4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
5FZIA 5FZGA 4CCOA 3PU3A 4GAZA 5FV3A 2XUEA 5FY4A 5A7NA 4QX8A 4CCMA 5ISLA 5A7PA 4DO0A 5FUNA 5FZHA 5A1FA 2WWJA 4GJZA 5FWEA 5FZOA 5F3EA 5IVJA 5FZDA 3OPWA 5CEHA 3N9MA 5IVBA 4Y4RA 3OPTA 3PURA 5F3GA 3K3NA 4NUBA 4D6SA 5FYMA 5FZMA 2P5BA 4GJYA 4QWNA 5FZ8A 4ASKA 5IVFA 4LIVA 5F5IA 4Y33A 5FYVA 3U4SA 5A1LA 1VRBA 5FZ0A 4QU1A 3N9NA 5FPBA 2PXJA 5LY2A 2Q8CA 3PUSA 3LD8A 3N9PA 5FP4A 5FYYA 3PUAA 3PTRB 4E4HA 5LY1A 3KV4A 4BISA 4QXHA 5FZEA 3KVBA 4IGOA 5FPUA 2OT7A 4LIUA 5LW9A 4CCNA 5A7SA 4IGQA 5FZ6A 5A80A 2OX0A 5FZOB 5FZAA 5A3WA 5FWJA 5FXWA 2YBKA 3AL5A 5F32A 4LXLA 2XMLA 5FZ4A 4HONA 5FY7A 2OS2A 4BXFA 4XDPA 5F5CA 5FP9A 5F39A 4EZHA 3ZPOA 5KR7A 5LWBA 4DIQA 2W2IA 5F2WA 4D6RA 2GP3A 4UF0A 5FYIA 5FPLA 3U78A 3UYJA 4QXCA 4CUGA 5FP7A 3AVRA 4QX7A 5IW0A 2GP5A 3LDBA 3K2OA 5ANQA 5FY1A 5FXZA 5FXXA 5FPAA 4IGPA 3AVSA 5FP8A 5A3PA 5F3CA 5IVCA 5FYZA 3ZLIA 4AI9A 4TN7A 4AAPA 5F5AA 2Q8DA 5A3NA 5FZKA 2VD7A 5A7WA 5FYBA 5IVYA 3DXUA 3RVHA 2XDVA 5FPVA 2YBSA 5FJKA 5FUPA 5F2SA 3KV9A 2YU2A 3AL6A 4URAA 5FYHA 5F37A 4D6QA 2OQ6A 2YPDA 3PU8A 5FZLA 5IWFA 4CCKA 4EZ4A 4C8DA 5IVVA 5FZ9A 5FZBA 5FBJA 5FZ1A 2OQ7A 5FY5A 3KV5A 5FYUA 3KV6A 3NJYA 3PDQA 4UF0B 4HOOA 5E6HA 4QXBA 5FP3A 4Y3OA 3DXTA 5A7OA 5IVEA 5A3TA 3N9LA 3PUQA 2YBPA 4GD4A 5FZ7A 4CCLA 5K4LA 4V2WA 3K3OA 5FZ3A 5A7QA 2Q8EA 2WWUA 5FYSA 5FY9A 2YU1A 2XXZA 5F3IA 5FJHA 3N9QA 5FXVA 4BU2A 3N9OA 5FY0A 4XDOA 3KVAA 5FYCA 5FYTA 5A7WB 5FY8A 4EYUA 4LITA 4V2VA 5FZFA 5FZCA 4CSWA 4CCJA
chains in the Genus database with same CATH superfamily
3EDPA 1OPMA 4IERA 1SLTA 4URTA 1OVSA 1ZGAA 4IL6C 3L9JT 5FQ0A 2RKHA 3RRDA 1MD0A 4XTMA 2G7UA 3R60A 2XVKA 3EMRA 2HYXA 2FQPA 4HX8A 2ZGOA 1PVEA 3RKYA 2QSFX 4WVWA 3BTYA 3EUAA 3POIA 3H3LA 1Y8RB 3H36A 4OAYA 1GOHA 2EIEA 1LQ1A 4BISA 1IRXA 5AIPA 4FPHA 2YSRA 4K1ZA 2IFWA 1LHVA 5L3FA 2BNNA 1RXFA 3D1NI 4FAHA 1AX1A 1UYYA 2QQAA 3QPTA 2ZHKA 2ZMKA 2HWF1 4G9SB 3T30A 2IC1A 2DA5A 2XONA 1FOD1 1PO11 2XJRA 2HWC1 3AC0A 4EM1A 2EICA 4AEKA 4M72A 1GR3A 4YZ1A 1RL3A 3H50A 3AZVA 3U10A 1CX1A 3HTSB 2JJ7A 1TZLA 4XSZF 2CV1A 3T2PA 1K61A 2JICA 5BMZA 3TYJA 2DTWA 3EQLF 4FP3A 2PYTA 3POYA 5IWFA 2ZEYA 3WG9A 1YFUA 3VBSB 1HKQA 5KXDA 3QODA 5J36A 1DPUA 3UGGA 5IAXA 4AI2A 1R093 1LDDA 4CDQA 4RM3A 5F6FA 3ZDVA 2ZXQA 1T2XA 2QQNA 1FBQA 4WF2A 4F83A 2CW8A 3THDA 4ZZLA 5BPDA 1SFYA 5A7WB 2VL8A 1WSUA 2VB6A 3P1IA 1ZVFA 1YTYA 1QGPA 3W2VA 4JQRA 1D5VA 1X2MA 5A1FA 2E36A 4CGZA 3DPRB 4ZDPA 1UPSA 1NLQA 2IVJA 1REPC 4DXSA 1ZGWA 1OXCA 3CNAA 4ESJA 4XFAA 3LIHA 4TZDA 5T5JA 1BIBA 5FTTC 5HDKA 5SV5A 3HMYA 4YIFA 1ZZ6A 4XPVA 1DGRA 4AVZA 2W1SA 3DV8A 1YW9A 4QXHA 2WFF2 5AFEA 2QTWB 3RTRA 3Q9VA 5HVQC 2ILMA 1WLDA 5LCWL 2DK8A 5FZ4A 1HRI3 2B9UA 3O1RA 3NSTA 5DUIA 2ORXA 2EH3A 3W6VA 1T6SA 2AYHA 5A6ZA 1YNAA 4N43C 4XMYA 2IP2A 4BQQA 3P6BA 4E7LA 5AVPA 3T09A 5GADJ 2K2SA 2X9DA 4FQ4A 4ZU5A 1H8AC 3BTAA 3MBWA 3GO5A 3IMMA 5IVVA 4LBOA 2PHFA 5J1YA 1D1BA 1OJLA 4AK3A 1YIFA 4YWAA 5FY5A 3VN4A 5E8AA 4CEWC 4UF0B 3JRHA 1ULFA 3FE5A 4M3CA 2VMGA 4YG2F 2JKBA 4XQDA 1TT0A 1TNRA 1E5RA 2VW2A 1W2AX 3BOWA 3FUQA 1MMGA 2WZEA 4Y1YA 1YI7A 2QVOA 2BQPA 5D4RA 3WTXC 4IOAF 3T1BA 4Q0PA 2E7XA 3IZOA 1FYLA 3A0NA 2FD5A 3WODF 3PQKA 3QOPA 1BW5A 2DF7A 4LKDA 1HKDA 4XRSA 4LMFA 1NZIA 4P5YA 2DUOA 1NTCA 5CISA 1UKGA 3VBHB 3BU7A 4B7EA 4G4FA 2O8QA 1B72A 1KGSA 2P7CB 4AEDC 2DI3A 1JUHA 4LQRA 3IN9A 1XG1A 4YRVA 2WSUA 1CVNA 4FXGB 5F9TA 1JT0A 1V54H 4Q0UA 2FDHA 3KE2A 1X36A 3C2BA 3HGGA 2GM4A 5CFCA 3LSDA 4COZA 3H0OA 1TQPA 4EWEA 1HDPA 4QX1A 3W58A 1I1GA 4XCBA 2QDRA 4UVBA 3ZLIA 2IZWA 5BNOA 4LG0A 2L3DA 1K5MC 3VDBA 3O1UA 1WQ2A 3NNLA 1CAXA 1V9U3 4YARA 1W8OA 4Y1XA 2PHUA 1R092 3QBQA 1I9RA 5ACA1 3AL6A 1UOBA 4QIWN 1LVKA 1XTAA 1O4YA 5K7ZA 5DPNA 5JOZA 3V0AA 2KZVA 1VE0A 3DCQA 3ON7A 4FPEA 4WM7A 3RZJA 5HCHA 5K4LA 4BOWA 1OMIA 4BWOA 4A3LJ 1MNEA 1UKRA 3R0AA 4XILA 5GTIC 1UY1A 4GWMA 1W0OA 2R49A 3NNJA 4A4AA 3PNVA 2A70A 4CE8A 4ZZ8A 1UZZA 1J75A 1I3HA 4YYOA 4BXXJ 5JSRA 3PSIA 2MEV1 4DYRA 1KDMA 2RS51 3CCVI 1HRI2 1PMIA 5FYYA 2OTLI 3L2RA 1NE4A 1WMDA 2A6EF 4AFAA 4XE9A 3S14J 2ARAA 4AXOA 4IGOA 3DBLB 2C6YA 3LSHA 3HD8B 4WBBA 2BJSA 4D69A 3WF4A 2STWA 1LOGA 2VPVA 1FPN3 4BCUA 3ZFGC 2J22A 4CUCA 3IDAA 5HOOA 1OR7C 1CAVA 1YJNI 2WO7A 1R5HA 3CMYA 5FP8A 3U1XA 4YVWA 3SNMA 2DPUA 1KITA 1YITI 1N47A 5FOJB 3G7DA 1DDLA 1AXKA 1UW8A 5IOZA 1CIYA 3LMMA 3B00A 2EIDA 4C8DA 4B4CA 5C5TA 4L5IA 2BGPA 1DLLA 5H9PA 4JYKA 3EJKA 4XF4A 3HJEA 3EETA 5F0HA 2HBTA 3OYMA 1S0JA 4ZJZA 4L18B 1W6NA 5C44J 4XBLA 1V6MA 3ES4A 5C4WA 1JYWA 1RITA 1CAWA 4M0NA 2ZHMA 1Z0HA 3JCUC 3EUHC 3J81K 4DGWB 2CG4A 1RUF1 1H30A 5LLQA 3HJRA 2G0EA 3I2OA 1PK6C 4B43A 1SBDA 4LO7A 5BNNA 4TYSA 3LQQA 4A0XA 2MNGA 1OF3A 2VZ3A 2EAAA 4AQTA 2PHWA 3SCFA 3K2ZA 2UYAA 4Q27A 2K7LA 1IUYA 2RDSA 3EYIA 3O1PA 4KH9A 1EAH3 3AL5A 2JB4A 5IP7J 2VCMA 4PGGA 3KLSA 4L9BA 3JRIA 2RMU3 1V9U2 3ROUA 4FT8A 2K3PA 2O8XA 3ZFEA 5KHHA 5FOBB 4AQ6A 2EVXA 1CN1A 2JVGA 5DV5A 2C26A 1PZ8A 2PN6A 3ACIA 1HJGA 5EYYA 3PUIA 1W5TA 1FX7A 4ESBA 1CAUA 2HWD3 4PGHA 1SMTA 3JTGA 1YQ5A 3K4LA 3AMHA 3WQ1A 5B1AH 1U5TC 2EXHA 