4D3WA

Crystal structure of epithelial adhesin 1 a domain (epa1a) from candida glabrata in complex with the t-antigen (galb1-3galnac)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
226
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata cbs 138
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 1
total genus 55
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d3wA00
2XJSA 4COZA 2XJTA 4AFBA 4CP2A 4GQ7A 4AFCA 4AFAA 5A3MA 2XJQA 4AI3A 4AHWA 4D3WA 2XJUA 4AHZA 4COVA 2XJRA 4ASLA 4COYA 2XJVA 4A3XA 4COWA 4AI0A 4LHKA 4AI2A 4LHLA 5A3LA 4CP1A 4AHXA 2XJPA 4LHNA 4AHYA 4COUA 4CP0A 4AI1A 4AF9A
chains in the Genus database with same CATH superfamily
4D6RA 1Z7S2 4Q4V1 3URFA 1O5UA 5HV0A 1LOGA 3AYDA 2C26A 3WUDA 3LIHA 2ZPXA 3WV6A 4V2WA 1GYKA 1KDMA 1SZBA 1XYNA 4XMIA 2GAUA 2X09A 3ORJA 4OI4A 3WT3A 3DYPA 3CDZB 5DAQA 4FP2A 2WQZC 2C0ZA 4B7KA 2CL2A 4NIGA 3VBHC 1KS4A 3N36A 2VQ0A 2BQPA 3PVOA 5JZGA 2GNDA 1S0IA 4XZUG 3OGRA 3VZLA 3C7GA 1QQP1 2CAVA 4XQ4A 5GKAC 2XG3A 1ULCA 1H6YA 4AFDA 1V6KA 4HSLA 2RM21 1BK0A 1OHFA 1GP6A 1F35A 2WNEA 2HWE1 1F4HA 5FZ1A 5F7UA 1SFNA 5LBBA 1U5XA 3ATGA 5A6ZA 1OH3A 4LBLA 4FQ4A 3P6BA 2PHWA 1DQ0A 4ES8A 5CADA 2FDFA 2Z2SB 2WKKA 2PAEA 2GDFA 4UT5A 4OHVA 4LO8A 3AL6A 3ZFFC 2PHXA 2VCCA 3MW3A 5FMDA 5L36A 1V6JA 1OLRA 4I09A 1E5IA 2RS52 2RMU1 2GN3A 3APBA 4CCEA 1S0CA 1RJ8A 3K2OA 4OUMA 1XNKA 3WG4A 2BWCA 2JWPA 3NNFA 3PLQA 1UWWA 4LE3A 3HIFA 5CBLA 5DPNA 5H9PA 3WSOA 2OKXA 5KHKA 3FHIB 1UL9A 3JB4C 3VN4A 2HWD3 1XBFA 4BHPA 2ZOEB 1GZWB 1TNRA 1HDKA 5HXMA 5LWBA 1D7PM 3P1IA 1BCXA 3EHKA 2VZ1A 2ZGLA 5IK8A 1FNYA 2D3RA 2OXBA 2QFEA 2P6HA 4JHTA 2HEWF 4GIQA 5A7QA 4KL1A 2RJKA 4AEDC 2WNUC 4CDWB 3S7EA 1H8TB 1K42A 1XU2A 2QNKA 5C3OA 4WM7A 5BNNC 5HCHA 5AC92 2WZR1 1JN2P 2O14A 5C8CA 5FOBB 1JYNA 5FYMA 4CPBA 5FJKA 2ZS6B 3CJIB 3LQCA 3WNNA 4FI9A 4NUBA 4Y22A 1VBC3 3UL2A 4BM8A 3N7MA 1Y9MA 4DUXA 2YPJA 2WZEA 4Y1UA 4OCTA 1R092 4RR3C 1AL22 3AB0A 1ULGA 3WCRA 3PVNA 1WGPA 4AQSA 1RUOA 3H0OA 3S30A 4E4DX 2H6CA 5F2WA 5FK8A 1UU4A 1QDCA 1WW5A 1CX1A 4ISRA 5FMOL 3RPQA 3JBG3 3H8RA 4Q5OA 3ZO0B 2YMZA 2C1FA 3A23A 3MPPG 1POV1 1VRH1 1XXNA 3OD0A 5FY5A 2BWAA 2XUEA 2Y6LA 5A3NA 3VZKA 3TEWA 3LFIA 3ACHA 4IE5A 5C8CC 1LOBA 3PNAA 1PO21 4P9IA 5GZFA 4LT5A 5TSWA 2VBBA 1NLQA 4FCAA 3AYEA 1RL3A 4C8DA 3POEA 2NZ9A 1AZDA 5FK7A 4NN0A 2IC1A 2Q5TA 1W6QB 4IEPA 1OQ1A 2HJIA 1W90A 3IPVA 2VMHA 2GN7A 4KMQA 3B3QE 3AC0A 2YBSA 5F3CA 1AYN2 4X6RB 5A3WA 2R32A 4ZS2A 2XKPA 2E7AA 3IM0A 2AC1A 3ZXKA 1AR61 1O7FA 3O1UA 1YQ5A 3UJOA 2RS11 2W68A 1NLRA 3MBWA 2PQSA 4GB32 3ZM8A 1MZ6A 3JQXA 2ZXQA 1SG3A 4HZFA 3ZYRA 1SFPA 5FJHA 4I0WB 4COYA 3RZJA 3W5NA 3ACGA 1OOPB 2XONA 3T4VA 4A3XA 1PGL2 1ULDA 1F31A 3MIHA 3JUUA 4Y5Z0 4AQTA 4U2AA 4XFIA 4LTAA 4O9EA 1DGWX 1KS5A 3HVDA 1G9DA 1FXZA 1QJX2 3BIWE 3ZLIA 4LKFA 4JHZA 4ZHNA 1MS4A 1X33A 1XNCA 3AYCA 3RYKA 4IV1C 5AFBA 4EN7B 3VBUB 3AVRA 4GH4C 3KV5A 1FMD2 2Q4SA 2VTXA 1J58A 1DGWA 2R062 3IAQA 5EIYB 5I8YA 3H1WA 4IGOA 5FOJB 3UJQA 4S2FA 4ET7A 1V6LA 4UXAA 5LA2A 5BNNA 1CAWA 2V72A 3ZFFB 4ATFA 3JBG1 4MOAA 3FN9A 2XWBB 4HN1A 1B35A 5FYVA 3WDUA 4QX5A 1ZRFA 2BGCA 1O91A 5D8AA 1MZEA 4CEWC 3WQ7A 1DLCA 3BPSA 1HJFA 4HVOA 3PMSA 1XNDA 4ZZ5A 2RMU3 1WCUA 4PLMA 2AEYA 1KJLA 3ZDSA 3OGSA 4D94A 5JR2A 2WNVC 2GH2A 4BB3A 1R082 3JBG2 5G04L 1HB1A 1FOD3 1DG6A 1OQEA 2UURA 3J8F1 4L92A 4XDPA 4UW4A 4B1LA 4AL9A 5FUNA 2BPA2 3OG2A 2QQNA 4Z1VA 3I59A 3CMGA 2B39A 3BCWA 1UX7A 1XPWA 1QH7A 1AR63 3DL3A 4Q0VA 4D7SA 4KBZA 4JKMA 4W6WA 3D82A 3O1VA 1BEV2 1J1TA 1C4RA 4ZPIA 3T0BA 3NKGA 4BLJA 3HWJA 1QEXA 2HWE2 1DZTA 3DXTA 3TN93 4HFSA 4R4ZA 5BPXA 3T4HB 3TBDA 3WW2A 2FDKA 2E31A 5D1IA 4BXFA 2WO3A 4AZZA 3C7EA 5DAXA 4E4SA 5J3UA 1W6NA 4MH0E 2W0XA 3LEKA 5FFOC 1W6OA 3WNOA 2JB8A 3L2HA 5GLWA 1Z78A 1W2TA 5DZGA 3ZPOA 2W94A 3AFGA 1QDOA 3WW1A 3ASIA 3HQUA 5F8PA 1L3JA 3FUOA 3HPNA 3RRDA 2LM3A 3ZSJA 3KT1A 1ULPA 3NNGA 2ZJCA 4PLNA 2YXSA 4A7KA 2IUWA 1OF4A 4CDUC 2D6LX 2VR4A 4F7ZA 5JIUA 1N1VA 4CDQA 1IOAA 1FATA 1W9TA 5K4LA 1S4CA 2JD9A 2Q30A 4XTMA 1YC61 1YIPA 3CZJA 1JH5A 1D4VB 3KS7A 2IXCA 4K7JA 1GOFA 1O8SA 2G9FA 4Q4X2 1VBB3 5GLVA 5F2SA 3VLBB 4JZRA 3MPBA 2NLRA 3BPZA 5K0UA 1ACCA 4DRVA 4XDOA 4M0HA 3AZZA 3RFRA 1W8ZA 2PA7A 4C1XA 1RUJ3 4CEWA 4CP9B 3UV9A 2DFCA 4AGRA 4QKNA 5DZEA 4RA0A 1VBD1 3GJBA 5T3NA 1PMHX 3VBSC 1WCDJ 1AR62 2RS31 4AXOA 3R4UA 5FYHA 4CCLA 2QTWB 3O1PA 1LR5A 2CY6A 4QDSA 4Z92B 2MEV3 2IXIA 1GANA 3WEZA 4R9CA 3SNMA 5FO9B 3B00A 3VBRB 1MS5A 1UKGA 3GCXA 4LULA 2UYBA 1R64A 3RWNA 1PGL1 1R1A2 1NUKA 2VUCA 3N3HA 2FMYA 4HANA 1WW6A 1PK6C 4P08A 3LDKA 3WHTA 4LBJA 1IG0A 1AR83 2JKXA 3MFAA 2Y6KA 3T2PA 3RZLA 1AX2A 4CU7A 4QB1A 5FUPA 3AJYA 2J7MA 1TZOA 5FZ8A 3CJIA 5CKNA 2VTFA 3DGTA 2J1RA 3O0VA 2ETEA 2WIIB 4EE2A 1YHFA 1O3TA 4KQ7A 2VZPA 3VDBA 5FZGA 1Q56A 1IS4A 1VE0A 1MZ5A 4GWIA 3ZXLA 1LU2A 2JEMA 4XQWA 3RZHA 5EQUA 5FXWA 3WG3A 2DDUA 2WO7A 4N43B 4I30A 4FFHA 2JE9A 2BBAA 2ET7A 3AMPA 4IL7A 2O1QA 1DQ6A 1NCRB 4ZXKA 4AVSA 4LBQA 3OB8A 5IW0A 4FPCA 5DUVA 1MEC2 4CDUA 3CIHA 1YUDA 1ND3C 2JDKA 4MYEA 4NPRA 5FREA 1KJRA 1QOTA 3AX4A 3B01A 1FPN3 4R9AA 4XAEA 4GKYA 1W6QA 2ZEYA 3MGUA 3QBQA 3R4DB 3WNPA 1W3VA 2G19A 