4LIVA

Structure of ycfd, a ribosomal oxygenase from escherichia coli in complex with cobalt and succinic acid.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
360
Chain Sequence
b'EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 94
structure length 360
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4livA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4livA01
2VD7A 5FYSA 5FZDA 5K4LA 5ANQA 5FPLA 4Y4RA 5A7OA 5FP8A 5FXXA 5IVYA 5A3PA 4QX7A 3AVRA 5FZGA 4BU2A 3OPWA 5IVCA 5FP7A 5FZBA 5F5CA 4Y33A 4NUBA 4CSWA 4GJYA 4QXHA 3DXTA 4CCLA 4QXCA 2XDVA 5FXZA 2Q8EA 5FYVA 5A7WB 2YU1A 5FBJA 5FJHA 5ISLA 3N9QA 5FPVA 5CEHA 5F5AA 4CCKA 5FXVA 5E6HA 4GD4A 5FYTA 4BISA 5FZKA 4IGOA 5FZOB 2YPDA 2OS2A 5F39A 5FZ9A 5IW0A 3KV6A 4HOOA 4LIUA 4ASKA 5FZCA 2OQ6A 5FZIA 5A7NA 5FZAA 5LY2A 5FXWA 3N9OA 5IVJA 5KR7A 4IGPA 2Q8DA 3U78A 4C8DA 3KV5A 3NJYA 3PTRB 4V2WA 3K3NA 5FPUA 5IVFA 4AI9A 5FP4A 5IVBA 2W2IA 5F5IA 3K3OA 5FWEA 5FY5A 5FZ1A 5F3EA 5FZ6A 5F37A 4URAA 5LW9A 3DXUA 4E4HA 2PXJA 4TN7A 3K2OA 5FV3A 5FYIA 5FWJA 5FP9A 5FPBA 3KV9A 5FZMA 5FUPA 3ZLIA 4QWNA 5F3IA 3KVBA 2Q8CA 2YBPA 5FYYA 5IWFA 5FYHA 4QU1A 4EZHA 3PUSA 3PUQA 4QX8A 4D6RA 5FPAA 4AAPA 3N9LA 3PU3A 4XDOA 5FZ4A 4V2VA 4XDPA 3UYJA 3LDBA 5FZLA 4EZ4A 5FY7A 4BXFA 3ZPOA 5A1FA 5LWBA 4UF0A 5A7QA 3AL6A 5FYMA 5FYUA 4HONA 4CCNA 3N9PA 4EYUA 5FY4A 2OT7A 2XUEA 5IVVA 4LITA 3AL5A 4CUGA 5A7PA 5F3CA 4DIQA 2WWJA 5FYBA 5A80A 4GJZA 5FUNA 4LIVA 2OX0A 5F32A 5FY0A 2GP5A 2GP3A 3LD8A 3RVHA 5FZ8A 1VRBA 5FYZA 3PU8A 5F2WA 5A7SA 4LXLA 5FZOA 3PURA 2YBKA 5A3TA 5FY1A 2YU2A 2XXZA 5FP3A 3N9MA 4D6QA 4QXBA 3AVSA 4UF0B 5FZ0A 4CCMA 5F2SA 2OQ7A 4CCJA 5FY8A 5A3NA 3KV4A 2WWUA 5F3GA 4DO0A 4IGQA 5FZEA 5FZ3A 2XMLA 3U4SA 5IVEA 5A1LA 3PDQA 5A3WA 5LY1A 4GAZA 4D6SA 5FZHA 2YBSA 5FJKA 3KVAA 4Y3OA 5FY9A 3N9NA 3PUAA 5FZ7A 5FZFA 5A7WA 4CCOA 2P5BA 3OPTA 5FYCA
chains in the Genus database with same CATH superfamily
1QZEA 2VOWA 2Z16A 3CNAA 2YUEA 1Z7S2 2RNJA 4K1ZA 3WTYC 3VYUB 2ZFWA 3VZKA 3GTLJ 3H36A 1W6PB 4KNYA 3AP7A 4DRVA 2YY1A 3I4PA 3E3VA 1K6OA 2EIEA 4ZZLA 3E1SA 1AZDA 1HX6A 4EEFG 1XE0A 3VGIA 2HEYF 3I4IA 4QKBA 3A4UA 1JMUB 2BEOA 1VBA1 3PIOF 3PJRA 2PQSA 2QENA 4QX0A 1U5TC 4JQFA 2RMU3 2P17A 4QIWN 3KVBA 3QACA 1OCOH 3FMSA 4LFUA 2IS6A 2ZEZA 3RWNA 2FNAA 2FQPA 1J1LA 4AVVA 3SLIA 4AHYA 3OUHA 2WY7Q 3BU0A 4RGSA 1PIV3 4P5YA 3TWIA 2HVQA 1MNDA 2YX7A 1NYWA 3OYDA 2GOXB 2M8EA 2O5RA 2BBAA 3NNFA 3OJBA 1GLNA 4GALA 3ULQB 2DDBA 1UMQA 4ZZ8A 1Z7S1 4PDWC 3VBHC 4LLFA 1X1DA 4RAGA 4YW5A 3B6CA 2KM2A 4OINF 2DJNA 2L9VA 2E1NA 2DTRA 1SLCA 1ZBA3 1MZEA 2X29A 5T3NA 2ICWG 4RHV3 1WKYA 5D8KB 4WM8B 4UW3A 1O59A 3MQ0A 5FYVA 1YFHA 3IWFA 3T1BA 1G4DA 3IPVA 2SBAA 1JW6A 1SMVA 5DCFA 3A02A 1FMVA 3BG7A 1MBFA 4KDPA 1QPIA 2DO7A 3VBFB 5E8GA 1X2NA 3FX3A 3QCWA 1JOBA 5GZEA 2WTEA 5T50A 3ZDVA 5F1RA 1RPWA 1SCRA 4COWA 4UFKA 2WO3A 2NOGA 3G4SI 4INDA 3U11A 1OLMA 2XB0X 3PUSA 3AZVA 4IUGA 1UELB 2CU7A 1MVQA 1YRZA 4FP2A 1Q56A 5J1RA 2OBPA 3MEXA 1IAWA 3I3LA 4LITA 1F35A 1IW7F 1SVLA 2DJIA 1K7AA 4C3HJ 4B7EA 2HOTA 3CJIA 1SMTA 4SLIA 5FFOC 1LODA 4YM0A 4LK0F 5L3GA 2EB7A 3KHCA 5FZ0A 5IAXA 3K4KA 3SZGA 5A3NA 3RG0A 1NZCA 2JMWA 3ORJA 1JUIA 5LY1A 1XSDA 1KEXA 4MV2A 2LRDA 2ZGKA 5FZ7A 4IVNA 1K5MC 2VGDA 1SD7A 1KJLA 1MQTB 3B5LB 4AI0A 2XRLA 2MGQA 2FBHA 2HI3A 1B72B 2ZGSA 5E16A 4B4QA 3S8PA 5IT9Z 1MH3A 4AIHA 4ZYDA 3ZXAC 4PBPA 3CCUI 2Y26A 5LBQA 1CONA 4IV1A 4Q8KA 5HDNA 2R5ZA 3JREA 1I1GA 1I50J 5JHFA 3WNOA 1HXS3 4CXWA 4HETA 2QQKA 2PTMA 5GLTA 2A5YB 3UR3C 1RJ8A 3R4UA 3CF5F 3AYDA 2R49A 4OI0A 4HVOA 3QOEA 3JD73 3FC0A 3I54A 4XACA 4GWJA 3HOBA 5A2QZ 3RYKA 3ZMSA 1SPPA 4P02B 3FLPA 2NOJB 1VMFA 3ISPA 3ZKYA 1A04A 2WZEA 3VWBA 4BY1J 5J36A 5L9VA 1UYYA 4N43B 1PM7A 3WDYA 4LULA 5HS8A 5JR7B 1HXDA 3NAUA 2H8WA 2NYXA 3TDZC 2EV0A 5DD8A 2H6BA 3SCFA 2IC1A 3WP6A 1V00A 1JZ7A 5FFZA 2PI0A 5A70A 2VUMJ 5C4WA 2K02A 1SLTA 3SCHA 4DYRA 5BNGA 5JCTA 2LG4A 4XLEA 1CD3G 4UF0B 4CCMA 1OLRA 1ODMA 3LSKA 2M2EA 2HR3A 1LGNA 5JZGC 3W6JB 3G1LA 2J42A 1H8TA 5A1AA 2L9RA 5CVIA 1PGW2 4Z6YA 1GP4A 2E7TA 5C3QA 3C7OA 3WP5A 3JRBA 4AFCA 2FE3A 1W8ZA 4WV8A 4O3MA 4KITB 1SG3A 1JUSA 3DP7A 4CCKA 1C3HA 2RS52 4HMZA 2BW3A 1UZ0A 3LFKA 5M5YJ 2JD4A 3ZFGB 3WG4A 3IL2A 3I5UA 3K4CA 1ZM1A 2VCMA 3H1CA 4A44A 3V7CA 1XD7A 2M7AA 4A6SA 3VUOA 3M1CA 3TBDA 1HCRA 1YC61 2BW8A 3F2ZA 1W28A 3ZN1A 1XMKA 2XIGA 3HQRA 4U0VA 4BQ2A 3AJZA 1TZOA 3WE2A 1QY4A 2DF7A 3JRCA 2RE9A 4UI9L 5BNPC 1SD5A 2C5DA 2EQRA 3OCPA 2DQRA 2Q1FA 2A3YA 2TBVA 3HBLA 4BQWA 4OUSA 2DCZA 4EJVA 2JG8B 5FY7A 1S2BA 3A01B 5FYMA 5F64A 5K7FA 3PVBB 4C91A 1FLIA 2QKLB 2XC7A 1Z7S3 5D2AA 2BWCA 5FREA 2N7GA 4FX0A 1G3YA 1O57A 1WLDA 3OF1A 3A03A 4DS0A 3RFRA 2QQBA 3OD4A 5D4RA 4LBQD 2XJRA 1DQUA 3HGGA 3OYCA 3GZEA 3KVAA 1H2LA 4MH0E 1TQPA 2CJJA 2L9SA 3HSEA 1YI2I 4YZ1A 2YMZA 2AUYA 3AVRA 2J1UA 3A0BC 2RS51 3GHMA 3O6BB 5FRMA 2V9VA 3ZRGA 2AS5F 4C3IJ 3QD6A 4I09A 2W1UA 3WDWA 1W2TA 3G6EI 3ZSMA 4XPVA 2B7YA 5CYVA 2WNEA 5J8FA 5ERLA 3HUGA 5ICCA 5C3SA 3VHNA 1L3LA 4LB6B 2GMMA 2GSYA 2VZOA 3PO2J 3NV3A 1CX1A 2QVSB 3VZMA 5M3FJ 4F8AA 2XVGA 3H1YA 2BV4A 2DMUA 3VDDB 1S7OA 1EPWA 5HCHA 2VMIA 3ZMDA 4XBNA 