4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
3K3NA 5FZ7A 5FZBA 5ISLA 5FPAA 3PU3A 4IGOA 5IVVA 5LY1A 5LW9A 3KV4A 5FY0A 4UF0A 5LWBA 4LIVA 3K2OA 5A1LA 5IVBA 3U4SA 2YBKA 5FZIA 5FYZA 3AVSA 2WWJA 5FYVA 3ZLIA 5IVYA 5FBJA 5FPVA 5ANQA 4BXFA 4LIUA 3PUQA 5FJKA 4Y4RA 4QX8A 5FV3A 5IVCA 3KV5A 3KVBA 4V2VA 4CSWA 5F2WA 3AVRA 5F5CA 5A3WA 5F2SA 4HONA 3RVHA 5FY7A 5F5AA 5A7OA 4LXLA 5IWFA 5F5IA 5FXXA 3DXTA 4AI9A 5FXWA 4IGPA 3PDQA 5IW0A 4CCNA 2XUEA 2OS2A 5FP7A 5FZOB 5IVEA 5FWJA 5FPUA 3N9QA 5FZ1A 5A7QA 5FY1A 4CCMA 3PUAA 2OT7A 5K4LA 4QXHA 5F3IA 2YU2A 4EZHA 5FYIA 5FZCA 5FZEA 5FYBA 2Q8EA 5FZAA 4TN7A 2WWUA 3AL5A 3PU8A 4IGQA 2P5BA 5FY5A 5A3NA 1VRBA 2XMLA 5CEHA 5FZKA 5IVJA 4GAZA 5FJHA 5A7NA 2Q8CA 3K3OA 5FZFA 4D6SA 5FPBA 3PURA 3KVAA 5FP3A 3N9OA 4DIQA 4AAPA 5FZ4A 2OX0A 4CCOA 3KV9A 4BISA 5FZ6A 2YU1A 5A1FA 2XDVA 5FYSA 5FYYA 5A3PA 3ZPOA 5FYCA 5FZMA 5F37A 5FYMA 5F32A 5A7PA 5FWEA 3U78A 5FZLA 5FZHA 5FZOA 2W2IA 5A7WB 5A7SA 4EZ4A 3DXUA 3N9MA 5FZ0A 4XDPA 5FUPA 3LD8A 2GP5A 4QXCA 5E6HA 4Y3OA 4URAA 5IVFA 4Y33A 5FYHA 4EYUA 5KR7A 4D6RA 3OPWA 5FZ3A 5FUNA 5F3GA 5F3EA 2PXJA 5FP9A 3UYJA 3LDBA 2YBPA 2OQ6A 4E4HA 4ASKA 5FZ9A 2YBSA 4XDOA 2VD7A 3PTRB 5F39A 4NUBA 5FZ8A 4QX7A 4BU2A 2OQ7A 4QXBA 5FPLA 2XXZA 4QU1A 4GJZA 5FY8A 2YPDA 5FY9A 2Q8DA 5FY4A 5FXZA 5FZGA 4CCKA 4D6QA 3NJYA 4HOOA 4CCJA 5A80A 5FXVA 5FP8A 4CUGA 3N9LA 3OPTA 5FYTA 3PUSA 5LY2A 5FYUA 4GD4A 5F3CA 3N9PA 3KV6A 4CCLA 4LITA 3N9NA 4V2WA 5FP4A 4QWNA 2GP3A 5A7WA 5A3TA 4GJYA 4UF0B 4C8DA 3AL6A 5FZDA 4DO0A
chains in the Genus database with same CATH superfamily
1YLLA 1BOAA 2WZR3 5JUVA 2OZUA 4GMP3 5DUUA 3HUGA 2BXYA 2BYVE 4Q4Y1 3BR0A 2JDKA 4B1RA 2RDSA 3WE2A 2IW5A 1U12A 5J96B 3JBG1 4LKSA 2M0CA 3EQEA 4QX3A 3ZYPA 3JAMK 4U88A 5TJJA 1JW6A 1MZFA 4B47A 3TNQA 1I6HJ 3ZXAC 4QKFA 2OZ6A 1GQPA 1VALA 1ZX5A 1PO22 1K42A 1MMDA 1OD3A 1GFF2 3R4SA 1ETXA 1Z67A 4L5IA 1A8MA 2BVLA 4FFIA 4AVZA 3ZFGB 5A3PA 1XSQA 3FMSA 3GX4X 3OEBA 1H89C 2LKXA 2QZ8A 2M7BA 3S6PA 2EJRA 4R1HA 2VBBA 1LJ9A 1ZQ3P 1W99A 2VULA 3J8F2 3TBIA 4XONA 5FYHA 3MIDA 4KIBA 4AHWA 2CTVA 5HLGA 2R1DA 5FZ9A 3CJIA 3H1YA 1U8BA 2L4AA 3OCPA 2HYGD 5HLIA 1J83A 2RAEA 2HWE3 1FX7A 2XBO1 2BUKA 1GZWA 4Y20B 4NC7A 4BKXA 2ZGPA 2KDOA 1CAXA 2EWNA 4XEZA 1JKOC 3HQXA 2WA0A 3TAYA 3I2GA 5FZDA 1W28A 2CYFA 5F5QA 1UZWA 1DG6A 5FOBB 1WHUA 3OUJA 3AKQA 3R05A 2W9XA 1B4AA 4Y1UA 2K27A 5K1YA 5D21A 4U2AA 4KA4A 3MBWA 3PFIA 1RUF3 3LFIA 3LEMA 2O03A 5FP7A 3HZJA 5IVEA 2E5ZA 1YHQI 3LSEA 1COV2 3OOPA 2NN8A 1D7PM 2DWRA 3ML6A 1G9FA 3UK9A 1ZRRA 3LSJA 3OS0A 4BXUA 2WT2A 3MV11 5ABJC 3AC0A 4XSXF 4DYQA 4IRGA 1XB9A 4A12A 4I0WB 1MMSA 4Q4X1 3BG9A 1O4TA 5JSPA 1S0IA 1V6NA 2A75A 1G8WA 4CVUA 4RGAA 4XM3A 2XAQA 5E16A 3M7AA 4QPIC 5IFTA 2KZVA 5IT9Z 3ITQA 3IH3A 3N9MA 4YVSC 1MSFC 2P5LC 2R93J 5EGOA 3V7CA 4I3GA 4X8NA 2IS1A 2E2IJ 4GKYA 1IZ1A 2ZMKA 3R6SA 3EB7A 4WM8C 4AEMA 3ZXJA 3RWKX 3VYRB 4YG2F 1F35A 4FETA 2FOKA 1R4MB 3KQRA 5C44J 1AKHA 2D3RA 1H88C 1GUUA 5CKQA 4N9IA 4M6YA 3O1PA 4LITA 3NW4A 4C2MJ 5A7WA 2W91A 2CV2A 3PTYA 1JZ5A 1H2NA 4ESJA 2HZTA 2YBKA 4QM9A 5JZGA 4X6RB 1JU3A 2EFQA 3KB5A 3JCUC 2Y33A 4IKFA 2R062 2WUHA 3MW2A 3I53A 2UUZA 3OUHA 4JRAA 5K0UC 4N90A 5CG9A 2DT7B 2MW8A 1W0TA 1EV12 2RR12 4BJ0A 3DFGA 4RGKA 3PVOA 2QUFA 2PN6A 1ZNPA 5LRSA 3W6VA 4XJ8A 1LOBA 5T5JA 3GFJA 2DJNA 4HK9A 2XHNA 1BIBA 2DFIA 2HQAA 1R083 4LLGF 4MHRA 3GZAA 1MEC1 2W00A 5TGTA 1NG6A 1FOYA 5K7FA 2ZACA 5FKMA 1MBEA 2ADUA 3JSPA 1QVUA 2KJBA 2PHLA 3B9CA 5CFCB 1CJDA 2RDPA 2QLZA 4HKWA 2A73B 1ND3A 3DBRB 2VMIA 1ZBA1 4IEWA 5E20A 3NAPA 3ZIWA 4NHLA 2WFF1 4YW2A 1CR7A 1PK6A 2IGOA 3OJBA 1GWKA 3K4KA 1JTZX 4BQ5A 2A07F 2VMFA 2F5CA 1S0GA 1LR5A 3H36A 3TN93 1POGA 1HDDC 4OIQF 2F2EA 2DK8A 1RJ8A 5FY8A 4GJZA 1W6PA 1U6GA 1W4MA 4QQOA 2HWVA 4IO9F 1WJ5A 3ELNA 4AE2A 1Z7S1 5EYRA 2IRFG 4BE0A 2GZWA 5L3DA 4WXHA 3K7AJ 2V4VA 5BXXA 3HN3A 2HBTA 3A4CA 4RGSA 4L0YB 4DYRA 2LFBA 3BR2A 3RKXA 4XBFA 5T54A 2LY2A 3SZGA 1JTXA 5BNGA 1MACA 4W1UA 4UXNA 3OGVA 4N43A 4XKCA 5D6FA 2V5DA 5F5IA 4R52A 4Z2YA 3ZQCA 4B8XA 1AYM2 1GWLA 2BV6A 1BW5A 3LWCA 1PGL2 2RN7A 1O57A 3HM5A 4BQAA 2UWCA 3DPUA 3BG7A 3B9IA 1AR62 4ENNA 3LQCA 1SFUA 5B66C 1E5RA 2H6BA 3GZ5A 5EYYA 3R0JA 1I1EA 3F9KA 1KDKA 4BIOA 4QPYA 2VC0A 3Q0VA 4JP0A 4URTA 3IIIA 2V6CA 2KXLA 4CU7A 5FUPA 1AF9A 2EA7A 4U87A 5J1RA 3RZZA 3F21A 3ES1A 3QBQA 3GTKJ 4L9BA 4UWDA 2V1UA 2V6EA 5D1IA 1ZKGA 1W5SA 1UMQA 1X1BA 3IRRA 2BJSA 3HPNA 3VB2A 4ZU5A 1DU0A 4GWIA 1JYIA 2MG4A 1UQXA 1VBC3 1O4YA 2VQTA 5J37A 3S1RJ 4J19A 1G9CA 2WV1A 1IN4A 1UF2C 1IN5A 3L2WA 5SV8A 3T1MA 1VFCA 4X0GA 1YI7A 3UKTA 2LYCA 3ASNH 2HGCA 5FYZA 2HYKA 1ONAA 3W9AA 5K5OA 4CRQA 4DY5A 4OMYA 5A3LA 1B35C 1IC8A 4ZZDA 1MW7A 5IK7A 1KFUL 2NS8A 4IESA 3CO6C 5DMYA 3FWEA 1MS4A 1V6IA 3L2VA 5HNHA 1G3YA 1MZ5A 1RRJA 1AWCA 2ZS6B 3TEXA 1SMVA 5CAZA 4XRSA 3SHRA 5FKOA 1PUFB 5C8CA 1VAKA 1MZEA 1O91A 3A0KA 5M0TA 4DYCA 4BY1J 3RZJA 4RLFA 4F55A 4FOWA 2RGVA 3K1PA 4IL7A 1XSVA 2RQPA 3BGAA 3PIJA 5EZGA 3MW4A 2X6OA 3DXUA 1FNNA 1BI1A 2Q1ZB 3FM5A 3MHZA 5LLQA 4IZZA 1UZYA 2QSFX 5DD8A 1W05A 4P14A 2DYSH 1FV3A 4AOCA 1BQPA 4XFIA 4DZGA 1NH3A 