1CAWA

Determination of three crystal structures of canavalin by molecular replacement
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
181
structure length
181
Chain Sequence
AQNNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title Determination of three crystal structures of canavalin by molecular replacement.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Seed storage protein
total genus 25
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cawA00
3IDCB 3RZZA 3EJKA 5D1IA 5C8WA 4IETA 4E2SA 3E97A 2EVXA 3G7DA 1DGWA 4HZFA 4IEVA 1ZNPA 3IBMA 4PJYA 4MV2A 3E5QA 3MYXA 3OCPA 4QX5A 4PIXA 2Q4SA 4BHPA 1ZRDA 5CVRA 1SFNA 2ET7A 4EWEA 1WGPA 4CYDA 4WVZA 1QWRA 2CGPA 1YFXA 5HI0A 4IEZA 1V70A 1CGPA 2VQAA 4HN0A 4XFFA 1FI2A 3FFQA 5LEKA 3D0SA 4IEUA 2HJIA 5JCTA 1OI6A 1FT9A 3CL1A 3DL3A 4F7ZA 2N7GA 1J1LA 2C0ZA 4N9HA 1NZCA 1ZZ6A 2GC3A 1UD1A 1RUOA 2QJVA 3TNQA 1EY2A 4TLFA 2PHLA 3FZ3A 4XF9A 4QMAA 3FHIB 4A2UA 4IEOA 1OMIA 4XFGA 4J1XA 2VPVA 3SCGA 4KU7A 1EPZA 4HVOA 4XF3A 3LOIA 1WLTA 2GAUA 1U12A 3WW2A 1O7FA 3DKWA 3LZZA 2PAKA 3WW3A 4AXOA 4AVBA 1HW5A 2OA2A 1PM7A 2ATFA 2QNKA 3LA7A 4IESA 4I2OA 2K9ZA 3HIFA 4WBBA 2D40A 1YUDA 4AQ6A 1XRUA 3KMHA 1YFUA 4D7SA 4Q0SA 4LA2A 1PMIA 2IC1A 5I0RA 3PVBB 1GQGA 4RD7A 5KHKA 3H8UA 1Q43A 4BIFA 1WA4A 2B9UA 5FPZA 2PTMA 3R6SA 3QACA 2D5FA 2BNOA 2O8QA 4LUKA 5I8TA 1O3QA 2EAAA 1RTVA 3E6DA 4BH9A 2BYVE 1CAVA 4HSLA 3IWZA 1YHFA 3M70A 5J48A 4PIYA 2I45A 2PFWA 3B02A 5KBFA 5JR7B 5CADA 4E2QA 2PA7A 3UKVA 1CAWB 4Q29A 2V09A 5J7MA 4O9GA 2UY9A 4KWJA 2XL7A 4HVQA 2BGCA 3LA2A 3MDPA 3D0JA 4XF0A 3IIAA 4I3PA 1YFYA 2ZKLA 3KSCA 4I09A 3VHRA 3SCFA 1ZZCA 3H1MA 2GC1A 4D7TA 3KGZA 4L11A 2XHKA 3CJXA 3ELNA 5K8SA 3BCWA 1LR5A 3KCCA 4YARA 1CAWA 4KWKA 4FAHA 1J59A 2QCSB 3I59B 1ZX5A 1Q3EA 4AQ2A 2QVSB 5LRSA 2ETEA 4MZUA 2GC0A 2EA7A 3ST7A 4HMZA 5E1RA 5I8SA 1ZZ9A 4IEYA 4HN1A 3USSA 3NL1A 4J1WA 3O14A 3RYPA 3E6BA 4XFIA 3I54A 3TNPB 1YLLA 5C6CA 4MGYE 2D5HA 3MZHA 2GZWA 1CAXA 4FAGA 2WFPA 3I59A 1EP0A 3RNSA 4EROA 4MH0E 1J3PA 2BNNA 4UXAA 3WW1A 2PQQA 5J3UA 2CV6A 2PAEA 4Q0PA 3S7IA 1RL3A 4BYYA 1XE8A 1LRHA 4Q0VA 4ZU7A 1ZREA 3PNAA 1GQHA 2XLGA 5I0UA 5T3NA 4HSJA 1O5LA 3ETQA 4XFCA 4AVCA 3EBRA 5I8YA 3S7EA 4DINB 1VR3A 3H1WA 2XKOA 3RYKA 2IXJA 3LAGA 2GC2A 3RPQA 1ZZ7A 2E9QA 2DCTA 2KXLA 3I7DA 4H7LA 4L2NA 3SHRA 4YNIA 2B5HA 1CAVB 3ACLA 4MUVA 5I0TA 4Q0UA 5FPXA 1YFWA 1X8MA 2MHFA 1CX4A 1UPIA 3KGLA 3OF1A 3GBFA 4KWLA 1VJ2A 3DN7A 3QOPA 4EWAA 3FJSA 4LULA 3GYDA 1O3RA 4QXKA 4I01A 1OFNA 2XGXA 3FWEA 5LRRA 3EO6A 3CO2A 4MGKE 4LUMA 4KL1A 4F8AA 5FLIA 4X6RB 4B29A 1UW8A 2XL9A 4MGIE 1UIJA 5I91A 4HVRA 2XLFA 2CAVA 2UYAA 1SEFA 2OZJA 5KHIA 1XE7A 2XLAA 2Q30A 3E6CC 1RC6A 1QY4A 4IEQA 5BV6A 3LA3A 4Q0QA 4HBNA 3ES1A 5KHGA 1RGSA 4PIZA 4JTNA 2FMYA 2D93A 1QXJA 1VP6A 5F1RA 3U0ZA 1O3TA 3DV8A 4YYOA 3ROUA 3EHKA 3U10A 5FDBA 4I0BA 4HLTA 2GU9A 3WW4A 1O4TA 3PLQA 3H50A 5CU1A 4EWDA 2CAUA 4QGLA 5JSRA 5EFUA 3IDBB 1Y3TA 1CAXB 1X8EA 5FCCA 3UKNA 1DZTA 4IEWA 4GULA 3NW4A 3EQEA 3SCHA 1G6NA 1J3RA 1Q5OA 4META 4MX3A 3BB6A 3BU7A 3U11A 4I02A 4NVPA 1H1IA 4XEZA 3NKTA 1RUNA 1JUHA 1ZRRA 3SXWA 2H0VA 3N4MA 4LTAA 4UBHA 1I6XA 3H7YA 4YSFA 1TQ5A 2QDRA 1NYWA 2MNGA 4XFHA 2Y0OA 4QM8A 2XKPA 2P17A 1EYBA 2ZCWA 3OD0A 3CLPA 2IXIA 4LLOA 5FQ0B 5JSOA 5E16A 2OZ6A 4Z07A 4EV0A 4ZU4A 4QM9A 3BPZA 1OD5A 2O1QA 3E5UA 1NE4A 2WC2A 4K8FA 2IXKA 4AVAA 3H3UA 3BALA 4OFGA 3H7JA 4FT8A 3NVCA 4JVAA 3H3ZA 1YWKA 1ZZBA 3ZDSA 1SQ4A 5FQ0A 3C3VA 2BNMA 2Q0AA 1X7NA 2F4PA 4O9EA 5I93A 4WZCA 1ZRCA 1UIKA 1DZRA 3HQXA 4IEXA 4LA3A 4UBGA 1I5ZA 3CF6E 3MPBA 5AVPA 2Z69A 3E5XA 4MGZE 3NSTA 4ONUA 1H1MA 3HT2A 4IERA 4P9GA 3HT1A 3ES4A 2Z2SB 4I0AA 1J58A 1ZVFA 1CAUB 2PYTA 5BPXA 4E2GA 5BY5A 3D82A 5LEJA 2OYZA 3RYRA 1ZZ8A 1O5UA 4XF1A 3FE5A 2IXLA 5FLJA 4OLLA 2IXHA 3UKTA 3L2HA 4X6QB 4ZU5A 2MPFA 2H6CA 4ORFA 5JSPA 2ET1A 3RDIA 1IPKA 3H1YA 4R52A 5JAXA 4N9IA 2HKXA 2K0GA 2BEOA 1NE6A 5FLHA 2Q1ZB 4JTOA 4LEJA 1J3QA 1CAUA 1LKNA 1IPJA 1ZRFA 4QGNA 2UYBA 2VECA 3JZVA 4FBFA 5KHJA 5BXXA 1DGRA 4XF4A 5EZWA 4JV4A 1L3JA 2PHDA 1Y9QA 3OTFA 4IEPA 3FX3A 3SMHA 3NJZA 3S0MA 2B8MA 2FQPA 2GH2A 1UCXA 3OGJA 4YRDA 1FXZA 4QGMA 2OPKA 1X82A 4Z82A 2IXCA 4R8HA 2UY8A 3H9AA 4XETA 3M3IA 2H6BA 1O3SA 4XFBA 5KHHA 1LB2A 2PAMA 1NXMA 3CEWA 4XFAA 3LWCA 4KU8A 5I0SA 1QXRA 5BUVA
chains in the Genus database with same CATH superfamily
1IQAA 5C8WA 4B4QA 2EIGA 2JDKA 1DGWA 2Q1FA 4Q4Y1 2VW2A 3I4IA 4KBBA 5DAVA 5DDJ3 3Q8AA 5JIAA 1FV2A 3NV2A 1IS5A 5AC92 4QDSA 2Q4SA 5FR3A 4BHPA 1K5MA 2E7QA 1TMF2 2XQXA 2ET7A 5CVRA 4Q4W3 5IK5A 1MS1A 5DPNA 2PHWA 1V6IA 1QWRA 5HI0A 4R9AA 4AI8A 3WP4A 1LHWA 1Z7S1 2F4LA 1B35C 3BTAA 2R063 2WWJA 3AZXA 3WP6A 4NIGA 4XFFA 2RS12 3C7GA 4MHRA 4GH4A 3D0SA 4AI3A 2HJIA 3K4DA 3CL1A 5A6XA 1E5HA 1G7YA 4Y4RA 4RS5A 3CZJA 4GALA 4LQRA 2A6YA 3LFIA 3OYWA 4QPWA 4ATFA 4N7UA 1HX6A 4XILA 3WDUA 4P5YA 1J1LA 4YVSB 3ZSEA 4COWA 1LAJA 3USUA 2GC3A 5C3OA 3T30A 1VBD1 2YV8A 1OLRA 2QJVA 2HEWF 1AL23 1SLTA 1OC1A 2IUWA 1NX9A 2LROA 3ON7A 4GKXA 2XWJB 4RGAA 2NPIA 4TLFA 1AR82 5BNOB 1GP6A 1EAH2 4GKYA 1TME3 2JG9A 2WS92 2R0FA 5CFDA 2HBTA 3VLBB 1FMD2 1VLNA 2B7YA 5FYHA 5IK4A 1X33A 1RHI1 4A45A 