3DYPA 4YZ3A 1QJY1 3ASNH 3E6BA 1LGCA 2GMPA 1DZQA 2CDPA 3IH4A 1YRNB 5GTIC 1UNBA 1S0IA 3WU0A 4X6AJ 1D5YA 3ETQA 3OYGA 1K12A 2BGOA 2RJLA 2UWCA 3L09A 1LVAA 3GVAA 5C5UA 3O1VA 4GMP0 3WODF 4IHTA 3CJRB 4UW4A 4QXBA 2Q0AA 3DF0A 4QX1A 1VQNI 1JOPA 2W95A 1BC7C 3ZFEB 3ZGKA 1JI8A 2A68F 2ZXQA 3GUDA 2LROA 5C8CB 1MIJA 3DTKA 3HKZN 2ZMKA 3S2DJ 3T1LA 3G2BA 1IXCA 5L7OA 2WAAA 3POWA 2O7OA 4YGEA 3ZMUA 1PX4A 1REPC 3W6KB 1OYWA 3K2AA 2H6CA 3M3YJ 5C3OA 3VYRB 2PN5A 2VPLA 3OYIA 1JKQC 2H94A 1Y8RB 5J40A 2A61A 1GQPA 2J1EA 4IQ4A 5FXWA 5BNOA 1JT0A 4UB6C 1VI0A 2Q4SA 2XLFA 4NWVA 2W92A 1XGSA 2C26A 5ACA2 1QVUA 4ET7A 3P1IA 1TWHJ 3UKTA 1ULOA 4E27A 1BYHA 3POGA 4AG4A 2GC1A 2LDUA 5FRNA 3WR0A 1NZIA 2DMQA 1SC7A 2HXOA 3L2CA 4UV8A 4O65A 5K9YA 4CXFA 1S0DA 3MMYB 2UUZA 5J3UA 2ZC2A 4J6GA 1IRZA 3KGZA 3WNMA 2JZYA 3IMNA 3C2GA 2VZ1A 4XZUG 1R1A2 1FOD2 1QQP1 3DEMA 4QPOA 3DKXA 2JDYA 1T6BX 4FTEA 3DKWA 3TKYA 2QQWA 4CCOA 4D5FA 1QU3A 1LOFA 5BUVA 5J8CA 1RUI2 5CKTA 2WAQN 4AQSA 3WG9A 2B8MA 4ZKTB 2EBIA 3T4VA 3T2QA 4F83A 3I2OA 3GTJJ 2AQEA 2JQ7A 2C9AA 4M4RA 5M5WJ 3EQLF 4PF1A 4B4CA 1LHOA 3C8XA 5ACA1 3V65A 5DN2A 3OBTA 2D6LX 3FHNA 1WMXA 1YHFA 3ELNA 3AL0B 4PBOA 2W2IA 5JHUA 4DEVA 3QPTA 1AWCA 2OC6A 3JBG2 5AIPA 3T8RA 3WTTC 1HV1A 4ZXKA 2D3PA 4P9XA 3HM5A 1VE0A 1QJEA 3OB8A 4GA9A 3LSPA 5DEQA 1SQ4A 3VLBB 5J7MA 3ROUA 2ADEA 3FUOA 1VJ2A 3L00A 1IGOA 1KD7A 2WKKA 1OCZH 3QYEA 3CF6E 3DU5A 1R1A1 1PUEE 3QPSA 4JKMA 1FOD1 2ZZJA 2YFZA 3FL7A 2P3JA 1YW9A 1VBB2 3SHFA 2M5WA 3U10A 1VTNC 4M9SA 2COBA 1RIRA 2VQTA 2HDWA 3O3KA 1D0XA 3LEGA 4WZFA 2E2HJ 3NV2A 4LBQB 2LK2A 3MKYB 4GMP3 3IDBB 4XBFA 2C6YA 3FXKA 1CESA 1SD4A 2D1HA 1NK3P 1G7YA 1XB4A 1YI9A 5IP7J 4AD9A 3WINE 1DHKB 4A3DJ 3DXTA 3IKVA 3GTMJ 4ZDPA 3UESA 1Y9MA 5F5AA 1VP6A 3IAM2 1ZA4A 3JBG1 4AQTA 2R1DA 4DUXA 1XN7A 1N77A 4QHBA 3J7LA 2XBO2 4I0AA 2EK5A 1TG7A 3I3EA 4P9GA 3HKZA 3TO6A 3OYMA 3OOUA 1CF7A 2OV7A 4FBFA 2BY1A 1YJNI 3OY8B 2A6TA 1DGLA 5LATA 4CGZA 1IS3A 4A3LJ 4UW6A 3RWKX 4LLOA 2VI6A 2BNOA 2MW8A 2AEZA 2BOJA 4Y5TA 3WTSC 1GR3A 2CNAA 3NV1A 1UOBA 3I71A 2TDXA 4D0QA 4R1HA 1YQ5A 5FUNA 2Y0IA 4EN8B 2XF6A 3K1PA 3PUHA 4IL7A 4EWAA 1ZZBA 1QVTA 2L9NA 3OGVA 3BP8A 4NRQA 2ID6A 1Y0NA 4IGQA 5KHJA 5DDJ3 4CO8A 2WT0A 1W9YA 5CG8A 4COZA 5C9AC 3LAGA 4YVSA 5H9RA 5K0UB 2G9ZA 3UK9A 1BM9A 3L2QA 4CA9A 1OURA 4X6RB 2QJVA 5KHDA 4FAHA 4IEVA 3MUY1 1D4VB 5JFRA 3U1DA 4C9YA 4KISA 3PJYA 4M01A 3DUIA 1LEBA 2J7MA 2HZDA 1GKBA 4QHZA 2XBO1 3ABMH 2DOEA 4FQGA 1HJGA 2R0QC 1P4AA 1G9AA 2E1CA 3PNYA 2A71A 2PHWA 2VE1A 2WAQA 3G3ZA 4GWNA 4OMCA 2R7XA 4A3KJ 1JXSA 4LT5A 3MWMA 3HN3A 1DPUA 3RSNA 1MZ5A 2YGLA 3ZXLA 4RGUA 2DVBA 2FUG2 3S2HJ 3RPUD 1XPWA 4XLPF 4EJTA 2COMA 1F36A 4MIMA 3MF9A 3H0OA 3G7DA 1IN5A 5FQ0A 1O3RA 1MDMB 4CUCA 2GMEA 5H2FC 1AL23 4IE7A 4HSRA 1W3VA 3IV5A 3LMMA 3LB9A 2TEPA 2E9QA 1OCTC 1HQNA 1YJWI 5DD4A 3QLQA 3CCLI 2ISYA 2IA2A 1D8KA 4H0EA 2AXTC 3VYTB 1OVPA 1HRI2 3WNNA 1JZ4A 1DGRM 2CQNA 2F17A 2K0GA 2DFFA 1W9FA 5FZ8A 2IAIA 3WX5A 4W8JA 1PVC3 4KBZA 4BQNA 1CJPA 2GN3A 3TBIA 2RS32 4NMIA 4LHNA 5FDBA 2DA2A 3D5LA 1ONAA 1MSEC 1UU5A 3HOZJ 3NWSA 3BALA 4YSFA 1SFXA 3HR9A 1DG6A 3ZFFC 1CWPA 2Y0OA 3K1NA 1JKOC 3ZM8A 3DXJF 1OBNA 4MXWA 4KGQA 2R1BA 4S0HB 4OU0A 4FPLA 5LHIA 1OD5A 5FBJA 3MZHA 4XCBA 1T95A 1H1IA 1O91A 3O2PE 4B4RA 3COAC 1QJX3 2QNKA 3PJQA 4MHGA 4FASD 5LA2A 3JRFA 5BPIA 2P7CB 4XURA 2OZ6A 5BXXA 1JGGA 1OCPA 1W6MB 2AO9A 1CQTA 1BI0A 1XBFA 4CDUC 2HYKA 3M8JA 4K6BA 3S5QA 4YRDA 1ZVFA 4HNUA 5CA6A 2ZCWA 2VPVA 5EGOA 1O4YA 1R1A3 4A7ZA 3ABZA 5F7UA 1V54H 4XDQA 3UV9A 4ITCA 1HRI1 3IC7A 5GAHJ 1PMJX 4Q0QA 2JENA 3ZPOA 3H92A 4ISRA 2WB1N 2E7AA 4ZXEA 2X5IB 2WNUA 1V5GA 1D2QA 2WFF3 1MMSA 1GFF2 1ERDA 1RUI3 4CU8A 2RS31 2LKPA 4FSJA 4NQWB 1W36D 5A6YA 5A7SA 3K4MA 1OR7C 4JGZA 2XAJA 2DUPA 5BS6A 1Y9QA 4PK4A 3DTEA 4MYEA 2V4VA 4YIRX 3I2HA 4WM7A 3K10A 4LKEA 2HQNA 4BGDA 2W3JA 3ITQA 3FMGA 1VRH3 3UJQA 1V6JA 4C2UA 1X1BA 4IHSA 1DGRN 2AYHA 5CAZA 2E5NA 1LFBA 3BTYA 3HHHA 2FD5A 4Y26A 4LTAA 5A3PA 3VD4A 2WLQA 4BQYA 3OPWA 1IV8A 5I8SA 2LP0A 2WY8Q 1ITYA 1YQCA 3HDDA 3R4SA 4YM3A 3OIPA 5T54A 2SLIA 2K9NA 3CMMA 1W6QB 2G0EA 1JZ8A 2XJTA 4M9ZA 2PLV3 3VBRC 4CZZA 3VBUB 1PK6A 3DPUA 2VBPA 1LDDA 5B5EC 3ZR6A 4BJTA 4X6QB 3CDLA 2Y64A 1MGTA 3FMQA 2DK5A 4OULA 1B6AA 2LVSA 1XU2A 3BPSA 5LGTA 4HF0A 3D0SA 2H09A 4GXOA 2RKHA 1DFQA 1VBB3 3CMYA 3EETA 1ZARA 2CV6A 1XB9A 2K9SA 3R0AA 2X85A 1DDLA 4O61A 4YVWB 2YC4A 2Y60A 4A3EJ 2JEMA 3CC7I 2OAZA 1A6CA 4FOVA 2HQRA 3M3CA 4PJLA 4XBLA 2WNVC 2IVMA 4FETA 1SFKA 4G4FA 5DYMA 3FBMA 1D8JA 4A3GJ 3R4KA 1WD4A 2HEVF 3MKLA 3HOTA 5A3WA 2GC0A 2HQ5A 2WT2A 1H4GA 3M2MA 1WWXA 4AEJA 2XLGA 2AHQA 1W7PA 1SZBA 1V5EA 5JVTA 5IVCA 2W1QA 2WWSA 2QUFA 2XOMA 4PHZA 3AFHA 1O3QA 2NAZA 2Z2SB 2GALA 3I49A 2CW7A 2WZR2 3AMQA 4O7XA 3NQHA 3VSLA 3KP4A 2B4KA 4KG8A 5FZKA 3JXSA 5GAEJ 2QTWB 3MW4A 5EZWA 1RB8G 4QPQA 4NPLA 1G3WA 3LWCA 1W1WE 1AVBA 2DW4A 3AZWA 3LIHA 4UY8I 4IV3B 1T0FA 2V4AA 4CP0A 4UBHA 3KD4A 2AC1A 2BWAA 2XQXA 4QDSA 3N9LA 2RR12 4N53B 2IUWA 3ZN4A 4KH9A 4AOCA 4P9YA 5B4XA 3FFZA 1H1AA 2HYXA 2X09A 1GYKA 5IVVA 5FYBA 3RQ4A 2X10A 3BR1A 2GP3A 2H0BA 2F5CA 3VZNA 4LXLA 3KP6A 1G59A 2D6OX 5JSOA 3B7MA 4QWQA 