1CAWA

Determination of three crystal structures of canavalin by molecular replacement
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
181
structure length
181
Chain Sequence
AQNNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title Determination of three crystal structures of canavalin by molecular replacement.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Seed storage protein
total genus 25
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cawA00
3E6DA 1O7FA 1I5ZA 4AQ2A 2Z69A 2EAAA 1SFNA 4TLFA 1PMIA 4R52A 4I09A 1X7NA 4P9GA 3S7IA 5J7MA 3LWCA 3CF6E 3S7EA 3H8UA 2F4PA 3IIAA 1CAWA 1XE8A 1YFYA 1GQHA 5I8SA 4QMAA 1OMIA 5LEKA 3M3IA 2EA7A 3LA7A 1J3RA 4BYYA 4I0AA 2VQAA 2XLFA 1NE4A 2D93A 2QJVA 4XETA 3NSTA 4HZFA 2XLGA 2IXHA 4HSJA 1FXZA 2CGPA 1GQGA 1YFXA 4KU8A 1QXRA 2BEOA 3WW3A 3OF1A 5LEJA 2V09A 4D7TA 4BH9A 4UBHA 4R8HA 4FT8A 4EWAA 4MV2A 3UKVA 1UD1A 2PYTA 1J1LA 3L2HA 1YFUA 1PM7A 5E1RA 4QM9A 4META 5F1RA 2ZCWA 4IEUA 4I2OA 3FZ3A 4IEQA 3WW1A 5KHIA 4Q0SA 3RPQA 4WZCA 2XKPA 3SCFA 2BNNA 4L2NA 3D82A 2XKOA 4FAHA 4FBFA 1UPIA 3RYKA 4XF3A 1CAWB 5I8TA 5I0SA 4X6QB 2D5HA 3MZHA 3D0JA 3EQEA 3IDBB 3R6SA 1UIJA 4Z07A 3NVCA 4Q0PA 5CADA 1DGRA 4FAGA 4XFAA 4KWLA 3I59A 3H3UA 4XF9A 4H7LA 1SEFA 3H1WA 4KL1A 3FFQA 2QDRA 1OFNA 4Q0UA 1ZX5A 3CO2A 3VHRA 3FX3A 4BHPA 2BYVE 4RD7A 4B29A 4QGNA 2C0ZA 2Y0OA 3BU7A 1ZRRA 1ZZ6A 2XL9A 2WC2A 3LA3A 1L3JA 3ST7A 1CX4A 5BXXA 4D7SA 4JTNA 2MNGA 1J59A 4HN1A 2PAKA 3ES1A 2CAVA 1YHFA 1UIKA 4Q0QA 3U11A 4F7ZA 3E6CC 1WA4A 2GC0A 4LA3A 4HLTA 5EFUA 4XFHA 2O1QA 2E9QA 2B8MA 1LR5A 4ORFA 1RGSA 4IEPA 4I3PA 1YFWA 4E2GA 2OPKA 5KHHA 5E16A 3E5XA 1RUNA 1O5UA 1O4TA 1ZZ9A 4HN0A 3FHIB 2K0GA 2Q30A 2VPVA 4QXKA 2UY9A 5I93A 3FJSA 1NYWA 4MGYE 1EYBA 3I59B 5FPXA 1RTVA 1RC6A 4LLOA 1H1MA 4F8AA 3H1MA 2BNOA 3DL3A 4IETA 2GH2A 2DCTA 4MGZE 3SMHA 3HIFA 5HI0A 3NL1A 2XLAA 3H7JA 3B02A 1QWRA 4MH0E 2O8QA 4Q29A 2XHKA 3S0MA 1CAUA 3ZDSA 1CAXA 3NW4A 4O9EA 3I7DA 4MZUA 5I8YA 3HT2A 2PAEA 2ATFA 4BIFA 3FE5A 2Q4SA 5KHKA 3E5QA 1XRUA 2QCSB 5BUVA 4O9GA 2GZWA 4EV0A 2WFPA 5FLIA 3SCHA 4EWEA 5AVPA 2XL7A 1Y9QA 2FQPA 3IDCB 2ETEA 2QNKA 5I0RA 4J1XA 4PIXA 1X8EA 1U12A 1QY4A 4OLLA 3WW4A 1CAVA 1H1IA 2PAMA 3LA2A 3WW2A 3H7YA 5D1IA 3RDIA 2IC1A 5T3NA 3DN7A 5FQ0A 3U10A 2D40A 4HVQA 2K9ZA 4PJYA 1Q43A 1WLTA 3DV8A 3LAGA 5EZWA 4JV4A 4IERA 2UYAA 3NJZA 5KHGA 4AVAA 4XFGA 3G7DA 5BY5A 4IEVA 4MGKE 1CAXB 4XFFA 5FCCA 3RZZA 2PHDA 4IEXA 3UKNA 3MYXA 1ZREA 4EROA 1NXMA 2D5FA 5JAXA 3GBFA 3KGLA 4KWKA 3KGZA 4KWJA 1J3QA 2Z2SB 3BCWA 2IXLA 1JUHA 4AXOA 1QXJA 4JTOA 5JSPA 1I6XA 2MPFA 5C6CA 5KHJA 2GC2A 2BNMA 4A2UA 1ZNPA 3KSCA 3NKTA 1OI6A 2I45A 3RYPA 1UW8A 4PIYA 3PNAA 1CAVB 3EO6A 1RL3A 4YSFA 3BB6A 2FMYA 1DZRA 3JZVA 4NVPA 1LB2A 3RYRA 3SHRA 2HJIA 1X8MA 4LULA 4YRDA 4HVOA 3KCCA 1ZZ7A 3E97A 3PLQA 2IXKA 1DGWA 2QVSB 2ET1A 3ELNA 3OCPA 3IWZA 3DKWA 1FT9A 4KU7A 4AVCA 1VJ2A 3H1YA 4I01A 4AVBA 2H6BA 4HMZA 5I0UA 3U0ZA 4E2SA 1ZZ8A 3USSA 4XFIA 5FPZA 3N4MA 4XFCA 1TQ5A 4ZU4A 3QACA 5KBFA 4J1WA 1WGPA 5FLJA 4LTAA 4UBGA 1IPKA 3SCGA 1O3QA 4XF0A 1O3SA 3O14A 4DINB 4WVZA 4I0BA 4Z82A 3TNPB 4IEZA 3H9AA 5K8SA 3MPBA 4Q0VA 4XF4A 4N9IA 5J48A 3SXWA 1FI2A 4HVRA 1UCXA 3KMHA 2N7GA 2GAUA 4IEYA 1V70A 1VP6A 2PA7A 3LOIA 4XF1A 4WBBA 4LUKA 2PQQA 2OA2A 2GC1A 4LA2A 2Q1ZB 5JR7B 4UXAA 2GC3A 2OZJA 4ONUA 1VR3A 4L11A 1Y3TA 4IEWA 3OGJA 4GULA 4QX5A 2PHLA 4LEJA 1OD5A 1YLLA 4ZU5A 5J3UA 1Q5OA 3LZZA 1NE6A 5BPXA 4MX3A 3EHKA 3C3VA 4HSLA 3TNQA 5CVRA 2IXIA 1IPJA 2MHFA 2IXCA 3RNSA 3CJXA 2OZ6A 5I0TA 5CU1A 3D0SA 2OYZA 4K8FA 1DZTA 1EPZA 1J58A 3MDPA 3FWEA 3ROUA 1CAUB 4PIZA 3M70A 3CEWA 4XFBA 1O5LA 1YWKA 1CGPA 2H0VA 4X6RB 1RUOA 3E6BA 1EP0A 1X82A 3OTFA 4YNIA 3EBRA 4IEOA 1ZRCA 3PVBB 1YUDA 