2RDQA 1RUC3 1K3IA 4PLOA 4UI9L 1JODA 1NA1A 4GMP3 4XXAA 5FCCA 2FD8A 1F15A 5EFUA 4ASMB 1NCQA 1SBEA 1FV2A 2BVBA 3ZFEB 1ZRDA 3GM8A 3EYPA 2QZ3A 2WZR3 3VD5A 4A44A 1UX6A 4BDVB 1VB2A 4EZHA 3GXUA 3ZMNA 1HV1A 2VC9A 2E9QA 3LF7A 4CRQA 4INDA 2DCKA 2BGPA 3M3OA 4KU8A 2I07B 1RUD2 3GHNA 3GGLA 1OA3A 1ZRRA 4K3UA 1AYM2 4LBOA 1K5MA 2XVLA 1FV3A 4QQOA 3SCGA 1Q5OA 4IV3B 1W3XA 5JWPA 2ENRA 1YFUA 4YZ4A 5FY7A 4RFT0 1SEFA 3SMHA 1YQ6A 4SBVA 2WFPA 3AYAA 4XVHA 3S7IA 4A42A 1US3A 1PK6A 1I6XA 3WP5A 2BNMA 5D21A 3MZHA 4QDQA 5FKCA 1JMUB 3SEEA 1Q43A 3WP6A 3NV2A 2J1EA 1L7QA 3T1LA 3VBFC 3M3EA 2RJLA 4YVSB 1OFNA 1QXRA 5AC93 2TUNA 2WZ8A 3OEAA 3UGGA 4E2QA 4J6GA 1J3QA 1UF2C 3WQ0A 1PZ9A 3NVCA 1UZYA 1LJ7A 1LODA 3ECQA 4XJZA 5LBEA 5JOXA 4PDWB 3FZ3A 4JRAA 4YGBA 1VRH2 4Z82A 2IVJA 3AL5A 2QQJA 4JCKA 1I9RA 1FI2A 1MZFA 1RITA 4DUVA 2HBUA 2RR13 3VDCA 1XNBA 1MS1A 2VZ3A 3KVBA 3QCWA 4QKFA 4RHV2 4CCOA 4LBKA 4URAA 1KFXL 2DVBA 4GMP1 3ME2A 2ZX2A 3LA3A 5C9AC 4CP1A 1H1AA 1A8MA 3DKWA 5C4WC 1NAEA 2XJPA 4QPWA 4JTNA 4OQ9A 4LOSA 4YW2A 4IXLA 2IFWA 2RM23 3ZYHA 3W9AA 1C1LA 1W6OB 2R073 3ZSMA 4WM8C 2JG9A 5BNOC 5I0SA 5FYZA 2R1DA 4AHWA 1VMFA 1IZ3A 1R1A1 1SHWB 4SLIA 4NAOA 5HV4A 5CISA 5DUWA 2Q8OA 1QJFA 4EROA 2VZUA 4E27A 2PXJA 4OLLA 4NVPA 1QKQA 1KD7A 4MX3A 1NE4A 4XEZA 3MIDA 3T0DA 4K20A 2W87A 2YU1A 3VB9A 4DZGA 2VZVA 2JDAA 1C5IA 3I2DA 3RQ0A 1YNAA 4CU8A 3E5UA 1W06A 3VKLA 2A6XA 1T2XA 1RUI2 4I3PA 2ZTNA 3R6SA 5FPAA 1LULA 3KV9A 4GB33 3SKVA 4CP0A 4COUA 5BUVA 2VZSA 2ZGNA 5FTTC 2ORXA 1GQHA 2NPIA 1K5MC 5JXHA 1JZ3A 2F4PA 2RR12 1HV0A 1O3RA 4FSJA 1C57A 2DCZA 3PIGA 2X10A 4H14A 3H8UA 3RI9A 3H7YA 1RYYA 5JDBA 1AYN1 1J1LA 5A6QA 3PDQA 2XJRA 4J1WA 1LTEA 4IGPA 3RMYA 3VD9A 3ZN4A 1KXGA 3U0ZA 4Y20A 2XL7A 2DCJA 2X5IA 1HXS2 3TEXA 1XRUA 1V6IA 2RR11 2J1SA 3CKHA 1RUI3 4FAHA 2OW4A 3BOWA 1RUH3 4LKEA 4XABA 2WAOA 3FLPA 4QWNA 1I3HA 3AXDA 4PQ9A 4NHMA 5KXEA 4BQ1A 2ZEZA 1EAH2 1QQP2 4QXBA 5FQ0B 4Z2WA 5CEHA 4LBNA 3SH4A 4CCDA 1NXMA 2YGLA 3C8XA 4Q27A 4XXPA 1BHGA 3LEIA 3VKFC 5GZGA 1LOFA 2WLPA 3KCYA 1RHI3 5D8AB 4AAXA 3PU8A 1OC1A 4DXZA 5C9AA 4A6OA 4AYUA 2ILMA 3GNEA 1WMEA 1FYUA 3AKRA 3OBZA 1LEDA 1YQ8A 2GC3A 4AEDA 5DN2A 4MXVA 4MADA 2VMIA 1OFSA 3IZOA 1BEV1 4M3CE 5FP9A 4WM7C 3T09A 3VBOB 3AP4A 1PIV2 1LNSA 2JG9C 4CCMA 5BNOA 5J48A 4PQQA 4LUMA 2V4VA 3I54A 4KWKA 2J42A 3JZVA 4Q4Y2 2D44A 2HWB3 4YWAA 4DO0A 3U4XA 2Y8KA 1J84A 3D3AA 1Y4WA 4IEZA 3RDIA 2FDIA 1H4GA 2VMGA 1WWYA 2VCMA 5FLHA 1XC6A 4K9SA 3VBHA 1QJU1 2Q8DA 3NAPB 5CFCA 4DEQA 1RIRA 1QGLA 2WS92 1CPNA 3HNMA 4RR3B 4P02B 3JQWA 1PGW2 3FFQA 2X53S 2A71A 3TB0A 1LKNA 1RB8G 1OKQA 2ZHKA 3NV4A 3NL1A 3ELNA 2WO1A 4LE4A 4Q4Y3 4QXHA 3ZFEA 5A3TA 1RGSA 3HN1A 1V9U1 4XW3A 4A45A 3BGAA 2A5ZA 4X6QB 3KHCA 3E6DA 1BQPA 4AF9A 1S0GA 4M4RA 2JICA 1O8PA 2KXLA 1Q3EA 1OPOA 4L0PA 3POJA 5FZKA 4A4AA 3JCIA 4FPYA 1TEIA 3LZZA 5FUIA 4XF4A 3T30A 5FR3A 1WW7A 2VOTA 1XOYA 1VBA1 2I45A 3MDPA 1AR81 5HXVA 1QNYA 4HONA 4XPVA 4Y33A 3T2OA 5C71A 3CBNA 4LXLA 3LDRA 2JIGA 3U4SA 1W28A 3WLUA 4FPJA 1NLSA 1UNBA 2DUPA 3ZIXA 2GZWA 3WINE 1WLWA 4P14A 1ZA7A 4IETA 2VMFA 3WX5A 1UYXA 2QQMA 1G7YA 3J8F2 4QHZA 1SCRA 1VMHA 4AEJA 4LHNA 5F6KA 4NIDA 4TWTA 4A7ZA 4NRPA 3MV01 4QHOA 4PBOA 4ES9A 1AL23 2HWE3 4IV1A 4LMFA 2JX9A 1NOVA 1IKPA 3ES1A 3IIIA 5A3PA 5F5IA 1YWKA 1K5JA 2QQIA 3J26N 3BALA 5L7OB 1QXJA 1SLIA 2Z42A 2DCTA 4KWJA 4MUVA 5ABJB 4RQPA 4YVWC 4PT6A 3VKNA 4BWOA 1V0AA 2WINB 1NY72 5GZEA 4BQYA 1FPN1 4B1MA 4BQWA 4FT8A 1TMF1 1UY4A 4I0BA 1HN0A 2EALA 4XF1A 1UQXA 4FBFA 3LB9A 3GZUC 1B35C 1UY3A 5L7OA 4FO9A 3WDWA 1JOPA 4XOGA 1CIYA 3TEYA 5FY1A 2DV9A 5A1AA 2R7EB 1X7NA 2K0GA 2A3WA 2YBPA 3GYDA 3GBFA 3HT2A 4IEWA 2XJTA 4AAPA 5C70A 2OS2A 3KQRA 4MGZE 2OYZA 3TWIA 1F9KA 1VAKA 1JU3A 2BVVA 4BQ2A 4TTGA 3I2OA 2D6KA 3NW4A 1M06G 3IKWA 4HKWA 3VKOA 1S0FA 1DZQA 3VD3A 1EAH1 2W52A 3DEMA 3BUCA 1W8FA 3OY8B 2DYCA 5GZDA 2NYYA 2ZGSA 2JECA 3AP9A 3O12A 4GD4A 3UKTA 3Q8AA 5T54A 4AVBA 4NHKA 3UGHA 3USSA 5A1LA 5JOWA 1UO9A 1W8OA 4Q0SA 4AVTA 4Z2AA 1GV9A 3V64A 1TQ5A 3GBWA 2Y0OA 2AZ5A 4XUPA 3LAGA 3OEBA 1HQNA 3U14A 4DNYA 2DVGA 5JLVA 3BTXA 1RUF2 1UY2A 4QX0A 1L7LA 4HXCA 5HPOA 3JD73 4QM8A 3USUA 2P1BA 3O5SA 3INAA 1SLBA 1RUC2 3O14A 4NHLA 5C3QA 4AVVA 4D0QA 3WDYA 1CAUB 1IKQA 1PIV1 1VBD2 1XSQA 1ZZ8A 3IMNA 4GAZA 4UOJA 1S55A 1ZBA2 1RVF1 1RUJ1 4QXKA 5FO7B 2WNOA 4WVMA 3LGRA 1FX5A 4Q8KA 4HVQA 2JDYA 3MV11 3VZNA 1UPSA 1O6UA 4AW7A 2VM9A 2RS53 3CJXA 4G4FA 1GZTA 2XQRA 2AENA 4RFRB 4YARA 2HH9A 2SLIA 5HBAA 4L2NA 4FXGB 3OPTA 2WYFA 2ZHNA 1UZZA 4CP9A 5L9VA 4Y4YA 1UAIA 1PMIA 1AHSA 2W95A 1GZWA 2XXZA 4WVZA 4WZFA 4EWEA 4YLZA 4V1PA 4LIVA 4BJ0A 2W1SA 5ANQA 5D2AA 2A1XA 2EXKA 4Q4W3 3U1XA 5I0TA 2WFF3 3LDBA 3MUZ1 1N3PA 1R081 2WL1A 3QH6A 2Q1FA 3P5BA 2P6CA 4P9WA 4YW4A 4P00B 3KV6A 2VVEA 1GMMA 1YO8A 2YY1A 5FBZA 1W6MB 3W21A 3ZYBA 3ABZA 4GWMA 3AZXA 4LHSA 2PLV2 4KWUA 2LW8A 1E57A 1ENSA 4PJYA 1W99A 3O0XA 3ZXJA 3RZKA 1U0AA 3O1OA 1A6CA 5HCBA 4RS5C 3WVJA 3I3MA 2DVFA 2DUQA 3VBSA 1VLNA 5IFTA 5IK5A 3B69A 4GA9A 2DBNA 4XILA 5KBFA 5FZDA 4QGMA 5GLZA 1G9AA 1ND2B 2J1TA 1U12A 2PHDA 5EXOA 3IPVB 4FQZA 3WF0A 3H8XA 4ZXEA 2TEPA 2AREA 4B4RA 1SLCA 3HR9A 4P9JA 2CAUA 3KB5A 3MEPA 1JZ6A 