5T5JA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5jA00
2E51A 4XJAA 3WVJA 4XOGA 3VKNA 1JBCA 1GBGA 4YW4A 1QGLA 3WHUA 2PHRA 4WVVA 2ZMLA 1IS5A 5HCAA 5JOWA 2WT1A 4PCRA 3VKFC 3ZXJA 1DQ6A 1VLNA 4M00A 2ZGQA 2WNEA 2ZACA 1LHVA 3AJZA 1SLBA 4K21A 1YIFA 2ERFA 5T55A 1G9FA 1LOGA 2D44A 2TEPA 3POSA 4XBQA 3V0BA 2E53A 2D7FA 4WV8A 1QU0A 1MS4A 1WCSA 5DUVA 5IT6A 1JYIA 1W0OA 1WLDA 3V0BB 3VKMA 4U2AA 3HN1A 1AX1A 4YM0A 3B69A 4CZSA 4YM2A 4NO4A 5KXCA 1S0BA 3T1LA 1S1AA 2YMZA 4Y1XA 2D6LX 2DVAA 1S0JA 4BQ1A 3ZSJA 1Y7BA 2DURA 3A0NA 5E89A 2R0FA 1FYUA 3WLUA 1JOJA 2C9AA 4XBNA 1JUIA 3VKLA 1W0PA 1CQ9A 2AH2A 3BODA 1W6PA 4YG6A 1I1EA 2ZGPA 4OZXA 1VAVA 1G9BA 5BYNA 4R9AA 1FATA 5GLUA 2Q5TA 2JD4A 1MVEA 4DRVA 2ZGLA 2D6NA 1SLTA 3LCPA 3I4IA 3T2TA 5T5LA 1DQ0A 4XMAA 4YW5A 5CBLA 1V6MA 3MPPG 3SLIA 1UX6A 4Y1YA 3ZSLA 5DUUA 4AWDA 4YGBA 1V6IA 1JN2P 1X50A 2GNMA 5CNAA 2H0BA 4P9WA 1LGBA 2EF6A 4JRAA 4CTEA 3ATGA 3UK9A 4YG0A 2A7AA 4SLIA 5SV8A 1Z0HA 4AYUA 4Q1RA 1D2SA 2A6VA 1GZWA 5E88A 1LESA 4PBOA 2AYHA 2ZGTA 2OW4A 5GALA 1AX2A 1KITA 2EXIA 3OJBA 1DGLA 1VALA 1LOBA 3ZSMA 4BOWA 1FV2A 1PZ8A 1LEDA 1S0FA 2DTYA 4YGEA 4YW2A 4YGCA 3WNXA 4FPYA 1A8DA 1LHOA 2WLQA 1UZZA 3DUIA 1G9CA 1V6KA 3ZXEA 4FOYA 1BJQA 1C1FA 1WUVA 2VW2A 4XJWA 3W58A 3U4XA 2HYKA 3IPVA 3ZXKA 2ZHNA 3SH5A 3ILRA 3N36A 4FPCA 1IKPA 3OGGA 1LU2A 2YZ4A 3MW3A 3WG2A 2UURA 3I8TA 3AZWA 2ZMNA 1O4ZA 4CRQA 1WLWA 1JXNA 4Q2FA 3SISA 2A75A 5IK4A 1QOOA 5HCBA 3BOPA 1IOAA 3N7LA 3O5SA 5GLVA 2ZGRA 4LBNA 1LCLA 4AVVA 2ZABA 5EYXA 4TYSA 1W6OA 4FOQA 2AGSA 5GZEA 3AYDA 3Q9OA 1MS3A 1WW7A 3WDUA 1C57A 1MS0A 4FPLA 2VUAA 2YXSA 5T50A 3AFKA 1QKQA 4XDQA 4DPNA 2D6OX 4M3CB 1BXHA 1W6MA 2A6XA 3KM5A 3ILNA 1MS8A 3AP7A 4XMIA 2CWMA 4RA0A 1GV9A 4XE9A 3WOGA 4ISQA 2JECA 5T5PA 4ATEA 2P2KA 4XIOA 5IUQA 3WV6A 1AJOA 1LOCA 4GXLA 3L2YA 4P9XA 5AVAA 1BYHA 2SLIA 4Q8LA 2AUYA 2DUOA 2WJSA 3SH3A 1SCRA 4AGRA 2W08A 2R16A 2OUHA 2JDZA 3B3QE 1S0CA 2C5DA 1APNA 1GICA 4XXAA 2D3SA 3WCSA 4FPHA 3RQ0A 1KDMA 3OYWB 2EIGA 4DQAA 1DQ5A 4RL7A 3RSJA 4FP2A 3R05A 3ZVXA 3R4UA 2EAKA 1QOSA 3ZPYA 2D6MA 4GWNA 3JUUA 1GZ9A 3USUA 2P34A 1J1TA 1S0EA 3A0KA 1UZYA 4L8QA 5GJ6A 1SCSA 1U0AA 1HDKA 2FHRA 4F83A 5T52A 2P3IA 1AVBA 1GNHA 1IS3A 1LHWA 1ENSA 2XG3A 1UMZA 5FRAA 5H9RA 1H9PA 3AXDA 1DLLA 1PZ7A 4YZ4A 4FPOB 3V0AA 5DUXA 1G9AA 1HQWA 1N1SA 3M3CA 2P3JA 2JKBA 2ZAAA 2VXRA 1QMJA 1MZ6A 1ULGA 2GMMA 2JE9A 5DZFA 1OFSA 1SLCA 3PMEA 1Q8QA 4FQ4A 3M3EA 1S0GA 4GKYA 3WDYA 3DGTA 4M01A 3LSEA 2UWCA 4HL0A 3RMXA 5H9PA 1WD3A 5DUWA 1ENRA 3N7MA 2PHXA 3A4UA 3INAA 2ZGKA 5L73A 1H9WA 3AP4A 2CWSA 2R0HA 3FLPA 1GZCA 1HKDA 1FNZA 2VH9A 2GN7A 4R9DA 3OY8B 3POYA 4XXPA 5KXBA 2GMPA 5JLVA 3NV3A 1EPWA 4MYEA 3QLQA 2ZGMA 1G86A 1QNYA 2OVUA 3O0WA 4TZDA 1F9KA 1DQ2A 1ZM1A 4GKXA 4FPJA 2EXKA 1I3HA 4R9BA 1O4YA 1W6PB 1DYPA 1KJRA 2LTNA 3M2MA 4YW1A 3WCRA 2D3RA 2GN3A 2I2SA 3PVOA 5IK8A 1F5FA 3R4SA 4AGVA 2DVDA 3ILFA 2BQPA 3N3HA 4FPGA 5GZGA 2ES3A 5DXDA 4Y22B 3ZYPA 3WDVA 2AR6A 3RG0A 1HQLA 1N3QA 4LBQB 1G7YA 2VU9A 4Y20B 2D3PA 4Y1ZA 2NN8A 3ZYRA 3JU9A 1QDOA 2UU8A 1CONA 2E6VA 2ZGSA 3AYEA 3UJQA 1KJLA 1ONAA 2CL2A 3T1MA 3B9CA 1QF3A 4Y1UA 1GKBA 1GSLA 1HLCA 2R1DA 3H0OA 3D5OA 1Q8SA 2WQZC 2WSUA 3MW4A 4Y22A 3RS6A 1SFYA 2WKKA 2WT2A 3N7JA 4ISRA 4K1ZA 4ZXKA 4NOTA 4Z8BA 5T54A 1N1TA 4YGDA 1JHNA 2D6KA 1YYNA 4FQZA 3PVNA 5JDBA 1S0DA 4XJ9A 2V73A 1AF9A 2CY6A 2DVGA 3WZ1A 2NYYA 4HANA 1A78A 2ZMKA 1LGNA 1DBNA 3WUCA 2B7YA 1GANA 4Y24A 2PELA 1UKGA 1DFQA 1A3KA 2ZA9A 3AYAA 1ULFA 3NWKA 1V6LA 2ZKNA 1SLAA 1JYCA 1Q8PA 4YZ3A 3IKWA 1SLLA 2A5ZA 3NV4A 3BIWE 3B01A 4Q27A 4P9YA 4FPFA 1LOFA 1RIRA 2LALA 1V6OA 4ZKTB 1LGCA 3ENRA 4JC1A 5E8AA 3HMYA 1AX0A 4PBPA 3FBYA 4XJ8A 5HCFA 2EALA 3O0XA 3AP5A 3ZXLA 4LBMA 2AREA 1W6NB 4AVTA 3KQRA 4YM1A 3IN9A 5T5OA 4YM3A 1LOAA 1SBDA 3V64A 3AX4A 4UW5A 4XTMA 3AJYA 1Q8VA 1F31A 3WDXA 2ZGUA 1ULDA 4Q1PA 1AXZA 4FP3A 1N1VA 1YO8A 2E7TA 1URXA 1CVNA 1DIWA 1W6MB 1N3PA 5H9QA 4K20A 3TAYA 1W6QB 1LULA 1PZ9A 4XILA 3SNMA 5JOXA 3FUQA 1D0HA 4Q26A 4Y1VA 5DG1A 1SBEA 1LHUA 4Y20A 1BZWA 2NMOA 1UPSA 1SACA 1VIWB 3RMYA 1LOFC 3FLTA 1UL9A 2G4IA 3HR9A 1QDCA 3OYWA 1WD4A 3WUDA 4Y26A 4PF5A 1IS6A 1XQNA 3AK0A 1MACA 3SH4A 2P3KA 1WBLA 2GNBA 4WVWA 3D6EA 5CAZA 4I30A 4XYXA 4BLIA 3RRDA 4P14A 3MW2A 4DFSA 3CNAA 5GZDA 1LECA 5H9SA 3AYCA 2ZBJA 1LODA 1C1LA 4W65A 5EXOA 3W59A 1AXYA 1ZA4A 1CIWA 5LK5A 1LTEA 4AGGA 1LHNA 2DU0A 4YZ5A 2W52A 1CJPA 2ENRA 1FNYA 1WW6A 1KQRA 2DVBA 2ZHKA 3TB0A 4XIKA 2R49A 1RINA 3AXEA 3M3QA 2JJ6A 1OQ1A 4BPZA 2NMNA 2DV9A 2EXHA 4M3CA 4XTPA 4BLJA 1CR7A 1AZDA 5EYYA 2D43A 4YLZA 3N35A 2ARBA 4DRRA 5GZFA 4YG3A 1N1YA 3AZZA 1YI7A 4YFWA 4KBBA 2NZ9A 1C4RA 1ULEA 1CPNA 2W39A 3ASIA 1MZ5A 5GLZA 4GA9A 4BMEA 3FLRA 5IK7A 3POWA 3WG3A 3VUOA 2DUPA 3WG4A 1IS4A 2E7QA 2PHTA 2NM1A 5F5QA 2A6YA 1FV3A 5GLWA 3AP9A 3LSDA 2XB6C 5EWSA 3WDWA 1LEMA 3D4KA 3MEPA 2A6WA 1IKQA 3BTAA 1AJKA 1UN1A 3WG1A 4R9CA 2A3WA 1CPMA 2YROA 1R1ZA 1VAMA 1CN1A 1GLHA 1S0IA 1WW4A 2PHFA 5CA6A 3WHTA 2OUJA 2ZZJA 3IM0A 4LBQA 1GYKA 4M3CF 5JVVA 4D69A 2A70A 5JOZA 2UWAA 3AZVA 4XHXA 5F9TA 2UWBA 1GNZA 3M1HA 4Q8KA 2AENA 1MR5A 1KRIA 1GZWB 1UAIA 