4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
5A3NA 5FP8A 5FXXA 3ZPOA 4IGOA 2XUEA 4HONA 2YU1A 4QX8A 4UF0A 5FPBA 5FZEA 5F2WA 5FZGA 5FP9A 5IVBA 4Y4RA 5K4LA 5FYMA 5FY0A 4D6RA 2WWUA 4LXLA 5F3GA 5FYYA 5IVYA 3NJYA 3K3NA 2XMLA 5FV3A 2OQ6A 3PDQA 5FYBA 5FZBA 4CCMA 5IVFA 5FPLA 5FXZA 4Y33A 4CCOA 5A3TA 3N9NA 5FJHA 2Q8CA 4EZHA 3N9MA 3PUQA 4CCKA 4CSWA 4LIUA 4AAPA 3OPTA 3KV5A 4IGQA 5FZKA 4CCLA 4QX7A 4GJZA 5FPVA 5E6HA 4ASKA 5F3IA 5FWJA 3U4SA 4C8DA 5A1LA 2YBSA 5F5CA 5FY4A 5FYCA 3AVSA 3KVAA 5ISLA 5FZLA 5LWBA 5FWEA 5FZ6A 5A7SA 5FUNA 5FZOB 5LY1A 5FJKA 4GD4A 4D6QA 5FY7A 3KVBA 2XXZA 3LD8A 4QWNA 3PU8A 4QXBA 5FYZA 2W2IA 3N9LA 5FZ3A 3KV4A 4CUGA 5FP4A 3RVHA 5A7WB 5FZCA 2YBPA 5F3EA 3AL6A 2OT7A 5F37A 5FUPA 3U78A 5FP3A 5FXVA 5FZ4A 5A7OA 5FZDA 4NUBA 3K2OA 5FYUA 5FXWA 5FZ0A 5FZHA 3N9PA 5FY1A 5LY2A 4AI9A 5FYVA 2OX0A 2WWJA 5FZFA 2Q8EA 4DIQA 4CCJA 5A3WA 4BXFA 3N9QA 5FY8A 2OS2A 4GJYA 4HOOA 5F2SA 5IW0A 3PUSA 4CCNA 3PUAA 2PXJA 5F39A 4LIVA 5FYSA 4E4HA 3N9OA 3DXUA 4V2WA 5KR7A 4Y3OA 3PURA 5F5IA 4IGPA 4XDPA 5A1FA 2P5BA 5FZOA 5F32A 5FBJA 4V2VA 2Q8DA 3OPWA 4UF0B 4XDOA 5FZ9A 4DO0A 5A7NA 5FZAA 3ZLIA 3KV6A 3LDBA 5FYHA 4EYUA 4BU2A 5CEHA 5IVCA 4LITA 4QXCA 5FZ1A 5FY5A 5IWFA 5A7WA 2GP3A 5FZ8A 2OQ7A 2YU2A 4EZ4A 5A7QA 5A3PA 5FPUA 5F5AA 2GP5A 5FYTA 5IVVA 5A80A 4URAA 2YPDA 2YBKA 4TN7A 5ANQA 4QU1A 5FZMA 5FZIA 4QXHA 3KV9A 4D6SA 3AVRA 5IVEA 3PTRB 5FPAA 3UYJA 3K3OA 5A7PA 1VRBA 2VD7A 5FP7A 5FY9A 3AL5A 5FYIA 4BISA 5F3CA 2XDVA 3PU3A 5LW9A 3DXTA 5FZ7A 4GAZA 5IVJA
chains in the Genus database with same CATH superfamily
4RQPC 1X50A 1O8PA 2V7FA 1ULOA 1ZK8A 2WNUC 1F2NA 2IGOA 2QNKA 1V6NA 1LOCA 3VWBA 2RVAA 2PMUA 5AC92 2D93A 4E7JA 2BY2A 4IEZA 2DA2A 2KZVA 3F22A 4LKFA 3M2MA 1IN5A 5JHFA 5D8KB 1VBE3 5CZKA 3VKNA 2RS32 1DHKB 1JZ4A 1MDMB 1A6IA 2X48A 1VR3A 1EPWA 1S7AA 5LD2C 3J81Z 2B42B 1P4AA 4AVTA 4FQZA 3BTIA 5C3RA 4A3DJ 4YVSC 4CEYB 4DMIA 3L1PA 1W0NA 3KP7A 2GALA 1Y39A 3AKPA 5FP3A 2KM2A 3RYRA 1U5XA 1UX7A 2OPTA 3ZX7A 4YNIA 3S2HJ 3THPA 4NOTA 5HS8A 5D6EA 4H14A 1AYM2 4FETA 1MDMA 5JLXA 3CIHA 5KR7A 4YYOA 1DGRM 1EV7A 3BYWA 1CZSA 1ULDA 1SLBA 1TNTA 4CEYA 1DFQA 2JECA 5FZ8A 4Q4Y2 3W2VA 3CLPA 1AL22 3M1EA 1KQ0A 3RPQA 2W57A 3AXDA 4M6VA 2ZAAA 3GZTB 4YRDA 3T2PA 3W2WA 4NB5A 1AR63 3LQCA 5HXVA 3SQOA 5LW9A 1LHUA 5FOJB 3ILNA 1SVOA 3PSIA 1LTEA 3GTJJ 4OMZA 4HLYA 4PJNA 2EF6A 2XL7A 3I4PA 4AE2A 4RB2C 1ZARA 3AKQA 3T4VA 1IN7A 5BNOB 5IVFA 4DUVA 1I1SA 3C7HA 4UOJA 2LM3A 2AREA 4CU7A 2WFPA 4PJMA 2UYAA 4FAGA 4TV7A 4EJOA 4Q8KA 1SFPA 5IT3A 4MX3A 2XUBA 1QWRA 1DYOA 4LULA 4JDNA 3KVBA 1W03A 1PVC2 1W39A 2BVMA 3I2HA 1HKSA 2NMOA 5AC93 2Y75A 3KQRA 3KHBA 1VAMA 2XASA 3HAGA 5BNOA 2A7AA 3ZYBA 2RS33 4B4RA 2IW5A 4OHXA 4C90A 5IT6A 2ZC2A 3WG7H 3FE5A 4XILA 2E33A 2HEYF 3U9GA 3B9IA 2RC4A 3JRFA 3GZAA 3ASNH 1O4YA 4BE1A 2GXGA 3S8PA 3V42A 4N43C 5CEHA 2Y0OA 4AIDA 4ZDLA 2PG4A 3S17J 3C7JA 1K7AA 4QXHA 3PTRB 2VJ4A 2WQZC 2MHFA 4XBQA 5FYIA 2H8RA 1BW6A 3FLRA 1VIWB 4PIYA 1AL0G 1ZZCA 1WQ2A 4DRRA 3ZN4A 1BLZA 2XJUA 2JA6J 3FHAA 3KHCA 2W3JA 2BERA 1AL23 2HVRA 1DGWA 1TT5B 1VQ7I 4LNVA 2E63A 1W36D 2VUJA 4A3IJ 3O0VA 2XB0X 4TYSA 2ZHNA 1UU4A 2VCBA 3KVAA 2PMHA 2K4JA 1AHSA 3B5LB 3U1XA 3J4UH 3V64A 1B9NA 1WMXA 3RWNA 1WCKA 4C9YA 5FLHA 1Y0UA 4AVPA 1GSLA 4ZTJA 1L7QA 3GBFA 4ZS3A 3SH4A 1UPSA 5K8SA 3VKLA 5DAQA 4U0WA 5ACA3 4RLQA 2QSGX 5CKQA 4ES9A 2BW8A 3OS2A 1VBE1 2Q8KA 1W6PB 3FHQA 4AGGA 3BODA 2UY8A 3KZYA 1DGWX 3LIGA 2JA8J 4LK6A 3T1BA 3WDYA 3B3QE 3JUUA 1I1EA 2QUOA 2PJPA 3A4UA 3LOCA 4E7KA 4GKXA 4COZA 3GCXA 3RJ2X 3AMNA 2X1DA 4OI1A 3G7DA 1W6PA 4E2GA 1TQPA 2DA6A 2PJRB 4OMCA 2RQPA 2ADEA 4DYQA 2D3SA 4KWLA 3K2AA 5IFPA 2QQPA 3C2BA 5FYBA 3U75A 3OGRA 3TOBA 4PDWB 4K9SA 1PK6C 3TL4X 1CIWA 1NLQA 2WAOA 4A41A 4XF4A 2DPDA 2XJRA 5F3IA 2DV9A 3U4SA 3QRFF 1P4XA 1AR61 1OYYA 4O9GA 2PJRA 4O6JA 3POIA 2KIMA 1AXKA 3ML6A 3W3CA 4LK0F 2ZGTA 1WKMA 3IB3A 3WP5A 1H2LA 3BIEA 5CFCB 4PDWA 2DYCA 2YXSA 3FXMA 4GXLA 2RR11 1KGYA 1K78B 4IEYA 3MCZA 4HX4A 4B43A 4J00A 1XPWA 3IPVB 1SD5A 5BY5A 2DFCA 5F1RA 4DO0A 2FE3A 2XHNA 1A6CA 5FZAA 5HDKA 2A3WA 3F23A 4FSJA 3JRBA 3EO6A 1O8SA 1G3SA 5CFCA 1FIAA 4Y1YA 3WE3A 4GKYA 1OOPB 3OOPA 1QJY3 4XLEA 5FO9B 2C9KA 4UHTA 5EF6A 2VNRA 4K20A 3ILRA 2YX7A 4HQMA 4GH4C 1YYNA 2VNOA 3Q9VA 1K78A 5FY9A 2KHMA 1FX5A 3S0MA 2CSOA 2QZ3A 4ZTFA 3V0AB 1FBSA 4TXWA 4F83A 2QQOA 3IPVA 4LR4A 1ZRDA 2ACJA 4CHUA 1R082 1LEMA 3QLQA 4IV1C 3LGRA 1U12A 2NVQJ 3HGGA 3JRIA 4F3JA 3POYA 1NA1B 3I0TA 3OEBA 2DLLA 3LWFA 4YFWA 5FV3A 3VHPA 1W7PD 4OYUA 1IGOA 1R6RA 1OOPA 4XRSA 2QQ8A 4KWKA 2BU9A 2RG4A 4C2TA 3UJOA 3PJRA 3FHIB 2W7NA 4C8DA 2ADDA 3V0AA 1CPNA 3ZSEA 2P81A 5J4YA 1JKQC 3T2OA 1Z0XA 3JCIA 2L7FP 1HW2A 2HYGD 3BPVA 1NA1A 3J7LA 3BR0A 1QJU2 3KLSA 3M4FA 5J4VA 3ZXLA 4E6KG 1O59A 1AL21 4N4OB 1HBXG 1E5IA 5D1IA 1FI2A 3KZ4C 4LJHA 4XCBA 3NEUA 2FDHA 4L0PA 3AJZA 3H7YA 2X51A 5ILVA 4OINF 1LKNA 4MGYE 4XRSG 2M30A 1CAWB 1ODMA 4AI2A 2K85A 1GP6A 4XJ9A 3L7WA 2EZHA 1BEV2 4ZZ5A 3C7EA 1JTZX 5JZGC 4QU1A 5E3NA 4XC9A 1V6KA 3RPUD 5FPAA 1BVVA 3T09A 1JJ8C 1ULFA 3PLQA 2XKOA 4N7UA 4KBZA 5FJ8J 5IVJA 1UY3A 2JG9B 