1CAXB 4AI3A 5K9YA 1IHMA 1KFUL 4XUQA 5FZMA 3ZR5A 1XYOA 5SV8A 4DPNA 3HBZA 4COVA 1FT9A 2QCSB 4N9IA 3WF3A 1Q8PA 1QU0A 4Q4X3 1VP6A 3H50A 2HBTA 4LQRA 3ZXDA 1LENA 2XBO1 4FVVA 2PELA 2I74A 1X8EA 2HWD2 3K75B 2XH6A 3OYWB 3POWA 1PK6B 2JDHA 4IEYA 2VU9A 1PVXA 4LHKA 4Q8LA 1LHOA 4GMP0 2NMOA 1D0GA 2GSYA 3JD72 5A6XA 2MHFA 1LRHA 2A6WA 3ZPYA 1LAJA 2VMCA 2R16A 1CD3G 3BTYA 1TME2 2VVDA 3LFMA 1LHVA 5JR7B 1SMVA 4LLFA 1TMF2 1BVVA 2K2SA 2CTVA 5A7SA 4XF9A 4EN8B 2VNVA 1W2OA 2KM2A 2Q1ZB 5DAWA 5KXCA 4FTSA 3WNLA 1RINA 3AZYA 1DQ5A 3N9MA 2HKXA 4P9LA 3TAYA 4CDQC 4XCBA 5FZAA 3LEGA 1WCKA 1GBGA 1UKRA 4GWJA 2QUOA 5GM0A 2WSVA 2VMEA 1DGRN 4NPMA 4QXCA 2D40A 3MW2A 4N43C 4UF0B 4WVVA 3WNKA 1BKZA 1CJDA 1BJQA 4O65A 1ONAA 3V65A 2PQQA 3A0KA 4TZDA 1JHJA 4EN0A 2AH2A 4LHLA 3WNMA 1H1MA 3ZSKA 3CHXA 1ND3B 2ZCWA 3VDAA 4N90A 1NCQC 2BTVC 3H3ZA 3ACFA 3EB7A 1NQJA 5FZ3A 4LA3A 2H0BA 1K45A 1XNAA 3TN92 1UW8A 1F2NA 4UFIA 1QJY3 1DYOA 2YV8A 3Q8BA 3SCHA 2DURA 4Y24A 4KWLA 5FPUA 2X29A 3TEZA 3VUOA 2RS51 4CZSA 2VUDA 4TSVA 5EYYA 4CEYC 2DU0A 2R49A 3QLQA 5DDJ3 4CCNA 2GALA 3OYWA 3TN91 2QQPA 1RHI2 1U5IA 1RUNA 3FBMA 1NX9A 2ARAA 3ZYPA 3KMHA 2CDOA 2ZMNA 2XLGA 3KF5A 5FYYA 2VUAA 5DUUA 1A34A 4IV3C 4CP2A 5J37A 4XFCA 1H8TA 2Z4FA 4RQPB 1W6PA 4BH9A 4OI0A 2ARCA 4MGSA 5C3PA 4R4XA 4P9GA 3KLSA 1IPSA 2W1UA 5JMOA 5GJ6A 4ASLA 2JDPA 3OTFA 4DIQA 2VW1A 1UN1A 2FDHA 2MEV2 3KQ4B 1PVC1 1H30A 2CGOA 3A21A 3LSEA 1W6NB 3MLLA 1PNGA 1UU5A 3NJZA 3OJBA 4HKLA 3AMQA 4OMCA 1HW5A 4LPLA 3I2FA 2ZGOA 4B4PA 4ZZ8A 3IDEA 3K46A 4H55A 3H3LA 4JRLA 3GZTB 5CFDB 2GNBA 3U11A 2OQ7A 5JSRA 4FTEA 4GB31 3RG0A 1YQCA 5CNAA 4JVAA 4IESA 2WS93 2ZKLA 2NQYA 3AKTA 1V9U2 2YB7A 4LKDA 5C4WA 5GALA 4BA6A 3A7QA 5A7WA 2PHLA 2VTXJ 5JI7A 4RD7A 5C9AB 5J96B 3E97A 1MQTB 3Q8CA 3OBTA 4RHV3 5FLJA 5GLTA 4ITCA 2YROA 2ZX3A 4Y26A 2EAKA 5K8SA 3PUAA 2PHFA 2CYFA 1FAYA 2RE9A 1RUE1 1WW4A 1S2EA 2VXJA 1UY1A 1W04A 2XB6C 3D0SA 3FFZA 2UY9A 4JKLA 4WM8B 5AVPA 4O9GA 2RHPA 4OHYA 4MLOA 4RN5A 1AR73 2VE1A 4EJRA 3KGZA 3MIEA 3WDXA 5ERLA 1QY4A 4XBNA 3PL0A 5LBFA 2UY8A 5IVYA 5BY5A 3VZOA 4IEUA 3VHNA 5A7NA 2JDNA 2PLV3 3KCXA 2EXJA 1VRBA 1S1AA 4XACA 1CGPA 2R0HA 5JXJA 2NN8A 3EMRA 3AVSA 2Q8CA 3S5AA 2J1UA 4YM3A 2RM22 1G86A 1G8WA 3KT4A 3BTAA 5KHJA 4BXSV 4RYDA 2R063 5J7MA 1IS6A 4AGVA 4YYOA 4IV3A 3RSJA 1MS0A 4ISQA 4DB5A 3KHBA 2OVUA 2UWBA 3UT0A 1YFWA 1CAWB 1MPXA 3JU9A 4QX2A 1WMXA 3VL9A 5ACA2 1OUSA 1E5HA 3BKZA 5FZLA 1D2SA 3MUY1 2IXKA 1LOAA 2D6MA 4QM9A 4BLIA 2VQUA 1JTZX 2QQOA 2ZGKA 4C0BA 2WS91 2BW8A 4MSVA 4W4ZA 3RS6A 1BMV1 3M3QA 5T50A 3IBMA 4CU6A 3GZEA 2W46A 1FOD2 1PM7A 3ZFGC 2ERFA 2IZWA 2Y33A 4ZU5A 4C90A 3PUSA 4ZU4A 4EZ4A 4LK7A 2RDRA 2VCBA 2XQXA 3CU7A 4LEJA 4Y3OA 3RMXA 3VDDB 4BMBA 3ZDVA 2WRAA 4MV2A 4XJ9A 2ID4A 2UWAA 4YZ2A 3I59B 3N7LA 1QH6A 3OSDA 2DU1A 4KU7A 4YW5A 4MGQA 4YGDA 2R30A 3ZMOA 2XPJA 3S6PA 2PHTA 2VULA 5JSPA 4FPOB 3AM2A 2WFF1 3FLRA 2BU9A 3MLKA 3HEIA 3VBOC 5IYYA 4K1YA 4QGNA 2CWMA 3QACA 5A33B 4EWAA 4HBNA 4YNIA 1LOCA 1Y9GA 3OOXA 4Y22B 1GZ9A 4JQTA 5CFCC 1HB3A 3MO4A 3ZXAC 5FZ6A 3O0WA 5F3IA 3NJVA 3HBKA 2QQWA 1F5JA 3FHQA 4LLOA 2WUHA 1ZZBA 5FZEA 5FZHA 2MNGA 2R072 2VMDA 4X8PA 4AI1A 5JAXA 3FLTA 1RMU3 3LPFA 2PMWB 4COZA 2QBXA 3NAPC 2E26A 2BDRA 5FPBA 4C0HA 2WA3A 2IWGB 5FWJA 3B5LB 5EJ3A 2C6SA 5AC91 1C1FA 2HEYF 5BNPB 4W6YA 4Y1ZA 3N9LA 4YM2A 4PHZA 4FP3A 2W47A 5EJ1B 4CXXA 1N3QA 2GMMA 1COV3 2A3YA 2ZGRA 1A8DA 1PO23 2N7GA 4QU2A 5LBCA 3HT1A 2HWB2 3VBUC 4GH4B 1R091 1AF9A 4PDWA 4B8EA 1O3QA 3MF9A 2ZABA 5FYTA 1RUE3 1UXXX 2BP6A 3AP7A 3ZN6B 1HRI3 1VMJA 4NHXA 1QJY2 5FAXA 4LO4B 4ARXA 4JGYB 2B4KA 2QDRA 4PIXA 4L99A 1UOFA 4XETA 1LOFC 5DABA 2YBKA 1DHKB 1VAMA 1U5ZA 4FTBA 1U5YA 5A3MA 4NAMA 3PHMA 2K46A 3D0JA 1R1A3 1GWLA 4NO4A 3K77A 3ILFA 4CDXB 5HCAA 1E5RA 2YPDA 1UIKA 1AR82 5A6YA 5AFEA 5HCFA 3WCSA 3POGA 4YW3A 3SCFA 5KXBA 1VBE1 3X29B 1KDKA 1RUG3 1W9YA 4ATEA 1QJU2 1QF3A 2C9KA 2EAAA 1RUI1 3EJKA 3I7DA 1DQ2A 4JDNA 4XJAA 3U78A 4M3CB 1LHWA 2WO2A 5CYYA 1VALA 2YC0A 5IT6A 3CL1A 4IUGA 2LRPA 1J83A 5L7OC 5EV7A 4NIIA 4QPGB 1RMU1 4CUGA 1UOJA 4PF1A 1C3HA 4GULA 5FMCA 1UY0A 3VBOA 4AR2A 1S0BA 2WC2A 4YW1A 3HNBM 3ZFFA 2VW2A 1WLTA 4YSFA 3ENRA 2O8QA 1W2UA 3AZWA 5H9RA 5DG1A 1XB9A 4ASKA 1DP0A 3U75A 3EQEA 4QD2A 5JMCA 3PVEA 1Y43B 4LIUA 2DBIA 4J1XA 2YFZA 2X5IB 4PIYA 4MHRA 4E2SA 1FPN2 3VGIA 1BEV3 2ZGPA 1YCIA 3DKQA 1YXWA 1RUH1 4M01A 2JXAA 4Q0QA 5DG2A 4A41A 1AR91 1FOD1 4PF5A 2JJ6A 1GOHA 3J8F3 4JAAA 4XJWA 3VD4A 1ZA4A 1HX6A 4K8RB 4LO7A 4LO6B 4MGKE 4G3YC 1LOEA 2YFUA 4AFAA 4CDUB 5H9SA 3GCWA 4QQ2A 5K0UB 2CWSA 3IB3A 4ORFA 1JBCA 1XE0A 1I5PA 1OD5A 1YLLA 3VBUA 1B09A 1ALYA 4RGAA 4OZXA 3W59A 3AZVA 1AR92 1SBFA 3OGVA 2BEOA 3SH5A 2EXHA 2D6OX 2NP0A 2BNNA 1S0JA 1ZZ7A 2RG4A 2JG8B 1AR72 4F8AA 4TXWA 1QWRA 3AK0A 3ALQA 2B42B 3AXEA 4LK6A 4LBMA 3QH7A 4M3CA 2QZ2A 3NWKA 2ZBJA 4FOYA 2CGNA 2NMNA 1CZTA 2IFRA 1P8JA 2XUMA 3NJXA 5DDJ2 1PZ8A 5M0TA 3OUIA 2JE8A 3VBSB 4K40A 3R05A 1WBFA 3N7JA 5LZ6A 1ASJ2 1FMD3 1DBNA 3RI8A 5KC5A 3H9AA 4RHV1 2PTMA 2D5HA 5JI9A 2HLEA 2BBVA 1COV1 3K48A 2ZKNA 3HQRA 4Q4X1 1GUIA 1O4TA 1GNYA 4L8QA 4CU9A 1NXD1 4FOWA 3K51A 1F5FA 3OUHA 3I3EA 4P9XA 1JW6A 1Q8VA 2KR2A 1HN1A 4YVSA 