5T5JA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5jA00
3VKLA 1DLLA 2AREA 3O0XA 2W68A 3HMYA 3MW2A 4YFZA 5GZCA 2W39A 2ZMKA 2AYHA 1VLNA 4PBOA 3PJQA 4D69A 4M3CF 3AZZA 5BYNA 1S1AA 1JBCA 2JE7A 1BJQA 1IS6A 1WBLA 2TEPA 2A71A 1TEIA 2ZGMA 1S0DA 3V64A 5GZGA 1ULDA 4XBNA 2NP0A 1CESA 3ZSKA 4Y1YA 5DUVA 2ZBJA 5T55A 2EIGA 2WQZC 1SBDA 2YXSA 3WDWA 3ENRA 1AZDA 1V6LA 3WDYA 4BLJA 1N1SA 4RL7A 1BXHA 1PZ8A 3RQ0A 3TAYA 2GALA 1IKQA 1CJPA 4XJWA 1YRZA 1QOSA 1FV3A 2PHFA 1H9WA 2JJ6A 1V00A 1RIRA 2JDZA 4GALA 1ENSA 2UWCA 1FATA 3NWKA 5T5PA 4AYUA 1MR5A 1O4ZA 1DQ4A 1QGLA 1WLDA 3UK9A 4H55A 3OBTA 3AYCA 3RS6A 2A6ZA 3FUOA 2DTYA 3WUDA 4R9DA 1GZWA 2VU9A 4YG6A 1DZQA 2VW2A 1DYPA 1MVQA 3WNXA 3RMXA 2E6VA 2NN8A 1GZ9A 1GNHA 1V6OA 4CTEA 1KDMA 3Q9OA 1OQ1A 3WDUA 4AGGA 1AXZA 1N3QA 4LBOA 1QOOA 2ZABA 3WUCA 4FPOB 4ISRA 2JKBA 2CWMA 5GLUA 3WDXA 2WJSA 5JOZA 3D4KA 1ONAA 4FP3A 1CR7A 1QOTA 3RMYA 3T1LA 2D6OX 3OPZA 1QNYA 1SLAA 4OZXA 1RITA 1LU2A 2R1BA 1DQ5A 4UW3A 3SH4A 1ENQA 1MS8A 1CIWA 4FPYA 1WLCA 3ZXLA 1BQPA 1MS9A 1QKQA 3POSA 3WVJA 4BLIA 5HCFA 4FPKA 5HCAA 2GMPA 2NYYA 4BM8A 4IQPA 4LBKA 4PCRA 1UZYA 2ARBA 3FLPA 3LSEA 2A3YA 1DHKB 4C1XA 2CYFA 1LHWA 1JYCA 1UAIA 2ZZJA 2DTWA 1DBNA 2DWRA 2DVGA 2WT1A 3O0VA 1W6MA 4Y1ZA 2ZGQA 4DRVA 2BQPA 2WT0A 1LECA 2DVFA 5E88A 4DS0A 4LBNA 1DQ2A 4GWMA 1GLHA 4M00A 3ZSJA 1UX6A 1ULEA 1W6OA 2R1DA 3NV1A 3WCRA 1NLSA 4GXLA 5DG2A 1UN1A 1Q8OA 1HLCA 3A0NA 3ILFA 2P3IA 4DRRA 4FQ4A 1G7YA 3ZSMA 2ZGLA 3SLIA 1YYNA 4FOWA 2LALA 1LGNA 2ZGTA 3PVNA 5KXEA 5IK7A 3KM5A 2CTVA 2ZGUA 1Q8PA 1G8WA 2LTNA 1LOBA 2YZ4A 4Y20B 3ZPYA 4F83A 3IPVB 4AGRA 1LENA 1VAMA 5E89A 2UU8A 3OGGA 3PVOA 5GLWA 1MS4A 4AWDA 2D3SA 2E7QA 1UMZA 4FPLA 1V6IA 2WLQA 2DUOA 1G9AA 3AZVA 3VKOA 3VUOA 1XQNA 1S0CA 1SLBA 1PZ9A 1LOAA 2VW1A 3RRDA 3IM0A 3M3EA 2D6NA 2ZAAA 1GNZA 2P2KA 1GBGA 4MYEA 2DU0A 1AX0A 1HKDA 1KJLA 1BZWA 3L2YA 1HDKA 4R9BA 4XTMA 3PVEA 4L8QA 4FPFA 1W6NA 3AK0A 1KITA 2OVUA 3AXEA 2WT2A 3FLTA 1JXNA 5DG1A 4BQ1A 1N47A 3V0BB 2ZHNA 4JCKA 4YG3A 1WLWA 4FOYA 5CNAA 1LOFC 1NXD1 1A8DA 1GKBA 2PELA 4Y22A 5T5OA 1N3OA 1WW6A 5DZFA 1DQ1A 2GN7A 3OY8A 5JLVA 1WD4A 2EXIA 3A4UA 2A6WA 2E7TA 1V6JA 1YXWA 4XMAA 2P3JA 1URXA 4XXAA 3AYDA 2EXKA 2UURA 2G4IA 4CRQA 1CONA 3V0AB 3IMNA 1IS3A 2ZGRA 2DUPA 2ZMLA 4TYSA 4PF5A 3INAA 1GANA 4RA0A 4YW4A 5GJ6A 2W52A 1FX5A 2D6KA 4GKXA 2C5DA 2ERFA 5E8AA 4I30A 4M3CE 1VALA 1YIFA 1G9DA 2HYKA 1N3PA 2GNTA 2A75A 1LEDA 1RINA 1R1ZA 3JU9A 4GA9A 4K1YA 1C4RA 1W6PB 4P9XA 2AH2A 4AGVA 1KRIA 4YW1A 2JD4A 1LHNA 1W0PA 4NOTA 2AR6A 3RSJA 5GM0A 1C57A 1C1FA 5KXCA 2CL2A 1LODA 1SACA 2A5ZA 4YG0A 1N1TA 1MZ6A 3BOPA 4YGEA 4YZ1A 2D44A 3N35A 2P34A 3B9CA 5IT6A 2GMEA 1LGCA 1LTEA 2C9AA 4Q1PA 4DQAA 2D3RA 1AJKA 4FQZA 4XJAA 1DFQA 2GDFA 3ZVXA 3OYWB 4FPCA 4XMIA 5GLTA 1Q56A 2E53A 3ASIA 4ZXKA 1G9CA 1DQ0A 4XILA 5DUUA 3WCSA 4YM2A 5IUQA 1MACA 1GYKA 3SITA 2YROA 5GLVA 2ZKNA 4LBMA 3UL2A 1IS4A 4KBBA 3B69A 4XIKA 3POYA 3WDTA 2EAKA 2ZGKA 4AVVA 3M2MA 2GNDA 2NMOA 3M3OA 2GMMA 1MS3A 3ZXKA 1MS0A 3AYEA 3DGTA 1FYUA 1F31A 2DVDA 3AX4A 1APNA 1CN1A 3MW4A 4FOQA 5H9SA 5GZEA 2R16A 1DGLA 3APBA 5GLZA 2ES3A 1S0IA 5CA6A 1G9BA 3FBYA 5L73A 4PQ9A 1EPWA 3N7JA 4FPGA 4FPHA 3U4XA 3DUIA 2XB6C 3ZSLA 5F5QA 1JW6A 4YZ3A 4Y20A 4Q26A 5DXDA 2YY1A 2A6XA 4UW4A 5EXOA 3AYAA 4CZSA 1JOJA 3ZXFA 1G86A 4TZDA 3FUQA 3O0WA 1FNZA 3LSDA 4XDQA 2XG3A 1SLTA 5SV8A 5IK5A 1Q8VA 4XZPA 5LK5A 4YM3A 4XXPA 5T5LA 1IS5A 1J1TA 4Y1UA 1LCLA 3W58A 1FNYA 1ULFA 3B00A 4Y24A 3ZXJA 4ATFA 2D43A 2D6MA 1LU1A 4BMEA 2EF6A 4U2AA 5DZGA 1CPNA 2WKKA 2YMZA 4FVVA 2DVBA 3AZXA 4XTPA 4XJ9A 2DUQA 1CVNA 5JOYA 3ILNA 2ZHMA 3D6EA 2NZ9A 1Z0HA 3NV2A 3ZXEA 1WW5A 5KXDA 1LHUA 1I1EA 2PHUA 3B01A 1WBFA 1Z78A 3AJZA 3T2TA 3A0KA 4SLIA 2GN3A 2UWBA 1WW7A 4FP2A 1MS5A 1LHVA 3O12A 2ENRA 3OJBA 1ENRA 2P3KA 3BODA 3VKNA 2SBAA 4YFWA 4K21A 4P9YA 4YZ5A 2NMNA 4AVSA 1FV2A 3O5SA 1JN2P 5CB7A 2CY6A 2JE9A 1W0OA 3MPPG 3SH5A 4NO4A 2WNEA 2DURA 3FFZA 2CWSA 2KM2A 4UW6A 4XIOA 5FREA 5HCBA 4K1ZA 1LESA 4GWNA 2EALA 1QDOA 3N7MA 4YGBA 1IKPA 3BTAA 4R9CA 1GZWB 1PZ7A 1SLLA 2PHTA 2ARXA 3MW3A 1Q8QA 2GNMA 1Y7BA 1ZM1A 1LJ7A 2EXJA 4GKYA 1SCRA 4WZFA 2I2SA 3CNAA 3IPVA 4YZ2A 2ZGOA 3KQRA 3WG3A 1LOEA 2DYCA 2A6YA 4LBJA 2ZHKA 5CBLA 2AGSA 1S0JA 4Y26A 1V6NA 3V65A 2DVAA 4ITCA 1SLCA 3N36A 2D6LX 4XE9A 5T54A 4YM1A 2V5YA 1MVEA 4XBLA 3WG2A 1JHNA 2FHRA 5JOWA 2A70A 5DUWA 3AP5A 3WOGA 3I8TA 5GZDA 1LOFA 3AZWA 3GALA 2A6VA 3N7LA 2DU1A 5AVAA 5H9PA 3VV1A 1JYIA 1OKQA 1S0GA 4U36A 4HL0A 3GNEA 4Q2FA 2W08A 4YGDA 1C1LA 4FPJA 2VY0A 1WW4A 4Q27A 4M3CB 2CNAA 2FMDA 3R4UA 2ZA9A 2V73A 2RHPA 3AFKA 5CAZA 1IOAA 2D3PA 4YLZA 1CQ9A 1MS1A 1S0FA 4XJUA 3V0BA 1WD3A 3AXDA 1N1VA 1SBFA 1LHOA 4XJZA 4BMBA 1F9KA 2OUJA 2PHXA 4C1WA 2AUYA 4WVVA 4AVTA 2SLIA 3IKWA 1YO8A 3WHUA 3SISA 2WSVA 1UZZA 3ATGA 2EXHA 1YI7A 1GZCA 2D6PA 2Z42A 2Q5TA 4LBQD 3V0AA 2OUHA 1AVBA 1H30A 1W6MB 3SNMA 3W59A 4ISQA 4ATEA 4Z8BA 1UKGA 3H0OA 4HANA 4XOGA 4PBPA 4Y1XA 4DFSA 4LBQB 1B09A 1HQLA 1KJRA 3AJYA 4JC1A 5GALA 1H9PA 5T52A 1KQRA 1AX2A 4Y1VA 1W6OB 4YW2A 4XHXA 5JMCA 3WG1A 1W6QB 1S0BA 1AX1A 1GSLA 2VXRA 3HR9A 1AXYA 1BYHA 1LOCA 1ULGA 