3WP4A 1N78A 1FX5A 3KCXA 3LSMA 2VZQA 3B9CA 2XMLA 3TMOA 2LM3A 3C7FA 5D8AA 2WB1A 5CVVA 3HC7A 4PSWA 2UYBA 4U88A 1DP0A 1JHFA 2WZR1 1ZRIA 2Y38A 1AXYA 1RMU3 1FBUA 1ZLJA 5A33A 1I6XA 1IQAA 2GA1A 4XRSG 3VB2A 3KS7A 4FPHA 1VQOI 5FJHA 2EIDA 5LBFA 5EFUA 3ALQA 3CL1A 3F8CA 3ZXKA 1FC3A 2L0KA 5ICEA 2W7NA 1MMDA 1DGRA 4AQ2A 4S2FA 4Y1UA 3SEPA 4HV5A 5EYXA 1AYM3 4XUOA 1CAXA 1OUXA 1SAXA 1W8OA 5C33A 1H0MA 1E3HA 2XR4A 3NJZA 3UT0A 2RR11 3HB9A 1FJLA 3T5XA 1RUH3 4U2AA 1KQ8A 2D3SA 2QYOA 3DECA 4CCDA 1J58A 3QU3A 1AOYA 3TGNA 2X48A 5A6ZA 2JE8A 1ETVA 1IG3A 4AQ6A 2EXJA 3N05A 1RUNA 2V1UA 1A3KA 1VBC2 1XE7A 3L2YA 4XIOA 3DYMA 4AU7A 4IEZA 4AYBN 3WG2A 3S1MJ 4Z2YA 1GUIA 5KK1A 5L3CA 4TYSA 2D1VA 3ENRA 4I99C 1L7LA 1Y8QB 3U4SA 5D5VB 4R4ZA 1WGXA 1UZVA 2I5UA 1IGNA 4IOAF 5EJ1B 3HRMA 4LBOA 5EYRA 2ZGLA 2ETHA 4Q0SA 1W8UA 1X8EA 3OUJA 3KLOA 1Z0XA 3NNJA 5KC6A 3BQZA 5GPAA 5T5OA 2DA7A 1QH6A 1UX6A 2CMPA 2VKDA 1VBE3 1OYYA 1A78A 5GTHC 6PAXA 2OQ6A 2O0YA 1OJLA 2OPWA 2JIJA 2VCCA 4R79A 1LE8A 3MICA 3DKYA 5F6LB 2JA6J 5F6KA 4HOBA 2A6EF 3ZLIA 3S93A 3LF7A 1MBEA 3HIFA 4LO7A 1FY7A 2VCBA 2EXIA 1VBC1 1P7IA 3V8JA 2VG9A 2R7SA 3J7AY 4Q4V2 4U87A 4G7ZF 4QPWA 2RDPA 5LCWL 1HRV3 2MNGA 2JSPA 4FE7A 2VE9A 2KIMA 1R22A 4HQEA 1MR5A 3KF5A 2W91A 2J22A 1OLQA 4HPKA 1BJAA 2R0FA 4MGKE 4GQ7A 4CP9B 1OPCA 5EG0A 4DY3A 4BQ3A 1GVJA 2HVRA 2P2KA 2VO5A 3CJIC 1HDKA 1HB4A 1ZTRA 2BHYA 2VNOA 3NARA 1AL0G 2HWE1 3LQQA 4XAAA 3E6DA 2J1VA 3KT4A 1KITA 1JT6A 3FFQA 4M0HA 2DTYA 1YFUA 2JG9A 3SZPA 4Q4W2 2IWGB 5I8TA 2IS4A 2CGNA 4A45A 2ZKZA 3H8RA 2XF7A 1W90A 5CVRA 2CAVA 1X3WB 3OY9A 3POBA 2KR2A 2VJXA 3WTWC 3KGLA 2P8TA 1FT9A 3GDBA 5FPUA 4L9VA 1WWYA 3WCSA 2V5DA 4DUWA 4IV1B 4GWMA 3VFZA 3DXUA 3MCZA 3I4MJ 2M0CA 4Q4V1 2A3WA 1LOBA 4E7JA 1Y6IA 5JMCA 5FTTC 2FQ3A 4QU1A 2DT7B 3JRHA 1QZZA 1OA4A 3SYTA 2PHFA 4V2VA 3CCVI 4M3CE 2VMHA 4QX3A 2VB6A 4CZSA 5C3PA 2WR9A 4YW4A 3TEDA 1X4PA 2Y6FA 4ASNA 1MZBA 2A6VA 1F5JA 3FK7A 2CWSA 4I76A 1MBHA 1FTZA 1MEC2 1KU2A 2CRGA 4F7ZA 5EZHA 4W6YA 5C4WB 4Q4W1 4U0YA 5JPMB 1O4ZA 3CZUA 3VZLA 2ZEXA 4G12A 5E3OA 1HF0A 4AYBA 2VUAA 4WX9A 3N7KA 2BZTA 4OLLA 3KX2A 5E3LA 2K3FA 2P6SA 2ZXWH 3GF6A 5LA0A 1H8TB 3VBOB 4P1WA 2YU3A 2R16A 5FYTA 5T52A 3Q0UA 4Q48A 2E33A 3CUQC 2QFEA 2KQRA 4Y20A 1IPJA 3DGTA 4M00A 3EDPA 4D7NA 5FY5A 3R0JA 1GZ9A 1WW4A 4KU7A 5J98B 4A3IJ 4R9AA 3VYSB 5ILVA 3DYOA 4XRSA 4QXKA 5FPBA 5FKNA 2EZKA 5FAXA 2JDAA 1WJCA 4XN0A 1QDOA 1D4M2 4IHXA 1V3FA 1FMD3 1K45A 5FKKA 2DVGA 3FHQA 4WVVA 2BQPA 1MEC1 1JHJA 2HWVA 4AI2A 2AZ5A 3WV6A 2VT3A 1ETQA 1VR3A 1VNDA 3KT7A 4A3MJ 4EM2A 4U0WA 1UZZA 2RHPA 5FFXA 5HI0A 1LQ1A 3VN4A 2D44A 1YLFA 4PSXA 3PDQA 3J8F2 1NG0A 3J9SA 4KICA 3G73A 3TEWA 2MD0A 2O6GE 3MIGA 4RYDA 5IT6A 2LBFA 4DUVA 4A0XA 5FZBA 3KCCA 1UHWA 5EJ3A 2R042 3K7AJ 3HJEA 5LD2C 1RUF1 3PL0A 1S7AA 1NCRA 3CP2A 4UW5A 3B02A 2YPDA 3AXEA 3ZQQA 2ZXJA 5FZAA 3GYHX 1R5GA 3NWTA 3VHOA 1CPMA 5FO8B 1RXFA 5DV5A 4S04A 2FU4A 3QPHA 1WH7A 4M4PA 4OHYA 4F3QA 1D4M1 3IRQA 2F2EA 1HOMA 1MQTA 2HWB2 3N3HA 4PI2A 3VB9A 2B9VA 3JAMZ 1A36A 1DZTA 1LECA 4D6RA 4AAPA 1NAEA 2XWBB 4UYBA 1UN1A 1IKPA 2XGEA 3UGFA 3ESWB 2O8OA 5F9TA 5J1XA 2DA3A 3GYDA 1K42A 2VULA 1W0PA 2QUOA 3HPGA 2NS7A 2ARAA 3K70C 3J8F1 3JUUA 3U07A 2GAUA 3ZKUA 2EXHA 3GBFA 3N9MA 3I53A 3RKXA 5F08A 2A73B 2W25A 3T08A 3ECHA 2CYFA 3AYAA 1FOXA 3DWLE 2ZEYA 3A4CA 5E3MA 2RG4A 2R041 1ULYA 3PSFA 1XNCA 1OOPB 4W97A 2HWD2 2DLLA 4HFSA 4Z2WA 1XDSA 3IAQA 2FD8A 4R8HA 1J09A 4N43A 4HBNA 4Q4Y2 2HZTA 1O5LA 2ZAHA 3H7JA 4HLTA 4K8FA 1N47A 3CKHA 1BI3A 4IE4A 1TNSA 3I8TA 1WI9A 1R7JA 3M8FA 5FZ9A 2NMNA 4PF5A 1BOAA 3KZYA 5L7OB 4GYGA 5EF6A 3JSPA 5L19A 3FXJA 4ZU7A 1FMWA 4BEHB 2RQQA 3I3MA 5H9SA 2ZBKA 2HWB1 3KMHA 3INAA 3O5SA 2R7ZJ 3PHMA 2R7WA 4QAWA 1F31A 1MACA 4HT1T 1VB4A 1R49A 2VXJA 1K79A 2DCYA 5BNOB 9ANTA 3JRGA 1TME1 2K4JA 1TWCJ 1QOTA 1WCMJ 1T2KA 4H2AA 2MH9A 1RXGA 1R9TJ 1IOAA 4AVTA 4XM3A 3D5SC 3NAPC 2UWMA 4EVIA 1OISA 1YX5A 2XJVA 4X8PA 3ZO0B 4M3DA 4I98B 2AH2A 1WGPA 3WTXC 1UMHA 5GALA 3SHRA 4PZJA 4NIAA 2ZSIB 1IXSB 3LL7A 1GUUA 3VKNA 3WF1A 5AFBA 1OQEA 3FXQA 2IT0A 2DYRH 4Q4Y1 1LNSA 2A6ZA 5CU1A 1SFOJ 4RR3C 4DY5A 1W8TA 5FLXZ 1EJ9A 5FD6A 3BR2A 2JG8A 3M4FA 5BMZA 3A01A 4LJHA 3U0ZA 3P5JA 1BVVA 2F5FA 3ON7A 4M9XA 5BPXA 1PO22 4BE0A 4MXVA 1EAH1 5FO5A 3BTJA 4K40A 4IQJA 3VDAA 4EROA 1HKSA 5DZEA 2LH9A 4ZYEA 2M87A 4JQRA 2CTVA 3J81Z 3BG5A 3T0DA 4HG2A 5JXHA 4TWTA 2L7ZA 2Z79A 3BYWA 1SFEA 5E1RA 3BJ6A 2JKBA 1Z21A 2HQAA 2B7EA 5HS9A 1H2NA 2D5FA 3OOXA 1WHUA 1QDCA 3ZYGA 1UG2A 1VQLI 2JPCA 5HV4A 3AL6A 3CCJI 2LOOA 3R61A 1HLCA 3SH5A 4DYQA 2O8XA 3V0AB 1LENA 3CP8A 2B63J 1SD6A 5F32A 4Q29A 1ZZ6A 3NKGA 4D3WA 4Z1VA 3HOYJ 4YNIA 5SV5A 1N25A 1X9PA 4CEYA 2P3YA 3E5QA 5FY9A 4FAGA 2WV1A 2QSGX 3GFJA 4WXCA 3IBMA 2XUBA 3L2UA 3BIWE 1H0BA 1MS1A 3BT9A 4CEWB 1EA3A 1PO21 4XYXA 1Y7BA 4FT8A 4CDXB 2LTNA 5FXZA 4PGHA 3GTKJ 1KGYA 1ORKA 2V72A 1GZWA 4QB6A 3MAJA 4FX4A 5E1WA 4FOQA 4ARYA 1HDPA 3AK0A 2YHJA 4Q27A 5FLJA 4P14A 2JVGA 1CVNA 3ZOIA 3ZXSA 3M1EA 3GTQJ 2EILH 5T55A 1W6NB 1COV1 3GTOJ 4DFSA 2NVYJ 2GNTA 1GP5A 1IUFA 5IK5A 3ZFEA 2D45A 3JRIA 1SFUA 1F8VA 1XGMA 4OMYA 3ZYHA 3S3OA 4KT5C 2DCJA 3GXUA 3HD8B 5DUVA 4CE8A 