5T5JA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5jA00
1YYNA 3MW3A 1SBDA 2CWMA 3IMNA 2WT1A 1LOFA 4GA9A 1JYIA 3AX4A 4XOGA 1MS1A 1YO8A 4YGDA 3VKLA 1GBGA 4ISQA 2ZGPA 3M3OA 4YM3A 1JHNA 5JDBA 4Y1ZA 4JRAA 2C9AA 3AYEA 1DLLA 4UW4A 3ZSJA 1IS4A 2JDZA 4XILA 5FRAA 1YXWA 2C5DA 2D6OX 3AYCA 3SNMA 4FPJA 3WV6A 1QNYA 1OFSA 1WLDA 1OQ1A 3JU9A 3TAYA 2WKKA 4XJAA 5H9QA 1I1EA 3I8TA 2A6YA 1S0IA 1C4RA 1G8WA 3A0NA 1GSLA 2VY0A 4FQ4A 4XTMA 4I30A 4RA0A 2YV8A 2H0BA 2R49A 2GDFA 3BTAA 1NLSA 1BKZA 5GM0A 1LHVA 4F83A 3AJZA 4FQZA 2GNTA 4Q27A 3UJQA 2ZBJA 3OY8B 2VW0A 1N3OA 4AYUA 3U4XA 4HL0A 4ITCA 2A70A 3ZYPA 1G86A 1V6NA 3QCWA 3WZ1A 2DYCA 1LOCA 1UL9A 1W6QB 2EXJA 2TEPA 4Y1VA 4AGGA 1GV9A 4BPZA 2D43A 3N7KA 1DYPA 3MW2A 1S0EA 2ENRA 4LBLA 4BM8A 3LSDA 2DTYA 2JD4A 1DQ4A 4BQ1A 3O5SA 4Y22A 5DUUA 1ZM1A 1AVBA 4YZ1A 3FBYA 5F9TA 2ARXA 4FPOB 3IM0A 3OBRA 5CBLA 1Q56A 4NOTA 4Q1RA 3GNEA 1PZ8A 4FOQA 4GALA 2VW1A 2NP0A 1I3HA 4Y24A 2B7YA 4Y20B 1W6OA 3OGGA 1CJPA 4HANA 2WLQA 1C1FA 2GALA 1DQ6A 1F9KA 1MVEA 2A75A 3BOPA 1LEMA 3ASIA 3V0AB 4YW5A 2D6LX 3OYWA 4XJZA 3RMXA 4XIKA 4AGVA 1JUIA 1BYHA 5IK7A 4FPLA 3B00A 1G9CA 4L8QA 1AX1A 2JE9A 1DGLA 1WBFA 2GN3A 2JKBA 4AVSA 3WCRA 4WV8A 2CY6A 4UW3A 3POYA 4CRQA 3D4KA 4ZKTB 4YW3A 1MZ6A 1G9DA 3IKWA 2PHTA 3AJYA 1DQ2A 2PELA 5JOXA 1S0FA 4C1XA 5JOZA 1Q8OA 1HKDA 4R9BA 1IKQA 2WSVA 1V6OA 3B3QE 3B9CA 1JYCA 2EXHA 4XE9A 3WG3A 4W65A 3AXEA 4K1YA 1SFYA 5CB7A 4BLIA 4Y1UA 3WLUA 1GZ9A 2LALA 1DQ5A 1UPSA 1S0DA 3ATGA 5E89A 2A6VA 1LCLA 1ENQA 1N47A 1U0AA 3AZWA 1HLCA 5GZEA 3WG1A 2ZHKA 4ASMB 3ZXEA 1S0CA 2P3KA 2RHPA 5EWSA 1LOGA 1WW6A 3IPVB 5KXCA 1S0GA 1SLLA 1Q8VA 5GALA 2GN7A 1HQLA 1QNWA 5T5JA 1G9AA 5DUWA 1DIWA 5T50A 3RQ0A 1IS6A 4GKXA 2VW2A 1JOJA 1YI7A 1LGBA 1NXD1 4WZFA 2D3PA 2CYFA 2Q5TA 2WQZC 2AENA 3D5OA 2AYHA 3N35A 5DUXA 5F5QA 1QOOA 3M1HA 1ONAA 2P34A 5LK5A 4D69A 1CR7A 1VIWB 2ZGOA 5JVVA 1MS4A 1MACA 2YXSA 1LOAA 4M3CE 3N7MA 2P3IA 1MVQA 4YGCA 1GYKA 2UURA 2DVDA 2V5YA 1GZWB 2PHWA 2YMZA 5T55A 1MS8A 1C57A 1MZ5A 3RSJA 1WCSA 4XMAA 4LBQD 3WDWA 1C1LA 3SH3A 4UW6A 2EIGA 4YG6A 1UMZA 4Y22B 2AGSA 4PCRA 2PHRA 3C2UA 3AXDA 3UJOA 4YZ3A 2R0HA 3I4IA 5H9PA 3KQRA 1UAIA 3WG2A 2GNMA 3PJQA 3WDXA 3OPZA 1LGCA 3T1LA 4ATFA 2AREA 2R0FA 3WUDA 1W6OB 1RITA 3PVNA 1BXHA 5E8AA 1V6MA 5DUVA 1SCRA 4YG0A 3SH5A 2P3JA 3V64A 4YZ5A 1LTEA 1N1YA 1F5FA 3OYWB 2ZGQA 1WW5A 4XHBA 5DXDA 2R1DA 3OBTA 3VKNA 1AXYA 4XBLA 3PVOA 1QDOA 4LBQB 1UZYA 2PHFA 2WT2A 2A6XA 3N7LA 3USUA 1V6LA 4K20A 1MS3A 1SCSA 1DHKB 2AH2A 2ZZJA 1CESA 1DQ0A 3NV2A 1GANA 2ZMNA 1WLCA 1KQRA 3ILRA 1W6MB 2A3XA 1URXA 3BODA 4M00A 1DBNA 1ULDA 1S0JA 2UU8A 5DZEA 4AVTA 3IN9A 1SBEA 1VALA 1G9BA 4GWMA 5GLUA 1G7YA 3GALA 4Y26A 3SLIA 4U2AA 4PBPA 2ZABA 4DFSA 1VAVA 1JXNA 1H30A 5E88A 5H9SA 3WG4A 2ZA9A 4FPKA 5KXEA 1V6JA 4YW1A 1FAYA 5JOWA 2ZACA 2JECA 4FPEA 2AR6A 2ZGUA 3T2TA 4YFZA 1DFQA 1AJOA 3AZZA 3UL2A 2D6KA 1LJ7A 3ZVXA 5GZDA 3M3EA 3FLTA 1A3KA 1BQPA 2HYKA 4M3CA 4ZXKA 2I2SA 2E7TA 2NMOA 2ZHMA 1GKBA 4BOWA 2E53A 1QGLA 3O0VA 1N1VA 1WW4A 2GNDA 1O4YA 2DURA 4K1ZA 4M3CF 3ILFA 1D0HA 4P14A 2ZKNA 4WVWA 2GMMA 4AGRA 2FMDA 4GXLA 4AWDA 2DUPA 3WCSA 1QKQA 2D3SA 2LTNA 1HDKA 4YFWA 3ZSKA 2A71A 3HMYA 2PHXA 4TYSA 1Q8PA 1W6PA 2JE7A 1LENA 2E51A 1FNZA 4UW5A 4YG3A 1KJRA 1CPNA 1Q8QA 2NM1A 3NWKA 4BMEA 2D6NA 3ILNA 3NV3A 4Y1XA 2NZ9A 1AZDA 1ENRA 2A6WA 3V0BA 5HCBA 1LU1A 2SLIA 3NV4A 4DRRA 4NO4A 1YRZA 4GWNA 1CIWA 4YM0A 3SH4A 3ZYRA 2CWSA 4LBKA 4YZ4A 2EXIA 3HR9A 3VV1A 1BZWA 4R9DA 1HQWA 2UWAA 2ZHLA 3AYAA 1WW7A 3M3QA 1FYUA 5EYYA 3N3HA 3POWA 1SLIA 4XJ9A 4YGBA 1W6QA 3AZVA 3HN1A 4C1WA 3ENRA 2XB6C 2EALA 3LCPA 4Q8KA 5JOYA 2DVBA 3AFKA 3ZXFA 2JJ6A 5DZGA 4U36A 4Q26A 1SLTA 4LBJA 4XJUA 1EPWA 5GZCA 4Y1YA 3RMYA 2ZHNA 2UWBA 5GLTA 1QMJA 1Z78A 2YZ4A 5H9RA 2DU1A 1LHNA 4LBMA 2VU9A 4FOVA 5AVAA 1N1TA 4R9AA 1GICA 3USUB 1MS9A 4DPNA 5DG2A 1WD4A 5GJ6A 1LGNA 1FV3A 1AXZA 3VUOA 2CL2A 2DTWA 2R16A 4CZSA 1JBCA 4YGEA 1LU2A 1Y7BA 2GMPA 4DRVA 1CN1A 1WD3A 5IK5A 3SISA 1JN2P 2ZGSA 5GLWA 3CNAA 1LHUA 1AJKA 1N3PA 5CA6A 1QF3A 1W6NA 4FVVA 3FLRA 1CONA 1DYKA 4JCKA 3QLQA 1AF9A 4FPGA 5IK4A 5GZFA 1QOSA 3PMEA 1KDKA 5T5LA 3V65A 1Q8SA 1FNYA 4YW2A 3RRDA 2ERFA 4XBQA 3MW4A 4P9YA 3A4UA 4YM2A 2ZGLA 1RIRA 4LBNA 3POSA 2R1BA 2W52A 3Q9OA 3LSEA 4M3CB 3APBA 3PVEA 4YM1A 3T1MA 1FATA 4YW4A 1QU0A 1D2SA 3KM5A 4XJ8A 4YLZA 1WBLA 1KRIA 1B09A 1LULA 1A78A 2A7AA 1A8DA 4XHXA 2NYYA 2A3WA 2OW4A 5GZGA 3O0XA 1H9WA 1WUVA 1ZA4A 4MYEA 5FREA 3JUUA 1CQ9A 4M01A 1LHWA 1AX0A 1SACA 1W6PB 3WDYA 3IPVA 4XBNA 4DQAA 1UN1A 3AP6A 3D6EA 1GZCA 2A3YA 2ZGRA 4RL7A 4Z8BA 4FOWA 4XIOA 5T5OA 2DVFA 3AP9A 2A5ZA 3V0BB 1LOEA 2GNBA 1ULFA 3AP7A 1LECA 2DUQA 2SBAA 5BYNA 1LODA 4XZPA 3W58A 3WDVA 3O12A 3WNXA 2DV9A 2CNAA 3A0KA 3AK0A 1CPMA 4BLJA 3M2MA 4BMBA 2E6VA 2ARBA 2CTVA 3WHTA 4ATEA 2WSUA 1KDMA 4FP3A 2GMEA 1IOAA 2NMNA 4CTEA 3FLPA 5JMCA 5IT6A 2ZMKA 3WVJA 3MPPG 2VUAA 5T54A 3VKOA 1DQ1A 1GZWA 4R9CA 5HCFA 4FPFA 3B69A 4Q2FA 1CVNA 2BQPA 1PZ9A 1J1TA 1KJLA 1FV2A 2EAKA 5T5PA 1LEDA 1IS3A 2AUYA 3INAA 4JC1A 5HCAA 3WOGA 4SLIA 2P2KA 4LBOA 3OJBA 2A6ZA 2UWCA 3AP4A 3RG0A 3H0OA 4Q8LA 2EXKA 3ZPYA 