4D3WA

Crystal structure of epithelial adhesin 1 a domain (epa1a) from candida glabrata in complex with the t-antigen (galb1-3galnac)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
226
Chain Sequence
SKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 1
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata cbs 138
total genus 55
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d3wA00
4LHLA 4LHKA 4CP1A 5A3LA 4AI3A 4AHXA 4CP0A 2XJVA 4ASLA 4COVA 4AFBA 4AHZA 4AI2A 4AI1A 5A3MA 4GQ7A 2XJRA 4CP2A 4AF9A 4LHNA 2XJUA 4AFAA 4AI0A 4COZA 4COUA 4AHYA 4AFCA 4AHWA 4D3WA 2XJQA 2XJPA 4COYA 4A3XA 2XJSA 4COWA 2XJTA
chains in the Genus database with same CATH superfamily
2IXHA 4TN7A 2GN3A 3VD4A 5JVVA 1H2NA 5F3GA 3VBUC 1YFXA 4XILA 4UF0A 3FJSA 4LO6B 4DEQA 2P6HA 3IKWA 3WP4A 2DURA 1V9U1 3J8F1 1D4M2 1RUF2 1B35A 4CUGA 2W95A 2PA7A 4UW4A 1P8JA 5J09A 4ATFA 1SHWB 3H0OA 2LM3A 2VL4A 5A7WB 3ZN5A 3ZMNA 3B3QE 1TZOA 2WNUC 2QZ3A 2VZ1A 1K42A 3WDYA 4OHYA 2AREA 5FMDA 4V2WA 1A8MA 1LOBA 1NLSA 1UY3A 4MZUA 1RMU2 1YRZA 2YGMA 3MIGA 4P9GA 3MDPA 2GAUA 2P17A 5FDBA 5HCAA 4ZU5A 4EN0A 3KF5A 4PCRA 5D21A 2A6XA 2DUOA 5FP9A 2E7QA 4AG4A 1NA1B 4QQOA 5I8YA 4ASKA 2Z79A 3M3EA 4AEJA 2G9ZA 1BLZA 3WNOA 3OYWA 3NQHA 4IEQA 4ASMB 4FTEA 5CG9A 4I01A 2FQPA 4B4RA 4Q4V3 1MEC1 3ROUA 1AR73 2EAKA 2OPWA 2VCAA 3OUHA 1EP0A 3L9JT 4M4RA 4XQDA 2VD7A 2Q0AA 1OURA 2OA2A 5A3UA 1MR5A 2XBO2 2A1XA 4H7MA 4BQ5A 2KD7A 4CXWA 4UWDA 5T5JA 4Y4YA 4JVAA 4MV2A 4E4DX 1ZYBA 4GWMA 4P00B 1ZREA 4BMEA 2EIDA 1J58A 1ENQA 2B4KA 5I8SA 1JHJA 5CFCC 4XUOA 1PVC2 3CJIA 3J26N 1UO9A 5EJ3A 4W6XA 1ZBA3 4OHXA 2VR4A 2RDRA 1UX6A 2I07B 3ATGA 4CCCA 4WVWA 4YWAA 1VALA 1LGCA 2J1TA 2VZOA 3ZIXA 2FD8A 2YV8A 2J22A 3UL2A 3CO2A 1PM7A 1WCDJ 2ZGQA 3N9QA 1XYPA 2RE9A 4LULA 1AHSA 1DQ2A 2WC2A 3PNAA 4QKNA 1JUIA 2X8KA 1W9FA 3LEMA 3SCHA 4YM3A 1RUC1 2VW2A 3OBAA 3RZHA 1G9CA 5I0RA 1VBE2 3H7YA 5A7WA 2IXCA 1LHUA 2ARCA 1CESA 3POYA 3RZZA 5FR3A 1XSQA 3J7HA 5FY0A 3SKVA 4XFBA 1GUIA 1KEXA 3JUUA 4NVPA 1VBD1 2MHFA 5H9QA 4CTEA 4E8CA 3SEPA 3KQRA 2BZDA 3ZFFA 2A7AA 4CEYA 1A3KA 3W58A 4CSWA 1NA1A 1GNHA 2HWE2 3I8TA 3MICA 4B4QA 2GU9A 1EAH3 2FDHA 2JB8A 2JX9A 4P5YA 4Z8BA 1WLWA 2DCZA 3KV4A 3PVNA 3E5QA 1GFF2 4ZONA 2P2KA 2Y8KA 4RHV3 1K5JA 1NKGA 1VRH1 1WA6X 3N3HA 3R4UA 4NE9A 4LKEA 5AVPA 1D2SA 3C7FA 4BXSV 2BNMA 2UURA 3K3OA 4KBZA 5SV5A 4COYA 4ZKTB 2HWD1 3E5XA 5APAA 2ARAA 5K9YA 1ND2A 1FV3A 4Y5SA 1HKDA 2JWPA 3GF6A 3GZEA 2VZVA 4UFLA 1W6PB 4F7ZA 4WVZA 3T09A 5FOJB 4J25A 1JHNA 3OG2A 4ARYA 1AR62 5I8TA 3C7HA 2YYOA 2H6BA 5A3MA 1UU6A 2J1AA 1YJKA 1G7YA 3U11A 1NZIA 2Z42A 4URTA 4FOWA 4FP2A 5JOYA 3WX5A 2DTWA 5FUNA 4AOCA 1QJU1 3VBOC 4XBNA 5B4NA 4Q4X2 2AEYA 3K46A 4XC9A 1LODA 3BB6A 4ATEA 4GWJA 4BLIA 5GLUA 4D3WA 5FOBB 1D2QA 4D6SA 3T2OA 1DLLA 1F5FA 2ARXA 5FBJA 4RR3C 3OD4A 3ILRA 4DXRA 2DF7A 2XJSA 3K4ZA 3EBRA 3HBKA 1MS9A 2CY6A 4LLOA 4FPHA 4JAAA 3ITQA 3PMEA 5FZ9A 1ND3B 4DRVA 4BXFA 3ZO0B 4LE3A 5JXHA 1APNA 2E53A 2R041 2WINB 5FZDA 3FHAA 3TN93 2Y6KA 3VGIA 5KHHA 1ZBE3 4BK5A 2E33A 4COZA 3PVBB 1YXWA 1A6CA 1Y4WA 2JDAA 2ZAHA 1H4GA 3PVOA 1POQA 1MS5A 1N47A 5IW0A 5EXOA 1WW4A 4DPNA 1KFUL 2XJPA 4P9LA 3ZYGA 1ASJ3 1H2MA 4Q4V1 5JPMB 2D43A 1AR71 3D8CA 3T0AA 3SH3A 1NXMA 1T6BX 5FLHA 2QQLA 5BNPC 1W6PA 2LS6A 4NMIA 5LY2A 1X7NA 4RGKA 2ZOEB 5GZFA 4Q4Y3 5FYVA 3USUB 5BYNA 1OOPB 2XL7A 1WGPA 1POV3 4XF4A 1QH6A 2WAAA 1N1YA 1AR92 1ZBA1 1YQ5A 2BVVA 2QVSB 1FATA 2VMHA 5FY1A 5FZOA 3NAPC 4FTSA 4CCNA 2TNFA 1D7PM 3DXUA 3VDDC 1XU1A 4PIYA 2VJXA 2D6NA 2C4XA 2JECA 3LIGA 3WDVA 1YQ2A 3WQBA 1Z7S3 2KR2A 3M3CA 3FUQA 1QJFA 1UOJA 4FFFA 5DXDA 5LB6A 4C1WA 1C3HA 4QX8A 3UKTA 4MHRA 4LO8A 3KSCA 5FY9A 4OYUA 1ND3A 2XG3A 2J1UA 3BYWA 3O1VA 1HRV1 1CPNA 2JXAA 5A1FA 4FFIA 1EAH2 1RXGA 2GMPA 5HXVA 2Z4FA 2GNMA 4AI0A 4CCKA 1PNGA 4M01A 2C0ZA 4OZXA 3WP6A 4RHV2 3SITA 4OHVA 1LEDA 5HXMA 5JXIA 1SMVA 1A8DA 3HD8B 2XVLA 2Q8DA 1NCQB 2BWAA 2WUHA 2GSYA 2DUQA 1H8TC 1CONA 1VJ2A 1H30A 2E7TA 1V6JA 3KZ4C 2D6LX 4FPGA 4WV8A 5CFDB 2W1UA 4EWEA 2GN7A 4ZHNA 4XQWA 1LCLA 3I2OA 3WDUA 4KG0A 2P6CA 5CU1A 4ZZ5A 1QDOA 1WW5A 1UU5A 2DU1A 4YRDA 3ST7A 1REFA 5C3OA 1SBEA 2WT2A 3P3PA 1OOPA 1OLRA 3QACA 4FXKB 4L92A 3ZMOA 2RMU2 1QY4A 5C5TA 4J1WA 2KA3A 1CJDA 4CDQA 3SXWA 4QDSA 3TBDA 3FLRA 3ZYHA 5FP4A 2A3YA 5A7PA 4AFDA 4M3CE 4NRMA 2YG0A 4J1XA 1DQ6A 3N9OA 3OGGA 5A32B 3WW3A 4IEYA 2Q30A 1LHVA 3HOBA 4A45A 4QQPA 2GC1A 3I3DA 1VPHA 1YI7A 1WUVA 3O7OA 5GKAC 1W9SA 2YC4A 2ZA9A 5FZHA 4O9EA 1S0FA 4E9KA 3I97A 2EA7A 4D7YA 2F4LA 2O14A 1QJY2 3WDXA 5IK5A 1RVF2 5JWPA 4A7KA 2JB4A 3TN92 4FTBA 5DG2A 1ZBE2 2W47A 1Q8QA 3VKOA 1AUYA 5HV4A 2VW1A 3RYRA 3ZFGC 3FHQA 1O59A 3JZVA 4L8QA 1X9TA 1S2EA 3RG0A 3ZX7A 4CDXA 1ZNPA 1YWKA 2RS53 4YM1A 1ASJ2 1MACA 4A3XA 1AXKA 3GZUC 1RUG1 4K9SA 3BODA 4JGYC 5J3UA 5D8AB 4QX7A 1RL3A 4KU8A 3VBHB 1RINA 2B5HA 1I5ZA 4YGEA 3WF1A 1GYKA 1MS4A 4OHZA 2OKXA 4U2AA 1VAMA 4HVQA 3B69A 3HNMA 4H7LA 2JD4A 4Q4Y2 5GZEA 1MQTA 4PHZA 4JQRA 3FLTA 5I93A 3ENRA 1CX4A 2D6MA 4R9DA 3GALA 4I3PA 4YVSB 5FZLA 2AR6A 4MOAA 1CIYA 1SBDA 3ILFA 3VDCA 1K5MB 3Q9OA 5ACA3 5DUUA 1WCUA 4XUNA 4R4ZA 5GZCA 2WQZC 3I54A 3SKJE 3PUIA 5A32A 2SLIA 1FPN1 