5FY0A 3UKVA 5KR7A 1E5SA 5IFPA 3J7NA 2P3JA 1EY2A 4MXWB 3M3CA 5IVCA 2I2SA 3BU7A 1BZWA 2FZ2A 2W91A 1ZREA 1W05A 3NKTA 4URTA 1POQA 3A22A 5FP3A 3KD4A 2X05A 1H1IA 1MACA 1SPPA 2PYTA 4RR3A 4Y1XA 1W0NA 2D3PA 5C7GA 2RS13 2R042 2KA3A 2WWUA 5FO8B 1ZM1A 1W2NA 4QGLA 2GNMA 1ULOA 3DYMA 3ZN5A 1BXHA 1ZBA1 4P5YA 2OUJA 4FXKB 1NA1B 3HD8B 3WY6A 2Q1MA 3M1HA 1LHNA 1NCRC 5FMBA 5I0UA 2HEVF 3THTA 1G9FA 1H0BA 2MEV1 2XOMA 2ARXA 3FL7A 2CSGA 3SHRA 3WQ1A 5C33A 1MS3A 4DXSA 1TVGA 4XFAA 5IHRA 3GJAA 2GC0A 2E7QA 3LIGA 4MHUA 3OD4A 3V0BB 4Q4W2 4D6SA 3R4SA 4Q0UA 4AFMA 5JZGB 4P5HA 1UMIA 5CU1A 3T1MA 1EPZA 3B7MA 1FNZA 4IEQA 3WG1A 2LS6A 1CONA 3N35A 1UMZA 5DMYA 1RHI1 4Z07A 1Z0HA 2RVAA 4UFKA 1SDDB 1XNTA 4GH4A 4N7UA 1EP0A 4B4QA 2WABA 4N43A 4KGGA 4NROA 4QDRA 3THPA 2CGPA 3EBRA 1GSLA 5A3OA 4R52A 1IQDC 3QOPA 4HK9A 5LY2A 5B4NA 1REEA 1PHMA 4LBQD 4JDMA 2W2IA 4M3CF 4XBQA 2XJQA 3G7DA 4HMZA 4YPJA 3ZKYA 1A78A 4AVCA 2LTNA 5J09A 2B5HA 5L19A 2B7YA 5FIXA 1SACA 1PX3A 3WP3A 3SITA 3H3UA 2AYHA 2WWSA 3H1MA 5FXVA 1VIWB 2G9GA 2W1QA 4Q2FA 3ILRA 3HJRA 1QJX3 1QQP3 1EV12 1NCQB 2IXHA 2HWC1 4Q4Y1 1N1YA 3VHPA 2AGSA 2GC1A 3VL8A 1YQ2A 3NNMA 1C8M2 1D4M1 3C7OA 4EN9B 5A3LA 3D8CA 4H7MA 1WLCA 1REDA 4BQ4A 1JOBA 1NYWA 1VAVA 1JI6A 1WD4A 1JYWA 4AI9A 2XJSA 3JD71 2CHHA 4AFBA 3T2TA 2L9LA 2P37A 4YG6A 3FUQA 1EUUA 5FYCA 5FYIA 3ZR6A 1YFYA 2VNOA 4XYXA 1J59A 5F3GA 1WMFA 1H2LA 2R0FA 5FZBA 5C4WB 5KHHA 2GMEA 2D3SA 2VL4A 1SCSA 2QDNA 5APAA 4E8DA 2VQAA 2BERA 1LESA 1PX4A 4XCAA 5BNOB 2E32A 2AUYA 1AX0A 4XF0A 3ZYFA 3AKQA 4QU1A 2BZDA 4WVMB 2ZHMA 3KVAA 2FHRA 4OZOA 4KH9A 4XIKA 1OOPA 2DTYA 2RMU2 4KG0A 2BUKA 5FYUA 3RGBA 1GNZA 4W6XA 1UPIA 2VJXA 4N9HA 5JCTA 5K7PA 1AL21 4NIHA 3I2KA 5JXIA 3BYWA 3CLPA 3ST7A 3POYA 4IDZA 2ZGUA 2QQLA 5CVRA 1DGLA 5LA1A 3B02A 3ZXGA 5CFDC 5LASA 1H6XA 4ZKTB 4FOQA 4YGCA 4CDWA 1JYCA 2A70A 5C5TA 1XE8A 1JZ7A 1WKYA 4FPFA 2WN3A 5F5QA 1VB4A 1K5MB 4CPBD 3ZKUA 3KCCA 4OMDA 1CPMA 1UYPA 3DF0A 3IAPA 1OVPA 1NQDA 2D6NA 5FYSA 1NT0A 4Y4RA 1DQ1A 1OXCA 1VRH3 3LOBA 3DN7A 2XL9A 2IXJA 3N9OA 1MQTC 1BYHA 5BNPA 4AG4A 4PBPA 1V6MA 4GKXA 4BYYA 1F4AA 4BQ5A 3WW3A 2R071 4FPEA 5BV6A 3MHZA 3A0NA 4I0AA 1JHNA 5L73A 4AI0A 3O1TA 2HYXA 5I8SA 2VVFA 2FBEA 2Q8EA 4V2VA 1OSGA 2VW0A 3FX3A 4L11A 1KQRA 1T6BX 4QPIB 1IS5A 4KBBA 4AEDB 4XF3A 1H8TC 3WDVA 3ETPA 4XFHA 5T5PA 1RJ7A 3LEMA 5BNNB 4YM0A 2BYVE 3SQOA 3ZXEA 1SLTA 1CZSA 2XWJB 3N7KA 2XDVA 2EICA 4QPIA 3BOPA 3CJIC 4D8MA 2VPVA 5JOZA 1IPKA 1DYKA 1QJY1 2EVXA 4RGKA 1OVSA 4JC1A 1S2KA 2O0OA 3C3VA 2SBAA 2B45X 4YM1A 4Q4V2 1R1ZA 2V5DA 3P3PA 3S5QA 4S2GA 4RGGA 2WN2A 3NNLA 2ET1A 2A6ZA 1DQ4A 4BK4A 1LU1A 4B7EA 2VGDA 3CNAA 1CX4A 5JIAA 3O1SA 5A7PA 4NRMA 1WMDA 4JTOA 1JYIA 3MI8A 4HSJA 2D7FA 3E6BA 1HRI1 5KHGA 2B9UA 2VOXA 1XYPA 1ENQA 3I97A 1NG0A 3AP5A 3ZFGA 4QPGA 5A3UA 1Q8OA 1MVEA 3PIJA 2ZAHA 4YGEA 2E53A 1QMJA 3S0MA 4GQ7A 1D4M2 3NMBA 4Y1VA 1QOOA 2WYSA 5FPZA 1PVC2 2YG0A 1HRI2 1KEXA 2P34A 2FCVA 4LO5B 1AJKA 4OHWA 4QQHA 5FZCA 3W20A 2ZHLA 1JYXA 4HK8A 4IEOA 3LPGA 2Y34A 3IDBB 4I3GA 4XHBA 5FBJA 3VDDC 1V70A 5JPNB 1XQNA 3ON7A 4AEMA 5ACA3 2LROA 3A4UA 1PM4A 2V73A 1GWKA 1HQWA 2J22A 2H6BA 2VBDA 5C3RA 5BNQA 1V00A 4ZONA 2O8OA 4JGZC 5L9RA 4BOWA 4UWDA 2D6PA 3I3BA 2ARBA 1YI7A 4OYUA 1GP4A 1RUJ2 3M8LA 1OPMA 3E6CC 3POFA 4XUNA 1LECA 4XUTA 5FY9A 5LRSA 2FMDA 4RL7A 2OT7A 1ZZ6A 4FPHA 1BBT2 4HN0A 5T5JA 2JE7A 3HN3A 4IV1B 2EIEA 2J1AA 4AHZA 2XBO3 2WSUA 2GC2A 2Y64A 3NAPA 1OBNA 5FKBA 4HPKA 4Q26A 3VBRA 5CFCB 4HLTA 4QT6A 2WFF2 1APNA 2VBPA 4DS0A 3KF3A 2E63A 4XQDA 4K8FA 1BMV2 2V4AA 1HIXA 2VY0A 3J4UH 3MW4A 2CU5A 5A1FA 4FFGA 4OHZA 4BQXA 3OCPA 1H2KA 3ZXFA 4CA9A 1HB2A 4IEXA 2GH8A 4UBGA 1AR71 5E16A 5FZ0A 5FPVA 1HKDA 3WF1A 5ABJC 1LGNA 4QKDA 4XFGA 5FWEA 2WNVB 2VZRA 3BIEA 4A2UA 2D98A 3T08A 1B35B 4BZ4A 2P3YA 1MEC3 3I3QA 5T55A 4CUCA 3UKNA 3FJSA 3I4IA 2P4EA 5IWFA 1LGCA 3BVCA 1RUE2 2W3JA 4HOOA 4X8NA 2P3KA 5I0RA 3GHMA 2AR6A 2RV9A 4R9DA 2DWRA 4DY3A 5EP9A 2BOJA 3HAGA 5FP7A 5ACA1 2HWF2 5JXGA 4XMAA 1VR3A 3SISA 1UOBA 3MF6A 4OFGA 2G9ZA 1GKBA 3QD6A 4TYSA 1VBB1 3LA2A 3PUIA 4CDXC 4LOTA 2PAKA 1X9TA 1SPPB 1JYTA 3D4KA 4NIAA 2TBVA 5J98B 2VOWA 4OQ8A 1OT5A 2YYOA 2HWD1 1GR3A 1SBDA 2XGXA 3DUIA 3M7AA 2WLQA 3TNPB 5GZCA 5IVJA 3HQXA 4WM8A 4XIOA 1AL0G 1AYM3 2Y26A 3RZGA 4EYUA 1AX1A 1CN1A 3AFKA 1N1SA 4P9YA 4YFWA 1Y3TA 5CG9A 1O5LA 1ZBE3 3RJ2X 2FDJA 4JDOA 3UETA 2JDMA 5DAVA 1VBE2 1LB2A 1US2A 4OUSA 5DDJ1 1H9PA 1MR5A 1JYVA 3ZVXA 3PVBB 3H42B 4QB6A 2AEZA 1WUVA 1Z7S3 3DXUA 4LITA 2BFUS 5C6CA 1W8UA 2LALA 1EAH3 1CESA 5F5AA 1JOJA 4Q29A 1OA4A 1C28A 1FMD1 1GNHA 2X5IC 3GDBA 4FPLA 1DZRA 4N53A 4YRDA 1DIWA 1RUF1 2VG9A 2TNFA 4IGQA 3HMYA 2BGOA 1X82A 5E8AA 3LWCA 2VNRA 2K9ZA 4FPGA 3VD7A 1W9WA 1JU4A 1MEC1 2WWJA 3RZZA 1UXZA 1AR93 3WZ1A 4CXYA 5LK7B 3UYJA 4I01A 5JUVA 4H7LA 5ABJA 1RVF2 5B2GB 1XE7A 1SFYA 3UK9A 4CCCA 3C7FA 1JZ2A 3MIGA 4XJ8A 2ZZJA 2VQTA 3N9PA 3ZX7A 1CAUA 3IN9A 4HKOA 5A32B 4Q1PA 1Y7BA 2ZA9A 4Q4V3 1EV13 3ILNA 4DUWA 2E6VA 3EO6A 1WLDA 1AXKA 2XJUA 4K21A 3I49A 1I1EA 1C8M3 5KWRA 1ZYBA 2E7TA 4EN6B 5KHIA 1JZ8A 5A70A 1ND2C 2PAMA 4HG6B 4D7TA 4CSWA 4AEKA 4XJUA 3MYXA 2DCYA 3BN6A 1O59A 2ATFA 4IW3A 5E1RA 1NZCA 4QKBA 1BLZA 