5JLVA 4FP2A 1F31A 4FPYA 2FHRA 3MEPA 2PHUA 4FPCA 4XMIA 5SV8A 2OUJA 3BIWE 4XXPA 2DVGA 1VLNA 3AZYA 3WUCA 1MS5A 2D44A 4PQ9A 3O0WA 4ISRA 1ULCA 2OVUA 2WT0A 1W6NB 3ZXLA 2W39A 3ZSMA 2YY1A 5KXBA 2W68A 2ZGMA 1SLBA 1YIFA 2ZGNA 3AYDA 1H9PA 1ULEA 4LBQA 1LESA 1RINA 3OY8A 1UKGA 4FPHA 1APNA 4H55A 1BJQA 1UX6A 2P37A 3R4SA 2W08A 4AVVA 1X50A 3TB0A 2D6MA 5CAZA 1SLCA 4YZ2A 2WJSA 2DWRA 1W6MA 1MS0A 1TEIA 2V73A 1Z0HA 4GKYA 3VKMA 1LOBA 2VXRA 2ZGKA 3ZXJA 4IQPA 1R1ZA 2ZGTA 2DVAA 2YROA 3FUOA 3N36A 2EF6A 4XYXA 1WLWA 4XDQA 5GLZA 2DUOA 2KM2A 2ZAAA 1GNHA 3FUQA 3NV1A 3AZXA 5T52A 1SLAA 1KITA 1OKQA 4OZXA 4DS0A 3WDUA 3ZXKA 1VAMA 1V6IA 2ES3A 3SITA 1W0PA 1AX2A 1QDCA 1V00A 3B01A 1IS5A 4FOYA 2D6PA 3M3CA 5EXOA 3R05A 3WDTA 5IK8A 4XXAA 1S1AA 1W0OA 4KBBA 3WHUA 4Y20A 4XJWA 4Q1PA 3ZSLA 4K21A 1N1SA 1ENSA 4WVVA 1GLHA 3V0AA 5GLVA 1O4ZA 1S0BA 2D3RA 4P9XA 4PF5A 1LOFC 1PZ7A 1SBFA 3DUIA 5EYXA 3W59A 1IKPA 5KXDA 1UZZA 4P9WA 2VH9A 1JW6A 4XTPA 1ULGA 2ZMLA 5DZFA 5L73A 3FFZA 3DGTA 1MR5A 1FX5A 1V6KA 3N7JA 1G9FA 3L2YA 1DZQA 4PBOA 5CNAA 1QOTA 2DU0A 3UK9A 1N3QA 4TZDA 1XQNA 2NN8A 1AXKA 3R4UA 2E7QA 3AP5A 2WNEA 5DG1A 2OUHA 2XG3A 1GNZA 2Z42A 1LHOA 5IUQA 2D7FA 3VKFC 2G4IA 3RS6A
chains in the Genus database with same CATH superfamily
3MW3A 5KHIA 2QJVA 3Q8AA 2Y6JA 1LOFA 3CQOA 3J8F3 4PIYA 5FQ0A 1GBGA 3FE5A 3CO2A 4FFIA 1JHNA 5JDBA 1RUE2 2ZJCA 4Y1ZA 4JRAA 3H3UA 2C9AA 1ZBA1 2FD8A 1IS4A 4X6QB 2D6OX 1AR73 3AYCA 2B4KA 3SNMA 1F5JA 2O0OA 2WWSA 1WLDA 1OQ1A 1RC6A 5IWFA 1I5PA 3TAYA 2WKKA 4N53B 3THPA 2IUWA 5JSOA 1C5HA 3DPRC 2A6YA 1D4M1 1TQ5A 4FQ4A 4AI8A 1UKRA 1AL22 3P5BA 4XTMA 4I30A 3VZMA 3P3PA 5FZOB 2GDFA 1ZREA 4GMP3 4COYA 1VRH3 4QXHA 3X29B 4F83A 4R52A 3WP4A 2RR12 1AYN1 3FZ3A 3GZTB 2MEV2 2P1BA 2ZBJA 4TLGA 3T4VA 3J8F2 2VW0A 2RDNA 1N3OA 1HV1A 3MO4A 4HL0A 5FZGA 2W2IA 1HXS3 3ZYPA 3LGRA 2OKXA 1NY72 2DYCA 2IFRA 2VBPA 2C1FA 2TEPA 1AR72 4TSVA 1AR82 2XONA 3LF7A 4Q0QA 1UY1A 1TME1 4QGNA 4QPGA 4BPZA 2ENRA 1J58A 3FHAA 4YPJA 2W9XA 1BEV1 1W9YA 4FFGA 3WNLA 3LA7A 4BHPA 3VD9A 4XUQA 2XJQA 1O3RA 1JOPA 4Y3OA 2K46A 3ZXGA 4BQ1A 3MIDA 3MHZA 4Y22A 4BDVB 1ZM1A 2OYZA 4CCNA 4YZ1A 1I5ZA 1BMV2 2PAMA 4GAZA 1VRH2 2OPWA 3IM0A 1VR3A 4IV3C 4BQ2A 5FBJA 1OF4A 4IV1C 3EO6A 1R1A2 3N9NA 4RQPC 5C8CB 5J36A 4WVZA 4FT8A 1QIQA 1ZZ6A 4WM8B 2B7YA 2CDOA 1W6OA 4BWOA 5J09A 2WLQA 1C1FA 5F3CA 1DQ6A 1REDA 1LEMA 3NO8A 3ASIA 3UNPA 4XCAA 2D6LX 5FLHA 4EYUA 4CCKA 2VM9A 4M0HA 1JZ5A 4XIKA 4AGVA 2E26A 4LKDA 5IK7A 1K5MC 2VBBA 2VVFA 3B00A 4Q0SA 3SC7X 3T2PA 1DYOA 1KFUL 3U14A 4BH9A 1DGLA 2EIEA 4MXWB 5F5IA 2HEVF 3SCFA 3WW1A 4CDUB 1WGPA 2HYXA 2WNOA 2RJKA 2XQRA 5JXJA 3OBAA 3VBHC 3POYA 3VHOA 4CRQA 5ANNA 5A33A 4NPLA 4QM9A 2FMYA 1MZ6A 1CAVA 1UZ0A 5JOXA 2PELA 4QM8A 1F4HA 1V9U3 4NIGA 1Q8OA 4R9BA 4S2DA 5JOZA 4XE9A 5FP8A 1JYCA 4W65A 1ZRIA 5IVBA 4K1YA 1SFYA 1RUF3 4LKFA 3TNQA 1GZ9A 5K0UB 5KWRA 5FWJA 4NIHA 1LCLA 2VZPA 3POIA 4HLTA 1U0AA 1OC1A 2CHHA 5IW0A 2BEOA 5FY7A 2C4XA 2ZHKA 4ASMB 1S0CA 2RHPA 3MBWA 5HV4A 5JXHA 2AACA 5EWSA 1WW6A 3IPVB 4LITA 1H0BA 1HB1A 4XFHA 1Q8VA 3I97A 1HQLA 1NZIA 3EXUA 4NN0A 3C7GA 2BU9A 3BGAA 5CEHA 5FPVA 3ACLA 1RUJ2 4CVUA 1NYWA 2VW2A 1EUUA 3KGZA 5I91A 1ODMA 1LGBA 1RUE1 1ZZ9A 2D3PA 3ZYBA 2CYFA 3GZAA 2Q5TA 1V9U2 5A3NA 3M1HA 3Q8CA 4ZXEA 1UU4A 3VBFA 2Y26A 4GH4B 2BZDA 2V5DA 5HI0A 1VMFA 1ASJ1 4PLOA 3WX5A 4AI9A 1MS4A 1MACA 3UKVA 4AI1A 4AQSA 2YXSA 4LORA 3BPSA 4M3CE 1W8HA 3GJAA 3N7MA 4NWVA 5A1FA 1DG6A 1AL21 3PURA 2UURA 2V5YA 1C8NA 5F37A 4NHYA 3HT1A 1GZWB 3HD8B 4GULA 3MUY1 4NMIA 1CD3G 2X53S 5FP4A 5T55A 3PHMA 1POV0 4HKLA 4QQPA 3UETA 3ZFEC 4A3ZA 4CDXA 1ND2A 2RR11 4YSFA 4FFHA 4XMAA 1ENXA 3WDWA 1C1LA 1G6NA 3J8F1 3URFA 5J96B 2AGSA 3B9IA 4PCRA 3VDDA 3U07A 3B02A 3C2UA 4RFT0 3AXDA 2GZWA 2Y34A 4MZUA 3UJOA 4CPBD 5H9PA 3KQRA 2ZEZA 2BGOA 3NQHA 2QQWA 1LGCA 5C3OA 1RUI3 3MLJA 4RHV2 3T1LA 4BQYA 3IDBB 4QU1A 2AREA 2XKPA 3WNOA 5G04L 2XH6A 5DUVA 5AVPA 1OFNA 3MIEA 4ZU5A 4YG0A 3R6SA 3V64A 4YZ5A 2UY8A 2K9ZA 1F5FA 4IEZA 2ZGQA 4CEWB 2VG9A 4C0BA 1EPZA 3NAPB 3I49A 5BY5A 1BMV1 1W2UA 3PVOA 1UZYA 2PHFA 4GMP1 4PDWA 1OOPA 2WFF3 4G9SB 4FTBA 4K20A 2GSYA 1ZA7A 1SCSA 3VBOA 4OHYA 4YVWA 3MICA 1DHKB 1PX3A 2GH2A 1CESA 2QNKA 3C3VA 3I2IA 4OI2A 1WLCA 1UYXA 1W6MB 4MHUA 3BODA 4M00A 1DBNA 1HXS1 1S0JA 2ET7A 1ZVFA 2DBIA 4QX2A 5DZEA 2QQLA 4ARYA 3IN9A 1W8FA 5C3QA 2YBKA 4FAHA 1RUI2 3GALA 3EBRA 3WNMA 2C6SA 5FPZA 2G19A 5A7PA 4A7ZA 1MZFA 2HWE2 1DU3D 1XYNA 3D3AA 4KGGA 1U5IA 2FDIA 4P5YA 3O1MA 4XAAA 1WMEA 2AR6A 2ZGUA 4YFZA 4QX8A 4H7LA 1WWYA 3THCA 3GCWA 2D6KA 2WNVC 3HVDA 2CGOA 3LA2A 4BIOA 2J1TA 2WNUC 4R8HA 3A7QA 5GZDA 3FLTA 1W8WA 2B9VA 5F2SA 4JHZA 2VD7A 4ZXKA 5TSWA 5FV3A 2QQPA 4HBNA 2WQ4A 1TVGA 3H7YA 4OQ9A 2ZHMA 1QGLA 1WW4A 4K1ZA 4YVSA 2DURA 3MPBA 4RGAA 4P9LA 1CZTA 1H2NA 2KXLA 4UBHA 4DXSA 2VUJA 4CU7A 1Y4WA 4GXLA 4HSJA 2ZAHA 5E6HA 2IC1A 4KU7A 5ABJA 3I2GA 1LENA 1FNZA 5BNPC 3ACFA 1KJRA 1CPNA 2NM1A 5I0DA 1FMD3 3KQ4B 4BMEA 4OI4A 1UZVA 1YFWA 2HWD1 4P02B 2JG9B 3V0BA 1NE6A 1R093 1YRZA 5D2AA 4IERA 4GWNA 4CU8A 3VDCA 3LDBA 3KVAA 3LKJA 1JYVA 1CIWA 2Q1ZB 3ZYRA 4F7ZA 5CG8A 5LA0A 4LBKA 3AFGA 2FCVA 