5T5JA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5jA00
2GDFA 2Z42A 3VKMA 1YIFA 2R49A 1KJLA 3OBTA 5DG2A 1H9PA 3AP5A 4L8QA 3B00A 2UU8A 3D4KA 5DUVA 4YZ2A 3M3CA 3OBRA 1QF3A 1DIWA 1JN2P 1N1SA 2P3KA 1C1LA 1SACA 1F5FA 1N1YA 1SBDA 1IOAA 4XJZA 2TEPA 4GA9A 2JECA 1JUIA 1AX1A 2A75A 1N47A 1LGCA 3IKWA 1LGBA 1RITA 3IPVA 1UKGA 4NO4A 3SH5A 4XJUA 4AYUA 3HMYA 2DU0A 4Y26A 1AZDA 1ULDA 1GNZA 1I3HA 2VUAA 1JBCA 2UWAA 4CRQA 2D6OX 1A3KA 1V6JA 3WLUA 1G9BA 2EIGA 2VW0A 2CYFA 3OGGA 3OY8B 3IN9A 2KM2A 1HLCA 2GNDA 1C4RA 3MW4A 5GLTA 1LHUA 1IKPA 1GKBA 1LOFA 1V6MA 2VY0A 1G9AA 4Y20A 1R1ZA 4R9BA 1G9CA 1W6MA 5EXOA 1VIWB 2EALA 3AYCA 1SCSA 2NMOA 3H0OA 5CA6A 2G4IA 5DUUA 1HQWA 1D2SA 1FX5A 1UZYA 1RIRA 1MR5A 4XTPA 2ZHMA 1XQNA 1S0FA 2ERFA 3I4IA 4UW4A 2JKBA 1HDKA 1KDKA 3WUCA 4FPHA 1Z0HA 5GLVA 4Y1UA 1MS0A 2AH2A 4XILA 3WZ1A 5GZGA 3WV6A 5DUXA 5E8AA 4ZXKA 3V64A 2P34A 4M3CA 2OVUA 3WDYA 3ZYPA 4FOWA 2W08A 2CNAA 1LHOA 2ZZJA 2UWCA 2EF6A 3NV2A 2ZAAA 4YM0A 1MVEA 2JE7A 2A7AA 2PHXA 2ZGLA 2ZHKA 1S1AA 3ILRA 3KQRA 3AZYA 3RMXA 4K20A 1MVQA 1S0JA 2EXKA 1VAMA 4M3CE 4FPGA 4HL0A 4DFSA 1G9DA 1AJKA 3AK0A 3DUIA 4FPKA 1KDMA 2A3XA 3FUOA 1LJ7A 4FPEA 1WBLA 1H9WA 1W6QA 4WVWA 4GWMA 4GKXA 3AP6A 2DUOA 3R4SA 2WSUA 2XG3A 4BQ1A 3B69A 2AGSA 4ISQA 2PHTA 1SCRA 1LTEA 3AZWA 4YG6A 4XMIA 3WDVA 1ENRA 1BKZA 2P37A 2VU9A 3ZXLA 1MS4A 1CIWA 3SNMA 1SFYA 3ILFA 2VW1A 1CPMA 4XHBA 4FOYA 1JYIA 4LBOA 5JOYA 4LBJA 5JLVA 4K1ZA 1MZ6A 1DZQA 2D7FA 4Y1YA 2ZGMA 3W58A 2D3PA 2DVAA 3FFZA 5E88A 5FRAA 1H30A 1S0CA 3AYAA 1G7YA 2P3JA 2UURA 4PBOA 4P9YA 3D6EA 1LCLA 1ULEA 3FLTA 4XJ8A 3APBA 3WUDA 2WT0A 5IK4A 4XYXA 3L2YA 1CONA 1LOGA 1MS9A 2UWBA 2W68A 1X50A 2C9AA 1LOFC 4Y1VA 2VW2A 2DTYA 3UJOA 1GLHA 3SISA 1GZCA 1V6OA 4Y22A 1W0OA 4YZ1A 4Y20B 1VAVA 5T5PA 2NP0A 2EXHA 1WUVA 2OUHA 1FNZA 1W6MB 1LU2A 5SV8A 1LHNA 3AJYA 1Q8PA 5EYXA 5T5LA 4UW5A 2AYHA 2A6XA 1N1TA 2WNEA 1ENSA 4YW5A 3ZPYA 2DUPA 4ASMB 3VKNA 4F83A 4XDQA 3AFKA 3AXEA 4YGCA 5DXDA 1LU1A 5H9QA 3V0BA 5JDBA 3ZYRA 2JD4A 2V73A 4DRVA 2ZA9A 4DPNA 2WSVA 3N7KA 1G9FA 3M1HA 4TYSA 4U36A 1LOAA 4GALA 4Y1XA 3N7JA 5GM0A 5JOXA 1JHNA 4Y22B 2FMDA 4YGDA 1YI7A 2R16A 3SITA 4BMBA 2D43A 4M01A 1ULFA 2AR6A 4LBNA 4XJWA 2DVBA 4RL7A 1G86A 4XJ9A 5FREA 2GNTA 1J1TA 3B9CA 1QOSA 1MS8A 2EXIA 2PHUA 3PVEA 4XTMA 5IT6A 1JOJA 3M3QA 2WT2A 3INAA 3QLQA 4FQZA 1AX0A 4OZXA 3ZVXA 1S0IA 2LALA 2WT1A 4I30A 2Q5TA 4DS0A 1BQPA 2DWRA 1KQRA 4YLZA 3A0NA 4YM2A 5GLUA 4Q2FA 3ZSMA 4JC1A 1I1EA 1WCSA 2AENA 2WLQA 3VUOA 1QDOA 1QKQA 2ARBA 4LBMA 2EXJA 1W6NA 4H55A 4YM1A 4FQ4A 2D6KA 4XBQA 4XZPA 4GKYA 1WW4A 2DVGA 1W0PA 3B01A 4XHXA 3BOPA 5AVAA 5KXDA 2SLIA 4FOVA 4BM8A 2ENRA 4P14A 1Q8VA 1SLTA 2DVDA 2WJSA 2A3WA 2ZMLA 1WD3A 4ITCA 2CY6A 2ZGKA 1LOCA 3Q9OA 3V0BB 4U2AA 2CTVA 4XE9A 5GZEA 1OQ1A 1MACA 1MS5A 3VKOA 1DYKA 3IM0A 5T5OA 3O0VA 2H0BA 4XBNA 4XMAA 4YW2A 5HCAA 2D44A 3OYWA 4R9DA 1IS5A 1FAYA 1LHVA 1FYUA 5GZCA 3PJQA 4MYEA 2JDZA 1C57A 1SLIA 4XIKA 3POWA 3WDTA 3ZXJA 5HCBA 3RMYA 5GALA 5IK7A 1WW5A 1DGLA 3RRDA 2LTNA 4FPOB 5CBLA 3O0WA 1KRIA 1CPNA 1RINA 3WNXA 1JYCA 2E6VA 4M00A 2VXRA 2ZGQA 4P9WA 1BZWA 3WG3A 2GNMA 3CNAA 2ZGPA 3NV3A 3AP9A 1ONAA 1W6OB 1OKQA 2EAKA 4ATEA 1QNWA 2XB6C 1UMZA 3N7LA 3NV1A 1GZ9A 5KXCA 4YZ4A 1QU0A 1SLLA 2DTWA 2DVFA 1AF9A 1V6KA 1DLLA 1UPSA 1YYNA 2DV9A 2ZHNA 2PHRA 4AVVA 4Q1RA 2ZGRA 3RQ0A 1FV2A 1MZ5A 1DHKB 4KBBA 1ULCA 3A0KA 4WV8A 3VV1A 1A78A 5F9TA 2YY1A 1WD4A 2BQPA 5DG1A 5LK5A 3NWKA 3POYA 3BODA 1DFQA 1Q56A 5HCFA 5T55A 3HN1A 1LULA 4C1XA 2JJ6A 2ZGNA 4YFZA 2D6PA 3MW2A 4YW4A 1YRZA 3T1LA 3O5SA 1W6PB 1O4ZA 1W6NB 3W59A 3B3QE 1F31A 4R9CA 2A70A 1S0EA 2AUYA 4UW6A 1CN1A 4LBKA 2ZGSA 2NN8A 2DURA 4XXAA 2D3RA 3N35A 1LEMA 4YW1A 3AJZA 4SLIA 1NLSA 4ISRA 4ATFA 3M3EA 4TZDA 1VALA 1W6OA 2E7QA 3AZVA 3R05A 1NXD1 3O12A 1CJPA 1Q8QA 4P9XA 2A6VA 4WVVA 5DUWA 4FOQA 4BOWA 2R0HA 1ZM1A 1QMJA 3UJQA 2DU1A 1DQ5A 1Q8SA 2CL2A 2DYCA 2AREA 2GMPA 2OW4A 5GJ6A 5KXBA 1GNHA 4LBQA 4WZFA 1DQ1A 3T2TA 3I8TA 2PHWA 1JXNA 1WW6A 2ZACA 5GZFA 3SLIA 1U0AA 1F9KA 2ZKNA 1ULGA 2GALA 4DRRA 2NMNA 1FV3A 3RS6A 1WLCA 3FLRA 3T1MA 1N3QA 5H9RA 3ZXFA 1AJOA 1BJQA 4NOTA 2V5YA 1GZWA 1SBEA 2NM1A 4RA0A 4XOGA 4PBPA 1FATA 2ZGTA 1DBNA 2ES3A 4IQPA 3ZSKA 2R0FA 1QNYA 5T52A 5IK8A 3FLPA 3ASIA 2E53A 3WDUA 3ZSJA 1PZ9A 5DZGA 1S0GA 3BTAA 3AZXA 2A3YA 4Q26A 3ATGA 3OY8A 3WG1A 1ENQA 1LOEA 1W6PA 1EPWA 1VLNA 3N7MA 1Z78A 3USUA 1AVBA 2P3IA 3MPPG 1HKDA 2CWSA 2DUQA 5JVVA 1GSLA 3LCPA 1SLBA 3ZSLA 3FBYA 2A5ZA 3SH3A 1APNA 1GV9A 3BIWE 4LBQB 1DYPA 3PMEA 4DQAA 3WDXA 5H9SA 1TEIA 3WCSA 5T50A 4AWDA 4M3CF 3WHTA 2ZMKA 1WBFA 1CVNA 3UL2A 2ZMNA 1LODA 4HANA 4JCKA 4BMEA 1D0HA 1WLWA 4YGBA 4AVSA 2D6NA 3TB0A 4PF5A 1S0DA 1DQ2A 1N3OA 3USUB 2R1BA 4AGVA 1FNYA 1GZWB 2W39A 4D69A 3DGTA 3RSJA 2A71A 5BYNA 1C1FA 4FPJA 3IPVB 3V0AA 5L73A 3LSDA 1SLAA 3V65A 3ZXEA 1SBFA 3O0XA 1IS4A 1V6LA 1PZ7A 2ZGUA 3AP7A 3PVNA 5GLZA 3WVJA 3N3HA 1URXA 3NV4A 4FPCA 1B09A 5KXEA 3QCWA 2I2SA 4R9AA 2A6ZA 1CR7A 1W6QB 3POSA 3OYWB 4M3CB 3C2UA 1BYHA 4GXLA 3IMNA 4Y24A 3VKFC 2SBAA 2GNBA 3VKLA 4Z8BA 5F5QA 4LBLA 2E7TA 3ENRA 4FP2A 1A8DA 4AGRA 4K1YA 3UK9A 1QDCA 2HYKA 