2Q4SA 1PGSA 1N75A 4RFRB 2VN2A 1NK3P 2R7SA 1LE8B 2VNOA 1K79A 2QUFA 3DFGA 2UV1A 3ABKH 4LB5A 1BN5A 5ILVA 2IXHA 1ZH5A 5HBAA 1QOOA 3GBFA 3HPHA 1JW6A 3T0BA 2Q2EA 1AR81 1BHGA 2YG0A 3KM5A 3TOBA 2VOPA 2JSPA 3E7LA 4G3YC 3OYIA 4RDUA 3DL3A 4IPAA 5LBEA 4IQ4A 1FPN2 1NZCA 4YW5A 2ADUA 1VBA1 4LK7A 3IBMA 2KRFA 2RG4A 2R073 3JB8A 1W05A 2RM21 3QYFA 1TWAJ 4SLIA 2LBFA 2ET7A 1X33A 3BUCA 1XSDA 4C2UA 1WUVA 2P7VB 1P8JA 4LBMA 1V6LA 2PMWB 4QB2A 4IE6A 3T08A 2DW4A 4NR1A 4BDYA 4LOCA 1AVBA 4QPIB 2WKKA 4X0GA 5D4SA 2OQ6A 1MS8A 4OIPF 3P5BA 5K0UB 5B1BH 3Q0UA 4MGTA 4P9LA 4AVBA 5CFDC 4D8MA 5IK4A 1GNYA 5F08A 2VOTA 4EJTA 3JREA 4FVVA 4A3ZA 4JOMA 2H8RA 4OHWA 3A0KA 3RMXA 5HCAA 4HANA 5JIAA 1D0HA 1FP2A 2TEPA 3VSLA 3OBRA 3C2UA 1OQEA 1WCSA 5J37A 4WVVA 4AF9A 5KHJA 4BBSJ 2QYOA 3RG0A 4I0BA 4K6BA 2DCKA 1EAH2 2K85A 1B9MA 2PMUA 1XYOA 3FXRA 5FRAA 3A2KA 4BE2A 1LOBA 5FO9B 4LKFA 3N9PA 2WIIB 2VMIA 3ZSEA 1O3SA 4QB1A 4CCCA 2HQNA 5JI9A 3WOGA 1LDJA 2RMU2 4QSHA 4NRQA 1H88C 4HOBA 1QH7A 5FZ6A 2OX0A 3RDIA 4EJWA 5C3EJ 2IEKA 3WTWC 5M5WJ 4MUVA 4Z07A 1XN7A 1ODMA 5JZGA 3H35A 2HWD2 1RNLA 3T2OA 3KP2A 2JA8J 4COVA 3F23A 4R9DA 4JHTA 2HJIA 2X85A 3ASIA 2L9RA 4WXHA 5HNHA 2M1BA 3WV6A 3M3CA 2JIJA 1LFBA 1E3PA 5C3QA 1B8IA 3UT0A 2AZ5A 4DNYA 5FRNA 3HR9A 5LBQA 4A7KA 4J01A 1R1A3 2Z69A 1S0CA 1IAWA 2G7HA 2P8TA 3ABMH 3TL4X 2J1UA 1OLRA 4OMCA 3UESA 2B0LA 3HGYA 3LA7A 3HBKA 2P17A 2Y34A 3BPVA 4NJ4A 3JRGA 4AIJA 1D3YA 4Z6YA 1Y56A 1NYWA 4XDOA 2M3AA 2B4KA 5FLHA 1AYN3 3FJSA 1CR7A 2XL7A 4P02B 5DN2A 2QENA 2E9QA 4CUAA 3AMNA 2WDBA 1OQDA 3NV1A 1POV0 2JZYA 3OPWA 4META 5CG9A 4Y20A 1RUG1 2W68A 2ADDA 2M2EA 1JYVA 2R072 4LIVA 3BCWA 1SLBA 2ZMLA 1WH5A 5C7GA 1ETKA 3DP7A 3PUSA 3TW6A 3KX2A 5A6YA 2D3RA 3FHAA 1A3KA 4XEZA 2J7MA 2ICWG 1X1CA 3ABUA 1SEFA 2K0GA 4FPGA 3DEUA 3THTA 3BROA 1D2QA 3NL1A 3JRCA 3JW4A 2X1EA 4KBZA 4CP2A 2P5KA 1MZEA 1APLC 1UAAA 1PM4A 1MQTA 4M3DA 2WLPA 3ZKUA 1U5IA 2LALA 3MW3A 1WH7A 3O2PE 3S30A 2XIGA 5FJKA 4HQMA 1J0RA 3WHBA 4CCKA 3EB7A 2V1NA 3VB2A 2P4WA 1MBJA 2H27A 1VBC3 1Q8OA 3FZ3A 5L3EA 4IEOA 3ETPA 3VBRA 1DQ0A 5EG0A 5IPAA 1YHFA 5KHIA 4ZHNA 4NMIA 3BP8A 4HA8A 2XF7A 2M4GA 3G1LA 1KJRA 4LA2A 4KWUA 5FKCA 2YX7A 3PNAA 2KA3A 3K51A 4IE5A 5GP9A 2Z16A 1QJY1 2Y6LA 1YJLA 2KRCA 4LBLA 1W7PA 1WW5A 3CC7I 2RHPA 1REEA 4NHLA 2V79A 3Q5FA 2V73A 2W57A 2XUBA 3RPUA 4LR4A 5FGMA 4UFJA 1YI9A 1ENXA 4P5HA 2LDUA 2VNRA 3HPGA 1XPXA 3ZXLA 5LW9A 3GXOA 2UU8A 4RGUA 3OD4A 4UXNA 5FKLA 2O8OA 2YUSA 1KQ0A 2SLIA 2HTSA 3OSGA 2XQXA 5TGTA 2JEMA 3KYDB 4OUEA 2BUKA 4FE7A 3DTEA 2CWEA 3VZOA 2IXLA 1R1A2 4IGPA 5A32B 1O3TA 4LBQD 3ZIWA 2ZX2A 3W2WA 4YGEA 1VQ9I 1PX3A 4W8JA 2VPLA 4L0ZB 3DPRC 4BNCA 1UJ8A 3ELNA 1AYN2 4JRLA 1WBFA 3NJYA 3WZ1A 5IT9K 1BKZA 4FE4A 5C71A 1DGRN 3WG1A 3ZSKA 1UU6A 3VDDB 5A3LA 4P9YA 4RQPB 3I2DA 2L54A 1FJLA 4GCVA 5A33B 2VUCA 2JDPA 3J7LA 2JG8B 3V0BA 1R71A 1H8TC 2QE3A 3MUZ1 4H3WA 4EN0A 1JZ5A 5IVJA 1H0BA 5E89A 1XSQA 1WCKA 1XGNA 1OOPB 3OPTA 1AXYA 2P5BA 4QWNA 5F5QA 4K1YA 2CMPA 2R32A 2IAIA 2B5HA 3ML6A 3FDYA 4Q4Y1 3BTXA 4GO1A 1UOFA 2VXRA 2PHXA 4MQ9F 4P9GA 2KP6A 4Q29A 1H1MA 1NQJA 2ARXA 1RESA 1NHAA 2WZ8A 3TEXA 2W24A 5K5QA 4BY7J 1SBFA 3KCYA 5D5VB 6PAXA 2COBA 3FBNB 2LNBA 3S1MJ 3UYJA 2EFOA 4CUGA 4XW3A 4N43A 3PQJA 3MDPA 1VBC2 1POV1 1UB9A 1DZRA 5KVRA 1OLMA 3H8XA 2OVUA 3CMAI 3I64A 5I0SA 5JOYA 3QRFF 5DAXA 2E1MB 2QSGX 1T8IA 4PUSA 4CDXC 3DU5A 4QGMA 2WADA 4I09A 1FOXA 1DGLA 2XOMA 1WCMJ 2PFBA 2H94A 1RUI3 4XFFA 2L9NA 4OHVA 1T08B 3GHMA 4IV1B 4K9SA 1RC9A 1E2XA 1FYKA 3IP4B 2R0HA 3C3WA 4XAAA 4EQQA 2G4IA 2MLKA 3WNMA 5FV3A 2VQGA 3H0GJ 1QPIA 2UY8A 4KI5M 5DUUA 2JDZA 1UFMA 3GFIA 3HM5A 2P3KA 4K20A 2X5IB 3HG9A 2ZJPF 1W8TA 4PFOA 4Y26A 2D1HA 2HR3A 3WU0A 1USTA 4MV2A 3ZQFA 2HWVA 4IW3A 2ETEA 4CO8A 4QKNA 1ND2A 3VZMA 4OINF 2VJ5A 4V2FA 2QA4I 1BC7C 1ND3A 2W92A 2VNGA 1HSTA 1BQPA 2XRLA 1YEWA 2O14A 4GWIA 4XUNA 4P9FA 3K4ZA 3WGIA 2W46A 1HRV1 3DTKA 1LHNA 2MC4A 1Y0UA 3BR1A 4S2GA 3C7OA 2W82A 1RXGA 4BJTA 3MW4A 3HN3A 1UY4A 4KGQA 5IJRA 3CZUA 2K9NA 4PSXA 4UUSB 2FBHA 5FD5A 2AENA 5FYHA 2WJSA 3HYIA 1G86A 3Q9SA 4E2QA 2F4MB 5J1XA 5EJCA 3ZYHA 1UOJA 1WCDJ 2R5ZA 2A3YA 5LRSA 2V5YA 1DYKA 1MMSA 3WQ7A 2YXSA 3ST7A 1G4DA 4IHSA 3QCWA 4P9XA 2B7YA 3FXJA 4HF1A 1R1TA 2FNPA 4AYBN 4M6XA 5JMCA 4R4XA 3SDGA 1PVC1 5LD2C 4Q4V1 5HV0A 3VGIA 3DPLC 4AD9A 4HNVA 2HH9A 4QGLA 3J7HA 2O6GE 2CO5A 4D6SA 2NS0A 5J1RA 3SFIA 1S0FA 1F5TA 3TB0A 1HSJA 3DGTA 3GFJA 1WBLA 3K1NA 1J5YA 1OKRA 1HIXA 1JXNA 2JA2A 3MYXA 2HWF3 5EGOB 2EZHA 2O0OA 5K7FA 2DA6A 3Q9OA 4XLEA 1FOD3 1PO13 1JKPC 3S17J 2HWC3 2R3SA 3AG2H 2W0XA 4FQGA 1SLAA 4DIQA 1ZG1A 3OYGA 5T54A 1M4WA 4YFNF 2B42B 2GLOA 1N1SA 1S7AA 3NQOA 1UPIA 4MADA 4Q4X1 3ZQLA 4R9CA 2PG4A 1B35A 1RUI2 2HXIA 4FSJA 1JUMA 4FPFA 4UNOA 4JX0A 4JGZB 2YPDA 3GDBA 3WF0A 3JBG3 3M3EA 4HAMA 2MLGA 3GCMA 3F6VA 1OISA 3CU7A 3ZN6B 2EV5A 2PN5A 2LREA 4Q0SA 3PUQA 2Q8EA 3J7MA 3A4CA 4FPLA 4UY8I 2F4OB 1KS4A 2E2JJ 3CQZJ 4Q4W3 2QZ2A 2PHDA 1L0OC 2JSCA 2E2HJ 1I3AA 4MXWA 3TO6A 2E51A 4QWQA 4YZ4A 1R9TJ 1SD4A 3SEEA 4XKWA 4AC0A 4Y4RA 1YQCA 5JI6A 4RGGA 5F3GA 1UMHA 1CJPA 2EA4A 1PX4A 4S2DA 1IPKA 2GN7A 4UVCA 