1H8VA 4KU7A 1EPZA 4HVOA 2C1FA 4XF3A 5CYYA 2YPDA 3MBWA 2BUKA 2RHPA 2VOKA 4JZRA 5AC91 3DKWA 1UY2A 1BHGA 2WQZC 3A7QA 2PLV3 1BCXA 4FPHA 4PT6A 1YYNA 5EJZB 1A6CA 3LIGA 3WW3A 1TVGA 4PF5A 4AVBA 5A3MA 1GBGA 3W20A 1KFXL 1W6QB 3W9AA 3ZIXA 5JI7A 4XXPA 4LPLA 3ACIA 2WNOA 1NY72 4YGBA 1OKQA 2E7TA 4GWJA 3D3AA 2D40A 4XDQA 5FZFA 3KCYA 1RUC2 3RGBA 1HRI1 1K42A 4B4PA 1GKBA 4D7SA 2W5FA 1OQEA 3JBG2 4KG0A 1PMIA 4FPLA 4YW4A 4URAA 2YFZA 3PVBB 5IVEA 1KRIA 2GNDA 5FY9A 3WHTA 1F2NA 2Y6GA 2JD9A 1AR81 1OA2A 5LK5A 1PVC3 1JYXA 3O1SA 4PCRA 4A42A 4CP9B 1U5XA 2QUOA 1AYM1 3OEAA 1MQTA 1S55A 4LO4B 4N8MA 5C8CA 1GQPA 4DUWA 2YC0A 2YMZA 4PQQA 4QX3A 1QJX3 2BYVE 1HIXA 3AP7A 1JYCA 4HG6B 4YWAA 5K0UC 1QGLA 5F3IA 2CHHA 1SZBA 1ULCA 1L7LA 3VBOA 5J48A 2VOTA 1W6MA 2HWE2 3OY8A 4HKLA 3VUOA 2ID4A 5A3OA 3ZN6A 2PFWA 3RVHA 3O0XA 3OPWA 5DN2A 1Y9GA 4D69A 3ZXAC 5D8AB 2Y38A 4BM8A 3H8OA 5ABJC 4XUPA 3A23A 4O9GA 3AYEA 3ZFFC 1QIQA 3PUSA 1LECA 1V6NA 2XL7A 3DKQA 5CFCA 2BGCA 1ENRA 3LA2A 4C1WA 3D0JA 4XF0A 2VCCA 1NCQB 2ZKLA 2CY6A 5HCBA 1OSGA 3IPVA 4N90A 2FCUA 3H1MA 1ULFA 1RUE3 2PHRA 2ZMKA 4E4DX 3AMMA 5FPUA 1MS3A 1AR72 2BRTA 1LGCA 1Q8SA 3ELNA 5T55A 4QAWA 3WOGA 5F5CA 1BK1A 2G9ZA 1LR5A 4B4RA 1CAWA 1V6MA 5GZEA 2XB6C 1JHJA 3J9SA 3SKVA 2W0XA 4DNYA 3NJXA 4DMIA 2SLIA 2WT0A 4TXWA 4BJ0A 4BWOA 3B9IA 3PU8A 2LALA 5FYCA 3BTXA 5EQUA 5IVJA 3T0DA 1T6BX 2HWC1 2JDPA 3D8CA 4P9YA 5FZIA 5T54A 5LRSA 4MZUA 2WKKA 5IJRA 3UNPA 2FBEA 1UY4A 3WX5A 2QQUA 1LHOA 4P9JA 4HMZA 4QKNA 3V64A 3VZMA 1YI9A 5I8SA 2CU5A 2W1UA 4EN9B 3J8F2 4IEYA 4XDOA 1LESA 5A1AA 4OHYA 2J1TA 2EXIA 3UETA 3E6BA 3TBDA 2DVAA 2UWAA 3UJOA 5T5OA 3WLUA 5C6CA 2B46X 2WO3A 3J26N 3MZHA 2V72A 2GZWA 3JD72 2VNGA 2JDAA 5EYYA 2R0HA 2ZJCA 2J1EA 4N43B 4CP2A 2RDNA 2WFPA 3FMGA 3I59A 2XHNA 4JX0A 4BQ5A 3MLLA 5IVVA 4P08A 4MHUA 1SMVA 4BLIA 1H6YA 1AR71 3T08A 1RXFA 2WZR3 1OQ1A 4B1MA 3NKGA 5FO8B 4EROA 4UXAA 2ADEA 3WW1A 3T3YA 2PQQA 1CZVA 2CV6A 4B7KA 5J3UA 1FPN2 5CKMA 3AJZA 1C28A 1UY1A 3AB0A 4NIDA 2DDUA 2MEV2 5IK7A 1RL3A 5FZLA 4DPNA 2YGMA 1K5JA 1C3HA 1RUH2 2CTVA 1CIYA 3GJAA 4Q0VA 3ITQA 2JE8A 2ZGRA 2VGDA 3KF3A 1JN2P 2WLPA 3NNGA 4QPGC 3K75B 4BIOA 2NP0A 2RM22 4TN7A 1O5LA 3C8XA 3ETQA 4AVCA 3EBRA 2Q8OA 1OOPC 1ZBE2 4K1YA 4QHBA 1J1TA 1D4M2 4XJ8A 4GWIA 4FVVA 5I8YA 2E26A 4D8MA 1Y9MA 4OZOA 1LHVA 1VR3A 3BVCA 3KT1A 3H1WA 4ITCA 3UT0A 3NRUA 4GWMA 1JODA 3LAGA 2G19A 2GC2A 4W6YA 1QQP1 1MACA 1URXA 1R093 4CXWA 3PJQA 2KXLA 3P1IA 1DLCA 4ISRA 3N9LA 5A70A 3VBFA 4FQZA 3NAPC 2VVDA 3WDYA 1U5YA 5FPXA 2QQNA 4RQPC 5H9QA 5E8AA 2D44A 4XYXA 5FWEA 5T50A 4LBQB 1DQ5A 2MHFA 1K5MC 2JDUA 4IE6A 4FPFA 2D3SA 5LB6A 2WNVC 4YM0A 4AI2A 1REFA 3KGLA 3TN92 3NNMA 1S1AA 3BTZA 3WNNA 5K9YA 1UKGA 4CCMA 2RS32 3RFRA 4XUOA 4YZ4A 1LEDA 1BEV1 3WNLA 4AGRA 2WO7A 2EXJA 1RIRA 2ZHLA 4QXKA 4I01A 1RUH1 1WW4A 5EJ1B 2XGXA 3FWEA 5IATA 1V00A 2D6KA 2XBO3 1UOGA 4BDVB 1ONAA 4LUMA 3BPSA 1FOD1 2R042 5IUQA 3ZN4A 1OPMA 4LR4A 5J98B 4F3JA 4ZS2A 3VBRB 2YUEA 4NWVA 4XCAA 1LOFC 4X6RB 4XVHA 3K4ZA 4YVWB 2P3JA 4CDUC 5KXDA 1UIJA 4WZFA 1MEC3 5I91A 3RI8A 2JWPA 2YBPA 4HVRA 3T2TA 4IV3B 4S2GA 3WEZA 1G9BA 2UYAA 5DAQA 2RDRA 4L0PA 3WF2A 2XUMA 1SEFA 4CCNA 5EHDA 3IDAA 2OZJA 4IV1B 4QHOA 2QQKA 4SBVA 2Y6LA 3PMSA 5A1FA 2XJPA 3O1PA 4M00A 3E6CC 3AXDA 5LA0A 4UAPA 1XU1A 4A44A 4G3YC 3HN3A 1GNZA 4CDXA 1GV9A 1R1A1 3HQUA 4CCJA 1QH6A 3T09A 1DQ6A 1AZDA 4QX7A 3ALQA 5FZBA 3WZ1A 1H4HA 1RUD2 3MIFA 1VP6A 3N9MA 3AYDA 4O61A 3BKZA 5ANNA 5EP9A 1DLLA 1JTZX 1W90A 3ZR5A 1DGRN 2WT1A 1ODMA 1X9TA 4HLTA 1V9U1 2GU9A 5FTTC 3VD9A 2RS31 2CYFA 1W9YA 2GNTA 1YNAA 3VBUB 5EPAA 4EWDA 1PIV2 3I3MA 3PVEA 5EFUA 3ZFGC 4Q4Y3 2VY0A 2NN8A 1CAXB 4H55A 4WM7C 1J84A 3H0OA 4JRLA 1NLRA 4AFAA 4XJWA 4JC1A 2TEPA 2YZ4A 3U37A 1WD4A 4NRQA 5JMCA 1G6NA 2O0OA 4MX3A 2FDJA 1MVQA 1JZ4A 4WM8A 4CTEA 5FZAA 3PU3A 1Q8VA 1OBNA 1Z7S3 4I02A 1B09A 2W1QA 1BKZA 2PMWB 2VCAA 1RUI2 4XJ9A 1H9WA 2KR2A 3RQ0A 4ASMB 1JS9A 4XEZA 3NKTA 5JWPA 5C8CC 5KXEA 3SXWA 4KGQA 4NRPA 1OXCA 1POV1 1QJZA 4LTAA 4DZGA 3ZPOA 1EUUA 3BUCA 3C7FA 4FOVA 4CEYB 1PK6B 4XFHA 2DUQA 1K45A 2Y0OA 2XKPA 1VBD3 1LOEA 3LDBA 5D21A 3ZXDA 2C24A 2ZCWA 3GXUA 4LIVA 1M06G 2IXIA 1GUIA 5FQ0B 2YU2A 3WG3A 2I07B 3ABZA 2DV9A 4U2AA 1SHWB 2OZ6A 2P5BA 5CIRA 4ZPIA 1TNFA 2VMIA 1SPPA 2V5DA 4QM9A 4ZU4A 1F9KA 1BBT2 1JZ8A 1RHI3 1DHKB 3DPRC 1E57A 3LSEA 1KS4A 2P37A 3AVRA 3K77A 3VKNA 4OCTA 2VZPA 3QCWA 5F9TA 1JYIA 3ZYJB 3WVJA 3MUZ1 4AVAA 5FXXA 1SACA 5AC93 3AFKA 4OFGA 3CDZB 1UMHA 4JVAA 2IZWA 1PHMA 5LBCA 5C9AC 4XZUG 4C90A 4XOGA 4AEDA 5DZEA 2OVUA 3CJIC 2YBSA 5C3PA 2CDOA 1PNFA 2JDYA 1RJ7A 2Q0AA 3L9JT 5DZGA 3MICA 1GWKA 5FZ9A 1UX7A 3IDEA 5IK8A 4W6WA 1ZRCA 4ET7A 1ND3B 1UIKA 1HRI3 1N3QA 2WT2A 1FAYA 3BIWE 3C7OA 4RA0A 4XJZA 3NNJA 3UL2A 4Y5Z0 5CG8A 5FXZA 3VGIA 3HQXA 1LOGA 5FMBA 4FFGA 4E9KA 1H6XA 2AACA 3LB9A 4Q5OA 3OSDA 3CF6E 2R49A 3AYAA 2P6CA 2R072 2Z69A 1UU5A 4EN6B 3VKLA 1W3XA 1CPMA 4XJUA 5JOYA 3HT2A 2YPJA 2FDHA 1AR83 4P9GA 1H2MA 1F35A 3KV6A 5F3GA 5FYBA 4I0AA 4BMBA 5C71A 4RFT0 1ZVFA 2WLQA 2V5YA 1W8TA 4KMQA 1AYM3 4LORA 5BPXA 1NCRA 1GZ9A 1ACCA 2OYZA 2Q8CA 2CWMA 1W6OB 4LITA 4JQTA 5A3NA 1HJGA 1KGYA 1KFUL 1O5UA 1REDA 3FE5A 2ZEWA 1F4AA 4R9DA 2BFUS 