4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
3PUQA 5F3GA 5FZ8A 2YBSA 4CCLA 2OS2A 3LDBA 5FZ6A 3UYJA 5F2SA 5F37A 4LITA 4GJZA 4Y3OA 4Y4RA 5FPVA 3N9PA 4QXBA 5FXZA 3PTRB 4ASKA 3PUAA 4QXCA 5A7OA 3KVBA 5F5IA 5IWFA 4LIUA 4IGPA 5LY2A 5F32A 5FBJA 4CCJA 5F2WA 5FYBA 5FXXA 5IVJA 5FYYA 3AVSA 5FYIA 4CCKA 3U4SA 2P5BA 5FZ1A 4CCNA 4LIVA 5F39A 3KVAA 5A3PA 2YU1A 5FYSA 4QU1A 5FP8A 3KV6A 5KR7A 4XDPA 4GD4A 3N9QA 5F3CA 5E6HA 3N9LA 4E4HA 5IVCA 3DXUA 5FYMA 2WWUA 5FPAA 2XUEA 4V2WA 5A7NA 5FYHA 5FJKA 2Q8EA 4QX7A 4C8DA 4V2VA 5FPLA 5FP3A 5FZIA 5A3NA 5FP9A 5FYTA 5F3IA 2Q8DA 5A1FA 5FZOA 3PDQA 2XDVA 5FY5A 2OQ7A 5FXVA 3OPWA 5FV3A 4DO0A 2OX0A 3K3NA 4BXFA 4NUBA 5FZEA 5FZKA 2OT7A 3DXTA 2W2IA 5FYCA 2WWJA 4URAA 5FY7A 4BU2A 1VRBA 5FUNA 5A7SA 5ISLA 5FWEA 5FXWA 4EYUA 5LY1A 5FP7A 3NJYA 5LW9A 5FY8A 3PURA 5FWJA 3KV4A 3N9OA 5A7QA 5FYVA 4D6QA 5IVEA 3KV9A 3PU3A 4EZHA 5FPBA 5ANQA 5FZ3A 5A3TA 5A7WB 4IGOA 3LD8A 4QX8A 4CSWA 4EZ4A 5FZ9A 5FZ7A 3AL6A 5FY9A 4TN7A 4CCMA 4QXHA 5IVYA 2VD7A 2XXZA 5F3EA 5FZFA 5FZDA 5K4LA 4AI9A 4UF0B 5CEHA 5FP4A 4IGQA 5FZLA 2GP3A 4D6SA 5A80A 2XMLA 3PUSA 4QWNA 5FZ4A 4LXLA 3KV5A 3RVHA 4BISA 3N9MA 5A7PA 5IVBA 5FZ0A 2YPDA 4HONA 5FZBA 3K3OA 3OPTA 4Y33A 4CUGA 5F5CA 5FJHA 5FYUA 5FY4A 5F5AA 4GAZA 4AAPA 5A1LA 5A3WA 5FZOB 5FZGA 4XDOA 4DIQA 4HOOA 2YBKA 5FYZA 5FPUA 5IVVA 3AL5A 2OQ6A 5FZAA 5FZMA 5FUPA 3ZLIA 3N9NA 5FY1A 3K2OA 5FY0A 3ZPOA 4UF0A 5IW0A 5LWBA 5FZHA 4GJYA 3AVRA 5IVFA 2YBPA 4CCOA 2PXJA 5FZCA 2GP5A 4D6RA 5A7WA 3U78A 3PU8A 2Q8CA 2YU2A
chains in the Genus database with same CATH superfamily
1W2UA 1XS9A 4URTA 2KKOA 3J7AY 2IVMA 4KH9A 2WY8Q 2LLKA 1UD1A 4JHTA 1LJ9A 1A6CA 4TLFA 3TB0A 2EZIA 1SBEA 1W06A 2NXNB 2XUMA 2KJCA 1ORKA 5A3UA 4QQ2A 4HXCA 1RUC1 2DMUA 1HF0A 1VBB2 2WWYA 2Y31A 3APBA 2O61A 2RS51 3LFIA 2PA7A 2GNTA 4IW3A 1HRI2 3M1CA 5C9AC 2QWWA 3G73A 1AVBA 4P9IA 5FV3A 1A3KA 2DFIA 3VFZA 4B29A 2M8GX 4BIFA 2IA1A 2D7FA 4XUQA 5IK7A 1PHMA 4M00A 3ORJA 2B9VA 3I2FA 4CCCA 2QQ8A 2BJSA 4MTDA 3REOA 5K0UB 1XU1A 4NMIA 4QPWA 1YEWA 2HWVA 3K4NA 4HV5A 4DRRA 4QQLA 2CU5A 3C2BA 3O1VA 1NA1A 2A7AA 1VAMA 1BR2A 1VBC1 2XAHA 4C2MJ 1NOVA 1VQ6I 1H9PA 2K4JA 5IYYA 3HXLA 2JA5J 1UY3A 4QQHA 2IXHA 1ASJ1 3PHMA 2JA6J 3B01A 4FXKB 3SHRA 3O3KA 1VQ5I 3HVDA 5JIAA 2FDKA 4LULA 5FKCA 3B00A 1FIPA 3SQNA 3KP6A 4RR3A 4M6YA 1HDPA 1DPRA 4Y5Z0 1SLLA 2VTFA 1JZ4A 4BM8A 1ENSA 5LA0A 3QYBA 1BVP1 3KWVA 1RUH2 2AQEA 2XLAA 1X1PA 1SANA 3OIPA 1VQ9I 2F5DA 4Q4W2 4A12A 1RUD2 3J80K 2RE9A 3W6VA 3LSTA 4DY3A 5ED4A 3KVAA 1SD6A 3I59A 3KM5A 3CCYA 4QHZA 4LTAA 3ZMUA 1SG3A 1B8IB 1HV0A 3WNKA 3BTAA 1BIAA 2ZHNA 4AIJA 3LOBA 3VYSB 2BRTA 2WNEA 4KG8A 1EKEA 3VEPA 2OZUA 1VMHA 1V55H 2V1NA 4XACA 1VBA3 4JDMA 3F8FA 3LSDA 4FPJA 2PMZN 5FY8A 4NAMA 5F9TA 4Q27A 1UOJA 3GBGA 3DTIA 2HVQA 2WNUA 4YGCA 1VTNC 1Z7UA 1ZM1A 1FMD2 5JZGB 2OD5A 2VJXA 1Q56A 4K40A 3H9AA 4IL7A 4E7KA 2R3SA 3HOSA 1PK6A 5BV6A 5E1WA 1KU9A 3OYBA 2GC1A 3RKWA 3CC2I 4LBOA 2PX9A 3U2RA 2ZJPF 4YRVA 4IXAA 1JHHA 1VBC2 2Q8OA 5M3MJ 2DO7A 1SLAA 5IP7J 1C28A 3LSPA 1B1BA 5CB7A 3ISPA 2O1QA 3WDWA 3RG0A 2CV2A 2X85A 1ZTRA 3DU5A 2HVRA 3GZEA 3WW1A 2BGOA 4ZDLA 1DCSA 4M3CF 3KD4A 5J4YA 2WADA 3UJQA 4NVPA 4MV2A 3ABZA 4F92B 3RJPA 1BCXA 1HW2A 5FFZA 4O3MA 4S2FA 2V09A 2DBNA 4KIFA 2B0LA 2YFZA 3RZDJ 2D6MA 4QHOA 2XUBA 4GZ9A 1HKSA 5D4RA 1WBFA 2FCVA 2UWMA 4C1WA 1G9CA 2JT1A 1J1TA 2XBO2 3OYWA 3DXTA 2IXCA 4XN3A 4NHLA 2HPMA 3RZKA 2WT1A 2EB7A 3UV9A 5LW9A 1RUJ1 5A6YA 1TNTA 1P7JA 3ZQIA 2GBYA 1RETA 5I8SA 5BNNC 3OBRA 4XHXA 4M9ZA 1QJX2 4Y22B 3NAPA 2PMWB 1QNTA 3JZVA 2MH2A 1HKDA 3D4KA 1J3RA 1A6QA 4CYDA 5F1RA 4LKDA 4JQRA 4AZZA 3BPVA 2W7NA 3WNOA 2XPUA 3BCBA 1IQDC 5LD2C 2XOMA 1U6GA 3TP0A 2DU9A 1SLTA 2YV8A 3FHZA 1D8JA 3SH4A 1D1BA 1K6YA 1YHQI 1OLTA 1O91A 4CDXA 1BBYA 2VNGA 2K46A 4Y3OA 1WRJA 2PN6A 2FCTA 2P0WA 3M9AA 4NWWA 4KG0A 5A7OA 2FRHA 2W1SA 1N3PA 1POV0 4XBFA 3KLSA 4CU9A 5CFDC 2ZO4A 2EPFA 5IOYA 4FE7A 3LWFA 1Q1VA 2P6HA 5F7UA 3GCWA 2MFZA 4M4PA 1NKGA 4M9SA 2X9DA 4J01A 4AVBA 1HOMA 3C2HA 1NT0A 4AF9A 9ANTA 1ULOA 4IHTA 3LPFA 1N75A 4IV1A 2P6CA 4HV6A 1KJLA 3VZOA 1O4ZA 4HKWA 3N7JA 1OOPA 4HN1A 4II2A 4RHV2 3I3DA 2YX7A 1PX4A 4WX9A 2PHLA 3RZLA 5H2FC 3JRIA 1H8VA 4MH0E 4B4QA 1Q8OA 5AC92 3I56I 3KZYA 3DL3A 4CDGA 3C2UA 4HL0A 5K4LA 3N7MA 3C7OA 3I4IA 3FLTA 2JMWA 4IPAA 4SLIA 5JAXA 4RR3C 3QCWA 4PGHA 4HZFA 4META 4AEMA 3OSFA 5L3EA 1H8AC 3I2GA 3O0XA 1YC61 4LHKA 1HDDC 3RJ2X 5IPAA 4F91B 3IRRA 3R61A 4JV4A 4XFHA 5GJ6A 5B1AH 3LEKA 3UNGC 4B1MA 2VY0A 2EH3A 3GXUA 2NLRA 2ELHA 1G3YA 4YVWA 3G4SI 3X2QH 3HWJA 2GQQA 1E3OC 4BEHB 3WF0A 4D6RA 1JTZX 2ADDA 1X36A 5DM7F 2JA8J 1JJ8C 2JG9B 2CH0A 4WXHA 2Z9OA 3ZOIA 3MW2A 4YG3A 1I6XA 2W94A 5DUIA 3AVSA 1SMTA 3IAQA 3JD72 1OPCA 4XFCA 4J6GA 3M7GA 4HANA 5DAWA 2HEWF 4FP2A 2EILH 3HGGA 2VNRA 2P1BA 3SFZA 3PUFA 1WLDA 4L5JA 5EG0A 2J5PA 2K40A 3LAPA 3MN2A 5FP9A 4YEJA 1IXSB 4A6DA 1ZRIA 5FMOL 2O5RA 4H3WA 2XQRA 1ON1A 1AKHA 4MGRA 4V2GA 3H0GJ 1J3PA 3BKZA 4N43C 5KXEA 3KZ4C 3ASOH 4Y5TA 4RB1A 1DQ6A 1RITA 3VGIA 4XIDA 2I8DA 3HBKA 2CQNA 2GWRA 2E33A 3WGHA 5IT6A 1LGBA 3CCLI 3OGGA 4LLOA 1S5LC 4Q4V1 1VQLI 