5T5JA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
b'SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5jA00
1Q8SA 1IS3A 3QLQA 4R9DA 4XJZA 2ZACA 2PHTA 2ZGUA 3FUQA 4YFWA 1CQ9A 1C1FA 1V6KA 1S0EA 2D6OX 4GKYA 5E89A 4LBNA 1MR5A 4AYUA 1LHWA 2R16A 2UWCA 3ZYPA 3AX4A 5GLWA 5KXBA 2ZGSA 1WLDA 4YFZA 4PCRA 2R1DA 1S0IA 4YGCA 1LESA 1HQLA 2JKBA 2VH9A 1MS4A 3V64A 2GNMA 2LALA 1Q8QA 5GZDA 3ZXJA 1DYKA 2VW2A 2E7QA 3AZYA 4Q1RA 2D6MA 1A8DA 1S1AA 2E51A 2PELA 3AYAA 3M3QA 4M01A 3WLUA 1MVQA 4AVVA 4Y26A 1TEIA 2BQPA 4CZSA 2JECA 2YXSA 5CNAA 2EXIA 4M3CB 1SLLA 2P37A 1WBFA 1V6NA 3D5OA 4JC1A 4R9AA 3RSJA 1YIFA 2GALA 4FP3A 2A71A 4Y24A 4K20A 4M3CA 4XYXA 3WVJA 2D3PA 1QKQA 1QF3A 1UMZA 2XB6C 3N35A 1KDMA 2GNBA 4WV8A 5GALA 1N1TA 3AXEA 1V6JA 4XOGA 3U4XA 2NYYA 1SBEA 2A3XA 1S0GA 1EPWA 2ZGKA 4BOWA 1QGLA 1UPSA 2P3KA 5H9RA 2A6VA 1MS9A 2VW0A 1GBGA 3I8TA 4FOWA 3RQ0A 5GZCA 2AREA 2A6ZA 3VKNA 5IT6A 3CNAA 3PVNA 3NV3A 3B00A 3N7KA 1SLCA 1AJOA 1SLBA 2DTYA 3BODA 1VIWB 1UZZA 1IKPA 3O5SA 4YW1A 2JDZA 3IKWA 2UWAA 4CTEA 3WG1A 1HQWA 3O12A 4P9XA 3L2YA 2C9AA 2A6YA 4YG6A 1WW6A 1XQNA 2NMNA 2ZHLA 4YW3A 1W6OB 2UU8A 1W6MB 2V73A 3BIWE 3IPVB 3ILNA 1SBFA 4XJAA 1LOBA 1N1YA 5JLVA 4LBMA 4XIOA 5F5QA 4GA9A 4FOYA 1W6MA 3AYDA 3IPVA 1YYNA 3PJQA 2ZGPA 1AXYA 4YM0A 4XZPA 1Z0HA 2JJ6A 5JOZA 3HR9A 1KITA 2GDFA 2AGSA 4Q2FA 3I4IA 3NV4A 4XILA 3A4UA 2ES3A 1QDCA 3MW2A 3TAYA 4DRVA 1W0PA 4I30A 4XIKA 1AZDA 5F9TA 4BLJA 2R0HA 1BJQA 3AP5A 3VKMA 4D69A 1FYUA 4UW5A 3WUCA 2NZ9A 4AGGA 2ZGLA 4H55A 3M3EA 4ATEA 1W6QB 3ZVXA 1YI7A 2PHFA 3IN9A 3OBRA 4FQ4A 4XBNA 5GM0A 1W6PA 4Q8KA 1DQ0A 1DBNA 3VKFC 4FPCA 1V6LA 5CAZA 4Y1YA 1Q8OA 2ARBA 4FQZA 1KQRA 5JDBA 2ZKNA 1WLWA 1H9WA 3W58A 4YLZA 4Y1VA 4DS0A 1IS6A 3ATGA 1Q8VA 1YRZA 4FVVA 5GLUA 1Z78A 1AXZA 4FPFA 1MACA 1N3QA 1SLAA 4BMBA 5E8AA 5T50A 4M00A 4XMIA 1S0CA 1GNZA 2A70A 3SLIA 4FOVA 2ZMNA 1W0OA 5CB7A 1GV9A 4UW6A 1APNA 1WW5A 2DV9A 1DFQA 1LCLA 2GNDA 3QCWA 5DG1A 3AZXA 4AGVA 4HL0A 5DZGA 3V0AB 3H0OA 4BLIA 4FPJA 5EYYA 1C57A 2A3WA 1OQ1A 3V0AA 5H9QA 3HN1A 4P9YA 4BQ1A 1DIWA 2GMMA 1D2SA 4M3CE 5EYXA 1O4YA 2PHXA 2ZGTA 2ZA9A 3R4SA 5HCBA 5T5JA 4BM8A 1BZWA 2ZBJA 2DVFA 4Z8BA 4YZ5A 1LHNA 3PVEA 1CN1A 3B69A 4XTMA 1ENRA 4WVWA 4YZ3A 3OBTA 1ZM1A 1KJRA 1N3PA 3IM0A 4IQPA 3OY8B 1NLSA 3ZXEA 4K1YA 1DGLA 1QMJA 2WJSA 4BMEA 3FUOA 4XTPA 2A75A 4XJUA 4XBLA 2WLQA 5DUXA 4LBQB 2DU0A 4GXLA 1DQ2A 1VLNA 2CWSA 3AP6A 3O0VA 4XE9A 1N1SA 2R1BA 2NN8A 1GZ9A 5IK8A 1RINA 4LBQA 2NP0A 2DUOA 3WV6A 3UL2A 1VAMA 2RHPA 2D6NA 1DLLA 4C1WA 4U2AA 5GLZA 2A6WA 2JD4A 3BOPA 3POYA 2PHWA 2AENA 1LTEA 4XMAA 5JOWA 1A78A 1V6IA 1MVEA 2CY6A 3PVOA 4PBOA 1YXWA 2ZGNA 1MS3A 1Y7BA 2D6LX 1SACA 1WD3A 3LCPA 3LSDA 3D4KA 3GNEA 4YW2A 1UKGA 1UZYA 4XBQA 2A3YA 2VW1A 1SFYA 1SLIA 4AWDA 2CNAA 2DYCA 1FATA 1JXNA 2FHRA 3WNXA 5JOYA 4PQ9A 1G9BA 2EXKA 1LJ7A 2CWMA 3M3CA 5SV8A 1JYIA 5FRAA 4W65A 1ULFA 4ITCA 1U0AA 4ISQA 3WHTA 1LENA 1FV2A 3V0BB 2D43A 4XXPA 3N7JA 5DG2A 1NXD1 1RITA 1VAVA 2AYHA 3V0BA 4SLIA 1V6OA 2DUQA 2NMOA 3W59A 4Y22B 5JOXA 1AXKA 4M3CF 5KXEA 3M2MA 4Q26A 1LOGA 3POWA 5EXOA 1GANA 2D3SA 4LBJA 1AX0A 1I1EA 5HCFA 2ZMKA 1IS5A 3ZYRA 1CIWA 1DHKB 3MEPA 1HKDA 2ZZJA 2WNEA 1H9PA 1ULCA 1ENSA 1GNHA 1HLCA 2P2KA 2ZAAA 4KBBA 1W6OA 4R9BA 4YG0A 3WCRA 2D44A 4NO4A 3ZXFA 2W68A 5HCAA 3KQRA 1I3HA 1S0BA 3A0KA 4LBLA 5GZGA 2YY1A 1JHNA 3USUB 2P34A 2ZGQA 1DQ4A 4R9CA 5AVAA 3WUDA 3RMYA 1UX6A 3D6EA 1FNYA 1KJLA 1ONAA 3OYWB 3T1LA 4FPLA 3AZWA 3AZVA 1JOJA 3SNMA 2EXJA 1G8WA 1LOFC 2W08A 1BQPA 2ZHNA 1LOEA 1JUIA 1LULA 3INAA 4YGEA 1F9KA 3NWKA 1DQ5A 1MS8A 2CL2A 3ZSKA 5CA6A 4FPOB 1YO8A 2P3IA 1ZA4A 4XXAA 4FPEA 1FV3A 2D6KA 3SH3A 1DQ6A 1OFSA 4AVSA 3B01A 3RMXA 1CVNA 3Q9OA 1N1VA 3ZXLA 1FAYA 2CYFA 1BYHA 4ZKTB 1W6QA 4FP2A 3ZXKA 2ZGMA 1MZ6A 5H9SA 4YGDA 1JW6A 4YZ1A 3WG2A 3ZSJA 4Y20B 1S0JA 3AK0A 4GALA 4RL7A 4MYEA 3ILRA 2ARXA 1CJPA 1WBLA 4Y20A 1WCSA 4LBQD 1A3KA 1ULEA 3MW3A 2CTVA 4Y1ZA 3RG0A 1HDKA 1LOCA 5L73A 1PZ7A 1AX1A 2ZHMA 4UW3A 1G9DA 1B09A 2UURA 3VKOA 1D0HA 1F31A 3LSEA 1QNWA 4Q1PA 4FOQA 5E88A 4BPZA 1G9CA 4TZDA 2SBAA 5DXDA 3VUOA 1LHVA 1WUVA 1WW7A 2OUHA 1CONA 2WT0A 2D3RA 4YW4A 2H0BA 4XJ9A 5FREA 3WG4A 3B3QE 4OZXA 5KXDA 1GZWB 2ZHKA 3N3HA 4K21A 4WVVA 2PHRA 1AVBA 2D7FA 4ATFA 2EAKA 1CR7A 4LBOA 4GWNA 3VKLA 1LU2A 4GKXA 5DUUA 1N3OA 1IKQA 4YM3A 1WD4A 5T55A 1G9FA 1GKBA 2EALA 3OPZA 1QOSA 1UL9A 2E6VA 3GALA 3AZZA 3ENRA 2GNTA 4Y1XA 4YW5A 3NV1A 3C2UA 5T52A 2EIGA 4ISRA 4JCKA 5IK4A 2ZGRA 1GLHA 2WKKA 1UN1A 3T2TA 5GLVA 1W6NB 4DRRA 3UK9A 1R1ZA 1WLCA 3NV2A 1G9AA 3OY8A 3WZ1A 4PBPA 3HMYA 2VXRA 1W6NA 2V5YA 4P9WA 1V00A 2VUAA 2XG3A 3R4UA 2SLIA 3JU9A 1QU0A 4YZ4A 4DPNA 1GICA 2YV8A 5H9PA 1KDKA 1LU1A 5KXCA 4ASMB 1QNYA 3AP4A 1PZ9A 1JYCA 1F5FA 2R0FA 4ZXKA 2E53A 1IOAA 3WDTA 1LEDA 5DZFA 3AYCA 1Q8PA 1LGCA 3OGGA 2WT2A 3WHUA 2UWBA 2DUPA 3AXDA 3ZSMA 5IK7A 3FBYA 2Q5TA 1FX5A 5T5LA 3TB0A 1G86A 3UJQA 4YZ2A 5JVVA 1LHOA 4DFSA 5BYNA 4K1ZA 2DURA 5T5PA 1MS5A 2DVGA 1ENQA 1RIRA 1OKQA 1WW4A 3ZSLA 3M3OA 4UW4A 1URXA 3AJZA 4YM1A 5GJ6A 3V65A 2ERFA 2FMDA 5DUWA 5DZEA 1SBDA 2YMZA 1SLTA 2PHUA 2B7YA 1MZ5A 2WSVA 2A6XA 2DU1A 2HYKA 3AP7A 