4NDLA 3ZDSA 1OUSA 4BDZA 2R061 4JGYC 4LK6A 1CF7B 2ARBA 4GYIA 1W05A 3K1MA 2LUWA 4IEJA 5FY4A 5GADJ 1J0RA 2FJ1A 4EJRA 4META 3THCA 3SJMA 1ND2A 1C5IA 5M5XJ 3H50A 4EM0B 3UKVA 4QDQA 4LA3A 4D5CA 2GU9A 3QH7A 5FZEA 2FDGA 2QQOA 2D97A 1C8M3 1B9MA 1JYIA 2ZJPF 1PZ7A 1W9TA 4L9NA 1BLZA 5TSWA 3EJKA 1VLNA 4XQDA 3BKZA 5JOYA 5AONA 3CEWA 2W08A 2XJQA 2IXHA 4P9JA 5E20A 2ZAAA 2ZZQA 2JE7A 1UJ8A 2E5ZA 1TW3A 3GZ6A 1UOGA 4U7BA 4G9SB 3K51A 3OEAA 2DBIA 3ONQA 1MBJA 1SBFA 4YVSB 5J1YA 1UX7A 4FPKA 2RAEA 3D5RC 4M6XA 1HKQA 4AI1A 1VQ4I 1W7PD 2KMUA 2GNMA 3LSEA 3PNTA 2ME6A 1AR91 2YU9J 1BK1A 2ZB9A 5B4NA 1IRGA 3FN9A 3K77A 2JDHA 2Y48A 3H5RA 1EF4A 1BK0A 4ZHNA 1NY72 4AL9A 2H1LA 3IN9A 5C4JJ 5CB7A 5FK8A 4FPYA 2JDNA 1PO12 2ZGOA 4IW3A 4CXYA 2LF8A 4RL7A 5GLWA 3OYKA 2A5WA 2VONA 2MEV2 2DV9A 1S6LA 3L7WA 1LEAA 1AYN2 4Y22A 1YQAA 4GO1A 1RHI2 2IW5A 4DJAA 2HWD3 2JPBA 3KM5A 1F5TA 4OHXA 2CFOA 3U4XA 3SDGA 3L2VA 3ATGA 2NN8A 2D7FA 5LRSA 5AC92 2I74A 2X0LA 2VQAA 5CQEA 1I9RA 3C18A 4OI2A 5IYDJ 4XZPA 1JI6A 2OUJA 4QKDA 4NROA 1DYPA 1M06G 4PI0A 3AKQA 2VODA 1RC9A 2YPRA 5K4LA 3TYJA 1YWKA 5K5RA 2QKMB 5FMOL 1XSRA 1MD0A 2ID4A 3UJOA 4BDVB 1ZH5A 2BY3A 4NO4A 4QQOA 4S2GA 4RN5A 1LU1A 2KRFA 2IA0A 4XVHA 1FPN1 4TXWA 2BNNA 4JHZA 4PDKA 4PFOA 3KFWX 1OXCA 4ASKA 1VB2A 1NY71 4MXWB 3GCXA 3VKFC 1US3A 2YR2A 4AF9A 1PO11 5T5PA 2WFPA 1HN0A 3RDIA 2HFHA 2A70A 4PLNA 3R6SA 3ES4A 2KFDA 2QQ8A 3K4NA 2MEV1 1AYN1 1KS4A 4J00A 3T0AA 3KE2A 1ZNPA 5B3SH 4QPGA 3HN1A 2BOIA 3BPXA 3CBNA 1NCQC 4FFIA 5BNNB 4FXKB 4UFIA 2ZOEB 4MG2A 3F95A 1ZELA 3HWJA 1BI1A 5EGOB 1QJU2 4FPFA 3J26N 4QGNA 2PMWB 4F3JA 4Q4ZF 3VBSA 2MD5A 3I3BA 3RMXA 4CA0A 3HGYA 2VMEA 3KP5A 2GNDA 2E60A 1LOAA 2VVDA 4KQ7A 4AAXA 2VQUA 3O0VA 4KG0A 2WNUC 1RYYA 4JKKA 1DYKA 3OSFA 5HDGA 2YBSA 4DOZA 2KPMA 4PJNA 3LEKA 2EVXA 2XAUA 3E5XA 3GALA 4JGZB 1W5TA 1AR71 1WCDJ 1SBEA 1Z05A 4JGZC 3J4UH 3M1HA 1APNA 4MGIE 4WM7C 2EIGA 1R5ID 2HPIA 1Y4WA 3SZTA 4QKFA 1X4OA 3B94A 1GQGA 2QQJA 4MX3A 2BXYA 3EQEA 2G9GA 4XORA 4QX5A 1DF0A 3WZ1A 5JUVA 3U78A 4F92B 5CVUA 2OD5A 3K6GA 1S2KA 3FLTA 4QPYA 4XR6A 4QKNA 1F2NA 4GZ9A 3LKJA 1V6MA 3M3EA 5J37A 2V9PA 3ZCOA 1PK6B 4N9HA 2GZWA 3J7ZI 5DUKA 4IDZA 3PUQA 3MW3A 3PM1A 1N3PA 4WXDA 1XGOA 4ESFA 4IEYA 5J4VA 2HDCA 2KIUA 2DK8A 1NLQA 2Q0OA 1GV5A 4RQPC 4ZY9A 3R0RA 4LNVA 4JYKA 5FY0A 2VL4A 3AZXA 1E5SA 2ZXHA 1PNGA 2P6HA 2R6QA 4FTBA 3BC8A 2VAUA 2UZKA 3MEPA 1S0BA 1RUC2 1LPQA 3LOBA 1GP6A 2WADA 5HDKA 2VOKA 1EH6A 1DDNA 4CDWB 4HL0A 1LVKA 3E6MA 3QPLA 3NNGA 5LEKA 2R5YA 5KCMA 1P2FA 3DF8A 2JDUA 5J96B 3GJAA 3T2PA 1FZPB 3OR2C 4PJMA 3ZR8X 5FMDA 4QPIA 2BHZA 4BBSJ 3Q9SA 1IS4A 1Z3YA 3I0TA 2Q8EA 3FMRA 4OFGA 5LBCA 4UUSA 1QNTA 1YJLA 4GH4A 4CU6A 1V4RA 3CMEI 2EWNA 4K3UA 1W7PB 2OS2A 3A0KA 1ASJ1 4FFHA 4BE1A 5DAWA 2JA2A 3OYWA 1AR82 4B09A 3KP3A 3FLRA 1UG0A 2W1OA 2IGKA 3KP7A 2XASA 2PX9A 4P9WA 3APBA 3SH3A 3GBWA 4XTMA 4TN7A 4LBLA 3AKPA 2VE8A 5EWSA 1POQA 4QWNA 3PIGA 3BQYA 5CG9A 3HOVJ 4OYUA 3W5MA 4XXAA 3TEYA 5DTDA 2CG4A 3KLSA 4XF0A 2Z4FA 1V6OA 3WF0A 2BZDA 3OS2A 5JSRA 1YITI 1CJDA 4EGZA 1QKQA 2WAFA 4LJZF 1T0FC 1OPOA 2W87A 2WWJA 1OKRA 3L2HA 2PN6A 3WGIA 2WJSA 3TN92 4XFIA 2KD7A 3FXLA 1FWZA 4LD5A 4LK1F 2FSWA 5F2WA 1WCKA 3MPPG 3OBRA 4E8CA 4EM1A 5EXOA 1W5SA 1DQ4A 3N36A 1TNTA 2L7KA 4V2FA 2QQ9A 1WFXA 4XL9A 3HOSA 1Y1WJ 5CPRB 4YW2A 4YFNF 4GAZA 3VSKA 3N9NA 3RSJA 5CFCC 1R36A 3KIOA 2OYZA 1H8VA 1IO2A 2H27A 3OGGA 2PFWA 2Y8KA 3ZMTA 1OFCX 5K1YA 4LO4B 4V1PA 5D8AB 2KZVA 4CH7A 1MJAA 3NJXA 5LEJA 5CBLA 4XOGA 4A3JJ 4XMYA 3FBYA 4XUTA 4G6DA 4LG3A 1XS9A 1KONA 4Y15A 1IPSA 4NQWA 3FXOA 3WGGA 3LAJA 5A33B 1RZ4A 4G94A 5IVFA 3RIRA 1QWRA 3QOPA 2E1MB 4Z07A 2C4XA 3G71I 3BN6A 3OEBA 1KRIA 1RHI3 4A93J 2ZJQF 1XSVA 2P81A 2ACJA 1JYCA 2HLEA 5AC93 4KL1A 1M1EB 1RKTA 1BBT2 3VKLA 1CAXB 3BTIA 1TLHB 2YPJA 4D9JA 2Q2EA 2CUJA 1BMV2 3H1MA 2XPUA 4TSVA 3B01A 3H3LA 4DIQA 1W6QA 3UKGA 3HT2A 1LFUP 4TLGA 2EINH 2IXCA 1Z9CA 1NA1A 3RKWA 1YFYA 3AJYA 4M3FA 4FP3A 2VN2A 3ZXGA 4ABZA 2RS12 1BC8C 2W0XA 2WN2A 3TW7A 1RUD3 1KU3A 2EF6A 2VECA 5FZHA 4ZYAA 3S3MA 4LHLA 3JRDA 3IAS2 2A6WA 1RVF3 3KQ4B 5L3DA 4D7YA 1I6HJ 2RM23 1R00A 3Q0WA 4KA4A 5ISLA 2HWC3 5FKBA 1UMIA 2JE9A 4Y13A 4I0WB 3CJQB 1AR63 5LB6A 4E2QA 4O9GA 4HX8A 1S4CA 2IFWA 3SMHA 2E7QA 1UZCA 2VTFA 4FTSA 3I2GA 1BBT1 4GB31 2HTJA 1U5TA 1QJU3 5F3IA 1BMV1 4BXUA 4NC8A 3MKWB 5E79C 4XOPA 5CFDC 3CO6C 1UPSA 3A0HC 2PHUA 2EICA 1POV1 4BK4A 1ON2A 2O8QA 2F4LA 3NQOA 2CUFA 1OCRH 2OT7A 4L11A 2V26A 5EP9A 5APAA 4PQ9A 2RS11 2XVLA 3PIPF 3C3WA 5C6CA 4MQVA 5LHGA 4AVBA 4YG2F 1FOKA 2IGMA 3K4ZA 2VC0A 2EALA 4FCAA 4E4SA 5F0HA 4XAEA 4UNOA 1T39A 3ZMZA 4YELA 1SACA 3WD5A 3GGLA 5FRAA 3CCQI 5B66C 3VD7A 1E0EA 3D3AA 3DEUA 4OQ9A 1X3ZB 1W2NA 3CDZB 5GPCA 3RPUA 1POGA 4B48A 3VBHA 2O14A 4BXSV 4HPKB 1H6YA 3OIQA 2L3DA 1G2HA 5HNHA 3PTYA 2ZXIA 1A6QA 4KIBA 1AA7A 2JDMA 2KJCA 2WINB 3D82A 2XDVA 3GZAA 2HKXA 5IFTA 3HEIA 4RA2A 4CP1A 1SVOA 3ZYRA 4HF1A 1VBA2 4BDYA 5FZOB 2XSJC 2LD5A 4AUXA 1ZR4A 2QQNA 2JG9B 2EXKA 2Z3YA 3S3NA 4A41A 1W2AX 4C1XA 1A5JA 3L9JT 5JLVA 5I0RA 1R4MB 3I7DA 2PAEA 4MZUA 4M3CF 3WG3A 3ZQ7A 1PHMA 2O8KA 5IOZA 5IK8A 1QGLA 1R1VA 4N7UA 4YGDA 2P7VB 3OYJA 4OAZA 4YARA 