1LGNA 4HOOA 2VMFA 1HXS1 1H0BA 2A71A 1QOSA 1W6PA 2VZVA 3ZFEB 1IPKA 3FHQA 3POIA 3T2QA 5CKNA 2AYHA 1UX6A 4R52A 4Y22A 2WSUA 2ZAHA 4HETA 5FLHA 5HCHA 2ZX2A 2FHRA 1LKNA 4JKLA 4DXSA 5FYVA 3WUDA 3VZNA 5KXCA 3O1MA 4Q1RA 1W8NA 4QPGB 2V73A 2Q5TA 1UYPA 1WCDJ 2J1UA 4AQSA 1SLAA 4QGNA 2UYBA 2V4VA 2VOXA 3JZVA 4FBFA 1UY0A 4XTMA 1JI6A 3OTFA 4IEPA 5A7OA 3EB7A 3FX3A 3S30A 5FYSA 3IIIA 4CU7A 2B8MA 2TBVA 3GALA 3KQRA 4YVSC 5LATA 4MG2A 5FWJA 5LASA 3MO4A 1ULPA 5FZ6A 4PDWC 3O0VA 4QQLA 1GOHA 2XJQA 5BNOC 4QGMA 2BW8A 3WR0A 3RS6A 4ZU7A 3FUQA 1HQNA 4GB32 1X50A 3RI9A 1M4WA 1GWMA 2IXCA 2ZTNA 2UY8A 5BNPA 2E53A 3HOBA 5IWFA 3ZYIB 2XVLA 3H9AA 4UWDA 2W92A 3ZYHA 3KB5A 1G86A 2ZHKA 1K5MB 2VUAA 4XDPA 4XFBA 5KHHA 1O3SA 3VBFC 4JHZA 1LB2A 2HWC3 2VCMA 2W9XA 3ACGA 2VQ0A 4FPCA 4QKFA 3BTYA 5A3PA 2P3KA 2VR4A 3CQOA 2A3XA 1NA1C 1NXMA 2VTFA 3OUIA 3SH3A 3TEXA 2G9FA 2QZ3A 3GZEA 1WBLA 3IKWA 4BK5A 3S57A 3WQ7A 4CDQA 4B7EA 4MGTA 4GH4B 2EVXA 3G7DA 1XSRA 4CEWA 4A3ZA 4AFBA 1PGL2 4RS5B 4AFCA 1IOAA 3OYWB 1VAVA 4PJYA 4MV2A 3PL0A 2X29A 3MYXA 3OCPA 3USUB 3B5LB 4CDUB 1GU3A 1KD7A 5F5AA 1VAMA 1UMIA 3ZIWA 1CESA 3H8XA 4LBMA 3SLIA 3DXTA 3R05A 1AR73 2XDVA 5GLTA 3ZYGA 4EN0A 3CNAA 4HXCA 2JG9B 4DQAA 5JXGA 1GOGA 4HONA 1HB4A 1LOBA 4M4PA 5FYYA 3APBA 4QU2A 5CFDB 3V0AA 4PBPA 3MW2A 3Q9OA 1PGW1 5JPNB 4FPKA 4AGGA 4RL7A 2D3RA 3M3QA 4XBLA 4HN0A 5K7PA 2VBPA 1FT9A 2TUNA 2ZZJA 5HXVA 1JOPA 1JU4A 3DL3A 3W21A 4BXFA 3R4UA 5CA6A 3ZDVA 2WFF2 3AJYA 1NZCA 3NO8A 4X8PA 5FXWA 3LSDA 1UD1A 1W2UA 2Z42A 1HN0A 1EY2A 4MSVA 1RUJ2 3ZMNA 1UN1A 1VRH2 5FYTA 4XF9A 2QQWA 2XPJA 2WSVA 4F7ZA 2A75A 1QQP3 2DUPA 5D8AC 3AFGA 2VPVA 2DUOA 3I2JA 2ZGOA 3K4AA 2QQIA 5DUWA 4NRMA 1CD3G 2EIBA 2XH6A 3WINE 4XCBA 1G8WA 4LKDA 3BU0A 1XXNA 3LZZA 2OUHA 3RZMA 4XUTA 1OVSA 3RJRA 1NCQC 4DXZA 4MLOA 3ILNA 1BZWA 4PI2A 1G9CA 2XONA 4P5HA 1SDWA 5DMYA 1MQTB 1NZIA 2K9ZA 4Y24A 3USSA 5C8CB 1S0IA 1O91A 3HIFA 5L7OA 1BEV3 3HBZA 5GLWA 1AR91 1MS0A 1QJEA 2CNAA 3KMHA 2AEYA 1YFUA 1ULEA 3OGSA 1RUH3 4LA2A 2IC1A 5FUIA 1SCRA 2DU0A 3VBOB 4OUMA 2VD7A 1W6MB 1W6NA 3OY8B 3VDDC 1FOD3 3Q8CA 4ASLA 1JYNA 1W28A 4UOJA 3AKRA 3ZN6B 3H8UA 1D0GA 3G6JB 4BIFA 5FO9B 1WA4A 2B9UA 5FPZA 2PTMA 5FRAA 1QJU1 2ARCA 1DU3D 4HL0A 1LJ7A 4LUKA 3E1F1 5CFCB 3DXUA 4FOWA 2OX0A 4LHKA 5I8TA 4AYUA 2WDBA 5FXVA 3U75A 1PM4A 1EV11 1VE0A 4QX0A 2DCYA 5A33A 1R1A3 3RWKX 1CAVA 1MZ5A 5FFOC 5C9AB 5C7GA 3POEA 3IPVB 2LS6A 2YC4A 3KF5A 4B3NA 3KLSA 2I45A 5TSWA 1KJLA 3LEIA 3B02A 4LO8A 4N43C 4P9LA 5L19A 4KI5M 5CADA 3U4XA 3R4SA 1MEC1 2QQLA 1UMZA 1V9U3 2J1RA 2R7EB 2ZGNA 3UKVA 1CAWB 2RS33 2V09A 1J83A 3DF0A 3WG4A 2RMU2 5J7MA 5ACA2 1DDLA 4EQVA 1WLCA 2ZX0A 5J96B 2BBVA 1W05A 3IAPA 1BXHA 2RDSA 4IE7A 1W06A 1Q8OA 2W91A 1LODA 1YO8A 4AAXA 1YFYA 3KSCA 4I09A 3VHRA 1ZZCA 2VW0A 4PDWB 1WCUA 4D7TA 4EN7B 5IVCA 3M3EA 4V2VA 3CJXA 5C4WA 5FMOS 2HWB2 2WNUA 1LTEA 3ORJA 4OYUA 2Y33A 1IG3A 4Q8LA 1E5IA 3ZLIA 4AQTA 4KWKA 3ZYRA 1R081 1W8ZA 5F5IA 4Y1UA 2W87A 2XXZA 2ES3A 1POV3 3KV5A 3CKHA 5IW0A 3I59B 1ZX5A 1VPHA 4Q4V2 3ZSLA 4COYA 4AQ2A 1RUD3 3MIDA 3PJYA 4GZ9A 2ORXA 1FV3A 4N7IA 2DCZA 2GC0A 2B45X 1G9FA 2EA7A 2PXJA 5GKAC 4GQ7A 1HLCA 1SFPA 2RS52 5CKQA 1QJY1 2GNMA 3ST7A 3BIEA 5JDBA 2A3WA 4QWNA 1FX5A 2WQ8A 1GZWA 3P3PA 3SH5A 1ZZ9A 5C3RA 1F31A 2AZ5A 1U5IA 5A7NA 1LNSA 3I54A 5A6QA 1E5RA 3OBAA 1AYN1 1D7PM 2W1WA 3TNPB 1I1EA 1JUIA 3OGVA 4XZPA 3I3QA 1YQ2A 5F8PA 2D5HA 2J1AA 4MGSA 5J36A 2CL2A 1CQ9A 2QKDA 2O14A 4COVA 5BNQA 1MZEA 2YROA 4NE9A 4Y20A 5JOWA 4HKOA 3MHZA 5JZGA 2BFUL 4LBQD 2OUJA 5FP8A 2HWB1 4BISA 3AP6A 3FLRA 1LHNA 4KBZA 4MH0E 3VBRC 1J3PA 1H2LA 1VBA1 3AK0A 1AR62 2I2SA 4YVWC 3WF4A 2JENA 1JW6A 2HEYF 2J42A 1XPWA 1IKQA 1OD3A 4XBQA 3U78A 4FTEA 2X5IA 4IV3C 3S7IA 2HWF2 4QB6A 4W6XA 1GR3A 4IV1C 4OI0A 3VBFB 1DCSA 1ZREA 1W2OA 3PNAA 4TYSA 2DU1A 5CNAA 2XLGA 4LJHA 5T3NA 3WSOA 3JB4C 4HSJA 1NA1B 1SFYA 1TMF1 4WVVA 4XFCA 1GYKA 2D7FA 1F8VA 2DVBA 1UQXA 1VIWB 4GJYA 4N53A 1UWWA 1UY3A 1VRBA 2WO1A 5B4NA 1YJKA 4O7XA 2GP5A 3ACFA 4Y1XA 2CDPA 2IXJA 4K6BA 4XACA 1S2EA 2RS11 2YXSA 3MIGA 2C9KA 3H42B 4B1LA 5CG9A 2DURA 3I7DA 4H7LA 4L2NA 3URFA 3HJRA 3VBUC 4LE3A 1BK0A 1MZFA 3POYA 3ACLA 4XURA 4SLIA 4U36A 4LLFA 2FZ1A 1HXS3 5LW9A 1WCKA 4OMDA 1RYYA 1XNBA 1YFWA 2RR12 5F6KA 1RVF2 1X8MA 2GMEA 4MXWB 5A3LA 1BYHA 3WD5A 2FCVA 1BVVA 1PO22 4P9XA 1EAH1 1UPIA 3OF1A 3AXEA 3CZUA 1VJ2A 2WS91 4EWAA 1FMD1 2BTVC 3P5BA 4RHV2 4BQ1A 4BLJA 3WNPA 2VUJA 1JYTA 3MV01 1NT0A 3O5SA 5FAXA 3GYDA 2HWF1 1O3RA 4I30A 4BCUA 4AK3A 1FATA 2ZHMA 3PVNA 3J7HA 2VUDA 4MGKE 4H2AA 5FP7A 3N36A 1T6GC 3RJ2X 4Y1VA 1DG6A 1N3OA 1ST8A 4NJ4A 4TLGA 4YW3A 5DAPA 3BOWA 4CEYC 1UW8A 1PK6C 2XL9A 4MGIE 3V65A 1DGWX 2QE3A 1V6KA 2WABA 5IFPA 3KS7A 1NY71 5F37A 1N1YA 4DS0A 1RUC1 4FO9A 1XE7A 2WZEA 2XLAA 3I3EA 3MIBA 4FP3A 5FUNA 4BA6A 4AF9A 1RC6A 3FL7A 5T52A 3WT3A 3AKSA 1H30A 3JBG1 1AJKA 2XJVA 4IEQA 4Q0QA 4HBNA 3ES1A 4NO4A 3OGGA 5L9RA 2C4XA 4RR3A 1S0DA 1JZ7A 4S2DA 1MR5A 4E27A 1ZBA2 3ZSJA 4FPOB 4JTNA 2D93A 3ZN5A 1DGLA 2W94A 4FXKB 1GZTA 3T2OA 1RMU2 1PO21 3DV8A 4LIUA 1V6LA 2LRPA 2Q8EA 3ASIA 2AC1A 2VZOA 4WM8B 3VZOA 3RZKA 5FDBA 1XYOA 5HBAA 5HV0A 2FZ2A 3PLQA 3H50A 4Q1PA 4RHV1 5CU1A 2NMOA 5JSRA 