5EWSA 5LK5A 4FPHA 4PF5A 5DUVA 4JRAA 3WCSA 4Y22A 3SH4A 4XHBA 3AFKA 2VY0A 3DUIA 1AJKA 2DVBA 4AVTA 2YROA 1DZQA 1QDOA 1ULDA 4U36A 3N7LA 2GMPA 2DVDA 4XJWA 5IUQA 3VV1A 3AJYA 4NOTA 2NM1A 4CRQA 2TEPA 1X50A 2W52A 4TYSA 1LGNA 4FPYA 1QOTA 4Q27A 2JE9A 1BXHA 3FLTA 1CPMA 1MS0A 1DQ1A 3FLPA 3R05A 1LODA 1UAIA 4F83A 2OUJA 3T1MA 2A7AA 2DVAA 3WDYA 1J1TA 3USUA 3RRDA 4XHXA 1JBCA 2I2SA 3OYWA 4XJ8A 4HANA 3WDVA 4DQAA 2G4IA 4FPKA 1V6MA 3RS6A 1ULGA 3DGTA 5GZEA 1IS4A 2YZ4A 1BKZA 3N7MA 1LOFA 4RA0A 2JE7A 2ZMLA 1SCSA 1MS1A 2AR6A 2ENRA 2R49A 1PZ8A 2VU9A 3BTAA 2ZABA 1KRIA 3N36A 1AF9A 5IK5A 1FNZA 2ZGOA 4P14A 3ASIA 3AYEA 3WG3A 4WZFA 3ZPYA 1S0FA 1Q56A 4YGBA 3POSA 3JUUA 4GWMA 1AX2A 3O0WA 1JN2P 1LOAA 2AUYA 1LHUA 1S0DA 3A0NA 3AP9A 4Y1UA 3UJOA 1W6PB 2OVUA 4FPGA 3O0XA 1VALA 4L8QA 2E7TA 3SH5A 1LECA 3B9CA 1CESA 2AH2A 2DTWA 5JMCA 2LTNA 1H30A 1GYKA 1GSLA 1LEMA 2EF6A 3APBA 3SISA 3M1HA 4Q8LA 3MPPG 3WDXA 4C1XA 5T54A 1SCRA 3SITA 2WSUA 5GZFA 2EXHA 4AGRA 5T5OA 2GN7A 2P3JA 3FLRA 3FFZA 1QOOA 3WDWA 1O4ZA 2KM2A 1GZWA 4YM2A 3WDUA 4YG3A 2OW4A 5GLTA 2GN3A 4XDQA 2C5DA 2WQZC 2DWRA 3KM5A 3OJBA 1GZCA 1N47A 1DYPA 2D6PA 2WT1A 2Z42A 4LBKA 2A5ZA 1C1LA 1C4RA 2W39A 2GMEA 3PMEA 5CBLA 1CPNA 3MW4A 1LGBA 3ILFA 3IMNA 3WOGA 1G7YA
chains in the Genus database with same CATH superfamily
4R9DA 4RQPC 4LTAA 2ZGUA 3FUQA 3L2HA 1CQ9A 3U4SA 2PLV2 3RZGA 4QQ2A 5A1AA 4LBNA 3THCA 4AVAA 1MEC1 2HLEA 3BIEA 4RQPB 1RUJ3 2AC1A 1FT9A 1V70A 2HEYF 2UWCA 2FCUA 3CO2A 4NJ4A 5GLWA 4LMFA 1PX4A 5FJKA 1OC1A 5FZDA 1AHSA 3ZOIA 3S7IA 4YFZA 4E4DX 4NRMA 1S0IA 1LESA 1HQLA 1RL3A 5DN2A 1MS4A 1J58A 1FOD3 3G7DA 5IVYA 1OMIA 3V64A 5I8TA 1PGW2 5IW0A 3C7FA 1PMJX 3E6DA 2E7QA 1FMD3 2W3JA 3N9NA 4KH9A 1S1AA 4KMQA 3WF2A 2FDGA 4AHZA 1YFXA 5A6ZA 1BVVA 5A7QA 1VAKA 1T6GC 4CZSA 2YXSA 4LOSA 4AI3A 3H7JA 2R042 4CEWA 1V6NA 4ASLA 3ELNA 1UOFA 4FP3A 2A71A 4Y24A 4K20A 4M3CA 5LBCA 1BMV1 1UY4A 1XNCA 3I49A 2RS13 1QF3A 1RUG2 3C7HA 3FWEA 4L9BA 2DBIA 4LO4B 4KG8A 2PYTA 5FYBA 1XB9A 3GF6A 4RHV3 1VBE1 3VBRC 1C3HA 3S7EA 2NYYA 2A3XA 4B4PA 3K2OA 2ZGKA 5H9RA 2P3KA 3DXUA 4ZU5A 4BJ0A 4K8FA 4RGGA 3RQ0A 1OF4A 2QJVA 3VBRB 2BEOA 4LK7A 3VKNA 1NAEA 2ZEZA 3PUIA 2W92A 3CNAA 3VD3A 3NV3A 4HOOA 3B00A 5F3IA 4R4XA 1AJOA 1IKPA 2CGNA 3BGAA 3NNGA 2TUNA 1W8ZA 4CUGA 3RDIA 1F4AA 1H1AA 5F3CA 5BUVA 2WINB 5M0TA 1XSRA 1RXFA 5JWPA 2WNOA 2YC2A 1WW6A 1XQNA 4RS5C 3TN93 2V73A 4UBHA 5FUNA 4XJAA 1JZ4A 1SBFA 2VZ1A 1X9TA 4AFAA 1E5RA 4BDVB 1ZRRA 2HYXA 3IPVA 4K7JA 5J48A 4AHXA 5D21A 2WNUA 3NNLA 3LA2A 1HRV1 3MGUA 2JJ6A 5FY4A 4BQ2A 3H7YA 1ND3B 1UOGA 4A3ZA 2BWCA 4I09A 4MHUA 1YQ2A 1QQP1 1AL23 1RUNA 3I4IA 3NV4A 5J7MA 1PO13 1UMHA 4ES8A 1RB8G 3A4UA 3ZYGA 2QQOA 5EIYB 3VBUA 2EICA 4XIKA 1AZDA 1NY71 2R0HA 2CDOA 3QH7A 4QX8A 3AP5A 1WMXA 3J7HA 3VKMA 4BZ4A 4JTOA 4F8AA 3BI3A 1FYUA 5A7WA 2E32A 2Y6FA 4A3XA 3JD72 2W1SA 3ITQA 5DAPA 5JXHA 1ALYA 1YI7A 4GZ9A 3IN9A 4W50A 3U07A 1W6PA 3I2JA 3AKRA 1W2TA 1XYNA 5DAQA 5C3RA 1RUH3 2FQPA 1DBNA 5FP3A 4PIZA 3VKFC 4BU2A 5L9VA 1PGW1 1L7LA 1BHGA 1RUJ2 1QIQA 5DAXA 1QY4A 4YW6A 5A1LA 2YPDA 1XNBA 2ARBA 4FQZA 1NA1A 3CJIA 1H9WA 3KF3A 3MIFA 3ZIXA 4YLZA 2RJ2A 1NCQA 5J98B 1D4M3 2VR4A 4MGQA 2VTFA 3GM8A 4UYBA 2R041 4DS0A 5BV6A 1RUD3 2GC2A 2MNGA 2W0XA 5GLUA 4V2VA 1MACA 5FMOL 5FYHA 1FOD2 1SLAA 3KLSA 1EV13 3VN4A 4NE9A 5JXGA 1QEXA 1KXGA 5KC5A 1RUG1 4PQQA 4XMIA 1S0CA 4A42A 3SLIA 3DV8A 3N9PA 2ZMNA 1W0OA 4QM8A 4UW6A 1APNA 1K5MC 4GB33 5FQ0B 1V0AA 3WF4A 3LKJA 2XJRA 4HL0A 5F5IA 1K5MB 2JEMA 2VM9A 1CX4A 1HB1A 1IG0A 2WYSA 4FPJA 1TME3 3BKZA 1ZZ6A 4XW3A 1D2SA 3KCXA 3MZHA 1VBA2 4Z8BA 3JQXA 2OPWA 4P00B 4YZ5A 1LHNA 4XTMA 1POQA 4FBFA 1KJRA 2V4AA 3IM0A 5FDBA 3U14A 3KWVA 1NLSA 3I2GA 1I5PA 2J1AA 1MQTA 4AF9A 3KHCA 3VDAA 4XJUA 4JGZA 4E4ZA 4LBQB 2DU0A 3NAPC 5AC93 5BNPC 2CWSA 5FIXA 1NCRA 1N1SA 2GP3A 2R1BA 1GZ9A 2E9QA 5IK8A 1W99A 4LNVA 3OUJA 3FL7A 3UL2A 2UY8A 3NAPB 5BNPB 1DG6A 4QX5A 1LTEA 1AYN2 1ND2C 4E4HA 2XXZA 1V6IA 1D7PM 1UCXA 3PVOA 4KGQA 5DDJ1 3EJKA 1UKRA 4IUGA 1GOHA 1YXWA 4HXCA 3O1OA 2D6LX 3WP5A 1WD3A 1PM7A 4LO7A 3ZFFA 4Q0SA 3LA3A 4HBNA 3GZEA 1UXXX 4NMIA 3CQOA 2DYCA 5FZ3A 1POV0 1RHI3 3WNXA 1JZ6A 3LOIA 4Q5OA 2EXKA 5KR7A 3CEWA 1LJ7A 1AL22 4MLOA 3F2ZA 1ULFA 2RVAA 1U0AA 2RV9A 3HNBM 3JB8A 4Q4V3 4XUTA 3WHTA 4OHYA 3WNKA 4XXPA 5FZLA 3N7JA 5I0TA 4A41A 2JIJA 3V0BA 5HPOA 3OOXA 1V6OA 3H1YA 2JX9A 3KT7A 4V1PA 3W59A 4GMP3 3WW1A 5JOXA 1AXKA 2W2IA 4JVAA 3M2MA 4QXHA 5FYMA 4Q26A 4E2GA 5CFDC 5ANQA 2WIIB 5EXOA 1OUXA 1GANA 1XOYA 2WBKA 1RUC3 1IPKA 3LPGA 5HCFA 2ZMKA 2QCSB 1COV2 3GZAA 3JQWA 1HKDA 1ZBA2 2WNEA 1FPN2 1H9PA 2VNVA 4TLFA 2F4PA 5IWFA 1ENSA 2DCYA 1HLCA 1RUH2 5JCTA 2ZAAA 2Y6KA 3LEIA 1GWMA 4KBBA 1HIXA 3WQ0A 5L7OA 5FXWA 4NO4A 4QKBA 3KV5A 1UY2A 3KQRA 1W2UA 4YWAA 1I3HA 4NWVA 1VBD1 3A0KA 4COUA 4XVHA 1W9YA 3HVDA 3C3VA 2ZGQA 3KHBA 1DQ4A 5AVAA 3VBSA 1H8TC 2GC0A 1XBFA 4FPLA 4NAOA 4ZONA 2OIIA 3PUHA 1TE1B 2XUEA 1W8FA 2OZJA 3GBWA 2KXLA 1H8TB 4JQRA 1F5JA 2HWD1 4JKMA 4RFRB 1LOEA 1JUIA 1LULA 3NWKA 5C8CC 4FPOB 1YO8A 2P3IA 1ZA4A 1VBA1 2VZ3A 4GB32 2FDJA 2QDNA 1FV3A 4H7MA 1RUF3 2JDMA 2IVJA 5T3NA 3RMXA 1CVNA 3LEGA 2IXCA 