4FPLA 4YG3A 1WW7A 1UZZA 3ZXKA 5EYYA 1DQ4A 1LENA 1UN1A 1GYKA 1CESA 1O4YA 2R1DA 1Y7BA 2C5DA 1V6IA 3WG4A 1ZA4A 1WLDA 2PHFA 3JUUA 1KJRA 4AGGA 4YG0A 5H9PA 3HR9A 1QGLA 1LECA 1MS3A 2ARXA 5JOZA 5JOWA 1JW6A 2ZHLA 4JRAA 4PQ9A 3WDWA 3A4UA 3FUQA 3GALA 2OUJA 1CQ9A 3RG0A 4YM3A 1GBGA 1AX2A 3OJBA 3PVOA 4GWNA 1PZ8A 4YGEA 1AXKA 5JMCA 2JE9A 3TAYA 3AYDA 4PCRA 3U4XA 2CWMA 3MEPA 2YMZA 3R4UA 2NZ9A 4FPYA 4YZ3A 3V0AB 4Q27A 4Q1PA 3OPZA 1IS6A 2GN7A 1QOOA 4BLIA 2D6LX 4Y1ZA 3M3OA 5GLWA 1LOBA 5T54A 2ZBJA 3AP4A 2WQZC 4BLJA 4CZSA 3GNEA 1AXZA 4Q8LA 5E89A 3LSEA 1LEDA 1IS3A 5DZFA 1MS1A 2GN3A 1IKQA 5DZEA 1YXWA 2YV8A 1GANA 3AXDA 4C1WA 1S0BA 2A6WA 1N3PA 2YZ4A 4YW3A 3D5OA 4FPFA 1KITA 4UW3A 3KM5A 3WG2A 4XXPA 1SLCA 1UAIA 3AZZA 3ILNA 4FP3A 3WOGA 1OFSA 2FHRA 2WKKA 1HQLA 1YO8A 2E51A 3MW3A 4YFWA 1V00A 1LESA 1UL9A 2P2KA 3JU9A 1UX6A 2GMEA 4K21A 1GICA 5IUQA 3SH4A 5T5JA 4FVVA 5CAZA 1N1VA 5IK5A 4XJAA 2B7YA 1AXYA 1LHWA 1Q8OA 4LBQD 5CB7A 5CNAA 1V6NA 2GMMA 4XIOA 1LGNA 2PELA 4XBLA 2VH9A 2D6MA 1QOTA 3AYEA 3WHUA 3N36A 4Q8KA 4YZ5A 2D3SA 1DQ0A 3WCRA 1DQ6A 1G8WA 4ZKTB 5EWSA 2RHPA 4BPZA 1BXHA 5GZDA 4W65A 2YXSA 4CTEA 2A6YA 2ZABA 2NYYA 2ZGOA 2YROA 3AX4A 3M2MA 2W52A 4AVTA
chains in the Genus database with same CATH superfamily
1H0BA 1KJLA 3KV4A 1H9PA 1HW5A 1NY72 3D4KA 5A6ZA 1K42A 1QF3A 4NWWA 3VBOA 5FZAA 1C1LA 1JYTA 1N1YA 1ULPA 1S2KA 4P9GA 2X5IA 4HPKB 3NRUA 2RJKA 3VBRA 4GA9A 2JECA 1JU4A 1AX1A 2A75A 1QJU1 4AE2A 5LA0A 1N47A 3IKWA 4FFGA 4IDZA 4NO4A 3IPVA 2IFWA 4RD7A 3SH5A 4GH4A 3VHRA 3ZMNA 1AZDA 3ZXAC 1HV0A 2PAEA 2W94A 4RR3C 2P6HA 1ZBA2 4Q0PA 5IFPA 2D6OX 1WA6X 4ET7A 5KXDA 1HRV2 2QDNA 2GC2A 3MW4A 5GLTA 1LHUA 1IKPA 1V6MA 4NRMA 1ZBE3 4MGQA 5C5TA 4E4HA 4BIFA 3AYCA 2NMOA 3LOIA 3H0OA 3K4AA 1RUOA 2Y60A 1HQWA 2R063 4LITA 1KD7A 1MR5A 4LIUA 3FE5A 2JKBA 4N43C 2FCTA 1KDKA 1UIJA 2XDVA 3WUCA 4ES8A 5I91A 2WYSA 3S6PA 5D1IA 3ZMOA 3W5MA 1Q5OA 2BERA 2IXHA 1REDA 3NNMA 1FPN2 4ZXKA 4RHV1 5I8TA 4QPIB 2OKXA 4OQ8A 2OVUA 2YU1A 3IIAA 5DPNA 1IHMA 4CU7A 3OB8A 4BA6A 1XE0A 3IDCB 2PHXA 3KQRA 1YFUA 3OEBA 4AI3A 4CDQB 4GH4C 5DAQA 3CU7A 1TMF1 1JYXA 5FZ4A 5LA2A 4FPGA 3T0AA 2W0XA 3ZYHA 5BNOB 3HQXA 1QJX1 3DUIA 1PIV1 1S2EA 4QMAA 3O1TA 3MLLA 1WBLA 1NCRA 3LF7A 4NROA 1W6QA 3I3EA 2MPFA 4CXXA 5A3NA 4GKXA 3T2PA 5EPAA 2HWF2 1GOHA 5FUPA 3OPWA 4IGOA 3AP6A 2DUOA 3TEXA 4PDWA 3B69A 2AGSA 2HWE1 1VBB1 1PM4A 4L99A 2WAOA 1LTEA 1O4TA 1PGSA 3WP6A 3ZYGA 3N9LA 3ELNA 3WQ7A 2DCKA 5JMOA 1MS4A 3SNMA 4UFLA 4CVUA 3J7NA 2X29A 1CAVA 2AEZA 2HWF1 3QH6A 3UGGA 4CU8A 1RHI2 1W05A 1V9U1 3OGRA 4JDOA 4A6SA 5F3CA 4DXTA 2QQWA 4K1ZA 5A3WA 1UY1A 2H0VA 3SCGA 3J8F3 3VBHC 3KT7A 2D7FA 3BCWA 1OLME 3W58A 4COZA 1RB8G 5CKQA 3T4HB 3AYAA 3CMGA 3AC0A 3N9PA 4BK4A 2HWE3 2MEV2 5F6KA 5CFDA 2VQAA 3E5QA 4Q4X2 5D2AA 2Y26A 3FLTA 4X8PA 3O1OA 2QKDA 3SC7X 2VMFA 5HV4A 5IK4A 2UWBA 3NSTA 3I3MA 4A2UA 4MO3M 3FZ3A 2C9AA 3UJOA 5JSPA 3HAGA 1O3TA 3G6JB 4RSUA 4CUCA 4YZ1A 1ND2B 5T5PA 2J1UA 1OH4A 1CZSA 5JSRA 4DIQA 3FHQA 1FNZA 3HNBM 4LA2A 2ID4A 2XXZA 3PIJA 3I2JA 4NHYA 5IJRA 5T5LA 2QCSB 4IE6A 4YRDA 1SPPA 4KL1A 4YW5A 5CKNA 2E32A 2WNVB 3ZPYA 1XB9A 1X9PA 4JX0A 1W2OA 3AXEA 3DKQA 4QDSA 4D6RA 5JDBA 1WCQA 3RZKA 4AQTA 4AI8A 3JBG2 3RVHA 2AACA 3C3VA 3EQEA 2IXLA 3PURA 1JOBA 2WSVA 4ZU5A 5CVRA 2ZX4A 3I3DA 2CDOA 4QPIA 1LOAA 4LR4A 5LY1A 2VGDA 4EWAA 4Y22B 5FO8B 2FMDA 2RS52 3PUAA 1CX1A 3ZFGA 4AI9A 1MPXA 1ULFA 1XYPA 2AR6A 4XJWA 4COYA 1BMV2 5A7QA 3SXWA 1AYN1 4A45A 4XUTA 4UBGA 2C26A 1QOSA 1MS8A 3IIIA 1UY4A 3PVEA 4OUSA 5FPVA 2OYZA 1JOJA 2H6CA 3TRSB 1OMIA 4FQZA 4AVCA 1VBD3 3ZVXA 1OOPB 2LALA 2Q5TA 4K7JA 1KQRA 1XU2A 5GLUA 5SV5A 4CDXA 3KB5A 5J98B 4RQPA 3VUOA 4ZU7A 1QKQA 3O1VA 4XBQA 2HWD2 3F2ZA 3AM2A 4CXWA 4XZPA 1RUJ1 1WW4A 2WN3A 2CHHA 1GQGA 2DCYA 2ZJCA 3K46A 2CGNA 4XHXA 5CFCB 3ZIWA 1W8UA 1SLTA 1MQTB 3OCPA 1JOPA 3FHAA 5GKAC 1UU4A 2ZGKA 1LOCA 3LEKA 5F7UA 3NNGA 3TN91 3H8XA 3ZFFB 3MUZ1 3VKOA 1QJFA 3JXSA 2JDYA 4CCCA 2H0BA 4DUWA 1NQDA 3AL6A 2PAMA 4RR3B 3W21A 4HKWA 4IE7A 2QQOA 1FAYA 1UXZA 3KCXA 4CCLA 2JDMA 2E63A 3LPGA 3PJQA 3WDTA 4AI2A 3ZXJA 1SG3A 3POWA 5HCBA 1HB3A 1R093 2GP3A 3W9AA 3G7DA 3HOBA 2LTNA 1ZZCA 4YYOA 1GU3A 1RINA 2X53S 5DDJ2 3WNXA 4OI1A 4LOTA 2OZJA 1SDDB 3THPA 5LEKA 2ZGPA 3NV3A 3AP9A 4ATEA 1OKQA 2EAKA 3Q8EA 4RHV2 2XPJA 1UMZA 2BNMA 3N7LA 3NV1A 3WW3A 5KXCA 4YZ4A 1SLLA 2QTWB 2DVFA 2Z2SB 4IE5A 4NAOA 4BXFA 4HONA 5LBCA 5K4LA 5JAXA 1S2BA 4MVTA 3ZPOA 3L2HA 3RQ0A 1OLQA 5EV7A 1K5MA 3S57A 1MZ5A 1DHKB 1TMF2 4CCMA 1CAUA 1A78A 3BU7A 5F9TA 1WD4A 2BQPA 4CCNA 3POYA 1XU1A 2VUJA 5HCFA 5FPBA 4BH9A 5C33A 5FPUA 2XWBB 5FYIA 4YFZA 2D6PA 4BWOA 2GC0A 4WM8C 5JXIA 1QQP1 1VBA2 1X9TA 5D8AA 4O65A 4YW4A 2ADDA 1VBD2 3AMPA 3UYJA 2XONA 1YRZA 3WNOA 4F7ZA 2OQ7A 2KA3A 3ECQA 4Q4X3 3UKNA 1O4ZA 3RI9A 3ZIXA 1F31A 4R9CA 2XHNA 1S0EA 2O8OA 1B35C 3CL1A 2YGMA 1CN1A 1F15A 3KWVA 4AL9A 5C3QA 2DURA 1ZRCA 5FUNA 2D3RA 1FMD3 1TNRA 1YQ8A 3V56A 4SLIA 1VBC2 2C6SA 2DCTA 2JG9C 4ATFA 5LCWL 4I02A 3WX5A 1UYPA 1VALA 1POV0 1W6OA 2EIBA 3CHXA 3NJVA 1DYOA 4KG0A 4XCAA 1NXD1 1YQ2A 2KXLA 4RFT0 1CAXB 3O12A 4RQPB 4BYYA 1CJPA 4GJYA 4P9XA 4EN0A 1YWKA 