4QU2A

The structure of jmjd7 with alpha-kg
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
318
structure length
318
Chain Sequence
GSMAEAALEAVRRALQEFPAAARDLNVPRVVPYLDEPPSPLCFYRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTELPQLLSDIESHVPWASESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLLHPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWYDMEYDLKYSYFQLMDTLTRATGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing protein 7
publication title The structure of JMJD7 with alpha-KG
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 86
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qu2A00
2WA4A 1H2MA 2XUMA 2YDEA 4Z2WA 4B7KA 2CGOA 5JWPA 4Z1VA 1H2LA 3P3PA 3P3NA 4AI8A 3KCXA 2W0XA 3KCYA 2YC0A 2ILMA 2WA3A 2CGNA 4B7EA 1YCIA 4BIOA 4QU2A 1H2NA 4NR1A 1MZFA 1H2KA 1IZ3A 1MZEA 3D8CA 2Y0IA 3OD4A 4JAAA
chains in the Genus database with same CATH superfamily
3OEBA 4XHBA 3V0AA 2NMOA 1FT9A 1WCKA 4Q4V2 1JH5A 3BU0A 5CKNA 1RJ7A 4AI3A 2HEWF 4YG6A 1CAXB 1H2LA 1UYZA 3LIHA 4CUBA 5H9RA 2BNNA 4AFCA 4A3ZA 1VMFA 4P9XA 5LEKA 1RL3A 1PIV2 2RJLA 1OPOA 2ZGNA 4XJ8A 2WFF1 5BXXA 4AL9A 4CDQA 4QDQA 3VBRB 5F9TA 1S2KA 5A70A 2B42B 2XWJB 1W2AX 4EYUA 1VB2A 4M00A 5JMCA 3WP5A 3ZN6B 2B7YA 3KF3A 3OBZA 1FPN1 2AREA 3ZDSA 1GQHA 1UZYA 3OPZA 4CTEA 1YQ8A 3QH7A 4WM8C 1U5IA 2FQPA 5T5PA 3FHQA 1I3HA 2D6MA 3IDCB 3LQCA 4DEQA 1C5HA 2GH8A 4PBPA 1WLTA 4YZ1A 4QX2A 1UZVA 4GH4B 4QU1A 2EALA 1Z7S2 3P3NA 5DAQA 1YJLA 5FR3A 2D93A 2VUCA 1VBA2 4P9IA 3J4UH 3U11A 5C7GA 4Y1UA 2QQKA 1C8M3 3IMNA 1JODA 2D6KA 3LAGA 1AR92 3AX4A 3PU3A 4QX5A 5EJZB 4DINB 1JYNA 4OZXA 1BXHA 2ETEA 1AXZA 1T6GC 4LUKA 3LFIA 2VO5A 3VV1A 3K46A 4GMP3 2EXJA 5EP9A 3BODA 3RZGA 1UPIA 3JB4C 5FZ3A 2PXJA 4QKFA 4TTGA 3MIBA 3R0RA 3BUCA 1FNZA 3OGVA 1O3TA 4JHTA 1GWMA 3VHPA 2D3SA 3R6SA 4YVSB 1ZX5A 3N35A 3I3DA 1LCLA 1CX1A 1BK1A 1NA1A 1NY72 3ENRA 3DV8A 1LHNA 1LU2A 4QPWA 5APAA 4R9CA 4WZCA 3AFKA 3O12A 1ENXA 4CUGA 1QF3A 1H2NA 5T5LA 4EWAA 2XLAA 1N3QA 1H2KA 2QQWA 1RB8G 3NSTA 4UWDA 5J37A 3MGUA 1UYPA 3JCIA 3R4SA 2WNVC 5FPUA 1LODA 3WF2A 2IXIA 3H9AA 4OCTA 3BTAA 3INAA 2QQNA 2VCCA 1QJX1 2HWF3 2EXIA 1IG0A 4PT6A 2ZKNA 1FMD3 5CFDA 4BA6A 4DZGA 1KFXL 3PMSA 1MS4A 4XF0A 2YU2A 2VMDA 3WF3A 2QZ2A 2GMEA 5FK7A 1W99A 1K5MB 3U78A 1IS4A 3AFGA 5I0SA 2ILMA 5LATA 1STMA 1VMHA 1QJY2 5D8AB 5FZHA 4FP3A 1X8MA 4UFHA 1DYKA 5GKAC 1AR81 4COWA 1HRI3 2A3XA 3C7OA 5FWJA 5LWBA 4HONA 2E7QA 1QOSA 3AP9A 5FMCA 4XJWA 2TEPA 2CAVA 1UF2C 5F5IA 1W3VA 1YIPA 2WQ4A 2ZMLA 3UKNA 5C8CC 4X6QB 2XLFA 3E6BA 1QQP2 3UKVA 4HSLA 4HKOA 4RHV3 1AR73 3NKTA 2ZA9A 5F5AA 3K4AA 4PCRA 2XLGA 1JZ6A 3MUY1 1W2NA 1HV1A 4LR4A 4O61A 3BN6A 3W9AA 2PLV2 4AXOA 3LFMA 3TB0A 2RMU1 4XBNA 1UAIA 1XYNA 3TAYA 2VZTA 2HH9A 4AFMA 2WZR2 5CNAA 1GZWA 4BQ1A 1Q56A 4AEJA 4RQPB 1ONAA 5FZOA 1TG7A 1LU1A 2OX0A 4AVAA 4KH9A 1I6XA 4N53C 2R071 4XC9A 4Y20B 1RUC3 1YO8A 1ZZ9A 4NN0A 5ANNA 1CAXA 2FHRA 4AAXA 3ILFA 1RVF3 4BMBA 4EN7B 2OPWA 4YM2A 5CADA 3VBSB 3OJBA 5E89A 5HXVA 1J84A 4CP0A 2VBDA 5DDJ3 1YRZA 4CDXB 1MS9A 4G4FA 4XXAA 1W2OA 2HWE2 4XJ9A 1VBD3 3HT1A 3I3MA 1WGPA 1ND2C 5JOWA 4E4DX 4ZU4A 1XNTA 4JKMA 2ZTNA 2J22A 4CEYB 4R4XA 1GQPA 1PNGA 3HJRA 1UY2A 2CWMA 4K6BA 3VKOA 2VZUA 3N7LA 4LKSA 4N7IA 5C6CA 5JMOA 1JZ7A 2G19A 1OH4A 5JAXA 4BQYA 5LB6A 3VKLA 1AYM1 3H3ZA 3SH3A 3N9NA 5I8TA 2RS52 3HR9A 3BTYA 3KF5A 4A7ZA 3NQHA 2J1SA 4BQ3A 1Y9MA 5JXHA 5KXBA 1W0NA 1UY4A 2Z4FA 5C70A 2WO1A 2ORXA 1W6PB 4LTAA 4OHYA 1JTZX 1R1A3 5I0RA 4LK7A 4IV1C 5GLVA 4M3CE 4EZHA 5KXCA 5FUPA 4B4PA 3WNNA 4AK3A 5CFDC 2EAKA 2VMHA 2QQJA 4QM9A 3ZXFA 5J7MA 4NAOA 4AGGA 1R1A1 2YXSA 5DABA 3B93A 4OHZA 3O0WA 5C3SA 2RDSA 4DXZA 1GUIA 3GJAA 4HFSA 4QX1A 4XURA 2CHHA 2RM22 1XNCA 2JKBA 3WQ7A 2QQMA 1TVGA 1OQEA 3NV4A 2QZ3A 4HPKB 2BU9A 4YVSA 4GIQA 2UY8A 4YARA 3USUB 3WOGA 1YI9A 5IJRA 1SLAA 5FZBA 1SFYA 1RUNA 2EICA 2HBTA 5EFUA 4Q0PA 4UBGA 4B4QA 1VBB1 2BPA2 4YRDA 4F7ZA 1Q8SA 4NWVA 3GALA 3WX5A 2BTVC 4ATEA 4BOWA 4ZS2A 4CSWA 5A1FA 3U0ZA 4Q4X1 2VMIA 2F17A 4YW7A 2C26A 1DCSA 1QY4A 3ZFFC 4A44A 4DO0A 2R49A 1ZRIA 3VBFC 5L9BA 1YQ2A 2JG9A 4P5HA 2Q8OA 4RFRB 3CQOA 1GKBA 2Y6KA 2GC3A 1VBC3 2OVUA 3LSDA 5D21A 5JXJA 4XQWA 4EZ4A 1BCXA 5FY5A 1J83A 1HX6A 4RGKA 3ZYIB 1ZZ7A 3LPFA 5FJHA 2FZ1A 4Q29A 3TWIA 2ZZJA 3WINE 2VBPA 2XPJA 3DYOA 3RI9A 1K5MA 3NNLA 4XFGA 5FKBA 5BNPC 3WW3A 3I2IA 1MS3A 4NIAA 1F4AA 4AQ2A 1CGPA 4PHZA 4IETA 2V5YA 2ES3A 3KT1A 4LA2A 3SKJE 1JYIA 1UU4A 4HZFA 3D0JA 1UY3A 2Y60A 4IEYA 1UZ0A 2PHTA 4LEJA 2YC0A 4DUWA 5FZFA 2ZAAA 3O0XA 5F37A 5JSRA 2PYTA 4FOVA 2W5FA 4GB31 3OB8A 2WFPA 2DCZA 3R4UA 1BMV2 1US2A 1V6LA 5KBFA 1IQDC 2W2IA 2G9ZA 4X8NA 3ZFGB 1PMIA 2XUEA 2QJVA 4DXSA 1D7PM 3O5SA 4MG2A 1KS4A 5JSOA 1BVVA 4LBQD 3O0VA 1MEC2 1RMU2 4YG0A 4XJUA 5L36A 4N9HA 5JWPA 3OF1A 5HCBA 2WT0A 3VKMA 2JD9A 2RR12 3A21A 3K3NA 3CJXA 4COYA 5FO9B 2PMWB 2K0GA 4KWJA 1EPZA 4DNYA 1XYOA 1V6NA 4Y20A 2FDIA 1C8M2 1HKDA 1WKYA 4UOJA 4GJZA 1AXKA 1GOFA 2D6OX 3J9SA 3PVOA 4ZU5A 4GWJA 3PMEA 4QQLA 3U1XA 2PHWA 1H4GA 1LULA 1AZDA 2KXLA 1H0BA 1CR7A 2AYHA 3AKQA 4KG0A 4Y1VA 4KWKA 3T2OA 4E9KA 3MUZ1 2XJRA 4CDXA 3OGJA 1V6JA 1GICA 4LO6B 2A73B 2EXHA 4BQWA 5EV7A 1NE4A 1R1ZA 5IW0A 3APBA 