1PK6C 1NY72 4EJRA 2PFWA 5FZGA 1X8EA 1Z7S1 1CZTA 4Z2AA 5JZGB 1E5HA 3GXUA 3ON7A 2RM22 3C8XA 3VBUA 2ZX4A 1E57A 2TEPA 4SLIA 4ITCA 3DUIA 4AQ6A 4X6QB 2BFUS 4YPJA 5A3TA 3EMRA 2FCTA 4NRQA 1ULDA 2JG9B 1RUI2 3IDAA 4IEXA 1RHI2 1B09A 3RYKA 3O12A 4DRRA 4KI5M 1YQ8A 2QZ2A 4D6QA 3BPSA 1CAVB 1CAWB 2W9XA 2ZGKA 1POV0 1W8NA 1F4HA 1OKOA 3OUJA 4LBNA 4PIXA 4P14A 5L7OA 5DPNA 2XLAA 5IFTA 5LA9A 3N7LA 2ADEA 2EF6A 2G9FA 4IE0A 3WDTA 5D8AA 2DCTA 2D40A 2QTWB 1TG7A 1UWWA 4FPCA 4PLOA 4AHZA 3EO6A 3WHUA 1QOSA 2WS92 4Q0VA 1W9YA 5FP8A 5HCFA 4XE9A 2ZGUA 5KBFA 5JIUA 2HWF2 3CJXA 2ZX0A 2JDPA 4YVSA 5FY7A 5IK7A 3AZYA 4MADA 4QDQA 3SC7X 1VIWB 2ZMNA 2XKPA 2AGSA 4KG8A 2ARBA 1R081 2D3PA 1F5JA 4KNCA 4LA2A 1UMZA 3FBYA 4E2GA 1LHNA 4NAOA 4UFHA 3A0NA 1IPKA 1YLLA 5F2SA 4AQSA 3BTYA 1AYN2 1YEWA 4N9IA 3OY8A 3AB0A 4C91A 2XHNA 1ULOA 2OZJA 3B7MA 3H3ZA 2RS32 3J4UH 3PUAA 4G9SB 3WG3A 3U75A 3S0MA 1SLBA 2WDBA 3EB7A 4Z2WA 1RUE2 5KXDA 3LOIA 2RJ2A 1I3HA 2YZ4A 3D4KA 4YGBA 1A78A 5JZGA 4OI0A 3RRDA 1N1TA 4K1ZA 2XJUA 1OT5A 2EIGA 2R1DA 1LHOA 2A5ZA 2PHFA 4OULA 3ACFA 3Q8BA 4GJYA 3ZPOA 3OTFA 5FP7A 3ZSKA 4KMQA 1UN1A 2JG9A 5FUPA 4DY3A 1X82A 2E26A 1T6GC 4LQRA 3NV4A 5FYCA 4PJYA 1CAVA 3HBZA 1CAWA 1KS4A 1N1VA 5JXGA 1O8PA 4NROA 4NO4A 3WF3A 3WUCA 4CP0A 1HDKA 4DS0A 5H9RA 1OH4A 1XC6A 2RS11 1JYCA 5A80A 4HN0A 2Y6LA 3ELNA 5LA2A 3E6CC 3ACLA 3GNEA 3R4DB 4M3CB 4Z07A 5CKMA 2Y26A 4UOJA 3CKHA 4NOTA 2HWB2 4AEDB 1W90A 2YBPA 4UW5A 3DGTA 4CDUC 1UZYA 3D0SA 5ACA2 1F4AA 2RDNA 1IS5A 2VZUA 4QU2A 2J1RA 3WNXA 4AK3A 2WSUA 2W52A 1O4YA 1JI6A 3FWEA 1SBFA 2PHDA 4ZXKA 1VBC3 1GWLA 5A1AA 4K3UA 1DYOA 4MXVA 5D1IA 1UY2A 1DGWX 2ZX2A 3T1MA 4AW7A 3WNMA 4CU7A 2MEV3 4NIDA 1W6OB 3O1OA 1V6MA 1OVSA 2CNAA 2ZGPA 4HN1A 4CU9A 2BEOA 2HEWF 1NG0A 2Q1ZB 2EIEA 4A41A 3DPRA 4MX3A 3E5UA 1TVGA 1VB4A 2P3KA 3KS7A 1PX4A 2HWC1 4Y1YA 2C26A 2ZGMA 3PTYA 1J1TA 3WR0A 1ZZ8A 3AMHA 1NLRA 2JG8C 5BV6A 4Y1XA 4OHWA 3W21A 4FOVA 3WINE 2AUYA 3IMMA 2TBVA 2UY8A 3MFAA 5C5UA 4EZHA 1IQAA 1N3OA 4CPBD 1XJAA 3LKJA 4ZY9A 3D6EA 3JD73 1LEMA 5LY1A 2VG9A 1FXZA 4RR3A 4NN0A 4N90A 4OVEA 4O7XA 3OD0A 1I5PA 2B42B 4YVWC 1PO22 4COVA 1W05A 3PMSA 4IV3B 4TWTA 3WNPA 1LOGA 2DBNA 1JYXA 1OC1A 3PURA 5FZ3A 3AFGA 5JLVA 1O3QA 5FK8A 3VBFC 3T0BA 4QU1A 2OUHA 2WFF3 4Q1PA 4Y1UA 4B1MA 2D7FA 2PQSA 5F6KA 3CZUA 4M3CA 4LBQB 2E9QA 4QQ2A 5LEKA 2YB7A 5CBLA 2PELA 5DAVA 2GH2A 1HJGA 2WZR3 4AEDA 1QXJA 1VBB2 4J6GA 1GZWB 3ACIA 5DUXA 5T55A 4PLNA 4JV4A 4W4ZA 1GV9A 2Y34A 3CBNA 4PQQA 4D7TA 2ZGLA 2VPVA 5JAXA 4UFKA 3K75B 3TNPB 1REEA 3A22A 3DL3A 1DHKB 2F6BA 4OCTA 4KBBA 1YNAA 1RTVA 3E97A 1BK0A 3ZPYA 2BU9A 5C3PA 5JOZA 3PHMA 3K4AA 4HXCA 4IQPA 3RSJA 3ZYJB 4OUEA 4XMIA 4ZZ8A 1CN1A 4BQXA 1RGSA 3C7EA 3E6BA 1CQ9A 2R061 4IV1B 2VZTA 1JU4A 2WO2A 3D5OA 4XUPA 3WEZA 2FCUA 3NKGA 1H1IA 1PO12 3NNLA 4WZFA 3SCGA 3VBRC 4CCJA 1OA4A 2VOWA 2VOTA 5AVAA 4MGTA 5LWBA 3AZZA 1GNYA 4XHXA 1YQ6A 4KQ7A 4HETA 2D6PA 3BIEA 4LBQD 1PZ8A 1ULCA 1RMU3 1IHMA 1KDKA 3T2TA 2YFZA 1U12A 5FZEA 1FMD1 1HB2A 2WO3A 1NAEA 4FXGB 2D98A 2EICA 2VGDA 1EV11 2WO7A 4LEJA 2VE1A 2VZ3A 5K0UC 3NJYA 2XJRA 1WMXA 3P6BA 1C8NA 4IV3A 2HBUA 2V73A 1GQPA 2XQXA 2ZPXA 4RN5A 5HBAA 1QXRA 1VB2A 1NCRC 4Y22B 3HNBM 2ZEZA 4MHUA 2OPKA 4CUCA 1IG3A 4FPJA 1OF3A 4N53C 1MZEA 2JDHA 2UU8A 2XBO3 1PIV1 2WNEA 2LALA 2XVKA 3IMNA 4K1YA 3IIAA 4XZPA 2ZZQA 4GB32 1FOD2 5H9PA 3VZKA 4BQ2A 4FPOB 1U5XA 4CDWB 1GZWA 4IDZA 2VCMA 4QX5A 4RFT0 1L7QA 3WP5A 1C5IA 2MEV2 4XFGA 2XJVA 3AP5A 1K3IA 1RUJ2 2WA3A 1LU2A 2XR4A 1VMFA 4UFJA 2BDRA 1VBC1 3AKQA 4WM7B 4AFBA 1YIPA 5C3QA 2PHXA 2VU9A 4HL0A 3CLPA 1B35B 4LOTA 4QD2A 2W2IA 4QHOA 5FZAA 3VZJA 1R1A2 3OBRA 4QMAA 1ULGA 1J83A 5BNNB 5DABA 4IV1A 1LAJA 3IDEA 4LJHA 4Y26A 4WVVA 3DYOA 4QPIB 1WW7A 3VL8A 1JOPA 2WYFA 3H50A 2CAUA 1QU0A 3JCIA 1ZRIA 4H55A 4NIIA 1RJ7A 1VBE3 1EUUA 2DCYA 4D7SA 1UW8A 5FY4A 4QXBA 4JKMA 4CEWC 1W03A 1GNZA 4Z1VA 4BLJA 3ZN6B 2IXIA 4TXWA 4A6OA 4MH0E 5JXJA 2G9GA 2PXJA 4ISRA 4IEOA 5BNOC 3V65A 4FQZA 2XUEA 3WVJA 4EV0A 1GZTA 2H0BA 3JD71 4H2AA 1AYM1 1AXZA 2CV6A 1NOVA 5LBBA 4GH4B 1V6KA 3IN9A 1R091 1S1AA 3OYWB 4IEVA 3P5BA 4DUWA 2E6VA 4P9XA 5JSRA 1S0CA 2HWE3 5C4WA 1JZ2A 1G9AA 2Y33A 4I30A 4HLTA 1YQCA 4KGQA 3T2QA 4Y22A 3U14A 1ODNA 4AHWA 5FPUA 5J37A 4QKFA 4D69A 1N1SA 3USSA 2K9ZA 4EWAA 1DU3D 5FO8B 1HXS3 3ALQA 4FP3A 2DVFA 2JJ6A 3ECQA 4QGNA 1WMDA 2WQ4A 2VBPA 5CKQA 4ZPIA 3RNSA 3BTZA 4E27A 1O5LA 1ULEA 2HH9A 3CJIB 4IE6A 1W9WA 1WMEA 4JGYA 4P5HA 3ZR6A 4CDWA 5CFDC 5FO9B 1GZ9A 2BOIA 1AR83 5FYIA 1YCIA 3T3YA 3M8LA 2HEYF 1AR63 1YO8A 3WSOA 5FV3A 2PLV1 3M3IA 1JYIA 3GJAA 4WVMB 2WWSA 3OGSA 2WA4A 4W6WA 4WM7A 5LW9A 4MG2A 1HRI2 5FZ0A 4XJAA 1LJ7A 2R073 1BVVA 4BA6A 1ULPA 5FZIA 1US2A 3VD7A 1LENA 3WLUA 5BNNA 4Q4X3 2YPDA 2IVJA 3AXEA 1AL21 2B7YA 3OCPA 4IEUA 4UFIA 2XMLA 3ACHA 3FZ3A 4QPIA 3U1XA 5GZDA 1D4M1 2D6OX 3INAA 4DIQA 2OT7A 1RUF1 3JBG1 1R64A 2X53S 5E6HA 1V9U2 5T5LA 5C9AC 3WT3A 4XW3A 4IGPA 3KLSA 2CYFA 5DDJ3 2QNKA 3POIA 4W8JA 3NNJA 1GICA 3ZN6A 3KQ4B 3ZFFB 4CEYB 3V56A 2VMEA 1QH7A 1S0EA 1RMU1 5EIYB 2HLEA 1BBT2 4RS5B 1FT9A 5IK8A 4GH4A 3CQOA 4HSJA 4FQ4A 1SLAA 3TWIA 4HK9A 1CAUB 1DLCA 2A6WA 4FO9A 4JTNA 2GH8A 2VH9A 5FYMA 4LO7A 1YFWA 