1W3XA 4B1MA 3PU3A 4XDPA 1RUC3 3WE3A 1WD3A 4E70A 3H8XA 2G19A 3H3ZA 1C1FA 1VBD2 2HOAA 4ANJA 4AI8A 3W2AA 5BNQA 3PURA 2CGPA 5ERIA 5GZDA 1UOFA 2WWUA 1MVEA 2HTSA 1NE4A 1RTVA 3D4KA 3TRSB 4I7HA 4D6SA 2VOPA 5FLHA 2QDNA 1UU4A 3H9GA 4B44A 4L9TA 1K5MA 4MGQA 1UAIA 3HBKA 1AR83 3IT8A 3P5BA 2WRAA 4G3YC 3ECOA 1XX5A 2HDDA 1RI7A 2B9UA 4L97A 1R083 3J7YJ 1W9SA 4GCVA 3V8LA 1ZBE2 1FNZA 3QH6A 1JZ3A 1K3IA 3ZXEA 1ENXA 4YFZA 5IYCJ 3W2VA 1W2OA 3O0XA 2MA3A 1V9U2 1WW6A 3OTFA 2L54A 4ENMA 5IW0A 1EV11 5LZ6A 3H1WA 1DLLA 4URTA 2C6SA 2RVCA 1SAUA 1S8NA 1VQ8I 2L02A 4A3FJ 3FXRA 5FZ1A 4MOAA 4IHWA 1UL9A 2IXKA 3DPRA 4IE5A 3FXMA 3WDUA 2AGSA 4OHVA 3TN93 1JJ6C 3NEUA 4ITVA 4Y20B 2Q8CA 3ZSLA 3GFMA 1VBD1 1TMF2 3RQ0A 5F1JA 1AKHB 2MPFA 1PUFA 1WJFA 4ESJA 4HRIA 2CUZA 1B59A 1QGPA 3H35A 1TNFA 1MW7A 1KYWA 2W24A 3VV1A 3MDPA 4CICA 4K8RB 5JXJA 4C3JJ 2IRFG 1VRBA 3LE0A 4AEDA 5FCCA 5KAFC 1ZREA 3LSIA 4NHMA 2HXIA 4WM8C 2DURA 4XETA 4BQOA 5JZGA 5FJKA 4OIOF 1QJFA 1XYNA 5CADA 1I1EA 2GNBA 2ZGRA 5CNAA 1ETXA 3Q5FA 4TZDA 1ZBE1 4B47A 3OSDA 2P0WA 2UY8A 2ECCA 3KZIC 3VBFC 2ZGNA 1V9U1 3JRAA 1G9DA 2STWA 5DABA 2IXIA 2W1SA 4YZ4A 4H3WA 4BAYA 2NLRA 4YIIA 2QCSB 5I0DA 3W20A 3R4DB 3OGSA 4MEYF 1LOEA 2LBFB 2E7WA 1UIKA 3VZOA 1GNZA 4HA8A 4Y24A 3NJYA 2LKXA 1XC6A 3GTGJ 2DYCA 4Q0PA 1NCRB 1QF3A 1TMF1 2IPQX 1X8MA 4CP9A 1LKXA 4UHTA 1ZZ7A 2K9ZA 3I2JA 2HWF1 1UZWA 4D7SA 2MFZA 1REFA 5DZGA 2F4OB 1BR1A 2C0ZA 4E9KA 5BNPA 4IEUA 3HSRA 3HEFA 3POIA 3FUQA 2RS13 3FM5A 3HZJA 1H1MA 3PMEA 4PUSA 4FO9A 4CCNA 4QT6A 2EPFA 3VKOA 4FXGB 4FE4A 2FDFA 2K85A 1JYVA 2XB6C 2CAUA 3RZKA 5J09A 2RDRA 1RUG2 1MQTC 4LIVA 2L9LA 3VHPA 2E2IJ 1X9TA 1Y1VJ 3LSDA 2UXNA 4LB5A 3IB3A 3IZOA 5D5XB 1HJFA 1UZYA 1G8WA 1BIBA 3HYIA 4XKWA 2CW0F 2XGCA 4JV4A 4CZCA 1JOJA 1SDWA 2EZLA 3WHTA 3ZPYA 2VW2A 1GBGA 3W2WA 5FP8A 3J7HA 4EQVA 1XMAA 5A32A 5GJ6A 1YJ9I 2WS93 1ZHFA 2H8RA 1UIJA 3RRDA 1KU7A 5E1ZB 1JZ2A 1ULCA 2QQAA 5FO9B 3SEZA 1PP7U 1SANA 4DINB 4BUPA 3WNKA 1FSEA 4ISQA 1NTCA 1VFCA 1AJKA 4XILA 1JH5A 2VR4A 1OKQA 3CJTB 4PGGA 1QBJA 1UY3A 4N43C 3PFYA 5DUWA 3L9FA 2BBVA 2ELKA 3MPBA 4AW7A 2KIFA 4P96A 1QXJA 2YC0A 2CHHA 2GIVA 4OIRF 4EV0A 3H5NA 1QU0A 1XTAA 1FIAA 2R7DA 3NKTA 1USTA 2OIIA 2M7BA 1D2SA 3ZQGA 1RUG1 3SXWA 3UYJA 1QHDA 2ZBJA 3QAHA 4LO8A 3ZXFA 3VBOA 2K40A 4G8XA 4RS5A 1B9NA 2R072 2EJRA 3U14A 3WQBA 2GBYA 2XXZA 3JTGA 1ZG1A 4D6QA 2VLAA 1DQ5A 3AVSA 4AHWA 2QSHX 1ZZ8A 3GXOA 1F4HA 1AX2A 1MMAA 2WL1A 4KWJA 4MHUA 1GT0C 1VBA3 3WDXA 4UFLA 1Z0HA 5KHIA 4BQXA 2M4GA 2NMOA 4Y1XA 1Z78A 3ZFGC 3TDUC 4HN0A 1E3PA 2O03A 5JXGA 1TC3C 2DOAA 4II2A 1PYVA 3LA7A 2LY2A 4AVZA 2WBKA 2DTWA 4P5HA 1AXZA 3TOAA 2R7FA 3I64A 4JAAA 4E7SA 3WG7H 5J6XA 5DCMB 5HBAA 4IF4A 1K78B 1X58A 2HEOA 1MNEA 3PMSA 3WT3A 4HQMA 3U1KA 2WA0A 2R92J 3GZUC 4ESBA 2I45A 2JB4A 4BA6A 1T98A 1YFWA 2JG8C 1XNTA 3H0GJ 4FOWA 4BLJA 2CUEA 2RGVA 1DIWA 3IKTA 3VOEA 1QJY2 4Q4X2 2A6YA 2F6CA 2BGPA 4YRVA 3V56A 3AP5A 5FZMA 1H2MA 3VHRA 3MVPA 4FTHA 4BB3A 1VMJA 4Y4YA 3OBAA 4YLZA 5FYHA 1ULGA 4PCQA 4AEKA 2NS8A 1K6YA 4K21A 4LG0B 3J80K 3FHAA 2XVCA 4W1UA 2R071 1WJAA 3PUIA 5D6FA 2WABA 2W00A 2Y0MA 4EN0A 4CVUA 1HLVA 1GV2A 1IF1A 5DAPA 3ZYBA 3KT1A 1I5ZA 4HPQA 4ZPIA 2G1MA 4YIFA 4FPEA 3MKZA 5FY1A 5JDBA 3DN7A 3RJRA 2OZUA 1GWMA 1XYPA 3HNBM 2LREA 2WZ8A 3OPTA 1RUE2 4MGRA 1REEA 4LGWA 2RDQA 2XAHA 2OUHA 5D6EA 3KWVA 2UV1A 1LUJB 5DQ0A 4CEYB 2M1BA 2KISA 3F3XA 3S30A 2ZX2A 5DUUA 3SEEA 3T8TA 2D6MA 3ABTA 2CSGA 4M3GA 4HV6A 2R0HA 2IJLA 3ILFA 1I39A 2PHLA 3H7YA 1BEV1 2JECA 2V73A 2EFOA 2R7OA 4CYCA 3VDDC 4FPGA 5FPXA 5GP9A 2I07B 4Q4X1 4W6WA 2DCEA 1CAUA 1ACIA 1ND3B 1IUYA 1YHQI 4AGRA 2FX0A 4L0ZB 1N1YA 1GZWB 2HVSA 2E7XA 3WF4A 2BE5F 3CJXA 4CDQB 3FK6A 1YW8A 1SFNA 1OOPA 5G05L 5F8PA 3GZNB 2VXDA 5TGTA 3QRFF 4UV9A 2R7VA 4ARXA 4IESA 3DL3A 1PM4A 1YTYA 1V6LA 2TRTA 3F8FA 3ZFEC 4XFCA 3KSCA 4DQ2A 3ACLA 1QQP2 4RB3C 5DAQA 4A3ZA 1G8XA 3GCWA 2YX4A 2QE3A 5C8CC 1SHWB 2XJPA 3CJNA 1WA6X 1ETOA 2OQ7A 5FY8A 5EPAA 3SQNA 2K5CA 3HPNA 1RUE1 4BEHA 2VASA 5FZ3A 1XSXA 4Q5OA 1CZSA 5A1LA 2PAMA 1BHGA 1IRXA 3CUOA 3LOCA 1CAVB 1J2XA 1ND2B 3POEA 4L18B 2FCTA 4XJZA 3E7LA 3BUCA 3BCWA 1BA5A 3JZVA 4HW0A 4JDMA 3ZQCA 2BFUS 1YW7A 1P92A 2M34A 3A7QA 1NG6A 2DUQA 2JDPA 2ZNYA 3V8KA 4NC6A 3KV6A 2OXBA 4XMAA 3TO9A 4MGTA 4ZDLA 2ZGTA 2DBNA 1W4MA 4XUQA 3PVNA 2DU0A 5LBBA 4A5NA 3NNMA 2Z1DA 3NRVA 3OUIA 2QZ3A 4DNCA 2EV5A 3C2HA 2V6EA 1IS6A 4HX7A 5L36A 4XEZA 2UWBA 1RUG3 2O61A 3BOPA 1ZZ9A 3P6BA 2G9WA 5JWPA 1IG0A 3KLNA 1QJZA 4M3CB 3WG1A 2UYAA 1TVGA 4CPBA 3GX4X 1W2UA 2KXLA 2XAGA 2KT0A 3FZVA 2FMLA 3KQRA 3O1OA 3TNQA 2YYOA 4H4KC 2BPA2 1D7PM 5C7GA 4LUMA 4COUA 1Z6RA 5B1BH 3U9GA 3RKYA 4FFGA 4GIQA 3VD3A 2HU9A 1GU3A 4GGGA 4FFFA 4Y22B 4D7TA 3KV4A 2JSCA 3AMNA 3CCSI 3GFLA 3M07A 2VM9A 4O9EA 2Q30A 5IK7A 2E51A 1RUJ2 1ZR2A 4XJWA 2LNBA 2WV0A 4AFAA 3QP5A 2NNYA 3T1MA 3F6VA 1OLME 2W9XA 3GO5A 1E5IA 2ZKLA 2VXRA 4LKDA 1U8BA 4QX7A 4NB5A 1HIXA 5FP7A 2OA2A 3AL0C 3BGAA 2GIZA 2QGUA 3N7LA 4BHPA 5AFEA 1BBYA 1JBCA 4LBNA 3LPGA 2GOMA 4BISA 3C2BA 4BY7J 3T0BA 3V0AA 5D1IA 2J5PA 4Y52J 1D0GA 2DFEA 3O0WA 3TAYA 5DM7F 5F3EA 2KP6A 4D0PA 1R1UA 3ZXJA 1Q8SA 3ABKH 3L2WA 4I3PA 5FLIA 1USSA 1TQ5A 