3U37A 3KZ4C 2WR9A 2YHJA 4FPKA 1V9U3 5FZIA 1Y9QA 2FCTA 2BNOA 2PLV1 1UZWA 2UWCA 1UIJA 2OX0A 2JKBA 3LSDA 3W5MA 3Q8FA 2B8MA 1W9FA 2QQVA 3WD5A 3F2ZA 4MGIE 1UZVA 3I2JA 1JZ5A 3GALA 5CKQA 4GWNA 2ZAAA 4I02A 4N53B 2CNAA 5T52A 4OULA 2VO5A 3B9IA 1RUG2 3W58A 4CUAA 3V0BA 3WF2A 4UYBA 4O7XA 5T5OA 3CZUA 1COV2 4AE2A 2OZJA 4WVWA 1HXS3 1D4M3 4UW5A 1QHDA 4Q1RA 2W92A 1VBC1 1A3KA 1RMU2 2Y6GA 2R6QA 4QMAA 4QX8A 5SV5A 1PO12 3V56A 3AMNA 3DPRC 2QVSB 1SDWA 2A73B 1BBT3 5EPAA 2QQUA 4AHYA 4CDQB 5FP4A 3SEPA 5IAVA 3C7HA 2VECA 3PU3A 5CZKA 4LBQB 5FPXA 3ZFEC 3I8TA 3WXPA 3VHOA 4LR4A 5LA9A 1POV3 3PTRB 1IS3A 1CJPA 1VBC2 1VBB2 1W8HA 1ULEA 2Z5WA 3WR0A 3USUB 4IEVA 4UFHA 4A6SA 5FZOB 2R041 2WJSA 1RUH2 1G9BA 1C8M1 2FCUA 2RDSA 4NMIA 2JDZA 5CKMA 3T2QA 4MGTA 5KXDA 3VV1A 2GP5A 3IWZA 5EJZB 1PO13 4UW6A 3RYPA 4E4ZA 4JX0A 5FZOA 5JOYA 2W08A 4L9BA 3LCPA 4OI1A 1TNFA 1Z7S1 1ZRIA 3LD8A 5AVAA 4HPKB 4F83A 3J7MA 2VAUA 5FYBA 3SH3A 4A3ZA 2ADDA 3BODA 2UU8A 2VZOA 5J1XA 1UU6A 4Y20B 2DFBA 5A7OA 1W6PB 1ND2A 4Y5TA 1W9SA 3WHUA 5C8CB 2BRTA 2DVDA 3BB6A 3VBFB 1RUF3 4E2GA 3THDA 2WT1A 3OGGA 3KM5A 3POIA 5F37A 4YVSC 1X36A 1Q8SA 4IE6A 4MVTA 3ITQA 3NRUA 4XZPA 4D6QA 3TRSB 3WNXA 4RQPC 2C9AA 3OBRA 4YVWA 4L97A 1NZIA 3G6JB 4ZY9A 2ES3A 3TYJA 1BVP1 3MIBA 4PCRA 1QJZA 4D69A 3ZSLA 3VBHB 4GXLA 1AYN3 1UZ0A 3OF1A 5G05L 1RXGA 2D5FA 2GMPA 2YGMA 3IIAA 3OUJA 5DUXA 1IPJA 1CQ9A 1RVF3 4NPLA 4HL0A 1DFQA 3B93A 3RWKX 4HETA 3DV8A 4DOUA 1NCRA 1QJEA 4BU2A 1K12A 4XUOA 4R9BA 4ARYA 4GJYA 3E1F1 5FPLA 1POV0 1PZ7A 1WA6X 2MPFA 2WBKA 3N9QA 4XE9A 1GQGA 2Y60A 3MLJA 3CEWA 4EWDA 5ISLA 5I0DA 2HWC2 1R093 2XMLA 3V0AA 1PGSA 2DVAA 2F4LA 4NRQA 4UF0A 1O4YA 3J9SA 4S2HA 4E9KA 1OA2A 2CV6A 4CCJA 4DFSA 4AI8A 1J3RA 3P3NA 1DLLA 1VPHA 1S0EA 2VH9A 4JV4A 2ZEXA 4LUKA 3HOBA 4DEVA 4B3NA 3U10A 5IVFA 4C1WA 2OUHA 5A33A 2R1BA 3O7OA 4D3WA 1PO22 3LE0A 2RS32 1OH4A 4NOTA 1VBE3 1IQAA 2WZR2 3NQHA 5C8WA 1PVC3 3M70A 3AMHA 5FZFA 4AI2A 4CCKA 3PUQA 3RNSA 2YC4A 1YRZA 3ES4A 2XHNA 5BYNA 5CFDA 3GF6A 2WNUB 4CDWC 1KITA 1RUG1 4UFJA 3AMMA 1DDLA 1OUXA 5F1RA 1SLAA 2Y0IA 4EV0A 2P17A 3B9CA 5LK5A 4J25A 4O61A 1N1TA 2WNUA 3OGJA 1YEWA 3IMMA 3JB8A 3B94A 4YG3A 3ROUA 2ZACA 2VOVA 1TME3 1QJU3 2VOKA 1MQTA 2R043 1IG3A 2CDPA 2C4XA 4UFMA 1V6NA 4XHXA 1JZ4A 1DCSA 3POSA 4LORA 2ZX1A 5D8AC 2QQKA 3KT7A 5FY8A 1N3OA 1DGRA 4RS5A 1ODMA 3V0AB 5IVBA 1VJ2A 3RZMA 4BCUA 5GLUA 1VBA3 3T3YA 4BMEA 2WNVA 1HRV1 1PNFA 5IK4A 4FOVA 3BU0A 4WM7B 4GALA 3PURA 3EXUA 4XAAA 2JG9B 3ZFGB 2WAAA 2YU2A 4PI0A 5E88A 4QAWA 5FZ7A 5IK7A 4QPIC 5FRAA 5H9QA 3S57A 1O3SA 5DQ0A 1ASJ1 1CVNA 3ZYJB 3Q9OA 4TLFA 2C24A 4W65A 2RS33 3I2GA 4LA2A 3POBA 5FZ9A 3RJRA 3VKMA 4XC9A 1H2NA 3I2HA 4OHXA 2YUEA 4FFFA 2Y6JA 2B9VA 1J3PA 4JQRA 1OLQA 3ZYGA 1N47A 1OOPC 2ADEA 5FDBA 5BXXA 1OI6A 1ZZCA 1YYNA 3PTYA 4M00A 1WCSA 3DCQA 5LRRA 1H4HA 3H1YA 4KNCA 2XLAA 4K1ZA 2IXLA 1ZX5A 2PHUA 2RDNA 3LA7A 2A7AA 1W39A 4BPZA 3WUCA 1MVQA 4Q0PA 4DINB 1XJAA 1UCXA 2OPKA 1HB4A 3ZYIB 2ZGMA 4D7YA 1TME1 1QXPA 2DTWA 1UMHA 3D5OA 2ZGTA 1I5ZA 4NWVA 1HJGA 1OLMA 2B46X 3F95A 4LNVA 2LUWA 2F6BA 4YG0A 2P2KA 5LW9A 4QHBA 3L2YA 3U07A 1RC6A 3NJYA 3BTZA 3NNJA 1X9PA 3VDDA 2WZPP 4NE9A 3ZSEA 1TMF3 2VZTA 5C5UA 3ETQA 5I8TA 4CEWB 5BNPC 3MICA 1O4ZA 1QIQA 3K4ZA 1D2QA 5LY1A 3AKPA 2KD7A 3WQBA 5LCWL 5IVEA 3K3OA 1ULFA 4YZ3A 4NR1A 5FQ0A 4B29A 2RJ2A 4R8HA 1WCQA 2BFUL 1EPWA 5F3EA 5CAZA 1GU3A 1HRV3 2HYKA 1OKOA 2GU9A 4XFFA 1W0PA 2DF7A 1MS9A 4IE0A 4Z8BA 1RUC1 3M3IA 4JGZB 1SLLA 1UYYA 2JG8A 3KWVA 4JGYC 4AWDA 5JSOA 2UYAA 4QX7A 1ASJ3 5FLIA 1XSRA 1UD1A 3SKJE 3K4DA 5FP8A 1X8MA 5FXZA 5F39A 5CG8A 5F6LB 4CEYA 1EYBA 1GFF2 1TG7A 4YVWB 1H9WA 1IGOA 2D93A 2G4IA 3H7JA 3JXSA 5FMOS 5IATA 1TE1B 4FAGA 2ZGQA 1V6OA 2P5BA 4KGQA 4QQPA 2XVGA 5JPMB 3N4MA 3H8OA 1C8NA 3CQOA 1GOGA 4TN7A 5JVVA 1EUTA 2JB4A 5A80A 2JIJA 1ZRCA 1OD3A 1PIV3 1AXZA 4DY5A 2Y6FA 2OA2A 1CZVA 3L9JT 4ZS3A 4OI2A 3TNQA 3WW4A 1AYM1 2DUOA 3UESA 4NJ4A 1W2AX 3E5QA 3K4AA 4K6BA 5J36A 3O1RA 3FBYA 4QPGC 4PIZA 1ZBE1 1WZXA 2XR4A 3M4FA 3OPWA 1DF0A 4MXWA 1CAXA 4MG2A 1BK1A 3PJYA 1QOSA 4COWA 2AACA 2ZZQA 2QE3A 1JUIA 4JKKA 4PI2A 3KV4A 4AGGA 4GZ9A 4H3WA 4IE7A 1PMJX 2ZMLA 4YW6A 2E51A 2XKOA 2XLFA 2Z79A 5CB7A 4CTEA 4DXTA 1Q8QA 3FC0A 3WP4A 4WZCA 4CDXA 4QB2A 2WDBA 3DECA 4E4HA 4N7IA 4NHYA 5FXXA 1QJX1 2HWC3 1R083 3M2MA 4OUEA 3TOJA 1HRV2 3PJQA 3LKJA 4YZ5A 2YC2A 1VBA2 1YJLA 3J7LA 4M0NA 3J7HA 4JGZA 1VBD3 2VZQA 4WV8A 4S2DA 1L7RA 5HI0A 2R061 4YW7A 5CA6A 1JUHA 1W03A 2ZX4A 3T0AA 5K0UC 4F3JA 2WA4A 1REFA 4YFZA 2ZEWA 1ODNA 5IUQA 4A7YA 2VCAA 1GWMA 1HLCA 4XBLA 1OF3A 1LHUA 1H8VA 4UFLA 2VXRA 3ZN6A 3VBRC 3AP6A 3FMGA 5F32A 5E89A 2FDGA 2WQ8A 3OPZA 1YJKA 4CXWA 2JG8C 1EV11 4JGYA 4CUBA 5T5LA 4XDQA 3PMEA 5F5CA 2HWF3 2E33A 2W9XA 2OPWA 4BE3A 4U36A 1T6GC 3R0RA 4W8JA 4CYDA 4DRRA 4KG8A 1OQDA 2OQ6A 1JS9A 3C2UA 1NE6A 2QKDA 3RYRA 2NM1A 2WT2A 2VUJA 4MGYE 5LATA 3SXWA 1WBLA 1W8WA 2OIIA 3NSTA 2EIDA 1NY71 2YDEA 4UW3A 3WG2A 1RUD1 1C5HA 1BBT1 3IDCB 3NO8A 3ZOIA 4LKSA 4N8MA 2H0VA 4RS5B 2VNGA 1HQLA 4W50A 3WF4A 1AJOA 2XHKA 1SQ4A 3FWEA 3Q8EA 4AQ2A 5LA0A 1LGBA 1CAVB 1WD3A 1OLME 4UAPA 4KI5M 4XTPA 4IE4A 1KRIA 4QQLA 4XURA 3E5XA 3NV3A 3VBFA 5IAXA 