1DQ5A 3NNGA 3PQJA 4F55A 5ACA1 5C9AB 4IETA 5FPBA 3N97A 1M06G 4MTEA 3O1VA 1CAWA 4NRPA 4LHNA 3O14A 2QEXI 3WU0A 2RS52 2CYYA 3ZYPA 3DTIA 1HRI2 3I64A 2QKMB 2Y64A 1ND3B 1OLMA 1QMJA 3NSTA 4WVWA 3HQXA 2M3AA 4LD5A 2A69F 2TRTA 4XABA 2ARAA 1EY2A 2JG9A 4CYDA 2V4JC 2CW0F 4XSXF 4XFIA 5C9AA 1E3PA 5G04L 5FROA 2V79A 1S0GA 1OCCH 1T39A 4RFRB 4Y5Z0 2VUAA 4UFJA 5E18F 4DFSA 4RHV1 4YIIA 2MW8A 4AIHA 5DN2A 4NC6A 3CCEI 2X6XA 4IESA 3TDUC 2KLOA 1ZRCA 4B7EA 4ONUA 1ND3A 4EEFG 3PUAA 2HQ5A 1W6MB 4E7ZA 2BNMA 3RZOJ 4IGPA 4I3PA 2R062 5F5QA 2XB6C 2VIXA 3OJBA 1RKWA 4LG0B 3JTGA 5IYYA 1QJU3 2A61A 5FYTA 1C8M3 2IS2A 1APLC 2YPDA 1BJZA 4G12A 2ZXWH 3U21A 2WBMA 2QCSB 4XLFA 4XUPA 4KIGA 3VD5A 2DVFA 2HJIA 3KSCA 2ZFUA 2XVGA 5KWRA 1W6MA 4HF1A 5FKOA 5A6XA 5HCAA 1SANA 4V19K 1XCVA 1P8JA 1V6OA 1U5YA 5I93A 2VW2A 1MPXA 3SEZA 2DMNA 4LG0A 2MPFA 5JMOA 1TTYA 4B4PA 1G8WA 3OYHA 3MICA 1S3JA 1XG1A 2MGQA 4IX7A 1L0OC 4XQWA 2FU4A 2PHDA 3BJAA 1N3QA 2R0QC 4ZDOA 3BQZA 3ERED 2DWRA 1QJY1 4HNVA 5BNQA 1Z77A 1S2BA 4A0XA 1XMXA 1HSTA 2PAEA 4D5CA 3ZYHA 3H3UA 3NV3A 3SHRA 4P9FA 4A12A 4H2AA 5FZ3A 1HV0A 2QE3A 5FZCA 3KD4A 2XAFA 1XCBA 3G6EI 4R9DA 3WLUA 1IXCA 4AYBA 3SJMA 3ECOA 1RMU2 3QYFA 2VO5A 4QQ2A 1GQHA 4L0YB 5LHGA 4IW3A 4Q5SF 3FHNA 4Q48A 3SISA 5LBBA 4TLFA 5IOZA 1ZBE2 2VASA 3JD72 3RZLA 5DABA 3SXYA 2AS5F 3FFQA 4BQWA 1FPN1 3KETA 3MIFA 1DQ2A 4IOCF 1VQPI 3JB4C 3HKZN 3VB9A 4FPYA 4AEKA 1MS1A 2RNGA 2W4SA 5FKLA 4EROA 1ZREA 2CWEA 2LLKA 4QHOA 2R063 2HXOA 4XHXA 5L7OB 2ZMKA 4GWJA 2WY8Q 5CQGA 4FPKA 1AR93 5FYYA 1BI1A 2CV2A 2JICA 2YG0A 5K5OA 2E71A 3N7MA 1B4AA 1ZGWA 1QOOA 4CICA 2QYOA 5JPMB 1RUI1 2IGNA 3WTVC 5K5QA 1H0MA 4L99A 1JHNA 3M8JA 3TEYA 1MNEA 3TP0A 4KICA 4DW6A 1W5SA 3TEWA 1S0DA 4D9JA 2WFF3 4K1ZA 4QX2A 5L7OA 3K48A 3LAPA 1WD4A 2P3IA 3IN9A 3RJPA 5BV6A 4DXZA 5ABJB 4FX4A 3ACIA 3A0HC 1ZYRF 5BNPC 1MSFC 2L9NA 1ON1A 1ACCA 2WNVB 1YX5A 3F9KA 3FMRA 1Q8OA 2Q8EA 2CW7A 1NE4A 3WQBA 1IF1A 3S2WA 2H27A 2EIBA 2VKDA 5JR2A 2A73B 4BS9A 1LESA 1DP3A 1WGPA 4KMUX 3FXOA 1STZA 5IYDJ 5LA1A 5ABJA 4L2NA 3I8TA 4YW4A 2WNVA 4L9BA 3CUQC 1C0WA 4QPGC 3KV9A 1BJQA 5E89A 3VZNA 2ID3A 3MLJA 1FOYA 4FXGB 1UAIA 2D44A 2XAHA 2NS7A 1XB9A 2XAQA 3CO2A 1DQ6A 2K9SA 3CJXA 4L18B 4P00B 3I2DA 5GADJ 1ZBA3 1POQA 3UKVA 1ZBE3 1IW7F 3JD73 2HKXA 5IYBJ 5K7HA 4MYEA 3MIBA 2EJRA 1QF3A 3I2KA 2C4XA 2I07B 1SFXA 4LE3A 3NJYA 3DPUA 4CZCA 4QXKA 2ZACA 4MGKE 2JE7A 4CDWB 2DFHA 3VBUB 4U7BA 4HLTA 3LZZA 4OZXA 1C8M1 1GZCA 3W6VA 3KM5A 3G2BA 2YR2A 5J98B 3VHNA 3LFMA 3ZYRA 2DU9A 2R16A 1Z3XA 4RAFA 3A2KA 1T33A 2NVYJ 3LNQA 1F5FA 3TN92 5JHUA 2MH2A 3EDPA 3O1PA 4E7SA 4GYGA 3JR9A 5IT9K 2YHJA 4W6XA 1WZ2A 4UW5A 2QLZA 4CDWA 4BXUA 4LLLA 3VBUA 1U9OA 1Q8SA 1GZ9A 2JZYA 4OCTA 4XXAA 4DB5A 5FY8A 5IY5H 2D6NA 2BNOA 2ZEXA 4L9JA 2OXBA 1W06A 2W39A 1UY2A 4EN8B 2VJXA 3KYDB 3CLOA 2XJQA 4AEDB 1REDA 4BEHB 5DDGA 2HDCA 2LOOA 4II3A 4Y24A 3M1HA 4NNJA 4ZY9A 3FM3A 4E8DA 3BPZA 5EDNA 3SCFA 1CQ9A 1NHAA 1BN5A 1QZZA 4AEDA 3MWMA 4BEHA 1C4RA 4U88A 2IUWA 3MFCA 3WDUA 2TUNA 4FPEA 4QHZA 2WA0A 1RJ7A 2ZGMA 4FFIA 1VFCA 4Y22B 2XPVA 4IHSA 3DV8A 2QTWB 2A75A 3GGLA 4RGUA 1S2EA 1X2NA 3TBIA 2AGSA 5FY7A 2KZGA 5IHRA 4A7KA 4CEWB 4M73A 5M5XJ 2VMCA 1KYZA 3TDZC 1XOYA 4G9YA 3C2UA 3KEYA 2IT0A 1WA4A 1ZTRA 1C8NA 1IG7A 5FYUA 1OFCX 1MBFA 3WY6A 1AR91 4UFKA 4UT5A 4Y22A 1KGSA 1XMAA 5A3OA 4PHZA 3HEFA 5F9TA 1D0YA 1SDWA 4FBFA 1UOFA 4CZZA 4CEWA 4XN3A 1UZWA 3CDIA 3L00A 1IDYA 2XJVA 2WFF1 2M7AA 4XXPA 3P3NA 2JG8C 2XGXA 2F6CA 1HRV2 2E1NA 3JQWA 1WMDA 2BV6A 4II2A 1XNTA 4BL0B 2LBFB 2VD7A 1W8OA 2JDNA 3HM5A 1JHFA 1IRXA 3OV8A 3BWGA 5EZWA 3HD8B 2EH3A 4GAZA 2F5VA 2EZKA 1H8AC 2B8MA 2WTEA 1A36A 3SNMA 3GVAA 2VOWA 2OUHA 1GUIA 3O2PE 5L3DA 2EIEA 1EH6A 3EUHA 2A71A 1NCQB 1I5PA 3QOEA 2BBYA 1GHCA 4GGGA 2BBAA 3NJVA 3SXWA 2J5OA 4ZH4F 1JGGA 3O8HA 2LBFA 2D3RA 5AVPA 5FWJA 4FPFA 1LFBA 3PFYA 5E1WA 1LODA 5LWBA 3I3LA 1Y8RB 4HMZA 4HKLA 2ECCA 2RJ2A 3DKYA 4Y20B 3D5SC 2QQMA 2KL4A 4YVWC 3LEMA 2RS12 4QQOA 1JT6A 1WCUA 1B8IB 1ZBA1 2GH8A 4NIIA 2VC1A 1NCQA 4B1MA 1R64A 2QQAA 3J7AY 2DDBA 2VUCA 3OR2C 2XL9A 4XONA 2ZX0A 2PXJA 2PAKA 5DD8A 3H7JA 1GWKA 1WSUA 5JOZA 3BOPA 3F8FA 2PELA 4XOPA 2EIMH 4Y20A 5LK5A 2CNAA 2PHRA 1MH3A 2R32A 1E3HA 2GP3A 4ZS2A 1B8IA 4P9WA 5FUIA 2ZCWA 3CLQA 4QB1A 5EWSA 3AVRA 1YRZA 2P7VB 5KXDA 2NP0A 2I2SA 1CN1A 4XMIA 4ZZ8A 3AG3H 3K1PA 2O8KA 1AR82 4BOWA 3BTAA 1H0BA 4IHYA 2LRDA 3HIFA 1ZR2A 1LOFC 1W4MA 5EIYB 2CDPA 2K2SA 2L0KA 3WF2A 4FI9A 2QKDA 4NROA 2P5KA 4KIBA 4WM7C 4LG3A 1HRV3 3NWTA 1G9BA 2IXCA 1FC3A 4XIOA 4BHCA 2R5YB 4ORFA 4XJUA 3IL2A 3HSFA 3TMOA 2ZGKA 2ORZA 3ZQQA 3O12A 2BWCA 4SBVA 5DM6F 5JVTA 2G4IA 1J2XA 1BR4A 5I0UA 4LMFA 1R4MB 3K70C 3BR2A 1H8TC 3P7NA 2ZHMA 1URXA 3KV4A 1U9NA 1CF7B 3M3EA 1XGNA 3K4DA 5HNFA 3E5QA 1DPRA 3SZTA 1XYPA 1OYIA 1FNZA 3IAS2 1D3YA 2R5YA 1J3QA 3RGBA 4LT5A 4PSXA 3CQOA 4DRVA 1YI9A 1DGRA 4RM3A 3VN4A 3ONQA 1ETQA 4UF0B 1FP2A 2D6KA 2PMZA 4FHTA 2V9KA 2W85A 3KGLA 5F04A 1TMF2 5E3OA 3VBSC 1MZ6A 4EJTA 2YU2A 1CF7A 4NIGA 5IK7A 4W50A 1RGSA 3UL2A 1K79A 5IP9J 4QU2A 4XW3A 2XAGA 1EF4A 2ZHKA 2C1FA 3DXJF 3KZIC 5JXIA 3AKSA 3D3AA 4ASNA 3OY8B 