4HN1A 3HT1A 4LOTA 1DGRA 1X7NA 3A22A 5FZEA 4K3UA 2CYFA 4CPBD 4E8CA 1FI2A 4ASKA 4OVEA 3W5MA 1W6QA 1AYM3 4DXTA 1PIV3 1CAUB 3MHZA 3VGIA 4A6OA 4W4ZA 4YZ1A 4XFAA 3ZO0B 3AK0A 4GALA 3LIGA 1TMF2 2IXLA 3ILRA 2X8KA 2WFPA 1CJPA 1WBLA 4Y20A 2K46A 2PN5A 4H3WA 5LBEA 2W47A 3HBZA 1TQ5A 4OUEA 4EN6B 4I0BA 2Y34A 1HRI2 1W9WA 2R072 2VVFA 4EWAA 4FAGA 2UURA 3VKOA 3WNNA 5E88A 2OQ6A 5AC92 2DCJA 4CP1A 4QDSA 1ZRIA 5FO8B 3VUOA 2CDPA 3GCWA 1CONA 4UF0B 2WT0A 1WGPA 2D3RA 4IEOA 2H0BA 4W6XA 5FREA 5FY7A 2JG9B 4CXWA 4UWDA 5KXDA 3QBQA 2XKOA 1OPMA 3VZNA 3WW3A 1X8EA 2PHRA 4ATFA 4KG0A 2WZR3 4LBOA 4GWNA 4HPKB 3POIA 3AKTA 3VKLA 1UYZA 1W04A 4CUBA 5T55A 5DQ0A 1UL9A 2E6VA 2GZWA 1GP4A 2FCVA 3P6BA 1RHI2 2EIGA 4ISRA 1OVSA 4DO0A 4E2SA 2V4VA 1UN1A 3T2TA 4CDXA 4IV3A 3C7GA 1GWKA 5JSRA 1WLCA 4XF9A 4Q4V2 3UYJA 1ZBA1 2ZS6B 1FPN1 3T30A 4Z82A 5BNOA 5F5CA 4EJRA 1AR61 1YIPA 3HT2A 4OI1A 4COVA 3R4UA 3GGLA 4FTSA 2SLIA 2N7GA 4QX0A 5IVEA 5JPMB 2WWUA 4IEZA 1QU0A 1PMIA 2JDNA 2PQQA 4MH0E 5HI0A 5H9PA 1PK6A 1RUI1 5C8WA 1LU1A 4XEZA 3K4AA 1GMMA 1ZZBA 5FZ1A 4DY3A 5I8SA 2FDHA 2ZX3A 5I0UA 4DMIA 3I3EA 1YFWA 2Y60A 4LK6A 2VUCA 4K8RB 5BNQA 5K7PA 2K9ZA 1JU4A 2Q1FA 4JZRA 4Y5SA 3Q8AA 4B1LA 4CEWC 2X53S 2XWBB 5JIUA 3OGVA 3WHUA 4CEWB 2J1EA 2Q5TA 5JVVA 5EFUA 4DFSA 2O14A 2VQAA 2XL7A 2YFUA 1RIRA 3ZSLA 4URAA 1WLTA 4QKNA 2E7AA 5FFOC 2FMDA 5DZEA 2WO1A 4LULA 3O1MA 4XF3A 2A6XA 1C8NA 1ULOA 4G4FA 3DYPA 5IVVA 3LGRA 5F2WA 4Y22A 2JE8A 3L9JT 3MIHA 3SH4A 4XHBA 4CVUA 2JD9A 1Z7S2 3HJRA 1AJKA 2O1QA 2VE1A 2DVDA 4XJWA 5G05L 1S2EA 1AYM2 2MEV1 1NG0A 2TEPA 1QJX1 2HWC1 2KR2A 2XJSA 4PJYA 4Q27A 1OPOA 4R8HA 5EP9A 5B4XA 4WM8A 5JMOA 1BXHA 1EPZA 1GWLA 5F3EA 2BYVE 4LKDA 5FAXA 2K2SA 4XETA 5FYVA 2OQ7A 4XDPA 1NZIA 1VR3A 3POGA 1QXJA 4I02A 1H0BA 3GYDA 2A7AA 2WLPA 3WDYA 5FUPA 4I2OA 5FZGA 1IQAA 2I2SA 2ZEXA 1EUTA 1WKYA 4DQAA 3NMBA 1CWPA 2Y8KA 2J1RA 4JV4A 2G4IA 4FPKA 2WNUB 4GAZA 3AMQA 2OXBA 3RS6A 2W1QA 3VDCA 5I91A 1XJAA 4LUMA 1IS4A 3I2DA 4TTGA 2PFWA 1NE6A 3CHXA 5FYTA 1BKZA 4LHKA 2ZMLA 5FP4A 4NHKA 2OKXA 1H4GA 5A70A 3BTAA 2AEYA 2WZR2 5BPXA 3P5BA 2Y64A 4JHTA 1YQ5A 2VBDA 3AYEA 3DL3A 2AEZA 1MEC3 3HQUA 4LPLA 3VBUB 3ZPYA 4MZUA 4QX2A 3URFA 1R091 3OG2A 4LEJA 1Q56A 5FPBA 3VDDA 4AEMA 3OPWA 5A3LA 3DYMA 2J42A 2BZDA 4FO9A 4JKLA 3RZKA 1F35A 2TBVA 4CUCA 3V56A 2AUYA 4J6GA 4QHZA 2YGLA 1BVP1 4DZGA 1CAVA 1W6PB 2OVUA 4BQXA 2FZ2A 2JDHA 1K45A 3HWJA 1NA1C 1WZXA 3CJIC 4G9SB 4XUQA 3MIDA 5CKQA 3RNSA 4E2QA 1CESA 2JB4A 5JMCA 1UWWA 1H30A 3LF7A 1LEMA 1NKGA 3APBA 2PAMA 4C0HA 1NA1B 2VG9A 3CJIB 4KWUA 3M1HA 4NIDA 4Q8LA 4A6SA 3AMMA 3J7NA 4UAPA 2Q0AA 4AQTA 4XFIA 2WSUA 1LNSA 1CAXA 4WM7A 4AGRA 5E6HA 3VBOA 1GZWA 3VL9A 3WDUA 5L9BA 1VPHA 3R6SA 2OW4A 1SFNA 4RSUA 5GLTA 3ZPOA 2WQZC 4Y5Z0 3SEEA 3WP6A 4JQTA 2WT1A 4ZXEA 2I07B 5E16A 5L9RA 1EAH3 4A7ZA 1C4RA 2W39A 3WF0A 1W8HA 4QQPA 3DF0A 1DYOA 1ODNA 3AFGA 1Q8SA 2K0GA 3RYPA 4CCLA 1JYXA 2ZACA 2PHTA 1A6CA 1V6KA 1S0EA 4GKYA 4IGPA 2QBXA 5CG9A 5E89A 4UFLA 4QGNA 2XQXA 2YG0A 1LHWA 1UU6A 3CZUA 2D5FA 3OGJA 3AX4A 3T0DA 2VVDA 3PMSA 4HKLA 4Q4W3 1DZTA 3ZSEA 3GJBA 5KXBA 4MG2A 4JGZC 4KWJA 4S2FA 4PCRA 1MQTB 4IW3A 4O65A 2NPIA 3LQCA 1T2XA 3H1MA 1S2KA 4JGZB 5KHIA 1UD1A 4RR3A 3BU7A 4AFMA 1MPXA 4UFKA 5I0RA 5JZGA 2VVEA 1NCRB 2WS91 5E1RA 4LT5A 1DYKA 2FD8A 3BOWA 5JAXA 4BQ5A 1TZOA 3M3QA 3WLUA 4QB1A 1HRV3 3S6PA 2Z69A 1TEIA 2BQPA 3B9IA 3PU8A 1BBT2 4COYA 5A6QA 1HJFA 4LLOA 1SLLA 1QQP3 1XU2A 4JC1A 2CV6A 5IFPA 3I54A 3VBFA 3RSJA 1WCQA 1ASJ2 1L7QA 1H1IA 4XYXA 3WVJA 2D3PA 4M4RA 1VRH1 2PLV3 3ZFFB 1UMZA 5IJRA 2WAAA 1O3QA 2G9FA 2B9VA 1KDMA 2GNBA 2J1TA 3AMHA 4FFFA 4WV8A 1W39A 5FTTC 2P6HA 3H8XA 1N1TA 1W3XA 3B02A 3DKWA 2XR4A 4OMDA 2D40A 3IMMA 5IAVA 1SBEA 2VZTA 1S0GA 1EPWA 4BOWA 1QGLA 1VRBA 2A6VA 3I8TA 4MGYE 3THTA 1GU3A 4N9IA 2RDQA 3PVNA 4XQDA 5CISA 2BFUS 3AKQA 1C8M1 3LEMA 3H9AA 3N7KA 4IEUA 3OUIA 3BTXA 2VZPA 3IKWA 2VL4A 2R043 3L2YA 3WY6A 3W9AA 1UY3A 3N9MA 3KCYA 2DFBA 2ZHLA 5LRRA 2P3YA 5FY8A 4C0BA 2Y6GA 4QKFA 1RUG3 1W8WA 2RS51 4IV1A 3I97A 3JXSA 4XIOA 2BNOA 4HLTA 1W6MA 4IE0A 5CEHA 3J9SA 1MZFA 5G04L 2XL9A 2VULA 4YM0A 2BVVA 3EYPA 1Z0HA 3VBSB 1AUYA 3ZN6A 5JOZA 3HR9A 2D5HA 5FZKA 2AACA 3MIGA 3IAQA 1GR3A 2HJIA 2HEVF 4Q2FA 5A32A 2CHHA 1US3A 2VZSA 4LHLA 3TAYA 4J1XA 3VZMA 3ZXAC 4DRVA 4AAXA 4LKSA 5HXVA 4PLMA 3D0SA 1VBE2 4XUPA 5F9TA 1F15A 1BJQA 4CXYA 4E27A 5KHHA 1QH7A 2ARCA 5FZIA 4D69A 3MFCA 2YBSA 4UW5A 2NZ9A 4CEYA 1IQDC 3M8LA 2HWE1 2ZGLA 4MXWB 2C24A 1QJFA 2WR9A 3FN9A 2EIDA 1W6QB 4XBNA 5GM0A 1PGL2 5J1XA 4UOJA 1E5IA 4D8MA 1DQ0A 2XJPA 3DPRC 3NKGA 2QQMA 1V6LA 3EBRA 4HFSA 1ZRCA 2VZUA 1W8OA 2BGPA 1U5YA 5JDBA 4X8PA 1P8JA 4X6QB 4YVSC 3DPRB 4NVPA 1ZBE1 1BBT1 1OD5A 1W9FA 5FK8A 1FXZA 1RGSA 1IS6A 5DDJ3 4YVSB 1Z78A 3IB3A 5ERLA 3WW4A 4XURA 4ZY9A 3TEYA 1N3QA 1YQCA 2YDEA 1UXZA 4QX3A 1W2AX 4AK3A 1OVPA 3SEPA 1YUDA 4BYYA 4AL9A 5A1FA 2WNVC 2A70A 5FP7A 3TBDA 4Y4YA 2BU9A 3J8F1 1RJ7A 5CKMA 1GUIA 4YNIA 1ZZ7A 5CB7A 4B4QA 2GNDA 3QCWA 1LCLA 5DG1A 4C8DA 2WNVB 4AGVA 1QQP2 1W2OA 4XUOA 5HV4A 1HX6A 5KHKA 5FXVA 4D3WA 3BTYA 5A3NA 4Z1VA 3V0AB 1H8VA 3VZOA 3WSOA 4FSJA 1V9U1 3H0OA 4LQRA 4BLIA 