1GZCA 3ACIA 4META 3VHRA 5LEJA 1WA4A 3SLIA 5LEKA 3DYOA 1DYPA 2FQPA 3RVHA 1CAVA 3OY8A 1D0HA 1F8VA 4EQVA 1UYZA 4OVEA 3OBAA 5DAPA 1PO11 1W0OA 4RSUA 1AXYA 1HXS1 5FZ4A 2PHRA 1ENXA 2A6YA 5DZFA 2V5YA 4QPYA 1ENRA 5I91A 1GICA 2WQ4A 1JXNA 1ND3A 1QNWA 3K3NA 4MZUA 1LCLA 5DXDA 4UBHA 3N9NA 3I3DA 4DQAA 4C91A 3FE5A 4AK3A 1ST8A 4CE8A 1MS8A 1W8NA 1NA1C 2IVIB 2ZMKA 3UGFA 4DMIA 1NKGA 4BIOA 4BISA 4AVAA 2WT0A 1XU1A 2OZ6A 3AJZA 4BQ3A 4BIFA 5KC6A 1M4WA 1S0DA 4TLGA 4ONUA 5ANNA 1KGYA 2XJVA 2JENA 1URXA 3WDTA 1YFXA 2HWF1 2EF6A 4BK5A 2Y38A 2D43A 5EZWA 5C3SA 1ZNPA 2PN5A 2A3XA 3ZIWA 3ACLA 3MFCA 5IVVA 3O1MA 3GZAA 3SC7X 5FY4A 1RUD3 3IDAA 1H2MA 5EWSA 5JZGC 1OMIA 2HWB1 4YZ1A 4N53C 5EYXA 2EA7A 2ORZA 1GP5A 1OURA 2C5DA 4AFCA 1UOGA 3DPRA 3NV1A 4QX3A 1GLHA 2Q0AA 1CWPA 2J1VA 2F17A 2ZX0A 2JDUA 4Y1YA 1CIWA 1ZVFA 1ZZ9A 2X8KA 4GJZA 1ZBA3 3DPRB 4DXRA 4G9SB 1DU3D 4AOCA 2PFWA 1YI9A 4ZU7A 1W6MA 2BV4A 4LJHA 2RS12 2W5FA 4Y5SA 2JD4A 5EHDA 4PDWC 2P3IA 3PUHA 3GBGA 4NWWA 2A75A 4CEYB 3VZJA 3WOGA 5F9TA 3FHAA 2XVKA 5FV3A 1CR7A 1STMA 1RTVA 4FFIA 3HNYM 1AUYA 3CO2A 4QX1A 2EIGA 1ZBE2 2VD7A 2GNTA 3I2IA 3UNPA 3KGLA 5IJRA 4I2OA 2V09A 4IERA 5L9BA 1W8TA 2Y6HA 2BOIA 3KSCA 4IQPA 2D97A 3BI3A 1G9CA 2EXIA 1S2BA 2G1MA 5A7WB 4WBBA 3LOIA 3AKSA 1G6NA 5A32A 2FZ1A 4M4PA 3CF6E 4HVRA 4H2AA 2GP3A 4MO3M 4XFBA 1LEMA 2QJVA 5E6HA 4HT1T 3VZMA 5CIRA 5I93A 2W39A 2W1WA 2XBO2 4E8CA 4AQ6A 1AVBA 2Z69A 1X50A 4Q4W1 5LB6A 2YZ4A 3MIFA 3THCA 1GQPA 1PGW1 1RXFA 1YIFA 2A6VA 2BJSA 2EIBA 5B4XA 4AHXA 4CVUA 3D6EA 3IT8A
chains in the Genus database with same CATH topology
1Z7S2 4Q4V1 3URFA 1O5UA 1LOGA 3AYDA 3WUDA 2ZPXA 3WV6A 1GYKA 1KDMA 1XYNA 4XMIA 2GAUA 4OI4A 3WT3A 4FP2A 2WQZC 2C0ZA 4B7KA 2CL2A 3VBHC 1KS4A 3N36A 2VQ0A 2BQPA 3PVOA 5JZGA 2GNDA 1S0IA 3VZLA 1QQP1 2CAVA 4XQ4A 5GKAC 2XG3A 1ULCA 4AFDA 1V6KA 4HSLA 2RM21 1OHFA 2WNEA 2HWE1 1SFNA 1U5XA 3ATGA 4LBLA 4FQ4A 2PHWA 1DQ0A 4ES8A 5CADA 2Z2SB 2WKKA 2PAEA 2GDFA 4OHVA 4LO8A 2PHXA 3MW3A 5L36A 1V6JA 1OLRA 4I09A 2RS52 2RMU1 2GN3A 3APBA 1S0CA 1RJ8A 4OUMA 1XNKA 3WG4A 2BWCA 3PLQA 4LE3A 3HIFA 5CBLA 5H9PA 5KHKA 3FHIB 1UL9A 3JB4C 3VN4A 2HWD3 4BHPA 2ZOEB 1GZWB 1TNRA 1HDKA 1BCXA 3EHKA 5IK8A 2ZGLA 1FNYA 2D3RA 2QFEA 2HEWF 4GIQA 4KL1A 2RJKA 4AEDC 2WNUC 4CDWB 3S7EA 1H8TB 1XU2A 2QNKA 4WM7A 5BNNC 5AC92 2WZR1 1JN2P 5C8CA 5FOBB 2ZS6B 3CJIB 4Y22A 1VBC3 3UL2A 4BM8A 3N7MA 2YPJA 4Y1UA 1R092 4RR3C 1AL22 3AB0A 1ULGA 3WCRA 3PVNA 1WGPA 4AQSA 1RUOA 3H0OA 3S30A 4E4DX 2H6CA 1UU4A 1QDCA 1WW5A 4ISRA 5FMOL 3RPQA 3JBG3 3ZO0B 2YMZA 2C1FA 3MPPG 1POV1 1VRH1 1XXNA 3OD0A 2BWAA 3VZKA 1LOBA 3PNAA 1PO21 4P9IA 5GZFA 4LT5A 5TSWA 4FCAA 3AYEA 1RL3A 2NZ9A 1AZDA 4NN0A 2IC1A 2Q5TA 1W6QB 4IEPA 1OQ1A 2HJIA 3IPVA 2VMHA 2GN7A 3B3QE 1AYN2 4X6RB 2R32A 2XKPA 2E7AA 3IM0A 3ZXKA 1AR61 1O7FA 3UJOA 2RS11 2W68A 1NLRA 4GB32 1MZ6A 3JQXA 4HZFA 3ZYRA 4I0WB 4COYA 1OOPB 1PGL2 4A3XA 1ULDA 1F31A 3MIHA 3JUUA 4Y5Z0 4AQTA 4U2AA 4XFIA 4LTAA 4O9EA 1DGWX 1KS5A 1G9DA 1FXZA 1QJX2 3BIWE 1MS4A 1X33A 1XNCA 3AYCA 3RYKA 4IV1C 5AFBA 4EN7B 3VBUB 4GH4C 1FMD2 2Q4SA 1J58A 1DGWA 2R062 5I8YA 3H1WA 5FOJB 3UJQA 4S2FA 5BNNA 1V6LA 4UXAA 1CAWA 3ZFFB 4ATFA 3JBG1 2XWBB 4HN1A 1B35A 3WDUA 4QX5A 1ZRFA 2BGCA 1O91A 5D8AA 1MZEA 4CEWC 3WQ7A 4HVOA 3PMSA 1XNDA 2RMU3 4PLMA 1KJLA 3ZDSA 4D94A 2WNVC 2GH2A 1R082 3JBG2 1FOD3 1DG6A 1OQEA 2UURA 3J8F1 4L92A 4UW4A 2BPA2 4Z1VA 3I59A 2B39A 3BCWA 1QH7A 1AR63 3DL3A 4Q0VA 4D7SA 4W6WA 3D82A 1BEV2 1J1TA 1C4RA 3NKGA 4BLJA 3HWJA 2HWE2 1DZTA 3TN93 4HFSA 4R4ZA 5BPXA 3TBDA 3WW2A 5D1IA 4E4SA 1W6NA 4MH0E 2W0XA 5FFOC 1W6OA 3L2HA 5GLWA 1Z78A 5DZGA 3AFGA 1QDOA 3WW1A 3ASIA 1L3JA 3FUOA 3RRDA 2LM3A 3ZSJA 3KT1A 4PLNA 2ZJCA 2YXSA 4A7KA 4F7ZA 4CDUC 2D6LX 1N1VA 4CDQA 1IOAA 1FATA 4XTMA 2Q30A 1YIPA 1JH5A 1D4VB 3KS7A 2IXCA 4K7JA 2G9FA 4Q4X2 1VBB3 5GLVA 3VLBB 3MPBA 2NLRA 3BPZA 5K0UA 4DRVA 4M0HA 3AZZA 2PA7A 4C1XA 1RUJ3 4CEWA 3UV9A 2DFCA 4AGRA 5DZEA 4RA0A 1VBD1 5T3NA 3VBSC 1WCDJ 1AR62 2RS31 4AXOA 3R4UA 1LR5A 2CY6A 4Z92B 2MEV3 2IXIA 1GANA 4R9CA 3SNMA 5FO9B 3B00A 3VBRB 1MS5A 1UKGA 4LULA 2UYBA 3RWNA 1PGL1 1R1A2 3N3HA 2FMYA 4HANA 1WW6A 1PK6C 3WHTA 4LBJA 1AR83 3MFAA 1AX2A 3AJYA 3CJIA 3DGTA 3O0VA 2ETEA 2WIIB 1YHFA 1O3TA 4KQ7A 1Q56A 1IS4A 1MZ5A 3ZXLA 1LU2A 2JEMA 4XQWA 3WG3A 4N43B 4I30A 2JE9A 2ET7A 3AMPA 4IL7A 2O1QA 1DQ6A 1NCRB 4ZXKA 4AVSA 4LBQA 4FPCA 5DUVA 1MEC2 4CDUA 1YUDA 1ND3C 4MYEA 4NPRA 5FREA 1KJRA 1QOTA 3AX4A 3B01A 1FPN3 4R9AA 4GKYA 1W6QA 3MGUA 3QBQA 3R4DB 5FCCA 1RUC3 4PLOA 4XXAA 1NA1A 4GMP3 5EFUA 4ASMB 1NCQA 1SBEA 1FV2A 2BVBA 3ZFEB 1ZRDA 2QZ3A 2WZR3 1UX6A 1VB2A 3ZMNA 1HV1A 2E9QA 4CRQA 4INDA 2DCKA 3M3OA 4KU8A 2I07B 1RUD2 3GHNA 1OA3A 1ZRRA 4K3UA 1AYM2 4LBOA 1K5MA 2XVLA 1FV3A 4QQOA 3SCGA 1Q5OA 4IV3B 5JWPA 2ENRA 1YFUA 4YZ4A 4RFT0 1SEFA 3SMHA 4SBVA 2WFPA 3AYAA 3S7IA 1PK6A 1I6XA 3WP5A 2BNMA 3MZHA 3WP6A 1Q43A 3NV2A 3T1LA 3VBFC 3M3EA 2RJLA 4YVSB 1OFNA 1QXRA 5AC93 2TUNA 4E2QA 4J6GA 1J3QA 1UF2C 3WQ0A 1PZ9A 3NVCA 1UZYA 1LJ7A 1LODA 3ECQA 4XJZA 5JOXA 4PDWB 3FZ3A 4JRAA 4YGBA 1VRH2 4Z82A 4JCKA 1I9RA 1FI2A 1MZFA 1RITA 5JIUA 2RR13 1XNBA 1MS1A 3QCWA 4RHV2 4LBKA 1KFXL 2DVBA 4GMP1 3ME2A 2ZX2A 