1KEXA 4W1UA 4ANJA 4QDRA 3WP5A 1VP6A 4ES8A 3PMSA 2A71A 1ZELA 4CDUB 1LOCA 2BW3A 1S0IA 4UXAA 4K8FA 1XNBA 1XOYA 1TQIA 4G7OF 5A3UA 3APBA 2ZABA 4N53B 1CGPA 3R61A 2L01A 2E19A 5DQ0A 1FMWA 2V1UA 1JT6A 3F22A 3H1WA 1LGBA 2P3YA 2A05A 3FKJA 2QKMB 1L7QA 5L9VA 3ZMOA 5LRRA 4FOVA 3CDIA 4L2NA 1OQ1A 2E32A 2MBFA 3LFKA 4WZFA 4P9UA 3AZZA 2Q1MA 3C8XA 5FPZA 4QX5A 3K9TA 3IPVA 3R4DB 2P2KA 2A1XA 5EJ3A 4A3IJ 4I99C 1WCUA 4XN3A 2J1RA 2VZTA 5M0TA 2Y0MA 1O4XA 3BG9A 5A3TA 4CCLA 4A3JJ 1G9DA 4XONA 2XL9A 2UWBA 5DCFA 4GMP3 3GZ6A 4UFKA 3CCRI 1ITYA 4EN8B 1AUYA 2MD0A 4MGQA 1TT5B 1RR7A 4PQQA 3J7AY 4PJMA 4R4ZA 4UVAA 2FDKA 2JG9A 2M9HA 2L02A 2Z33A 4F52A 4A0YA 1V00A 1NCRB 2HWF2 2XR4A 1FOD2 1O5LA 4C90A 1PO12 2EIBA 2HTJA 2HWC2 2C4XA 2VKHA 2Q30A 3OYKA 1N3PA 3D5RC 4Y5TA 3HRUA 4E7IA 1I5ZA 2ZJCA 4QPYA 5LHHA 5I8TA 2DMNA 1AJKA 1W39A 1QJU2 5K0UC 4V19K 3S6PA 4CU7A 1GFF2 2VC9A 3ZRGA 3K77A 4QX0A 4O9EA 4JVAA 1R00A 5ACA3 3EUKL 1UZ0A 3JBG2 5DG1A 2EZIA 1PYVA 4K40A 2J1VA 2XPJA 1E0EA 4YLZA 1G7YA 3PVOA 4MEYF 1FTTA 1IKQA 1BW6A 3UETA 4E8CA 4CHUA 3BYWA 3WUDA 2PLV1 3SZGA 5CVVA 4XUTA 1MBEA 3POFA 2E53A 4KL1A 4Q4W2 3VBFB 3N9LA 2X6OA 3JB4C 4MGRA 2FCTA 5A7QA 1ZZBA 1WJFA 2N7GA 4BXUA 3MPBA 2BW8A 3HSRA 1XRUA 1S9HA 3MZ8A 1ODDA 2D98A 3NAPA 5FUNA 1F4HA 2MEV3 2OA2A 4RFT0 2RS53 5T5LA 4HEA2 2DA1A 4PQ9A 3F0CA 4I30A 4TLFA 4HVRA 2H1KA 5IK8A 2A6ZA 3IH3A 4UWDA 1GOFA 2HPMA 3QU6A 4TLGA 2V4AA 1QDCA 2JDHA 2IRFG 1GU3A 3PUAA 2DQRA 2JA7J 1W6OB 5BNPA 4DEQA 3L2UA 3I59A 2OT7A 5D8KB 1UY0A 2FU4A 4HQEA 3RSJA 3J81Z 5EHDA 3CHXA 4BXFA 1F35A 2LROA 4M00A 1HA8A 2QJVA 2WLQA 4HKLA 3ATGA 2R0FA 5ABJA 5H9RA 3MUY1 2XHNA 4YELA 2DXIA 2VIXA 5DAQA 4EROA 3WNNA 4DYQA 4IHWA 2N8GA 3DPTA 1LKXA 1YS7A 3ZSJA 1G6NA 1DZQA 4AGGA 3DXTA 4RB0A 1WMEA 4MTEA 4V2WA 4AVAA 4IZZA 3IB3A 4YG0A 4RA2A 3IAM2 3RYKA 3F95A 3B01A 3VYSB 3I2FA 5B4XA 2ZGUA 3BTJA 1AR71 5J7MA 4XACA 4ENJA 1LODA 2X09A 4LKSA 2ZGPA 4A45A 4LPLA 5HCFA 2EV6A 1UHWA 2Y6HA 4AU7A 5C3SA 4QXKA 3H3VK 4FTBA 5T3NA 1VB2A 4HRIA 3U4SA 2RJKA 2M34A 4XKBA 4KIBA 1FIPA 4XF1A 4Y52J 4AVPA 2HOAA 2CWSA 3JXSA 2GNBA 2IXKA 1MS5A 1S2EA 2A3WA 3L2VA 1WGXA 5ACA2 3BKZA 2QKDA 4CU9A 5FLJA 5DUKA 1NCQA 1WD4A 3OPZA 4D6RA 4FFHA 1JHNA 1NH3A 1AF9A 1JTYA 4KICA 2C6SA 2DWRA 2GALA 4D1QA 3S3MA 2WUHA 5DUXA 1TLHB 1OD3A 1TZOA 4NVPA 2ZKZA 4URAA 3KP6A 3H0DA 3LAJA 5FZLA 3RQ0A 4B1MA 3HDDA 1NG7A 4NIHA 1RKTA 4KWLA 2DBBA 4KWKA 3T8RA 2DU9A 2VC0A 4IX7A 5APAA 3NNGA 2R043 2D93A 3ZDSA 4FASD 1FWZA 1UMQA 1ULCA 3M3QA 4P14A 5L9RA 2MEV2 4L9NA 2PBIA 4IVNA 5FXVA 3A01B 2RS52 4CVUA 2V9PA 4RGAA 3IAPA 2E35A 2HXOA 2WNOA 2EZLA 1VTNC 1UG2A 3GLLA 1QNYA 4BS9A 3N7LA 2IS4A 2WB1A 2AR6A 3VDXA 1MS9A 4KU8A 2XF5A 1MEC1 1HXS1 1WCQA 1R64A 2WY7Q 1G3YA 4AEMA 1LEBA 4YFKF 5C8CB 1VBA3 3WTYC 4MSVA 5AC93 2XJPA 3IRRA 4IEUA 2RM23 4XLCA 3J7YJ 5JVTA 5JVVA 1X1BA 4XICA 2WSVA 4CEYB 2XSJC 4MGYE 2X0LA 4EN6B 1VR3A 1JZ2A 3Q8EA 2XJQA 1JXSA 4B29A 4B47A 2NS8A 1OA3A 1SG3A 2VZUA 3VBSA 2W1UA 3WG3A 1PVXA 2Z9OA 1Q8QA 4QHZA 1C8M1 4QDQA 3USSA 4B4QA 3JUUA 3L2WA 4RHV1 4YVSB 4RB1A 2W87A 3GTMJ 2QQ9A 2DMTA 5FDBA 1A6IA 2DA3A 2VD7A 5L3DA 4IEWA 5A7WA 1T2KA 4YW4A 4YPJA 2BOIA 1LFPA 3J7NA 3QPLA 3SITA 3DPRA 4AI1A 4AE2A 1J84A 4QQPA 1XC5A 3AXEA 2FQ4A 5CVUA 1XNKA 3ORJA 1KA8A 4A6DA 1MSFC 2HOSA 1PZ9A 2TUNA 2W1WA 2BTVC 1XBFA 3ZPYA 2I10A 1I3QJ 4TXWA 4D5CA 2WZPP 1W36D 2GC3A 2WY8Q 3LQCA 4GGGA 2M30A 1V5FA 4IJAA 4NHMA 2QQLA 3WE2A 4N9IA 5CEHA 5IK5A 4RR3B 3WNPA 3W3CA 3CLQA 4DXRA 2O61A 2VZSA 4NHXA 2AXLA 2H8WA 2IJLA 3ECOA 3U21A 2QBYB 2KXLA 3LD8A 5DYMA 1GZWB 1X7NA 4UAPA 3ZQ7A 4Y5SA 3AZWA 1OLQA 3WDYA 1JOBA 2DA7A 1ASJ3 1TWCJ 1ZBA1 3CUQB 3ZYBA 4IESA 2EFPA 1IG7A 1JYCA 3TO9A 5G04L 3QOEA 3OYHA 1K5JA 5FKBA 1T38A 4UF0A 2DUPA 3VHRA 3K2OA 5A1AA 4OQ8A 4C2MJ 2BXYA 4AQSA 4AI9A 3BY6A 4TV7A 1EKEA 2R042 2Y8KA 5ICCA 1ZNPA 4LK1F 4YW7A 3MV11 4S05A 2JUCA 1TEIA 2E7WA 1B8IB 2LRPA 1I5PA 5CIRA 1C5IA 1OFSA 3QAHA 5FYUA 4IRIA 2UURA 4HBLA 1A36A 2LM3A 3GGLA 1UYXA 1Z7LA 1GV9A 4AHYA 4IEPA 3H7YA 1WVRA 3VBHA 3ERMA 1QMJA 4OAZA 2RE9A 4U0WA 4NHKA 3W21A 1ON1A 1HLVA 3GM8A 2CQKA 5E3MA 4IV3C 1IJWC 5KAFC 3IDBB 1PGL1 1VBA2 3HRMA 4OI1A 1TP4A 1RUG3 1J09A 5AC92 2BNMA 1XSXA 3OIPA 2RM22 1LUJB 3MIHA 4HSRA 4WZCA 1UOGA 5IVBA 4RAFA 1RUJ1 1GSLA 3AKTA 1BLZA 5F27A 1GWKA 4Y20B 2WYSA 1KRIA 3K46A 1OFNA 2HGCA 3EPZA 4D9JA 3J4UH 1O4TA 4II3A 2VAUA 3HBLA 4KQ7A 5C9AB 2YC4A 1MR5A 2ECBA 1C8NA 1GBGA 5HDNA 2QBXA 4Z1VA 5DMYA 3IL2A 1LKNA 3VD7A 5LGNA 1VBE1 2OS2A 1B59A 1SCSA 5FBZA 3V7SA 1DUXC 3WTUC 5JLVA 4A7ZA 2LD5A 1MNMC 3T1LA 2CW7A 2XLFA 4AL9A 1GVJA 2L4MA 4BQ3A 4NE9A 2E7TA 3VOEA 3FIWA 1YFWA 2KFDA 1CD3G 1HKTA 5JHUA 3E0JB 5IY5H 4IEQA 3OGSA 4UOJA 1GXPA 1XGMA 5DS9A 1GQGA 5SV8A 4OFGA 5AVAA 1N3QA 5E17F 2XUMA 2GNMA 3MEXA 2BP6A 1LHOA 5FBJA 5C70A 1WW4A 4M3CF 3RGBA 4ZYAA 1TQ5A 1N77A 4HK8A 1XCVA 2WQZC 1SVLA 1BMV1 2DTZA 2KR2A 1AZDA 3TNQA 1IS6A 3KETA 2R7EB 5IFTA 3H9GA 1FMVA 5I0DA 1OBNA 2KDZA 2XUEA 4M4RA 1WJCA 1QJY3 2Y2ZA 5GALA 5H6QA 1UIKA 4M73A 4M4PA 5FZDA 3F3XA 4XRFA 1ASJ2 4HMZA 4PFPA 3U2RA 4MGZE 2V26A 3OBTA 2Q8CA 4DNCA 5FMCA 2FOKA 5T5PA 5CZKA 2VECA 