5A3MA 3K69A 2R073 5JOXA 3WOGA 3M70A 3S14J 2OJED 1WVRA 4XDOA 3MIBA 3WW2A 4YWAA 1DUXC 4CEWA 1SCSA 1IXRC 4HONA 4CDXA 2YG0A 2RS53 4EATA 4IEOA 3SNMA 1BW6A 2PMHA 1LAJA 4QPGB 4L92A 3GF2A 1RUJ1 4WZCA 2G7HA 1IN8A 1IN7A 2G7UA 3LEIA 3POSA 3RQIA 1W6NA 2Z69A 1IHMA 1LHUA 2N8GA 5JR2A 4FOYA 2CDOA 1OPMA 4L0PA 3VBSB 2RMU2 3KEOA 5JOWA 3MO4A 3W5NA 4G6QA 2V1NA 5CVJA 3UL2A 2CQQA 5T5JA 1DU3D 1QJY3 2XAQA 3CCMI 1PIV2 2JJ7A 4WVWA 5FKOA 1FYKA 4LLGF 2DPDA 2P1BA 1OSGA 1D0YA 4LKSA 4DZGA 3N9OA 3BR3A 2AXLA 3MZYA 3CQOA 4XFHA 5FMBA 2EFWA 4KFCA 4BZ4A 3O7OA 4CDUA 5FP9A 4EWEA 4LOCA 3MFAA 3LQRA 5ED4A 3ZMVA 4RB0A 4B4PA 2VC9A 4AYUA 4A6EA 4NRPA 2G4IA 1T6SA 4BHBA 5LASA 1ZBA2 3BB6A 4QGMA 3BG9A 3HTUA 2A05A 1UKRA 4EJWA 2CU5A 4RHV2 5DUXA 2M4KA 4XQFA 1QXPA 2VBXA 2GXBA 4UFMA 5K0UC 3OYNA 1JJ8C 1U6GA 2VXZA 1KXGA 5EEAA 1X1AA 3WF2A 1H8AC 3CC2I 1LRHA 2RMU1 2ZACA 4AWDA 2ZMEB 2XG3A 2Y0SN 4DEQA 5IVEA 5ICFA 1MH4A 2WSUA 4CU7A 4Y3OA 5JI7A 4HDVA 4OMDA 1P4WA 3ZVXA 4MGYE 1PIV1 3SDBA 1QRYA 4E6KG 2VNGA 1S0JA 1WMFA 1N1VA 1P6RA 4ETSA 4RMNA 3ZR5A 1OC1A 3PSIA 4PCRA 3BROA 2R5YB 5ABJB 4BJ6C 4NHYA 5C44J 4JRLA 5E6HA 4K7JA 2IVIB 3VBRA 2BVMA 2IFRA 2ZFUA 4QPIB 4M3BA 3C7EA 2E1OA 1E5HA 2DDUA 1B4AA 4UUSB 3N7JA 4GH4B 4FVVA 5JXIA 2EZIA 2ZHNA 1QQP3 2OPTA 2EIBA 1ZBA1 4NPRA 3ZMOA 3ZSKA 3M7GA 3OYWB 4NRMA 1CN1A 5A6QA 1DQ2A 5EEHA 4RHV1 1OQ1A 2NVQJ 1OA3A 1E3OC 1VIWB 3M8LA 3PLQA 1FIPA 4OIQF 1ULPA 1MMGA 5A1FA 3H8OA 2JIGA 1IPKA 4D69A 2KLOA 1LOCA 4A3CJ 4JX4A 2P5KA 2BVLA 2Y30A 3K2ZA 2E36A 4LOTA 5HCBA 2WNVA 2B42B 2QDRA 3EUHA 5D5UB 4HANA 5F3GA 3I4NJ 2ZGUA 5ACA3 3HPHA 4LUKA 4RLQA 1RESA 3K4LA 3JD72 1JE8A 2P5BA 2VTXA 3WNXA 4XLAA 3S16J 3IDCB 4XRMA 1AHSA 5GLUA 3PFIA 3LEMA 2W5FA 1G3TA 2C9KA 5F5CA 1P4XA 3JCUC 3I2FA 5F6FA 5E89A 5BNNA 2VJ4A 1AF9A 4E8DA 4P08A 3N9QA 1KDKA 2XUMA 2A6XA 2D6NA 2TCTA 2Y6LA 4OCTA 2VBYA 1E17A 1LHWA 4UXNA 4UVCA 4YEJA 1TQMA 1O3TA 1FOD3 3I3DA 4IQPA 4XF3A 5FO7B 1D1BA 1KDMA 4XMIA 2LKSA 1W39A 3AZYA 3ZN6A 2VVEA 2X5IC 2JRMA 2D6KA 4KWLA 3FIWA 1W03A 4BWOA 4MTDA 1JYNA 4IKFA 5JI6A 3T3YA 1WW5A 3W3CA 4KBBA 4HDUA 3BR6A 3QODA 5JIUA 4XN3A 4BXFA 1TWFJ 2VUJA 2EZHA 2YFUA 3FXUA 1HXS1 2DU1A 3F21A 3FBIB 4BJ5C 5JI9A 4XOTA 1URXA 5IT3A 2M8GX 1XNKA 2F5EA 1YEWA 3HQXA 3JD71 5HNFA 4NPMA 1MBGA 1PGL2 2DQLA 2Q2EB 1ETYA 1K4SA 3JBG3 1B35B 4IO9F 2DMTA 2MYSA 3DU6A 4XQWA 5GLZA 3DLLF 4QQPA 3PUAA 1NA1B 3VBUC 2UU8A 3B73A 1UY1A 4LLLA 1T08B 2LY1A 5IYYA 1QPMA 2A69F 5E1XA 3N97A 2BERA 1OA2A 3J81K 2Y0SA 5FPVA 1DPRA 2OQRA 1BXHA 2Y9ZA 1X7NA 1ZGJA 3GEZA 1STMA 2Y6KA 1OMIA 5IHRA 2A1XA 1O3SA 2EFQA 4YVWC 2FCVA 2W46A 3HOWJ 4AXOA 5CJ9A 1BN5A 4URAA 2L4MA 2L7MP 3N35A 1CPNA 1WMDA 4CDWA 2EA2A 4ZH4F 1I3HA 1WBFA 5EZGA 1V70A 1FBQA 3E97A 2E71A 4G7HF 2JVHA 3ERED 3S0MA 2WYFA 1U5TB 2XUEA 1V6NA 2XAFA 2CQ7A 1PGL1 1EY2A 3KETA 3W6VA 1ALYA 2ZX4A 1UXXX 3RZLA 1KQ9A 1GNYA 2XBO3 1BZWA 4PLOA 4RA0A 1R6RA 3I9V2 5FPZA 4TTGA 1KGSA 3P3NA 4A0ZA 1UO9A 3MLLA 1ENSA 1PZ9A 4XIKA 2XKPA 2IZWA 4LKFA 1QZYA 5C71A 4COVA 4RS8A 4FPJA 4BQ5A 4XTPA 1FYLA 2PMZN 1FEXA 4PDWB 3VBHB 2V7FA 2AQFA 4RAYA 2F6BA 3D6EA 4IV3C 4P9UA 5IUQA 1ZGAA 4QQHA 1GOGA 3QYBA 1GXQA 4HF2A 3U75A 3VDCA 4Q2FA 2VC1A 4NIHA 1W5CC 2ZX1A 3HRSA 3PTRB 2VBZA 4AI9A 1JUMA 2QBXA 4N53C 2Y2ZA 1EH8A 1JHHA 2RC4A 2BVBA 3BDDA 2VUDA 5CLSA 2FMYA 2WN3A 3BG6A 2EFNA 2G9FA 3MHZA 4S05A 4Q26A 2EH3A 4COYA 1WW7A 1YI7A 1UAAA 4XSZF 3OIOA 3WU2C 2R7UA 1BKZA 4FISA 3JU9A 5FR3A 3USUB 2Y6GA 4RAZA 4YGCA 4B1LA 4TLFA 2JX9A 4M6YA 1OLTA 2CV2A 2ZMLA 1XCVA 5EEGA 3B6AA 1JYWA 5DXDA 3VDBA 4XE9A 3SCGA 3Q8AA 4C2TA 3OYLA 4IXLA 3OL3A 3MYXA 2PQQA 1X1CA 1ZX5A 3F23A 2X9DA 4MSVA 5LA9A 1HQWA 3Q8FA 3HNYM 5FYCA 3ACHA 2KZGA 5FPLA 3FHIB 2WQ8A 1U3EM 1IDZA 5FB2A 3RI8A 1XSQA 4HLXA 4NWWA 2IXSA 4L9BA 4AM3A 3I55I 5E8AA 2PELA 1K5MB 2XPWA 3BZKA 1HRI3 3DCFA 1KU9A 3NMBA 4MVTA 2PJRB 2BFUL 2FCUA 3ACFA 1LKNA 3KV5A 5KXCA 2R7RA 2RS33 2J1RA 1VQ5I 3FJSA 1ST8A 4XICA 4XUPA 4JDNA 5FV3A 1GOHA 1XRUA 5H6QA 3BOQA 1W36C 3M3IA 4LHSA 1H88C 4Z8BA 4CP2A 2B46X 2B45X 2CH0A 2F48A 3J7NA 4PIYA 4RM3A 4KI5M 1C5HA 5KXDA 3DPRB 3H0DA 4BQ1A 2M0MA 3DPRC 3M4OJ 4KIGA 3IDAA 1NE6A 1O5UA 3EYYA 1ODDA 4X8NA 4HSJA 5HV0A 3TNPB 2GXGA 4ENJA 2OTJI 1R1ZA 1AX1A 1FYMA 1PDNC 1PUFB 4OUMA 1ONVA 3BTZA 3ECQA 1S9HA 2HWE2 5EYYA 2ERFA 2W1WA 2FA5A 2W82A 2IS1A 3DBHB 2PYTA 2KIQA 1Q8VA 2P37A 4IPAA 4AEDB 4HVRA 5JLXA 4AEDC 2LALA 3BPVA 3B93A 2B9SA 2BJSA 5JZGB 3IUOA 1X33A 1JUPA 2QVOA 1N3QA 3I56I 3DQVC 2MH2A 4MUVA 2ZKNA 2KDZA 4R9DA 2BBYA 2ZJCA 2WIIB 4RGXA 4IGPA 4XXPA 1VPHA 2VOOA 2DYSH 3A1YA 1JZ5A 2QA4I 3CUQA 2WQ4A 2QQPA 1ON1A 1FOYA 3WW4A 4R4XA 2PMZA 4YFXF 4MADA 5FUPA 2VH9A 3RGBA 4AFMA 2XQRA 2EIMH 2OVUA 1G6NA 1G3SA 5FPAA 2KRCA 2JDZA 4A2UA 1I1SA 3TP0A 5FMOS 4W65A 4IE0A 2X4HA 1U0JA 2HOSA 3BTCA 4ZS2A 2O1QA 1YQ8A 5BNPB 1XMXA 1Q5OA 5FZOA 1LR5A 2YC2A 3EXUA 3S7EA 4DO0A 2VZTA 3AX4A 5FK7A 2VMGA 1T56A 4KMQA 3W21A 2OCCH 3IIIA 3UGHA 3QYFA 2V79A 4MGZE 2FDJA 2IS2A 5ILUA 2EIKH 5F0CA 3ASOH 2VQ0A 1PGW1 3WSOA 1JHNA 4IV1C 4W4ZA 1Y43B 3GHNA 4DBRA 2ZABA 4M6VA 4EN7B 3ZXDA 4KNCA 3MGUA 2Q1ZB 5F27A 2CFXA 5A32B 5FZIA 3LA2A 1YYNA 3IP4B 1YIPA 2FHRA 2ARXA 4GMP1 2IXJA 1Q3EA 