2X53S 1BK0A 4CEYA 3PDQA 1OKOA 1ST8A 3G7DA 1SLCA 4I0AA 1C1LA 1SBFA 3C7GA 1S0GA 4LO8A 3KCYA 2P1BA 3WG4A 4JTNA 2W1QA 4WVVA 3ZN4A 5FY7A 5IATA 1LTEA 5DUVA 2Z2SB 3M3CA 3AXDA 4PF5A 3B5LB 2YBSA 4ZXKA 5C5UA 3HQRA 5CEHA 4LHSA 4YSFA 1A6CA 2JG8A 2BJSA 4IXLA 4K9SA 3IIAA 3VHOA 1R081 2XVLA 2I2SA 2GC1A 4F83A 1M4WA 2JG9C 4CPBA 1GSLA 1Z78A 3RQ0A 5I0DA 2PN5A 4LKDA 2HWF2 5LA9A 4XABA 3RJ2X 2E7AA 4O7XA 1JOBA 1FMD2 3DCQA 5L7OB 2JDZA 4IGPA 1DQ6A 3I2JA 5BUVA 2HWD1 1W39A 5AVPA 2A3WA 2ZJCA 4Q0SA 3NO8A 2Y26A 5C9AB 2QNKA 1BLZA 5FP7A 4NHMA 5F6LB 5T5JA 4BISA 5FYBA 4Y22B 1AHSA 4Q8KA 4JGYB 2X5IC 3HNBM 3QLQA 3USUA 2UU8A 3AJYA 3S7IA 1RUG3 1VALA 2BGPA 1XNDA 2DDUA 1H8VA 2XVKA 4AI9A 2WINB 3O14A 1SFPA 3VBHA 4YVWB 5FYTA 3FWEA 1YWKA 1QU0A 3ECQA 2Y0OA 2IXKA 4RHV2 4NRMA 1AR72 3K2OA 5C3PA 3V0BB 3DL3A 3H0OA 2Y6LA 4K20A 4QKNA 4BPZA 2VULA 2FCUA 4HKLA 1ZZBA 5A1AA 1DBNA 4YW1A 5LBBA 1WWYA 3O1TA 2VD7A 4IUGA 4XW3A 1H1AA 2NM1A 4XFCA 1RUE3 3RYRA 5A33B 4D6SA 3OYWB 3MI8A 3SNMA 2ARBA 3ELNA 4FT8A 1YNAA 1RUC2 2ZHLA 4TWTA 1IPJA 4IERA 5ISLA 3WZ1A 4B8EA 2FCVA 3B3QE 2ZMNA 3KCCA 3LEMA 1UMHA 4SBVA 4Q4V3 4YYOA 2UYBA 1D0GA 4V2VA 2R061 3LGRA 3CZJA 2BBVA 4QPIA 4YGDA 3B7MA 4KQ7A 4Q2FA 1TME2 3RZMA 1LGNA 1E57A 1VBD2 5FV3A 1PIV3 1B35C 4UAPA 3ZFGA 1R092 1PVC1 2A6VA 4BIFA 1BEV1 1ZYBA 2PA7A 4BU2A 4CEYC 1WD3A 2CDPA 1MPXA 4D6RA 1FOD3 3LEIA 1TNFA 3C7HA 1L7RA 2ZPXA 2ZBJA 2I07B 4UFLA 4UW3A 4XE9A 1S4CA 4XUOA 1LB2A 2WWSA 4J25A 2WNOA 1OD3A 2WO7A 3POGA 5A3NA 1Y4WA 1UMIA 1ULOA 5FP8A 4PDWC 3RS6A 3M70A 4OHWA 3ZX7A 2H6CA 4L8QA 5FXWA 1AR63 1ZZ8A 2JG8C 3CDZB 4RFT0 4TLGA 2IXHA 1V0AA 5ANQA 3BKZA 3PNAA 1Z7S3 2WSVA 1QXJA 2VW0A 1OPMA 2ZX0A 4LA3A 1W0PA 1PGW2 2PHDA 2VOKA 5JR7B 4MX3A 2LS6A 4EN0A 2JDYA 5EJ3A 2JB4A 1VBA1 4E4HA 5JOXA 4N7UA 5CB7A 3URFA 4ES9A 2BERA 3I2KA 4H7LA 2XHNA 1F2NA 3M3IA 1AR91 2WS93 4WBBA 5DUUA 3OUHA 2YU1A 2DYCA 1YUDA 2BVVA 4QX0A 2WA4A 5GLZA 3AJZA 4R8HA 5DUWA 4QAWA 5F3EA 2OZJA 2HKXA 1PO23 5LK5A 3ETQA 2JECA 3POEA 4XJZA 1GZCA 5JZGA 3E5XA 2NMNA 3VBHC 4ISQA 3E6CC 1O3SA 1RUOA 2YG0A 4FI9A 4CP9B 2RV9A 3D0SA 5C3RA 1IG3A 4XTMA 1AL22 2K46A 3GZAA 1OC1A 3KV5A 4HVRA 1WBFA 1QHDA 2XJTA 3VZLA 2Y6JA 1VBC2 1NY71 1WW4A 4YLZA 3AVRA 1RUF3 3O1OA 1EAH3 2WNVB 3AZZA 5A3WA 2YPDA 2Y6HA 5L7OA 3OGSA 1D4M2 2VQ0A 3LDKA 4E27A 5C9AA 1EUUA 4IEOA 2QFEA 2V73A 5IUQA 5G04L 2B8MA 3MV01 4Y22A 4DUXA 4U2AA 2P6HA 4PI0A 4BZ4A 4JGYA 5LASA 5FRAA 4IEZA 2ET1A 1R64A 4QQHA 5FFOC 5IVCA 2JWPA 4MSVA 1QJY3 3FJSA 3K51A 1HRV1 3BIWE 4MGSA 5G05L 1QJFA 1YFYA 4QPIC 5CKQA 4YVWA 2Q0AA 1SDWA 2MEV3 5FLIA 5FYHA 1Y9QA 4QMAA 2XGXA 5HCAA 4YFWA 1PK6C 2YUEA 1KEXA 3J7MA 4OQ8A 4PI2A 2VXJA 3KVAA 3V0BA 3BI3A 1WCSA 3RZKA 1XE0A 5C8CB 1QGLA 3A23A 4NAMA 4RL7A 1OXCA 3WW2A 3ZIWA 3J8F3 3VDDC 1CZTA 4TN7A 5FLJA 1QQP3 3N7JA 5GZFA 4DEVA 3VDBA 2HWB3 4FAGA 2EF6A 2OQ6A 3T30A 3F95A 2BWCA 3AP5A 1POV1 3H3LA 3DYPA 3OYWA 3NRUA 3RZLA 1BJQA 1DLLA 1FAYA 2D6PA 2D98A 2PLV3 1VAVA 2VVDA 4XAAA 3T3YA 3OOXA 2WAAA 3VKFC 1G9AA 4LOTA 4Y4RA 1JZ2A 4D8MA 1W9WA 4BB3A 4CCCA 1DHKB 2W91A 2C4XA 1ENRA 4MOAA 1BHGA 2ERFA 2GN7A 2WNEA 2IC1A 4Q4W2 5KHKA 1W06A 2IZWA 2XOMA 2KA3A 4N53B 1XE7A 3T1LA 2GNDA 1WZXA 1ZRFA 2A5ZA 2WZR1 1JU3A 2E26A 4LORA 4P00B 3I54A 3SCGA 1LECA 2D3PA 2WN3A 3HQUA 2BZDA 3I59B 1RHI1 2QVSB 5FO7B 4R52A 2V4VA 1IPSA 1T6BX 4GALA 4QXBA 4FP2A 4L92A 3T2TA 3SLIA 4HVOA 3WDWA 2VXRA 3I3QA 3ZLIA 2DU1A 2VQUA 4HK8A 2HWE3 4KMQA 1IHMA 1U5ZA 1ND2B 4P08A 1X7NA 4LOSA 3RRDA 4LBKA 5IK8A 1QJU3 2VL4A 1KDKA 1KS5A 1TQ5A 1MZ6A 1EUTA 2JEMA 1ASJ1 4ZS3A 4K8RB 5JZGC 1FX5A 5IT6A 2AEZA 1JYXA 4AHYA 2V72A 4XF9A 5JOYA 2G4IA 4XILA 2O1QA 4EN9B 1C5IA 1UQXA 1S0DA 1PM7A 2A71A 4DPNA 2NN8A 4B7KA 2IWGB 2ORZA 2YHJA 5FYVA 4META 3UKTA 1KJLA 2RS51 5E8AA 4JTOA 3TNPB 2C9AA 1O4ZA 1DYOA 3MF6A 3ON7A 1OF4A 4IV1B 5JSPA 4HBNA 1SCRA 2JXAA 1XNBA 5C9AC 5CFDB 4PIXA 2ADEA 2DCYA 1IKPA 1L7QA 1Y43B 2XHKA 5L73A 1N1SA 5HPOA 1ULFA 5IYYA 1RUG2 2F4PA 2E6VA 2SBAA 2VBBA 2V09A 3DKWA 3RDIA 2WABA 3UJOA 3ZYJB 5KXDA 4F8AA 3ZM8A 3CLPA 3NAPC 4ITCA 1RITA 1SACA 1TMF1 1GBGA 2VUDA 5FZCA 1HQWA 5F5QA 3AYAA 4LO5B 2RM21 4CP9A 5A3UA 3Q8BA 3WW4A 3VDAA 5FYIA 4PIZA 3ITQA 3ILRA 4FFGA 1WBLA 1YLLA 3ZFFB 2G1MA 2GAUA 3VDCA 3PU8A 3VBFB 3RWKX 4OULA 1G9FA 1X50A 1W28A 3MZHA 1RUE2 1E5HA 1W8ZA 2BUKA 2PHFA 1ZVFA 3KT7A 4QPYA 4QWNA 1YQ6A 2ZGRA 1GANA 2W1SA 1LOCA 4QXKA 4Z1VA 4JX0A 3FFQA 2EIDA 2GZWA 3AP6A 3POIA 4DY5A 2CWSA 4AOCA 3M3EA 2B5HA 4LBNA 4N9IA 5FZOB 5BNPB 1SDDB 2PHUA 2R30A 4YW4A 5FMOS 1DP0A 4COZA 2WQZC 2W08A 2L9LA 2RS13 5C5TA 1GQGA 2YY1A 3CKHA 2DUQA 3MIGA 4AW7A 3R05A 1MACA 4ZZ8A 3JB8A 3OGRA 4QT6A 2ARXA 5EQUA 3E5UA 4X8PA 1SLTA 3JBG3 5C8CA 1QNYA 2QUOA 3ZSLA 5FXXA 1Q8QA 4IEXA 3V56A 1FOD2 1S0IA 1X9TA 3MLLA 3RI8A 3V65A 1POV0 2VY0A 2O14A 1BMV1 4AVTA 4BYYA 1BBT2 3L2HA 4Z2WA 5DMYA 3H8RA 1ZZCA 5T54A 1MEC3 1RMU3 4AFBA 4KG8A 1OI6A 3D3AA 4LITA 4MHUA 1LHWA 3KGLA 2QQLA 2BW8A 5FPAA 3TBDA 1AR62 1V00A 2OW4A 2XWBB 3O1RA 2R1BA 4P5YA 1ZRRA 2GNBA 2RR13 1CESA 4BJ0A 3MEPA 1MS1A 1L3JA 1RMU1 1XU2A 1EYBA 2D7FA 4LBJA 1NX9A 3AP4A 4N53A 2VZSA 3C2UA 3SXWA 1IS5A 1NT0A 2RR11 1KITA 3VHRA 2FZ2A 2LRPA 4RGGA 3EBRA 4CU7A 3BTZA 2XDVA 4XZUG 5B4NA 3I59A 1RUD2 