2B5HA 3H3ZA 3UKTA 5BV6A 4XEZA 2HKXA 1ZRFA 1Q3EA 2PFWA 4YARA 3E5UA 3BALA 5JCTA 2BGCA 4HBNA 4MUVA 1NZCA 5FLHA 1ZRDA 1LRHA 3ES4A 4QM8A 1XE7A 2EVXA 5JSRA 3H50A 1J3PA 3I54A 2XGXA 5LRRA 2CV6A 4JVAA 2B9UA 1LKNA 4LUMA 1O3TA 4I02A 2CAUA 4MGIE 5FQ0B 5FDBA 2UYBA 4QGLA 4E2QA 1ZVFA 1ZZBA 2ZKLA 1EY2A 2UY8A 3QOPA 1ZZCA 3EJKA 2ET7A 3IBMA 2VECA 1G6NA 2P17A 3CL1A 2GU9A 5C8WA 1O3RA 4N9HA 5LRSA 4AQ6A 3HT1A 5JSOA 3BPZA 2KXLA 4ZU7A 2PTMA 1SQ4A 2Q0AA 3GYDA 3ETQA 5I91A 1HW5A 4OFGA 3CLPA 4QGMA 3HQXA 4YYOA 4CYDA 3ACLA 2H6CA 2IXJA 4EWDA 3OD0A 4IESA
chains in the Genus database with same CATH superfamily
3C8XA 1LHUA 1R1ZA 1UL9A 1HJFA 1U5ZA 4OHZA 5FZAA 4GKYA 3NWKA 1PMIA 4UAPA 4I09A 3I2KA 4LHSA 2DTWA 4BOWA 4LO7A 2QQNA 2VMIA 1HQWA 4AE2A 2WIIB 4P9LA 1YJLA 2CNAA 1XE8A 4XQ4A 3WSOA 1HIXA 1X50A 1GQHA 3VBUA 5EYXA 4D6RA 1HXS3 1RUJ3 3ZXFA 2J42A 5J36A 3WHUA 2DVGA 2R063 3CDZB 3BIEA 5FYYA 2C5DA 2E51A 1SACA 5CFCA 5H9RA 3GM8A 2RS31 4GB31 1HXS2 5K4LA 2RM23 4CEYA 1JOBA 2R062 1RITA 2D93A 4XETA 3WCSA 2P4EA 2HEYF 4LE4A 3VDBA 2CWMA 3TEYA 1LTEA 2XLGA 4RQPB 1H4GA 5C9AC 4HSJA 1FXZA 1RUH2 1XU1A 2GDFA 1UY0A 3Q8CA 4XDPA 3V0AA 5LEJA 2V09A 3M4FA 3RI9A 2Y6GA 4LBLA 2VQTA 4YZ2A 1RUG1 3OBTA 2VW1A 4ATEA 2LUWA 5C3OA 2VZVA 1K45A 4EWAA 4MV2A 1ND3B 1JS9A 1UD1A 2D43A 1ODNA 2ADDA 2YBKA 1S4CA 3V56A 1NCQA 2EIGA 3VD9A 1XXNA 4OHWA 3OGSA 1YFUA 4ARXA 4META 5A7WA 1UU6A 4EZHA 5F1RA 1OLRA 1X33A 2JIJA 3ZSJA 1QEXA 1U0AA 2FDJA 3VD4A 5JI7A 4IEUA 2JDKA 3MV01 1PVXA 4NJ4A 1H6YA 4QX2A 3LDRA 5LBEA 1PZ9A 4LBKA 3AL5A 3RPQA 2ERFA 4HANA 4RSUA 3ZN6B 3W9AA 4L2NA 2WSUA 5DUWA 5DPNA 4FAHA 5A32A 1UMIA 1PNGA 3OPZA 1H8TB 1Z7S3 4H55A 2XG3A 3LE0A 2FDGA 3ZXGA 2A3WA 1UPIA 4EQVA 1VAVA 5APAA 1MVQA 3AC0A 5I0SA 3U4XA 1ST8A 3ZXDA 4X6QB 3J7MA 1CONA 2VCAA 3NV4A 3N7KA 1Y7BA 1ALYA 1NUKA 1Z7S2 2BW8A 1YQ8A 3ZIXA 3ACIA 4FQZA 3Q9OA 2ZGNA 1TMF2 3VBRA 1W2AX 3AFGA 5F3GA 2R073 4ITCA 2D6OX 3MLLA 4NHKA 4H7LA 4B1LA 1I9RA 1SEFA 5KXCA 1ULEA 1F5JA 1XPWA 2W92A 4JZRA 2R072 1OURA 4NOTA 3ACGA 4X8NA 4Q0UA 4Q4Y3 2XMLA 3HBKA 1X9PA 4H2AA 3K77A 2HH9A 3IAQA 3VD3A 2Y60A 3VBOA 4DUXA 2WZR3 2X5IB 1JYTA 2C0ZA 4Q4Y2 5FREA 2I07B 1REEA 5A6XA 4P9WA 2QBXA 4OUMA 3N36A 2IUWA 3VKFC 1BYHA 3DXUA 3WDVA 1CX4A 1HRV2 2A6ZA 2VNGA 3I3BA 5BXXA 3F95A 2WDBA 1TVGA 1MZ6A 2PAKA 1J59A 3W21A 2K46A 4URTA 3A0KA 2HWB3 4IV3A 3DYOA 2GMPA 3OUJA 1UAIA 2Y6JA 4HLTA 5DUXA 1RINA 3H8XA 5FUPA 3O1RA 5FYCA 3AYDA 3RVHA 4XMAA 1RGSA 3VBFB 4R9CA 3BIWE 4LBJA 4XJ8A 3UNPA 4E2GA 4DUVA 2D6LX 1W90A 2GALA 3HBZA 3OGGA 1RUNA 2VBBA 4CTEA 2YXSA 4V2WA 4HN0A 2AEZA 3OUIA 4XZUG 1F4AA 2K0GA 3THCA 4CCLA 4F7ZA 2FDFA 2VR4A 3MFCA 5FPAA 2WAOA 3SEPA 4Y24A 3K4ZA 5GZFA 1OKQA 2WO7A 1CZVA 5I93A 3FJSA 4NIDA 1GR3A 1C8M1 3POWA 5B4NA 5KWRA 3CKHA 4NPRA 5ACA1 1RC6A 3AX4A 5A1LA 3OY8B 2WN2A 3WF0A 1GZWB 1VLNA 3H1MA 4IW3A 4F8AA 3DL3A 5EIYB 5FWEA 2DCTA 5GZEA 3S57A 2A6WA 5FBZA 2VTXA 2XLAA 4CE8A 2QZ2A 5GLZA 1CPNA 4KI5M 4XCAA 5FAXA 2ADEA 3ZXEA 1QWRA 4MH0E 5FOBB 5FPLA 1U5IA 2WLPA 4PDWA 3VL9A 3AXDA 2B42B 3PTRB 1D2SA 2JDYA 3NV2A 4FPFA 3AP9A 4Q29A 4HL0A 4WM8A 5HXVA 5CA6A 5CEHA 4EN7B 2JX9A 5BNNA 1TEIA 1EUTA 1H2KA 4ES9A 2XPJA 4O9EA 4PT6A 3UV9A 3F2ZA 3I7DA 4QHOA 4YVWB 2VO5A 4YW4A 1C8NA 3T2QA 5I8YA 4IE5A 4ZS2A 2DWRA 4IE4A 2W47A 3GCWA 1GNHA 2WFF3 3ZYBA 4E4SA 4MG2A 3MEPA 2XQRA 5KHKA 4ASMB 1JZ6A 2J1VA 2XJTA 3E5QA 1AHSA 5EXOA 2WFF2 1VBC3 3IAPA 4RHV3 1FATA 1O59A 5CB7A 2SLIA 4IV3C 1MEC1 2QFEA 4AG4A 5FLIA 4W6YA 3TOJA 4EWEA 5IHRA 3ZIWA 2FZ1A 3WNKA 1SHWB 2XL7A 2XBO1 2ZGMA 4FPCA 2KA3A 4J1XA 3ILNA 3AYAA 3W5MA 1QY4A 3O0WA 4DY3A 2D6MA 5EV7A 1ND3C 2K2SA 4NHMA 1R083 2ZX2A 1CX1A 3NNGA 3FLPA 3AP4A 2O14A 3RDIA 4LBOA 2QDNA 3VZLA 2AEYA 2FHRA 1IS5A 4JKMA 5T3NA 4AL9A 1OPMA 4V1PA 