1RC6A 5I0RA 3CJNA 3NAUA 3V42A 1WI9A 5FZAA 1YQAA 2JA5J 3C18A 2D1VA 2EZKA 2DFIA 4EVIA 3KIOA 1TBXA 4XF3A 2Y26A 4XHBA 1GP6A 2V6CA 2E6VA 2ARBA 1MMAA 4CDQC 1JUPA 3S7EA 5HXMA 1D4VB 5D21A 2EALA 5GLUA 3NARA 1FYMA 4ATEA 2X51A 2JRTA 1HN0A 1OA4A 2VBXA 4MQVA 2MYSA 5DD8A 2WO1A 1AXZA 4HNTA 2VOWA 3JSOA 1W8HA 1RUG2 2F17A 3WNLA 4XUQA 4UV9A 4B09A 1FX5A 5FD6A 1T33A 1UYZA 1X1PA 5JXHA 1ZK8A 2FDGA 1NA1B 1PHMA 1TQMA 2DVGA 4HG6B 3D4KA 3O7OA 2P6SA 4FQZA 2FDIA 2HNHA 2FZ1A 4YW1A 4Q4Y3 3OY8B 4XBQA 3UK9A 3S32A 4N53C 4U36A 3RI9A 5EYRA 3LOBA 1UN1A 4B7KA 4G7HF 4UW4A 4HLXA 3OV8A 2ZX4A 1ZGJA 4RAZA 3O0VA 3GTPJ 4CCNA 1IO2A 3ZOBA 4BLIA 3B6CA 4XDQA 2A7AA 4WK8F 2E2IJ 4M01A 4H0EA 4A2UA 2CTVA 3CL1A 4UYBA 1IC8A 1LE8A 3NNFA 4HBNA 2OV7A 3R4SA 2GBYA 4Q5OA 4OMZA 4CP9B 4CP1A 3M1HA 5FLVA 1IW7F 1ZRDA 5GZGA 3ZX7A 4GDFA 3FHNA 3K70D 1WW6A 3VHOA 2GC2A 1IG0A 4XLFA 1S29A 2VKEA 1SZBA 4FFGA 5FMOL 1ENSA 1ZHFA 5A7OA 3BI3A 2YBPA 3SH3A 2PMZA 1QJY2 2MHFA 1DP0A 1KDKA 1Z0XA 1JBCA 2BVMA 4DZPA 3GUDA 1MACA 2MABA 5FMDA 3TQNA 1QXRA 2GOMA 3VUOA 4Y5Z0 2FD8A 1HB4A 1KFUL 4BQ1A 2LUWA 3NRUA 2XQRA 2VQAA 2KT0A 2OQGA 1D8KA 2DN0A 1YX3A 4Y17A 1RUD1 3K3NA 5CFCC 5I91A 3HT2A 4U88A 5FPBA 3NQHA 1E5HA 3IUOA 5KBFA 2HDCA 4UFMA 1NE6A 2AACA 3GBGA 1ND2B 5BNOC 5BYNA 1KQ8A 2D45A 2D6MA 4QD2A 3C7FA 4LIUA 3T1MA 1HRV3 1BJQA 1BK0A 4QPIA 4AW7A 1Q8VA 3ERED 1F15A 1EH8A 4PJNA 1RUC1 5K0UA 2VJXA 1AX2A 3AK0A 4WM7C 1ZZ8A 2W85A 4XLPF 4LD5A 1IRFA 5LA0A 3GVAA 1SPPB 4FAGA 1IXRC 2ZEZA 1RVF1 1T6GC 5EXOA 3O1TA 3I3EA 4NROA 1K42A 2VGDA 1A04A 4D7TA 4BB3A 3DWLE 2JWTA 1MJ9A 5F64A 3KF3A 5CLSA 2WO3A 2QKLB 2JB8A 2GN3A 3IDCB 3VV1A 2RS31 1QZEA 4GIQA 3N9QA 2E60A 2NPIA 2NYXA 4Q4Y2 2VBWA 2D6PA 3D6EA 4IHVA 1PVC3 3FISA 4Q4V3 4MGKE 3I2JA 1K7AA 5FFOC 5FR3A 1K6YA 3TDZC 5CG8A 2GA2A 5DCMB 2HWE1 3RQIA 3C7GA 4QX3A 1JYNA 2W25A 3C3VA 3URFA 4BPZA 3HOZJ 3GNEA 1BVVA 4LE4A 3S2HJ 2XV4S 5FFXA 2NOGA 2CUZA 3FMRA 1XGOA 3CTAA 5FP4A 1ZAOA 5TSWA 4FFFA 4YVWC 1YJ9I 2K9SA 2PHRA 3AKRA 3GJBA 1XDSA 3R05A 5FZOB 4NWVA 2GNDA 3VD3A 4LXLA 1NLRA 3HHHA 4BHCA 3EO6A 1P92A 2DVDA 4MO7A 4Q1RA 3U78A 4Q4X3 1K83J 2KIMA 1Y6IA 3FMSA 3LDRA 3I4IA 4CPBA 4L92A 2BXZA 1JI6A 4YIIA 4JK1X 4SBVA 1U2WA 2RDNA 5C4WC 2LOOA 2ZCWA 2ZTNA 3OS0A 4D7SA 3ZMSA 2QCSB 4HETA 4HV5A 2VQHA 3GWZA 1SDWA 5M5YJ 5DM7F 3OL4A 1VQ5I 2R7TA 2BOJA 3BR0A 3F6OA 2YU1A 4UBGA 2R16A 5BNNC 5LHIA 1UD1A 3OYNA 1R22A 1HV0A 3L2QA 4WM8B 2VJIA 3PSFA 4X8NA 3N05A 3I56I 3PUFA 3PO2J 4DXTA 3LEMA 5B3SH 3VKOA 5FZHA 2VOXA 3R6SA 1S4CA 2PFWA 4GH4B 1H2NA 4V2GA 4YG3A 3QYBA 4JDMA 5J47A 1W9TA 1O3RA 1HRV2 4NC8A 2PA7A 3P7NA 1IXCA 4PIYA 1Y43B 3ZFEC 2VW1A 2GA1A 4DY3A 1ENQA 2OAZA 4XR6A 4P1WA 3V4GA 1QKQA 4CU8A 4ENNA 5L19A 1KQ9A 1V55H 2MH2A 4LB6B 1HW2A 1OH3A 1W0NA 5FY7A 5BS6A 3MICA 3WUCA 3ONQA 4FX4A 1Y1WJ 5K8SA 4W6XA 5AONA 5GLTA 5KHDA 3OTFA 4G94A 3VD5A 2WB1N 2EFNA 4OMYA 2E31A 4XZUG 1GKBA 3K1PA 4BY1J 2Y0SA 4QB6A 3RCOA 3MEPA 2OCEA 3UR3C 1RZ4A 3BJ6A 2UXXA 4UUVA 5EWSA 3G6EI 5CKMA 3FK6A 1IN4A 3KLOA 4CA9A 1GV2A 4P00B 4W50A 3U1KA 1PVC2 4Q4V2 4LHLA 5FB2A 3HT1A 1OT5A 2CU5A 4J19A 4N9HA 1APNA 3VB9A 2M7BA 1BJZA 5FROA 1LULA 3M7GA 3E5QA 2P5VA 3KP3A 3POJA 3JSPA 1H9TA 1U5YA 4JGYB 2HOTA 5E3LA 4LE3A 2C24A 1LRHA 5F0FA 2GIVA 3H1YA 1XYPA 2ZFWA 2ZEXA 2AXTC 3M7AA 4XK4A 3CF2A 4L9VA 1X1AA 1VNDA 4CXFA 3BC8A 2VASA 3KF5A 5M3MJ 1J3QA 3OYLA 4YM2A 5H2FC 4FO9A 4HN0A 4YVSC 4DQ2A 1KONA 4HPKB 4XFCA 5LY1A 4HT1T 5FZEA 3A22A 3ZFFB 5A32A 3AMMA 1V70A 4LLFA 4XL9A 2V4VA 2XJSA 2YFZA 2DA2A 2XMLA 4OHZA 2G9FA 2VMDA 5LEJA 1WKYA 4LMYA 3O0WA 4RS5B 2CL2A 1CF7B 5FP7A 2GQQA 2AEYA 3A21A 3OIQA 1FC3A 5CYVA 1FY7A 3VDDA 1O59A 4P55A 4RQPA 4CU6A 3RZHA 2PLV3 1BC8C 1RINA 2DU0A 2LTNA 1L3JA 2O03A 2JECA 4GKXA 5FO8B 1D4M1 2JG8A 3JRDA 1PM7A 4HLYA 2FZ2A 1GWLA 3DKXA 2VQ0A 4C0BA 1VMHA 4WVZA 4Y22B 3MIGA 4P9JA 2EAKA 1MVQA 3WCRA 2HPIA 3RQ4A 5ICEA 1E17A 4RR3C 3MKLA 1OOPA 2XLGA 4PK4A 3J80Z 1MS1A 3ZXAC 4XLAA 4RSUA 5EZGA 4OZXA 9ANTA 2R7DA 2YY1A 5K7PA 2MPFA 4QX8A 4ZU4A 1F4AA 3ACFA 1POGA 1JKQC 3VPRA 5CNAA 2FX0A 2VZQA 2D40A 5L7OA 1M06G 3PIGA 4F93B 2G1MA 5JZGC 1UZWA 2CSGA 1QY4A 1JYIA 2IGOA 2EBIA 3LPFA 4O9GA 1OQYA 2ESNA 2XBO3 5DABA 2W48A 3S8PA 2FQ3A 1Z67A 1DFQA 3TGNA 2GAUA 2YZ4A 2DVFA 3SJMA 2YU9J 3GX4X 4HDUA 1VQMI 3LSIA 2WS92 1ACCA 2DOAA 3AYCA 1NY71 5JR2A 4AHXA 1DGWA 5HXVA 1X8MA 1ULYA 4XORA 4KN4X 5LGUA 1JS9A 2HZDA 2NNYA 1BVP1 5B4NA 4EN7B 4KITB 5DDJ1 1BBYA 1RJ8A 1ZZCA 1ZBE1 3B5LB 3WQ0A 4IV1A 5IK7A 3FBMA 4PSWA 2QFEA 1W36C 3NWSA 4YFZA 2K5CA 1H6YA 3I54A 2FMDA 3UV9A 2V72A 3BPSA 2PMHA 2A3SA 4EM2A 2X5IA 3PO3J 1YLLA 3I0TA 1YIJI 3FM5A 2FCUA 3O12A 2AREA 2VODA 3C7HA 2WTEA 3HQRA 5IYDJ 1AR73 4CUBA 2EK5A 1JOPA 1DU3D 4JRAA 1VMFA 3DF0A 1BA5A 3I71A 5A7PA 3QH7A 2JDMA 3LEKA 2CYYA 2BVLA 3CCEI 1QXJA 5TISC 5GZCA 5JAXA 1VQNI 3WHTA 1V6JA 1XE0A 4U2AA 3CC2I 4ZPIA 1HF0A 2FJ1A 3WF2A 3CCLI 1R1ZA 3U75A 1UNBA 2KIUA 2DCEA 1MQTC 5KNLA 3VL8A 2HDDA 4UUSA 2VMFA 4CICA 4ISQA 4FPYA 4Q8KA 1ZLJA 4FCYA 1PMJX 3AAFA 2VQTA 3MZYA 4H4KC 2OQRA 1XNDA 3RPQA 4AFBA 5E16A 2B9SA 1AYM1 4ENKA 3VBRC 5KHGA 4E7ZA 2A6XA 3MVPA 4JQFA 3PIOF 2LLKA 3E6DA 