5K0UA 1C57A 2ET1A 1OQ1A 2HH9A 1NY72 4CDXC 4LHSA 2GMMA 2HKXA 4AEDA 5EYXA 5CU1A 5HCBA 1O4YA 2PHXA 4BWOA 2RM21 2P17A 3OUHA 3R4SA 1JTZX 4F7ZA 4CDXB 4YZ3A 3WNPA 4CDQC 3OBTA 2KD7A 1ZM1A 3E5UA 4CPBA 4K1YA 5LA0A 4BA6A 4BMEA 1HV1A 4CDQB 5BNOB 4CDUA 1VBC1 1PK6C 2HWF1 3TEXA 4P02B 5HV0A 2W1UA 5L19A 4ZS2A 1GNYA 1VLNA 2RR11 4XC9A 1W9TA 2NN8A 1VBD3 1PK6B 1TVGA 2DUOA 1K5JA 1VAMA 3KGZA 4Q0UA 2D6NA 4EZ4A 3ETPA 5KWRA 3S5AA 2A6WA 2DDUA 1OLMA 1SEFA 2QE3A 2PHWA 3POYA 2BNNA 4IE4A 1SHWB 4DUVA 3NNMA 2CY6A 3S5QA 4LA2A 5CVRA 1NQJA 2ZKLA 3FHQA 5FPUA 2FDFA 3WG2A 4YW2A 1SACA 3LSDA 1UKGA 3HOBA 3NL1A 3I2IA 1YWKA 1UZVA 1ZREA 1VBA3 1SLIA 2ETEA 4FFGA 2WN3A 3KQ4B 3MO4A 1JZ5A 2VZRA 3CIHA 1FATA 4AVCA 4YARA 1PVXA 1VMHA 3MLLA 3MUZ1 1G9BA 2XUMA 2ORZA 1JYIA 2ADEA 1QXPA 3ZIWA 2XKPA 1F2NA 4DNYA 1NLRA 1J3PA 3ZR5A 1PGL1 5CZKA 5DG2A 1X36A 4SLIA 2NMOA 4HVRA 4Y22B 2E31A 2UYBA 2IXJA 3VD4A 2YFZA 4IGQA 2Q30A 2QNKA 5EZWA 5C4WA 2XJTA 3IIIA 5FZ4A 1AYN3 1IS5A 3ZYRA 1CIWA 1LR5A 2XJUA 3WOGA 4HG6B 4B7EA 2P5BA 4Y33A 4YPJA 1AR81 2X05A 1ZZ8A 3KSCA 2GH2A 1W6OA 1S2BA 2QUOA 4NPLA 1ND3C 2Y38A 4X8NA 3RVHA 1H4HA 2XWJB 1NUKA 1UOBA 2W68A 2VCAA 3SXWA 5FPVA 4CSWA 5HCAA 3IDCB 3MDPA 1S0BA 2WL1A 2BRTA 5GZGA 4QPIA 1JHNA 5DDJ2 5F8PA 5KHGA 3RMYA 1IG3A 1WMFA 4MGZE 1CZSA 2PAKA 4LE4A 4N90A 5LATA 4DXZA 3AZWA 3AZVA 4UFHA 1G8WA 4MXVA 3I59A 1RTVA 3WW2A 3INAA 2I74A 4NIAA 4CCDA 3ZSKA 4IEQA 2WUHA 5LK7B 2JXAA 2FMYA 4FPEA 2D6KA 1DQ6A 1OHFA 3B01A 1COV3 5A32B 1ZBA3 2XH6A 1FPN3 1FAYA 1DGWA 2ADDA 2LM3A 1BYHA 3VDDB 1AR63 1TNRA 2ZGMA 5H9SA 3HAGA 1UMIA 4A2UA 4R52A 5FLJA 2OS2A 3T2PA 2Z79A 1RUI3 2ARXA 3N9QA 3MIEA 1POV1 1CAVB 3GXUA 4GULA 4LBQD 1A3KA 4BISA 1ULEA 1YJKA 3FHIB 3M3IA 4Y1ZA 2JG8A 3RG0A 5L73A 5D8AA 4Q0QA 2ZHMA 3MPBA 3EO6A 1UQXA 1QJY1 3T3YA 3C8XA 1D0HA 3LSEA 2OPKA 1QNWA 3MUY1 4WM7C 3RZZA 4B3NA 4BPZA 1K12A 4DOUA 4XACA 4TZDA 3VBOC 4NIGA 1C5IA 1VBD2 1WUVA 1WW7A 3FFQA 1CAXB 4WM7B 4XJ9A 1BEV1 1E57A 3B3QE 3H1WA 3WG4A 3ZN4A 1CAWA 3VBOB 1QJU2 1XE7A 1GZWB 2VBBA 2ZEWA 2BGOA 1W9SA 2NLRA 4K21A 5APAA 5LCWL 2EAKA 3MICA 2WQ4A 2HWD2 4HETA 5DUUA 2ZJCA 3NKTA 4QXCA 4RN5A 3RZMA 4YM3A 4MADA 4MHRA 1BLZA 1TMF3 2CAVA 3ENRA 4BQ4A 4Y1XA 5LW9A 4H2AA 3AKSA 3C2UA 5T52A 5C3SA 3TEWA 2ZGRA 1DP0A 2F17A 5GLVA 1W6NB 2BERA 4IETA 1R1ZA 2QTWB 2P4EA 3NV2A 4DRRA 5J96B 1JZ2A 1HRI3 2R073 3QACA 4DB5A 4PBPA 1OI6A 2HWC3 2VXRA 3UGGA 3VD9A 1T6BX 4W8JA 3I7DA 2V5YA 2XG3A 1W3VA 2G19A 2G9ZA 5A3UA 1HXS1 1H2LA 1KDKA 1PGSA 4OQ9A 3H8RA 3I2OA 3J7LA 1QNYA 1YEWA 2BBAA 3AP4A 5JZGB 2R7EB 2CGPA 1JYCA 3I2KA 3R0RA 4EV0A 2VXJA 4W6WA 4AI9A 3J26N 5F6KA 1XC6A 1OA3A 2XLAA 1YQ8A 2EVXA 1IPJA 1Q8PA 3AMPA 4QGMA 3SMHA 2UWBA 2DUPA 3ZSMA 5IK7A 4K9SA 3TB0A 3PDQA 4YZ2A 2R6QA 3O7OA 2ZX2A 3VBFB 3H3ZA 4XAAA 4P9GA 3UNPA 2JDKA 1PNGA 1OKQA 1WW4A 3BTZA 2DFCA 3M3OA 1W0NA 2C9KA 5GJ6A 4OULA 5DUWA 5KBFA 1BK1A 1SLTA 1PVC1 1AR72 5C9AA 4OLLA 4IESA 3AP7A 4XQWA 2Q8CA 4FXGB 4CCMA 1EYBA 4XUNA 5DUVA 4JRAA 3EMRA 3WCSA 4A44A 2XLFA 4XZUG 2IFWA 2DVBA 1AR91 4AVTA 2VO5A 1QDOA 4Q4Y1 4OCTA 1AR62 5BY5A 3HNYM 2W46A 4CRQA 4M4PA 2BW8A 1QOTA 4KGGA 1WMDA 5FMCA 2JE9A 4O61A 3FLTA 4M0HA 3WNOA 1RUI2 1SMVA 3VDBA 3DKQA 4ARXA 3A23A 4EWEA 4F83A 5LY1A 1K42A 1QJU1 2OUJA 3T1MA 4NHMA 3GHNA 1R1A2 1OFNA 4IV1B 3USUA 5EPAA 3RRDA 1LKNA 4KNCA 3WDVA 3OYWA 2KA3A 2V72A 3K4DA 4RD7A 1SQ4A 1VB4A 2WZ8A 5LBBA 4LKFA 3ZN6B 2HBUA 4AI1A 3WNMA 1J59A 3RJRA 1FMD1 1OKOA 2VNRA 4AEKA 4YVWC 1Z7S3 5ACA2 1MS1A 2AR6A 2ENRA 2R49A 3ETQA 3KV4A 1PZ8A 2ZABA 4TSVA 3LPFA 4OI2A 4YVWB 3N36A 3POJA 4N9HA 3CL1A 5IK5A 3WG3A 5J37A 4ORFA 4WZFA 4NAMA 3OD0A 3POFA 4IE5A 1KS5A 4L0PA 4LUKA 4NPMA 1S0FA 3MYXA 2FCTA 4YGBA 5FY0A 1OT5A 2RS11 1OOPA 1AX2A 2PHDA 5FLHA 5CFCA 3MV11 5I0DA 4QXBA 4R4ZA 1CIYA 3Q8FA 4DUWA 2XHNA 5FOJB 1RVF2 4CP9A 1S0DA 2VMFA 3AP9A 4Y1UA 2X10A 5FY5A 4FPGA 3UJOA 4NROA 3O0XA 3D3AA 1VALA 2MEV2 3E5QA 4L8QA 1QJX2 2HWC2 5EHDA 4CYDA 2WS93 4QAWA 2DTWA 4XFBA 2JG9C 2LTNA 1DU3D 4OQ8A 1GYKA 2EF6A 5F3GA 2OA2A 1DLCA 1KD7A 1PX3A 1XPWA 2C0ZA 3ST7A 3O14A 3ZYHA 4C1XA 4MVTA 3RGBA 3SITA 3B94A 5GZFA 3ZFEA 2EXHA 1XNDA 5FPAA 5JUVA 3FLRA 4P9LA 1QOOA 3VBHA 1J84A 3SCFA 1O4ZA 2CU5A 2VMHA 1VRH3 2W5FA 3DCQA 5FY9A 2JDUA 4QXKA 2DBNA 3WNLA 2C5DA 2VMEA 1JYVA 4HKOA 3KM5A 1OA4A 4L11A 1AR71 3UT0A 5F7UA 2Z42A 2XMLA 3ZKUA 2A5ZA 5CBLA 4NUBA 4O9GA 3IMNA 1G7YA 3RZJA 3QLQA 2PHLA 4XJZA 3OB8A 1KS4A 3O1PA 1OQEA 1R092 2OZ6A 1C8M3 3FZ3A 4CDWA 4AEDB 1I5ZA 4P5HA 1RUE1 5FO9B 5BNNA 1MR5A 1OUSA 1R082 2VD7A 2JICA 4JDMA 3ZYPA 2VUDA 3GZUC 2XVGA 2XVKA 4JDOA 4CA9A 4HONA 3PU3A 4RQPA 2ZGSA 3T0AA 5FZAA 1WLDA 3GBGA 4CDUB 2Q4SA 2R1DA 1W06A 4YGCA 1R1A1 2W91A 2JKBA 3LWCA 4BH9A 4DXSA 2R30A 4LE3A 2LALA 1Q8QA 2BOIA 5FOBB 3I3BA 3JB4C 3QOPA 3UGHA 4NHYA 1UYXA 3AZYA 4DEVA 2RMU1 2D6MA 2E51A 2PELA 3AYAA 3NVCA 4M01A 1MVQA 4AVVA 2JECA 4HK9A 4QDRA 3K3NA 5DMYA 2VAUA 3BUCA 4Q0VA 4M3CB 1RMU2 4QU1A 1UF2C 1PO22 4HN0A 4X6RB 5ACA1 1YIFA 2GALA 3HN3A 3VZJA 3HBKA 5FMOS 2XQRA 3AVSA 3T2OA 5I8YA 1LAJA 2JIGA 2XB6C 4AE2A 1EV11 2VMDA 5GALA 1RYYA 4IEPA 2IVIB 3AXEA 4UBGA 4JGYA 4XOGA 1PNFA 1H6YA 1JUHA 2WA4A 3MLJA 