1R082 2YZ4A 3LKJA 3NAPA 5C8CA 3AJZA 4N53C 4HVQA 2K9ZA 5T52A 1DGLA 3M1HA 1Q43A 3LAGA 4XIOA 4LJHA 4CU7A 2NP0A 2VZRA 4FOQA 4QX0A 4KG0A 1RUJ1 1ZBE3 1IOAA 4AVAA 5BY5A 1DHKB 3GJAA 4CU8A 4LIUA 3RQ0A 3AP7A 1SCSA 4XURA 4XFFA 4M3CF 4UI9L 5BNPA 3D8CA 2AACA 3RZJA 1ZBE2 2RM21 2UWAA 4IEXA 4PDWC 3JU9A 4QQ2A 2YG0A 2JG9A 2PLV3 4GMP3 4QPGB 4EROA 2WA4A 4YM2A 1UKGA 3SQOA 5A70A 3JBG2 2D5FA 5F3IA 1NKGA 1PO11 4LLFA 1QQP1 1JZ2A 1AR61 2Z5WA 3KGLA 3KGZA 1U5YA 1VBB3 3D3AA 4OHXA 1GWKA 2C9KA 2D3SA 1AYN3 4E8CA 2A6XA 1KFUL 2XVLA 4AEMA 4CCCA 5FXVA 5F3CA 5HCFA 3HWJA 4PBOA 4AXOA 4BLIA 4HG6B 1VBB2 1AR91 1WCUA 1I6XA 2OUJA 4Q2FA 4NIIA 2MPFA 2X5IC 3RZMA 2BNMA 4A2UA 1COV3 2TBVA 3NKTA 2OQ6A 1MR5A 3VD5A 3ZYPA 1UPSA 1GOFA 4M4RA 4QKBA 1CAVB 3EO6A 4RR3A 1RL3A 2IWGB 1H1AA 1COV2 3GZAA 3ZFGB 4IGQA 2AREA 1NY71 2FMYA 5J37A 1BBT1 4Y20A 4QQHA 3RI8A 3VDAA 2EAKA 4V2VA 2Z42A 3RYRA 4HXCA 3SHRA 2HJIA 4BCUA 4YRDA 5FV3A 4TLGA 3PLQA 4BWOA 1DGWA 1Q56A 5T5OA 4CRQA 5KXDA 4JGYA 3H8RA 3L9JT 2BP6A 3IWZA 5GKAC 4GAZA 2P2KA 3BTAA 4CXWA 2ZAAA 2ZGTA 5C8CC 2OW4A 2VUAA 1JI6A 4I01A 1HRI3 4AVBA 2EXHA 2BWCA 1KITA 5KR7A 3U0ZA 5DAVA 3KVAA 4E2SA 1VRH3 2PELA 4NHLA 3VKLA 3ZN5A 5M0TA 3OEBA 5DAQA 2A5ZA 3NNMA 1IG0A 3DXTA 4AI2A 1AX2A 1VRH2 3AMNA 2PHWA 1PK6A 2QQJA 2RJ2A 4J1WA 5FLJA 2DUPA 4CUBA 5FP9A 4XE9A 2WZR1 1XNAA 3KB5A 1DQ4A 4Q5OA 1W28A 4I0WB 1NA1B 2X8KA 2ZGKA 3CMGA 2JG9C 2CGNA 4GZ9A 2WL1A 2Y38A 2IFWA 4XF0A 3RJ2X 1G9BA 2YYOA 4WVZA 3PUQA 1JYVA 4IEZA 3J4UH 4M3CA 5IK7A 2WABA 4ISRA 4OQ8A 1AZDA 4M00A 2HWE1 5FXXA 5IYYA 3S5AA 3KZ4C 3KF5A 1N3OA 2CU5A 5FZLA 3V0BA 5K8SA 4XF4A 1LESA 5LBFA 4TWTA 1US3A 2HWB1 1GQPA 3AZVA 3VHOA 1FI2A 2GAUA 4IEYA 1FMD3 2W94A 1VP6A 4N7IA 4AAPA 1V9U1 1OH3A 4Z8BA 5AVAA 3WD5A 3WNLA 4FOVA 5A3MA 4Q4X3 4XF1A 5CFDC 5JMOA 2PQQA 4QKFA 2WO3A 3VBSB 2LM3A 3IIIA 3BKZA 2Q1ZB 2OT7A 1RUD3 4NWVA 5JOXA 4NN0A 1LHVA 2BJSA 5ANQA 5K7PA 4Q4V1 2GC3A 3R4SA 1UY2A 4N43A 5C4WA 1RXGA 3T2PA 2DVDA 2WZEA 4UW4A 4GALA 1W0PA 4QHBA 1AR81 2E63A 2X09A 4YZ1A 1WW7A 4AEDC 3LD8A 1OT5A 3R4DB 1UZWA 1W9WA 2PHLA 1J1TA 2YPJA 1CN1A 3AKPA 2PHFA 3Q8BA 4QX5A 1VE0A 4AI0A 3UGHA 1DG6A 1PZ8A 3VKMA 4LKEA 4YM3A 5FY7A 1VBD2 3I3DA 5FYSA 5L7OA 3CJXA 2OZ6A 5I0TA 1LOFA 2JDPA 3D0SA 5CU1A 4K8FA 1EPZA 1HV1A 1NCRA 1W8FA 3KD4A 3POSA 4P02B 3MDPA 3FWEA 2ZMNA 1JXNA 1SPPB 2BV4A 4FTSA 1IZ3A 2VVEA 5FP8A 2HYKA 3QD6A 3ZOIA 3ECQA 4LT5A 4G9SB 2FD8A 1RMU3 2E6VA 1KGYA 1GZCA 1C3HA 2RS53 2GNBA 5IWFA 4BM8A 3A22A 1PM4A 4AGVA 1GBGA 3K48A 2H0VA 4X6RB 4BMBA 1FOD1 4CPBA 2DDUA 2VXJA 3EBRA 1ZBA3 1XE0A 2X10A 2WT2A 3K51A 1CVNA 3MBWA 4PLMA 4ZY9A 1VBC1 2WZPP 3OD4A 4QPGC 2B5HA 1E5SA 5AC93 3UKTA 4BLJA 3HPNA 1ZRFA 1ZBA2 3PUIA 2PFWA 3K2OA 5FYVA 1W8OA 3BALA 3E5UA 5IK5A 5JCTA 5FZEA 3I2JA 4MUVA 4SLIA 5FLHA 3VZKA 3OG2A 3ZYHA 5AC92 4OUSA 2JXAA 4FQ4A 2GP5A 1XNCA 1F35A 3ITQA 3VZOA 4CU9A 3I54A 2XGXA 3KF3A 3CNAA 3VV1A 3HQRA 4M3CE 1VBE1 4DFSA 2QQUA 4LUMA 2UURA 1ND2B 4IGOA 1O3TA 1EPWA 4MGIE 5C5TA 1BLZA 1WLCA 4UW6A 4XMIA 3VD7A 5JXIA 4Y1UA 4AI1A 2ENRA 1YNAA 3J7HA 5FZ0A 3M2MA 4CDQB 4E2QA 2ZXQA 1ZZBA 2W1SA 2CYFA 4OZOA 2D3RA 1EY2A 1M4WA 1GICA 1W8NA 1UY3A 2ET7A 2VOWA 4R4ZA 5IW0A 1KS5A 5A33B 1UO9A 3KV9A 3LCPA 4D6QA 4LNVA 4E9KA 2VECA 3DUIA 3T4HB 5C8WA 4FVVA 5L7OC 4LITA 5K0UB 3KT4A 4AQ6A 1LOFC 2ZEWA 3HT1A 4DZGA 2AENA 3PTYA 3BPZA 1NCRC 2XJUA 4HKWA 5GLWA 5JDBA 4B4RA 1JOPA 3GYDA 1QJU3 3ZSMA 3MO4A 3CLPA 4QGMA 1W9FA 4XTPA 4AF9A 4E8DA 5HV0A 3PUAA 3ACLA 4CYDA 5F39A 3RMXA 2XJRA 3W59A 2DTYA 1WKYA 1XBFA 4R52A 1RVF3 4IESA 5FBJA 5FZMA 4UWDA 4EWDA 5JUVA 5CKQA 1Q8QA 1O7FA 2F4LA 4JHTA 1YRZA 3IKWA 1I5ZA 4NAMA 5KXBA 1UN1A 4AQ2A 2WQZC 1QJX3 1X36A 2Z69A 5FMCA 3FC0A 1JZ3A 1RVF2 4LK6A 4TLFA 1UYXA 4LHLA 1BJQA 5LASA 5A80A 2D3PA 