3JU9A 4Z8BA 4J25A 5K5OA 3B5LB 3SITA 1QH7A 4QLCU 2W47A 4M0NA 4YFWA 5A32A 2JRTA 4MO7A 4YW5A 3EPZA 2RR13 1X50A 3JAMZ 1H0BA 2VE8A 1Y3TA 3ALQA 3JBG2 4B7KA 3F23A 4M3EA 5FDBA 2TBVA 4PBPA 1LTEA 2GC0A 1BR1A 2HI3A 2ECBA 4ASKA 1UIKA 4CO8A 3L2UA 3QPSA 5J4VA 2PJRA 1BZWA 3BQZA 1I6HJ 4LK0F 1W28A 1X8EA 1U9OA 1DZQA 5L19A 3KT1A 1YFXA 4PFOA 3H8RA 4BAYA 3ACFA 5AFBA 3GALA 1ENRA 1RVF3 2CMPA 1BI3A 5LLQA 4OHVA 1MEC2 4QU1A 1AR82 2DQLA 2Y0MA 2DXIA 4Q4Y2 3E6BA 4XFIA 2V4JC 3W20A 2MH9A 2DUPA 2M5WA 5J3LA 3AYDA 2WA4A 4HAMA 2VW1A 3P5JA 2HWB3 1RUH1 1I27A 3WTZA 1OQEA 3PVEA 1Y9QA 3WP3A 4ABZA 2LREA 5DXDA 2OU2A 2HWF1 5KK1A 3RI8A 1OQ1A 4TXWA 2M45A 2ZHMA 1K4SA 3TP3A 5BMZA 1YFUA 3LZZA 2ZTNA 2VOPA 1SPPA 4GKYA 4M9XA 3FHNA 1ZYBA 3IN9A 2P7VB 5CU1A 3V7RA 3ZRGA 4NIHA 4DRVA 4JGYA 4NPLA 2VUAA 4AGVA 2CSGA 5JOYA 1UO9A 1HKQA 3A0HC 3SCHA 4K1YA 3K3OA 1YW9A 2JN6A 1OHFA 4IE6A 5DAVA 4KICA 4W97A 3ZXGA 1MVQA 3DYPA 5LBCA 4GXLA 1OISA 5FZAA 1YW7A 2WO2A 2TDXA 3O1TA 3SEQA 4OIQF 2ZMLA 1ZRCA 4ZZ8A 2HBUA 2QCOA 2Z2SB 4BUPA 3OYNA 5KAFC 3CESA 4J19A 4NRPA 1PMJX 1PO23 4OQ9A 2XJQA 2CUFA 2CGOA 3PMSA 2ZGPA 3LOCA 2K9SA 2HWB1 2CUJA 3GFLA 3WU0A 1XC5A 1OCRH 3WP4A 1PYVA 4QPGB 2VULA 3TOJA 5HLTA 3ML6A 2ZX3A 4FPOB 1YJLA 2TEPA 1W7PD 1TME1 2RNJA 1RHI2 4ARXA 1OQYA 5J1YA 2HWC3 4U36A 5LZ6A 5FP8A 5FYMA 3SEPA 1ZELA 4WWCA 2EXKA 3EUKL 2PHWA 4B44A 1XN7A 5JVVA 4RGXA 2DK8A 1XRUA 4Y4YA 1R1ZA 1QY4A 4S04A 4PZJA 1WD3A 5I91A 2RM21 2NOGA 1BJAA 1GZWA 3AMNA 1SLCA 2OJED 3M4FA 4RGKA 1VAKA 1KQ9A 1MGTA 4C9YA 5FLMJ 3HRTA 4EV0A 3ZYRA 1N1VA 2RMU1 1Z21A 1G3TA 5JWPA 2E19A 2G7UA 1JHNA 4B4PA 1XNCA 1DZRA 5IVBA 3QD6A 3OYFA 2ENRA 4HVRA 2JDKA 5FZGA 1W8WA 4HPQA 3CO6C 1EF4A 1GNYA 4KWUA 2R93J 4Z82A 1UHSA 1KQRA 4LO7A 4GFBA 5IVFA 1J3QA 1VBB1 5FFXA 1ULDA 3WF1A 3WE2A 4IHYA 2IGOA 4KL1A 1NXMA 2O6GE 3VBRA 1R093 4P9UA 2OIIA 4A44A 5E8AA 2WO7A 3PLQA 1XNKA 2VLAA 1ZZ6A 3GFJA 4R52A 3ACGA 5LEKA 4A5MA 5EEHA 2G4IA 5LRSA 4RS8A 3S2WA 3VBSA 2ECCA 3MF9A 4JBAA 4P5YA 3V64A 1L7QA 4NE9A 3JD73 4MUVA 5APAA 2CGPA 4GYGA 4A7YA 3B3QE 4AGRA 2WO3A 2BPA2 4X1EA 1WW6A 4E7ZA 4EJTA 4AYBN 3TL4X 5M5WJ 5IK8A 4K21A 3VZLA 1OA2A 2QQKA 4CDXB 3ZQQA 1QWRA 2VOOA 2CL2A 1U5TC 2MEV3 2G9WA 1JI8A 4XUNA 2BWCA 1RVF2 4YYOA 2DA3A 4GH4A 1MEC3 5DUVA 2A3YA 5FY1A 1X9PA 4FOWA 3HSFA 4Q4X1 1ST8A 5M0TA 3OD4A 1O4XA 4B3NA 2PTMA 4DUWA 1B35A 2JSCA 2GN3A 1QQP1 1X1DA 2IAIA 1WW5A 1YFYA 2VKVA 4CVUA 1KONA 1TWAJ 5DDJ2 1R64A 5GZDA 4LUMA 3GVAA 3P6BA 2FF4A 4FPCA 3WODF 1DDNA 1ZAOA 2IT0A 2BV6A 5C44J 1MS1A 2XVKA 4JGZC 2BXYA 4AHYA 1IG3A 2P5LC 3K3NA 4Q4W3 1JKPC 2RM22 1U5ZA 2COMA 4Z1VA 2MABA 2LKXA 3MF6A 2NS0A 5I0UA 1OBNA 3K9TA 1DZTA 2B8MA 3NV1A 2D97A 4XJ8A 4M74A 2VL8A 5FMBA 3K1MA 2RDSA 1C8M3 3M3CA 1XYOA 4CCDA 5D5VB 4XUTA 3TWIA 1CD3G 3LSGA 1S9HA 2RG4A 3LAGA 1AR93 2E7AA 4BDZA 2BVLA 2HYJA 1O57A 2VZOA 3AK0A 5KXCA 1V5GA 4DIQA 3NQOA 1CONA 2YR2A 3ZYIB 2X05A 1SMYF 2D5VA 5BNOB 3W6KB 1AR61 1ENHA 2UY8A 3KB5A 3JR9A 1KGYA 4OUMA 3RSJA 3RKYA 4B1LA 1AL21 1OF4A 2V7FA 1VALA 4E4DX 2JA2A 4HKOA 4IEZA 3RI9A 3PFIA 3VKLA 1FPQA 1WCMJ 5CQEA 1GLNA 5HDKA 4BE1A 1DLCA 2QKLB 1NG7A 3MLLA 5A2QZ 1SEFA 1I3HA 4WVWA 3S3MA 4RMNA 4FP3A 2PMHA 3CZ6A 1HB1A 3AZZA 5FYHA 2YHJA 2K86A 1AJOA 2LBFA 1CGPA 4MOAA 1HXS3 4RA2A 2RS32 1YQCA 3WHTA 1POGA 2VQAA 3GHMA 4Y15A 1WWXA 2DTZA 1Y43B 1VRH3 3RZGA 2DT5A 3JQXA 3GLXA 2YGLA 3RIRA 1H8TB 3OYLA 4XAAA 2RV8A 4FBFA 4A3BJ 3AP7A 2HS5A 2NM1A 4LLNA 2WZR3 5C3QA 3FZ3A 1H1AA 4NIGA 3ZMOA 3S8PA 2KA3A 5JSPA 4QKNA 4BQOA 1IN7A 5E20A 3QU3A 1XMKA 1FYLA 2JWPA 3ZN6B 3T1MA 5DZFA 4R1HA 4KN4X 5JXHA 4RQPA 1ZBE1 5EJ3A 2K7LA 3E7LA 3ZSJA 2DI3A 3ZCOA 1JYCA 1VQ7I 2ZBJA 4BJTA 1Z9CA 1PO13 1UZZA 3NSTA 1NA1B 3ZDVA 1LDKB 2BHZA 4AIHA 1Y39A 3O5SA 4I6ZA 4BZ4A 1AX0A 1C8NA 1EAH3 2VNOA 1K3IA 2WZR1 4EATA 1YJWI 1FOXA 2ZX4A 1R1UA 3L2RA 4RB3C 3CU7A 4D3WA 1ZHFA 4CDUA 4ANJA 2RS12 2W9XA 3QOPA 1RUF1 1WZ2A 5FOBB 4PJ0C 5FYVA 3OOPA 4F93B 3AG3H 2HFHA 5LGUA 4BLJA 3EYIA 5J36A 2ZKNA 2E60A 1W6PA 1KS4A 1U5TA 5FZFA 5IATA 4KUMA 3E97A 2VMHA 4M72A 2AEZA 2HWF3 2VU9A 2PEXA 1BBT1 3AM2A 4Z2YA 3FC0A 2CFOA 3FBYA 3A4CA 2XPWA 4IXLA 1B35C 5J48A 1Y8QB 5JLWA 1E5HA 2Y6HA 4I09A 3PTYA 3BZ6A 4ZJZA 4EROA 5GTHC 3K0LA 1SLIA 4A3IJ 3KLNA 5KXBA 4LOSA 1W8UA 2Y0OA 3ZSKA 4UF0A 1DIWA 2D40A 3HR9A 5CVVA 4ES9A 4CCOA 3SH3A 3IUOA 2ZGNA 4UUVA 4JTOA 2Q8CA 2XPVA 2YBSA 3NV4A 3J9SA 3ON7A 2NVQJ 4XF1A 2QZ2A 4OOIA 4EGZA 4LB5A 4Y26A 1LDJA 2K02A 4MGTA 4A0XA 4FOQA 5HLHA 1KFUL 3UKTA 1HLCA 3OYWB 4QB2A 3WTUC 5F2WA 3RKXA 2LH9A 3UESA 5ICFA 3PM1A 4Q26A 4JCKA 1UY0A 5A7NA 3KCXA 3OD0A 5HCAA 3B6AA 2E9QA 4AHZA 3TBIA 5KC5A 3BG5A 3J7MA 5F6LB 4ENMA 4AVCA 2B7EA 1IPSA 1QJU1 1JU4A 3CUQC 3H35A 4OHYA 1WCDJ 4P9GA 2EV5A 1Z3XA 4LK7A 4I99C 4QHBA 4XQWA 2M87A 4D6QA 5JOZA 1ALYA 5J37A 4ZZDA 1T6BX 4PJJA 3NO8A 2OW4A 1GP5A 4YM3A 3E1SA 5LHHA 4EN0A 1RKWA 2EFWA 1VI0A 4BOWA 4CA0A 3IPVA 3I53A 4P5HA 4HSRA 1JYXA 4YRDA 4PDWB 2HYKA 4ISRA 3T09A 2R5YA 2QKMB 4JQFA 3JRHA 3CCRI 4OUSA 3W5NA 1R5ID 3AL0C 4NJ4A 2O8KA 3J8F1 1CAXB 5FBZA 1K7AA 1OLMA 3JB4C 3T0YA 2YUSA 1TNSA 4AEKA 4XK4A 2ZJCA 3TO7A 2WC2A 4EWAA 4K1ZA 2XONA 