3IDBB 2WRAA 2LTNA 5JMOA 5FMCA 3VDDB 2JJ6A 2WYSA 1ND3C 3A0NA 3VV1A 5FY5A 5FYZA 2WZ8A 1QH7A 4IEWA 2EIEA 2HWE1 2NM1A 4QT6A 4GULA 1VBE2 1MS5A 3EQEA 4Q4X2 4ZONA 2ZMNA 3SCHA 3WUCA 3RZGA 2A6XA 4YLZA 1A8DA 2ZGLA 1XJAA 3A21A 2VH9A 3BU7A 1SPPB 2VC9A 2WNEA 4W50A 3O7OA 5FYUA 3U11A 4I0WB 4NVPA 4P9WA 3VKFC 4YZ3A 1W0PA 5FZHA 1NOVA 5FY4A 3KWVA 1W8HA 1RUNA 4M3CF 2ARXA 1JUHA 1P8JA 1ZRRA 2H0VA 3N4MA 1WW5A 1POV0 4FOQA 3RG0A 3TRSB 3GCXA 3AKPA 1TQ5A 3RZJA 2XUEA 4QKBA 1GFF2 2D6OX 3CMGA 4OMCA 1CWPA 2ZGSA 5F39A 1IHMA 1EYBA 4AEDB 2A3YA 1BJQA 5FZKA 4OQ8A 2VMGA 4LLOA 4CU8A 4GA9A 2DFCA 3WY6A 3ZFEC 3JB8A 5LK7B 1YRZA 5FJKA 3OJBA 3LKJA 3AM2A 3BPZA 3S6PA 1OLQA 2O1QA 4Z2AA 4QQPA 1US3A 3BN6A 3ZXJA 4ES9A 4QXCA 4EE2A 5CISA 1N1TA 4NR1A 2JXAA 3D5OA 2A6ZA 4ZXEA 4D6QA 2VZSA 5IVYA 1ASJ2 4AWDA 4D3WA 1CVNA 1VBE1 4AR2A 2W39A 4UW5A 3IMNA 3NVCA 1WLWA 3DECA 1VBB2 3PIJA 2YYOA 4C0BA 4R9BA 1AXKA 3J8F1 4J25A 5C4WC 3AZZA 4D6SA 2F4PA 5T5LA 2WNUC 4CCEA 3WG2A 1LGBA 4QPIA 3T0BA 3MW3A 2QQOA 1AR93 4M3CA 1DZRA 1OLME 4I3GA 5BNNA 3JCIA 4QHZA 4JGYA 3JD71 1R1ZA 2VZUA 1W9WA 5DG1A 2WQ4A 5FPLA 2ZX4A 3LEGA 4UBGA 2DVDA 4D7YA 1I5ZA 2C5DA 2B39A 5F3EA 1FYUA 2RDQA 4ONUA 1WMEA 2JDNA 2VZ1A 4Y22B 5L9BA 2VNVA 4AFMA 4DB5A 2B4KA 4LE4A 1OT5A 4G4FA 4NAOA 3HT1A 1REEA 3ES4A 4Q27A 3THCA 4RSUA 1QJU3 4XIOA 2VZRA 3M3OA 2PYTA 3B69A 4E2GA 1FPN1 2JKBA 3UJQA 3BGAA 5LEJA 4OI4A 5DUUA 2VTXJ 3KHCA 1O8PA 2MEV1 3RYRA 1ZZ8A 3VHPA 3R4DB 3MF6A 2IXLA 5FY0A 5GZGA 3O1VA 5FMOL 4FTBA 3VN4A 4YPJA 1EV13 2IXHA 3IM0A 4GH4C 3L2HA 4QX8A 4X6QB 2H6CA 2RM21 1C1LA 4ORFA 4RS5C 1Q8QA 4PLOA 1WMXA 2QZ2A 2YDEA 4OUEA 5B4XA 3WDXA 3SC7X 1VBB1 1VBC2 1RUG2 1ZBE1 3S5AA 1D4M1 3PURA 4Z1VA 4TZDA 2VBDA 2WAAA 4XW3A 1RXGA 1UYXA 1W6QA 2HKXA 3O12A 4QQHA 2C26A 1NE6A 1A3KA 2Q1ZB 2GN7A 2ZGPA 3H3LA 4XHBA 3OUHA 3ETPA 3TEYA 1WWYA 2JG9C 5BNPB 5CFDC 2W3JA 4QB1A 3ZO0B 1K3IA 2DYCA 2E6VA 1G9AA 1N3PA 3TAYA 3RZHA 3PIGA 2VECA 1OUXA 5KHJA 1MZ6A 3AZVA 4LMFA 2R16A 3HNMA 4MOAA 2HWD2 5DUVA 5EZWA 4JV4A 2PHDA 2UWBA 1PZ7A 2W08A 2VQUA 4QDQA 2VL4A 5FK8A 4ZY9A 4YZ1A 2XVKA 4RGKA 3TN91 2VG9A 4N53C 2ZEZA 2KM2A 5M0TA 4CDQB 5JXJA 2CGNA 4YRDA 1FXZA 4K21A 2ZZQA 2OPKA 4CEWB 5A6YA 3B9CA 2GH8A 1UO9A 1R083 3I97A 4Z82A 3PUIA 3SNMA 3VB9A 1MPXA 2P4EA 4COUA 3POFA 1S0FA 3ZSMA 4YG6A 4LBLA 4QU1A 3M3IA 5DDJ2 1V0AA 4CXYA 2R041 2ZBJA 4H7MA 2WA4A 1H8TA 1COV2 1DQ0A 2ADDA 1H9PA 4Q4W2 1QJY3 5FY1A 2E31A 3V0AB 1D4VB 3CEWA 2D3PA 1BLZA 4W8JA 5LWBA 2RMU3 1QXRA 2AEZA 3P6BA 4FPGA 1GLHA 3WF1A 5LY1A 4H3WA 4JGZA 4QXHA 3IDCB 5A80A 4BPZA 3EJKA 5D1IA 2R062 3MLJA 3E97A 4E2SA 4ZKTB 1MQTC 1AYN3 1PVXA 1TEIA 4IEVA 4QDRA 2ZGKA 4DXRA 2VULA 3IBMA 5FZEA 3ZMOA 4QX5A 1N1SA 1PZ9A 2RJLA 3VBSA 4FSJA 3CIHA 1RUD1 4Q8KA 1DQ2A 2IVJA 1ZRDA 4Y33A 1SFNA 3THPA 3VBOC 4FFFA 1GSLA 2W52A 4ATEA 3HBKA 1AL22 4LOTA 3ILRA 4WVZA 2HWB3 4CDWA 1YFXA 3VD4A 2NZ9A 1H1AA 4YZ5A 1VBA3 1V70A 3MIHA 1TME2 1CGPA 3ZXLA 5GALA 1PIV1 2A1XA 5LEKA 1W2TA 2WO2A 4IEUA 5DAWA 3VHOA 3DYOA 1OI6A 3MW4A 5JCTA 2ARBA 2R32A 2Y6HA 5CFCC 1RITA 4JKKA 4AEJA 2JB4A 4UFKA 2OIIA 4OHVA 3U07A 4N9HA 4RR3C 5KWRA 3M7AA 1TMF3 1COV1 1VMHA 1RUOA 2ZAAA 5IAVA 4CZSA 3TNQA 1NQJA 1I3HA 3UESA 1C1FA 3K2OA 4NHXA 3B93A 3FZ3A 4AI0A 4QMAA 4E8DA 2AH2A 3FHIB 4IEOA 5L7OB 1OMIA 1OFSA 3LEKA 1RUI1 4XFGA 2RS13 3NNFA 3KCXA 3HPNA 3QH6A 2LW8A 3SCGA 3WNOA 4Y5TA 1QJFA 4ARYA 2H0BA 3LOIA 1W6NB 4IDZA 5H9PA 5C5UA 3NMBA 1CPNA 4K20A 4CPBD 4L8QA 3B94A 5LBBA 3OBTA 5GLZA 2AR6A 3VBHA 1QKQA 1ZYBA 2ZHNA 5FZOA 1HW5A 4AZZA 1PNGA 1VMJA 1PM7A 2OA2A 2ATFA 2P3IA 1EAH3 4NROA 3LA7A 2WS93 4IESA 4TTGA 4I2OA 3LD8A 1QXPA 1FMD3 4YW1A 1BBT1 2DWRA 2JG8A 4INDA 2HWF3 1UOJA 1EPWA 1KDKA 3FN9A 2YB7A 5A33B 1L7RA 4Q0SA 3W58A 3WCRA 4AG4A 1QJX2 3WNMA 4AAPA 5GLUA 1BVP1 1AX0A 2IWGB 1W8FA 2OKXA 1GQGA 2WN2A 4RD7A 3ZR6A 3CBNA 1NLQA 1F5FA 1KS5A 1N47A 1IS4A 3ZYBA 4IE0A 5GZDA 3N7JA 1Q43A 1WLDA 2XOMA 4OI1A 1KXGA 4CU6A 4FCAA 5SV5A 3R6SA 1S0JA 2CGOA 3QACA 5J09A 2HBUA 4H14A 2A7AA 4AVTA 4C91A 2O8QA 1RUC3 2V4AA 1O3QA 5DQ0A 1ND2A 1MS4A 2Y6KA 4WVMA 3JBG3 4BH9A 4YW6A 4Y5SA 2HEVF 4GD4A 3GZTB 4OHWA 4HSLA 1LENA 3GBGA 5JIUA 1YEWA 2R071 3IWZA 1YHFA 3HWJA 3LEMA 1ULDA 4GMP1 4MYEA 2W68A 2ZX1A 4PQ9A 3I2IA 4PIYA 1GWLA 3VZLA 4AI9A 5C4WB 1IPSA 1OUSA 1PO23 5LZ6A 1A34A 2VAUA 1RUE2 5FKCA 2WNUB 4LBQA 5FBZA 3S5QA 5KBFA 4UYBA 5BYNA 4CCKA 2PA7A 5IVFA 1B35A 4A3XA 2OQ6A 1POQA 4RHV3 4Q29A 5FK7A 3AYCA 3NV4A 1O4ZA 3A22A 2UY9A 4AFDA 2BDRA 2DTWA 2Q8DA 3JUUA 4HVQA 3MIEA 2BZDA 2PHTA 1R64A 4M0HA 1UF2C 2JD4A 4OHZA 3I2DA 1RUF2 1W03A 3EXUA 2WINB 3EYPA 1UU6A 4QXBA 3MI8A 3WQBA 3IIAA 4I3PA 5LA9A 2HWE3 5C33A 4C0HA 1UNBA 3D4KA 4LBKA 2QQVA 2GC1A 1VMFA 2VM9A 1WW6A 4AGVA 2R6QA 2VMDA 4GJZA 5JPMB 1OF4A 1GZWB 2A6WA 2XHKA 4HK8A 1FNZA 3N9PA 1JZ5A 2BGPA 2D6PA 3BCWA 3KCCA 4YARA 4AHWA 3AP9A 5A1LA 1S4CA 3W5NA 2JIGA 1J59A 5J1XA 4ES8A 2DVGA 2E51A 1C4RA 3D6EA 3C2UA 4LHLA 4A4AA 1BMV2 3TYJA 1Q3EA 4Y20B 1QOTA 4Q2FA 1UU4A 2QVSB 1W04A 3DYPA 1RMU3 2ETEA 5JZGB 4C1XA 2W2IA 3GF6A 1PX4A 2WZR2 2ZPXA 1UYZA 1F4HA 2WJSA 2X5IB 3NL1A 2XMLA 4HN1A 4GB31 3K46A 4J1WA 3RYPA 5KC5A 4XFIA 1Y4WA 1C57A 4DEVA 2DCJA 2G9GA 4MGYE 2VBBA 3MUY1 1OQDA 1S0GA 