5GM0A 1QNWA 3VKOA 5DG2A 4LBQD 3PJQA 3ZSKA 1CESA 2DU1A 3OBRA 5IK5A 4UW4A 4XBLA 1G8WA 5FREA 4XJZA 4H55A 1KDKA 1RITA 3PVEA 2P37A 4ASMB 1LU1A 1Z78A 1TEIA 2A71A 1V6JA 2VW0A 2DYCA 4LBKA 3ZXFA 3USUB 4GALA 2JE7A 1FAYA 2VW1A 4C1XA 1QOTA 2ZGNA 2D6PA 2DWRA 2W68A 2CTVA 4WZFA 5T5JA 3VV1A 3FFZA 3AZYA 1N3OA 1NXD1 4BM8A 1N47A 3V0AB 3WDTA 2CNAA 1AXKA 1FX5A 2YV8A 2DTWA 2Z42A 3NV1A 4LBJA 4XZPA 2A3YA 2PHWA 4FPKA 3SITA 1W6QA 1LJ7A 4PQ9A 4U36A 3IMNA 3QCWA 3UL2A 2ZHLA 2GMEA 3GNEA 4YZ2A 3M3OA 4FOWA 2V5YA 2NP0A 1H30A 1DHKB 1G9DA 4K1YA 1LENA 2CYFA 2FMDA 3OBTA 1W6OB 4YFZA 5KXDA 2ZGOA 5KXEA 2GALA 4YZ1A 1BQPA 1OKQA 3OPZA 1DYKA 3V65A 3O12A 1MS5A 1BKZA 1W6NA 4FPEA 1DQ1A 5GLTA 1YXWA 5DZGA 1Q56A 4DS0A 3UJOA 2PHUA 2RHPA 2YY1A 5DZEA 4ITCA 1MS1A 3GALA 1Q8OA 3O0VA 4LBLA 4BMBA 3AZXA 1WW5A 2EXJA 2GDFA 3APBA 1V00A 3OY8A 3C2UA 4FOVA 4UW3A 1DZQA 1JW6A 1LOEA 3B00A 5CB7A 5GZCA 5JOYA 1WLCA 1SLIA 4XJUA 1YRZA 1MVQA 1NLSA 4FVVA 3NV2A 4IQPA 1DQ4A 2GNTA 2WSVA 4JCKA 4AVSA 1MS9A 2ARXA 2VY0A 1ULCA 1WBFA 2A6ZA 4C1WA 1B09A 1SBFA 4XHBA 2SBAA 1ENQA 1V6NA 2A3XA 2DUQA 2WT0A 4GWMA 3AP6A 4ATFA 2ZHMA 5JMCA 4LBOA 4M3CE 3IPVB 4UW6A 4YW3A 2R1BA 2GNDA 3N7KA 2DVFA 3FUOA 2KM2A
chains in the Genus database with same CATH superfamily
3NNFA 4XJAA 3RZHA 3AVSA 4CP0A 3VKNA 1JBCA 2ETEA 1OKOA 2W0XA 5JI9A 3BU0A 2BGPA 1IS5A 1XE8A 5JOWA 4AEJA 1EV12 3WY6A 4Y4RA 5FWJA 4LLOA 3WT3A 1AL22 1CWPA 1QJX1 2PLV2 1YQ5A 2WNUB 2DBNA 1CGPA 2GP3A 2O8QA 2TEPA 3H42B 3IDBB 1IZ3A 3K75B 3ZFFC 1ZRFA 5IT6A 2D7FA 5CKMA 4DXZA 4KU8A 1ODNA 4AFCA 4E27A 1RTVA 1ZRIA 3IZOA 3HN1A 1AX1A 3J7HA 4KGGA 1X9TA 4WM7C 1VBE1 4NO4A 5EQUA 5FWEA 3PVBB 3T1LA 5KXCA 1VBE2 4A3ZA 3WNLA 1JOPA 1O5UA 1Y7BA 2DURA 5E89A 2WWUA 3E6BA 1FYUA 3JB8A 3NKGA 3WLUA 5F39A 4MUVA 2C9AA 5A7PA 1VBA3 1JUIA 1L3JA 2OX0A 1PO12 4GIQA 5IHRA 1TNFA 4XF9A 3U1XA 3ZO0B 1ACCA 1W6PA 1BMV2 4YG6A 2ZGPA 1C8M1 3NJZA 5FXVA 5JXGA 2RMU3 4LXLA 1JTZX 1C8NA 4O9EA 2CAVA 1MVEA 1COV1 4BHPA 5DMYA 1OH4A 1VBD3 1SLTA 3ZDSA 3VB9A 5JUVA 3T2TA 4ASLA 4XMAA 1Q43A 4YW5A 1V6MA 4LKSA 2JICA 3CU7A 5FMDA 1NKGA 1E5HA 1PK6A 2WWJA 3MPPG 5ERLA 3SLIA 4AVAA 3DL3A 2QTWB 1ZBA2 5DUUA 1VBB1 4AWDA 3J8F1 1X50A 1HJGA 3DXUA 5CNAA 3PUIA 2F6BA 1PO13 1UO9A 4P9WA 2VZQA 1L7QA 4WM8A 3HT1A 1E57A 5FP7A 4BK5A 5SV8A 1Z0HA 2VPVA 1ZX5A 1D2SA 3EO6A 4BDVB 3CJIA 2RMU2 2XOMA 4PBOA 4AZZA 3IT8A 5IVFA 1ZRCA 2PHDA 5BNNB 1KITA 2EXIA 2J22A 2O14A 4B4RA 2YU1A 1BK1A 3VDDA 5IVBA 1VALA 3ZSMA 5K8SA 1PZ8A 4YGEA 1VBC1 3KD4A 3SQOA 4H14A 4FPYA 2CHHA 3BPSA 5FBZA 3DUIA 1V6KA 1F15A 3ZXEA 1ULOA 1W90A 3PIGA 1C1FA 1WUVA 3W9AA 5J96B 3OF1A 3I2IA 1CAVB 1KEXA 3KV6A 3RFRA 2XGXA 3U4XA 4QQPA 4IV3B 4NRPA 5CYYA 4UFMA 2VZ1A 4K6BA 2BTVC 5JR2A 1NE4A 1IKPA 2Z2SB 3EQEA 2UURA 5IAXA 1OUXA 3JXSA 3FC0A 4AI9A 1LR5A 5C4WC 4LHSA 4CRQA 4Q2FA 5FYTA 5F37A 2XLFA 4R52A 3QH6A 5C8CC 1QJEA 5HCBA 4UXAA 3FMGA 4Q4Y3 4S2HA 5FZ9A 3RQ0A 1PO21 2V4AA 1SFPA 3GCWA 4LBNA 5LY2A 5K0UC 5EYXA 5F5AA 1J58A 4E4DX 2Q1ZB 4GJZA 3VD3A 4FOQA 1PVC3 2MHFA 2ZX0A 3Q9OA 4H7LA 5IW0A 5KHGA 1ODMA 4JDNA 4LOSA 4QKNA 4XVHA 3WDUA 3WW4A 2Q8DA 1PVXA 4CEWC 3J7LA 5DN2A 5FZHA 2C1FA 1R1A2 4XDQA 4DPNA 4MV2A 2AZ5A 3TYJA 1WGPA 4UT5A 3AFGA 2P17A 5LBEA 4JTNA 1MS8A 2WO1A 3VL9A 4QGMA 2JG8C 1GZTA 2XJPA 4N43B 4RA0A 5BY5A 5LY1A 2JECA 2ZCWA 3RJRA 5FYUA 4QWNA 2R043 4UI9L 4CVUA 5DDJ1 2ZX1A 3L2YA 4P9XA 3S7IA 1PNFA 3DYPA 5J09A 1BYHA 2SLIA 2VM9A 4AOCA 2GZWA 4LKFA 5A32A 1MZFA 1E5SA 1SCRA 1EP0A 1JZ4A 4ZU5A 3ZN4A 2JDZA 1TNRA 3B3QE 4PDWC 5D1IA 1K45A 5BPXA 3P6BA 5J37A 3LZZA 4LA3A 2A1XA 3MLKA 1BBT1 1KDMA 3I3EA 2EIGA 4V1PA 1NXMA 1DQ5A 4RL7A 1XOYA 2H0VA 3WX5A 3R05A 5AC91 3ZVXA 2XH6A 1Y4WA 3ZPYA 2D6MA 4NPLA 5LA2A 4HMZA 3JUUA 1GZ9A 3USUA 2P34A 1J1TA 1S0EA 4L8QA 1QJZA 2YBPA 5DDJ3 5GJ6A 2ARCA 5FY0A 4CP1A 3O1TA 2WNVA 1GNHA 1REDA 4D7SA 1ENSA 2E7AA 5C8WA 2XG3A 3VZNA 3AL5A 3FX3A 4NRQA 5H9RA 5DUXA 3AM2A 5FP4A 1SQ4A 1H6XA 1H8TC 1N1SA 3THCA 4LO8A 5I8TA 2BWAA 2XWBB 4QDSA 2ZAAA 3JBG2 4Q4W3 2TNFA 2VXRA 3FWEA 3IIIA 3N9OA 4QT6A 5F5CA 3VBFA 1SLCA 5FTTC 4B8EA 4CEYA 1U5IA 2VOTA 4CU9A 4LITA 3DGTA 3LKJA 3VBUC 4QGNA 1OOPC 1UY0A 3VBRA 5H9PA 4PQQA 4UOJA 5CFDC 4PDWB 4CE8A 5E6HA 1EV11 2VECA 1NCQB 2BBAA 5BNQA 1RVF2 2ZGKA 3VHOA 2AC1A 4EE2A 3FLPA 2B45X 4XURA 3UETA 4JV4A 4LE3A 1NA1A 2VH9A 1BEV1 3VZLA 1ZREA 3Q8BA 3MGUA 4Y3OA 5LB6A 1T6BX 2Q8OA 1EPWA 4JDOA 4H2AA 1QNYA 4QB1A 1F9KA 1UOGA 3DKWA 3WF3A 4FPJA 5FZ3A 3FN9A 1AR71 1O4YA 2RR13 3M2MA 5J3UA 4M0NA 1SMVA 1Y9GA 2XXZA 2VJXA 3PVOA 3ELNA 4SBVA 1KGYA 5FFOC 3GBWA 1OA3A 2DCTA 4FPGA 3LQCA 1PVC1 3O1SA 4UFLA 1CAXB 1NA1B 3TWIA 4OMDA 2MNGA 4B4PA 5J36A 1UOFA 3ZIXA 1YC61 1HRI3 1JMUB 3ZYRA 1YEWA 1JOBA 2UU8A 2D5HA 2VG9A 4EROA 2E6VA 2ZGSA 3AYEA 2QQIA 4A6SA 3WW2A 2YYOA 4D7YA 1NCQC 1UCXA 2WFPA 5CIRA 4EN9B 3KT1A 4DO0A 1GSLA 4CEYB 3KT4A 3MW4A 1Q8SA 2WQZC 2WSUA 4Z07A 4RGGA 4Y22A 1SFYA 1RHI3 3E1F1 3VZMA 3DN7A 3POFA 4K1ZA 1O5LA 5JMOA 4ZXKA 2VQAA 1FI2A 1XU1A 2FZ1A 4EN0A 5C5TA 1JHNA 3U07A 1XNDA 2BNOA 3OUJA 1FMD1 1W3XA 3VZKA 5E1RA 5CFCA 5KC5A 5HI0A 2TUNA 2ZMKA 3RYRA 1O8SA 4FTEA 2Y0IA 2V4VA 1DBNA 1UYXA 1RUE3 4LPLA 