4YW4A 1W2OA 1RUC2 2XIGA 3DECA 2FDIA 3PO3J 4IV3B 1GOFA 1MZBA 2JXAA 3X29B 1E5SA 1KD7A 1S7OA 4HLTA 1E2XA 2R30A 1QGLA 4XF4A 4OZOA 2BTVC 5T50A 4ISQA 4LPLA 3DBRB 4AQ6A 3WF4A 1LCLA 3MLJA 2VKEA 3WCRA 4BE0A 3E0JB 1V3FA 3PNVA 2OVUA 2E7TA 1WCKA 5A1FA 3S5AA 3WW4A 4MEYF 2IVIB 1ERDA 1S0EA 3G2BA 1MS8A 4AK3A 2C1FA 1I5PA 4FOYA 2W85A 4WM8A 3C7JA 3LQRA 2ERFA 2BOJA 2EICA 4OINF 4AEJA 3MICA 4OIRF 2PLV3 3QOEA 1AF9A 4L92A 1ULYA 1YS6A 1DQ2A 5FZ9A 3MUY1 2VOWA 4G7ZF 3FXJA 4PJNA 3BR1A 3VDBA 1NCQB 1W2NA 2WNVC 5E3LA 4GALA 1TW3A 2R92J 4RFT0 3K6GA 4YG6A 3PUBA 4W50A 5FR3A 3KGZA 2YPJA 2MNGA 2ORXA 4DXSA 4LKFA 1MVEA 2R1DA 2VB6A 5DEQA 1TTYA 1NLRA 1CF7B 4XUOA 1MNEA 1ZZBA 4JTNA 4PIZA 1FC3A 3D5LA 4XIOA 2GP5A 5K9YA 3Q0UA 4LMYA 1N77A 4D94A 3MDPA 4ES8A 4Y4RA 2BNOA 2TUNA 2E7WA 3SHFA 2D5FA 1S29A 4PLOA 4XW3A 4EM2A 3QPLA 4W6WA 4IHVA 2Y6LA 2QA4I 2OKXA 1AXYA 2IJLA 1UU4A 2ZNZA 3ERED 1LGNA 5LHGA 1QHGA 5F39A 4EEFG 1I39A 4A3DJ 3ONQA 4M01A 2FUG2 5D2AA 2VZ3A 1KDMA 2GMPA 1UU6A 4LLLA 2JIGA 5GAGJ 1F9KA 3TGNA 4AIKA 3T8RA 1LEAA 5GM0A 1IN4A 2L7FP 3FWEA 4RLQA 2Y0SA 1RMU1 4XHBA 4CXYA 5DMYA 3IMNA 1UYXA 5IT3A 3AMQA 3C3WA 4F55A 3OSGA 2XHKA 4P14A 3EETA 2FD5A 3RPUA 3CHXA 2LYCA 5J8FA 1RUE3 4CCMA 1UU5A 4CICA 1UPSA 3CJIC 4ASNA 3LFMA 2Z16A 3BOPA 2P3JA 4YIFA 2VVFA 2UWBA 5LBQA 1X9TA 3IDCB 4GKXA 5I0RA 2XGDA 1WVRA 2VPRA 2DK5A 3E5XA 2RNGA 1X7NA 3VSKA 4B4CA 3DTEA 3NWSA 2H1LA 3B94A 1HSTA 4F8AA 3IAS2 5FZHA 4YNIA 4Q4X2 4ESFA 4A3LJ 3KQRA 4DBRA 3ZYBA 2HWF2 2WLPA 4AGGA 3D82A 2MGQA 3MO4A 3AMHA 1OA4A 2CWMA 3CMGA 4ZH4F 5F37A 2FDGA 3B7MA 2HXIA 1VMFA 3E1F1 4IV3C 2K4BA 1AYM1 4PLMA 3VHPA 2LD5A 1D0ZA 4JX5A 2W1QA 2GALA 2VMCA 4FFIA 2M2EA 5J8CA 1LENA 1QOTA 4EN8B 3HC7A 4D0QA 1EPWA 1FJLA 3ACIA 5B4NA 1W03A 4FPYA 3LA7A 3RQ0A 3ZQGA 1QU3A 5EFUA 2CQXA 4AYBA 2Y9YA 3WUDA 5FKOA 4AFBA 1X3ZB 3V65A 3ZDSA 2PAMA 1XE8A 5FZEA 5FZKA 1PGSA 2ZGKA 5CNAA 3NJVA 2WAFA 3MKYB 3VDDB 1TWGJ 1S0GA 3K2AA 5L3DA 2LROA 2P3KA 4YFZA 1HXS1 2I74A 5ABJB 4AM3A 2VZVA 4EMSA 2WT0A 4YPJA 2OCCH 3BCAA 2P3IA 5DG2A 3ILRA 5F5CA 3ECHA 1DYKA 1XNDA 1IO2A 4QPIB 4AWXB 4F83A 1BJZA 4L2NA 1EUTA 1AYM2 3GXOA 3H0DA 2IS2A 4FO9A 1V5EA 3E6MA 5ABJA 1EAH1 3VD3A 2CUEA 2JJ6A 2WNUB 3CJQB 2QUOA 4NHMA 1IW7F 4R9AA 5SV5A 4IQ4A 1GNZA 4EJRA 2X6WA 1MS0A 1YQ2A 1QJY2 2FBEA 1MH3A 3FUOA 3PTRB 3L9JT 2Y9ZA 2Y0IA 4AI3A 4OI0A 3VKFC 3ZFFA 4YFNF 3M3YJ 4AVAA 1URXA 1US3A 4A3XA 5F04A 5FK8A 4HNUA 2WS92 3KYDB 4RYDA 3AZXA 4NNJA 4BY7J 3NJZA 2DA7A 1MZEA 3WCSA 3KZIC 3SCGA 1XDUA 2Q8EA 1I1GA 4KGQA 4IV1C 4KIBA 4Q29A 3TO6A 4R4ZA 3NJXA 2XJVA 1YX5A 4PDWC 4QQPA 2VT3A 2QCSB 1ZZ9A 2JD9A 2YXSA 3I4MJ 1M1EB 5FYCA 2KL4A 2K3PA 3GTPJ 1QPMA 2DOAA 1WLTA 3WLUA 2E34A 2W4SA 3OYEA 2LG4A 4QX0A 2BVVA 3H92A 2SBAA 1W04A 1TC3C 1DGRA 1HRV2 4X8PA 4IEJA 1LULA 4KU7A 3TN93 1Z77A 3A0KA 2BUKA 3LKJA 2CJJA 5A7PA 1S55A 1W9FA 2D1VA 4AUXA 2VM9A 4CYCB 4LK6A 2HR3A 3HSRA 3BTJA 5F1JA 4MQ9F 1FOWA 3CUOA 3JRGA 3QPTA 2VPVA 1UG2A 1XNAA 1WPKA 1W5SA 3PUQA 5EQUA 2LC2A 1VAVA 3BG7A 2M3AA 1GWMA 1A8MA 2XAUA 3S5QA 1COV1 4UVCA 4QXBA 2R5ZA 4DW6A 2VC9A 2VG9A 4Q0QA 1W8HA 4UFKA 4ARYA 5IWFA 3FUQA 2JG9A 1Z1DA 5FBJA 2DOEA 2NQYA 4AIDA 2VBXA 2DDAA 3ZSLA 5DDJ1 1H9WA 2V1UA 2DCZA 1WJCA 1T6SA 5L3CA 3TDUC 1RUE2 4KMFA 3M8FA 2WR9A 1XGMA 3AJZA 3NL1A 3B9IA 2VONA 1M4WA 3NNGA 2KT0A 1ZN2A 1UYZA 4LMFA 1D7PM 2QENA 1YUDA 3DGTA 2WO1A 5HXMA 4UAPA 1O3SA 2B7YA 1R9TJ 3MIEA 2XBO1 1DG6A 1YNAA 3H9JA 1MS5A 1MMGA 3I64A 5ACA2 4HSLA 2AH2A 3GF6A 2XH6A 4MHGA 2AACA 1Q8PA 4C3JJ 4C90A 4QWNA 3I3LA 1DHKB 4BB3A 4FXGB 4S05A 2YPDA 4OMCA 4RL7A 1J5YA 1NK3P 4HQMA 1W0TA 1W9TA 3AXDA 3WTSC 2WNUC 2Z42A 5A3WA 4FETA 4XDOA 1K83J 3UKVA 1W36D 2HBTA 2W39A 1ZRFA 2ZKZA 3ZLIA 5EYRA 3BOWA 3KS7A 1YRNB 4HVQA 4LHSA 3MHZA 2QNKA 4EN7B 5T3NA 1OCOH 1NHAA 1LFBA 1WCSA 1BLZA 4DNCA 1UHMA 2EIMH 3MW4A 3FMRA 1H1IA 3MIBA 1FAYA 2EA4A 2E53A 4XPVA 3POWA 3W2VA 1TZOA 1ACIA 4I2OA 1UJ8A 1Y1WJ 1CAWB 1PO22 1AUYA 4F3QA 5KVRA 2E7QA 4LBQD 2PLV1 1DF0A 5C3SA 3USUB 2DVFA 2Y6KA 1LAJA 2JX9A 4P9JA 5FUIA 4FX4A 3H36A 4TLGA 3H5NA 1RUG3 1H88C 3VBFB 2JDAA 2JKXA 1XYNA 3SDGA 1ZGWA 2PHRA 2FD8A 5JMOA 3P9IA 4CEWC 1TNFA 3VDCA 1X4OA 1E3HA 4XETA 3POBA 3R4DB 4XUPA 4EYUA 3GTGJ 3IPVB 5CPRB 1WFXA 2ARAA 4BMEA 2SLIA 1LU1A 5JR7B 3G3ZA 5HI0A 1RUI1 1HQNA 2QZ8A 5K0UA 3I9V2 4LJHA 3D5SC 5BNOA 2JA7J 3QPHA 2RHPA 5HCHA 3SDBA 1FPN2 4XF0A 3IKWA 2X1CA 3ELKA 4XCBA 2UV1A 2C9AA 2B9SA 4KU8A 1UHWA 4JX6A 4UVAA 3DKQA 4OHWA 1PUFA 3DEWA 3I7DA 2YBKA 2DFFA 1X19A 4PGGA 2Y0SN 1QGPA 4XFGA 2X6XA 2ZXQA 2IRFG 4ZDPA 3HMYA 2R7XA 3ZN6A 2CQQA 3HUGB 3IMMA 5LY1A 5KHIA 2Q1ZB 2EAAA 4LO6B 1SVMA 1JYVA 1C1LA 3KGLA 3CDIA 5IJRA 3Q0VA 5HV4A 5CQGA 1JH5A 4CCKA 4NHXA 3BOQA 1DQ1A 2VW2A 4DQ2A 1H8TA 3ZQHA 3BPXA 4A3ZA 4XEZA 1WI3A 1RUD3 3K77A 3DPTA 2VVDA 3VBUC 3BU0A 5C8CC 5BUVA 4UWDA 2PG4A 2IUWA 2YZ4A 2ADUA 1KU2A 2FHRA 1VBE2 2CO5A 4DY5A 1Z7LA 2V9PA 1PGW1 1VQKI 3L7WA 2KIMA 5A7QA 2CSOA 2ZMNA 3HOWJ 4Y1XA 4RM3A 4XDQA 5T52A 1U5IA 3NWKA 2LF7A 3G1MA 5LBBA 3FXQA 3SXYA 3ABTA 3JUUA 3BTXA 1BM9A 2CTVA 2NNYA 4A3CJ 2MD0A 5C3OA 1KU7A 3TEYA 5DDGA 1TW2A 3RMXA 2WTEA 4DYQA 2ES3A 4IEUA 