3WW1A 3KZ4C 1VJ2A 4QPGA 1C8M1 1DZQA 1VR3A 2E31A 4IV3A 2DUPA 2WS92 4HK9A 4XDOA 4XF1A 5JI7A 1WMEA 1NXD1 2PFWA 3ZXEA 5HCHA 2W95A 1WLCA 1YJKA 3I2FA 4HMZA 3MIHA 1E5RA 5SV5A 3MF9A 4S2HA 3VBSA 1ND2A 1Y7BA 4NHLA 4GMP1 3UESA 1PO22 4KI5M 3SH5A 3GGLA 3WNLA 1SEFA 4C8DA 4OHVA 4CCDA 4QQ2A 5CAZA 2RS33 4XETA 4LJHA 4ISRA 2ENRA 2P5BA 3IT8A 5HV4A 3I2HA 2E63A 3OBTA 1W2TA 1CX4A 1OVPA 4AEKA 1W6NA 2JDNA 4NPRA 4B7EA 1W9TA 2AC1A 1JBCA 4CXXA 2DFCA 2XONA 4AHZA 3N9OA 1SCSA 3MFAA 4AE2A 4FPLA 2E7TA 4ORFA 3PVEA 4FTSA 1JHJA 2VCAA 3THCA 1G8WA 4Q27A 1RUF2 4QX7A 5F3GA 1EAH2 2VZ1A 4I0BA 1WCUA 2JG9B 4L2NA 4RS5B 4YW5A 1DDLA 2VR4A 4FVVA 4CXYA 5KHIA 3O1SA 1MZ5A 4P9JA 1S2EA 5FYUA 4IV1A 2HYKA 2VNRA 3FE5A 2B46X 1FYUA 1S0FA 4RA0A 4R9DA 3ZXKA 3WV6A 4ATFA 3S6PA 3NJYA 4KWUA 1O8PA 3AB0A 1APNA 1ZM1A 3GHNA 3ZSMA 3DPRB 5F2WA 2HWF1 2B4KA 5AVAA 3W21A 2AUYA 1HV0A 2IFRA 2VZPA 2WZ8A 5FY8A 1FMD1 4W6WA 4MLOA 4RYDA 5KHJA 3WXPA 1WCQA 2IUWA 3NL1A 3AYCA 3SKVA 1LOFA 4IEQA 3ZN5A 4UW6A 2ADDA 2X5IB 3B9IA 1NQJA 1UZZA 2R043 5FZEA 3ZYHA 2P17A 2MEV2 4W4ZA 1UKRA 2XKOA 2DWRA 3OD0A 5EYYA 2D6NA 5FP4A 1NCQC 1HRI1 3MPBA 2P34A 4JRLA 4DXRA 2AGSA 1UIKA 5C3OA 1C57A 1C3HA 3J8F2 4Q4Y3 2VQTA 5JXIA 3ZFFA 2HWB2 3BB6A 3VBFA 3Q8EA 5D2AA 3RG0A 1H8TA 1AF9A 2WZEA 1LHOA 3ZMNA 3AMMA 1K5JA 4WVMB 3I3EA 1CIWA 4RHV1 1AR71 2JDHA 1AYN2 1HB4A 4Y24A 2WDBA 1O8SA 5L9VA 2QBXA 1O5UA 3ZR6A 4K8FA 3K77A 4E2QA 4XIOA 1G9CA 2Z42A 4LNVA 2FBEA 5BNPA 4GWMA 4CXWA 3POYA 1JYCA 4LBOA 3ST7A 4XXPA 2WWJA 1PHMA 2F4LA 2FDHA 1W8NA 3MLJA 4CRQA 1PMHX 3RZHA 1K45A 3QACA 4M4RA 2EIBA 4L99A 4FTEA 4AVCA 3IDBB 4JKKA 5FJKA 3LD8A 2ZX4A 3MHZA 5FAXA 2VGDA 1RUC1 4DB5A 4QPGC 4IV3C 2ZXQA 1DZRA 1RVF1 5IVEA 2ET7A 2VZ3A 1TME3 1B35B 3A4UA 5FMOL 3W5NA 1OFNA 3VUOA 2CGPA 4QD2A 1KGYA 1W9YA 1R093 1NLQA 1QJU2 4P9WA 5DDJ1 3U10A 5F7UA 5FZDA 2XQXA 2AR6A 2HJIA 1YIFA 4M3CA 1GP5A 4NHXA 2JDKA 2JDAA 1VBD1 3ACHA 3MIFA 5GLWA 4C90A 2D40A 4SLIA 4DMIA 1R091 3KWVA 4FTBA 1FATA 2XJPA 2R1DA 1POQA 3G6JB 3OPWA 3LA7A 4PDWB 4DOUA 1CPMA 5HI0A 1JZ8A 2ZACA 2ZMKA 1PO12 3NVCA 1VAKA 3B94A 4MGZE 2JG8B 4L97A 3ZYFA 4CVUA 4FFHA 4NPLA 3RNSA 3LIGA 3N9QA 4ZPIA 1DGRN 3AVSA 3WDVA 1KDMA 1D2SA 1VB4A 2YFZA 1W6QB 1QH7A 4NJ4A 4GXLA 4OMDA 4Q5OA 5FREA 3WSOA 3MV11 1S0JA 2XG3A 3IPVB 2PQQA 1NZIA 3K4ZA 5LRSA 1UY0A 2LW8A 1COV2 3ZOIA 3LOBA 4HSJA 4XUQA 5I93A 1ZBE3 5ACA2 1BZWA 3AZYA 3NJVA 4GMP0 1EV13 1PGW1 1A8MA 1S55A 1IS3A 4IESA 1OLMA 2D44A 4UT5A 1LOFC 5BYNA 5FDBA 4QGNA 3OEAA 1HQLA 4OI1A 3O1MA 1IGOA 5GZGA 1W8UA 3FHAA 4I0WB 2Y34A 5K0UA 1NLSA 3IAQA 1DGWX 4HKWA 2V5DA 3VB9A 1RGSA 3VBHB 1HXS3 4O9GA 4NIGA 5DQ0A 1FNYA 4N8MA 3VL8A 1O7FA 4E2GA 5LA1A 3ZYPA 3IM0A 5HCFA 1DQ0A 1OQ1A 2A75A 1FV3A 1AL23 1SBDA 5CBLA 4RS5A 1H8TC 1RJ8A 2XB6C 4RSUA 4N43A 1OOPA 2DVGA 1QEXA 3HWJA 4CCJA 3ME2A 3L2YA 1OUSA 3OCPA 4BQ5A 3WHTA 1D4M3 1UD1A 1VBC1 2J42A 2ZHKA 3DPRA 3HBZA 1CZVA 3NW4A 4HXCA 1U5YA 4JC1A 5A6ZA 2BV4A 2VNOA 2O0OA 3HOBA 4H3WA 4IE4A 1JZ3A 2GSYA 3H1YA 2XMLA 3GZUC 3OGGA 2V4AA 4C0BA 1ZRDA 5BNNC 2AEYA 2RS12 5T3NA 2X5IA 1YFXA 1U5XA 2DTYA 4XDQA 4AWDA 1AJOA 1WMFA 4NE9A 5C71A 4P9YA 3FUOA 3POWA 3O1PA 4QPIB 4ET7A 3JBG2 4DQAA 2GN3A 2WLQA 3WF0A 1WLWA 4HT1T 1PK6B 4XQ4A 3CHXA 1H4HA 2GH2A 1VBE3 3LKJA 4KBBA 1CQ9A 2FDJA 2Y0IA 3OD4A 4M0NA 4YGEA 5A7PA 5AFBA 4JAAA 3SMHA 1J3QA 1WD4A 3VDDB 3PLQA 3A0KA 1WW5A 4WVMA 1JI6A 1AX0A 5H9QA 5FBJA 4AFDA 2TUNA 4IEVA 4AGRA 3A22A 2XVGA 5IFPA 3WP6A 1JXNA 1DGWA 1GP6A 3MW3A 1YHFA 3NWKA 3UYJA 3WG1A 4COVA 1PX4A 2VW2A 3F2ZA 5A32A 1N1VA 2ID4A 2BNMA 2WT1A 2XJUA 1MS8A 4UW4A 4Q4W3 2DVBA 4YZ3A 4DS0A 4KWLA 4W6XA 4XIKA 2VAUA 3KQ4B 4FAHA 2XBO3 1RUJ3 4V2WA 1FXZA 4KGQA 4TZDA 3IBMA 1GNZA 2G9FA 1FI2A 2ZGQA 3D6EA 1B35A 5JI9A 3ACIA 3BU7A 2RS32 4MUVA 4EE2A 4L9BA 4NIHA 1M06G 3UL2A 4D3WA 1G6NA 5ERLA 3FBMA 1W8WA 1TEIA 5FPLA 5K0UC 2AH2A 1W8OA 2BDRA 3UGHA 3LPGA 4URAA 1CAVA 4MXWB 4QGMA 5JZGB 4LBMA 4PDWA 1V9U2 5EYXA 5FP3A 5GALA 3I4IA 1HIXA 4L11A 3NKGA 5F3IA 1X9PA 4XUNA 4QHOA 3THPA 4GQ7A 1OKQA 2IVIB 1NCRC 1ULDA 3KVBA 1RXGA 4AHXA 4AI2A 1W6QA 2VMCA 1SLIA 4RS5C 4ZKTB 2ZGLA 5A7WA 5J48A 3IPVA 4IE6A 1OOPC 1ZA7A 2WBKA 2Q1FA 2VECA 2MHFA 4N43C 2DV9A 5FY9A 4AZZA 5T52A 2CU5A 3I7DA 2DCTA 4OI0A 4EWDA 1RUI3 3HPNA 3FLPA 1YXWA 3DPRC 1UKGA 2J1TA 3HN3A 4Q0VA 4Z82A 5CZKA 2VZRA 4OFGA 1O4YA 2CAUA 1JU4A 5A3MA 1HQNA 1JMUB 3RPQA 5A6YA 4XZPA 1QJX2 4FBFA 2D43A 1D0HA 2R042 1WA4A 3MIEA 3AKTA 4FXKB 5SV8A 2A70A 1OBNA 3LF7A 5TSWA 3AKPA 3WCRA 5LK7B 1SG3A 2VG9A 3NAPB 2H6BA 3W20A 1NZCA 1W05A 3TN93 1JOJA 3GHMA 1RUG1 1N3OA 4Q4Y2 4OI2A 3NJXA 3SEPA 1JYTA 1SFNA 1CIYA 2Z5WA 4AQSA 2OPKA 4XJAA 5AFEA 3EJKA 1DLCA 2MPFA 4XPVA 3MW2A 2A6ZA 5FY1A 3HD8B 4W8JA 2IXJA 2YMZA 3M2MA 4O9EA 1J59A 4JQTA 4PLMA 1V70A 3ZYBA 1VMJA 2NPIA 1BYHA 3NMBA 3CO2A 3FN9A 2RHPA 4DRVA 2VTFA 4M4PA 4XAEA 3UETA 4D0QA 4PBOA 1XU1A 4Q0QA 3CEWA 2ZOEB 3DXTA 3PTYA 1S2BA 4H55A 1RUE1 4RN5A 3KQRA 4Y26A 3PIGA 5FZ0A 3T09A 4E8DA 3H8UA 2CYFA 2W39A 3ACGA 3GJBA 5K7PA 3WF4A 1QDCA 2Y38A 3OPTA 3BOPA 4ZY9A 4CDUC 3N9MA 3M3QA 1K3IA 2OXBA 4XBQA 3K4DA 2I45A 4YZ5A 3BTXA 3OBAA 5FZKA 3VD3A 1ULEA 4Q4V1 2R072 1PK6A 4XTPA 3WEZA 3GCXA 4QKDA 1JZ5A 3HNYM 1IOAA 1H6YA 3VDDA 3THDA 3ZSKA 