5A1LA 4V2WA 2B39A 1J3RA 1DFQA 1QXJA 2BW8A 2J7MA 3DYOA 5FLIA 3PU3A 4PIYA 1IQDC 2Y60A 5IVCA 1RUE1 1Q8PA 4Q4X3 4W8JA 5I0UA 1SLLA 2A5ZA 3NV4A 2HKXA 1WMXA 3MIBA 5J1XA 4Q27A 4P9YA 2RV9A 1R081 2K9ZA 1W2OA 3ENRA 1IGOA 4OCTA 4XABA 1V9U1 5LRSA 3R0RA 5E8AA 1AX0A 5L36A 4FFIA 4AI2A 4EN7B 3I3MA 2OQ6A 4NPMA 1RGSA 4HKOA 4I0AA 5G05L 2YHJA 4YM1A 1YFXA 4AVTA 3IN9A 2FCTA 1SBDA 3ZXDA 4XTMA 2CAUA 1DP0A 3H3UA 4CCNA 4QAWA 1PO22 1JZ5A 1F31A 2YFZA 1UY4A 2ZGUA 3MLLA 1O3QA 1UOJA 1AXZA 4FP3A 1N1VA 4Y33A 1JODA 2E7TA 4NHLA 1VMHA 1C28A 1DIWA 1W9YA 4S2GA 1AYN3 4XFHA 4OI4A 3U0ZA 2WO2A 4JGZC 1W6QB 1XNKA 1NCRA 1LRHA 1LULA 1PZ9A 3SNMA 2BGCA 2QUOA 1C5HA 4Q26A 4XDOA 4Y1VA 1SBEA 2HYXA 4Y20A 1OI6A 1BZWA 3AL6A 1O4TA 5FPLA 3FLTA 3KT7A 1UL9A 1YQ2A 1PO23 4PF1A 3HR9A 1PGL1 1I9RA 5FZOB 3K3NA 2W1UA 3W5MA 3PUQA 3WD5A 1FOD3 1NQDA 2P3KA 1DF0A 2GNBA 4R8HA 3GCXA 3WP6A 4CUBA 3S5AA 5CAZA 3TRSB 1AYN2 3HQXA 1TQ5A 4MGYE 4DY3A 5A7NA 1PX4A 2ZXQA 1LECA 2Y6GA 4YVWC 4QHZA 3HJRA 2YBSA 3K4ZA 1S2EA 4NRMA 5FP9A 2QQNA 3DECA 3MPBA 4AGGA 3E6DA 1EV13 2DU0A 2Y26A 5FZAA 2LS6A 2E32A 2ENRA 4ZU4A 3VDAA 2DVBA 2ZHKA 2WUHA 4QX5A 2XLAA 3M3QA 2JJ6A 2HWF3 4IEZA 4M3CA 3LA3A 1HIXA 3BGAA 1JZ8A 1CR7A 1D0GA 1AZDA 3A22A 5EYYA 5A33B 1SG3A 3N35A 4YG3A 4BK4A 1BCXA 1N1YA 1YI7A 4GAZA 1VRH1 1O59A 3CIHA 2QNKA 1ULEA 2W39A 4N8MA 1QH7A 4P9LA 3KGZA 4R4ZA 3QACA 5APAA 1RMU3 2CGNA 3POWA 3WG3A 4HVQA 4DUXA 5FZIA 1TMF1 3B9IA 4WM8B 1ZVFA 2GC2A 3KHBA 1DGWX 3WNKA 2WS91 2NM1A 5I0DA 3GGLA 2VCAA 3LSDA 1ZZ9A 3D82A 4E4ZA 5BNOA 1UWWA 2RE9A 4N43A 5EWSA 2HWF2 5F5IA 3TNPB 3D4KA 2Y33A 2OYZA 4DEQA 3K77A 1IKQA 5B4XA 4R9CA 2YROA 3S0MA 3IWZA 3VD4A 4CXYA 3ETPA 1COV3 4YVWB 5CA6A 5FPVA 5FZ4A 4DUVA 3WHTA 2YGLA 3I2KA 4LBQA 1RVF1 1W8OA 2A70A 4QQOA 4I2OA 3AZVA 3RZJA 4BQYA 2PQQA 3LEIA 1O8PA 1DGWA 2AENA 4N7UA 5KHIA 5M0TA 4UBGA 1RUJ1 1LKNA 2AEZA 1QNWA 2VMGA 3VKOA 4LBQD 5JZGC 1VRBA 3KB5A 4CPBD 2QFEA 2VCBA 3O1RA 4TWTA 1UQXA 1G8WA 3KCCA 4BU2A 3RWNA 5FREA 3PVEA 1PK6C 2FMYA 2R041 1Z78A 4G3YC 2VCCA 4AFBA 1JYVA 1V6JA 4D6QA 2DYCA 3USUB 2BERA 4YVSC 2RS12 3ZMOA 1RUF1 2GU9A 3GXUA 3POGA 4PIXA 3KLSA 4BISA 2Z5WA 5HCHA 4AR2A 4DEVA 1QOTA 3KWVA 2Y64A 5LEJA 3MIFA 1H1IA 2DWRA 2W68A 5T5JA 3VV1A 2JG9A 2VTXA 3VD7A 4HPKA 4BQ3A 3FFZA 4I09A 3AZYA 1HB2A 4LOTA 1YFYA 5C8CA 4QPYA 2CNAA 2RS31 1FX5A 3LPFA 2DTWA 4XZPA 4OVEA 3ZXAC 2OS2A 1A6CA 5JSRA 3T4VA 3MICA 4KWKA 4CP9B 3H9AA 1LJ7A 4PQ9A 4U36A 1RUH1 1XB9A 3ZFGB 4COZA 3TEZA 2IVJA 4JQTA 4RD7A 1W04A 5CKQA 4YZ2A 4BIFA 3A7QA 1VBB2 2ZJCA 3M3OA 3OBAA 1H30A 1DHKB 3SKJE 1WCDJ 1UZ0A 2C9KA 1OA2A 2OZ6A 3KV5A 2RDRA 1HQNA 3ZFGA 1RC6A 1W6OB 3CEWA 5FXWA 4Y4YA 3EXUA 1J3PA 1DU3D 3ACLA 3V65A 3O12A 1BKZA 1W6NA 5FLHA 5FZCA 1YXWA 4L9BA 4Q0VA 5DZGA 3GZAA 2RHPA 2YY1A 1W3VA 2OT7A 3VD9A 4LO7A 4AEKA 3J26N 4RGAA 2R073 3O0VA 2ADDA 2EXJA 2XHNA 1X8MA 4YRDA 1V00A 3OY8A 4HT1T 4NVPA 1OPMA 5CB7A 1JW6A 3B00A 4H3WA 5A3NA 2OPWA 5CFCC 5GZCA 1VBB3 1SLIA 1TME3 3VHPA 1MVQA 3RZMA 4C0BA 2ARAA 5EFUA 2Q1MA 2BEOA 1PM4A 2ARXA 1ZBA3 1ULCA 5FZ8A 5L9BA 3I59B 4A4AA 3I97A 2SBAA 4HFSA 4IE0A 4LEJA 1V6NA 3GZTB 4JGYC 2O1QA 2WT0A 3BKZA 2R30A 1TMF2 3FL7A 3EJKA 4JKKA 4QKDA 1DDLA 1C5IA 4M3CE 4UW6A 4XF4A 4YW3A 2GNDA 3RMXA 1HX6A 4NHMA 4FTBA 2Q4SA 1STMA 4XW3A 1ST8A 2WLPA 2YB7A 3BALA 2W1WA 1RJ8A 2PHRA 4WVVA 1S55A 4JGYA 5JIAA 3OUHA 2WT1A 5BNPB 2ZEZA 3WP4A 2WNEA 2ZACA 1LHVA 3NNJA 3BIEA 4KU7A 4KNCA 2I07B 5ACA2 1SLBA 1ENXA 1NY71 1YIFA 2BU9A 1EUUA 2HWB1 2QQKA 3TN93 2D44A 1W9TA 3AMNA 3SC7X 3B02A 3V0BA 1DG6A 5DUVA 1MS4A 2ORXA 1W0OA 3DF0A 1L7RA 3VKMA 1PNGA 3V0BB 3J8F2 1H2MA 1PGSA 3M4FA 1HB1A 1W39A 1S1AA 1NCRC 3KV4A 2D6LX 4Y1XA 4EWEA 1QJFA 3ZSJA 2LROA 1JOJA 4XBNA 3NQHA 1I6XA 3BODA 1BVVA 1PVC2 5ACA3 2MEV1 3VBOA 5BYNA 5DAWA 3O1VA 4R9AA 3BPZA 1PGW2 3ZLIA 1FATA 3O14A 3JD71 2Q5TA 4DRVA 3T2QA 2V72A 2ZX4A 4BJ0A 3LCPA 4OI2A 2X53S 4C8DA 5T5LA 3AMPA 3B7MA 1JYNA 1AR83 3GBFA 5BNPC 1UX6A 1WA4A 2BOJA 5LWBA 3CF6E 3KGLA 3NAPB 3B5LB 3IBMA 3RZZA 1TE1B 3LEMA 1J3QA 4XACA 2GNMA 3Q8EA 5ABJC 2XKPA 1W03A 1LGBA 2QQJA 4FFFA 4IXLA 4JRAA 5FZLA 3ATGA 3SKVA 1VMFA 4SLIA 4Z82A 3N9NA 4AFMA 3TNQA 2UY8A 4Z2AA 1NT0A 1SEFA 5FKCA 4PJYA 2B42B 1LESA 5E88A 4BYYA 2ZGTA 2R6QA 3K46A 2CDPA 4CDWC 5AVPA 3C7EA 1FT9A 1OVSA 5D8AA 1FV2A 4YVWA 4AEDC 1LEDA 2QCSB 2WNUC 4MHRA 1UY2A 2WN2A 3FJSA 1KXGA 4YGCA 1OOPA 3OTFA 5EP9A 3WNXA 1LHOA 1HJFA 2WLQA 5FXXA 5A3LA 4CCJA 1G9CA 1J59A 3VBHC 1ZRRA 1BJQA 3HWJA 4E2GA 1ZZBA 2WAOA 3E5QA 1Y3TA 3LPGA 3HNMA 1IPSA 3DKQA 2EIEA 1D2QA 4MXWA 2X09A 3ACGA 1LU2A 2YZ4A 3IMMA 5C71A 3I8TA 4I02A 1RHI2 4QDQA 1WLWA 1JXNA 3NAPC 4WVZA 1YJKA 5FYIA 5FQ0A 5IK4A 5KHKA 4QPGB 1IOAA 3O5SA 4CUCA 1R64A 2C24A 1LCLA 2ZGRA 2ZABA 5FMOS 2MPFA 2AGSA 2YU2A 3AYDA 4I3PA 3SCFA 3WNMA 2YBKA 5A1FA 2DCKA 2VCMA 4MGSA 1T2XA 1W8WA 1GNYA 4AQSA 1MS0A 4FPLA 3NMBA 5LA1A 3KVAA 1AL21 4UF0A 4QU2A 1QKQA 3DV8A 2D6OX 4NIHA 1UMHA 4P00B 5FYYA 4RGKA 3AP7A 2F4PA 1XYOA 4HBNA 2FCUA 1AHSA 2W87A 2JDKA 4ISQA 4XIOA 1ZBA1 2I74A 5LA9A 5IUQA 4PLMA 3MFAA 4AFDA 4K7JA 2B9VA 1R091 2LM3A 5EJ3A 2Y6KA 5K4LA 4RR3B 1IQAA 4Q8LA 2AUYA 4LO6B 2DUOA 3E5UA 