4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
5FPVA 2WWUA 4Y33A 4Y4RA 5FJKA 5FZFA 5FZ3A 5FZMA 4GJZA 4LIVA 4LXLA 4QXBA 4CUGA 5FYBA 4AI9A 5ISLA 3U4SA 5FZ6A 5LY1A 5FXWA 3AVSA 2OX0A 4BU2A 5A3PA 4GD4A 2PXJA 5IVEA 2Q8EA 5FV3A 4HOOA 5IVFA 5FBJA 4EZ4A 4CCKA 3DXUA 5FUNA 5FZBA 5A3TA 2OS2A 5F2WA 3KVAA 5A7PA 3PUSA 4EZHA 5A7OA 5FY8A 5FXVA 3K2OA 3N9MA 5F39A 2XXZA 4CCMA 2Q8DA 4QXHA 4D6SA 3KV6A 5FZ1A 4IGOA 2YPDA 5IVVA 5FPUA 5FXZA 5A3NA 2YBPA 4C8DA 2XDVA 3K3OA 4HONA 3N9OA 3PDQA 5A7QA 4CSWA 5FJHA 5K4LA 5IVCA 5A7SA 4V2VA 3ZPOA 5IVBA 4QWNA 5ANQA 4NUBA 4IGQA 4DIQA 4ASKA 5CEHA 3K3NA 3AVRA 3NJYA 5FZLA 3PUAA 5FWJA 4CCNA 2YU1A 5FP7A 4E4HA 5FYYA 4CCLA 3LD8A 5FZ4A 5F37A 5FZHA 2YBSA 5F32A 2XMLA 3N9PA 5FY1A 4EYUA 3OPWA 5FZOA 4QU1A 5FZ7A 5LW9A 3PTRB 4BISA 4LIUA 4XDPA 2W2IA 4TN7A 5F5CA 5FWEA 5FYTA 5FZEA 5FZIA 5FZGA 3RVHA 4Y3OA 4CCOA 4CCJA 4XDOA 5F3CA 2YU2A 5FZ0A 4QX8A 5FYZA 2WWJA 2GP5A 5IW0A 5FYVA 3PU3A 5FZDA 3UYJA 3AL5A 5F5IA 4QX7A 5F3EA 5A7WA 3U78A 5FZ8A 5E6HA 5FP9A 5LY2A 4URAA 5FYMA 5FYCA 5FY9A 5F2SA 3KV9A 4LITA 5IVYA 1VRBA 5FY0A 5FZ9A 5FY5A 3KVBA 3PU8A 2P5BA 3AL6A 4GAZA 2GP3A 5FPAA 2OQ7A 4GJYA 5FY4A 3N9QA 2XUEA 4D6QA 5FPBA 5FY7A 2OQ6A 4UF0B 5FP4A 5FXXA 5KR7A 5FZAA 5F5AA 5FYSA 3N9NA 5A7WB 5F3IA 5A1LA 2YBKA 5FYIA 3LDBA 5FZOB 3N9LA 3PURA 5FPLA 5FYUA 5FZKA 4DO0A 5A3WA 3KV5A 5IWFA 4D6RA 5IVJA 4V2WA 2Q8CA 3KV4A 5FP8A 5A1FA 4AAPA 2OT7A 4UF0A 5FUPA 5LWBA 3DXTA 5FZCA 4QXCA 5FYHA 5FP3A 4BXFA 3OPTA 3PUQA 5A7NA 5A80A 4IGPA 2VD7A 5F3GA 3ZLIA
chains in the Genus database with same CATH superfamily
3JD73 4BXUA 1LDJA 4ES8A 1MJ9A 1N3OA 3VBSB 1GV2A 5EG0B 1VR3A 4AR2A 2AYHA 2XUMA 3N3HA 4XQ4A 4EJRA 2GIVA 5GAEJ 4YARA 2J1VA 4CU8A 2ELKA 1IZ3A 5JR2A 3ZYBA 1T0FC 5JUVA 1GP4A 2HPMA 2P3KA 4KG8A 3WTXC 1LE8A 4UB6C 3DKQA 1US2A 2HWF2 3BT9A 3AAFA 2R6QA 3GXUA 3WTYC 4XJ8A 5JXJA 2DBBA 3GZEA 2EA7A 1NQJA 2Q1FA 4ITVA 3Q8FA 4LBQB 1HSJA 2W39A 1UXXX 2XLFA 1P8JA 1A78A 2ZMLA 4XLAA 1ZG5A 2R3SA 1X9TA 2BV6A 1LOAA 2RE9A 4YVWC 5FK7A 2MD0A 3BYWA 1F31A 3LKJA 5FY0A 4UUTA 5L7OC 3LEIA 4Z2WA 3AJZA 5IK4A 2EFOA 1IRXA 4NOTA 5I8SA 2YHJA 3REOA 3ZR8X 3P5BA 1H6XA 4IV3B 1RHI1 3VKOA 5F0HA 4QHZA 1R5GA 1RUF1 2ILMA 1WSUA 5JVGF 1MZFA 4AQ6A 1W8HA 3M1HA 4CDQA 1DP7P 1FLIA 2LY9A 3IWZA 4Y33A 1AYM2 1QOTA 4ISQA 3AFHA 3VWBA 2RDNA 4FPGA 2KQRA 1MBEA 4BHPA 5JHUA 3QP5A 1OYIA 4INDA 1WCUA 1G3YA 3F8FA 5FZBA 2VUJA 2JICA 4MH0E 2Z16A 1P4WA 3K2OA 3H8OA 1FXZA 4Y1UA 3ON7A 1VBC3 3LSJA 5ILSA 4AQTA 1KFUL 4OMCA 3HRTA 3W6VA 4QT6A 2QM3A 4F91B 2G0EA 3FBIB 3D82A 4QKBA 5ABJA 2HTJA 2XJQA 5A2QK 2QVSB 1MD0A 2NZ9A 2WAFA 3E5QA 3QH6A 2VZ1A 2VU9A 2YBSA 4LA2A 1NLSA 4AZZA 1NH3A 2VC9A 4ZU5A 3AKQA 2HGCA 2P5LC 5CG9A 3VZJA 5DCMB 2QEXI 3ITQA 2A73B 4P9LA 4YRDA 1A35A 5D8AB 5FY9A 1TBXA 1UMQA 1VNDA 2QQ8A 1KJRA 1WHUA 3T2OA 5FO9B 2H6CA 1ZGJA 2Q30A 5FKBA 4YEJA 4ZU7A 4RM3A 4YVSA 3S5AA 4XOPA 3G1LA 5T54A 2YV8A 3HZJA 1LOCA 2F4IA 3L2CA 5J3LA 1FY7A 3WNKA 3KV4A 1FP1D 4YVSC 4E9KA 1TZOA 2RKHA 3WTZA 2H1KA 4HF2A 2VD7A 4HZFA 3VUOA 1LKXA 3GTGJ 2X85A 1OFCX 3H3LA 1Y8RB 2W57A 3NAPA 4QXBA 3R0RA 3TOAA 3ETQA 4KITB 2JDMA 3OB8A 2YR2A 1TL8A 2D6LX 4IEXA 2Q0AA 4AGGA 1R64A 1W6OB 1YYNA 4EZHA 2R7FA 1KQ8A 5ICFA 2J22A 3A21A 4XAAA 2DN0A 2P37A 1WVRA 1WWXA 3H1MA 3VBFA 4BXSV 1X1AA 3POFA 1H0MA 5D6EA 3MHZA 3POBA 1JOBA 5TJJA 3IH2A 4PUSA 1HQWA 4L97A 1YXWA 4Q5SF 2M34A 3IKVA 2XKPA 5FZ7A 1TVGA 2ICWG 2JSPA 2KZGA 1QIQA 2W1WA 3MW2A 2W0XA 4CCJA 2COMA 2VCBA 1RMU1 4K20A 3H3UA 1GBGA 1IN4A 2EILH 3CO2A 1SVOA 2IW5A 4META 3LFKA 1MMNA 5DZGA 3LSGA 1FBQA 1UZCA 3ZVXA 5GJ6A 5KHGA 3N05A 4DRVA 3ACLA 3PL8A 4XE9A 2CV6A 4J6GA 2ZMNA 2V1UA 5FY7A 3DCQA 4YZ5A 2HKXA 2H8RA 3CP2A 4UB8C 5FD6A 3D5OA 1MBJA 1RUOA 1JODA 4BUPA 5JMOA 2WLQA 3RZGA 3FXRA 5FYHA 1ONAA 3OYNA 5FZMA 1TQMA 3ZFFB 5HNFA 5IYDJ 2HWF1 5IJRA 3W6JB 4B8XA 2PXJA 4P9FA 1TEIA 4U7DA 5B3SH 1TLHB 4Q4W3 5JI9A 3GMEA 4ZDOA 4A3DJ 1ENSA 1OOPB 1IS6A 1T33A 1UZ0A 3ELNA 3A02A 2CGPA 2CTVA 1E5SA 3LCPA 1PX4A 1T6GC 1LAJA 1GQGA 4XRSA 1TWHJ 2X9DA 4ZYHA 2EFPA 3NWSA 1SLLA 1QA6A 1R49A 2ZXWH 3RI4A 4XF9A 4YVSB 4Q4X3 4MGKE 3H3ZA 3CMAI 3HOVJ 3CJIC 3WG3A 2X48A 2PELA 1ETYA 4Q5OA 2VI6A 4AYUA 2X1CA 1IS5A 1DUXC 5GKAC 5IT9Z 4JTOA 4Z92B 5M3MJ 2YDEA 4NROA 3ZQCA 2DU0A 4U88A 2Y34A 1Z05A 3J26N 6PAXA 4LA3A 1LOBA 1OLMA 1QJFA 3A7QA 1UAIA 1SLBA 4M3DA 2VAUA 1LCLA 5T5PA 1GR3A 5A33B 2E51A 1R4NB 4HNVA 3A01B 4XLHA 1IGOA 1W90A 4CXFA 1W99A 2QWWA 2E7TA 4MXVA 1NAEA 1ZNPA 4HBNA 1OPOA 2ZMEC 2RHPA 3ZKUA 5EIYB 4FPYA 1HRV2 4XF4A 4BH9A 4FCYA 2R7UA 2ZX1A 3F6VA 2V79A 2AO9A 2LSOA 5EYYA 2GA2A 3HUGB 2PAKA 4ASNA 4G8XA 3WOGA 1VF9A 4EN7B 1LHOA 1FYLA 4AVAA 5BNGA 2R32A 2PQ8A 5C9AB 3PTYA 1JI6A 2DMUA 4XM3A 5D5WB 3EUHC 5E8GA 3WQBA 2GALA 3DTEA 1CZSA 3AK0A 2IVMA 5F64A 3G1OA 4E8CA 1Q8OA 4CDWC 3DL3A 1PUFA 5F5CA 1O57A 5KK1A 4R1HA 2A69F 3JD71 2G9ZA 2EV0A 1PGL2 5F1JA 1O7LA 3GF2A 2WQ4A 5GALA 4DEQA 1ON2A 2IA0A 1XDUA 4GYIA 4RHV2 2WZ8A 5FDBA 2VNVA 1XSXA 3CESA 4LEJA 2ZJ2A 3BTJA 1Y39A 4D7MA 5JHFA 3PURA 2W7NA 2CV1A 3ZN0A 4W65A 4EN8B 1XMKA 3KZYA 3FUQA 2MBFA 2QUOA 4Q4Y1 2LM3A 4NMIA 1FX7A 4KQ7A 