4XFHA 5H6QA 4AK3A 2JKBA 4LOCA 2KA3A 4YW1A 2F5EA 4FP3A 2HU9A 2VNRA 4P9UA 1B1BA 4UYBA 4XRFA 1F9NA 5I0DA 4C3IJ 2C6YA 1HKQA 4XF4A 2L7FP 1PIV3 2J1SA 1AR91 5JOWA 5T55A 3KF5A 1QJX1 3D0SA 3TRSB 5FJKA 1BM9A 3MGUA 3G1OA 5GTIC 5JFRA 1EAH2 1FPN2 2WO2A 5ERIA 2PELA 4RGRA 3GTMJ 2NQYA 5FWJA 1ASJ2 1J58A 2OUMA 2VXDA 4GALA 3W20A 1PVC1 1BBYA 2F4IA 3F22A 4HF1A 2DVGA 1XNAA 1ULCA 1FZPB 1HSTA 1DLCA 4G7HF 4JDOA 4OVEA 3IM0A 2J1AA 1R1A3 3O0VA 4B3NA 3VDBA 1VBA3 4J25A 2G9ZA 2FJ1A 3HHHA 3C3VA 5AC91 2OV7A 2VC1A 5DCFA 3IDEA 1FMWA 3MUY1 1Y56A 2G0EA 2BRTA 2GN7A 3UL2A 4WK8F 2W2IA 1OQEA 3PQKA 4XXPA 4L9VA 3VBOB 1FOD2 3SH4A 2WFPA 5A3OA 2EALA 3KHCA 5BPIA 2H1KA 2JJ6A 3I2JA 1SLCA 4COZA 3R60A 2YPDA 2XB5A 1XTAA 1BIAA 4PQQA 3KD4A 3LDKA 2J1TA 4MQ9F 2RV9A 3J26N 1X2MA 3DTKA 3QOPA 1LOCA 4YIRX 2V9PA 1I3HA 1UD1A 1H9WA 3AZVA 2FUG2 3KX2A 5I0SA 4OULA 1AX0A 5FBJA 1SFPA 4LIUA 1DLLA 5FMOS 3WG3A 5J3UA 4EN6B 4UFIA 5I0UA 4KMQA 2VMHA 3K10A 4HX7A 4IGPA 1DGRM 4G9SB 3A0BC 1LKNA 1ZGAA 1OQYA 2ISYA 5CNAA 1Y6IA 1LOEA 5K5RA 1WVRA 3DXJF 3FMQA 4C91A 2A3YA 3MFAA 5J6XA 3KYCB 2ZXQA 4IERA 4RFT0 3WHCA 1VPHA 3GMEA 2Y38A 2DTWA 3I4NJ 5C71A 2F5DA 1SPPB 5EWSA 2DA7A 2ET1A 1NG7A 2JUCA 1UMZA 2F4PA 2HBUA 3I4MJ 2RS33 2GAUA 2CNAA 2SLIA 4PSWA 5GLZA 2CQQA 3J81Z 5LD2C 3RQIA 1RHI2 2Y2ZA 3BUCA 4F3QA 4UBGA 2MA3A 4OHYA 2C5DA 3L2RA 3C2UA 3FLTA 4HKLA 3RTRA 2CAVA 2R041 4FVVA 2L5QA 3AP4A 5FO8B 3DEWA 1POV3 3D6EA 1P6RA 4AEKA 5ICCA 1K5MC 3P9IA 2HOTA 1A6CA 5F0FA 4CP1A 3O0WA 4HOOA 2HXOA 4CCJA 4D1QA 3CBNA 1RR8C 2RHPA 3F72A 1UYYA 1PP8F 1UPSA 2LSOA 5J98B 3KT4A 4XFCA 1YRNA 1XMXA 2ECCA 2D5VA 3S1MJ 1ODDA 3AYCA 3ZYRA 5ISLA 2OD5A 2DFCA 3K48A 5HVQC 1F5FA 1XE7A 2WNEA 3A02A 3ZXDA 5HNFA 2YHJA 4XC9A 3WDWA 4ZYGA 5EJZB 1QH7A 5IP7J 2OZJA 1RB8G 1OMIA 2ERFA 2QQVA 2ZKLA 2ZMEC 2VY0A 4Q4W3 2G19A 5I8YA 3Q9SA 4HVOA 2NNYA 3BLYA 3CZ6A 1ZLKA 3ZN1A 1BA5A 4PT6A 4MGRA 4V2FA 1JJ6C 2ADDA 4A3XA 1O4XA 2NOGA 1E3HA 1NX9A 2VT3A 3LAPA 3AP9A 4KU8A 4CDUB 1UMIA 1MS8A 3L00A 2E7QA 2ZBJA 2VJ5A 3HB9A 2IC1A 5EJ1B 3CNAA 4A41A 2JICA 3OD4A 1G8XA 3CU7A 3KQ4B 4XIOA 5GAHJ 3M8EA 4MNUA 3WQ0A 3CC2I 1OLQA 1T0FC 2HWD3 2VZPA 2ZKZA 1XU2A 4CUCA 4PGHA 1LCLA 2HWF3 4LPLA 3RRDA 2BNOA 4HV6A 4CCKA 3ACGA 4L9JA 4K20A 4NAOA 3U1XA 1LOGA 3F8FA 3T3YA 4PGGA 3A22A 4HXCA 3LSHA 2RNGA 3K1NA 2XR4A 4KWKA 4C2TA 4EGYA 2LY9A 5J36A 3IWZA 3JCIA 1BXHA 2ZO4A 1AJOA 1P92A 5FO5A 1HF0A 2X09A 5I91A 1H9TA 4EM0B 4D7MA 1YITI 1ETWA 2XPWA 3ABMH 2HLEA 1RUG3 4RBOA 3PUFA 4ABZA 4YW7A 2QQNA 5DXDA 2QKDA 2XPJA 4JKMA 3OGGA 3AXDA 3BQZA 5BQTA 2GALA 2XRNA 5BNPB 3GCMA 4U36A 3K9TA 4IL6C 3U21A 2OVUA 3MUZ1 1CAVB 2XDVA 5J1UA 2VONA 3I59A 2V73A 1P4WA 1W0PA 5E18F 2BBYA 5F37A 3WHBA 5CQGA 4Q4V2 2NS7A 5EEGA 3M1HA 1GYKA 3L1PA 2CGOA 1IRGA 4A3MJ 3EUHA 2RMU1 1BEV1 1C8M2 1ZM1A 1DU6A 1OISA 3HQRA 4XMYA 2ZAAA 3GTPJ 3DU6A 1D0XA 1FBQA 3V7SA 2EV5A 2NNNA 3QD6A 2HWE2 2XL9A 4MIMA 4LBQB 4OHZA 3WTZA 1RPWA 3KP2A 5EYXA 2HTSA 3BG6A 5IVBA 3B5LB 4UW6A 2TRTA 1LFUP 4GH4C 2ZJQF 2PAKA 5ICGA 1OJLA 3UKVA 4Q2FA 4DQAA 3CP8A 2IVMA 2WZEA 3VHNA 1RKTA 1ZRCA 1OR7A 3J9SA 1FLIA 3ON7A 5D5XB 1MVEA 3KSCA 2Y60A 2HI3A 1H0BA 2JA2A 4NPLA 1RUF2 3BR5A 3WW4A 4MXWB 3LA2A 5AFBA 1LVKA 1KU2A 3AL5A 2LR8A 4L5JA 2MHFA 1O3QA 3ECQA 4XF9A 3OYWA 2WY8Q 1CIYA 1WMEA 2X6WA 2R6QA 1J5YA 2VN2A 2O0OA 5E3NA 2ORXA 4YNIA 1D8KA 1EA3A 1S55A 2DVFA 2XJVA 4RS5B 1T56A 3CZJA 5FROA 3NV4A 4M3BA 3LQQA 3V8LA 3LQRA 5I8SA 3QLQA 2CW8A 2JD4A 3LEGA 2EK5A 3I49A 1LPQA 4R79A 5BNOA 3HAGA 1OUXA 4A7ZA 3R4KA 1ZA7A 3M3EA 1XGOA 2H8RA 4EQVA 4KDPA 1O7FA 2DOEA 1JJ8C 4HL0A 4H14A 1HB3A 5H6RA 3I4IA 1TNTA 2GM4A 2OTJI 4U0WA 2DCYA 4MO7A 4EVIA 1QNWA 5JPMB 1OFNA 4RL7A 4JHTA 5FY0A 3WP4A 1FATA 1YXWA 3DP7A 2VMGA 2DMTA 2JTVA 5ANQA 1CX4A 1LHOA 3RMXA 2E7XA 1EF4A 4MO3M 3LOBA 5KK1A 2AYHA 2J1RA 3OYHA 1K5JA 2YZ4A 4JV4A 1BOBA 3M9AA 2R7DA 5FLJA 2JQ7A 1NK3P 1MDMA 1R9TJ 2V1DA 4QPGC 5LHHA 4HSTA 1VMFA 4CE8A 2Y26A 2RS11 4TWTA 2W85A 3MKLA 3PVEA 5F08A 3WXPA 3PURA 4HMZA 3AL0C 2RS51 2VGDA 2VR4A 3N4MA 4OCTA 1ENRA 5CADA 3D3AA 2M4GA 5FZMA 4XTPA 3PJYA 4EN0A 4KGGA 2DU1A 1YYVA 4BQYA 1S29A 1IZ3A 3M3IA 1XMAA 1W7PB 2ZXHA 2ET7A 2VTFA 5ED4A 4PIXA 1KGSA 1XU1A 2M30A 1RIRA 3QPTA 4QIWN 2WT1A 1OKRA 3D5RC 4ZZ5A 2N8GA 4BDYA 1YQ6A 3DKXA 4NOTA 1BKZA 1QDCA 2DO7A 1OPOA 2D43A 2HEYF 1DF0A 4XFGA 3VL8A 2P7CB 1BMV2 1ULEA 3B94A 2G7UA 3KWVA 4QX8A 4ZJZA 2W1WA 4E7HA 1I5ZA 4FOYA 2PHTA 3L2CA 1FOD1 5FY7A 3HOVJ 3W2VA 3E7LA 3OGRA 3WTXC 2E1MC 3WW2A 2JDAA 1N47A 1ZAOA 3CKHA 3SQNA 1OOPC 1M1EB 2Q8EA 1J3PA 3DEMA 4QPIB 2K86A 5IVJA 3MLJA 4YVSB 4LT5A 1DGWY 2WS93 2M1BA 1AU7A 2Q0OA 4WM8B 1OYYA 5HCHA 4AC0A 1WRJA 3DQVC 1RVF3 1PO11 1AR81 2VPLA 3AG2H 4XSZF 1A36A 2IXLA 4IEPA 5EF6A 1IUYA 3SCGA 3I2HA 4M3DA 2MPFA 3MIGA 1EJ9A 1MJAA 3GTGJ 1LHWA 1W2AX 3H1CA 1RXGA 3TO6A 3R4DB 2VO5A 5FPLA 1RL3A 2QEXI 1O8PA 3RI4A 4NO4A 1H8AC 5FKBA 3OYGA 1WJDA 5C4JJ 1WJCA 3J7NA 1UYZA 2YMZA 3POWA 1Z6RA 5C8WA 1VBC2 3AL6A 3K51A 5K0UB 4R9BA 3MCZA 5B1AH 3I2KA 3P7NA 4GMP0 5A1LA 5JOYA 3CTAA 3G4SI 2D6NA 2L2OA 3S3OA 4LBJA 5JWPA 2PQ8A 4FPKA 2FCTA 2DA3A 2RKHA 3QH7A 2W25A 3CC4I 3NKGA 3OV8A 