1UIKA 3MLLA 4XAAA 2BW8A 1X8MA 2EXKA 4OI4A 4YNIA 1UZWA 2QQPA 2AYHA 1DF0A 2QQVA 3IIIA 1ND2B 3RWNA 2ERFA 2VTXA 1IKPA 4LHSA 2WN3A 1IPJA 3GZAA 5E89A 4QPWA 2VOXA 1W8TA 2VOVA 3POEA 2J7MA 3ZN4A 1YJLA 2DFBA 2QQJA 1LU1A 1DP0A 2VECA 3OEBA 4W50A 4AVSA 3GBGA 2ZTNA 1LGBA 2G19A 2VNVA 3ZKUA 3AYAA 1QNWA 3LDKA 4CA9A 1FV2A 4LR4A 5KC6A 1PVC1 3B9IA 4WVMA 5HV0A 2NM1A 1AR93 5KR7A 1WCSA 2YFUA 2ZX1A 3CZJA 4DXZA 3AJYA 4Q0UA 3THDA 1LRHA 3VD5A 1RB8G 2UWAA 3NKTA 5FXVA 2PAMA 5FYHA 3T4HB 3OJBA 1WBFA 2XOMA 5FMOS 3PLQA 1W8UA 3HN1A 4XDPA 1C5HA 2E31A 1ALYA 2JD9A 2QQUA 4BE3A 3OUIA 2QDRA 1BEV1 4BM8A 4INDA 1VBE1 4KWKA 1TME1 4CCOA 2K0GA 1Q43A 3AKPA 1RUC2 4AI1A 1CZVA 1AJKA 4XFFA 4AXOA 2P34A 3HT2A 1IOAA 2G1MA 2ZBJA 1Q8SA 5LRRA 2OXBA 1KQRA 2B9UA 1DG6A 2ORZA 4RS5A 4RQPB 4YW1A 3V64A 3KB5A 1X50A 2AACA 3NJXA 3THCA 1X36A 1CAUA 4XFHA 1DZQA 3KMHA 2PYTA 3I2KA 1V0AA 4BH9A 1HXS2 3BTXA 3RJ2X 4WM8B 5KHJA 3MW3A 2ZS6B 4YYOA 1UNBA 1KITA 4XDOA 1QOOA 1W8FA 3TEZA 3BI3A 1MPXA 4AI3A 2VCCA 2WL1A 2NLRA 1PMHX 4LK6A 4MSVA 1AR82 1UIJA 4XHBA 5IFPA 4HKWA 5DZFA 4P9YA 1HB1A 3M7AA 4LKFA 4MYEA 5FKBA 4MO3M 4A7YA 2JKXA 4M00A 1OQDA 2FCVA 3DXTA 4MGIE 1RUH2 3LZZA 5J98B 5A7OA 1IPSA 5FZOB 4DXSA 3SEEA 1JN2P 2FDJA 2R072 2W91A 1AR61 4AHYA 1WLDA 2RMU3 2QQWA 2V4VA 4QPGA 4DY5A 2J1EA 1IGOA 1WZXA 1ONAA 4E4ZA 3NW4A 3DECA 4HOOA 4ISQA 2Y60A 4Q5OA 1RUD2 4RFRB 3LEGA 1ZRCA 2WLQA 1OH3A 3WF4A 2VTXJ 4TYSA 1CJPA 4Q4X1 3SCFA 4XJ9A 2Q1FA 3AZXA 4IETA 5DDJ2 3ES1A 3JU9A 4X8PA 4C8DA 1IKQA 2JDUA 3ZSEA 4KWJA 3I59B 2X09A 4N43C 4AVVA 3IB3A 5FZCA 5JSPA 1H0BA 4Z92B 4X6RB 1QJY3 4N9HA 1Y3TA 3AMPA 1RVF3 2B39A 3ILNA 4XFIA 1GOFA 4BYYA 4N7IA 4RQPA 2JG8A 1UYPA 1AJOA 1T2XA 1GU3A 3PDQA 4NIAA 1EUTA 1QJX3 1WLCA 4HSLA 5JUVA 3DEMA 2GC2A 1G9DA 2QDNA 4V2VA 1LOEA 1OD3A 2L9LA 2QUOA 1O4ZA 4WM8A 2C6SA 2Y0IA 1W2UA 3H1MA 3NV2A 2VBBA 2OYZA 4F8AA 5T3NA 3VBSC 5ABJB 2WNVC 4BJ0A 3I2HA 2DVGA 3DCQA 2BJSA 2VXRA 1WA4A 2Y6JA 4YM0A 3L2YA 4GQ7A 1S55A 5AFBA 5LATA 3BVCA 5FJKA 5CADA 4KGGA 2YGLA 3WQ7A 4R9CA 3LCPA 3NJZA 1OFSA 1DQ5A 3THPA 4CDQB 2VAUA 2X5IC 3TEWA 1V6LA 3S7IA 2VZSA 1GZCA 5EJZB 4LXLA 3AL6A 1AR91 3APBA 3LEKA 1UY1A 5LK5A 4R8HA 4FPEA 4UFMA 5IVYA 4XF1A 4E4HA 4CP1A 5FLIA 5I0SA 2CWSA 1UOGA 5LK7B 2ORXA 4W65A 4JGZB 1NXD1 1NT0A 2ZGOA 3D82A 4NHXA 3UKVA 4DZGA 1MZ5A 5SV8A 2BV4A 3RZKA 5T50A 3DN7A 5FXZA 4K21A 3I59A 1KGYA 2RM23 4L9BA 1WKYA 1PGW2 3N9PA 5DUWA 2AZ5A 4ES9A 2QJVA 4HZFA 3WDWA 4NPMA 3OOXA 3WG2A 1RUI3 3C7OA 3UGHA 1RHI3 3M3OA 5F37A 4CDXB 1W2OA 5IVJA 1GQHA 2I74A 2H0VA 4QGLA 4GWIA 2CL2A 3NNFA 4OI2A 1EAH1 1V70A 1SDDB 3EYPA 1CVNA 4P9JA 5FZ4A 3ZFEB 3O1TA 5G05L 2NP0A 3GYDA 1JOBA 1G86A 1ZA7A 2ENRA 5KHGA 3J7LA 2IFWA 2D93A 4RHV1 1M06G 4ASLA 1G6NA 1DQ0A 3IWZA 3ZXGA 1VMHA 2YROA 2VMIA 5ABJA 3R05A 1MQTB 1C4RA 1DZTA 3I2JA 4AL9A 4YZ2A 4XUQA 2BQPA 2WS93 5FZFA 4R52A 3HWJA 1COV2 1RYYA 2GNDA 4XXPA 1O4TA 4L0PA 4RD7A 4JKLA 4YARA 3WW1A 2HWF3 2WZEA 4Q0SA 4D94A 2P3IA 3H8XA 1HN0A 4RSUA 3LB9A 2PTMA 1MVEA 4JQTA 1NE4A 4XBLA 1YUDA 3ZYRA 3LDBA 5A33A 1QHDA 3BIWE 1AYN3 2RMU1 2OQ7A 4D0QA 3CU7A 2EXIA 1HQNA 3HNYM 5B2GB 1S0IA 2ZX3A 3LFIA 2RS33 1OLQA 2YXSA 3BU0A 3SH4A 3VBUB 1W2AX 1RUE3 2LTNA 4Y20A 1ZVFA 1US3A 3WG4A 4JGZA 3AZWA 5EYYA 3VZOA 5HI0A 2BNOA 3LOBA 1TQ5A 3LIHA 3WUDA 3WG1A 4PDWA 3ZVXA 3UT0A 3K77A 4UXAA 2Q8CA 3MW4A 3VZMA 3I3MA 1JU3A 3RMXA 4AVCA 5C70A 2WNUB 1X9PA 5T52A 1QJX2 1I6XA 3MF6A 3TN91 3CL1A 3O1SA 5L7OB 1GP5A 1ZBE1 1V6OA 3BTAA 2N7GA 1C28A 4K8FA 4CZSA 4ZXEA 1W28A 4NJ4A 5A7QA 4XCAA 5GLTA 3ZFEA 3L2HA 4LKSA 4XYXA 5FO7B 3URFA 3WV6A 4CP9B 5DMYA 1ASJ1 1UMHA 1YHFA 2TUNA 1Y7BA 5FZ8A 4GIQA 4RYDA 3MGUA 4Y1ZA 1XYOA 5JOWA 1UD1A 1RUG2 3DYPA 4LO4B 4XFCA 1GWKA 2VUJA 2ZEWA 5IJRA 1MZFA 2RDSA 4UAPA 2HEVF 2HWB3 4QM8A 2PHLA 3UJOA 4ZU7A 4Q4Y1 1H9WA 3KM5A 1F8VA 5FUIA 3SLIA 1POV1 3OY8B 3LQCA 4AR2A 4NAMA 1JZ6A 5CFCB 4NIGA 2OQ6A 4LHKA 4XJUA 2W1SA 4CE8A 4XAEA 5IHRA 4H3WA 4RGAA 1Q8PA 2J1SA 4MGKE 1UKRA 2HBTA 2WQ8A 2P3YA 4LE4A 4RGGA 4B3NA 5ANQA 1B35C 2OW4A 4BOWA 3GHMA 3KT7A 1DIWA 4QPYA 4CUBA 4NPLA 4EN7B 1NY71 3AVSA 4QDRA 4META 5FXXA 1UCXA 2NYYA 5I0UA 3GDBA 2H6CA 1XNAA 4A3ZA 3GGLA 1YC61 3VD3A 2XLGA 3KF3A 4GJZA 4MGYE 3NV1A 4GZ9A 1NLQA 3ZR5A 1VAKA 1YIFA 2VMGA 4QB6A 2WNUA 1S2KA 1HX6A 1U5YA 3MIHA 5GALA 1F35A 3KVAA 4JDNA 2DTYA 2YU2A 4K6BA 5IVFA 3PJQA 1PO23 1ZRDA 3VL9A 2QQOA 1SPPA 1RXFA 2B45X 3U37A 4CP9A 4GALA 4P02B 4LHNA 3O1RA 4Q27A 1UU4A 1C57A 3N7KA 1PGSA 1BQPA 1K45A 1W8OA 1HQLA 2VC9A 3Q8FA 4JCKA 3IDBB 3J7NA 2WS91 4UYBA 5H9SA 2BP6A 2VZRA 1NQJA 3AKRA 4QXKA 3MIEA 1VBB3 3UJQA 3WXPA 5IK4A 5KXBA 4XOGA 4YLZA 5C8CC 3IBMA 4D8MA 3CJIC 1MS1A 1WBLA 2HWF1 4LOSA 1BMV2 1VBA2 4KU7A 2Y6GA 1TE1B 4FPLA 5FPLA 5CFCA 3O1UA 2DWRA 4AI9A 1JZ8A 1S2BA 3DPRB 3CEWA 3H3LA 3ZM8A 1C1LA 2CHHA 4CCEA 3M4FA 1R082 4DEVA 3ZOIA 1DQ4A 4JDMA 2ET7A 4PF1A 4U36A 3NMBA 2QQMA 3BU7A 1PM4A 4YW4A 1XNKA 4EZ4A 4FVVA 3IDCB 3VBOB 1HQWA 2ZGSA 4LPLA 1PO13 1QQP3 4GD4A 2VVFA 2E32A 4QKBA 5DUVA 2UYAA 3GHNA 5F7UA 2UYBA 4C1XA 3ACGA 4A4AA 4RR3B 2RR12 3W5MA 2WWUA 2D3SA 4M0HA 2QQIA 3CMGA 2BOJA 1QGLA 1WMFA 4HVOA 4YZ1A 1QJZA 3ZFFC 4CEYC 5FTTC 5C33A 1CAXB 1KJLA 1NA1C 1YI9A 2RS51 