA 3ZSMA 4O9EA 3AXEA 4HKLA 1CIWA 1CGPA 1QJX2 5L7OB 3OYWB 4XOGA 1LGBA 3T1LA 3ZFGC 4EWDA 1QOTA 1QNYA 4OHWA 1ENSA 1RVF1 5K8SA 1R091 1X50A 1CAWA 1GZWB 4Q4V1 5C33A 2CGOA 4RHV1 2RMU2 3FWEA 5CIRA 2XHKA 3KB5A 5J7MA 1UAIA 1BEV3 4YVSA 5C8CB 4LBKA 1Q8QA 4N90A 2XLAA 1AHSA 4CP2A 3E97A 4JV4A 4LBQA 1LHNA 3O7OA 5GLZA 3BB6A 4YSFA 1X7NA 2ZAHA 2H6CA 2QUOA 4G4FA 4Q26A 3MEPA 1HDKA 1CPNA 5J98B 1F9KA 5I0TA 4Y22B 4A7YA 2WFPA 3KS7A 2VMIA 4JDNA 2RMU3 4ZKTB 4D7YA 2Y38A 4K20A 4QMAA 2HEWF 2OA2A 3IPVA 4OVEA 4AVVA 4RGAA 3O0VA 4I0AA 4RGGA 1SLTA 3FLPA 4GMP0 3M3IA 1UW8A 5IK7A 2DF7A 1D4VB 3V0BB 3R4UA 2RS11 1YRZA 4IL7A 4YZ4A 5IUQA 3ZFEC 3KD4A 1MS3A 4AQTA 3KMHA 3NAPC 5FO9B 3MF9A 5LEJA 3VZJA 4LR4A 4B4QA 5IK4A 3KT7A 2WSUA 1SACA 1C28A 4I02A 2VOXA 1SEFA 3LZZA 1YNAA 1CQ9A 1ENQA 1NYWA 2DFBA 4FOWA 5BY5A 3VBUA 5D8AC 2ZX4A 2YC0A 1J59A 1WCDJ 4XW3A 2YHJA 4IV1C 1H8TC 1X36A 1X33A 4KG8A 4COYA 4YGDA 2W08A 1T6GC 4BCUA 4QPGC 2ZMKA 4PLNA 3A4UA 3AMNA 3ALQA 3WW3A 2GNDA 2X5IC 1UPSA 3PVNA 3AYDA 4M0HA 4OLLA 2D3PA 2ZS6B 2A6WA 1GBGA 2RJKA 1BBT2 3H3UA 4WVMA 3RWNA 4PJYA 3T1MA 2EXIA 4ASMB 1W6MB 5T55A 1IHMA 1RMU2 2HWB2 2VOWA 5DUWA 2DUQA 3UK9A 5T3NA 4XPVA 1PGL1 1D0GA 2YXSA 3ILNA 4INDA 1AVBA 2RJLA 2WNUA 1C5IA 1OLQA 3ATGA 4HKWA 4XILA 1CAXB 5J36A 5C6CA 1ZBE2 5C8CC 4DOUA 1IOAA 4LTAA 2ZHLA 1TMF2 2ZKLA 2GC3A 1QJY3 1VBB1 4FOVA 1OFSA 4GB31 4M0NA 3VHRA 2Q0AA 1BBT3 1VR3A 2X53S 3FMGA 4PIXA 5KHHA 4CDXB 4MLOA 4FPKA 1S0BA 3K51A 4KGGA 1NA1A 1OHFA 4B4RA 5FTTC 1ULFA 1Q8VA 2HWB3 1V70A 3ES4A 3M1HA 3ZFFA 2ZHMA 1TME2 3JD71 1RUC2 5JCTA 1SBFA 2IXIA 3EBRA 2B42B 1Q56A 4LULA 1PVC1 1BCXA 1NE4A 3MW2A 3ROUA 1AZDA 1GICA 1YI7A 2ZGTA 2JG8B 3J26N 4CRQA 2I74A 1SBEA 3WOGA 4KQ7A 4ZXKA 1B35A 1AR72 5T5JA 4P9LA 1TMF3 1KITA 2ET7A 3VBHA 3RQ0A 