1IG3A 2E32A 2B39A 4RAYA 5IYYA 3KM5A 1SHWB 3LEIA 1A6IA 1MH3A 2DBBA 5JDBA 2E53A 1N1SA 5IT9K 3DPRC 3SEZA 4GB31 4MTDA 1RITA 3ZFEA 2DDBA 4G94A 3RQ4A 4NBQA 5FYMA 4QX1A 3AG1H 2TCTA 3ERMA 3LF7A 2WZ8A 5EIYB 4FX4A 1X9TA 3HYIA 1MIJA 1HB2A 3HSRA 5HCAA 3KLNA 3AP6A 4UT5A 3V7RA 1QWRA 3HL2A 4WVVA 2JPCA 2Q8DA 3AG3H 5IUQA 4FOQA 2FMLA 2QA4I 5CFCA 2FBEA 3OPTA 4B1LA 1MBHA 1US2A 4JX4A 3O8GA 3JRAA 4D9JA 3ZSMA 3LCPA 1E17A 3ECHA 2EXJA 5IT6A 2A6WA 4CYDA 2VTXA 2ID3A 2GXBA 1DQ2A 1JU4A 2IXKA 2F4MB 5JIAA 1HC8A 2JB8A 3WHUA 3BR1A 1BI3A 1UYXA 4C90A 4YW4A 3U75A 1GMMA 2G9WA 2Y6GA 3TGNA 4AVVA 1BR4A 5LA2A 5L9BA 3TMOA 5D8LB 4IV3C 1PZ9A 4COUA 1JT0A 1TL8A 2DK5A 1YFYA 2XV4S 4XW3A 3ZSJA 4U0YA 4QLCU 4IEYA 4A3LJ 3ASIA 1Q5OA 3W2WA 2GXAA 1HSJA 3WR0A 1R1A2 3N7KA 2CMPA 3WHTA 3WX5A 2WA3A 4WM7C 1H6XA 1GHCA 4GWJA 3IL2A 4AGVA 1QQP1 3I64A 1A31A 2EIDA 2MSYA 2NYYA 4FPOB 1HW2A 3G1MA 5ICFA 4BCUA 3LZZA 1V70A 4XFFA 2PMZA 4KIFA 3MKZA 5GPCA 3TDZC 3PFYA 3HGGA 5JXIA 2LK2A 1R093 2JRTA 1D0YA 1H4GA 2Q2EA 4J6GA 1YO5C 3BZKA 1IG0A 3H3LA 3I3QA 1BBT1 1U3EM 4FFHA 1YQ2A 3RPQA 2W5FA 2YC2A 2Y48A 4AFBA 4NRMA 1ETYA 4P1WA 1ZVFA 2VNGA 3ZDVA 3LGRA 2XVLA 5IP9J 1MMGA 3W6KB 1LDDA 5F7UA 2ZABA 4NRPA 1C0WA 1KS4A 1DZTA 3FK7A 3A0NA 2EFOA 2JIGA 5KXBA 1SD5A 4CP9B 2ES3A 2DODA 2STWA 1OQ1A 2WINB 4PFPA 4ZXEA 2YU9J 2YU2A 3GUDA 4IEQA 4JOMA 2P6TA 4DB5A 3DEEA 3I2FA 4E9KA 2M8EA 1IQAA 2EZHA 3E1F1 3A21A 1HQLA 3KVAA 5FK8A 2MEV2 4DIQA 1N3QA 3GZNB 1ND2A 3ACLA 2CS3A 4ENMA 4JCKA 3H1WA 3M8LA 4G7OF 3JB8A 2QQOA 5DV5A 3PO3J 1F4AA 3CZUA 3UV9A 1R5ID 3S15J 4XFBA 2RS32 2K3PA 4NMIA 1VQPI 1OLTA 3V0BB 3D5OA 4MGIE 3VHRA 1R58A 4JVAA 1WWYA 3K69A 2QZ2A 5I0TA 4MFDA 1EV7A 4OIRF 1FMD2 2FBHA 2X0LA 3HKZN 1IPJA 3S5AA 2Z5WA 2UXXA 1Z7UA 5IHRA 1O6UA 5A80A 3V0AB 2EPFA 2Z79A 2PAEA 4MQVA 3KFWX 4M74A 4PUSA 1R71A 2L02A 2P6SA 2XAJA 3HRSA 3F23A 3GM8A 1K45A 3WF1A 2KM2A 3VOEA 1Q8SA 1DGRN 1UWWA 4BQ3A 3GGLA 1LNWA 2BP6A 4UF0A 2JJ7A 1OKQA 1S6LA 2PJRB 1U9NA 4X6AJ 3KYLA 1ULFA 1BVVA 1ENHA 5AONA 3LWFA 1Y9GA 3TYJA 2IS4A 4IHYA 3DXTA 3LPFA 3JRIA 2CY6A 2Y6HA 4XICA 1IGNA 3QU6A 2B9UA 3RSJA 2FRHA 4OIOF 2MLGA 1T8IA 4W6XA 3SKJE 3T4HB 3OL3A 5J47A 1SEFA 1SD4A 1CQ9A 1DFQA 4C0HA 1AUYA 4DS0A 2XH6A 1FAYA 1REPC 4BISA 3TO9A 4JHZA 4WVMA 4CA9A 1QGLA 2XROA 2PMZN 1QXPA 1RUI3 1F36A 2O5RA 4XUPA 3LD8A 5ACA2 1MEC3 4HAMA 3I3BA 3NJXA 3ETQA 5FTTC 1JZ3A 4ASLA 3KHBA 3IDAA 4RR3C 1FP2A 5IOZA 4JDMA 4MXVA 1QVTA 3KP4A 2WADA 1IJWC 1R1VA 1UG2A 1IGOA 3NNLA 3ZGKA 5BS6A 1REEA 1VNDA 4XLNF 4BHBA 2VPVA 2GMMA 2HWB1 2NYXA 1U78A 1QJU2 4RHV3 3BIEA 5GJ6A 3VBOA 3BTLA 1MQTC 3OYMA 1RINA 1G9AA 5LWBA 4OFGA 4M3CB 1VF9A 3EUAA 4QXKA 1WSUA 1IG7A 4ZY9A 4V2VA 4ZDPA 1T33A 4XQFA 1YIPA 2CL2A 3UNPA 4ETSA 1U5YA 1JOBA 2QF7A 3ILRA 4IVNA 3S57A 1VR3A 1D4M1 3P6BA 1SLLA 1VRH3 5BMZA 5GADJ 2ZJCA 4P02B 2JK3A 2WNUC 2DOFA 3GZUC 4Z82A 5LB6A 4FPEA 4W8JA 1MSEC 2OF7A 4KT5C 2LBFB 2I8DA 4CEYA 1VMHA 2O6GE 2X9DA 1WMFA 3AFKA 4UXAA 2MH9A 4FXGB 1K5MB 1RUC3 3B00A 5F6KA 4FQGA 5KHJA 3DKYA 1VBD2 1XYPA 1W6MA 4E70A 3AYEA 2P37A 5KHGA 3R4UA 1S72I 2A3XA 2DBIA 2PG4A 1BI0A 4BJ5C 3PQJA 3Q3SA 3K4AA 4Z07A 2K4JA 3I54A 3NNMA 4CCDA 1TE1B 4LG0B 1WD4A 2ZOEB 1KGYA 2DUPA 3KS7A 2EXHA 4IXAA 1XYNA 1N77A 5HOOA 5CYVA 3IZOA 4PJNA 4P9LA 2NZ9A 2FU4A 2JDYA 4B29A 3POSA 1RUD2 4MADA 3OS2A 1X3ZB 2DTZA 1GP4A 2FEZA 1UKRA 3WNOA 4CU8A 2IT0A 4PLOA 2WNOA 2PTMA 3NQHA 1NZIA 3MICA 4UW5A 2ZMEB 2EB7A 2WSVA 2EBIA 5L7OA 5FYVA 3GDBA 4UV8A 3CDLA 4XLAA 1ZR4A 3OOUA 2XJPA 4A3GJ 1CAUB 1R23A 4B44A 5B2GB 2M3AA 3VZMA 4CH7A 3IDBB 4META 1W1WE 4LO7A 4RLQA 1QA6A 2VZVA 3L9JT 2M34A 2BY2A 2NVQJ 3QYFA 2ADEA 2VT2A 4YYOA 1TWCJ 3DYOA 5JOZA 1KQ0A 4L99A 1HW5A 3J81K 2MABA 3CIHA 4GGGA 4HF2A 3CO2A 3WQBA 2OX0A 4Q4ZF 4AM3A 4JTNA 4LA2A 2C26A 3FMRA 2R071 3NEUA 2FE3A 2ZJRF 2XLFA 1BW6A 3B7MA 2WKKA 3O1SA 3MMYB 1WCKA 3WT3A 3KZYA 4K9SA 3JRHA 3FBMA 5C4WA 1GZ9A 2ZPXA 4Q1RA 4OI2A 2D3PA 3PHMA 3MPBA 5E3MA 2CV1A 1GSLA 2QCOA 2JMWA 3BTXA 4NR1A 5CVRA 3ZQLA 4S04A 4C1XA 1WJBA 4BQNA 4CDUA 1U5TA 2OBPA 3GNEA 1EY2A 3THCA 2P3YA 2VE1A 3DCQA 4Y22B 1S9HA 2DMUA 1ZRIA 1WCSA 3GBWA 1J1LA 4M01A 2WJSA 3KV4A 2W47A 1X4OA 4WXCA 2K02A 1TT5B 2D6KA 5DZEA 1GP6A 4K7JA 4ONUA 4I0AA 2OU2A 1WW6A 2BW8A 1W5CC 3CDZB 4FCYA 2BE5F 1OD5A 3IKVA 3AMQA 2CSOA 2GNMA 5FY1A 2ID4A 2CFXA 2WZPP 1UU4A 1VQ7I 2XMLA 1ZREA 1XDUA 3FFQA 4Z1VA 2KQRA 4A69C 1S2BA 5CBLA 1P7JA 4EWAA 2HR3A 1Q1VA 3WOGA 2DA6A 1PVC3 3GFLA 4CDQB 5BPXA 2ZMLA 4QGLA 2W52A 1HN0A 4NIHA 5FZLA 3JXSA 4URAA 4AIJA 2D98A 4GA9A 4NHKA 5L9VA 4GIQA 1EH6A 1Y0UA 4LKEA 2JG8C 1RXFA 4QQPA 4COWA 2QVSB 1SZBA 2OQ7A 1R00A 4QDSA 2OIIA 2W4SA 4GH4B 4DINB 5LASA 4LLFA 1FYLA 4DXRA 4EWDA 4N8MA 3ACHA 4PBPA 4CCLA 4RB1A 3WSOA 3ZVXA 4ZDLA 3DTEA 1XBFA 2X6YA 3OYCA 4YEJA 4BBRJ 1X7NA 2YDEA 1C57A 3USUB 3ZQIA 1V6JA 4IHTA 1NXMA 2OUHA 1MS0A 5FV3A 1MMAA 2ZEZA 1E5SA 1VQOI 3HRUA 5KXDA 1HRV1 1V5EA 1AL21 3MIHA 4XIKA 3AYAA 5D8AA 3OTFA 3O6BB 2NP0A 2FQPA 3R61A 2WQ8A 2BW3A 4YVWA 1ENQA 4GXLA 5FZAA 1V54H 5DAPA 4W6YA 2UXNA 1OF4A 4MGQA 4AYBN 2BBAA 4QM8A 1AVBA 1ZTRA 4R4XA 4MGZE 4KBBA 4XOGA 3CL1A 4Q8LA 4HANA 3ZMTA 