1MZ5A 1W6PA 1SLIA 1VIWB 5H9QA 1DIWA 4W65A 3IN9A 4XYXA 3M3QA 4Q8LA 1LEMA 1AF9A 2VH9A 1GICA 1AXKA 1D2SA 3T1MA 4M3CA 2VUAA 3JUUA 5F9TA 1LULA 1S0EA 3AP9A 3OBRA 3USUB 5JOXA 4YM0A 1N1YA 3ILRA 3B3QE 3AP6A 5KXBA 2R0HA 4XHBA 4FOVA 4ZKTB 2ZGSA 1QF3A 2P37A 3N3HA 3WLUA 3OYWA 4WVWA 2D7FA 2ZHLA 3PMEA 1LOGA 1QU0A 1D0HA 2GNBA 4BPZA 4UW5A 3N7KA 3ZYPA 1WCSA 1KDKA 4XBQA 1O4YA 3VKFC 2A3XA 2VW0A 2R0FA 1VAVA 3AP7A 4P9WA 1SFYA 1W6NB 4YGCA 1WUVA 2OW4A 1LGBA 2ZGNA 3FLRA 3QCWA 4K20A 3UJOA 3WV6A 4Q8KA 3C2UA 3D5OA 5IK4A 3R4SA 4YW3A 5DUXA 1QNWA 4LBQA 5JVVA 3ZYRA 1I3HA 5T50A 2H0BA 2ZMNA 3MEPA 4Y22B 5IK8A 5H9RA 5EYYA 1W6QA 1A3KA 5GZFA 5JDBA 1BKZA 3OY8B 3R05A 3LCPA 3HN1A 1V6MA 1SBEA 1FAYA 4XJ8A 1GV9A 1CPMA 3QLQA 3TB0A 1UL9A 1OFSA 3NV4A 4M01A 4ASMB 3AP4A 1G9FA 1U0AA 3BIWE 2E51A 1ZA4A 3I4IA 2ZGPA 1F5FA 2A3WA 2A7AA 3POWA 2PHRA 1HQWA 3WG4A 1SCSA 4FPEA 3SH3A 3WDVA 5T5JA 1V6KA 3USUA 3WZ1A 1X50A 4YW5A 1DYKA 5FRAA 2UWAA 5EYXA 2PHWA 1AJOA 2NM1A 3RG0A 2B7YA 5EWSA 3AZYA 1QDCA 4YZ4A 4DPNA 5DZEA 3UJQA 2JECA 1Q8SA 2AENA 3M1HA 3NV3A 2DV9A 4LBLA 4Q1RA 4R9AA 4JRAA 1QMJA 4WV8A 2YV8A 1UPSA 2R49A 2ZACA 3VKMA 4P14A 3WHTA 4BOWA 2WSUA 1ULCA 3M3CA 1DQ6A 1JUIA 1A78A
chains in the Genus database with same CATH superfamily
3VKLA 1DLLA 4XUTA 4BQ4A 3WW1A 2W68A 1RUG2 5I0TA 3HMYA 5DAXA 1XSRA 4YFZA 3K4ZA 2BWAA 3FJSA 5D8AC 3AZZA 4EZHA 1JBCA 5FZ8A 2ZEYA 1NA1A 1BK0A 4OHVA 1RUD2 3VBUC 2A71A 4CEWB 4ZZ8A 4NRMA 3A7QA 3AKRA 1S0DA 1PVC1 1HN0A 3LQCA 2NP0A 1CESA 5FMBA 2BEOA 3ZSKA 5T55A 1HV1A 2RS32 2WFPA 1SBDA 3WDWA 2B8MA 5FZOA 4QPWA 2WNOA 2RM22 2WQ8A 4RS5A 2Q1ZB 4H2AA 4GJZA 3WP5A 2VZOA 4RL7A 1BXHA 2W87A 3RQ0A 4CP0A 2GALA 3DN7A 1CJPA 2PA7A 4HSLA 1QOSA 1UU5A 4XJWA 4CEWC 3H8XA 5FY8A 2JDZA 3CBNA 2UWCA 1FATA 5T5PA 3KWVA 3KCCA 1EP0A 1US2A 1BBT2 1DQ4A 1RUJ1 5A32A 3NRUA 2VXJA 3H8UA 3UK9A 3MICA 4C91A 3GZUC 2O0OA 1ODNA 3VBUA 2D5FA 3WUDA 3BTZA 5CZKA 1C8M3 2VU9A 3BGAA 3KGZA 1DZQA 2VW2A 4TXWA 2C4XA 3VBRB 2NN8A 3KQ4B 1GZ9A 4R8HA 4E2QA 1V6OA 2JWPA 3Q9OA 2XLAA 3MIEA 1AXZA 2ZABA 1I6XA 2JKBA 5EP9A 2IXIA 4H3WA 2CWMA 1W9YA 1JS9A 2XDVA 3PTYA 4LUKA 4RSUA 4W8JA 5FPAA 4KWLA 4F3JA 5JOZA 3D4KA 3J8F1 1CR7A 1W8FA 4AVCA 2BVVA 2EICA 3GBGA 3VBHB 3VBRC 1QNYA 2FZ2A 3A21A 2W94A 1JZ8A 4LORA 4O9GA 2BU9A 3I3MA 5LBBA 1PIV3 5HCFA 5JPMB 4MV2A 3ZSEA 2NYYA 1W9SA 4IQPA 3VBHC 4AE2A 2ARBA 1AHSA 1REEA 2A3YA 1LHWA 4DUXA 1NOVA 1H6YA 1Y9GA 2DTWA 1DBNA 3CEWA 4GMP1 3AC0A 2DVGA 3I97A 2BVBA 2HWC2 1W6MA 2W47A 4KG0A 1D4M3 2WS92 4NR1A 4JKLA 4QKFA 2WT0A 2FDHA 5E88A 3WW3A 1BVVA 1K5MA 1L3JA 1RUG1 2R7EB 2W0XA 3LPGA 1DGRA 2X8KA 4LBNA 3FN9A 4CUGA 2BUKA 4AVBA 2R1DA 3DF0A 4L92A 4CUCA 4OUEA 4DMIA 3WCRA 1E5RA 1NLSA 2DFCA 4GXLA 1EV13 4B29A 1X9TA 2VUCA 1ZZ8A 4DRRA 2XL7A 2I45A 4FQ4A 1G7YA 1GOFA 2VAUA 5AVPA 2RS31 1LGNA 2ZGTA 3PVNA 5KXEA 3VD5A 4E4HA 2ZGUA 1Q8PA 5FZ0A 4N53B 2WO1A 1VBA3 1SPPB 2UY8A 5F3EA 3RWKX 2RM21 3RYKA 4BK4A 1LENA 5E89A 3ON7A 2UU8A 3DYOA 1JZ7A 5IFPA 3PMSA 2G9ZA 2MEV1 4NROA 2B39A 4Q29A 1UMZA 3MLKA 3G7DA 5L9RA 5JUVA 3RJRA 2P3YA 3OD0A 3WNNA 3JB8A 4AVAA 1QJU2 5DDJ3 5TSWA 3CJIB 1RVF1 2BTVC 1HXS1 4MGSA 2VW1A 4FFGA 5ANQA 3IM0A 5FZBA 5IFTA 4N53C 1OH3A 1Y9MA 5DAWA 1GBGA 2WFF1 1HDKA 1CIYA 1X33A 1OVSA 1ZZ6A 3PVEA 5IVBA 4LR4A 5CG9A 2R043 4FPFA 3WX5A 1W6NA 4NJ4A 3AK0A 4TTGA 2RS13 5ABJA 2QZ2A 2WT2A 4META 1BEV2 4HVRA 1WA6X 2OPKA 2YGLA 4CCCA 1W9FA 1MZFA 1N47A 2BZDA 4LIUA 2ZHNA 3CJIC 4JCKA 1AR83 3MF9A 3LAGA 2VZSA 1LOFC 1NXD1 5I8SA 1GKBA 2CSGA 2IUWA 4Y22A 5KHHA 3RFRA 3WQBA 5JI9A 5DZFA 2GN7A 2PQSA 3OY8A 1JTZX 2Y6HA 2A6WA 2E7TA 5CYYA 4XXAA 3AYDA 5EJZB 3I54A 2QQKA 1QJY2 2XWBB 4JX0A 5ANNA 4D8MA 4YW4A 5FIXA 4CXWA 5JXHA 2W52A 2ZTNA 3HN3A 3VN4A 2C5DA 3S5AA 1VALA 2HYKA 2ZJCA 3DXUA 2GNTA 1TVGA 4WM7B 1R093 3T4VA 2D97A 1RINA 1R1ZA 3JU9A 4GA9A 5FXVA 2RS52 5FP9A 3TEWA 1C4RA 1W6PB 5F3IA 4JTNA 3LA7A 5CVRA 1L7LA 4YRDA 4IEXA 4YW1A 2UYAA 3H1WA 4IW3A 1KRIA 1O7FA 1LHNA 2WN2A 4LK7A 1W8UA 1LODA 1KGYA 1SACA 4YG0A 4QAWA 4EWEA 3ZFFA 4XCBA 1MZ6A 4YZ1A 3ZR5A 4WM7C 3B9CA 1J83A 1T6BX 2ARCA 5A3NA 1FMD3 3N9NA 4DQAA 2HEVF 4XJAA 2KD7A 2F4PA 3O7OA 3WQ0A 4LTAA 1VBE3 3OYWB 4XMIA 4AAPA 1Q56A 3ASIA 1UOFA 5FUPA 1ZYBA 1QQP3 5IUQA 1MACA 1KD7A 4IEVA 5F2WA 3SITA 5KHKA 1F5JA 2ZKNA 1XYOA 4MSVA 1IS4A 3AMHA 3POYA 5L9BA 5ISLA 4DXZA 5FYZA 3M3OA 4OYUA 3AMMA 1AR63 2BGPA 4XF0A 5FYTA 1MS3A 4QPGA 3D0SA 2FDIA 4ASLA 3H8OA 3HQXA 3GM8A 3K4AA 1CN1A 3LEMA 4Q4X3 2VOTA 4WM8B 4AFAA 1PHMA 1CZSA 2R16A 1DGLA 5GLZA 3JD73 1OF3A 1CJDA 1W8HA 1S0IA 1GFF2 5CA6A 1UY1A 5FPZA 5BNPA 3FBYA 2X5IA 5L73A 3H9AA 5FPLA 3N7JA 3UKVA 2F17A 5FLHA 1S55A 4FPHA 2PAKA 1TMF2 2C26A 1JW6A 1TZOA 3ZFGC 3TN93 5DXDA 2YY1A 1BEV1 3MLLA 5C8CB 1O3TA 2RDQA 4QKNA 5D2AA 4XURA 3VL8A 1ZZ7A 1TME2 5J36A 2DBIA 3FUQA 4WM8C 4TZDA 1FNZA 1NCQB 5F39A 4N43A 1R082 2J1UA 4XZPA 3PUIA 2DFBA 4YM3A 2OPWA 4S2HA 2Y6KA 2HJIA 1J1TA 3AM2A 1WMDA 2J1VA 3KCYA 5DMYA 4FTSA 1C5IA 1KFXL 4AG4A 1CZVA 1RXFA 3U78A 5A7WB 5C8CC 5FPUA 1ZREA 2BBVA 4HETA 1ULFA 2GC0A 1U5IA 2DF7A 3B00A 4CYDA 2D43A 2VPVA 3LIGA 1NZCA 1VRH3 1NCQC 4GIQA 2DCTA 3I3EA 2YU2A 1YQ5A 3K48A 