1M06G 3AMMA 2W08A 2R16A 2L9LA 3J7MA 4HSJA 1UXXX 5GKAC 2XL7A 4RSUA 4TXWA 4TTGA 1QXPA 4ZXEA 5C3QA 3VBOC 2D3SA 1AR91 2RDQA 2DCYA 3D8CA 4FPHA 4MXVA 4Q4V2 3WCSA 3OYWB 3S6PA 1VR3A 3SEPA 4QPGC 2QBXA 4DQAA 3RSJA 1QJU1 3C7GA 2VBDA 4IEQA 2WZR3 1QOSA 2XKOA 3VN4A 1H8TA 3OEBA 3ACFA 4IGQA 4E2QA 1ZNPA 2BNNA 3OGVA 5JIUA 4AI3A 4DINB 3GF6A 2XVLA 1REFA 3OOXA 2J1TA 1REEA 1XYNA 5FPZA 4BZ4A 5A80A 2VBBA 2P3IA 2FD8A 2VMHA 4AHWA 4PHZA 1LHWA 4RS5C 5JZGA 4N90A 1U5ZA 3AXDA 3MV01 4YZ4A 1SZBA 2QZ3A 1G9AA 3KS7A 2P3JA 2JKBA 3U78A 1QMJA 5FBJA 2Y0OA 3SEEA 4FSJA 2PN5A 2VAUA 2WFF3 1OLQA 2FDGA 1VBC2 3WDYA 1XBFA 1AR93 2XJTA 4PDWA 4HL0A 5FP3A 5F2SA 3BUCA 4LLFA 1WD3A 4QPGA 5DUWA 1OURA 4MOAA 4E9KA 2JB4A 2PHXA 3N9LA 4A7KA 5L73A 2XVGA 1LAJA 1OLRA 1BLZA 3H3LA 1HKDA 5FZOA 5L7OB 1MQTB 1RUJ2 5KXBA 2D40A 4ES9A 4IE6A 2VOXA 4OQ9A 2UYAA 3NV3A 3ABZA 4XF0A 4MYEA 5BUVA 3QLQA 4GH4A 4OUEA 5C9AA 3O0WA 3H7JA 1DQ2A 1UU5A 1I3HA 2WBKA 5FZGA 5DABA 1OHFA 1DYPA 1KJRA 4YW1A 2IZWA 1OOPB 2D3RA 2JG9C 2V09A 2VZTA 5IK8A 2GC1A 1W8TA 2PYTA 3THTA 3ZFEC 2CGPA 3N3HA 4IEYA 4QXHA 2ES3A 3H50A 5JAXA 4QM9A 5KR7A 2G9FA 2ZEXA 5FZ1A 1OLME 4HK9A 2D3PA 4OI1A 5BV6A 1QDOA 4XCAA 5FOBB 2W3JA 3USSA 3S5QA 3C7OA 3TOJA 4XC9A 1YWKA 4UBHA 4XUQA 5FYCA 1HRV2 1KJLA 2CL2A 4GJYA 4Z92B 5JXJA 3VBSB 4NHKA 2BOIA 3B9CA 4FAGA 1DZRA 1B35B 2IFWA 2R1DA 3H0OA 4L92A 5A7QA 1RUD1 2ATFA 2FBEA 3D5OA 2VUCA 3BYWA 1VPHA 4JKLA 3N7JA 4OHWA 3RS6A 5L7OC 3VBUB 3LOIA 4Z8BA 2FZ2A 1N1TA 4AI8A 1JI6A 4FQZA 2W94A 3ZOIA 5JDBA 1FPN1 2CY6A 2DVGA 1HXS3 3DYMA 4HANA 4NHXA 3WZ1A 5A6YA 2P1BA 1ND2C 4BE3A 4A2UA 1PM7A 2VTXJ 2WQ8A 2B7YA 4D0QA 1O7FA 3JD72 1JYXA 2IXKA 3JQXA 4JHZA 4OHZA 1UZVA 4AEDA 1QQP3 4Y5TA 3IAPA 1A3KA 2K46A 2Z79A 2WZR1 3AYAA 3CJIC 1V6LA 3KF5A 1W05A 2HEYF 1SLAA 4OHVA 4XAEA 3U37A 4Y5SA 4D8MA 5JPNB 4CDWA 1OH3A 2VVDA 2WO7A 2IFRA 1CD3G 2YFUA 3BIWE 1NY72 2HWB2 2VZSA 2WA3A 1V6OA 1XSQA 1ZZ8A 3LDKA 4URTA 4JC1A 3S57A 2NLRA 1K12A 1H2LA 3HMYA 1FXZA 4XJ8A 5HCFA 1HXS2 2Q0AA 2EALA 3H1MA 4JAAA 3O0XA 3AP5A 5F3EA 4LBMA 4ES8A 3KQRA 4JGZA 4I0BA 2CGOA 4YM3A 2VOVA 2XJRA 1B35C 1SHWB 3AX4A 4UW5A 3T0AA 3TEXA 4P5HA 4Z1VA 4NIAA 2DFBA 3ETQA 4Q0QA 4QQ2A 1ULDA 2JIJA 4IEUA 5BNOC 1YO8A 2C26A 5FYBA 2VMFA 3WF1A 3WF2A 2GSYA 3ZYIB 4K20A 2R072 3M3IA 3TAYA 5C3PA 4A42A 2QKDA 1COV2 1PX3A 2HBTA 5F2WA 5KBFA 5JOXA 5FR3A 3FUQA 1W2TA 1D0HA 2VNVA 4Q0PA 1RXGA 1XSRA 1JYWA 2NMOA 4P9GA 2NQYA 1UPSA 4PIZA 4S2FA 3SCHA 3N4MA 1DYOA 1GQHA 5HXMA 5C6CA 2VUJA 4CDQC 1OPOA 1PGL2 4QM8A 5HPOA 3ZYFA 4PF5A 1IS6A 4LUMA 1NLRA 3AK0A 4AG4A 1TMF3 4DZGA 2XBO2 4AQTA 2XBO1 4WVWA 2JD9A 4AL9A 4I30A 2VC9A 1OSGA 4BLIA 4P14A 3MW2A 3VBRB 3WXPA 3CNAA 2ZKLA 1LODA 5G04L 5EXOA 3T0BA 3HVDA 4CCEA 1R1A1 4LKDA 1LTEA 1RUI1 1UF2C 4YZ5A 4YNIA 1FNYA 5FY9A 1W0NA 4I3GA 4DOUA 2JDUA 5A6XA 2PAMA 4BPZA 2EXHA 4GWJA 3RDIA 3TN91 3TN92 2B5HA 2D43A 4ZONA 4LQRA 5GZFA 2XJUA 1EUTA 3POBA 5LA0A 3WINE 1HB3A 1UZWA 4KBBA 2NZ9A 1C4RA 1GU3A 3ASIA 2NPIA 3OD0A 1MZ5A 4MGZE 4GA9A 4BMEA 1EAH2 3FLRA 4JRLA 1GP6A 4ZHNA 2DUPA 3OD4A 1YLLA 4QHOA 2E7QA 3H8XA 1CAUB 1ZZ7A 2PHTA 5F5QA 1FV3A 1XJAA 1YQ6A 1JYTA 4YARA 1RUC2 3MEPA 2A6WA 1K3IA 1UN1A 1VJ2A 4GH4C 2A3WA 3O1MA 1XYPA 5JXHA 5EZWA 1DLCA 4MLOA 3OGRA 3OEAA 1GYKA 4M3CF 5JVVA 1F35A 2UWAA 4OLLA 2HEWF 4P9IA 4QPIB 2UWBA 3M1HA 4Q8KA 2X5IB 4QMAA 2EIBA 3M70A 4ZU7A 1RUH3 5GM0A 4TLFA 5DG2A 1GOGA 2W46A 3PJQA 4Q4Y2 2W1QA 4AAPA 3ON7A 1CESA 4XUPA 4UW4A 4AVCA 3X29B 2P37A 4K3UA 1LU1A 2VQTA 2VW0A 4LBKA 3ZYBA 5FLJA 2GAUA 4N9HA 2BUKA 3N9MA 4IEWA 4ZY9A 4DY5A 4C1XA 4AE2A 4JZRA 4L97A 4WZFA 5F3GA 1RUI3 3CQOA 4EWAA 5BNNC 4BM8A 1BHGA 1N47A 1P8JA 1YHFA 2DDUA 1NLQA 1OD3A 1AXKA 4LBJA 2G1MA 2Z42A 4NWVA 3HOBA 1QJU3 4H7MA 5FY1A 5JZGB 2RS51 2ZAHA 3DPRB 4QQHA 5J98B 1NQJA 3H8RA 3T30A 3UL2A 3QCWA 2GH2A 2GMEA 3K4DA 5C9AC 2VVEA 2YUEA 3SMHA 4E4HA 2NP0A 2V5YA 4YW7A 3THPA 1VRH2 4CSWA 3PMSA 3CO2A 1KFUL 2CYFA 2FMDA 2QDNA 3OBTA 4IV3C 3RZGA 5KXDA 2ZGOA 4HXCA 4MG2A 3MHZA 5KXEA 2VUDA 4HKLA 4YZ1A 3I3BA 1JZ6A 1OKQA 2BBVA 1MS5A 2Y34A 4XETA 4FPEA 5LATA 2R062 1Q56A 2RG4A 2HWE2 1YQ8A 5DZEA 5I8SA 2Z4FA 1VB2A 2YPJA 3VHNA 1Q8OA 3O1UA 4I01A 2LW8A 1S2BA 5A7OA 2JWPA 3ZFGC 4UW3A 3C2UA 4BQ2A 4EN6B 5K0UA 2YPDA 3TEWA 1WLCA 1RUG1 4XJUA 4IL7A 3IAQA 1GQPA 1F8VA 1VRH3 5CU1A 2VO5A 2VQUA 4CEWB 3MYXA 2VZVA 1AR82 3NV2A 1POV0 4IQPA 2GNTA 2WSVA 2OPKA 1IG0A 4MADA 1NX9A 3M7AA 3QBQA 3ZXGA 2HLEA 1CZVA 1SPPB 3C7HA 4IV1A 2DUQA 4YSFA 4BWOA 2WA4A 2QQOA 2ZHMA 4CCKA 5JMCA 4QB6A 2P5BA 4P02B 5DAQA 4BA6A 2AEYA 2DVFA 2KM2A 2E51A 3CLPA 4JKMA 1YUDA 1BK0A 1CZSA 2BVBA 2VTFA 4MSVA 4XOGA 3WF4A 2LRPA 3ES1A 4NPRA 3LA7A 1GBGA 4QXBA 4XDPA 3ZFEA 1QGLA 4MGTA 4Q4V3 4A45A 4XFBA 1OLMA 2PFWA 3K51A 1RVF3 2HWC2 3J9SA 4XQWA 4FAHA 1B35A 4P5YA 4PCRA 3ZXJA 5C3OA 4IERA 1VLNA 3M8LA 2EA7A 3AJZA 4KQ7A 3LD8A 3PNAA 1D4VB 4MXWB 4QX8A 1UIKA 1X9PA 4OUSA 4K21A 2ERFA 1G9FA 4FFGA 5C5UA 2E53A 4WV8A 1QU0A 1WCSA 3WQBA 4LE4A 5A3OA 2OIIA 3NVCA 1UU4A 3B69A 4YM2A 2XDVA 2WNUA 1RMU1 3ZN6B 4BQ1A 1S0JA 3MZHA 1CZTA 3T2OA 2R0FA 1QIQA 3GM8A 5CISA 2XR4A 4PT6A 1YJLA 3WW1A 2VMCA 3D3AA 3MIHA 2AH2A 3C3VA 