5FZBA 3I3EA 4P9IA 1UPSA 3WF0A 1LGNA 1OKQA 3MPBA 4MXWA 3RQ0A 4UW3A 2AC1A 4XJWA 3VLBB 2V5YA 1Y9MA 3ZYBA 2NMNA 2GNBA 4O9GA 4X8NA 2XHKA 2CAVA 5IWFA 5LZ6A 1KXGA 5A6QA 4EROA 1HB3A 2Y64A 1H9PA 1CR7A 5GLZA 2ZHLA 2WN2A 1ND2C 4GB33 1A34A 1FOD3 4TSVA 2QCSB 2J1VA 2C1FA 1SFPA 2FDGA 2Y0OA 4QX0A 5ACA1 1S0JA 5IAVA 3MLJA 4A6SA 4AZZA 1RUJ3 4I0WB 5EQUA 3W5NA 4NWWA 1FAYA 1OVPA 4LBMA 1TMF2 3MIDA 3R0RA 1KS5A 4HONA 1SFYA 2A3WA 1BJQA 1R1A3 2WBKA 2JDNA 3N9MA 3NSTA 5AFEA 1S0GA 3H8OA 1HV0A 4BZ4A 3NAPB 2I2SA 5J48A 3T4VA 3I7DA 4XFAA 3VDDB 3VBOA 5KWRA 2DVBA 3PJYA 1ZX5A 5FYSA 1JZ3A 3B94A 4XF3A 4EN6B 4XETA 5G04L 3HIFA 4IERA 4MGZE 5FFOC 1GANA 4BIFA 2HWC2 5A3LA 4DINB 1O7FA 1VMJA 2EIBA 4FBFA 3V0BA 5B4XA 3N9LA 3KV9A 1CD3G 4QKDA 1OHFA 1CAXA 1G8WA 3LDRA 1QNYA 4HKLA 2ZZJA 3MEPA 1IS4A 3AMQA 1LOCA 1W6NA 3M3QA 1PO21 5F9TA 4BQWA 3PVEA 4QXCA 4AVAA 1JXNA 1LOFC 2D6KA 2VZQA 2WJSA 3DF0A 3HVDA 3Q8EA 5A7SA 4OI1A 5LA1A 3ZKYA 2ZEXA 3N7JA 4IE5A 4XTMA 4S2FA 1H8TB 3ZIWA 5FPXA 3BPZA 5FMCA 1W99A 2VBDA 3O5SA 3E1F1 1UQXA 3G6JB 5BNPA 3I3BA 2FDIA 5FPBA 1AX2A 1PMIA 3ZDVA 3U10A 3MUY1 1J59A 2KXLA 5AC93 2GMMA 1XPWA 1HRI3 4GWNA 2ZHNA 1QWRA 2V72A 4YW3A 2R49A 2LRPA 1QQP2 1PNFA 2ILMA 4OLLA 3VZLA 3NAPA 2WRAA 4OMCA 2C5DA 1VAVA 2R0HA 4G4FA 1LULA 2DCKA 3VDDA 3AMNA 4YSFA 3VD9A 3KGLA 3HN3A 5JDBA 4E8DA 3EQEA 3HJRA 4I0AA 5EZWA 2XQRA 4LLFA 1PO11 2A6VA 2R062 4QHZA 1V9U3 3RGBA 2WO1A 1PMJX 3LD8A 3H9AA 1ND3C 2W46A 2CWMA 1TEIA 1VP6A 4QQLA 3N36A 1S0BA 3BOWA 4E2QA 4URAA 1I1EA 3MYXA 4OQ8A 4KWUA 3OEAA 5DZEA 3LGRA 5C4WB 1BBT3 1D0GA 2WFPA 3U4SA 2VNRA 4XIKA 3AXDA 3EXUA 3LPFA 4EN9B 2JDZA 1H4HA 1UX7A 5CB7A 5CAZA 1LNSA 5CNAA 3UGGA 4LNVA 1FMD2 1ODMA 1EV12 3MIFA 2HJIA 4JGYB 2X10A 3ZLIA 1BZWA 4QB2A 4YG0A 4AAPA 1EPWA 1QMJA 1H8TA 5E16A 3NNMA 4AI8A 1KDMA 2X29A 5DAWA 3K51A 3NRUA 3UESA 2EXJA 1UY0A 4HANA 1D0HA 3NVCA 2VXJA 1G9FA 1WCKA 2VULA 1WD3A 2Q4SA 3N35A 4CP2A 2LW8A 1OOPC 3D0JA 5FPAA 2MEV1 2PHWA 4JX0A 4KWLA 1XE8A 1VRBA 3H42B 1RUJ1 1QKQA 2P37A 4QAWA 2YDEA 3KCCA 3WQ1A 5JMOA 5BNQA 1KFXL 3EJKA 1HW5A 1MS3A 2Z5WA 1C8M2 1U5ZA 1UKGA 3B02A 4QQHA 3O1MA 1F15A 1OUXA 1JH5A 2O8QA 3M1HA 2X05A 2WT0A 1ZA4A 3OGRA 1O3SA 2PMWB 3TB0A 3BOPA 3JB8A 4LHLA 1CGPA 4CCDA 4M4PA 1FNZA 1H1AA 2NQYA 1PK6B 3KVBA 3MIBA 5FYZA 4K7JA 2QFEA 3OGJA 1SG3A 1RJ8A 1DFQA 4YZ3A 4EE2A 4HT1T 4XACA 1RUC3 3Q8CA 4XF9A 2ZJCA 5T5PA 3RI8A 2Y6HA 2ZKNA 4AF9A 2IWGB 4AVTA 5KXCA 5FZ6A 3O1PA 4XCBA 2WZPP 1GSLA 1SLLA 1QEXA 1MVQA 3RFRA 4CDXC 3B00A 2EALA 1QDCA 1DDLA 3ES4A 1VBD3 2XJQA 4HBNA 5BXXA 2ATFA 2XUMA 1AYM2 4JHZA 2WFF1 4HPKB 4XABA 4Q4W2 3ZFGA 5CG8A 2A6YA 3AX4A 5ISLA 1R092 1OFNA 1NCQC 1SLCA 2IVIB 2W08A 4UT5A 4UBGA 5E8AA 3PUQA 5FK7A 4IUGA 4IEWA 4K8RB 1FI2A 5A7NA 3K48A 2QQNA 4R4XA 5KHKA 2E7AA 2WZR1 3KV5A 5IUQA 4AGGA 3S7EA 1K12A 1AL0G 5EFUA 4XQ4A 4HVRA 3QCWA 5AC92 1RUH3 2HWD3 2A3XA 3DKQA 1W39A 3VKFC 3HQRA 5A70A 3U0ZA 4BWOA 3RZMA 1V6NA 1PGL2 5GLVA 2BYVE 3I2FA 1REDA 1RUD3 3U07A 3VKLA 3GZTB 3HMYA 2ADDA 2VUAA 2Y38A 2VQ0A 3ZXFA 1FNYA 4TZDA 3ZXAC 3J8F2 1UF2C 2VNOA 1XE7A 3IT8A 1DGWA 4NHYA 4N7UA 5F5CA 1URXA 5FAXA 1QJU3 4Y24A 1PVXA 2EXHA 2JE8A 1PK6A 1E5RA 4PLMA 1LESA 1H8VA 3ZXJA 1AL22 1OXCA 2YPJA 4Q8KA 5A6XA 1F31A 2WABA 1JMUB 3I2IA 4XJZA 2YC0A 1UOBA 3BALA 1QF3A 3JBG2 3ZXEA 2W1QA 2PHRA 3SISA 4QGMA 3IAQA 5JIAA 4Q2FA 1Q8VA 1NYWA 2VMFA 2FMDA 1W8WA 3A23A 3DKWA 4YG3A 5F1RA 1BBT1 3BN6A 5JPNB 3T0DA 2CTVA 1OA2A 2VTFA 5L7OC 1VR3A 3K3NA 3KT1A 3VDAA 2R043 3FE5A 4HPKA 5D8AC 4BQYA 2A73B 3K2OA 1W0OA 3VBHC 1JS9A 5GZGA 2XBO1 1L7RA 3I3QA 1MEC2 5I91A 5J36A 5K4LA 4FT8A 2XWJB 3OPTA 5FYTA 2ZACA 3POGA 4FAGA 3IM0A 5LA0A 2PHUA 1N3PA 2JDYA 1OSGA 4GKYA 5GM0A 3AKTA 1U5IA 5F5IA 3AL5A 4YVSC 2RHPA 2W87A 4QPGB 2OIIA 2OUJA 3M70A 4YFWA 1K5MC 4CUAA 2JICA 4SBVA 2YMZA 2W94A 2WIIB 3UK9A 4I0BA 2DVAA 4CDUB 4LKDA 5F6LB 3FBMA 5EV7A 1UAIA 3QD6A 4LORA 5IATA 4BQ4A 3WNNA 3HAGA 5C8CA 5FIXA 2G4IA 1S4CA 2WT1A 2ZKLA 5HPOA 2GNTA 1UXZA 3AFKA 3RZLA 1JZ5A 2WNOA 5FBZA 3KV6A 4XZUG 5C3RA 1MZ6A 5JZGC 2Z69A 3S5AA 4LK7A 1FYUA 3POBA 3RYPA 1GBGA 3T2PA 3A21A 3BGAA 1TNFA 1SCRA 1LECA 1AX0A 2R6QA 4JRLA 3NNGA 2JG8B 1JODA 2JG9C 4XIOA 5FYUA 5BPXA 5LBEA 3THTA 5F5AA 1H2KA 1HB4A 4BQ3A 1BEV2 2FMYA 1VBD2 4UI9L 4MVTA 1TME2 1UYYA 3TRSB 4YZ5A 2HWE1 1BYHA 1DYKA 4COWA 4R9BA 5CVRA 3R4SA 2BTVC 1HRV3 4JDOA 2ZAAA 3LFMA 1OPOA 2F4PA 2VZPA 4PBOA 3W59A 3BKZA 4YVWB 1HXS1 3P1IA 5E88A 3PTRB 1XYNA 1UL9A 1HLCA 4E2SA 4QM9A 3F2ZA 4CU8A 2BERA 3AYDA 4M3CF 1VRH2 5JR7B 3GBWA 3VBFB 2XONA 4HFSA 3ETQA 2BRTA 3FMGA 3HEIA 1COV3 1LR5A 2HWD2 1Q5OA 3WW2A 4C90A 1STMA 1AR81 5A3PA 3AP6A 4S2HA 3ZYPA 4FOYA 4L11A 2FDKA 2W3JA 5FZ1A 3CF6E 1RUH1 4CDUA 3NWKA 1DZRA 2ZABA 3FHIB 2R071 2W5FA 4XMAA 2A75A 3WY6A 4CXXA 1JZ7A 4OQ9A 4LT5A 1RUD1 4OUSA 1QJU2 1XB9A 3H7JA 1IZ3A 2W0XA 3DPRC 2GC3A 1F9KA 3NV3A 5J96B 1XQNA 2YUEA 3F95A 3JXSA 4IL7A 5EJ1B 4QX1A 1Q3EA 3WQ0A 1HIXA 5FRAA 1H6YA 2VQTA 3AMMA 5DDJ1 3WOGA 4YFZA 2KM2A 3WW4A 3EHKA 2VVDA 5E1RA 3VBRB 4XF0A 4Y4RA 2OX0A 4DOUA 4GULA 4PF5A 4QWNA 4CYDA 1LHWA 4AYUA 2GALA 3WCSA 2BGOA 3UKNA 3W20A 2W39A 1Z78A 4YM2A 3ZXKA 4XXAA 4LTAA 3O0WA 2R042 2YHJA 3LF7A 4YW2A 2DUPA 1PZ9A 