3UGFA 1CPNA 1POQA 2WKKA 2YMZA 5CEHA 3JB4C 3ZFGA 5JZGA 3AZXA 1DGWA 1M4WA 1OLMA 1W2UA 4XJ9A 2DUQA 4COVA 3QH6A 4E2GA 4KU8A 4ARXA 2RR12 2ZHMA 4IGPA 2VMHA 3MGUA 1Z7S1 5FP7A 1RUE3 2ORXA 3GXUA 2ZEXA 3ME2A 5C71A 1WW5A 2HWE1 1VRBA 5AFEA 1W8NA 2PHUA 3B01A 1WBFA 3GCWA 4AHXA 4BQWA 4ZXEA 4CEYB 5LEJA 2XUEA 5I8YA 3MDPA 2ZS6B 4GB32 3O12A 1ENRA 5FZGA 4IUGA 3PVBB 3TEXA 3OBZA 2NMNA 1NCQA 4XQWA 3O5SA 2MNGA 5IWFA 3MPPG 5FREA 4RGKA 2CWSA 4XIOA 1PVC3 2VM9A 4QPIB 4CEYC 4QX1A 3T4HB 3PTRB 3R6SA 2HEYF 1OT5A 2ET1A 1O6UA 4MG2A 3AVRA 3E6DA 1Y7BA 4Y20A 1LJ7A 1SCRA 4WZFA 3IPVA 1BCXA 1S2KA 5FZKA 4JGYB 4UBGA 1LOEA 1ZBE2 3I59B 2DYCA 2ZHKA 5CBLA 4A3ZA 5DN2A 2VMDA 2RJ2A 5FQ0B 4QHZA 4YM1A 1MVEA 3RVHA 1IGOA 3WG2A 4QPIC 5K8SA 4KGGA 2FHRA 3LA2A 1H2MA 4QT6A 3AP5A 1RUJ3 4KI5M 2QE3A 2RDRA 1O59A 2Q0AA 1ALYA 3BUCA 3GALA 3UKNA 3MZHA 2A6VA 2CGOA 5AVAA 4JGYC 4U36A 1OI6A 1HRI1 2VTFA 4YGDA 1C1LA 5EZWA 1WW4A 3HBZA 2CNAA 1QH7A 1UO9A 1P8JA 4HZFA 3R4UA 4AXOA 4XAEA 3THTA 1IOAA 2PLV1 4E9KA 1TME1 2QNKA 5FZHA 1WD3A 3ZM8A 3AXDA 3URFA 3VBFB 1R081 2XKPA 2OUJA 2PHXA 2V72A 2AUYA 2QUOA 4AVTA 2VVEA 2SLIA 4UOJA 1FPN1 4RHV2 3PU8A 1JODA 3SKJE 4DB5A 4AI8A 5IVFA 3CZUA 4MXWB 1GP4A 2D6PA 4LA3A 5FYUA 3R4DB 4LBQD 5FZEA 5F32A 2ETEA 1C8M1 5FBZA 5J98B 1U12A 3H0OA 1F4AA 5JSRA 3OG2A 1OQDA 4QMAA 4WZCA 3VBFC 1E5IA 1KJRA 2LW8A 4GWJA 2VO5A 3UV9A 1H9PA 5T52A 4A44A 1AX2A 2EA7A 5JMCA 2XQRA 4JQRA 1B35B 1UW8A 4JHTA 4UF0B 3WG1A 2RR11 2Z5WA 1GP5A 1VBD3 2VXRA 4DNYA 4UFKA 1OLME 4LT5A 1VMJA 1V9U2 1RJ7A 2RG4A 4IV1B 5H9QA 4XF4A 4W65A 3IN9A 3K2OA 2D93A 4XYXA 1O5LA 1VPHA 2Y0OA 5F8PA 3RYRA 4HG6B 5HXVA 4L11A 1AXKA 3EJKA 1YWKA 1OFNA 2ADDA 1LULA 1SFNA 3AP9A 1RUG3 3LFIA 5SV5A 4B4QA 4F7ZA 2ET7A 1B35C 2VZPA 3N9MA 5JPNB 1EPZA 4XHBA 5BV6A 1MPXA 4D7TA 3N3HA 4IV1C 2IC1A 3TBDA 2O1QA 4QX3A 2D7FA 3ACFA 4CU9A 3ZXDA 1LOGA 1RUH2 4KWJA 3U14A 1Y3TA 3N7KA 3ZYPA 1WCSA 2RS33 1RGSA 3HNYM 4MXWA 1D2QA 4XBQA 2A1XA 2K0GA 1LB2A 3C8XA 4P00B 1COV1 2A3XA 2VMIA 2RM23 2VZTA 4P9WA 5FPVA 1WUVA 2OW4A 1STMA 1ZBE1 1EY2A 4Q0PA 3R4SA 3GF6A 5DUXA 5JVVA 4E2SA 2VZVA 5F5CA 3RNSA 4B3NA 2LROA 2ZMNA 2IXCA 2O14A 5IK8A 1B35A 1UPIA 1RVF3 1QIQA 1BBT3 5IVYA 2ORZA 4J1WA 2QDRA 2VJXA 3ELNA 4IV1A 4UT5A 3NV4A 1UYPA 4XFHA 3BIWE 1G9FA 1HV0A 2ZXQA 3WY6A 1F5FA 1VBA1 3LB9A 1AR71 3P3NA 1YFUA 1C3HA 3T30A 3SH3A 3WG4A 3FX3A 4MGZE 4Z2AA 3E5UA 2W1WA 2NM1A 1QDCA 3GYDA 2PMWB 3TEZA 4RHV1 3POJA 2WNUB 3HOBA 3NV3A 5FMDA 4C8DA 4W6WA 5LRRA 4UXAA 1QMJA 3E5XA 1PK6B 3FBMA 5CKNA 2ZACA 3LPFA 4Y3OA 1BLZA 4P14A 2CU5A 5FUIA 5BXXA 1WCQA 4CP1A 2P3KA 1QJX2 4KH9A 2RS11 3A23A 5CFDA 1RL3A 3GZAA 2BERA 1OD5A 3Q8CA 2IFWA 3OOXA 2RDSA 1AR81 2JE8A 2WNUC 4CCMA 1NE4A 4P08A 1S1AA 1AL0G 1DF0A 2JE7A 4LKFA 1IS6A 1CGPA 1PK6C 1WBLA 2BV4A 5C3QA 4S2FA 5BNOA 3CF6E 3VZOA 4S2DA 1ULDA 3NO8A 1NCRA 1XXNA 2ZBJA 2HWC3 1OUXA 2OZ6A 4BCUA 1RHI1 2WYSA 2E31A 3J9SA 3ENRA 3LE0A 1RYYA 1CAXB 3MV01 1N1SA 4E4DX 4FO9A 4XDOA 1IKQA 4CCKA 1WMFA 4CPBD 3RZHA 2PHFA 1H9WA 2JJ6A 1V00A 2JX9A 2VZQA 3NVCA 1HB3A 1RIRA 3THCA 3VD3A 4AEJA 1XE8A 2OX0A 5A6QA 1GU3A 3WF2A 2XQXA 4J6GA 5FUNA 3ZMNA 3O1TA 1QGLA 4L9BA 2QQJA 4H55A 4EZ4A 3RS6A 4QD2A 5C33A 2A6ZA 3D0JA 3S30A 4BB3A 1GZWA 5A70A 4BZ4A 3HD8B 1POV1 1MVQA 1ULOA 2ZAHA 3RMXA 2E6VA 4CP9A 2FDKA 1PO12 5KXBA 2NPIA 4FCAA 3UETA 4B7KA 4D6SA 1YHFA 3IDEA 4AAXA 4CTEA 4ZZ5A 3RZMA 1OQ1A 5EFUA 3LEGA 3SMHA 2TUNA 1QJU3 1FMD1 2O8OA 3I2IA 5CKQA 3VHNA 2AEZA 2PAEA 1SG3A 3I7DA 4Q4V2 2WO7A 4MHUA 1VBE1 3VD7A 2C0ZA 3KT7A 5LA2A 2J7MA 1CAUB 4AI0A 2YU1A 3NNJA 3OPZA 4OZXA 5J48A 1LU2A 1YFWA 4EJRA 3OBAA 2PXJA 4N7UA 1ENQA 4AQSA 1QJEA 1KEXA 4Q4Y2 1CIWA 1BEV3 4CVUA 2YGMA 4FPYA 1BK1A 3DV8A 3NKGA 3U75A 1MS9A 1TE1B 3IDCB 3WVJA 3KHCA 3L2HA 1NQJA 2HH9A 2UYBA 1RUF1 2XLFA 2NQYA 5HCAA 1MQTB 2GMPA 1S2EA 5APAA 5FO8B 3KLSA 5A3LA 1XYNA 2HEWF 3Q8EA 3FLPA 5IYYA 4OQ8A 1IG0A 1H1AA 1DHKB 2WL1A 1NLRA 3T0DA 4C0BA 4IGQA 2VVFA 2ZZJA 3WW2A 4QX8A 3ZIWA 1QJX1 2ZGQA 3POGA 2JXAA 3LD8A 1MQTC 4MGYE 1DQ2A 2LRPA 2XXZA 1F35A 1XNAA 1GLHA 3U07A 3MPBA 5HPOA 3NJYA 1W6OA 3I3QA 4AHYA 4QQOA 3FZ3A 3O1PA 4B4RA 1UN1A 1Z7S3 1Q8OA 3B02A 2HWE3 2Y6LA 5JIUA 5EV7A 3ZSMA 3SLIA 1YYNA 4FOWA 1RB8G 5IK7A 2J1EA 2CTVA 3BCWA 2LTNA 1LOBA 1HW5A 4NMIA 3R0RA 3WNPA 2RDNA 3TOJA 4PJYA 3ZPYA 3UESA 1ST8A 3POFA 1CWPA 2PN5A 2YDEA 5KC6A 1RJ8A 4AWDA 3RZGA 2WLQA 2DUOA 5LBCA 5FR3A 3H8RA 1G9AA 3AZVA 1OOPB 2UY9A 4K6BA 4UFJA 3M70A 1MQTA 4OCTA 1XQNA 4Y4RA 5BPXA 2Q8EA 3VKOA 4QGNA 4K8RB 3VUOA 5FYMA 1XNBA 5EJ1B 2RVAA 4K8FA 3WF3A 1YUDA 3CU7A 4RD7A 1OH4A 2DU0A 1R1A2 2CDOA 4J1XA 2D98A 2JDPA 3LFMA 5IATA 4RQPA 4IXLA 3MIDA 1IPSA 2RMU2 3SQOA 5AC92 4IEOA 4YNIA 1KITA 2OVUA 4BQ1A 1OOPC 2WNVA 3BALA 4AEDB 3HAGA 1NZIA 3K3NA 2BWCA 1WLWA 5IHRA 4FOYA 2WINB 4NN0A 3UGHA 1A8DA 5T5OA 2YUEA 1WW6A 2Q8DA 1AYM2 4YVSB 1A34A 4UI9L 1SMVA 1URXA 4Q4W2 4X8PA 2UURA 1HRI3 1PGW2 1K5JA 4XFGA 4AEDC 3OTFA 3IBMA 1XYPA 2ZMLA 2B45X 4TYSA 4DEQA 3LF7A 4FAGA 4LXLA 3N9QA 4PF5A 4URAA 5EIYB 3ZXAC 4A4AA 5GJ6A 4LJHA 2PLV3 2R071 1TME3 4P5YA 5M0TA 1YIFA 2B5HA 2XMLA 1N3PA 1R083 5HCHA 4LO6B 1HB2A 4YVSC 4QXKA 2FD8A 1X7NA 