3SCHA 4UF0A 2CGPA 3R4SA 4HVRA 3KPHA 2I45A 2QQ9A 3V0BB 1XNDA 2ZGRA 1G6NA 4QX3A 2HYXA 2EAAA 1GNHA 4CCOA 2YPJA 3N9MA 4Q4W3 2W1WA 3OYCA 3FK6A 3AL0B 4HW0A 5LZ6A 2O5RA 3C3WA 4LBQB 5L19A 1V0AA 5A1LA 3AVSA 2WT2A 2DVGA 1RUF1 1LE8B 1X33A 5FUNA 1OA4A 3OY8A 4BQ3A 2O61A 2DA5A 5KVRA 4NHMA 4XNFA 3ZFEB 3V0BA 2WA3A 4HSTA 1SHWB 2VTFA 5DAXA 3GZ5A 1AR72 3NAPC 3KCXA 3PIJA 1HKQA 5I8TA 2OKXA 4LBQA 1I5ZA 2Z33A 5HLIA 1LE8A 1J59A 2BE5F 1Q1HA 4LLGF 5A7NA 2ILMA 1WBLA 1ETOA 3LL7A 4U2AA 3O7OA 4PSWA 3ZFEA 3LA7A 2E7TA 3K6GA 5JI6A 3EPZA 1RC9A 2XROA 2GC2A 4L11A 3KYLA 5L36A 5JPNB 3WD5A 3DTKA 1F4HA 1BL0A 1Y0NA 5GZCA 4CDQB 4CDXC 2VBPA 1GVJA 4U87A 2YU1A 4HPKB 3PO3J 1TMF3 3NNFA 1VBA1 4QM8A 5K4LA 3HSEA 3D0JA 1RI7A 4AVCA 4BLIA 1EV11 1TZOA 1ENQA 1QJX1 3MW3A 2W87A 1T6BX 2JJ7A 4Z2AA 4CDQA 3V4GA 1QHGA 1HW5A 3ZXAC 3BR3A 4XBFA 1OLQA 4MOAA 1FOD1 5A7SA 5L3CA 5EFUA 2FHRA 4D69A 4HPKA 2PA7A 4COYA 4LOSA 2XF5A 1K5MB 5LBEA 4Q1RA 4ES8A 4E9KA 4NJ4A 4OQ9A 1Z3YA 5GAGJ 4WV8A 5EJ1B 4AR2A 1FSEA 2E19A 1HRV1 1ZG3A 3BN6A 3EYIA 4M00A 3LQQA 2ARCA 5TJJA 1SBEA 2B0LA 2Z9OA 1SAUA 5BPIA 1UWWA 3BB6A 4S2FA 5HV4A 2M8GX 2GC0A 1K5MA 1NLSA 1R00A 5E1XA 1AUYA 1AR73 4C2MJ 1ULPA 4A4AA 3GXUA 4FVVA 3CP8A 5ANNA 5B4XA 3VD9A 2VZPA 3ES1A 5APAA 3GTGJ 3K4BA 2LFBA 2G0EA 4XKCA 1HQNA 1ZGAA 1D4M2 2ARXA 1COV2 1JOPA 4M3BA 1IS6A 3ECQA 3MMYB 1GDTA 1PGL2 1KS5A 3QYBA 4RQPB 2L3DA 4CDUC 4EVIA 3PVEA 3DCFA 2K9MA 1Q3EA 2WNUB 2OYZA 3ETQA 5DAVA 2QQKA 1EUTA 4AGVA 4HL0A 2XBO2 5C4WC 1VBB2 1W28A 4ZC3A 4UFIA 5T5OA 3CL1A 3HGYA 5EEGA 3FUOA 3H50A 4QPIC 1I6XA 3WW3A 5FLMJ 5GTHC 4RQPA 2ZBKA 1NXMA 3ZMZA 5ICGA 3LSJA 1PO22 4YELA 1CESA 1CPMA 4YVSB 2WNUA 3HJEA 3P9IA 4Q4W1 5D5WB 2GZWA 4I02A 4NHYA 2A5YB 5EPAA 1HV1A 3VSKA 4ET7A 3WEZA 3OY9A 1UYYA 1ZQ3P 5JR7B 2Y9YA 2D40A 4XLCA 5T54A 2Y26A 1TG7A 1GU3A 4JP0A 5C5TA 1YNAA 4RA0A 5CVIA 5SV8A 2IXKA 3WQ7A 4EWDA 4JX4A 4COVA 4PJ0C 1HN1A 2ZJRF 3UYJA 1FP1D 5F0FA 4INDA 2DU1A 5K0UC 2Y6LA 4YVSA 4C0BA 2W5FA 3OR1C 3BQYA 4PT6A 4F52A 2DFEA 4NAOA 5D4RA 3AZXA 1UOBA 1DP0A 2ZBJA 4TSVA 1LR5A 3HRSA 1JN2P 4M3CF 1LFUP 3L2CA 4YGDA 3IP4B 4LLNA 4RAZA 5BUVA 1UAAA 1ND2C 1W0OA 4UVCA 3BY6A 4MIMA 2XF6A 1WUVA 3CCJI 5DEQA 2PHUA 2PTMA 5FYCA 1QHHD 1SD4A 3T4HB 3WG9A 1UXZA 3T30A 1TNRA 1RUE2 4KT6A 5CVVA 1D4M3 2WYFA 1F36A 5A7WB 1COV3 5EP9A 5A33B 2VC9A 1RUJ3 2BVVA 4D8MA 1U8BA 3N36A 1V70A 2ZGQA 5BNGA 3V8KA 4MO3M 1MS9A 1J3RA 2E7AA 1SACA 4M74A 2BYVE 2ZSIB 1ZZ6A 3GJBA 2A07F 2CAUA 2BY0A 2DT7B 2EA2A 1GZTA 4R79A 2XBO3 4Y1VA 3A03A 1VBB3 4ISQA 2MG4A 2FEZA 2L5QA 3CJTB 1A3KA 3ZM8A 1S0BA 5A33A 5A7WA 2JB4A 4QLCU 3K77A 1RIRA 3OD0A 3KP4A 1UU5A 2H6CA 3S32A 5LLQA 5FLIA 3IH3A 1UCRA 3DU5A 2B9SA 2DVBA 1FMWA 1QH7A 1CAUB 3JRGA 5FK7A 2W1OA 4N43B 4LQRA 2UV1A 2ES3A 1MMGA 4IJAA 2R7VA 3ABTA 5H6RA 3B9CA 2V26A 2WWUA 3OYGA 3UKNA 3ZSKA 2HPMA 3RKWA 3TO9A 4KIFA 4YZ5A 2E1OA 4IHVA 2VW1A 3ZDSA 4OUMA 3MUZ1 3UETA 1CAUA 4BQ5A 3RNSA 5JI7A 1AR71 5B66C 2M2EA 2Y0SA 4UUSB 3CC2I 1IHMA 4N43A 1DQ1A 3C18A 5FFXA 1H6YA 2FD8A 3DEWA 3VSLA 1VPHA 4Y4YA 2MEV3 3ZMOA 1S7EA 5JLVA 3GHMA 4EGYA 3F3XA 1PHMA 4BQYA 3HQUA 4IPAA 4XBNA 2A3SA 4BQAA 4BQ2A 5HCHA 3ZFGC 2HWE2 3HTUA 1XXNA 2IS1A 1VAVA 4Q0SA 3VKFC 4UUSA 1XQNA 3U14A 5GTIC 1NA1C 2B7EA 1RRJA 1XC6A 1WCQA 1Z67A 3GYDA 1C1FA 2VE9A 4K6BA 4X1EA 1LVAA 2HBTA 3EB7A 3GBWA 5A80A 3CC7I 2PHTA 3OYLA 2ZX1A 5HCBA 1G7YA 2LF7A 4DZPA 2LC2A 4HX7A 4QPYA 3H35A 3I2FA 4FCYA 3A0NA 1X4OA 4UV9A 4KL1A 1RUG2 1SMVA 4AQTA 2NS8A 3OBRA 4BJ0A 5LCWL 5EEHA 3WUCA 1VQ5I 4Y33A 2BGOA 4LOTA 2J42A 2J1SA 5F0HA 3IMNA 4J6GA 4IL6C 4NWVA 4LLOA 4LLFA 1IPKA 5J36A 1H9TA 5KHDA 3I2JA 3BZCA 4K3UA 5FZ6A 4MGSA 2DAOA 5LHHA 3FKIJ 1V6LA 3NNJA 3LD8A 4CXYA 3BTXA 1PK6B 2NVTJ 3SEEA 3AG4H 4O5VA 3C7GA 1HX6A 2QZ2A 5FUPA 5ED4A 3VYTB 4G8XA 1CWPA 4XJZA 2PQ8A 2L2OA 4AI9A 3ZR5A 5BPXA 5C9AC 5JR3A 5M0TA 1JXSA 4QMAA 4EM2A 1KU2A 5IAXA 1C1LA 1O7FA 2J22A 1WA6X 1PK6A 1DU0A 2FDKA 1MZBA 2ZGNA 2WO2A 3B69A 3DU6A 4AFBA 1ZNPA 3B73A 2WRAA 2BW3B 2RM22 3TP3A 3MUY1 1RUJ1 2VVDA 4KGGA 1XGMA 2O9LA 1IQDC 2RMU2 2EIDA 1LPQA 2TCTA 4HPQA 4RM2A 3JU9A 1W9TA 2OU2A 4DQAA 4CU8A 1DLLA 4UB6C 4A7ZA 1KFUL 1GLHA 1ZVFA 3LSTA 3WVJA 5JVGF 3TOJA 3K4CA 2BW3A 3NQOA 3LSIA 3FXRA 4KFCA 3KZZA 3WOGA 3KT4A 2KDZA 1UZCA 2VKEA 4IV1B 2VOXA 2HR3A 3FM5A 5AIPA 4GRIA 3H9QA 1VBC3 1CGPA 1IQAA 4KH9A 1LKXA 2E7QA 5DV5A 4G7OF 1Y9GA 1AJKA 4FP3A 5K5RA 3OYDA 1UF2C 1ODDA 2J1AA 3SLIA 3MKLA 4FFHA 2Y6FA 2K4BA 5M5WJ 3THDA 3CMYA 4IV1A 3ZYJB 2X6OA 2J7MA 3DKWA 2COBA 3MIEA 2R3SA 1RHI3 4JVAA 5JSOA 4KT5C 1S0JA 1BXHA 3ZP5A 4FX0A 4BZ4A 1RYYA 2DUOA 4AAXA 1W0PA 1WMFA 3OUHA 2GOXB 4RAYA 4IV3B 2NZ9A 2HVQA 2MEV1 4Y17A 1ZA7A 3O3KA 5FLVA 3OBZA 3H0OA 1F9KA 2O03A 1HDDC 2YFUA 5TGTA 1UZZA 3U1KA 2Y38A 2LVSA 1QA6A 4DPNA 1ACIA 4JOMA 2AACA 4P1WA 3H36A 3M8FA 2XUMA 4BYYA 2EVXA 5JZGB 2XJPA 1YCIA 4NE9A 5KK1A 4XFCA 2CGNA 5FLJA 2OTJI 4FAHA 4A3KJ 5CU1A 4IV3A 3WNLA 3HT2A 2JD9A 3G1MA 1OSGA 1YWKA 1IUYA 4PBOA 1MBHA 2RM23 1QGLA 2E31A 3SKJE 1AOYA 3DPTA 3RMXA 1PO13 2ICWG 2L9LA 1OMIA 2ARBA 2QQJA 2RMU3 1R093 4NO4A 1JI8A 1KU3A 3OYJA 4FTHA 3E7LA 2A6YA 2JEMA 4QX5A 3S2DJ 