2YC2A 1PMJX 2VNGA 4I30A 1PIV1 2J7MA 3MO4A 5A80A 4A7YA 4LHLA 1O3QA 2JICA 1W2UA 3NNFA 2WUHA 5A6QA 4NRPA 3GNEA 2PELA 3P6BA 1FOD1 1BBT3 3FL7A 3O7OA 5DG2A 3WNKA 5ABJA 1OA3A 3LA3A 1G7YA 3ALQA 4LT5A 1DG6A 1AUYA 3GBWA 3MFCA 1J3RA 1VRH2 4TXWA 3UK9A 4LPLA 2YZ4A 1B09A 3HVDA 4WM7C 1QWRA 2E9QA 2QQVA 2RE9A 1AR61 1LOEA 2FMDA 3POBA 1ZNPA 1ZRCA 1QJEA 4NHKA 2Y64A 4KBZA 2JKXA 4INDA 3UNPA 1Z7S1 3IAPA 1ZBE2 5I0UA 4JCKA 1MR5A 2VCBA 3OG2A 5FO8B 3SEEA 4Y33A 2CTVA 1EV12 2YV8A 1RUD3 4FPHA 1MZEA 1OVSA 2YGLA 1RUH3 4IQPA 2RG4A 3ABZA 5FLHA 3SC7X 5KC6A 5FPVA 2Y6GA 3S57A 2LROA 4AAPA 4K1YA 4MV2A 3JUUA 4YG3A 2WS91 4Q1PA 4X6RB 3WF1A 4QHBA 1NQDA 1HXS2 4MXWA 3TRSB 5FZLA 2VZVA 4CA9A 1PO21 2RDRA 4GULA 1VAMA 4YM1A 3AP7A 5FTTC 5J09A 2W9XA 5CG9A 2E51A 1KQRA 1CJDA 1DU3D 1OD5A 4CU8A 1GZ9A 1AJKA 2ZGTA 1XBFA 3H8OA 2Q8CA 1PZ8A 1XB9A 1QJZA 3L9JT 1HJFA 2NQYA 3Q9OA 4GJYA 4UI9L 2BNOA 2GDFA 4Y5Z0 5FIXA 4AI0A 2EAAA 1DIWA 3U4SA 1N47A 5FYZA 1O59A 2H0BA 2LM3A 2XL7A 2J1UA 5FZ8A 4Q4X2 5I8SA 5IVJA 1RUF1 4CEWB 1EAH1 2A1XA 4I2OA 3UT0A 2FDFA 1WUVA 5DAPA 5JXGA 4EWEA 5BNOC 1NUKA 1ND3C 2OUHA 4I01A 2OS2A 3MBWA 3VBUC 2P3JA 2ZX3A 3HNMA 1DQ2A 3ACLA 3ZPOA 3DECA 3CF6E 4D6QA 4QX8A 4MGKE 2I74A 3ORJA 2JD4A 1IKQA 1LENA 3NAPA 5A7NA 1O91A 3KT4A 4WZFA 3ZXJA 2VH9A 1UXZA 3VZKA 3RYKA 1QJY1 4COUA 1VBE2 1NCQB 2DU0A 4LLFA 1NXMA 3QCWA 5JVVA 3RMYA 4EQVA 2MEV1 3K3OA 3LOIA 4BXFA 1ZBA2 1VE0A 1GMMA 2VM9A 4FFIA 3J8F1 4UF0A 2WQ8A 4A3XA 3RZJA 1QQP1 2WC2A 1LAJA 3IN9A 4XFFA 5FQ0B 2HWB1 5ABJC 1LNSA 4L0PA 3GDBA 3J7LA 1AYN3 1UXXX 1S0CA 4OI4A 2WJSA 4CE8A 3PURA 4QB1A 4NR1A 4NWWA 3ZVXA 3AZXA 4AEDC 2OIIA 4CUAA 2PLV1 1LOBA 3GYDA 2YBPA 4MGYE 1CZSA 1JHNA 3Q8AA 4QX3A 4B4RA 5A6XA 1CONA 2D6LX 4Z07A 4XMAA 1GOGA 2XBO2 3WY6A 3S5QA 5K4LA 4D94A 1KD7A 4C0HA 3O1UA 1RUJ2 4XFBA 2J1VA 4NIIA 2ZS6B 1ULGA 5GJ6A 4ARYA 1HLCA 5H9SA 4JDOA 5FZ4A 4QPGB 3QBQA 3RMXA 4IV3B 4YPJA 4GA9A 4PJYA 4EN6B 1F15A 2GMPA 3THTA 3NV3A 5FOBB 5IVFA 5T55A 3ROUA 1CAUB 2B45X 2A7AA 3FFZA 5F5CA 3VZMA 4Z8BA 3FC0A 4DXTA 4BK5A 1Q8VA 4Q26A 2C9KA 2VW1A 1GWKA 1WCDJ 2HWE1 3AKSA 1EPWA 4FQZA 1U12A 5E1RA 4XEZA 5FY0A 1W6NB 3BGAA 4IE7A 2VTXA 1QJU1 4JV4A 4LIVA 4HL0A 4PF1A 4ARXA 1A34A 4W65A 1JUHA 1QNWA 1OT5A 3RZZA 1PM4A 4LBQA 2VMFA 5LRRA 4Q1RA 3TYJA 1PO13 3NNMA 4K40A 4D7SA 3DUIA 4Y4YA 3WG2A 3EB7A 2ZGKA 1MQTA 2ZEWA 5FUIA 4FOQA 1RUI2 2B9VA 2PTMA 2JDUA 3J26N 2KM2A 4PQQA 1X36A 4P02B 1COV3 2A6XA 2HBUA 4HETA 4YM3A 5CISA 4MYEA 3ZR5A 2OUJA 3LB9A 4XVHA 1HB2A 2VOWA 5ACA3 4R4ZA 2QKDA 2ZGUA 3JQXA 5J98B 4B3NA 5FUNA 3TOJA 4FPYA 3AMPA 1DZTA 1H1IA 4OYUA 1LOGA 5F2SA 2BWAA 3POSA 1CPNA 5FXZA 3C7FA 4QDRA 1XC6A 4FOWA 4G3YC 2YB7A 1SMVA 3TN92 2JE7A 3W5MA 1HJGA 2XQRA 1F9KA 4HN1A 4I02A 1KRIA 3ZPYA 2X8KA 1V6OA 1PX3A 2UY9A 3EO6A 1Q3EA 3VKNA 1NLRA 4ZU7A 2EIGA 5FKCA 1JW6A 4WVWA 2GP5A 2BGCA 4MHRA 2BBAA 3ZFEC 3E5QA 1PGL2 1OA2A 3HIFA 4LKEA 2GNMA 4KU7A 1H8TB 5DAVA 1OA4A 3CJIC 2P37A 4LQRA 2NLRA 2QQPA 4FQ4A 1BVP1 4CEWA 1I1EA 1J3PA 4JRAA 5C8WA 4Y1YA 1LHUA 4CCKA 2O8OA 3PUAA 1TNRA 1F31A 3WP4A 4BH9A 1VLNA 5KR7A 2HWC3 4ASKA 3ZDVA 1UOBA 3HMYA 2Y8KA 1P8JA 3VBOC 5AC93 4GWIA 3ZKYA 4Q8LA 3S0MA 2PAKA 4A42A 1SLBA 1ULCA 4JHZA 1W6OB 5BNNB 2WNUC 4LO4B 3EHKA 1C28A 2CY6A 5FZ7A 2OQ7A 1O3RA 3HEIA 4AVBA 3AM2A 4J1WA 5I0TA 4AFAA 2RS11 5FZGA 1NCQA 3ETPA 1YQCA 4IE5A 4RGAA 3VLBB 4BXSV 4EROA 1CWPA 2JB8A 1YI7A 3DGTA 2GC2A 1LGBA 4OZOA 2ZHMA 1JN2P 3FHIB 2K9ZA 4Y5SA 2R062 3RYPA 1A3KA 2RDQA 3JBG1 5LBCA 1JZ4A 4M3CB 4FO9A 2VJXA 3BVCA 1OF3A 5FMBA 3WCSA 5J3UA 5FQ0A 2WFF3 5CYYA 1PVC2 3UJQA 2D3RA 1BEV2 2VCMA 2W68A 2DFBA 2P3KA 3E6DA 5FZAA 5F32A 3FBYA 3S30A 2JDMA 4K1ZA 1UMZA 1MEC1 2R16A 1VP6A 5C33A 5IK4A 1QXRA 2W1WA 1CD3G 1FPN3 2Y6FA 4QU2A 4CDWC 3KGZA 4GAZA 4XCAA 1MQTC 2VMGA 3KV4A 1RC6A 4EJRA 1WW6A 2VC9A 2DVFA 3CMGA 3D8CA 1G9DA 2WWUA 3NV2A 3TEZA 3FZ3A 1RUH2 5KHGA 5FPXA 5J36A 4CPBD 2EXKA 2PAEA 2WLPA 2XXZA 4MGIE 4I3PA 4IEUA 2CGOA 2PQSA 2R0FA 1CAUA 4IGOA 1H6XA 3T0AA 5T5OA 1W3XA 3WQBA 1VIWB 4FPFA 4BWOA 4H7MA 3WDXA 2HLEA 4XHXA 1W6MB 4NPMA 2CL2A 2EA7A 4AI1A 5K0UB 2VNVA 4UFKA 4LHKA 1HN0A 4ONUA 1W8HA 2RS31 3RJRA 1RIRA 2WYSA 3HT2A 2JJ6A 5C4WA 3T0BA 1V9U3 1O5LA 5DPNA 1N1YA 3BYWA 1UZWA 4AF9A 4C91A 5KC5A 2O8QA 4BQ4A 3VGIA 5C3QA 1N1TA 1NCRB 3MLKA 1ALYA 3USSA 5GZCA 1AXYA 2CDOA 2VTXJ 1XNAA 4G9SB 5JIAA 1V9U1 3LDRA 3M7AA 4QB2A 5EIYB 2WN2A 4FPGA 4N43B 1OOPB 3J7NA 2R6QA 4Y1XA 3GM8A 2J1RA 2VOTA 2X10A 4CEWC 5FYSA 4YNIA 4CCOA 1PZ9A 4RR3A 3O1VA 3N9PA 2ZABA 5BNQA 2DBNA 2LALA 5LA2A 3U14A 5J1XA 4Y1ZA 1HB3A 3V64A 4W6YA 3ZO0B 1F5FA 3H42B 2D97A 2JDPA 4GZ9A 3RWNA 4DFSA 4EV0A 1QJX3 2YBKA 3HBKA 5JLVA 1V6KA 3MW4A 2WKKA 4JGZC 4XUTA 1IZ3A 5IAXA 3R4DB 1S0EA 3KMHA 5I8YA 4LBLA 3NNJA 4O65A 3IB3A 1UCXA 1H2MA 1UPSA 2R041 3GZEA 4LUMA 4KL1A 4MADA 4YW6A 4A45A 5LW9A 1PVXA 4JDNA 5FP9A 5JR2A 1HRV2 4XQDA 5CFCA 2R0HA 1GU3A 2VPVA 5FCCA 3SH4A 1AR83 5BNNA 1I5PA 5JPMB 2VE1A 3AKRA 4KU8A 2XJSA 2Z69A 3DN7A 3POJA 2C0ZA 4LE4A 4QM8A 5F1RA 5LY1A 4Q4Y1 4V1PA 5EHDA 1DQ4A 5F3CA 1GR3A 5JCTA 1OH3A 1SHWB 3T4VA 1N3PA 4BIOA 4YWAA 3WNMA 3N3HA 4I3GA 4JKLA 4MVTA 4TSVA 1O6UA 4C1XA 1HW5A 2HYXA 4OUEA 2GNTA 2FCTA 3PJYA 1GV9A 2EIEA 2WRAA 3VD9A 3VZNA 3CZUA 