4FSJA 4L97A 3KIOA 1KZHA 4ENJA 3PSFA 4AAPA 4CDUB 4DS0A 2PFBA 1I1SA 2ZMEB 5C5TA 1ND3C 2YSRA 4LLGF 4RGUA 1AR73 4A3JJ 4UBHA 1LDDA 2G1MA 2PXJA 2CAUA 3OJBA 2VC0A 2HOSA 1XXNA 1SDDB 1FT9A 1BYHA 5T5JA 2R7UA 3BUCA 1ETWA 1DBNA 4XQFA 4ZU5A 2ZMEA 5M3FJ 2LTNA 3KF5A 5G05L 2I45A 4FAGA 5CA6A 2C5DA 1K79A 4GMP3 1ZBE2 2AYHA 4UW6A 1BW6A 3DBHB 2X1DA 4D8MA 3P1IA 1NQJA 5FPAA 5L9VA 2VQLA 3UKGA 4AVVA 4D7MA 5DYMA 1WWYA 2EFQA 3GTOJ 5FLVA 1BEV1 4D1QA 4M3CB 1BEV3 2P4EA 4INDA 1OPOA 2WBMA 1CJPA 1S0CA 2QQWA 3ZQCA 2XL9A 3FLRA 4BL0B 4AQSA 1OFNA 4LBKA 4PQQA 1E3PA 3CLQA 3GX4X 1YO5C 4SBVA 3JAMK 1NZIA 1TMF2 2A6WA 3TOAA 4EWDA 3DEUA 4NB5A 3CCUI 4N43B 2LKPA 3MBWA 5JDBA 4UF0B 1PK6B 2W00A 3OIQA 2RDPA 4JGYB 4Q1RA 4NN0A 4UW3A 1D4M2 2QQBA 2A5ZA 4GAZA 1OMIA 3K7AJ 1J84A 4OMDA 2BY2A 3A21A 3OBTA 1GQHA 1AX1A 3S57A 3AFHA 3LA2A 2BVBA 1EH8A 2DFHA 1X1AA 3ZOBA 1F36A 1W6NB 2ELKA 1BI0A 4IEYA 4WK8F 5FAXA 3HGYA 5EEAA 1LQ1A 1UXXX 1IV8A 3VBUB 1RC9A 4KFCA 2AO9A 3KV6A 3CUQA 2QZ3A 2RMU2 2HTSA 3OYDA 2PQQA 1JJ6C 4AL9A 2BV4A 2XB6C 3UL2A 1RUF3 1UN1A 2RS11 1GXQA 4Q0SA 3WD5A 3WV6A 4UW4A 4AC0A 3DTKA 1GZ9A 2Y8KA 3BY6A 2H94A 3F22A 4IHWA 3ZMDA 3P5BA 2CAVA 1S7AA 1JUPA 2WAAA 2VASA 4YVSC 1T0FA 1CX4A 1W0NA 5LFAA 4D69A 4HNVA 3VL8A 4E6KG 2DCYA 1NYWA 4Q0UA 4Y20B 1A8DA 2P7CB 3V0AB 4XBLA 4S0HB 3WGIA 2LALA 1R1TA 2QBYB 3H5AA 5F5AA 2O8OA 2VUJA 3CCQI 4GWNA 4E70A 4AEDC 2W24A 2VUCA 3DPUA 3DUIA 3G1LA 3WUCA 4XLEA 2W87A 2BBVA 5JLVA 1SC7A 2JIJA 3CF6E 1Q8VA 2XC7A 4N8MA 1VBA1 2IPQX 4UUTA 1FYUA 2WABA 3WR0A 3KX2A 4MX3A 1SPPB 4I0AA 1YI2I 1BC8C 2KLOA 5CBLA 1JN2P 1F1ZA 4XR6A 2COBA 1PM7A 2ZSHB 4LJZF 3IM0A 3FBNB 1V6KA 4LO8A 1J9IA 3BIWE 4OQ8A 5FO7B 3KLOA 5T54A 5A3LA 1K5MA 3FXLA 3AKRA 4HF0A 4BXXJ 1LOFA 1O4YA 1WJAA 1Q1HA 1K4TA 2O0OA 3PURA 5DAXA 1ODMA 2IS1A 1XU2A 3HT2A 4XRMA 3CQZJ 3O1UA 3PIOF 3JW4A 2F2EA 4LO4B 4A2UA 2MLKA 4L18B 1T38A 2IXSA 1G2HA 4R4XA 3VHOA 1PZ8A 3BTCA 5A80A 4WVZA 3L2YA 2DTRA 2ZAHA 3BR2A 4P9WA 4AVSA 1DQ4A 5CYYA 2H27A 1JS9A 3AKZA 4LQRA 2W46A 3TN91 3CJRB 1ND3B 1FNNA 2BQPA 2ZMEC 3ABUA 1MDMA 3MV01 2RKHA 3K10A 4QXKA 3QBQA 2JSPA 1ZQ3P 1VIWB 4PJYA 2D45A 1NLSA 3KF3A 4C1XA 5D6EA 1GU3A 2XAGA 4UB8C 3IL2A 4D7SA 3LDBA 2A5YB 1AZDA 1ND3A 3NAUA 5FO8B 3I4NJ 3VUOA 1HJFA 4ZXEA 1MBKA 4A3GJ 2BXZA 3ZN0A 1HA8A 1TWCJ 1QHHD 4YZ1A 3UT0A 1B35B 2DPDA 4M71A 3J8F2 2ET1A 2HLEA 5CFCB 3NV2A 3FMGA 2M9HA 2A07F 2STWA 4XURA 2XDVA 2XVGA 3T1BA 1XNBA 5F0HA 3ASIA 2XLFA 4I02A 2LY9A 1A78A 1NX9A 2DURA 3F72A 3KV4A 2GA2A 1R7JA 2F6CA 2E26A 1LOGA 4U0WA 3OYAA 2C24A 5FREA 2E1MC 3NKGA 4YGDA 4GWMA 3VZMA 1CAUB 3I2OA 3VBSC 3ZFFB 4DB5A 2QKDA 1CESA 2L9LA 5L3FA 1FOKA 2QLZA 2V6EA 4Y33A 2VH9A 2A3SA 3MEXA 4L8QA 3BZCA 2DYSH 2ARBA 4LOTA 3K69A 3DPRA 4OMYA 4AFMA 1AHDP 2BNNA 5H9PA 2KM2A 3FJSA 4L9BA 4ETSA 1VB2A 3FE5A 3K2ZA 4X6QB 3WTYC 1O59A 3S32A 1USTA 3BJ6A 1OH3A 1XSRA 4UFJA 4P9XA 3S3NA 3KP4A 1BKZA 1MS4A 2HWD3 2ZOEB 4FI9A 4P1WA 2CGNA 4UYBA 1SFEA 2DMQA 1GYKA 5C6CA 5FLXK 4BY1J 1A5JA 3R4KA 1YWKA 1ZX5A 2STTA 5BYNA 2WWUA 3OS1A 5GAHJ 4Y17A 5CG8A 2JUGA 2WV0A 2WDBA 3OWTA 3B02A 1JYTA 3H42B 5C3PA 4OIOF 4XJWA 1JHFA 1LJ7A 4Y13A 5IY5H 5JSOA 2ZFUA 2EINH 3V7SA 4F52A 3CMAI 4L0ZB 4CSWA 4D7NA 3AJYA 5FKBA 1S1AA 3A03A 1W3VA 2IXIA 3C7EA 3NNLA 3ZFGA 2XMLA 4P08A 1SACA 4COVA 3WTVC 1YJNI 1A6IA 2DOFA 2DA5A 3GJAA 3BP8A 3BQYA 1JMUB 4P5OA 4DUXA 1W6MB 2MA3A 5LASA 1BJQA 4R9DA 2ZGRA 4EE2A 1GQPA 1Y6IA 2R7FA 3V56A 3H3UA 1ZG1A 2D1HA 2XF6A 3K4MA 3TAYA 1XMAA 2G0EA 4QD2A 3EXUA 4E27A 1TMF1 1K12A 2RQPA 3T30A 3FK7A 1VRH1 3U78A 1C8M1 2FX0A 1R22A 4QX2A 3LPGA 4XNFA 4PLNA 2KIUA 2DMNA 4WVVA 1YFHA 4XN0A 4IDZA 1ND2B 2L0KA 1RMU3 1R081 1FYKA 1DU6A 3I3MA 4JHZA 2V5DA 2K9LA 4BHBA 5FKNA 4CZSA 3ASNH 3PFYA 2EALA 4GMP1 4JOMA 2BOLA 1Y9MA 1REPC 3G6EI 4GB31 3SZPA 1BIBA 3WTXC 2V73A 4CEYC 5FJ8J 4ONUA 4BU2A 3B9CA 4I3PA 2W5FA 1U12A 2WYSA 3TDZC 5IVEA 4W65A 2OUHA 2RS53 3PVBB 2CFXA 4L99A 3BDDA 4ZYHA 2GM4A 2K9QA 4QX8A 1F8VA 4QGLA 3I3EA 1SMVA 4E4ZA 2HOTA 3NNMA 3I2HA 1ND2A 1D3YA 2HTJA 2QDNA 1Q5OA 2E7XA 3OMYA 5BQTA 4LA2A 4MFEA 3AAFA 3VBRB 1OT5A 1KS5A 3I2KA 4AQTA 1QJFA 3LNQA 2XROA 2ZKLA 1D5VA 4ZC3A 4UB6C 4GMP0 4RDUA 3LDRA 2AENA 3LEMA 4V19K 3E5QA 1GKBA 2QE3A 5J09A 1IN6A 2WB1A 1KYZA 1OKQA 4I7HA 1BBT3 4MYEA 4Q2FA 5IP6A 3HRSA 3NARA 2F4LA 3ETQA 5DZEA 1TQPA 1GV5A 4F3JA 2RS33 3QH7A 4RD7A 2AZ5A 4LK1F 3GM8A 3RQIA 4ZHNA 5JCTA 4RS5C 5M5XJ 5FRMA 3ZIXA 5I8YA 2IEKA 3WE3A 3Q9VA 3R4UA 4COUA 1WLWA 5FKKA 4GA9A 5ICGA 3OCPA 4RFRB 1TME3 4GCVA 3T8TA 1EP0A 1U5YA 2L9SA 3K51A 1YIPA 1XGOA 2LM3A 2V26A 3LQQA 2VAUA 1BQPA 4H2AA 5A6QA 1S0BA 4UHTA 5A32B 5CZKA 5FP7A 2R7WA 2LKSA 2RS13 4BK5A 3FMQA 4YM2A 1LKXA 3KPHA 1NE6A 1D8KA 4FPHA 2HWE2 3C1DA 1LODA 3C18A 2F5VA 2XLGA 5D8AB 2YC2A 3UGHA 5DAPA 1V54H 4MGKE 1R083 3I4PA 5D8AC 1VBE3 4QGNA 1R71A 4IX7A 2JRMA 1SQ4A 4BYYA 1QO0D 2J1EA 3OL4A 4ET7A 3JRCA 3MYXA 1WJBA 3IIAA 2ID4A 3A01B 4N43A 4CP1A 2WA3A 3VODA 2TNFA 2J1TA 2CW0F 4BE3A 5GZEA 3M7AA 3T2OA 1EAH2 3IAM2 3IAPA 4K3UA 2WIIB 5CKTA 1VPHA 1X3WB 4X0GA 3K4ZA 3NNJA 3D6EA 2FMYA 2Y33A 3ST7A 2QYOA 2XVLA 1UYYA 3WHBA 3OTFA 4KDPA 5I93A 3N36A 3HOZJ 