3ZCOA 4FTEA 2GNMA 3AG1H 2FOWA 2WL1A 2VCMA 1I39A 4CXFA 2H1KA 4R4XA 3ISPA 2PLV1 1AZDA 4A3FJ 5JZGA 3QODA 2WABA 2HU9A 4K40A 2FX0A 3OYEA 4Z82A 2YMZA 1KFXL 5LBFA 2VR4A 1Z21A 3I9V2 2LTPA 1FV2A 3HVDA 4BY7J 4LIVA 1UYPA 3AG2H 4V2WA 3UT0A 3NRUA 2VC0A 2X10A 1RTVA 1AX0A 2P34A 4MQ9F 4NRQA 4LA2A 5ICEA 5FZ9A 3KB5A 1IXSB 1HC8A 1MBJA 4NHKA 1NT0A 5GJ6A 2QQNA 3A21A 2GA1A 3OL4A 1PMJX 1TW2A 2JX9A 3MLKA 1P6RA 3HMYA 4GB32 5FZIA 3TO7A 2JQ7A 3C3VA 2Z3YA 4YLZA 5FLXK 3CZ6A 5E8IA 1DG6A 1BI0A 4A3GJ 4IGOA 3HG9A 2WNVC 5DPNA 1VQNI 3FXLA 3RFRA 1NAEA 2QA4I 2A1XA 2DBNA 4KBBA 1U3EM 4ENKA 4BH9A 3GF6A 4C3JJ 4YM1A 1HQWA 3FKJA 5B4NA 4DNCA 4CO8A 2FBIA 5DD4A 3ZKYA 4IHTA 4WM8B 3ZN1A 1QNWA 3UESA 1CZTA 4A6SA 4H55A 3N9LA 1WPKA 4LTAA 2JJ6A 2JTVA 1G9CA 4FO9A 4YRVA 1ZLJA 4MEYF 5FXWA 2IXSA 1LEDA 1NG6A 4NHJA 1A31A 4BXFA 5EYYA 1LGBA 2H8WA 1MEC3 4FP2A 2YC4A 2JE9A 4LORA 4WM8A 3ALQA 2VOOA 1FPQA 1WZXA 3I55I 5GZEA 3F8CA 3VBUC 4E7LA 1WHUA 2QQBA 2ZGUA 1UY0A 1AYN3 2UY9A 1VBC1 5IPAA 5A7QA 4XUQA 4LMYA 1Q8PA 4HDVA 2HWB1 2NNYA 2H94A 4D6SA 1YFWA 4ABZA 4XLPF 5LBQA 3ECHA 1YIFA 2O0OA 4Y1UA 2MC4A 1OF3A 3MEPA 1WLDA 2WN2A 4I76A 1B1BA 1IRZA 2ENRA 3JZVA 5C6CA 1RHI1 4AI3A 3ZQHA 3ABLH 3ZXKA 1YYVA 1MZ5A 4Q4X2 1WJ5A 4CPBA 1BW5A 4CCKA 1QQP1 1FOWA 2VQ0A 4IEQA 3KEQA 4E4ZA 1JUMA 3FZVA 1W8WA 4Z2YA 4WX9A 2WS93 1YO5C 3MQ0A 2E9QA 1D0GA 2VQUA 2CWMA 3VOEA 3ZPYA 1KDMA 3KWVA 2N8GA 4W97A 2JB8A 3IH2A 5DQ0A 3INAA 2YBPA 2B39A 4GXOA 1QDOA 4P9YA 4NHLA 4MHGA 3RRDA 4NUBA 3M07A 3K4MA 2KA3A 2YUEA 1VE0A 1JGSA 2XRLA 1GXQA 2WB1A 4LUMA 2V73A 5IW0A 4XRFA 4S04A 2M9HA 1PO11 2W95A 3DXUA 3ZYIB 1W36C 3A0BC 2D98A 4LJZF 5BNPB 1R9TJ 1R091 4XJ8A 3ACHA 2JA7J 2JENA 3B00A 2F17A 4H7LA 5C8CC 1N77A 1IJWC 4BJ6C 4JCKA 2NMNA 4YARA 1IPJA 2Y31A 1L7LA 3BTZA 3ABUA 5GPCA 3WW2A 3IKVA 2WAQA 3P9KA 3TEXA 3Q8EA 2LF8A 3PU3A 1NQJA 2CH0A 3TNPB 3ZFFB 2A3XA 5BNPA 3TW6A 5KHGA 5FKBA 3CUQB 4IHWA 4QPGB 2EZLA 1QH6A 5I8SA 3CZJA 2BBVA 4O3MA 4FPOB 2P4WA 3H42B 3L2UA 4E27A 1USTA 1KYWA 2KT0A 5LA0A 4M3CE 4KITB 2K7LA 4META 2BUKA 2CTVA 2BNNA 3TW7A 3GZNB 1Y7BA 3ZN0A 2YBSA 1V54H 3COAC 2ESHA 3ZFFA 3MKZA 1OQDA 4M9XA 4WCGA 3CUQA 4QPGA 4D1QA 2DUPA 1QXRA 3DYMA 1RKTA 2LMDA 1DLCA 1LOBA 1SEFA 3EXUA 2ME0A 4HEA2 2JIJA 2OX0A 1UHWA 3POWA 1A34A 3IM0A 3N9QA 4WXDA 2K46A 1B09A 4QWQA 5E79C 2EPFA 3WP4A 3I53A 4BJTA 2PQQA 2KXLA 1JE8A 1XPXA 1E57A 3AMQA 1H8VA 1IXRC 1I9RA 4DZGA 2VN2A 3EHKA 4Q0VA 2CRGA 3J8F2 2PHLA 2VJ5A 2DUQA 1YOVB 1UQXA 3D5OA 3OWTA 4A42A 5ANQA 4YG3A 4Q4V3 4YZ4A 2DCZA 3ASIA 3SDBA 1XNAA 1QQIA 3ZYGA 1T2XA 3OBTA 2E60A 3CJNA 5FKKA 4PLOA 3DBHB 1H2NA 3AP9A 1DGWY 5E20A 1MEC1 3KF5A 4AQ2A 2YX4A 2X8KA 1LEAA 2CMPA 4RB3C 3HBKA 5FZGA 2BRTA 2DA1A 4P5HA 1PGW2 2ZMLA 3L2WA 4NWWA 3GO5A 1AYN1 4MGIE 3VPRA 1RIOH 5KC5A 1POV3 2EICA 4DOUA 1VQLI 1G4DA 4FOQA 3T1LA 4KWJA 4EWEA 5JIUA 3H9AA 1LOEA 3AKZA 1BIBA 5FQ0B 4LE4A 2ZMEB 1VZ0A 4JAAA 4X6RB 1CX1A 2HWD3 2DDAA 1GQGA 3PO2J 1IAWA 3IAM2 2DW4A 1ALYA 2HYFA 4D7YA 3L2YA 5C5UA 4KQ7A 2HWC2 2Z5UA 1NH3A 2UU8A 4OFGA 3TNQA 1O3TA 3RZKA 4J1WA 3GTPJ 2WS91 4AQSA 5FMDA 2J1TA 4V1PA 5FQ0A 3BP8A 1QRYA 3JAMK 2ZMEA 2WAEA 2B5HA 4OUEA 1W0TA 5E88A 2HWF2 2K9LA 1F9NA 1DZQA 4XZUG 2MD5A 2CQQA 5FRNA 5D8AC 1PUEE 3N4MA 3RI8A 3Q0UA 1REFA 4HG6B 4ASMB 1UFMA 2V4VA 2RNJA 5AFEA 1QBJA 4HSRA 3WHTA 1RUD3 5FZEA 1LDJA 3WDWA 3J8F3 1QZYA 1TW3A 3GEZA 2DTZA 3O1SA 1VNDA 1G3TA 2GC1A 4DZJA 3ZSJA 1HKTA 5EV7A 2Y2ZA 4AQ6A 5GM0A 2PMWB 5J3UA 2CSGA 3GWZA 4Z07A 1WI3A 2AYHA 3JXSA 3LB9A 2LRPA 4M4PA 3WTTC 1R4NB 1R1A2 1FTTA 1BKZA 4CH7A 3IUOA 1ENSA 3I4IA 3E6DA 2JMWA 1WWYA 2Y0IA 4R9BA 2XG3A 1MS8A 3URFA 3W58A 3CDZB 2OC6A 5KAIC 2AC1A 2RDSA 2ZABA 4L9TA 1OC1A 1H30A 3HKZA 1POGA 2HKOA 4PF1A 5FZ0A 2OUMA 5FYVA 5CQEA 4YIRX 3ZSMA 1OR7C 3ZQFA 4WBBA 4OVEA 5J47A 1AWCA 4YVWB 4XIKA 5T52A 2WR9A 5B5EC 5FBJA 4W1UA 3NRVA 1XX5A 2E1MC 1FV3A 2YB7A 4S2GA 2VMGA 2R1DA 4Z92B 3LSMA 4AHZA 2R7TA 1PZ7A 2RN7A 1U8RA 1UIJA 1JH5A 3MF9A 4ESJA 4P02B 3HN1A 2C24A 1NK3P 3POJA 4YVWA 5D5UB 1UOJA 3DGTA 1J58A 2C5DA 5J3LA 3S1MJ 1QU0A 1W2NA 1XNCA 1TWHJ 2P3KA 5T3NA 3I3MA 1AVBA 4UXNA 3WZ1A 4E2QA 3EYYA 2VUDA 2HWF3 4BK4A 3KCYA 2XH6A 2QSFX 4KU8A 2EXHA 4FPCA 2P17A 1HW1A 3POGA 3R61A 3FBNB 2F4PA 4J19A 5DXDA 4Q4V1 1QNYA 2R042 1K4SA 4QPWA 2PI0A 1T6GC 2YY1A 3I71A 2QDNA 3QD6A 4AUXA 2YSRA 1TQMA 1FWZA 3I2OA 2G19A 4BE2A 4AIJA 1S0IA 1LOFA 4I30A 3OMYA 2O6GE 4YZ1A 1H6XA 1YQ6A 4LO6B 1H8TB 2FQPA 3BJOA 2ZXJA 4P9UA 1R1ZA 2W9XA 1WJEA 4FTBA 3SEQA 1JYXA 4R4ZA 4CZSA 4EJRA 3MKWB 1C3HA 2DCKA 2W1SA 1DCSA 1FLIA 3WNNA 1JU4A 5BXXA 3V7CA 5IOYA 2YPRA 3NMBA 3ZKUA 2MNGA 5F5AA 4B09A 1MJBA 4MFDA 2B7YA 4OIRF 2P3YA 2VB6A 1U5ZA 2ZKNA 3KLNA 3PUFA 2HWD1 4UBGA 2DYSH 3VZLA 1H8TA 3DP7A 2DF7A 1K5MC 2VOTA 4RGXA 1HXDA 3VBSB 4B47A 5DCMB 2LR8A 2Z42A 4OMYA 3REOA 3PTYA 3IRQA 1AJOA 2AUYA 3ATGA 3HPGA 3I49A 4LUKA 1AX2A 2WAAA 4K2EA 2L7KA 4N53C 4UW6A 3QU3A 4XDQA 1XSQA 4OUSA 2Y6HA 2JXAA 1RUH2 3VBSA 4LO5B 5DCMA 3MZ8A 3V7RA 3VYRB 2B9VA 2WNEA 1PP8F 5CJ9A 2CHHA 1F5TA 4MGRA 2WJSA 1XSXA 1DBNA 1IS3A 3WHUA 1RUD1 2P6CA 4AIKA 3QCWA 2BV4A 2R7RA 2HEWF 1ETXA 5LA2A 1UELB 3BTLA 1QXPA 