4M0NA 5FYBA 4BMBA 2ZB9A 5LY1A 1YC61 4IV3C 3LA7A 4LK1F 1WCQA 4CYCB 3PJRA 2EIBA 1YI7A 1AWCA 4U87A 2Y30A 2UYBA 1SFEA 4BJTA 4ATEA 2Y6FA 3O1MA 2OBPA 1UZVA 4ZU4A 3T4HB 5EEGA 1N47A 1EY2A 1JMUB 1W04A 4AVBA 1POV0 1X9PA 2ZXHA 2JVHA 2R4GA 3J7HA 4HG6B 2WV0A 1K3IA 5C4WB 5FLHA 4HDVA 3NNJA 4HOBA 4QKFA 1R091 4AEDB 2Z99A 2LC2A 1X1BA 1W0PA 2DTZA 3WHCA 3SHFA 1YFHA 3Q8CA 5EWSA 2O03A 1OUXA 5C4WA 4OHYA 4FPLA 5C33A 3TW6A 5C4XJ 1BLZA 2TCTA 1ZRDA 5APAA 3TOJA 5JOZA 2Q5TA 4C90A 3TP3A 2ZHLA 3CL1A 4KN7X 1YJKA 3WX5A 5I0UA 3CCYA 2ZACA 2WKKA 1OCOH 4ZKTB 4QIWN 3CJNA 3OG2A 5ABJB 5ICCA 4WM7A 1ZLJA 1D1BA 1OVPA 4YM0A 1PO12 1UMZA 1M4WA 1NA1A 1VMFA 1DGRA 3WP4A 3LE0A 3KVAA 2KKOA 3HPNA 4UAPA 2IP2A 4JTNA 2XHNA 2EZKA 5I0SA 3MIFA 4XXPA 5FB2A 4WM8C 2HOSA 5HCHA 1OCRH 3H7YA 2WT1A 4M00A 1ZK8A 1Z77A 2C9KA 2Y6LA 2D6PA 4M9SA 5GLWA 2D2WA 2LD5A 1GLNA 3W6KB 2CQQA 3LA2A 2XAFA 3IMMA 4XURA 1BHGA 3GWZA 1AL21 3F95A 1UPSA 3KGZA 2E7QA 2DVDA 4E7HA 1F5TA 3TP0A 4A69C 3C7OA 5DD4A 3HNBM 4Y1VA 3UT0A 5E6HA 3W5NA 2BVLA 1RUH1 1PUFB 1LHNA 2E26A 4YGEA 4ENNA 2VQ0A 4EJVA 2EA2A 2RV8A 3WNMA 5F5AA 3E5XA 3DEEA 3WQ0A 2MG4A 2R7TA 2V4JC 2MHFA 4EQVA 4CE8A 3GTQJ 1A6QA 3OYKA 1RUH3 3UV9A 2ZS6B 3ZFEB 1W39A 3V8LA 4FFFA 3V0AA 1YX5A 1A04A 2EIDA 3J81K 2OCCH 2V1NA 2GMMA 1BI2A 2HS5A 1HQCA 2IGKA 1EH6A 5GZDA 4QX3A 5KHJA 2LH9A 1UHSA 5L3GA 2JE7A 1P7IA 4HX8A 4GH4B 2JECA 4AIDA 2ZKLA 3GYHX 1X8EA 3DUIA 2LOOA 3ZSLA 4Q4W2 4YPJA 1DPUA 2VZUA 3BCWA 2X6XA 2ZGTA 2HBTA 4X6RB 5I0RA 5BNOB 4COVA 3PUAA 3BJAA 4P14A 1PMJX 2ECCA 2JA6J 2E2HJ 5LA2A 1ZBE2 3NW4A 2HQAA 2X5IB 1C0WA 3BY6A 2KJCA 3GBFA 3AJYA 4BGDA 2GXBA 4CDXC 1YLLA 1W6PA 2CU5A 5FKMA 5GLVA 1X3UA 1GHCA 4FHTA 4JCKA 3KX2A 2VJXA 5J47A 1KRIA 1WD3A 3WUCA 1OLRA 2BNMA 4AG4A 5A2QZ 4IEJA 1V9U1 1H9TA 4KIFA 1G59A 1FMD1 1HSTA 3DF8A 1E0EA 4XUNA 4BIOA 2JA5J 1S7AA 1UYXA 1H2MA 2JMWA 3IKTA 1DQ2A 4XMIA 3GFIA 2J1SA 3W2VA 4MEXF 1C4RA 2RS13 3CJIB 1W7PD 4LO4B 1UIKA 4D7NA 3CJTB 3WNOA 1V00A 2NS0A 1QQP3 3OGGA 3S2WA 3LB9A 4W8JA 1IO2A 4XIDA 4XF1A 1TNTA 4QPGC 1DGRN 4HQMA 1ND2A 1OA3A 2QKLB 3DPTA 4QPGA 3CMEI 5IFTA 2OF7A 4PIZA 3JQWA 1SVLA 5CIRA 2VODA 1MVQA 4V1PA 1REFA 1RUI1 3GDBA 2P8TA 2LREA 3MYXA 1GYKA 2FQPA 4M3BA 1F5FA 1CR7A 1ZA4A 5FZHA 2ZGUA 2ZNZA 1GNHA 5T5JA 4YLZA 3HAGA 4UW6A 1J75A 4HQEA 5DCFA 4AIKA 3ZR5A 3CCQI 4QU2A 3BLYA 4V2GA 4WXHA 2XBO1 4BJ0A 1QZEA 1D8JA 5EPAA 4ZTFA 4QHBA 3HD8B 4FETA 4S04A 2P3YA 3IH3A 5GLZA 4XACA 1NG7A 4TLFA 3KP4A 1LULA 5CFDC 4ZYAA 2IVIB 2PLV3 3KT4A 3FFQA 2IEKA 1GP5A 3DPRC 4A3JJ 2VMGA 1RIOH 3POWA 4OI2A 1QMJA 1MVEA 3I3DA 4HPKA 2X1EA 2IAIA 2WZR3 5CLSA 1HV1A 3VHRA 5JI6A 3H1WA 1OCTC 4LBKA 1K4TA 3NKTA 3LEMA 2W3JA 2DTYA 9ANTA 1JYIA 5FMOS 2KIFA 4A3IJ 2BFUS 3N7MA 1RUC2 4EROA 3H0GJ 4A7ZA 2F5DA 3THTA 5CKNA 1SHWB 4AW7A 2L4MA 1W4MA 1SD5A 3MEPA 4XIOA 2HWC3 4WVMB 3CQZJ 2FJ1A 2BQPA 3BR1A 2LS6A 2VXRA 2DU9A 2JA8J 5FFXA 4RS5A 3I59A 2MH9A 4BB3A 4CTEA 2RDQA 3TEDA 3DYOA 2B0LA 2ZA9A 2VNGA 1ODMA 3MUZ1 5DM7F 3AMMA 1G3SA 1X58A 5FYTA 4A7KA 4MOAA 1S0EA 3LSMA 2V72A 1VQPI 1MEC3 3PIPF 1Y4WA 1IPSA 1P9QC 2Z9OA 1XE0A 3ILNA 1QOSA 5F2SA 2DFCA 1WQ2A 3OGVA 2F17A 4YG3A 3VKLA 2JWTA 1VRBA 3FLPA 3RI9A 2BY1A 4C2TA 4AFAA 1DZTA 5C44J 3HNMA 4E4ZA 3NWKA 3VHNA 1FNNA 4YM2A 2JG8A 2ETHA 3PIOF 1KJLA 5IVJA 1GOHA 3POSA 1T6SA 3ZXAC 3CEWA 3PUQA 2VBPA 1ZG3A 2EXKA 4BQ5A 5A70A 3G4SI 4GYGA 1VBE3 2D45A 1HA8A 3KWVA 2RR13 4LQRA 2G19A 4BQXA 4F52A 5IVFA 2VXJA 2HVSA 1OD3A 4L5IA 4JC1A 1VB4A 3ZXJA 1T6BX 4IEZA 1RUD1 1T95A 2PHUA 4YWAA 1Y1WJ 1PJRA 2XSDC 3MQ0A 1UB9A 1ACCA 5CEHA 4XIKA 4F3JA 4O6JA 1LGNA 4FQZA 1TMF1 4FCAA 3KB5A 3RJPA 1RGSA 4FTBA 1JHHA 3C7GA 5CKQA 4FOYA 4OINF 1W9FA 1V9U3 2DWRA 4FOVA 3AXDA 1B9NA 4UW3A 4UW4A 4FPJA 2BDRA 2D6OX 3ZFFC 3VV1A 2VVEA 1G7YA 2ZJRF 1NZCA 3U21A 3O3KA 1DIWA 1TP4A 4HFSA 1NCQC 1WW5A 4KI5M 3CJRB 4QX7A 5A6ZA 2O3FA 4M4PA 1BI1A 3QWLA 2ID4A 1ZA7A 5IK8A 1BVVA 1CF7B 1ZBE1 3H8XA 3GTKJ 4YYOA 4LHLA 5B4NA 3CO7C 4MGQA 1RHI3 1D1CA 2FCVA 5E3MA 2QQLA 4QDQA 3ZXEA 2HWD1 5JR7B 2YU3A 4HT1T 2BE5F 1FPN2 2ES3A 2V9PA 1PK6B 3F8NA 1NZIA 4QB1A 2OZUA 1QHHD 1GICA 2LR8A 1XCBA 1DZRA 2BVBA 4IL6C 4IESA 1W1WE 2FE3A 3P3PA 3S30A 2ZGQA 2JDZA 2VCMA 4F93B 3AMQA 3ZSEA 2IT0A 2K9LA 5HCAA 4JGYC 1UY4A 2IRFG 3RNSA 4U7BA 2W24A 2H94A 3OV8A 3A4CA 2VC1A 1H1AA 1W3XA 2AZ5A 3DWLE 2B42B 1K5JA 3VBUC 1COV1 4BY1J 3M1CA 3PNTA 3LZZA 2VMIA 3B5LB 4HSTA 1PGSA 2VUAA 3OL3A 4Q4W1 5DTDA 4A6OA 4A0ZA 4HX7A 5T55A 2RJLA 1T39A 2K3FA 5JWPA 4WXCA 1K12A 2PN6A 1C8M3 4H4KC 5BNPC 3RPQA 4XLNF 4P9IA 1CJDA 5I8TA 2XIGA 5HLIA 1CF7A 3K4MA 3H9GA 3WW2A 1C5HA 5T3NA 5KHDA 3KV9A 1S9HA 1X4PA 4FPCA 1FEXA 3ZPYA 4XQFA 3FHIB 2RQPA 2M5WA 2JD9A 2LROA 2K2SA 3ECHA 1VRH1 2AC1A 3TEZA 2VQTA 1W6QB 2DODA 3F21A 4CDWA 2BZTA 3WQ1A 2I8DA 1IRFA 3FLTA 3K6GA 4OIPF 5IK5A 1ZRCA 4Y7NJ 5LA1A 3ZYGA 3FF5A 3ZQIA 2HEWF 2R043 3ZFFA 1VE0A 1PZ8A 1WA4A 3ZYHA 4MYEA 3Q9OA 5KXBA 1OQ1A 5KWRA 3E3VA 2J1TA 2RAEA 2A71A 3W21A 1WGPA 3C7JA 3B01A 2QQPA 1B9MA 2CWMA 1VBA1 4NHYA 2QENA 4GALA 4EM0B 2CUZA 3BPXA 3C7HA 1K45A 2VH9A 4DYCA 2Y69H 4WVWA 1TQIA 4XORA 4JVAA 3ABMH 1J83A 4GB31 4UV9A 1IC8A 3ZRGA 