4I2OA 3FHZA 4Y5TA 2DF7A 1J84A 4AVBA 2WS92 1GOHA 1GU3A 3CC7I 1RVF2 3ESWB 5EG0B 2KJCA 4OI1A 3ZYHA 2V09A 5KHDA 4PDKA 3FN9A 3ASOH 4IOCF 1JN2P 1OCPA 3U1DA 4IEUA 2R7XA 3O0XA 1WLTA 1JZ6A 2BXZA 1TME2 1FV2A 4A6OA 4XE9A 2ZKNA 4OIPF 4HPKB 1STMA 4F83A 1O5UA 1QMJA 3GLLA 4S05A 4K40A 1XPXA 3G3ZA 3OSGA 1COV3 2ZX4A 1M4WA 4ZTFA 3C2GA 4E7ZA 5LK7B 3FXOA 3ABTA 2FCVA 4QPGB 1MS9A 3SYTA 3L2QA 2ENRA 2ZAHA 1V6OA 4WWCA 2VW0A 2R7TA 4Q8KA 2W1QA 3QYEA 5CKTA 3AL0B 1TMF2 2E36A 4C1WA 1GKBA 2LY1A 3RZDJ 1QY4A 4EZHA 2DVAA 4ZU7A 4XN0A 3ES4A 4IGQA 4N43C 2NS0A 1S1AA 4XUTA 1V6KA 4OUEA 1IPSA 3DEUA 4D8MA 1DP0A 4CP0A 3I3DA 4UB6C 3V4GA 5ANNA 4S2GA 4BEHB 4RGXA 4XDQA 5FLHA 4AGGA 1RUJ2 1TNRA 5CPRB 3B02A 4PSXA 1OI6A 3U78A 2D2WA 2LUWA 1V3FA 1X1PA 3QP5A 2VBZA 2DA4A 1NXD1 2VQHA 3MW3A 3W5MA 2L54A 3ZN0A 1SFOJ 2ELHA 5E1XA 1AR72 1S4CA 2JG9C 5F3EA 2FDGA 5LHIA 3RDIA 4IHWA 1V9U1 4OQ8A 5FY4A 4L11A 1V5GA 5FZGA 4BQ4A 1NK2P 4ZXKA 4HNTA 5JMCA 3PUSA 2GIVA 3VYSB 3M7GA 2HZDA 4EMSA 1EH7A 1EV13 1LESA 2RR13 4QWNA 5L3EA 4TLFA 3JUUA 2E1MB 1W7PA 5FPAA 3BZCA 3RZLA 3B73A 3TO7A 3AVSA 3QQAA 4HYEA 1H6YA 3S5QA 2AENA 3UGHA 2VQ0A 5FLMJ 4QX2A 3FKJA 3WG9A 3GTOJ 3AP7A 3U9GA 1N1TA 1SFYA 3FXRA 1ITYA 1DQ0A 3NARA 1HRI1 4AZZA 2GBYA 1WH7A 4Q4Y2 3T30A 2WY7Q 3JBG2 5JLVA 1UKGA 1QRYA 3WG4A 2WWSA 3IB3A 1U5IA 3TKYA 1AXYA 4TZDA 2IPQX 3OPZA 3KEOA 1XYOA 5ABJA 1T2XA 4BM8A 5C8CC 1HCRA 5EPAA 5FZHA 1ON2A 4G6TB 4D69A 4NIIA 4N0BA 1WJEA 2R92J 4KYWA 4G6QA 4QPIA 4CP2A 1C1FA 3CQOA 1ULPA 4BU2A 1ZYBA 3O8HA 4C9YA 4MOAA 2B9VA 4D7NA 4LO6B 3QOEA 1H8TA 1QJEA 2ZHNA 4AFDA 4EN7B 3DYMA 5BPDA 3ABKH 3OYDA 4Z2AA 2GIZA 2JDZA 1UY3A 1OLRA 3CJTB 2E31A 1YQAA 3P3NA 4CYCB 2EIKH 4XMIA 3BC8A 1U9OA 2AXLA 1NKGA 4KL1A 4EJOA 3E1SA 3GFIA 2Q8KA 2JD9A 4LBLA 1PVEA 4BQOA 4P5YA 3K4ZA 5FPVA 1APLC 2XBO2 4QT6A 3GVAA 2ZGQA 4E4SA 2P5KA 2ZBKA 5K7ZA 2O14A 5F2SA 2VOOA 2JUGA 3AKSA 3ZKUA 1KA8A 1OC1A 2B8MA 3DPRB 5DG1A 2VQAA 4PJ0C 2CGNA 2G9FA 3OGSA 1MS1A 2E7WA 2JRMA 3FXJA 2QQUA 5K0UA 4LLNA 5LA9A 2KIFA 3RZOJ 4M4PA 5HI0A 3K75B 2C9KA 3O7OA 2HEOA 1QZEA 2HXIA 1UB9A 1FNYA 1C8NA 2OCEA 3QP6A 4IHSA 1S7AA 2GN3A 4QPOA 2DYCA 5DAWA 2ZCWA 4A5MA 1W7PD 4PBOA 1NY71 4E8DA 2OC6A 4C3HJ 3BU0A 2K9ZA 2XB6C 2JA8J 5AVPA 3WUCA 2BTVC 1O7LA 4XABA 4FTBA 5SV5A 5K7PA 3OYIA 3G73A 1YHFA 1PHMA 2YV8A 3RPUD 1RR7A 4EQQA 2ZJ2A 1A5JA 4Q4X2 3JRCA 4XDOA 3I97A 4JGYB 4XZUG 5IFPA 2AXTC 2ACJA 2XVGA 5FMCA 2VW1A 4D6QA 1LE8A 4O6JA 2P4WA 5FYTA 1BC7C 3IP4B 3HBZA 5T3NA 3SH5A 3BPVA 4RS8A 3T08A 4HSRA 2BHZA 3QPLA 4GJYA 5K9YA 3AK0A 2QUOA 1I39A 4JKKA 1JBCA 3EBRA 2CO5A 2R7UA 2OQRA 3UGFA 1AYN1 1MH4A 1O3RA 5GLVA 1BHGA 4Y13A 4LHNA 5EZWA 3FXMA 1T98A 1QEXA 1OPMA 5IVCA 3BOQA 1VIWB 3FHIB 3J80K 4P9XA 3IPVB 3AZZA 5FK7A 3NAUA 5KHKA 4H0EA 2OS2A 1SFEA 2VQGA 3VL9A 3VD7A 4WM7B 3L7WA 2NMNA 4M3CF 3NNFA 2PYTA 1N78A 4DOZA 2F17A 1OA2A 3OBTA 1FSHA 4W4ZA 4Y1VA 4YLZA 3GZTB 4K2EA 2JZYA 4BHPA 2Y69H 4XLFA 2R5ZA 1SACA 2RDRA 2QQBA 3ZM8A 4PF1A 1IKPA 2RS13 5IY5H 1WMDA 1LEDA 2KD7A 3L9FA 2I10A 2RS53 2C4XA 1ULYA 1YJ9I 4JAAA 2EICA 2EV6A 5CVVA 4XLHA 3V64A 2VQLA 2DDUA 4NPRA 1OPCA 3OPWA 1MEC2 5C3PA 4PDWB 3WP3A 3H0GJ 1WGPA 3GTQJ 2W1SA 2P0WA 1UY2A 4BA6A 3I71A 2W84A 1PGW1 1Q8PA 4XAEA 3A01B 1ZBA2 1SLAA 3PMSA 4KNCA 1EAH3 2PLV1 4PI0A 1FPN3 4BQ2A 5GZGA 2WFF2 3W21A 2LRPA 1OLMA 2YYOA 1UY1A 2VQUA 2UZKA 2QKMB 1ASJ3 3ZXKA 2QZ3A 1RMU1 2P4EA 3QPHA 1HW1A 4YELA 3FFZA 5CQEA 1AOYA 2EINH 1UHWA 3IN9A 3JB4C 3PNAA 1OCCH 4HF0A 3ZFFB 1CF7B 2WZR1 5J48A 1Z7S2 3K46A 3C7OA 3HOBA 4EJTA 1YUDA 5A1AA 1H0MA 1P8JA 4GULA 3NSTA 1B35A 1GZCA 2Y31A 4ES8A 2HVRA 2VZQA 2E71A 1HKTA 2B63J 1FOD3 3POGA 1RC9A 3N05A 1H9PA 4QAWA 1FP1D 5F1JA 5C6CA 3H50A 2JDMA 4KNYA 2Y6KA 2JPBA 4IPAA 3DN7A 2FD8A 3BJ6A 2EQRA 3WODF 4EE2A 1HN1A 2KRHA 2Y0MA 4LLLA 1W36C 4XOTA 2VMCA 5EHDA 4XUQA 5A6QA 4YG3A 2VBPA 3VBFA 5KR7A 3LE0A 3F8MA 5GP9A 2QQAA 1DZQA 3HTUA 1PO13 4QX7A 5FJ8J 4V2GA 5HDGA 1SLBA 3ZQ7A 3LSIA 2E7AA 5A6XA 2QENA 1PUEE 2YFUA 2FQ3A 3S16J 4JX5A 2E2JJ 1W6NB 1XN7A 1KEXA 2J1UA 3ZXEA 2DW4A 2EIBA 3HQUA 4BB3A 2EV0A 3KZIC 4QQHA 3KP3A 4Z8BA 1AX2A 4RFRB 2RDQA 4YFXF 3K4CA 1RYYA 2I07B 2ETHA 3GTJJ 4LMFA 2WAFA 3WGGA 3S93A 3M8FA 2OXBA 5LK5A 2BPA2 1FX5A 3V0AA 2X29A 1HV0A 4AI9A 2DU0A 3KZZA 4P9GA 2VIXA 3CMYA 4KWJA 2G9GA 5FDBA 4YRDA 1LNSA 5BNPC 5C3QA 1ZG5A 3AFGA 2DVDA 3BY6A 3VLBB 3S1NJ 2PJRA 1ACCA 3KZ4C 4IEJA 4A0XA 3CLQA 1N25A 1VAVA 2JWPA 3IHUA 3ZQHA 4X8PA 4F7ZA 1FMVA 2HWC1 1RIOH 2VUCA 4CZZA 1H2MA 1LAJA 3MZHA 1YG2A 4CPBD 1F5TA 4PHZA 5DDJ1 3W5NA 3HBKA 4LKFA 4BBSJ 1RUNA 1LOFC 4FTEA 2QM3A 3OBRA 5GALA 1UCRA 2BFUL 4HKOA 3ZYGA 1MQTB 5GZEA 4WVWA 2L3DA 4I02A 2KKOA 4RN5A 2A6VA 2QWWA 4OQ9A 3VYTB 5AIQA 1H1IA 3EJKA 2M8GX 1SD6A 5G05L 4DGWB 2DDAA 2AUYA 3VKLA 3ZIXA 1MJBA 4QQ2A 4QPWA 3I55I 2XF5A 1A04A 1R49A 2L7ZA 3OYNA 2KZGA 2ZXIA 2R0QC 3KV5A 2ZX0A 2KMUA 2ZFWA 2WNUB 4ZYEA 4A44A 4CDWA 4B4QA 2VKDA 1XNTA 3HR9A 5FXWA 5A6YA 3HOUJ 1MR5A 4CCMA 1AR92 3D4KA 1W8ZA 2CUZA 1QJX2 5FZEA 2IXIA 3S2DJ 2CDOA 1NLSA 4L0PA 3EMRA 4Q5SF 1E3OC 2QQPA 3LMMA 1Y9QA 5E3OA 2GSYA 2E1NA 3CDIA 4CHUA 2QBXA 3I2DA 1R081 4CDXA 1MKMA 1HV1A 1PVC2 