3KVBA 4FXKB 3TWIA 3WEZA 4CSWA 5FDBA 1FPN3 4A7ZA 4IE6A 2D40A 4P9XA 4XW3A 2IWGB 4XQ4A 5FYIA 5D8AA 2R061 2OXBA 3FWEA 4EWDA 2WYFA 1W0PA 3WP3A 5GM0A 3DKWA 2CL2A 5L19A 3H42B 2R6QA 4N90A 1W90A 4HVOA 1UY2A 1RC6A 4KMQA 1W3XA 3N35A 4HFSA 2VUDA 2GMEA 4D6QA 3AL6A 2TBVA 3ROUA 4XUPA 4Q1PA 4O65A 5FXZA 2RR13 2C1FA 3AMNA 5E6HA 4FPCA 3ZVXA 4EE2A 5FZ6A 2E53A 1UYYA 3PJYA 1G9CA 1DQ0A 2B9VA 3MUZ1 4D0QA 4XILA 5DUUA 2VQTA 4NIIA 4CEWA 3MYXA 5FP3A 2IXLA 3E6CC 1UZVA 4MGQA 5LY2A 1WLTA 1QY4A 4BWOA 3ZYHA 4NPLA 4G4FA 2QQPA 1E5HA 1FI2A 1XNDA 3KVAA 3B69A 4KBBA 4LOSA 4MADA 2OYZA 2EAKA 4BQXA 4AHZA 5LA0A 4DUVA 3ACHA 4OMCA 1RMU2 4KQ7A 2BOJA 3AYEA 2H0VA 3WNMA 1F31A 2DVDA 1TNFA 4OVEA 3AX4A 5FO7B 2PAMA 3IDBB 1XOYA 2YBSA 1D0GA 4FOQA 5H9SA 2XBO2 3LDBA 2W1SA 1K45A 1DGWX 1VBD1 3VHRA 3NKTA 1G9BA 5LA1A 1DDLA 4PQ9A 1HX6A 3BVCA 1COV3 2WAOA 4Y4YA 5LBFA 4FPGA 4CDUB 1PMIA 2RMU1 1ZBE3 3ZSLA 5B2GB 4YZ3A 5A7NA 2E63A 3VBRA 4UW4A 4CUBA 3AYAA 5FYBA 1EUUA 1JOJA 3ZXFA 1G86A 1OURA 4CXXA 2DDUA 1PO22 1UY4A 4OUMA 3O1UA 4W50A 4XDQA 5KC5A 4ZONA 5IK5A 1Q8VA 4IETA 4EQVA 4FFHA 4HPKB 5KR7A 2QFEA 1RUD1 3LIHA 3AMQA 1AYM1 4XXPA 2D5HA 2V4AA 5T5LA 4CDUC 1IS5A 1JYXA 4Q0QA 4Q4W1 1LCLA 1ND3B 3VBHA 3W58A 4XFAA 5A1AA 4D94A 3T0BA 4YARA 1QJZA 2JENA 1AR73 2XJUA 3WNLA 2Y6GA 4LHKA 2FZ1A 1HQNA 3JQXA 1BVP1 5DZGA 2X53S 3CL1A 5A3PA 2JDUA 1UKRA 2DVBA 3LEIA 4H7MA 4BQ2A 4IEZA 4TLFA 4NHLA 3SEPA 1UIJA 1WWYA 2RJLA 1ND3C 1FXZA 2Y34A 3ILNA 4RHV3 3HWJA 2P6HA 1BBT1 2NZ9A 2VR4A 2ZKLA 5IAXA 2ZX1A 4L0PA 2VCMA 1JYWA 4QQ2A 5KXDA 2J1SA 1LHUA 1QHDA 3T2TA 2YG0A 2UWBA 3OGRA 1WW7A 2VZ1A 4FP2A 4PF1A 3NAPB 1GP6A 2YFUA 3FE5A 1LHVA 1XU2A 3OJBA 4NUBA 1RUNA 3BODA 3UKTA 4PIZA 5FTTC 3X29B 4K21A 4P9YA 3KV9A 5I0SA 3AMPA 1YQCA 5CB7A 4YVWB 2GAUA 5F3CA 3I49A 2LUWA 3K3OA 2YPDA 1RUC2 1W0OA 5LA9A 3SH5A 4NO4A 2WNEA 4JTOA 4XFFA 1DCSA 4I09A 2EALA 2ZX2A 4A6SA 4CA9A 3ES1A 1ND3A 3VDAA 3NAPC 4AQTA 1IKPA 3BTAA 1SLLA 3B9IA 1F8VA 3MW3A 5E16A 1RHI3 1Q8QA 4N53A 1ZM1A 2AEYA 1SPPA 2EXJA 3GGLA 4YZ2A 5K7PA 4GMP0 3KS7A 2ZGOA 3KQRA 3WG3A 1DG6A 1SQ4A 2VMFA 4QU2A 4YVWC 2JB8A 1GQHA 3BN6A 2DVAA 3NSTA 1YIPA 1H8TB 1J3PA 4XBLA 4Q5OA 3BPZA 4OQ9A 2GC1A 1OA4A 4MLOA 2X29A 1J59A 3ZXGA 1UD1A 3CJIA 1ZRCA 5GZDA 1LOFA 4WBBA 4UFLA 3EMRA 3C7HA 2E33A 2FCVA 2AZ5A 1S0GA 2XVKA 1POV3 2HWC1 2W08A 2QJVA 2WS91 4ES8A 4M3CB 3C3VA 4MGTA 3NAPA 1H8TC 5CG8A 4QX7A 1W99A 2VECA 3AFKA 1S0FA 5DQ0A 2BBAA 4QKBA 1N1VA 1SBFA 4XJZA 3ALQA 4ZHNA 1VMFA 2HWD2 4LLOA 4AHWA 2ILMA 4JGZB 2WSVA 4XZUG 5FZ9A 1U5ZA 1YI7A 4NIGA 2Z42A 4NHXA 2FCTA 2Q5TA 4HKWA 4HMZA 3W59A 2G9FA 4DINB 4K40A 3J7NA 4ISQA 4ATEA 3D8CA 2Y33A 5A3MA 3FHIB 5FZAA 1WMEA 4IV3B 4Y1XA 4DFSA 2O8QA 4LBQB 1RUF3 3NNMA 4ZS3A 1H8TA 1KQRA 5JMOA 5F6KA 4WM7A 1QJU1 4DXRA 3P1IA 1JI6A 3WT3A 5JXGA 1K12A 1AX1A 4DO0A 1BYHA 1W2AX 4MH0E 1W6PA 1SLIA 1VIWB 2ZPXA 5FZLA 4P5HA 3UGGA 1DIWA 5B4XA 1UOGA 3M3QA 4OI2A 3GCXA 3OUIA 5JIAA 3IAPA 3IWZA 4IV3C 1AF9A 2VH9A 5JR7B 2BYVE 3LGRA 1QJX3 2Y6FA 1D2SA 1MZEA 4M3CA 4WVMB 1S0EA 5F1RA 1NLQA 4YM0A 2C9KA 3CMGA 5A3WA 3H7JA 1NX9A 1JZ3A 5FYHA 1WCDJ 3MHZA 4I0WB 1QF3A 2P37A 3U1XA 2YC4A 3WLUA 3ACIA 1RUC1 1A8MA 3OYWA 4WVWA 4QDRA 2J1RA 2P5BA 5C8WA 2ZHLA 5FMOS 1QU0A 1D0HA 2GNBA 3IIAA 5C4WB 3WNOA 5FPXA 3DECA 2ZOEB 3E1F1 1QJY1 1UU6A 4QB1A 5FPBA 4M4RA 3VKFC 2R0FA 1VAVA 4QX0A 1LKNA 1ULPA 2XL9A 2ZGNA 4V2VA 1LGBA 3WV6A 2XVLA 4IV3A 4ZU7A 1DP0A 4LBQA 3PUAA 5F6LB 1I3HA 5E1RA 4KWUA 3FHAA 3MEPA 3S6PA 1JOPA 1NYWA 5FLIA 5C4WC 2VC9A 2RS51 4URTA 5EYYA 5JDBA 1A3KA 1WZXA 4UFIA 1UYXA 3R05A 4WM8A 4Y5Z0 4RFRB 5FOBB 4NPRA 5JXIA 3GHMA 1X8MA 3NL1A 1T6GC 3C7OA 3KF5A 5KBFA 1IQDC 5FY4A 1GQPA 1ZA4A 2Q1FA 5FK7A 1ZVFA 2QQOA 1GNYA 2NLRA 2A7AA 3POWA 1HQWA 1SCSA 4AFCA 5C8CA 3BU0A 1EUTA 1X50A 3AB0A 1DYKA 4Q0UA 5FRAA 3RZJA 3KGLA 5AFBA 3ZR6A 1YFYA 2PHWA 1AJOA 2PYTA 4Q4V3 5DPNA 1ENXA 4TWTA 3RG0A 4DPNA 3AZYA 2FQPA 2HWD1 4PI0A 3LEKA 4JAAA 4LQRA 5DZEA 1Q8SA 1C8NA 1L7RA 2V4VA 3M1HA 3N9OA 4Q1RA 5I0UA 4JRAA 5LATA 3N9PA 4Z82A 5A7WA 3SKVA 2VQ0A 5A7QA 2JD9A 3VKMA 3WHTA 4NHYA 3VDDB 5LASA 4QM9A 4XF3A 4AW7A 3GJAA 4LA2A 2XKOA 2R073 3SC7X 2H6CA 2AREA 2OT7A 3O1OA 3MW2A 5GZCA 2W39A 1LNSA 2AYHA 2VNGA 3KT1A 2CGNA 4PBOA 3VBSB 2B46X 4NHKA 4NWVA 1BJQA 2G9GA 2TEPA 4N9IA 5FY9A 4QGLA 5FKBA 2R063 3EXUA 3VDDC 4QGMA 3V64A 4XBNA 4XDPA 1J1LA 5DUVA 2EIGA 2WQZC 1W39A 2YXSA 4OULA 1TMF1 2VCCA 4CEYA 1X36A 4AFDA 1XPWA 4NIDA 2CHHA 2JEMA 1ZZBA 4CDWB 4COWA 3VBSC 4FI9A 2I74A 4SBVA 1ZNPA 1PZ8A 3TAYA 1YRZA 3SCHA 1OVPA 4GALA 3NWKA 2ZEZA 3OUJA 4HN0A 5FXWA 5L7OB 4MGIE 4CCJA 5K0UB 1X9PA 4QPIA 1WLDA 5KHJA 2VE1A 2W92A 5EJ3A 4CDWC 3FUOA 5T3NA 2DTYA 3VZMA 4ET7A 3QACA 3IMMA 3VDDA 3VBOB 2Y8KA 3PIGA 3WNXA 2Z4FA 4JGYA 4LIVA 2HBUA 3I59A 3U37A 1GNHA 3W9AA 5I0DA 4ZU5A 4LNVA 4AK3A 1ZX5A 5JR2A 5L7OC 3EO6A 5FQ0A 1QOOA 3MIHA 5K0UC 4Y5TA 5FV3A 3MI8A 4FPOB 4E4ZA 5A3TA 1J3RA 2WZ8A 3WDXA 4G9SB 2Q30A 1QOTA 5F2SA 1H2KA 3VBOC 3RMYA 3T1LA 2JKXA 1HRV2 1SLAA 4WVZA 1RITA 4UW3A 2RMU3 4CDXB 1W8TA 3GZEA 1UZ0A 1MS8A 3T09A 1ASJ2 3NNFA 1O4TA 2R042 3DCQA 4CDWA 4GB31 1WLCA 1XE0A 1PM7A 1BQPA 3ZXLA 1QKQA 1UMHA 