3ACIA 4CE8A 1BZWA 4R9DA 1AYM1 4W6WA 1RUF1 3KVBA 3C7FA 2OA2A 5EYYA 4BISA 5FXVA 3D82A 2QQJA 3HN1A 2EA7A 4XETA 2XJVA 2J7MA 2VZSA 5JMOA 2VE1A 1JYWA 4Q26A 1QEXA 3MF9A 1EPWA 4XQ4A 2VQUA 1SPPB 5GZCA 4Q4Y3 1E5IA 5HXMA 2V09A 5A6ZA 1Z78A 2YZ4A 3B7MA 1O8PA 1DLCA 1R092 1OPMA 3VBUC 3USUB 5I8SA 5FYHA 4P08A 4BCUA 2YHJA 1XNBA 1NA1B 1HRI3 5LASA 4CZSA 3ZOIA 5CFDC 4O9GA 1IG3A 2GMPA 4ZPIA 4DRVA 5F32A 3VDBA 1CN1A 5IK5A 3J9SA 1NAEA 5FBZA 3SISA 1X8MA 2O1QA 3UESA 3ZM8A 4D6QA 4ET7A 5GLWA 4CUAA 3CNAA 1JZ2A 1WMDA 2FZ1A 2ET1A 1QF3A 3EQEA 1DYKA 1YJKA 1RTVA 4JCKA 4XURA 4AHWA 4D6RA 4WZCA 1AF9A 2I74A 1UYZA 5LEJA 3TEWA 4RS5A 5IK4A 5GZFA 4Q4Y2 1GNYA 4C0HA 2BVBA 3V65A 1UW8A 4KWJA 5D8AA 4QX1A 1Q8SA 1FNYA 4NWWA 4UFIA 1W8ZA 1H4HA 1W8NA 2C9KA 1UX7A 2MNGA 4GWJA 2YBSA 4LHLA 4P9YA 4RD7A 2Q1MA 3QH7A 1KS4A 1OBNA 1NZCA 3Q9OA 3T30A 2VULA 1HRI2 1RUI1 3PVEA 3T1MA 4MGTA 1QU0A 4LK7A 1WBLA 1HIXA 2XVLA 2B5HA 2G1MA 3Q8FA 1A8DA 4GZ9A 4K6BA 1C8M3 2WL1A 5FZCA 3VBRC 2OZJA 2O8QA 2W94A 5BNOC 5CFCC 3S5QA 5GZGA 1RUH3 4MYEA 2XJRA 4Y4RA 4A6OA 3OPTA 4IV3B 1NG0A 1NX9A 1LHWA 4QGMA 3M4FA 5CVRA 2WFF1 3IPVA 3AMNA 4OUMA 2YPDA 2QUOA 5F5AA 3OF1A 3VHNA 5C6CA 2RS13 4B1LA 2ZGRA 4RR3B 4AHYA 4OUSA 1YLLA 2A5ZA 1UY2A 1CZVA 4P9JA 1ULFA 1PGW1 1MEC2 4OVEA 5A32A 5LZ6A 1LODA 2YPJA 2VR4A 4XZPA 3WDVA 4ES8A 5FFOC 1FOD3 1PIV3 3H7JA 2CNAA 4L97A 2YU1A 4RYDA 3BU0A 4BLJA 2ZEWA 2HEYF 2KD7A 2ARBA 1W28A 4WBBA 1X36A 1S4CA 2QBXA 2ZKLA 2PHDA 4HPKB 2XWJB 2GMEA 5F6LB 1XC6A 5I0TA 1RUH2 1VBC3 1LRHA 2QQUA 2QQNA 3FLPA 4IETA 4N53C 2ZMKA 1PO23 1XNDA 2VUAA 2YG0A 3JCIA 3VKOA 1GZWA 2QCSB 4FI9A 4O61A 5JZGA 2IXJA 3DYOA 4Q2FA 3VHPA 4NPRA 3V56A 2RS12 1PZ9A 1J1TA 1S2BA 1HB4A 2AUYA 2JG8B 3INAA 4JC1A 5CISA 2BNNA 4OI1A 1YCIA 1UY3A 2XJTA 4OYUA 5I8TA 2RS53 4P5HA 2A6ZA 3AP4A 5IVJA 3RG0A 4QHOA 2WWJA 3H1MA 4JGZA 3UGGA 1WLTA 4FP2A 2FHRA 5DAQA 3RPQA 2PHUA 4Y33A 4AHZA 1US3A 1K42A 1FMD1 2DVGA 3C7EA 4QQOA 3RNSA 4BE3A 3AZYA 4DXTA 3EHKA 3OSDA 5FYVA 3O0WA 1PO22 3I2KA 4ISRA 4PLMA 3ZXLA 2W39A 3ZSMA 2YY1A 1OD5A 3NAPA 5IFPA 2W68A 1GOFA 2YFZA 3AYDA 1ULEA 2JD9A 3LB9A 4KQ7A 1GZTA 1ODNA 4KMQA 3UGHA 3TYJA 3TWIA 2X29A 4LUMA 2W1WA 2VMEA 2VOKA 3OEBA 3DXTA 5C8CC 3LEMA 2WJSA 2DWRA 1W6MA 4WM8C 3VKMA 4AVAA 4MADA 3HQUA 4EN6B 5AFEA 2VMDA 4L99A 5IAVA 2VCCA 5FZLA 2YROA 3CL1A 3KLSA 2EF6A 4LOTA 3MFCA 4XYXA 4S2HA 1WLWA 5DDJ3 3ZFEB 2KM2A 1YQCA 1IZ3A 1SLAA 2VNVA 1OA2A 1OKQA 4Q4Y1 3I2OA 3HQXA 3MIGA 3ZXKA 1NCQA 1VAMA 1AX2A 4ZU4A 1UD1A 4AXOA 2Q4SA 2R073 4CDUC 1IS5A 5FPLA 1CX4A 3HAGA 5EXOA 3SCHA 3R05A 4KBBA 1UMIA 4OCTA 1IQDC 3LFMA 2Q30A 5FOBB 3EMRA 5F6KA 1W3VA 3CIHA 1N1SA 3V0AA 1YFXA 3DN7A 5J98B 5KBFA 2WWUA 4RGKA 1PZ7A 1SBFA 3W59A 4UF0B 3BPZA 5K0UC 5A3PA 3PL0A 1ULGA 3H1WA 5ACA2 3FFZA 3DGTA 5DDJ2 3DKQA 3NW4A 1MR5A 4DIQA 1V6KA 4PBOA 3BI3A 1G9FA 3L2YA 1K12A 5EHDA 1AR61 5CNAA 2DU0A 3UGFA 4MVTA 3KS7A 2E7QA 3F2ZA 3AP5A 1NQDA 2WNEA 3L2HA 2XG3A 4NHXA 2BBAA 1GUIA 1RB8G 2R072 4SBVA 3VKFC 2DFBA 1MZEA 4HVRA 4KG8A 1SBDA 2CWMA 4CDWA 1J59A 2WT1A 1JYIA 3D8CA 4XOGA 4YGDA 3WSOA 1OQEA 4NVPA 4OFGA 4XF0A 1HB2A 5LW9A 4N7UA 5LA9A 3KV9A 2ZGPA 3M3OA 4G4FA 4NUBA 4E4DX 4YM3A 4CYDA 5J37A 3HBKA 4UW4A 3ZSJA 3JB4C 1C8M1 1PNGA 2Y38A 4GH4C 2BOJA 4XC9A 3M8LA 1Q43A 2UYBA 1AUYA 4K8FA 4FPJA 3ACGA 1PK6A 1OFSA 1RUH1 4BZ4A 1D4M3 4JTOA 5FWEA 1OLME 2ADEA 3JU9A 4EN0A 4CCJA 1RUC2 4JDNA 1QQP1 3ETQA 1UOFA 3A0NA 1GSLA 2VY0A 4XAEA 5FLJA 1NLRA 2VUDA 4CXWA 3OBZA 2RS11 4QHBA 2R49A 3BTAA 1W0NA 1BKZA 1O6UA 1LHVA 5JWPA 2XLAA 4FQZA 1IG0A 1PO13 5FYMA 5CADA 4D0QA 1FOD1 1HJFA 1PIV1 2J1EA 3OY8B 4X8PA 4DUXA 1VB4A 4Q0PA 3RFRA 2A70A 1HN1A 2WQ8A 5BNPB 2BRTA 4LNVA 3BOWA 3RZGA 2HBTA 1W6QB 2EXJA 2LW8A 3DPRA 4LO4B 4AGGA 1VBC1 2D43A 3KV6A 1D4M2 3N7KA 3O14A 3PDQA 1PO21 3E5XA 1DP0A 5FTTC 4MXVA 4A45A 2N7GA 4GIQA 2DTYA 4CEWC 2RVAA 1DQ4A 4L11A 1U12A 5DQ0A 3O5SA 2D40A 1PVC1 4XUNA 3TRSB 2P6HA 2RJLA 5A3MA 3FBYA 4JKLA 3SHRA 1VBD3 3RZHA 3OBRA 1Q56A 2BNMA 4Q1RA 4CP1A 1PZ8A 4MGKE 2RS51 5FYUA 4E4HA 3OB8A 3ZYJB 4GALA 2NP0A 3JB8A 1SFNA 1WMXA 3BOPA 3WNPA 4GMP0 1TME2 5JR2A 1PNFA 1LKNA 5EIYB 3ZFGB 1ULOA 1JZ4A 3OYWA 3I2DA 3WP3A 3THTA 2XHNA 1VBB1 4N7IA 3PUQA 2LS6A 2WN2A 1BHGA 2JICA 3I7DA 4IV3A 4LJHA 1LAJA 4IV1A 4YNIA 2JKBA 3FFQA 1JODA 3FHIB 3HIFA 3KHBA 4RQPA 4AVSA 1EUTA 3ZIXA 1QXRA 1VPHA 1ULPA 1VBD2 1RHI3 3I3EA 2PAKA 5HBAA 4YW3A 3IKWA 2B39A 1OUSA 3UKNA 1IKQA 3WG3A 1V6OA 1M4WA 3B9CA 4H7MA 3CHXA 2VXJA 2WA3A 4DUWA 1K5MA 4Y1UA 3WLUA 2LALA 3T2QA 1FT9A 2VOWA 4FCAA 4BQ3A 2A6VA 3DECA 5K9YA 1ENQA 4GJZA 3WR0A 4Q4W3 3AKPA 3I59A 2KA3A 2OXBA 1J1LA 2P3KA 5C71A 2XJPA 2QVSB 5KXCA 3TBDA 3VBHA 1XB9A 5M0TA 1S0GA 1SLLA 2HLEA 2X5IC 4ASLA 2GN7A 5JPMB 2JG9C 1DIWA 3N9MA 5T50A 2QZ2A 5FP7A 2FDKA 2F4LA 2JDHA 1ND3B 4L2NA 1XYOA 5LWBA 1RHI2 1XPWA 5SV5A 4QX3A 3VB9A 1XE8A 4P9IA 1BVVA 1OQDA 2Z79A 2WQZC 3D5OA 4LPLA 4UOJA 5JAXA 5F5QA 4FSJA 1RXFA 2ZXQA 1JU3A 4KI5M 3AKQA 2ZGOA 3T0AA 3BTYA 2JDMA 4HVOA 1C3HA 2J1AA 3FX3A 2YGLA 2GP3A 4K40A 5FUIA 1O5UA 2JDNA 3M7AA 3W5MA 1FI2A 2WYSA 1YQ6A 5E1RA 5JUVA 2PAEA 5LATA 3CJIC 1GP5A 3DYPA 4LO5B 2YMZA 3OUHA 4XW3A 1CAWB 