1CAXA 5LBEA 4DXTA 3LCPA 4CDXC 3AX4A 4DRVA 3OD4A 2IFWA 4XTPA 1VBE3 5SV8A 1ALYA 4N53B 3JU9A 5LBFA 3VL9A 5LA1A 3RNSA 5FJHA 1JOBA 3QH7A 4PF1A 1QNWA 3KV9A 5FY8A 5A7SA 1S0CA 3J8F3 3M1HA 4TSVA 1H2KA 1D2SA 5FV3A 2NQYA 3GHNA 4HFSA 3V0BA 2PAEA 1S2KA 2EIDA 2VMCA 1H4GA 1PGL1 1CR7A 4EZ4A 4E4SA 1XNDA 2PHXA 5K0UA 3JD73 1XE8A 4BYYA 1LRHA 2VOWA 3DGTA 3KQ4B 4AHZA 4AW7A 4GIQA 1GQHA 2R1BA 3N3HA 5I0UA 5HCAA 4LT5A 2BJSA 5A32A 4F83A 3J7MA 2JDMA 5HXMA 2JECA 5IT6A 3I2OA 2AREA 4CP1A 5A3TA 1QDOA 1W9SA 3S7EA 5JXHA 2BWAA 3U1XA 5ABJA 4DINB 3QD6A 4JAAA 2JDZA 2KA3A 1HDKA 3FBMA 2VXRA 1QEXA 1FPN3 2XKOA 3ZFFA 3RYKA 4WM8C 3W5MA 2VVFA 2BP6A 2BVVA 2MEV3 3RPQA 3GDBA 4E4ZA 5A7PA 1RINA 2DCTA 1RJ8A 4NN0A 3SHRA 1GANA 3N9NA 2B5HA 4QKDA 2IFRA 2GMPA 4A6OA 2JEMA 5DXDA 2WFF1 1HRV2 2JICA 2RM23 1ENSA 2W1SA 4Q0UA 4R9CA 4BOWA 2XBO2 4YGDA 5CB7A 1VBB3 4FOYA 1ZBE3 3PUQA 1AXYA 1D4M3 2RE9A 1RUJ1 3RWNA 5AFBA 1X9PA 3ZM8A 1VRH1 3UK9A 3MPPG 1I5PA 5JOXA 1UZYA 3GBFA 4KWLA 4DIQA 3DN7A 3QOPA 4OUSA 4KH9A 4NWWA 4BE3A 5FZ1A 1JU3A 4LNVA 2B42B 1SBFA 1W8OA 2NYYA 1WD3A 4RR3B 4GWNA 5IYYA 1UYYA 2BGOA 2Y6JA 3QLQA 4DY5A 3CO2A 4CP0A 4CCDA 3WP5A 2Y6FA 5FLIA 2NMNA 4UFJA 5FY7A 3TN93 2P34A 3GBWA 4XPVA 4AEDC 2XLFA 1V6JA 3BI3A 4UW6A 2DFBA 4XQWA 4AVSA 4FPEA 2Q30A 5F5QA 2FDIA 2BQPA 2GDFA 3OPTA 2P3YA 2Y0IA 1QY4A 4L92A 4Q4Y2 5FBJA 1PZ8A 3CU7A 3NV1A 2VNOA 1HRV1 2WR9A 2R043 3OOXA 1GMMA 5FZ7A 4BXSV 4PIZA 3OPZA 4R4XA 4MGQA 3WQ1A 1QXJA 1GP4A 5F1RA 3EMRA 2XJUA 3U0ZA 3NJYA 4YYOA 3ROUA 3U10A 4A7ZA 5A7WA 4BU2A 3ILFA 1W2NA 3WW4A 3A4UA 4AHYA 4ZHNA 4PLMA 5A3WA 2BV4A 3IB3A 1DYKA 4RGGA 1Q8PA 1NLSA 3LE0A 2P6HA 1NCRC 1PX3A 4UF0A 2YBKA 2ZS6B 1ULGA 2JG8C 4FQ4A 4S2FA 1YC61 4QPGA 4A7YA 1WCSA 3O1UA 1YXWA 2GSYA 3LDRA 3KV4A 3HQRA 4MO3M 1OOPA 1LEMA 3NW4A 2QQMA 1X36A 1LOAA 3I8TA 4DEQA 1ZA4A 3HNYM 2ZOEB 1Q5OA 1J3RA 5I0DA 1QNYA 3BB6A 3POJA 1W3VA 1Y43B 2RMU1 2YHJA 5ACA1 2ZGTA 4FTSA 1GNYA 1PIV3 1H1IA 2VMEA 4LBOA 1RHI2 5L73A 3VL8A 1JYWA 1UKRA 2C6SA 4AHXA 1ND2C 3T2PA 3NAPA 1I6XA 4YSFA 4RQPA 4CCOA 2QDRA 4K8RB 2MNGA 3PHMA 1COV3 5JLVA 2P17A 2WNVA 4NAMA 1W9TA 4GXLA 4K3UA 3VKOA 3ZX7A 3CLPA 2EXHA 5D2AA 5JSOA 1UOBA 5E16A 2VQTA 4QPIB 1CIWA 1RUI3 4M3CB 4L99A 5BNNB 1OD5A 2WWUA 2CGPA 3E5UA 1D0HA 4JGYB 4UFIA 1HRI2 4M01A 4ZXKA 2VU9A 4E4HA 5BNPC 2VCBA 2IXKA 5JXIA 4Q4V1 3TWIA 3BALA 1PO12 4XQDA 1QHDA 3M2MA 1C8M2 5JR2A 4FT8A 1LOFA 2DBNA 4CDUA 3H3ZA 3B01A 1YWKA 1ZZBA 2RS51 1QDCA 3AMPA 5CEHA 1W9FA 3F2ZA 2HH9A 4DRRA 3NV3A 1D2QA 4TWTA 5FOJB 1SQ4A 1OA4A 2B9VA 3AKTA 3C3VA 1X7NA 4O9EA 1BBT3 2XJRA 2QFEA 5I93A 1AYM2 4WZCA 4A7KA 2CSGA 3O1RA 4JRAA 4XHXA 4CDQC 5FYMA 2X05A 4CEWC 4IEXA 1L7QA 4YM1A 5FPBA 3MFCA 5IVBA 5APAA 5AVPA 1ULOA 3UV9A 3E5XA 4MGZE 3UGGA 3IT8A 3NSTA 3T4HB 2WIIB 4K40A 2E33A 1PGSA 2EALA 4UFMA 2XG3A 4QQOA 1AR61 4HK9A 3THTA 4YM3A 1J58A 5AVAA 3WF3A 1JHNA 3O1OA 2EICA 1DQ1A 3ZFGA 3D82A 4XC9A 5E6HA 3AMNA 4UI9L 4FPYA 1IGOA 1Z78A 4Q26A 1XC6A 4WM7A 1NAEA 2WL1A 5FLJA 4CDXB 3I2KA 4X8NA 3AP5A 2QBXA 1PO11 3SITA 2Z4FA 5HCFA 1AX2A 1C8M1 2R073 1PMHX 3FLTA 3PUAA 4GMP3 2K2SA 2ZEYA 4Y3OA 3OUJA 3RDIA 5HPOA 5KC6A 3H1YA 2QQPA 1DFQA 2JE7A 1JZ3A 2GN3A 3OB8A 2AUYA 1C5HA 3KHBA 1CN1A 2QQJA 4N9IA 4XMAA 2D98A 3SH4A 2E7AA 3PTRB 4AEMA 2BEOA 3RSJA 4HPKA 1NUKA 2VE1A 3HEIA 1CAUA 3O1TA 4NIAA 1IPJA 3LPFA 5C70A 2ZMLA 1UOFA 4UFHA 2EXKA 4MXVA 4YM2A 3WV6A 1PMJX 2VUCA 2ZA9A 1KQRA 1OPOA 4OQ9A 3N9OA 2Z5WA 4CU9A 5A7QA 3CHXA 1H8TB 3KVAA 4XF4A 1L3JA 2RR11 1Y9QA 1RVF1 3S0MA 1O6UA 5FZ4A 2HWC2 4CA9A 2FQPA 1TZOA 3J7NA 2ZKNA 3WNKA 3OGJA 1S0BA 3POBA 2P2KA 3I2FA 4YGCA 4ZZ5A 4YG3A 5FPAA 4NOTA 3LQCA 3WDVA 2F17A 4JGZB 3DPRA 3K3OA 1XSQA 2A6VA 2DF7A 1UAIA 1X82A 4DUXA 3OG2A 4JKMA 4R8HA 5EIYB 2Y26A 5L7OC 3GCWA 3ZXKA 5F2SA 4IGQA 1GICA 1HB3A 4XETA 3VBSB 2K46A 5L36A 2FDFA 4CUAA 5EJ3A 3JXSA 4OULA 4MADA 1GNHA 2H6BA 4CPBA 2EAKA 3KVBA 4CUGA 4ARXA 2FDGA 1VB2A 5C9AA 2IVIB 1A8MA 3B3QE 3CJIA 4CDWB 1SBDA 1HKDA 3W59A 4YFZA 4XFAA 5FP4A 3LWCA 3PVOA 4O65A 1QF3A 2Q1MA 1ZM1A 2W95A 3P3NA 1ODNA 2OS2A 4GB33 1Z0HA 2YU1A 1S0EA 4IE4A 3RZZA 4IETA 4YW5A 2ZGMA 3I3DA 1YI7A 1RUF3 4HZFA 5B2GB 4BK4A 1ZNPA 4AVVA 3E5QA 4CRQA 3T1MA 4PIXA 1ZBA1 1K12A 1AVBA 5ERLA 1RMU1 4EWEA 5IHRA 1WGPA 1SBEA 3K51A 4CYDA 4IL7A 4WVWA 1C8NA 4GAZA 3FC0A 3SEEA 2ERFA 4IEZA 3WHUA 5JI9A 2VQAA 3MEPA 3ENRA 2GNBA 4WV8A 4QD2A 3ZKYA 2WA3A 1FI2A 3FFQA 3RRDA 4DUVA 1QQP2 4JQRA 4LK7A 3DEMA 3J7LA 3N7KA 5EV7A 1A78A 2N7GA 4XBNA 1U0AA 2C0ZA 5C5TA 3VBHB 1ZZ6A 5FZOB 2YGLA 3HMYA 4Q4X1 4YGEA 1OF3A 1SLBA 2VOVA 4JCKA 2ZGUA 3RZLA 1AXZA 1W0OA 4HANA 1S2BA 2PHLA 1UL9A 1IQDC 1NCRB 4A2UA 4UT5A 2JKXA 2JG8B 1STMA 3ZXGA 4J1XA 4XAAA 2Y8KA 1BEV2 1UZZA 4NUBA 4K1ZA 3M4FA 3Q8FA 2VJXA 3FBYA 2VXJA 5FZDA 1DBNA 3FLPA 4L97A 4BQ3A 2R1DA 1WLTA 2WFF3 2GAUA 2VMHA 1U12A 3V56A 1O7FA 3WW2A 4EJRA 1W6PB 3OBRA 4EYUA 2L9LA 3AZYA 4V2WA 1FOD2 1WW7A 4YVSA 5C3SA 2PAKA 4AXOA 1RUJ3 1WKYA 5FZGA 3GGLA 3NWKA 4PDWA 1VRH3 2QNKA 3POWA 5BNOA 1YQ6A 2HYXA 3AL5A 2ZEXA 4DY3A 3IMMA 3T1LA 1ENQA 1ND2B 3KT7A 4WBBA 1U5ZA 4WVMB 1YUDA 2XQRA 4AQ6A 1XRUA 2RJKA 1KEXA 2BU9A 2XJSA 4LO6B 3SQOA 5FZCA 2VVEA 4D94A 2OPWA 3LF7A 4PLNA 4ZZ8A 4ASKA 1ASJ1 1R1A2 