1ZNPA 3U0ZA 2CSGA 1UPSA 2WO7A 4CCNA 5C70A 1MS9A 3Q8BA 1RVF1 3SKVA 4FOWA 1UZ0A 4LKEA 5GZCA 2AREA 5IATA 3O1SA 2J1UA 3QD6A 4V2WA 2BV4A 1O3RA 2IFRA 3VBRA 1YNAA 3FX3A 5DAWA 4D7YA 3BODA 2DTYA 2P1BA 1TME1 4GJYA 2ZTNA 1HN1A 1ZBE3 3BCWA 5C4WB 1BBT3 1LB2A 4D7SA 3WG1A 1HQWA 4YG6A 2XLGA 3VHOA 4FCAA 4HVQA 1ASJ3 2WNUC 3P1IA 4BHPA 4AFBA 1W6OB 2WS92 3CU7A 5LWBA 4KQ7A 3HQRA 3BIWE 3IPVB 3ILNA 4XFCA 1LOBA 1N1YA 4QPIC 4LBMA 5F5QA 3E6CC 1NT0A 3J8F3 4GA9A 5IVCA 4FOYA 4AI2A 3AYDA 1HJGA 2WWJA 3JZVA 1YYNA 3PJQA 1IHMA 1AXYA 2PAEA 4PT6A 4QPIB 4RS5A 2X29A 3NJZA 1Q5OA 4XZPA 2RS32 3VBUC 1HV0A 1W8TA 2QDRA 4IDZA 1V9U3 3LFIA 2O8QA 3IWZA 1VRH2 3I59B 4Q29A 2QQLA 2W95A 4XILA 3T4VA 2ES3A 1QDCA 1JU3A 3MF9A 3MW2A 5KC6A 3RYRA 2B8MA 1U12A 1W03A 3CZJA 1OURA 4I30A 3BU0A 1NQDA 5A7WB 1R081 3KVBA 2Z5WA 2C6SA 3ORJA 4PHZA 3ACIA 2LW8A 3AC0A 2ZXQA 1UIKA 1SDDB 5C7GA 4AGGA 1QWRA 1HW5A 2JKXA 5JIAA 4H55A 3M4FA 4ATEA 2OX0A 5LA2A 3ZVXA 1DGRN 4F3JA 4WZCA 1C8M2 1NCQC 2RDSA 5JSOA 4NPRA 3SC7X 4FPCA 4OUSA 5CAZA 2JG8C 4Y1YA 1NCQB 1Q8OA 3EQEA 4EE2A 2ZKNA 1WLWA 4FFHA 1HB3A 2C1FA 2JG8B 4D6QA 4Y1VA 1RMU1 2QQWA 1PO21 1YRZA 2IXKA 4QMAA 2RS52 2A1XA 1YCIA 2Q8EA 2IXIA 4BMBA 3FHAA 5T50A 4IEVA 2F4LA 1UU5A 1VBE3 1GNZA 2B42B 2BWAA 2UYAA 3CF6E 3X29B 3HPNA 4GH4A 4GQ7A 4QX7A 4OHVA 5FK7A 3BALA 4MGTA 3WP4A 5BXXA 3VHPA 3JBG1 3PJYA 3ABZA 3NSTA 1YFYA 3JCIA 2LROA 4M0NA 4QPGA 5EYYA 2A3WA 2DF7A 1K5MA 5EQUA 3HN1A 4BQ1A 4EYUA 5EV7A 5FMBA 4M3CE 3PIGA 2JB8A 1MQTC 3OF1A 4NHXA 5FR3A 1BZWA 4N43A 2DVFA 4ONUA 3VD5A 4MGIE 3PVEA 1CN1A 2HWE2 3B69A 1ENRA 1GQHA 4WVWA 4QWNA 2QVSB 1N3PA 1O8SA 5K4LA 3B5LB 4HSJA 4N8MA 3GDBA 1F4HA 1NCRC 3ZXEA 1DGLA 2WJSA 1K3IA 4XTPA 1AR83 3OD4A 2A75A 2E33A 4WVZA 5EJZB 1H1MA 2WLQA 5DUXA 3RJ2X 2R32A 4GXLA 5CKNA 1DQ2A 4XE9A 1ZBE2 2OT7A 4LBQA 4AOCA 3U78A 2RHPA 4DINB 3WEZA 1DLLA 2JDAA 3IAPA 3UESA 2RS31 3ZFFC 4C1WA 3T4HB 4CCOA 2AENA 4QQOA 1W05A 1A78A 1QH6A 3N4MA 3NAPA 5LASA 2JDPA 4PBOA 2E26A 3EB7A 1JZ7A 2FDKA 4LXLA 3LCPA 2J1SA 2YGMA 5A33A 1Q3EA 1UZYA 3J8F2 4XBQA 2A3YA 5A3TA 5C5TA 2VW1A 1OSGA 4ZS3A 5A7NA 1SFYA 4GIQA 1ND2A 2CNAA 4ARYA 2WFF2 2FHRA 4PQ9A 1V9U2 3NW4A 5HXMA 5FZ0A 4QQHA 2ATFA 2CWMA 3M3CA 3LIHA 2YPJA 1XE8A 3OSDA 5SV8A 3RWKX 4W65A 3EHKA 4ITCA 3V0BB 4EROA 5C3QA 5C9AB 3ACGA 1QJZA 3BN6A 3CKHA 3K46A 2RM22 4QU2A 4D0QA 3RZLA 5FZOA 3KV9A 1WA4A 1XYOA 4AEJA 4AVBA 3ALQA 2DUQA 3D8CA 1F8VA 5IHRA 1POV3 3PNAA 2VZQA 2WA3A 4MGSA 5L7OC 1LOGA 3POWA 2VQTA 4META 2D3SA 1I1EA 1AX0A 2FZ1A 1VP6A 1STMA 1DHKB 1VBC2 1UZWA 3MEPA 3T09A 5L7OB 2HWF2 1ULCA 1QJY3 5AVPA 1Q43A 1C28A 1ODMA 2WWSA 5CFDA 3VBSC 2RR12 1CX1A 5LZ6A 1Y9GA 3LAGA 3NO8A 3ZXFA 1HB4A 2RJKA 1BEV3 2VQUA 4KWKA 4BQWA 2WO3A 5HCHA 3AVRA 1WCKA 4LBLA 2VJXA 3F95A 1O8PA 2EIBA 2YY1A 3ES4A 1GP6A 3WXPA 4A4AA 4WVMA 2DCZA 2P34A 2Y0IA 2HWB1 3IDBB 2OYZA 3USUB 1UX6A 3D6EA 3OYWB 1KJLA 5C3OA 1OD3A 1JOJA 1U5XA 2EXJA 3SNMA 2W08A 1CGPA 2ZHNA 1J3RA 4UT5A 3CJXA 2DCTA 4YGEA 1DQ5A 2IUWA 1H6XA 4OFGA 4BXFA 5CA6A 2XBO2 2Q1MA 4XXAA 5FZ7A 5HBAA 1PHMA 1UNBA 5FWJA 1OFSA 4AI0A 3BPZA 3NJYA 1OOPC 1MZEA 1OA2A 4ZKTB 5C8CA 2MHFA 4FP2A 1MZ6A 1I9RA 1OOPB 1VE0A 4QX1A 4YGDA 3ZYFA 4CP2A 2BNMA 4QGLA 3ZSJA 3NJVA 4RL7A 4Y20B 4P14A 4MUVA 4EWDA 1OF3A 3ZMNA 4CP9B 3WT3A 3LZZA 2X5IA 3MW3A 1RUOA 1AR82 1HDKA 1LOCA 1B35A 1X82A 2XJQA 4RGAA 2Y33A 4OYUA 4OMCA 4UW3A 1DGWX 3IT8A 3PHMA 3TOJA 1G9DA 5F32A 4Q1PA 4IEXA 5LA1A 2WQ8A 4QPWA 2H6BA 5A6XA 2RE9A 5DXDA 2OUHA 1UO9A 4YW4A 5FPZA 2EAAA 2BJSA 3DECA 4JKKA 5ANNA 4BQYA 2R061 1JZ3A 3I3DA 4TN7A 2YC0A 2WFF1 4QT6A 2G9GA 4MV2A 2ARAA 3N3HA 2VCCA 4WVVA 1AVBA 2D7FA 3GZTB 1CR7A 3O1UA 1LU2A 4GKXA 5FZBA 3WP3A 2XJVA 5JXIA 1PVC3 2ZEYA 1IKQA 3KF5A 4IV3C 2PA7A 1WD4A 5J36A 1G9FA 1GKBA 4I0AA 3OPZA 3PTRB 1QOSA 3S30A 1R64A 3AZZA 5FP9A 5BNOC 4Q4X1 4IV3B 5A7OA 3NV1A 1UYYA 1C5HA 4JCKA 2VZVA 1GLHA 2WKKA 4LA3A 2QKDA 5A7SA 5BNNC 2PXJA 3WQ7A 3UK9A 4AXOA 2TNFA 3OY8A 3WZ1A 3LE0A 2GH8A 3KGLA 5BNNB 3FBMA 4LITA 4AI8A 5KHJA 3BB6A 3WD5A 4P9WA 5ABJA 1DCSA 1V00A 2VUAA 3ACLA 4NHLA 5FMDA 2Y6HA 5B4NA 4YZ4A 4DPNA 3ES1A 1GICA 5FJHA 4QHBA 4PF1A 1QJU3 2YHJA 4QD2A 5CADA 4CTEA 1JHJA 4OHWA 4UFIA 3K77A 2WDBA 4BE3A 3D0JA 4CCEA 2V5DA 1QJY2 4MX3A 2HWD3 4B8EA 1H2NA 1O3TA 3LDRA 1JZ8A 1VBB1 4UFMA 3T0BA 1UY0A 1D2QA 4BB3A 1LEDA 5FWEA 3AYCA 3E97A 4ZU4A 1BEV2 1Y9MA 2WT2A 3MLKA 5FZMA 4L92A 3AXDA 5FP8A 3KS7A 4XCBA 2XBO1 3FBYA 1FX5A 1M06G 1G86A 1REFA 2BUKA 4TLGA 1OXCA 1LHOA 5FZFA 5A3WA 5BYNA 3H3LA 4K1ZA 1UU4A 1ZZ9A 2JDYA 2HEWF 1REDA 5A80A 1RJ8A 1MS5A 2DVGA 1ENQA 3TN92 4HKWA 4JGYC 4UW4A 1SPPA 4QHOA 4YM1A 2ERFA 3LA7A 3C7OA 2PQSA 1US2A 5IFTA 2Q1ZB 2YMZA 4A7KA 4Z92B 1VMJA 2PHUA 5DPNA 4CU8A 1MZ5A 2QQVA 4JGYB 3UETA 4AW7A 2HYKA 1HQNA 4PLOA 5LK5A 3THPA 4D6SA 4YYOA 3OEBA 5FV3A 4PF5A 3VHNA 1H2MA 2VTXJ 3RWNA 2J1VA 4N7UA 2ET7A 4LHNA 4WM8C 5FBJA 3AFKA 3LOBA 1EAH1 1I6XA 2VY0A 3DUIA 5F6LB 2MPFA 1DZQA 4FXKB 3P3NA 3N7LA 4U36A 3TNPB 5A3MA 4WM8B 4PI2A 1OBNA 3VV1A 3AJYA 2NM1A 5D2AA 4FFIA 1X50A 1JS9A 2W52A 2RDRA 3DXTA 1W2NA 4FPYA 4TYSA 4RGKA 1DZRA 4J1WA 1CPMA 1MS0A 1DQ1A 1HXS2 3FLPA 4KU8A 3IDAA 1JODA 3NRUA 