4IEWA 4M3CA 2CWMA 1N47A 2NP0A 1V6JA 4TSVA 1AX1A 1BYHA 2AREA 1KRIA 3USSA 2CTVA 1POV0 3AKQA 3THPA 4AQSA 1H1AA 2VW0A 3N4MA 2FHRA 2BQPA 1O4TA 2WQZC 4BPZA 4RFT0 1ND3A 2WA4A 4TYSA 2HWE3 1RUC3 4DB5A 2WT2A 4HMZA 3SH4A 4B7EA 1AUYA 1DGWX 3VZNA 3MDPA 4NHLA 2HWD3 3FC0A 1J1TA 4OZXA 5JDBA 1PGW1 2PFWA 3J4UH 1YWKA 3U07A 4CEWA 2XWJB 3FLRA 2QCSB 4LE3A 1UCXA 2R0HA 2RM22 5FQ0A 2EXKA 4KH9A 4IERA 3NV3A 4HETA 5FLIA 2VU9A 2WS91 3E5UA 2HEYF 5DUVA 3GBGA 4ATFA 1GKBA 1MACA 3WCSA 4H7MA 5EXOA 1QQP2 1H0BA 5KXBA 1FYUA 3TOJA 3ASIA 4OI2A 1EV11 1F8VA 3IMNA 1DU3D 1YJKA 3ZXJA 1OOPB 1Z7S2 4NO4A 1FMD2 3ILFA 2D97A 3SH3A 3WV6A 4QGMA 3B94A 1Y3TA 2MEV2 5EJ3A 1SFNA 1BVP1 1HW5A 4EV0A 2E7TA 1IGOA 5GZDA 5T54A 4GIQA 1VBE2 2VVDA 3TN91 3CL1A 5GALA 1AR63 4CDXC 2G4IA 5FREA 1RUF1 3UJOA 2Q1ZB 3HN1A 1KJLA 2GMMA 5CFCB 4XF9A 3CLPA 1N1VA 3QH7A 1U0AA 4HANA 2FMYA 1UPIA 1QQP3 2RS51 2ATFA 1R1ZA 5E89A 4A3XA 3SITA 2GN3A 5BNQA 2XBO3 3H3ZA 1DF0A 4HK8A 3VZKA 1RHI2 4YM3A 3D4KA 1H9WA 4L2NA 2D6KA 3WLUA 1CONA 1CJPA 1Z78A 1Z7S3 2O1QA 4H55A 1FPN1 1AJOA 4XXPA 1F5FA 1YIPA 3WXPA 1PZ7A 2IFRA 3ZXAC 4AQ6A 4B3NA 3V65A 1DQ4A 4I2OA 1SCRA 1YXWA 4YGEA 1FAYA 1FT9A 1QH6A 2DFCA 5GJ6A 2ZZQA 4XHXA 4HPKB 5J48A 4RS5B 4I3PA 1G9BA 2UWAA 3K48A 3KQRA 5F5QA 1XE7A 1QY4A 1UD1A 3AZWA 3S6PA 4ONUA 5FLJA 1Q8PA 5C4WA 5KXDA 3J8F1 4IEXA 5GLVA 1OA3A 1D4M1 2R072 5LK7B 5HXVA 4OHZA 1QHDA 1M06G 5E8AA 1QGLA 1GR3A 3RI8A 5HBAA 4YZ2A 1NCQB 4Q1PA 1PK6B 3AKTA 3VL8A 4FP2A 4XTMA 1G9DA 4Q4X1 3JQXA 1PO11 4AHZA 4LA3A 1HKDA 4CDWB 3JCIA 1Y7BA 2AENA 1QOOA 5EV7A 3TBDA 3ZYPA 4NPRA 1OD5A 4AYUA 2H6BA 1LHOA 2BNNA 5SV8A 2YGMA 3ZDSA 4C90A 4XYXA 2JG9A 2XL9A 4IESA 4N53B 4FVVA 4F8AA 4KBBA 5BNOA 4UXAA 5A32A 1HV1A 1DZTA 1NXD1 2WC2A 2OUJA 2WLQA 2R073 3LA3A 4AVAA 4HN0A 4W65A 