5FPXA 4M4PA 5EHDA 4O61A 4AF9A 5FMCA 1VBC3 1I1EA 1ND2A 2RJ2A 1VAVA 2WZ8A 2D93A 1AR92 2N7GA 5ANNA 5CEHA 1HN1A 5FYSA 4QX0A 4ARYA 3EB7A 5FY4A 1TG7A 3KCXA 2ZGLA 1OF3A 3QOPA 3H3ZA 4A3XA 3PUAA 3UKVA 5CBLA 4NWWA 5E16A 5FZ0A 1OQEA 2G9ZA 3NO8A 4MGQA 1XNCA 3ALQA 3D0JA 3E5XA 5FYZA 3NL1A 3B93A 3ZSLA 1RUJ3 1UNBA 1VB4A 1LNSA 3GHNA 3P3NA 4L99A 1JN2P 1X33A 2ZOEB 4KBZA 2EF6A 3T08A 4CTEA 4CDXC 3UK9A 1ASJ2 4YG0A 2A7AA 4BQXA 1ASJ1 2A6VA 2E26A 4D6SA 1S2KA 1Q5OA 2Y6LA 4AXOA 1JUHA 5CG8A 4DMIA 1KD7A 2BVVA 2OW4A 2ORZA 5GALA 1AX2A 3WP5A 1A8MA 2HBUA 1C8M2 4G4FA 3ACHA 2WINB 2MEV2 5CADA 5FUPA 1LOBA 4BOWA 2DTYA 2TBVA 4XFIA 1GWKA 3SHRA 5T3NA 2WS93 4YW2A 5A70A 3MDPA 1UZZA 4PLNA 3BOWA 4GWIA 2X5IA 3UKNA 2WZR2 2X29A 4FCAA 2K0GA 3KHCA 5ABJB 4QKFA 5J48A 4XJWA 1XPWA 3W58A 1TVGA 2HYKA 3IPVA 2G19A 5DQ0A 3ZXKA 1H2NA 2ZHNA 1W8UA 3ILRA 3SXWA 1TZOA 3N36A 2UY9A 4C90A 3OGGA 2IWGB 2FDFA 3VHRA 4LTAA 3JQWA 1VAKA 3AZWA 3CHXA 3L9JT 3POIA 2ZMNA 4IGPA 4O9GA 1JS9A 4LIVA 4NAMA 3SISA 5BNPA 4NE9A 1QOOA 3THDA 4AVVA 2WS92 4O7XA 2CSGA 3BTYA 4CEYC 4TYSA 4PLOA 1FMD3 5GZEA 4WBBA 2WFF2 1MS3A 1W9SA 4WVMB 1ZRDA 4LO5B 4QKBA 1DGRN 5FDBA 1C57A 4XPVA 3FZ3A 4Q4V1 3VDDC 3VBFB 5AFBA 4MX3A 1Y9MA 4HVOA 2YXSA 4LORA 3AKQA 5EJZB 3AFKA 4FO9A 1QQP2 1XXNA 1M4WA 5FPAA 4UWDA 1W6MA 2WNVC 2VXJA 2A6XA 3ZIWA 4LJHA 3BI3A 2RS52 4RS5A 4XE9A 5FO8B 2W2IA 1HRV1 3WOGA 2GP5A 4E4SA 3HEIA 4IUGA 3WV6A 1AJOA 1FOD2 1LOCA 5IATA 5AVAA 3OSDA 2JDYA 3HBKA 3SH3A 2VULA 1WMDA 1SPPA 4LK7A 3IDAA 1E5RA 1S0CA 2C5DA 4CCOA 4COYA 2B4KA 1GICA 2XQXA 5FY8A 3UESA 4MH0E 4RQPC 2HH9A 4KL1A 4MGIE 2ZPXA 3KMHA 3HPNA 2IXHA 4FP2A 2Q8CA 5LZ6A 2RS53 2PQSA 3OGSA 2EAKA 3R4UA 5AC92 1ZYBA 2KXLA 1WCKA 4QXKA 4AQ6A 4OMCA 1UIJA 1V70A 1AR61 1VBD1 2B46X 4QHBA 3U14A 1RYYA 3B94A 4CU6A 2JKXA 2X10A 2C0ZA 3A0KA 3VBFC 2OZJA 4QDRA 1BEV3 4F83A 1HDKA 2FHRA 4IEPA 3ME2A 4RR3C 1AVBA 5T52A 3RI8A 1IS3A 2EICA 1HRV3 2DCJA 2WNVB 3WQ7A 4HN1A 3JB4C 5C33A 1DLLA 2W1SA 3I2FA 4FPOB 2RR11 5A7SA 3BTXA 4UYBA 1HQWA 5F8PA 3M3CA 2XBO3 1CX1A 3LDBA 2QZ2A 5FK8A 4K40A 3PMEA 5AC93 4M4RA 5LBFA 2YDEA 4W6WA 1ND3C 1BBT3 3NW4A 4M01A 4CU7A 3LSEA 1QEXA 2UWCA 3GZUC 5BXXA 3URFA 3PURA 4EWDA 2KA3A 4PI2A 3S30A 1AL0G 4MVTA 3RZKA 4X8NA 5FY5A 2CU5A 2W47A 2WDBA 4PI0A 3N7MA 3I2DA 4RQPB 3INAA 2VE1A 2OKXA 2W95A 1D4M2 2CWSA 3MFCA 2R0HA 1GZCA 1EY2A 3P1IA 2I45A 4KG0A 2JDPA 5JWPA 2FDHA 3OY8B 3POYA 4LK6A 4XXPA 5B4NA 2GMPA 5JLVA 2ZX3A 2JEMA 3KSCA 4OFGA 1NG0A 4I0WB 2ZGMA 4IE4A 1O3SA 3P3PA 3VBOB 3MBWA 4GKXA 5KHHA 4XFGA 2EXKA 1BVP1 1JHJA 3WCRA 3LWCA 4KG8A 4BB3A 2GN3A 3VD5A 1A34A 4MZUA 1VBE3 4IV1B 5LCWL 5FMBA 3VLBB 1V0AA 2DVDA 3WF0A 5GZGA 2QQPA 1D4M3 1HV0A 3ZYPA 5BNNA 3GZEA 2VQ0A 4META 3RG0A 1HQLA 1S4CA 3RWKX 4WM8C 3WQ1A 5KHJA 2ZTNA 1G7YA 1DGRA 1ND3B 4W6XA 3LIGA 5TSWA 5ACA1 2JX9A 3JU9A 2IUWA 2H6CA 1R083 1CONA 3NRUA 3GBGA 1US2A 5C8CB 1RL3A 1UMIA 4NMIA 2JG9B 1JU4A 4KH9A 1VP6A 4Q0UA 4Y1UA 4ATEA 5FXZA 1CAUA 2VZOA 2WT2A 4FTSA 4ISRA 4GULA 3AKTA 5T54A 2BWCA 2WRAA 2D6KA 3LFMA 4IESA 1YYNA 3PVNA 2RMU1 4GB33 4XJ9A 2V73A 4QB2A 4AHYA 2P3YA 4CDUB 4IW3A 4XF3A 3LGRA 2WYSA 1OA4A 1XE7A 1MQTC 4GMP0 3WUCA 1YFUA 2D98A 4Y24A 2VNOA 3DPRA 4N43C 3LB9A 1UKGA 3NJVA 2X05A 1W99A 2ZA9A 3ZM8A 4YVSB 1JYCA 5FZ7A 3IKWA 3B01A 4XF1A 4XUOA 4ZKTB 3HIFA 4WVMA 2DFCA 5A7WB 1LGCA 3MIDA 4GB32 1G6NA 4PBPA 3FBYA 2C4XA 3HQUA 4L2NA 4OHXA 2DCZA 4J1XA 3ZXLA 1W6NB 3L2HA 4ZS3A 3T2PA 4N53C 5T5OA 4BIOA 1HB4A 1LOAA 1EAH3 3V64A 1Q8VA 2Q8EA 4QX7A 3WDXA 3VBUA 4Q1PA 5FUNA 3K2OA 5IVJA 3EHKA 4QX3A 2WIIB 1URXA 1CVNA 3OBZA 2HWC1 4QPIA 1NOVA 1W6MB 2B8MA 2R071 1JZ2A 2E31A 3VBSC 4B3NA 5A33A 1KS5A 3DXTA 4J25A 3LF7A 4XILA 2PLV1 4W4ZA 3Q8AA 3R6SA 5DG1A 3AB0A 2ADEA 1H8TB 2V5DA 4EZHA 1SDDB 2JDHA 1VIWB 1SACA 1QJY1 2FQPA 2VVFA 3RMYA 1HW5A 1LOFC 1ZBE1 4XZUG 4Q4Y1 1RUH2 2Z69A 2G4IA 2YC0A 1K5MC 4DXRA 3OYWA 4X6QB 2RDSA 5FCCA 3A23A 4Y26A 4QD2A 4W6YA 1XQNA 3P5BA 3T3YA 3C7FA 2R042 1WBLA 5FZEA 5IJRA 3UGHA 5CFDB 3D6EA 2FDKA 1W8HA 1H1MA 4CXXA 4DFSA 4DUWA 1UXZA 4P9JA 4XFAA 5FJHA 5GZDA 5H9SA 4B7EA 2ZBJA 4W65A 1C1LA 3W59A 2B9UA 4CDQA 5ABJA 5IFPA 1CIWA 2HWE1 5LK5A 1LHNA 4F3JA 1RUI2 4TLGA 1CJPA 2QQVA 3ACIA 1KQRA 2HEVF 1AR62 4XIKA 2O0OA 3AXEA 4CCMA 4C0HA 3RPQA 1H4GA 2Q30A 2NMNA 2DV9A 4LHLA 1ZBE2 4YLZA 4XFCA 2ARBA 4P08A 5DDJ2 2GC3A 4ORFA 5F32A 5LW9A 5BNOB 5IK7A 1WKYA 4DXTA 5LRRA 3VGIA 3WG4A 4HONA 4RN5A 1K5MB 4CCCA 3SCGA 1ZA7A 2E9QA 1AYM2 2IXCA 3AP9A 2WZEA 2QDRA 4RQPA 4D7TA 3C8XA 3WDWA 3BTAA 4A7YA 3WG1A 1OT5A 5EIYB 1VAMA 1POV1 1MEC2 3CZUA 1GLHA 2PHFA 1MEC1 1XC6A 3I3DA 3JCIA 4AAXA 1D4M1 2OUJA 2ZEWA 4AI0A 4D69A 1H2KA 5JOZA 5KWRA 1QJX2 1ALYA 4XHXA 5F9TA 2HWD2 3PU8A 4DXSA 1GNZA 3MIEA 1MR5A 1KRIA 1GZWB 1UAIA 2WABA 2Q1FA 3ST7A 2YC2A 3ZSKA 1EPZA 3MF9A 5C70A 3I2JA 4LHNA 2BDRA 3OBRA 5I8YA 5IK5A 4XBLA 3I3QA 5D8AB 2E33A 4H55A 1KDKA 4XJZA 3NNLA 4E8CA 4AHXA 1TEIA 2J1SA 4GH4B 3AKSA 2FCVA 3UGGA 2CV6A 2DF7A 1JZ3A 5A3PA 2JE7A 4GMP1 1C8M3 1X7NA 2WQ4A 2MEV3 4CDXA 2ZGNA 3JZVA 4CCDA 2D6PA 4NAOA 4LUKA 1QJX3 4NROA 1NZCA 4QPIC 1SFNA 1O6UA 3FBMA 5FIXA 2FDIA 3O1PA 4YPJA 5FO9B 3QD6A 3NAPA 