1RUE1 3AMPA 1A34A 3H42B 4XUOA 5E18F 3KCXA 1REDA 5LK5A 5C4JJ 5IYYA 4OOIA 3IWFA 5FKKA 2XRNA 4FOYA 3KV5A 2KDOA 2R061 4YG6A 2DDUA 5E6HA 2BBAA 1RRJA 3B7MA 1T95A 1T0FA 1R4MB 3FK7A 1QRYA 1BBT1 4Z82A 1MEC3 1HXS3 1PNGA 2UWCA 4XFGA 2EV0A 4PJYA 2EIGA 4HKWA 3K0LA 4IL7A 4M9ZA 4KGGA 2VMHA 5EGOA 4F7ZA 2ZXJA 2P81A 3NJXA 5T55A 2D2WA 3SC7X 4ET7A 1DQ4A 2XBO2 4L5EA 4A6EA 4GXLA 4BJ0A 3RKXA 1MMNA 4OIRF 5J6XA 4DOZA 3NKGA 2Q8OA 1GICA 2K4BA 5DTDA 4QKDA 3MIFA 1US2A 2ORZA 2WT1A 2W52A 2JVHA 3M07A 1DYOA 5K5RA 1SMVA 2BWAA 2D5HA 4H7MA 5D2AA 5JWPA 2CAUA 4FOQA 1RR8C 2WL1A 2ZJQF 1WHUA 1C8M3 1X8EA 4JGZA 4RHV3 1EJ9A 2NYYA 2IFRA 3Q3SA 3NRVA 4LFUA 2W7NA 4XOGA 5F39A 1L7RA 4O7XA 3ZN6A 3VODA 2ZMEB 3LDKA 2WABA 2W3JA 5ILUA 3H9JA 3VZJA 3SISA 1HB3A 3GJAA 1AX0A 2ZAAA 4ASLA 2IA2A 4Y4YA 2ZPXA 2YV8A 3KV9A 1IUFA 3OL3A 1YLFA 4MH0E 4C3HJ 5I8YA 1AR72 1RETA 1EV7A 3OYWB 4EEFG 3VBUB 4XOPA 2KL4A 1S8NA 1AWCA 4MHGA 3RI8A 4XF0A 1CQTA 4Y1UA 1FV2A 4LLNA 2VOOA 2VH9A 2FBEA 1IN7A 2LMDA 5FYCA 3FF5A 3CO7C 1Z7S2 1MJAA 4KNCA 3HKZA 2XPUA 4CDUA 1N3OA 4ZTFA 1YCIA 1A6QA 1MPXA 2DVAA 3WEZA 3F8FA 1LOEA 5ERLA 5F3EA 3VD4A 2VZVA 1HV1A 2CU7A 3L2CA 4HSJA 1BI2A 4N53A 1RUOA 2P5LC 3LSMA 1ZBA3 2CQQA 2EPFA 3FXOA 4RAGA 1W5CC 3KD4A 4E4HA 3NEUA 4C1XA 3EYPA 2ZACA 4OI0A 2VZOA 5A3WA 1OCPA 1W1WE 2PMZN 3K4MA 5JOWA 1R6RA 5F6LB 2UZKA 3J7ZI 5H9QA 2EA7A 2XGCA 3HEFA 2MFZA 2KM2A 2LS6A 4ONUA 2F5EA 2ISYA 1SD6A 3ECQA 2J5OA 5IVCA 2DTRA 3G71I 4R1HA 2WAQA 2KIFA 1D1AA 3PVEA 3RKWA 5JDBA 4B1RA 4FPCA 4A3MJ 4GXOA 5A3MA 1UCXA 1ZX5A 1MEC2 1HXS2 1NQDA 2DT6A 2O5RA 1EF4A 4QQOA 1F2NA 2O7OA 1K4SA 1NCRA 2VOKA 2V7FA 5FRMA 1URXA 3K4AA 1OURA 4K21A 4MHRA 3VD9A 1ND2C 3ZXKA 2FMYA 2WNUB 3KGLA 1ND3C 5BXXA 4BMEA 2EF6A 2PQSA 1RUJ3 4I0WB 4A3GJ 3OYJA 2LY9A 2JD4A 4OZOA 1FZPB 5EV7A 3OOUA 1B09A 1EPWA 2K40A 4XRMA 3BCAA 3FBIB 5D8AB 5J48A 1C8M2 4QU1A 2PXJA 2JDYA 1C0WA 4RHV2 3SXWA 4JP0A 2DJNA 4ITCA 5DEQA 5HV4A 1VBE3 2VCBA 1S0GA 3VKFC 5FREA 3PHMA 4XQ4A 3ZYGA 2WT2A 4G9YA 4EJRA 2VBBA 1FLIA 4O5VA 1JUIA 4LA3A 1MS0A 2KD7A 2LP0A 3LWFA 3W9AA 3CMGA 3QP6A 3H5AA 3SQOA 3VBOB 4Y24A 5BPIA 2IS1A 5ANQA 3VBFA 2PHLA 5F3CA 4XJWA 5FYZA 3BQZA 2BY3A 2BBVA 3CDLA 3AP6A 1ZA7A 2ZXIA 3K69A 2EB7A 3RI4A 3BDDA 2XDVA 3FLRA 3HSFA 1YHQI 4E70A 2BFUS 1JODA 2VE1A 4M3FA 1FPN1 1QEXA 1EP0A 1UX6A 4UHTA 2P34A 4PLNA 2XXZA 1RHI1 2ZX1A 2WRAA 4ESFA 3FC0A 4L97A 5BV6A 4KG8A 5GTHC 1SD7A 3H3UA 4FP2A 2VU9A 3AYDA 1U12A 5FZGA 3ZXJA 1W6OA 3MD2A 3Q8CA 4ASMB 1Q56A 1ZBA2 3JR9A 2F6CA 3T2TA 3FMGA 4BK4A 3V64A 2GNTA 4KMQA 3AP7A 3S0MA 3BZKA 1CWPA 2RV8A 1QA6A 3FBYA 3P5JA 2YS9A 3P9CA 5BNGA 1UYPA 3SCGA 3P9KA 3V65A 4DUXA 1F31A 5EFUA 2RS11 2W00A 4NIDA 1UG0A 5IP9J 3IDEA 3J8F1 4E4DX 1MW7A 5DUWA 4DBQA 3PL0A 3T0AA 1B35C 1FNYA 2WA3A 1JZ4A 5A6XA 1W6MB 3X29B 3VKLA 3BG3A 1YFHA 4FOWA 1LB2A 1JGGA 3WW3A 1QJX1 3G3ZA 2GP3A 1SMYF 3KT7A 3E3VA 4JQTA 2LF8A 4KIGA 5C6CA 5KCMA 2F4LA 3GZTB 4A7YA 3AVSA 4AYUA 3I7DA 4XRSG 2ARCA 5J3LA 4A6SA 3MHZA 5KAIC 1P4WA 4ZU7A 4XIOA 2MG4A 1PGL2 1WZXA 1I1SA 4A44A 2UUZA 3FL7A 4LORA 1YIOA 3GYHX 5CAZA 4JCKA 2RGVA 1O7LA 3D5LA 3AG4H 1SACA 1OYIA 3PLQA 1ONVA 4DB5A 4N4NB 3KP4A 4M3BA 1RUJ2 2ID6A 5I0TA 2R93J 2AGSA 3RYPA 2VUMJ 1C28A 1H8VA 4ZY9A 3THPA 5FZFA 3WG4A 3PU3A 2IXSA 1MSEC 5DXDA 2CUJA 3WQBA 3OR1C 3S1NJ 3RZOJ 3DUIA 1VBE2 1BEV1 2H6CA 3C2GA 4M0HA 5H20A 4DZJA 5E3NA 1DDNA 5CQGA 2R5YB 1SFKA 3CCYA 4IRGA 4G6TB 1K3IA 4HXCA 3WP4A 5H9SA 1MBGA 4XIDA 1TTYA 5HS7A 2DFFA 4KG0A 2PJRB 4CEWB 2YBKA 2W84A 5F8PA 3SEPA 2A68F 1TME1 5J96B 3IRQA 3AYAA 2XPVA 4XDPA 2NXNB 2D6NA 2WC2A 4XF9A 4CDWB 4BQ2A 5FYIA 3TEZA 2Y64A 2FSWA 2X10A 4KMFA 3PVNA 3D5OA 4JX6A 1VALA 4I6ZA 2MGQA 1WJDA 1BMV2 4V1PA 3H5NA 3A01A 5EQUA 3ASOH 3NV2A 2CV6A 4UT5A 3IIIA 3OIOA 3DXUA 1STZA 1PMHX 1VRH3 4AEJA 2H1LA 4OLLA 3FXKA 3ACHA 2MH9A 1YO8A 2WN3A 4PBOA 1XS9A 5LA9A 3RIRA 2JG9C 3QLQA 2VG9A 4AEDB 5C8CA 5FJHA 4Y7NJ 1LU2A 1ZYRF 2VT2A 4OWRB 2E1NA 3FFZA 4XJUA 2WWYA 1WGPA 4COWA 4R8HA 3AZXA 2JMWA 2A61A 3O1MA 1KFXL 4CEYA 1IN6A 1PNFA 3R4KA 4MTDA 3K2AA 2CDOA 3VYUB 5JUVA 3MZHA 2WAOA 5HLGA 2QZ8A 5FZ8A 3HRTA 1F8VA 1K5MB 4Z2YA 1QOTA 1WJ5A 2NQYA 4E8DA 4YVSA 3EBRA 1LGNA 2X29A 2VKVA 2VCCA 1RUC3 4RGRA 3FXLA 3O5SA 4QPWA 5F32A 1R081 2VQLA 4JKLA 1WLCA 5E88A 1Z91A 2DMPA 3ZPOA 1UF2C 4IHYA 1JZ8A 2ADEA 3QACA 2VPRA 4CPBD 1RVF3 2JD9A 5DZGA 4XMAA 5E8IA 1MNDA 2KRHA 1FMD1 2L9LA 5D8LB 3BWGA 4CP0A 1MDMB 1A8DA 1UELB 4GA9A 2NVYJ 2PQ8A 1GZCA 1C5HA 5F37A 1Z1DA 3L09A 4EGZA 3QPSA 3NAPC 2RS33 1XE7A 3MI8A 4DYCA 3IKTA 2JE8A 2D97A 5EJ1B 1WWXA 2Y6GA 5BPXA 1BOBA 5JMOA 3HQUA 3U0ZA 4RR3A 3K3OA 4YM1A 4QLCU 3F72A 2IA0A 1QQP1 1FSEA 3ZQCA 1JGSA 4IHXA 2HWE3 2QBYA 1IDYA 1GZWA 3QWLA 4YW3A 2HEOA 3JRFA 1IF1A 5BNPC 4QPGB 2LTPA 3ZFGB 3LIGA 4M6VA 3CUQA 3WP6A 1X9TA 1LU1A 5FPXA 1SVMA 4K2EA 3DCFA 1VQOI 1Z77A 3FLPA 4I3GA 4LO4B 2OD5A 1G9FA 5ABJC 5FZ0A 5IT3A 3PJYA 2YC2A 5J8FA 2DPDA 2FCVA 2YR2A 3RYRA 3VFZA 3WT3A 4D0PA 5FKMA 5KXEA 1F9KA 4AVTA 5A7SA 2JTVA 5FWJA 1EYBA 2DURA 1AKHB 1U8BA 2OJED 3I4PA 4GALA 4A3CJ 1J1LA 1IZ1A 2I45A 5F5CA 5A2QZ 3ZGKA 4LOTA 3SLIA 3ZP5A 5JLWA 1JHFA 4HPQA 3BPZA 