4HONA 4XF0A 5F0CA 4BE0A 2DT6A 4LO6B 2AH2A 3QU3A 2BWAA 1VAVA 2EA4A 5J09A 2B39A 3COAC 4BE1A 4L0YB 4QQOA 4NAMA 3S7IA 4Q0VA 1U5ZA 3AP6A 1J59A 5ILVA 2AACA 3ELKA 4GCVA 3JBG2 1YFXA 4EJOA 2XLGA 2WWSA 5EZHA 4YVWA 2WNUA 3BKZA 4XZPA 2JG8C 3LGRA 3HT2A 3EBRA 4I01A 4QPQA 2C0ZA 4CEWB 1VQLI 4AUXA 5C7GA 1BR4A 5FZ9A 1RUG1 2HKOA 5AFBA 3CTAA 4CZSA 2XJUA 3FKIJ 1IW7F 3I9V2 3S3OA 4D6QA 3TW7A 1AJOA 4U0VA 4PJYA 4ZS2A 4Z2AA 2JN6A 4CU7A 2VKHA 1BA5A 3MW3A 5T50A 1TWGJ 1QH6A 5G05L 3RJ2X 1PNFA 1YIOA 3WF3A 1SCRA 3VD3A 3WV6A 4MFEA 4CGZA 4GMP3 4E7KA 2DCEA 3F2ZA 1SD7A 1ZRIA 2J1UA 5LZ6A 5J8FA 5GADJ 3VHPA 1Y9MA 4DY5A 1W9TA 2IS4A 4RFRB 3OOXA 3IDBB 1H2KA 1AF9A 3K4CA 1R58A 4BQ1A 2OXBA 3SZGA 4Y24A 4NHMA 5D1IA 3ZSMA 5EYRA 2XPJA 3MWMA 4M9XA 4E4DX 4YZ1A 3U10A 1W0NA 2YFUA 4XLCA 5J96B 1TC3C 1S0BA 1D4VB 3HOWJ 3ES4A 4PGHA 4O9GA 2HEVF 1ORKA 4IE6A 3AP4A 3FLRA 1ENQA 5FLMJ 2M4GA 2LKPA 2P1BA 3GTOJ 1AX1A 1XNKA 3SQNA 1HB1A 5JXGA 4EWEA 1FOD2 4XPVA 3UGGA 4HPKB 1W6NA 1MS8A 4L9JA 2M0MA 1IKPA 3ULQB 3VSLA 3ABUA 4TV7A 5LRSA 4DFSA 3ZYRA 2JG9A 2DVGA 2RS51 1V3FA 1VRH2 4HXCA 2KRHA 4B4CA 3DLLF 2WNVC 2ESHA 4H7LA 1ODNA 2ZGSA 4KU8A 3K4ZA 2E7WA 3SMHA 3I2DA 4MX3A 2PHTA 3GEZA 2IGNA 2YX7A 2ZHMA 4UOJA 2P6TA 3P5JA 5FP4A 2XPWA 4A3EJ 3L2RA 3I2GA 5TRDA 1UYPA 1XGMA 3EPZA 3ILFA 1PM7A 3KLNA 1UAAA 3A01A 1T2KA 1K6YA 1R1A3 2CAVA 5FPVA 1FV3A 2AUYA 1WJAA 2HOAA 2GC1A 3ZN6B 4XHBA 5HLHA 1SQ4A 4AYBN 2G9FA 4P9WA 3D0JA 1WRJA 4GB32 1IDYA 4D3WA 4QDRA 2LK2A 2ZAHA 3SC7X 2R072 4BZ4A 1B35A 4EWDA 1RUNA 2R1DA 5FXZA 4MGRA 2ARBA 2ZKNA 3N9OA 4KDPA 1QJX3 5E1ZB 1RMU2 4N9IA 4CPBD 1AYM3 1YQAA 1SBDA 3JBG1 2JENA 4Z8BA 1LTEA 3RMXA 2FA5A 5LBCA 1QWRA 3HJEA 3H42B 3ZFGC 4Q48A 3FISA 2YUSA 1XMXA 4YG6A 2BOIA 3FM5A 1DLLA 1K6OA 2CUEA 3RWNA 3RSJA 3CDLA 1RUH2 1XE8A 1YX3A 2FDKA 3AP9A 5BOXA 3VSKA 1EAH1 2GLOA 1LOEA 2UXNA 3I3BA 1Y56A 2R16A 3AKTA 2E9QA 2LMDA 1VBA2 3L2HA 4AHZA 1ZG1A 2QZ3A 1MACA 2HTSA 3G6JB 4CDXA 1H9PA 5C3QA 2Q0OA 1PHMA 3GO5A 2XJRA 2R042 4WM7B 1N78A 1IXSB 2D6MA 4MGZE 1OFNA 2UUZA 1REPC 1QXPA 1D0XA 2OUMA 3J7NA 4UBHA 2WSVA 2R5YB 3UKTA 3ONQA 4GXLA 1UD1A 3KF3A 3ZMTA 3MBWA 2JE8A 3QYEA 4XF3A 5FBJA 1RUF2 5JVVA 2JJ6A 1XGOA 1GKBA 1W6QA 2Q1ZB 3BQZA 1AHSA 1A36A 3KT7A 5JDBA 1DP0A 3LDKA 1ZM1A 4IEWA 2R071 1ND2B 1JW6A 3ZQQA 2XL7A 2LF7A 4L5JA 1IRZA 2VMDA 2W1SA 1MS4A 4LGWA 1BR1A 1ZYRF 4WM8B 5DZFA 5LBEA 3VD5A 3C2UA 4OULA 2H0VA 3Q9VA 2C24A 4CEWC 4ZXEA 4PDWB 1GNYA 4W6XA 5CU1A 1E3PA 3RI8A 4QTRA 4AVPA 4K1YA 4G7OF 5E89A 1D4M2 3J7LA 2M30A 2P5BA 2GOMA 4NQWB 4A0YA 4ZZ8A 1XU1A 2TBVA 3LWCA 5FUIA 1DQ5A 4UFHA 1HKSA 1IS3A 3LDBA 3D5LA 2FMLA 2LVSA 4E7ZA 4UNOA 1E57A 2FEZA 1RVF2 3FXMA 2F4MB 4IGPA 5E18F 4A3BJ 2EALA 4WVVA 3PSIA 1YJWI 3P6BA 4UWDA 5A3PA 3VL8A 3QAHA 3OMYA 3J7MA 1K79A 3E0JB 1R4MB 4QD2A 2HXOA 4IV1B 1RPWA 5A7SA 4ZC3A 2F5VA 3MFAA 3DN7A 3POJA 1BJZA 5H9QA 3MEXA 3ZXSA 1Y8QB 5D6FA 3LNQA 3HGYA 4RAGA 3B9IA 4XFGA 3A03A 1RKWA 1CGPA 3I58A 2YROA 1S7OA 5JIUA 3WP3A 2XB0X 3JRGA 5K0UC 3SCHA 2BOLA 3J81Z 4N7IA 5ILUA 2D5FA 2QQOA 2WLPA 4W6WA 4GAZA 3CLOA 2LKXA 3PJYA 3C7FA 1B72B 2DMNA 2Y38A 3RZKA 4NRPA 1YRNB 3K1NA 5FO8B 2MEV3 3USSA 2R7XA 1R7JA 5GPAA 3JSOA 2BGCA 1XS9A 2F2EA 3PMEA 2Q8EA 4L9VA 1CQ9A 3S2DJ 4CCKA 2W87A 3CU7A 4OHVA 5A3MA 5D8LB 2LALA 5FMOL 2VT3A 3ALQA 3PQJA 1IXCA 1SMTA 3E7LA 2VVDA 3HB9A 1XX5A 3HEIA 2F6BA 1H1MA 4C8DA 4LLLA 4I7HA 3S16J 4L5EA 1E5IA 2HWE2 3N7LA 3HMYA 3GZUC 3AL0C 1YIFA 3EMRA 5CVJA 1VBD3 2K9ZA 1UW8A 1KEXA 1UKGA 1C8NA 2JQ7A 1JYNA 4JGZC 1V5FA 5BYNA 2E33A 3I59B 4A6DA 2RC4A 4LHSA 1BMV2 1ON1A 3DQVC 3OD0A 4XW3A 2FOKA 4P9JA 1YS6A 1MDMB 4LPLA 3NQHA 3L7WA 2D7FA 1K5MC 3AL6A 1RXFA 4H3WA 4NRQA 1BI3A 2WYSA 3FMSA 3CBNA 1RUC1 2QUFA 3VDAA 1O4YA 1SMYF 3PVEA 4D7YA 3ZN1A 4KA4A 2AGSA 1QJZA 2UURA 2K85A 5K7PA 5BNQA 2CV2A 2X51A 3B93A 4JRAA 2F48A 3R0AA 3QH7A 1WJDA 3EQLF 2XRLA 1OA4A 2HVRA 1WLWA 1J2XA 1UPIA 3Q8EA 2VCAA 2CJJA 5C9AA 4CDUB 1G2HA 1XSQA 1ETWA 1FPQA 3T1MA 2AHQA 3H9JA 2EIJH 1OQDA 5IT6A 2BW8A 3WDTA 1HDPA 2XAHA 5D8KB 1UG0A 3BROA 4NWVA 2QYOA 3WF0A 3VYRB 1T8IA 1SCSA 3BTYA 3OS0A 5M5XJ 4NVPA 3N7KA 4GO1A 1HLVA 2FCTA 3A22A 2TRTA 4IEOA 3J8F2 5LGNA 3ZOBA 3KP6A 1PX3A 5L73A 3RZZA 2VN2A 1F1ZA 1MMSA 3BODA 3BZ6A 2VXDA 2XVLA 2W2IA 3LL7A 1PK6A 4KIBA 5E88A 4Q4ZF 5AC92 3NARA 4M6YA 1DQ1A 3JTGA 5KXEA 2EWNA 2Y64A 3M3QA 1S6LA 2QGUA 1WWYA 1G8WA 1NYWA 3ABZA 2BFUL 2WO2A 5LCWL 1IV6A 4C91A 4M72A 1NA1B 5C3OA 1TT5B 4A44A 1DP3A 2BVVA 2E35A 4UF0B 3SCGA 1JU3A 4TYSA 2R073 3H0OA 2Z5UA 2RDSA 3I3LA 4YGCA 3A1YA 2CSOA 3K1PA 2DQRA 4R9BA 1Y0UA 1QJX2 2ET7A 1TT0A 2GBYA 4CDGA 4P9XA 3SZTA 1BK1A 1KU3A 1E3HA 4COZA 2XB5A 4NHXA 3N97A 1YRNA 3M1EA 2H1LA 2GXAA 3K4DA 3OYBA 5F2WA 4HVRA 4B7KA 3KPHA 2R7RA 1K5MA 3MUY1 2DA3A 5KAFC 5CB7A 4AI3A 2G9GA 3RYRA 2FBHA 3HUGA 1JOPA 3LSHA 3AVRA 1UQXA 2L5QA 2EH3A 1O91A 3JRBA 4DXZA 1FWZA 3HPHA 4ZYGA 2GA1A 1XQNA 2KR2A 4YW5A 4JKKA 5L3EA 3VBUA 3MFCA 2HZDA 1FYUA 3WNNA 1LU2A 1W5CC 4XLEA 3ABTA 1S0DA 2WS91 4Q0SA 1QQIA 1GWMA 4DUXA 3OIOA 1HLCA 4LHKA 1WCMJ 4KYWA 4TXWA 4WV8A 4PJNA 3VYSB 5FYUA 4OWRB 3HOBA 3CD6I 4I0AA 1TME3 3FN9A 3FIWA 2DU1A 2VIXA 