1W2UA 4CDWB 1NXD1 2XWJB 4HZFA 5ANQA 3WDTA 3NV1A 5DAVA 4N7IA 4AEDB 4COUA 4FXGB 3I2OA 2A3YA 2J1UA 1RUG2 3NJXA 1W6QA 3ZFFA 1QJY2 5HV4A 1FOD1 2J1RA 4ONUA 3VBHB 3CBNA 1GWLA 2KR2A 4FOWA 3ZMNA 3VBHA 3PTYA 2PA7A 1LENA 5LEKA 3D0SA 3ZFFB 2YC4A 3ZYGA 5LASA 3AC0A 2WYFA 1VE0A 5A3WA 2LUWA 1CJDA 1DYKA 1GQGA 4NIGA 3FHQA 1FMD2 1Z7S3 5D8AC 3H7YA 5GLTA 3U75A 4CYDA 4CUGA 2OA2A 1C3HA 2D97A 3UJOA 1WMFA 2PHUA 4GQ7A 5C4WA 3KVBA 3TBDA 5JSOA 4ITCA 1RUG3 5HXVA 1MS1A 1NZIA 3GALA 5K9YA 2X8KA 3AZXA 1WW5A 4FOVA 3APBA 4ASMB 1XRUA 2VMIA 2WWSA 3H8OA 3FFQA 1LOEA 1RUE2 1IHMA 1UY1A 5JOYA 5CZKA 1H1AA 3V56A 3POEA 4FVVA 1POV3 1NCQA 2HWD1 3IDEA 1PIV3 4IE5A 1DQ4A 4X8PA 4AVSA 1YNAA 1MS9A 1V9U2 3MO4A 2J42A 1SBFA 4LNVA 4XHBA 3OUIA 4GWMA 2ET7A 3AP6A 4ATFA 4RYDA 1ASJ3 3H1WA 3JBG1 3U11A 4HKWA 4LBOA 1UYYA 3IPVB 2R1BA 5JCTA 3AMQA 4WM7B 3ILFA 2VNGA 4MGKE 3WVJA 4RHV3 5FOJB 5HBAA 5I0RA 4YW4A 1W9WA 3WHUA 3A21A 5A3MA 1X36A 3DPRC 1JU3A 2ZMLA 4INDA 1MQTA 5FMOL 5HCAA 3VKFC 4B1LA 1DQ6A 1ZZCA 2ZX2A 4M00A 2ZGQA 1RXFA 2QQWA 4HN0A 2W9XA 3GDBA 3F95A 3FE5A 4TN7A 3WNNA 5DPNA 3IIAA 2RM21 2XMLA 1BEV2 1LOGA 2WN3A 3KQ4B 3POSA 4JVAA 4XBQA 5T55A 4O65A 1JYIA 1CAVA 1JH5A 3WW3A 2WO3A 3HNBM 1WLDA 2RJKA 4U2AA 4CZSA 4YM0A 4BXSV 1HV1A 5IYYA 1W2NA 2XUMA 1S0BA 1GFF2 1RHI1 2YGMA 4XQ4A 2YMZA 5FJKA 3RNSA 3MI8A 2DVAA 3UKTA 2WZPP 1SDWA 3A0NA 3AKPA 3CDZB 1CAWA 4CU8A 3HAGA 1MPXA 3IB3A 4D94A 3CMGA 1GUIA 1PO11 4RS5B 1OMIA 1U5XA 3VKLA 1UU6A 1W0PA 1CQ9A 2XUEA 5F6LB 4JQRA 1RUF2 1UPIA 2BP6A 2BJSA 4OZXA 1BBT2 4KGQA 1G9BA 2R061 2WAAA 1FPN3 2XHKA 4NHYA 2GH8A 4LR4A 4WM7A 5GLUA 3ZR5A 5K0UB 2JD4A 2QVSB 3OB8A 3KCYA 3GJAA 2D6NA 4FI9A 4ZZ5A 4UFHA 3I4IA 4MO3M 4IEXA 4F7ZA 4OI0A 1DQ0A 3ZKUA 2VL4A 3MLJA 3ZN6A 1UOBA 4Y1YA 4JTOA 1H0BA 3BCWA 1PK6B 4YGBA 1V6IA 2RDNA 3F2ZA 2H0BA 1UW8A 5C3SA 1RUD2 5JI7A 1J1LA 2VBPA 5FZBA 3WEZA 4RFT0 1JZ7A 2C6SA 4AYUA 4Q1RA 1GZWA 1D7PM 2EIDA 2VR4A 1EAH1 1FPN2 2AYHA 2JDMA 3HN3A 3OJBA 1Y9QA 2HJIA 3JD73 5C4WB 1DGLA 1OF4A 4A7ZA 1O91A 1F4AA 1S0FA 5FKBA 3VDBA 4COWA 5J7MA 4V2VA 1I5ZA 1A8DA 4QXCA 5FV3A 3UV9A 4CPBA 4FXKB 3ZFEB 1EYBA 4FOYA 4QQLA 4D3WA 5JXIA 1RUD3 2ID4A 2VW2A 3PDQA 1W2AX 3ZN5A 1H6YA 4KWLA 2JDAA 3SH5A 3ZYJB 1OUSA 4ET7A 4FPCA 2JE8A 5CKNA 3WG2A 4RFRB 2RM23 3MW3A 4AVBA 1HXS1 5DAXA 2BV4A 2JG8B 3HT2A 4Y5Z0 4EQVA 3H1YA 1O4ZA 3OGJA 5A7WA 4A6OA 2A75A 1K5JA 1VBA2 3BOPA 3N7LA 4FFHA 2UYBA 2Y8KA 4QPWA 5GLVA 4EJRA 4IE7A 3FHIB 3U4SA 1W6OA 4EYUA 1WW7A 1UY3A 3Q8FA 4YW6A 3RGBA 3E6CC 5IAVA 2RS13 4CUAA 1OXCA 2VUAA 3POJA 5T50A 2BFUL 2AACA 4NIIA 1I5PA 2XL9A 4M3CB 1ND2B 4CDUA 1BXHA 2RM22 3KM5A 4JGYB 3ILNA 4XMIA 1OBNA 2CWMA 4HVRA 1GV9A 1O3RA 3CKHA 5T5PA 1ZZ6A 2P2KA 5FY7A 4IEVA 1UYZA 1QY4A 4J6GA 3MUY1 5A6ZA 4GXLA 1VMJA 3ECQA 4CP2A 3EYPA 2VZRA 1AR72 1OC1A 2E63A 4ZZ8A 2WJSA 3LAGA 4WZCA 2DBIA 4AGRA 3W5NA 4XCBA 4UFJA 2OUHA 3UGFA 1J84A 1NUKA 1APNA 1PMHX 4XXAA 1AYM1 2GC0A 2W92A 3W21A 1LB2A 3PLQA 3PUSA 4B7KA 4YYOA 3WP3A 4AQ2A 5A6QA 3OPTA 4BQ5A 1AL23 1T6GC 1XNTA 4GWNA 5D21A 1NA1C 1QH6A 1NCRB 1UZYA 1GP4A 1SCSA 1U0AA 1H8VA 3DEMA 3CZJA 2RVAA 1WLTA 1R082 3RJ2X 4ZPIA 2K2SA 4K9SA 4OULA 1TME2 1Y43B 4W50A 3PIJA 4X6RB 4OQ8A 1UMZA 1TME1 1H4HA 4S2DA 5FRAA 4K8RB 3ZKYA 1H9PA 2VNRA 4M0HA 2BGOA 1PZ7A 3V0AA 3RVHA 2IXJA 1WWYA 1E5IA 2P4EA 3VDDB 5F3CA 3ITQA 1MZ6A 1ULGA 2GMMA 2JE9A 4LMFA 1OFSA 3MUZ1 1RUC3 2VGDA 5DZFA 5FYHA 1Q8QA 4CDQB 4FQ4A 3BN6A 2ZS6B 3M3EA 1S0GA 4GKYA 4YVSA 3K3OA 1XU2A 4CP9A 2WR9A 1YI9A 3CJXA 4TSVA 2ZZQA 1NAEA 5B2GB 1ENRA 1WCQA 1VBD2 3A4UA 2Y6FA 3BU7A 2IXLA 4HPKB 1H9WA 3AP4A 1AR63 3K4AA 5F3IA 5FZKA 3UYJA 4QU1A 5FZ6A 4ASKA 1FNZA 2GN7A 2PTMA 4R9DA 3BVCA 1PIV1 3ZSEA 5FZFA 4CXWA 3MIGA 4ZS2A 1K42A 1W8ZA 1G86A 2OVUA 1W06A 4TZDA 2WNOA 1ZM1A 1W8FA 4R9BA 1X82A 1W6PB 4KWJA 2LTNA 2W91A 1XNBA 3J8F3 2I2SA 2QJVA 1F5FA 2RS11 3R4SA 1HN0A 1R093 4N9IA 4AGVA 2BQPA 1Z7S1 1KS4A 5DXDA 4Y22B 3WDVA 2PMWB 3KZ4C 3LA2A 4KWUA 2AR6A 4NUBA 4B29A 4B1MA 4UFIA 3GJBA 5L7OA 1N3QA 4UFKA 1QJU2 4HLTA 3R4DB 2XJQA 4LBQB 2VU9A 2BYVE 2XONA 4LKEA 4Y20B 4Y1ZA 2NN8A 2XVKA 4Q4X1 3RI9A 5AFEA 2JG8A 4OYUA 5F1RA 5ISLA 3LEKA 1IPKA 3UJQA 5FYMA 5EPAA 1ONAA 2IXIA 3T1MA 3NKTA 1QXRA 3G6JB 3OPWA 1QF3A 1GKBA 1HLCA 2W5FA 4IV1C 3RYPA 1R092 3I49A 1CAXA 2WKKA 4LO4B 2XQRA 3AVRA 4NN0A 4NOTA 1CX4A 2X5IC 3JBG3 4Q4W2 5L9RA 3IDCB 4YGDA 5IVEA 3HNYM 3KF3A 2R063 1S0DA 2BFUS 2HWE3 1AF9A 4AFAA 2NYYA 5C3RA 3WSOA 1A78A 2P6CA 1ULPA 4GMP3 5FP8A 2IVIB 4EV0A 1F4HA 1LGNA 4LT5A 4XUTA 4XQDA 1PGW1 1RUC1 1GANA 2A73B 2PELA 2YG0A 4QGLA 4LIUA 3AKRA 1CAWB 1R1A3 3NNMA 3S7EA 3EMRA 3NWKA 3J4UH 1ULFA 2ZKNA 2G9GA 3I2HA 2VD7A 4YZ3A 1OFNA 3LEGA 4OHYA 3BB6A 3Q8CA 4FPFA 1LOFA 1RIRA 2LALA 4IGOA 4Q5OA 4JGZB 4DB5A 3T0DA 1ZBE3 3E97A 3I54A 1GP5A 1QJY3 1UYPA 2BZDA 3EBRA 4ARXA 4E8DA 3ZDVA 5L19A 2JB8A 1DCSA 4GB31 3G7DA 2JXAA 2F4LA 2RR12 4BQ4A 2AREA 3O1OA 3PUHA 3ZYHA 1GMMA 3HQRA 1O3TA 1ND3A 3AJYA 5C9AB 2D5FA 4A44A 2HWC3 1AYN1 1AYM3 5I0SA 1YQCA 1Z7S2 3H8UA 3CL1A 3WQ0A 3O7OA 4J1WA 1GWMA 4KMQA 1N3PA 5H9QA 3ROUA 1YFWA 4N53A 2R32A 1OQDA 5EV7A 1L7LA 1MEC3 1WA6X 4KI5M 3PJYA 4QX2A 5LBBA 5I93A 