5FXZA 5CADA 4HN1A 3MLKA 4BOWA 4NWVA 1UY0A 3FFQA 3ORJA 2HEYF 1GOGA 5J36A 1J58A 1RUF1 3LWCA 3VDBA 4UWDA 4JGZB 4K40A 1R1A2 2WNVA 3J9SA 3CJIB 4IEOA 4DRRA 1IG0A 3KMHA 1W9WA 3UV9A 2WZ8A 5LW9A 3T1MA 3WT3A 1GP6A 5JXJA 5H9RA 3ZR6A 5J37A 1LB2A 1AJOA 3BVCA 1OD5A 1POV3 1BJQA 4NOTA 4YPJA 1GZWA 4FO9A 1H4HA 4RA0A 4E9KA 4R4ZA 5DAVA 1IQAA 4QHZA 3O14A 4D7SA 3WF2A 1TME2 1W04A 3MI8A 4PBPA 1RVF1 2PFWA 2ZGTA 1DBNA 1M4WA 3JBG3 4IQPA 3KF3A 3WP3A 3ZSKA 5K7PA 5IVBA 4KWJA 3BN6A 3ZFEA 4EQVA 5LWBA 5DZGA 5IATA 4CP2A 2R071 1U5IA 3LA7A 3LEIA 5LEJA 5FV3A 2A3YA 2WLPA 5FZEA 4GD4A 5EFUA 3QBQA 3UGHA 2VECA 5FQ0B 1VLNA 3A22A 1AVBA 2P3IA 3LCPA 1HQNA 5C8CA 5G05L 3GBFA 2XH6A 2A5ZA 3SH3A 4H14A 2OX0A 4I3PA 1GV9A 3P3PA 4PLNA 4LBQB 4QAWA 4RGGA 4E4DX 4LO8A 1DYPA 3ZM8A 2GC3A 1PGL2 2XUEA 3WCSA 5LA1A 5T50A 2VCAA 4CP1A 1S55A 2ZMKA 3SKVA 1ZZBA 4Q4V1 1K12A 3MYXA 3UL2A 4P00B 1R092 2ZMNA 4JCKA 4A7ZA 1RYYA 3ZN6B 1D0HA 4YGBA 2YU2A 5ISLA 2X09A 4E4ZA 5FZBA 1N3OA 2GZWA 4JAAA 4LPLA 3PU3A 4CDUB 3QACA 4QXBA 4WM7C 3E5UA 4CDWC 3DGTA 3KV6A 3V0AA 4FPJA 1NA1A 3VHNA 4UFMA 1CZVA 1SLAA 1FPN3 4CP9A 4QWNA 1BVVA 3O0XA 5FYUA 3GCXA 3PVNA 3WVJA 3N3HA 3ZKYA 3MZHA 4KNCA 4XQDA 4CE8A 1MEC1 3BALA 3VBUA 1H8TB 2BGCA 1W6QB 1VBB2 4MGYE 5TSWA 4A7KA 4DINB 3OUJA 4OHWA 3VBOC 1PO13 1XYNA 1XYOA 3WW4A 1W2AX 3LDBA 2SBAA 3POGA 4CEWC 2XJSA 2OA2A 1W2TA 2CU5A 4MGZE 1UW8A 2E7TA 3NJZA 1A8DA 1ZA7A 3PDQA 2K2SA 3DECA 1XRUA 1XNDA 4K1YA 1NE4A 4OCTA 2WA4A 1ZZ8A 4QU2A 4XVHA 4FPLA 2Y38A 2Q1ZB 1AR62 4RQPC 1UZZA 1AYM1 4WZCA 5FZLA 5EYYA 2QE3A 1VB4A 2PAKA 1BCXA 4QT6A 1VE0A 1T6GC 3GHNA 2VNOA 3VD9A 1EV11 1DP0A 1WLDA 1ZA4A 2PHFA 1Q3EA 2DBIA 3JUUA 4KWUA 1KJRA 4Y5SA 3PVBB 3GF6A 4JZRA 2ET1A 1E5RA 4Q4W3 1QGLA 1LECA 5H9PA 4B1LA 2RE9A 3MFAA 3BKZA 4WVMB 1CAVB 1VB2A 2B45X 1YJLA 3WDWA 4ZONA 2WZR1 3IT8A 4LT5A 2OUJA 1YFYA 3RG0A 3RZGA 1GBGA 3ZLIA 1EUUA 3ETQA 2JE9A 1GP4A 3RNSA 3U14A 2W5FA 1SMVA 3I2IA 3U4XA 1VBC1 1DDLA 2Q0AA 4BQ5A 4C91A 2ZKLA 4W6YA 1IS6A 1VMHA 2D6LX 3RFRA 5GLWA 3THDA 2VR4A 5HV0A 2ZOEB 5FZGA 2IC1A 1UX7A 2WQZC 3HT1A 1COV2 4YVSA 5E89A 3PLQA 2QQVA 3OGVA 5EJZB 3HEIA 5FZOB 5EJ1B 1ASJ3 1IS3A 2RM21 3ZN6A 5JR7B 3TN92 2JG8B 2WINB 1H8VA 4UOJA 3T2QA 1WMEA 5E1RA 1AR73 4PLMA 1YXWA 4C1WA 5LK7B 1J83A 2YYOA 4V2WA 4FI9A 1S0BA 2EIDA 1RUI2 2YZ4A 3FN9A 1QWRA 4Q0SA 1H2NA 4YW3A 3OPTA 4E2QA 1RGSA 4QKDA 4UW3A 3N9QA 5AFEA 3KM5A 1HRV1 3WG2A 5ABJA 1SLCA 1UAIA 3AZZA 3KS7A 1MZFA 2FHRA 1LNSA 2E51A 3MW3A 4GZ9A 4LKDA 5BNNA 4IERA 3FBMA 2JDNA 5F5AA 5IUQA 1UX6A 3K3NA 3POFA 4FVVA 4LUKA 2W1QA 4EN8B 2C4XA 3EBRA 4LO6B 1LHWA 4PIZA 1HXS3 5FY4A 4DZGA 1HJGA 5CB7A 1V6NA 4BE3A 4PI0A 1MEC3 1IPKA 1LGNA 2VOXA 3ITQA 4P08A 3VHOA 2V09A 2D6MA 1QOTA 1UQXA 3AYEA 4AHZA 2XBO3 1LRHA 4Q8KA 2D3SA 5A6QA 1DQ0A 5C8CB 1DQ6A 3ZOIA 3WQ1A 1JYNA 4XPVA 5ERLA 4BPZA 5GZDA 1ZRFA 2A6YA 2ZABA 1E5HA 3AX4A 3M2MA 3CJXA 3BGAA 4AVTA 1J3RA 2Z42A 2I45A 3IB3A 4N43B 4AI1A 4LA3A 1NCRC 3VN4A 5FZ0A 2VL4A 1W8HA 2UU8A 4YVWC 1D4M3 1W03A 3P3NA 3AKPA 1JN2P 3PIGA 4Y33A 4XAAA 5KC5A 1F5FA 3KZ4C 4Z07A 1SBDA 4UF0B 4CDQA 4XJZA 1OI6A 4JGYA 1KFUL 4JGZA 1JUIA 2ET7A 4ZS2A 1MEC2 3I54A 3QH7A 4CXYA 1LGCA 2ORXA 2RDNA 1LGBA 4OFGA 1NA1B 4AYUA 4OI2A 4QPGB 2J1AA 3HMYA 4D7YA 4J1XA 2CSGA 1ULDA 2WIIB 1OC1A 1JBCA 2D93A 2VUDA 4PJYA 1JTZX 3JD71 4Q5OA 1OFNA 2XLFA 4QXKA 1A3KA 1V6JA 2YC0A 5DAWA 2CYFA 4HLTA 3OY8B 2KM2A 1C4RA 2WFF2 1GFF2 5EIYB 2Z5WA 1LOFA 1GKBA 1ZRRA 1G9AA 2VY0A 1R1ZA 5EXOA 1VIWB 2FCUA 5E6HA 1SCSA 1W28A 3MDPA 5L36A 4UAPA 1FX5A 4Z2WA 1QQP2 1VBA1 1RUJ3 4DMIA 1EY2A 2WS91 2RS53 2HH9A 3KVBA 3VD7A 1OOPC 1NCRB 5D8AB 2GAUA 4Y1UA 2XKOA 1MS0A 2OQ6A 5FYYA 1UO9A 1TG7A 4X8NA 3MF9A 3WV6A 5E8AA 4NE9A 3VBFA 2V72A 3V64A 3AVSA 2ZXQA 5A70A 3C7EA 3WDYA 3H9AA 1XE7A 2QQKA 4FOWA 1YNAA 2G9ZA 2JIGA 2QZ2A 4WM7B 2PN5A 4N7UA 4RGKA 2A1XA 2ZAAA 2A7AA 2ZGLA 3ILRA 1S1AA 1Z7S1 3AZYA 1PGW1 3RMXA 2WL1A 1S0JA 1C28A 2EXKA 2VVDA 1PMHX 4M3CE 3WQ0A 2ZX3A 3EJKA 4HL0A 1ODNA 1AJKA 3AK0A 1G9DA 1AYN2 1UY2A 4ZHNA 1MZEA 2A3XA 2L9LA 3FUOA 1LJ7A 4FPEA 1H9WA 4XF9A 4GWMA 2QQUA 5FYMA 1AHSA 2MNGA 4ZPIA 3R4SA 2WSUA 2XJPA 4BQ1A 1IZ3A 5F8PA 4BXSV 4ISQA 1XC6A 4L9BA 2PHTA 2J42A 1RC6A 4O9EA 1ENRA 2WNVC 4F8AA 2YBKA 4QPGA 3O1RA 2VW1A 5F32A 1RVF3 2VBBA 3MHZA 4FOYA 3H7YA 5A1AA 1I9RA 4LLOA 3WSOA 5JLVA 3RZLA 3WXPA 2JD9A 3I2DA 2LS6A 1QQP3 2UY8A 4Q4Y2 4B7EA 1TME1 2ZGMA 2DVAA 3ZFGB 3KLSA 3THCA 3ON7A 4UYBA 3Q8FA 3K4ZA 1S0CA 1YC61 1HV1A 4PDWC 1OH3A 1G7YA 2XBO2 3NO8A 3QOPA 4RS5B 1ZRDA 1FOD1 1W3XA 4PBOA 4BQ2A 1JS9A 5IAVA 4DY5A 3I2FA 2RS11 5FOBB 5IHRA 4Q29A 2WNUB 3VBSA 3ACFA 1UPIA 3VL8A 2WT0A 4RGAA 1CONA 1LOGA 1MS9A 1QXPA 2WDBA 3ZSEA 4GWIA 1GWLA 4UXAA 4Y1VA 3VBUC 2DTYA 4RN5A 3KSCA 2ZEWA 4XFBA 5FP8A 1GZCA 4Y22A 4OLLA 5L9BA 2GP5A 3SISA 1FXZA 4B4RA 1W2NA 2NP0A 1DF0A 2C1FA 4Q0UA 1W6MB 5SV8A 5L9VA 1OQEA 3AJYA 2JB4A 1Q8PA 4FTEA 2VMHA 1N1TA 1QIQA 3L9JT 2VZVA 1ENSA 2R32A 4LXLA 3R4DB 2DUPA 5FY5A 3VDDC 3BPSA 3J26N 3MIGA 3V0BA 1QJEA 1D7PM 3WEZA 4AK3A 1IPJA 4N53B 3ZYRA 2JDUA 4XUOA 5C4WB 5EQUA 2WWUA 5AC91 2K0GA 2VCMA 3N7KA 1W9FA 1G9FA 3PMSA 4LO7A 4N43A 1AR61 4U36A 4GALA 