4JAAA 1HB4A 3CLOA 5FZOA 3CMYA 3K1PA 4BHCA 2OQ7A 5JI6A 2DJNA 1V5FA 4PJLA 2HXOA 1ZR4A 4W8JA 3TNQA 5C5UA 3I3BA 1EA3A 5L73A 5A3OA 1O3QA 4H55A 5LGTA 1RINA 5GTIC 4HX7A 2KHMA 1LU2A 3M1HA 4TSVA 1ZH5A 2VD7A 5C4WA 4EM0B 2CV1A 3VHRA 3C7HA 2BFUL 2FNAA 1PNFA 3K4BA 4JP0A 1RUJ3 2QF7A 5BNQA 3OUJA 3BZKA 1O3TA 2HZTA 2XGEA 4Z07A 2WZR2 3OGSA 3S17J 2ARCA 4YW3A 3VDAA 2CQ7A 4BH9A 3ZVXA 4P9FA 4M73A 2Z99A 2PMUA 3C8XA 5ACA1 3L09A 5F3GA 5FZ8A 3SYTA 1SFXA 2GOXB 3OPZA 1N78A 3FM5A 3E6DA 1RUNA 2J7MA 4CE8A 1CIWA 2ADEA 5K7FA 3ZXEA 4NRMA 3VYUB 2Y38A 4PJMA 5SV8A 4BIOA 2JWTA 3M8EA 5C8CA 1G59A 3ZXAC 5A3PA 1TL8A 2RDRA 1N3QA 4CTEA 1PO12 3OV8A 3TNPB 3PJRA 2BOIA 1DGLA 4MXWB 2WLQA 2XWJB 3GBWA 1YX3A 4QTRA 2WINB 2ZEWA 3HBZA 5E8IA 1RHI3 3CC4I 5DN2A 2VTXA 5CG9A 3FDYA 4Y1VA 1DFQA 1X3UA 1HX6A 2X48A 4PDWA 2B39A 2IGNA 3ZYFA 2OQRA 1ENXA 1CQTA 3INAA 1H4GA 3V8LA 2JE9A 2WT2A 1SAXA 1RMU2 3WDXA 1LHVA 3ROUA 2VR4A 5FPBA 4OHXA 5JPNB 3HEFA 2P6SA 3U07A 3KHCA 3O8HA 2AUYA 5JOWA 2VOKA 5GLUA 1MS3A 3LQCA 3FN9A 1R49A 4M6VA 1Z67A 2W1WA 4ZXKA 4DINB 3AYCA 4BE2A 1P92A 2P6TA 2HDDA 3SFIA 2JDPA 1JZ6A 3U21A 3R0RA 3FX3A 5C9AA 1T33A 3TEWA 1K42A 5JR3A 5JZGA 3FHIB 5A3MA 1VF9A 1POV3 3CZUA 4OZXA 5ICCA 3PMEA 5DUXA 3FXKA 3VD5A 3WTWC 2IZWA 1XOYA 1JKQC 4N7IA 3KVBA 1JKOC 1RUE1 2V5YA 5FYIA 2VZ1A 2Y69H 2LSOA 4LIVA 4RM2A 2F4PA 4LR4A 4XDPA 4GD4A 4QQOA 2A5WA 5HS8A 2Y26A 3KE2A 4HBNA 4QGMA 3QU6A 2VBBA 4YZ2A 4YIRX 3FKIJ 5KXDA 4KT6A 3SZGA 2L54A 3U1XA 5J96B 5EP9A 2GC3A 1UNBA 1WUVA 4CDWA 2ACJA 5HNFA 1B9MA 3MZ8A 3WU2C 4IRIA 3H8UA 4W6YA 2IS6A 1FOD1 4RBOA 1MEC1 4I0BA 4U88A 4XIKA 1T8IA 2R041 2YPRA 1U5TB 3I0TA 1H1MA 4N53B 4ASMB 2XF7A 2QSFX 3OGJA 4W4ZA 3PL0A 2VOVA 2VCCA 2QQVA 2Q0AA 3VYRB 1HRV1 1W6QA 1F5JA 3E6CC 2EFNA 2D6KA 2IP2A 3N4MA 2DWRA 1O5LA 4LXLA 1MPXA 4B47A 1HLVA 1XSXA 3DLAA 1MZFA 3ECQA 2WSUA 2BW8A 1UIJA 1JUIA 1F4HA 3ZXSA 2IWGB 5HS7A 3O0VA 1D0GA 5FZMA 1ETYA 1FV2A 2CW8A 2H8WA 2HYGD 1OD5A 3CLPA 2A70A 3ZN1A 4AFAA 4YIIA 5A2QK 3ZM8A 3O1RA 2DCKA 4CP0A 1QOOA 4HT1T 1EV12 3VHNA 4K20A 1QQP2 2CS3A 3BALA 5E3OA 1WQ2A 2WFF3 1X1CA 1IQAA 2D6NA 1U9NA 3R0JA 1QVUA 3JRAA 1RUC3 4Q4V2 3EQLF 3PVNA 4JK1X 4Y22A 1SFOJ 1CPNA 1RUI2 4QX7A 2QQIA 2V1XA 2GSYA 1RIRA 2R7OA 1QEXA 4HA8A 3HKZN 4NBQA 2OAZA 2CQKA 4BQ4A 4CEWB 3B69A 1G6NA 3DPLC 5LK7B 4HX8A 3WXPA 3OYHA 3T0BA 1UWWA 1WZXA 4S2DA 3TKYA 4LB6B 1TVGA 4DBQA 1B6AA 3OYMA 2GNDA 2YUEA 1QZZA 3RGBA 2MEV2 3WG3A 2GXBA 2ZGUA 4IE7A 5BNOC 3DCQA 4XBNA 5ABJC 3QP6A 3VWBA 1FV3A 4MLOA 3GTQJ 4E7HA 1OFSA 4XLHA 4M4RA 3IKVA 1XB4A 4DZJA 3S30A 1XG1A 4ZYEA 2LOOA 1NCRA 2C6SA 1C5HA 4MEXF 2EV6A 3AL5A 2XAQA 4L9VA 2V4AA 2Y64A 1QF3A 4QDRA 1AL0G 2HOAA 2HPIA 5FMDA 1POQA 2PQ8A 3TYJA 3D3AA 3WQBA 3T0DA 1SCRA 2RREA 2Z79A 2GMEA 4G6QA 4XORA 1FMD1 1RZ4A 2VOXA 2B4KA 3WG9A 2Z3YA 3WY6A 1K5MB 3MW3A 2FBHA 2JICA 1E17A 1LR5A 4G9YA 3RWKX 2IGMA 4XYXA 2P5KA 1MSEC 2FBKA 1V6NA 2J1AA 2X5IC 3ZIWA 2RS31 3IZOA 4C8DA 3OYIA 4PIXA 5EZGA 4CUAA 2ZAAA 2WKKA 3KCYA 2HWD2 5FY5A 2L9VA 4K8FA 1E5IA 1V70A 2NVTJ 4XMAA 1VQ4I 1OLQA 2OV7A 3RFRA 5AFEA 3V0AA 1R4MB 4UNOA 5K5QA 1F9NA 3B73A 2RR12 3T2TA 3WF2A 3WDTA 2RR11 3WZ1A 2WZPP 5BOXA 2QVOA 5HS9A 1OSGA 2VZUA 1W7PA 3POIA 2JG8A 3CP8A 4ZS2A 2JZYA 1UELB 1RUH3 2TCTA 3AC0A 5ILUA 3VBHC 4DNYA 4JRAA 4CH7A 4CUBA 2V72A 1YE9A 2PHFA 2H8RA 4COWA 4RAFA 2WFPA 1UY1A 2FMLA 3ZSEA 5IT9Z 3E5UA 3PUIA 1IRXA 4HSTA 1H2KA 2A6ZA 4Y1UA 1R091 2EIEA 1R092 1JU3A 5TSWA 5DUWA 3LE0A 1BHGA 3LMMA 3FM3A 2YROA 3COAC 2Q5TA 3MFKA 4L9JA 4L5IA 3GTKJ 3ZXFA 1NXD1 3ZKUA 2XSDC 4BMBA 5D6FA 1QXPA 2LW8A 3FFZA 3OY8B 1HXS2 1YO8A 1W9WA 5IVJA 1Y1VJ 4RQPC 4YWAA 2ARXA 1DQ5A 1IXCA 2XQXA 1PO21 1V9U1 4Q1PA 2MPFA 3T2PA 3U75A 2GAUA 5IP9J 1B8IA 1OYWA 2VT2A 4R9BA 4DXRA 4X8NA 5GP9A 2EZKA 3F8CA 1FSEA 1U8RA 3S93A 2JG9C 5HVQC 4DO0A 5BNPB 1OKOA 5A1AA 3VB2A 2W2IA 3U1DA 3V7CA 3BC8A 3Q0WA 2ZEYA 4Q48A 2EZHA 1ZZ7A 1LEBA 4RLFA 1W6NA 4MTEA 1TWHJ 2OZJA 1JW6A 3LD8A 5IK5A 1RJ8A 1V6IA 1QNYA 3HNMA 5KAIC 3O7OA 4CDQB 2RC4A 3S2HJ 3IH4A 1W9YA 1F43A 1MS9A 3ACLA 1GDTA 1S6LA 4FAHA 5GADJ 2WFF2 5K7HA 1AHSA 4Z92B 4BKXA 4AD9A 1PP7U 3MGUA 1OLRA 2V9VA 5FY0A 5JMCA 1YRNA 3THTA 1NCQC 1RB8G 5GZFA 2GH2A 1R58A 3CF5F 4BQAA 5EZWA 1YRZA 5DZGA 2XKOA 4GJZA 3HTSB 3I55I 3H3ZA 1UKRA 3DV8A 1YITI 4L9TA 4CCJA 4G6TB 3AP6A 2DCTA 2MBFA 2WRAA 4WZFA 2YU1A 4DZGA 3WHCA 2LMDA 3IRQA 3DLLF 5BNGA 1UKGA 1MMSA 4DXZA 4MVTA 2JDYA 3CCSI 2ID6A 1U2WA 4BDVB 2A1XA 2Y6GA 2KRHA 3D1NI 1DUXC 2XJRA 4M3GA 5I0DA 4URAA 5JVGF 1HB3A 1R36A 2P3YA 1UFMA 2Q1FA 3HOUJ 3ABMH 3RPQA 1YXWA 4QKFA 3ZMTA 4LKEA 4UFHA 1EV7A 1G9FA 1RHI1 4IGOA 3MLKA 4I30A 5J98B 1T56A 4CU6A 2F5FA 1Q3EA 3H1YA 4KIGA 3OUHA 2W95A 3ZX7A 2K27A 4CCEA 1OXCA 2R0HA 1BR4A 1ZZ8A 2PYTA 3NMBA 4PBOA 4G3YC 2VMEA 2W92A 5FJHA 2A6HF 3W21A 1L0OC 2HWD1 1WCQA 3I58A 4U7DA 3P3PA 3ECOA 1LOAA 4OMZA 1OD3A 4IOAF 5DD8A 4GXOA 2FQ3A 3IV5A 2VZSA 3FKJA 3J7LA 1W2TA 3PU8A 5CLSA 1IKPA 1WA4A 2ZACA 1F4AA 3ITQA 2D5HA 4PCQA 3F8NA 2KR2A 4QB1A 4UFIA 5B5EC 2DYCA 3I2IA 5GPAA 3Q8FA 1XCBA 5FYYA 5FLXZ 1O5UA 1UZWA 1W39A 4CCNA 4O65A 5CKQA 2VE9A 3VBOB 4WZCA 4WV8A 3KP5A 3GZ6A 2DFCA 