2D6NA 2LALA 3LWCA 2EF6A 3CF6E 2RR12 5FZIA 1NA1C 3SKVA 1QJX2 5E88A 1RUG2 3TEXA 4LR4A 3ALQA 1CAWA 1H0BA 2MEV1 3PVOA 4JKKA 3P6BA 3O1UA 4WVMA 1W04A 1R093 5E8AA 1ULPA 3GZTB 4IUGA 3DPRA 3I2OA 4GWNA 5C9AB 1FV3A 1OMIA 1GP6A 2EIDA 4XC9A 4IV1C 2BBAA 3M3IA 5J98B 3PL0A 1J3RA 1R092 5FRAA 4I0AA 3CU7A 2XLFA 3GGLA 1DGRN 1G86A 1WW5A 1NE4A 3UGFA 5A1AA 2VG9A 4XILA 5LA2A 1B35A 4HZFA 1AJOA 3GHMA 1QGLA 3KV5A 2IXHA 3M8LA 4YM0A 5FZ3A 2Y34A 3PVEA 2AYHA 4FCAA 5EWSA 2VVDA 3OYWB 3RZLA 2RVAA 4WM7C 1SFPA 1GKBA 2WNEA 5CNAA 1ASJ1 2BEOA 3WY6A 4D7TA 2VH9A 1S1AA 4QX8A 1HRI1 2EALA 4CP1A 5T50A 4R8HA 4UFHA 3O12A 4Y1YA 1LOGA 1OLQA 2PYTA 1LOBA 5JPMB 1PIV3 4IXLA 3L2HA 4DS0A 4GWIA 1PM7A 3MIHA 5E1RA 4BQ1A 1NXD1 2ZCWA 5F6KA 1SLAA 2Y6LA 1NLSA 1SLTA 2VNRA 3FZ3A 4Z2AA 2JKBA 4IEQA 3TYJA 1V6IA 1L7QA 4CDXA 4Q1RA 4CDWA 3SCFA 4NPMA 4LBQD 2BNNA 4INDA 2WBKA 5DZFA 1F8VA 2R043 1ENSA 2J1UA 4GWJA 2WT1A 1V6JA 4FBFA 1V6LA 2HWC1 4XF3A 4QB6A 4X8PA 1JYNA 3BGAA 3R0RA 4QDRA 5A3PA 1MS0A 2R042 3OBRA 4LHKA 3VBUB 1QU0A 3D0JA 1FMD1 3IDBB 2ZPXA 1CIWA 2JWPA 3U07A 4COUA 4EZ4A 3RZHA 3POFA 4Z07A 4MGTA 1AYM2 5CADA 4BPZA 2VW0A 1GWLA 2RS11 4Q4X1 5FFOC 1BEV1 3H3UA 3MHZA 2CTVA 1AL0G 4CEYB 4SBVA 2RMU3 3I2HA 3JD72 1J83A 4Q4W3 5FY0A 2DU0A 4A44A 5FIXA 4JAAA 1OFNA 5E6HA 5D8AA 5C70A 2W87A 1PX4A 1ZX5A 3UESA 2RMU2 1AXKA 4QX3A 5DUUA 3VHRA 5IK8A 4BHPA 1DQ1A 4B29A 2PMWB 3PHMA 1XYNA 4NPLA 3WP6A 4QGNA 3BU7A 3V0AB 3CBNA 4ATFA 2DBIA 1RUC1 1CR7A 2HBUA 2WNVA 4XJWA 1H4HA 3I2GA 3TAYA 2RV9A 4K9SA 1WBFA 1L3JA 1K5MA 2VVFA 1PGW2 2Y0IA 3HAGA 5FZBA 4AFAA 1NCQB 4AYUA 2WS91 4B3NA 1W9YA 3B94A 2CAVA 3MLJA 4FFGA 3LFMA 1KJLA 4JRLA 5FK7A 5A7WB 1UIKA 4AVSA 5JZGA 4A7ZA 2BOIA 3RGBA 3BOWA 3T08A 2GC0A 4AR2A 5F5QA 3LIHA 5FXWA 1GWMA 1LGCA 1LOCA 4XFHA 3HQUA 5FO7B 2B8MA 1LR5A 1TME3 3MPPG 1F2NA 2R0FA 5A32B 1XB9A 1BMV2 1NOVA 5KHHA 5E16A 4OUEA 1O5UA 1O4TA 1ZZ9A 5SV8A 1TME2 4CDXC 3MIFA 4DRVA 2VMDA 4ES8A 5B2GB 4CDWC 1AXYA 5IJRA 2Q30A 3E6CC 2VPVA 1UXZA 2XONA 2WSVA 1Y43B 2ZBJA 1WCSA 2JG8C 4K1ZA 4QAWA 4MGYE 1EYBA 2Y8KA 5GLVA 4AHXA 4EE2A 1KQRA 2D44A 2ZX1A 3FHQA 3R05A 4K6BA 4NAOA 4PLOA 4A6SA 1GU3A 5FPXA 1UZYA 1QF3A 1RUI1 2WINB 4LLOA 2JE8A 3EXUA 2IZWA 3POIA 4MGZE 2P1BA 4LIVA 3PJQA 3SMHA 4QQLA 4Y1VA 5HI0A 3VBOB 3KQRA 1OA3A 1WD3A 2WJSA 2XJVA 1WWYA 3AYCA 4PF5A 3KQ4B 1JHNA 5FKBA 2VC9A 4CUGA 4ASLA 5F9TA 5D8AC 2XHKA 5FUNA 4BXSV 3ZDSA 1CAXA 1K5JA 4YZ4A 5F8PA 3ZPOA 1JTZX 4XAEA 3KHCA 1RUH3 1WBLA 4QDQA 2YUEA 5CBLA 4MZUA 1RUE1 2YROA 1Q8SA 1XQNA 1HN0A 1OD3A 4ZONA 1VBA3 2ATFA 2VBPA 4IV3B 1URXA 2WNVC 3UYJA 1XNDA 1JBCA 4XBNA 4NMIA 5IAVA 4XUTA 4W8JA 2VCMA 1BQPA 2EIBA 1VBA2 2VZSA 1QDOA 2G1MA 4XUPA 3GALA 2Q8CA 4XJZA 1AL21 4O9GA 1N1VA 3TN91 4FFHA 2EIEA 5JZGC 5FMBA 2GZWA 3A0NA 4OI2A 4EV0A 2WRAA 5AVPA 2ZOEB 1IKQA 3VHPA 1NAEA 1QJU1 1DYOA 5B4XA 1ACCA 4YG3A 3O5SA 1LHWA 1Y9QA 1UNBA 2VXRA 2ETEA 3IDCB 3W20A 1U12A 2AZ5A 5F3EA 4CCEA 4Q8LA 1MS5A 4K21A 4CDUA 1W3XA 4N53B 1ZM1A 2OIIA 4XXPA 3H7YA 4DPNA 1CD3G 4A6OA 1PGSA 5D1IA 4YG6A 1W0NA 2WWUA 2E26A 5FP7A 1JZ8A 5CG8A 1QJY2 4PLNA 1D4VB 4MO3M 1SFYA 3U10A 2D40A 1TMF3 1DLLA 1BKZA 1EV11 2L9LA 2QTWB 3AFKA 1XJAA 4RN5A 4UOJA 2WNUA 2XJSA 4PDWB 5EZWA 3T0BA 4AVTA 5GZGA 1AR92 1FPN2 1W6MA 1C5HA 4IERA 1D0HA 4JV4A 1XSQA 2UYAA 2DURA 4WM8B 2ZZQA 1KD7A 4W50A 1VRBA 5FP4A 4IEVA 4MGKE 4KGGA 1VB2A 3ZN4A 3BU0A 2BGPA 3ZFFA 4K1YA 3ZKUA 4A7KA 1C1LA 2W52A 1MQTA 1UZVA 2PHDA 3VBUC 4AI3A 4DB5A 5BYNA 2ZS6B 3UKNA 4BE3A 3MYXA 2VY0A 1CWPA 1AR71 4F3JA 1D4M1 2ARCA 2Q5TA 3VZMA 2B9VA 2NLRA 2Q1MA 4KQ7A 4D69A 1HRV3 4CEYC 4TZDA 3I3MA 4KWKA 1LU1A 2DYCA 2Z2SB 3BCWA 4P9IA 2IXLA 4GKXA 2A7AA 3FMGA 4K40A 5JIUA 5SV5A 1XYPA 4QXBA 4D7YA 1UZZA 1HB2A 2FMDA 4NHYA 5C6CA 1JZ5A 2YBSA 4DXZA 4F83A 