4Y4YA 1SQ4A 1JTZX 4AGGA 4E4SA 4K6BA 1XYPA 5FLHA 4WZCA 2UU8A 5DG1A 1ALYA 2VW1A 1CESA 4AGRA 1G7YA 5H9PA 1OKQA 1PIV2 3TWIA 3N35A 4BHPA 5FO8B 5BYNA 1J3RA 2QDNA 2NLRA 2ZHNA 3EJKA 3RJRA 4ES9A 3AP7A 3HBZA 3WHTA 4M01A 2ZX1A 2D44A 1QXPA 5CFCC 1LESA 4AXOA 5JI7A 5BUVA 1FV2A 3N3HA 2ZTNA 1MR5A 2PHDA 3AM2A 3FLTA 1H8VA 1PO21 1CAWB 4Y20B 4FTEA 1BXHA 1ZRRA 1EYBA 4NVPA 4YM1A 4RQPA 2WZR2 4MGYE 4P5HA 5FMOL 2RR11 2O0OA 3AJZA 4K8FA 3IDBB 4MV2A 1VBA2 2XJPA 3VZLA 1MEC1 1NCRA 4YVSB 2AH2A 3DPRA 1H2NA 5FPXA 2RS31 2X8KA 1HRI2 3ELNA 4LBQB 1PIV3 4OI4A 1RUE1 3PLQA 5AVPA 4IEZA 4L8QA 1K5MA 4MZUA 3ZXFA 2TBVA 2ZACA 3VKMA 1A6CA 5ACA2 2UWBA 1WMDA 3CJXA 2Q4SA 1ZZ9A 1V9U2 3KLSA 2WZR3 3VHPA 3KT1A 2HWC2 2WNVA 3FBYA 1VBA3 3DN7A 3IPVB 3FHIB 1H9PA 2WIIB 4Q4Y1 1XYNA 5BXXA 4AVBA 4JVAA 3AFKA 4WM7A 5EFUA 5JZGA 4QT6A 1HRI3 1QXRA 1AYM2 1U12A 1IPKA 1NCQC 4GH4A 1PK6C 3MW4A 3CO2A 1RUG2 1AL22 1IS3A 1HXS2 5EYYA 5AC92 2IXKA 2NN8A 1ZBA3 2BPA2 4W6YA 5GLTA 3VGIA 4HT1T 3OF1A 2GC0A 3D0JA 4XTPA 3W58A 3VBUB 2R49A 2ZABA 1V9U3 1AR82 1ULEA 2LUWA 4AEDA 2D3RA 3INAA 3OD0A 4CDQB 2HWC3 2VUAA 3C2UA 4AI3A 1EPZA 1DGWA 3WUDA 3QLQA 3RG0A 1I5ZA 3WG2A 3BPZA 1RVF3 3AK0A 1R093 3ZYIB 4WM8A 4PLMA 1WD3A 5CU1A 4Q4V3 2K2SA 5FAXA 4YARA 1G6NA 1REEA 4FTBA 3FUQA 4YG3A 1RUG3 4YGBA 1AL23 1COV1 1C1FA 1HXS3 4K7JA 4WVMB 1MZ6A 2R30A 2ZKNA 3URFA 3ZVXA 1J58A 5JLVA 1ASJ2 1V00A 2A75A 2ERFA 3ZSJA 1ZREA 4K21A 1S0DA 4AWDA 4AI1A 1JH5A 2QE3A 4L99A 1BVVA 3HQXA 2AZ5A 5E16A 5I0RA 1VBD1 2K0GA 1RUH1 2WNUB 4XFGA 5K0UA 2R32A 3L9JT 1JOJA 4GKYA 2NM1A 4YVSC 2EAKA 5DZEA 3RNSA 2CWSA 4I3GA 2EXHA 1RUI1 5LEKA 4OUMA 5FOJB 2GNBA 1UN1A 3B7MA 1CAVA 1AR91 3NV4A 4YZ3A 3AX4A 1DQ5A 4QQHA 1GYKA 1VRH1 4MXWB 5DDJ2 3B9IA 5F1RA 1NA1B 4S2FA 2ZCWA 5JAXA 5KWRA 1DG6A 3ZN4A 2