4ARXA 2PA7A 4CCOA 4BK5A 2W1QA 3KWVA 3T09A 2GC1A 4YZ3A 5FZ0A 1B35C 1UAIA 3WG2A 1NA1C 2WC2A 1NUKA 4PJYA 1ASJ2 3KMHA 1GP6A 3OPZA 1IPJA 2Y60A 2Q8EA 1V0AA 5C9AB 4MG2A 4YYOA 4AFDA 4KH9A 1KD7A 3ZFEA 1SDWA 1SQ4A 4MGYE 1N1YA 5DXDA 4XHBA 2R1DA 1QJX3 4LBQB 1U5ZA 3N7LA 2A6XA 3PTYA 4AFAA 5LK7B 4MOAA 1ZBE3 2ZCWA 1PO11 1W2TA 2WO3A 2ZMNA 1KQRA 3WD5A 1XE7A 4IEVA 4CCLA 1CZSA 1PGL2 2OS2A 2CGNA 1QJFA 3H9AA 4AVTA 3BYWA 1ACCA 3WT3A 1SBEA 1VALA 4GWMA 4BK4A 1G7YA 4Y26A 3SLIA 4AFBA 1UY4A 2VOVA 4PBPA 2ZABA 4AG4A 3GZUC 1JXNA 2ZA9A 3DXUA 4WM7B 5KXEA 3C7HA 1FAYA 5FUPA 2JECA 3BB6A 5F7UA 2HBUA 1COV3 1NE4A 2WO2A 5FYZA 5FZ1A 3UL2A 5B2GB 1VBD1 4IXLA 4INDA 1ZBE2 3WQ0A 3M3EA 4HOOA 4PT6A 3WQBA 4RR3C 4M3CA 2E7TA 1HXS2 4QDQA 1REFA 2FZ2A 2P4EA 2Z2SB 4EN8B 3H50A 4OULA 4XUPA 4CPBA 1N1VA 4M3CF 1TZOA 1O4YA 4NAMA 2IZWA 1TNRA 3RDIA 2WS93 4P14A 4UFMA 4E4SA 4AWDA 4LT5A 4E2QA 2R061 2D3SA 2E31A 3WW4A 4QPWA 1HDKA 4YFWA 2A71A 3HMYA 2PHXA 4TYSA 4UFJA 1OT5A 2VOXA 1MPXA 2JE7A 4M4PA 3U10A 2HWD3 3PUIA 5BPXA 2VMGA 2WNVA 2PXJA 3KV4A 3LQCA 2WNUA 1YWKA 3CKHA 3O1PA 4JGYB 5JXIA 1ENRA 1COV2 5HCBA 4DEVA 3NV4A 1CX1A 1WA6X 1H6XA 1RHI1 4XDOA 4JQTA 2EIDA 5KR7A 3KHCA 1SMVA 3N9QA 1TNFA 3G7DA 5FY1A 1GQPA 2JG8C 3TNPB 1AYM3 4BIFA 5APAA 3RVHA 5A7QA 4XF1A 4JHTA 4YZ4A 2YBPA 3BCWA 3HR9A 2BERA 1I6XA 1CAUA 3USSA 2WS92 4AL9A 1HQWA 5F1RA 5KHGA 3FMGA 3VBSB 3AYAA 1WW7A 2P5BA 3ZIWA 1KFXL 3M3QA 5C5UA 1XNAA 1JYXA 3POWA 4K7JA 3LDRA 4IDZA 4LA2A 1W6QA 3NNLA 3PNAA 4Q4W1 3ENRA 3LCPA 2EALA 3IT8A 4YGBA 5B4XA 4AEDC 5KHKA 2J22A 3ZFFB 3H8OA 5FYSA 5HPOA 5DZGA 4R4ZA 3RZZA 3CJXA 2HWD2 4XJUA 1VBE3 4O7XA 4Y1YA 3JQWA 2UWBA 3KSCA 4JKMA 5F5CA 4UYBA 3ZFGA 4LBMA 4M4RA 2VU9A 2XOMA 4KWUA 4FOVA 1HRV1 3OOXA 5AVAA 3ACHA 4EN7B 5I0RA 2VPVA 2ETEA 4XFIA 3J4UH 1AYM2 4LLFA 5GJ6A 3VUOA 1RUF2 2JIJA 3AVRA 4EWEA 1PMIA 4L9BA 5L7OB 3BTZA 4EE2A 1GMMA 3K4ZA 1H4GA 3C7OA 3SEEA 1J3RA 2RDRA 1S55A 3N9LA 1JZ8A 1LHUA 5CA6A 1W6NA 2WYFA 1TE1B 4LULA 1CONA 1XYPA 1JHJA 4QMAA 4BXFA 3KGLA 3Q8BA 5LBFA 1DGRN 2V72A 1QOSA 1ZYBA 3VBUA 3VZOA 5JIUA 2ZS6B 1KDKA 2PQQA 1RMU3 2VNOA 2VNGA 5IATA 1RYYA 1RVF3 2ERFA 5CFDA 3QBQA 3A4UA 1PGL1 3ON7A 1RIRA 1XOYA 3W21A 3POSA 1PMJX 2R1BA 4Q4X3 4YM1A 3VD5A 3APBA 5FIXA 5T3NA 1FATA 4AQ6A 1OD3A 3U11A 1O3SA 2C0ZA 3ST7A 1LULA 4QX0A 1XU2A 3W5NA 3WY6A 1WMFA 4L92A 4AI3A 2HWC3 1POQA 2A3WA 4XF3A 2OW4A 3N9OA 4P00B 1WUVA 3WF3A 3AL6A 4ASKA 2ATFA 1QJX1 4XPVA 3POBA 3ME2A 1AX0A 1SACA 1T6BX 1BK1A 1W6PB 2QQVA 2YU2A 2W87A 4B4RA 2HJIA 1ZBE1 3C8XA 3RWNA 2VTXA 4DQAA 5DAWA 2VMIA 3AP6A 5EV7A 2GP5A 1E57A 5C33A 4RL7A 1K5JA 5JIAA 2R30A 1RVF2 3BVCA 4Y5Z0 1UXXX 2D5FA 2QFEA 2RE9A 2SBAA 3AP7A 3VBRA 4BA6A 3W58A 5BYNA 3O12A 4Q4X2 3ZKUA 4JQRA 3A0KA 3AMQA 5BNOA 3TEYA 5CFCA 2VZOA 3ZYFA 2E6VA 3ZX7A 2OT7A 4Z82A 5LEKA 2JDKA 3ORJA 4QPYA 4DXRA 4Z2WA 3U4SA 2VQ0A 4FP3A 4CEYB 2WFF2 3SQOA 3LPFA 4JDMA 1W9FA 4JZRA 4LXLA 4A3XA 3MPPG 2FDJA 1COV1 5F3IA 4FO9A 4MV2A 3VZNA 5HCFA 1CAWA 4FPFA 4CP9B 1PGW2 2Z4FA 1LNSA 1KJLA 5L9VA 1OA4A 5HCAA 3WOGA 2BW8A 3B94A 4IW3A 1IGOA 4MUVA 2WS91 1FXZA 2HH9A 4LBOA 2Q8OA 1MQTC 4LKEA 5FO7B 4CP0A 2QQIA 2PTMA 3T0BA 4Q8LA 4KWKA 1RJ7A 2EXKA 2R041 2VZVA 5FXXA 5JLVA 4N53A 2X5IB 3MEPA 4HFSA 2IXIA 1D4VB 4XMIA 3WF2A 5SV8A 1O7FA 4WVMB 2OUJA 3O1OA 1W39A 1W99A 3PIJA 3DEMA 5FZOA 5CKNA 2HEWF 3MZHA 2G9FA 2RM21 3JD73 4QU2A 4LIUA 4JV4A 2WT0A 4PF1A 5KXBA 1GQGA 3TN91 5LRSA 2YGMA 2ZGMA 1H8VA 4B8EA 4LBQA 3W9AA 3LDKA 1OI6A 5GKAC 1RINA 1QXJA 1UKGA 2WN3A 4HONA 4NRMA 1APNA 1UX6A 3I2JA 2W08A 4AVVA 1X50A 2D6MA 5FK7A 3ZR5A 1RGSA 1SLCA 5CAZA 3K46A 2VCMA 1AHSA 4XVHA 5C70A 1Z0HA 3OUJA 1OXCA 3P1IA 1RXGA 1LOBA 4PLNA 4QQHA 3T08A 4EROA 1JZ7A 4XEZA 1GWMA 3QH6A 1R1ZA 2DVAA 1EV13 3FUOA 3CJIB 1O8SA 3N36A 5E16A 1FMD2 2FBEA 3ZFGC 5JSPA 4QXKA 3MYXA 2DUOA 5GLZA 3VZKA 5BNNC 1GNHA 1VBE1 2E63A 3NV1A 3HN3A 5T52A 1W9WA 1IPKA 3AKRA 5FY5A 1KITA 2FDGA 5EP9A 4Q0VA 3WDUA 4DS0A 1YJLA 2RDSA 2ID4A 3POFA 4QKDA 2ES3A 5KC6A 3HOBA 5C8CA 3HEIA 1B35B 2D6PA 2OPKA 4FOYA 2WR9A 5IK8A 1S1AA 3SCGA 4WM8A 5F3EA 4AOCA 2QE3A 2FDFA 4C8DA 3NL1A 3ZSLA 3NJYA 4K21A 1QXPA 3JXSA 1GLHA 3BUCA 2K0GA 1O4ZA 3OPWA 4H14A 2P17A 1UO9A 1Z7S3 3IZOA 3WW3A 1DGWA 2TUNA 4OMCA 2VZQA 3NJVA 4QKFA 3VZLA 2VH9A 1EV12 3WNKA 1AR63 2XL7A 4XTPA 1L3JA 2ZMLA 1ZRFA 3NRUA 1R64A 2XHKA 3GZEA 4MXWA 3N7JA 4YW7A 4CDUA 3FBMA 1DCSA 1QOTA 3UK9A 4IEXA 3IIIA 1KGYA 1REEA 1AXKA 1XQNA 2Z69A 1RMU1 1VAKA 5DG1A 4BB3A 2OUHA 2Z42A 1LHOA 1QJY3 3GCXA 5IUQA 1RVF1 5FPBA 2D7FA 5GLUA 5FY0A 1RUD3 1YYNA 3IMNA 1ND3C 4GA9A 3AX4A 1MS1A 1YO8A 3VKLA 1OPOA 5A6YA 5FLIA 1J83A 5K0UA 3BN6A 4H3WA 4CCMA 1XRUA 4UAPA 3H8XA 1Z7S2 4GQ7A 5A3UA 2QDNA 1YXWA 2HWC1 4PI0A 3FHQA 2RV9A 1UOJA 3PU8A 3QOPA 1QNYA 5C3PA 1AR62 1A8MA 4I02A 1QQP3 3IWZA 4TN7A 1QJZA 1O59A 1I1EA 1F8VA 2XBO3 3I8TA 1C4RA 1ZRDA 4IGOA 5F39A 3I3MA 1T2XA 2UY9A 1OMIA 4RA0A 4V1PA 4XFAA 1P8JA 3T0DA 3LIGA 1NLSA 1UPIA 2J1UA 2VZTA 1CAXB 4V2VA 5FZBA 5CU1A 4N43B 1YI9A 3RWKX 4Q27A 2YYOA 1ALYA 1H2KA 4GH4A 4XFBA 3CU7A 1V70A 1YHFA 4E4ZA 1RUOA 3U75A 1C8M2 2CGPA 1GQHA 2DFCA 4HKWA 4ITCA 1X9PA 3NMBA 4D3WA 4AAPA 