4N4NB 3POGA 1ZKGA 3TQNA 1OKRA 5FJ8J 4CZZA 5LFAA 2GIZA 4KIGA 2W46A 5J37A 5A33A 2J5OA 2IXLA 3EO6A 4RGRA 1BIBA 1E5HA 3O7OA 3CZJA 5A3TA 3ZXFA 2CH0A 1R5HA 2Q8DA 3WTTC 2NVQJ 1UY2A 2BNNA 2JEMA 4M6XA 1R092 3ZPOA 1SFOJ 1BC8C 5FLVA 4ENMA 3HQUA 3OL4A 3QU6A 1IF1A 1VBD2 1SMVA 1HF0A 3I2KA 5JXIA 5TGTA 4UT5A 3KS7A 2HWE1 1MIJA 5F3CA 3RZHA 2HU9A 1Q8SA 5FYVA 4G4FA 1KQRA 3KETA 1AR73 2WZPP 3QQAA 1UF2C 4AVSA 1R1UA 4DBQA 4ZYEA 2WA3A 5BNNA 1X4OA 3T8TA 4B43A 5E1RA 5FZAA 2XVCA 4OIOF 1L0OC 1V9U2 2JXAA 3ZYPA 2VOWA 2MYSA 2VUMJ 2NVUB 3QOEA 4XRMA 3MV11 1W7PA 2E2IJ 2F5FA 2Y31A 2D40A 3QACA 1YLFA 4CICA 5I0DA 2BXZA 1EYBA 1XNAA 3CNAA 3DF0A 4GKXA 3QPHA 2PFBA 5DDGA 1WLCA 1LFUP 4HV5A 1SLTA 4LLGF 4UVAA 3O8GA 4GXOA 2VTXJ 1CAWA 1AR82 1R1VA 3MIDA 4AQ2A 2A5YB 4CUBA 4PF1A 5FJHA 1TZLA 1PIV2 2MD5A 5C4JJ 4MIMA 1G4DA 4N8MA 2HDCA 1FNZA 2X05A 4Y52J 3TOBA 2VBBA 4IRIA 4XFHA 3H36A 3LQQA 1W03A 3SKJE 1ULOA 5DD8A 4HANA 4LO8A 1YUDA 4AI2A 5F32A 1JZ6A 1OMIA 2ZHNA 3LA3A 4QU1A 2PQQA 5FR3A 5DV5A 3DEUA 5J36A 2FD8A 1WW4A 1V6OA 5IT3A 4XHXA 3K4LA 5I93A 2BYVE 5FYZA 1NA1C 3ACIA 1OD5A 4Y5SA 3RJRA 3NRVA 1ITYA 3CC2I 4BLIA 2IBDA 1MQTB 2DQLA 1STZA 2WQZC 1XSVA 2XF6A 2V4AA 2E7XA 2OQ7A 3DBLB 1HN0A 2D5HA 4NRMA 4ZDLA 2DUPA 1ZARA 1LENA 1S0JA 4GKYA 2WRAA 1Y7BA 3H5RA 1NG0A 3KQ4B 4FE4A 1OC1A 4EWAA 1R6RA 3V7SA 4ATFA 4IERA 2WFF2 4I30A 5C4WC 2G1MA 1LVAA 1U5TC 3MKYB 3U4SA 3RPUA 3VDBA 3RKWA 5CFDA 4BU2A 2ZGPA 1NK2P 3T0BA 1JBCA 1NCRB 1YW8A 4YGBA 3DEWA 5FY8A 4MXWA 1T0FA 3HC7A 5FZ1A 3ZXDA 4G9SB 3WE2A 4EN9B 3VEPA 2XGEA 3IWFA 1KZHA 3RMYA 3GCWA 3Q9SA 3K3OA 3OD4A 3MKWB 3CJXA 2VASA 4XKCA 1DGWY 1K83J 4BY7J 2YYOA 1Q1VA 2K4BA 2DCKA 2EFNA 1Y3TA 3ATGA 1VRH3 2L7KA 2W91A 2C9AA 4EVIA 4PI2A 4HA8A 4YZ4A 2BEOA 4R9AA 2HI3A 2HOEA 4JP0A 4AIJA 1H8TA 4XDOA 3VBRC 1P6RA 5K7HA 3IAPA 4A42A 1O7FA 2KIUA 2QQ9A 2HEOA 4CDWB 3L1PA 1RINA 4IV3A 2OKXA 1VQKI 5CVUA 5CPRB 4N43C 4MLOA 3Q0WA 4P1WA 5FKCA 3JRIA 2RM23 1I1GA 1RUF3 1S3JA 3IAS2 3M7GA 3PUFA 2XASA 5A1LA 5FZOB 1ULDA 1ULCA 3LFMA 3V65A 4RS8A 3QLQA 2P7CB 3E1F1 2MABA 5C3RA 4B1LA 1R082 3KD4A 4N9HA 4RB3C 2CYFA 2RNGA 2MW8A 1V6JA 2JDNA 1CZTA 3PNAA 2M45A 4EATA 3NL1A 3S3MA 4EZ4A 4OHXA 2XC7A 2VJ4A 4BJ6C 1CAVB 5FK8A 3PUSA 1YTYA 4CCMA 1DU6A 1X1PA 3RZMA 2JRMA 3V8KA 4QPGB 2E53A 2FDFA 5A7QA 5K4LA 4CZCA 2EVXA 1ENRA 4CDUA 2OC6A 3ZFGB 3S0MA 5CKMA 3HHHA 3T8RA 1NHAA 2W08A 1JT6A 2B9SA 4D5FA 1SFPA 1O3RA 2CNAA 2QNKA 4IPAA 2DK8A 4XAEA 5GLUA 4IUGA 3NAPC 4H55A 1U5TB 3DFGA 2BBYA 1HXS3 1TW2A 2O5RA 3ENRA 4HK9A 4L92A 4WZFA 4GFBA 1IN7A 2BY3A 4LOSA 1AYN3 4P5HA 4BDYA 3ASOH 2ARXA 1X3WB 2WS92 4Q8LA 2XUEA 3HQXA 4ZTJA 1U0AA 2LKSA 4PLMA 1VALA 2EV6A 4UHTA 3WG9A 3EYIA 2WT0A 3JCUC 2W4SA 1VBB3 3FC0A 3CCSI 3ZFEA 5E8AA 4Y1XA 1IG0A 3WF4A 3HBLA 3DXTA 3QPLA 4HYEA 2A6EF 3TAYA 1MBFA 3SISA 3TNPB 3WG1A 1ENHA 2NM1A 3HN1A 4CA0A 3A23A 2XUBA 3UKGA 4QKNA 1C8M1 4RLQA 1O8PA 5JZGA 2CAUA 4NB5A 5JSRA 1BW6A 1HCRA 3FZVA 4IEQA 1ETOA 3THCA 4GWIA 1EV11 4J25A 2OZJA 4S05A 3BU0A 4CP2A 3MKZA 1OLME 5IVBA 2GDFA 5CNAA 1Q5OA 3UESA 4G6QA 2QF7A 2WZR2 2KPMA 3ZCOA 2TDXA 1E17A 3T2TA 3KQRA 3S1RJ 3ILRA 3OYIA 1WI3A 2PLV2 3AG4H 1W8ZA 1ZBA3 1CESA 1LE8B 4TN7A 2IS1A 1FOWA 1WZXA 5DAWA 3CCLI 3K70D 1VQNI 4YZ3A 2OUHA 2DOFA 1HKQA 1MEC1 2XAUA 3RGBA 4C0BA 3VBFB 1UOBA 1AXZA 2MC3A 2NS8A 2HWB3 1EA3A 3KP3A 1R1A1 1G9BA 4CEWA 5LASA 2BNOA 5C8CC 1YE9A 2DUQA 3VB9A 1ZN2A 3K46A 4DY3A 2O0YA 2E34A 3VFZA 3H5AA 2DJIA 2ZGLA 5FCCA 1YEWA 4NIAA 5BNOA 3AKSA 1MZ6A 3V7CA 3M9AA 2WTEA 4IOCF 3JCIA 1ULGA 3CUQC 3O2PE 4NIIA 2WN3A 4B8EA 2QQWA 4OUSA 1AL23 2KFDA 2XQXA 4UUSB 4CUCA 1EUTA 4Y1ZA 3IMNA 2ZX4A 3KF5A 2HXIA 4XXAA 3LSPA 3SYTA 3T3YA 2VKVA 1D3YA 2C1FA 2LG4A 4QMAA 4YELA 1GV9A 4DOUA 3F72A 3K77A 4XKVA 4G7HF 2M2EA 2HQNA 2JIGA 2P81A 3WNPA 4FTEA 2FDGA 3T4VA 3F22A 2WDBA 4C0HA 4O65A 1PUEE 2MC4A 2EAKA 4JRLA 2UY9A 1FPN1 5LA0A 4BWOA 2A1XA 4PBPA 3WCRA 4MQVA 3BTLA 1DGRM 5H9RA 3AP7A 3URFA 1HB4A 1BVP1 5LEKA 2LY2A 1FIPA 3WD5A 5K8SA 3W3CA 3F23A 1BK0A 1H6YA 2LNBA 1LESA 3UGHA 2QCOA 5FPBA 1IRGA 2DBNA 1TW3A 3LPGA 4C9YA 4FTHA 1RUG2 3K7AJ 2IPQX 3ZSKA 1D0HA 5A3WA 2L9RA 1AYM1 3VD4A 1VQ6I 5KAIC 2DO7A 3V8JA 3MIEA 4Z07A 2VTXA 1S0IA 4N4OB 1YJLA 5L19A 2VE9A 1OH3A 4CHUA 1SDDB 2BTVC 3BDDA 2OIIA 4WZCA 3VDCA 1YQCA 1HIXA 2D98A 4ZYDA 1HV0A 4FFHA 3KZZA 2RS11 2XXZA 1F4HA 1MMAA 2XB6C 2WA0A 3GTMJ 1ZVFA 2Z79A 1AJKA 1GMMA 1U3EM 3POYA 3BOQA 1QDCA 4E7JA 1LQ1A 1HQLA 3GHNA 1URXA 2D3PA 1MS1A 3A0HC 3QPTA 2JG9C 3FWEA 2D1VA 5F27A 2ADEA 1BI0A 4I3PA 4A3XA 2J1RA 2NNNA 4Y13A 1YRZA 3HN3A 5FZ0A 1US3A 4YW2A 3H3VK 3CMYA 1FPN3 1MDMA 1VBB1 1QO0D 2KD7A 5J48A 5JOWA 3CMMA 2VY0A 1W8UA 2P2KA 3GF6A 2YY1A 1RUE3 4UUSA 1G9DA 2V6CA 3ZMDA 2WO1A 2E2JJ 1TTYA 4WWCA 2VONA 1TQ5A 2GMPA 1YW9A 3TNQA 1GLHA 2CW0F 4W50A 3MKLA 2WNOA 2GOXB 1QPMA 1RJ7A 4Z1VA 1PDNC 5L7OA 1K4SA 3L00A 3KCCA 4UY8I 4A2UA 2V5YA 4O61A 5FKNA 3JAMZ 1QF3A 4HOOA 4A45A 2PN5A 1V0AA 4G9YA 2OVUA 2ZEYA 2J1AA 4B3XA 2V1DA 4BMEA 1QH7A 1ZLKA 4M3EA 1O59A 4OHWA 3BI3A 3AZYA 5LRRA 1I6HJ 2CYYA 2BHYA 4AI1A 5BNNB 4I0BA 2FXAA 1QU0A 4LB5A 5K5QA 4E4HA 4P5OA 4EV0A 2DW4A 1L7RA 2WB1A 3RQIA 