2RS32 1PMJX 5A1AA 1LHUA 1XNAA 5JPMB 2HWD3 3FHAA 5K7PA 2XLGA 4LA2A 2QQLA 3TEYA 4HG6B 5CVRA 1V9U3 2VOKA 4OUMA 3W20A 5A3UA 4CDUC 1QDCA 3ZX7A 1WD4A 3WUDA 1OD5A 1WMEA 1YCIA 2QQUA 1UX7A 4IETA 1QHDA 1MACA 3NNGA 5FK7A 3VBSA 3VL8A 2VMDA 4Q4W1 3SH4A 4COVA 1WCUA 4XYXA 2WFF1 3RRDA 3HD8B 1OVPA 2Y38A 3LIHA 3RYKA 3WNPA 4Z2WA 2BRTA 4RHV2 5L9VA 4NR1A 3AYCA 4GD4A 1IG3A 1WZXA 2RS33 1AXYA 2BNMA 1XE0A 4AHZA 1ZA4A 1QQP1 2HWF1 4LHKA 5FO7B 3VDCA 3UNPA 5HV0A 2W52A 2XPJA 3TB0A 1WW6A 4Q4X2 2R49A 3PHMA 1RINA 2H6BA 2RJLA 1U5YA 1OQ1A 5D2AA 4YWAA 5F7UA 2JDNA 4IDZA 4JX0A 4XTPA 4BLJA 4N53B 5I0TA 2JIGA 4XUNA 5KC6A 2WC2A 4DRRA 2EVXA 4BH9A 3AZZA 5FYVA 5EJ1B 5I91A 2XJSA 3GHMA 4YFWA 1POQA 2O8OA 1AUYA 1CPNA 1UD1A 4OZOA 5GLZA 3VZOA 4NIDA 5DAPA 3N9PA 3VUOA 2J1VA 3J7NA 5LK7B 1IS4A 4GZ9A 2FDJA 4D6RA 2PHLA 4RHV1 4XAAA 1U12A 2A6YA 3ZR6A 4AI1A 5GLWA 1RJ7A 1W9FA 2XB6C 1RUF3 1W8NA 1RUOA 1DZTA 4L11A 1LEMA 2PAEA 2VZ3A 2XJVA 5FZDA 1F5JA 3OCPA 1AJKA 2CDOA 4CA9A 3PTRB 1CPMA 4FT8A 1R1ZA 4CCLA 4DNYA 1HRI2 4UAPA 1W28A 2ZEYA 1CN1A 1S0IA 1WW4A 3QH7A 3DCQA 4G9SB 4UF0B 4QX1A 2ZZJA 3IM0A 4L0PA 2QQMA 4IEOA 4R4XA 4HOOA 3NSTA 3PL0A 4HSLA 4F8AA 1RUNA 1GOFA 1PIV2 2P6HA 1NE6A 2DU1A 5JR7B 3LOBA 2IC1A 4DIQA 1RITA 2JENA 3I7DA 2VZPA 4CEWA 3NJYA 2PXJA 2A71A 3ES4A 4E2SA 3CJIB 2VZUA 3ZXFA 4GALA 2QE3A 1FAYA 2VW1A 4CDXB 2BPA2 3WNOA 1BMV1 1MZEA 5IFTA 4JDMA 2EAAA 3K48A 1QWRA 3UT0A 1F2NA 4C91A 4URAA 5FZMA 3RZLA 2CTVA 4FBFA 5LBCA 4EN8B 2OXBA 5FPBA 2Y6JA 1N3OA 2VOWA 4A41A 1UKRA 2OQ7A 4AW7A 3T09A 3V0AB 2YV8A 3KV9A 4AEMA 2PHWA 4FPKA 5FUIA 1PMIA 3SITA 1CIYA 3IMNA 3MF6A 4XEZA 3OG2A 4K8FA 2ZHLA 4NJ4A 4RR3A 1NYWA 1YIPA 3GNEA 5FAXA 4JHTA 3VZJA 5CFCB 5FPUA 1RB8G 1GOHA 1RMU2 4EZ4A 3I2GA 2WL1A 2Y6HA 1G9DA 4K1YA 4B4QA 5SV5A 4YFZA 5A32B 1Q3EA 3I59A 4BQWA 3LFIA 2GALA 1BQPA 3OPZA 1GR3A 1DQ1A 4HETA 2R7EB 2PAKA 3ORJA 4DS0A 3MV11 2ET1A 5IVYA 5CFDA 1K5MA 3N9QA 5F6KA 4BMBA 4LBLA 3LE0A 5CG9A 3HBZA 2GDFA 4HK8A 1HRI1 4IV3A 5IWFA 1DZQA 1X8EA 3WR0A 3AMHA 1IPJA 1YRZA 5JSPA 4XFFA 1KFXL 1NLSA 5IVVA 1AR81 2F17A 1J83A 3LDRA 4BCUA 3BTZA 4JCKA 2VMEA 5FQ0B 3T4HB 2VY0A 5A3TA 2J1EA 1PHMA 1WBFA 2A6ZA 1B09A 4Q0SA 3ZPOA 4C1WA 2PLV3 2KD7A 4BXFA 2HWB3 1ENQA 2A3XA 3VBRC 5C7GA 3GYDA 4LULA 4Q29A 1AR73 1VBA1 2ILMA 4AK3A 3U10A 3N7KA 4MHUA 3FUOA 2J1AA 1US3A
chains in the Genus database with same CATH topology
4XJAA 4CP0A 3VKNA 1JBCA 2ETEA 2W0XA 5JI9A 1IS5A 1XE8A 5JOWA 4AEJA 1EV12 3WY6A 4LLOA 3WT3A 1AL22 1QJX1 2PLV2 2WNUB 1CGPA 2O8QA 2TEPA 3IDBB 3ZFFC 1IZ3A 1ZRFA 5IT6A 2D7FA 4DXZA 4KU8A 4AFCA 4E27A 1RTVA 3HN1A 1AX1A 4KGGA 4WM7C 1VBE1 4NO4A 5KXCA 3T1LA 3PVBB 1VBE2 1O5UA 1Y7BA 2DURA 5E89A 3E6BA 1FYUA 3JB8A 3NKGA 3WLUA 4MUVA 2C9AA 1VBA3 1JUIA 1L3JA 1PO12 4GIQA 1TNFA 4XF9A 3ZO0B 1W6PA 1BMV2 4YG6A 2ZGPA 1C8M1 3NJZA 2RMU3 1JTZX 1C8NA 4O9EA 2CAVA 1MVEA 1COV1 4BHPA 1VBD3 1SLTA 3ZDSA 3T2TA 4ASLA 4XMAA 1Q43A 4YW5A 1V6MA 2JICA 3CU7A 1PK6A 3MPPG 3SLIA 4AVAA 3DL3A 1ZBA2 5DUUA 1VBB1 4AWDA 3J8F1 1X50A 5CNAA 2F6BA 1PO13 4P9WA 4WM8A 3HT1A 1E57A 5SV8A 1Z0HA 2VPVA 1ZX5A 1D2SA 3EO6A 3CJIA 2RMU2 4PBOA 3IT8A 1ZRCA 2PHDA 5BNNB 1KITA 2EXIA 4B4RA 1BK1A 3VDDA 1VALA 3ZSMA 5K8SA 1PZ8A 4YGEA 1VBC1 3KD4A 4H14A 4FPYA 5FBZA 3DUIA 1V6KA 3ZXEA 1C1FA 1WUVA 3W9AA 5J96B 3OF1A 1CAVB 3U4XA 2XGXA 4QQPA 4IV3B 4K6BA 2BTVC 1NE4A 1IKPA 2Z2SB 3EQEA 2UURA 3FC0A 5C4WC 1LR5A 4CRQA 4Q2FA 2XLFA 4R52A 3QH6A 5C8CC 5HCBA 4UXAA 3FMGA 4Q4Y3 4S2HA 1PO21 4LBNA 5K0UC 5EYXA 1J58A 4E4DX 2Q1ZB 4FOQA 1PVC3 2MHFA 2ZX0A 3Q9OA 4H7LA 5KHGA 4JDNA 3WDUA 3WW4A 1PVXA 4CEWC 2C1FA 1R1A2 4XDQA 4DPNA 4MV2A 2AZ5A 3TYJA 1WGPA 3AFGA 2P17A 4JTNA 1MS8A 3VL9A 4QGMA 2JG8C 2XJPA 4RA0A 4N43B 5BY5A 2JECA 2ZCWA 3RJRA 2R043 5DDJ1 2ZX1A 3L2YA 4P9XA 3S7IA 1PNFA 5J09A 1BYHA 2SLIA 2GZWA 5A32A 1MZFA 1SCRA 1EP0A 4ZU5A 3ZN4A 2JDZA 1TNRA 3B3QE 4PDWC 5D1IA 5BPXA 5J37A 3LZZA 4LA3A 3MLKA 1BBT1 1KDMA 4V1PA 2EIGA 3RQ0A 1NXMA 1DQ5A 4RL7A 2H0VA 3WX5A 3R05A 5AC91 3ZVXA 2XH6A 3ZPYA 2D6MA 4HMZA 3JUUA 1GZ9A 3USUA 2P34A 1J1TA 1S0EA 4L8QA 1QJZA 5DDJ3 5GJ6A 4CP1A 2WNVA 1GNHA 1REDA 4D7SA 1ENSA 2E7AA 5C8WA 2XG3A 3VZNA 3FX3A 5H9RA 5DUXA 3AM2A 1SQ4A 1H8TC 1N1SA 4LO8A 5I8TA 2BWAA 2XWBB 2ZAAA 3JBG2 4Q4W3 2TNFA 2VXRA 3FWEA 4QT6A 3VBFA 4CEYA 4B8EA 1SLCA 5FTTC 1U5IA 3DGTA 3LKJA 3VBUC 4QGNA 1OOPC 3VBRA 5H9PA 5CFDC 4PDWB 1EV11 2VECA 1NCQB 5BNQA 1RVF2 2ZGKA 3VHOA 3FLPA 2B45X 4JV4A 4LE3A 1NA1A 2VH9A 1BEV1 3VZLA 1ZREA 3MGUA 2Q8OA 1EPWA 4JDOA 1QNYA 1F9KA 3DKWA 4FPJA 1AR71 2RR13 1O4YA 3M2MA 5J3UA 4M0NA 1SMVA 3PVOA 3ELNA 4SBVA 5FFOC 3GBWA 1OA3A 2DCTA 4FPGA 1PVC1 1CAXB 1NA1B 3TWIA 2MNGA 4B4PA 5J36A 3ZIXA 1HRI3 3ZYRA 2UU8A 2D5HA 2VG9A 4EROA 2E6VA 2ZGSA 3AYEA 3WW2A 2YYOA 4D7YA 1NCQC 1UCXA 2WFPA 5CIRA 4EN9B 3KT1A 1GSLA 4CEYB 3KT4A 3MW4A 1Q8SA 2WQZC 2WSUA 4Z07A 4RGGA 4Y22A 1SFYA 1RHI3 3VZMA 3DN7A 4K1ZA 1O5LA 4ZXKA 2VQAA 1FI2A 1XU1A 2FZ1A 4EN0A 1JHNA 3U07A 1XNDA 2BNOA 1FMD1 3VZKA 5E1RA 5CFCA 5KC5A 5HI0A 2TUNA 2ZMKA 3RYRA 4FTEA 2Y0IA 1DBNA 1RUE3 2B39A 1J3RA 1DFQA 1QXJA 2BW8A 5FLIA 4PIYA 1RUE1 1Q8PA 4Q4X3 5I0UA 1SLLA 2A5ZA 3NV4A 