4E2SA 3H5AA 3Q9VA 1C0WA 2IGNA 5DPNA 4G6TB 3EHKA 4ZONA 1V0AA 3AMMA 3CESA 5DDJ2 4YM1A 1H30A 3MV01 1H9WA 3AC0A 4R9CA 1RNLA 1MMNA 4IRHA 2VZVA 4NIGA 4FI9A 2FDHA 4IRIA 1AUYA 1JYXA 1ZRFA 1O8PA 1XE8A 3BJOA 2XKOA 1DGWX 3ABUA 3WTUC 3OV8A 2WZR3 4EYUA 4XLHA 1MPXA 3P9CA 4XFBA 5C4WC 4IEPA 2VW1A 3S17J 5GLVA 2GP5A 4XLNF 5EV7A 3TEZA 1KFXL 2HEWF 4CPBD 1TQIA 4IRGA 4RB2C 4HEA2 3BR5A 5I91A 1H8TC 4E7HA 3G1OA 3VBOC 1GZCA 3AFKA 1W99A 4RS5B 3RZOJ 4RS5C 1A35A 4YW1A 2RR13 1RUF2 4OOIA 2VOTA 4RAFA 3NWKA 1AL22 1WLCA 4HNTA 1AKHA 2ZHKA 4AWXB 4H14A 1LESA 3F9KA 3VL9A 1ZA7A 2HYJA 5EIYB 1DYOA 1PJRA 1GZTA 4LIUA 1QEXA 2LSOA 1T38A 1J3QA 5DDJ1 3S15J 1PVC2 2LMDA 1A31A 2IVJA 1HQCA 3RS6A 2DA1A 3D5OA 3N4MA 4ENKA 4L99A 5TJJA 3EBRA 2QF7A 3I3QA 2EV6A 3AXDA 4NR1A 4JK1X 5FLMJ 3OYFA 1NXD1 3D8CA 4MFDA 4GRIA 2PFBA 3A2KA 1AX0A 1W0UA 4GFBA 3NJVA 4GKXA 3BODA 2D40A 3FKIJ 1IJWC 2P4EA 3NAPA 2Q5TA 2K86A 2QQMA 4D94A 1WI3A 2CO5A 2L01A 3Q8EA 1J84A 4ONUA 2J1AA 2HNHA 3V0BA 4LO6B 1QJX2 4N9IA 4WBBA 3LSGA 2YBKA 3WDVA 2YU2A 4O5VA 3HNMA 1PGSA 5HPOA 4UB8C 2VZPA 1AL21 1WSUA 3ACIA 1U5YA 1ENQA 4WWCA 4NVPA 5KVRA 2VBWA 3K4BA 3AZZA 4OI4A 3WU1B 1XC5A 4XKCA 1ZG5A 2JTVA 4RR3A 2XSDC 4M3EA 4Y1ZA 4XONA 1VBC3 4ASMB 4N90A 1PVC1 2WFF2 2VZ3A 2WDBA 1XYOA 3ZMNA 1C57A 2NZ9A 1EH7A 4XJ9A 2MLGA 1OT5A 1F9NA 1UCRA 1HB1A 1QNWA 4PT6A 3GWZA 2VQCA 3HOXJ 4IERA 3DLAA 1XXNA 1UB9A 3K0LA 4XKBA 5FJ8J 1QMJA 2E35A 1TME2 2YGMA 2PXJA 1B1BA 4CYCB 4R9BA 4ZYHA 1YQ2A 1VRH2 1CAUB 2V9KA 3TP3A 2VNVA 3RZGA 3DV8A 1ULEA 1APLC 5FZ4A 2ET1A 2HWE3 2WA3A 2EA4A 3F8NA 4LK7A 4Y1YA 1QJX1 1VAVA 4RGRA 4JP0A 4UAPA 3HMYA 3KEQA 4H7LA 1TTYA 4XNFA 4B7KA 4E7LA 2CWMA 1DQ0A 2DMPA 5I0TA 2IEKA 2PLV2 4LBKA 1KYZA 1OOPC 2JK3A 3RNSA 4MLOA 1EP0A 1LTEA 2VY0A 1N75A 2XHKA 4JZRA 2ET7A 3OG2A 4RGAA 4CRQA 2JT1A 3LCPA 3BU7A 5M3MJ 2P3KA 4R52A 3H42B 1MNMC 1J1TA 1E5RA 2ZPXA 4ENNA 2ZSHB 1ZZCA 2ES3A 5L7OC 4IXAA 4Q4V3 2HS5A 2WFF1 4E7ZA 1RUI1 4ZYGA 4EJOA 3TW6A 1US2A 2DT5A 1EAH2 4UUVA 1W04A 2RN7A 1EKEA 3I58A 3QBQA 3S32A 2DU9A 2VOXA 5LLQA 1JU3A 4GD4A 1NT0A 2CL2A 1IC8A 5BNOC 3V4GA 4CDGA 4IEWA 2OUMA 1VRH1 3HG9A 2HYGD 1GVDA 3DEEA 1XOYA 4YYOA 2GA2A 1OD3A 1OFNA 1TW2A 3WCRA 3J7MA 2XGDA 4Q1RA 1KJRA 1UHSA 3KV9A 3RMYA 5L9RA 3F8BA 4SBVA 2HPMA 1R5HA 1YS7A 3TB0A 4S2HA 4DXRA 3H9JA 4Q4W3 4KMFA 4P9LA 4XLFA 2PLV1 4JGYA 5HVQC 5A6XA 4BPZA 3KHBA 3LGRA 1W8HA 5T5LA 1J5YA 1B09A 2X53S 1FOWA 4HAMA 1YE9A 4YW3A 2R30A 3H9QA 3HTSB 5DCMA 1VAMA 3PVEA 1QXRA 3LFIA 4ZZDA 1DZRA 5FYZA 3W58A 1K78A 1N1TA 5FP3A 2YDEA 4XK4A 4LE3A 1VBB1 3CHXA 4DB5A 4MNUA 2VU9A 1LOFC 5FZFA 1GWKA 3RYRA 2VT2A 5K5OA 3IIAA 5DG1A 1UYPA 2E26A 2DVDA 2B5HA 3W59A 2JWTA 3AMHA 5GZCA 3JB4C 5FLVA 5DG2A 4KJZA 4LG0A 1NX9A 1SFYA 2K2SA 2CYYA 5C9AB 3C2UA 4C1WA 1COV2 1OFSA 1Q1VA 3K48A 2ZJ2A 1YCIA 2K27A 3U2RA 2KL4A 5LY2A 1ZQ3P 3WQ0A 1MEC3 2H0VA 4D8MA 2FF4A 1Y39A 1L7RA 3KP2A 4IJAA 1H2KA 2ECBA 5EHDA 4DQAA 2BTVC 4E4HA 2R062 4LO5B 2W4SA 4AVSA 4L5JA 4X0GA 5CYYA 3WY6A 2LYCA 2F4PA 2ORZA 3KYCB 1D1AA 1RMU2 5DM6F 1J83A 3POYA 3AKTA 2QLZA 2KA3A 3PNAA 1OKOA 4WVZA 2FNPA 5CQGA 1GMMA 2OX0A 3OGRA 2W52A 1WA4A 3ZYPA 1RUF3 2HBUA 2QQLA 1IDYA 5TISC 1OH4A 1FYUA 5FD5A 1WQ2A 4CEWC 5D8LB 4B1RA 1A8MA 1ND3A 3CZJA 4OZOA 4CDXC 1F1ZA 1AYM2 4AIKA 2Y6HA 1KQRA 1W6OB 4W50A 4AK3A 4XC9A 1X50A 2UXXA 5FYSA 1RUH2 3QU6A 2QKDA 4CDQA 4KGGA 2WA4A 2NP0A 2R7TA 4XFAA 1D4M3 1N3OA 1S0EA 5L3BA 1F43A 2IXLA 3WXPA 2HOEA 1ZYRF 2WO1A 3RZDJ 1O4TA 1GHCA 4OWRB 1AR92 3RJPA 5IK4A 3LPFA 1JTXA 3WQ7A 3ZFFB 5D5WB 1L0OC 3WEZA 3I59A 3K3NA 1UY2A 5KXBA 1FNNA 4I3GA 1BI2A 4NJ4A 3MLKA 3J8F3 3IWZA 2RV8A 4IHVA 2WO2A 2X6XA 3WUDA 1RMU1 2FQ4A 2AR6A 1LEMA 1XNAA 4C0HA 1CAVA 4IEQA 4RDUA 1HA8A 4XIDA 4RM2A 3NL1A 2Y34A 1RGSA 4YG3A 2RVAA 5IP9J 1ULFA 1VAKA 2VJJA 2R043 5L73A 2R32A 2PA7A 4XUNA 2AENA 4P9FA 1NCQA 4CDUB 1H9GA 1UQXA 2W48A 1A8DA 1O7FA 3WQ1A 5E17F 1VBE2 1AYM1 3LSTA 1SEFA 3PU8A 2ESNA 2MG4A 2WZPP 4WF2A 2ORXA 1LNWA 1FX7A 2GQQA 3ZP5A 4NHJA 4YG0A 4K9SA 1RUH1 4EGYA 5A3OA 4YVSC 2DT6A 4Q5SF 1YO5C 3MZ8A 1W8NA 2HWB3 2IP2A 4AEMA 3C3VA 2XROA 5CIRA 1TT0A 1OYIA 3SXYA 3O1MA 3CLPA 1JKRC 2E2JJ 4M3CA 1HN1A 2WQZC 1QHGA 1FPN2 3VL8A 2C24A 3CO2A 1TME3 1R4NB 4NE9A 1HRV2 3FZ3A 1WZXA 3ZSJA 3DTIA 4DYCA 4AHZA 1HW2A 3M7AA 4YW7A 1OHFA 4V2GA 4E7IA 2WNOA 5JAXA 2PHRA 2FMDA 3QWLA 4CHUA 1U9OA 2A75A 5I8YA 3R60A 3VBRB 1X19A 4D7MA 5DAVA 1MJ9A 4QQLA 4WVMB 1L3JA 3S5AA 3SITA 3LDRA 5J47A 4Q4Y3 3FF5A 2Z5WA 4LOSA 2TNFA 4JX0A 1GOFA 5IT9K 1VBE1 5BY5A 3ML6A 3VODA 3MIFA 4DNYA 1U0AA 4XQ4A 2NVTJ 2ZX3A 3O1TA 1DQ1A 1S72I 4RQPA 4A5MA 4XJ8A 4BMEA 1IZ1A 1R1TA 3THDA 1JODA 3O1UA 2JRTA 1Y56A 4PJ0C 1HV0A 1YOVB 1EAH3 3AAFA 1AR72 4DXSA 5GZGA 2NNNA 3HQUA 5DAXA 5LA1A 4JBAA 2I2SA 4L5IA 5A2QK 5D4SA 3M3QA 2WNVB 1HRV1 4KMUX 5IVYA 4F93B 1JUHA 2VTXJ 3ZOBA 1O6UA 3EUHC 2XONA 4M0NA 2XV4S 1GSLA 1FAYA 3F0CA 2K3PA 1XQNA 1TL8A 5KC5A 4YZ2A 3BLYA 4AIJA 3CLQA 2IA1A 3IHUA 5IVJA 1DQ6A 4FQ4A 3ST7A 4GULA 3MFKA 2HJIA 2QBYB 3CMGA 3G1MA 4I6ZA 5BNNC 1STZA 1TP4A 4B8XA 1SLIA 1IRFA 2X1DA 3GZTB 2X8KA 1QA6A 5FYIA 2OW4A 1J3RA 4A3XA 3PO3J 4PFPA 2LRPA 5HXMA 1BL0A 4OZXA 4KN4X 2ZS6B 2CWEA 3S1QJ 1B8IA 3ZN6B 