4Y1XA 1TZOA 3MLJA 2HWB3 2R16A 1RXGA 3MPBA 5FZ9A 3SITA 3VZJA 4A44A 4BMBA 1PX3A 4YARA 4LBNA 2EAAA 2DVBA 2GNTA 4H7LA 3B9CA 1HN1A 4LMFA 3VLBB 5CFDB 3T08A 4FSJA 5A1FA 4QB2A 4ZXEA 5FKBA 2KD7A 5A7WA 3Q8CA 4CYDA 5C3SA 1YJKA 5LRSA 2BOIA 2PXJA 4NHXA 4YLZA 3A0NA 4IL7A 4FT8A 4Q2FA 2BBAA 3U10A 1CZTA 1I1EA 2J7MA 1R082 1O59A 1ZNPA 4IV3C 4LBMA 4AEDB 4MGIE 1W6NA 4FQ4A 4GKYA 4NR1A 4PI2A 5IVCA 3BOPA 1UU5A 2C0ZA 2VOTA 4BM8A 5FOJB 4P14A 5IWFA 2ZMLA 2B5HA 3N9MA 2JX9A 3MICA 1CAWB 2VPVA 5GZEA 4XQ4A 1OQ1A 4H2AA 1MS5A 1DU3D 1DYKA 4XBNA 4YW2A 5FBJA 4I0WB 4UFJA 5HCAA 4CPBD 3ES1A 4LOSA 1EPZA 4HSLA 5FO7B 5C3RA 5EJ3A 1C57A 1SLIA 5IK7A 5K9YA 3O1MA 3JBG1 4HPKA 5FP3A 4LLFA 3OSDA 4IESA 1DGLA 3RMYA 1JZ8A 2E33A 4FPOB 3O0WA 1KRIA 4MG2A 1QJX3 5FZDA 2ZGQA 4QPGC 1YHFA 1WCKA 2XL9A 2VBDA 3WY6A 3UETA 1W6OB 4N7IA 5C3PA 4ES9A 3H8OA 1GZ9A 2XVLA 4TWTA 2DTWA 3ETPA 3KF5A 1V6KA 3D0SA 2ZHNA 4UBHA 2ZGRA 3CKHA 1H2LA 4AFCA 5J48A 3RJRA 4KBBA 3A0KA 3NNFA 3VB9A 4UFHA 3BPZA 2YY1A 4ZY9A 5DG1A 5LK5A 1OF4A 3NWKA 3ES4A 1Q56A 2FZ1A 4F3JA 3S7IA 1XSQA 3HN1A 3CZUA 4C1XA 2VTXJ 1PK6A 2P17A 3JB8A 2I07B 3Q8AA 2ZX1A 4AFMA 4A4AA 3D82A 1EYBA 2B8MA 2C24A 3NQHA 3I2GA 2ZCWA 2FDFA 2W3JA 1UZVA 5L7OC 4O61A 3B3QE 2VVEA 4CCKA 1HXS1 2AUYA 3FX3A 3IDAA 4UW6A 4ZZ8A 4JQTA 4XQWA 1RMU3 2NN8A 1LR5A 5KHKA 4OUMA 4HETA 2HWB1 1LEMA 4YW1A 5FPLA 2W1WA 4KU7A 4AHWA 1H4GA 2HWC1 1HB1A 2Z4FA 3DN7A 1XXNA 2Q8CA 2W2IA 5C7GA 5A1LA 1BBT3 1H1AA 5AVPA 3T3YA 3WQBA 4HN0A 3TNPB 2BZDA 2RV9A 3OBZA 3MIEA 2A6VA 4Q4W2 4IW3A 5DUWA 4E8CA 3KT1A 4IETA 1ZM1A 1QMJA 4IEPA 4HSJA 3KCCA 2TUNA 1DQ5A 1ND3C 2DYCA 2B9UA 2GMPA 2K9ZA 3VZKA 2E26A 1RMU1 3KCYA 1RUD1 1LAJA 1F9KA 1V0AA 2ZKNA 4MH0E 2GALA 1UWWA 2XR4A 2VVFA 1UZWA 1GUIA 3GGLA 5FZKA 3C8XA 2WFF3 4DXRA 5FYCA 4Y3OA 3GBWA 3OGJA 1UKRA 3LFIA 2WBKA 1NQJA 4KI5M 5BXXA 1X7NA 4QM9A 4Z92B 3RYRA 3VL9A 2YFZA 4XETA 1K45A 3BI3A 3AVRA 1CD3G 1HRI2 4G9SB 2BJSA 3NAPB 4Q4V3 4IEXA 1J1LA 2R061 5IK8A 1D4M2 3CJIA 1PK6B 2W95A 3FLPA 4TLFA 4AR2A 3ZSJA 5CU1A 3OD4A 1S0GA 2RS32 2R041 4QX2A 4MGKE 3H42B 1PX4A 3B7MA 4JRLA 3WG1A 1ENQA 1AR93 3ZX7A 3N7MA 1EPWA 4CDUA 3BYWA 2CWSA 1GSLA 3PUIA 3GDBA 5FZ6A 5JXGA 5DDJ3 3TN93 2BRTA 3ALQA 1OLRA 4CU9A 3KD4A 4CP0A 4AFAA 4A7YA 2QQMA 2VCCA 4AWDA 1WWYA 3WHTA 5BPXA 1QH6A 1CVNA 1EV12 4QX5A 4TSVA 3QD6A 2Y0IA 1JU3A 2AZ5A 4SBVA 2D6NA 3RWKX 1VBE1 4B4QA 5FIXA 4CUAA 5FQ0A 4AGVA 1BEV1 3I2OA 5L19A 4QGNA 3VZMA 3RSJA 3GZAA 1NUKA 3B9IA 3C7FA 3IPVB 5L73A 2HLEA 2VOVA 1XNBA 1RUE3 4AHYA 3LSDA 5A6YA 1YI9A 2R7EB 2BUKA 3LDRA 3ZXEA 1IS4A 3C7OA 1PZ7A 1IGOA 3AP7A 4MXWA 5GLZA 3WF3A 4BDVB 3TEYA 1YLLA 4GMP0 3KT4A 1AL0G 4FPCA 4QD2A 1QJU2 3ST7A 5KXEA 3QCWA 4HOOA 2I2SA 2RMU3 2A6ZA 4IGPA 2LM3A 2RJ2A 3E97A 4IV1A 4IV3B 2W91A 5FP7A 3TYJA 3URFA 3NKTA 3OYWB 4JVAA 4M3CB 2VOKA 3VKFC 3IMNA 5FY8A 3J8F1 1DZTA 3TNQA 2V4AA 3RZZA 4CSWA 3BTZA 1H2KA 5CFCA 1DGWA 4MZUA 2BYVE 2JEMA 3JB4C 5F5QA 1C5IA 4QQOA 4WBBA 4ONUA 4EN6B 4IEQA 5JIUA 4FP2A 2FDKA 2X10A 2BU9A 2BWCA 3UK9A 5I0UA 5FDBA 1VMJA 1WW7A 4NHMA 3U37A 2HWD1 3OUHA 3ZXKA 4HMZA 1DQ4A 1K5JA 1LENA 2VUCA 2WQ8A 1GYKA 4KG8A 5FLHA 5FMCA 2BEOA 2FDIA 2C9KA 2RR13 3WF1A 1AL23 1OPMA 4W6WA 3O7OA 5BNNB 3EYPA 4HVOA 3K2OA 2Q1FA 3FMGA 1C3HA 2XGXA 1DLCA 1IG3A 2VAUA 3PNAA 2WRAA 5JOWA 5FLJA 1JW6A 1SEFA 1L3JA 2OS2A 4YW7A 1TE1B 1NKGA 1VJ2A 1VPHA 4QQ2A 5A6XA 1ASJ2 2B9VA 3A4UA 2XJQA 2CAVA 2W87A 2XL7A 1CQ9A 2QBXA 1PZ8A 1V9U2 1AXKA 4YGEA 3T0BA 4BISA 5JMCA 3BIEA 4PDWB 3NNJA 1GP5A 1R081 4JKKA 4OHZA 2JIJA 3H3ZA 5T3NA 4CDQC 4FPYA 3OF1A 4YZ3A 4Q27A 3OPZA 4W50A 3PUQA 4BLIA 1NLRA 2QZ3A 1AYN3 5A3OA 4D8MA 1LOBA 5C9AA 1NCQC 2VZ3A 4BLJA 4AZZA 1AXZA 1JODA 4Q8LA 3LSEA 2VM9A 1LEDA 4W4ZA 5I93A 3I49A 2VZ1A 4Z2AA 3H1YA 4COUA 1M06G 4O9GA 3I2HA 1MS1A 4GWJA 4A6OA 1NLQA 3GCWA 1HRI3 1X8MA 2YV8A 2EICA 4FPFA 3LIHA 4HG6B 4UF0A 5J1XA 4LE4A 1VBE3 4CEWA 4FP3A 3ILNA 1UU6A 4QQHA 4CCOA 4OI0A 3P6BA 2XKPA 4YFWA 3HPNA 4I01A 4LHLA 4P5YA 1D4VB 1UL9A 2QQNA 1I6XA 3SH4A 4Y5TA 2IVJA 5F3IA 1N1VA 4ZU4A 5CEHA 3OUIA 4IV3A 2YGLA 1Q8OA 1UZ0A 4XF3A 4LBQD 3WF4A 4CEYC 1QHDA 2BFUL 4FTBA 3U07A 2WS92 3B02A 2PELA 4JGYC 1HRI1 1HX6A 4YZ5A 1U12A 3WHUA 3N36A 3WCRA 3NMBA 3B93A 4ZKTB 3LEMA 1BMV1 5I8SA 2VQUA 5F2WA 2IWGB 3IMMA 4LIVA 1O5LA 1VBE2 2E31A 2NYYA 1CAWA 2YROA 3AXDA 3THTA 3GM8A 4KGGA 1BBT2 2GDFA 4HK9A 3WP4A 4DXZA 2R49A 4DB5A 2P1BA 2P6CA 1YFXA 3X29B 3PJYA 5FPZA 2IZWA 2WO2A 2QJVA 3I2KA 3ZFGC 1OLMA 2VMEA 1DCSA 3B00A 4Y4YA 3A23A 4AFDA 3OBRA 1RUF3 4ARYA 1TQ5A 3O1PA 1J84A 1N1SA 3ABZA 5I0TA 4QPIC 4B8EA 1NG0A 4QX8A 5F5IA 5ACA2 1IOAA 1RUD3 2TEPA 1F35A 2WS93 4YWAA 1RTVA 5JWPA 1EV13 1RUC1 1UKGA 2XMLA 4AHXA 1NOVA 2DU0A 4KWLA 5FY1A 3C7GA 5C9AC 1GNZA 1I3HA 4MXWB 2UWAA 1FOD2 2EIGA 2VW0A 5CYYA 4G4FA 4XW3A 5FXWA 4CU6A 3IN9A 1HLCA 2GNDA 4URTA 5IFTA 5DAPA 5BNNC 4Y20A 5FYHA 3FWEA 4D6SA 3U4SA 4R9BA 4AVBA 2EALA 3IDEA 4XDOA 5DUUA 3PUSA 2JE8A 4E2SA 2IUWA 3KHCA 1OKOA 2AEYA 1HJFA 2ERFA 3I4IA 4RFRB 4UW4A 1FMD1 2VMDA 3ZN4A 1HDKA 4MGSA 2VNGA 4KGQA 1RUNA 2V4VA 1Z0HA 1OUSA 5GLVA 4XILA 3WZ1A 3AMNA 5GZGA 1J3PA 2Q8DA 1TNFA 1STMA 5HCHA 4GB31 1ZZ7A 5CIRA 