3LA3A 5C9AC 4CP1A 1H1AA 1A8MA 3DKWA 5C4WC 2XJPA 4JTNA 4YW2A 4IXLA 2IFWA 2RM23 3W9AA 1C1LA 1W6OB 2R073 3ZSMA 4WM8C 2JG9A 5BNOC 5I0SA 2R1DA 4AHWA 1IZ3A 1R1A1 4SLIA 5DUWA 2Q8OA 4EROA 4E27A 4OLLA 4NVPA 1QKQA 1KD7A 4MX3A 1NE4A 4XEZA 3MIDA 4K20A 4DZGA 3I2DA 1C5IA 3RQ0A 1YNAA 3E5UA 3VKLA 2A6XA 4I3PA 1RUI2 2ZTNA 3R6SA 1LULA 4GB33 4CP0A 4COUA 5BUVA 2ZGNA 5FTTC 1GQHA 1K5MC 2NPIA 2F4PA 2RR12 1HV0A 1O3RA 4FSJA 1C57A 2DCZA 4H14A 3H8UA 3RI9A 3H7YA 1AYN1 1J1LA 2XJRA 4J1WA 1LTEA 3RMYA 3ZN4A 1KXGA 3U0ZA 4Y20A 2XL7A 2DCJA 2X5IA 1HXS2 1XRUA 1V6IA 2RR11 4FAHA 1RUI3 2OW4A 3BOWA 1RUH3 3FLPA 1I3HA 3AXDA 4PQ9A 4NHMA 5KXEA 4BQ1A 1EAH2 1QQP2 5FQ0B 4Z2WA 4LBNA 3SH4A 1NXMA 2YGLA 4XXPA 4Q27A 3VKFC 5GZGA 1LOFA 2WLPA 3KCYA 1RHI3 5D8AB 4DXZA 5C9AA 4AYUA 2ILMA 3GNEA 1WMEA 1FYUA 3AKRA 1LEDA 2GC3A 4AEDA 4MXVA 2VMIA 1OFSA 4M3CE 1BEV1 4WM7C 3VBOB 3AP4A 1PIV2 2JG9C 5BNOA 5J48A 4LUMA 3I54A 4KWKA 3JZVA 4Q4Y2 2D44A 2HWB3 3U4XA 4IEZA 3RDIA 1H4GA 2VMGA 5FLHA 4K9SA 3VBHA 1QJU1 3NAPB 5CFCA 1RIRA 1QGLA 2WS92 1CPNA 4RR3B 3JQWA 1PGW2 3FFQA 2X53S 2A71A 3TB0A 1LKNA 1RB8G 2ZHKA 1OKQA 3NV4A 3NL1A 3ELNA 4LE4A 4Q4Y3 3ZFEA 1RGSA 3HN1A 1V9U1 4XW3A 2A5ZA 4X6QB 3E6DA 1BQPA 4AF9A 1S0GA 2JICA 2KXLA 1Q3EA 1OPOA 3JCIA 4FPYA 1TEIA 3LZZA 4XF4A 1WW7A 5J3UA 1VBA1 2I45A 3MDPA 1AR81 5HXVA 1QNYA 4XPVA 3WLUA 4FPJA 1NLSA 2DUPA 3ZIXA 2GZWA 3WINE 1WLWA 4P14A 4IETA 3WX5A 1G7YA 3J8F2 1SCRA 4AEJA 4LHNA 5F6KA 4TWTA 4A7ZA 4PBOA 4ES9A 1AL23 2HWE3 4IV1A 2JX9A 1NOVA 1IKPA 3ES1A 1YWKA 3J26N 5L7OB 3BALA 1QXJA 1SLIA 2Z42A 2DCTA 4KWJA 4MUVA 5ABJB 4RQPA 4YVWC 4BWOA 3VKNA 5GZEA 2WINB 1NY72 1FPN1 4FT8A 1TMF1 4I0BA 2EALA 4XF1A 4FBFA 3LB9A 3GZUC 1B35C 5L7OA 4FO9A 3WDWA 4XOGA 2DV9A 3ZFFC 1X7NA 2K0GA 2A3WA 3GYDA 3HT2A 3GBFA 4IEWA 2XJTA 3KQRA 4MGZE 2OYZA 3TWIA 1F9KA 1VAKA 2BVVA 2D6KA 3NW4A 1M06G 3IKWA 4HKWA 3VKOA 1S0FA 1DZQA 1EAH1 2W52A 3OY8B 2DYCA 5GZDA 2NYYA 2ZGSA 2JECA 3AP9A 3O12A 3UKTA 4AVBA 5T54A 4NHKA 3USSA 5JOWA 4Q0SA 4AVTA 1GV9A 3V64A 1TQ5A 3GBWA 2Y0OA 2AZ5A 3LAGA 1HQNA 4DNYA 2DVGA 5JLVA 1RUF2 3JD73 4QM8A 3USUA 3O5SA 3INAA 1SLBA 1RUC2 3O14A 4NHLA 4AVVA 3WDYA 1CAUB 1IKQA 1PIV1 1VBD2 3IMNA 1ZZ8A 1S55A 1ZBA2 1RVF1 1RUJ1 4QXKA 5FO7B 4Q8KA 4WVMA 3LGRA 1FX5A 4HVQA 4AW7A 3VZNA 1UPSA 3CJXA 2RS53 4G4FA 2AENA 4YARA 2SLIA 5HBAA 4L2NA 4FXGB 2ZHNA 1UZZA 4Y4YA 1UAIA 1PMIA 1AHSA 1GZWA 4WVZA 4WZFA 4EWEA 4YLZA 4V1PA 2EXKA 4Q4W3 5I0TA 2WFF3 1N3PA 1R081 2WL1A 3QH6A 4P9WA 4YW4A 2VVEA 1YO8A 2YY1A 5FBZA 1W6MB 4GWMA 3AZXA 2PLV2 1E57A 1ENSA 4PJYA 3ZXJA 3O0XA 1U0AA 1A6CA 5HCBA 4RS5C 3WVJA 2DVFA 2DUQA 3VBSA 1VLNA 5IK5A 3B69A 4GA9A 4XILA 5KBFA 4QGMA 5GLZA 1G9AA 1ND2B 2PHDA 1U12A 5EXOA 3IPVB 4FQZA 2TEPA 2AREA 4B4RA 1SLCA 3HR9A 4P9JA 2CAUA 3KB5A 3MEPA 1CAXB 4AI3A 5K9YA 1IHMA 1KFUL 1XYOA 5SV8A 4DPNA 3HBZA 4COVA 1FT9A 2QCSB 4N9IA 1Q8PA 1QU0A 4Q4X3 1VP6A 3H50A 3ZXDA 1LENA 2XBO1 4FVVA 2PELA 2I74A 1X8EA 2HWD2 3OYWB 2XH6A 3POWA 4IEYA 1PK6B 4LHKA 2VU9A 1PVXA 4Q8LA 1LHOA 4GMP0 1D0GA 2NMOA 2GSYA 3JD72 2MHFA 1LRHA 2A6WA 3ZPYA 2R16A 1CD3G 1TME2 2VVDA 1LHVA 5JR7B 1SMVA 4LLFA 1TMF2 1BVVA 2K2SA 2CTVA 4XF9A 4EN8B 2KM2A 2Q1ZB 5KXCA 4FTSA 1RINA 3AZYA 1DQ5A 3TAYA 2HKXA 4P9LA 4CDQC 1WCKA 1GBGA 1UKRA 2QUOA 5GM0A 2WSVA 1DGRN 2D40A 3MW2A 4N43C 4WVVA 5JDBA 1BKZA 1CJDA 1BJQA 3V65A 1ONAA 2PQQA 3A0KA 4TZDA 4EN0A 2AH2A 4LHLA 1H1MA 3ZSKA 1ND3B 2ZCWA 4N90A 1NCQC 2BTVC 3H3ZA 1NQJA 4LA3A 2H0BA 3TN92 1UW8A 1F2NA 1QJY3 2YV8A 3SCHA 2DURA 4Y24A 4KWLA 2X29A 3VUOA 2RS51 4CZSA 4TSVA 5EYYA 4CEYC 2DU0A 2R49A 3QLQA 5DDJ3 2GALA 3OYWA 3TN91 2QQPA 1RHI2 1U5IA 1RUNA 3FBMA 3ZYPA 3KMHA 2ZMNA 2XLGA 2VUAA 5DUUA 4IV3C 4CP2A 5J37A 4XFCA 1H8TA 4RQPB 1W6PA 4BH9A 4OI0A 4R4XA 4P9GA 3KLSA 5GJ6A 4ASLA 3OTFA 2VW1A 1UN1A 2MEV2 1PVC1 1H30A 2CGOA 3LSEA 3MLLA 1W6NB 3NJZA 1PNGA 1UU5A 3OJBA 4HKLA 3AMQA 1HW5A 2ZGOA 4B4PA 3IDEA 4H55A 4JRLA 3GZTB 5CFDB 2GNBA 3U11A 5JSRA 4FTEA 4GB31 3RG0A 5CNAA 4JVAA 4IESA 2WS93 2ZKLA 2NQYA 3AKTA 1V9U2 5C4WA 5GALA 4BA6A 2PHLA 5JI7A 4RD7A 5C9AB 5J96B 3E97A 1MQTB 4RHV3 3OBTA 5FLJA 5GLTA 4ITCA 2YROA 2ZX3A 4Y26A 2EAKA 5K8SA 2PHFA 2CYFA 1FAYA 2RE9A 1RUE1 1WW4A 2XB6C 3FFZA 4WM8B 3D0SA 2UY9A 5AVPA 4O9GA 2RHPA 4OHYA 4MLOA 1AR73 4EJRA 3KGZA 3MIEA 3WDXA 1QY4A 4XBNA 2UY8A 5BY5A 3VZOA 4IEUA 3VHNA 3KCXA 2PLV3 2EXJA 1S1AA 1CGPA 2R0HA 2NN8A 4YM3A 2RM22 1G86A 1G8WA 3KT4A 3BTAA 5KHJA 5J7MA 2R063 1IS6A 4AGVA 4YYOA 4IV3A 3RSJA 1MS0A 4ISQA 4DB5A 2OVUA 2UWBA 1YFWA 1CAWB 3JU9A 3VL9A 5ACA2 1D2SA 2IXKA 1LOAA 2D6MA 4QM9A 4BLIA 1JTZX 4C0BA 2ZGKA 2WS91 2BW8A 4MSVA 3RS6A 1BMV1 3M3QA 5T50A 3IBMA 1FOD2 1PM7A 3ZFGC 2ERFA 2IZWA 4ZU5A 4C90A 4ZU4A 3CU7A 4LEJA 3VDDB 3RMXA 4BMBA 4MV2A 4XJ9A 2UWAA 4YZ2A 3I59B 3N7LA 1QH6A 4KU7A 2DU1A 4YW5A 4YGDA 2R30A 3ZMOA 2XPJA 3S6PA 2PHTA 2VULA 5JSPA 4FPOB 3AM2A 2WFF1 3FLRA 3MLKA 3VBOC 4K1YA 4QGNA 2CWMA 3QACA 5A33B 4EWAA 4HBNA 4YNIA 1LOCA 4Y22B 1GZ9A 5CFCC 3ZXAC 3O0WA 1F5JA 4LLOA 1ZZBA 5JAXA 2MNGA 2R072 4X8PA 4AI1A 3FLTA 1RMU3 4COZA 3NAPC 4C0HA 2WA3A 2IWGB 3B5LB 5EJ3A 5AC91 1C1FA 2HEYF 5BNPB 4W6YA 4Y1ZA 4YM2A 4FP3A 1N3QA 2GMMA 1COV3 2A3YA 2ZGRA 1A8DA 1PO23 2N7GA 