4YVSA 4FPKA 1ZNPA 4DNYA 2I45A 2VOTA 4K7JA 3RYPA 5FZ4A 3KV6A 3PNAA 3H8OA 1IGOA 5GALA 3WZ1A 3WINE 1S0IA 5C7GA 2YC4A 1NCQC 2P3JA 4HFSA 3S5QA 3VDDA 2YBPA 5ISLA 2J7MA 2R49A 1DZRA 5LY1A 1DU3D 2EXKA 3NO8A 4NVPA 1FYUA 5A3NA 1G9FA 2WNOA 2QQPA 3NAPB 2W08A 5C8CB 1JW6A 2R7EB 5C3QA 3E97A 1VB4A 2JDZA 4ET7A 3ELNA 5EYYA 4RQPA 2WYFA 1NLRA 3MFAA 1YYNA 4XHXA 5A3LA 4KU7A 4S2HA 4AVCA 4JGZA 1JHJA 3H1YA 3WNMA 3GXUA 2H6BA 1BXHA 4HMZA 4ZS3A 2Q8EA 4COYA 2DUOA 3MUY1 2WNUC 3RRDA 3UGGA 5LCWL 3I4IA 2JG9B 4MLOA 5FPZA 3PDQA 3VBRC 3SH4A 1KXGA 4H14A 4ZU4A 1APNA 4AFBA 5JVVA 4FSJA 1IPKA 2R32A 2VTXJ 5ABJA 5C33A 4S2FA 4XABA 2P3YA 1QH6A 4YM1A 3O7OA 4L97A 1Q8OA 4Q4V2 1HB1A 5HCBA 3PU3A 1BVP1 3WDTA 1N1TA 2WO1A 2XWJB 3TNPB 3BTZA 1RUF1 3VBOC 2Q1FA 2KM2A 3H9AA 3OGVA 1AR82 4YFWA 1W6OA 4HETA 1W6PB 4JHZA 2W0XA 3MPBA 1H8TA 5CFDB 4Q0VA 4JC1A 2XOMA 5J48A 4RR3B 4HVRA 1DCSA 2ZHNA 3KVBA 1CQ9A 1M06G 1V70A 4YW2A 3RWNA 3ASIA 5LW9A 3ACFA 4LPLA 3EMRA 1W2NA 1PGL1 1Q8PA 3LOIA 3GZEA 1IPSA 1EAH1 1W03A 3J8F1 3WF3A 4UFJA 4AEDB 1OVPA 4HPKA 2V5DA 5JI9A 2OZJA 1ULCA 4K20A 5JIAA 2R6QA 4JCKA 1W9SA 3O1VA 1VR3A 4L11A 2QQKA 3JUUA 2ZTNA 5JR2A 4AW7A 2VMFA 3OGJA 4JX0A 3RMYA 3ZSKA 4LEJA 3NNJA 3RZGA 4MXVA 4ZU5A 1MZFA 3WF1A 4AGGA 2G9GA 1NE6A 2UU8A 3MIEA 3IMMA 1JZ4A 3EHKA 4HSLA 1QIQA 5TSWA 4BA6A 4QB2A 1IPJA 2BVBA 2W1QA 1LNSA 3O1PA 1HQLA 1DFQA 1PK6B 4RYDA 4W6WA 4WVWA 1ZA7A 2QQOA 1DZTA 1PVC3 1STMA 2IVIB 2VCBA 2VQUA 5FYBA 4AI9A 2FBEA 1J58A 3U1XA 1HXS1 4E4DX 5HXMA 3OBAA 5DABA 3OUHA 1SLLA 3ZR5A 2R061 4AI8A 1CAUB 4PIZA 1ULDA 5FK8A 5L9BA 1PVC2 3PIJA 3UL2A 4M3CB 3JBG3 3ZYFA 1I3HA 2VOKA 3VUOA 1RUH1 3FBMA 3V0BB 4COVA 3V65A 1MVEA 3UETA 2E53A 2JEMA 1O5LA 4MVTA 4WM8C 4AFCA 1TNFA 2XJQA 2JDNA 4IE6A 3AXEA 3DYPA 3E1F1 5BNNC 2NZ9A 5A6ZA 4CSWA 1JOJA 2VZPA 4KG8A 4YNIA 5CG9A 1R1A2 4IEOA 1GYKA 2WZ8A 1PZ7A 3T30A 4PQ9A 1XSRA 1LEMA 1DBNA 4JDOA 5A1FA 1YUDA 5FZ1A 5BNOA 5FZ6A 4XBQA 3CJIA 1YXWA 1QOOA 3IDEA 2V4VA 2ZGSA 4MOAA 1AVBA 2NN8A 2WA3A 1D2QA 1F4HA 2BGCA 1IS4A 4HBNA 3PMSA 4C0HA 5EJ3A 4GJYA 5C4WB 5HBAA 1KRIA 2D6PA 4XIKA 4PBPA 2NQYA 5IATA 4QM8A 5DN2A 4H7MA 2EVXA 1GZTA 3U14A 3H50A 1IQDC 1J3PA 1C5IA 2YHJA 5JSRA 2RJLA 4LOTA 2RDQA 5FJKA 2B9UA 3TWIA 4I02A 5JMCA 3ETPA 2CAUA 5FQ0B 2YDEA 4DMIA 2EXIA 1WD4A 3IT8A 3JB4C 1UQXA 1Z7S1 2UYBA 1VIWB 4QGLA 3NJYA 4QXCA 2LS6A 4Q26A 5FY9A 3ZM8A 5L7OB 4YVWA 1ZVFA 1IS3A 1TMF1 4UF0A 5FYIA 3ATGA 1NCRB 2BFUS 3TEWA 3VBHA 3HN3A 4LO8A 3KHBA 1K12A 3IBMA 2ILMA 2YB7A 1UYYA 3NAPC 4URAA 2VL4A 1S0EA 3BOPA 2R071 1ENRA 5HCAA 5FKCA 4RFRB 3SKJE 1RXFA 1GP5A 5G05L 1CZSA 4L0PA 4AAXA 1W6NA 4XBLA 2PTMA 1SQ4A 5I91A 3M3CA 4EN6B 1HW5A 3GZUC 4M01A 4Q4Y1 4XUNA 3NNLA 4BXFA 1JUIA 4LQRA 5T5PA 2VNOA 1RHI2 4P5HA 1ZRIA 4OI1A 5BNPC 1W8HA 3LFIA 1ENQA 3MW4A 3NV3A 2IXJA 5I8SA 2LTNA 2DF7A 1FNZA 2JICA 4RGAA 4FTEA 1H9PA 4D3WA 1NT0A 2HWF3 3D5OA 4QB1A 4QU2A 4OQ9A 2VZTA 2CSGA 2E33A 2EAAA 3K3NA 4R4XA 2DCJA 2EXJA 1X7NA 4BISA 1KEXA 4NROA 2HWF2 1OF3A 4XAAA 3NNFA 4IV1B 3S7EA 3MIDA 3ZXLA 2F4PA 5BNOC 3IIAA 1UX6A 4IL7A 1UY1A 4CPBD 1G9DA 2HWD3 1YFYA 2Y6FA 1UOGA 4ZZ5A 1ONAA 5FYUA 4QQOA 4C0BA 2FDKA 1OQEA 2YY1A 5LEKA 2HWD2 1DYKA 5GJ6A 3ZFEA 2EA7A 4WM7B 4BYYA 3I3EA 4KBBA 3BI3A 2VQAA 4RR3C 5FTTC 3KT1A 4G3YC 1KS4A 1ZA4A 5C5UA 3NSTA 4P9XA 3GBGA 5FMOS 4JQTA 5IUQA 3NJXA 4E27A 1FNYA 3CZJA 1GQGA 3AP6A 4FO9A 1UMZA 2BVVA 4KU8A 2AUYA 2XB6C 3WW3A 1FAYA 1PO23 1VBD3 1GV9A 4BH9A 1ENXA 1S2EA 3K46A 4FT8A 4JGYC 2E7AA 3UKVA 3LSEA 1W6QB 1PO22 2NPIA 5L36A 5DDJ2 4UFMA 3RSJA 4QM9A 1BEV2 1E5IA 2VE1A 1OQ1A 4EJRA 2BGOA 3CQOA 5JXGA 2WR9A 4I2OA 2B39A 3QCWA 3WW1A 4Y4RA 2Q8DA 3O1OA 4Q0SA 1JYCA 4WZCA 2XKPA 3ACHA 2E7QA 1KDMA 1PK6C 5A6YA 1UKRA 3CZUA 2XDVA 2XKOA 5GLTA 4YZ5A 5CFCC 4HK8A 2WFF1 