5DABA 2W08A 2YC2A 4NPRA 5FBZA 2CNAA 4LQRA 2ZZJA 2FDJA 3NV2A 4AG4A 2ZHKA 2PHDA 3T09A 2HWF3 1W9SA 3CBNA 1MVQA 1V9U3 4DFSA 2WNUA 1LKNA 2Y34A 3HBKA 5BV6A 5A3UA 1F8VA 4FPKA 4AOCA 1Y4WA 1RUD2 1WGPA 2LROA 3AMMA 2CGOA 5JI7A 3P5BA 1JMUB 4QX3A 2XG3A 4OHXA 3POJA 1DGWX 4GB33 5A3LA 5J3UA 1XBFA 1SCRA 3JCIA 5AC92 4Z1VA 1CJDA 1EAH3 1ASJ1 1CIWA 4GH4B 4XFCA 2FMYA 5AFBA 5B4NA 5KHIA 1GR3A 5JUVA 2BTVC 2OPWA 3DCQA 1CPMA 4YSFA 1XSRA 4LBOA 2MEV1 5JOYA 4LBJA 3BUCA 4X6RB 5KBFA 1YEWA 1MZ6A 3M70A 5KC6A 1DZQA 3IBMA 3USSA 4QHBA 4Y1YA 2D3PA 3FFZA 5F39A 1AR91 2LUWA 4WM7A 5E88A 3SCHA 2NPIA 4ZZ5A 4NIDA 3DYOA 1D4M1 2P3JA 2VMCA 4JHTA 4P9YA 4MUVA 1LCLA 1OVPA 1ULEA 4XJ8A 2P5BA 5FZOA 3WUDA 1RUC3 1X50A 1LOFC 1O91A 2DBNA 2VQ0A 2VW2A 1GLHA 3VGIA 1V6OA 2E7AA 4Y20B 3P1IA 5F37A 1VP6A 1RUE2 1ST8A 3VBHB 1UOJA 2HYXA 1LU2A 4AAPA 4I3GA 5K8SA 1H6YA 5EYXA 4UW5A 2AYHA 2A6XA 2AC1A 4MGTA 2Q8EA 1H1IA 3HBZA 1I5ZA 3HD8B 3K3OA 2QQJA 3TBDA 2ZX0A 2E9QA 4F83A 3TEWA 5DXDA 3AFKA 4YGCA 2WZPP 1LU1A 4P02B 5KHHA 1QJY3 1RUE1 1OF3A 1RXFA 4D3WA 4D6QA 2V73A 4DRVA 2ZA9A 2VBPA 4DPNA 5IVYA 1Y9QA 2YB7A 3M1HA 2FD8A 1WKYA 1WMXA 2MHFA 3PL0A 1H8TA 4P9JA 1RUC2 3AFGA 3CZJA 1JHNA 3LD8A 1GWMA 1QXJA 4N8MA 4YGDA 1YI7A 3NKGA 4DO0A 1CIYA 5JR2A 1X36A 2RG4A 1ZBA1 4RL7A 5DMYA 3NL1A 5FREA 1J1TA 2VTFA 2CGPA 1L7RA 5FMOL 2GH2A 4BU2A 4H3WA 1BBT1 3VD4A 5IT6A 2LW8A 4XTMA 1OUXA 4IXLA 2BNNA 1O7FA 3QLQA 4OZXA 1AX0A 4YNIA 4I30A 2WT1A 1BQPA 1RUI1 4TLGA 4CDXC 3J8F2 3SHRA 3GZEA 4QDQA 3ZSMA 4JC1A 2BGOA 2YBPA 2W46A 1WCSA 2AENA 2WLQA 4Q4V2 5A3PA 1JZ4A 1AR82 1W8TA 2EXJA 4H55A 4YM1A 3JZVA 2D40A 3GZUC 5A7NA 3UKTA 3B94A 1WCUA 2DVGA 4PIXA 5FZ3A 4BZ4A 2SLIA 3DPRC 2VCBA 2ENRA 3LA2A 1Q8VA 3OEAA 1UMHA 2WJSA 2A3WA 4ITCA 4MXVA 5CFDC 2JICA 3V0BB 4XE9A 2WZEA 3NNLA 1HXS2 4RHV3 1MACA 4QU1A 4NUBA 4V2VA 3WNNA 3RYPA 5HBAA 3MIDA 3BB6A 1VAKA 3O0VA 3NW4A 3OYWA 4IV1C 4R9DA 2XBO1 2ZEXA 1FYUA 2FBEA 4MYEA 4XABA 5F2SA 4UFIA 1B35A 1ZVFA 5GALA 1WW5A 3RRDA 2XJVA 3KV5A 3E6CC 4OMDA 5DQ0A 4NIGA 1REFA 2E6VA 3WNLA 4M00A 1PK6C 1BK0A 5FYTA 2GNMA 4FFIA 4KWKA 3CNAA 1YFWA 1ONAA 1ZZ6A 3PUHA 1ZX5A 3OBAA 2XLAA 2XB6C 2W47A 3CIHA 3ZFEB 1QU0A 4BJ0A 5ANNA 3ZFFC 5FR3A 1DLLA 1YYNA 5BNPC 5IVEA 2PHRA 4AVVA 4Q1RA 3DXUA 4BQWA 5DDJ1 3LZZA 3AKTA 3NJXA 1IPSA 1PMJX 5FZMA 1PNFA 3PTRB 4CUGA 4WV8A 3VV1A 3KQ4B 3DPRB 4D94A 3HQUA 5JCTA 2B46X 5ABJB 3HNMA 4AQSA 2ZGNA 2VC9A 3GXUA 3O1SA 5IYYA 3M4FA 5D8AC 5FZHA 2JXAA 3MW2A 4NHLA 2VQTA 5FY7A 4BB3A 4QPYA 4MHRA 2Y0OA 1PO22 2JDAA 4CDUC 1EUTA 3MBWA 3ZO0B 1WZXA 1RUG2 1JUHA 2PLV3 4LBKA 2GC1A 2ZGSA 1DGRA 4BQ4A 4JGZC 3N35A 5F1RA 2R042 2W9XA 1PNGA 3AJZA 3RDIA 5BY5A 2Y6FA 4DNYA 2G19A 3LKJA 4TZDA 4GJZA 3VDAA 2E7QA 1RUF2 3AZVA 3R05A 1VRH3 4DOUA 5BNPB 1QXRA 2NQYA 4K3UA 5KWRA 1L7QA 2GSYA 1O3SA 1AL22 1OURA 1L7LA 4LNVA 4FOQA 2FCVA 2ZEZA 2WZR3 5CKMA 4QQLA 4JKLA 1YQ6A 2DU1A 1Q8SA 1Y43B 2OW4A 3A21A 3OOXA 3KGLA 4Q4X1 4TXWA 5GJ6A 5KXBA 1GNHA 2F17A 4EYUA 2YDEA 3T2TA 4GMP3 4LO5B 2FZ2A 2PHWA 1VBC3 1WW6A 2PQQA 2ZACA 3DYMA 1U0AA 4DUVA 4FXGB 2R073 1KS5A 3S30A 1ULGA 1QJZA 2R043 3R6SA 3RGBA 4ARXA 5ACA1 5BNQA 4BQYA 4IEVA 2R6QA 5FYBA 3UNPA 2ZPXA 5JZGB 2Y6KA 5CISA 2VNVA 1CGPA 1ZBA3 1N3QA 1VRH1 3HWJA 3ZXFA 1FI2A 5K0UB 2ZX2A 1U5ZA 1HB2A 5F3EA 1RJ7A 2NM1A 4XEZA 1EAH1 4A3XA 1SZBA 4BK5A 5A33B 5FK8A 1Y9GA 4RS5C 4MX3A 1FATA 2O8QA 5KHJA 5KHGA 1PO23 2WQ4A 2R0FA 3H7JA 3LA3A 2WNUC 1QNYA 5EHDA 1C5HA 1VBA3 3SCFA 4GMP1 3ASIA 5JOXA 2UYAA 3EHKA 1RUJ2 1PZ9A 3AKQA 3N9OA 1YCIA 1COV3 3DL3A 1UYZA 2HWB2 3AZXA 4IV1B 2ZEYA 3ATGA 4MV2A 5C6CA 1LOEA 2YPJA 3EO6A 2Y6GA 3USUA 1Z78A 3C7HA 3MPPG 2ADEA 4QKFA 3ZSLA 2RS12 2WN2A 5A32B 1UXXX 1NZIA 1U5YA 1JHJA 2WFPA 1FPN1 3BIWE 3VBRC 2BOJA 3ME2A 4LTAA 1D0GA 2PA7A 2X5IC 1R64A 3PMEA 4DQAA 3FHIB 3WDXA 1JZ3A 3KHBA 3VBSC 1TEIA 5A7PA 4CCEA 1HB4A 1W99A 3NAPA 4WVMA 3LDKA 1XNKA 4C90A 1NXMA 1WBFA 5C4WC 5C4WA 1LODA 4HANA 4BMEA 4ORFA 3AKSA 5BNPA 3ZFFA 5DAXA 1PIV3 1AUYA 4AVSA 5F3GA 5FCCA 4PF5A 1S0DA 1DQ2A 1HRV3 4NVPA 3H1WA 2K46A 3MIFA 4XF0A 1F4AA 3E6DA 3DV8A 4O7XA 2W39A 4YW6A 5FWEA 4DEQA 4NHKA 4D69A 5FMBA 3WR0A 2RMU2 1RUH2 2Y6LA 1POQA 1JI6A 2WWJA 2OT7A 1S4CA 2ATFA 1SBFA 5FZ7A 3HIFA 2HJIA 2ZGUA 4R8HA 4CCJA 4QKBA 3LE0A 5FP4A 3RI8A 2HEVF 3U78A 1AR63 5C70A 2HWC3 4L0PA 3NV4A 1I5PA 2BNOA 2BVVA 4HXCA 1B09A 3MIHA 4CEYB 2DCJA 4NPLA 4R9AA 3RPQA 1WMDA 3POSA 1NE6A 1BYHA 4GXLA 4Y24A 1RMU2 4W8JA 2I74A 3SMHA 3E5XA 5EZWA 4JKMA 1TME3 4ZS3A 4URAA 1PM7A 1ZBE1 3DPRA 1VBD1 2RDQA 4LBLA 4NIAA 1O3QA 2VD7A 4AGRA 1O3RA 4R52A 1RUH3 3A7QA 4CUBA 4XFGA 1GOFA 2PYTA 1FOD3 4COWA 3ACLA 5FYZA 1NZCA 3ZXDA 1CESA 1BHGA 1O4YA 2WO3A 1OHFA 5K0UA 3VDCA 2XVGA 2IVIB 3EXUA 1V6IA 3OGSA 2O14A 4M4PA 3RZMA 4XF1A 3LFMA 4BCUA 3UKVA 3ZYBA 1NA1C 1XJAA 4YG0A 3K4DA 3JD73 1X82A 1MS3A 2ARXA 4IE4A 4RYDA 5JOZA 2G9FA 1XPWA 4IEZA 2ZHLA 4JRAA 4L11A 4PQ9A 4XAEA 3K51A 1H8TC 1W9YA 3FUQA 2ARCA 3GALA 5FLIA 1AX2A 3PVOA 1W8WA 2JENA 1ZRIA 3TAYA 3AKRA 1D2QA 4M0NA 1GNYA 4P5HA 2RM22 3MEPA 4DY3A 5I0DA 2CV6A 3R4UA 3MF6A 4MOAA 1XNTA 3EB7A 4IE0A 2JDKA 3W20A 2P4EA 3PHMA 4JGYB 1SHWB 4Q1PA 5FO9B 3V0AB 4I2OA 