1HQNA 1PGW1 1VRH2 4RN5A 1FOWA 3LCPA 2HVQA 4J1XA 2RJ2A 5JI7A 4ZXEA 4EATA 4U0YA 4ZZ5A 4BJ5C 5IVYA 4IEVA 1OKQA 2ES3A 2YU2A 4JX5A 3RZMA 2H09A 1FBSA 1W6QB 4BLJA 4DPNA 4MFDA 2YDEA 1PK6B 3AXDA 5FLXZ 3BR5A 1MBKA 4RMNA 4FPJA 2Z99A 2ZX3A 3S1RJ 4EM0B 4MG2A 1F5JA 4QQHA 1SANA 1Z3YA 2HDWA 1Z9CA 2BYVE 5CBLA 1GDTA 4KFCA 2KZGA 1JJ6C 2BZDA 5C9AA 3WDVA 1S0EA 1DBNA 2EXIA 2RDQA 1H9PA 2JX9A 2JPBA 4IKFA 2VKDA 4OULA 2ZZQA 2LW8A 1NX9A 4BIFA 4BXSV 3KZZA 4ASNA 2WAEA 4GQ7A 1NCQC 1RUC2 3ZQGA 3M8LA 1W04A 3CO6C 4HN1A 5A70A 4ABZA 4WXCA 2I2SA 3TP3A 1HLCA 2J1TA 4O6JA 1U5TB 4PHZA 3WXPA 2DODA 1XMKA 3LA3A 1ETQA 1ODNA 1RVF2 2VOVA 1JE8A 3MPPG 3CCSI 2DK5A 3M3YJ 1ZARA 2ETHA 4MXVA 3BVCA 2VI6A 1YRNB 2DV9A 5CU1A 5BY5A 3W5NA 3K4BA 4XM3A 4DJAA 4NWWA 1GP5A 4FX0A 2RS32 4AGRA 3IM0A 1SDDB 3I58A 3GCXA 4OI2A 2YMZA 4ZONA 4DXZA 1JI8A 1QZZA 2XJVA 1LOAA 5E20A 1NLSA 2L9SA 2ZEWA 4CA0A 1A5JA 2YBSA 2DCTA 3HOSA 4ZS3A 1HX6A 1R1VA 2Y60A 2PAEA 2FHRA 3OYDA 2P6CA 2HWE2 2QNKA 4QAWA 4CXWA 4XFHA 2RN7A 4BDZA 2NMNA 2RDRA 1POQA 1AOYA 4AI3A 1TNFA 4LLLA 3ZMNA 2V4JC 2ZGNA 3I9V2 2K46A 3O3KA 5LA2A 2Q5TA 1LDKB 4XHXA 1W0UA 2NVXJ 2DOEA 2YC0A 2X6WA 1D7PM 4QT6A 1B4AA 1VZ0A 1QHGA 1IXSB 3TEDA 1U78A 1P6RA 3B69A 5CVIA 4S04A 2YGMA 2XG3A 2Q8KA 3RZKA 1WJEA 3A23A 1Y7BA 3OGRA 1RMU1 3O8HA 3VBSC 4DZGA 3H5RA 5HPOA 3HNYM 2UYBA 1TL8A 2ZMEC 1NT0A 1J3PA 4EMSA 4UB8C 1L3LA 1TWFJ 1QO0D 4ZYHA 3UGFA 1XDUA 4AWDA 5FO7B 3LOCA 2CRGA 2R7WA 2IWGB 3HAGA 3UNPA 5CFDB 4YNIA 3K7AJ 3ILFA 4Y15A 3GBWA 4N0BA 3MCZA 1D8JA 3VDAA 3ZSLA 3S5AA 3HKZN 2M0CA 5CVJA 1XD7A 5IW0A 1O57A 5J1UA 1D4M3 3UKTA 3HNBM 3TW7A 4IXAA 2XAGA 5CQEA 5FZKA 3ZOIA 1TMF1 2HFHA 4DOUA 2JA6J 1NA1A 3WX5A 2RC4A 3WNXA 1E3OC 3WF3A 1TNTA 5LBBA 1E57A 3I49A 3AFGA 3GF2A 3SYTA 2FUG2 2F4IA 1GQPA 2D7FA 3OY8A 5T50A 4OUMA 1U3EM 1U0JA 4Z2AA 2KKOA 1CZSA 2V9VA 1ZR2A 1K78B 3K10A 2YGLA 3DYMA 3I2IA 1KS5A 1HOMA 3WU1B 4CCJA 3BG5A 2QEXI 3SH4A 3KQRA 1H89C 1ULPA 2OKXA 3TEWA 1R36A 1W9WA 3OBAA 2XC7A 4AFCA 2WAQN 2ZJRF 1VQ4I 4C3JJ 1GZTA 5L7OB 1OSGA 1RYYA 4FPOB 2XASA 5HDGA 3EQEA 5K5OA 4B44A 2QM3A 3LSEA 5JSOA 3NV3A 4CP9A 2FNAA 2NM1A 3AP4A 3KVBA 3B9CA 1OC1A 1I1EA 3LSJA 2CV2A 5EF6A 5DZFA 5DDJ3 4EV0A 2TCTA 1D1CA 4QM8A 1ZBE3 5LWBA 2DMUA 3KYCB 1S6LA 2AO9A 3HOXJ 4MGIE 4D7MA 1XSVA 3THCA 2EXJA 3O1SA 4X6RB 3VBHC 4F3JA 1WA4A 4KN7X 2XGDA 5EEAA 1QNWA 3ALQA 1S0DA 4I2OA 4EJVA 3U11A 2HOEA 1IZ3A 3UKGA 4Y13A 1SEUA 2XKPA 5FO5A 2KIQA 3AM2A 3W20A 2X4HA 5LK7B 3MFCA 4C1WA 2DO7A 2R0QC 4YW2A 2X8KA 3VSKA 1DYPA 4GMP0 3CBNA 5HODA 4EQVA 2XSDC 2WNVB 3K75B 2OTJI 1SQ4A 2DUQA 4XETA 1W6PA 2BVVA 3USUB 1NG0A 1X3WB 2CNAA 1NG6A 1UHMA 4Q5SF 2QQMA 3W5MA 4AAXA 2E1CA 3ECHA 5D5XB 5B2GB 3AB0A 3POWA 4L5JA 1LAJA 4LLOA 2OA4A 4HK9A 2IT0A 1BR1A 2R7XA 3I3LA 1G3SA 5F1JA 4A12A 3RSNA 1EH6A 1TNSA 4H7LA 3ZM8A 4I98B 2BPA2 4NQWB 1AR93 3I97A 1D2SA 4OQ9A 1SPPA 1W8ZA 3W59A 3I3MA 4NBQA 1NXD1 1QGLA 2XH6A 4BQWA 1D4M2 2ZGLA 1AYM3 4B1LA 1RKWA 1KXGA 2ME6A 4XYXA 1RUE3 4N7IA 2DTYA 1F5FA 3ME2A 3FFQA 4LK6A 1Y9MA 4NO4A 1LFUP 1W8WA 1XYNA 3UKNA 4WWCA 3KWVA 4A0ZA 2R063 3ZXDA 2OU2A 4BUPA 1TE1B 3POEA 4WV8A 2Y0OA 2XLAA 3HXLA 5DCMA 5EEGA 1C3HA 1YJWI 1H4GA 4QXBA 1BBT3 2NLRA 2QQPA 5JR7B 4R9BA 2D5FA 4AVSA 2KQRA 5J40A 3S93A 5G05L 3N9OA 2ZKLA 3PFIA 2FDJA 1JZ3A 3PMEA 5EDNA 1QJU1 5IATA 2Z2SB 2OZ6A 1TWHJ 1UZCA 4KT6A 5FZOA 2H0BA 3JAMZ 5CJ9A 5KWRA 2HEVF 2CFOA 2ELKA 1NY72 3NJZA 3JU9A 3JBG1 4A41A 4IE7A 4P08A 4MZUA 3M9AA 1IDZA 3CDHA 4L0YB 3WNOA 3HIFA 1YG2A 2XWBB 2W5FA 2CH0A 5DDJ2 4GRIA 2NAZA 1ZBE2 4RB2C 5D5WB 2QQ8A 4FTSA 2XVLA 4LG3A 1TWGJ 3Q0VA 2Z3YA 3L9FA 4J00A 5FXWA 4Q4W1 3K6GA 2HWB1 2NNNA 4PI0A 3RJ2X 4AQ2A 1X82A 1E5IA 2YFUA 3VL9A 5JXIA 4ISRA 3I2KA 5A3PA 1H8TB 2I5UA 1XE8A 4WM8A 1MZ6A 3M8EA 1YWKA 5E1WA 1F36A 3M8FA 4D0QA 4Q8LA 3FLTA 3DPUA 1FOKA 2O9LA 5JVGF 4GH4A 1ZLKA 3ESWB 4UFHA 5E8GA 3ISPA 4AZZA 4MYEA 4PI2A 2LG4A 4HDVA 2ZBKA 2B7EA 4RS8A 4DS0A 1D0XA 1ULGA 2VTFA 5E3OA 3H3ZA 3BB6A 2CAVA 2R7OA 2GMEA 2KPMA 3KLNA 1G9CA 1AR92 4E2GA 2KMUA 4WVMB 1OA2A 4CDWC 2V1XA 3OS1A 4JBAA 1FV3A 4XLNF 2XJUA 2W47A 1G9AA 1MS4A 3RKQA 1AYM2 4XSXF 2OUHA 1KZHA 1OKOA 4YZ5A 1N25A 1S2KA 3OF1A 4QMAA 4C9YA 1RUE2 3KV4A 1LGCA 4GMP1 3CJRB 1ZN2A 1RIOH 2JT1A 1EV11 2IS6A 4CDXB 3KEQA 1UMZA 4AG4A 1S7OA 1XU1A 4XMIA 1QDOA 4JDOA 3Q8BA 1AR61 4E7KA 1I6XA 4HF0A 5IOYA 1ZR4A 2R062 5FPLA 1Y3TA 2OPWA 2P37A 1XX5A 1P4AA 2D44A 1H2KA 2FF4A 3GEZA 1R23A 4OYUA 2VY0A 1U6GA 2W9XA 2EXKA 5F5AA 1NKGA 3N7KA 1GUIA 5LZ6A 1BBT2 4M3CE 2GXBA 4YZ3A 1NUKA 3WD5A 3EXUA 3A0BC 1GXQA 2IXCA 3PU8A 2PJPA 4JGYA 4MOAA 3NO8A 1W5SA 3GZ5A 3ZYRA 1GOGA 1H1AA 4L0PA 1WI3A 2W1QA 1R5ID 3ZMDA 1Z21A 4RB3C 4KISA 4A3DJ 3AFHA 1QNTA 2Q1ZB 4HPKA 4YM0A 4CSWA 3JRAA 3MLLA 2F5VA 4MIMA 3ZFFA 4NAMA 2VTXA 2CY6A 5CADA 2Q0AA 1EPZA 1PIV1 4JKMA 1V5GA 4CZZA 4QPIC 4BYYA 4NC6A 5ANNA 3ZN1A 1N1YA 4LULA 1U9OA 3RFRA 4RS5A 2DCZA 2FBKA 3LSRA 1CF7A 4A69C 3OG2A 4DMIA 3JD71 2XAQA 4P5OA 3PFYA 5LY2A 5D6FA 1X9PA 2GDFA 2LKPA 3N35A 4D3WA 1J2XA 4ARYA 3ZR6A 2VXZA 5EIYB 2WQ4A 3ZYIB 4X8PA 3S2DJ 3CLPA 1C57A 4MX3A 3MQ0A 4E7HA 4AGVA 2AEZA 5FP9A 4Y22A 2QQOA 3DQVC 