2Y6KA 5A3OA 1A34A 1CAWB 5I8TA 5GZDA 5KC5A 3OGRA 5DZEA 1SBEA 2D5HA 2DVFA 1GP4A 4NIGA 4N8MA 3MZHA 3MLKA 2A71A 1Z78A 3EQEA 3ZKYA 3DPRB 3R6SA 5AFEA 4Q0PA 3T0AA 4FAGA 4RHV1 2JDHA 4KWLA 4EN8B 3I59A 4GD4A 4TXWA 4YZ3A 5I0DA 3MF9A 1QOSA 3NQHA 5E89A 2QQWA 4KL1A 1QNWA 1OH4A 2CWSA 1SMVA 4FPJA 4K3UA 2QDRA 3OPTA 4XUOA 5F5IA 1B35B 1SBFA 3C2UA 1JYWA 2DVAA 1JYXA 3CO2A 1LODA 5FZ7A 3ZFEC 2OPWA 4RD7A 1HLCA 1UX7A 3ZSEA 5KC6A 1R081 1WLWA 2Y0OA 2A6VA 3K4AA 4NRQA 3PMEA 3AKTA 3WQ7A 4A41A 1ZZ6A 4LE3A 4N43C 5C4WC 4DXRA 3LA3A 4XYXA 2VU9A 3ST7A 5FYHA 3A7QA 5LATA 4D7SA 1IHMA 2MNGA 1LOAA 3JB8A 1BVVA 4BZ4A 3LPGA 1GOGA 4FPHA 1OOPA 4YFZA 3C7GA 1F31A 3SC7X 1JN2P 1RUI2 3B5LB 4LBNA 2TEPA 1ZBE1 1HB3A 4CDXB 5EFUA 3WG3A 4CDWB 2E9QA 2WKKA 2NYYA 1UYPA 3I3QA 3USUA 1AXZA 3LF7A 3JBG1 4IEPA 4ORFA 2JG8B 1CJPA 1DQ6A 3N7LA 2J1TA 4I3PA 2WN3A 4CEWA 1G8WA 1FV2A 4Y5SA 2PLV1 4GMP1 2YC0A 1O4ZA 1W8UA 3GNEA 3ZYRA 3WLUA 2RS32 4GB32 3THPA 1AJKA 4QKNA 3P3NA 1VBB1 4XJ9A 1JYIA 1VMHA 1AYN1 4LOSA 3WNOA 2RR13 5FJHA 1RTVA 2P5BA 2ARBA 1RUG3 3BYWA 5A3WA 5T5LA 1H1MA 3H3LA 4PI2A 2BNOA 1SBDA 2F6BA 1QKQA 5D8AB 2G4IA 4IGPA 3HIFA 5DG2A 3NL1A 1COV1 4AK3A 2RDNA 3B02A 4HOOA 3B69A 4J25A 2R30A 1LULA 4B7EA 5JPNB 1YQ6A 3MGUA 4N7UA 4UW3A 1G9CA 2WNVB 3LEIA 2ZABA 4BQYA 1K5MB 2DU1A 1W2OA 4P5YA 3NW4A 3GBWA 1GZ9A 1W8ZA 2C1FA 2BBVA 3HT2A 2PAEA 2VAUA 3AM2A 4MXWA 3ZXAC 3ZYIB 4RS5A 4EN9B 5JZGB 4BIFA 5J09A 2ZGRA 1DP0A 4FP3A 5L19A 5LK7B 2Q4SA 1GSLA 3AZXA 3S6PA 4GJZA 5CKMA 2B46X 1QXPA 5LY2A 1XRUA 4COZA 1DYPA 4XHBA 2QCSB 1VMFA 2C9AA 1EV12 1UOFA 2G9ZA 1OOPC 4HK9A 1VRH1 2WFPA 1DLCA 1W05A 1PMJX 1I5PA 5JWPA 1J84A 5LBBA 3SISA 3U37A 5EJZB 4P9YA 4NR1A 5IVEA 2BPA2 3T09A 2ZJCA 4L99A 1WLDA 3VLBB 3JXSA 4YW3A 1X8EA 4GH4A 3M3EA 3AVSA 2P37A 4CCNA 3WW4A 5FP3A 2A73B 5FZGA 4CEWC 4FFIA 1H1IA 2PAMA 3A21A 3LA2A 1NX9A 3HNYM 3WW2A 4AEKA 2GH8A 3IZOA 4GXLA 4A3XA 1QJEA 4MHRA 1E5RA 3AL6A 4C91A 2ZZJA 1US2A 3AKSA 4YGCA 4QPIA 1AYM3 4CDQA 4PJYA 4BQ2A 5IFTA 3M3QA 1WLTA 4RA0A 3T1LA 1A78A 2A75A 3NJZA 1XNKA 3ZMNA 2ZEZA 3JD73 3DF0A 4G4FA 4XFGA 3G7DA 5ERLA 4AQSA 1CAXB 4WV8A 3SNMA 2V4AA 2O8OA 5FCCA 3G6JB 2JB8A 1YQCA 2VZ3A 4Y5Z0 1RUD1 2A3YA 3UJQA 1V6KA 2GN3A 3DPRC 1ZREA 2XUMA 1LHOA 5FZOA 4QX1A 3THDA 3WDWA 2AC1A 5JAXA 1K42A 5F7UA 4BB3A 3POYA 1H2LA 1VPHA 1WCQA 1MS3A 1J3QA 5D2AA 3RS6A 1C8M3 1VBD1 4MADA 3N7MA 1B35C 3N35A 4RS5C 3P1IA 1JODA 1JUHA 3B3QE 3QH7A 4GWMA 4JTOA 3ZPYA 5ACA3 4HKLA 5JSPA 1REDA 3N9MA 3AKQA 3FHAA 4OHYA 1C8M2 1NLQA 4AHZA 2P6HA 2ZX4A 5ACA2 4D8MA 1QOTA 3Q8AA 1OI6A 1SZBA 2KR2A 5FYMA 4CDUB 4PIYA 5ANNA 1JU4A 1G9AA 3LEKA 2CDOA 3JZVA 3DCQA 3PVNA 4DXSA 1RMU1 2JE9A 2RS51 2VD7A 4E4ZA 1LB2A 1V6NA 4DEVA 1X8MA 4LULA 4PF1A 3PJYA 3KCCA 3OOXA 1F5FA 1Q8VA 3IN9A 5L73A 1RYYA 4PQQA 5DG1A 4KGQA 1VAKA 2QVSB 3IPVA 4IQPA 2WNUB 3MW3A 2HBTA 1DDLA 1POV3 1W6MB 1MPXA 1S0FA 1MZEA 2WT0A 3OCPA 4QHZA 5FYTA 1ZBA1 2LROA 5H9PA 4C1WA 3DKWA 3VBRB 1FT9A 4U2AA 4YGDA 1VJ2A 5AC91 3J7NA 4BQ5A 2Y64A 3ZFFB 1YQ2A 3IB3A 4Y26A 4KMQA 1MQTB 4FXKB 1ZZ8A 1GLHA 1MEC3 4LBQA 4YW5A 3USSA 4XFIA 5FYZA 3N4MA 3KM5A 4J6GA 4CCDA 3GJBA 1TQ5A 4XFCA 1LU2A 3QACA 3ZXJA 2XBO3 2F17A 1MEC2 2Z79A 1WGPA 2ZMLA 4MGQA 4QXHA 5FMDA 5KBFA 4ZPIA 5EHDA 4UBGA 5H9QA 3SITA 4GA9A 3SCGA 3LOBA 4FPYA 5FZ9A 4TYSA 1QH7A 2XBO2 1O3QA 2A6YA 2VMEA 4LMFA 1O3SA 3O14A 2NMNA 4DINB 4BQWA 2ZGLA 3WG4A 4Z82A 2JD9A 3OJBA 4CP9A 1A8MA 1UZ0A 3WQBA 2XR4A 1GNZA 2LW8A 4YVSB 5K9YA 4JDMA 2SBAA 2W46A 1C28A 1LJ7A 5FZDA 4UFIA 2ID4A 2GSYA 1BK1A 1K5MC 4O65A 3SEEA 3KMHA 2ZGPA 4PI0A 2RG4A 3SH3A 3VDDB 5IVBA 1TNRA 3K75B 4TN7A 3HEIA 4GMP0 5G04L 2BDRA 3U75A 1WCDJ 3WEZA 2R1BA 4C1XA 5DZGA 1L7RA 1SLCA 5IT6A 5J1XA 1RJ8A 3VN4A 1O8SA 5CKNA 3AZYA 4NO4A 4RL7A 4LA2A 2VJXA 