5APAA 2DCZA 2RDRA 1NY71 4L97A 3ZDVA 4LK7A 3FJSA 5C8CC 4JHZA 1NCQA 4S2DA 5T54A 2ZBJA 4LORA 1JYVA 3GNEA 5DZFA 4PT6A 1JH5A 2GN3A 3WP5A 5FXVA 4EV0A 4NJ4A 1KS4A 1IKQA 1A34A 1X33A 2TNFA 4JTNA 4AFBA 2VJXA 3U11A 1GANA 4YVWA 5FXXA 1N3PA 1W06A 5LASA 2DF7A 3D5OA 1KITA 1Q43A 1V70A 1REEA 4XXPA 1YIPA 3VHPA 1OA2A 2WKKA 2Q4SA 1HQLA 1OXCA 1YO8A 4AEJA 2WYFA 4WVZA 1V00A 1LESA 4C0BA 1WA4A 5C9AB 2GMEA 1AR81 2VZQA 4K21A 4QX0A 1PVC2 4DXSA 5DN2A 2W92A 1F4HA 4XJAA 4QB6A 2RR12 1AXYA 1EAH2 2JG8C 4FAHA 1QJX2 2Q8OA 4KBZA 3WNKA 5FFOC 1W8ZA 4LKFA 5L7OB 5CNAA 5IVJA 4QXCA 4XBLA 3GZTB 5HXVA 4HVQA 2O1QA 1ND3A 3K75B 2QVSB 4HVRA 5FK7A 5A32A 4R4XA 4UT5A 1G8WA 1OBNA 2QQPA 5EWSA 3T0DA 1Y9MA 4CEWB 1BXHA 4XFHA 2IFRA 4CTEA 2HWE2 2MEV3 4B4PA 2ZGOA 3BU0A 3I3QA 3LOBA 1G6NA 3VKMA 1ULOA 1W8NA 1YIFA 2ZTNA 1RUH1 3OBTA 2XWJB 5DG2A 1QJY1 4JDMA 2PHLA 3AP5A 1OA3A 3AB0A 4L8QA 5DUVA 4YZ2A 3M3CA 1DIWA 2P3KA 1SACA 1PGL1 5J96B 4CPBA 4V1PA 1MQTA 4INDA 1RITA 5B2GB 1QJY2 4XJUA 1QEXA 4Y26A 2PQSA 2VZRA 5C3OA 2VUAA 2FDHA 3IAQA 4Q4W1 3RZHA 4CRQA 1O8SA 1OA4A 2B42B 4W6XA 2JG8A 3VBSB 4LE3A 3WLUA 1G9BA 3OGGA 4XF4A 3TEZA 5FZ1A 1O8PA 4K8RB 2HBUA 5LRRA 2P3YA 5A33A 2RS31 1C8M3 1B35B 1G9CA 1W6MA 1RHI1 1SFPA 2WA3A 2WABA 1BK1A 3CO2A 1PO21 3I59A 4BQXA 5CA6A 2G4IA 2X5IB 1J3QA 2RJLA 5FMOS 3M7AA 5FKCA 1D2SA 1UOBA 1UZYA 1RIRA 1XNAA 2PLV1 2D5FA 4XTPA 2ZHMA 3I3BA 1XQNA 1S0FA 4AEKA 5BNOC 3O1UA 2J1TA 2Q30A 2JDPA 1QJU3 1DGRN 3JQWA 4L92A 5FY0A 4FPHA 2J1VA 4PQQA 4GULA 3ZKUA 4P9IA 5A80A 3DF0A 2AH2A 1K3IA 5DUXA 2HEWF 4BQ3A 2LRPA 5LZ6A 2P34A 4M3CA 2CDPA 2ORZA 3MIBA 5C8WA 4EZHA 3ZYPA 1AR71 1ND3B 4B7KA 1LHOA 3POIA 2UWCA 2EF6A 4YM0A 1MVEA 2JE7A 4CA9A 3BTXA 2XJTA 1RHI3 4K20A 2BP6A 3IAPA 3LEGA 4FTSA 3SEEA 1VAMA 1UY3A 4E2GA 3CJIC 2VO5A 5JPMB 3S5QA 2VULA 1TVGA 1R1A3 4H7MA 1KDMA 1BEV2 3DEMA 1W8FA 4IUGA 4KMQA 5FZFA 4TN7A 1US3A 4WVWA 1XE8A 5HPOA 1Z7S2 5A3MA 1DZRA 1ZYBA 2OPKA 2ARAA 2O0OA 2RVAA 3AZWA 4YG6A 2G1MA 3R0RA 3VD3A 4XMIA 1VRH2 1BKZA 3WDVA 5JIAA 2P37A 2VU9A 1ZZ9A 3F95A 3ZXLA 3S0MA 3H8RA 4MHUA 1SFYA 3ILFA 5A7SA 3VDDB 3K48A 4XHBA 1QY4A 2VZTA 3VBUB 4A3ZA 1JYIA 2XJRA 1PO12 4N53C 2JKXA 4TTGA 4D7TA 3J4UH 1R091 4MSVA 1KGYA 4J6GA 4X6QB 4DEVA 4XFFA 4LK6A 2R072 5ANQA 4YVWB 5D21A 3PTYA 1O6UA 2ILMA 4XZUG 1H30A 5FRAA 2VE1A 5B4XA 4JV4A 2X05A 4QQPA 3GJAA 3RYKA 1AR83 2UURA 3B5LB 4GB32 3D3AA 4IEUA 4OVEA 4FBFA 3D6EA 5JSOA 4DUXA 5ABJC 4K8FA 2Y6JA 2WC2A 3APBA 3D8CA 4Q4Y1 5FMDA 5BNOA 2FDGA 4XYXA 3L2YA 2W68A 4LHNA 3LGRA 4CDXB 3T4VA 1UYXA 2YG0A 3DKWA 3ACIA 5F6LB 4EE2A 5FTTC 1W0OA 2XJUA 1RUG3 1VAVA 2EXHA 1WUVA 2OUHA 1XOYA 2WUHA 5L7OA 1LHNA 1PMIA 5A7OA 2WNEA 3LIGA 4Q0QA 2RS33 1T6BX 4HKLA 1UYYA 4ASMB 2RDSA 2BFUS 2QQLA 1UCXA 3VKNA 4XDQA 3ZR5A 4EROA 5H9QA 1IQDC 1RJ8A 1E5IA 2JD4A 2RS13 2WO7A 3GYDA 4EWEA 3E6BA 4M4RA 4TYSA 1FT9A 1VRBA 1W90A 3VBFB 4CCDA 4OMCA 1R083 2TBVA 2Y64A 3N7JA 5GM0A 3HVDA 4BHPA 5I0SA 4K9SA 2BPA2 4PF1A 2D43A 2GU9A 4M01A 4AEMA 1OD3A 2XQRA 4HT1T 1G86A 4XJ9A 2JWPA 1JZ2A 3WW2A 2EXIA 2PHUA 3NVCA 4XCBA 5FZIA 4OUEA 3M3QA 4Z82A 2WT2A 3INAA 3EMRA 4OI4A 3E1F1 5IAXA 1S0IA 2B39A 4DS0A 2CAUA 4QHOA 2DWRA 4YM2A 2VTXA 3FC0A 3MV11 1PVXA 4Y4RA 3T30A 2YHJA 2WWSA 3J7LA 1ND2C 1QDOA 2BWAA 2ARBA 2W1SA 1K5MB 1A6CA 2D6KA 2WNOA 3VBOB 3S5AA 5AVAA 4E4SA 3B01A 1W0PA 4GAZA 3UESA 5J09A 1AL21 4EJRA 4FOVA 5FP9A 3IWZA 4ASKA 2Y33A 2VZPA 2YC4A 3Q8BA 4RS5A 4HZFA 3ROUA 3TWIA 3GJBA 2DVDA 5ACA3 1WD3A 4N9IA 4E27A 1KEXA 2BGPA 2CY6A 4UFKA 1YUDA 4QXHA 1ACCA 3Q9OA 1W0NA 2CTVA 4U2AA 5JZGC 4J25A 3J7MA 2WFF1 2VOWA 1POV1 3IM0A 5T5OA 4XMAA 5C5UA 1NT0A 1U5XA 5FJKA 2D44A 2WAAA 2DFBA 5FY9A 1IS5A 2OIIA 1LHVA 3HQRA 5GZCA 1Z7S3 4XIKA 2JDZA 3TOJA 2J1SA 4IGQA 3OTFA 3HN3A 4EWDA 5CBLA 4NIHA 1CPNA 3H50A 3POBA 4G3YC 1JYCA 4P9WA 2WZR2 2VXRA 4WM8A 1BZWA 1ODMA 3WG3A 2IXJA 2VMGA 2ETEA 4NAMA 1GZTA 1OQDA 1OOPA 1QNWA 3UT0A 1GQHA 3N9NA 4XFAA 4P9LA 1AF9A 3LAGA 1UPSA 4Q4Y3 2DV9A 4AQ2A 1US2A 3DYPA 3RWNA 3SEPA 2D98A 1K5MC 3ZYIB 4EN7B 1FV2A 3ZN5A 1ULCA 3CLPA 2V5DA 3I97A 3LQCA 5JI9A 1EP0A 1PO11 5LB6A 4OHVA 3HNYM 2X8KA 3BODA 1DFQA 1BLZA 5T55A 3SKJE 3U75A 3GHMA 4FFHA 1LULA 4XUQA 2JJ6A 4XFIA 2J22A 4YVSB 1J59A 5FWJA 2Z69A 3VDDA 4N9HA 2QDRA 2OXBA 3FL7A 2UY9A 4OZOA 3BTYA 4D0QA 1BEV3 1H2MA 4JDNA 3T1LA 3O5SA 4OULA 4RR3A 3VZNA 3VZLA 1W6PB 2ZS6B 1W6NB 2IXKA 5FJHA 3W59A 4E8DA 4FAGA 2A70A 5HXMA 2J1RA 2D5HA 3U0ZA 5K0UC 3VD5A 2RR11 2VXJA 1CAUB 4XXAA 4OHYA 5FPAA 4LUMA 3ZYJB 5BUVA 2G9GA 3M3IA 1PVC1 3DXTA 4KU8A 1NLSA 1ALYA 4ISRA 5LBEA 5A7WB 3M3EA 2RMU1 3M8LA 4ASLA 5JZGA 3ACHA 4IEYA 5IW0A 5M0TA 4XC9A 1XNCA 5FYVA 3VZOA 3MGUA 1Q8QA 4L2NA 3JD72 2ZAHA 4WVVA 2XLGA 2R0HA 1RUI3 5CZKA 3UJQA 2XUMA 1HIXA 2DFCA 5A3TA 2CL2A 3BOWA 3S7EA 2AREA 4KH9A 5IVFA 4LBQA 4PHZA 1GWKA 1FMD2 2EA7A 2PTMA 1DQ1A 4WZFA 2W1UA 3RJ2X 2QQIA 3VBRB 3I8TA 5KR7A 3I7DA 1JXNA 4QGMA 5GZFA 4A41A 3SLIA 2KR2A 2DDUA 3H3UA 4FFFA 1MQTC 4C0HA 5I0RA 1E57A 2N7GA 1W9TA 1C8M2 2NMNA 1FV3A 3RS6A 1WLCA 2EVXA 3FLRA 1WLTA 3CF6E 4MADA 2RM23 4META 4PLOA 1VBB3 2HKXA 4EZ4A 2QUOA 2V5YA 1HN0A 1SBEA 2VG9A 5G04L 3SQOA 1YQ5A 5CFCC 4XOGA 