4LOSA 5I0RA 4NIIA 3HD8B 5IAXA 1LULA 3AVSA 4DOUA 3U14A 1CX1A 5FZMA 4EN8B 3ZKUA 3X29B 5KHKA 1NA1A 3O0WA 3FHAA 4QQ2A 4YW2A 5FP3A 1B35B 1LU1A 3IN9A 4B8EA 5JZGC 2E63A 2FMDA 2ZACA 1AJOA 1V9U2 2VW1A 1SG3A 1YQ5A 2BNOA 2D5FA 4NPLA 4XIKA 3MGUA 1HB2A 4UW3A 2EAAA 1RTVA 2X5IC 3E6DA 2JDHA 4KGGA 4IUGA 2ARAA 1HQWA 3I3BA 1HRV3 4Y4YA 4KNCA 1SLCA 1TNRA 4IGOA 1XNKA 4XQ4A 4ZS3A 3VKMA 4IXLA 1WCQA 4GMP0 3M70A 2G1MA 2Y64A 4P00B 2UU8A 3PMEA 2D6NA 3A0KA 1SCSA 4XAEA 2LUWA 3KD4A 1O4YA 2RVAA 4W4ZA 4BB3A 1KITA 4MXWA 5AFEA 5JR7B 3ZXFA 4E2QA 3ZPYA 1XE0A 4CP9A 1UXZA 3K48A 2VZTA 3GM8A 2JE9A 1UZ0A 2OQ7A 4KWJA 3VD7A 1XNTA 4CSWA 1JZ2A 1IZ3A 2F6BA 2ORZA 3HVDA 3N35A 4NMIA 2WAOA 4URTA 3MDPA 4R4ZA 3SCFA 1QMJA 1VBC1 1RUG1 2Y60A 4UFLA 3N9QA 2GALA 1ENXA 1O59A 3KGZA 5HV4A 1W39A 4L11A 3WG1A 3AMQA 5FREA 5CBLA 1JYVA 5K8SA 3ZVXA 5ACA3 2PELA 5D8AA 4IQPA 2E32A 3I2GA 1DYPA 4XABA 2FDKA 4FAHA 4NHKA 5JUVA 1WA6X 2QCSB 2EF6A 3B7MA 4LBJA 4PBOA 1E5SA 2BERA 5LA2A 3FFZA 3NQHA 2Z79A 1TE1B 1LOCA 2HWD1 4FFIA 1W99A 3LDKA 2O8OA 4DO0A 1NCQA 4MVTA 4YZ2A 5GZCA 4PI0A 3T4VA 2XVGA 2YC2A 4KQ7A 4BQ2A 1UXXX 4QPYA 3JQXA 3IZOA 3ZYPA 3AC0A 5H9SA 4HT1T 4LXLA 5E1RA 4QX2A 2D97A 3AZWA 4XJAA 1CONA 1YIFA 3V0BB 4Z2WA 4COZA 3O14A 1KJRA 2JX9A 4OZXA 1HJFA 2D6LX 5F32A 4A41A 2XWBB 1OH4A 4NPRA 5K0UB 1YLLA 4Y26A 5DZFA 2J7MA 4P02B 3POSA 2SBAA 3N7MA 2ZX3A 4M4RA 1OA3A 1UZVA 1Y7BA 5DDJ1 1LHUA 3VDDA 5G04L 4Q4V3 2VTXA 2QDNA 1T2XA 5A32B 1W2AX 4FPJA 4FAGA 1SLLA 4K9SA 4BQWA 2OT7A 2PLV2 4G9SB 2RS53 4Q4W1 1TG7A 3VDAA 1EP0A 5FYIA 5ABJB 1OKOA 3C7EA 4JDMA 3ZFFB 5A6ZA 2BNNA 1DP0A 1WMFA 1VB4A 2J1VA 3B00A 2ENRA 2R061 5H9RA 4Q0PA 3Q8BA 2BBAA 3K3NA 4YW7A 4NHLA 2FCTA 2R30A 2PHFA 1W8WA 4HKWA 1YJLA 4NIHA 4LO7A 1HB1A 2D6MA 3LGRA 2G4IA 1HXS2 4CCLA 4RFRB 4N43A 2VZ3A 3BYWA 1AL21 4LKFA 5J37A 2OW4A 1IS3A 1AR63 1PVC2 5JVVA 4AL9A 1TME1 3WP3A 3UGFA 1BQPA 1LCLA 2W46A 1ZZ7A 2GP3A 2E9QA 3JQWA 4RN5A 2WYFA 2XR4A 4YNIA 4IE5A 1HN1A 1CAVB 5F3CA 3ZOIA 4MUVA 3AKQA 1PO13 3GHMA 3QBQA 5I0TA 2UWCA 2J1SA 1C8M3 5BUVA 4OHXA 2PLV1 3ZYFA 1F15A 2JB8A 2A70A 1CJPA 5FP9A 5FKBA 2PQSA 2TNFA 5C3QA 1CX4A 1H2NA 3AL6A 3H8RA 3ECQA 3KT4A 1ZA7A 2UURA 5EYXA 3FJSA 3KZ4C 4CVUA 1JOJA 3MV11 3Q8EA 4LULA 1EUTA 4W65A 1FNYA 1OURA 1N1VA 5GJ6A 5L9VA 1OFNA 5KR7A 4AI1A 5LRRA 3EO6A 1XBFA 2X09A 4JDOA 3VZJA 1G9DA 2OXBA 2RR13 1RVF3 4KL1A 4F8AA 4KWUA 2Y34A 5FZ3A 5A7WB 4LHNA 4B29A 1WZXA 3HN1A 1PVC1 3LIHA 4IW3A 1IS6A 2BOJA 5T5JA 3WQ0A 2CAVA 1I9RA 3ATGA 4CUCA 4UF0B 4FP2A 5FO7B 5KHIA 2XJTA 3UYJA 1XU2A 1SLIA 1VAKA 3VD5A 4QPIC 1HQLA 5BV6A 4D0QA 1QJX1 3LA3A 3MFAA 5FPVA 5F6LB 3T0AA 5BNNC 5GZFA 2YY1A 4JGYC 5KHGA 3VZKA 1UPSA 1OOPB 3WF0A 1RGSA 3J4UH 2BWCA 4Z8BA 2FMYA 3SKJE 5LY2A 1O3TA 4CCCA 3VD3A 5LCWL 3VHNA 2ILMA 3EHKA 3VBRA 5EXOA 4YVWA 4I0BA 1SDDB 1JH5A 1O4TA 5DAXA 2GMMA 4QB2A 2RJ2A 4IV3A 1PGW2 3ME2A 1DQ4A 1APNA 2CAUA 2LM3A 4QGLA 3SISA 3WDTA 4IV1A 4FI9A 4OI2A 3NAPB 1Y3TA 3INAA 1CJDA 1X8EA 5EWSA 5FZ8A 4RQPB 3U4SA 1AL0G 5E89A 5K4LA 3NNLA 3GJBA 1WUVA 1YQCA 1ZBA3 5FCCA 1QU0A 1DZTA 3UKNA 2WNVB 1US2A 4IGPA 1DIWA 4A6SA 1RUE1 2YG0A 1JBCA 2WUHA 4META 4FFHA 3GZUC 4RYDA 4PHZA 2PHUA 4UW4A 3HNBM 1LU2A 4FXGB 3KM5A 3MF9A 1VALA 2WWSA 2X8KA 3VBUA 3ZSKA 2WZPP 1RUF1 4CUBA 4BZ4A 2ZGQA 3BOPA 3M8LA 4UBHA 2AGSA 2ZABA 3H7YA 5DABA 3THDA 1NYWA 4Z92B 3LPGA 3R0RA 3DCQA 4Q4X3 4QM8A 4XXAA 3I49A 5ISLA 3OD0A 5IFTA 1Q56A 3DUIA 4L9BA 5FUPA 1JMUB 3OGRA 4Z07A 5FMDA 1MS8A 2RG4A 1CZTA 4YG0A 1GOFA 1NG0A 5GM0A 4EV0A 4BQYA 1IKPA 1HV1A 3TEZA 2C9AA 4YFWA 1NKGA 3FUOA 4AE2A 1AR92 1R092 1NE4A 3POGA 4ISQA 4E8CA 5F7UA 3L2YA 2BVBA 2WC2A 3C7HA 4K8FA 3TEWA 1NXD1 3H3UA 2A73B 3HR9A 1BMV1 3RMYA 5FIXA 3F95A 4BQXA 5FZ0A 3H7JA 3UGHA 4CEYA 1PK6A 1H8TC 1DYOA 3ZXEA 5ANQA 1ZRIA 2WZR1 2PN5A 5F2WA 3ZDSA 3ZFGB 5FQ0A 2BNMA 1QJU2 1XNAA 2P1BA 2X53S 5T5PA 4JHTA 4WM7B 4M3CE 2DVFA 2W47A 4JGZC 1GP5A 4XMIA 1OLMA 1UZWA 3TOJA 3WNXA 5A3UA 3LOBA 2NLRA 4JDNA 1V6OA 1YCIA 1JZ6A 3VDBA 1EV12 1ASJ3 4LA3A 4LBNA 4Y1ZA 3AP4A 4KG8A 4LKEA 5E88A 5CZKA 3MPBA 2ZXQA 2VZQA 3VBSC 4CXXA 1H1MA 3OEBA 4IERA 3GNEA 1C5IA 1XYPA 2QTWB 2HYKA 1O8SA 2Z2SB 3N7LA 4M0NA 1AF9A 3HAGA 4HPKB 4NHYA 1MEC2 1CAUB 4CDWC 5CAZA 5BY5A 2AENA 1DZQA 3DYMA 4P9IA 5G05L 1R091 3LFMA 4XF1A 1QOOA 4AOCA 2BPA2 1ND3A 4OLLA 3VDCA 3GZAA 4LO5B 3UKTA 1W0NA 4ZU5A 2MPFA 3SEPA 3TB0A 1AUYA 2I74A 5GLVA 5JSPA 1XNCA 2ET1A 4XUQA 2CWSA 4OVEA 1OHFA 2FD8A 5FOBB 2X10A 5JAXA 1XYNA 4XUNA 3DPRB 4EZHA 3WCSA 2K0GA 2J22A 1JXNA 5DUXA 4JTOA 4LEJA 2VNRA 1J3QA 2BOIA 4XE9A 4Y1YA 4D6RA 1ZRFA 1R082 1WBFA 3WXPA 1W6OA 2DCKA 3BODA 1RB8G 1GZCA 4AEKA 1OVPA 2D43A 3WDWA 1F5JA 1WMDA 2XBO1 4NHMA 1DGRA 1W8UA 1XB9A 5BXXA 1VBC3 1RUG3 1YQ8A 2RV9A 3NJZA 3CJIB 3SMHA 4CE8A 2GH2A 3ZFEA 2WBKA 1YIPA 1UCXA 3PDQA 3VBHC 1MVEA 5KXBA 1QJY2 2VO5A 2A5ZA 3OBZA 1CZSA 2DTYA 4BQ4A 1KDMA 1XQNA 2DBIA 3RMXA 1Z7S2 4V1PA 1HV0A 2JIJA 4DFSA 1AYN2 2WN3A 3PUHA 1AHSA 4LKSA 1IG0A 2HWD3 3PTYA 3M3CA 3ACHA 4QX1A 4J6GA 2HLEA 4BMEA 4P14A 1DF0A 4LHSA 3AMHA 5JOZA 2KD7A 2PAMA 1VBD2 1OH3A 5DG2A 4LK6A 1MS9A 4C8DA 3IAQA 1XOYA 2YFUA 4KU8A 4NPMA 4S2HA 5I0SA 3NJVA 4K7JA 3I2HA 1AX1A 3MLKA 1VBA2 1NQDA