2M4KA 3CL1A 3DXUA 2JB8A 1Z7S2 3JRFA 2HGCA 1YQ8A 4BJ5C 2BZDA 5KHKA 3BJOA 2ZB9A 3ZYGA 2L4MA 1EY2A 4IE5A 3OS2A 1UZ0A 1LOBA 1K78A 1ULFA 1OKRA 1LHOA 4DOUA 4L11A 4FTBA 5F27A 1H6XA 4I3GA 5E89A 3O1SA 4JKKA 3BR5A 3HUGA 3WP6A 2ZEXA 4UV8A 3AL6A 3VBUA 1I1EA 4DYCA 1QU0A 2EIJH 1RR8C 1G4DA 2ZS6B 5EXOA 1JZ7A 2GXAA 4UFLA 3NNFA 1GVDA 5IYBJ 5FO9B 2JDZA 2ZXIA 2BE5F 2WS91 1ETKA 3ZFEA 4XL9A 4XLNF 5LGNA 4BXSV 1WH5A 1TQ5A 3HOBA 2WYFA 2VMFA 4CXWA 2DTWA 2YY1A 1MBGA 1Z05A 4IQJA 4OI4A 4NC6A 3NWTA 2BGPA 3U0ZA 2NYYA 2KD7A 4QXCA 4C2TA 1HRI1 4XMYA 4OLLA 4RGAA 5J3UA 4YM1A 1QKQA 2IA0A 1ZVFA 3M2MA 1NA1C 3BPZA 1YYNA 2R7QA 3ZMVA 4MGZE 4KNCA 2YMZA 2UUZA 3GZ5A 1R6RA 1CJDA 3IBMA 5ILSA 1O4TA 2PLV2 4NIDA 1R5GA 5FYTA 2EFPA 2Q8DA 2E36A 4HPKB 5L36A 2I2SA 3OPWA 3H0OA 3MPPG 4IEXA 4QB6A 5FQ0A 5FY7A 1ASJ3 3ZPYA 4RN5A 3BG9A 3GZUC 1IUFA 4JX4A 4HF1A 4JKLA 2BFUS 4IV1B 3GZNB 2MD5A 1P6RA 1KQ8A 1H9GA 3FXOA 5GZCA 1T08B 4D6SA 3D8CA 1TQIA 1QJEA 1TMF3 4A3MJ 1DP0A 3N9MA 1NCQA 3CCVI 2DCJA 2IXJA 5A1LA 2HYFA 4HMZA 4UT5A 2QQPA 5J1XA 1AYN2 1MZ6A 1SFUA 3V0BA 4YW1A 5EG0B 3JREA 3VN4A 3I2JA 3H5RA 5HPOA 5E3MA 5IFTA 5CVJA 1GMMA 2UURA 5EJZB 4U2AA 1VFCA 4Y1ZA 2BBAA 3A2KA 2VMGA 4Q0PA 1PVC1 1GHCA 2HWB2 1U0AA 4FPLA 4BNCA 1Q8SA 4LO5B 2HWC1 5CKNA 2NVYJ 4OFGA 3KSCA 3N35A 3FFQA 2WAQA 2KMUA 2GN7A 3H8XA 4MSVA 3RSNA 1S72I 1DQUA 3ABKH 4UV9A 1R4NB 1TNRA 2XUEA 3AKSA 4FTSA 1ON2A 2D3SA 4IV3A 3DEEA 1GZTA 4WVMA 3WINE 5F3IA 4CYCA 4D5CA 2AR6A 1WJ5A 5T5LA 4X6RB 4WM8B 2EA2A 2HOEA 4KJZA 2HYXA 1GBGA 4RGRA 1DYOA 1V0AA 1HN1A 4QMAA 3JXSA 3SXWA 1D4M3 2HH9A 3VZKA 2G9GA 1ETXA 2OBPA 5FZ7A 1NTCA 3POSA 4ENNA 1W1WE 2JEMA 4XXAA 4XXPA 4L0YB 1XBFA 1YQ5A 2ZBKA 2ZJ2A 3PUSA 1ZYRF 1C3HA 4YZ5A 1OI6A 2XWBB 2GZWA 2AEYA 1SFNA 1NE4A 1PGL1 4G7OF 4AVZA 2AHQA 3I71A 4HNTA 2GOMA 5FZOB 2JE8A 2HWC2 4LD5A 1VBB3 5H9QA 4MZUA 4AEDB 2UYAA 1WMEA 2K9MA 4JGZA 3T2QA 4EN9B 2ME0A 5FROA 3RYKA 4AXOA 4HFSA 1UQXA 4A6OA 3GCMA 1S7EA 5HOOA 4AU7A 5A33A 2E1OA 2P8TA 5D1IA 4AVTA 2Y6JA 3LIGA 2PMZA 2JD4A 1MBFA 5GPCA 3JTHA 3CDHA 1Z0HA 5I0TA 4OIPF 3WT3A 1R00A 3MIHA 3CIHA 3DU6A 2OZ6A 1QJY3 3AB0A 3GBFA 2Q2EA 3MPBA 3KMHA 3N9QA 5JLXA 3CCMI 3AZWA 5IYCJ 4E7IA 3K4AA 3WNXA 1K6OA 3G1OA 4CHUA 2M0MA 2XF5A 1QQP3 1XQNA 1FX5A 4XKWA 5LEJA 2XVCA 1VLNA 2FJ1A 1I5ZA 2WWJA 4PK4A 3RTRA 2HEYF 5DM6F 2DVAA 3WNMA 1PMIA 1UX6A 3WDUA 4CDXC 5L9BA 2LVSA 1U3EM 4RAGA 1JI6A 1RUI3 3KEYA 5CEHA 4IEQA 2HJIA 4IRGA 1CPMA 1SD4A 4OYUA 3JB8A 5JFRA 4GO1A 4IRHA 1FMWA 3AYAA 4PI2A 3LSHA 3USUA 4LKSA 2XSJC 2L4AA 4XTPA 2OPKA 3RQ4A 2BEOA 2DDUA 2X8KA 4DOZA 3MZHA 2R071 2TRTA 4PHZA 2Z5UA 2X09A 5IVVA 1FXZA 2D6PA 5CFCC 1T95A 4AI1A 5A6ZA 1BA5A 3WW3A 2QQLA 3H50A 4XSXF 5C4WB 3F8BA 2Y6FA 2F48A 2O7OA 5BPDA 4LORA 1RUG2 3IH2A 1C8M2 4IKFA 2HKOA 4Q8LA 3P7NA 1VBA2 1GSLA 3N97A 2VBWA 4ENKA 1X1BA 2GIVA 5J6XA 2UY9A 3P3NA 4YVWC 3QYEA 5D5WB 1W99A 4QWQA 5BPIA 1FP2A 3GF2A 3JCUC 1MBEA 2DU0A 1QIQA 1ACCA 1RUD1 1KITA 3SISA 4NRQA 5A3NA 4XQDA 2UXXA 4XLCA 4R79A 2C9KA 1APLC 3EJKA 2YC4A 2GNMA 2RV9A 3MAJA 2FZ2A 4OU0A 1SDWA 3S2DJ 3A01A 4L5EA 4Q5OA 1Y4WA 1VQ8I 2PAKA 3G71I 3GUDA 2JG8B 3OR1C 5JHUA 3AXEA 3UJOA 3BPSA 5A6XA 4PCRA 4HK9A 4DXTA 4COYA 5ACA3 1KYWA 4QPIA 4B8EA 4AI0A 5FZ0A 3H9QA 3Q8CA 5D8AA 3EYYA 3BU7A 5EV7A 4HQEA 1DU0A 2RAEA 5FPUA 1ZR2A 2L2OA 5C8WA 3K70D 4YSFA 3AVRA 5HODA 3MIDA 3AMMA 4PF5A 1J09A 1XE0A 2DA2A 2K9ZA 2BP6A 1YLFA 1QBJA 3RNSA 5JHFA 2UWAA 2R0FA 3M8LA 5D5XB 2JKBA 3IDEA 2R7RA 4LITA 1XTAA 2VPLA 4D5FA 1LHWA 2I10A 1DGWX 4AFCA 4WXCA 2L9RA 1R1VA 3RWNA 3T4HB 3BB6A 1DPUA 3W5MA 5FLIA 1CN1A 1ODNA 3ZFEB 4A7ZA 3S1QJ 4YW2A 5IAXA 3FXRA 4KBBA 3PO2J 4BQNA 3PDQA 4A3KJ 3IDAA 2N7GA 1DGRN 2VODA 3BLYA 5FXWA 3G6JB 5L7OA 3HRUA 4LEJA 4FHTA 4QPGC 4IERA 1QRYA 2KRFA 3SC7X 3L2CA 3AKPA 3FISA 1QJZA 4B09A 4XC9A 5FY9A 3R4SA 4XICA 2IBDA 1EPZA 3EUHA 4XJUA 3BWGA 4BLIA 3ZXKA 5JSRA 3KV5A 1N47A 2RQQA 1P8JA 5E79C 4HONA 1Y8RB 4LG0A 5E1ZB 4JDNA 3QRFF 4H7MA 5IAVA 2R062 1O6UA 2CHHA 1ONVA 1PO11 2QDRA 4D0PA 5E1RA 1TBXA 3H3LA 2OF7A 4FT8A 2LUWA 1PMHX 4AW7A 3OYCA 4R8HA 5HNHA 5FZ6A 2PBIA 1WMFA 2VMDA 1V6MA 1BEV2 4IGPA 3UK9A 2OA4A 2O8XA 4CPBD 2YDEA 4AOCA 3DEMA 4XJZA 5C70A 3GEZA 2AXLA 4N0BA 4RA0A 5F3CA 3OS0A 4LE4A 4HDVA 4XKVA 1YI7A 2MG4A 3HSEA 3LSRA 4CEYB 3OL3A 2NS8A 3DYMA 3VBFC 4IETA 5KHJA 2IFRA 1CWPA 5F0FA 5ILVA 5FWJA 2K9NA 1O7LA 4NC7A 3A7QA 5CJ9A 2CYFA 3CEWA 1UMZA 4AFDA 2L9NA 2W52A 2LY1A 1J0RA 1STZA 2NP0A 1UY2A 2XJSA 2BVMA 1YJ9I 2W1OA 2FCUA 3WQ7A 2R5YB 4WM8C 3PNTA 4LBMA 1JYIA 3LWCA 3ZQLA 1M06G 3LSKA 3CO2A 1AU7A 4A7KA 2WFF1 2LBFB 3HHGA 3BJAA 4A3EJ 1BC7C 1OVSA 5DABA 4ZKTB 1ETOA 3FMSA 1D5YA 1W6OA 3N7KA 4XM3A 1W8OA 3F6OA 1DP3A 3U4XA 1IF1A 1CAVA 3ME2A 3VBSB 1W6QB 3HZJA 2EA7A 1WJDA 5C33A 1QDOA 1EV13 3TBDA 2LK2A 3EUAA 4QM8A 1PVC3 4EJWA 3OBZA 4XOPA 1JT0A 2XRNA 3VB9A 1OQDA 1S4CA 4P55A 1JZ3A 5FXVA 4HG2A 2HNHA 3WGGA 4BK4A 5EZHA 2Z1DA 2WZ8A 5GLWA 1LRHA 2F6BA 3J7NA 1SHWB 4FPFA 4EZHA 2GH8A 1X33A 1QXRA 1GR3A 1GANA 1Z7S1 3TO9A 4O61A 3ACHA 2IS4A 3HPNA 4WBBA 2KFDA 2AS5F 2DUOA 1QXJA 4RR3B 1SBDA 1GP4A 4QDQA 1PUFB 1PNGA 2B42B 4CZZA 4QPOA 1NG6A 2V6CA 