4PIYA 3AMHA 3CQOA 4B29A 4HK8A 1SPPB 1C8M1 1SDWA 3MUY1 4M0HA 1UD1A 2JG9A 3WW1A 1X8EA 2ES3A 4CP9B 5HI0A 4HBNA 5T52A 1W3VA 4OQ9A 4NN0A 2E53A 3CDZB 3WDUA 2QFEA 3BTAA 4LJHA 2XOMA 2UYBA 3AL5A 4Q26A 3OY8A 4XUNA 5FYSA 3N4MA 1ZREA 1NYWA 1W6PA 1VR3A 4BIOA 2PLV2 1PHMA 1HKDA 1WCDJ 2DUQA 4FCAA 5JVVA 1SLBA 2BBVA 3VBFC 3FBYA 2VZSA 2YUEA 1APNA 4XUPA 2HBTA 2J1EA 4NMIA 3RZJA 1SFNA 5E16A 1GMMA 1UOGA 2YBSA 3H1MA 5H9SA 5LBBA 4M3CF 3NAPC 1RL3A 3D0JA 2IXCA 2VZOA 3CEWA 1RUG1 4JQRA 3J7HA 1WLWA 4LKSA 1R1A1 3H8UA 1COV1 3TB0A 1YQCA 4QX7A 4C8DA 3WNPA 3USUB 2R1BA 4AXOA 1FNYA 1GZWB 1W2UA 3I59B 2IXIA 2FQPA 2A71A 3HJRA 4S2GA 5BYNA 1C1FA 1OSGA 3W5NA 2VZUA 5CG9A 3V65A 2HWD3 4N53A 4WM8B 4AAXA 1V6LA 5AC93 2YPDA 2H6BA 5C71A 1URXA 2F4PA 1KFXL 4HKOA 1ENXA 1OVSA 1O5UA 1CR7A 4K6BA 1RVF2 1KXGA 2XQXA 4LHKA 3C2UA 1SQ4A 3PU8A 4AF9A 1T2XA 3KVAA 2GH8A 4QKNA 2GNBA 3OG2A 3VKLA 4Z8BA 5J7MA 2B4KA 2JG9B 5JPNB 3HT2A 1E5SA 3ENRA 1JZ7A 1UNBA 5JXHA 4N90A 4I09A 2PMWB 1QDCA 1W8OA 2HYKA 3H3LA 4YG3A 1JZ6A 4LHSA 4QM8A 5LY2A 4GIQA 4Q0VA 1UN1A 3ZDSA 2YFUA 3OD0A 5FZ8A 4A42A 2RS51 2D97A 2XHKA 3T2OA 4B3NA 4CEYA 2R1DA 2ZZQA 2QNKA 1Y7BA 2C5DA 2HWC2 2BW8A 4NRQA 4QPWA 4AI0A 2VNRA 1PVC3 5LATA 4EN9B 4CDWA 4OYUA 2BVBA 4QB1A 3WG4A 2NLRA 2Q1MA 5CG8A 3KV9A 4XDPA 4AGGA 4JTOA 5I8YA 4QX1A 1VMFA 1F5JA 3HR9A 3UGFA 1NCQB 4AW7A 4UI9L 1CWPA 3LPFA 4LEJA 3MV01 2VMIA 3MO4A 2A73B 2Y6HA 4AVAA 5LBFA 4I0BA 4LKEA 2BDRA 4YM3A 4LULA 4AQ6A 2Z79A 3OJBA 1AYM3 1F2NA 4GWNA 1H6XA 1JYWA 4NPMA 4XURA 3KGZA 5FZCA 3AYDA 1GQPA 1OT5A 4B1MA 1W39A 3POEA 4PCRA 4S2HA 1PIV2 2CWMA 4IEWA 2YMZA 2NZ9A 5LA9A 5FUIA 1P8JA 2GN7A 1AR92 1QOOA 4I0AA 1CX4A 4Y1ZA 3U1XA 3M3OA 1UOFA 4YVSC 3WNMA 3AP4A 4CZSA 3K77A 4J1WA 3ZFEC 4FXKB 1OPOA 2XVKA 1ZBE2 2Y8KA 4QGLA 1NX9A 1CAXA 1DG6A 4KQ7A 3AMQA 4GQ7A 1H1MA 5DZEA 5FPXA 3WF0A 1UIKA 1UF2C 3MFCA 2R062 4QDRA 2A6WA 4MLOA 1TMF3 4XACA 1AYM2 1JZ5A 2JB8A 1A8MA 2R30A 4S2FA 2BV4A 4HFSA 3WOGA 1OFSA 2F4LA 2EIEA 3GBGA 2WR9A 3WINE 1AR72 5L9RA 3NJYA 2P2KA 3JU9A 3ZXGA 4COVA 5IVVA 1GICA 1NAEA 5T5JA 1WMFA 1PGW2 2F6BA 5CAZA 1BVP1 5IK5A 4LO4B 2B7YA 1ND2A 3LB9A 3VBHA 1UMIA 3WD5A 5EP9A 3JQXA 4AEDA 2GMMA 4XIOA 5F5CA 4AEDC 4CDWB 3IZOA 2VH9A 4NRPA 1C8NA 2RHPA 2WO1A 4W65A 5FAXA 2YXSA 3ACGA 3IDBB 1QH7A 2JDHA 2OZ6A 3ZYFA 1Y3TA 4NIIA 4Y5Z0 2W52A
chains in the Genus database with same CATH topology
1H0BA 1KJLA 1H9PA 1HW5A 1NY72 3D4KA 1QF3A 4NWWA 3VBOA 1C1LA 1N1YA 1S2KA 4P9GA 2X5IA 4HPKB 2RJKA 3VBRA 4GA9A 2JECA 2A75A 1AX1A 4AE2A 1QJU1 1N47A 3IKWA 4NO4A 3IPVA 2IFWA 4RD7A 3SH5A 4GH4A 3VHRA 3ZMNA 1AZDA 3ZXAC 1HV0A 2PAEA 4RR3C 1ZBA2 4Q0PA 2D6OX 1HRV2 2QDNA 2GC2A 3MW4A 5GLTA 1LHUA 1IKPA 1V6MA 1ZBE3 4BIFA 3AYCA 2NMOA 3LOIA 3H0OA 1RUOA 1HQWA 2R063 1KD7A 1MR5A 3FE5A 2JKBA 4N43C 1KDKA 1UIJA 3WUCA 4ES8A 5I91A 3S6PA 5D1IA 3ZMOA 1Q5OA 2IXHA 1REDA 1FPN2 4ZXKA 4RHV1 5I8TA 4QPIB 2OVUA 3IIAA 1IHMA 4BA6A 3IDCB 4CDQB 2PHXA 3KQRA 1YFUA 4AI3A 4GH4C 3CU7A 1TMF1 4FPGA 2W0XA 5BNOB 3HQXA 1QJX1 3DUIA 1PIV1 4QMAA 3MLLA 1WBLA 1NCRA 1W6QA 2MPFA 4GKXA 2HWF2 3AP6A 2DUOA 4PDWA 3B69A 2AGSA 2HWE1 1VBB1 4L99A 1LTEA 1O4TA 1PGSA 3WP6A 3ZYGA 3ELNA 3WQ7A 2DCKA 1MS4A 3SNMA 2X29A 1CAVA 2HWF1 3QH6A 1RHI2 4JDOA 1V9U1 4K1ZA 2H0VA 3SCGA 3J8F3 3VBHC 3KT7A 2D7FA 3BCWA 3W58A 4COZA 1RB8G 3AYAA 2HWE3 2MEV2 5F6KA 5CFDA 2VQAA 3E5QA 4Q4X2 2Y26A 3FLTA 4X8PA 2QKDA 5IK4A 2UWBA 3NSTA 4A2UA 3FZ3A 2C9AA 3UJOA 5JSPA 3HAGA 1O3TA 3G6JB 4RSUA 4YZ1A 1ND2B 5T5PA 1FNZA 4LA2A 5T5LA 2QCSB 4YRDA 4KL1A 4YW5A 2WNVB 3ZPYA 3AXEA 5JDBA 4AQTA 4AI8A 3JBG2 3EQEA 3C3VA 2IXLA 2WSVA 4ZU5A 5CVRA 2ZX4A 4QPIA 1LOAA 4LR4A 2VGDA 4EWAA 4Y22B 5FO8B 2FMDA 2RS52 3ZFGA 1ULFA 2AR6A 1XYPA 4XJWA 4COYA 1BMV2 3SXWA 1AYN1 4UBGA 1QOSA 1MS8A 3PVEA 4OUSA 2OYZA 1JOJA 2H6CA 3TRSB 1OMIA 4FQZA 4AVCA 1VBD3 3ZVXA 1OOPB 2LALA 2Q5TA 4K7JA 1KQRA 1XU2A 5GLUA 5SV5A 4CDXA 3KB5A 5J98B 4RQPA 3VUOA 4ZU7A 1QKQA 4XBQA 2HWD2 3AM2A 4XZPA 1RUJ1 1WW4A 4XHXA 4CDQC 1GQGA 2DCYA 2ZJCA 5KXDA 2CGNA 5CFCB 3ZIWA 1SLTA 1MQTB 3OCPA 5GKAC 1UU4A 2ZGKA 1LOCA 3TN91 3ZFFB 3VKOA 2H0BA 1NQDA 4RR3B 2PAMA 4HKWA 1FAYA 3KCXA 2E63A 4AI2A 3PJQA 3WDTA 3ZXJA 3POWA 5HCBA 1R093 3W9AA 3G7DA 2LTNA 1ZZCA 4YYOA 1RINA 2X53S 5DDJ2 3WNXA 4OI1A 2OZJA 3THPA 5LEKA 2ZGPA 3NV3A 3AP9A 4ATEA 1OKQA 2EAKA 4RHV2 2XPJA 1UMZA 2BNMA 3N7LA 3NV1A 3WW3A 5KXCA 4YZ4A 1SLLA 2DVFA 2Z2SB 5JAXA 1S2BA 4MVTA 3L2HA 3RQ0A 1OLQA 5EV7A 1K5MA 1MZ5A 1DHKB 1TMF2 1CAUA 1A78A 3BU7A 5F9TA 1WD4A 2BQPA 3POYA 1XU1A 2VUJA 5HCFA 4BH9A 5C33A 2XWBB 4YFZA 2D6PA 4BWOA 2GC0A 4WM8C 1QQP1 1VBA2 5D8AA 4YW4A 1VBD2 3AMPA 1YRZA 4F7ZA 2KA3A 3ECQA 4Q4X3 3UKNA 1O4ZA 3RI9A 3ZIXA 1F31A 4R9CA 1S0EA 2O8OA 1B35C 3CL1A 2YGMA 1CN1A 1ZRCA 2DURA 2D3RA 1FMD3 1TNRA 3V56A 4SLIA 1VBC2 2DCTA 2JG9C 4ATFA 4I02A 3WX5A 1VALA 1W6OA 1POV0 4KG0A 1NXD1 2KXLA 4RFT0 1CAXB 3O12A 4RQPB 4BYYA 1CJPA 4EN0A 4P9XA 1YWKA 5CADA 4HN1A 3MLKA 4BOWA 4NWVA 3FFQA 2HEYF 5J36A 1J58A 1RUF1 3LWCA 4JGZB 4K40A 1R1A2 2WNVA 3J9SA 3CJIB 4IEOA 4DRRA 3KMHA 3UV9A 3T1MA 3WT3A 5H9RA 5J37A 1LB2A 1AJOA 1OD5A 1POV3 1BJQA 4NOTA 1GZWA 4FO9A 1H4HA 