3R05A 5LEKA 1GQGA 4B1MA 4BIOA 1UX7A 1UAIA 2VC9A 2XOMA 2L9LA 1SFPA 2B46X 2C26A 4Q4W1 5DABA 2Q8DA 4CU7A 3FMGA 5F2SA 4RYDA 3HEIA 1PM4A 3ZXGA 1ENXA 4XHXA 1OQDA 4PLNA 4XJ8A 1PMHX 1AR73 3PURA 3VD7A 4CCCA 1UY1A 1V6MA 4KL1A 4RS5B 5LBFA 5A3OA 3WF1A 3DGTA 4OI0A 3I2FA 1Y4WA 1JYNA 3TYJA 3VHRA 2YZ4A 3N7MA 3ZN5A 1LOFA 1L7RA 3VDDC 4AAPA 3PLQA 3OBAA 1YHFA 1O6UA 2ZZQA 3VZLA 1KRIA 3G6JB 1IGOA 4CCJA 1FNZA 1PVC2 1RUE3 1UIJA 2B5HA 2VMGA 1QJEA 2EIEA 3ASIA 1J1LA 3UGFA 5FZ8A 4B4RA 3LFMA 2PLV1 3IZOA 3JUUA 3POSA 2ZX4A 3O0WA 2WAOA 3O1TA 1VMFA 1LOAA 1M4WA 2Z4FA 4GWJA 1AR92 3ZX7A 1YFUA 4Q4Y2 3A0NA 2B9UA 1R1A3 4IE7A 4S2HA 1UOJA 2VBPA 5CYYA 2E7TA 3SH5A 4DUXA 3B9CA 2ZOEB 5D1IA 4C90A 1ACCA 4KWLA 1GSLA 2RMU3 4B7KA 4DEQA 5CG8A 4NN0A 3SISA 4I3PA 3MPPG 5F39A 2O0OA 3J7MA 4CCKA 2VCMA 2QFEA 1SCRA 5GKAC 1KFUL 5ACA3 3KCCA 4XFFA 5FKCA 2P3JA 4OHXA 4GH4C 3WDWA 1YJLA 3OEAA 2UY9A 4YM2A 4TWTA 4O7XA 1XE0A 1IPSA 2GN3A 1ULPA 3KT1A 4GH4B 4XDQA 3ZKYA 5J3UA 3OJBA 3B93A 4LIUA 4FAHA 1G9CA 1FMD2 1N47A 1ST8A 1W8NA 1DYPA 2D6PA 3DYOA 4LBKA 4QPGC 2VECA 3M70A 4B29A 2GU9A 3PMEA 2GMEA 1RVF3 3MW4A 3H3UA 3ZFGA 4LO8A 4LR4A 4OUMA 4QPGB 5B2GB 2MEV3 2WZPP 4N43C 1IS3A 1QJX3 2D93A 5DAVA 4YFWA 2Y6LA 1C1FA 2D6OX 4PIXA 4P08A 2RS12 4AHYA 3Q8EA 4OZOA 2VZOA 4N43B 1KEXA 3IBMA 4AYUA 1D0GA 5AFBA 2R16A 1J3QA 4RR3C 5JZGC 5IVJA 1OH4A 3KT4A 4RHV2 2P6CA 2IC1A 4E8DA 4L97A 5K8SA 4LLFA 4RR3B 3NNJA 3GJAA 2VH9A 5FKBA 5I0SA 2GNMA 5GZDA 3ZXJA 3VBFC 2VW2A 3AMNA 3ECQA 4NIHA 4Q1RA 1A8DA 4YRDA 1CJDA 2F6BA 4Y26A 5IYYA 1GZTA 2VNGA 3I3QA 1QHDA 5CNAA 2EXIA 3O1VA 1ZX5A 1GFF2 3C7EA 2P37A 4R9AA 1WBFA 3D5OA 3POEA 3AM2A 4GD4A 1JYWA 3B7MA 2Y6JA 3W20A 4Z2WA 1JMUB 3SHRA 5A33B 5FO7B 1R093 3GHMA 2H0VA 5CIRA 3H50A 1QKQA 3IDEA 4K6BA 3U1XA 5FY1A 3N35A 5JSPA 1R083 1ND2B 3KV6A 3PUSA 4N7IA 1REEA 5FXZA 5A6YA 3LB9A 1A8MA 1O5UA 1V6JA 2RG4A 3U4XA 5FXXA 2YC4A 3HIFA 4LO6B 1VJ2A 2VW0A 1GBGA 5C6CA 1ZRDA 3LEKA 4K40A 2YU2A 3JD71 1RUE2 2A6ZA 2GC1A 4HZFA 1PO12 5IT6A 5FZOB 4PDWA 2A73B 3N9LA 2LS6A 2ZAHA 4JHZA 4ET7A 1SLCA 2YYOA 4XQ4A 1SLBA 3E1F1 4IEYA 1VIWB 4MO3M 3AB0A 1UZZA 3O5SA 4YW1A 4EQVA 1RUJ1 2JDZA 3R4DB 4IV1C 4AR2A 4SBVA 4ZU7A 2I45A 2UWAA 4LJHA 4PIYA 1RMU3 1NXMA 5FYUA 4NRQA 3O12A 4P9XA 1PO23 3D82A 2C9AA 2A6YA 3OPTA 4C91A 3ZDVA 1JH5A 5FZHA 1TG7A 2NMNA 4YW3A 5CFDB 4JAAA 5FYSA 2UU8A 1W6MB 1XNAA 2RMU2 4RFT0 5JLVA 1FOD1 3WX5A 4IEWA 4N53A 3GBFA 3O1RA 5JR2A 1BK0A 3IIAA 2ZGPA 4J25A 3JBG3 5C33A 4WVMB 3KB5A 3HNMA 2B39A 2YB7A 1GOFA 1D4M2 1E5SA 2XVLA 1KITA 3RI8A 4ZZ8A 2BBVA 1EUUA 2GDFA 2VOKA 1RUD2 3ROUA 2AGSA 3A21A 4ZPIA 4GJZA 4CEYC 1EV12 4AG4A 2VMIA 2IZWA 5FPXA 1W28A 3S0MA 1W0PA 3VB9A 3P3PA 2WABA 4IGOA 4BLJA 4BIFA 4CEYB 5FYYA 4COZA 4BCUA 1NOVA 4A45A 1Y9QA 5FPLA 1XNKA 3BVCA 3LDBA 4RHV1 4H7LA 2Q8OA 5JR7B 3WUCA 3POBA 3M3EA 5C8CB 1ZA7A 2PHFA 3WR0A 3OBRA 4FQ4A 1XSQA 4MXWA 3SCGA 5ISLA 3NQHA 4Q8KA 4FT8A 1TME2 3KVAA 5AFEA 3ACFA 2X5IC 3K4ZA 5LY2A 3BYWA 2O8OA 2PMWB 2XGXA 1B35C 1KQRA 4HMZA 1VB2A 2RS33 2X5IB 3W58A 2XONA 3KMHA 2JWPA 1B35B 2BVBA 1U5IA 4QDQA 3ATGA 1O4TA 1Q8VA 1YI9A 3DPRA 1LRHA 4FPFA 1AXZA 4FVVA 1QXRA 4BK4A 1DDLA 5LB6A 2LUWA 1AYN1 2VOTA 3EXUA 5E8AA 3TN91 2QQPA 4YVSA 2BPA2 2B45X 3AL5A 5A7PA 1CZTA 4M00A 4I01A 2HBTA 4FOVA 2GP5A 5K0UC 1GV9A 5LRSA 2DV9A 1WW5A 3AKPA 1DFQA 2LRPA 3AZXA 3HD8B 3H8UA 4AEDC 3FC0A 5K0UB 4Y4RA 5DZGA 2WNVA 1YC61 4XABA 3T08A 1AL21 2RDNA 5FBZA 3U10A 1PO11 2BFUL 3V0AA 5H9QA 4P9YA 4P9IA 1DIWA 4KU7A 4QPYA 2Y0OA 5T5JA 2PTMA 2ZGTA 4BM8A 2ZA9A 4CDUC 2BP6A 4AZZA 2ZBJA 4KBZA 4INDA 4JRLA 4XF1A 2FDIA 5ABJC 4IQPA 4EN7B 3OY8B 4FI9A 4QB2A 1QMJA 2RS53 3DEMA 3PL0A 3FUOA 4HSLA 4URTA 4CP0A 1X9PA 1COV1 5ABJB 4XBLA 4LIVA 4CDQA 1RUH1 1WMEA 3PUAA 2C4XA 3AP6A 3O0VA 4XFHA 2QQNA 1RINA 2NP0A 3WV6A 3PUQA 4U2AA 1NX9A 2HWB3 5GLZA 1XNTA 1RUC2 2JD4A 2W9XA 3BOPA 1WCDJ 1YQ6A 1WA6X 2ZX0A 1D4M1 3OBZA 4XMAA 1BCXA 4NWWA 1OLRA 5EJ1B 1MVEA 5JOWA 3ME2A 1RUD1 2W87A 1ZRFA 2ZGNA 1MS3A 1Y7BA 2IWGB 4IL7A 5FYCA 1JYTA 3D4KA 3GNEA 4H14A 3RZHA 1XXNA 4S2DA 3ZXDA 4AWDA 3JBG2 4EN0A 2BTVC 2HWE3 4Y5TA 1JXNA 4MSVA 4KI5M 4GB31 3OGSA 5JOYA 1SPPB 3A7QA 4JDNA 2ZX1A 5FRAA 4ISQA 4AFDA 3HQXA 4QB6A 1J83A 1LENA 1FV2A 5C4WC 2D43A 4YSFA 3DN7A 5SV5A 1NXD1 2RJLA 4IXLA 1RITA 1UPIA 1VAVA 2AYHA 1IZ3A 2ILMA 4EN8B 3KZ4C 4M3CF 5KXEA 1A34A 2D97A 1RUF2 1KFXL 1TMF1 4LBJA 4FTBA 2ORXA 4XPVA 4S2GA 2ZZJA 2Z2SB 3WQ1A 1UYPA 5FLIA 1GNHA 2P2KA 2G1MA 1G6NA 1HRI1 1PIV2 2R071 3LD8A 4MOAA 4R9BA 4YG0A 1Y43B 2D44A 3WCRA 1D4VB 2VQ0A 2BOJA 3UKTA 3E5XA 2R063 1TNFA 5FCCA 5AC91 4QQLA 2WFF3 3CBNA 4E4SA 2IXHA 2W94A 5FUIA 5IVFA 3WUDA 4R9CA 3VZKA 1ZZCA 5IAXA 1ND3A 2YUEA 1FNYA 1GQPA 1ONAA 4TXWA 3T1LA 1EP0A 5JI7A 1LOFC 4UI9L 3UKVA 5FZ9A 1BQPA 2RM23 3RFRA 3CDZB 1F9KA 5FZCA 4Q4X3 1MS8A 2CL2A 4D94A 4CE8A 4ES9A 3Q8CA 3K75B 3ZR6A 1W8UA 5C3PA 5C5UA 2YBPA 3SH3A 1E5HA 4AVSA 4PI0A 3TWIA 4AQ6A 1RHI1 3I2HA 1VBC3 3Q9OA 1N1VA 2XDVA 3FJSA 3ZXLA 2J7MA 2HWF3 2ZCWA 2WC2A 1SZBA 1U5ZA 1GOGA 2BDRA 3E6BA 4XF0A 3ZXKA 2RR13 4Q4V1 4YW7A 1JW6A 4XAEA 5D8AC 1S0JA 3USSA 4JTNA 4MYEA 2GSYA 4GWIA 4GMP1 3TRSB 2FBEA 5D8AB 1WCSA 