3POSA 4XF9A 5HV0A 4O9EA 4BLIA 4JDMA 4FPKA 4HK9A 1QXRA 4EN9B 4X8NA 2VL4A 2GZWA 3VBFA 4IL7A 5IW0A 3VLBB 3FC0A 4EV0A 1LAJA 4BM8A 4LBKA 1RUD3 5CKMA 1UZYA 5FBJA 5BY5A 1AYM3 1NY72 2HWB2 5CFCB 5KHGA 4CDXC 1WCKA 5A33B 2ARAA 4CPBA 5BUVA 5C3OA 4ONUA 5K0UA 1EYBA 2JG8B 4Q4W3 1G6NA 1PM4A 2VG9A 3BOWA 1OBNA 4XUNA 2ZX3A 4XCAA 4DUWA 3N9LA 5C3PA 1AUYA 4DOUA 4GD4A 4Y1ZA 4PLNA 2BQPA 4FTBA 1LECA 2DVFA 3WW4A 1XC6A 3CJXA 4QDSA 2QZ3A 5FAXA 5BNNB 1PNGA 2IXJA 5CFCC 1AR92 2YC2A 4M00A 3BIEA 1NUKA 4UWDA 4OUSA 2Q4SA 3P3PA 4UF0A 1R092 2YB7A 1I9RA 2CAUA 3FHQA 2P3IA 5FYVA 2QQIA 4ZY9A 4BU2A 1VB4A 1ZZCA 2ZGLA 3DPRB 1K3IA 1W2OA 4BQ5A 5JAXA 2K9ZA 2VQUA 3E97A 5C9AB 3KM5A 5A6XA 1G8WA 5CU1A 4MGKE 4UFHA 5BNNC 3B94A 4PLMA 1VAMA 4ARYA 2XONA 2OKXA 4A45A 4BIFA 2VNVA 3PVOA 1MS4A 4QQHA 5FOJB 4FPLA 1OPOA 4V1PA 3TRSB 4AL9A 2KXLA 1HB1A 1XBFA 2LM3A 4C0HA 1CX1A 1ZA7A 3I3DA 1OLQA 4EWAA 4PI2A 2KR2A 5FXXA 3DPRC 1SLBA 2MHFA 1GOHA 5FY7A 3RWNA 4EN7B 4LULA 5A33A 3RRDA 5C9AC 4I3GA 3M3EA 2D6NA 2ZAAA 4MYEA 1AYN2 1HKDA 1QQP2 1KJLA 1BZWA 4M0HA 3L2YA 4EYUA 1X8EA 1V70A 2XR4A 5DABA 3EQEA 3NW4A 4D7YA 3WF4A 2BNOA 5IVCA 3FLTA 4Y5SA 1JXNA 3GZTB 4J25A 4PDWB 5KWRA 3V0BB 4ZPIA 1AR62 2ZX0A 2WA4A 3DEMA 2P4EA 2ZZQA 3ETPA 5FMCA 2PELA 4D7SA 4Q4X2 1WA4A 1DQ1A 1WD4A 1V9U1 3KHBA 4FSJA 4XMAA 2Y64A 2P3JA 3JD72 5A3OA 5I91A 2I07B 1HRV1 2EXKA 1ODMA 4N8MA 5FY0A 4BA6A 2G4IA 4XETA 4CRQA 3MIBA 1CONA 1U5XA 3TNQA 2WS93 2VMEA 3GBWA 4V2WA 3V0AB 1ASJ1 2DUPA 4PDWC 3T2PA 3INAA 1W8OA 4DXTA 4GWIA 3IB3A 5E8AA 3TN92 4IDZA 4W4ZA 1UU4A 2WA3A 3MF6A 2B9UA 4AFBA 1QJFA 1ZRIA 3GBFA 5FYYA 4K1YA 2HWB1 2Y6JA 1O3SA 3A22A 1RUH1 1TNRA 1YQ2A 4NAOA 4CU6A 1RUI2 2WNUA 2E26A 4JRLA 2AH2A 4XUOA 4AGVA 1QWRA 2PTMA 4JHZA 2K2SA 1IZ3A 4RGAA 4NOTA 1PK6A 4QB2A 3RSJA 1C57A 4A7YA 1C1FA 5FZ3A 2HWF2 4UAPA 2IXKA 3MIFA 1N1TA 5L9VA 3ZN4A 4OHZA 3UNPA 2BRTA 2D44A 2QQWA 3CO2A 1VRH2 5IT6A 1AR91 4PDWA 4IE4A 4BK5A 4HKOA 1LGCA 4DY3A 2D3RA 1AJKA 2BW8A 4GULA 1S4CA 1DFQA 2GDFA 5FZFA 2EVXA 2JDKA 2QBXA 3W20A 4GAZA 4ZXKA 2WDBA 3NQHA 1JU3A 3I2FA 3WCSA 2WAAA 2VOXA 5EQUA 1WGPA 3F95A 5C70A 2YROA 4Z1VA 4TSVA 4GH4B 4HK8A 3MFAA 1Q3EA 3LA3A 1REDA 4LBMA 3UL2A 4XACA 2WUHA 4XIKA 3Q8FA 2HBTA 2ZGKA 5FO9B 1O8SA 3M2MA 2GNDA 1CAXA 2NMOA 4AEKA 2E9QA 2GMMA 3WD5A 4BH9A 3DXTA 1MS0A 2QDNA 2WQ4A 2VNRA 1APNA 1RUC3 3MW4A 4P9IA 1GUIA 5GZEA 4JQTA 1HN1A 2IVIB 1W8WA 5A7OA 1W0NA 3T0AA 3ZFEB 4EROA 3PUSA 2VTXJ 4A6OA 3APBA 5A1FA 4GH4C 1EAH2 4UFMA 1PVC2 1JOBA 1QJY3 4JV4A 4LKSA 4I3PA 1CX4A 1VR3A 3ITQA 3DUIA 1W2TA 1UYZA 2IVJA 5FLJA 5EXOA 5A80A 5C5TA 4CZSA 3ZFEC 1R64A 1VBC2 1OF4A 4IEQA 4NHMA 2QQUA 3WSOA 4D3WA 5C6CA 5GKAC 1DU3D 2L9LA 2RS53 5SV8A 2XJVA 3IDAA 1TG7A 2W91A 4OFGA 1CAWB 1RUJ2 4Y1UA 2DBNA 2JG9B 1CAUA 2P6CA 1YEWA 5JCTA 4B7EA 3HBKA 4BIOA 2CAVA 4RFT0 3MLJA 4Y24A 4MVTA 1TQ5A 4NIAA 3KF3A 4ATFA 5ERLA 2EF6A 3ACLA 1POV0 3DYPA 4U2AA 2XOMA 4XFIA 3K46A 4FVVA 4PQQA 1FOD2 2HWD3 1CVNA 3H3ZA 2JG9C 2V5DA 2OQ7A 1RUI1 1Y9QA 3NV2A 1MEC2 2WN3A 3J8F2 4OI4A 3VHOA 3EYPA 4INDA 1I1EA 4IE5A 3AJZA 1OXCA 4JDNA 2HWF1 3RI9A 4OZOA 5F5AA 4SLIA 1GWLA 5FZOB 1PO11 2ID4A 2GH8A 4RS5B 3WQ7A 1OUSA 3VDCA 3KCXA 4BXFA 1MS5A 3SCGA 4F8AA 2FCUA 4OI1A 4KGQA 1YI9A 3S7EA 3VKNA 2SBAA 4CDQB 4YZ5A 2LS6A 3CIHA 2QQMA 1V0AA 1FV2A 4Q4V1 1JN2P 5LZ6A 4X6RB 2OA2A 3HQRA 1JYNA 3JCIA 2BDRA 4A7KA 3H1YA 4JZRA 1CAWA 3N7MA 4YGBA 4RS5C 3O1SA 4R4ZA 1TMF3 1WCUA 1PZ7A 2PHTA 2ATFA 4GKYA 4Q4Y1 3ZKYA 3P6BA 2WWUA 3CNAA 4CDQC 1UOBA 2VD7A 2A6YA 4LBJA 3CKHA 4ASKA 2AGSA 1V6NA 2BOIA 4YPJA 4IGOA 2DCZA 3V65A 3N36A 2D6LX 1CAVB 2EAAA 5F5IA 1OOPA 3KV5A 3VGIA 2X09A 3G6JB 1JHNA 4BQYA 4MXVA 1ZRFA 3WOGA 1M06G 3AZWA 1EAH1 3K4DA 2WLPA 3O1RA 2VUJA 2JDAA 2DU1A 5FFOC 3TYJA 3KB5A 3VV1A 4LHLA 2B42B 5LW9A 4HL0A 3W5NA 2IZWA 5HV4A 2FMDA 1C5HA 2ZA9A 2V73A 2RHPA 4AEDA 1VBC1 2D3PA 2MEV2 1CQ9A 1NG0A 3WXPA 5C3RA 4CDQA 5FCCA 1LHOA 1UX7A 2WRAA 4BXSV 4BMBA 1F9KA 4BISA 4AI3A 4OHYA 4WVVA 3IKWA 1YO8A 2DCYA 1NKGA 1RVF2 1UF2C 1HXS2 3VB9A 3AKPA 4YSFA 1UZZA 3CQOA 4H7LA 4YVSA 5G05L 3VD4A 3OD4A 2EXHA 2YBKA 1UIKA 3OGSA 5DAQA 4HOOA 2WFF2 2OUHA 1H30A 1W6MB 4AI1A 4GB33 3O1VA 2H6BA 4FAHA 1W06A 3M8LA 4E8CA 1UKGA 4Z8BA 4HANA 3ORJA 1K5MB 4XOGA 1ZBA2 1DZRA 5EHDA 3AJYA 2YC0A 3MUY1 5J96B 4XABA 1CAVA 1FOD1 4Y1VA 2BP6A 3HNBM 4HSJA 2HYXA 4LHSA 5JI7A 2W3JA 2YPJA 3Q8AA 2TNFA 1S0BA 3RZZA 4Z92B 1LOCA 1UXXX 3OCPA 1MEC1 1MZ5A 1OSGA 1WKYA 3LOIA 4GZ9A 4DXSA 2MPFA 5JSOA 1R1A1 1H0BA 4DY5A 5I8TA 4XFCA 3LDRA 4Q8LA 3PUHA 1K5MC 3VDBA 1GICA 4Y33A 3RZKA 5AC91 5J1XA 3E6BA 3W5MA 2OQ6A 3OGVA 5F9TA 2J42A 2WIIB 2XJPA 4CCDA 3O1MA 4CP2A 1C28A 4RGGA 4OLLA 1GR3A 3B3QE 5ACA2 1LRHA 2BFUL 1SFPA 2R0HA 2Z2SB 3OEAA 4FOVA 2OZJA 2ZGSA 4RYDA 4E8DA 4EN0A 5LWBA 3L9JT 3JQWA 4W6XA 1Y4WA 3OUHA 4QQLA 3V56A 4E4SA 3SXWA 4FT8A 5FZDA 4CE8A 4Z2WA 1PGW1 1KDKA 1HJFA 1PGSA 1O4YA 2VW0A 2VOKA 3I3BA 3AP7A 4IE0A 4YGCA 1SFYA 1W6NB 4FBFA 3QCWA 5B4NA 4Q8KA 3OPTA 5ABJB 1ND2B 2WR9A 5CISA 5IK4A 5EPAA 4YW3A 5JSPA 1QNWA 1JZ2A 4CCEA 1OD3A 2H0BA 2WC2A 1JU4A 2BGOA 1AL22 2RJKA 4Y22B 4AF9A 5LK7B 3ABZA 4MHRA 2GU9A 3OY8B 5LEKA 3LCPA 2E32A 