1G86A 1V6NA 3QCWA 4KNCA 3WZ1A 1UL9A 5FKBA 5IFTA 4Y1VA 1GV9A 4X6RB 5C9AC 5FZ4A 2EICA 1DYPA 1VBA3 1QQP2 2GU9A 3NJXA 1S0EA 4GJYA 4LBLA 4NHLA 5JR7B 4CDQB 4JRLA 1NCRB 2XBO2 1PVC3 1UIJA 3LSDA 2QQMA 3K51A 5ERLA 1BK0A 1JS9A 3WP6A 1HW5A 3WQ7A 1AVBA 1OH3A 1FOD2 1PIV2 4J1WA 1QY4A 5ABJC 5A7WB 3CZJA 5CBLA 2YFUA 4IE0A 4UI9L 4LO8A 1QH7A 2P6CA 5FZAA 2WO7A 4AEDB 4Y20B 3TOJA 1DF0A 3ZN6B 2GALA 5FPAA 1YUDA 2B45X 1VBB3 1VBC2 3ETPA 5L9BA 5FXZA 5FK8A 5DABA 4NJ4A 4Z1VA 5JI7A 4XJZA 3RMXA 1GP4A 4CEWA 4Z2AA 1JUIA 1BYHA 4FAGA 4DINB 1VBA2 4FPLA 3JD71 2R32A 4WM7C 3QACA 1WZXA 4HKOA 1PVC2 5I0SA 3ABZA 5IVCA 2JE9A 4HN0A 3A22A 1WBFA 4ZONA 2MHFA 1TMF1 2CAVA 4BYYA 1RUG3 5A7SA 1WCDJ 5A6XA 2CY6A 4UW3A 2RS52 3H8RA 4ZKTB 5FYBA 5HV0A 1G9DA 3PU3A 2PHTA 2LROA 1DQ2A 2ADDA 1S0FA 5FO8B 4NPMA 1HKDA 5LBCA 3B3QE 2IXHA 2EXHA 3FJSA 3GYDA 1R081 3KT4A 5FQ0B 3SEPA 4TTGA 1EV11 2TBVA 4KU8A 2Y0IA 5EJ3A 2NLRA 4XUTA 1VBB2 1ZRRA 1UPSA 3ATGA 4RN5A 3VLBB 2GC2A 3AMPA 5BUVA 1N47A 4I0WB 3AZWA 1HLCA 3IDCB 4Q4V1 1ST8A 4ZU7A 3VD4A 2X10A 4HXCA 1HV0A 3OGRA 4CP2A 3GBWA 1H1MA 3NKTA 3KF5A 1E5SA 5GALA 4GB33 5T5JA 1G9AA 4JGYC 3T3YA 4RFRB 1RUG2 3ALQA 1HB3A 2CAUA 3LEGA 1VB2A 3F95A 4QHZA 4NIIA 1JMUB 4AQTA 2R7EB 5AC93 2XXZA 3MIBA 3M3IA 4WZFA 5IVEA 1HX6A 4TWTA 3BIEA 3N35A 2AENA 4N9HA 3KB5A 5DUXA 5FPUA 1Z7S1 2EAAA 3DYMA 4YW6A 4HK8A 5LK5A 3KD4A 3NJZA 4CCCA 3KCYA 3VBSC 1VIWB 1ZX5A 1O3QA 5JVVA 2Y6FA 4GD4A 3J7MA 1LOAA 2LRPA 1YEWA 2VTXJ 3ZFFC 2JG9A 1H1IA 5FY8A 4YGCA 3UKTA 1GYKA 4QPGB 1AR93 2PHWA 1QJY1 5CKQA 1MS8A 1MZ5A 1YQ8A 1D0GA 4GB32 1RUD1 1PMHX 1XNKA 4NROA 3EJKA 3SH3A 2BNOA 2JKXA 2XQXA 4NRQA 3AMMA 4Y22B 2PHRA 4QT6A 3J26N 3THDA 4NIAA 5AC92 3WW2A 4CCDA 3S57A 3I4IA 4TXWA 3MI8A 2VECA 2GNMA 3PJQA 4XQDA 3WDXA 1NT0A 2CU5A 5A3LA 5L7OC 3WEZA 4QB2A 3L9JT 2R0FA 3WUDA 4IE7A 1W6OB 3DKWA 5E8AA 4OHZA 4BJ0A 4ORFA 4UXAA 4NIDA 3CJIA 2QTWB 2XBO1 1SPPA 2BVVA 3B5LB 4EN9B 1IHMA 3JQXA 3K3OA 3U37A 5IVFA 3VKNA 4MH0E 1AXYA 1AR92 2WLPA 1QDOA 2VO5A 1GFF2 4N8MA 4PHZA 2ZPXA 3USUA 2OX0A 1VP6A 1MS3A 1MQTB 1OLQA 5I93A 4E8DA 1B35A 2AH2A 1NA1A 4Y5SA 1DQ0A 5A80A 1KXGA 3NV2A 1GANA 4AEMA 3ILRA 4COUA 2G9GA 4OZOA 2A3XA 1URXA 5A33B 2UU8A 4I01A 5C8WA 1CAVB 2XVGA 4DUVA 2JE8A 4AFCA 2RDQA 4IE6A 4U2AA 1IPSA 3BU7A 4RSUA 3RZKA 1VBA1 5FMDA 1VAVA 2WINB 3MV01 1H30A 3E5UA 5E88A 5H9SA 3WG4A 2XUMA 3O1SA 3O1VA 4FPKA 5EQUA 4ZZ8A 1BBT3 4YW1A 5JOWA 4HK9A 4URAA 4XUOA 4AEJA 3T2TA 3POEA 4YWAA 3WINE 1H2MA 1DFQA 1YFYA 1PO12 2JDUA 1UYYA 1W3XA 3E97A 2HWF3 3DL3A 1F2NA 3HNBM 4LHSA 2RS33 4JX0A 2PFWA 3T4HB 1YQ2A 1A3KA 2DF7A 2HYKA 2XWBB 3LD8A 2I2SA 4K9SA 4XZUG 3ZYIB 4HMZA 4ZS2A 2VZ1A 4BOWA 1H6YA 4XF9A 5C4WC 3O0VA 4OUEA 1FPN3 1XSRA 2R063 1D2QA 3RI8A 5BNNB 4WVWA 2CSGA 2D5HA 5KC5A 4AGRA 3OD0A 4HSLA 3I2HA 3VGIA 3I54A 2FMDA 2DUPA 5IHRA 1QKQA 2LTNA 3VBFB 4AR2A 2QZ3A 2VOTA 2IFWA 2JDAA 3GDBA 3RYPA 2E51A 4LIVA 3POJA 4CEYC 4UW5A 2XGXA 3PUHA 4YG3A 1Q8QA 1QHDA 3NWKA 3PIGA 1H8TC 1RUG1 4RR3A 4BQ4A 2NZ9A 2VQAA 1LU1A 5LY1A 4DRRA 2PLV3 5EFUA 2RS32 2WZR3 2ZX2A 4A7KA 2Q8DA 4B4PA 3LZZA 5L9RA 4A42A 5JXGA 4CDXB 3U78A 1YIPA 2DBNA 2CWSA 3LE0A 1FPN2 2EXIA 3VDDB 2R062 4HPKA 4QDSA 3MLLA 1W8UA 2RMU3 4S2GA 4ZHNA 1JYNA 1J3PA 4EJRA 2BWCA 2H6BA 1UYPA 3DCQA 2DVBA 1BCXA 4B7KA 3SXWA 3ZXFA 4U36A 2NPIA 1SLTA 3CLPA 3TEZA 3IAQA 4GB31 2D93A 3RMYA 1XBFA 2DCKA 1HRV3 4Z07A 5GLTA 2JG8A 1QMJA 2O14A 4CSWA 5H9RA 1ZNPA 5FCCA 4Q5OA 2DU1A 1KS5A 2PLV2 4AAXA 5AC91 2WZR2 4PDWB 1OOPB 1EAH3 4R9AA 3A21A 4DPNA 3GXUA 2A1XA 5DG2A 1XXNA 3VBOB 5FZEA 1OVSA 4YVWB 1LGNA 1OSGA 2VMCA 1OUXA 3I3BA 3MDPA 3GBGA 3SMHA 2R16A 4AK3A 1JBCA 2F17A 4AEDA 3K48A 2K2SA 4YGEA 1Y7BA 2RMU2 4Q4W2 3ZN6A 1F35A 4IUGA 2ZGSA 2CV6A 5CZKA 3K4DA 2GC0A 2C24A 4UT5A 2QKDA 4YARA 4FVVA 2JXAA 1AR91 1W8TA 2BOIA 2HKXA 2JDPA 3ZMOA 4FPGA 1YQ5A 4JKKA 5K4LA 1DGWX 5LBEA 3PMEA 5KHHA 1HRV2 5FZKA 4D7YA 4OHVA 3RRDA 5DAXA 4IEWA 4XBQA 3MW4A 3EYPA 4QB1A 5A70A 1EAH2 3RI9A 1NQJA 3IDEA 3Q8EA 2EVXA 4LBNA 5K8SA 2W52A 1NXMA 3LSEA 1T6GC 3IDAA 2W1UA 2VVEA 4LOSA 4JTNA 2MEV3 3J7LA 2VMHA 4YLZA 4YW4A 3ZN5A 2YUEA 4QQLA 1KRIA 1B09A 4YVSB 4K3UA 4LA3A 1UNBA 4QWNA 2VAUA 2NYYA 3HJRA 1H1AA 4ZZ5A 1O5LA 1H2LA 3KV5A 4GWIA 2X8KA 1E5HA 3JUUA 5ABJB 4M01A 1AR83 4I0AA 5L36A 4KG0A 2A73B 1O3TA 1XJAA 3D6EA 1UOBA 2I45A 4QXBA 2DCJA 4Z8BA 4DB5A 4XIOA 5T5OA 3N4MA 3ZDVA 2D97A 3V0BB 3HT2A 1J3QA 1ZZ7A 2DUQA 4D7TA 1YFUA 3LEKA 1VMHA 3WNXA 4UF0A 1LB2A 3AK0A 1R1A3 3M2MA 2W46A 5DAVA 3JBG1 4ATEA 3OGJA 4UFKA 3P6BA 4HT1T 4W4ZA 3HWJA 4MGQA 4TLFA 1QJX2 1BBT1 1IOAA 4QPIC 5FY4A 4XACA 2IXLA 2WZPP 5FKCA 4FXKB 4QGLA 5C7GA 3OG2A 2JX9A 2HWF1 2ZX4A 1PVXA 2Q0AA 2RS31 4R9CA 3WQ1A 1PGSA 3B69A 3ZYHA 4DY5A 1UQXA 2DCYA 2EAKA 3MGUA 1FV2A 4J25A 4E9KA 1LEDA 4EWAA 4N43C 5J7MA 1FPN1 2JDYA 2R043 3GHMA 1CIYA 4ONUA 2ZZQA 3K2OA 2ZEXA 3HQRA 3VD7A 5FPXA 4NHKA 3H0OA 3LFIA 2L9LA 5F8PA 3ZPYA 3S0MA 2ZX1A 1F31A 2BV4A 3NNJA 5FO9B 2P3YA 4IE4A 3O1RA 1QJU3 2RM23 3BIWE 4XXPA 3TN93 4E8CA 2ARAA 3WUCA 4CDQC 2D44A 5EZWA 4PQ9A 1NCRC 1ULCA 2IVIB 3AL5A 4LTAA 2PLV1 1YIFA 2WZR1 1H9PA 5A1LA 1LESA 4QX7A 1GOHA 3J7HA 4RS5B 3UT0A 