4MHRA 5L9RA 3LSMA 3THPA 4II3A 1BBT2 2KDZA 1IPJA 1FBUA 3JCIA 4HW0A 3WG7H 1REEA 4FFGA 3CUQB 2VQHA 4E4SA 3DKYA 1PM4A 4IO9F 4QX3A 3FIWA 2IVJA 1Z91A 3DPRB 4OVEA 4YG0A 4FCYA 1ETQA 4QX1A 1NH3A 3CBNA 4KWJA 1JXSA 2JQ7A 3MEPA 3MKWB 4NHJA 2YB7A 5LRRA 2L01A 4M3DA 2VZQA 2QFEA 3CO7C 4P00B 3VBOA 2J1SA 4XLFA 4NUBA 3TN92 2OT7A 2GIZA 2MLGA 1XMXA 4OAZA 3I54A 5J7MA 1F31A 3OYGA 5FWEA 2XHNA 3GTJJ 1J1LA 3CJNA 1R082 2E32A 1W8TA 2RJLA 5H9SA 1W3XA 4H0EA 4ATEA 3A0BC 4LBQA 1JKRC 4YVWB 1W4MA 2R072 1P2FA 5K1YA 1VQPI 1SFYA 4N7UA 1BK0A 5BNNB 3WTTC 2ISYA 3W6JB 4ZYGA 3KQ4B 5C4XJ 3WSOA 4AI8A 1JOBA 1VBD1 3J80Z 1AXKA 5C4WC 3GNEA 3IWFA 2VQTA 3DN7A 2JE7A 1RUJ2 3TMOA 5BXXA 1CAUA 3ZPOA 3CF2A 2IC1A 3RZMA 4CDQA 2P34A 1RIOH 3UR3C 3HNYM 1IZ3A 4DEQA 3TQNA 1W6MA 2VJ5A 3TW6A 2ZZQA 2OPTA 5F8PA 5DG1A 2E5ZA 2R49A 5HCBA 1JBCA 5FXXA 2CWEA 2ZHLA 5CADA 2OUMA 4O5VA 5LA9A 5F64A 3ZR6A 2ZPXA 3CCJI 1DU3D 5IVCA 4W6XA 1YS7A 2Q0OA 3OIOA 2D3RA 3MV11 2A69F 3C7GA 2VZPA 5FPLA 2UZKA 2A71A 3HQUA 3RRDA 3LEGA 1WBLA 1ITYA 2H0BA 2A3XA 4U0YA 1WW7A 4E2QA 1ULPA 2AQFA 1LE8A 2RJ2A 4YW6A 4DUVA 1G86A 3CMEI 1GWKA 3WQ0A 4LT5A 4Y5SA 2OQGA 2JUCA 1AR63 1KGSA 1C57A 3GYDA 5A7WB 3I59B 3NRUA 1WGPA 2PHTA 1ZG5A 4UI9L 3K4DA 4PUSA 3TRSB 2XGCA 5GKAC 3ZFEC 4HYEA 4NPRA 5EIYB 2LTPA 3NEUA 1IRZA 2DV9A 1XB9A 4Y20A 3I49A 1IV6A 1I50J 3G7DA 2EIKH 3NRVA 4JKMA 1F4KA 1C4RA 1WD4A 2Y60A 4NQWB 1LHNA 1XDSA 1UCRA 4MGSA 2N8GA 1R1A3 2EIGA 2XJUA 5B4XA 1RPWA 5LA2A 2M1BA 3QQAA 4XOTA 3N7LA 1ZGJA 3GO5A 4XRSA 2OTLI 2J1RA 2KJBA 4M3FA 1ZGAA 1W5TA 4PSWA 3DF8A 4IOCF 3J7AO 2CDOA 1EJ9A 5F32A 4HLXA 2Z33A 2M8EA 4LG3A 4AE2A 3CDZB 1O8SA 3NVCA 3WVJA 4IHXA 4W1UA 4V2WA 3O1PA 5GLTA 5FJKA 4KN7X 4N4OB 2YX4A 5H9RA 2QQAA 3S1NJ 3DBLB 4YFXF 1IS3A 1VNDA 2I5UA 4AQ2A 3N05A 3BODA 2L02A 2ZZJA 3POEA 2ETHA 1TG7A 1WJEA 1MACA 1MD0A 3AFGA 3SJMA 1Y56A 1AR83 3ZXDA 5AIQA 3HAGA 2X29A 2DBBA 3Q3SA 4A45A 4C0BA 5F08A 1H2LA 2GC2A 1UPIA 3DYOA 1B72B 4K2EA 4TV7A 1RJ7A 4N53A 4RGSA 5DD4A 3VBRC 4QXHA 2YC0A 1G8WA 1ETVA 1MIJA 1RNLA 5H6QA 2E63A 2YGMA 2UXNA 1NUKA 2G7HA 1MMAA 5E18F 4XBQA 5CVRA 3ZYJB 3VZNA 4ZTJA 4S2GA 3P9KA 4TTGA 4NO4A 1V6JA 1HDKA 5EYYA 1H0MA 1TT0A 5K8SA 1BVVA 3V8KA 2EXIA 1EUUA 1T98A 3O12A 3D5RC 4DFSA 1LOCA 1OCPA 1F35A 1FSHA 4JGZB 4E8DA 1WSUA 3VLBB 2NMOA 5BPXA 1YW8A 2R0QC 1AYN1 2UWCA 2QVSB 1HBXG 1Z78A 1RGSA 5F5IA 3VBOC 2GLOA 1AKHB 4QU2A 1W6OB 4XJAA 3GGLA 1P7IA 2XV4S 4FCAA 1Z3YA 3KHBA 1HXDA 4BGDA 3KZZA 3WEZA 4E4HA 4YM0A 2VBZA 2W3JA 1QA6A 2WA0A 5D8KB 5F5QA 1RUOA 5IT9K 3PSIA 1VJ2A 1BW5A 4G6DA 3HOXJ 1WGXA 1TZLA 1NY72 1F15A 3EYPA 4BCUA 4BWOA 4C2UA 3SZTA 4NAOA 3NJYA 1FOD3 1FMD3 3LDKA 1LEDA 4AG4A 2HU9A 4U0VA 3V0BB 3POGA 1T0FC 2F17A 3PJYA 4XAEA 1DQ0A 3HDDA 3K46A 5KHDA 1AYM3 4GH4C 1UW8A 2Y30A 4A5NA 4XONA 4MG2A 1MJAA 3W2AA 2X6OA 2WAQN 4PSXA 2QSGX 1B4AA 5GAEJ 2VO5A 1BI1A 4QKDA 2EVXA 3GCXA 3SMHA 4GIQA 3H7YA 1UX7A 1W90A 4G8XA 2H6CA 4C91A 1ZBE3 1NK2P 4MXWA 1FY7A 4XFFA 1COV3 2BDRA 4B43A 5LB6A 3M1EA 1W9SA 3DKXA 5HBAA 1PGW2 3RYRA 2E2HJ 4JQTA 5FPVA 4IL6C 3N9PA 2DPUA 5FD5A 3KFWX 4QAWA 1YHFA 2VXJA 4MGYE 2ZX1A 2C26A 1D4VB 1PGL2 1RXGA 2CUZA 4ZTFA 3OGRA 4GULA 1X4PA 4IF4A 4BBRJ 2G19A 4FOVA 3JQWA 2Z5WA 4OUEA 4O9GA 1XX5A 2LRDA 4LBJA 2LFBA 4L0PA 5LHIA 1LKNA 1JZ2A 2WUHA 4IE4A 4UXAA 2F5EA 3LOIA 2ZGQA 4FISA 2DTYA 2M4GA 2VZRA 3U9GA 2NZ9A 5FD6A 1XYPA 3U11A 3E3VA 3HM5A 1OCCH 1H2MA 3IT8A 2R7ZJ 4RHV3 1CF7A 3VV1A 1N25A 2P81A 2BGCA 3DWLE 1G3SA 3RMYA 4LNVA 4XABA 4A42A 4V2FA 1HQLA 3BTIA 2D93A 3I2DA 1CIYA 2FOKA 4Z2WA 1HN0A 4UFMA 3OF1A 5FYZA 3Q8AA 1HCRA 2V79A 2BY0A 4IVNA 3ZGKA 2DU1A 2A6EF 3N9NA 5T55A 2ZABA 1WW4A 4PI0A 4Q4Y1 1UZCA 5FZCA 5HDGA 4RB0A 2RN7A 4EQQA 5CISA 1MQTA 2AXTC 2VCMA 3VDDC 1XSDA 2DMTA 4DJAA 3SLIA 1GFF2 5E8GA 1VMJA 2R063 2P5BA 5FZ1A 4FTHA 2W08A 3SQOA 1YQ6A 5E6HA 3C2GA 2KRCA 4PDKA 3DKWA 2ZEZA 5LA1A 1GZWB 2D43A 3ES1A 3UNPA 5DAQA 3URFA 1MNMC 5DV5A 2E51A 4H4KC 1CQ9A 1JZ5A 1MMNA 4QDSA 1T39A 1P4AA 4HPKA 1WHUA 1LB2A 1JHJA 1FATA 2OYZA 2QM3A 1ONAA 1REFA 4NR1A 1C1FA 5FLJA 1QOSA 1GT0C 5C3RA 1Q43A 1HSJA 5AVAA 2BY1A 1UMQA 4O6JA 3IB3A 4XLAA 5JI9A 3OB8A 3F0CA 2L7MP 3OPTA 1USSA 2DT7B 4NPMA 3HOTA 5FY4A 2NPIA 2B45X 1IZ1A 1X82A 2WQ4A 2KIFA 3CJIA 4EM1A 5F6KA 5EGOB 5J1UA 1WKMA 2ET7A 1A31A 4H14A 4IEWA 5E16A 5F2SA 3S7EA 1ZK8A 3EO6A 3H3VK 2WWSA 1QDCA 2O3FA 4Q4ZF 2VUDA 5LY2A 4HLYA 2PFWA 3ERMA 2WQ8A 3AP5A 4BJ0A 4BQ3A 2HKXA 2F4MB 2FQPA 2QQ9A 1XNTA 3N9LA 2VTXJ 4EGYA 1NAEA 4B8XA 1NLQA 5L7OC 5FMCA 2D6LX 2E31A 3BVCA 2WAOA 4O7XA 4OI1A 4LOCA 2WV1A 4P9LA 4HVOA 3KP2A 5HDNA 1BN5A 1PUEE 4XKBA 4DPNA 3A0NA 3LL7A 4D7YA 1FBQA 3MQ0A 1YI9A 1VR3A 1G9AA 2EFOA 4KWKA 3GZTB 4UXNA 2E2JJ 1XD7A 3FXMA 1FZPB 3R05A 4U87A 1OFCX 1A34A 1MR5A 1OPMA 3T4VA 4E2GA 5KC6A 1GVJA 2DLLA 4RQPB 3IP4B 5H6RA 3FBMA 1FI2A 2O9LA 3ZFGC 3WDYA 4MIMA 1F2NA 2DT6A 2XRLA 1IN8A 5HV0A 3KT7A 4HX4A 4NIAA 3J4UH 4R9CA 1IS5A 2NVXJ 1QQIA 1N3OA 4XFAA 5KWRA 1I9RA 2NN8A 1X2MA 3PUHA 1H4HA 2YG0A 4J1XA 4PIYA 1FLIA 3ZYHA 2CV6A 3JSPA 2FBIA 1QNWA 1PP8F 2FXAA 1GXPA 3K4LA 5EEGA 4EN6B 4F7ZA 5JXIA 4Y1YA 1ZNPA 2J42A 4DEVA 2MEV1 5J1RA 3PUAA 5D5UB 