5CG8A 4RS5C 4MTEA 4Y7NJ 3G1LA 2Q1FA 4YW6A 1KDMA 5J1XA 3WGHA 2O7OA 1MNMC 4HX4A 2DMNA 4XJAA 3EHKA 2C0ZA 2DA2A 2K5CA 3WQ7A 3JQWA 4LO8A 2KISA 1QU3A 5C3EJ 1DPRA 3U1KA 5AC92 2XAUA 3LB9A 1US3A 3TP0A 3Q9VA 3F6VA 1VJ2A 5FY9A 3PVBB 3TN91 2XAGA 3AZXA 5APAA 1OYIA 4FI9A 1UAAA 4N53C 2OPTA 2GC0A 1JZ7A 1VZ0A 4HV5A 4GD4A 1XDSA 1OFCX 5T50A 2QJVA 4AIHA 5HLHA 4BPZA 4XCAA 3JRGA 1DYKA 3HUGB 3MFCA 2VTXJ 3HD8B 4LG3A 1SFNA 2H6CA 5ICEA 1S8NA 2WWJA 1KJLA 1VQ8I 1UU5A 3JRFA 2HPMA 1ZZ8A 1KS5A 5J7MA 2L9RA 1CIWA 2ELKA 1IN8A 3ZRGA 1SAXA 1DDNA 3VZOA 4RB0A 4A45A 3QODA 3M3OA 4A3EJ 3V8JA 2VG9A 4S2DA 1D0GA 1YIJI 4Q4V3 2CSGA 2BFUS 4YGBA 3UR3C 3UT0A 4W97A 4P5HA 1V6LA 1GLNA 2VBDA 2ZMEA 3WD5A 4AHZA 1VB4A 5DUXA 2GC3A 4LJZF 1C8M3 3HSFA 1T6BX 1T95A 1Y8RB 4QGMA 5JR7B 5EP9A 2VASA 5C33A 3HEFA 1CAUA 2Z99A 2EZLA 3B93A 5ILSA 4XL9A 3K70C 2GNBA 2W0XA 5ERLA 3HOXJ 2ESNA 1TW2A 1I27A 4FX0A 4A5NA 3VB9A 2K7LA 1KFXL 2GH8A 3N7LA 3PMEA 1WCDJ 2Y34A 1GZWB 5DEQA 5CFDC 2L7MP 4DRRA 3CCQI 1REDA 1T0FA 2CGPA 1D1BA 1LOAA 2X48A 1T08B 4IRHA 1ZG1A 3M70A 2R042 3Q0UA 3LPGA 3BTYA 4BHCA 2DUOA 2A6ZA 2OW4A 3AX4A 1B72B 2A70A 2P3KA 1VQNI 1FYKA 4GCVA 4Y1YA 3I58A 1Z21A 4I01A 1LENA 4CSWA 3IMMA 1MMNA 3BALA 1EKEA 2DXIA 2QYOA 1FI2A 3VDDC 3KEYA 3LL7A 4XKWA 3URFA 3TP3A 5FXXA 3OWTA 1FEXA 4F52A 2PHXA 4Y22A 4AEDC 2OT7A 4J01A 4LULA 2I5UA 4AGRA 1FTTA 4E7KA 1JH5A 5IPAA 1XQNA 2JG8B 5FPZA 2P1BA 3O1MA 1S0CA 4RD7A 4KI5M 5FYCA 1TQ5A 2EFWA 3BJAA 3E3VA 4NE9A 5JI6A 1V00A 2BWCA 5LA1A 4XDPA 1IHMA 2W46A 3J7HA 3IAQA 1B8IA 2YUEA 3A4UA 2X1EA 4G6DA 1OVSA 3GCWA 5T5LA 5DPNA 3A0HC 4NUBA 1MPXA 1ZZBA 2JT1A 1AKHB 3AAFA 1MBGA 2YX7A 4GZ9A 5FR3A 2IA2A 4HNUA 2XB0X 3REOA 2WYFA 5H9RA 1ULOA 2R5YA 1UO9A 4E8CA 1SDWA 2IXCA 4ZH4F 1ULDA 1W9YA 2B4KA 2A61A 2J1VA 5JZGB 4GYIA 2EZKA 2EIJH 3PUIA 1XE8A 4LK6A 3AMPA 3QAHA 1PIV1 4FPFA 1IS3A 4G3YC 3PLQA 2HWB3 1NQJA 3BDDA 4GH4A 2Y6JA 4LLOA 4NHJA 1X3WB 2XKOA 1KRIA 3H3ZA 1JUIA 1NCRC 3NO8A 3FMGA 4QKDA 2AACA 2G1MA 2WO1A 2VVEA 3U14A 1CAWB 3I4PA 5HDNA 2R4GA 4HK8A 2Q8CA 3USUA 1UZCA 4AQ2A 4MEXF 3GYDA 1ZGJA 1EH8A 1JKQC 3PUHA 1H1MA 3WTSC 1O3TA 1VBA1 5GM0A 1R1ZA 4NIDA 1Z77A 1WMXA 5TSWA 3OUIA 5FKNA 4ATEA 3ZFEC 3INAA 4F91B 1F5JA 3UYJA 1W6PB 2I74A 3O1OA 4H7MA 1Y8QB 2WRAA 3BPZA 1L0OC 3WLUA 5LBCA 2JB4A 3HWJA 4L9NA 3CD6I 1O8SA 2QE3A 2I45A 5BNNC 1JHJA 3CCVI 4TTGA 1KITA 4QGNA 4M9SA 2W92A 3ULQB 1GICA 1A8DA 4EM1A 2RMU2 4FHTA 3OL4A 3IAS2 1BEV2 1J3RA 2HQ5A 4JRLA 3SEEA 1YO8A 3VSKA 1UJ8A 4K1ZA 1JXSA 4E7SA 1REFA 1YYNA 3VHPA 5B5EC 4ANJA 4N43B 5JR2A 4UFLA 5F5CA 4TXWA 5A33A 3JW4A 4NPMA 4G9YA 5A3WA 1GVDA 2ARBA 4HPKA 1YCIA 3PL0A 2GNTA 2Y6LA 2GC2A 2XIGA 1IDYA 1PGSA 3VV1A 3ZCOA 2EAAA 3NWTA 4QSHA 3V42A 5C9AA 4XJWA 4M3FA 1TP4A 2PN5A 1PX3A 4Y5Z0 2R7ZJ 1YS6A 3LFKA 4QPGA 2O1QA 2O8KA 3QRFF 2JG9B 5FZ6A 4COYA 4FISA 1YOVB 1L7RA 3EQLF 2WDBA 3A23A 4ATFA 1D5YA 4HQMA 1IRZA 2VECA 1ZGWA 1RZ4A 2E1OA 1G9BA 5A32B 4E2QA 2CWEA 1IN6A 4DBQA 4CTEA 2WBKA 4YGDA 5C3OA 5E17F 2V9KA 3POIA 2B7EA 4NN0A 3ACIA 3Q8CA 3ZO0B 1LU2A 3O1TA 2R073 5FUNA 2DMPA 3WU2C 1AHDP 2QQ8A 2JE8A 4XHXA 1UAIA 4FTSA 3U2RA 1JODA 3C2BA 4BEHA 5FXZA 2EFPA 3FBIB 1POV1 3BR6A 4ESFA 4J1XA 1D0HA 3OIPA 4BK5A 1ACIA 2BZDA 5FQ0B 3RI9A 4FAGA 2AEZA 3B6AA 2XQRA 3MI8A 1XS9A 1QJZA 4IHVA 3TNPB 4LIVA 1K12A 2R7RA 4IOAF 4EJWA 1GVJA 2CW0F 5FRAA 4B48A 4BOWA 2CW7A 5BYNA 2XJQA 1JTYA 5L3BA 1VBB1 2A6EF 3I2IA 3MIBA 3VBHC 4Q47A 3GBGA 3AJZA 1YFHA 2JE7A 3CEWA 4NJ4A 2R30A 1YLFA 1Z1DA 5C8CB 1QHDA 4QX0A 1VRBA 4Q4W1 2FDFA 2WB1A 3N3HA 2PMWB 2DVBA 2Y0SA 1OOPA 2FNAA 3PVNA 2LMDA 1VP6A 1WPKA 5DUVA 4YIIA 4LBOA 4TV7A 2MH2A 1ND2C 4LHLA 2RS12 4QKNA 5HPOA 2W48A 4EJUA 2HJIA 4Y3OA 2IVJA 2R7VA 3HNYM 1RKWA 4NWWA 4CEWA 3RJPA 2RJKA 2RS52 2Y0OA 1CPMA 4FXKB 3CMAI 4IEXA 1A34A 1Y43B 2HYFA 2YBPA 1E0EA 2CWMA 4QMAA 5F39A 4QXBA 4K6BA 1IXSB 5JMOA 2HWD1 5M3FJ 4OLLA 4RM2A 3V65A 4AW7A 1R5HA 3T2OA 3ALQA 2HWF1 1F43A 4MLOA 1FOXA 3T0BA 2A68F 3IUOA 1X58A 4I0BA 3L09A 1U0JA 1PMJX 1OLME 5IVVA 4XQ4A 4EATA 3HC7A 1S0DA 3BOPA 4D7YA 5DCMB 3DYPA 3PNYA 5DS9A 5EJCA 1W2NA 2FZ1A 2ZXJA 1YFUA 3I3EA 3F95A 3O5SA 3SKVA 1SFKA 2PFWA 4KBZA 1PYVA 4YFKF 4W65A 1RUG1 1AL23 3BB6A 2K0GA 1ZH5A 3BKZA 3TBDA 1NCQA 3ZYFA 3KETA 4YSFA 3MZ8A 2M87A 2V1NA 3CUOA 3ZN6B 4ZZLA 4A3ZA 2K3FA 3Q9OA 5LGTA 1BK0A 4RQPC 4A0ZA 3U37A 5FCCA 1IDZA 4LD5A 2RM21 4D5CA 3KEQA 2RG4A 4M6VA 1X8EA 1QHGA 2F48A 2E9QA 3UKGA 2OQGA 5A70A 2DYRH 1JXNA 3HOZJ 3UETA 4NHYA 2EAKA 4DUXA 1PO12 5J09A 3KT1A 1AR82 4RAGA 4M3EA 1RUE1 3NJYA 2R7FA 5HS9A 2D6PA 2HVSA 4XFAA 2P17A 2GU9A 1Q8VA 3HDDA 1MVQA 3K3NA 2YX4A 2QBYB 2AEYA 3ROUA 3OS1A 3ZYBA 2Y64A 4EJVA 3ZN5A 2VXZA 1CD3G 5E8AA 2MEV3 2PQQA 1Y4WA 3HRTA 5B4NA 4YFNF 1W6OA 5F0CA 3M3YJ 3MF9A 3J7LA 2PFBA 3LIGA 2ZC2A 3VZNA 1SVOA 2VCAA 5J8FA 1LTEA 4HLYA 3FJSA 1XC6A 1VQLI 4QXHA 1ZBE1 1B9MA 4CZCA 5H9QA 5EQUA 4IV3A 4Q48A 3PO2J 2ORZA 1FMD3 2DN0A 3HVDA 3JD71 1RJ7A 4GO1A 4QTRA 4W6WA 1ZARA 3SLIA 5IT3A 5DUKA 4KN7X 3OY8B 5A2QZ 3D8CA 4UUSB 2RQQA 4JZRA 1GT0C 4WM7A 3VBSA 3I2OA 4CEYC 1Z05A 1W0OA 2CWSA 1GQGA 4ARXA 2HDWA 4GB32 5FP9A 2R7SA 2K9SA 2FDKA 1XCBA 1ZHFA 