4JTOA 2WWJA 2R1BA 1KRIA 4AVBA 4Q0PA 4C0BA 1V6IA 5F3EA 2UWCA 5A6YA 5EHDA 1YYNA 2AENA 2ZHKA 5FMBA 1XRUA 2Q8OA 4YVWA 5K0UB 1AF9A 2W1WA 3H8RA 3T30A 4TLFA 3AP4A 3POJA 5FJHA 4L97A 1NCRB 4Q4V2 1RUG3 1GOHA 4FPYA 5DAQA 1AR72 3VBFA 1OI6A 3JB4C 3ME2A 4MUVA 2B9VA 1UZVA 5T54A 3FC0A 3MF9A 4MGQA 4AEDC 1F2NA 3AM2A 1W9TA 3WZ1A 4B4PA 1WCQA 1L3JA 4N53B 1ZZ7A 1W8ZA 1LOFA 4YW7A 1SCSA 3AC0A 1JOJA 2YU1A 5A33B 3PU8A 1XSRA 5L9VA 2VUDA 1ZZ6A 3GCXA 3QOPA 2R0FA 1J3RA 1D4VB 2CGNA 2QQKA 4FOQA 3H1YA 2A6ZA 3J7MA 4XDQA 1W6MB 1ZBA2 2VW0A 3MW2A 4LBJA 5J7MA 4Y20B 1JW6A 4FAHA 3A4UA 3KWVA 2IUWA 5FPZA 1YFUA 1RC6A 3TOJA 5IVBA 5C8WA 2BFUL 5I0DA 4PDWB 3SH5A 3U4XA 3V0AB 5CIRA 2CGPA 1OMIA 3M2MA 3VV1A 1UMIA 4B8EA 2WZ8A 2Q1MA 4Q0QA 1IQDC 1FPN3 4I09A 1PGW1 3VBRA 2HYKA 1S0DA 2XXZA 4R9AA 1NZCA 4AQTA 3PUSA 4DFSA 3KHCA 2XH6A 1ENXA 4CEWB 1UXXX 4ET7A 4B7KA 1DQ1A 5FP3A 2GC0A 4NHKA 1HRV2 4I02A 4YW6A 2DU0A 4JZRA 3H3UA 5LBFA 5L9BA 5BNOB 5BY5A 1HJFA 1N3QA 1O6UA 4D6RA 4IV3C 4Y3OA 2K2SA 4I2OA 1SLIA 3VHRA 5F3IA 3BUCA 2VNGA 5GJ6A 1QIQA 3MV01 5FWJA 1NQDA 1JYNA 5K0UA 2ET1A 2V4AA 4L99A 2XLFA 3S30A 5IVEA 5FQ0B 3PIJA 1NCRA 1L7LA 2IFRA 3OBZA 3TYJA 2FDFA 3POWA 4AEMA 1SFNA 4FFGA 4OZOA 4Q26A 3UV9A 5HCBA 3RJRA 1COV1 2YC2A 4N53A 1ZZ9A 4WBBA 5C71A 3QH7A 1IS6A 2CDOA 3SNMA 2CSGA 2JDKA 2WR9A 1VBA3 1DGRN 2BBAA 4UW6A 3UGFA 3OPWA 3KT4A 3LE0A 4AHXA 1EY2A 2OVUA 3AKSA 4CRQA 4LUMA 1JBCA 5EP9A 1W6MA 3VDBA 5D2AA 2GZWA 3ZSJA 4PI2A 1R083 4IV1C 3USUA 1EPZA 4NUBA 2XB6C 2WSVA 2D3RA 3IPVB 4LBKA 2O1QA 1HN1A 3V0AA 1DGLA 1GP4A 1W0NA 3JQXA 1OPMA 2CGOA 2YBSA 3RWKX 2Q5TA 5BUVA 1NUKA 2B8MA 4G3YC 1E5IA 1QJY1 1W04A 2RV9A 1NE6A 1RVF1 2JEMA 2RR13 4S2GA 3WHTA 1LOAA 3UYJA 4CVUA 4AAXA 3RS6A 3B93A 4XUTA 5C9AB 1GKBA 1UYZA 4CEWA 3CNAA 3WF2A 1ZRRA 2JENA 4UBHA 1ZZCA 1QJX1 1SPPB 5F2WA 1OLME 4FFHA 2DV9A 1ZM1A 3MI8A 4GAZA 4OFGA 4P9WA 5BNOA 1CX1A 5C4WC 4Y1VA 3NJVA 2FBEA 3ORJA 4N8MA 3SQOA 4PQ9A 2Z2SB 4BU2A 4BK4A 3QBQA 2HKXA 2JE9A 2YY1A 3I4IA 4YGDA 4S2DA 2B46X 1V00A 5DAXA 3FN9A 5FQ0A 2NN8A 1W06A 2FZ2A 2RS13 3ASIA 1W6QB 4PI0A 3LWCA 3OPZA 3O0VA 4Q1RA 2P4EA 4JHTA 3ZXDA 3OGVA 2XVGA 4CDWC 1NCQA 2BVBA 5KC5A 1BK1A 1I9RA 1OF4A 1UYXA 4IE7A 3S5QA 4FSJA 5M0TA 1GP6A 1GMMA 5CFDA 2NZ9A 2VMDA 2QKDA 4WM7C 2JKBA 2RJLA 1EYBA 3VHPA 4DQAA 3I49A 3MBWA 1TMF3 3SHRA 2EAAA 4IGOA 5BNNC 3C2UA 3AVRA 4F3JA 2A71A 4WZCA 4QPIC 2IXJA 5A6ZA 3IPVA 1FPN2 2VCBA 4CXYA 1SDWA 4CCMA 1KD7A 2RM21 2FHRA 5J1XA 1LB2A 1Z7S2 3MV11 3WCRA 4A44A 3KCYA 4ARXA 1H6XA 2R32A 5JI7A 5FKCA 2HWC3 3D3AA 1RUI1 3KHBA 1RHI1 1TNRA 5C9AA 5A3WA 5F8PA 2IXLA 1MS0A 2WLPA 3AP9A 3LSEA 4MXWB 3T1LA 3C7GA 4GH4C 1O91A 3OB8A 2GP3A 1W2TA 5GLWA 1KJRA 3MHZA 2ZCWA 2MNGA 1O3TA 4DB5A 4LIUA 4IW3A 5IAXA 4FPFA 2D97A 4AGRA 2O0OA 3VN4A 2J42A 1AXYA 4DNYA 2WYSA 1H1MA 1W6QA 4O65A 3RPQA 1RITA 3VHOA 1M4WA 4YZ4A 4FPKA 1QOTA 1LTEA 1PZ7A 2PAKA 3G7DA 4OMDA 4A42A 5A3OA 3VBHA 4GKXA 1NX9A 2OS2A 2R16A 2P1BA 4XJ8A 3WD5A 5JR2A 1BMV1 3N9NA 1AYN1 4PBPA 1VBA1 4DXTA 5DZGA 1SZBA 2VQAA 3NO8A 3CDZB 4IEPA 2UWBA 2VMCA 3OBTA 2RS31 1J84A 2ZGTA 4H14A 5CYYA 3TNQA 2P5BA 4AFCA 1RUE1 4ZS2A 5DG1A 1K5MA 2NMOA 3FUOA 4PT6A 4BHPA 2LUWA 1W0PA 4LBLA 1YFYA 1H2LA 1BHGA 4M0NA 4NWVA 1OUSA 2C24A 2ES3A 5FY8A 4E4SA 4V1PA 5DAPA 5LRSA 1BCXA 2HYXA 2R063 2BGPA 1W2NA 3V0BB 4EQVA 3P3NA 2OZ6A 1ENRA 2AEZA 2MPFA 3LA3A 3N7MA 5FZMA 2PQQA 3AYEA 1IG0A 4N43B 2BUKA 4AE2A 3FFQA 2V5DA 2RR11 3FFZA 1JUHA 1DYPA 1W6NB 3NL1A 4GMP3 4RS5C 4RL7A 5FZKA 3S57A 3SMHA 5A1LA 4Q29A 4LMFA 4CU6A 5FPVA 1RIRA 2DFCA 4MLOA 1QJEA 1VE0A 1SLTA 4IXLA 1XNBA 5LCWL 4QX2A 3R6SA 2BPA2 3RI9A 1FMD3 3C3VA 4QT6A 2RS52 1Q8OA 2RS12 1WD4A 1EV13 3T08A 4I3GA 1J3QA 5K7PA 3ABZA 1ST8A 2XJTA 2DCJA 2AH2A 3DV8A 2HWB1 3GBFA 3O14A 5T5OA 2Y6FA 1JYVA 3VBSB 1VLNA 2WNVB 5C3SA 1FX5A 4DUXA 2RJKA 4IEZA 4QXHA 5BNPB 3A7QA 3UETA 1XNTA 1RUNA 1PIV3 4HKOA 4AGVA 4AEKA 3AZVA 2BGCA 3RMYA 4LIVA 4O61A 2JIJA 4ORFA 2XWBB 4QPGC 4YG6A 3RZJA 1GR3A 5C6CA 2X5IB 4OUMA 5L9RA 3MLKA 2R7EB 3UNPA 5CISA 4Y33A 1XBFA 2A70A 1TMF1 1C8M3 5CA6A 1IS3A 3MZHA 3HQXA 2XKOA 4F83A 3QH6A 4BQ1A 1OQEA 3U78A 2K46A 3I2DA 1R1ZA 5F3CA 4MGSA 3JQWA 4K20A 2W68A 5FXWA 4AWDA 2GP5A 2XL9A 4IE4A 2VM9A 4KL1A 1GOGA 4N43A 2DBIA 3VUOA 4BCUA 2XPJA 4RQPC 1GWMA 2QBXA 2VO5A 4HK8A 4ZS3A 4YGCA 4LUKA 3N4MA 4K40A 2YBKA 5FCCA 3B9CA 1G9BA 3ZYIB 2QE3A 2PAEA 3ZXLA 1C1FA 3VZNA 3FX3A 3PU3A 1U0AA 2W92A 1UY4A 3CHXA 3FLPA 1Y9GA 4LA3A 5CEHA 1AYM3 4WM8C 4FCAA 4Q4W3 4QHBA 3BCWA 3AJZA 3MO4A 1R093 3LA7A 5DN2A 1ZZBA 1PHMA 2ZXQA 3WNKA 3H1WA 5FY5A 5F5QA 4DMIA 4BMBA 4HG6B 4NHMA 4AFMA 3POSA 4BPZA 5F39A 1VBB1 3VBSA 2WNVA 3ZDSA 2CDPA 2ETEA 3POFA 1Y43B 5IVCA 4DUVA 2ZEYA 3E6DA 3A0KA 5LEJA 1SACA 3MPPG 1XNCA 2SBAA 1Z0HA 4IESA 4BISA 4CPBA 4JKKA 5DQ0A 1AVBA 1XU2A 1CIWA 3J9SA 5CZKA 1ENSA 5FZ7A 5I0TA 3S6PA 3RZGA 1PGL1 3O0XA 1WLTA 1W3XA 1XOYA 5FYBA 4EN8B 2LROA 2X5IA 4NIHA 2PLV3 5FYYA 2VQUA 2ZGNA 1OLMA 3CIHA 4XTPA 2PN5A 2ZGRA 1CPMA 1QQP1 3HT1A 3J8F3 2ZMKA 5K8SA 5KXEA 1ACCA 1W6OA 4GXLA 4IGQA 3ZSMA 1W8HA 1QXPA 3Q8AA 4Y5Z0 5EPAA 1AL23 2XGXA 5JCTA 3LPGA 3IAPA 2BBVA 1D4M3 2E51A 2ID4A 2R30A 4CCLA 1RUF3 2WAOA 5IYYA 4JC1A 1UZ0A 3JBG3 4XEZA 