3E6BA 3CDZB 3OY8A 4FPHA 4E27A 1MQTA 4H55A 2E9QA 1BJQA 4Y4YA 3WF1A 1ZRCA 4DZGA 5D8AB 3TB0A 5BNPA 2AC1A 1TEIA 3NKGA 4FTSA 2R042 1RUJ3 2RMU1 2IXCA 2ZGKA 3ZXJA 3LWCA 4W6XA 2HWB3 4IQPA 2ZGTA 3LPGA 2GC3A 1SEFA 1UIKA 4AW7A 1QJU2 1SHWB 3VL9A 1UXZA 2RM22 2XLFA 2ZAAA 3AZXA 3TN92 2OQ7A 3MIFA 4OZXA 4LO6B 4XFCA 2R6QA 1Y9MA 5JI9A 1OA3A 1V6IA 3SITA 1W0PA 2VC9A 3ZPOA 2WBKA 4QDRA 3N9PA 1EAH1 4IEQA 3WDTA 4XXAA 1W0OA 3WHUA 4META 4N90A 1HJGA 4XJWA 1OKOA 2W47A 2VJXA 4Q1PA 4QB6A 1DZRA 1HQNA 3ELNA 4LQRA 4RGGA 3AC0A 5IJRA 2I07B 3CF6E 4WVVA 4XCBA 1EP0A 1JOBA 1S0BA 3ROUA 3P3NA 1LOFC 4FXGB 4PF5A 2O8OA 3FWEA 4XFFA 5A32B 5BXXA 5BNNA 5HCHA 2HWB2 5EYXA 5KXDA 3IAPA 4JDOA 1JH5A 4P9WA 3BTXA 1VBE2 1QWRA 1JW6A 5L73A 5DZFA 1D7PM 1W2OA 2B42B 4RHV3 4A41A 1FX5A 3HPNA 1DZQA 2Z5WA 4Q4X1 4TZDA 1M06G 2NN8A 3R4UA 1YNAA 5FZDA 4B4QA 4CUCA 4OMDA 3H1YA 2WRAA 5JZGB 2E7AA 5IYYA 2JB4A 4OHXA 4DNYA 2FCTA 1UCXA 4ISQA 4AHXA 2MEV1 2YDEA 4PI2A 3DF0A 5FZHA 2BUKA 2DCZA 4B29A 3AYEA 1DLLA 4D8MA 4J1XA 2JDZA 4XILA 5FRAA 1Q5OA 2W0XA 2C5DA 2BJSA 2GAUA 3WV6A 1NY71 5LA2A 4JGZB 4QQ2A 5JPNB 1AR71 1AR81 4XJAA 3D0JA 5H9QA 1RMU2 1S0IA 1G8WA 4COVA 2WIIB 2BGPA 5AFBA 3J7NA 3AM2A 4MHRA 4Q29A 4QPGC 2HWE3 4O9EA 1ND3A 5C4WB 4CXYA 2YV8A 2H0BA 1GU3A 5GM0A 2VQTA 2WAOA 3AJZA 2GNTA 1IQAA 3SKJE 2VCBA 3MV11 1VRH1 1KEXA 2GH8A 3UJQA 4Z92B 2ZEYA 4AEKA 1R1A1 4AYUA 3JZVA 4IEOA 4B3NA 3U4XA 1NOVA 1O4TA 4M0NA 2HWC2 1W9SA 1WCKA 1A34A 1LOCA 5FZ6A 1H8TB 4ZS3A 1W03A 5A3TA 3OUIA 2H0VA 2BTVC 2QQKA 4KWLA 3VD3A 3BALA 2FQPA 3MW2A 1AL0G 1X33A 3H3ZA 4BM8A 4URTA 3U1XA 1OVPA 1Y9QA 2JD4A 2Y6HA 5DUUA 1GOGA 5FZMA 3VHRA 5F9TA 2ARXA 1NCQB 2FCUA 3NNMA 4FPOB 2YC2A 3WNNA 1W2AX 4YRDA 4BQ5A 2QQOA 4NOTA 3GNEA 4XF4A 4DO0A 1WCUA 3CBNA 4FOQA 4BXSV 2VW1A 1I3HA 3CZUA 4Y24A 1GWKA 5C9AA 3MF6A 2ZTNA 3OGGA 1CJPA 3K4AA 1Y9GA 4HANA 5J1XA 1F9KA 1MVEA 2A75A 4OHWA 5FMOL 3RGBA 4OI0A 3V0AB 1QJU1 4YW5A 4A4AA 1W2NA 3PTRB 4R4XA 1X9TA 1DDLA 3FL7A 4AZZA 2PN5A 4FBFA 2J1RA 3NNFA 4NAOA 1JZ3A 3ZXDA 5A7NA 3R4DB 2Y64A 1TMF3 4Y5TA 3WXPA 5F2WA 4MSVA 2VCAA 4L8QA 5LA1A 1G9CA 4B7EA 1AX1A 5CYYA 2GN3A 5D21A 2ZX3A 3WCRA 4WV8A 4CCEA 3UYJA 4QXCA 5FP9A 1L7QA 2D98A 4EQVA 2IWGB 1TG7A 3A23A 3D4KA 3E1F1 3GM8A 1DZTA 4DEQA 4AFMA 2XMLA 2WABA 1R083 3AJYA 1Q3EA 1RUJ1 3PVBB 4C1XA 2J1SA 4CDWB 5FZFA 2WSVA 2HWB1 4FTEA 1V9U1 3AXEA 2XUEA 5CB7A 1POV3 2WDBA 4Q4V3 4BLIA 3RYKA 4WM7A 4IGPA 5E89A 1DQ5A 1S0DA 3S30A 1W06A 3JD72 4QKNA 5C3RA 3VBFC 3VZJA 4PIXA 5GZEA 1WA4A 3IBMA 3MLKA 3AVSA 3WG1A 3GF6A 1ZZCA 3ZXEA 1PK6B 1TMF2 1LOGA 2G9ZA 4CU6A 3GHNA 4G3YC 1QNWA 4LEJA 5DUWA 2LUWA 2C26A 3KZ4C 3RQ0A 3ES4A 4LHKA 2BFUL 5LY2A 1IS6A 4GKXA 2J42A 4MX3A 4LE4A 1JOJA 1YI7A 1NXD1 4CDXC 1ND2C 3LOIA 1R082 5FMBA 3AKSA 2B46X 4PQQA 3ZYGA 5FR3A 2AYHA 3G6JB 3ZKYA 1QOOA 3ZSEA 2WA4A 3VDDC 1RUNA 4NR1A 1ONAA 5FYCA 5I8YA 2P34A 4LLOA 1UMHA 4D69A 1CR7A 4Q4V2 1JZ6A 5JCTA 1U5XA 1YC61 4HETA 4AQ2A 4RHV1 4COZA 3OEAA 4QD2A 2P3IA 5FDBA 1VJ2A 3DPRB 5A1AA 4JGYA 3RZMA 5C5TA 1MVQA 2DVDA 2TNFA 4J6GA 2Y33A 1C57A 3M70A 3RSJA 4NRPA 1WCSA 2V4VA 4LBQD 5CIRA 4UW6A 2EIGA 4YG6A 1UMZA 3E6CC 4PDWC 3E6DA 1OOPC 3ZXAC 2BYVE 2ORZA 2R0HA 3VBOC 3VBSA 4H2AA 4DXZA 5LCWL 4YVWC 3RZLA 3NVCA 1CWPA 4QPIB 5FOJB 1MEC3 2VUCA 4LK6A 3HNMA 2XDVA 3ZFFA 1LR5A 5B4NA 3ZO0B 4EZ4A 1QJEA 4IL7A 1RITA 1VRBA 1BXHA 2PQSA 3PVNA 2X05A 1V6MA 3LAGA 1SCRA 4XDPA 3SH5A 3ZDSA 2P3JA 1OLRA 1LTEA 1QJY2 3OYWB 4LO7A 1WW5A 4L0PA 1UU6A 3OBTA 2HWE1 4X8NA 4XBLA 1K3IA 1RUD2 3SKVA 1NLQA 4CU9A 2WT2A 4N9IA 3NNGA 5J48A 2WAAA 1V6LA 2BP6A 3H42B 4QX5A 4AI2A 4ES9A 4W6YA 4IV1B 2ZZJA 4RQPB 5L7OA 4S2FA 3IB3A 4MGIE 4A2UA 1ULDA 3K75B 1XNCA 5L19A 3BKZA 1JYTA 1G9BA 1OF3A 2JB8A 2XPJA 4YVSC 4I3GA 3ES1A 4DFSA 2WFPA 1SDDB 3PUSA 5DPNA 2F4PA 2W1SA 1K5MB 4AVBA 4D94A 3RJRA 1V6JA 5DAPA 5FZ3A 4CUBA 2ZACA 2XJUA 4FPEA 3I59B 2BBVA 4BU2A 1AJOA 1OH4A 2W5FA 3AZZA 5FZ9A 2WZEA 4LMFA 1LJ7A 3VBHB 3ZVXA 5DMYA 4AF9A 3W20A 1BQPA 4BQXA 5DN2A 5FJHA 3H3LA 2NMOA 3QD6A 1GKBA 2E53A 2GNDA 2VGDA 3I2FA 2VZRA 3ILFA 1D0HA 4PIZA 2ZKNA 2GMMA 3LOBA 2F6BA 3O1TA 4E2SA 4EWDA 3ECQA 3WCSA 3ZLIA 3ZSKA 2ARCA 4F8AA 2RJ2A 1J84A 1Q8PA 3KT7A 1L7LA 1W6PA 4Q0UA 2YC0A 1ZZBA 5CKMA 1OHFA 4KGQA 2D6NA 3ILNA 3NV3A 4MGSA 5A3OA 1XE0A 3B93A 4Y1XA 2Y8KA 1OLMA 5LRRA 4P9GA 1AZDA 2A6WA 4DY3A 3O1UA 5A7OA 2SLIA 5C4WA 2WZ8A 4NO4A 3I3QA 1UOGA 5FJKA 5BNQA 2J1VA 4OQ8A 2VZUA 4KL1A 5D1IA 2YC4A 2W95A 1S2KA 4YM0A 3SH4A 1R091 2Y6KA 1S2EA 1NKGA 2Y0OA 2H6CA 1W90A 5G05L 5ISLA 3VV1A 1POV1 2OQ6A 3KF3A 2UWAA 2ZHLA 4DMIA 5FAXA 4CEYA 4I0BA 1FYUA 4UFLA 3N3HA 4LUKA 1SLIA 4XJ9A 1H8TA 2VNRA 2XKOA 3AZVA 4C1WA 1XNTA 2XB6C 4Q8KA 5IVVA 5J3UA 5JOYA 1W04A 3AFKA 3HBZA 2JJ6A 5FMCA 2RG4A 4LBJA 3PMSA 1W8OA 2WUHA 4CP9A 5ACA3 2ZHNA 3MIHA 5FXWA 1ZZ8A 3ITQA 4AE2A 1VE0A 2CDPA 4W50A 1LHNA 1Y43B 4RS5C 1CGPA 1Y3TA 1N1TA 1GICA 1MS9A 3UV9A 1WD4A 2VTFA 1X8EA 3OGSA 5D8AC 2XLGA 1FV3A 1AXZA 2AEYA 2CL2A 2XJSA 2DTWA 2X5IA 1HN0A 3IIAA 1LU2A 4C91A 4WVMA 1C28A 1HRI1 1PHMA 1WD3A 3POGA 2IXKA 5FYTA 1JN2P 2JENA 1XSQA 3WF4A 2B9UA 3LEIA 1AJKA 1N3PA 3S5AA 4LR4A 3U0ZA 1PM4A 1UU5A 3FLRA 