3WNOA 5HV0A 4CDQC 3AL6A 2FDGA 4E2SA 3TNQA 1OFSA 2P6CA 1SPPB 5A32B 1Q5OA 1W6OA 4H2AA 1UU6A 4W50A 2OYZA 4DIQA 4KNCA 4R9AA 1UYYA 1QH6A 2YYOA 1WMXA 2RMU3 3BCWA 3GZTB 2JE9A 3P5BA 4I09A 4CDUB 3MPPG 4DRRA 1UL9A 4BLJA 4JVAA 1CJPA 5J96B 1UY1A 3M8LA 3P3PA 1QDOA 3PJQA 3EMRA 4XF3A 1D2QA 1DQ1A 4ZONA 4UFJA 2CSGA 2QE3A 2R073 1PGSA 5K9YA 4UW5A 4PLNA 2WR9A 4XOGA 3QH6A 2Q1MA 1TME1 1DGLA 1RHI2 2F6BA 2UURA 4S2GA 1IQAA 1REEA 2QTWB 4LXLA 2KR2A 4HN0A 3SCFA 2OT7A 5E6HA 1X33A 1CAVB 4JDMA 1TE1B 2Q5TA 3HQXA 2C6SA 1DQ5A 1L7LA 1G86A 5FPBA 5LY2A 5C4WC 3KHBA 3C3VA 3W59A 3T0DA 2ATFA 3VBRA 1ASJ2 2WT2A 4AVVA 1ENQA 4A2UA 1VRH3 2ARCA 2DCJA 3WUCA 4MZUA 5A7WB 4WM7B 3B00A 3ZN6A 5EWSA 2BYVE 2XKPA 5LBEA 1AYM3 3UGGA 4AHWA 4AQTA 2VVFA 3C7EA 4M3CF 3PUSA 4CU9A 5IVVA 1VRH1 3N7MA 3PUHA 3U75A 4N90A 4AVSA 4RR3C 1NA1C 2VVEA 4XMIA 1RTVA 4BE3A 4S2FA 4M0HA 3WD5A 4GH4A 1UX6A 2IXLA 4NO4A 1QOOA 2ZZQA 5KHHA 4AGVA 1ZBE1 2W87A 2Q8EA 3VL9A 4D69A 2YROA 4NHYA 3VD5A 1GLHA 1W6MA 1OUXA 3JD72 4FPOB 1UX7A 1EV11 5FZ6A 1XQNA 4NROA 2IXCA 1Q8OA 2XL9A 2RJKA 2A6YA 3IKWA 5LBFA 1LRHA 2BRTA 2ZX1A 1O4TA 3KM5A 4MO3M 3H1MA 2CNAA 2KD7A 2FD8A 1TZOA 3IIIA 2JX9A 4QHZA 2ZGOA 2H0VA 3VZOA 2B9UA 4A6OA 3ATGA 5CFCC 3CNAA 1NCRA 1HXS1 4LO7A 4K21A 3AZWA 1TMF2 1JYWA 3QOPA 3H3UA 4CU6A 1AVBA 3Q8FA 4URTA 3QD6A 4A41A 5BY5A 5A1LA 1VBB3 2ZKLA 1AL21 5LA0A 4CYDA 5DAXA 3AMHA 3I2GA 2Q8DA 1IPKA 2NYYA 1H30A 4Q4X3 2HWC2 1W90A 4AYUA 5A7SA 3UGFA 2K2SA 2RVAA 5AC92 3PL0A 4XBLA 5BNOB 1YFUA 1ND3B 4KGGA 3E97A 1D4M1 1V6MA 4P14A 5D1IA 2FDKA 3VBUB 2N7GA 2WO2A 1UOFA 2XH6A 3CBNA 3D5OA 2QCSB 1KJRA 1OLME 3T1MA 4UYBA 3JQWA 4FOYA 2IVJA 4BCUA 3FX3A 1LEMA 2W3JA 3DEMA 4AEMA 4XFIA 3LSEA 3LDBA 2J1EA 3KHCA 1DF0A 3T08A 4FCAA 1SBEA 4NMIA 5D8AA 4BMEA 2E33A 4GB33 1ULPA 1BKZA 1VBE1 2Q4SA 2WFF2 3ASIA 3WNPA 4CCMA 5BV6A 2PHLA 4XCBA 1ZBA3 5JIUA 5IFTA 1UN1A 1JOPA 1SQ4A 1ODMA 2W0XA 3AK0A 3LEKA 3WP3A 5ABJB 4OVEA 1BQPA 5JOZA 1ACCA 2ZGSA 3WDUA 2GP3A 4WVZA 1ZBA1 2BOJA 2ZEYA 1FPN2 4E4ZA 1IS6A 1SPPA 3VBRC 1UW8A 2X05A 3TEYA 4AEDB 4MGQA 4HG6B 3WDYA 1T2XA 4QQPA 3AXEA 1XYPA 1NAEA 4CDUA 4NRQA 1MVQA 2QQOA 1RYYA 1VPHA 2XUMA 3AMQA 4Q4W1 4UFMA 3GCWA 2R7EB 1WA6X 4H14A 3WHUA 5A3PA 3EXUA 2RDNA 2VZOA 3WVJA 3ZKUA 1UOGA 4ZZ5A 2XBO1 4GH4C 4RQPA 1EP0A 2XJQA 1RUJ1 1GZTA 2YFUA 5DXDA 4P9LA 2SLIA 3ACFA 5LEJA 1NKGA 3B01A 3KLSA 3CIHA 1QOTA 4CCNA 4B1MA 1UNBA 2QQIA 3WUDA 2JENA 3KS7A 1MZFA 2Z79A 5GLTA 5EZWA 4A7KA 4XFAA 2D5FA 3H50A 5GZDA 3SCHA 3SITA 3CL1A 3OUIA 3DF0A 3KV9A 5GLUA 1E5IA 1ZA4A 4OMCA 1LEDA 4YW3A 1XRUA 4WM7A 3JZVA 2WSUA 1MS0A 4TLFA 5A7OA 3WLUA 4CP2A 3PUQA 1LKNA 3I49A 4YVSC 3VHNA 1OMIA 4LMFA 5FYYA 2WIIB 4B29A 3PVNA 3K75B 1HN1A 3OSDA 1YQ5A 3EYPA 1R083 1GFF2 1KXGA 2C1FA 1GYKA 1YCIA 3H8XA 5A3LA 3PVBB 4BLIA 4FPCA 1RUI1 1UIJA 1NYWA 3KSCA 3TEXA 3PUIA 2AZ5A 2PHXA 3AYDA 1LJ7A 3HN1A 1LESA 4FXGB 1ODNA 4RD7A 1W6PA 1Q43A 2JIGA 1RINA 2HWD3 2R32A 2GU9A 5IVBA 2YDEA 4BM8A 4OLLA 3WNXA 3KB5A 3LZZA 2YPJA 4A4AA 1UU5A 4AR2A 1DYPA 1AX2A 2W92A 4ZXEA 5DG1A 4OHXA 3M1HA 1S0BA 3GBGA 4ZHNA 1CN1A 2VU9A 5DZGA 1AR82 5IHRA 5IVYA 3N4MA 4MH0E 3TN91 1K5MC 3ZFEB 1VRBA 4LIUA 2E32A 1SLLA 5D8AC 1XE8A 1W9FA 2OZ6A 4FPJA 4HPKA 4JZRA 1HRI2 2JE8A 3CU7A 4DY3A 1LHVA 3ILNA 3ES1A 3CJIB 3U37A 5B2GB 2OKXA 1CAWB 4UF0B 3RSJA 4XF4A 3U07A 1PGL1 2VOVA 4CCEA 1ENSA 2YGMA 3LA2A 1I9RA 3ES4A 5BNOA 2TBVA 1ND3A 2PAMA 1H1MA 5FZMA 3D4KA 3JU9A 3GBFA 3VBUA 4HLTA 1REDA 3EQEA 3BOWA 3VBOB 2RMU2 2MNGA 1F8VA 1DGRA 2WNUB 1YEWA 2VQAA 3ZYRA 4LULA 5FWEA 3HAGA 2HEYF 2ZHNA 5FZ9A 5L9RA 4LE3A 3AZVA 4UXAA 5FK8A 1ZZ6A 4CP1A 2DVDA 5IWFA 2ZAHA 1PZ7A 1UOJA 1YFWA 2Y33A 4RQPC 5CIRA 1QKQA 1XNKA 5LCWL 2XR4A 1NOVA 1OLQA 5KWRA 3MIDA 2R063 1JYVA 3N36A 1RVF2 3H1WA 1UWWA 4CZSA 1YC61 3IDAA 4E4SA 1V6IA 3VBSC 5LZ6A 1S1AA 1C8NA 1NE6A 3D82A 3MYXA 1PVC3 5DDJ2 2ZGPA 1BEV3 4CDXC 1W8FA 2C24A 1F4HA 1Y9GA 3I3BA 3N9LA 3U4XA 4AI8A 3ZYGA 4LBQB 1BBT1 3OTFA 2WAOA 4AEDA 1W9SA 3ZXAC 1D4VB 3ZIXA 4BK4A 1XJAA 4NIDA 3I97A 3NNGA 1AYM2 2W94A 2UYAA 2JIJA 4CDWB 3I2OA 5F39A 3AC0A 1MQTB 4HANA 1NG0A 4TYSA 3RVHA 1J1LA 1QXPA 4J6GA 2BFUS 2QQUA 2DBIA 3H7JA 3Q8CA 4WM8B 3UV9A 4HOOA 2NP0A 4M01A 5FZIA 3X29B 5F8PA 1A78A 2ARAA 2EVXA 1XOYA 2P4EA 1RUD1 5IAVA 2IFWA 3OY8B 4IGQA 1RUH1 4ASLA 4Y3OA 5IK7A 1HB1A 1R1A2 5DN2A 2G9GA 4QB6A 1VBA3 4LLOA 1UO9A 1K12A 1W0OA 1AR93 3M4FA 2BQPA 2XJVA 4GKXA 2VUJA 3E1F1 2W46A 3JXSA 4IE0A 2CV6A 4XFHA 3GF6A 3RFRA 4YGCA 3WG3A 5FPZA 3FLRA 1VBB2 3AMNA 1FV2A 1X82A 4IEPA 2UWAA 1GP4A 2C5DA 1SZBA 5EXOA 3ZXDA 1WMDA 4R9BA 5FOJB 3VZJA 3KD4A 4ES8A 5KXEA 4D7TA 2GALA 2BP6A 1LR5A 2TNFA 3AYEA 1J1TA 1F5JA 1YYNA 2W52A 2HEVF 2ZCWA 3FMGA 1J58A 3PHMA 1Y3TA 1GNYA 1W03A 4PLOA 4S2DA 4UBHA 5CVRA 3LE0A 3PTRB 5E88A 2DF7A 3S5AA 3VD7A 4YM0A 5BPXA 4JGZB 2A6WA 2VOXA 4GWNA 4IDZA 4JQRA 4YFZA 1AX1A 3SQOA 1WW7A 1GWLA 5CKMA 3B9CA 2P3YA 3H7YA 3N7KA 1H9PA 2DTWA 1X8EA 2PHRA 4Z2AA 2BVBA 5EPAA 3BIEA 1W04A 3ZFEA 2E53A 1XSRA 1W8TA 1US3A 3LEGA 4FPEA 1HRV3 4GB32 3FUQA 3RGBA 3S7EA 5M0TA 1XPWA 4PQ9A 3C8XA 4BQ2A 3V0AB 3MICA 3CJIA 3FLTA 3M3OA 2UWBA 4E8CA 3POFA 4MGTA 1CAWA 2D5HA 5CG8A 4U36A 5L19A 1G9BA 2GMMA 2BOIA 2DCKA 5T50A 4NOTA 3T2PA 5B4XA 5JUVA 4QDSA 