3FHAA 1VAMA 1GR3A 3WINE 1STZA 5GLUA 4ZTJA 4CUGA 4RA0A 4QHBA 3OBAA 1VQ4I 4Y4YA 4YFZA 2K40A 1ERDA 4WX9A 1OA3A 4BQ1A 1V9U3 2Z2SB 4DO0A 1P2FA 1BVP1 5F9TA 2IVIB 2LNBA 2GMEA 3HMYA 4FAHA 1J9IA 2X1CA 4LB5A 5IVYA 4AXOA 3S32A 2MLKA 5C3RA 3A01A 3S3MA 2QSGX 1DBNA 2NVXJ 4B3AA 5A7OA 5EZHA 1MZ6A 3DKQA 5L9RA 3MYXA 4FP2A 1IV8A 5L7OC 3JTGA 4I7HA 3BR3A 1L3JA 4ISRA 3N9QA 3F8CA 1JYXA 2VODA 4BQXA 3DLAA 1DZRA 5FYIA 3SNMA 4MFEA 5ACA3 3B3QE 2IS6A 5F6FA 3CJQB 2N7GA 4A6DA 4B4CA 1CF7A 3QU3A 2VZ3A 4RMNA 3JRDA 1JYWA 5H20A 3VD5A 1IXRC 4WVZA 1TQIA 1VQKI 2VBXA 2ID6A 2WAEA 2PHWA 1K78A 3O3KA 3RJ2X 3CDHA 1OVPA 4OWRB 4CUBA 1TT0A 1XMKA 4ENKA 2QTWB 2M9HA 1ZA4A 1QJU3 3WP5A 2M4KA 4YG0A 4NAMA 4LORA 3LDBA 4JX0A 5KC5A 1BJQA 2WAOA 2W7NA 4DMIA 2A6HF 1QQP2 4V1PA 4BYYA 5HLTA 3TEWA 3K4JA 2EFNA 4OMZA 4WF2A 3DCFA 3WTYC 1X82A 2DT5A 3T0YA 1T6SA 2GMPA 3S2WA 4IE7A 2E26A 1K4SA 4QX5A 3ZMZA 4C8DA 1I1SA 2DA1A 2ZGSA 3AZYA 5DABA 3WU0A 1YEWA 1VQ6I 2M45A 3IBMA 3HT1A 4IX7A 4MX3A 1DQUA 1BBT2 1F31A 2GLOA 4IUGA 3T4VA 2JDHA 3ZMUA 1H8VA 4LUKA 4LK1F 5HODA 2ZGOA 2J5OA 1VBD3 2EIMH 3E0JB 3WV6A 1ZLJA 3POFA 4NB5A 2QQKA 2A69F 2WAAA 2D44A 2X53S 2MC4A 2F5VA 3WNKA 3BPSA 3L2YA 2VM9A 1UX7A 2CJJA 2EA2A 4E6KG 4OI4A 4CDQC 5FYSA 5FYYA 2I2SA 2WO3A 2KLOA 2ZGNA 4DJAA 1OF3A 1D0ZA 2Z42A 3NRVA 5FWEA 1IAWA 2W95A 2WNVA 3ABZA 1RUD3 5T5PA 2XQXA 5JVVA 1OXCA 3KGLA 3ISPA 1IS6A 4HSLA 1MGTA 2XF6A 2XRLA 1S0EA 3H5AA 1UXXX 2AH2A 1SBEA 2H8WA 1AXZA 4MHUA 2RJ2A 4NC6A 2QQMA 4LGWA 3AYDA 5C4XJ 2DCKA 2QCSB 4UVAA 4RR3A 4ET7A 1W39A 1CZSA 3K4LA 2STTA 3RFRA 3MAJA 4P96A 4PCQA 5JI9A 3GFMA 1W06A 2VQCA 4Y26A 3LSMA 2ZGTA 3W59A 3WCRA 2A3WA 4OUSA 1UG0A 4F3JA 2O8OA 3CUQC 3NL1A 3A2KA 3T1LA 4YZ1A 3ATGA 2B0LA 3RVHA 2FHRA 4L8QA 2BY3A 3VUOA 3WNNA 2BZTA 5HV0A 1JGSA 4B09A 4UFMA 1L7QA 4BMBA 3OYWB 2CQNA 5LBFA 5D8AC 4PFOA 1HLVA 2A7AA 5A7NA 1JT6A 1ENSA 2L7KA 2BQPA 2IGNA 2NOJB 3BVCA 1WJFA 4YVWC 1LRHA 2ELJA 2CU5A 1O3SA 2XLAA 4O3MA 4XJUA 5CU1A 1S0JA 1WUVA 2FQ4A 4M72A 1FOWA 4BGDA 2WTEA 3NV2A 5D2AA 5JR3A 3POJA 4N53B 4RA2A 4KICA 4EYUA 4D6RA 1FC3A 3CCUI 3C8XA 5F3GA 4INDA 3BJOA 2XXZA 1FYMA 1BLZA 3ZP5A 2BHYA 2DTYA 2WLQA 1I1GA 5IP6A 3WF0A 4EN8B 1BR2A 2HOSA 1YWKA 3KV6A 1ENXA 4Y52J 1WW4A 2J22A 3B69A 2JIJA 2PLV3 3I8TA 2AS5F 3UESA 3PSIA 3VODA 1LKXA 2BERA 1PMIA 3HNMA 1D5VA 3BROA 1CESA 2KPMA 4M9ZA 1PMHX 3ERED 5HXVA 4JKLA 2XKPA 3ZXFA 5J1YA 2HWB2 4TLGA 4CUAA 2BEOA 1X9PA 3WNPA 2L9SA 5FPUA 1HB1A 2X85A 2HNHA 1UN1A 1BC8C 4AAXA 5E89A 3C7FA 2L9LA 4OHVA 4UW3A 1XOYA 4BL0B 2D97A 3DGTA 4AL9A 2R3SA 3H92A 2RC4A 3WNLA 1ZRFA 5A1FA 2M2EA 4JYKA 1Z3YA 4BDVB 1D4M2 4NDLA 1V55H 3ZMOA 4ZPIA 3ZFGA 1RUH1 5CFDB 1RI7A 3Q8AA 3FZ3A 4FPLA 3HT2A 3S2HJ 2LRDA 1TWFJ 4Q0SA 2PX9A 4XAAA 3UJQA 2ZGRA 3CCMI 2BGOA 2XOMA 2KDZA 1JI6A 2VBYA 1V5FA 4F93B 1EUTA 2CQKA 4CCCA 1R091 4UNOA 1E57A 3N9LA 3TEDA 1NE6A 4GFBA 1C4RA 1KU9A 1QPIA 3QACA 3VDDB 2P7VB 4AVTA 3N9NA 3JRBA 4Y20A 1X19A 4NC8A 4Y24A 1W8TA 2YR2A 4MEYF 4XBQA 4XF1A 1JUSA 1LEAA 2OPKA 4XJZA 3D0JA 2VVFA 4AEDB 3BOWA 1ST8A 2UV1A 1HBXG 1P4AA 1AL0G 1IS4A 2E51A 4U0VA 3J7AO 4XK4A 1TG7A 4ZS3A 3MO4A 1Q56A 4OYUA 3I9V2 3ZXGA 1PZ8A 2EIGA 3H9AA 1RTVA 3ZXSA 4BWOA 4AIKA 4XQDA 1O4ZA 1CQTA 5IAXA 2JXAA 1T39A 5FKCA 4XCBA 4IQ4A 2B46X 3ZSLA 3OR1C 5LEKA 4C30A 1OCRH 2NMOA 3CCJI 3D5SC 1B72A 5FPBA 1FWZA 1KYWA 4LK7A 5GLWA 2P6HA 4FFGA 3VBUC 4LQRA 2BV4A 2AQEA 4WBBA 1VQ5I 3KIOA 2HQRA 2WABA 3N97A 1TME3 2Y30A 4F92B 2D3SA 2UU8A 3AJYA 4UAPA 3VPRA 3H5RA 4F8AA 2PMHA 5FB2A 5EEHA 1SMTA 2P3IA 2PXJA 1C1LA 2HWC3 2W68A 2R072 4DZPA 2VD7A 4BE1A 1D2SA 5DDJ3 5D5UB 5M5XJ 2JG8A 1UZZA 3KMHA 2XC7A 5FYUA 1CZVA 3ZR6A 1J75A 1NA1C 1TMF3 2QFEA 1EPZA 5CKNA 5FP4A 3BQYA 3GTLJ 2GC1A 2ZFUA 1H8TC 4ISQA 4A3FJ 1W2OA 4D0PA 2BU9A 1NCRB 2ZEWA 2CV0A 3J80Z 4IQJA 4AG4A 4TYSA 4S2FA 3E6CC 3LOCA 3BT9A 2E5NA 4A3IJ 2VVDA 5JAXA 2KIUA 3Q0WA 2XJSA 1TEIA 2BOJA 1RUJ3 4BLJA 2P3JA 5IW0A 1NE4A 5FZOB 1WFXA 3T09A 5TISC 2LC2A 5D4SA 1QBJA 1XPWA 4FPJA 2BY0A 3GJAA 3KLOA 4NRQA 3CLOA 4CXYA 2MFZA 1AR73 3ZFEB 4L5EA 4XF0A 4X6QB 3TL4X 1BN5A 4RAZA 1ZK8A 5GPAA 1DPUA 5JSRA 1BJZA 2IS2A 3QYBA 5B1BH 3OYFA 1Q1HA 3TDUC 3VBRC 3GHNA 3ZMSA 1WCMJ 1LDKB 1G7YA 4CXWA 5BNNB 4LUMA 3H0OA 1RUI1 5E6HA 3GCXA 5FFOC 3NJVA 3J7AY 4WCGA 4YG6A 3RYKA 1CAWA 2VZOA 3ZSKA 1JZ8A 2O0YA 4JGYC 4YWAA 2ZX3A 5D5VB 5D8KB 5KHHA 5A3MA 3DWLE 3NKTA 2EVXA 1W2UA 4OU0A 2A05A 1JZ2A 3N9PA 3I0TA 1Z7LA 3S8PA 4PQ9A 2CU7A 4PZJA 5FZ7A 1P4XA 5FZBA 2E63A 4XQWA 2LP0A 2TUNA 5LY1A 2XHKA 4Q4Y3 2VB6A 2UYAA 4RHV1 4MGYE 4IETA 4DXSA 4P00B 3JBG3 3C7JA 2QDNA 2XGDA 5F04A 3TWIA 3VGIA 1PM4A 4AEJA 3CLPA 4N9HA 5KVRA 2PHRA 1Z3XA 3RGBA 3RSNA 1LB2A 2JDUA 3WF4A 2R7EB 3M4FA 4DXZA 1GLHA 1FY7A 3RYPA 2OA2A 3TOBA 1U0AA 1Y0NA 1LHVA 3JZVA 1HRV2 1VRH1 1AL22 2NPIA 4II2A 4AFMA 1WD3A 4DUVA 4AVAA 4UI9L 5JI7A 4FPCA 4MG2A 3UGGA 1IRFA 1VBE1 2IXHA 1HX6A 2YROA 1MS5A 1RUC1 1OT5A 5L36A 4Y17A 3AKTA 4AQTA 4PDWC 3MEXA 2TDXA 1R64A 2HS5A 2Q2EB 5C7GA 3BTIA 1K83J 5FLIA 2XBO3 3DF0A 2JG9A 2DA5A 3WUDA 4E7JA 5L3CA 6PAXA 2DPUA 1WLCA 2PEXA 4FSJA 3DUIA 4XR6A 3MWMA 1NHAA 5A32A 4UFKA 5DM7F 1WW5A 1LDJA 