1SDDB 3HN1A 1V6MA 1GWKA 1FAYA 1SBEA 4L2NA 3KT4A 1GV9A 4R52A 1CPMA 4D6RA 2Q1MA 4M01A 1OFSA 1ND2C 5ABJC 2IXHA 3AP4A 2PQQA 2N7GA 4CDUA 4DZGA 3JBG2 2A3WA 3WDVA 2PHRA 3WZ1A 1US3A 4LE3A 5LCWL 1VBB2 1RUOA 4AI2A 3H3UA 5F7UA 4NAMA 1Q43A 5EYXA 4XFBA 3QOPA 5EWSA 4YZ4A 4CU8A 3UYJA 1OA2A 2JDYA 4HPKA 1V9U3 4LOTA 2JECA 2AENA 4LBLA 1PMJX 2DV9A 2FDJA 2BPA2 1HRV3 5D21A 4WV8A 4YW6A 3ZYJB 1UPSA 2R49A 3M4FA 3RDIA 1ASJ3 1CZTA 3VZLA 1GOGA 4BOWA 5HXMA 2WSUA 1ULCA 1VB2A 3ZFFB 3BTXA 2VCBA 1ND2A 1A78A 4CCNA 1ZBA1 5J09A 3O0XA 3PDQA 1YQ6A 2RE9A 5FWJA 3U0ZA 3ECQA 1RMU1 5L36A 1XNKA 2QQVA 2OS2A 2ZMKA 3J7LA 1VLNA 5A6ZA 3PJQA 1OQEA 4W6YA 4M3CF 4D69A 5BYNA 2HWB3 2XBO1 4HXCA 1RUH3 4AQ2A 3WNKA 2ZEWA 4X6QB 1TEIA 5A1LA 2ZGMA 1W8ZA 2JDNA 4KBZA 5GZGA 3ZFFC 4OHXA 5C3SA 4Y1YA 2WZEA 2XJTA 1NXMA 1UWWA 1QXPA 2DCKA 1OHFA 5I93A 4P9LA 1UMIA 1YQ8A 1AZDA 2BNMA 1V6LA 1AR93 1OMIA 3WDYA 4BLJA 4KWKA 5ACA1 2A73B 4QPGB 1PO21 5J7MA 2CV6A 4BYYA 3ACGA 1FV3A 5LBEA 2X05A 2RV9A 5LY1A 3PNAA 3I2DA 1BMV2 4YVWA 1ZRRA 1ENSA 1ACCA 2VZ3A 4AYUA 1GQGA 1VMHA 1MR5A 1O4ZA 1YCIA 1Z7S2 4NIHA 3H50A 5BNPB 2X5IB 2HWE2 2XJRA 3AYCA 3OBTA 4AZZA 3SEEA 3WQ1A 4AR2A 4R9DA 4YG6A 3PLQA 1DLCA 1DYPA 4Q0SA 4EN8B 4QPGC 3H3LA 4B8EA 1SEFA 4S2GA 1JHJA 4CCOA 1KDMA 3WDUA 2WZPP 4AGGA 2JB4A 2VNOA 1N3QA 4LBOA 1AL21 4JGZC 3OB8A 4NPMA 3ETQA 1IQAA 1SZBA 4I01A 4N43B 3WUCA 1XNCA 4ISRA 2X5IC 5BNPC 2GC3A 1BHGA 5GLUA 2WJSA 2WZR2 1AYN3 3K77A 1ONAA 4FP3A 2QTWB 3EHKA 3SCFA 4A3XA 4LMFA 3RGBA 4XEZA 2D6OX 3SH4A 1GMMA 3NJVA 2R1BA 1DQ5A 3H7YA 4LUMA 3T08A 3JBG1 5JWPA 5FZCA 3H1MA 1VBB1 1J3QA 3PIJA 4N43C 3ZIXA 3HQUA 3O14A 3ZFGB 5JZGB 4XVHA 1QH6A 3EBRA 3WF0A 2YFZA 4PCRA 4LEJA 3LSEA 4JGZA 4C1XA 5HBAA 3KV6A 2CYFA 1T2XA 3ZKUA 1JYCA 1UAIA 2DWRA 4JVAA 4LK6A 4UBHA 2WT1A 1HRI2 1NT0A 3O0VA 5C5UA 4DRVA 5F37A 5JZGC 2JICA 1JMUB 2B4KA 1CD3G 5FP8A 4DS0A 2J22A 4QXCA 2PLV2 4GWMA 3ZYBA 2JIGA 3ZN5A 1Y43B 2DCJA 2XHKA 3ZSJA 2XLGA 1UX6A 1O91A 4KL1A 1ULEA 3NV1A 4N7IA 3PL0A 2YHJA 1RUI3 5DG2A 2Y60A 1HLCA 3A0NA 3HEIA 3ILFA 3PUQA 4MO3M 1FPN2 4Z07A 4IE7A 3LOBA 4YYOA 1JZ5A 2R32A 5CIRA 2HWF3 2LALA 2YYOA 2QQNA 3VHPA 4F83A 2YZ4A 4Y20B 1PO13 2XWJB 4TN7A 2GH2A 3IPVB 2W2IA 1C8M2 4XF1A 4AGRA 4L99A 2OIIA 4WVMA 3K51A 3OGGA 5IVJA 3KSCA 5GLWA 5FJKA 2D3SA 2E7QA 1JZ6A 3I2OA 1V6IA 4CU7A 1BMV1 2FMYA 3KMHA 4IEPA 5FJHA 2JIJA 1UOJA 4HKLA 1S0CA 4ZS2A 1PZ9A 1LOAA 1J58A 4HBNA 2Y0IA 3NJZA 3AKQA 1GNZA 2P2KA 4RN5A 5C4WA 5FZIA 3VZNA 1AX0A 5FZMA 1H8VA 3OEBA 4R9BA 3MBWA 1F15A 4XTMA 4L8QA 4Q4Y3 2FDGA 5DAPA 3BU7A 3WR0A 3AXEA 4P02B 4JDOA 5DG1A 1JYVA 3OGJA 1X82A 3D82A 1H6XA 3E5QA 1IG3A 4YG3A 3NNGA 4K7JA 2G1MA 1PIV2 3I2HA 4XQDA 5CNAA 3WINE 4ORFA 3ZDVA 1N3OA 1I5ZA 3AKSA 5JLVA 3N4MA 1EAH3 2WZR1 2EXIA 2VMGA 4CCLA 3A4UA 3UT0A 2FBEA 1V6JA 1YXWA 4UYBA 4QU1A 1F2NA 1PNFA 5LB6A 3ZYGA 4LO4B 3IMNA 4IESA 1IS3A 1COV2 2ZGRA 5F3GA 2J1AA 3NNLA 1GANA 4RA0A 3Q8BA 5FY1A 1D4M2 1FX5A 1VBC3 2D6KA 1UY3A 2ERFA 4GKXA 4I30A 1I5PA 4M3CE 4A42A 3KZ4C 1G9DA 3F2ZA 4O7XA 2IFRA 3AL5A 3POEA 4LKEA 2A75A 1LEDA 4L97A 1OA3A 3RYPA 5DAVA 5FKCA 1EV12 5CADA 2JD4A 4CUAA 2VZUA 1JUHA 2AR6A 3W21A 3ZYIB 5KXCA 4I2OA 3FMGA 2A5ZA 2HKXA 2VCAA 3T2QA 2JDMA 2F4LA 1VBA2 3ZDSA 4YGEA 3BOPA 1AR72 3M7AA 3LKJA 3MV11 2P34A 1J84A 4BJ0A 1FOD3 3I2GA 1LTEA 2C9AA 3M3IA 1XJAA 3VBSA 4FQZA 5A3UA 4PIYA 2PHDA 3ES4A 5GLTA 1E57A 5DDJ2 2VGDA 1KS4A 1MEC3 5IAVA 1OKOA 3J8F3 4NWWA 1QXJA 1R1A3 1S2BA 4YM2A 2Q8OA 3J7MA 1DYOA 1PGL2 1GYKA 2GSYA 1KFUL 3GDBA 1GWMA 4JKMA 5GLVA 5AC93 1W9TA 4GQ7A 3B93A 4KG8A 4AFMA 4COUA 3OSDA 3WDTA 4AVVA 2EIEA 2F6BA 1WMXA 2RS12 4QB6A 4LO7A 2W95A 1H1IA 3AVSA 2XPJA 3ZXKA 4IEWA 1F4HA 2XHNA 1FYUA 3DGTA 3GJBA 1UY0A 1O3QA 2VVDA 1AR82 3GHNA 3RI8A 5FYCA 2XUMA 3ZPOA 2G19A 1PX4A 1H4GA 3HIFA 2VOWA 2WWSA 5L7OA 4BDVB 5FMOL 2YBPA 2ES3A 2QCSB 4PT6A 2XH6A 1XB9A 4GMP3 4I0AA 4QHBA 1EPWA 5FYSA 4XPVA 5IJRA 1UXZA 2WABA 1UQXA 1U5YA 4IEUA 2WWJA 2XB6C 3U4XA 1OPMA 5F5QA 3VBOA 1D4VB 1PMHX 1RHI2 4Q26A 3BYWA 3POBA 2A6XA 3HNMA 1H2NA 3S5QA 4KNCA 1VJ2A 1PIV1 1JYTA 5FZ7A 3O0WA 1W03A 1SHWB 2Y38A 3LSDA 4QX2A 2XG3A 1SLTA 2GP3A 2JG8C 3BB6A 4LITA 5LK5A 5FZ4A 2VOVA 2W1QA 1PX3A 3POIA 1W3VA 3LDKA 1XNTA 3S57A 1FNYA 4AEMA 3FL7A 1JZ4A 1D7PM 4CDXA 4P9JA 3PU3A 4HONA 4B1MA 3ZXJA 2D6MA 3MFCA 1D4M1 1LU1A 4COYA 2MEV3 4JKKA 4BMEA 5CFDB 4NE9A 3IZOA 4ZU4A 1KXGA 5FWEA 3ZO0B 4XTPA 1FMD2 5FZ1A 3BPSA 3QD6A 3VL9A 5IVVA 2EIBA 5JOYA 1HXS3 3D6EA 4EN6B 5CFCA 1VBE2 1Z0HA 2ADEA 4LO5B 3J7HA 4I02A 4FFFA 1OC1A 1EV11 3ZXEA 5BNOB 2JG8A 2VMCA 4GJYA 2CDPA 4P9GA 5FY5A 1NCRB 2WFF3 1OLRA 1Z78A 4IERA 4A2UA 5A7SA 3A0KA 2JDHA 2Y26A 3DYMA 3NJXA 4QQPA 5K4LA 5CFDC 2GN3A 1JH5A 2CGPA 3SHRA 2VZRA 1ZBA3 3WP4A 2P17A 1VAKA 4IEYA 2ENRA 3USSA 3C7GA 1RMU3 3S0MA 3VD9A 4MZUA 5BNNA 4YFWA 2VBDA 3KV4A 5JXJA 4LLFA 4AVSA 1RUF2 2XBO3 4B1LA 3KD4A 5BNOC 2CY6A 2JE9A 1UCXA 1YNAA 3HT1A 4QKDA 5DDJ1 1DGRN 1NCRC 2P1BA 3AKTA 4PLOA 2DURA 3FFZA 2KM2A 4UW6A 4XC9A 5HCBA 3NMBA 4BHPA 4CXYA 4K1ZA 1LESA 4GWNA 2Q8CA 1NAEA 3PHMA 1PGL1 1QDOA 1L7QA 1XE7A 3DPRA 3MO4A 3QBQA 4NRPA 3BI3A 4KU7A 4R9CA 1GZWB 5C9AA 2ARXA 2GNMA 