chains in the Genus database with same CATH topology
1IQAA 5C8WA 4B4QA 2EIGA 4Q4Y1 1DGWA 2VW2A 3I4IA 4KBBA 5DDJ3 5JIAA 1FV2A 3NV2A 1IS5A 5AC92 2Q4SA 4BHPA 1K5MA 2E7QA 1TMF2 5CVRA 2ET7A 5IK5A 4Q4W3 1MS1A 2PHWA 1V6IA 1QWRA 5HI0A 4R9AA 4AI8A 3WP4A 1LHWA 1Z7S1 3BTAA 1B35C 2R063 3AZXA 3WP6A 4XFFA 2RS12 4GH4A 3D0SA 4AI3A 2HJIA 3CL1A 1G7YA 4RS5A 4GALA 4F7ZA 2A6YA 3OYWA 4ATFA 4N7UA 1HX6A 4XILA 3WDUA 3ZSEA 1J1LA 4YVSB 4COWA 3USUA 2GC3A 1VBD1 2YV8A 1OLRA 2QJVA 2HEWF 1AL23 1SLTA 4GKXA 4PDWB 4TLFA 4RGAA 5BNOB 2XWJB 2NPIA 1AR82 1EAH2 4GKYA 1TME3 2JG9A 2WS92 2R0FA 5CFDA 3VLBB 1FMD2 1VLNA 2B7YA 5IK4A 1X33A 1RHI1 1H8VA 4KU7A 1EPZA 4HVOA 2C1FA 4XF3A 2BUKA 2RHPA 2VOKA 5AC91 3DKWA 2WQZC 2PLV3 1BCXA 4FPHA 1YYNA 3WW3A 1A6CA 4PF5A 4AVBA 5A3MA 1GBGA 1KFXL 1W6QB 3W9AA 3ZIXA 5JI7A 4XXPA 1NY72 4YGBA 1OKQA 2E7TA 4XDQA 2D40A 3KCYA 1RUC2 1HRI1 4B4PA 1GKBA 4D7SA 1OQEA 3JBG2 4KG0A 1PMIA 4FPLA 4YW4A 3PVBB 1KRIA 2GNDA 3WHTA 1F2NA 1AR81 1OA2A 5LK5A 1PVC3 4PCRA 1U5XA 2QUOA 1AYM1 1MQTA 1S55A 4LO4B 5C8CA 2YC0A 2YMZA 1QJX3 2BYVE 1HIXA 3AP7A 1JYCA 5K0UC 1QGLA 1ULCA 3VBOA 5J48A 1W6MA 2HWE2 3OY8A 4HKLA 3VUOA 3ZN6A 2PFWA 3O0XA 4D69A 3ZXAC 5D8AB 2Y38A 4BM8A 5ABJC 4O9GA 3AYEA 3ZFFC 1LECA 1V6NA 2XL7A 5CFCA 2BGCA 1ENRA 3LA2A 4C1WA 3D0JA 4XF0A 1NCQB 2ZKLA 2CY6A 5HCBA 1OSGA 3IPVA 4N90A 3H1MA 1ULFA 1RUE3 2PHRA 2ZMKA 4E4DX 3AMMA 1MS3A 1AR72 3ELNA 1LGCA 1Q8SA 5T55A 3WOGA 1BK1A 1LR5A 4B4RA 1CAWA 1V6MA 5GZEA 2XB6C 3J9SA 2W0XA 4DNYA 4DMIA 2SLIA 2WT0A 4BWOA 3B9IA 2LALA 2HWC1 3D8CA 4P9YA 5T54A 5LRSA 4MZUA 2WKKA 2FBEA 3WX5A 3V64A 1LHOA 4P9JA 4HMZA 3VZMA 1YI9A 5I8SA 4EN9B 3J8F2 4IEYA 1LESA 2EXIA 3E6BA 3TBDA 2DVAA 2UWAA 3UJOA 5T5OA 3WLUA 5C6CA 2B46X 3J26N 3MZHA 2GZWA 3JD72 2VNGA 5EYYA 2R0HA 2ZJCA 4N43B 4CP2A 2WFPA 3I59A 3FMGA 3MLLA 4BLIA 1SMVA 1AR71 2WZR3 1OQ1A 5FO8B 3NKGA 4EROA 4UXAA 3WW1A 2PQQA 5J3UA 2CV6A 4B7KA 1FPN2 3AJZA 1C28A 3AB0A 2MEV2 5IK7A 1RL3A 4DPNA 2YGMA 2CTVA 1C3HA 1RUH2 4Q0VA 4ZU7A 4QPGC 2ZGRA 2VGDA 1JN2P 2WLPA 2NP0A 4BIOA 2RM22 1O5LA 3ETQA 4AVCA 3EBRA 2Q8OA 1OOPC 1ZBE2 4K1YA 4QHBA 1J1TA 1D4M2 4XJ8A 5I8YA 4FVVA 1LHVA 1VR3A 3KT1A 3H1WA 4ITCA 4GWMA 3LAGA 4W6YA 2GC2A 1QQP1 1MACA 1URXA 1R093 3PJQA 2KXLA 4ISRA 3VBFA 4FQZA 3NAPC 2VVDA 3WDYA 1U5YA 5FPXA 4RQPC 5H9QA 5E8AA 2D44A 4XYXA 5T50A 4LBQB 1DQ5A 2MHFA 1K5MC 4AI2A 4FPFA 2D3SA 2WNVC 4YM0A 1REFA 3KGLA 3TN92 1S1AA 5K9YA 1UKGA 2RS32 4YZ4A 1LEDA 1BEV1 4AGRA 2EXJA 1RIRA 2ZHLA 4QXKA 4I01A 1RUH1 1WW4A 2XGXA 3FWEA 1V00A 2D6KA 2XBO3 1ONAA 4LUMA 1FOD1 2R042 5IUQA 3ZN4A 1OPMA 4LR4A 5J98B 4F3JA 3VBRB 2YUEA 4NWVA 4CDUC 1LOFC 4X6RB 5KXDA 4YVWB 2P3JA 1UIJA 4WZFA 1MEC3 5I91A 3RI8A 4HVRA 3T2TA 4IV3B 4S2GA 1G9BA 2UYAA 2XUMA 1SEFA 4IV1B 2OZJA 4SBVA 3PMSA 2XJPA 4M00A 3E6CC 3AXDA 1XU1A 4G3YC 1GNZA 4CDXA 1GV9A 1R1A1 1QH6A 1DQ6A 1AZDA 3ALQA 3WZ1A 1H4HA 1RUD2 3MIFA 1VP6A 3AYDA 1DLLA 1JTZX 1DGRN 2WT1A 4HLTA 1V9U1 2GU9A 5FTTC 2RS31 2CYFA 2GNTA 1YNAA 3VBUB 4EWDA 1PIV2 3PVEA 5EFUA 3ZFGC 4Q4Y3 2VY0A 2NN8A 1CAXB 4H55A 4WM7C 3H0OA 4JRLA 1NLRA 4AFAA 4XJWA 4JC1A 2TEPA 2YZ4A 1WD4A 5JMCA 1G6NA 2O0OA 4MX3A 1MVQA 4WM8A 4CTEA 1Q8VA 1Z7S3 4I02A 1B09A 1BKZA 1RUI2 4XJ9A 1H9WA 3RQ0A 4ASMB 5JWPA 4XEZA 3NKTA 5C8CC 5KXEA 3SXWA 4KGQA 1POV1 1QJZA 4LTAA 4DZGA 4FOVA 4CEYB 1PK6B 4XFHA 2DUQA 2Y0OA 2XKPA 1VBD3 1LOEA 3ZXDA 2ZCWA 1M06G 2IXIA 5FQ0B 3WG3A 2I07B 4U2AA 2DV9A 2OZ6A 5CIRA 1TNFA 2VMIA 4ZU4A 4QM9A 1F9KA 1BBT2 1RHI3 1DHKB 3DPRC 1E57A 3LSEA 1KS4A 2P37A 3VKNA 3QCWA 5F9TA 1JYIA 3ZYJB 3WVJA 4AVAA 1SACA 5AC93 3AFKA 4OFGA 4JVAA 2IZWA 1PHMA 5C9AC 4C90A 4XOGA 4AEDA 5DZEA 2OVUA 3CJIC 1PNFA 1RJ7A 2Q0AA 3L9JT 5DZGA 3MICA 3IDEA 5IK8A 4W6WA 1ZRCA 1ND3B 1UIKA 1HRI3 1N3QA 2WT2A 1FAYA 3BIWE 4RA0A 4XJZA 3UL2A 5CG8A 4Y5Z0 3VGIA 3HQXA 1LOGA 4E9KA 3LB9A 3CF6E 2R49A 3AYAA 2R072 2Z69A 4EN6B 1UU5A 3VKLA 1CPMA 4XJUA 5JOYA 3HT2A 2YPJA 1AR83 4P9GA 1H2MA 4I0AA 4BMBA 4RFT0 1ZVFA 2WLQA 2V5YA 1AYM3 5BPXA 1NCRA 1GZ9A 2OYZA 2CWMA 1W6OB 1KFUL 1O5UA 1REDA 3FE5A 4R9DA 2BFUS 1LGNA 1HXS1 1H0BA 2A71A 1QOSA 1W6PA 3ZFEB 1IPKA 2AYHA 1UX6A 4R52A 4Y22A 2WSUA 2ZAHA 4HETA 5FLHA 2ZX2A 2FHRA 1LKNA 3WUDA 3VZNA 5KXCA 4Q1RA 4QPGB 2V73A 2Q5TA 1WCDJ 1SLAA 4QGNA 2UYBA 2VOXA 3JZVA 4FBFA 4XTMA 3OTFA 4IEPA 3FX3A 3S30A 2B8MA 2TBVA 3GALA 3KQRA 4YVSC 4PDWC 3O0VA 4QQLA 5BNOC 2XJQA 4QGMA 2BW8A 3WR0A 3RS6A 3FUQA 1HQNA 4GB32 1X50A 3RI9A 1M4WA 2ZTNA 2IXCA 5BNPA 2UY8A 2E53A 3ZYIB 2XVLA 3H9AA 3KB5A 1G86A 2ZHKA 1K5MB 2VUAA 1O3SA 4XFBA 5KHHA 3VBFC 1LB2A 2HWC3 2VQ0A 4FPCA 2P3KA 2A3XA 1NA1C 1NXMA 3SH3A 2G9FA 2QZ3A 3IKWA 1WBLA 3WQ7A 4CDQA 4B7EA 4GH4B 2EVXA 3G7DA 4CEWA 4AFBA 1PGL2 4RS5B 4AFCA 1IOAA 3OYWB 1VAVA 4PJYA 4MV2A 2X29A 3MYXA 3OCPA 3USUB 3B5LB 4CDUB 1KD7A 1VAMA 3ZIWA 1CESA 4LBMA 3SLIA 3R05A 1AR73 5GLTA 3ZYGA 4EN0A 3CNAA 2JG9B 4DQAA 5CFDB 2CGPA 1LOBA 3APBA 4QU2A 3V0AA 4PBPA 3MW2A 3Q9OA 1PGW1 5JPNB 4FPKA 4AGGA 4RL7A 2D3RA 3M3QA 4XBLA 4HN0A 5K7PA 1FT9A 2TUNA 2ZZJA 5HXVA 3DL3A 5CA6A 3R4UA 2WFF2 3AJYA 1NZCA 3NO8A 4X8PA 3LSDA 1UD1A 1W2UA 2Z42A 1EY2A 4MSVA 1RUJ2 3ZMNA 1UN1A 1VRH2 4XF9A 2XPJA 2WSVA 2A75A 1QQP3 2DUPA 5D8AC 3AFGA 2VPVA 2DUOA 2ZGOA 5DUWA 1CD3G 