3G6JB 2PHFA 1W9FA 3VBHB 2WQZC 2VJIA 2HEVF 1QOSA 4FQ4A 4UFHA 3SISA 5DUIA 3ZFFC 2KRCA 4AVCA 2ZHKA 3AMMA 3FXKA 2XJRA 2MBFA 3PM1A 3CQZJ 2AQFA 5FREA 1OUSA 4XXAA 3H5NA 4LK0F 2FBIA 5FQ0A 4AI3A 2F5FA 3BCAA 2ZZQA 3BTCA 1WBLA 2YXSA 1MZBA 4JGZC 4N7IA 2VJJA 1UIJA 1HXS1 3FIWA 3S17J 4YPJA 1XE0A 1ND2B 4JC1A 1JKPC 1E2XA 4Q4X3 3IMNA 4B8EA 3OB8A 1KQ8A 2XASA 2UWAA 3SCHA 2ZMNA 2K2SA 3KV9A 1PUFA 1RGSA 3H1MA 1LGCA 1ZN2A 1R1UA 1CGPA 2V5YA 2YB7A 4I3PA 4PI2A 2D6MA 2MYSA 2JX9A 3WDVA 5JHUA 1GXQA 4A7KA 1QJY1 4ON0A 1JYVA 4LOSA 4YGCA 3C1DA 1FTZA 3OBZA 3BI3A 4A6SA 3VZKA 2JA5J 4HG6B 2ZEXA 2OUJA 3HOYJ 3VEPA 4MGKE 5FMOL 2WR9A 3VBFC 2OTLI 1UIKA 1MBFA 4IEZA 3HIFA 5FLXZ 4A3KJ 1AX1A 4YM0A 2J1EA 1S0FA 2BNMA 4QU2A 3TQNA 4UF0B 1LECA 4BE3A 5CVJA 2NLRA 1V9U2 3ZX7A 3HN1A 4M71A 4BMEA 1SDDB 4PIZA 3U4SA 4MVTA 4ZKTB 4IRIA 4BLIA 2CDPA 2IZWA 1L7LA 5F2WA 5CZKA 1PJRA 1NLQA 2JSCA 5KWRA 1NOVA 1FBSA 2MD5A 2ISZA 2DV9A 2FOWA 3PDQA 2V4JC 1IW7F 2KL4A 4IE0A 2IJLA 4UVBA 4RQPB 1GNYA 2O61A 2WL1A 2WQ4A 5FJHA 4WVMB 4BZ4A 3HPGA 3MIEA 2ATFA 3PNTA 2OYZA 5DCMA 5GTHC 1OCTC 3K77A 1ZBA3 1QKQA 1JE8A 1HRI2 2WFF3 1QJFA 1UHSA 2FF4A 2X5IC 1Y1WJ 3THPA 4IV1C 1YQ5A 2F6CA 3DPTA 5F27A 1WLDA 3G71I 1OYWA 5LGNA 3H3VK 4FTHA 2X05A 1YJWI 1OFSA 2VZ1A 4Y1ZA 4GWNA 4ZYDA 1OURA 1G59A 2W57A 4AVSA 3ZN6A 2Y9YA 1RNLA 1QZYA 1Z7S3 3WDXA 2ARXA 2VAUA 2QDRA 3CHXA 2AC1A 1GZTA 3WY6A 1UOGA 5L3FA 1H30A 1YW7A 1JKRC 4IGOA 1HB4A 4A3JJ 3AM2A 4H3WA 1N1VA 2H09A 1Y1VJ 1SQ4A 4QB2A 3WF2A 3LFUA 1PO21 1KONA 1YRZA 1QZZA 3VN4A 4HW0A 2ZA9A 5DTDA 4AF9A 2GA1A 2W08A 2FD5A 2CUEA 2NAZA 4UV9A 1Z6TA 5A7QA 1SCSA 5DM6F 2KFDA 2ARCA 2XL7A 4CDWC 2QBYA 1TQPA 1T2KA 4HA8A 3EUKL 4ESBA 4D6SA 3J8F1 4CEYB 5FPXA 4QB1A 1K61A 1IV6A 1QPMA 3S7IA 2CAUA 2CUJA 3C2HA 2V4AA 4ARYA 1U5ZA 2D40A 1W6MB 4LHSA 4KISA 1QIQA 1SPPA 3HHGA 3G2BA 1YX5A 4E4DX 1CWPA 2VNOA 1MS3A 1JGGA 3FE5A 5K5QA 2VH9A 4CDXC 3WQ1A 5DAQA 5LBEA 3Q8BA 1NY72 5J40A 1BJAA 3LEKA 3E5QA 5C5TA 2XVCA 1F4KA 2XVKA 2VW2A 3PIGA 3I5UA 4QPQA 4DEVA 5IOYA 3VDCA 2JSPA 3OY8A 2COBA 2RV8A 4UUSA 5A3TA 1TC3C 4S0HB 5L7OB 3O1RA 3F8NA 2VJXA 3FM3A 2NVTJ 2DJIA 1COV1 5EXOA 2VZSA 3ST7A 2KRFA 1Q43A 2G7HA 4CXFA 2BWAA 2YGLA 3HJRA 3HOTA 2VKVA 2OJED 5J4YA 1TWGJ 2VLAA 3CF6E 2DTRA 3RG0A 3WTVC 3MF6A 2XPUA 2XUEA 3I7DA 1AHSA 1G4DA 5GZFA 4DNCA 1NLRA 1M06G 2E6VA 5BY5A 5FMDA 1AYN2 2W1OA 2EH3A 3DTIA 2WWUA 4E7IA 1W8WA 2ZSIB 2UURA 1RETA 1FJLA 3OYEA 5IYDJ 1IQDC 2UY9A 1VBB3 3D5LA 3C3WA 3I3LA 5A2QK 1SMYF 4MYEA 1J3QA 1B6AA 2HOAA 5LZ6A 5F64A 4L97A 4Q26A 4OZXA 4ENJA 4KMUX 2GNDA 1W8OA 1BZWA 4HVQA 5F6LB 1SBDA 1FXZA 5I8TA 2LDUA 5DZFA 5C4WB 4WZCA 1X36A 4DQ2A 4UUTA 1TLHB 3GZEA 1R5GA 3CJIC 2R49A 3FDYA 4G8XA 4CICA 5TRDA 2E34A 2OQ6A 5H9SA 4AIDA 2AREA 1U5TB 2VXJA 4PIYA 3MD2A 5E8IA 3M3QA 3AMNA 1MBKA 1QF3A 3VWBA 4LOTA 4XUNA 5F8PA 2R061 4PLNA 1CPNA 2DLLA 1UCXA 1AR93 1LODA 1EV11 3GEZA 1QJX3 4UW4A 5FFZA 1PGW2 2RR11 3LSGA 4GYGA 2CG4A 2PLV2 3ZSEA 3F3XA 4YM2A 2Z5UA 2DFBA 3F6OA 3KVBA 3SITA 2DMQA 4HZFA 4DXTA 1OQDA 4OAYA 3P9KA 4P9IA 3ILFA 3K4DA 1RMU2 2JVGA 1DQ6A 4CU6A 4CGZA 5K4LA 4D94A 3KLSA 1SVLA 2WZR2 4A2UA 2HOEA 2Q0AA 1USTA 5FP3A 5AC93 3CMMA 3KGZA 5BNPA 1G3TA 2AR6A 4BQWA 1E5IA 3CJNA 3KCYA 4RSUA 4DUWA 2QVOA 4A93J 1CAVA 2ZNZA 2LALA 5I0RA 2Y0IA 2D7FA 3ECOA 4V19K 1GV9A 4IHXA 2ZX1A 1PP7U 4XPVA 3ACFA 2RVAA 4L18B 1UX6A 4G7ZF 1R22A 1D2QA 3ZYJB 2LOOA 2R7OA 3TW7A 1WCUA 3SQOA 3WTUC 1LOFA 5EFUA 3WF3A 2RM23 3MQ0A 3VD9A 1KYZA 3IH4A 2IBDA 1APNA 2DCJA 5FP8A 2TEPA 1VI0A 5D5WB 2D45A 2VBWA 3CUQB 2ZNYA 1WJAA 4OI0A 3NMBA 5JZGC 4LBQA 1AYM1 4P5OA 1G3SA 1RUE3 2JE9A 2WLPA 2VUMJ 1PGL1 2YU3A 3V8KA 3LDRA 1NZCA 4Y4RA 5D8AB 2K9MA 4QB6A 1W36D 2VOPA 1AR61 3P5BA 2OCCH 3SC7X 2L01A 2BW3B 3FUQA 1F2NA 1XNBA 4YVWB 3LA3A 4AHYA 1PDNC 2X1DA 4MXWA 4MUVA 1JHFA 2DURA 2GXGA 2DUQA 1U8RA 5FD5A 1ND3C 1RUOA 2CV6A 2WSUA 4A3DJ 3T2TA 3H9GA 3NAPC 4JDNA 3HXLA 1ZBE3 4AQSA 5IK4A 1YQCA 2GA2A 1TBXA 4LTAA 1YQ8A 3RZMA 1PK6C 1YC61 1E3PA 5CLSA 3JSOA 5H2FC 4EZ4A 1JZ4A 2R043 4XACA 4O9EA 5FRMA 4RS5A 3JD73 2WAQA 4N7UA 1FOKA 1ZZ6A 1GANA 1HKSA 1TWHJ 2HWC2 1DP3A 3USSA 4M3GA 4UVCA 3H7JA 2LROA 5DDJ2 3OYJA 3MZYA 1AXKA 4B4RA 4B3XA 3IRQA 1FNZA 4XETA 4N53A 2J5PA 3DBHB 2DFHA 4II3A 2ESHA 2XGEA 1UNBA 3Q8EA 4P9WA 1P9QC 1YNAA 4I98B 1W9SA 1IO2A 4DRVA 1K7AA 3BP8A 1QXJA 4PJYA 1NUKA 4QDRA 3SH3A 5IWFA 5G04L 4HRIA 3D82A 4YFWA 4IE4A 4YZ2A 5EEAA 3WU1B 5JIUA 2IWGB 2E35A 3KP5A 1JYTA 4HBNA 2VUAA 2XONA 2VOTA 3WP6A 5FZCA 4DNYA 2A5ZA 1IUFA 5A3NA 4CCEA 1TNSA 4B7KA 5FZKA 1Y3TA 2Z3YA 2D6LX 3U10A 1SG3A 1IPKA 4L0ZB 4OMDA 2O8QA 3JR9A 3POEA 4LBQD 5C9AC 3C7EA 3J7MA 4LR4A 2HYJA 5HXMA 4JBAA 4A6EA 2YY1A 4A3BJ 5LFAA 2ILMA 2P8TA 4OHWA 2W82A 4QXCA 4KGQA 3EXUA 1PVXA 4HBLA 4XYXA 1J0RA 4XLEA 2PBIA 1IOAA 1R082 2E7TA 1JYCA 3CMGA 5KNLA 4MZUA 2BY1A 3I56I 1CX1A 4K8RB 2LD5A 2JVHA 2IFRA 4KG8A 3T5XA 4DZJA 4XBLA 1LHNA 5F3CA 1EAH1 2VCBA 1FPN1 2ECBA 1I9RA 5CFDA 4M0NA 2IFWA 3RPUA 3HJEA 1X50A 2A6TA 1WI9A 1AA7A 1ASJ1 4YZ5A 5M3MJ 2Q8OA 3TN92 4JQRA 3SCFA 3RNSA 2QQLA 4HFSA 3TOJA 3EYYA 5FD6A 2E60A 1EP0A 1W6QB 2Z69A 3CJRB 4HONA 3BU7A 4OMCA 3VBUB 