5DAWA 3BCBA 3H8OA 4G12A 4PIZA 5JCTA 2K9ZA 1OCCH 1QJFA 4UBHA 2C5DA 3QQAA 1SFPA 3I3QA 3LAGA 5JPNB 4KJZA 4QPGC 1ERDA 3I5UA 4QU2A 5E1XA 4M9XA 1JYTA 5F04A 3HOUJ 3H92A 3O8GA 4AYBA 1RHI3 3H8RA 4A3EJ 3BZ6A 1XU2A 2BWCA 1D0YA 4G8XA 4II2A 3M1EA 4XLHA 3JCIA 5FY0A 5IT6A 2GSYA 4LOSA 2IXJA 3AYEA 2PQQA 2A6WA 1UO9A 2L5QA 2ZZJA 1WFXA 2ZO4A 5FWEA 4CYCB 3M4OJ 1LVAA 1UMIA 1IOAA 2RS13 3E5XA 3SKVA 3J8F3 1TG7A 3N9NA 1BI1A 2YHJA 4ZS2A 1A31A 4P9WA 2L7FP 3J80K 3OYEA 1G3TA 2Y9ZA 3S16J 3ABLH 3OUJA 5B66C 3OYFA 3CP8A 2RR11 3ZPLA 4AHWA 1QJX3 4E4ZA 4PCQA 3AKQA 5K9YA 1CPNA 4DUWA 2FA5A 2WWSA 3LFUA 4INDA 5TRDA 4C30A 3O14A 4LBNA 3TAYA 4NPMA 5FY1A 4NPLA 3PNYA 3OGVA 3N36A 3RS6A 2Y30A 2D3SA 2YPRA 1U0AA 3RZDJ 2JPCA 2LFBA 1RUF3 2FRHA 3K4JA 3AJYA 2NOJB 2ET1A 2J1SA 2VNVA 2M0MA 3GXUA 3TBDA 2VE9A 2E26A 1MBFA 3RZGA 5CPRB 4IEXA 2XB6C 4C2TA 3TRSB 3D5SC 1PO21 4AI0A 4PT6A 1YQ2A 2R6QA 2A5ZA 3B93A 3HUGB 3ELKA 5JHFA 1BEV3 3S3OA 4M9SA 2VO5A 4P9IA 5KXCA 2EINH 3MN2A 1I39A 1C4RA 4HVOA 3U14A 1GT0C 1FAYA 1VQ7I 4XXPA 2DCYA 3D0SA 3H9QA 1ZRFA 2R30A 1ZG5A 1HBXG 2DAOA 5FYMA 2R041 2P3IA 5GLWA 1N1VA 1QZYA 2ZA9A 3E1SA 1G8WA 2OW4A 3AFKA 4IO9F 4JDNA 2XJTA 1T98A 2ZHNA 2JRMA 1TME3 5IP6A 4XIKA 1VB4A 1SFEA 3DECA 4DINB 2ZGSA 2EILH 1LNWA 4XUPA 4KBBA 4PCRA 1KU3A 5DZEA 4HONA 4A6OA 5AIQA 1KGYA 3T0YA 2ZAHA 4BZ4A 2G9ZA 1FTZA 1H0MA 4NIGA 1ZZ7A 3I8TA 3KHBA 3B02A 2BHYA 3WTSC 5FXZA 1ULDA 4B4RA 1RIRA 3EYYA 3TEYA 3ZMUA 1RHI2 1ZRCA 4AHZA 4D7YA 5AC91 1HC8A 3VHPA 2IVIB 4U87A 1AR83 3RVHA 2BOLA 3AKSA 3KS7A 1LHWA 1Q43A 2CUFA 3LL7A 1USSA 4BQ4A 3C1DA 5KXBA 3QD6A 4OCTA 1VQLI 2OZJA 3D82A 1ZKGA 2RQQA 4MEXF 1DHKB 1ZTRA 1J1TA 2YX4A 1ACIA 2C0ZA 3KGZA 1AL21 2C1FA 1FPQA 2B39A 3I3BA 2RS12 2DA4A 4I0AA 1S1AA 4B3NA 4D94A 3J8F2 1TW2A 1W06A 5D6EA 4JX4A 4NRPA 3ZXGA 4HG2A 1U9NA 1DP3A 2LSOA 2V9KA 3GZNB 3ZYFA 2X6XA 1QJX2 2ZKNA 4PF5A 2D6OX 4JKKA 1IS3A 4Y33A 1JKRC 2ZMEA 4PDWB 5DDGA 3PJRA 1R083 2ZMNA 4AI8A 3VDDC 5J3UA 2XWJB 4RQPC 3BIEA 1T39A 1HQWA 1YOVB 5EP9A 4FPKA 1OUXA 2JG8C 2ISZA 2DLLA 2XB0X 1FMD3 3I2GA 4EZHA 3OYWA 3VBUA 2RQPA 4QX7A 1FXZA 1RUF2 3TP0A 5FXXA 3NVCA 2F4PA 4JC1A 2Q0OA 1OOPC 4LLGF 2Y33A 1IRGA 1ORKA 1Z7UA 5FYBA 4LBKA 3AL0B 3WG7H 4QKBA 1GANA 1UY3A 3SFZA 3NWTA 5FCCA 1PUFB 1ASJ1 2PI0A 4WXDA 4BEHB 3G6JB 1A8MA 4BM8A 4FFIA 4LHNA 1QQP3 3ZR5A 1BEV2 5GPAA 5L7OC 1DQ2A 1XMAA 1SFUA 3C7EA 5L3CA 4GFBA 2J1AA 1ZA4A 3H9AA 1CONA 3I4NJ 4NB5A 2EIKH 1G59A 3NV4A 4LGWA 2J5PA 4EYUA 1FI2A 4KMUX 1UIJA 3GALA 4CCDA 1OCRH 5FKOA 2A5YB 4DBRA 3CZ6A 2LKXA 3PIPF 3DU6A 4X6QB 3K4DA 3MO4A 1TME2 4BBRJ 2A73B 2LK2A 1E5SA 4E6KG 2E1MC 1IGOA 2H0VA 2HU9A 2EJRA 3EHKA 5F5IA 2L9VA 3UNGC 4HKOA 1YI2I 1PP8F 1COV1 4LUMA 1ULEA 2DFEA 4XJ8A 4KIFA 1IG3A 4IV1C 3KMHA 3IH4A 3BODA 2VVFA 3R0JA 3CCQI 2DMQA 1DQ5A 1BL0A 1MS3A 3FHZA 2GU9A 2WR9A 5CA6A 5KR7A 1AR82 2X5IC 2IPQX 4KT5C 2DFCA 4MFEA 2EFWA 1W9YA 3RWKX 5HI0A 5FPAA 2WNVC 4XJZA 4OUSA 3BG7A 5HS9A 1OF4A 3MKYB 3FWEA 3BTCA 3IV5A 2HI3A 4LHKA 2WNUA 1SFNA 2VULA 3MIEA 2BDRA 3LZZA 5I93A 3I55I 4LJZF 2VZPA 3RWNA 2CV0A 4YFWA 1KQRA 1JUSA 1LJ9A 4IRHA 1K12A 4BQ5A 5FZ3A 4ZDOA 2K86A 1HKSA 3DTIA 1DF0A 1FOYA 2WN2A 5D8AA 2HS5A 4E7SA 3ZQHA 1LR5A 5FY8A 1QIQA 3CC4I 4RAYA 1X19A 1Y8QB 5GKAC 2GZWA 4PJ0C 1CZTA 1I27A 4JZRA 5IAVA 1YW8A 2CS3A 1LCLA 2OZUA 1XC6A 3N3HA 1R082 1R49A 1LOFA 1U5ZA 3N9MA 4X6AJ 3CJIB 1MMDA 3DKWA 3HBZA 2RREA 1GWMA 2R1BA 2W39A 2ZGKA 1A6CA 3VBOA 4DRVA 2JDKA 4KWJA 1W0PA 3CESA 4CYDA 4IOCF 2D6KA 2PAMA 1FMD2 4IEJA 1ENHA 2HYFA 2P6TA 1BR4A 3BJAA 3IMNA 2FXAA 4KUMA 1BZWA 3BJOA 4XURA 1JTXA 3R4UA 2DDAA 3E5UA 1BK1A 1DGWX 4FISA 4B3AA 2VUAA 4OHXA 2MC3A 4H14A 3AZYA 4YGBA 4HZFA 1T0FC 3OYBA 4UB6C 2LR8A 5JSPA 3F9KA 1O8PA 1QQP2 1V6IA 2ZS6B 4Q0VA 1Y9GA 3N7JA 1LESA 4KDPA 2BRTA 1OPOA 4N7UA 4D6QA 3BR2A 3LKJA 1I50J 3KFWX 1Q1VA 2R7RA 1OCZH 2QQBA 3BR6A 1S0BA 3AG1H 1SLCA 1ONAA 1GQHA 3PVBB 4M71A 2VZ1A 4IHTA 2FMLA 3D0JA 3GTGJ 4YM3A 4AM3A 3I2HA 3OWTA 5GM0A 2Y75A 4XJAA 2NVTJ 2B9VA 1RMU3 1MVEA 2P0WA 1UXZA 4TSVA 1J83A 3Q8FA 2B8MA 1P7JA 1D0ZA 4WX9A 1PZ7A 4XQWA 4JGZC 1W6MA 4QPOA 3M2MA 4XTPA 3ENRA 4OIOF 1HB1A 2AHQA 1PGW2 3GTLJ 3HSEA 1JN2P 4M3EA 4YGDA 2COMA 1MH4A 4Q4ZF 3V8KA 1WLTA 5FPUA 2OUJA 1N1TA 1X4PA 2ZBJA 5DAVA 4EN9B 3INAA 2CWMA 3V8JA 2E63A 4ZZDA 3Q8AA 4YGCA 4BAYA 4DEVA 1OH4A 3E97A 1Y9QA 2DFHA 4U7DA 3OSFA 1TMF3 3GFMA 1K6OA 1O4ZA 3LSPA 1W2NA 3LDBA 3DYOA 3GTOJ 3RZLA 1C1FA 4DUVA 2FE3A 4ENMA 2BV6A 5LGTA 2L7ZA 4TN7A 1OCOH 4ZYEA 1XB4A 4PDKA 3VYTB 2BNOA 1W3XA 1DQ1A 2L0KA 4L9TA 5AFBA 4CDUC 4I76A 1J7KA 1ULOA 4GZ9A 3VHNA 4RLFA 2A07F 5CKTA 2M8GX 1VBD1 3OR2C 3OS2A 5IYCJ 5C3RA 1SCRA 3OOXA 4N4OB 2JDNA 3IAS2 2R5YA 1HDDC 5HLIA 3HOYJ 2JWPA 4GWNA 4LBQB 3CKHA 5FMBA 2Y9YA 4ES9A 4M3GA 2PJRA 3B94A 5I8SA 2AQEA 2RV9A 3WTVC 1XPWA 4GJZA 4CEWA 1NOVA 4ETSA 4YZ2A 1S2BA 3MF6A 4RL7A 1FP1D 1DCSA 3AP5A 1Y1VJ 3T5XA 2IBDA 1IHMA 2PELA 4CDWA 1POV3 2OBPA 2RNJA 3QPHA 3GHNA 2ZX0A 1R5GA 3WF1A 3WE3A 1X3UA 2HYKA 4H2AA 2QCOA 2B46X 2W08A 4AIDA 3ZIXA 3F8NA 2VMEA 2HVSA 1IN8A 1H2LA 3LNQA 1TC3C 5T52A 1OLME 3IC7A 2BE5F 1S7EA 1UX7A 2VT3A 1NCRC 3CEWA 1JHJA 2Y48A 4BHPA 