1IHMA 1XSQA 4CP9B 2R041 2I2SA 5A6YA 4QPYA 3RJ2X 5J3UA 4XAAA 1S0JA 5ACA3 4Y26A 3IAQA 1PO23 4ITCA 1SLCA 4XE9A 1W28A 5D1IA 5T54A 2V5YA 3P5BA 4I0BA 1IPKA 1H4HA 1O5UA 2GC2A 4NRQA 4DEVA 1NY71 5JOWA 2VBPA 2A70A 5FP4A 5DUWA 2GP5A 3ST7A 3BKZA 2R30A 3I8TA 3JZVA 2W1UA 4LKDA 4XUQA 3N7LA 5H9PA 3AFGA 1JYIA 1OKQA 1NQDA 2VQAA 2Z79A 3GNEA 4Q2FA 3I2KA 4FPJA 2VY0A 4Q27A 1E5SA 3HJRA 4FXGB 3THPA 5FK8A 2BNNA 4QWNA 5CAZA 1HIXA 1H1MA 4YLZA 4QXBA 1MS1A 4XJUA 3V0BA 2VULA 1XU1A 1AL23 4BE3A 3BTYA 4RR3B 4C90A 4MX3A 5K9YA 3TNPB 1HJGA 4AOCA 4C1WA 1R091 3T3YA 3C7EA 3WHUA 1UNBA 1YJKA 3SISA 3IIIA 4DIQA 3ATGA 1RUE2 2C24A 1GZCA 4PHZA 2W46A 4R4XA 4A41A 3JBG3 3V0AA 3EB7A 2EIDA 1AVBA 3SNMA 3QH7A 4OMDA 5C7GA 1VBB3 3MIGA 4YW7A 4Q0VA 4RR3C 4HLTA 1LR5A 3PURA 4PBPA 4HVQA 2ZCWA 1B09A 1HQLA 4JC1A 5GALA 5KHIA 3RZLA 2VBBA 3ZN6B 1QEXA 1W6OB 4YW2A 4XHXA 1VP6A 3I2JA 4LO8A 1W6QB 1HB4A 2WO3A 4QXHA 1GSLA 3HR9A 2W9XA 1AXYA 1ULGA 4HN1A 1Q5OA 3VZJA 5BNQA 5HI0A 5G04L 2PHLA 1W05A 4PIXA 2XGXA 3C7FA 1AYN1 1O3RA 1QQP1 3HPNA 1LEMA 3LWCA 4HT1T 3ZYFA 3WF1A 3DL3A 2QQLA 3K75B 4M0NA 2BGCA 3T1MA 2W5FA 2VUAA 3JUUA 3CDZB 3OBRA 5JOXA 2KA3A 3USUB 3U10A 2E7AA 3ZX7A 1W04A 1DZTA 1N1YA 2R072 3CLPA 3OPWA 2J1TA 3ILRA 4MUVA 4NVPA 1AR61 4YWAA 3AP6A 4H14A 4FFIA 4RR3A 3ZLIA 4ZKTB 4M4PA 3DKQA 4QHOA 4Q4X1 5A7PA 4BQ3A 2HLEA 3B7MA 3OF1A 3PMEA 4G3YC 4TLGA 1W2NA 4LHNA 4BPZA 1SDWA 3FFQA 1FT9A 3JD71 3CZJA 4UW5A 3U4SA 2R062 1REFA 1RXGA 1YFXA 3CHXA 3ZMOA 3HT2A 4RQPB 3RPQA 2QKDA 1UZWA 1H2LA 4GH4A 4O61A 1ZZ9A 3U11A 3VZKA 4K20A 3FLRA 3UJOA 4B4PA 3C2UA 3D5OA 5I0RA 2BJSA 3TN91 1A6CA 1XRUA 2WNVB 2X10A 4AI9A 3HVDA 3TEYA 3THDA 3ZYRA 4LE4A 2BFUS 2XJQA 2K46A 5T50A 4QM8A 4QX5A 2FDFA 2Z69A 3ZN6A 1YLLA 4N9HA 4LPLA 3JXSA 5H9RA 3ZFEA 1W6QA 1NA1B 5GZFA 1BKZA 3LZZA 5J37A 4RQPC 2WO2A 3T2OA 4OI0A 2VTXA 4XJ8A 3ZOIA 5LRSA 1PVXA 3QLQA 4K3UA 2V09A 3TB0A 1UL9A 4ASMB 4FTEA 1U0AA 2WNVC 2E51A 1KS5A 1IPJA 2C6SA 2ZGPA 3I4IA 4OHWA 3IT8A 4MOAA 4FPEA 4AQ6A 5T5JA 1V6KA 3D3AA 3USUA 1VRH1 4COZA 4E27A 5IVEA 4YW5A 3B5LB 2UWAA 1NA1C 1W9WA 2AC1A 1NE6A 1VE0A 2B7YA 2AACA 1K42A 1RTVA 1YJLA 2QVSB 2WZR3 4ES9A 3UJQA 4R9AA 1VBD2 3J26N 5D8AB 1RUE1 5A32B 2JG9A 3J4UH 2YV8A 1O8PA 1YC61 4QDQA 3VBUB 2WBKA 2PFWA 1GZTA 2XJSA 2XVGA 3WP6A 3M3CA 1DQ6A 1ZRDA 3S7IA 1JUIA 4K9SA 2ZX4A
chains in the Genus database with same CATH topology
3VKLA 1DLLA 3WW1A 2W68A 1RUG2 5I0TA 3HMYA 4YFZA 2BWAA 3FJSA 5D8AC 3AZZA 1JBCA 1NA1A 4OHVA 1RUD2 3VBUC 2A71A 4CEWB 3AKRA 1S0DA 1PVC1 2NP0A 1CESA 3ZSKA 2BEOA 5T55A 1HV1A 2RS32 2WFPA 1SBDA 3WDWA 2B8MA 2RM22 4RS5A 2Q1ZB 4RL7A 1BXHA 3RQ0A 4CP0A 5JCTA 2GALA 3DN7A 1CJPA 2PA7A 4HSLA 1QOSA 1UU5A 4XJWA 4CEWC 2JDZA 2UWCA 1FATA 5T5PA 3KCCA 1EP0A 1BBT2 1DQ4A 1RUJ1 5A32A 3H8UA 3UK9A 3MICA 4C91A 3GZUC 2O0OA 3VBUA 3WUDA 2D5FA 1C8M3 2VU9A 3KGZA 1DZQA 2VW2A 3VBRB 2NN8A 1GZ9A 4R8HA 4E2QA 1V6OA 3Q9OA 2XLAA 3MIEA 1AXZA 2ZABA 1I6XA 2JKBA 2IXIA 4H3WA 2CWMA 3PTYA 4LUKA 4RSUA 4F3JA 4KWLA 5JOZA 3D4KA 3J8F1 1CR7A 4AVCA 2BVVA 3GBGA 3VBHB 3VBRC 1QNYA 2FZ2A 4O9GA 1PIV3 5HCFA 5JPMB 4MV2A 3ZSEA 2NYYA 4IQPA 3VBHC 4AE2A 2ARBA 1AHSA 1REEA 2A3YA 1LHWA 1NOVA 3CEWA 2DTWA 4GMP1 1DBNA 2DVGA 2BVBA 2HWC2 1W6MA 4KG0A 1D4M3 2WS92 4NR1A 2WT0A 5E88A 3WW3A 1BVVA 1K5MA 1L3JA 1RUG1 2W0XA 4LBNA 1DGRA 2X8KA 2BUKA 4AVBA 2R1DA 3DF0A 4L92A 4DMIA 3WCRA 1NLSA 2DFCA 4GXLA 1EV13 4B29A 4DRRA 1ZZ8A 2XL7A 2I45A 4FQ4A 1G7YA 5AVPA 2RS31 1LGNA 2ZGTA 3PVNA 5KXEA 2ZGUA 1Q8PA 4N53B 1VBA3 2UY8A 3RYKA 2RM21 1LENA 5E89A 2UU8A 3PMSA 2MEV1 4Q29A 2B39A 1UMZA 3MLKA 3G7DA 3RJRA 3OD0A 3JB8A 4AVAA 1QJU2 5DDJ3 5TSWA 3CJIB 1RVF1 2BTVC 1HXS1 2VW1A 3IM0A 4N53C 1GBGA 2WFF1 1HDKA 1X33A 1ZZ6A 3PVEA 5CG9A 4LR4A 2R043 4FPFA 3WX5A 1W6NA 3AK0A 2RS13 5ABJA 2QZ2A 2WT2A 4META 1BEV2 4HVRA 2OPKA 2YGLA 1MZFA 1N47A 2ZHNA 3CJIC 4JCKA 1AR83 3MF9A 3LAGA 1LOFC 1NXD1 5I8SA 1GKBA 4Y22A 5KHHA 5JI9A 5DZFA 2GN7A 3OY8A 1JTZX 2A6WA 2E7TA 4XXAA 3AYDA 3I54A 1QJY2 2XWBB 4YW4A 2W52A 2ZTNA 3VN4A 2C5DA 1VALA 2HYKA 2ZJCA 2GNTA 4WM7B 1R093 2D97A 1RINA 1R1ZA 3JU9A 4GA9A 2RS52 1C4RA 1W6PB 4JTNA 3LA7A 5CVRA 1KRIA 4YRDA 4IEXA 4YW1A 2UYAA 3H1WA 1O7FA 1LHNA 1LODA 1SACA 4YG0A 4EWEA 3ZFFA 1MZ6A 4YZ1A 4WM7C 3B9CA 1FMD3 4DQAA 2HEVF 4XJAA 2F4PA 3O7OA 3WQ0A 4LTAA 1VBE3 3OYWB 4XMIA 1Q56A 3ASIA 1ZYBA 1QQP3 5IUQA 1MACA 1KD7A 4IEVA 3SITA 5KHKA 1F5JA 2ZKNA 1XYOA 4MSVA 1IS4A 3AMHA 3POYA 4DXZA 3M3OA 4XF0A 3AMMA 1AR63 1MS3A 4QPGA 3D0SA 4ASLA 3HQXA 4Q4X3 1CN1A 4WM8B 4AFAA 1PHMA 2R16A 1DGLA 5GLZA 3JD73 1CJDA 1S0IA 1GFF2 5CA6A 5FPZA 5BNPA 3FBYA 2X5IA 5L73A 3H9AA 3N7JA 3UKVA 5FLHA 1S55A 4FPHA 2PAKA 1TMF2 1JW6A 3ZFGC 3TN93 5DXDA 2YY1A 1BEV1 3MLLA 5C8CB 1O3TA 3VL8A 1ZZ7A 1TME2 5J36A 3FUQA 4WM8C 4TZDA 1FNZA 1NCQB 4N43A 1R082 4XZPA 2DFBA 4YM3A 4S2HA 2HJIA 1J1TA 3AM2A 1WMDA 3KCYA 4FTSA 1C5IA 1KFXL 4AG4A 1ZREA 5C8CC 2BBVA 4HETA 1ULFA 2GC0A 1U5IA 2DF7A 3B00A 4CYDA 2D43A 2VPVA 1NZCA 1VRH3 1NCQC 4GIQA 2DCTA 3K48A 1CPNA 2WKKA 2YMZA 3JB4C 3ZFGA 5JZGA 3AZXA 1DGWA 1M4WA 1W2UA 4XJ9A 2DUQA 4COVA 3QH6A 4E2GA 4KU8A 2RR12 2ZHMA 2VMHA 3MGUA 1Z7S1 