1RUJ2 1D7PM 1LOEA 1A6CA 1R64A 1OKOA 1OUSA 1SLBA 2CY6A 3WVJA 4AOCA 2BOJA 1U5XA 4H3WA 4LO6B 4ZHNA 2B7YA 1W3VA 2VBDA 5JOZA 1PO13 4ONUA 5FPBA 1HX6A 1QQP3 2RM22 1QJY3 1AR63 1RVF1 1Y3TA 3AKRA 4JGZB 5EPAA 4XOGA 5FZKA 4XJAA 4YGBA 1IKPA 2OVUA 4GULA 3P5BA 4XUQA 2RR11 3RJRA 1PO12 3N9LA 2C4XA 2W2IA 1OD5A 1YLLA 1QJX1 1QQP2 3ZLIA 3K4DA 1AR62 1Q5OA 5FZHA 3ME2A 3ZX7A 1O4YA 3UK9A 4MX3A 1AR93 1FPN3 1SCRA 1WZXA 2VTFA 3C3VA 2DVBA 2WYSA 4FOYA 1MS4A 4O61A 5CVRA 3WDXA 4DXTA 2UWBA 2UWCA 5GZCA 2AGSA 2JDUA 4Y22A 3AMMA 4AGRA 4D0QA 3N9PA 2OYZA 5ABJB 3WG2A 1R091 2TUNA 1G7YA 4QD2A 2G9FA 1JU3A 3ROUA 4AFDA 4EYUA 1MZ5A 5BNNB 5IAXA 3DEMA 2V72A 4ARYA 1S55A 1BBT3 2HLEA 2V73A 4LBMA 3Q8FA 4ISQA 1W6OB 2BQPA 4OI4A 1W39A 1L7LA 3WP5A 4XFBA 1XU2A 2RHPA 5LA9A 3WDUA 3CIHA 1JH5A 1NY72 3WOGA 1BBT2 1RUOA 5JXHA 1UYZA 1P8JA 2W39A 1EP0A 2R0HA 5A7PA 3OTFA 2WLQA 1GANA 1ZRCA 2J1SA 5IVCA 3WQ0A 1RB8G 2WWSA 2ZA9A 3LGRA 3H3ZA 1AX1A 3ILFA 4XEZA 2HKXA 3R4UA 5F2WA 4BIOA 4CCKA 2WWJA 2AR6A 1Q3EA 4AWDA 4YARA 4HPKB 3U78A 1PIV1 3N9QA 3ORJA 1ZRDA 2GN7A 3POJA 1LRHA 3ES4A 4UFKA 1WCKA 1W99A 2E7TA 2CDPA 2QQLA 2ZAHA 2VUCA 4XVHA 2ZGUA 2JKXA 5LRRA 3IM0A 4COWA 4P9JA 1ULFA 2VNVA 2CV6A 4JVAA 2GP3A 3HOBA 4L92A 5DXDA 1OF4A 2WQ8A 1VMJA 1IG3A 2WZR2 4KBZA 2R041 4CDUC 1ZYBA 4OHVA 2BFUL 2QZ3A 2HWE3 5F6LB 5LBCA 4Y5TA 1S0DA 3LQCA 2BZDA 2OS2A 2YMZA 1AYM1 3ENRA 3MF6A 3D6EA 1W8WA 2UY8A 3ABZA 3EJKA 2HWE2 3HJRA 1YI7A 4NIAA 2X05A 3BPSA 4C8DA 3JD71 1G6NA 1V9U3 2P17A 1Y9GA 2VZUA 3CL1A 1OA2A 4MHUA 2XUEA 3NJVA 5BNPB 2HWB2 5CIRA 1N3QA 3I97A 4N9HA 1BHGA 4NRMA 3A4UA 2RMU1 3HR9A 1WW4A 2KXLA 4Q4W1 3WT3A 1V9U2 2V5YA 1HDKA 1ND3A 2Q0AA 2VMCA 5FWJA 3IDAA 3AVRA 5A7OA 3HQXA 4Q4V3 5JOYA 4QQPA 1NG0A 4YYOA 5AFBA 3ZFFC 4N90A 3WDYA 2H6CA 3AZWA 1PGW1 1MQTC 1OLMA 1OHFA 2W1UA 3OPWA 1AR83 3C7HA 4QT6A 4UW5A 3ZSLA 3RZKA 3E6DA 5BNOB 4N53A 2W1WA 3PIGA 4CU6A 3WNXA 4XXAA 1NZIA 1X9TA 2A1XA 3CJIB 3D4KA 1UF2C 1SFNA 4LHNA 3ZN6A 2XVKA 3FUOA 4OULA 1ULOA 3RWKX 1N1SA 4LXLA 4FTBA 3S7IA 4P9GA 4CXYA 4EN0A 5J7MA 1UY4A 3H8UA 3NV1A 2NM1A 3BUCA 1UMHA 3N9OA 5LZ6A 3J26N 2XHNA 2JD4A 3WUCA 4OCTA 4YLZA 3ZR6A 1C57A 1BMV1 1E5HA 3CHXA 4QMAA 2OQ7A 1B09A 4Y20B 4YVSC 4D6SA 4BJ0A 3LB9A 1TME1 4B4PA 3MW2A 2ORXA 1Z0HA 1K3IA 2X53S 3A23A 3LA7A 4FOWA 5A7NA 5FMOL 1LECA 2XQXA 1DF0A 3POEA 1HKDA 1Y9MA 2QJVA 1LGBA 3VDDC 1YCIA 2OXBA 2WAAA 4UF0B 1H9WA 2DFBA 4JGYB 4XACA 3T0DA 4FPGA 1POV1 4W65A 1FOD3 3VBHB 4CUCA 5A6QA 2CGPA 1YFXA 4K8RB 4CCJA 2PHRA 4FI9A 3IMNA 2X5IA 2VGDA 5EP9A 4M0NA 1QXRA 4DY5A 1PHMA 3OF1A 4JQRA 1FOD2 5FY4A 5FPVA 4UBHA 1WA6X 1YIPA 1W6NB 4RQPC 2QKDA 5F2SA 4B4QA 5HPOA 1JMUB 4BQXA 2VZOA 4IE7A 4DEQA 2ORZA 2B45X 1J1LA 4JGZC 3WNNA 1VBC2 4RHV2 4Z92B 4KWUA 5IFPA 5A7QA 4YG0A 4AVVA 1HQNA 4I30A 5LA0A 4QX7A 3FUQA 5CFCB 5FOJB 5KHIA 4OZXA 4S2DA 3I49A 3QH6A 1VBE3 2JENA 3WQ1A 5IVYA 4XQWA 3VKNA 3D82A 4TSVA 3DYMA 2JDMA 3VBFA 3BN6A 4XDQA 1F15A 5ABJC 1R1A3 5FY1A 5FZ8A 1VBE2 1DQ5A 1WMFA 4JDNA 1PMHX 1VBA1 3RYKA 5CFDA 2VM9A 3B00A 3T2TA 1DQ0A 1LAJA 2WQ4A 3ZXKA 5F37A 1XYOA 3AZZA 3LDKA 3B7MA 1UIJA 2QUOA 2GNDA 2HEWF 3NVCA 3J9SA 1DGRA 4XFAA 1H8TC 3ZFEB 4RGKA 3BVCA 4XF9A 3OY8A 2KD7A 3H1WA 3FFQA 1GZWA 4N43B 3JQXA 4BK5A 5H9SA 1OLME 2QQMA 2DCZA 3AJYA 4L9BA 5T5JA 3W58A 1OBNA 4A42A 3AMHA 3C7OA 2CHHA 1CZTA 2XXZA 1QJY1 3FX3A 5C71A 2BYVE 1AUYA 2OUHA 2PHTA 2PLV2 5F5AA 3WHTA 1ZRRA 3GDBA 2XL9A 1POQA 2WC2A 5LA1A 3AB0A 4RFT0 5JOWA 1TZOA 2PHUA 4D94A 4OYUA 3GF6A 4JTNA 2ZHKA 3J7LA 1FPN1 4HN1A 3ES1A 4Y1ZA 4C90A 4S2GA 4DUWA 3UT0A 2C6SA 5DMYA 1AYN2 1KJRA 4AFMA 1SLIA 1W6PA 1YHFA 2R1DA 2FZ2A 2GMEA 2ZEYA 4Q0QA 2LRPA 2BU9A 2MEV3 3MIGA 4M4PA 1IQAA 1E57A 1QNYA 4Q1PA 1XOYA 4Y3OA 3U11A 1WA4A 2OX0A 2YGLA 4LA3A 3B01A 3LSDA 3T2OA 