2OA2A 1Z0HA 4NUBA 1OQDA 1JUIA 4ASMB 4A6SA 4BQXA 3ZFGC 3VBOA 5IK5A 2AENA 4CDQB 1AYN1 4FPKA 3SHRA 2DURA 1POV3 2WNUA 2Q30A 5DUXA 1PNFA 4OUSA 3DKQA 2ZGMA 2W1UA 4YZ4A 4WV8A 1DFQA 4AG4A 5I91A 1I5ZA 5A33A 2VUAA 2WYFA 4HVQA 4K7JA 3LWCA 2DUOA 4UFIA 3OUJA 1QIQA 4C1WA 1LOAA 1REFA 4K3UA 2WZR3 2AACA 3ZMOA 1WLDA 3ZXGA 5HBAA 4LK6A 3WT3A 4GKYA 3IZOA 2ZEZA 2NZ9A 2RJ2A 3IWZA 5FYMA 1LGCA 4IL7A 1RHI3 2GC0A 3MDPA 4DUVA 5GM0A 1OURA 1GOHA 3VD4A 4OUMA 4Y5TA 3WR0A 5FBZA 2LUWA 3T2QA 1OSGA 4GD4A 4YW2A 3VN4A 1HDKA 5A3OA 1A8DA 4Q0UA 2WZPP 1F35A 5C4WB 2QDNA 4F3JA 3BPSA 4QQOA 2VZQA 1URXA 1XSQA 1C1FA 2YC4A 3AL5A 4CDWA 1ASJ3 1RXFA 3NV1A 3LCPA 3KCXA 3SISA 2J1AA 1EY2A 3DYMA 4LKFA 2DVAA 5EJ1B 1PO11 5A3TA 4EN8B 3GXUA 4BDVB 1R082 1U0AA 5E16A 3ZSEA 3ZXLA 4CUCA 2A3YA 3I8TA 4IW3A 4B1LA 4WM8A 4XDPA 1C4RA 2ZX2A 1NA1B 4RR3B 1XXNA 3DXUA 3PIJA 5DAWA 4XUPA 1Q8PA 3WDTA 4D7YA 3B69A 5K8SA 4XYXA 3TEWA 2WO3A 4PIYA 1COV1 2RS53 3OY8A 3ZSJA 1GNHA 3W58A 1OHFA 2HWD2 2BGOA 5ACA1 2X09A 3JD73 5FXVA 4QKBA 4CCLA 5JPNB 2BFUL 3IDEA 3IMMA 5FMDA 5JDBA 5L7OC 3B02A 2X29A 5A7QA 3JD71 5CU1A 5DZEA 1E5SA 3P1IA 1ZREA 1QMJA 5CFCB 1AL0G 1CVNA 2VMEA 3BALA 4FFFA 4MXVA 4JGYC 1H9WA 1JS9A 5DZFA 5CA6A 2P3IA 1TMF3 3NJZA 3J7HA 4LHNA 5F6KA 5H9PA 2P2KA 2RM23 2UWCA 4P9GA 1MVEA 4QXHA 4QGLA 2B39A 4BHPA 3T4HB 4FSJA 4Z92B 5FY4A 4YVWC 3WQ0A 2BEOA 2FMYA 5GZEA 3OBRA 2LTNA 3A0NA 4IEWA 3KV6A 4NVPA 3I2DA 4AQ6A 1K42A 2HWC1 1UYXA 4QXCA 3A7QA 2WNVA 5FYCA 2WA3A 2CGNA 4JGZA 2QDRA 5AC91 5FZ1A 2Q1ZB 4J1XA 3WQ1A 1MS5A 2ZEXA 2W47A 1KFUL 2WL1A 3BPZA 4YGBA 4XACA 5HXMA 4OQ9A 4YZ2A 1GZWB 3K48A 1OLRA
chains in the Genus database with same CATH topology
4XHBA 3V0AA 2NMOA 1FT9A 1WCKA 4Q4V2 1JH5A 1RJ7A 4AI3A 2HEWF 4YG6A 1CAXB 1H2LA 5H9RA 2BNNA 4AFCA 4P9XA 5LEKA 1RL3A 1PIV2 2RJLA 1OPOA 2ZGNA 4XJ8A 2WFF1 5BXXA 4CDQA 3VBRB 5F9TA 1S2KA 2B42B 2XWJB 1VB2A 4M00A 5JMCA 3WP5A 3ZN6B 2B7YA 1FPN1 2AREA 3ZDSA 1GQHA 1UZYA 3OPZA 4CTEA 3QH7A 4WM8C 1U5IA 2FQPA 5T5PA 1I3HA 2D6MA 3IDCB 1C5HA 2GH8A 4PBPA 1WLTA 4YZ1A 4GH4B 2EALA 1Z7S2 3P3NA 1YJLA 2D93A 1VBA2 4P9IA 3J4UH 3U11A 4Y1UA 1C8M3 3IMNA 2D6KA 3LAGA 1AR92 3AX4A 4QX5A 4DINB 4OZXA 1BXHA 2ETEA 1AXZA 1T6GC 4LUKA 3VV1A 4GMP3 2EXJA 3BODA 1UPIA 3JB4C 3MIBA 3R0RA 1FNZA 1O3TA 3VHPA 2D3SA 3R6SA 4YVSB 1ZX5A 3N35A 1LCLA 1BK1A 1NA1A 1NY72 3ENRA 3DV8A 1LHNA 1LU2A 4R9CA 4WZCA 3AFKA 3O12A 1ENXA 1QF3A 1H2NA 5T5LA 4EWAA 2XLAA 1N3QA 1H2KA 1RB8G 3NSTA 5J37A 3MGUA 3JCIA 3R4SA 2WNVC 1LODA 2IXIA 3H9AA 3BTAA 3INAA 1QJX1 2HWF3 2EXIA 2ZKNA 1FMD3 5CFDA 4BA6A 4DZGA 1KFXL 3PMSA 1MS4A 4XF0A 2QZ2A 2GMEA 1K5MB 1IS4A 3AFGA 5I0SA 2ILMA 1QJY2 5D8AB 4FP3A 1X8MA 1DYKA 5GKAC 1AR81 4COWA 1HRI3 2A3XA 2E7QA 1QOSA 3AP9A 4XJWA 2TEPA 2CAVA 1UF2C 1YIPA 2WQ4A 2ZMLA 3UKNA 5C8CC 4X6QB 2XLFA 3E6BA 1QQP2 3UKVA 4HSLA 4HKOA 4RHV3 1AR73 3NKTA 2ZA9A 4PCRA 2XLGA 1HV1A 4LR4A 3W9AA 2PLV2 4AXOA 3TB0A 2RMU1 4XBNA 1UAIA 1XYNA 3TAYA 4AFMA 2WZR2 5CNAA 1GZWA 4BQ1A 1Q56A 4AEJA 4RQPB 1ONAA 1LU1A 4AVAA 4KH9A 1I6XA 4N53C 2R071 4Y20B 1RUC3 1YO8A 1ZZ9A 4NN0A 1CAXA 2FHRA 3ILFA 1RVF3 4BMBA 4EN7B 5CADA 4YM2A 3VBSB 3OJBA 5E89A 5HXVA 4CP0A 5DDJ3 1YRZA 4CDXB 1MS9A 4G4FA 4XXAA 4XJ9A 2HWE2 1VBD3 3HT1A 1WGPA 1ND2C 5JOWA 4E4DX 4ZU4A 2ZTNA 4CEYB 4R4XA 1PNGA 2CWMA 4K6BA 3VKOA 3N7LA 4N7IA 5C6CA 5JAXA 3VKLA 1AYM1 3H3ZA 3SH3A 5I8TA 2RS52 3HR9A 4A7ZA 5KXBA 4LTAA 1W6PB 4OHYA 1JTZX 1R1A3 5I0RA 5GLVA 4IV1C 4M3CE 5KXCA 4B4PA 5CFDC 4AK3A 2EAKA 2VMHA 4QM9A 3ZXFA 5J7MA 4AGGA 1R1A1 2YXSA 4OHZA 3B93A 3O0WA 4DXZA 4HFSA 2RM22 2JKBA 1XNCA 3WQ7A 1OQEA 3NV4A 2QZ3A 4HPKB 4YVSA 4GIQA 2UY8A 4YARA 3USUB 3WOGA 1YI9A 1SLAA 1SFYA 1RUNA 5EFUA 4Q0PA 4UBGA 4B4QA 1VBB1 2BPA2 4YRDA 4F7ZA 1Q8SA 4NWVA 3GALA 3WX5A 2BTVC 4ATEA 4BOWA 3U0ZA 4Q4X1 2VMIA 1QY4A 3ZFFC 2R49A 3VBFC 2JG9A 4P5HA 2Q8OA 1GKBA 2GC3A 1VBC3 2OVUA 3LSDA 4XQWA 1BCXA 1HX6A 3ZYIB 1ZZ7A 2FZ1A 4Q29A 3TWIA 2ZZJA 3WINE 2XPJA 3RI9A 1K5MA 4XFGA 5BNPC 3WW3A 1MS3A 4AQ2A 1CGPA 4IETA 2V5YA 2ES3A 3KT1A 4LA2A 1JYIA 1UU4A 4HZFA 3D0JA 4IEYA 2PHTA 4LEJA 2YC0A 5JSRA 2ZAAA 3O0XA 2PYTA 4FOVA 4GB31 2WFPA 2DCZA 3R4UA 1BMV2 1V6LA 5KBFA 4X8NA 3ZFGB 1PMIA 2QJVA 3O5SA 1KS4A 5JSOA 1BVVA 4LBQD 3O0VA 1MEC2 1RMU2 4YG0A 4XJUA 5L36A 4N9HA 5JWPA 3OF1A 5HCBA 2WT0A 3VKMA 4COYA 2RR12 5FO9B 3CJXA 2K0GA 4KWJA 1EPZA 4DNYA 1XYOA 1V6NA 4Y20A 1C8M2 1HKDA 1AXKA 2D6OX 3J9SA 3PVOA 4ZU5A 3PMEA 4QQLA 3VBSA 2PHWA 1H4GA 1LULA 1AZDA 2KXLA 1H0BA 1CR7A 2AYHA 3AKQA 4KG0A 4Y1VA 4KWKA 4E9KA 2XJRA 4CDXA 3OGJA 1V6JA 1GICA 4LO6B 2A73B 2EXHA 5EV7A 1NE4A 1R1ZA 3APBA 2X53S 4CEYA 3G7DA 1SLCA 4I0AA 1C1LA 1SBFA 1S0GA 4LO8A 3KCYA 3WG4A 3ZN4A 4JTNA 4WVVA 1LTEA 5DUVA 2Z2SB 3M3CA 3AXDA 4PF5A 3B5LB 4ZXKA 4YSFA 1A6CA 2JG8A 4IXLA 4K9SA 3VHOA 3IIAA 1R081 2XVLA 2I2SA 2GC1A 4F83A 1M4WA 2JG9C 1GSLA 1Z78A 3RQ0A 2PN5A 2HWF2 3RJ2X 2E7AA 1FMD2 5L7OB 2JDZA 1DQ6A 5BUVA 2HWD1 1W39A 5AVPA 2A3WA 2ZJCA 4Q0SA 3NO8A 2Y26A 5C9AB 2QNKA 4NHMA 5F6LB 5T5JA 4Y22B 1AHSA 4Q8KA 4JGYB 2X5IC 3QLQA 3USUA 2UU8A 3AJYA 3S7IA 1RUG3 1VALA 1XNDA 1H8VA 2XVKA 2WINB 3O14A 3VBHA 4YVWB 3FWEA 1YWKA 1QU0A 3ECQA 2Y0OA 2IXKA 4RHV2 3V0BB 1AR72 3DL3A 3H0OA 4K20A 4BPZA 2VULA 4HKLA 1ZZBA 