3OF1A 5DS9A 4ITVA 2R043 4IE5A 1HXS2 5E16A 4PJLA 1EP0A 3MIHA 3OBAA 1TWCJ 1DP7P 4GO1A 4QPOA 3H3ZA 3NAPB 4Y5SA 4LITA 1R5ID 4RR3C 2VVFA 2Q1FA 2OA4A 4ZU4A 1AA7A 3ZQCA 5J96B 4M9SA 4OAYA 1HN0A 3PJQA 4DUXA 5DDJ1 4IQJA 5FP7A 4XTMA 1XGOA 3I2GA 4A6OA 4WZFA 1WJDA 2Z99A 1XE7A 3NAPA 3BGAA 4LXLA 3K3NA 4CDXB 5A2QZ 1XRUA 4D7SA 3F0CA 5FPLA 2VZUA 1JOJA 3V65A 2XSJC 1VQOI 1TME2 4PIZA 5SV5A 1NCRC 3OYAA 3I97A 3DLAA 5HS9A 2FQ3A 5FZLA 5DUUA 2VMIA 2XWJB 2R073 3AP5A 1X82A 5KC6A 1IZ1A 1HJFA 2TDXA 2DI3A 2VBZA 3OS1A 1RVF2 4LBKA 2ZGSA 2ATFA 4QDRA 4XL9A 3RSNA 2D43A 4CDXA 4UVBA 3AMMA 4UWDA 5LFAA 1O4TA 4D5FA 4NC7A 4QGLA 2WZR3 1R58A 1K6OA 3FXUA 1LJ7A 3HRTA 1LHNA 5IUQA 5KNLA 2EIKH 4PFPA 2XJTA 2NOJB 1BK1A 1J09A 5L3EA 2WO3A 2VBXA 1YFUA 3D5RC 4BMBA 4CP9B 2L9RA 4XR6A 1ZRRA 3HOSA 4D7MA 2E26A 4AM3A 1KQ9A 5FO8B 3IH4A 1G2HA 2V72A 3DXTA 2GP5A 1HXS3 3H8RA 4L9NA 1FBUA 1EKEA 3RG0A 5D6FA 4UI9L 2X05A 1BC7C 4AK3A 4CP9A 1BOAA 4AYUA 5EYXA 1Y6IA 4ZZDA 2KIFA 1LOGA 1YX3A 1QNTA 4NPMA 3KX2A 2KRFA 2VONA 1WW4A 2CL2A 1IS5A 4CCLA 3HOYJ 4KI5M 1BQPA 3J26N 3JSOA 5DG2A 1SFEA 1RC6A 3MVPA 5DAWA 3LA3A 2HOEA 1JZ8A 2R5ZB 1PUFB 2BFUS 1SFUA 4CDUB 1S72I 1ETKA 3K4LA 1JI6A 3AC0A 2R1BA 5CVUA 3MV01 4K1YA 2ISZA 2DMTA 4HV5A 3SYTA 4MZUA 1ULGA 3MW4A 3VUOA 3CMAI 1ZAOA 2VZVA 3IIAA 4JHTA 3HWJA 1IN6A 1TME3 1FT9A 1AXYA 5C4WB 2CFOA 2VXRA 4HQEA 4I6ZA 1UIKA 2LSOA 1AYM3 1C5HA 1BYHA 3WNKA 3KMHA 4YM2A 3D0SA 2E2HJ 5GZDA 1MNMC 4QPIB 3AFGA 1K3IA 1RVF3 2R5ZA 1PUFA 4CDUA 3BR5A 4LEJA 1EAH2 3IDCB 4CGZA 4Q4Y3 1YI2I 1T8IA 4KUMA 2RQQA 4I98B 3Q3SA 4BJ5C 1FMD2 5C4WA 3AKTA 2QQVA 3MYXA 4JQRA 3OYFA 4G7HF 3CDHA 1UJ8A 4BHPA 4QPIA 2JUCA 3H9JA 1W0UA 3ZPLA 1A78A 5F0CA 2WA4A 2LREA 5K0UB 4NIHA 3IMMA 2IZWA 3I3DA 5HDGA 1NY71 1K4TA 5LB6A 1BBT2 3IV5A 2AR6A 4J1XA 5HBAA 1TNSA 4IEWA 1YQAA 3M1CA 1DU6A 3BROA 1C5IA 1OURA 3HRUA 1X1BA 2VXZA 5EZGA 2OD5A 2CV1A 4ZXKA 5DZFA 1YW9A 4WWCA 4OI2A 4UFLA 5FD5A 3WR0A 1ND2B 2ZNZA 1SCSA 2BHYA 1CAVB 1S8NA 4BACA 1PVC3 4MHUA 5K0UA 3K75B 3C2GA 3D82A 4JQTA 3DBLB 4XACA 1V9U2 2PHWA 2PAMA 1W5CC 3DFGA 1OI6A 1WH7A 2ID4A 3OUJA 2IA2A 3W6JB 4CE8A 3ELKA 1KJRA 3WE2A 4E7HA 3RZDJ 1JUHA 4CCNA 3H8OA 3Q0WA 5FYSA 2IXLA 1QO0D 1ND2A 4YWAA 5DAPA 1SCRA 1CAVA 1D5YA 1CZVA 2CY6A 2R071 2FNAA 1PIV2 2D6PA 3RQ4A 4A0ZA 1VBD2 2W48A 5BYNA 3M8EA 3PUIA 2FBEA 2QJVA 4M3DA 1D2SA 2HQNA 2JDHA 2D6LX 5J48A 4RB1A 2HXIA 4BISA 4L5EA 2YC0A 1B35C 3VD7A 2WZR1 1GOFA 4Q0QA 2VVEA 2V6CA 4Z1VA 3FMQA 4XORA 1RESA 3JSPA 3R05A 4P5YA 3LPGA 1X3ZB 3VDAA 4NPRA 2MD0A 3GTOJ 3JRHA 2GXBA 5KBFA 1AHDP 1YQ5A 2XOMA 5A6ZA 3BKZA 3H0DA 1FMD3 4F7ZA 5M5YJ 3TRSB 1NG0A 2X29A 3VDXA 2VE8A 4Y52J 2LYCA 1OQ1A 1V3FA 2WNOA 4QHBA 1OISA 1MNDA 4AHYA 3AL6A 3MDPA 3W5MA 3C2HA 3C7OA 3IAPA 3WX5A 4AEJA 2X53S 1UYXA 3H5AA 2BP6A 3OPZA 3PNTA 1ZG1A 4XLHA 3R4UA 2O1QA 1K42A 5TSWA 5AC91 3E3VA 3PURA 3CESA 1W05A 3L2HA 4JGZC 1R5GA 2RS31 1XTAA 3P6BA 4ESFA 3SH3A 2ZFWA 2JUGA 1YLFA 3ZFGB 2A6XA 4JX0A 4R52A 3O1TA 4XLAA 5T55A 4RL7A 1EA3A 3D1NI 5HI0A 4CRQA 5DG1A 1OA3A 1ASJ2 3OUIA 4HXCA 3BR1A 1TME1 5L3BA 1O7LA 5L3GA 3ZXJA 2FDGA 3ESWB 4K21A 2X09A 1AYM1 5IVBA 2P2KA 3VDDC 3J80K 2XB5A 2W0XA 3ZFGA 1VBD3 4PZJA 4IUGA 4XRMA 5L9VA 5A6YA 5TISC 2Y69H 2QZ8A 1IC8A 1EH7A 2G7UA 3CCMI 3RI9A 4CA9A 5T5LA 3DPRC 4AFDA 5FAXA 2YYOA 4HK8A 4Q4Y1 5FRMA 1X3UA 2CV0A 5FY4A 3ME2A 2NM1A 1SAXA 2VZOA 1UG0A 2D2WA 4IV3C 1DGLA 1JYIA 4E2SA 3P3PA 2PMZN 3J7YJ 3DEUA 3VD3A 5E3LA 1W8UA 3LWCA 3K46A 3L09A 1EPZA 2VOKA 2WT0A 4AI1A 4XFFA 2ZX3A 1PGSA 5LY2A 1D8KA 4KNCA 4XUNA 4CCJA 2HOSA 4LBJA 2E5ZA 2VZ1A 3QWLA 3U4XA 3ZO0B 2PYTA 3PNAA 4IE4A 1QZEA 3UK9A 1ZN2A 1MMNA 3D4KA 3TGNA 4XK4A 3GCMA 9ANTA 3ABMH 1Z6TA 4O9EA 2R4GA 3Q9OA 1NXD1 2VAUA 2BTVC 2ELJA 2C6SA 4P9XA 4C91A 3DN7A 2ZGPA 2WZ8A 5H9SA 1PVC1 2L4AA 4L9VA 5CVJA 4LO7A 2XDVA 1FOKA 1AXZA 3ZQIA 1HB2A 3RI4A 3H1YA 2GMEA 1XMKA 3LEKA 4HONA 4ISRA 4QX8A 3JBG2 3DLLF 3J81K 2F4LA 2R93J 4XE9A 1R083 1KU9A 2YUSA 3BU7A 4CCMA 4GWNA 2J1RA 4XJWA 5FDBA 3AZWA 2AXLA 3S7EA 1GVDA 3OIOA 1WBFA 5DMYA 3HBLA 1J75A 1TWGJ 1IOAA 2IC1A 4YM3A 1BI3A 3H3VK 1BMV2 1ASJ3 4OHZA 3EQEA 5F5CA 5F6LB 1Z7S2 4BBRJ 3UKTA 3V8LA 1GYKA 4A44A 2OQRA 4BQXA 2ID6A 3OYWB 1H9WA 3GXOA 3RYPA 3ON7A 5LBCA 2D3PA 1VRH2 4NVPA 1WRJA 3D8CA 2H0BA 3GM8A 4BY1J 1GWMA 3C1DA 1TNFA 3P9CA 1YJKA 1JHJA 3BTCA 5I0SA 5BMZA 3FWEA 3LOIA 4A3JJ 4E4HA 3ZQLA 2R7ZJ 5CA6A 2KR2A 4I3GA 1FMD1 3F8BA 3O0WA 1MIJA 2L9VA 4EE2A 1OCPA 3OYWA 3WNOA 4EYUA 1VQ6I 3WCRA 3GHNA 1S55A 2WLPA 1BHGA 2A3YA 2HH9A 2FNPA 2M34A 1BEV3 3POSA 1XSRA 1EYBA 4WM8C 2YROA 2ORXA 3MLLA 2ZB9A 3LSEA 5F7UA 4MH0E 3M3QA 5K7FA 2DMQA 1VB2A 3ACLA 3JREA 1Z0HA 1JS9A 3ZRGA 4BXSV 1RETA 4CDGA 4RS5B 2VT3A 1M4WA 5IYCJ 1H2KA 4P55A 4YFXF 2AEYA 1UKGA 1XNBA 3PDQA 1R36A 4EN7B 2UWMA 4BIOA 4IEUA 3L2RA 4EJVA 2RS53 4NIAA 2X1EA 1F5JA 1HRI3 4GJZA 3C8XA 5GLVA 2MLKA 2WLQA 4UW4A 2RJLA 5CISA 5F6KA 2DQLA 1TT0A 4RGRA 3MO4A 1ST8A 3PU8A 1RL3A 4LB5A 1U2WA 4RS5A 5LATA 1GQPA 3UJQA 3TB0A 4R8HA 3FUQA 4IRHA 2H0VA 2NPIA 2AXTC 3N3HA 4Y26A 5A7OA 5LRSA 3GYHX 4XJAA 3W5NA 2CUEA 4PBPA 3G3ZA 4ENJA 3QPHA 3BUCA 4RAGA 3PUBA 3J7MA 3S1NJ 