1SFUA 5EEAA 2ZAAA 2QQIA 2NMNA 2ID3A 3ISPA 5LBBA 3PFYA 3WDYA 5ACA1 1IZ1A 1TQPA 2E31A 1RIRA 3P1IA 4E2QA 3SEEA 1ETXA 2RMU2 4MO7A 3IRQA 2RMU3 2YC2A 2OPTA 4IRHA 4O5VA 1ZBA2 2V73A 4NIHA 5IP6A 3TKYA 2VZSA 2XH6A 1AU7A 3JUUA 5KR7A 1W5TA 3RTRA 1WUVA 2BOJA 1CIWA 2UXXA 4YG2F 5EQUA 1RETA 3RG0A 2K9NA 1RB8G 3TO9A 1Q8PA 3DKWA 2TUNA 4IKFA 4NIDA 4UV8A 3EHKA 4NO4A 1NG6A 4A3ZA 5FJKA 2AEYA 4UFJA 2YMZA 3F8MA 4JGZB 1MH3A 2HYKA 1XG1A 2RS12 3OY8B 3I2IA 2WT2A 5GZEA 3V7RA 1VZ0A 2R7QA 2RDPA 1A5JA 4HSJA 4QGNA 5J4YA 2BW3B 1KFXL 4IGOA 5DQ0A 4M9ZA 3OBRA 1JH5A 3BPZA 2GWRA 1H88C 3C3WA 5H9SA 2VBYA 1AL22 2CW8A 1NK3P 5FRAA 2V9KA 1MSFC 3LD8A 1RUC3 2M3AA 2O9LA 2Y0IA 1HXS2 1VB2A 3C1DA 4CXXA 2CUFA 2JDHA 3IRRA 2PMZA 3F3XA 3S3NA 3S93A 2HH9A 3QP6A 5K7FA 3FXUA 4L0ZB 2ZSIB 2RVAA 3LAPA 4LB6B 4KMFA 4KMQA 3QOPA 2BUKA 3S15J 1ND2C 2P34A 4XDQA 2CO5A 4HBLA 5BNNC 3ZOIA 4IJAA 2VQAA 3OUIA 3U37A 1XC6A 3SJMA 5FFZA 1OFSA 4A41A 3H5NA 4WXDA 3CKHA 2VQGA 4CA9A 1WFXA 2IXKA 4UXAA 2JDAA 4E70A 3S6PA 2C4XA 5EV7A 1FOD3 3LSEA 1T98A 3Q8BA 3ESWB 4L0PA 3HR9A 3NO8A 1E3OC 1MS5A 3JAMK 3RPUD 1MGTA 4CUGA 1R083 2P3JA 2QQVA 4E27A 1SLCA 1BEV3 4LLOA 1CQTA 5TSWA 3NWTA 3FHAA 3S57A 1AX0A 3DXUA 2D1HA 4Q4Y3 3PVNA 3UR3C 4DINB 3CF5F 2VKDA 3TN91 4A4AA 1REEA 3MLJA 2WAEA 2ZGRA 1ZZ8A 3X29B 1LRHA 2D3SA 3J8F3 1VQ9I 1NE6A 2B4KA 1UU5A 1TME2 4C30A 3ZMUA 2PEXA 1XRUA 3NAPB 4QPOA 1JS9A 1POQA 1D0YA 2PAEA 1Q1HA 2ZEWA 5LEJA 3CCUI 2NYXA 4FPFA 4AVCA 1VBA3 5FGMA 2LLKA 3MIGA 4UXNA 3CO6C 1YI9A 3OUHA 4ZXKA 3S32A 4BDZA 3FHZA 4IE5A 3EYYA 2GQQA 1RJ8A 3INAA 5A3LA 2VOPA 3SDGA 1LNSA 2R5ZA 2OPWA 3RDIA 4AHYA 3PU8A 2ZZJA 4HLTA 5T52A 3RZJA 3M8FA 4YFKF 3CCVI 3KMHA 3BR5A 1FAYA 1QXRA 1YO5C 2GN3A 3NV3A 5BPDA 4ZY9A 4Y1YA 3L2WA 5CFDB 2O14A 3JREA 4CDQC 4PJ0C 1VMHA 4G12A 5LWBA 3ZGKA 1N3QA 2J1EA 4NPRA 5EXOA 2M87A 4HKOA 5A6QA 2E1MB 2B46X 2WAAA 4MTDA 5GAHJ 4LXLA 1H8AC 4G3YC 4IHTA 4N53C 1GDTA 5LHHA 1DYOA 4GD4A 3E6BA 1KU2A 1ND3B 3OGRA 4YW6A 3AG1H 2VNOA 1Y6IA 1Z7UA 2VQLA 2E32A 4KISA 1JXNA 4I09A 4YIIA 4DZJA 3QRFF 1QJY2 4Q4V2 3JQXA 1VQ7I 2DT5A 4U2AA 1W5SA 2FX0A 4AU7A 1UMHA 3VKMA 1UN1A 2OA2A 5LD2C 1JUSA 4B1MA 2GC3A 4OZOA 2ZMEB 2ORZA 4LBQA 4ENJA 3I5UA 3PL0A 2QQBA 4NC8A 3RYKA 4LG0B 2K9MA 1PZ9A 4YFNF 4ANJA 3VDDA 4JK1X 3WGHA 4D0PA 3CZ6A 2DA6A 4YW4A 3IAM2 1O4XA 1F5JA 4I99C 3HVDA 3SXWA 3OBTA 2KIMA 1OKOA 4Y5TA 4JQTA 5B66C 3QPSA 2E19A 2DFFA 2ZC2A 1UZZA 5DUWA 5FP9A 2IA2A 1IUYA 3M8EA 4RS5C 1XTAA 1JI8A 3KFWX 5E1XA 1GQPA 1HC8A 1I3HA 1JJ6C 1OYWA 5DG2A 4PCQA 1H8TB 4BACA 1LOFA 1CAWB 3BG3A 1BR2A 4GIQA 3N9LA 4Y17A 3NNLA 1CD3G 3N4MA 3I0TA 2OT7A 4M4RA 3SKVA 1N1VA 4M3CB 3R4KA 1DG6A 4BL0B 1Z67A 1YQ6A 1JYVA 4LIVA 2XF7A 3K70C 2HQRA 3IHUA 3PSFA 4Y15A 4UUVA 2I5UA 1HJFA 5F8PA 2DBIA 4MSVA 5JI7A 1I3QJ 2JDPA 1U5TA 4HNUA 4IEYA 1TMF3 1NX9A 4BK5A 1NCRC 2ETEA 3GZNB 2X4HA 1SEUA 3O8HA 2DURA 2VCCA 2DA5A 2LBFB 1EF4A 5E79C 4BJ5C 1NXMA 2UWAA 3U0ZA 1U5YA 1F36A 4DZGA 1FI2A 2FOWA 2Y33A 3ERMA 1AHDP 4II2A 2R7OA 2RREA 1SC7A 1HKDA 1DU3D 1VBB2 2A61A 2EZHA 1K61A 1W9WA 3IAQA 3DTKA 4XFIA 4B3NA 3I3QA 2Y9ZA 4LORA 3DKXA 3FJSA 3LMMA 1G9CA 4IXLA 1T2XA 4B44A 1VAKA 1S1AA 3CZUA 1R081 2ZKZA 5F6FA 2R7DA 4GMP1 1DBNA 1YJNI 2Y0OA 2HJIA 3UGFA 5FYSA 4Q8KA 1H4GA 2KIQA 4G7ZF 1IKQA 4U0WA 3JBG3 1WH5A 4MZUA 4JZRA 4OOIA 3ZMNA 3TN93 1OUSA 1WW6A 1B72A 1YIJI 1CPMA 2P4WA 2IS6A 2VOTA 3FL7A 1N77A 3TO7A 1MMGA 1DDNA 2H6BA 2CWEA 2MNGA 4AAXA 5HDNA 1VQOI 2H27A 2GNBA 2AENA 4XVHA 3H9AA 5FBZA 1MPXA 2VJIA 2PJPA 5CADA 4QB2A 3MMYB 4D7SA 5HS7A 3ZKYA 2QSFX 1CAUA 5IVVA 1CPNA 3BPVA 1BBYA 3NV2A 2FSWA 1W3VA 4RR3A 4V2FA 4CEYC 2FHRA 1JZ5A 2W52A 5F08A 4BQWA 4IEVA 5J4VA 3WINE 5CQEA 1QY4A 1JGGA 2VPLA 2AQFA 2FDHA 4X1EA 3J80K 3OGSA 2RQQA 1FOYA 5K5RA 3H50A 2Z69A 2DF7A 3VGIA 1UY3A 5KC5A 1G9AA 2PG4A 1HXS1 3OOUA 2R0HA 3FHQA 1MJAA 4EN6B 4K6BA 5FZDA 1WGXA 4XL9A 2XL9A 3ZXGA 4AFDA 4GWJA 4NBQA 5DPNA 5J3UA 2VUCA 1XC5A 2R7SA 1SD6A 3AP5A 1QJU3 1WH7A 5FXXA 3P9CA 4EM2A 3KEOA 1XNTA 5FLJA 1C8M2 5L9RA 3I53A 4KGGA 2R92J 1AX2A 2WUHA 3IB3A 4YIFA 5IWFA 1FC3A 4RN5A 3WNXA 3BG7A 4QXCA 4BE3A 4D0QA 4KWLA 1D4M1 2RVCA 4QAWA 4N7UA 1RMU3 4FE7A 5FRMA 1HKTA 1FMVA 3OYCA 4XCBA 3VZLA 1BC7C 1PVC3 5M0TA 3FXQA 1QJY3 4Q4V3 4PDWA 2WBKA 2D93A 1NOVA 5J6XA 4P00B 1BM9A 3U14A 3GXOA 4JV4A 1A8MA 2BZDA 2EIKH 1SD4A 3JD72 4EM1A 2XDVA 1KGSA 1FBSA 1PP8F 3T1LA 4OI4A 2NP0A 5SV5A 1ZH5A 1YNAA 3TN92 4CXWA 1V6KA 3NJYA 4G6DA 3ES1A 2ZX0A 2RMU1 5KXCA 3BR6A 4XR6A 3WP6A 4B4PA 2Q4SA 4FPHA 3MLKA 1ZTRA 1EP0A 2QQKA 3KHCA 2R5ZB 3LSKA 2YU2A 1XJAA 4XBLA 4NIGA 3WTSC 1PO23 1ULFA 3AX4A 2IFWA 4NHLA 3LSDA 5FREA 3CQOA 1WCSA 4FI9A 2LDUA 2J7MA 2VBZA 2ZFUA 4MEYF 4AI8A 1U6GA 1WCKA 2YBKA 4DS0A 3HRSA 1H9GA 5J98B 2HWD3 3SFIA 1XD7A 5A1FA 4BE2A 3IDEA 2Z2SB 2PHDA 2A07F 1WLTA 3GCMA 2PTMA 1JHJA 4JHZA 4WM8A 4JX5A 5F9TA 1U78A 2OX0A 4Y5Z0 1FSEA 5F04A 2A6HF 1S0CA 1I39A 2HWD2 5HV4A 1W0UA 2K86A 1QXJA 4BK4A 2E7AA 3VYUB 1QNYA 4WF2A 2QA4I 1IQAA 1C3HA 4XNFA 2DTRA 1OI6A 1FNYA 3DBHB 1AR63 5IP7J 1MBHA 5HLGA 1IS4A 2NRAC 2WC2A 2FQ4A 4Q1RA 3FM3A 1SLIA 1V6MA 1RKTA 4F3QA 3R0JA 1FT9A 4PCRA 4YFZA 1VPHA 