3QLQA 1UWWA 4I3PA 2KR2A 2IVJA 1SZBA 4NHMA 2PMWB 2BGCA 4V2WA 2MPFA 4EZHA 5T5LA 4EV0A 5BV6A 1RUC3 4OLLA 1W9TA 2VZ3A 4YW2A 2FDHA 1F15A 2NQYA 4I09A 2E33A 4YM2A 2ZGLA 2B8MA 3K3NA 2JIGA 4HG6B 2JEMA 3PUAA 3I3DA 4M3CB 3S7EA 3K77A 1MEC1 3DV8A 4IE5A 5FZIA 3KM5A 1D2SA 1K45A 4XJ8A 2JWPA 5FMOS 1A78A 1RJ8A 1ZBA3 2A7AA 3PLQA 4CA9A 2VMFA 1JI6A 4JAAA 4XHXA 3FN9A 2DCTA 1H9WA 1ZA4A 2E32A 3O0XA 4LHNA 3LA3A 5FREA 5I0UA 4IEYA 2W3JA 5IAXA 1CQ9A 1GR3A 1XU1A 3WDYA 4O65A 1A6CA 1W05A 4XBNA 2WNVB 2Y6GA 1UN1A 2WNUB 1US2A 1GZCA 2A3YA 2VBDA 4FOWA 4QAWA 5FY9A 2DVFA 3AP9A 5JSRA 3CMGA 1LOEA 2GNBA 5EJ1B 1BLZA 5JZGC 1AYN3 1LECA 4BQWA 3AKTA 1U5YA 3D0SA 3KCXA 3JBG3 3KCCA 2DV9A 1CPMA 1F4AA 5A6QA 2DDUA 1EY2A 4XABA 4BMBA 3RZJA 2CTVA 3WHTA 5K7PA 3O7OA 3GJBA 1ZBA2 2WSUA 1CAUB 1EYBA 2Y6LA 3VN4A 3WF0A 1KDMA 3S6PA 4D6SA 4D7SA 4JGZC 2LM3A 4DOUA 2BPA2 1TME3 2NMNA 4CTEA 2EIBA 4A7YA 4CUGA 5IT6A 5JMCA 5CG9A 3WVJA 1RL3A 1BEV3 4B1MA 5FP3A 1CJDA 4QKBA 5ANQA 5T54A 4UWDA 1DQ1A 1JTZX 1X82A 5LBBA 1I9RA 3OGVA 4UFHA 2ZX0A 1CVNA 1VMJA 2BFUS 2BQPA 3OTFA 5T5PA 4AVCA 1IS3A 3NAPC 1PX4A 4CXXA 4SLIA 5KHJA 1AYN2 2P2KA 3H8UA 3OJBA 2UWCA 3JBG2 3RYRA 1JU4A 1GWLA 1WCQA 4QPIA 3ZN4A 4K8RB 1BBT2 4FPYA 5LB6A 4FPCA 4HN1A 5HXVA 4MLOA 4HVQA 2XVKA 3IMMA 1VLNA 2HWF2 1UF2C 1MS5A 1JUHA 1CAXA 2OVUA 1BEV2 3AB0A 1W6NB 4N43A 1ND2B 2QDRA 5EPAA 1SLBA 2ZOEB 3E5QA 1L7RA 2OIIA 2ZGNA 4IEPA 5FZ8A 4AI0A 5FYIA 1NCQC 3VBUB 1WKYA 2P37A 2VL4A 4HZFA 3R4SA 4FFFA 2X09A 4XQWA 2OZ6A 1SG3A 5FUNA 3GGLA 1DGRA 4YZ2A 2XR4A 1MS0A 2V73A 5C3SA 5CFDB 4GKYA 4F3JA 4MO3M 2VXRA 5FZ7A 2ORXA 2W91A 1C5IA 3NSTA 4CDQA 1NCRA 1UY0A 2PHLA 2W92A 1X7NA 4XDQA 5IVYA 1QH6A 3VDAA 4A6SA 3FUQA 3MFAA 1E5RA 4KBZA 3GBFA 5ACA1 5DDJ1 2WO1A 3HNYM 4A44A 1PM7A 3MUZ1 3LIHA 2V4AA 4MGZE 5A7WA 1QDCA 1OURA 1V00A 2BWAA 3OCPA 3B01A 4LE3A 4W8JA 3M3CA 4I2OA 4IESA 3ZMNA 2YB7A 1UZWA 4IGQA 2R071 2UYAA 2AZ5A 3EB7A 4JVAA 4NE9A 4Y20A 1O91A 5A3WA 4COWA 4IEUA 3T2OA 1RUE3 1ENSA 3OD4A 4C90A 4ZY9A 5GLVA 4CDWC 4P9XA 2D3RA 3FC0A 4UBGA 1STMA 2AEZA 5FYYA 3VBRB 4E2GA 3S7IA 3DUIA 1IKPA 2ILMA 2Q1FA 1UZZA 3KT1A 4LKSA 3RJ2X 5BNOB 3AMHA 5CFCB 3CEWA 1ASJ3 3PJYA 3TEXA 2VVDA 2PYTA 5EJZB 2Q8CA 3WP5A 3ZR6A 1N3QA 1PK6C 1AL23 3R0RA 4XFGA 5F3GA 1SFPA 1GNZA 1RUC1 1BVP1 3VL8A 2XL9A 2BDRA 4ATFA 2G4IA 2RR13 3RS6A
chains in the Genus database with same CATH topology
3MW3A 5KHIA 2QJVA 1LOFA 3J8F3 4PIYA 5FQ0A 1GBGA 3FE5A 3CO2A 1JHNA 5JDBA 1RUE2 2ZJCA 4Y1ZA 4JRAA 3H3UA 2C9AA 1ZBA1 1IS4A 4X6QB 2D6OX 1AR73 3AYCA 3SNMA 1F5JA 2O0OA 2WWSA 1WLDA 1OQ1A 1RC6A 3TAYA 3THPA 2WKKA 4N53B 5JSOA 1C5HA 3DPRC 2A6YA 1D4M1 1TQ5A 4FQ4A 4AI8A 1UKRA 1AL22 4XTMA 3VZMA 4I30A 3P3PA 2GDFA 1ZREA 4GMP3 4COYA 1VRH3 3X29B 4F83A 4R52A 3WP4A 2RR12 1AYN1 3FZ3A 3GZTB 2MEV2 2ZBJA 3J8F2 2VW0A 1N3OA 1HV1A 4HL0A 1HXS3 3ZYPA 3LGRA 1NY72 2DYCA 2IFRA 2C1FA 2TEPA 1AR72 4TSVA 1AR82 4Q0QA 1TME1 4QGNA 4QPGA 4BPZA 2ENRA 1J58A 4BHPA 1BEV1 3LA7A 2XJQA 1O3RA 3ZXGA 4BQ1A 3MIDA 4Y22A 4YZ1A 1ZM1A 2OYZA 1BMV2 1I5ZA 2PAMA 1VRH2 3IM0A 1VR3A 4IV3C 4IV1C 3EO6A 1R1A2 4RQPC 5C8CB 5J36A 4WVZA 4FT8A 1ZZ6A 4WM8B 2B7YA 1W6OA 4BWOA 5J09A 2WLQA 1C1FA 1DQ6A 1REDA 1LEMA 3NO8A 3ASIA 5FLHA 2D6LX 4M0HA 4XIKA 4AGVA 5IK7A 1K5MC 2VVFA 4Q0SA 3B00A 1KFUL 4BH9A 1DGLA 4MXWB 3WW1A 2HEVF 3SCFA 4CDUB 1WGPA 2RJKA 3VBHC 3POYA 3VHOA 4CRQA 5A33A 4QM9A 2FMYA 1MZ6A 1CAVA 5JOXA 2PELA 4QM8A 1V9U3 1Q8OA 4R9BA 4S2DA 5JOZA 4XE9A 1JYCA 4W65A 4K1YA 1SFYA 1RUF3 3TNQA 5K0UB 1GZ9A 5KWRA 1LCLA 4HLTA 1U0AA 2BEOA 2ZHKA 4ASMB 1S0CA 2RHPA 5EWSA 1WW6A 3IPVB 1H0BA 4XFHA 1Q8VA 1HQLA 3EXUA 4NN0A 3ACLA 1RUJ2 1NYWA 2VW2A 3KGZA 5I91A 1LGBA 1RUE1 1ZZ9A 2D3PA 2CYFA 3GZAA 2Q5TA 1V9U2 3M1HA 3VBFA 1UU4A 2Y26A 4GH4B 5HI0A 1ASJ1 4PLOA 3WX5A 4AQSA 1MS4A 1MACA 3UKVA 4AI1A 2YXSA 4M3CE 3N7MA 4NWVA 1DG6A 1AL21 2UURA 2V5YA 1C8NA 3HT1A 1GZWB 3HD8B 4GULA 5T55A 1CD3G 2X53S 3PHMA 1POV0 4HKLA 4QQPA 3ZFEC 4YSFA 4CDXA 1ND2A 2RR11 4XMAA 1ENXA 3WDWA 1C1LA 1G6NA 3J8F1 3URFA 5J96B 2AGSA 3B9IA 4PCRA 3VDDA 3U07A 3B02A 3C2UA 4RFT0 3AXDA 2GZWA 3UJOA 4MZUA 5H9PA 3KQRA 1LGCA 1RUI3 3MLJA 4RHV2 3T1LA 3IDBB 2AREA 2XKPA 2XH6A 5DUVA 5AVPA 1OFNA 3MIEA 4ZU5A 4YG0A 3R6SA 3V64A 4YZ5A 2UY8A 2K9ZA 1F5FA 4IEZA 2ZGQA 4CEWB 2VG9A 4C0BA 1EPZA 3NAPB 5BY5A 1BMV1 1W2UA 3PVOA 1UZYA 2PHFA 4GMP1 4PDWA 1OOPA 2WFF3 4G9SB 4FTBA 4K20A 2GSYA 3VBOA 1SCSA 4OHYA 4YVWA 3MICA 1DHKB 2GH2A 1CESA 2QNKA 3C3VA 4OI2A 1WLCA 1W6MB 3BODA 4M00A 1DBNA 1HXS1 1S0JA 2ET7A 1ZVFA 5DZEA 3IN9A 4FAHA 1RUI2 3GALA 3EBRA 5FPZA 4A7ZA 1MZFA 2HWE2 1DU3D 1XYNA 4KGGA 1U5IA 1WMEA 2AR6A 2ZGUA 4YFZA 4H7LA 2D6KA 2WNVC 2CGOA 3LA2A 4BIOA 2WNUC 4R8HA 5GZDA 3FLTA 4ZXKA 5TSWA 2QQPA 4HBNA 2WQ4A 3H7YA 2ZHMA 1QGLA 1WW4A 4K1ZA 4YVSA 2DURA 3MPBA 4RGAA 4P9LA 1H2NA 2KXLA 4UBHA 2VUJA 4GXLA 4HSJA 2ZAHA 2IC1A 4KU7A 5ABJA 1LENA 1FNZA 5BNPC 1KJRA 1CPNA 2NM1A 1FMD3 4BMEA 4OI4A 1YFWA 2HWD1 2JG9B 3V0BA 1NE6A 1R093 1YRZA 4IERA 4GWNA 3LKJA 1CIWA 2Q1ZB 3ZYRA 4F7ZA 5CG8A 4LBKA 3AFGA 1BZWA 4R9DA 1AYM1 4W6WA 1RUF1 2OA2A 5EYYA 3D82A 3HN1A 2EA7A 4XETA 2XJVA 4Q26A 3MF9A 1EPWA 4XQ4A 