5JSOA 1CWPA 3WNLA 5EYXA 4COUA 2PHTA 1O8SA 4Z82A 5EWSA 1BXHA 3LEIA 3AYCA 4GMP1 3PIGA 2VY0A 4Y5TA 3ZFGB 1OD5A 4BB3A 1JYTA 3TEXA 5FLJA 3VHNA 5CKNA 3KGZA 5LBCA 5L73A 5JI9A 3WP3A 4XVHA 5TSWA 1OA3A 4A2UA 1OBNA 2VVEA 4W6YA 4DO0A 1XE0A 5ABJC 3RVHA 1MEC3 4NR1A 3AP7A 1CZSA 4GB31 3VB9A 1FOD1 4AI2A 2O8OA 1AX1A 1JZ4A 3GJBA 3H8UA 1BKZA 2DVDA 4JRAA 1PIV2 1UOFA 2Q8EA 3ZSLA 3IZOA 3KD4A 4A7ZA 3FL7A 2EVXA 1JTZX 2E63A 2RG4A 4CDQC 4QB1A 1PX3A 3TEYA 3OSDA 2ZMLA 3W9AA 5IVVA 1J3PA 4LBQA 4NHLA 4B1LA 1Y9QA 3K4DA 1W3VA 2JE7A 4EYUA 2CU5A 4P08A 2IZWA 1VBC2 4GMP0 1R1A1 5FMOL 4ONUA 4TTGA 4KH9A 4GA9A 4NPRA 5L19A 3HPNA 1GLHA 1PVC3 4C0HA 1E5SA 2I45A 2V09A 2XDVA 2JDMA 2D5HA 2DDUA 1C8M1 2C9AA 2WKKA 4JGZC 4Q8LA 4UF0B 5JOXA 4XPVA 1MS8A 1X33A 5HCHA 4QX3A 3LSDA 3QLQA 1UPIA 1SEFA 2D44A 2UY9A 4L2NA 5LASA 4PDWC 2IC1A 3B5LB 4HMZA 4RA0A 1ULFA 1DGRA 3HQUA 4AFAA 3LAGA 4B7EA 1OQ1A 3B01A 4BDVB 5F32A 1JYWA 3OF1A 3KCXA 4BIOA 2DYCA 3PUHA 1BEV3 2D5FA 2C9KA 4EWDA 4LBOA 1TME3 3JD72 4XBQA 4ES8A 1O5UA 5L36A 2BWCA 3I2GA 3X29B 3ZFEC 3LA2A 3AK0A 3GM8A 2RVAA 2NPIA 2GMEA 1DBNA 3PL0A 1ZRFA 2JIGA 4TLGA 4PIZA 2VOKA 5ERLA 1RUOA 2ZHMA 3DYMA 4NRPA 4Q4W1 5KHIA 3HR9A 1Q56A 1GQGA 4FI9A 2FZ1A 1MQTC 2BNNA 3MFCA 4XURA 1WW6A 4YW5A 1BVP1 4LITA 1VRH3 4AQ2A 2WFF2 3GCWA 2VUCA 3TAYA 5ANNA 5A3NA 3VKNA 1HV1A 1UZZA 2IXKA 1DCSA 1J1LA 1AZDA 3MUZ1 3RDIA 1WWYA 4LO5B 3VKMA 2F17A 5C7GA 1SQ4A 5FREA 5FWEA 4B29A 1O3RA 2WZR2 5IT6A 2GDFA 2RDQA 4ZU4A 1XNDA 5AC91 1LKNA 3ETPA 1HRI1 5C8CB 2PLV2 3ZYFA 5JMCA 1XXNA 2P3JA
chains in the Genus database with same CATH topology
2IXHA 2GN3A 5JVVA 1H2NA 3VBUC 1YFXA 4XILA 3FJSA 4LO6B 3IKWA 3WP4A 2DURA 1V9U1 3J8F1 1D4M2 1RUF2 1B35A 4UW4A 2PA7A 5J09A 4ATFA 3H0OA 2LM3A 3ZN5A 3ZMNA 3B3QE 2WNUC 2QZ3A 3WDYA 2AREA 1A8MA 1LOBA 1NLSA 4MZUA 1RMU2 1YRZA 2YGMA 3MIGA 4P9GA 3MDPA 2GAUA 2P17A 5FDBA 5HCAA 4ZU5A 4EN0A 4PCRA 2A6XA 2DUOA 2E7QA 4AG4A 1NA1B 4QQOA 5I8YA 2Z79A 3M3EA 4AEJA 3OYWA 4IEQA 4ASMB 4FTEA 5CG9A 4I01A 2FQPA 4B4RA 4Q4V3 1MEC1 3ROUA 1AR73 2EAKA 1EP0A 3L9JT 4XQDA 2Q0AA 2OA2A 1MR5A 2XBO2 4H7MA 5T5JA 4Y4YA 4JVAA 4MV2A 1ZYBA 4GWMA 1ZREA 4BMEA 1ENQA 1J58A 5CFCC 5I8SA 1PVC2 3CJIA 3J26N 5EJ3A 4W6XA 1ZBA3 4OHXA 3ATGA 1UX6A 2I07B 4WVWA 1VALA 1LGCA 3ZIXA 2YV8A 3UL2A 3CO2A 1PM7A 1WCDJ 2ZGQA 1XYPA 2RE9A 4LULA 1AHSA 1DQ2A 2WC2A 3PNAA 1JUIA 2X8KA 3SCHA 4YM3A 1RUC1 2VW2A 1G9CA 5I0RA 1VBE2 3H7YA 2IXCA 1LHUA 1CESA 3POYA 3RZZA 4XFBA 3JUUA 4NVPA 1VBD1 2MHFA 5H9QA 4CTEA 3KQRA 3ZFFA 4CEYA 2A7AA 1A3KA 3W58A 1NA1A 1GNHA 2HWE2 3I8TA 3MICA 4B4QA 2GU9A 1EAH3 2JX9A 4Z8BA 1WLWA 2DCZA 3PVNA 3E5QA 1GFF2 2P2KA 4RHV3 1VRH1 3N3HA 3R4UA 4D7TA 5AVPA 4F8AA 1D2SA 4COYA 2BNMA 2UURA 5SV5A 4ZKTB 2HWD1 3E5XA 5K9YA 1ND2A 1FV3A 1HKDA 3GF6A 1W6PB 4F7ZA 4WVZA 5FOJB 1JHNA 1AR62 5I8TA 2YYOA 2H6BA 5A3MA 1UU6A 1YJKA 1G7YA 3U11A 2Z42A 4URTA 4FOWA 4FP2A 5JOYA 3WX5A 2DTWA 1QJU1 3VBOC 4XBNA 4Q4X2 4BLIA 1LODA 3BB6A 4ATEA 4D3WA 5GLUA 5FOBB 1D2QA 1DLLA 1F5FA 2ARXA 4RR3C 3OD4A 3ILRA 2DF7A 2XJSA 3EBRA 1MS9A 2CY6A 4LLOA 4FPHA 4JAAA 3PMEA 1ND3B 4DRVA 3ZO0B 4LE3A 1APNA 2E53A 2R041 2WINB 3TN93 3VGIA 5KHHA 1ZBE3 4COZA 3PVBB 1YXWA 1A6CA 2ZAHA 1H4GA 3PVOA 1MS5A 1N47A 5EXOA 1WW4A 4DPNA 1KFUL 2XJPA 4P9LA 3ZYGA 1ASJ3 1H2MA 4Q4V1 5JPMB 2D43A 1AR71 3D8CA 3SH3A 1NXMA 5FLHA 5BNPC 1W6PA 1X7NA 5GZFA 2ZOEB 4Q4Y3 3USUB 5BYNA 1OOPB 2XL7A 1WGPA 1POV3 4XF4A 1QH6A 1N1YA 1AR92 1ZBA1 2BVVA 2QVSB 1FATA 2VMHA 4FTSA 3NAPC 2TNFA 3VDDC 1XU1A 4PIYA 2D6NA 2JECA 3WDVA 1Z7S3 3M3CA 3FUQA 5DXDA 4C1WA 1C3HA 3UKTA 4LO8A 3KSCA 1ND3A 2XG3A 1HRV1 1CPNA 2JXAA 1EAH2 2GMPA 4AI0A 5HXVA 2GNMA 1PNGA 4M01A 2C0ZA 4OZXA 3WP6A 4RHV2 3SITA 4OHVA 1LEDA 1SMVA 1A8DA 3HD8B 2XVLA 1NCQB 2BWAA 2GSYA 2DUQA 2E7TA 1H8TC 1CONA 1H30A 1VJ2A 1V6JA 3KZ4C 2D6LX 4FPGA 4WV8A 5CFDB 4EWEA 2GN7A 4XQWA 1LCLA 3WDUA 4KG0A 5CU1A 1QDOA 1WW5A 1UU5A 2DU1A 4YRDA 3ST7A 1REFA 1SBEA 2WT2A 3P3PA 1OOPA 1OLRA 3QACA 4FXKB 4L92A 3ZMOA 2RMU2 1QY4A 4J1WA 2KA3A 1CJDA 4CDQA 3SXWA 3TBDA 3FLRA 4AFDA 2A3YA 4M3CE 4J1XA 1DQ6A 3OGGA 5A32B 3WW3A 4IEYA 2Q30A 1LHVA 4QQPA 2GC1A 1YI7A 1WUVA 3O7OA 5GKAC 2ZA9A 4O9EA 1S0FA 4E9KA 2EA7A 4D7YA 1QJY2 3WDXA 5IK5A 1RVF2 5JWPA 4A7KA 3TN92 4FTBA 5DG2A 1ZBE2 1Q8QA 3VKOA 1AUYA 2VW1A 3RYRA 3ZFGC 3JZVA 4L8QA 3RG0A 4CDXA 3ZX7A 1ZNPA 1YWKA 2RS53 4YM1A 1ASJ2 1MACA 4A3XA 1AXKA 3GZUC 1RUG1 4K9SA 3BODA 4JGYC 5J3UA 5D8AB 1RL3A 4KU8A 3VBHB 1RINA 2B5HA 1I5ZA 4YGEA 1GYKA 1MS4A 4OHZA 4U2AA 1VAMA 4HVQA 3B69A 4H7LA 2JD4A 4Q4Y2 5GZEA 1MQTA 4JQRA 3FLTA 5I93A 3ENRA 1CX4A 2D6MA 4R9DA 3GALA 4I3PA 4YVSB 2AR6A 1SBDA 3ILFA 1K5MB 3Q9OA 5ACA3 5DUUA 4R4ZA 5GZCA 2WQZC 3I54A 5A32A 2SLIA 1FPN1 1PK6C 1NY72 4EJRA 2PFWA 1X8EA 1Z7S1 5JZGB 2RM22 3VBUA 2ZX4A 1E57A 2TEPA 4SLIA 4ITCA 3DUIA 4AQ6A 4X6QB 2BFUS 1ULDA 2JG9B 1RUI2 4IEXA 1RHI2 1B09A 3RYKA 3O12A 4DRRA 2QZ2A 1CAVB 1CAWB 2ZGKA 1POV0 4LBNA 4PIXA 4P14A 5L7OA 2XLAA 3N7LA 2EF6A 2G9FA 3WDTA 5D8AA 2DCTA 2D40A 4FPCA 4PLOA 4AHZA 3EO6A 3WHUA 1QOSA 2WS92 4Q0VA 5HCFA 4XE9A 2ZGUA 5KBFA 5JIUA 2HWF2 3CJXA 2ZX0A 4YVSA 5IK7A 3AZYA 1VIWB 2ZMNA 2XKPA 2AGSA 4KG8A 2ARBA 1R081 2D3PA 1F5JA 4KNCA 