4QU2A 3HT1A 2HWB2 3VBUC 4GH4B 1R091 1AF9A 4PDWA 4B8EA 1O3QA 3MF9A 2ZABA 1RUE3 3AP7A 3ZN6B 1HRI3 1QJY2 5FAXA 4LO4B 4JGYB 2QDRA 4PIXA 4L99A 4XETA 1LOFC 1DHKB 1VAMA 1U5ZA 4FTBA 1U5YA 5A3MA 3PHMA 3D0JA 1R1A3 4NO4A 3ILFA 4CDXB 5HCAA 1UIKA 1AR82 5AFEA 5HCFA 3WCSA 4YW3A 3SCFA 5KXBA 1VBE1 3X29B 1KDKA 1RUG3 4ATEA 1QJU2 1QF3A 3EJKA 2EAAA 1RUI1 3I7DA 4JDNA 1DQ2A 4XJAA 5K7PA 4M3CB 1LHWA 1VALA 2YC0A 5IT6A 3CL1A 5L7OC 5EV7A 4QPGB 1RMU1 1C3HA 4GULA 3VBOA 1S0BA 2WC2A 4YW1A 3ZFFA 2VW2A 1WLTA 4YSFA 3ENRA 2O8QA 1W2UA 3AZWA 5H9RA 5DG1A 3EQEA 4QD2A 5JMCA 3PVEA 1Y43B 4J1XA 2X5IB 4PIYA 4E2SA 1FPN2 3VGIA 1BEV3 2ZGPA 1YCIA 4M01A 1YXWA 1RUH1 2JXAA 4Q0QA 5DG2A 1AR91 1FOD1 4PF5A 2JJ6A 3J8F3 4JAAA 4XJWA 1ZA4A 1HX6A 4LO7A 4MGKE 4LO6B 4G3YC 1LOEA 4AFAA 4CDUB 5H9SA 4QQ2A 5K0UB 2CWSA 4ORFA 1JBCA 1YLLA 1OD5A 3VBUA 1B09A 1ALYA 4RGAA 4OZXA 3W59A 3AZVA 1AR92 1SBFA 2NP0A 2BEOA 3SH5A 2EXHA 2D6OX 2BNNA 1S0JA 1ZZ7A 2JG8B 1AR72 4F8AA 1QWRA 3AK0A 3ALQA 2B42B 3AXEA 4LBMA 3QH7A 4M3CA 2QZ2A 3NWKA 2ZBJA 4FOYA 2CGNA 2NMNA 2IFRA 2XUMA 5DDJ2 1PZ8A 3VBSB 4K40A 3R05A 1WBFA 3N7JA 1ASJ2 1FMD3 1DBNA 3RI8A 5KC5A 3H9AA 4RHV1 2PTMA 2D5HA 5JI9A 2BBVA 1COV1 3K48A 2ZKNA 4Q4X1 1O4TA 4L8QA 1NXD1 4FOWA 3K51A 1F5FA 4P9XA 1JW6A 1Q8VA 3UKVA 4YVSA 2P3JA 1EY2A 4MXWB 3M3CA 2I2SA 3BU7A 1BZWA 2FZ2A 1ZREA 3NKTA 4URTA 3KD4A 1H1IA 1MACA 2PYTA 4RR3A 4Y1XA 2D3PA 2RS13 2R042 2KA3A 5FO8B 1ZM1A 4QGLA 2GNMA 3ZN5A 1BXHA 1ZBA1 2OUJA 4FXKB 1NA1B 3HD8B 3WY6A 2Q1MA 3M1HA 1LHNA 1NCRC 5I0UA 3THTA 2HEVF 1G9FA 1H0BA 2MEV1 2ARXA 3SHRA 3WQ1A 5C33A 1MS3A 4XFAA 2GC0A 2E7QA 3V0BB 3OD4A 4Q4W2 3R4SA 4Q0UA 4AFMA 5JZGB 4P5HA 5CU1A 3T1MA 1EPZA 3B7MA 1FNZA 4IEQA 3WG1A 1CONA 3N35A 1UMZA 1RHI1 4Z07A 1Z0HA 4GH4A 4N7UA 1EP0A 4B4QA 4N43A 4KGGA 3THPA 2CGPA 3EBRA 1GSLA 4R52A 3QOPA 4HK9A 1REEA 1PHMA 4LBQD 4JDMA 4M3CF 4XBQA 2XJQA 3G7DA 4HMZA 1A78A 4AVCA 2LTNA 5J09A 2B5HA 5L19A 2B7YA 1SACA 3WP3A 3SITA 3H3UA 2AYHA 2WWSA 3H1MA 1VIWB 2G9GA 4Q2FA 3ILRA 1QJX3 1QQP3 1EV12 1NCQB 2HWC1 2IXHA 4Q4Y1 1N1YA 3VHPA 2AGSA 2GC1A 3VL8A 1C8M2 1D4M1 4EN9B 5A3LA 3D8CA 4H7MA 1WLCA 1REDA 1NYWA 1VAVA 1WD4A 2XJSA 3JD71 4AFBA 3T2TA 2P37A 4YG6A 3FUQA 1YFYA 2VNOA 4XYXA 1J59A 1WMFA 1H2LA 2R0FA 5C4WB 5KHHA 2GMEA 2D3SA 1SCSA 2QDNA 2VQAA 1LESA 5BNOB 2AUYA 1AX0A 4XF0A 3AKQA 4WVMB 2ZHMA 2FHRA 4KH9A 4XIKA 1OOPA 2DTYA 2RMU2 4KG0A 2BUKA 1GNZA 4W6XA 1UPIA 4N9HA 5JCTA 1AL21 3CLPA 3ST7A 3POYA 2ZGUA 5CVRA 1DGLA 3B02A 3ZXGA 5CFDC 4ZKTB 4FOQA 4YGCA 4CDWA 1JYCA 2A70A 1XE8A 4FPFA 5F5QA 1VB4A 1K5MB 3KCCA 1CPMA 3DF0A 1NQDA 2D6NA 3LOBA 1DQ1A 1VRH3 3DN7A 2XL9A 2IXJA 1MQTC 1BYHA 5BNPA 4AG4A 4PBPA 1V6MA 4GKXA 4BYYA 3WW3A 2R071 4FPEA 5BV6A 3A0NA 4I0AA 1JHNA 5L73A 4AI0A 5I8SA 2VVFA 2FBEA 1OSGA 2VW0A 3FX3A 4L11A 1KQRA 4QPIB 1IS5A 4KBBA 4AEDB 4XF3A 1H8TC 3WDVA 4XFHA 5T5PA 1RJ7A 5BNNB 4YM0A 2BYVE 3ZXEA 1SLTA 2XWJB 3N7KA 4QPIA 3BOPA 3CJIC 2VPVA 5JOZA 1IPKA 1DYKA 1QJY1 2EVXA 4JC1A 1S2KA 2O0OA 3C3VA 2SBAA 2B45X 4YM1A 4Q4V2 1R1ZA 3P3PA 4S2GA 4RGGA 2ET1A 2A6ZA 1DQ4A 1LU1A 4B7EA 2VGDA 3CNAA 1CX4A 5JIAA 1WMDA 4JTOA 1JYIA 3MI8A 4HSJA 2D7FA 3E6BA 1HRI1 5KHGA 2B9UA 2VOXA 1XYPA 1ENQA 1NG0A 3AP5A 3ZFGA 4QPGA 1Q8OA 1MVEA 2ZAHA 4YGEA 2E53A 1QMJA 3S0MA 4GQ7A 1D4M2 4Y1VA 1QOOA 5FPZA 1PVC2 1HRI2 2P34A 4LO5B 1AJKA 4OHWA 4QQHA 2ZHLA 4HK8A 4IEOA 4I3GA 3IDBB 4XHBA 3VDDC 1V70A 5JPNB 1XQNA 5ACA3 4AEMA 3A4UA 2V73A 1HQWA 2H6BA 5BNQA 1V00A 2O8OA 4JGZC 4BOWA 2D6PA 2ARBA 1YI7A 1RUJ2 3M8LA 1OPMA 3E6CC 1LECA 5LRSA 2FMDA 4RL7A 1ZZ6A 4FPHA 1BBT2 4HN0A 5T5JA 2JE7A 4IV1B 4AHZA 2XBO3 2WSUA 2GC2A 3NAPA 5CFCB 4HPKA 4Q26A 3VBRA 4HLTA 4QT6A 2WFF2 1APNA 4DS0A 2E63A 4XQDA 4K8FA 1BMV2 1HIXA 2VY0A 3J4UH 3MW4A 4OHZA 3OCPA 1H2KA 3ZXFA 4IEXA 2GH8A 4UBGA 1AR71 5E16A 1HKDA 5ABJC 1LGNA 4XFGA 2WNVB 4A2UA 2D98A 1B35B 4BZ4A 1MEC3 5T55A 3UKNA 3FJSA 3I4IA 1LGCA 1RUE2 4X8NA 5I0RA 2P3KA 3GHMA 2AR6A 4R9DA 2DWRA 4DY3A 3HAGA 5ACA1 2HWF2 4XMAA 1VR3A 3SISA 3MF6A 4OFGA 1GKBA 3QD6A 4TYSA 1VBB1 3LA2A 4CDXC 2PAKA 3D4KA 2TBVA 5J98B 2VOWA 2YYOA 2HWD1 1GR3A 1SBDA 2XGXA 3DUIA 3M7AA 2WLQA 3TNPB 5GZCA 3HQXA 4WM8A 4XIOA 1AL0G 1AYM3 2Y26A 1AX1A 1CN1A 3AFKA 1N1SA 4P9YA 4YFWA 1Y3TA 5CG9A 1O5LA 1ZBE3 3RJ2X 4JDOA 1VBE2 1LB2A 4OUSA 5DDJ1 1H9PA 1MR5A 3ZVXA 3PVBB 1WUVA 1Z7S3 2BFUS 5C6CA 1EAH3 1CESA 2LALA 1JOJA 4Q29A 1OA4A 1C28A 1FMD1 1GNHA 2X5IC 4FPLA 4N53A 1DZRA 4YRDA 1DIWA 1RUF1 2VG9A 2TNFA 3HMYA 1X82A 5E8AA 3LWCA 2VNRA 2K9ZA 4FPGA 1MEC1 3RZZA 1AR93 3WZ1A 5LK7B 4I01A 4H7LA 5ABJA 1RVF2 5B2GB 1XE7A 1SFYA 3UK9A 3MIGA 4XJ8A 2ZZJA 3ZX7A 1CAUA 3IN9A 4HKOA 5A32B 4Q1PA 1Y7BA 2ZA9A 4Q4V3 1EV13 3ILNA 2E6VA 3EO6A 1WLDA 1AXKA 2XJUA 4K21A 1I1EA 1C8M3 5KWRA 1ZYBA 2E7TA 4EN6B 5KHIA 1ND2C 2PAMA 4D7TA 4AEKA 4XJUA 3MYXA 2DCYA 2ATFA 5E1RA 1NZCA 3KZ4C 2YHJA 4FPKA 1V9U3 1Y9QA 2BNOA 2PLV1 2UWCA 1UIJA 2JKBA 3LSDA 2B8MA 3WD5A 4MGIE 3GALA 4GWNA 2ZAAA 4I02A 4N53B 2CNAA 5T52A 4OULA 3B9IA 1RUG2 3W58A 3V0BA 5T5OA 1COV2 4AE2A 2OZJA 4WVWA 1HXS3 1D4M3 4UW5A 1QHDA 4Q1RA 1VBC1 1A3KA 1RMU2 2R6QA 4QMAA 5SV5A 1PO12 3V56A 3AMNA 3DPRC 2QVSB 1SDWA 2A73B 1BBT3 4AHYA 4CDQB 2VECA 4LBQB 5FPXA 3ZFEC