2TUNA 4DZJA 1X1PA 5FYUA 2V6CA 3ZYJB 3AL5A 5BYNA 2X51A 1PO23 3AP4A 3MIEA 3NVCA 1MBKA 5BPDA 4RD7A 4A69C 3POJA 2BU9A 1BR2A 1XNBA 4WXHA 5KHGA 3WTZA 3WP3A 2B39A 2A6HF 4CCJA 2RJ2A 4EN9B 4BHCA 4OI1A 5LK5A 1J75A 4AE2A 1GWLA 1JN2P 4HSTA 3PUFA 1UHMA 3R05A 1COV3 3OGJA 2VVFA 2VJ5A 4XCAA 3TEXA 4O6JA 1JTYA 5CFCA 1HB3A 1A34A 3VD5A 2DWRA 4ZC3A 1C1LA 2QCOA 2VQHA 3J80Z 4HX4A 1ASJ2 1P9QC 1Q8PA 2R063 1U5ZA 4QM9A 1HQLA 3KEYA 1FMD2 2W85A 1PK6C 2OQGA 2Q1MA 4Z2AA 3AYCA 2I8DA 1XU1A 4ATFA 2HYFA 2MABA 3MN2A 5EQUA 4A7KA 1WPKA 1T8IA 3O1PA 3JTHA 4U36A 2NYYA 2ZMEA 1MS5A 3SFZA 4CUBA 4ZU4A 3T09A 1MS9A 2K9QA 1ETWA 2GWRA 1EV7A 4Z82A 2BVVA 1UWWA 2Z99A 1OQDA 3AG1H 2ZTNA 3NW4A 5D21A 2V1XA 3P3PA 3PUBA 2MLKA 2QQUA 2IBDA 2DXIA 1PZ8A 5H20A 3SC7X 4BE3A 4QM8A 1IG7A 4RGGA 1V5FA 4CDWC 2BP6A 2VQGA 4BS9A 5ABJA 1C4RA 2D98A 3ACGA 2NPIA 3CTAA 3PNVA 4IL6C 5J48A 3LIGA 3WHCA 3FWEA 2M30A 1SFPA 3LWFA 1JYTA 1AR93 2RV9A 2BY0A 3OYEA 4NIIA 3HRUA 3WW3A 3WDTA 5LBEA 1JU4A 4Q1PA 4Y4RA 2W68A 4PLMA 1FMD1 3ERMA 3NSTA 3BTLA 2WYSA 1BCXA 4Y33A 4JC1A 3IKWA 4II3A 4BIOA 1VF9A 3ZIXA 4LA2A 3FISA 2FDKA 3V42A 2L4AA 3T0YA 4L5EA 4TV7A 3VDXA 2J1SA 5FKLA 3D0JA 4C8DA 4QSHA 4N7IA 1UY4A 3K3OA 4HSLA 4HZFA 4B8EA 3LAPA 3IDEA 2D5VA 2LS6A 2CV0A 1Z67A 4LHKA 5JOZA 2K9MA 1U8RA 1VZ0A 3P9KA 2NS0A 1OF3A 1SEUA 2JA7J 4EMSA 1SLAA 1EUTA 5C3RA 1V6KA 5CFDA 1F5FA 1UW8A 1V6IA 2XL9A 5LWBA 2XJUA 4XFFA 3M3OA 3IPVB 4N4NB 3HBZA 3BCAA 3LQCA 1U5XA 4CUGA 2A5ZA 5A7PA 1WJBA 4M72A 4WK8F 3U1XA 4DOUA 1V55H 1FPN3 1W06A 2YZ4A 1LJ7A 5D8AC 2OCEA 4IETA 1VMHA 5KAIC 3WGHA 1DCSA 1MSFC 4F91B 3CCEI 2XWJB 2UY9A 1GNHA 5A7WA 1SMYF 4EZHA 1PO13 1Z1DA 1AXKA 2NQYA 2WUHA 3K70D 3MLJA 1CAWA 5ILSA 2HKOA 1ZLKA 2MEV3 1AYN3 3RYPA 4CCCA 2E1MC 4CCLA 2DVFA 2DMNA 3L1PA 2GC2A 1YLLA 1T2XA 3CIHA 3CJIB 1I27A 1CGPA 4NIDA 4BKXA 2OKXA 2FZ2A 2DA5A 1PX3A 2ZX0A 4N4OB 4NHLA 3J7AO 1TBXA 4I01A 2EIJH 3VKMA 3B69A 2YXSA 4E4DX 4GB32 3AB0A 5IVBA 2HGCA 3EUKL 1ENHA 4JRAA 1MS4A 3O12A 4IX7A 4N8MA 2KRHA 4UFJA 4QU2A 5LW9A 1B35A 4BCUA 1X82A 1NXMA 5HCAA 3QQAA 1K4TA 2RQPA 2VPRA 2GN7A 1QQIA 3DBRB 5IWFA 3JB8A 3K4JA 3BR0A 3N7MA 2BGCA 2P6TA 4MTEA 1QO0D 2CS3A 3AMPA 3IAPA 3H3UA 1AR73 3CC4I 2QZ8A 2ARCA 4BQAA 2NM1A 4B3AA 1JTZX 2R5ZB 2WBMA 4YFWA 2E31A 4GJZA 4U7DA 3UNGC 1E2XA 4HBLA 4JDOA 1SLBA 1LULA 4DW6A 1HC8A 5KBFA 4A6DA 3AP9A 1KFUL 5EJCA 3T4HB 1Z3XA 4ZS3A 2PG4A 1HW5A 3LFMA 5GM0A 3OPZA 3O8GA 1SPPB 3UKNA 2XH6A 1W6PA 4L0YB 4BK5A 1OCCH 2LY9A 2A7AA 3BVCA 3LSJA 4YW6A 2XPJA 4I02A 1XCBA 2O9LA 1DGWA 2V4JC 1MS3A 4V19K 3A21A 1IKQA 3MFCA 5FIXA 4MO7A 4CYDA 4LR4A 4AFDA 3D1NI 1YIJI 2DPUA 3DKQA 3OYHA 1VALA 4W6XA 4QGLA 5FZCA 1R64A 5J1UA 2DFHA 2GH8A 1BR4A 1IV6A 4HG6B 1RR8C 4QB1A 2LW8A 5DZFA 2ISZA 4OHZA 2Z42A 4DZPA 3K2OA 1D1CA 4GWIA 3Q9OA 1RC6A 1BW5A 2PAKA 3H8UA 1O7LA 3CUQB 3RJ2X 4NHKA 1A6IA 2MSYA 1AJOA 4AR2A 1TWAJ 3C1DA 4UUTA 1LHVA 2D5HA 2YS9A 3RTRA 1F4KA 2DUOA 2BW3B 4PDWA 3OR1C 2WSVA 4MO3M 2ESHA 4MQ9F 2DFCA 2LC2A 4BLIA 1BIAA 4IHYA 3ZYFA 1U5IA 4ZZ5A 2OPKA 1UD1A 5CISA 3K4DA 1WBLA 1ASJ3 2VZRA 3ZIWA 3SKJE 1YO8A 5JPNB 4WM8A 2O3FA 5K5QA 2VBDA 3F6OA 5IATA 2K9LA 1LDJA 5A7OA 4BBRJ 3QP6A 3A0NA 2JG9C 5FZGA 1POV0 4G7OF 2P5LC 3VBFA 2E63A 1EV12 5BOXA 1XPXA 3USUA 4RGKA 4F52A 3JCIA 4ZU5A 5FKCA 3Q3SA 5FXVA 2VKVA 2BOLA 3AG3H 2EAAA 5C8WA 4IGOA 1YIOA 4Y7NJ 4UVAA 5E88A 2UURA 1BVP1 1IQDC 1I3QJ 4LORA 4UWDA 3RZJA 3ZPLA 2FEZA 1RJ7A 2WC2A 2F4MB 4J19A 1NKGA 1EUUA 3CO7C 3IH3A 1REDA 4E2GA 1C8M2 2ETEA 3ZQFA 4C90A 1UOJA 1G9BA 4Q47A 4AHXA 4JVAA 2YBPA 2CY6A 5KHKA 3FDYA 2C1FA 5IJRA 1SDDB 3AG2H 1ZRCA 2MC3A 2D6PA 1CQ9A 4LBJA 1H9TA 2PHTA 4NOTA 3PIJA 1Y0UA 3KPHA 4CXXA 1S7EA 3JSOA 3BIEA 1OI6A 1TT5B 1NUKA 4RB1A 2JUCA 3HUGB 4QB2A 1YIFA 3RVHA 4XF9A 3SKVA 1ODNA 5IP6A 4DMIA 2PJRA 4OVEA 4B29A 1B72A 3LA3A 1D0ZA 4PQQA 1DLCA 4JKLA 2FXAA 1H6XA 1HDDC 3U37A 3B9IA 1YFXA 1LDKB 3OSGA 2R4GA 3CQZJ 5JMOA 1VQMI 5JLWA 3TOJA 1Z77A 3JQXA 3RKQA 3Q8CA 1UXZA 4CSWA 3HVDA 2DTZA 2XVKA 5B1AH 3TQNA 2BV6A 2P6CA 4M74A 1Z6TA 4A12A 4HOOA 1S0FA 1H89C 1OH3A 5H6RA 3MV11 1ZRDA 5KNLA 4I30A 1C8M1 2DCKA 2HWF2 3CD6I 2D3RA 2X6WA 4QQ2A 3B3QE 3WNLA 5JR3A 3RZHA 3MD2A 1FV3A 3ZQHA 3OYBA 1BQPA 2ELJA 3CDHA 5I0SA 2QM3A 3WLUA 1MKMA 2RDNA 3RI4A 3KYLA 1R58A 2BXZA 2DODA 4UF0A 2ADUA 2BUKA 5J3LA 3EB7A 3BJAA 2MBFA 2ME0A 4NAOA 2FBKA 2P3IA 3RCOA 2VBBA 1S55A 1ULDA 3TL4X 4Y1VA 1MZFA 4UOJA 2KKOA 1WZ2A 2WAOA 3WUCA 3ME2A 4XFGA 1HW1A 1UY0A 4XHBA 3SISA 3NAPB 3GTPJ 2VCAA 1CR7A 4RSUA 4HK9A 5HLIA 3ZN5A 4NAMA 4K1YA 1R71A 3V0BB 4ZDOA 4ATEA 4FHTA 4LLNA 5FXXA 1BBT3 1FSHA 3ZFGA 4CU9A 4L2NA 1UFMA 4GB33 4YGBA 2EFPA 3C7GA 5I0UA 2HWD1 3GNEA 1K61A 2P34A 1NCRC 3U21A 2WAEA 1OQYA 3NRUA 3THPA 2D43A 1POV3 4IOCF 1G86A 2ELHA 3HRTA 2DI3A 4RR3B 2RREA 5ICGA 2PQ8A 1F15A 1VQPI 4UVBA 5FWEA 3THTA 5KXEA 3POFA 4ES8A 2PMUA 1BJQA 5AIQA 1WJDA 3AYEA 1PVXA 1S3JA 3LZZA 1J9IA 4EJUA 1FPQA 1G9FA 2W94A 5FROA 5LGNA 1UKGA 4DPNA 5FGMA 2J1TA 5M0TA 2VKHA 1W8FA 2QQIA 1RINA 1IN6A 2Y6JA 4RFT0 1NHAA 5F3CA 1LFPA 2QQVA 3RPQA 5A3LA 1OF4A 1S0CA 1CZTA 2PEXA 4PJJA 1YYVA 2OZJA 5C5TA 1VQ6I 3FBNB 3K9TA 2E53A 1QHHD 2D93A 5DDGA 1LEDA 2D2WA 4N0BA 1Z91A 1RETA