3OY8A 2SBAA 5EHDA 5LW9A 3MICA 4XTMA 2PAMA 4PQ9A 5DUVA 3MZHA 5K5OA 1COV2 4RSUA 1BIAA 5DS9A 4KG0A 3WLUA 2GAUA 4D69A 2GC2A 1P4AA 3GZTB 2WV1A 2DDUA 2WWYA 1DHKB 4OAZA 4AEJA 3GTLJ 2GP3A 3VYTB 2HNHA 1JN2P 2ARAA 2IXHA 2OQ6A 2YC0A 1CONA 1QHDA 2XWBB 4B3AA 4KJZA 3JB8A 1LEMA 2HWC1 2B7YA 2XPUA 4A6SA 5FOJB 3KEYA 5BY5A 5HLTA 1JJ8C 3Q0UA 1X82A 5C3EJ 4MNUA 2DCZA 1LHVA 2QQNA 5L9VA 4AVVA 4H0EA 2QJVA 5E16A 2VZTA 3AZZA 1I50J 4HETA 1JYWA 1V70A 4KWKA 1B59A 2JUGA 2X1DA 3BG5A 1R1TA 4A5MA 4NPMA 2VZOA 2VULA 3VBHA 5K1YA 3I3MA 4OIQF 1KU9A 4P9YA 1U12A 1BYHA 2RGVA 3CF6E 1LGBA 1FOKA 3APBA 3OR2C 3IV5A 3HKZN 3WW1A 3QD6A 3HOSA 3AYCA 1AR61 1TMF2 4YIRX 2E5ZA 1LVKA 3MV01 2YPJA 1H2NA 1F9KA 2L2OA 3ZXLA 1BQPA 4RFT0 1OOPC 3K1MA 3MZ8A 2Q2EA 4A12A 4BKXA 2BU9A 3CUQB 1UG2A 1C57A 4HPQA 2MLKA 3WQ7A 2QBYA 1ZRRA 1UU6A 4LR4A 5F5IA 2BY0A 3OY9A 3OYJA 3ZQFA 2ZBJA 1AZDA 1YJ9I 4RAZA 3BC8A 3HL2A 1ODDA 4XMYA 2QQUA 2OYZA 2GSYA 5EJCA 2YFZA 1GP6A 1UZWA 1ONVA 2ZOEB 1ENXA 1Z0XA 2BERA 1VMJA 5FKLA 1DGWA 1Y9GA 2NLRA 1LGCA 1ZGWA 2E71A 5FZFA 4IV1C 3AB0A 3A0KA 4LBJA 4LG3A 2PMUA 1OSGA 3J80Z 5FZ6A 3PNYA 4XBFA 2O8OA 2YGLA 3C18A 2PQSA 5HCFA 1RC6A 1SBEA 2Z33A 1ZR4A 3N7JA 1KQ9A 3M3IA 1LECA 2OD5A 4IHVA 1FJLA 4LLFA 1QKQA 2HYXA 1GUUA 2C5DA 3O1PA 1JYTA 1X33A 4JBAA 5ANNA 1PGL1 2VMHA 1BOBA 2ELHA 1OR7A 1RESA 1GSLA 2VOVA 4FPOB 5LB6A 3ABLH 2DI3A 4IW3A 3RQ0A 2JE9A 2ZBKA 4X6AJ 4ONUA 4CH7A 4Q27A 4EYUA 3ZN6A 2EIGA 4A0XA 5A32A 1AUYA 1E2XA 3CMGA 4K8RB 1JZ4A 3H1YA 4KUMA 3TBIA 3CJQB 5B1BH 1YYVA 1ZZBA 1UHWA 4KICA 1YIPA 3ZMSA 2JB4A 2LW8A 4XBNA 1B1BA 1SG3A 1P7JA 4ABZA 5JSOA 2VZVA 4BEHA 1SLAA 4EEFG 2E6VA 4W4ZA 3G73A 1BJQA 4B48A 2R041 3VODA 2GNMA 2PHFA 1N25A 2WAQA 1NCQB 1U8BA 4H14A 3VLBB 4FVVA 1RUJ1 4BXFA 2UWMA 3I4NJ 1R5ID 1FMD3 3JRAA 4QQLA 2W1OA 2YG0A 1T08B 3B02A 4XETA 2V5DA 2ZCWA 1JE8A 4BNCA 1S72I 5IT9K 4L11A 3HYIA 4A3MJ 4FOQA 4ESBA 3I2HA 4L9NA 3RIRA 1HXDA 3JRHA 1DYKA 4HX4A 2LP0A 3E97A 4CCDA 3JTHA 3ME2A 3MO4A 5AFEA 3DECA 4BAYA 4HKLA 3VDDC 3DPRB 2I45A 3K0LA 2UWCA 4DXSA 3WTVC 2F5CA 1JHNA 1VP6A 5F37A 5F0FA 4FXGB 3CC4I 4KBZA 1I3AA 5IYYA 3M07A 5HDGA 4CP9A 1CAVA 4P9UA 4B1RA 5LK5A 4LKFA 4HVQA 4DPNA 4ZS3A 4NQWA 3WW3A 4DOZA 2HLEA 3ML6A 2Z1DA 5F3EA 5A7WA 1WPKA 2G9WA 4EQQA 4HEA2 2ZXJA 4YW1A 4PBOA 4ARXA 5G04L 3SFZA 3C2BA 1PO22 2KRFA 2JJ7A 4IHWA 2O1QA 3OS2A 3CDHA 5CVRA 4AEDC 3OJBA 3BR2A 4QX2A 3OSFA 5IYBJ 5J1RA 1PZ7A 3K2ZA 3HRMA 1AVBA 4RQPA 3BOPA 2DMQA 2RNJA 4TSVA 3RRDA 5A6XA 3RKYA 3OGJA 1C1LA 4GJZA 2HYGD 4Q47A 2YXSA 4LBMA 3ZMZA 5C71A 3IUOA 1O8SA 4RA2A 4M74A 3PIJA 4FP3A 2VR4A 3LFIA 2DYCA 5L3BA 3HIFA 3ROUA 2LRDA 3BZCA 1WD4A 1O3SA 2ZJCA 1S2EA 4GDFA 2R7VA 2W48A 4FISA 4C3JJ 4OQ9A 1VQ4I 4P96A 4LBQD 1O5LA 3TDZC 4QXKA 2VPVA 2HEYF 4GMP0 3T0YA 4UYBA 4Y22B 1OJLA 2YU1A 5C70A 2PBIA 3CLPA 1BBT1 2BPA2 5LK7B 3R4DB 1EPWA 1JUPA 1G86A 2L01A 4P9GA 1TE1B 1BJAA 4IHXA 1I9RA 4FX4A 1D5YA 5IHRA 5EGOB 1R093 5GZCA 1W05A 5LLQA 5LHGA 5F5QA 1F43A 1ZZ9A 5IW0A 2RS53 5AIQA 3H7JA 4RHV1 3H35A 1WMEA 1W6MA 3FHNA 4E7SA 4A3KJ 3GX4X 5CVVA 3SHRA 2YB7A 3WU1B 1FSHA 5CG8A 4FFGA 4GJYA 2V09A 1HDKA 2V6EA 1OBNA 2DAOA 1IHMA 2XJPA 3VDDB 4GA9A 3VN4A 2FDIA 3DPLC 1PP7U 3HKZA 3U1DA 4Q4Y2 1CAXB 1MH4A 2XGXA 1RTVA 5H9PA 4IDZA 5DXDA 3BZKA 1H89C 1NCQA 4ZH4F 2ENRA 1VI0A 4I0WB 1JGSA 3QODA 2AXLA 3R05A 3E6DA 4RGSA 1B35C 4JOMA 1VJ2A 5TISC 4YRVA 2UYAA 5EYXA 1YOVB 5BNOC 4P08A 1SDWA 1XB4A 1B35B 4QKDA 3IDCB 1QNWA 1AR83 1I27A 4R9DA 1TWCJ 1I1EA 2PHRA 1PO11 4QXHA 4X6QB 2F4LA 3B3QE 3H92A 4AFBA 4M3CE 1HRI2 2HZTA 3UJQA 1U0JA 1H1IA 1QVUA 3LEKA 4FO9A 3JXSA 1V54H 3V0BA 2V7FA 2FNAA 1SEFA 5F7UA 4NHJA 3LOBA 1W8FA 4QLCU 2PJRA 2BXYA 2MEV1 4CCOA 1RUD2 2CFXA 3M3CA 1GT0C 1GFF2 2A3SA 4LKDA 4PF5A 1TWAJ 2WAOA 2DCJA 4A5NA 1QQP2 1JHFA 2B9VA 5LBQA 3PUHA 5CFCA 2CQ7A 2HWC2 4G94A 3VDXA 1WKMA 1QHGA 2KDZA 2D3RA 3SEQA 1ZZCA 2HDDA 1XE7A 4KMUX 3AZVA 4D8MA 2PHXA 2WA4A 3D8CA 4XSXF 1RHI2 5FUPA 4A3CJ 5A80A 1FMWA 3M3OA 5A3UA 5FZ3A 2PMWB 4ES9A 1DZQA 4M0HA 2LF8A 2VE8A 1HBXG 1W2AX 2DDAA 3QCWA 4C3IJ 1XNDA 3EJKA 2ME0A 1K78B 4BQ2A 1AR71 1O3TA 5CFCB 2D6NA 5FV3A 4BPZA 3OYGA 2F6CA 3G6EI 3J9SA 1QJU2 2KMUA 5A7PA 2YGMA 1LKNA 5A7OA 4W97A 1OHFA 5JR3A 2O61A 5IATA 2CGOA 2W84A 1O5UA 4LMFA 3HRUA 1K78A 2Y0SA 2GXGA 3LWFA 1XOYA 2A6ZA 2VZQA 4LJHA 1WLDA 5ANQA 3VD7A 2K40A 4QGMA 4MXWB 3FZ3A 2ISZA 4M3CA 3HGGA 3FUOA 3BG9A 4M01A 1UHMA 1U5IA 4Y4YA 2HYFA 1B8IB 2R062 1TG7A 1ETQA 4BQ3A 3N9PA 3EDPA 2PYTA 4FAHA 2QFEA 3D0SA 5T5OA 4FTSA 3WG7H 2DJNA 3OR1C 1Z7S1 4UVCA 2RR11 5FYMA 5GTHC 3MF9A 2KHMA 1IJWC 5ACA2 1J0RA 5JPNB 5D21A 2ESNA 2ID6A 3WF1A 1W28A 3N9QA 2NOGA 4II3A 1CX1A 3NSTA 1HB2A 3ACFA 4IZZA 1UCXA 4L99A 2JT1A 2ZGNA 2EFWA 3KP5A 3BIWE 5BQTA 3OIPA 3BU7A 1XGSA 1H2LA 4XJZA 1Q8VA 2ZGOA 5F3GA 4DUWA 1N1YA 3V0BB 3U4XA 2DFEA 5J1UA 3BJ6A 1D2QA 5CKTA 5A1AA 3JW4A 4IHSA 3BGAA 1FP2A 1Q56A 1CN1A 1ULEA 4QHOA 4I98B 4PJMA 5C3PA 2VQCA 2GH8A 3OYWA 3ZMVA 4GULA 3NVCA 1GZWB 5D8AA 2RS31 1W6OA 5IVCA 4BDVB 4PFOA 1CVNA 1IGNA 3TWIA 1YFUA 1WI9A 4MTEA 2P6HA 5LGUA 4EMSA 5HS9A 3VBSA 3VZMA 2MEV2 3VBRA 5DUUA 1V4RA 3OPZA 3OYDA 1HW5A 1MBKA 