4RA0A 4E9KA 4R4ZA 4D7SA 1IQAA 3O14A 1TME2 3MI8A 4PBPA 1RVF1 2PFWA 2ZGTA 1DBNA 1M4WA 3JBG3 4IQPA 3WP3A 3ZSKA 5K7PA 4KWJA 3ZFEA 5DZGA 4CP2A 2R071 1U5IA 3LA7A 5LEJA 2A3YA 2WLPA 5EFUA 3QBQA 2VECA 5FQ0B 1VLNA 1AVBA 2P3IA 3LCPA 1HQNA 5C8CA 3GBFA 2XH6A 2A5ZA 3SH3A 4H14A 4I3PA 1GV9A 3P3PA 4PLNA 4LBQB 4RGGA 4E4DX 4LO8A 1DYPA 2GC3A 1PGL2 3WCSA 5T50A 4CP1A 1S55A 2ZMKA 1ZZBA 4Q4V1 3MYXA 3UL2A 1R092 2ZMNA 4JCKA 4A7ZA 3ZN6B 1D0HA 4YGBA 4E4ZA 1N3OA 2GZWA 4JAAA 4CDUB 3QACA 4WM7C 3E5UA 4CDWC 3DGTA 3V0AA 4FPJA 1NA1A 3VHNA 1SLAA 1FPN3 1BVVA 3O0XA 3PVNA 3WVJA 3N3HA 3MZHA 4KNCA 4XQDA 1MEC1 3BALA 3VBUA 1H8TB 2BGCA 1W6QB 1VBB2 4MGYE 5TSWA 4A7KA 4DINB 4OHWA 3VBOC 1PO13 1XYNA 1XYOA 3WW4A 4CEWC 2SBAA 2XJSA 2OA2A 4MGZE 1UW8A 2E7TA 3NJZA 1A8DA 2K2SA 4K1YA 1XRUA 1XNDA 4QU2A 1NE4A 2WA4A 1ZZ8A 4FPLA 2Y38A 2Q1ZB 1AR62 4RQPC 1UZZA 1AYM1 4WZCA 5EYYA 2QE3A 1VB4A 2PAKA 1BCXA 4QT6A 1T6GC 3GHNA 2VNOA 1EV11 1ZA4A 1WLDA 2PHFA 1Q3EA 3JUUA 1KJRA 3PVBB 3GF6A 5H9PA 2ET1A 4Q4W3 1QGLA 1LECA 2RE9A 3MFAA 4WVMB 1CAVB 1VB2A 2B45X 1YJLA 3WDWA 2WZR1 3IT8A 4LT5A 2OUJA 1YFYA 3RG0A 1GBGA 3ETQA 2JE9A 3RNSA 3U4XA 1SMVA 1VBC1 1DDLA 2Q0AA 4C91A 2ZKLA 4W6YA 1IS6A 2D6LX 5GLWA 2ZOEB 2IC1A 3HT1A 2WQZC 4YVSA 1COV2 5E89A 3PLQA 3ZN6A 1ASJ3 1IS3A 2RM21 5JR7B 3TN92 2JG8B 2WINB 1H8VA 1WMEA 5E1RA 1AR73 4PLMA 1YXWA 4C1WA 5LK7B 2YYOA 1S0BA 2YZ4A 1RUI2 4Q0SA 4YW3A 1QWRA 1H2NA 4E2QA 1RGSA 4UW3A 5AFEA 3KM5A 1HRV1 3WG2A 5ABJA 1SLCA 1UAIA 3AZZA 3KS7A 1MZFA 2FHRA 2E51A 3MW3A 4IERA 3FBMA 5IUQA 1UX6A 4FVVA 4LUKA 4EN8B 4LO6B 3EBRA 1LHWA 4PIZA 1HXS3 4DZGA 5CB7A 1V6NA 4BE3A 1MEC3 1IPKA 1LGNA 2VOXA 3VHOA 2V09A 3AYEA 1QOTA 2D6MA 4AHZA 4Q8KA 2XBO3 1LRHA 2D3SA 5C8CB 1DQ0A 1DQ6A 3WQ1A 4XPVA 4BPZA 5GZDA 1ZRFA 2A6YA 2ZABA 3AX4A 3M2MA 4AVTA 3CJXA 1J3RA 2Z42A 2I45A 4N43B 4AI1A 4LA3A 1NCRC 3VN4A 2UU8A 4YVWC 1D4M3 3P3NA 3AKPA 1JN2P 5KC5A 1F5FA 3KZ4C 4Z07A 1SBDA 4CDQA 4XJZA 1OI6A 4JGYA 1KFUL 4JGZA 1JUIA 2ET7A 1MEC2 3I54A 3QH7A 1LGCA 4OFGA 1LGBA 4AYUA 1NA1B 4OI2A 4QPGB 3HMYA 4D7YA 4J1XA 2WIIB 1ULDA 1JBCA 2D93A 4PJYA 5K8SA 1JTZX 3JD71 1OFNA 2XLFA 4QXKA 1A3KA 1V6JA 2YC0A 2CYFA 4HLTA 3OY8B 2KM2A 1C4RA 2WFF2 1GFF2 2Z5WA 1LOFA 1GKBA 1ZRRA 1G9AA 2VY0A 1R1ZA 5EXOA 1VIWB 1SCSA 3MDPA 5L36A 1FX5A 4Z2WA 1QQP2 1VBA1 1RUJ3 4DMIA 1EY2A 2WS91 2RS53 1OOPC 1NCRB 5D8AB 2GAUA 4Y1UA 2XKOA 1MS0A 3WV6A 4X8NA 3MF9A 5E8AA 3VBFA 3V64A 3WDYA 3H9AA 1XE7A 4WM7B 4FOWA 1YNAA 2QZ2A 2PN5A 4N7UA 2ZAAA 2A7AA 2ZGLA 3ILRA 1S1AA 1Z7S1 3AZYA 1PGW1 3RMXA 2WL1A 1S0JA 1C28A 2EXKA 2VVDA 4M3CE 3WQ0A 2ZX3A 3EJKA 4HL0A 1G9DA 1AJKA 3AK0A 1AYN2 1MZEA 2A3XA 3FUOA 1LJ7A 4FPEA 1H9WA 4XF9A 4GWMA 1AHSA 2MNGA 3R4SA 2WSUA 2XJPA 4BQ1A 1IZ3A 4ISQA 4L9BA 2PHTA 1RC6A 4O9EA 1ENRA 2WNVC 4F8AA 4QPGA 2VW1A 1RVF3 4FOYA 3H7YA 1I9RA 4LLOA 5JLVA 3WXPA 3I2DA 1QQP3 2UY8A 4Q4Y2 4B7EA 1TME1 2ZGMA 2DVAA 3ZFGB 3KLSA 1S0CA 4PDWC 1HV1A 1G7YA 2XBO2 3NO8A 3QOPA 4RS5B 1ZRDA 1FOD1 4PBOA 4DY5A 2RS11 5FOBB 4Q29A 2WNUB 3VBSA 3VL8A 1UPIA 2WT0A 4RGAA 1CONA 1LOGA 1MS9A 1QXPA 3ZSEA 4UXAA 4Y1VA 3VBUC 2DTYA 3KSCA 4XFBA 3SISA 1GZCA 4Y22A 4OLLA 4B4RA 1FXZA 2NP0A 1DF0A 2C1FA 4Q0UA 1W6MB 5SV8A 1OQEA 3AJYA 1Q8PA 4FTEA 2VMHA 1N1TA 3L9JT 1ENSA 2R32A 3R4DB 2DUPA 3VDDC 3J26N 3MIGA 3V0BA 4AK3A 1IPJA 4N53B 3ZYRA 5C4WB 5AC91 2K0GA 3N7KA 4N43A 1G9FA 3PMSA 4LO7A 1AR61 4U36A 4GALA 4Y1XA 3MLJA 2HWB3 2R16A 3MPBA 3SITA 3VZJA 4BMBA 4YARA 4LBNA 2EAAA 2DVBA 2GNTA 4H7LA 3B9CA 3VLBB 5CFDB 4FSJA 4CYDA 1YJKA 5LRSA 4YLZA 3A0NA 4IL7A 4FT8A 4Q2FA 3U10A 1I1EA 1R082 1ZNPA 4IV3C 4AEDB 4LBMA 4MGIE 1W6NA 4FQ4A 4GKYA 4NR1A 3BOPA 1UU5A 2C0ZA 4BM8A 5FOJB 4P14A 2ZMLA 2B5HA 2JX9A 3MICA 1CAWB 2VPVA 5GZEA 4XQ4A 1OQ1A 1MS5A 1DU3D 1DYKA 4XBNA 4YW2A 4I0WB 5HCAA 3ES1A 5FO7B 1EPZA 4HSLA 5EJ3A 1C57A 1SLIA 5IK7A 5K9YA 3JBG1 4HPKA 3RMYA 4LLFA 4IESA 1DGLA 4FPOB 3O0WA 1KRIA 1QJX3 2ZGQA 4QPGC 1YHFA 1WCKA 2XL9A 3WY6A 1W6OB 4N7IA 4ES9A 1GZ9A 2XVLA 4TWTA 2DTWA 1V6KA 3D0SA 2ZHNA 4UBHA 2ZGRA 1H2LA 4AFCA 5J48A 3RJRA 4KBBA 3A0KA 3BPZA 2YY1A 5DG1A 5LK5A 3NWKA 3ES4A 1Q56A 2FZ1A 4F3JA 3S7IA 3HN1A 4C1XA 1PK6A 2P17A 3JB8A 2I07B 2ZX1A 4AFMA 3D82A 1EYBA 2B8MA 2ZCWA 5L7OC 3B3QE 2VVEA 1HXS1 2AUYA 3FX3A 4UW6A 4XQWA 1RMU3 2NN8A 1LR5A 5KHKA 4OUMA 4HETA 2HWB1 1LEMA 4YW1A 4KU7A 4AHWA 1H4GA 2HWC1 3DN7A 1XXNA 1BBT3 1H1AA 5AVPA 4HN0A 3TNPB 3MIEA 2A6VA 4Q4W2 5DUWA 3KT1A 4IETA 1ZM1A 1QMJA 4IEPA 4HSJA 3KCCA 2TUNA 1DQ5A 1ND3C 2DYCA 2B9UA 2GMPA 2K9ZA 3VZKA 1RMU1 3KCYA 1RUD1 1F9KA 2ZKNA 4MH0E 2GALA 2VVFA 2WFF3 3GBWA 3OGJA 1UKRA 1NQJA 4Z92B 5BXXA 1X7NA 4QM9A 3RYRA 3VL9A 4XETA 1CD3G 1HRI2 4G9SB 3NAPB 4Q4V3 4IEXA 1J1LA 2R061 5IK8A 1D4M2 3CJIA 1PK6B 3FLPA 4TLFA 3ZSJA 5CU1A 3OD4A 1S0GA 2RS32 2R041 4MGKE 3WG1A 3B7MA 4JRLA 1ENQA 1AR93 3ZX7A 3N7MA 1EPWA 4CDUA 2CWSA 1GSLA 5DDJ3 3TN93 3ALQA 1OLRA 3KD4A 4CP0A 4AFAA 4A7YA 4AWDA 3WHTA 5BPXA 1QH6A 1CVNA 1EV12 4QX5A 4TSVA 3QD6A 2Y0IA 2AZ5A 4SBVA 2D6NA 1VBE1 4B4QA 5FQ0A 4AGVA 1BEV1 5L19A 4QGNA 3VZMA 3RSJA 3GZAA 3B9IA 3IPVB 5L73A 2VOVA 1XNBA 1RUE3 4AHYA 3LSDA 1YI9A 2BUKA 3ZXEA 1IS4A 4MXWA 1PZ7A 1IGOA