5BQTA 4AEDA 5L9BA 4IV3B 2IXIA 3GZAA 3CDZB 1IRZA 3GW2A 2AS5F 1U5XA 2Y6KA 1SD5A 1D5YA 2GIZA 3OUIA 3K1MA 3MFKA 2UY9A 1IN5A 2BY2A 3HHGA 4BQXA 3ITQA 2K3FA 3WDTA 3F8BA 1RMU2 4EE2A 3AKZA 3KP5A 1K5MA 4OVEA 1VAKA 2OYZA 5GZDA 1N78A 1W6PB 3BOQA 2E7QA 4GB31 1ETWA 3KZ4C 3HTUA 2ME0A 2XPWA 2OCCH 3CF6E 4RD7A 2UWMA 2ELHA 3ETQA 5K7HA 4XBNA 1Z78A 5LBCA 1AU7A 1NK2P 1S55A 3ILNA 3A1YA 1X58A 2BGOA 2NMOA 4IE4A 1WW7A 1V5EA 4BHBA 3HC7A 4XFBA 2WV1A 1AHDP 2VTXJ 1Q8PA 1YQ8A 3VBFC 1V0AA 4CCEA 1GNHA 2HZTA 4C0HA 1MDMA 1TMF2 3L00A 2X1DA 1JJ8C 1ETOA 2VQUA 5FQ0B 1JHHA 1VF9A 4FTHA 4QHOA 2VBDA 1H1IA 3W6JB 4E2SA 2WZR1 5CVRA 4XC9A 4RGSA 3CP2A 4UW3A 2NP0A 4M74A 1H4HA 2CGOA 2XVGA 5IHRA 4I02A 2X1CA 3RJPA 3VYRB 1JKOC 1X1DA 2HVRA 2DBNA 3CJXA 4QPGA 2ZOEB 5FZBA 1AHSA 1VFCA 3ZFGA 2STTA 1P7IA 4XN0A 1OR7A 3N97A 3GCWA 3B73A 3ULQB 1CESA 2Q1FA 1QJU3 4JAAA 3KVAA 5GAEJ 1Q8SA 4BA6A 4Q26A 4JHZA 3WGHA 3LF7A 5ILSA 2WYFA 4CCMA 4DO0A 3ZYPA 3HOVJ 4NN0A 1DP7P 3S5QA 5C3PA 5E1RA 4PIXA 3D8CA 2WBKA 2X48A 1AKHA 4IXLA 4CDQB 3AMQA 2WINB 5M3FJ 2K4JA 4JV4A 2A5WA 2JN6A 4BQYA 3NKTA 1GHCA 4LEJA 2HWB3 1YW7A 1DGRM 1FT9A 2Y69H 3PNTA 3DF8A 1JYXA 5A80A 3EUHA 1Y39A 4XOTA 3BN6A 2GWRA 2LKSA 3BIWE 3OEAA 1KD7A 2HBUA 2OUMA 1W6QA 3IHUA 3JQWA 1EH7A 2ACJA 3WDUA 1PK6A 2A6TA 1C1LA 3KEYA 4XAEA 4EJUA 3VWBA 3W6KB 1IKPA 2Q8DA 3FKIJ 5C5UA 2O3FA 4PLOA 2DCJA 3BTIA 4Y1VA 2DJIA 3LWCA 3RJRA 2H6BA 4G6QA 1OYYA 4QQLA 2IGMA 1UCRA 4YIRX 1IPJA 4CZCA 1W0TA 4LHSA 3VDCA 1RJ7A 1UXXX 5KK1A 1VBB1 4XQFA 5A2QK 4BGDA 1SVOA 2A6HF 5FY9A 4F92B 3KZIC 1NXMA 5JR3A 5D1IA 1W3VA 2ZGTA 1CJDA 1YYNA 2WS91 1DU6A 3BT9A 3WTZA 1U5TA 5GLVA 1ETYA 5DD4A 1XGSA 3KZYA 4M3CB 1DG6A 1H9WA 1JH5A 1VI0A 2D6LX 2F48A 3PURA 5FLXK 1YRNA 5FZMA 4YRDA 1NAEA 1EV13 3A03A 3CF5F 3FMQA 3ZN0A 1Q3EA 1RUH1 3MV01 2GXAA 4Q47A 1AR63 1VPHA 1Z6TA 2WA0A 3T2QA 1J58A 3CO2A 1VQ8I 3TN91 2Y6JA 3LE0A 2BBYA 1OPCA 1ENRA 1B72B 1W9FA 3ZMTA 1YFYA 1GVDA 4NIAA 4RYDA 3T4VA 5C8CC 3VZNA 4QHBA 4ZC3A 4NRMA 3SZTA 3U4XA 1DU0A 5F6KA 1JU3A 3BQYA 4RA0A 2CHHA 2WA4A 3POSA 3KCCA 3HOBA 4HX4A 4CEYC 4EZ4A 2XVCA 2R7UA 2ZHLA 2GMMA 1UHSA 2K9LA 3HB9A 5CFCB 5K1YA 3E1F1 2E5ZA 4AUXA 3G73A 3T4HB 2A3XA 1RUNA 3AP9A 1WJBA 1IQDC 1MKMA 4BL0B 3GF6A 1VAVA 5BNOB 3IIAA 4W97A 4LG0B 2D5VA 4S2HA 3MMYB 4PDWC 1CAXB 1PIV3 1WRJA 4LITA 4OI4A 4AIHA 4HW0A 1MIJA 2PLYA 2D43A 2R4GA 5EPAA 4M6YA 1W03A 1GV5A 3V0AB 1AJOA 3JZVA 4R79A 4Q4X2 4W65A 3JD73 5CFDA 2HWB2 4WM7B 1B6AA 4IQPA 1XCBA 2CSOA 2JXAA 2RDPA 3HWJA 5A1LA 3I53A 2IUWA 1DQUA 4ZYGA 4A3FJ 3AL0C 4BJ6C 4QQ2A 1W2OA 3ZMZA 4BQOA 3LB9A 2JDAA 1TW3A 1XB9A 1S72I 4JTNA 4R52A 1W9SA 3T8TA 1RGSA 2MA3A 1UU4A 3SXYA 2PEXA 3UKVA 1ZREA 3CCUI 2M7AA 1K78A 1W4MA 2X6YA 2XB5A 1B1BA 1IV6A 2XBO1 4IF4A 3MF9A 1EY2A 2UWAA 3K4CA 2IGNA 5M5XJ 3FHQA 5J8CA 3CUQC 2F6BA 1CAVB 4B8EA 5C8WA 3BG6A 3S15J 5FFZA 5EJZB 3SMHA 3WVJA 3CCJI 1DQ6A 1VQKI 1QF3A 4LBJA 4YVWB 4BE0A 4PZJA 4ORFA 1FSHA 1HQLA 2VQCA 2VMCA 3A4UA 2GXGA 3H1CA 5LASA 4BACA 3ZXFA 4CCOA 2KJCA 2WNEA 2QQIA 4KYWA 1A78A 1HJFA 1EV12 5IUQA 2IW5A 2CYFA 4HLTA 3BGAA 1OUSA 2ZGMA 3KEOA 1AR62 3CLOA 1E3HA 2F5DA 4BIOA 4CDGA 2RR13 3KB5A 4CZSA 2BERA 4O65A 1W6NB 1OCTC 2GC0A 3OMYA 1MZFA 2HKXA 3ZO0B 2VJ4A 3WDWA 5C4WB 1CAWB 3WTTC 2LY1A 2F5FA 2ZFUA 2VJJA 5L3BA 3WG2A 2C9KA 1VLNA 3I3DA 3IAQA 1ST8A 2HQ5A 4HSTA 4YEJA 4L8QA 2M87A 3WU2C 3TNPB 4UW6A 5BNNB 1F9NA 1QU0A 1Z7S1 2Z4FA 3CD6I 4LNVA 4AVVA 1SLLA 2V6EA 3TDUC 1W8UA 4A3KJ 3NNMA 2YPJA 1FNNA 2EA2A 3V56A 2WNVA 1JU4A 3U9GA 2WFF1 1XQNA 2ZC2A 3USUA 4F55A 3S3NA 1XNTA 1YXWA 1ZRRA 5C9AC 3OYCA 1FATA 2JENA 4C3IJ 1PIV2 1PO23 2ZB9A 2CFXA 3CJIC 3LEIA 3ZFEB 2HQAA 4GD4A 1R1UA 4S0HB 1EUUA 1FYUA 1JTZX 3WDXA 2P6HA 2J42A 2YB7A 2ERFA 5F3IA 3FXQA 4XFIA 3JD72 3U37A 3HQXA 1CAUB 1J3RA 1QH6A 4HVQA 2LH9A 2DFBA 1IS4A 4NQWA 1G8XA 1SLIA 3G1OA 5JOXA 1YFXA 4LO8A 5GPCA 5FZIA 4GAZA 4TWTA 2DYSH 3LGRA 1PDNC 3FM3A 3H8UA 3HNMA 3WSOA 1VAMA 1P9QC 3KT1A 2LC2A 2W95A 2TBVA 2HLEA 1FIAA 1T6BX 4L9JA 1VJ2A 2PLV2 3WY6A 4ATFA 2RVCA 3WGGA 1YJKA 4MVTA 1OHFA 3HVDA 4Z2WA 3AX4A 4D7NA 5FKNA 3BZCA 3LSTA 4Z8BA 2Q2EB 3LA2A 4DY5A 3DEMA 2JE9A 4BE1A 2R7VA 4RGXA 4TTGA 2ELJA 4DRRA 2Z79A 4QDSA 3BLYA 3HOWJ 2CW0F 5IFPA 1DPRA 5C33A 2FBIA 2E5NA 1MZ5A 1SHWB 2I74A 3E6CC 3TO7A 3S2WA 3R0RA 5FLIA 5J98B 2LBFB 4FTEA 2KLOA 1V6KA 3JRBA 4AOCA 1QQIA 2G19A 1AL23 4COYA 1HW1A 3KSCA 4NC7A 1PUEE 3I4MJ 1STMA 1W90A 2GH8A 1BI3A 5FYTA 3J9SA 3LQRA 2XGEA 3TWIA 1R091 3WLUA 1ZQ3P 4CXYA 5CYYA 5HNFA 2RR12 3ZR8X 3MFAA 3MAJA 1R7JA 3OBZA 1G3WA 4UFLA 1FNZA 1OYWA 3F21A 4LJHA 1GMMA 1H6XA 4BH9A 3H1MA 1QHDA 2V09A 4AWXB 4S2FA 5ICFA 4EWDA 5LFAA 1H8TA 4EGYA 4B48A 3E6MA 4W6WA 3VKMA 4ZKTB 2LVSA 1HN1A 1NA1C 1YYVA 2RNGA 1QHHD 2VC1A 4P96A 1VIWB 3P3PA 4XZPA 4IQJA 2W2IA 3JAMK 2Y31A 4LO5B 2R7ZJ 4BE3A 2GP5A 3B9IA 1TVGA 1HRI1 2CGNA 4A42A 4AFMA 4XCAA 1J9IA 2VXJA 1X2NA 3AJZA 2W1OA 2ATFA 1PO22 1ETVA 3NWKA 1QOSA 5F7UA 3CQOA 5D5UB 4BDVB 1MH3A 4AFDA 2XHKA 5F2SA 1QBJA 2BU9A 3A0HC 2RJLA 3PTYA 5JZGB 5FZ1A 2XAUA 4HV6A 3TKYA 1XNAA 3BOPA 3GZEA 2JUGA 2CQ7A 5FP3A 2L7KA 4WVMA 2I8DA 1HB2A 1GNZA 3WW2A 4IUGA 3VKNA