1DBNA 4YW1A 4XW3A 1H1AA 2NM1A 4XFCA 1RUE3 3RYRA 5A33B 3OYWB 3MI8A 3SNMA 2ARBA 3ELNA 4FT8A 1YNAA 1RUC2 2ZHLA 4TWTA 1IPJA 4IERA 3WZ1A 4B8EA 3B3QE 2ZMNA 3KCCA 4SBVA 4Q4V3 4YYOA 2UYBA 1D0GA 2R061 3LGRA 2BBVA 4QPIA 4YGDA 3B7MA 4KQ7A 4Q2FA 1TME2 1LGNA 1E57A 1VBD2 1PIV3 1B35C 3ZFGA 1R092 1PVC1 2A6VA 4BIFA 1BEV1 1ZYBA 2PA7A 4CEYC 1WD3A 1FOD3 1TNFA 2ZPXA 2ZBJA 2I07B 4XE9A 4UW3A 1LB2A 2WWSA 4PDWC 3RS6A 3M70A 4OHWA 3ZX7A 2H6CA 4L8QA 1AR63 1ZZ8A 2JG8C 4RFT0 2IXHA 3PNAA 1Z7S3 2WSVA 1QXJA 2VW0A 1OPMA 2ZX0A 4LA3A 1W0PA 1PGW2 2PHDA 2VOKA 5JR7B 4MX3A 4EN0A 5EJ3A 1VBA1 5JOXA 4N7UA 5CB7A 3URFA 4ES9A 4H7LA 1F2NA 3M3IA 1AR91 2WS93 4WBBA 5DUUA 2DYCA 1YUDA 2BVVA 2WA4A 5GLZA 3AJZA 4R8HA 5DUWA 2OZJA 2HKXA 1PO23 5LK5A 3ETQA 2JECA 4XJZA 1GZCA 5JZGA 3E5XA 2NMNA 3VBHC 4ISQA 3E6CC 1O3SA 1RUOA 3D0SA 4XTMA 1AL22 3GZAA 4HVRA 1WBFA 1QHDA 2XJTA 3VZLA 1VBC2 1NY71 1WW4A 4YLZA 1RUF3 1EAH3 2WNVB 3AZZA 5L7OA 1D4M2 2VQ0A 4E27A 5C9AA 4IEOA 2QFEA 2V73A 5IUQA 2B8MA 4Y22A 4U2AA 4BZ4A 4JGYA 5FRAA 4IEZA 2ET1A 4QQHA 5FFOC 4MSVA 1QJY3 3FJSA 3K51A 1HRV1 3BIWE 1YFYA 4QPIC 4YVWA 2Q0AA 1SDWA 2MEV3 5FLIA 1Y9QA 4QMAA 2XGXA 5HCAA 4YFWA 1PK6C 2YUEA 3V0BA 1WCSA 5C8CB 1QGLA 4RL7A 3WW2A 3ZIWA 3J8F3 3VDDC 5FLJA 5GZFA 1QQP3 3N7JA 2HWB3 4FAGA 2EF6A 2BWCA 3AP5A 1POV1 3OYWA 1BJQA 1DLLA 1FAYA 2D6PA 2D98A 2PLV3 1VAVA 2VVDA 3VKFC 1G9AA 1DHKB 1ENRA 2ERFA 2GN7A 2WNEA 2IC1A 4Q4W2 5KHKA 2IZWA 2KA3A 4N53B 1XE7A 3T1LA 2GNDA 1ZRFA 2A5ZA 2WZR1 3I54A 3SCGA 1LECA 2D3PA 3I59B 1RHI1 2QVSB 5FO7B 4R52A 4GALA 4FP2A 4L92A 3T2TA 3SLIA 4HVOA 3WDWA 2VXRA 2DU1A 4HK8A 2HWE3 1IHMA 1U5ZA 1ND2B 1X7NA 3RRDA 4LBKA 5IK8A 1QJU3 1KDKA 1KS5A 1TQ5A 1MZ6A 2JEMA 1ASJ1 5JZGC 1FX5A 5IT6A 4AHYA 4XF9A 5JOYA 2G4IA 4XILA 2O1QA 4EN9B 1C5IA 1S0DA 2A71A 1PM7A 4DPNA 2NN8A 4B7KA 2IWGB 2YHJA 4META 3UKTA 1KJLA 2RS51 5E8AA 4JTOA 3TNPB 2C9AA 1O4ZA 3MF6A 4IV1B 5JSPA 4HBNA 1SCRA 2JXAA 1XNBA 5C9AC 5CFDB 4PIXA 1IKPA 2DCYA 1Y43B 2XHKA 5L73A 1N1SA 1ULFA 1RUG2 2F4PA 2E6VA 2SBAA 3DKWA 2V09A 3RDIA 3UJOA 3ZYJB 5KXDA 4F8AA 3CLPA 3NAPC 4ITCA 1RITA 1SACA 1TMF1 1GBGA 1HQWA 5F5QA 3AYAA 4LO5B 2RM21 3WW4A 4PIZA 3ILRA 1WBLA 1YLLA 3ZFFB 2GAUA 3VBFB 4OULA 1G9FA 1X50A 3MZHA 1RUE2 2BUKA 2PHFA 3KT7A 4QPYA 1ZVFA 2ZGRA 1GANA 1LOCA 4QXKA 3FFQA 3AP6A 2GZWA 4DY5A 2CWSA 3M3EA 2B5HA 4LBNA 4N9IA 5BNPB 2PHUA 2R30A 4YW4A 5FMOS 4COZA 2WQZC 2W08A 2RS13 1GQGA 2YY1A 3MIGA 2DUQA 4AW7A 3R05A 1MACA 3JB8A 4QT6A 2ARXA 3E5UA 4X8PA 1SLTA 3JBG3 5C8CA 1QNYA 2QUOA 3ZSLA 1Q8QA 4IEXA 3V56A 1FOD2 1S0IA 3MLLA 3RI8A 3V65A 1POV0 2VY0A 1BMV1 4AVTA 4BYYA 1BBT2 3L2HA 4Z2WA 1ZZCA 5T54A 1MEC3 1RMU3 4AFBA 4KG8A 1OI6A 3TBDA 1LHWA 3KGLA 2BW8A 1AR62 1V00A 2OW4A 2XWBB 2R1BA 1ZRRA 2GNBA 2RR13 1CESA 3MEPA 1MS1A 1L3JA 1RMU1 1XU2A 1EYBA 2D7FA 4LBJA 3AP4A 4N53A 3C2UA 3SXWA 1IS5A 2RR11 1KITA 3VHRA 2FZ2A 4RGGA 3EBRA 3I59A 1RUD2 3WW1A 3KZ4C 1VJ2A 4QPGA 1C8M1 1DZQA 1VR3A 4IV3A 4XF1A 2DUPA 2WS92 4HK9A 5I8SA 5JI7A 1WMEA 1NXD1 2PFWA 3ZXEA 1WLCA 1YJKA 5SV5A 4HMZA 3MIHA 3MF9A 4S2HA 1ND2A 1Y7BA 4NHLA 4GMP1 1PO22 3SH5A 5CAZA 1SEFA 4OHVA 4QQ2A 2RS33 4XETA 4ISRA 2ENRA 3IT8A 2E63A 3OBTA 1CX4A 4AEKA 1W6NA 4NPRA 4B7EA 1JBCA 2DFCA 4AHZA 1SCSA 3MFAA 4AE2A 4FPLA 2E7TA 4ORFA 3PVEA 4FTSA 1G8WA 4Q27A 1RUF2 1EAH2 4I0BA 2JG9B 4L2NA 4RS5B 4YW5A 1DDLA 4FVVA 5KHIA 1MZ5A 4P9JA 4IV1A 2HYKA 2VNRA 3FE5A 2B46X 1FYUA 1S0FA 4RA0A 4R9DA 3ZXKA 3WV6A 4ATFA 3S6PA 3AB0A 1APNA 1ZM1A 3GHNA 3ZSMA 3DPRB 2HWF1 5AVAA 2AUYA 1HV0A 2IFRA 1FMD1 4W6WA 4MLOA 5KHJA 3WXPA 3NL1A 3AYCA 1LOFA 4IEQA 3ZN5A 4UW6A 2X5IB 3B9IA 1NQJA 1UZZA 2R043 2P17A 2MEV2 1UKRA 2XKOA 2DWRA 3OD0A 5EYYA 2D6NA 1NCQC 1HRI1 3MPBA 2P34A 4JRLA 2AGSA 1UIKA 1C57A 1C3HA 3J8F2 4Q4Y3 3ZFFA 2HWB2 3BB6A 3VBFA 3RG0A 1H8TA 1AF9A 3ZMNA 1LHOA 3AMMA 4WVMB 1CIWA 4RHV1 1AR71 1AYN2 4Y24A 1O5UA 4K8FA 4E2QA 4XIOA 1G9CA 2Z42A 4LNVA 2FBEA 5BNPA 4GWMA 3POYA 1JYCA 4LBOA 3ST7A 4XXPA 1PHMA 3MLJA 4CRQA 3QACA 4FTEA 4L99A 4AVCA 3IDBB 2ZX4A 5FAXA 2VGDA 1RUC1 4DB5A 4QPGC 4IV3C 1DZRA 1RVF1 2ET7A 1TME3 1B35B 3A4UA 5FMOL 2CGPA 1OFNA 3VUOA 4QD2A 1R093 4P9WA 1QJU2 5DDJ1 3U10A 2AR6A 2HJIA 1YIFA 4M3CA 4C90A 1VBD1 3MIFA 5GLWA 2D40A 4SLIA 4DMIA 1R091 4FTBA 1FATA 2XJPA 2R1DA 3G6JB 4PDWB 3LA7A 4DOUA 1CPMA 5HI0A 2ZACA 2ZMKA 1PO12 3NVCA 1VAKA 3B94A 4MGZE 2JG8B 4L97A 4Z1VA 3RNSA 3WDVA 1DGRN 1KDMA 1D2SA 1VB4A 1W6QB 1QH7A 4GXLA 5FREA 1S0JA 2XG3A 3IPVB 2PQQA 5LRSA 1COV2 3LOBA 4HSJA 5I93A 1ZBE3 5ACA2 1BZWA 3AZYA 4GMP0 1EV13 1PGW1 1A8MA 1S55A 1IS3A 4IESA 2D44A 1LOFC 5BYNA 5FDBA 4QGNA 4OI1A 1HQLA 1IGOA 5GZGA 4I0WB 5K0UA 1NLSA 1DGWX 4HKWA 1RGSA 3VBHB 1HXS3 4O9GA 3VL8A 1FNYA 4E2GA 1O7FA 3ZYPA 3IM0A 5HCFA 1DQ0A 1OQ1A 2A75A 1FV3A 1AL23 1SBDA 5CBLA 4RS5A 1H8TC 1RJ8A 2XB6C 4RSUA 4N43A 1OOPA 2DVGA 3HWJA 3ME2A 3L2YA 3OCPA 3WHTA 1D4M3 1UD1A 1VBC1 2ZHKA 3HBZA 3DPRA 3NW4A 4ZKTB 1U5YA 4JC1A 2VNOA 2O0OA 4H3WA 2GSYA 3H1YA 3GZUC 3OGGA 4C0BA 1ZRDA 5BNNC 2RS12 5T3NA 2X5IA 1YFXA 1U5XA 2DTYA 4XDQA 4AWDA 1AJOA 1WMFA 4P9YA 3FUOA 3POWA 4QPIB 3JBG2 4DQAA 2GN3A 2WLQA 1WLWA 4HT1T 1PK6B 4XQ4A 1H4HA 2GH2A 1VBE3 3LKJA 4KBBA 1CQ9A 4YGEA 2Y0IA 3OD4A 4M0NA 5AFBA 4JAAA 3SMHA 1J3QA 1WD4A 