2QQUA 5C71A 2CTVA 4ZHNA 1RUC1 2QZ3A 1H2KA 1PZ7A 1AX1A 1VBB3 3LDKA 3ZYJB 1B09A 2VOXA 4MGKE 1F31A 1O91A 3CMGA 3T2QA 4FOQA 4BK5A 1CAWB 2SBAA 2VMCA 1LHVA 2XBO3 4BXSV 4UFJA 2HWB2 3SKJE 4CUAA 4OZXA 3OGRA 5FQ0A 2ZHKA 1S4CA 3SCHA 2WZEA 1ZVFA 4P5YA 5L36A 1N3OA 2AZ5A 3MIBA 2NQYA 1OLME 4P9JA 4Z2AA 2VOVA 1JOPA 1UW8A 3KD4A 3M7AA 2CAUA 2EALA 2W1WA 3ZFGC 2JENA 3GALA 2GNTA 4YW5A 3MBWA 1S55A 5IK4A 2E63A 3ZFGB 1O5LA 1RUF1 2X09A 1G9AA 3MF6A 1Z7S1 3FE5A 1NE4A 1WCUA 2VNOA 5EJ3A 3HMYA 4AFCA 1W6NA 2VUJA 2WO2A 4JX0A 3ZYIB 1AYM1 1PIV1 4AHWA 2VCBA 3WQBA 4D6RA 3JU9A 3NJXA 5FYZA 3OTFA 4OI4A 2VPVA 3ZLIA 3VL8A 3SQOA 2YV8A 4I3GA 3U37A 1L3JA 3H42B 4HVOA 5A3PA 5KXCA 1GP5A 1NYWA 4ASMB 1HN0A 5BNPA 2WN2A 1PZ9A 2D98A 1NLQA 4LORA 1F5FA 2R0FA 4XFGA 4UXAA 4Y3OA 4ZXKA 2E53A 1IOAA 3AL6A 3PVBB 4DXRA 3WDTA 4O9EA 5DZFA 3ZMOA 1CD3G 1LGCA 3OGGA 2BGCA 2R062 4GMP0 1X8MA 4XCAA 4CU6A 5T5LA 4E9KA 2Y26A 4XDOA 3U75A 3UJQA 5C9AC 1OH3A 5K9YA 2DURA 4AQSA 5T5PA 3RYKA 2VOWA 1URXA 3AJZA 3V65A 2WZR1 2H6CA 1SBDA 2B7YA 2WSVA 3NNFA 1X33A 4Q4X2 2DU1A 1NZCA 5EWSA 4FPHA 3UV9A 3ZYBA 5F37A 4I0WB 4PDWC 3K3OA 3W5NA 3S57A 3TNQA 1O7FA 4COWA 3J4UH 4EN9B 2YROA 1YLLA 1ULDA 2WRAA 4PDWB 2GMPA 1JOBA 4LO5B 5IUQA 4HT1T 4QM9A 4G3YC 4BQ3A 3VLBB 4NOTA 1MEC2 3RI9A 3K48A 1LGNA 3ZM8A 2YU1A 5IVBA 5LA9A 4WBBA 1LODA 3MFAA 2DCKA 1JI6A 2GC3A 3BPSA 3OCPA 2EA7A 4N53C 1O59A 2DVAA 3I3MA 1RXGA 1J1TA 1VBB2 1OLQA 4DY5A 2XHKA 4A7YA 1JBCA 4N53B 4FTEA 2ZPXA 4HANA 3QH6A 4AQ2A 4Z07A 1ZYBA 1DF0A 1W90A 1AL0G 1H8TA 1XU1A 1ULGA 5GZEA 3GCXA 2WYFA 5TSWA 5JI9A 5I93A 5FYIA 5LEJA 4RA0A 2B4KA 2JE7A 4CU9A 1SCSA 1SG3A 1O3SA 3WINE 5CFCC 2VU9A 3RPQA 2YBKA 5JPNB 3ZDSA 3K51A 3UKNA 4HK8A 4D7TA 1BMV2 1AF9A 1XYPA 1Y3TA 1RC6A 2VGDA 2ZGOA 5CFCB 4YVWA 1WWYA 1KGYA 4DIQA 4L2NA 4Q0PA 4GWMA 1CAUA 1HXS3 3MI8A 1JN2P 2QZ2A 2QQKA 4NRPA 1EAH2 4XF4A 1LHUA 4IERA 4L99A 5J09A 5F1RA 3PIJA 4W6YA 2V09A 3TEZA 1LECA 4ZZ5A 3ZFEC 2AH2A 5F5AA 3U11A 3THDA 3VBHC 3H8OA 2ID4A 4CXXA 4EZHA 3ZFEB 3WDXA 5T54A 1SDWA 3MV01 5FZ6A 4OHZA 4Q4W2 3VBHB 3PTYA 4UF0A 4NR1A 5T5OA 2GN7A 2JG9A 3CLPA 3ACHA 3FFZA 3N9OA 4NIIA 2KM2A 1CZVA 5JXJA 4YG3A 1ASJ1 2VTXA 2QQJA 4HPKA 2CGOA 2DWRA 1GZCA 4QKDA 3W21A 4CDWC 2GAUA 1HRV2 3WF3A 2J22A 1EY2A 1C1LA 4IE6A 1AR93 1HB2A 1CPNA 1XRUA 4Q4Y3 1LGBA 3ILFA 3ON7A 4CDWB 2XPJA 3JD73 2QQIA
chains in the Genus database with same CATH topology
4R9DA 4RQPC 4LTAA 2ZGUA 3FUQA 3L2HA 1CQ9A 2PLV2 4QQ2A 4LBNA 4AVAA 1MEC1 4RQPB 1RUJ3 1FT9A 1V70A 2HEYF 2UWCA 3CO2A 5GLWA 1AHSA 3S7IA 4YFZA 4E4DX 1S0IA 1LESA 1HQLA 1RL3A 1MS4A 1J58A 1FOD3 3G7DA 3V64A 1OMIA 5I8TA 1PGW2 3E6DA 2E7QA 1FMD3 4KH9A 1S1AA 4AHZA 1YFXA 1BVVA 4CZSA 1VAKA 1T6GC 2YXSA 4AI3A 3H7JA 2R042 4CEWA 1V6NA 3ELNA 4FP3A 4Y24A 2A71A 1BMV1 4K20A 4M3CA 1XNCA 2RS13 1QF3A 1RUG2 3FWEA 4L9BA 4LO4B 4KG8A 2PYTA 3GF6A 4RHV3 1VBE1 3VBRC 1C3HA 3S7EA 2NYYA 2A3XA 4B4PA 2ZGKA 5H9RA 2P3KA 4ZU5A 4K8FA 4RGGA 3RQ0A 2QJVA 3VBRB 2BEOA 3VKNA 3CNAA 3NV3A 3B00A 4R4XA 1AJOA 1IKPA 2CGNA 2TUNA 3RDIA 1H1AA 5BUVA 2WINB 5JWPA 1WW6A 1XQNA 4RS5C 3TN93 2V73A 4UBHA 4XJAA 1SBFA 4AFAA 1ZRRA 3IPVA 4K7JA 5J48A 4AHXA 2WNUA 3LA2A 1HRV1 3MGUA 2JJ6A 3H7YA 1ND3B 2BWCA 4I09A 1QQP1 1AL23 1RUNA 3I4IA 3NV4A 5J7MA 1PO13 4ES8A 1RB8G 3A4UA 3ZYGA 3VBUA 4XIKA 1AZDA 1NY71 2R0HA 3QH7A 3AP5A 3VKMA 4BZ4A 4JTOA 4F8AA 1FYUA 4A3XA 3JD72 1ALYA 1YI7A 3IN9A 3U07A 1W6PA 3AKRA 1XYNA 1RUH3 2FQPA 1DBNA 4PIZA 3VKFC 1PGW1 1RUJ2 1QY4A 1XNBA 2ARBA 4FQZA 1NA1A 3CJIA 1H9WA 3MIFA 3ZIXA 4YLZA 1NCQA 5J98B 1D4M3 4DS0A 5BV6A 2R041 1RUD3 2GC2A 2W0XA 2MNGA 5GLUA 1MACA 5FMOL 1FOD2 1SLAA 3KLSA 1EV13 3VN4A 1KXGA 5KC5A 1RUG1 4XMIA 1S0CA 3SLIA 3DV8A 2ZMNA 1W0OA 4QM8A 4UW6A 1APNA 1K5MC 4GB33 5FQ0B 3LKJA 2XJRA 4HL0A 1K5MB 2JEMA 1CX4A 4FPJA 1TME3 1ZZ6A 4XW3A 1D2SA 3KCXA 1VBA2 4Z8BA 3JQXA 4YZ5A 1LHNA 4XTMA 4FBFA 1KJRA 3IM0A 5FDBA 1NLSA 1MQTA 4AF9A 4XJUA 4JGZA 4E4ZA 4LBQB 2DU0A 3NAPC 5AC93 5BNPC 2CWSA 1NCRA 1N1SA 2R1BA 1GZ9A 2E9QA 5IK8A 4LNVA 3UL2A 2UY8A 3NAPB 5BNPB 1DG6A 4QX5A 1LTEA 1AYN2 1ND2C 1V6IA 4KGQA 1UCXA 3PVOA 5DDJ1 3TN92 3EJKA 1UKRA 1YXWA 2D6LX 3WP5A 1WD3A 1PM7A 4LO7A 3ZFFA 4Q0SA 3LA3A 4HBNA 2DYCA 1POV0 1RHI3 3WNXA 3LOIA 2EXKA 3CEWA 1LJ7A 1AL22 4MLOA 1ULFA 1U0AA 3JB8A 4Q4V3 3WHTA 4OHYA 4XXPA 3N7JA 5I0TA 3V0BA 3W59A 1V6OA 3H1YA 2JX9A 3KT7A 4V1PA 3WW1A 4GMP3 5JOXA 1AXKA 4JVAA 3M2MA 4E2GA 5CFDC 4Q26A 2WIIB 5EXOA 1GANA 1RUC3 1IPKA 5HCFA 2ZMKA 2QCSB 1COV2 3GZAA 3JQWA 1HKDA 1ZBA2 2WNEA 1FPN2 1H9PA 4TLFA 2F4PA 1ENSA 2DCYA 1HLCA 1RUH2 5JCTA 2ZAAA 4KBBA 3WQ0A 1HIXA 5L7OA 4NO4A 3KQRA 1W2UA 1I3HA 4NWVA 1VBD1 3A0KA 4COUA 3C3VA 2ZGQA 1DQ4A 5AVAA 3VBSA 1H8TC 2GC0A 4FPLA 2OIIA 1TE1B 3GBWA 2OZJA 4XF3A 2KXLA 1H8TB 4JQRA 1F5JA 2HWD1 1LOEA 1JUIA 1LULA 3NWKA 5C8CC 4FPOB 1YO8A 2P3IA 1ZA4A 1VBA1 4GB32 2QDNA 1FV3A 4H7MA 1RUF3 5T3NA 3RMXA 1CVNA 4HN1A 2IXCA 3HT1A 1DGRA 1X7NA 4K3UA 2CYFA 1FI2A 4OVEA 1W6QA 1AYM3 1PIV3 1CAUB 3VGIA 4YZ1A 4XFAA 3ZO0B 3AK0A 4GALA 1TMF2 2IXLA 3ILRA 2X8KA 2WFPA 1CJPA 1WBLA 4Y20A 2PN5A 4H3WA 3HBZA 4EN6B 1TQ5A 4I0BA 1HRI2 2R072 2VVFA 4FAGA 4EWAA 2UURA 3VKOA 