1RUE3 3ME2A 1WW5A 2HWE1 5AFEA 2PHUA 3B01A 1WBFA 4AHXA 4CEYB 5LEJA 5I8YA 3MDPA 2ZS6B 4GB32 3O12A 1ENRA 3PVBB 2NMNA 1NCQA 4XQWA 3O5SA 2MNGA 3MPPG 5FREA 2CWSA 4XIOA 1PVC3 4QPIB 4CEYC 3R6SA 2HEYF 2ET1A 3E6DA 1Y7BA 4Y20A 1LJ7A 1SCRA 4WZFA 3IPVA 1BCXA 1S2KA 4JGYB 4UBGA 1LOEA 1ZBE2 3I59B 2DYCA 2ZHKA 5CBLA 5FQ0B 4YM1A 1MVEA 1IGOA 3WG2A 4QPIC 5K8SA 4KGGA 2FHRA 3LA2A 1H2MA 4QT6A 3AP5A 1RUJ3 2QE3A 2Q0AA 1ALYA 3GALA 3UKNA 3MZHA 2A6VA 2CGOA 5AVAA 4JGYC 4U36A 1OI6A 1HRI1 4YGDA 1C1LA 5EZWA 1WW4A 3HBZA 2CNAA 1QH7A 4HZFA 3R4UA 4AXOA 3THTA 2PLV1 1IOAA 4E9KA 1TME1 2QNKA 1WD3A 3AXDA 3URFA 3VBFB 1R081 2XKPA 2OUJA 2PHXA 2AUYA 2QUOA 4AVTA 2VVEA 2SLIA 1FPN1 4RHV2 4DB5A 4AI8A 4MXWB 4LA3A 2D6PA 3R4DB 4LBQD 2ETEA 1C8M1 5FBZA 5J98B 1U12A 3H0OA 5JSRA 3VBFC 1OQDA 4QMAA 4WZCA 1KJRA 3UV9A 1H9PA 5T52A 1AX2A 2EA7A 5JMCA 4JQRA 1B35B 1UW8A 3WG1A 2RR11 2Z5WA 1VBD3 2VXRA 4DNYA 4LT5A 1V9U2 1RJ7A 4IV1B 5H9QA 4XF4A 4W65A 3IN9A 4XYXA 2D93A 1O5LA 2Y0OA 3RYRA 5HXVA 4L11A 1AXKA 3EJKA 1YWKA 1OFNA 1LULA 1SFNA 3AP9A 1RUG3 4B4QA 5SV5A 4F7ZA 2ET7A 1B35C 5JPNB 1EPZA 4XHBA 5BV6A 4D7TA 3N3HA 4IV1C 2IC1A 3TBDA 2O1QA 2D7FA 3ZXDA 1LOGA 1RUH2 4KWJA 1Y3TA 3N7KA 3ZYPA 1WCSA 2RS33 1RGSA 4MXWA 1D2QA 4XBQA 1LB2A 2K0GA 1COV1 2A3XA 2VMIA 2RM23 4P9WA 1WUVA 2OW4A 1ZBE1 1EY2A 4Q0PA 3R4SA 3GF6A 5DUXA 5JVVA 4E2SA 3RNSA 4B3NA 2ZMNA 2IXCA 5IK8A 1B35A 1UPIA 1RVF3 1BBT3 4J1WA 2QDRA 4IV1A 3ELNA 3NV4A 4XFHA 3BIWE 1G9FA 1HV0A 3WY6A 1F5FA 1VBA1 3LB9A 1AR71 3P3NA 1YFUA 1C3HA 3WG4A 3SH3A 3FX3A 4MGZE 3E5UA 2NM1A 1QDCA 3GYDA 4RHV1 2WNUB 3NV3A 4W6WA 5LRRA 4UXAA 1QMJA 3E5XA 1PK6B 3FBMA 2ZACA 4P14A 5BXXA 4CP1A 2P3KA 1QJX2 4KH9A 2RS11 5CFDA 1RL3A 3GZAA 1OD5A 2IFWA 2WNUC 1AR81 1NE4A 1S1AA 1AL0G 1DF0A 2JE7A 1IS6A 1CGPA 1PK6C 1WBLA 4S2FA 5BNOA 3CF6E 3VZOA 4S2DA 1ULDA 3NO8A 1NCRA 1XXNA 2ZBJA 2HWC3 2OZ6A 4BCUA 1RHI1 3J9SA 3ENRA 1CAXB 1N1SA 4E4DX 4FO9A 1IKQA 1WMFA 2PHFA 1H9WA 2JJ6A 1V00A 2JX9A 3NVCA 4AEJA 1RIRA 1XE8A 4J6GA 3ZMNA 1QGLA 4L9BA 4H55A 3RS6A 4QD2A 5C33A 2A6ZA 3D0JA 3S30A 1GZWA 4BZ4A 3HD8B 1POV1 1MVQA 2ZAHA 3RMXA 2E6VA 1PO12 2NPIA 4FCAA 4B7KA 1YHFA 3IDEA 4CTEA 1OQ1A 5EFUA 3SMHA 2TUNA 1QJU3 1FMD1 2O8OA 3VHNA 2PAEA 3I7DA 4Q4V2 1VBE1 2C0ZA 3KT7A 1CAUB 4AI0A 3OPZA 4OZXA 5J48A 1LU2A 1YFWA 4EJRA 4N7UA 1ENQA 4AQSA 4Q4Y2 1CIWA 1BEV3 2YGMA 4FPYA 1BK1A 3DV8A 3NKGA 1MS9A 1TE1B 3IDCB 3WVJA 3L2HA 1NQJA 2UYBA 1RUF1 2XLFA 2NQYA 5HCAA 1MQTB 2GMPA 5FO8B 3KLSA 5A3LA 1XYNA 2HEWF 3FLPA 1H1AA 1DHKB 2WL1A 1NLRA 4C0BA 2VVFA 2ZZJA 3WW2A 3ZIWA 1QJX1 2ZGQA 2JXAA 1MQTC 4MGYE 1DQ2A 1GLHA 3U07A 3MPBA 4AHYA 1W6OA 4QQOA 3FZ3A 4B4RA 1UN1A 1Z7S3 1Q8OA 3B02A 2HWE3 5JIUA 5EV7A 3ZSMA 3SLIA 1YYNA 4FOWA 1RB8G 5IK7A 2CTVA 3BCWA 2LTNA 1LOBA 1HW5A 3ZPYA 3R0RA 3TOJA 4PJYA 2PN5A 2YDEA 5KC6A 1RJ8A 4AWDA 2WLQA 2DUOA 1G9AA 3AZVA 1OOPB 2UY9A 4K6BA 5BPXA 3M70A 1MQTA 3VKOA 1XQNA 3WP5A 3VUOA 4QGNA 1XNBA 4K8FA 1YUDA 3CU7A 4RD7A 1R1A2 2DU0A 4J1XA 2D98A 4RQPA 4IXLA 3MIDA 2RMU2 5AC92 4IEOA 4YNIA 1KITA 2OVUA 4BQ1A 1OOPC 2WNVA 3BALA 4AEDB 3HAGA 2BWCA 1WLWA 4FOYA 2WINB 4NN0A 1A8DA 5T5OA 2YUEA 1WW6A 1AYM2 4YVSB 1SMVA 1URXA 4Q4W2 4X8PA 2UURA 1HRI3 1PGW2 4XFGA 4AEDC 3OTFA 3IBMA 1XYPA 2ZMLA 2B45X 4TYSA 4FAGA 4PF5A 3ZXAC 5GJ6A 2PLV3 2R071 1TME3 1YIFA 2B5HA 1N3PA 1R083 4LO6B 4YVSC 4QXKA 1X7NA 4FXKB 3TWIA 5FDBA 1FPN3 4A7ZA 2D40A 4P9XA 4XW3A 2IWGB 4XQ4A 5D8AA 2R061 3FWEA 4EWDA 1W0PA 3WP3A 5GM0A 3DKWA 2CL2A 5L19A 2R6QA 4N90A 4HVOA 1RC6A 3N35A 4HFSA 2GMEA 2TBVA 3ROUA 4Q1PA 2RR13 2C1FA 3AMNA 3ZVXA 4FPCA 2E53A 3PJYA 1G9CA 1DQ0A 4XILA 5DUUA 4CEWA 3MYXA 2IXLA 3E6CC 1WLTA 1QY4A 4BWOA 2QQPA 4G4FA 1FI2A 1XNDA 4KBBA 3B69A 2OYZA 2EAKA 4AHZA 1RMU2 4KQ7A 3AYEA 2H0VA 1F31A 2DVDA 1TNFA 4OVEA 3AX4A 5FO7B 2PAMA 3IDBB 4FOQA 1D0GA 5H9SA 2XBO2 1DGWX 1VBD1 3VHRA 3NKTA 1G9BA 1DDLA 4PQ9A 1HX6A 1COV3 4Y4YA 4CDUB 4FPGA 1PMIA 2RMU1 1ZBE3 3ZSLA 5B2GB 4YZ3A 2E63A 3VBRA 4UW4A 3AYAA 1JOJA 3ZXFA 1G86A 1PO22 4OUMA 4XDQA 5KC5A 1Q8VA 4IETA 4HPKB 2QFEA 1RUD1 3AMQA 1AYM1 4XXPA 2D5HA 5T5LA 4CDUC 1IS5A 4Q0QA 4Q4W1 1LCLA 1ND3B 3VBHA 3W58A 4XFAA 4D94A 4YARA 1QJZA 2JENA 1AR73 2XJUA 4LHKA 2FZ1A 1HQNA 3JQXA 1BVP1 5DZGA 2X53S 3CL1A 1UKRA 2DVBA 4H7MA 4IEZA 4TLFA 4NHLA 1UIJA 2RJLA 1ND3C 1FXZA 3ILNA 4RHV3 3HWJA 1BBT1 2NZ9A 2ZKLA 2ZX1A 4QQ2A 5KXDA 1LHUA 1QHDA 3T2TA 2UWBA 1WW7A 4FP2A 3NAPB 3FE5A 1LHVA 1XU2A 3OJBA 1RUNA 3BODA 3UKTA 4PIZA 5FTTC 3X29B 4K21A 4P9YA 5I0SA 3AMPA 5CB7A 4YVWB 2GAUA 2LUWA 1RUC2 1W0OA 3SH5A 4NO4A 2WNEA 4JTOA 4XFFA 4I09A 2EALA 2ZX2A 3ES1A 1ND3A 3NAPC 4AQTA 1IKPA 3BTAA 1SLLA 3B9IA 1F8VA 3MW3A 5E16A 1RHI3 1Q8QA 4N53A 1ZM1A 2EXJA 4YZ2A 5K7PA 5IK5A 4GMP0 3KS7A 2ZGOA 3KQRA 3WG3A 1DG6A 1SQ4A 4QU2A 4YVWC 1GQHA 2DVAA 3NSTA 1YIPA 1H8TB 1J3PA 4XBLA 3BPZA 2GC1A 1OA4A 4MLOA 2X29A 1J59A 3ZXGA 1UD1A 3CJIA 1ZRCA 5GZDA 1LOFA 4WBBA 2AZ5A 1S0GA 2XVKA 1POV3 2HWC1 2W08A 2QJVA 2WS91 4ES8A 4M3CB 3C3VA 3NAPA 1H8TC 5CG8A 2VECA 3AFKA 1S0FA 1N1VA 1SBFA 4XJZA 3ALQA 2HWD2 4LLOA 4AHWA 2ILMA 4JGZB 2WSVA 1U5ZA 1YI7A 2Z42A 2Q5TA 4HKWA 4HMZA 3W59A 2G9FA 4DINB 4K40A 4ISQA 4ATEA