4LA2A 1UMZA 3FBYA 4E2GA 1LHNA 4AQSA 3A0NA 1IPKA 1YLLA 1AYN2 4N9IA 3OY8A 3AB0A 4C91A 2OZJA 3H3ZA 3B7MA 3J4UH 2RS32 4G9SB 3WG3A 3S0MA 1SLBA 4Z2WA 5KXDA 1RUE2 3LOIA 1I3HA 2YZ4A 3D4KA 4YGBA 1A78A 5JZGA 4OI0A 3RRDA 1N1TA 4K1ZA 2XJUA 2R1DA 2EIGA 1LHOA 2A5ZA 2PHFA 4OULA 3OTFA 3ZSKA 1UN1A 2JG9A 4DY3A 1X82A 1T6GC 3NV4A 4PJYA 1CAVA 3HBZA 1CAWA 1KS4A 1N1VA 4NO4A 3WUCA 4CP0A 1HDKA 4DS0A 5H9RA 2RS11 1JYCA 4HN0A 3ELNA 3E6CC 3ACLA 3GNEA 3R4DB 4M3CB 4Z07A 2Y26A 4NOTA 2HWB2 4AEDB 4UW5A 3DGTA 4CDUC 1UZYA 3D0SA 5ACA2 1IS5A 4QU2A 3WNXA 4AK3A 2WSUA 2W52A 1O4YA 3FWEA 1SBFA 2PHDA 4ZXKA 1VBC3 4K3UA 5D1IA 4MXVA 3T1MA 1DGWX 2ZX2A 4AW7A 2MEV3 1W6OB 1V6MA 2CNAA 2ZGPA 4HN1A 2BEOA 2HEWF 1NG0A 2Q1ZB 3DPRA 4MX3A 3E5UA 1VB4A 2P3KA 3KS7A 2HWC1 4Y1YA 2ZGMA 3PTYA 1J1TA 3WR0A 1ZZ8A 3AMHA 1NLRA 2JG8C 5BV6A 4Y1XA 4OHWA 3WINE 4FOVA 2AUYA 2TBVA 2UY8A 3MFAA 1IQAA 1N3OA 3LKJA 3D6EA 3JD73 1LEMA 2VG9A 1FXZA 4RR3A 4NN0A 4N90A 4OVEA 3OD0A 2B42B 4YVWC 1PO22 4COVA 3PMSA 4IV3B 4TWTA 1LOGA 3AFGA 5JLVA 1O3QA 3VBFC 2OUHA 2WFF3 4Q1PA 4Y1UA 2D7FA 5F6KA 4M3CA 4LBQB 2E9QA 4QQ2A 5LEKA 5CBLA 2PELA 2GH2A 2WZR3 4AEDA 1QXJA 1VBB2 4J6GA 1GZWB 5DUXA 5T55A 4PLNA 4JV4A 1GV9A 2ZGLA 2VPVA 5JAXA 3TNPB 1REEA 3DL3A 1DHKB 2F6BA 4KBBA 1YNAA 1RTVA 3E97A 3ZPYA 5JOZA 3PHMA 4IQPA 3RSJA 1PGL2 3ZYJB 4XMIA 1CN1A 1RGSA 3E6BA 1CQ9A 2R061 4IV1B 3D5OA 3NKGA 1H1IA 1PO12 4WZFA 3SCGA 3VBRC 1OA4A 2VOWA 5AVAA 3AZZA 4XHXA 4KQ7A 4HETA 2D6PA 4LBQD 1PZ8A 1ULCA 1RMU3 1IHMA 1KDKA 3T2TA 1U12A 1FMD1 4FXGB 2D98A 2VGDA 1EV11 4LEJA 5K0UC 4IV3A 2XJRA 1C8NA 2V73A 5HBAA 2ZPXA 1QXRA 1VB2A 1NCRC 4Y22B 2OPKA 4FPJA 4N53C 1MZEA 2UU8A 2XBO3 1PIV1 2WNEA 2LALA 2XVKA 3IMNA 4K1YA 3IIAA 4XZPA 2ZZQA 4GB32 1FOD2 5H9PA 3VZKA 4FPOB 1U5XA 4CDWB 1GZWA 4QX5A 4RFT0 3WP5A 1C5IA 2MEV2 4XFGA 2XJVA 3AP5A 1RUJ2 2WA3A 1LU2A 4AFBA 1VBC1 3AKQA 4WM7B 1YIPA 2PHXA 2VU9A 4HL0A 3CLPA 1B35B 4QD2A 3VZJA 1R1A2 3OBRA 4QMAA 1ULGA 5BNNB 4IV1A 3IDEA 4Y26A 4WVVA 4QPIB 1WW7A 3VL8A 3H50A 2CAUA 1QU0A 3JCIA 4H55A 1RJ7A 1VBE3 2DCYA 4D7SA 1UW8A 4CEWC 1GNZA 4Z1VA 4BLJA 3ZN6B 2IXIA 4MH0E 2G9GA 4ISRA 4IEOA 5BNOC 3V65A 4FQZA 3WVJA 4EV0A 3JD71 2H0BA 1AYM1 1AXZA 2CV6A 1NOVA 4GH4B 1V6KA 3IN9A 1R091 1S1AA 3OYWB 4IEVA 2E6VA 4P9XA 5JSRA 1S0CA 2HWE3 5C4WA 1G9AA 4I30A 4HLTA 4KGQA 4Y22A 4AHWA 5J37A 4D69A 1N1SA 3USSA 2K9ZA 4EWAA 1DU3D 5FO8B 1HXS3 3ALQA 4FP3A 2DVFA 2JJ6A 3ECQA 4QGNA 1WMDA 2WQ4A 3RNSA 4E27A 1O5LA 1ULEA 4P5HA 3CJIB 1WMEA 4JGYA 4CDWA 5CFDC 5FO9B 1GZ9A 1AR83 1YCIA 3M8LA 2HEYF 1AR63 1YO8A 2PLV1 3M3IA 1JYIA 4WVMB 2WWSA 4W6WA 2WA4A 4WM7A 1HRI2 4XJAA 1LJ7A 2R073 1BVVA 4BA6A 1LENA 3WLUA 5BNNA 4Q4X3 3AXEA 3OCPA 1AL21 2B7YA 4IEUA 3U4XA 3FZ3A 4QPIA 5GZDA 1D4M1 2D6OX 3INAA 1RUF1 3JBG1 2X53S 1V9U2 5T5LA 5C9AC 3WT3A 4XW3A 3KLSA 2CYFA 5DDJ3 2QNKA 1GICA 3ZN6A 3ZFFB 4CEYB 3V56A 1QH7A 1S0EA 1RMU1 5IK8A 1BBT2 4RS5B 1FT9A 4GH4A 4HSJA 4FQ4A 1SLAA 3TWIA 4HK9A 1CAUB 2A6WA 4FO9A 4JTNA 2GH8A 2VH9A 4LO7A 1YFWA 1UIKA 3MLLA 4YNIA 2BW8A 1X8MA 2EXKA 4OI4A 2QQPA 2AYHA 1DF0A 1ND2B 3RWNA 2ERFA 1IKPA 1IPJA 3GZAA 5E89A 2VOXA 2VOVA 3ZN4A 1YJLA 2DFBA 2VECA 1LU1A 4AVSA 3GBGA 2ZTNA 1LGBA 3AYAA 1QNWA 5KC6A 1FV2A 4LR4A 1PVC1 3B9IA 4WVMA 2NM1A 1AR93 1WCSA 2ZX1A 4DXZA 3AJYA 4Q0UA 1LRHA 1RB8G 2UWAA 3NKTA 2PAMA 3OJBA 1WBFA 5FMOS 3PLQA 3HN1A 1C5HA 1ALYA 4BE3A 2QDRA 1BEV1 4BM8A 4INDA 1VBE1 4KWKA 1TME1 2K0GA 1Q43A 3AKPA 1RUC2 4AI1A 1AJKA 4XFFA 4AXOA 2P34A 3HT2A 1IOAA 2ZBJA 1Q8SA 5LRRA 1KQRA 2B9UA 1DG6A 4RS5A 4RQPB 4YW1A 3V64A 3KB5A 1X50A 1X36A 1CAUA 4XFHA 1DZQA 3KMHA 2PYTA 4BH9A 1HXS2 3RJ2X 4WM8B 5KHJA 3MW3A 2ZS6B 4YYOA 1KITA 1QOOA 4AI3A 2WL1A 2NLRA 4MSVA 1AR82 1UIJA 4XHBA 4HKWA 5DZFA 4P9YA 3M7AA 4MYEA 4A7YA 4M00A 1OQDA 4MGIE 5J98B 1RUH2 3LZZA 1JN2P 2R072 1AR61 4AHYA 1WLDA 2RMU3 4DY5A 4QPGA 1IGOA 1ONAA 4E4ZA 3NW4A 4ISQA 1RUD2 1ZRCA 2WLQA 4TYSA 1CJPA 4Q4X1 3SCFA 4XJ9A 3AZXA 4IETA 5DDJ2 3ES1A 3JU9A 4X8PA 1IKQA 3ZSEA 4KWJA 3I59B 4N43C 4AVVA 5JSPA 1H0BA 4Z92B 4X6RB 1QJY3 4N9HA 1Y3TA 3AMPA 1RVF3 2B39A 3ILNA 4XFIA 4BYYA 4N7IA 4RQPA 2JG8A 1AJOA 1QJX3 1WLCA 4HSLA 2GC2A 1G9DA 2QDNA 1LOEA 2QUOA 1O4ZA 4WM8A 2Y0IA 1W2UA 3H1MA 3NV2A 2OYZA 5T3NA 3VBSC 5ABJB 2WNVC 2DVGA 2VXRA 1WA4A 4YM0A 3L2YA 4GQ7A 1S55A 5AFBA 5CADA 4KGGA 2YGLA 3WQ7A 4R9CA 3LCPA 3NJZA 1OFSA 1DQ5A 3THPA 4CDQB 2X5IC 1V6LA 3S7IA 1GZCA 1AR91 3APBA 5LK5A 4R8HA 4FPEA 4XF1A 4CP1A 5FLIA 5I0SA 2CWSA 5LK7B 4W65A 4DZGA 4JGZB 1NXD1 3D82A 2ZGOA 3UKVA 1MZ5A 5SV8A 5T50A 3DN7A 4K21A 3I59A 2RM23 4L9BA 1PGW2 5DUWA 2AZ5A 4ES9A 2QJVA 4HZFA 3WDWA 3WG2A 1RUI3 1RHI3 3M3OA 4CDXB 1GQHA 2I74A 2H0VA 4QGLA 2CL2A 4OI2A 1EAH1 1V70A 1CVNA 4P9JA 3ZFEB 2NP0A 3GYDA 1G86A 2ENRA 5KHGA 2IFWA 2D93A 4RHV1 1M06G 4ASLA 1G6NA 1DQ0A 3IWZA 3ZXGA 2YROA 2VMIA 5ABJA 3R05A 1MQTB 1C4RA 1DZTA 4YZ2A 2BQPA 2WS93 4R52A 3HWJA 1COV2 2GNDA 4XXPA 1O4TA 4RD7A 4YARA 3WW1A 2HWF3 4Q0SA 4D94A 2P3IA 4RSUA 3LB9A 2PTMA 1MVEA 1NE4A 4XBLA 1YUDA 3ZYRA 5A33A 1QHDA 3BIWE 1AYN3 2RMU1 3CU7A 2EXIA 1HQNA 5B2GB 1S0IA 2ZX3A 2RS33 1OLQA 2YXSA 3SH4A 3VBUB 3WG4A 1RUE3 2LTNA 4Y20A 1ZVFA 4JGZA 3AZWA 5EYYA 3VZOA 5HI0A 2BNOA 3LOBA 1TQ5A 3WUDA 