2HKXA 3MIBA 4Q27A 4P9YA 1R081 2K9ZA 3ENRA 1IGOA 1V9U1 5LRSA 3R0RA 5E8AA 1AX0A 5L36A 4AI2A 4EN7B 1RGSA 4HKOA 4I0AA 4AVTA 2YHJA 4YM1A 1YFXA 3IN9A 1SBDA 3ZXDA 4XTMA 2CAUA 3H3UA 1PO22 1F31A 2ZGUA 3MLLA 1O3QA 1AXZA 4FP3A 1N1VA 2E7TA 4NHLA 1C28A 1DIWA 4S2GA 1AYN3 4XFHA 4OI4A 3U0ZA 4JGZC 1W6QB 1XNKA 1NCRA 1LRHA 1LULA 1PZ9A 3SNMA 2BGCA 2QUOA 1C5HA 4Q26A 4Y1VA 1SBEA 4Y20A 1OI6A 1BZWA 1O4TA 3FLTA 3KT7A 1UL9A 1PO23 3HR9A 1PGL1 1I9RA 3WD5A 1FOD3 1NQDA 2P3KA 1DF0A 2GNBA 4R8HA 3WP6A 5CAZA 3TRSB 1AYN2 3HQXA 1TQ5A 4MGYE 4DY3A 1LECA 4YVWC 3MPBA 4AGGA 3E6DA 2Y26A 1EV13 2DU0A 2ENRA 4ZU4A 2DVBA 2ZHKA 4QX5A 2XLAA 3M3QA 2JJ6A 2HWF3 4IEZA 4M3CA 3LA3A 1HIXA 1CR7A 1D0GA 1AZDA 5EYYA 5A33B 3N35A 4YG3A 1N1YA 1BCXA 1YI7A 1VRH1 4R4ZA 2QNKA 1ULEA 2W39A 4P9LA 1QH7A 5A32B 3KGZA 3QACA 1RMU3 2CGNA 3POWA 3WG3A 4HVQA 1TMF1 3B9IA 4WM8B 1ZVFA 2GC2A 1DGWX 2WS91 2NM1A 3LSDA 1ZZ9A 3D82A 4E4ZA 5BNOA 2RE9A 4N43A 5EWSA 2HWF2 3TNPB 3D4KA 2OYZA 1IKQA 4R9CA 2YROA 3S0MA 3IWZA 1COV3 4YVWB 5CA6A 3WHTA 2YGLA 4LBQA 1RVF1 4I2OA 2A70A 4QQOA 3AZVA 2PQQA 1DGWA 2AENA 4N7UA 5KHIA 4UBGA 1RUJ1 1LKNA 2VMGA 1QNWA 3VKOA 4LBQD 5JZGC 3KB5A 2QFEA 4TWTA 1G8WA 3KCCA 3RWNA 5FREA 3PVEA 1PK6C 2FMYA 2R041 1Z78A 4G3YC 4AFBA 1V6JA 2DYCA 3USUB 3ZMOA 4YVSC 2RS12 1RUF1 2GU9A 4PIXA 3KLSA 2Z5WA 1QOTA 5LEJA 3MIFA 1H1IA 2DWRA 2W68A 5T5JA 3VV1A 2JG9A 4HPKA 3FFZA 4I09A 3AZYA 1YFYA 5C8CA 4QPYA 2CNAA 2RS31 1FX5A 4XZPA 2DTWA 3ZXAC 4OVEA 1A6CA 5JSRA 3MICA 4KWKA 3H9AA 1LJ7A 4PQ9A 4U36A 1RUH1 3ZFGB 4COZA 4RD7A 4YZ2A 4BIFA 1VBB2 2ZJCA 3M3OA 1H30A 1DHKB 1WCDJ 1OA2A 2OZ6A 1HQNA 3ZFGA 1RC6A 1W6OB 3CEWA 4Y4YA 3EXUA 1J3PA 1DU3D 3ACLA 3V65A 3O12A 1BKZA 1W6NA 5FLHA 1YXWA 4L9BA 4Q0VA 5DZGA 3GZAA 2RHPA 2YY1A 4LO7A 4AEKA 3J26N 4RGAA 2R073 3O0VA 2EXJA 1X8MA 4YRDA 1V00A 3OY8A 4HT1T 4NVPA 1OPMA 5CB7A 1JW6A 3B00A 4H3WA 5CFCC 5GZCA 1VBB3 1SLIA 1TME3 3VHPA 1MVQA 4C0BA 5EFUA 2Q1MA 2BEOA 2ARXA 1ZBA3 1ULCA 3I59B 2SBAA 4HFSA 4LEJA 1V6NA 3GZTB 4JGYC 2O1QA 2WT0A 2R30A 1TMF2 3EJKA 1DDLA 1C5IA 4M3CE 4UW6A 4XF4A 4YW3A 2GNDA 3RMXA 1HX6A 4NHMA 4FTBA 2Q4SA 4XW3A 2WLPA 3BALA 1RJ8A 2PHRA 4WVVA 1S55A 4JGYA 2WT1A 5BNPB 3WP4A 2WNEA 2ZACA 1LHVA 4KU7A 4KNCA 2I07B 5ACA2 1SLBA 1ENXA 1NY71 1YIFA 2HWB1 3TN93 2D44A 3AMNA 3V0BA 3B02A 1DG6A 5DUVA 1MS4A 1W0OA 3DF0A 3V0BB 3VKMA 1PNGA 3J8F2 1H2MA 1PGSA 3M4FA 1W39A 1S1AA 1NCRC 4Y1XA 2D6LX 4EWEA 3ZSJA 1JOJA 4XBNA 1I6XA 3BODA 1BVVA 1PVC2 5ACA3 2MEV1 3VBOA 5BYNA 4R9AA 3BPZA 1PGW2 1FATA 3O14A 3JD71 2Q5TA 4DRVA 2ZX4A 3LCPA 4OI2A 2X53S 5T5LA 3AMPA 3B7MA 1AR83 3GBFA 5BNPC 1UX6A 1WA4A 3CF6E 3KGLA 3NAPB 3B5LB 3IBMA 3RZZA 1TE1B 1J3QA 2GNMA 5ABJC 2XKPA 1LGBA 4IXLA 4JRAA 3ATGA 4SLIA 4Z82A 4AFMA 3TNQA 2UY8A 1SEFA 4BYYA 4PJYA 2B42B 1LESA 5E88A 2ZGTA 2R6QA 4CDWC 5AVPA 1FT9A 5D8AA 1FV2A 4YVWA 4AEDC 1LEDA 2QCSB 2WNUC 3FJSA 1KXGA 4YGCA 1OOPA 3OTFA 3WNXA 1LHOA 2WLQA 5A3LA 1G9CA 1J59A 3VBHC 1ZRRA 1BJQA 3HWJA 4E2GA 1ZZBA 3E5QA 1Y3TA 1D2QA 4MXWA 1LU2A 2YZ4A 3I8TA 4I02A 1RHI2 1WLWA 1JXNA 3NAPC 4WVZA 1YJKA 5FQ0A 5IK4A 5KHKA 4QPGB 1IOAA 3O5SA 2ZGRA 1LCLA 2ZABA 5FMOS 2MPFA 2AGSA 4I3PA 3AYDA 3SCFA 2DCKA 4AQSA 1MS0A 4FPLA 1AL21 4QU2A 1QKQA 3DV8A 2D6OX 3AP7A 2F4PA 1XYOA 4HBNA 1AHSA 4ISQA 4XIOA 1ZBA1 2I74A 5IUQA 4PLMA 3MFAA 4AFDA 4K7JA 1R091 2LM3A 5EJ3A 4RR3B 1IQAA 4Q8LA 2AUYA 4LO6B 2DUOA 3E5UA 3AMMA 2W08A 2R16A 4HSJA 5GKAC 2XL7A 4RSUA 1QXPA 3VBOC 2D3SA 1AR91 3D8CA 2DCYA 4FPHA 4MXVA 4Q4V2 3WCSA 3ZN6A 3OYWB 3S6PA 1VR3A 4DQAA 4QPGC 3RSJA 1QJU1 4IEQA 2WZR3 1QOSA 2XKOA 3VN4A 1H8TA 4E2QA 1ZNPA 2BNNA 5JIUA 4AI3A 4DINB 3GF6A 2XVLA 1REFA 1REEA 1XYNA 5FPZA 4BZ4A 2P3IA 2VMHA 4AHWA 1LHWA 4RS5C 5JZGA 4N90A 1U5ZA 3AXDA 4YZ4A 2QZ3A 1G9AA 3KS7A 2P3JA 2JKBA 1QMJA 2Y0OA 4FSJA 2PN5A 2WFF3 1OLQA 1VBC2 3WDYA 2XJTA 1AR93 4PDWA 4HL0A 4LLFA 1WD3A 4QPGA 5DUWA 4E9KA 2PHXA 4A7KA 5L73A 2XVGA 1OLRA 1HKDA 5L7OB 1MQTB 1RUJ2 5KXBA 2D40A 4ES9A 2VOXA 2UYAA 3NV3A 4XF0A 4MYEA 5BUVA 3QLQA 4GH4A 5C9AA 3O0WA 3H7JA 1DQ2A 1UU5A 1I3HA 4YW1A 1OHFA 1DYPA 1KJRA 2IZWA 1OOPB 2D3RA 2JG9C 2V09A 5IK8A 2GC1A 2PYTA 3THTA 3ZFEC 2CGPA 3N3HA 4IEYA 5JAXA 2ES3A 3H50A 4QM9A 2G9FA 4HK9A 2D3PA 4OI1A 5BV6A 1QDOA 5FOBB 3USSA 3TOJA 1YWKA 4UBHA 1HRV2 1KJLA 2CL2A 4Z92B 3VBSB 4NHKA 3B9CA 4FAGA 1DZRA 1B35B 2IFWA 2R1DA 3H0OA 4L92A 1RUD1 2ATFA 2FBEA 3D5OA 4OHWA 3RS6A 5L7OC 3N7JA 3VBUB 3LOIA 4Z8BA 2FZ2A 1N1TA 4AI8A 4FQZA 5JDBA 1FPN1 2CY6A 2DVGA 1HXS3 3WZ1A 4HANA 1ND2C 4BE3A 4A2UA 1PM7A 2B7YA 1O7FA 3JD72 2IXKA 3JQXA 4OHZA 4AEDA 1QQP3 3WQ1A 3CJIC 3AYAA 1A3KA 2WZR1 2Z79A 4WVMB 1V6LA 5JPNB 4OHVA 2HEYF 1SLAA 4CDWA 2VVDA 2IFRA 1CD3G 3BIWE 1NY72 2HWB2 2WA3A 1V6OA 1ZZ8A 4URTA 4JC1A 2NLRA 1H2LA 3HMYA 1FXZA 4XJ8A 5HCFA 1HXS2 2Q0AA 2EALA 3H1MA 4JAAA 3O0XA 3AP5A 4LBMA 4ES8A 3KQRA 4JGZA 4I0BA 2CGOA 4YM3A 2VOVA 2XJRA 1B35C 3AX4A 4UW5A 4P5HA 4Z1VA 2DFBA 3ETQA 4Q0QA 4QQ2A 1ULDA 4IEUA 5BNOC 1YO8A 2GSYA 3ZYIB 4K20A 2R072 3M3IA 3TAYA 2QKDA 1COV2 5KBFA 5JOXA 3FUQA 4Q0PA 1D0HA 2NMOA 4P9GA 2NQYA 1UPSA 4PIZA 4S2FA 3SCHA 3N4MA 1GQHA 5C6CA 2VUJA 4CDQC 1OPOA 1PGL2 4QM8A 4PF5A 1IS6A