3U75A 4AVTA 5JIAA 5FWEA 4QQ2A 3ZQLA 1F15A 3S2HJ 2GP5A 2VJJA 2CY6A 1AR92 4B09A 3KEQA 1SFXA 3USUA 5BUVA 4L9TA 5FY5A 1G3WA 1BBT2 4G6TB 1Z7S2 5LA9A 4LOCA 2PLV1 4LFUA 4QM9A 3TB0A 4CP1A 4JX0A 1L3JA 3THPA 2GNTA 2NYYA 4SLIA 3AZWA 4ZZDA 3GFJA 1HOMA 4LO7A 4GRIA 1FYKA 4UF0A 2JRTA 4XTPA 4HL0A 1GWLA 2VOKA 2B45X 4COYA 1ZRFA 3DU6A 1ND3C 5JLWA 1PIV3 5IOYA 3GNEA 2DVBA 3NNGA 3AG3H 3G71I 4IX7A 3RKQA 3OCPA 2VNRA 1GZTA 5F39A 4QSHA 5KHKA 3B00A 4JKLA 2F4PA 5FPUA 1QGLA 3C3VA 5FLXK 4OHZA 4FSJA 4MGYE 4V2VA 2PJRB 1GXQA 1L7QA 3I56I 3OYLA 4NUBA 5FWJA 3H9QA 2OCEA 1RUG3 4S2HA 1G9FA 4AIHA 5T5LA 3ZP5A 1D0ZA 2ACJA 1BMV1 4BISA 4LIUA 1JKRC 2TEPA 4EJTA 4I02A 2W94A 4IF4A 3FFZA 2C6YA 1SPPB 4OIRF 2WAQN 3A2KA 1PYVA 1SAXA 1OPMA 3LAJA 2TNFA 2EFQA 3MAJA 2DOAA 4XEZA 3U07A 3L2UA 4E7LA 4AF9A 4XLPF 4XZUG 2A6YA 3RWKX 3TO6A 3I49A 2LTPA 1ACIA 2EF6A 4YM3A 5EG0A 3FBMA 4R9CA 2KLOA 3WGGA 3NMBA 3QBQA 4ZHNA 1W6PB 1YQ2A 3W5MA 2WWUA 4BQOA 4HKWA 3OTFA 2NVYJ 3IPVB 3PUIA 1AYN2 3OYFA 1WBFA 3P3NA 4XC9A 4XCAA 5JVTA 1X7NA 4QX5A 3SDBA 3JZVA 5HV0A 3A0NA 2LUWA 2Y2ZA 2EQRA 1U2WA 4PJLA 3P7NA 2IFRA 2BJSA 4YFXF 2E60A 4XMAA 3PIGA 4M71A 3MZYA 4KWJA 1RNLA 2B7EA 4LE3A 2X8KA 2XBO2 1DDLA 1OLTA 3S8PA 2MPFA 2BWCA 4M3CF 4MG2A 1QBJA 4AYBA 1KS5A 2FD5A 2VJ5A 2DTWA 4PFPA 1ETKA 3ZQ7A 3JU9A 3VHOA 3FE5A 2CFOA 2DK5A 1YHFA 3LAGA 1RL3A 5FY1A 2EZLA 2O7OA 3PTRB 1VAMA 1IPJA 2XJVA 3AYDA 3GZAA 3AZXA 4BOWA 2VXZA 2Z4FA 1OH4A 1JT0A 2XJTA 1POV1 3GZ6A 1W36D 5JMCA 4XK4A 2L02A 1VIWB 2ZMKA 3O5SA 5F6KA 4FFIA 1EJ9A 4I6ZA 4JGYA 4C2UA 2L9VA 5EZWA 5H20A 2VZRA 3SCFA 4OZXA 2NNYA 1D8KA 3NV4A 5IAVA 2GZWA 3GBGA 4A3LJ 5FPAA 2QCSB 2UZKA 2W25A 3R60A 4A7YA 3KCYA 4KT6A 3ZFEC 1RVF1 2F5EA 2IZWA 5CA6A 4AFCA 4LBLA 5CZKA 2ZJQF 3K75B 1A34A 1JZ3A 2KRCA 5FP3A 2COBA 1UU4A 5DYMA 5E8IA 4QQHA 2DLLA 5KBFA 3F8CA 3ACGA 3WU0A 5ISLA 3WG4A 3L09A 4PLNA 1EH8A 1LDDA 4ARYA 3WCSA 2LRPA 2ZSHB 4ENKA 2QVOA 4QB6A 4LMYA 4HN0A 3KYLA 4D6SA 3J4UH 2YX4A 5BMZA 3KHBA 2FZ1A 4W6YA 2VZ3A 4I3GA 1R71A 3WGIA 4IE0A 2K7LA 3GM8A 2VE1A 2CQXA 4J19A 1ZELA 1SBFA 3NJXA 1MBGA 5DABA 2DFBA 2IXIA 4CDUC 3VBUB 4L18B 5FO7B 1PO13 1RUD3 4XUOA 1XGNA 1AR81 2RG4A 4RHV3 1UZYA 3AL0B 3DXJF 4XOTA 3FK7A 3F6OA 3OS1A 5KVRA 4NWWA 1OVSA 3IL2A 4QPWA 5GM0A 2DCYA 2EV5A 5JCTA 5DUIA 3G2BA 3UYJA 2WO7A 1SFYA 3OWTA 4HF1A 2DV9A 5FIXA 3Q5FA 5DAVA 4F92B 1GNZA 5IP9J 5KNLA 2R1BA 2PMZN 1UELB 4UFMA 2HVQA 4AVZA 3SH4A 1PO21 1ASJ2 5FP8A 4JGZA 4OAYA 4BHBA 3MVPA 2ZX2A 4IL7A 4OFGA 1Z91A 4QPYA 1T56A 4YG0A 4RR3C 3GW2A 3I8TA 5IFPA 1VTNC 4N43A 3WDVA 1OURA 2FMYA 5L36A 3D6EA 2CU7A 4XYXA 1D5VA 1LEBA 4H2AA 2UV1A 4XJWA 4DW6A 4KGQA 4AGRA 4OMDA 2EZIA 2DMPA 3GFMA 3MIBA 2L7MP 2WO3A 3M70A 1LB2A 1DQUA 2AREA 3AKPA 3BOWA 2DCTA 4QWNA 2VOXA 4DBRA 2DYSH 4RGKA 3ZSJA 5B5EC 3TEWA 2A7AA 5IPAA 1AR62 3TL4X 1VBE2 3O1UA 1JZ2A 3AKRA 4UFKA 5HXVA 3CCJI 4FPKA 3K2AA 3JR9A 2ZMEA 4GZ9A 2I74A 4LD5A 1X36A 2CDPA 2DA4A 2EK5A 2CQNA 4WVZA 3I2FA 1POV3 2CW7A 2XWJB 3LQRA 5M5YJ 1DF0A 3FMRA 5AC91 1S29A 4XKBA 3I4PA 3GZ5A 3UETA 1NCRA 2W82A 3IZOA 2IA1A 4K9SA 4LK7A 5K9YA 1FTZA 2FUG2 1W7PB 4BBRJ 3O1TA 1YCIA 4E2SA 3AXEA 4RYDA 1EUUA 5J1YA 4AK3A 3L2YA 4EN0A 5C8CB 1JZ8A 2XQRA 4MGTA 2E5NA 1HW2A 1ASJ1 3GGLA 2K9SA 3NV1A 2DA1A 1UYZA 5J8CA 1X8MA 4AI9A 1WMDA 5E17F 3HBKA 4TZDA 1APLC 3WVJA 4TLGA 1S0FA 1X1CA 2VZPA 5CQGA 2RS32 5FPXA 1IG3A 4BS9A 2W95A 1APNA 3U11A 3V64A 1J1LA 5DAPA 2M4KA 4R79A 2X6WA 1SANA 4GQ7A 1W6MB 4A93J 1KGYA 2DPUA 1UNBA 4HF0A 4DXRA 3E5UA 2YZ4A 2BVMA 2R7WA 4LLNA 5D5UB 3OBAA 3D4KA 3L2VA 1LOFC 2VW2A 4HSLA 1JUIA 1F8VA 5CVIA 1V5GA 4N53B 3WDXA 2FBKA 5IAXA 4Q0QA 4OYUA 1PM4A 5IVYA 1DQ0A 1UCRA 4OVEA 4AEMA 1EH7A 4AD9A 1Z1DA 3OYEA 1XBFA 2RN7A 3N9NA 2B63J 1UY1A 2JIJA 5FZKA 1YS7A 3BCBA 3P9IA 2YC4A 2Q8CA 4N53A 3WT3A 1EAH2 1C28A 2VBWA 2YS9A 4CPBA 2DA2A 3W9AA 4BLJA 1IN8A 1ZYBA 1ERDA 4XILA 1ZQ3P 2BW3A 3BTCA 1FOXA 5ICEA 1OCPA 2OW4A 4DQAA 5FMBA 2WQ8A 4Q2FA 4RMNA 4L8QA 5IVEA 4FOWA 1XPWA 1NQDA 2LY1A 2DFIA 3TRSB 4BXXJ 1I6XA 3HOXJ 1HB3A 2NS7A 3TDUC 2ERFA 4XFAA 2YPDA 1S2KA 1D7PM 1FV2A 1G6NA 5EFUA 1HDDC 5C3SA 4WK8F 3MN2A 3SEZA 1XXNA 3DLAA 4KN4X 4CO8A 1NXD1 1RR7A 3OIQA 4NC6A 2VM9A 2Q2EB 2BV4A 1W2TA 5FD5A 1EV7A 5DDJ1 2JTVA 4JX6A 3HPGA 2VGDA 3ZDSA 1QGPA 1DQ6A 3D5RC 1RRJA 2XHKA 4RBOA 3FX3A 3LQCA 3GUDA 3J7ZI 3BTIA 1GOFA 4KNYA 2XGDA 1BN5A 1J1TA 2EJRA 4MHGA 1SAUA 4RL7A 1B6AA 1W2NA 3MFKA 4E7IA 4JAAA 2A3XA 2JKXA 1NY71 3TMOA 2K9QA 5FQ0B 3NNMA 2EINH 3ERED 2A6VA 1J9IA 5FPLA 2LTNA 2W92A 4XABA 4U36A 3DKYA 4IOAF 2ZJPF 3ZDVA 4RGAA 2P7VB 1WMXA 1UYYA 4ZZLA 5FPZA 5AC93 3PFIA 4Y22A 4CDQB 4PQQA 2NN8A 3V56A 5FMCA 4CEYA 1D4M3 4ASLA 1KYZA 2LFBA 2Y48A 1VQMI 1CZVA 3MW4A 2HR3A 4RR3B 5HODA 3EXUA 2AR6A 4UFIA 2QTWB 1BW5A 2VKEA 1SFKA 3AM2A 4MADA 4E6KG 5FRNA 1QZZA 5A3NA 2JPBA 4MGSA 2L7FP 4NPLA 2P3IA 2A70A 4XQDA 4OUMA 3SZPA 2BGPA 2VQUA 4IQJA 2Y6JA 2I07B 5H2FC 1KDMA 4KL1A 1IDZA 5DMYA 5BV6A 1DGWX 3LPFA 2DFHA 4O3MA 4S2FA 4LULA 5C5UA 3ORJA 4BCUA 1YQ8A 2QZ8A 2DVFA 2X6YA 2BBAA 2DDBA 4LO5B 1W36C 2WN2A 1U9OA 2W1QA 3WY6A 5IYCJ 2VTFA 4LG0A 4DYRA 3B69A 1W2UA 2XAQA 1K42A 3ZN4A 5LGTA 3ASNH 