3WG1A 4PDWA 3ZVXA 4UXAA 3MW4A 3VZMA 3RMXA 4AVCA 2WNUB 5T52A 1QJX2 1I6XA 3MF6A 3TN91 3CL1A 5L7OB 1ZBE1 1V6OA 3BTAA 2N7GA 1C28A 4K8FA 4CZSA 5GLTA 3ZFEA 3L2HA 4XYXA 5FO7B 3URFA 3WV6A 1ASJ1 1YHFA 2TUNA 1Y7BA 4GIQA 3MGUA 4Y1ZA 1XYOA 5JOWA 1UD1A 1RUG2 4LO4B 4XFCA 2VUJA 1MZFA 2HEVF 2HWB3 4QM8A 2PHLA 3UJOA 4ZU7A 4Q4Y1 1H9WA 3KM5A 1F8VA 3SLIA 1POV1 3OY8B 5CFCB 4LHKA 4XJUA 4H3WA 4RGAA 1Q8PA 4MGKE 1UKRA 4LE4A 4RGGA 4B3NA 1B35C 2OW4A 4BOWA 3GHMA 3KT7A 1DIWA 4QPYA 4EN7B 1NY71 4META 1UCXA 2NYYA 5I0UA 2H6CA 2XLGA 4MGYE 3NV1A 1VAKA 1YIFA 2VMGA 2WNUA 1S2KA 1HX6A 1U5YA 3MIHA 5GALA 4JDNA 2DTYA 4K6BA 3PJQA 1PO23 1ZRDA 3VL9A 2B45X 4GALA 4LHNA 4Q27A 1UU4A 1C57A 3N7KA 1PGSA 1BQPA 1HQLA 5H9SA 4JCKA 3IDBB 2WS91 3AKRA 5KXBA 1NQJA 4QXKA 3WXPA 3MIEA 1VBB3 3UJQA 5IK4A 4XOGA 4YLZA 5C8CC 3IBMA 3CJIC 1MS1A 1WBLA 2HWF1 1BMV2 1VBA2 4KU7A 1TE1B 4FPLA 5CFCA 2DWRA 1S2BA 3DPRB 3CEWA 1C1LA 3M4FA 1R082 1DQ4A 4JDMA 2ET7A 4U36A 3BU7A 4YW4A 1XNKA 4FVVA 3IDCB 3VBOB 1HQWA 2ZGSA 1PO13 1QQP3 2VVFA 5DUVA 2UYAA 3GHNA 2UYBA 4C1XA 4RR3B 2RR12 2D3SA 4M0HA 1QGLA 1WMFA 4HVOA 4YZ1A 1QJZA 3ZFFC 4CEYC 5FTTC 5C33A 1CAXB 1KJLA 1NA1C 1YI9A 2RS51 4P9IA 1UPSA 1LGNA 1OKQA 3MPBA 4MXWA 3RQ0A 4UW3A 4XJWA 3VLBB 2V5YA 2NMNA 2GNBA 4O9GA 4X8NA 2XHKA 2CAVA 1KXGA 4EROA 1H9PA 1CR7A 5GLZA 2ZHLA 1ND2C 4GB33 1FOD3 4TSVA 2QCSB 2C1FA 2Y0OA 5ACA1 1S0JA 3MLJA 1RUJ3 4I0WB 4NWWA 1FAYA 4LBMA 1TMF2 3MIDA 3R0RA 1KS5A 1SFYA 2A3WA 1BJQA 1R1A3 3NSTA 5AFEA 1S0GA 1HV0A 4BZ4A 3NAPB 2I2SA 5J48A 3I7DA 4XFAA 3VDDB 3VBOA 5KWRA 2DVBA 3PJYA 1ZX5A 3B94A 4XF3A 4EN6B 4XETA 3HIFA 4IERA 4MGZE 5FFOC 1GANA 4BIFA 2HWC2 5A3LA 4DINB 1O7FA 3V0BA 4FBFA 1CD3G 1OHFA 1CAXA 1G8WA 1QNYA 4HKLA 2ZZJA 3MEPA 1IS4A 3AMQA 1LOCA 1W6NA 3M3QA 1PO21 5F9TA 3PVEA 4AVAA 1JXNA 1LOFC 2D6KA 3DF0A 2WJSA 4OI1A 3N7JA 4XTMA 4S2FA 1H8TB 3ZIWA 5FPXA 3BPZA 3O5SA 3G6JB 5BNPA 1AX2A 1PMIA 3U10A 1J59A 2KXLA 5AC93 2GMMA 1HRI3 4GWNA 2ZHNA 1QWRA 4YW3A 2R49A 1QQP2 1PNFA 2ILMA 4OLLA 3VZLA 3NAPA 2C5DA 1VAVA 2R0HA 4G4FA 1LULA 2DCKA 3VDDA 3AMNA 4YSFA 3KGLA 5JDBA 3EQEA 5EZWA 4I0AA 4LLFA 1PO11 2A6VA 2R062 1V9U3 3H9AA 1ND3C 2CWMA 1TEIA 1VP6A 4QQLA 3N36A 1S0BA 3BOWA 4E2QA 1I1EA 3MYXA 5DZEA 3LGRA 5C4WB 1BBT3 1D0GA 2WFPA 2VNRA 4XIKA 3AXDA 3EXUA 4EN9B 2JDZA 1H4HA 5CB7A 5CAZA 5CNAA 4LNVA 1FMD2 1EV12 3MIFA 2HJIA 4JGYB 1BZWA 4YG0A 1EPWA 1QMJA 1H8TA 5E16A 4AI8A 1KDMA 2X29A 3K51A 2EXJA 4HANA 1D0HA 3NVCA 1G9FA 1WCKA 2VULA 1WD3A 2Q4SA 3N35A 4CP2A 1OOPC 3D0JA 2MEV1 2PHWA 4KWLA 1XE8A 1RUJ1 1QKQA 2P37A 2YDEA 3KCCA 3WQ1A 5BNQA 1KFXL 3EJKA 1HW5A 1MS3A 2Z5WA 1C8M2 1U5ZA 1UKGA 3B02A 4QQHA 2O8QA 1JH5A 3M1HA 2WT0A 1ZA4A 1O3SA 3TB0A 3BOPA 3JB8A 4LHLA 1CGPA 1FNZA 1H1AA 2NQYA 1PK6B 3MIBA 4K7JA 2QFEA 3OGJA 1RJ8A 1DFQA 4YZ3A 4HT1T 1RUC3 4XF9A 2ZJCA 5T5PA 3RI8A 2ZKNA 4AF9A 2IWGB 4AVTA 5KXCA 2WZPP 1GSLA 1SLLA 1MVQA 4CDXC 3B00A 2EALA 1QDCA 1DDLA 3ES4A 1VBD3 2XJQA 4HBNA 5BXXA 2ATFA 2XUMA 1AYM2 5CG8A 2WFF1 4HPKB 3ZFGA 4Q4W2 2A6YA 3AX4A 4OHYA 1R092 1OFNA 1NCQC 1SLCA 2W08A 5E8AA 4UBGA 4IEWA 1FI2A 3K48A 4R4XA 5KHKA 2E7AA 2WZR1 5IUQA 4AGGA 3S7EA 1AL0G 5EFUA 4XQ4A 4HVRA 3QCWA 5AC92 1RUH3 2HWD3 2A3XA 1W39A 3VKFC 3U0ZA 4BWOA 1V6NA 5GLVA 2BYVE 1REDA 1RUD3 3U07A 3VKLA 3GZTB 3HMYA 2VUAA 2Y38A 2VQ0A 3ZXFA 1FNYA 4TZDA 3ZXAC 3J8F2 1UF2C 2VNOA 1XE7A 3IT8A 1DGWA 4N7UA 5FAXA 1URXA 1QJU3 4Y24A 1PVXA 2EXHA 1PK6A 4PLMA 3ZXJA 1LESA 1H8VA 4Q8KA 1AL22 2YPJA 1F31A 4XJZA 2YC0A 3BALA 3JBG2 1QF3A 3ZXEA 2PHRA 3SISA 4QGMA 5JIAA 4Q2FA 1Q8VA 1NYWA 2FMDA 5F1RA 3DKWA 5JPNB 4YG3A 1BBT1 2CTVA 1OA2A 5L7OC 1VR3A 3KT1A 2R043 3FE5A 4HPKA 5D8AC 2A73B 1W0OA 3VBHC 5GZGA 2XBO1 5I91A 1MEC2 5J36A 4FT8A 2XWJB 2ZACA 4FAGA 3IM0A 2PHUA 1N3PA 4GKYA 1OSGA 5GM0A 3AKTA 1U5IA 4YVSC 2RHPA 4QPGB 2OIIA 2OUJA 3M70A 4YFWA 1K5MC 2JICA 4SBVA 2YMZA 2WIIB 3UK9A 4I0BA 2DVAA 4CDUB 5F6LB 3FBMA 5EV7A 1UAIA 3QD6A 3HAGA 5C8CA 2G4IA 2WT1A 2ZKLA 2GNTA 3AFKA 5FBZA 1MZ6A 5JZGC 2Z69A 1FYUA 3RYPA 1GBGA 1TNFA 1SCRA 1LECA 2R6QA 1AX0A 4JRLA 4CRQA 2JG8B 4XIOA 2JG9C 5BPXA 3THTA 1H2KA 1BEV2 2FMYA 1VBD2 4MVTA 1TME2 3TRSB 4YZ5A 2HWE1 1BYHA 1DYKA 4COWA 4R9BA 5CVRA 3R4SA 2BTVC 1HRV3 4JDOA 2ZAAA 3W59A 1OPOA 2F4PA 4PBOA 4YVWB 1HXS1 5E88A 1XYNA 1UL9A 1HLCA 4E2SA 4QM9A 3AYDA 4M3CF 1VRH2 5JR7B 3GBWA 3VBFB 4HFSA 3ETQA 3FMGA 1COV3 1LR5A 2HWD2 1Q5OA 3WW2A 4C90A 1AR81 3AP6A 4S2HA 3ZYPA 4FOYA 4L11A 3CF6E 1RUH1 4CDUA 3NWKA 1DZRA 2ZABA 3FHIB 2R071 4XMAA 2A75A 3WY6A 4LT5A 1RUD1 4OUSA 1QJU2 3H7JA 1IZ3A 2W0XA 3DPRC 2GC3A 1F9KA 3NV3A 5J96B 2YUEA 1XQNA 4IL7A 3WQ0A 1Q3EA 1HIXA 5FRAA 5DDJ1 3WOGA 3AMMA 4YFZA 2KM2A 3WW4A 3EHKA 2VVDA 5E1RA 3VBRB 4XF0A 4DOUA 4GULA 4PF5A 4CYDA 1LHWA 4AYUA 2GALA 3WCSA 3UKNA 2W39A 1Z78A 4YM2A 3ZXKA 4XXAA 4LTAA 3O0WA 2R042 2YHJA 4YW2A 2DUPA 1PZ9A 4JTOA 1KRIA 2R1BA 4AVBA 4Q0PA 4C0BA 1V6IA 2UWCA 1YYNA 2AENA 2ZHKA 2Q8OA 1XRUA 4YVWA 5K0UB 1AF9A 4TLFA 3AP4A 4L97A 1NCRB 4Q4V2 1RUG3 4E4DX 4FPYA 3VBFA 1AR72 3MZHA 1OI6A 3JB4C 3ME2A 4MUVA 5T54A 3FC0A 3MF9A 4AEDC 1F2NA 3AM2A 3WZ1A 4B4PA 4N53B 1L3JA 1ZZ7A 1LOFA 1SCSA 1JOJA 5A33B 1ZZ6A 3QOPA 2R0FA 1J3RA 1D4VB 2CGNA 4FOQA 3H1YA 2A6ZA