3VDDB 3PLQA 3A0KA 1WW5A 4WVMA 1AX0A 5H9QA 4AFDA 2TUNA 4IEVA 4AGRA 2XVGA 3WP6A 1JXNA 1DGWA 3MW3A 3NWKA 1YHFA 3WG1A 4COVA 2VW2A 5A32A 1N1VA 2BNMA 2WT1A 2XJUA 1MS8A 4UW4A 4Q4W3 2DVBA 4YZ3A 4DS0A 4KWLA 4W6XA 4XIKA 4FAHA 2XBO3 1RUJ3 1FXZA 4KGQA 4TZDA 3IBMA 1GNZA 2G9FA 1FI2A 2ZGQA 3D6EA 1B35A 5JI9A 3BU7A 2RS32 4MUVA 4L9BA 1M06G 3UL2A 4D3WA 1G6NA 3FBMA 1TEIA 5K0UC 2AH2A 1CAVA 4MXWB 4QGMA 5JZGB 4LBMA 4PDWA 1V9U2 5EYXA 5GALA 3I4IA 1HIXA 4L11A 3NKGA 3THPA 4GQ7A 1OKQA 1NCRC 1ULDA 4AHXA 4AI2A 1W6QA 4RS5C 1SLIA 2ZGLA 5J48A 3IPVA 4N43C 1OOPC 2VECA 2MHFA 2DV9A 5T52A 3I7DA 2DCTA 4OI0A 4EWDA 1RUI3 3FLPA 1YXWA 3DPRC 1UKGA 4Q0VA 4Z82A 4OFGA 1O4YA 2CAUA 5A3MA 1HQNA 3RPQA 4XZPA 1QJX2 4FBFA 2D43A 1D0HA 2R042 1WA4A 3MIEA 3AKTA 4FXKB 5SV8A 2A70A 5TSWA 3WCRA 5LK7B 3AKPA 2VG9A 3NAPB 2H6BA 1NZCA 3TN93 1JOJA 3GHMA 1RUG1 1N3OA 4Q4Y2 4OI2A 1SFNA 2Z5WA 4AQSA 2OPKA 4XJAA 5AFEA 3EJKA 2MPFA 4XPVA 3MW2A 2A6ZA 3HD8B 2IXJA 2YMZA 3M2MA 4O9EA 1J59A 4PLMA 1V70A 2NPIA 1BYHA 3CO2A 2RHPA 4DRVA 4PBOA 1XU1A 4Q0QA 3CEWA 2ZOEB 3PTYA 4H55A 1S2BA 1RUE1 4Y26A 3KQRA 3H8UA 2CYFA 2W39A 5K7PA 1QDCA 2Y38A 3BOPA 4CDUC 3M3QA 4XBQA 2I45A 4YZ5A 1ULEA 4Q4V1 2R072 1PK6A 4XTPA 1IOAA 3VDDA 3ZSKA 2VNGA 4I30A 1PIV1 4A7YA 4LHLA 1O3QA 2JICA 1W2UA 3GNEA 2PELA 1FOD1 1BBT3 3O7OA 5DG2A 5ABJA 1OA3A 3LA3A 1G7YA 3ALQA 4LT5A 1DG6A 1AUYA 3GBWA 3MFCA 1J3RA 1VRH2 3UK9A 2YZ4A 1B09A 4WM7C 1QWRA 2E9QA 2RE9A 1ZRCA 1AR61 1LOEA 2FMDA 1ZNPA 4NHKA 4INDA 1Z7S1 1ZBE2 5I0UA 4JCKA 1MR5A 5FO8B 2CTVA 1EV12 2YV8A 1RUD3 4FPHA 1MZEA 2YGLA 1RUH3 4IQPA 5FLHA 5KC6A 4K1YA 4MV2A 3JUUA 4YG3A 2WS91 4Q1PA 4X6RB 4QHBA 1NQDA 1HXS2 4MXWA 3TRSB 1PO21 4GULA 1VAMA 4YM1A 3AP7A 5FTTC 5J09A 5CG9A 2E51A 1KQRA 1CJDA 1DU3D 1OD5A 1GZ9A 1AJKA 2ZGTA 1PZ8A 3L9JT 1QJZA 3Q9OA 4Y5Z0 2NQYA 4AI0A 2BNOA 2GDFA 2EAAA 1DIWA 1N47A 2H0BA 2LM3A 2XL7A 4Q4X2 1RUF1 4CEWB 1EAH1 4I2OA 1WUVA 4EWEA 5BNOC 2OUHA 1ND3C 4I01A 3VBUC 2P3JA 2ZX3A 1DQ2A 3ACLA 3CF6E 4MGKE 2I74A 2JD4A 1IKQA 1LENA 3NAPA 1O91A 3KT4A 4WZFA 3ZXJA 2VH9A 3VZKA 3RYKA 1QJY1 4COUA 1VBE2 1NCQB 2DU0A 4LLFA 1NXMA 3QCWA 5JVVA 3RMYA 2MEV1 3LOIA 1ZBA2 3J8F1 4A3XA 1QQP1 2WC2A 3IN9A 4XFFA 5FQ0B 2HWB1 5ABJC 1AYN3 4OI4A 1S0CA 2WJSA 4NR1A 4NWWA 3ZVXA 3AZXA 4AEDC 2OIIA 2PLV1 1LOBA 3GYDA 4MGYE 1JHNA 4B4RA 1CONA 2D6LX 4Z07A 4XMAA 2XBO2 3WY6A 4D94A 1KD7A 4C0HA 1RUJ2 4XFBA 2ZS6B 1ULGA 5GJ6A 1HLCA 5H9SA 4JDOA 3RMXA 4QPGB 3QBQA 4IV3B 4GA9A 4PJYA 4EN6B 2GMPA 3THTA 3NV3A 5FOBB 5T55A 3ROUA 1CAUB 2B45X 2A7AA 3FFZA 3VZMA 4Z8BA 3FC0A 1Q8VA 4Q26A 2VW1A 2HWE1 1WCDJ 3AKSA 4FQZA 1EPWA 1U12A 5E1RA 4XEZA 1W6NB 4JV4A 1QJU1 4HL0A 4W65A 1JUHA 1QNWA 3RZZA 4LBQA 5LRRA 4Q1RA 3TYJA 1PO13 4K40A 4D7SA 3DUIA 4Y4YA 3WG2A 2ZGKA 1MQTA 4FOQA 1RUI2 2PTMA 3J26N 2KM2A 1X36A 1COV3 2A6XA 4HETA 4YM3A 4MYEA 2OUJA 3LB9A 2VOWA 5ACA3 4R4ZA 2QKDA 2ZGUA 3JQXA 5J98B 4B3NA 3TOJA 4FPYA 3AMPA 1DZTA 1H1IA 1LOGA 2BWAA 3POSA 1CPNA 4FOWA 4G3YC 1SMVA 3TN92 2JE7A 1F9KA 4HN1A 4I02A 1KRIA 3ZPYA 2X8KA 1V6OA 2UY9A 3EO6A 3VKNA 1Q3EA 4ZU7A 1NLRA 2EIGA 1JW6A 4WVWA 2BGCA 3ZFEC 3E5QA 1PGL2 1OA2A 3HIFA 2GNMA 4KU7A 1H8TB 1OA4A 3CJIC 2P37A 2NLRA 2QQPA 4FQ4A 1BVP1 4CEWA 1I1EA 1J3PA 4JRAA 5C8WA 4Y1YA 1LHUA 2O8OA 1TNRA 1F31A 3WP4A 4BH9A 1VLNA 2HWC3 3HMYA 5AC93 3VBOC 4Q8LA 3S0MA 2PAKA 5BNNB 1SLBA 1ULCA 1W6OB 2WNUC 4LO4B 3EHKA 1C28A 2CY6A 1O3RA 4AVBA 3AM2A 4J1WA 5I0TA 4AFAA 2RS11 1NCQA 4RGAA 3VLBB 4EROA 1YI7A 3DGTA 2GC2A 1LGBA 2ZHMA 1JN2P 3FHIB 2K9ZA 2R062 3RYPA 1A3KA 3JBG1 4M3CB 4FO9A 5J3UA 3WCSA 5FQ0A 2WFF3 3UJQA 1PVC2 2D3RA 1BEV2 2W68A 2DFBA 2P3KA 3E6DA 3FBYA 3S30A 4K1ZA 1UMZA 1MEC1 2R16A 1VP6A 5C33A 5IK4A 1QXRA 1CD3G 1FPN3 4QU2A 4CDWC 3KGZA 1MQTC 2VMGA 1RC6A 4EJRA 1WW6A 2DVFA 3D8CA 1G9DA 3NV2A 3FZ3A 1RUH2 5KHGA 5FPXA 5J36A 2EXKA 2PAEA 2WLPA 4MGIE 4I3PA 4IEUA 2CGOA 2R0FA 1CAUA 5T5OA 1VIWB 4FPFA 4BWOA 4H7MA 3WDXA 4XHXA 1W6MB 2CL2A 2EA7A 4AI1A 5K0UB 4LHKA 4ONUA 2RS31 3RJRA 1RIRA 3HT2A 2JJ6A 5C4WA 1V9U3 1O5LA 1N1YA 4AF9A 4C91A 5KC5A 2O8QA 3VGIA 1N1TA 1NCRB 3MLKA 1ALYA 3USSA 5GZCA 1AXYA 5JIAA 4G9SB 1V9U1 3M7AA 4FPGA 4N43B 1OOPB 4Y1XA 2R6QA 4CEWC 4YNIA 1PZ9A 4RR3A 2ZABA 5BNQA 2LALA 4Y1ZA 3V64A 4W6YA 3ZO0B 1F5FA 4DFSA 2D97A 5CG8A 3RWNA 4EV0A 1QJX3 5JLVA 1V6KA 3MW4A 2WKKA 4JGZC 1IZ3A 3R4DB 1S0EA 3KMHA 5I8YA 4LBLA 1UCXA 1H2MA 1UPSA 2R041 4LUMA 4KL1A 1PVXA 4JDNA 1HRV2 4XQDA 5CFCA 2R0HA 5FCCA 2VPVA 3SH4A 1AR83 5JPMB 3AKRA 4KU8A 2XJSA 2Z69A 3DN7A 4QM8A 2C0ZA 4LE4A 5F1RA 4Q4Y1 4V1PA 1DQ4A 1GR3A 5JCTA 1N3PA 4BIOA 3N3HA 4I3GA 4MVTA 4TSVA 4C1XA 1HW5A 2GNTA 3PJYA 1GV9A 3VZNA 4CDQC 4E2SA 3TNQA 1OFSA 5A32B 5BNNA 1Q5OA 1W6OA 1UU6A 2OYZA 4KNCA 4R9AA 1QH6A 2YYOA 2RMU3 3BCWA 3GZTB 2JE9A 4I09A 4CDUB 3MPPG 4DRRA 1UL9A 4BLJA 4JVAA 1CJPA 5J96B 3M8LA 3P3PA 1QDOA 3PJQA 4XF3A 1D2QA 1DQ1A 2QE3A 2R073 1PGSA 5K9YA 4UW5A 4PLNA 4XOGA 3QH6A 2Q1MA 1TME1 1DGLA 1RHI2 2F6BA 2UURA 4S2GA 1IQAA 1REEA 4HN0A 3SCFA 1X33A 1CAVB 4JDMA 1TE1B 2Q5TA 3HQXA 1DQ5A 5C4WC 1G86A 3C3VA 3W59A 2ATFA 3VBRA 1ASJ2 2WT2A 4AVVA 1ENQA 4A2UA 1VRH3 2DCJA 3WUCA 4MZUA 4WM7B 3B00A 3ZN6A 5EWSA 2BYVE 2XKPA 4AHWA 1AYM3 4AQTA 2VVFA 4M3CF 1VRH1 3N7MA 4AVSA 4N90A 4RR3C