3W20A 2XRNA 2JVGA 3N9OA 3VL9A 2OPWA 2PN5A 3M70A 5EEAA 3SITA 1YJNI 4XDOA 4FXKB 1BR2A 3ZLIA 4AEMA 3EUAA 1G3YA 4XZPA 4U0YA 1PM7A 4Y1ZA 3POBA 3Q8FA 4FPGA 3I56I 5DUWA 4ITCA 1GICA 1W90A 5LGUA 5FKNA 2JKBA 2ZZJA 2CQNA 3HOTA 4CCCA 3K3OA 3AKRA 3S93A 2ZXIA 3KS7A 2R0FA 3QQAA 2XKPA 4ZU7A 3VHRA 3TEZA 4P9GA 3RS6A 1UL9A 2EK5A 5DUKA 4OQ8A 1A6QA 3AFHA 5ICCA 3QU6A 3ZXGA 3LSHA 4XEZA 3VBFC 4IKFA 2MA3A 5C4JJ 3USSA 5A3TA 2FOKA 2W68A 3BG6A 5FZKA 1E3OC 3HTSB 4XFGA 1RINA 1V5EA 4TTGA 3MBWA 3J9SA 1PZ9A 2W08A 4NIDA 5FZOB 1OA2A 4B4QA 5CNAA 2VKVA 1ULCA 3KP6A 2W46A 3I54A 4D0PA 3DPLC 2FXAA 1DZTA 1N75A 4AWXB 4G7ZF 1R081 4HZFA 4OI4A 3ZFFC 4L5IA 1RMU3 1MQTC 5FO5A 5GLUA 4NHXA 2XQXA 4GWIA 1LECA 1JU3A 3ZR6A 5CKTA 4BAYA 1T98A 3VD4A 5T50A 2RE9A 2BDRA 3PMEA 5FZOA 4I7HA 2J1VA 2VU9A 3IDEA 2OUJA 5K1YA 2LG4A 2A6VA 2IXHA 3LSRA 2LY1A 1VRBA 4A93J 2F5CA 1NK2P 2XGEA 3S14J 5F3CA 1JT0A 1Y8QB 4S2HA 5CVRA 3T2QA 2VXDA 1QJU1 5C33A 5A3NA 2Y60A 3LOBA 2Z16A 1ZZ7A 2GWRA 2QWWA 2UXXA 2E51A 4C1WA 1KDKA 1NUKA 3PUHA 5EHDA 4FOWA 2DDUA 5J1RA 4I99C 3ZMNA 3ZMDA 2CUFA 4XFAA 4DUWA 2VM9A 3WGHA 1BEV1 3FX3A 1SLTA 5ISLA 2K9NA 2DMPA 1MW7A 3ELNA 4AFCA 1PYVA 4LKSA 1IS4A 4OHVA 4WVVA 2L01A 2VQCA 3L2QA 5H6QA 3IKTA 3LSPA 3K10A 3CJIC 4MGZE 4AW7A 4EM0B 3H5RA 2GAUA 4BQNA 1FTZA 3D5LA 2RVCA 4H0EA 3VZMA 4AFAA 2CO5A 3HOUJ 2P5VA 4GMP3 4XF9A 4IDZA 5BNNC 2Z4FA 3CMGA 3PIPF 4DBQA 2VBDA 2RS51 2WDBA 4LBMA 1HRI1 4G94A 3VGIA 3ZXEA 3JRCA 2K02A 1XB4A 3HRMA 1O5UA 2ZS6B 5ERLA 2RV8A 5J1XA 2LK2A 5DZGA 2M4KA 2WKKA 2EZIA 4B48A 5J7MA 1W2TA 3BVCA 2VODA 1CX4A 4EN6B 2ADUA 1CJDA 5E1RA 2HWVA 3GW2A 2Y0SN 2ZMEC 3JRDA 4A3EJ 5D5VB 2EFOA 3H0GJ 5C8CB 4A3MJ 2QVOA 1T56A 1QJEA 1C57A 3POEA 1K61A 4IRIA 4XVHA 2VZQA 1YJ9I 4M6YA 1VBE2 1F31A 2R061 4CU6A 1SFOJ 4MXWB 3PNVA 2EXIA 4BUPA 1Y3TA 5D5XB 2N7GA 1FZPB 5L9RA 1YHFA 4UYBA 1O4ZA 1IG0A 2AQFA 1D2QA 2L4MA 4HNTA 5KHIA 5C8CA 5AVAA 5FPZA 1B9MA 2XLAA 4YEJA 4URTA 2B45X 3WT3A 3BZKA 3ACGA 4G3YC 4O65A 2K9ZA 3TN93 2L7MP 3W9AA 3OYNA 1GV5A 5H20A 3VBRC 3S3NA 2EFNA 5M3MJ 1R5HA 4MXWA 2Z5WA 4Y1XA 1IKQA 3PMSA 1SLCA 3FK7A 1TC3C 2HQRA 2CWSA 1TL8A 1DUXC 3CDLA 3CCUI 4UUVA 2D5FA 2BXYA 3BCWA 1GP4A 3NJXA 2NLRA 2QKLB 4HLXA 2A68F 2LH9A 1OPCA 5FZ1A 2FZ2A 1XC5A 3T5XA 2YU3A 2XLGA 1RB8G 1AR62 2O8QA 4WVZA 1VTNC 1VQ4I 4MGQA 2D1VA 1KJLA 1QKQA 3O1UA 4R9AA 1RMU1 5LEJA 2I74A 4A3BJ 4I09A 2A05A 2O7OA 3GMEA 1OUSA 3CO7C 3R4KA 4L5JA 3HPHA 3KF3A 4LGWA 2GOMA 2G9ZA 2RR12 3APBA 2WC2A 2QBXA 1UY4A 1S0EA 2WO1A 5HNHA 1O5LA 5L73A 4Y15A 3I59B 1ZBE1 3T8TA 3H8UA 3JD71 1ON2A 2ELKA 4QX7A 1O3RA 1QJZA 1G86A 1MS3A 1LU1A 1WJFA 1ZZBA 4YSFA 4QT6A 2IGKA 4A3CJ 5FCCA 2Y48A 2DN0A 1YXWA 4QWNA 1IRFA 4PJYA 1SPPB 2ZEWA 1HLCA 3M9AA 1ZGJA 1TQ5A 4W65A 3GBGA 2NYXA 3I59A 4K7JA 2WWJA 4B3NA 1LDKB 2OS2A 3PJYA 2NOGA 1N1VA 5J09A 3WDXA 3AMHA 2KP6A 1N1YA 1GV2A 4ZHNA 2ZMNA 3D6EA 2JSCA 4KGQA 2B63J 2LUWA 3ZSLA 2D45A 1SPPA 4NC8A 2DODA 3QPTA 4GCVA 2OZUA 5GAEJ 3VZKA 1T95A 2QQUA 4P9JA 1W7PB 1UPIA 2OZJA 1J1LA 3G6JB 2KD7A 4JKLA 3ETPA 2GN3A 4A3ZA 4FT8A 4M0NA 2BXZA 2XUEA 4MHRA 1FNYA 4GZ9A 4IQPA 4OIPF 4GMP0 4GMP1 4AVAA 5M3FJ 1H1IA 1JODA 3K9TA 5D8AB 1AU7A 3PVBB 2QGUA 1WW5A 4FQGA 3B02A 2Q0OA 3OTFA 4XQDA 3AP6A 3Q0VA 4G9SB 1W7PA 1HOMA 3FIWA 1P4WA 3T1MA 2NNNA 1O4XA 4AD9A 4N4NB 4P5OA 2JWTA 2CDOA 4M9ZA 3V7SA 3SCGA 3ES4A 4MSVA 4N9IA 3GLXA 2DK5A 4FOVA 3NV1A 1APNA 4BE0A 4I0AA 3WTYC 2QVSB 2RR13 5D8AA 4YM0A 4MTDA 5F6FA 2IWGB 3CKHA 2XIGA 1FAYA 1LVKA 2RS13 1JTXA 1LHOA 2YV8A 1QVUA 2BGCA 1W9WA 4DY5A 4CP0A 4Q26A 5FY1A 5ACA2 3FMSA 1YQ2A 2P6SA 4JTOA 3RWKX 4XQFA 4GWMA 5FD6A 3AYDA 4JV4A 1FYKA 3HBZA 1PX4A 1MZEA 1ZKGA 4YW6A 1HQLA 1E0EA 2LROA 2JDMA 2L7ZA 1Y4WA 1YJWI 3WGIA 3VLBB 3TN91 4B8EA 1OYWA 1S9HA 3RPUA 2FQ4A 1XDUA 1BC8C 3WNPA 2E1MB 5JSRA 3DL3A 5I0RA 5FP8A 3RTRA 2FUG2 3AM2A 1AR83 4RHV2 1Z7UA 3T0BA 1QVTA 1XSVA 4PGHA 4JTNA 3U37A 4AVBA 2EFWA 1WJCA 4CTEA 1OR7A 3QACA 2HQAA 2P37A 2PFBA 3AMPA 3NJZA 3RZZA 2OA2A 1UB9A 3CF2A 3P5JA 3OG2A 4KDPA 1SBDA 1SFKA 3CQZJ 3GTMJ 4BMEA 4QSHA 2D97A 1WKYA 4GDFA 1SVMA 3BCAA 2OIIA 5FJKA 3BTJA 4YGEA 1IG3A 4X6AJ 2KRHA 4PI2A 2IBDA 2GLOA 2GMPA 2ZTNA 3S16J 5I0TA 3S5QA 3VHOA 1D1BA 1L3JA 2DJIA 2X6YA 3PNYA 3IDBB 1UZYA 2JDAA 4HX8A 2P6TA 4F91B 4EN9B 1WMEA 3MW2A 1BI2A 3ZGKA 1L7RA 2O14A 1FJLA 1VI0A 2ZEYA 1TLHB 3VL8A 4KWUA 4MUVA 2HPIA 3AP7A 2GNTA 2DJNA 5JMCA 2JKXA 2FF4A 2ZX2A 1GBGA 2VECA 4X6QB 1OFNA 4XQ4A 5FPUA 1SD7A 1QJY2 3T0DA 4B7KA 4C30A 4UFMA 1ZRIA 1N47A 2F4MB 2GMMA 1I3AA 1OT5A 4IXLA 3H9GA 5C8WA 3FISA 3IC7A 1LUJB 2DA3A 2WV1A 2DOFA 1DQUA 2MLGA 4L97A 4TZDA 1WFXA 1UU6A 1OFSA 5H2FC 2MH9A 4HOBA 4O61A 3W59A 4OULA 3OD4A 2ECBA 2OQGA 5FZBA 3FXQA 4HA8A 4OIOF 2Q0AA 4PK4A 4IO9F 2W24A 4RGKA 3ZOIA 4Q47A 3PM1A 2ISYA 1O3SA 3J7NA 2BZTA 2HGCA 5E6HA 1KONA 1FPN2 2QBYB 1K12A 3HOWJ 4RHV3 2UZKA 4MG2A 1X9TA 4A5NA 2WSVA 2XVKA 4N53B 1UNBA 2TEPA 2R7SA 3MIGA 2MABA 1U0AA 2COMA 4JX5A 1LGCA 2VL4A 1S2KA 2CQ7A 1YHQI 2AENA 1YFHA 2VI6A 2J5PA 2XVCA 3FMGA 3OIPA 1OCTC 1OQEA 2QBYA 1MZFA 4PUSA 1C28A 1NZCA 3JTHA 4MQVA 3LMMA 1RUI2 5IT9Z 4N53A 1JZ3A 3I3EA 3CEWA 5A3PA 5HCFA 1RZ4A 