4EM2A 3UKNA 4DW6A 1J7KA 1C5IA 2O3FA 3U07A 3VDDA 1J59A 2R7QA 5F3IA 3DU5A 4PJLA 4H55A 4XJ9A 4QKBA 4A0YA 4RAFA 3ZR5A 2P2KA 1H1AA 3FHQA 1NTCA 4JK1X 1S7EA 3RWNA 4AEDA 1HDKA 4AAPA 4CCOA 3COAC 5ABJB 5JVTA 2V9VA 2DCTA 4L9TA 3BTAA 4UHTA 4YVSA 3EPZA 2FDJA 1EPWA 5LGUA 2WAQN 3G6EI 2Q4SA 3ZQFA 1XNDA 4FCAA 2R0FA 1XG1A 4WM8A 5A7SA 2RMU3 2KT0A 5HV4A 2Y6FA 1V4RA 1BEV3 1FYUA 4HX8A 1NA1B 4I09A 2A5YB 5GZDA 2E1CA 3TOAA 3MKYB 2PAMA 4I30A 2HDDA 3PTRB 1H8TB 3VDXA 5BUVA 2LW8A 4R8HA 2CHHA 4Q1PA 2XWJB 4CEWC 3K4BA 4HLXA 3RQ0A 4Y5SA 1S7OA 4M6XA 2CUFA 3WGIA 2CQ7A 3T8RA 2X4HA 3FK6A 1R1TA 2EIEA 1LFPA 5CISA 1SVMA 4D0QA 2ZGLA 1J09A 3RMYA 3O1UA 3AVRA 2Z16A 5KBFA 3IIAA 3K70D 3CO7C 1MJ9A 4R9AA 1W3VA 1N3OA 4JQTA 3GYHX 4ZYAA 4BAYA 3DV8A 5EJ3A 2IGKA 4M73A 3VBRB 1RHI1 1NCRA 1FIAA 1LGNA 3HSEA 4AI2A 4HETA 2CFOA 4J1WA 3SDBA 3VD4A 3VD3A 3OOXA 2PA7A 2YU1A 2DQLA 4UOJA 2ME6A 4PJMA 2IAIA 3ABUA 1NCQC 1ZELA 5FZOA 2YG0A 4EJRA 3UNGC 1X1AA 2XAFA 2YSRA 1GOGA 3ZYIB 4HG2A 4XVHA 5CIRA 3L2UA 3E6BA 1PNFA 1W8NA 2YPJA 1FSEA 3T0DA 1LE8B 1Z0HA 4XKVA 1WCQA 4PF5A 3GZ6A 1G9DA 4XORA 4X1EA 2QNKA 3OIOA 2Z4FA 1XSXA 2PMUA 2KIMA 3E6MA 4HVRA 4LA3A 1LQ1A 2RREA 4KWUA 4XURA 4NIAA 5BNNA 3PUBA 3LSKA 4H2AA 4ZHNA 4DFSA 2FBKA 1OSGA 3BYWA 4YM3A 3E5XA 3FKIJ 4HDVA 3LKJA 4BACA 4M0HA 2IXSA 2L9VA 2E33A 2COMA 1KU7A 5DYMA 3BG5A 3HKZA 3OG2A 1N3PA 2DBNA 4GRIA 2JENA 3SMHA 3ZOIA 1KQRA 3WZ1A 2W39A 2XWBB 3CJXA 1VLNA 3G7DA 4JX6A 3NNJA 1IKQA 5EV7A 1KD7A 1JI8A 1PIV2 1SFXA 4EV0A 2W1UA 2AO9A 2IEKA 3FUOA 5FZFA 2R5ZB 1D8JA 2ZGKA 1DGRA 3SHFA 3JQXA 3PJQA 3BZ6A 1UOBA 4P55A 3W58A 5DAXA 2CYYA 9ANTA 2X6XA 2FA5A 3KF3A 4LBMA 1HOMA 4UFJA 5A7PA 2Z9OA 2VOWA 4KQ7A 4GXOA 1OH3A 2NVUB 3HRMA 4H4KC 1N75A 2CQXA 5JLWA 1R6RA 1W04A 5JLXA 1X1DA 3CF2A 3THTA 1RUH3 3VBSC 2M7AA 1VBA2 2OPWA 4AWXB 2X51A 4CPBA 3T2QA 5GZCA 2B42B 1YX3A 4GMP1 5HCBA 4QHZA 3RYRA 2A6XA 3FXLA 1W90A 3E97A 1W8FA 1HXDA 1VMJA 4NQWB 1KQ9A 2K9NA 1QNTA 2BVVA 2E19A 1CONA 1RC6A 1AJKA 1LGBA 1G6NA 3DBLB 1HJGA 4JGZB 4AVPA 2O8XA 3AKPA 3OSFA 1I5PA 4CXXA 1B35B 2QQIA 4P9YA 2D1VA 3FC0A 3JTHA 3M1EA 3ZN4A 2DT6A 4B1MA 4CP9A 1F15A 3VZJA 1W9WA 5A6ZA 2L4MA 1ON1A 3VBHA 3AZWA 2TBVA 4HN0A 1Q8OA 4Q4V1 4D5FA 5FUIA 2JWTA 4Q5OA 4HQEA 1C8M1 1AR83 3U11A 1DYPA 2AZ5A 3L2HA 1XJAA 5FKLA 3GF2A 2F6BA 4FBFA 1XGMA 3VBFB 4BXSV 4FE7A 3OGJA 2P6CA 2HWE1 2AHQA 1ETKA 2YGMA 3V0BA 2PI0A 1ZG3A 3RIRA 2C9AA 4IF4A 3P9CA 1URXA 4IE5A 2Q5TA 4IE6A 4IEOA 1TW3A 5LCWL 4UY8I 3WTTC 2IGMA 4NIGA 2VKHA 4D7TA 4YARA 1CN1A 4O9GA 1Y39A 1BL0A 4GKXA 5JCTA 4ZDOA 5M5WJ 4TSVA 1RUF1 4XUOA 4E4ZA 2LS6A 1FIPA 4AD9A 4ZC3A 4OINF 3P3PA 1Y9MA 5D6EA 1NT0A 1NYWA 1JUPA 4FT8A 4XIDA 5F5AA 3HEIA 1OA4A 5BOXA 1WQ2A 2JA6J 3WW1A 5KHIA 2P81A 5FY5A 1W0NA 2WIIB 2HTJA 2XGXA 1HJFA 2FSWA 2X5IB 3WW3A 4IV1B 4GB33 3ME2A 2A71A 1VBB2 4IEVA 3ENRA 4LO4B 1GQHA 4HLTA 3GJBA 4HNVA 3OSDA 3DKWA 4B7EA 1XD7A 2R0HA 3QWLA 2X10A 1VQ9I 4PLMA 3ABLH 5FOJB 3EUHC 4Q4W2 3SFZA 3ZPYA 1U2WA 1S0BA 2K85A 5IYBJ 5F0HA 4UBHA 4Z6YA 5FLXK 4Q0VA 1WLWA 4RQPA 5E79C 3ZXLA 4C0BA 1VE0A 5JXHA 3RKYA 2GWRA 3F8BA 2WNVC 5B3SH 1X4PA 2ZJPF 3GBFA 1LULA 2X8KA 3M2MA 2A1XA 3C7HA 1I50J 4LB6B 2VXRA 1SANA 5D4RA 5CKMA 1ODMA 1EYBA 5ILUA 3LOIA 4ZZ8A 2R7WA 1SCRA 4KMFA 5GAEJ 1OR7C 2HWD2 1SAUA 4CDWB 4BXFA 4XRMA 2HYXA 2HWF2 3EYPA 4M3CA 1ZZ7A 2C24A 1IF1A 2B7YA 1HA8A 3NNGA 1POQA 3IAM2 2KP6A 5BV6A 1K3IA 1J1TA 3PUAA 3CP2A 1Z91A 2Y9ZA 4M00A 4AUXA 1O59A 3ZR8X 3JAMZ 3CCRI 2ICWG 4CDXB 1LEMA 4P9JA 3RKWA 3W6JB 3VFZA 2ZXWH 1DIWA 5I93A 5IK5A 1GP5A 1QQP3 3T2PA 3OF1A 1UW8A 4BDZA 1FBUA 3PSFA 1GV2A 2LBFA 2VUDA 1RUG2 5IK8A 2QKLB 3KE2A 2M0MA 3O12A 1K5MA 5BNOC 1L3LA 1OCOH 1UOFA 4K3UA 2E2HJ 1Q8QA 1FPQA 1R7JA 2A5WA 2XUMA 5JXJA 1MNEA 3ETPA 3ZPLA 1VBE3 2K4BA 4W50A 2D6OX 1BMV1 1BBT3 1HKDA 2RVCA 3H35A 4BIFA 4LG0A 2R1BA 5FO9B 2RM22 2WA4A 5LHGA 4JQFA 2CH0A 3CCSI 2WBMA 2VE8A 1IS5A 2ZB9A 1YI2I 2VJ4A 1RUE2 1I6XA 1YIFA 3NVCA 2LH9A 4RDUA 3MLLA 2PHUA 3GW2A 2MNGA 1PM7A 1HQCA 1X8MA 1Q3EA 3MDPA 1YE9A 3J7ZI 3SDGA 4XBNA 4ZU4A 2YPRA 3FLRA 5J3LA 5HS8A 4KT6A 1YI9A 1ORKA 3EETA 3E5UA 3T0AA 5JHFA 3OYBA 1WBFA 3RS6A 4LHKA 2P5BA 5J4VA 5KC6A 1UHMA 5IATA 5JPNB 3IT8A 4XHBA 3CJIB 3A03A 1K6OA 3KP7A 2XJUA 2YC4A 4A42A 3HBLA 3OYLA 1ODNA 3ZMVA 2V7FA 3HNBM 1GOFA 3IC7A 1HXS3 3ZPOA 2FNPA 1QQIA 1ZBE2 4YZ4A 4AI0A 5E1RA 1TZLA 1CAXB 1E5HA 1J2XA 4UB8C 3N35A 1DGLA 4N4OB 4K21A 2ZHMA 2IA0A 1VTNC 1ZRDA 3WG7H 3JD72 1PNGA 1VBC1 3ZFGC 4BE2A 4NHXA 1F9KA 5JOXA 3M8JA 5DUWA 4COVA 5A3UA 4XRSG 4AYBA 5L19A 1D1AA 3RCOA 4BXXJ 3TEYA 2D5HA 2H94A 1QJY3 2W3JA 2WT0A 1UPIA 2WN2A 4H7LA 3WNMA 3MKWB 2JKXA 1G3WA 1TQMA 2RDNA 2WO7A 1FT9A 1V6MA 4FPHA 2XUBA 3J7YJ 1DGWX 1VQMI 1NAEA 3IAPA 3W3CA 3Q5FA 2UYBA 5FLVA 2H0VA 3UJOA 1WW7A 3K6GA 1WKYA 4HEA2 4P08A 4AI8A 1ULGA 4E7LA 1UY0A 4Q0PA 4JTOA 3FXQA 4LXLA 1LFBA 4LBKA 4YW3A 4Y15A 4CCNA 1KZHA 3WDUA 3VKOA 3M07A 3A7QA 1F8VA 1KU3A 5BNQA 3PIOF 3AP5A 2NM1A 3H8OA 3R0RA 5EGOB 1SC7A 5CYYA 4XILA 4O61A 4MV2A 3K2ZA 5AVAA 3J4UH 1OKOA 3OR2C 3GF6A 1OCZH 3BIWE 4G12A 4OHXA 1QOTA 3ZMNA 1ZYRF 2ETEA 2WYSA 3K4MA 5L3GA 4MGSA 5LRRA 3HOSA 1A78A