2XH6A 3WINE 1G8WA 1XXNA 3LZZA 2OUHA 3RJRA 1NCQC 4DXZA 4MLOA 3ILNA 1BZWA 1G9CA 4P5HA 1SDWA 1MQTB 2K9ZA 4Y24A 5C8CB 1S0IA 1O91A 3HIFA 5L7OA 1BEV3 3HBZA 5GLWA 1AR91 1MS0A 2CNAA 3KMHA 1YFUA 1ULEA 1RUH3 4LA2A 2IC1A 1SCRA 2DU0A 3VBOB 4OUMA 1W6MB 1W6NA 3OY8B 3VDDC 1FOD3 4ASLA 3AKRA 3ZN6B 3H8UA 1D0GA 3G6JB 4BIFA 5FO9B 1WA4A 2B9UA 5FPZA 2PTMA 5FRAA 1QJU1 1DU3D 4HL0A 1LJ7A 4LUKA 5CFCB 4FOWA 4LHKA 5I8TA 4AYUA 1EV11 2DCYA 5A33A 1R1A3 1CAVA 1MZ5A 5FFOC 5C9AB 3IPVB 4B3NA 3KLSA 2I45A 5TSWA 1KJLA 3B02A 4LO8A 4N43C 4P9LA 5CADA 3U4XA 3R4SA 1MEC1 3UKVA 1UMZA 1V9U3 2ZGNA 1CAWB 2RS33 2V09A 3WG4A 3DF0A 2RMU2 5J7MA 5ACA2 1DDLA 1WLCA 2ZX0A 5J96B 2BBVA 1BXHA 1Q8OA 1LODA 1YO8A 1YFYA 3KSCA 4I09A 3VHRA 1ZZCA 2VW0A 4D7TA 4EN7B 3M3EA 5C4WA 3CJXA 5FMOS 2HWB2 2WNUA 1LTEA 4Q8LA 4AQTA 4KWKA 3ZYRA 1R081 4Y1UA 2ES3A 1POV3 3I59B 1ZX5A 4COYA 4Q4V2 3ZSLA 4AQ2A 1RUD3 3MIDA 3PJYA 1FV3A 4N7IA 2DCZA 2GC0A 2B45X 1G9FA 2EA7A 4AQSA 5GKAC 4GQ7A 1HLCA 2RS52 3ST7A 1QJY1 2GNMA 5JDBA 2A3WA 1FX5A 1GZWA 3P3PA 3SH5A 1ZZ9A 1F31A 2AZ5A 1U5IA 3I54A 1AYN1 3TNPB 1I1EA 1JUIA 4XZPA 2D5HA 5J36A 2CL2A 1CQ9A 2QKDA 4COVA 5BNQA 1MZEA 2YROA 4Y20A 5JOWA 4HKOA 5JZGA 2BFUL 4LBQD 2OUJA 2HWB1 3AP6A 3FLRA 1LHNA 1AR62 4MH0E 3VBRC 1J3PA 1H2LA 1VBA1 3AK0A 2I2SA 4YVWC 2JENA 1JW6A 2HEYF 1IKQA 4XBQA 4FTEA 2X5IA 4IV3C 3S7IA 2HWF2 4W6XA 1GR3A 4IV1C 4OI0A 3VBFB 1ZREA 3PNAA 4TYSA 2DU1A 5CNAA 2XLGA 5T3NA 3JB4C 4HSJA 1NA1B 1SFYA 1TMF1 4WVVA 4XFCA 1GYKA 2D7FA 1F8VA 2DVBA 1VIWB 4N53A 1YJKA 4Y1XA 2IXJA 4K6BA 2RS11 2YXSA 3MIGA 5CG9A 2DURA 3I7DA 4H7LA 4L2NA 3URFA 3VBUC 4LE3A 1MZFA 3POYA 3ACLA 4SLIA 4U36A 4LLFA 2FZ1A 1HXS3 1WCKA 1XNBA 1YFWA 2RR12 5F6KA 1RVF2 1X8MA 2GMEA 4MXWB 5A3LA 1BYHA 3WD5A 4P9XA 1BVVA 1PO22 1EAH1 1UPIA 3OF1A 3AXEA 1VJ2A 2WS91 4EWAA 1FMD1 2BTVC 4RHV2 4BQ1A 4BLJA 2VUJA 3O5SA 5FAXA 3GYDA 2HWF1 1O3RA 4I30A 4BCUA 4AK3A 1FATA 2ZHMA 3PVNA 4MGKE 3N36A 1T6GC 3RJ2X 4Y1VA 1DG6A 1N3OA 4YW3A 3BOWA 4CEYC 1UW8A 1PK6C 2XL9A 4MGIE 3V65A 1DGWX 2QE3A 1V6KA 3KS7A 1NY71 1N1YA 4DS0A 1RUC1 4FO9A 1XE7A 2XLAA 3MIBA 4FP3A 4BA6A 4AF9A 1RC6A 5T52A 3WT3A 3AKSA 1H30A 3JBG1 1AJKA 2XJVA 4IEQA 4Q0QA 4HBNA 3ES1A 4NO4A 3OGGA 4RR3A 1S0DA 4S2DA 1MR5A 4E27A 1ZBA2 3ZSJA 4FPOB 4JTNA 2D93A 3ZN5A 1DGLA 4FXKB 1RMU2 1PO21 3DV8A 1V6LA 3ASIA 4WM8B 3VZOA 5FDBA 1XYOA 5HBAA 2FZ2A 3PLQA 3H50A 4Q1PA 4RHV1 5CU1A 2NMOA 5JSRA 3IDBB 2LTNA 3VDDB 2JJ6A 1ND3C 3A0NA 3VV1A 1QH7A 4IEWA 2HWE1 2NM1A 4QT6A 4GULA 1VBE2 1MS5A 3EQEA 4Q4X2 2ZMNA 3SCHA 3WUCA 2A6XA 4YLZA 1A8DA 2ZGLA 2VH9A 3BU7A 2WNEA 3O7OA 3U11A 4I0WB 4NVPA 4P9WA 3VKFC 4YZ3A 1W0PA 1NOVA 1RUNA 4M3CF 2ARXA 1JUHA 1ZRRA 2H0VA 3N4MA 1WW5A 1POV0 4FOQA 3RG0A 3TRSB 3AKPA 1TQ5A 1GFF2 2D6OX 2ZGSA 1IHMA 1EYBA 4AEDB 2A3YA 1BJQA 2VMGA 4LLOA 4GA9A 2DFCA 3WY6A 3ZFEC 3JB8A 5LK7B 1YRZA 3OJBA 3LKJA 3AM2A 3BPZA 3S6PA 1OLQA 2O1QA 4QQPA 3ZXJA 4ES9A 1N1TA 4NR1A 2JXAA 3D5OA 2A6ZA 1ASJ2 4AWDA 4D3WA 1CVNA 1VBE1 2W39A 4UW5A 3IMNA 3NVCA 1WLWA 1VBB2 2YYOA 4C0BA 4R9BA 1AXKA 3J8F1 5C4WC 3AZZA 2F4PA 5T5LA 2WNUC 3WG2A 1LGBA 4QPIA 3MW3A 1AR93 4M3CA 1DZRA 4I3GA 5BNNA 3JCIA 4JGYA 3JD71 1R1ZA 5DG1A 2WQ4A 2ZX4A 4UBGA 2DVDA 4D7YA 1I5ZA 2C5DA 2B39A 1FYUA 4ONUA 1WMEA 4AFMA 4Y22B 4DB5A 4LE4A 4G4FA 3HT1A 1REEA 3ES4A 4Q27A 4RSUA 1QJU3 4XIOA 3M3OA 2PYTA 3B69A 4E2GA 1FPN1 2JKBA 3UJQA 5LEJA 4OI4A 5DUUA 3RYRA 2MEV1 3VHPA 1ZZ8A 3R4DB 3MF6A 2IXLA 5GZGA 5FMOL 4FTBA 3VN4A 1EV13 2IXHA 3IM0A 4GH4C 3L2HA 4X6QB 2H6CA 2RM21 1C1LA 4ORFA 4RS5C 1Q8QA 4PLOA 2QZ2A 2YDEA 3WDXA 1VBB1 1VBC2 1RUG2 1ZBE1 1D4M1 4Z1VA 4TZDA 4XW3A 2HKXA 4OHYA 1W6QA 3O12A 4QQHA 5L19A 1NE6A 1A3KA 2Q1ZB 2GN7A 2ZGPA 4XHBA 2JG9C 5BNPB 5CFDC 3ZO0B 2DYCA 2E6VA 1G9AA 1N3PA 3TAYA 2VECA 5KHJA 1MZ6A 3AZVA 2R16A 5DUVA 2HWD2 5EZWA 4JV4A 2PHDA 2UWBA 1PZ7A 2W08A 4YZ1A 2XVKA 3TN91 2VG9A 4N53C 2KM2A 4CDQB 2CGNA 4YRDA 1FXZA 4K21A 2ZZQA 2OPKA 4CEWB 3B9CA 2GH8A 1R083 3SNMA 4Z82A 4COUA 1S0FA 3ZSMA 4YG6A 4LBLA 3M3IA 5DDJ2 2R041 2ZBJA 4H7MA 2WA4A 1H8TA 1COV2 1DQ0A 1H9PA 4Q4W2 1QJY3 3V0AB 1D4VB 3CEWA 2D3PA 2RMU3 1QXRA 4FPGA 1GLHA 4H3WA 4JGZA 4BPZA 3IDCB 3EJKA 5D1IA 2R062 3MLJA 3E97A 4E2SA 4ZKTB 1MQTC 1AYN3 1PVXA 1TEIA 4IEVA 2ZGKA 2VULA 3IBMA 3ZMOA 4QX5A 1N1SA 1PZ9A 2RJLA 3VBSA 4FSJA 1RUD1 4Q8KA 1DQ2A 1ZRDA 1SFNA 3THPA 3VBOC 1GSLA 2W52A 4ATEA 1AL22 3ILRA 4WVZA 2HWB3 4CDWA 1YFXA 2NZ9A 1H1AA 4YZ5A 1VBA3 1V70A 3MIHA 1TME2 1CGPA 3ZXLA 5GALA 1PIV1 5LEKA 4IEUA 3VHOA 5JCTA 1OI6A 3MW4A 2ARBA 2R32A 5CFCC 1RITA 4AEJA 2OIIA 4OHVA 3U07A 4N9HA 4RR3C 5KWRA 3M7AA 1TMF3 1COV1 1RUOA 2ZAAA 4CZSA 3TNQA 1NQJA 1I3HA 1C1FA 3B93A 3FZ3A 4AI0A 4QMAA 2AH2A 3FHIB 4IEOA 5L7OB 1OMIA 1OFSA 1RUI1 4XFGA 2RS13 3KCXA 3QH6A 3SCGA 2H0BA 3LOIA 1W6NB 5H9PA 1CPNA 4K20A 4L8QA 3B94A 3OBTA 5GLZA 2AR6A 3VBHA 1QKQA 1ZYBA 2ZHNA 1HW5A 1PNGA 2OA2A 1PM7A 2ATFA 2P3IA 1EAH3 3LA7A 2WS93 4IESA 4I2OA 1QXPA 1FMD3 4YW1A 1BBT1 2DWRA 2JG8A 4INDA 2HWF3 1EPWA 1KDKA 5A33B 4Q0SA 3W58A 3WCRA 4AG4A 1QJX2 5GLUA 1BVP1 1AX0A 2IWGB 1GQGA 4RD7A 1F5FA 1KS5A 1N47A 1IS4A 5GZDA 3N7JA 1Q43A 1WLDA 4OI1A 1KXGA 4FCAA 5SV5A 3R6SA 1S0JA 2CGOA 3QACA 5J09A 4H14A 2A7AA 4AVTA 4C91A 2O8QA