2PHXA 3FC0A 2W00A 1HF0A 4H4KC 1GXPA 2RS11 1MBKA 2WT1A 3ZVXA 2WSUA 2VZSA 2XPWA 4RR3B 2VW0A 4HETA 1W2AX 2VE1A 4JRLA 1H89C 5IAVA 3EMRA 1OLTA 2JSPA 3OYBA 2XMLA 1X8MA 3ENRA 2BOLA 4AC0A 5LHIA 3M3CA 1JZ6A 3CBNA 3ZIXA 4MXVA 5ICFA 2WB1N 2GNDA 4FQ4A 4XIDA 2ZAHA 2KMUA 1D5VA 1VQMI 2R49A 3KT7A 3ORJA 1WCDJ 2BHZA 3S15J 3UKGA 2EV5A 4AI8A 4RR3A 2BY3A 1E5SA 1Q8QA 1T6SA 5FKMA 3KFWX 2XXZA 4IXAA 2ZO4A 1HA8A 4XURA 1S6LA 1AR81 2G9FA 1UMHA 2Q8OA 1WLWA 3N7LA 2FCUA 2JK3A 1DQ4A 1NCRB 5F8PA 2NXNB 4RGSA 2JE8A 2FJ1A 1X36A 3O1RA 2DCYA 2D1HA 2WAQN 1H1AA 2F48A 5F64A 1FPN3 1VP6A 4OIQF 1JBCA 4D7TA 4YG0A 3BG3A 1W2UA 2VZ3A 3O6BB 1I1GA 4ZYEA 1SLLA 4HT1T 4QKDA 1C8M2 1L3LA 1W8ZA 4Z6YA 1ERDA 3Q8BA 1YFXA 1NCRA 3DTEA 2R7XA 3AYCA 3FZ3A 4PIXA 4YZ3A 3Q8AA 1LHVA 2WBKA 5LGNA 3EQLF 3RYKA 4DYCA 2L9SA 3S6PA 1UY1A 3QYEA 2V5DA 5JFRA 5A3UA 2IPQX 4B4CA 1RUI3 4ZONA 1RXGA 2K40A 2WWYA 1OCZH 3HSRA 2XLFA 5JXJA 3S57A 3N9NA 4M0HA 1TMF1 4DGWB 3WDTA 4WXCA 2VBWA 1J3PA 3OGVA 2LY9A 4NBQA 2STWA 5GLWA 2DFFA 1JHHA 5JI9A 1A5JA 2CU7A 1LJ9A 5F3EA 5C3PA 3J7ZI 3F8NA 2EXJA 3MFAA 2PX9A 4LBLA 1YEWA 2KJCA 1R7JA 2VT2A 3NWKA 3OEAA 4LBQD 1JUSA 3GJAA 1PO23 3HC7A 4UW3A 1HB3A 4EV0A 4EWAA 1XDSA 2Q8DA 2AEZA 1YS6A 3K4JA 4RS8A 3UR3C 2AZ5A 2MBFA 1H88C 4AGRA 1RR8C 3LDBA 4BU2A 3A7QA 2W52A 2OF7A 5HLTA 3ZR8X 3IWFA 3AYAA 2OJED 2ZKZA 1VALA 1R49A 3CCLI 2AH2A 1N3PA 5IVEA 3K0LA 1X19A 2M45A 5KXCA 3HL2A 4ESBA 1GR3A 4HF0A 4ANJA 5F1JA 2HVSA 4IERA 2LS6A 3ZXSA 1S0FA 1AR92 5BOXA 1UO9A 2X5IB 4HBNA 1WVRA 3MFKA 2ZGLA 4ZZLA 4GALA 4Q0PA 4JDOA 3VZOA 2QUFA 4HBLA 2LY2A 3L9FA 1GNYA 1XBFA 2WFF2 1QEXA 3KCCA 5A3MA 4RSUA 1MSEC 1NE6A 3OGSA 2IVIB 4B3XA 5EG0B 3HOZJ 1W2OA 4Q4ZF 2X5IA 2EQRA 1RUE3 1NOVA 2HOAA 1HSJA 2ET1A 2ET7A 2VQLA 2KRCA 2QQLA 3H5NA 4GA9A 2F5FA 3Q9SA 3NQHA 2V09A 2XHKA 5F2SA 3IWZA 2M87A 5C3QA 2DPUA 2GIVA 1AKHB 3O1MA 4EATA 2DQRA 4ENNA 1JTYA 1EUUA 5EG0A 1FX7A 1YFYA 2ZSHB 4ASLA 3KV6A 4J25A 4YPJA 4PFOA 1HDPA 4XBLA 1FIPA 1H1MA 1NZIA 3GFJA 3HYIA 3LSGA 5FZMA 2VMFA 1PJRA 3K51A 2EILH 1W6QB 5EYRA 3KQ4B 5GP9A 1JYTA 3A23A 3SFZA 4JKKA 2DA7A 1V5GA 1FBQA 3AXEA 4C3IJ 1ZBA2 1AKHA 3HB9A 1XU1A 4QQPA 1W8TA 5D2AA 1JZ5A 1STMA 1H4HA 1J1TA 1W9YA 1S1AA 3IIIA 2Q2EB 4UBHA 4OLLA 3G71I 2VY0A 1HCRA 1B35B 1W6QA 3GDBA 4JX6A 4M6XA 1D0ZA 5CFDC 3OS0A 4S0HB 1ZX5A 2KQRA 2VMHA 4B29A 2YS9A 3ZOBA 4QQHA 1OVSA 3QPLA 3A01B 1VMHA 4LBNA 1JUPA 2ZXQA 1PZ8A 5F37A 3EJKA 3WW1A 2Q2EA 3R0RA 1B35A 4ETSA 2GSYA 2LNBA 1D4M1 4KYWA 3FFZA 1COV1 4A7YA 1J84A 4BWOA 1ETYA 3ROUA 1PGL1 2IRFG 2HWE3 4IEJA 1OPMA 4A45A 2DU0A 1IZ3A 2FRHA 3A01A 4M01A 3N05A 1YIOA 3HOVJ 4AF9A 3I3BA 5CG9A 4FISA 2XQRA 5DZEA 1OH4A 3LCPA 3P1IA 3ZMTA 2OQ7A 3VBHC 3OYKA 2WZPP 1H9GA 2VKHA 4YW1A 3RMYA 3HXLA 1X8EA 3B6CA 5GKAC 3DF8A 2XBO1 3CCRI 1VBB1 4JGYC 4JGZB 3I5UA 2UWBA 2AHQA 3F95A 1MR5A 3WF4A 1OLME 3LPFA 2P1BA 4H3WA 4XPVA 4HDUA 3RKQA 3QP6A 2Q1MA 5JVVA 2PN6A 5DTDA 1PO21 1RUG3 4F8AA 4EMSA 4ON0A 2NQYA 1Q1VA 4TLGA 1UW8A 1LENA 3LIHA 3CNAA 2H6BA 4MO7A 2WN3A 4AXOA 3BR6A 4UFHA 2R92J 1JYVA 4JGZA 2VOPA 2PBIA 2VXJA 1T0FC 1YG2A 3VDDB 1LFPA 3MIDA 3OSFA 2X85A 4QGMA 3F2ZA 2WWSA 3MEXA 4OOIA 2VCAA 5CKMA 5KCMA 5FOBB 3DPRB 3ZDVA 5I0DA 2IAIA 5FFZA 1SMTA 2ZEZA 3J7HA 2ZOEB 4XUOA 1FYLA 3T08A 4MVTA 3AAFA 3U1DA 3UGGA 2K27A 3RSJA 4B1LA 1U5TC 4CUAA 3OCPA 4B8XA 4RS5C 3AYEA 1LOAA 3VDDA 1RUOA 1DDNA 5JIAA 3TQNA 3EUKL 1X1AA 3WXPA 2VQAA 3TOAA 3DPRA 1JKRC 4F92B 4WXHA 5DUXA 4JBAA 3CF6E 3E5UA 5AIQA 1RUF2 4YG2F 4IRGA 5GPAA 1H9PA 1VMJA 1RUE1 3T0AA 2X0LA 5L9BA 5KHJA 5K7PA 2DA4A 2X1CA 2Y34A 4XSZF 2UWCA 4IE0A 1RNLA 3S3MA 4QQLA 1YITI 4YZ2A 4PQQA 3E0JB 2GN7A 2XONA 2RDQA 2E36A 1X1DA 4YG6A 3MGUA 3MZHA 4M3CB 3DEMA 4J01A 1MJ9A 3WCSA 1WD3A 5IK8A 1ZZ9A 2HDDA 5B3SH 4A3XA 3L2VA 4HV6A 4W6YA 4LHLA 1QPIA 4D6QA 1J7KA 4JHZA 4QB6A 5JAXA 2BZDA 1QGPA 4M3CA 1WCSA 2YDEA 2CQKA 2VBBA 3M3IA 3S30A 2OT7A 4E7IA 3GNEA 2FDFA 2W25A 3FLTA 2A70A 2QQWA 1VBA2 1W99A 2BOIA 5JWPA 4FFFA 3TBDA 4HANA 2EIGA 2NRAC 2ZKLA 3QAHA 1EV12 3LF7A 3JCUC 5A1FA 5F32A 4JC1A 1QJX2 1T38A 3T3YA 4QDQA 3ILFA 2V1DA 3EBRA 2V1XA 5FIXA 1FOD2 2AO9A 4HNUA 4L0ZB 1BCXA 2R7WA 1ULEA 5E8GA 1U5IA 4GYIA 4MEXF 1OCOH 1X7NA 5LRRA 4NQWB 4RMNA 2VBYA 2VPLA 4R9CA 3G1OA 4A6DA 2R0HA 1I3HA 1D0HA 1E5RA 3LDKA 3U2RA 4ARXA 1R1TA 2HWE1 3I3QA 4FPLA 5FP9A 2M7BA 3RJRA 1YIPA 4GQ7A 1RUF3 1US2A 1PDNC 3RZHA 3O5SA 2G9GA 2KFDA 1EJ9A 2A6ZA 1NKGA 1TP4A 3OPTA 4IGQA 1WCMJ 1G3WA 2E2IJ 3ABZA 4NQWA 1CIYA 3DECA 4QIWN 4HSLA 2DO7A 3HNBM 3JB8A 4LO4B 4LB6B 1YLLA 4OHYA 2VH9A 3PL0A 2ZXHA 3DQVC 1XYNA 2CS3A 3S7IA 2X4HA 3PL8A 3TWIA 1RPWA 1A35A 1US3A 5C7GA 1RUG1 1A8MA 3DYPA 1WH5A 4DIQA 4KG8A 1WJAA 1U6GA 3NKTA 4F93B 2YGLA 4XFHA 1XN7A 3TO6A 3SDGA 3CJRB 3I4NJ 1GWLA 2V4AA 4WZCA 1ZM1A 3A0KA 4LA3A 4COUA 4PCQA 5FY5A 1SLIA 3NV2A 2ZZQA 1PVEA 3GALA 1V6JA 4IOAF 3Q5FA 5A6QA 1I3QJ 4GB33 2LDUA 1UX6A 1VBA3 4P96A 1GOGA 3WODF 1EV13 1QJX3 5JOWA 4AWDA 5TRDA 1RUC2 5HDNA 5EJCA 5ERIA 2DBBA 3K7AJ 1W1WE 3LFUA 1WW6A 1Y43B 3R0AA 4OAZA 4XYXA 1DPUA 1FOD3 4Q4W2 4I2OA 1MH4A 1UHMA 4BCUA 5KHKA 1EH8A 2Y9ZA 4RB0A 1W8NA 4ZDPA 4XF1A 4E4DX 4E70A 3RZMA 5C44J 