5E88A 5AC92 2DCJA 4CP1A 5FO8B 3VUOA 1CONA 4W6XA 2WT0A 1WGPA 2D3RA 4IEOA 2H0BA 5FREA 2JG9B 5KXDA 3QBQA 2XKOA 1OPMA 3VZNA 3WW3A 1X8EA 2PHRA 4ATFA 4KG0A 2WZR3 4LBOA 4GWNA 4HPKB 3VKLA 3AKTA 5T55A 1UL9A 2E6VA 2GZWA 1RHI2 2EIGA 4ISRA 4E2SA 1UN1A 3T2TA 4CDXA 4IV3A 5JSRA 1WLCA 4XF9A 4Q4V2 1ZBA1 2ZS6B 1FPN1 5BNOA 4Z82A 4EJRA 1AR61 1YIPA 3HT2A 4OI1A 4COVA 3R4UA 4FTSA 2SLIA 2N7GA 5JPMB 4IEZA 1QU0A 1PMIA 4MH0E 2PQQA 5HI0A 5H9PA 1PK6A 1RUI1 5C8WA 1LU1A 4XEZA 1ZZBA 4DY3A 5I8SA 2ZX3A 5I0UA 4DMIA 1YFWA 5BNQA 5K7PA 2K9ZA 4CEWC 2X53S 2XWBB 5JIUA 3WHUA 4CEWB 2Q5TA 5JVVA 5EFUA 4DFSA 2VQAA 2XL7A 1RIRA 3ZSLA 1WLTA 2E7AA 5FFOC 2FMDA 5DZEA 4LULA 2A6XA 1C8NA 4G4FA 3LGRA 4Y22A 3MIHA 3L9JT 3SH4A 4XHBA 1Z7S2 1AJKA 2O1QA 2DVDA 4XJWA 1AYM2 2MEV1 1NG0A 2TEPA 1QJX1 2HWC1 2XJSA 4PJYA 4Q27A 1OPOA 4R8HA 4WM8A 1BXHA 1EPZA 2BYVE 5FAXA 2K2SA 4XETA 1VR3A 1QXJA 4I02A 1H0BA 3GYDA 2A7AA 2WLPA 3WDYA 4I2OA 1IQAA 2I2SA 4DQAA 4JV4A 2G4IA 4FPKA 2WNUB 3AMQA 3RS6A 5I91A 4LUMA 1IS4A 3I2DA 2PFWA 1NE6A 1BKZA 4LHKA 2ZMLA 4NHKA 1H4GA 3BTAA 2WZR2 5BPXA 5A32A 4P14A 3AYEA 3VBUB 3DL3A 1MEC3 3ZPYA 4MZUA 3URFA 1R091 4LEJA 3VDDA 1Q56A 4AEMA 5A3LA 4FO9A 2TBVA 3V56A 2AUYA 4J6GA 2YGLA 1BVP1 4DZGA 1CAVA 1W6PB 2OVUA 2FZ2A 3HWJA 1NA1C 3CJIC 4G9SB 3RNSA 3MIDA 4E2QA 1CESA 5JMCA 1H30A 1LEMA 3APBA 2PAMA 4C0HA 1NA1B 2VG9A 3CJIB 3M1HA 4Q8LA 3AMMA 2Q0AA 4AQTA 4XFIA 2WSUA 1CAXA 4WM7A 4AGRA 3VBOA 1GZWA 3VL9A 3WDUA 3R6SA 2OW4A 1SFNA 4RSUA 5GLTA 2WQZC 4Y5Z0 3WP6A 2WT1A 2I07B 5E16A 1EAH3 4A7ZA 1C4RA 2W39A 4QQPA 3DF0A 3AFGA 1Q8SA 2K0GA 3RYPA 2ZACA 2PHTA 1A6CA 1V6KA 1S0EA 4GKYA 5CG9A 5E89A 4QGNA 1LHWA 1UU6A 3OGJA 2D5FA 3AX4A 2VVDA 3PMSA 4HKLA 4Q4W3 1DZTA 3ZSEA 5KXBA 4JGZC 4KWJA 4S2FA 4PCRA 1MQTB 2NPIA 3H1MA 1S2KA 4JGZB 5KHIA 1UD1A 4RR3A 3BU7A 4AFMA 5JZGA 5I0RA 2VVEA 1NCRB 2WS91 5E1RA 4LT5A 1DYKA 3BOWA 5JAXA 3M3QA 3WLUA 1HRV3 3S6PA 2Z69A 1TEIA 2BQPA 3B9IA 4COYA 1BBT2 4LLOA 1SLLA 1QQP3 1XU2A 4JC1A 2CV6A 3I54A 3VBFA 3RSJA 1ASJ2 1H1IA 4XYXA 3WVJA 2D3PA 1VRH1 2PLV3 3ZFFB 1UMZA 1O3QA 2G9FA 1KDMA 2GNBA 3AMHA 4WV8A 1W39A 5FTTC 1N1TA 3B02A 3DKWA 2D40A 1SBEA 1S0GA 1EPWA 4BOWA 1QGLA 2A6VA 3I8TA 4MGYE 3THTA 4N9IA 3PVNA 4XQDA 2BFUS 3AKQA 1C8M1 3H9AA 3N7KA 4IEUA 3IKWA 2R043 3L2YA 3WY6A 3W9AA 3KCYA 2DFBA 2ZHLA 5LRRA 4C0BA 1RUG3 2RS51 4IV1A 4XIOA 2BNOA 4HLTA 1W6MA 3J9SA 1MZFA 2XL9A 2VULA 4YM0A 2BVVA 3ZN6A 1Z0HA 3VBSB 1AUYA 5JOZA 3HR9A 2D5HA 3MIGA 1GR3A 2HJIA 2HEVF 4Q2FA 4LHLA 3TAYA 4J1XA 3VZMA 3ZXAC 4DRVA 5HXVA 4PLMA 3D0SA 1VBE2 5F9TA 1BJQA 4E27A 5KHHA 1QH7A 4D69A 3MFCA 4UW5A 4CEYA 2NZ9A 3M8LA 2HWE1 2ZGLA 4MXWB 1W6QB 4XBNA 5GM0A 1PGL2 1DQ0A 2XJPA 3DPRC 3NKGA 1V6LA 3EBRA 4HFSA 1ZRCA 1U5YA 5JDBA 4X8PA 4X6QB 4YVSC 3DPRB 4NVPA 1ZBE1 1BBT1 1OD5A 1FXZA 1RGSA 1IS6A 5DDJ3 4YVSB 1Z78A 3WW4A 1N3QA 2YDEA 4AK3A 1YUDA 4BYYA 2WNVC 2A70A 3TBDA 4Y4YA 3J8F1 1RJ7A 5CB7A 4YNIA 4B4QA 1ZZ7A 2GNDA 3QCWA 1LCLA 5DG1A 2WNVB 4AGVA 1QQP2 1HX6A 5KHKA 4D3WA 4FSJA 4Z1VA 3V0AB 1H8VA 3VZOA 1V9U1 3H0OA 4BLIA 5K0UA 1C57A 2ET1A 1OQ1A 1NY72 4CDXC 2GMMA 2HKXA 4AEDA 5EYXA 5CU1A 5HCBA 1O4YA 2PHXA 4BWOA 2RM21 2P17A 3R4SA 1JTZX 4F7ZA 4CDXB 4YZ3A 4CDQC 3OBTA 1ZM1A 3E5UA 4K1YA 4BA6A 4BMEA 1HV1A 4CDQB 5BNOB 4CDUA 1VBC1 1PK6C 2HWF1 5L19A 1VLNA 2RR11 2NN8A 1VBD3 1PK6B 2DUOA 1VAMA 3KGZA 4Q0UA 2D6NA 5KWRA 1SEFA 2A6WA 2QE3A 3POYA 2PHWA 2BNNA 2CY6A 4LA2A 5CVRA 1NQJA 2ZKLA 3WG2A 4YW2A 1SACA 3LSDA 1UKGA 3NL1A 1YWKA 1ZREA 1VBA3 1SLIA 2ETEA 1FATA 4AVCA 4YARA 1PVXA 3MLLA 1G9BA 2XUMA 1JYIA 1QXPA 3ZIWA 2XKPA 1F2NA 4DNYA 1NLRA 1J3PA 1PGL1 5DG2A 1X36A 4SLIA 2NMOA 4HVRA 4Y22B 2UYBA 2IXJA 2Q30A 2QNKA 5EZWA 5C4WA 2XJTA 1AYN3 1IS5A 3ZYRA 1CIWA 1LR5A 2XJUA 3WOGA 4B7EA 1AR81 1ZZ8A 3KSCA 2GH2A 1W6OA 1S2BA 2QUOA 1ND3C 2Y38A 4X8NA 1H4HA 2XWJB 2W68A 3SXWA 5HCAA 3IDCB 3MDPA 1S0BA 2WL1A 5GZGA 4QPIA 1JHNA 5DDJ2 5KHGA 3RMYA 1WMFA 4MGZE 4LE4A 2PAKA 4N90A 4DXZA 3AZWA 3AZVA 1G8WA 4MXVA 3I59A 1RTVA 3WW2A 3INAA 2I74A 3ZSKA 4IEQA 5LK7B 2JXAA 2FMYA 4FPEA 2D6KA 1DQ6A 1OHFA 3B01A 1COV3 5A32B 1ZBA3 2XH6A 1FPN3 1FAYA 1DGWA 2LM3A 1BYHA 3VDDB 1AR63 1TNRA 2ZGMA 5H9SA 3HAGA 4A2UA 4R52A 5FLJA 2Z79A 1RUI3 2ARXA 3MIEA 1POV1 1CAVB 4GULA 4LBQD 1A3KA 1ULEA 1YJKA 3FHIB 3M3IA 4Y1ZA 2JG8A 3RG0A 5L73A 5D8AA 4Q0QA 2ZHMA 3MPBA 3EO6A 1QJY1 3RZZA 1D0HA 3LSEA 2OPKA 1QNWA 4WM7C 4B3NA 4BPZA 1G9CA 4TZDA 4DOUA 3VBOC 1C5IA 1VBD2 1WUVA 1WW7A 3FFQA 1CAXB 4WM7B 4XJ9A 1BEV1 1E57A 3B3QE 3H1WA 3WG4A 3ZN4A 1CAWA 3VBOB 1QJU2 1XE7A 1GZWB 2NLRA 4K21A 2EAKA 3MICA 2WQ4A 2HWD2 4HETA 5DUUA 2ZJCA 3NKTA 4YM3A 1TMF3 2CAVA 3ENRA 4Y1XA 3AKSA 3C2UA 5T52A 2ZGRA 5GLVA 1W6NB 4IETA 4DRRA 1R1ZA 3NV2A 5J96B 1HRI3 2R073 3QACA 4DB5A 4PBPA 1OI6A 2HWC3 2VXRA 3I7DA 2V5YA 2XG3A 1HXS1 1H2LA 1KDKA 1PGSA 1QNYA 3AP4A 5JZGB 2CGPA 1JYCA 3R0RA 4EV0A 4W6WA 3J26N 5F6KA 1OA3A 2XLAA 2EVXA 1IPJA 1Q8PA 3AMPA 4QGMA 3SMHA 2UWBA 2DUPA 3ZSMA 5IK7A 4K9SA 3TB0A 4YZ2A 2R6QA 3O7OA 2ZX2A 3VBFB 3H3ZA 4P9GA 1PNGA 1OKQA 1WW4A 2DFCA 3M3OA 5GJ6A 4OULA 5DUWA 5KBFA 1BK1A 1SLTA 1PVC1 1AR72 5C9AA 4OLLA 4IESA 3AP7A 4XQWA 4FXGB 1EYBA 5DUVA 4JRAA