5GZCA 4Q4Y3 2V09A 1Z78A 2YZ4A 3B7MA 1R092 1OPMA 3VBUC 3USUB 5I8SA 4BCUA 2YHJA 1XNBA 1NA1B 1HRI3 4CZSA 5CFDC 4O9GA 2GMPA 4DRVA 1CN1A 5IK5A 3J9SA 5FBZA 3SISA 1X8MA 2O1QA 5GLWA 3CNAA 1WMDA 2FZ1A 2ET1A 1QF3A 3EQEA 1DYKA 1YJKA 1RTVA 4JCKA 4AHWA 4WZCA 1AF9A 2I74A 5LEJA 4RS5A 5IK4A 5GZFA 4Q4Y2 4C0HA 2BVBA 3V65A 1UW8A 4KWJA 5D8AA 1Q8SA 1FNYA 4NWWA 1H4HA 2MNGA 4LHLA 4P9YA 4RD7A 2Q1MA 3QH7A 1KS4A 1NZCA 3Q9OA 2VULA 1HRI2 1RUI1 3PVEA 3T1MA 1QU0A 1WBLA 1HIXA 2XVLA 2B5HA 4K6BA 4Q4X1 1A8DA 3VBRC 1C8M3 2WL1A 2OZJA 2O8QA 5BNOC 5CFCC 5GZGA 1RUH3 4MYEA 2XJRA 4IV3B 1NG0A 1LHWA 4QGMA 3M4FA 5CVRA 2WFF1 3IPVA 3AMNA 4OUMA 2QUOA 3VHNA 3OF1A 5C6CA 2RS13 2ZGRA 4RR3B 4AHYA 4OUSA 1YLLA 2A5ZA 4P9JA 1ULFA 1PGW1 1MEC2 4OVEA 5A32A 1LODA 2YPJA 4XZPA 3WDVA 4ES8A 5FFOC 1FOD3 1PIV3 3H7JA 2CNAA 4L97A 4BLJA 2HEYF 2ARBA 4WBBA 1X36A 2ZKLA 2PHDA 4HPKB 2XWJB 2GMEA 5F6LB 5I0TA 1RUH2 1VBC3 1LRHA 3FLPA 4IETA 4N53C 2ZMKA 1PO23 1XNDA 2VUAA 3JCIA 3VKOA 1GZWA 2QCSB 5JZGA 2IXJA 4Q2FA 3VHPA 4NPRA 3V56A 2RS12 1PZ9A 1J1TA 1S2BA 2AUYA 2JG8B 3INAA 4JC1A 2BNNA 4OI1A 1YCIA 2XJTA 5I8TA 2RS53 4P5HA 2A6ZA 3AP4A 3RG0A 3H1MA 4JGZA 1WLTA 4FP2A 2FHRA 3RPQA 2PHUA 4AHZA 1FMD1 2DVGA 4QQOA 3RNSA 4BE3A 3AZYA 3EHKA 3O0WA 1PO22 4ISRA 4PLMA 3ZXLA 2W39A 3ZSMA 2YY1A 1OD5A 3NAPA 2W68A 3AYDA 1ULEA 3LB9A 4KQ7A 3TYJA 3TWIA 2X29A 4LUMA 5C8CC 2VOKA 2WJSA 2DWRA 1W6MA 4WM8C 3VKMA 4AVAA 4EN6B 5AFEA 4L99A 2YROA 3CL1A 3KLSA 2EF6A 3MFCA 4XYXA 4S2HA 1WLWA 5DDJ3 3ZFEB 2KM2A 1IZ3A 1SLAA 1OA2A 1OKQA 4Q4Y1 3HQXA 3MIGA 3ZXKA 1NCQA 1VAMA 1AX2A 4ZU4A 1UD1A 4AXOA 2Q4SA 2R073 4CDUC 1IS5A 1CX4A 3HAGA 5EXOA 3SCHA 3R05A 4KBBA 2Q30A 5FOBB 5F6KA 1N1SA 3V0AA 1YFXA 3DN7A 5J98B 5KBFA 1PZ7A 1SBFA 3W59A 3BPZA 5K0UC 1ULGA 3H1WA 5ACA2 3FFZA 3DGTA 5DDJ2 3NW4A 1MR5A 1V6KA 4PBOA 1G9FA 3L2YA 1AR61 5CNAA 2DU0A 4MVTA 3KS7A 2E7QA 3AP5A 1NQDA 2WNEA 3L2HA 2XG3A 1RB8G 2R072 4SBVA 3VKFC 2DFBA 1MZEA 4HVRA 4KG8A 1SBDA 2CWMA 4CDWA 1J59A 2WT1A 1JYIA 3D8CA 4XOGA 4YGDA 1OQEA 4NVPA 4OFGA 4XF0A 4N7UA 4G4FA 2ZGPA 3M3OA 4E4DX 4YM3A 4CYDA 5J37A 4UW4A 3ZSJA 3JB4C 1C8M1 1PNGA 2Y38A 4GH4C 3M8LA 1Q43A 2UYBA 1AUYA 4K8FA 4FPJA 1PK6A 1OFSA 1RUH1 4BZ4A 1D4M3 4JTOA 3JU9A 4EN0A 1RUC2 4JDNA 1QQP1 3ETQA 3A0NA 1GSLA 2VY0A 5FLJA 1NLRA 2RS11 4QHBA 2R49A 3BTAA 1BKZA 1LHVA 5JWPA 2XLAA 4FQZA 1PO13 5CADA 1FOD1 1PIV1 3OY8B 4X8PA 1VB4A 4Q0PA 2A70A 5BNPB 4LNVA 3BOWA 1W6QB 2EXJA 3DPRA 4LO4B 4AGGA 1VBC1 2D43A 1D4M2 3N7KA 3O14A 1PO21 3E5XA 5FTTC 4MXVA 2N7GA 4GIQA 2DTYA 4CEWC 1DQ4A 4L11A 1U12A 3O5SA 2D40A 1PVC1 3TRSB 5A3MA 2RJLA 3FBYA 3SHRA 1VBD3 3OBRA 1Q56A 2BNMA 4Q1RA 4CP1A 1PZ8A 4MGKE 2RS51 3ZYJB 4GALA 2NP0A 3JB8A 1SFNA 3BOPA 4GMP0 1TME2 1PNFA 1LKNA 3ZFGB 3OYWA 3I2DA 3THTA 1VBB1 4N7IA 2JICA 3I7DA 4IV3A 4IV1A 4YNIA 2JKBA 3FFQA 3FHIB 3HIFA 4RQPA 4AVSA 3ZIXA 1QXRA 1VBD2 1RHI3 2PAKA 5HBAA 4YW3A 3IKWA 2B39A 3UKNA 1IKQA 3WG3A 1V6OA 1M4WA 3B9CA 4H7MA 2WA3A 1K5MA 4Y1UA 3WLUA 2LALA 1FT9A 2VOWA 4FCAA 2A6VA 5K9YA 1ENQA 3WR0A 4Q4W3 3AKPA 3I59A 2KA3A 1J1LA 2P3KA 2XJPA 2QVSB 5KXCA 3TBDA 3VBHA 1S0GA 1SLLA 2X5IC 4ASLA 2GN7A 5JPMB 2JG9C 1DIWA 5T50A 2QZ2A 1ND3B 4L2NA 1XYOA 1RHI2 5SV5A 1XE8A 4P9IA 1BVVA 1OQDA 2Z79A 2WQZC 3D5OA 5JAXA 5F5QA 4FSJA 3AKQA 2ZGOA 4HVOA 1C3HA 3FX3A 2YGLA 4K40A 1O5UA 3M7AA 1FI2A 5E1RA 2PAEA 3CJIC 4LO5B 4XW3A 2YMZA 1CAWB 2PA7A 2GC1A 4YZ3A 1B35C 1UAIA 3WG2A 1NA1C 2WC2A 4PJYA 1ASJ2 3KMHA 3OPZA 1IPJA 5C9AB 4YYOA 4AFDA 4KH9A 1KD7A 3ZFEA 1SDWA 1SQ4A 4MGYE 1N1YA 5DXDA 4XHBA 2R1DA 1QJX3 4LBQB 1U5ZA 3N7LA 2A6XA 3PTYA 4AFAA 5LK7B 1ZBE3 2ZCWA 1PO11 2ZMNA 1KQRA 3WD5A 1XE7A 4IEVA 1PGL2 2CGNA 3H9AA 4AVTA 3WT3A 1SBEA 1VALA 4GWMA 1G7YA 4Y26A 3SLIA 4AFBA 2VOVA 4PBPA 2ZABA 4AG4A 3GZUC 1JXNA 2ZA9A 4WM7B 5KXEA 1FAYA 2JECA 3BB6A 1COV3 1NE4A 3UL2A 5B2GB 1VBD1 4IXLA 4INDA 1ZBE2 3WQ0A 3M3EA 4RR3C 4M3CA 2E7TA 1HXS2 1REFA 2FZ2A 2Z2SB 4EN8B 3H50A 4OULA 1N1VA 4M3CF 1O4YA 2IZWA 1TNRA 3RDIA 2WS93 4P14A 4E4SA 4AWDA 4LT5A 4E2QA 2R061 2D3SA 3WW4A 1HDKA 4YFWA 2A71A 3HMYA 2PHXA 4TYSA 2VOXA 2JE7A 3U10A 2HWD3 5BPXA 2WNVA 2VMGA 2WNUA 1YWKA 4JGYB 1ENRA 1COV2 5HCBA 3NV4A 1RHI1 1SMVA 1TNFA 3G7DA 2JG8C 3TNPB 1AYM3 4BIFA 4XF1A 4YZ4A 3BCWA 3HR9A 1I6XA 1CAUA 3USSA 2WS92 1HQWA 5F1RA 5KHGA 3FMGA 3VBSB 3AYAA 1WW7A 3ZIWA 1KFXL 3M3QA 3POWA 4K7JA 4LA2A 4YGBA 1W6QA 3PNAA 4Q4W1 3ENRA 3LCPA 2EALA 3IT8A 4AEDC 5KHKA 3ZFFB 5DZGA 4R4ZA 3RZZA 3CJXA 2HWD2 4XJUA 1VBE3 4Y1YA 3JQWA 2UWBA 3KSCA 4LBMA 3WP3A 2VU9A 4EN7B 4FOVA 1HRV1 5AVAA 5I0RA 2VPVA 2ETEA 4XFIA 3J4UH 1AYM2 4LLFA 5GJ6A 3VUOA 1RUF2 4EWEA 1PMIA 4L9BA 5L7OB 1H4GA 1J3RA 1S55A 1LHUA 5CA6A 1W6NA 4LULA 1TE1B 1CONA 1XYPA 4QMAA 3KGLA 1DGRN 1QOSA 1ZYBA 3VBUA 3VZOA 5JIUA 2ZS6B 1KDKA 2PQQA 1RMU3 2VNOA 2VNGA 1RVF3 2ERFA 5CFDA 3QBQA 3A4UA 1PGL1 1RIRA 3POSA 2R1BA 4Q4X3 4YM1A 3APBA 5T3NA 1FATA 4AQ6A 3U11A 1O3SA 2C0ZA 3ST7A 1LULA 1XU2A 3WY6A 1WMFA 4L92A 4AI3A 2HWC3 4XF3A 2A3WA 2OW4A 1WUVA 2ATFA 1QJX1 4XPVA 3ME2A 1AX0A 1SACA 1W6PB 1BK1A 4B4RA 2HJIA 1ZBE1 3RWNA 4DQAA 2VMIA 3AP6A 5EV7A 5C33A 1E57A 4RL7A 5JIAA 2R30A 1RVF2 4Y5Z0 2QFEA 2D5FA