4LHKA 2RM21 3HR9A 4HN1A 1REPC 3VBFB 1LDDA 2RMU1 2R7FA 2VZRA 4DYRA 4JRAA 2W47A 2VQHA 4QTRA 5FZHA 5DYMA 1F35A 3E6MA 4IF4A 1AX1A 3SKVA 1ZLKA 2K5CA 1OJLA 1UXXX 2HYKA 3E6CC 2CGOA 3PHMA 2WINB 3G73A 1IO2A 1DIWA 5JXGA 3GTKJ 4HF2A 3PQKA 3VBFA 3M4OJ 1FOXA 2RDNA 2VJJA 1MQTB 4AVZA 5IVCA 5C3OA 3KT1A 2UUZA 4IHXA 4DEVA 3GFMA 2E6VA 2I5UA 1PMIA 3IZOA 2FDIA 2RGVA 3IRRA 1V5FA 3UNGC 3BCBA 3B01A 1Y1WJ 3F72A 2ELHA 4Q1PA 3ZQGA 5FZ7A 2KPMA 1W3XA 4AU7A 2ZJPF 2E7XA 1OVPA 2DBIA 3CHXA 3VBOC 1T2KA 2RAEA 2WY7Q 2QENA 3VEPA 1NG7A 4YGBA 3HHGA 1MQTA 3CF5F 2YGMA 1SZBA 4A6EA 3VZJA 1T08B 3GZUC 4BQ4A 1JZ7A 1IRGA 4Q5OA 4Q4X3 3MPPG 5D21A 2EV0A 2DFIA 2EFPA 1N3OA 3JQXA 2WUHA 4PDKA 2M1BA 1QOSA 3OSDA 1RUC3 3GTLJ 1YUDA 2P6HA 2WZEA 4ZXEA 1GNZA 3HT1A 1SQ4A 4CUGA 3LDRA 4M71A 4OWRB 2E7WA 1ULYA 3M8LA 4HK9A 2IA0A 1W6OB 3ZMUA 4ZU5A 4NR1A 3OYMA 2MYSA 3GF2A 4HVOA 2SBAA 3IKWA 2ZX4A 1ORKA 5JSPA 4CUCA 4LOCA 2M5WA 2EBIA 2HEOA 3MF6A 2W92A 3CJIB 1J0RA 4DOZA 1NX9A 3LAJA 5IWFA 3H1CA 1RR7A 1GZWB 2RV9A 5HS7A 1W6OA 5BNNB 5JCTA 2OW4A 4N7IA 5C4XJ 2NN8A 2C26A 1YW7A 4X0GA 4M4RA 2KIQA 1GOHA 4K8RB 4KN7X 2E32A 1DU3D 5H9PA 4UXAA 1IV8A 3QP5A 2LW8A 2WIIB 2UYBA 3CJIA 2P7CB 2NYYA 5F2WA 3BALA 3SZPA 1RUNA 5D4SA 4Z8BA 3KP5A 2YC2A 1JZ2A 1GZWA 1KA8A 4Q2FA 4IL7A 1E2XA 5BNNA 3O1OA 2O8OA 4CEYC 1KS4A 4DXTA 1ETWA 4IEPA 4NAMA 2A6TA 2MSYA 1TE1B 4ARYA 5EJZB 1W9SA 1JYNA 1PX3A 4GB31 1SG3A 4JKMA 4P14A 4GD4A 5HODA 4AHWA 3WNXA 1CQTA 4HSJA 4R1HA 1OCRH 1W9FA 4QXBA 2D5VA 2O8XA 2D5HA 3SEPA 5B2GB 1O91A 5K9YA 3DUIA 4MADA 2LKSA 2DVAA 2LKPA 4COWA 5J6XA 4ATEA 3VODA 2ZA9A 4BDZA 4XKBA 1JW6A 1I6HJ 4XN0A 2LKXA 2JN6A 4DY3A 4V2VA 3AB0A 2IFRA 1ITYA 3VBRB 2ZGOA 2YZ4A 2E1CA 4XCAA 1U0JA 3PIGA 3OOXA 1Z91A 2VCCA 3BZ6A 3F6OA 4N90A 5G05L 2J1EA 1D0XA 1JJ6C 1BIAA 2VZTA 3FBYA 3BU0A 5LGTA 2NS0A 4YIFA 2YU9J 4AZZA 2QFEA 5BNOC 2FBHA 4V2FA 4DS0A 3HHHA 5AFBA 3WG4A 2DT6A 4S05A 5CADA 5LA9A 1DDLA 3VBRA 2O3FA 4RN5A 3HNYM 3JRAA 3NARA 3GUDA 1YW8A 3ZN6B 4BBSJ 1MVQA 2XSDC 4CPBD 4RLFA 4LK7A 4OZOA 1V4RA 4N9HA 4WF2A 4CP2A 4LIUA 2OBPA 5E17F 2WADA 3A22A 5J8CA 1HJGA 1F8VA 4A3LJ 2JDKA 2G7HA 5CAZA 4FASD 1N1TA 2F5DA 2MC3A 2RHPA 2Y6JA 1OKQA 1BZWA 1OPOA 3ITQA 1RUJ2 4KN4X 5FYZA 2XWBB 3B93A 1F1ZA 1N25A 3ZN6A 1KD7A 2P8TA 5GLZA 5C3SA 1UCXA 1UYZA 4BE3A 2K3FA 1VQKI 3RQ0A 2VTXJ 3M7GA 5I8YA 3C7FA 2QDRA 2GBYA 4IEXA 5EZHA 2BJSA 3LA2A 4Q4X1 4QKFA 3GX4X 4NPLA 4CXXA 5CYYA 4IZZA 2BWAA 5A32B 2HWC3 3AZVA 3O0XA 2GM4A 5LASA 5KAFC 5FYHA 4RGGA 4W6WA 1RUC1 1Z78A 4HKOA 4UVAA 4FOYA 1MKMA 3VDBA 1O57A 3CJQB 2JA5J 1JOBA 3ST7A 2B9UA 4BIFA 2IJLA 3WTXC 4PQ9A 2BVBA 2QF7A 1J83A 3NV4A 1K5JA 3NAUA 1X58A 1O6UA 3ZN5A 1MBEA 2RKHA 2IXIA 3CCVI 1KRIA 1F43A 1AF9A 5A32A 3OL3A 1W5TA 4PJJA 4PF5A 4RFT0 5FMOL 5K7ZA 4HN0A 2OQ6A 1BR1A 4XFBA 4QAWA 2X9DA 1OH3A 4EQQA 3AX4A 1LNWA 3S3OA 4QKNA 5FLXZ 3N7JA 3RZGA 1SD6A 4CYCB 5FPVA 2VOVA 2GC3A 2CQXA 2WAFA 3THCA 2GA2A 4XAEA 3GLLA 1R1A3 2MEV2 4M3GA 2EV6A 3WQ1A 3USUB 1POV0 1POV1 1BBYA 1YQ8A 5HPOA 1FEXA 2QQIA 3NNLA 1R71A 2F4OB 4I0WB 2PFWA 3HJRA 5A1AA 4AL9A 2B46X 2DK8A 2M0CA 1CAXB 3CO6C 2FMLA 3TEDA 4LK1F 3DEEA 3F8MA 4QPQA 1A04A 4EJUA 4CYCA 2BQPA 4ZYGA 1K6YA 4HVQA 3K4NA 2DCTA 4XETA 3KIOA 3BT9A 5F5IA 3O8GA 1YRNB 1A8DA 2Z69A 3U11A 4KG0A 3NL1A 5J1UA 2JDZA 3USUA 2XPUA 1D4VB 3LFIA 1TQIA 3M7AA 5LK7B 3K4ZA 2JRMA 3THTA 4MGTA 4EQVA 1ZHFA 1GMMA 4BLJA 1KU7A 1VQ9I 2Z79A 2Y8KA 2IA1A 4AYBN 4CU9A 5DM7F 1CAXA 2FDJA 1JYWA 2PLV2 4XF3A 2BVLA 2HOTA 1WLTA 4UAPA 2FD5A 4S2DA 1NTCA 1Y1VJ 2L54A 1SLAA 2E2JJ 3KE2A 4PDWC 1Z9CA 1SDDB 3ZPOA 1YRNA 5JXHA 2E34A 1UKRA 2JA2A 4M3FA 2GXAA 5CG8A 5F27A 2XJSA 2BEOA 3MHZA 2VULA 1KXGA 5EQUA 3KV5A 5CB7A 3J8F1 3B6AA 5CFCC 3K69A 2VQGA 1ODNA 5FWEA 5ILSA 4OHWA 1QDCA 2DTYA 1VB4A 2EB7A 2Y0MA 3H1MA 3W21A 5C71A 2K0GA 2HDWA 1GUUA 4YW3A 5HLGA 2DOEA 1XU2A 1IUFA 2M0MA 2LTNA 3QBQA 4GJYA 4L92A 1LB2A 1RXFA 1K83J 5F39A 2CAVA 3MN2A 1PGW1 3R60A 3EETA 5IP6A 3X2QH 1X3WB 1OOPC 1B6AA 2W1QA 4YW7A 1GT0C 2SLIA 5J40A 3KP3A 2LALA 4M72A 1OD3A 3KLOA 2F6BA 5CBLA 1HLVA 2DMUA 2OTLI 4ZYDA 3MD2A 1VMFA 3GFLA 3K4KA 5CLSA 4XLNF 1G9AA 2F4IA 1GP5A 4OI0A 1CONA 1NLRA 3OYIA 1Q5OA 3I7DA 1DYKA 2VL8A 3DKQA 2PHFA 3LSKA 3WG1A 2V1UA 3U07A 3CMMA 1MMSA 3IT8A 4DJAA 4MFEA 2D7FA 1P7JA 4HRIA 1NYWA 3CMEI 2R30A 3WSOA 2HWC1 1R23A 5FPXA 2OPKA 1KITA 5IFTA 3WUDA 1DQ0A 5A70A 5F08A 4DEQA 1YJLA 2PLV3 4I0BA 2Y6GA 4BM8A 2HWF1 3V56A 4GIQA 4BDYA 3BLYA 1VBC2 2Q30A 2DYRH 1RUH3 2JDPA 2HWB2 4LHSA 3HEIA 3FDYA 2FCTA 1P2FA 3CD6I 1CD3G 3JW4A 1LAJA 4IEVA 5LEKA 4Q8LA 2VNGA 2BOJA 1RHI2 4BQQA 2EFQA 4LKEA 5HXMA 2IS6A 2P5BA 3HZJA 2GU9A 1QQP2 4FE4A 2BFUL 2JG9C 1R1A1 1OF4A 4KISA 3CU7A 5D8LB 1Q43A 4RYDA 1WGXA 3BI3A 5FK8A 3IDAA 5FR3A 2HZTA 1F4KA 3B94A 4C3HJ 3T8RA 1BK0A 1VF9A 1ND3C 4PCRA 4XAAA 1YQCA 2C0ZA 4BQ1A 5JLWA 1PNGA 5FYMA 2R7OA 5T5JA 3E1F1 1MMDA 1PO12 3TKYA 3POFA 1PM4A 4EZHA 5J8FA 1R092 4CSWA 1W8FA 4AAPA 4JZRA 2VJIA 1FYMA 4ASKA 2MFZA 1XE0A 1UMQA 4AVSA 4N0BA 1V00A 1IKPA 2Q1ZB 4Q27A 3SQNA 5HV0A 4MNUA 4GH4B 2W2IA 4KMQA 2BGPA 4BDVB 2XGCA 2WO7A 3KGZA 4N8MA 4D0QA 5FZ4A 1I27A 4LKDA 1RITA 2JIGA