4HLXA 1W06A 1JKOC 5FYCA 3O1SA 4XJ9A 2XR4A 1W0OA 5ED4A 1Q43A 2A5WA 4BBSJ 4K8FA 4ZZ5A 2K4JA 1ZR2A 3UNGC 5DZEA 5GTIC 2HWVA 2WNVA 3KP7A 3C7EA 1PGW2 4KNCA 5CYYA 4TWTA 1HJGA 4F83A 3EUHA 2Z5WA 4DJAA 3CDIA 1VBC1 2D43A 5CBLA 3R4UA 4DNYA 4W1UA 2ZEXA 1JUHA 2JG9B 4AHWA 3K10A 2VMEA 3M4FA 2JDYA 3ZM8A 2O8KA 3RZOJ 2XVKA 1GZWA 3AVSA 3GALA 3RKXA 3SEPA 5KC6A 2X5IA 2HPIA 2XAGA 3CF2A 4HG2A 3QYFA 2VMCA 1S4CA 2X6OA 4AC0A 2W5FA 1Q3EA 4K21A 4KH9A 4QX0A 4ZDPA 3KZIC 3FXJA 3POEA 4ZJZA 4MHRA 4EGZA 5FOBB 4GH4A 3RYPA 2KJBA 3LSIA 2BHZA 2O8XA 1HRI1 3O0WA 2QKMB 1L7LA 3S17J 2GMEA 4H7MA 5FZ4A 4JQFA 3DPUA 2V9VA 1NT0A 3C2HA 2JG8B 3H8RA 4AGVA 4R8HA 1MZ5A 2YU9J 2PHLA 1M1EB 3UNPA 4Y3OA 1A8DA 1FOD1 4O7XA 4NN0A 4PSXA 3S5QA 4QX8A 5IK7A 4LNVA 4LJZF 4QDSA 2OAZA 2E36A 3H0DA 1HRI3 4BYYA 2VL4A 2W68A 3BALA 2QZ2A 3HEFA 3T1BA 2STTA 1USSA 5DUKA 3UKVA 1XYOA 4D1QA 1WKYA 3PNVA 3VL9A 5K0UB 3VZOA 3F9KA 2K5CA 3EYPA 5HI0A 4IETA 5FLIA 1JYXA 1R1ZA 2OJED 5ERIA 3LSRA 1KXGA 2STWA 1B8IA 3LEGA 3JSPA 2L9SA 3H8UA 2NXNB 1FYMA 2LBFA 3AMHA 4X8NA 4MUVA 1HW1A 4OMZA 1X2MA 3E6MA 2ZABA 1PVC1 3FMQA 1JOJA 4TTGA 2JWPA 2L0KA 4DXTA 2RDRA 4CVUA 5F1RA 4ETSA 4DNCA 1SFNA 3SLIA 4LOTA 2W47A 4LT5A 3B6CA 4NC7A 1MS3A 2D5VA 1QJU1 3WEZA 3I2OA 2WIIB 2WB1N 2W1UA 3LDRA 2R0FA 2JB8A 3FXLA 3NKGA 5B4XA 4Y26A 3QYBA 1H9WA 2E63A 5FYYA 4IV1A 5LATA 1RXGA 5FLXZ 1UOFA 2OQRA 3WZ1A 3AMNA 2OA4A 4C3HJ 4GWMA 2VW1A 3L2QA 4BQ4A 2IC1A 3AL5A 3SQOA 1E5RA 1LU1A 2F4OB 4BEHB 5AONA 2WNEA 2E1OA 4KBBA 5CAZA 2QQJA 2NMOA 3BQYA 2D6KA 2RS33 3I71A 5EJ3A 5A3OA 3BTZA 2HWB1 4X0GA 1Z78A 3C8XA 2I2SA 4AAPA 2BBVA 2GM4A 2OTLI 3MIHA 3WHBA 1WZ2A 3VBFC 4XRSG 2KXLA 4XJAA 3HSRA 4UW5A 1N75A 2VW0A 2X29A 5DEQA 3GLXA 3ZMOA 2EBIA 2R0QC 3MDPA 1UOGA 5EDNA 1PVC2 3AFKA 5GZGA 3TGNA 1TNFA 3DTIA 1F4KA 2PI0A 2IJLA 5JSPA 3HWJA 5FXVA 4A3FJ 2VBDA 4LHNA 1I5ZA 4X8PA 4XQWA 3DYMA 1H0BA 4Q29A 4JGYB 3Q3SA 1Z9CA 3IH4A 2K46A 4DIQA 4LK0F 1QRYA 5IY5H 5FZLA 4QPIC 5E3LA 3I7DA 1KONA 2OV7A 3CIHA 4CCLA 4WVMA 1W8WA 1CIYA 1P92A 4IE7A 1O6UA 4AHXA 4F8AA 1HX6A 1LOGA 3CCMI 2GN7A 3T2QA 4LK6A 1A31A 2FNPA 5FO5A 1DU0A 3IC7A 2R5YA 1WJ5A 2RM22 1X3ZB 2X53S 5FQ0A 5A6YA 3THDA 4XJUA 1ZX5A 2K0GA 2FF4A 1NKGA 3CP8A 5DG1A 4D94A 3FBNB 2IS2A 3CUOA 1LR5A 1LUJB 3FMGA 4DO0A 3O0XA 1K7AA 2FBEA 5ABJC 3E6CC 2CL2A 2QDNA 1VQ5I 1A6CA 3CUQA 2R49A 2BRTA 2CG4A 4V19K 4KFCA 2OU2A 3OUJA 3HT1A 2DT7B 2QQAA 1CJPA 5FTTC 3IDAA 5CFCC 2WBMA 1S0GA 1GU3A 1N1SA 2ZZQA 5B2GB 1H4HA 2FDJA 5I0TA 3WU2C 3OSGA 1C5IA 4IE4A 2JUCA 1WCDJ 3CCRI 1BEV2 4CU6A 1USTA 4HRIA 1OQYA 1WBLA 1VBD1 3KV6A 1R36A 3GCXA 4D9JA 4ASMB 4BM8A 4P5YA 2OQGA 1LJ7A 1J7KA 2WZR1 3OYHA 4OQ8A 2A68F 1L3LA 2N8GA 2VECA 2Y6GA 4CXYA 1DPRA 4MGIE 1TNRA 3J8F1 3M2MA 3OSDA 1LEDA 4P55A 2Q1MA 2Y26A 3K3NA 4OU0A 1MNDA 3K4KA 1FATA 2JK3A 5BNPA 2FCUA 2E1MC 1XYPA 2ZPXA 1YQ5A 1OF3A 2EIEA 1EKEA 3T5XA 1VLNA 2M7AA 3BJOA 3U78A 5GLTA 1VQ8I 1UWWA 1J84A 4QPIA 3RS6A 1B4AA 4ITCA 3VPRA 4WX9A 3CC7I 1IQDC 4EGYA 3BTAA 4CP0A 2XONA 2Y8KA 3KLOA 5JXHA 3Q8AA 2ADDA 4IHYA 5JOXA 1N1TA 2XG3A 2IXSA 1QJX1 2G7HA 4Q26A 2BGOA 2Y9YA 4COWA 1IUFA 1UXZA 5FZCA 2IGOA 3DV8A 3OPTA 2X10A 4DYQA 5FAXA 4PIXA 2Y0SN 4XFFA 4URTA 4MV2A 1DLCA 2RJKA 5CJ9A 3K4JA 3PVBB 5EJ1B 4HSRA 1JTZX 3MLLA 2OTJI 5BPXA 1POGA 2V26A 2VBXA 5I8YA 1OR7C 2ZXIA 4A6EA 1KYWA 3K4NA 1O4ZA 4RGXA 2ORXA 3M7AA 4B7EA 4DMIA 1W9YA 4AQSA 1KQ0A 4XSZF 4PDWC 1MNEA 1R23A 3OF1A 2VVFA 1J3QA 1AR91 2WFPA 5I91A 1HRV1 4C1XA 3BUCA 3AMPA 4CEYB 2AXTC 2HDWA 2KDOA 1MSEC 1SZBA 4CDXB 2DMTA 1TWFJ 3V42A 3OPWA 4D7TA 5HXMA 3O1VA 4XBQA 2MGQA 1W9SA 4RAYA 2FRHA 3TYJA 4FT8A 4IQPA 1PIV1 4RB1A 3I97A 1ASJ3 1M06G 1PMIA 3DPRA 3NNFA 3HOTA 4PDKA 4N0BA 2YSRA 2CHHA 5FY4A 2PHWA 5GP9A 4J1WA 2WINB 3PO2J 4RQPC 1IG7A 4RB2C 2MA3A 1O3QA 2W9XA 5FYIA 3ZIXA 2G7UA 3EB7A 4F55A 3K48A 1UL9A 2XPVA 3K4BA 2WR9A 1YHQI 3HOYJ 2XBO3 4FX0A 1MQTC 4M6VA 3ABKH 1Z6RA 1JUMA 4XICA 1H30A 4J01A 5E20A 1BEV1 2ADUA 4DUVA 3JRFA 3OBZA 1UKRA 1MW7A 2Z3YA 4QQPA 1CAUB 2PMHA 2VL8A 3LSTA 1IPKA 3B94A 2OS2A 4CCEA 2R30A 3KLSA 1KS4A 1JTYA 4RGUA 4YGDA 4RB0A 3ZN5A 1Y9QA 1D1AA 2EXIA 4QPIB 4Z2YA 4PI0A 3ACHA 4XUTA 1LODA 5CYVA 3O1RA 3HTSB 1ST8A 2XJSA 1Y43B 3ZIWA 2ARCA 4FQGA 1RZ4A 4AM3A 3IKWA 4HW0A 1RUE2 4MQ9F 3BCAA 2PX9A 4YSFA 5FZIA 3NJZA 1YI2I 1IV8A 4RS5B 2WJSA 3FDYA 2H8WA 1K5MB 1IAWA 4AWXB 4S2GA 2P5VA 3ZO0B 2IUWA 4ZONA 1PMHX 4GH4C 2XF5A 4YZ2A 3MD2A 4R52A 1Z7LA 1OF4A 1CWPA 2WABA 2YUEA 5F6LB 1VFCA 2CRGA 3EUKL 2NOJB 1BKZA 4XUQA 3WTWC 4D6RA 5D2AA 1XNBA 3FK6A 5EGOA 2IVJA 1GXPA 1GVDA 1IOAA 1MS9A 1S7EA 1ZHFA 5DCMA 2X5IC 2L9NA 4EJUA 1X1DA 1FZPB 2VB6A 2HWB2 3CHXA 4HNTA 1LFPA 1EAH3 1MZBA 1AKHB 3VBOA 1W6NB 1S2BA 1QJY1 4Q4V1 1XN7A 2FBIA 1ZREA 3UKNA 2JD4A 2C26A 4GGGA 4XN0A 2WNUC 4WBBA 1J3PA 4LUMA 4XRFA 1Y0NA 2XGCA 2YBPA 4BQAA 1JKQC 2JDUA 4UVBA 1YITI 2Q8OA 2H09A 3HSFA 2EXHA 5FFOC 1OLQA 4FQ4A 4YFWA 1IN6A 4Q4X2 1MZEA 5HS8A 3MGUA 4IO9F 3WTUC 5C5TA 2W85A 3F0CA 1KD7A 3T0DA 1HN1A 2VUDA 5BS6A 1V55H 4CCCA 1GVJA 5C8CA 1BL0A 2UWBA 4BQYA 3IT8A 4SBVA 5E3OA 3W20A 1J09A 1F9NA 5DAXA 5LY2A 2XKOA 4JDMA 2V1XA 3ZX7A 3KVBA 2QQMA 5EZGA 4