4CEWA 2HDCA 3Q9OA 4Q4X3 5BNPA 1HW1A 5E17F 1HJGA 4XFBA 1RXFA 1W5CC 4N9HA 2VQ0A 4LLFA 1H30A 2MSYA 4DMIA 3V4GA 4FASD 1JTXA 2FSWA 2B46X 3CCEI 2V4VA 4KISA 1X2NA 1D2QA 1LECA 4CEYA 3T3YA 2VOTA 3ZMSA 2FE3A 3NQHA 5TGTA 4CP2A 3AP4A 2YFUA 4ZU7A 1G3WA 4KA4A 3K70C 1SVOA 5TRDA 1RVF1 2QBXA 3MI8A 3BROA 2C0ZA 3N3HA 1E5RA 3K4JA 4A3FJ 1OCZH 1K5JA 4ZPIA 1K5MC 2QBYA 3LB9A 2K0GA 2PHXA 3W3CA 1RUF2 1QZYA 4UUSA 3WX5A 4X6AJ 2O14A 2QEXI 2BNMA 2EF6A 2VGDA 4OI2A 5B3SH 1W7PB 4HF2A 4GRIA 3LAJA 4HOOA 2ETEA 3SKJE 3U1KA 2WSVA 2PAEA 1SFKA 5CFCA 3K2OA 5HCFA 1WMXA 1VE0A 2ZXWH 3KEQA 1IS4A 1A04A 1JOPA 4HN0A 1OUXA 3ENRA 2FU4A 2K85A 5I8TA 4QX5A 3JRDA 1V9U2 1LGCA 2MC4A 2B9UA 1IC8A 4RSUA 1IG7A 3DFGA 3LSEA 2CRGA 4YGEA 5FIXA 3C7FA 5LCWL 5DUUA 2ZNYA 2J1UA 2Z69A 3EHKA 1JE8A 4XRSG 1MQTC 5EJ1B 1L7RA 2E1CA 3LCPA 2DUQA 4ZZLA 2ZHKA 3M70A 1JXNA 4IESA 2R16A 4E8CA 2L7KA 4CXFA 3AFKA 4D9JA 3KCCA 4GWJA 1IN5A 4FPKA 1MH4A 2ZA9A 3T1LA 3VZJA 3Q8EA 3S7IA 3W59A 1MMDA 3ZN5A 3KV9A 1O8PA 2D98A 4HRIA 4B48A 3F9KA 3IH3A 3Q5FA 4JZRA 2NS7A 3GWZA 4CDWC 2BZTA 4XE9A 3PNYA 4CDWB 5BY5A 4LBLA 2DFBA 5FZBA 3O14A 2ZGTA 5G04L 2QQMA 5F0CA 3VKOA 3S16J 1KA8A 1UYPA 3QLQA 3LF7A 3OEAA 5DCMB 3HD8B 2K5CA 4CUCA 3ZMZA 3DF0A 1BI2A 2Y2ZA 1DGRM 3WW2A 5FGMA 1C5IA 4QT6A 4N90A 4YG2F 1KFXL 3BG6A 3BGAA 3HHHA 4ZS3A 3L2QA 3F2ZA 1S0IA 1D0XA 2RDQA 2ZGLA 3RZOJ 2K3FA 4J00A 1LHUA 1OJLA 1D0YA 3OY8A 1TEIA 2NAZA 2W48A 1PZ9A 3DPRC 3ZR8X 5DPNA 2JVHA 2XKPA 4WM7C 2ESNA 1IPKA 3ZFGB 3PJQA 2ZMKA 2X6YA 2Q30A 2CNAA 2XB0X 2LF8A 3OOUA 4Z2AA 4NQWA 4S2HA 3LFKA 4CP9A 3BG3A 1YJKA 4BXFA 4TZDA 3ULQB 2GDFA 1D1CA 1VRBA 2X10A 1K61A 4BBSJ 5A7SA 3WG1A 5ISLA 1ZLKA 1UZYA 5EWSA 2XJPA 3WG4A 4GDFA 1U5XA 2JDUA 3FF5A 3AKQA 1E0EA 3R0AA 4AAXA 3O1MA 3J8F3 2BW3A 3AZVA 4KMQA 1IXRC 1JGSA 2GMMA 2JDMA 2JJ7A 1UAAA 1ZBA2 2MHFA 1IDYA 2Y34A 3A1YA 2OC6A 1QJX3 2GXGA 4KITB 1RKTA 2QQNA 2ESHA 2ISZA 3EB7A 5EJCA 1EYBA 2QUFA 1RC6A 2IA2A 1PIV3 4KGGA 1PIV1 5A7WA 1GOHA 1D1AA 4EVIA 2EXJA 2VNVA 3M07A 1NQDA 2Y48A 3A02A 3CC7I 3PQKA 1JGGA 4P96A 3T08A 1FIAA 3GLLA 1MQTB 3PVOA 1QH6A 4CU7A 4FFHA 1OR7C 4XILA 1KEXA 3HN3A 3U4SA 1JUSA 5IYDJ 4G9SB 5KCMA 1RR7A 5CYVA 4ASLA 1AJKA 2JB4A 1VQOI 1J75A 1OCTC 4YVSA 1APNA 2FEZA 3MFCA 3B6CA 2M7AA 1S0JA 2M0CA 4N4NB 3WOGA 5JOXA 4OULA 3MIGA 1UL9A 1STMA 1B09A 5FQ0B 2EAKA 2R7EB 4UVBA 4WF2A 4LUKA 3ESWB 4BACA 4EZ4A 2CW7A 4KWLA 2XXZA 1Z0XA 4AWDA 4IE0A 2EXHA 2F4IA 3MKLA 3R6SA 1VRH2 1JUHA 1YIFA 4BQ1A 2DJIA 2DYRH 1UMIA 1POV1 2WNOA 1P4WA 1UOFA 1FOD2 2GU9A 4HG6B 1OOPB 3AMPA 1AWCA 5BNNA 3RDIA 3EQEA 4BPZA 1XPWA 5JR2A 1R23A 4UOJA 2AC1A 1W0OA 5CAZA 3HQRA 5CFDA 3U14A 1ZBA1 4E7LA 3JTGA 5K7ZA 2PHUA 2A73B 3F3XA 5LBEA 5T5PA 4NDLA 1AL22 2VN2A 4EQVA 5DCMA 1QJU2 1XC6A 2ILMA 2EJRA 1D2SA 1UAIA 2DDBA 1COV2 1L3JA 2LY2A 5LATA 1CZVA 1TWFJ 4XRFA 2EV0A 2KPMA 3VD7A 4PQ9A 2IW5A 1DGWA 1XGSA 1W8NA 1U8BA 2V1DA 3WQ1A 3ABLH 1OA3A 2LP0A 3ILNA 4I76A 3KP3A 2E35A 5GLZA 2DA4A 4KI5M 1O7FA 1SCSA 4LFUA 3J81Z 2NOJB 2PJPA 1R5HA 3IKTA 3CQOA 3C3VA 1R1A1 3V8JA 4YGBA 3RJRA 3AG1H 5FZLA 2H0VA 2WNVA 2W84A 4Q47A 5FO5A 4AHWA 4BQ2A 2A61A 1SAUA 2W0XA 3IIIA 1MW7A 3V42A 2G9FA 5JUVA 3VD9A 2R073 4XSZF 3DP7A 4FQGA 2BHYA 2E2IJ 1BK1A 3IHUA 2KXLA 5E88A 1IKQA 2VE1A 3S3OA 3SNMA 5JI7A 2VQGA 2OTJI 3HQXA 2A6TA 3ZYPA 3ES4A 2VKHA 5L3BA 3POJA 1BL0A 4QPQA 4LBNA 3USSA 3I5UA 3M3QA 4YARA 3GFIA 2A3WA 3JSOA 2PELA 4FPGA 5EPAA 2X5IB 4U7BA 4ZDOA 3MMYB 3QAHA 3BTYA 4J1WA 4QSHA 3S14J 1AR81 3BTZA 4Q5SF 1IGOA 1CAXA 5DCFA 3ZO0B 1HIXA 1NZCA 4AYUA 4OAYA 4XVHA 3BN6A 5DQ0A 1V6LA 1NCRB 3O8GA 3SEEA 4LGWA 3RCOA 1UOGA 1VP6A 1AL23 4AI2A 3QODA 3ELNA 1FWZA 4IZZA 4WM7A 2DAOA 2DA1A 1Y0NA 1WMDA 4H7LA 1JTYA 1FX7A 2WS93 1BXHA 1PJRA 1ZBA3 3HYIA 3CTAA 2ZGMA 2WJSA 1EH7A 1H2NA 1V6OA 4WCGA 3B93A 3WG2A 5ANQA 1MZ5A 5E1XA 3BTLA 5A33B 4PFPA 3HOYJ 2DA6A 2VBYA 2A05A 6PAXA 2A68F 3VD4A 4FX0A 1CAWA 1VBD2 1ULGA 3JBG3 3BCWA 1W05A 3L2WA 3MFAA 2ICWG 3THDA 1CZTA 2E5NA 3AYEA 4E7SA 3QACA 3MD2A 4JYKA 4QIWN 2P5VA 3LFUA 2DN0A 3EUHC 3BR6A 1HRV3 2WZEA 1N1TA 4IEPA 3ZPLA 4JC1A 4CDQC 5EYXA 2QQOA 3AG4H 2EQRA 4XKCA 4RGGA 1RRJA 4CPBA 3M3EA 1IRGA 1REDA 3M3IA 2KP6A 3AZYA 1KU3A 2NYXA 3CNAA 3BT9A 2UU8A 4BXUA 3FLPA 1OC1A 1Y0UA 3BIEA 2VMIA 5LBFA 4KT5C 4FQZA 1LEMA 1P4XA 2VCBA 1UG0A 5HXVA 2X5IA 1HQCA 4NROA 3VPRA 2RS52 4V2VA 2VECA 2BYVE 5DTDA 2R1BA 5HLIA 1OR7A 5GALA 1LNSA 4XZPA 3RS6A 5M5YJ 3OY9A 3ZKYA 2CU7A 1WI9A 4JGYC 4OWRB 4RAYA 4JX0A 4ZZ5A 4KNYA 2B5HA 2D3PA 3KYCB 1VBE1 5C8CB 2RMU3 1FTZA 2HWE1 2DVBA 1BOAA 3ZFFC 3OR2C 3W58A 2VXZA 4ESBA 3CMMA 5FKMA 2R7DA 1QJU3 4C0HA 3K75B 1F5FA 2Q4SA 4UBGA 2QTWB 1MSFC 1LFPA 2L5QA 1GOGA 1W0PA 1U78A 1HKTA 3A22A 3KYLA 2PLYA 1KJRA 2FNPA 1FNZA 1TME2 4BQ5A 2YBPA 4DZPA 1YCIA 5DDJ3 4HEA2 2JDNA 2OPWA 4HETA 4K9SA 2QGUA 1GP6A 4FE4A 2EIBA 3RZHA 3F21A 1FNYA 1XE7A 1Z7S3 2XASA 2KZGA 1LPQA 2JG8C 2ID3A 2R042 1EH6A 2M34A 4A69C 1YFWA 1SD7A 3FHAA 2Q1MA 3GTLJ 3VBHA 1DYPA 3VKMA 3AP9A 5DS9A 2CDPA 1TP4A 1PZ7A 2NVUB 2XBO3 5I0SA 4CA9A 3LGRA 2D6OX 4NC8A 2K2SA 4FVVA 1YTYA 5KBFA 3M8JA 1FPN1 4K8RB 5C71A 1S2EA 2VIXA 1OOPC 1G8XA 1MBJA 3OSDA 1