3WF4A 1QJZA 4MSVA 1GFF2 4CCOA 2O1QA 2X29A 1OVSA 3WP3A 1KDKA 2MEV2 2R16A 2J1RA 2J22A 4LORA 4P00B 1RHI3 1YEWA 2D6KA 2YFZA 2Y6HA 1YFWA 2ZX0A 4QKDA 4Y1XA 1C1FA 2OPKA 3FLTA 1W2UA 3E5XA 2YFUA 1OPOA 1GUIA 4QPYA 4AEDA 2P3KA 3GCXA 4AHYA 3VB9A 5A3UA 3FHIB 3WG1A 2FDHA 2ZGQA 4A7YA 3VZJA 1HRV1 3VBFC 4QXKA 2UY9A 2YU1A 3MI8A 4XW3A 4R9DA 1NYWA 2VW2A 2VCCA 3AMPA 3O0VA 1ASJ3 1LCLA 3I59B 4XJUA 4XPVA 4Z2WA 2A3XA 2J1EA 4YW1A 1QHDA 4PCRA 2JB4A 2C24A 3QLQA 4JKLA 1ASJ2 4LO4B 4IETA 2GH2A 3RG0A 5IVJA 5A7SA 1HRI2 4LKFA 3H7JA 4Y33A 3WF2A 1HN1A 3WV6A 2GNTA 3T3YA 3WXPA 1LEDA 3KV4A 5DUVA 1XNBA 3CJIC 3WNPA 3NMBA 2O8QA 3THTA 4OMCA 3HD8B 1WW6A 3AP5A 3N3HA 4FPLA 3KCYA 1HJGA 3WUDA 4I3GA 1CAUA 3S0MA 2Y26A 4A45A 3AMQA 5LK5A 3I2DA 2ZHMA 1S0BA 2XWBB 1ODMA 2D98A 1OOPB 1WMXA 5DAWA 3VL8A 2HWC3 4QPGA 4YGEA 2W9XA 1YO8A 3FE5A 4YW6A 4R9AA 1UOJA 4B7KA 4CVUA 3LPFA 3APBA 2HWC2 4GQ7A 4XCBA 2IFRA 3KT7A 4YVWC 1OXCA 4LK7A 2DCKA 3USUB 5BUVA 3O0XA 3QBQA 2RS13 5DDJ3 4AEJA 1BEV3 1T2XA 1VAMA 4CEWB 3VBHC 1BK0A 1FMD2 3SCHA 1OFSA 1S0CA 4XZPA 2RS12 3C7FA 3KLSA 1PNFA 2FQPA 4Q4X2 3WP4A 4ASKA 2QNKA 1H8VA 3LEGA 2DFCA 2FCUA 4PIXA 4U36A 4A3ZA 5I0RA 3DECA 5DQ0A 4DOUA 1WMDA 4XTMA 1DQ2A 4OLLA 3ON7A 1RUD2 4HONA 5GLUA 1CAVA 1S0JA 3FL7A 3ILRA 3K3OA 2W5FA 4NE9A 5F5CA 3RFRA 1SDWA 1W06A 1RUC3 3I8TA 3PUHA 1A3KA 4W4ZA 5F32A 3ZFGA 2IC1A 3VKOA 2JJ6A 2E31A 3DN7A 3LEMA 5FQ0A 1I1EA 5J96B 1OA4A 4MGSA 1RUC2 2TNFA 2WS93 5JLVA 5FO8B 1QJFA 1T6BX 4WVMB 3DV8A 2W3JA 4CUAA 5FZCA 3BTXA 5FO9B 4AHWA 2IVJA 2WS92 5KHGA 1PX3A 1CIYA 3URFA 1LHNA 4BQ4A 5IVFA 2Q8OA 3FFZA 5CYYA 3EB7A 4CZSA 3LIGA 3MIBA 1POV0 3N7JA 3RZZA 3ZMOA 4W6XA 4MXWB 1OQDA 4RS5B 1D0GA 4MYEA 5C3RA 1NXMA 4CP0A 3SLIA 1W9TA 1T6GC 3HMYA 1S2BA 1RMU2 2RS52 1TE1B 2ZHLA 3GBFA 1V6MA 4KWJA 5IVVA 2DBNA 1DIWA 4BU2A 1NA1A 4DRRA 2CGOA 1TG7A 4CCMA 1XNTA 1GMMA 1QXJA 1RUI3 3OEAA 2FDIA 2DCYA 2YGMA 3I2FA 1MS9A 1OC1A 2GC2A 4OVEA 5KHJA 3MUZ1 2YPDA 3PU8A 1HB4A 5T55A 3KSCA 2C26A 4GH4B 4IV1A 2JE7A 3OBZA 1PVC1 5BNQA 3B93A 1NQJA 1UW8A 4UYBA 1GNYA 4LKSA 2PXJA 1RIRA 1H6XA 2NMOA 2VULA 4YSFA 2O0OA 2OKXA 2VUDA 3W5NA 3BB6A 4NHXA 1AF9A 1YJKA 1LENA 5FZFA 3NKGA 2YC2A 2RS33 4GB33 3H42B 2VOVA 1R1A1 2J1AA 4WM7A 3VBSA 4JRAA 4HVOA 5LB6A 1ZZ7A 1RUE3 4QPIB 4BMEA 1RJ7A 3POGA 3BODA 4B1MA 2IXKA 2PQSA 2ET1A 3ZFGC 4E4HA 4IE0A 3VGIA 2PHXA 2W68A 3POBA 3B9CA 1CPMA 1WMEA 1MS1A 4A4AA 1RUE2 3NRUA 5HV4A 2W91A 2BTVC 2JDAA 2RDSA 4AQTA 2VOXA 5CISA 1W8TA 4ZKTB 2QE3A 2AH2A 3JCIA 3PURA 4FPEA 1AL23 5I0UA 4YWAA 3TN93 1UU5A 3O1MA 1S0GA 2RJKA 3AK0A 5CZKA 1H2NA 4Q8KA 4DQAA 1V00A 2D7FA 5FZOB 3L2YA 1W6QA 2XH6A 5A3TA 1AL22 2VMGA 2W95A 2ZKNA 4FXGB 3TN92 2FCVA 1CESA 4FFFA 3VZNA 4LTAA 3FLRA 1SG3A 2VZQA 4CP2A 2H0BA 1QJU2 4YPJA 4Y4YA 1QDCA 1O91A 1MS8A 2A70A 3TRSB 1SPPA 5EJ1B 4NWWA 4ZXKA 1SDDB 4I0BA 2GMMA 1JZ7A 5KXEA 5DAXA 5T54A 2D97A 2WUHA 3ZDVA 2P3IA 3TEZA 4CXXA 3V64A 3HN1A 2ZMKA 1EV13 1REFA 4N9IA 2YU2A 3SXWA 2ZGOA 1UCXA 2N7GA 4B8EA 1UXXX 3UJOA 1CJDA 4HT1T 4RGGA 5FXZA 4NRPA 4P14A 2G19A 2EICA 5CAZA 2PA7A 3LDBA 3BTYA 2VQ0A 5FY5A 1EUUA 4WBBA 5FUIA 1N47A 2RDRA 4LUKA 4TTGA 1RHI1 2OA2A 3O1TA 2GC1A 3KCXA 3N9NA 1HV0A 3T1MA 3VDCA 1V0AA 2DV9A 4P08A 5JR7B 1AR73 3IPVB 4UXAA 1D4M3 5FY8A 5GM0A 4DIQA 4Z1VA 3T4VA 4WVVA 5L9RA 4UT5A 2JECA 3B9IA 3GHNA 4OMDA 1AR72 5IK4A 3VBSC 1D4M2 1MACA 2I74A 4IEWA 1A8DA 1NQDA 2HWF1 2XVGA 3INAA 4HKOA 1BCXA 4PHZA 4QDSA 2FCTA 3KWVA 4LBQB 1ND2A 5J3UA 3LZZA 5BPXA 3TNQA 1W2TA 3FN9A 2IXIA 2WO2A 2Y33A 1O8PA 2MHFA 2IXCA 3OSDA 3RNSA 1H2MA 4IDZA 3DKQA 5LWBA 5HCHA 1ULGA 2HWD1 3EYPA 2GNMA 5D21A 1VALA 2CL2A 1DZQA 1LGNA 2DUQA 1PIV2 3WR0A 5FR3A 5A33A 2HEVF 1QMJA 3TB0A 4XDOA 3ZYGA 1AX0A 4NIHA 3C7EA 2JIGA 3M70A 1UWWA 3AYEA 3MICA 2BERA 3CEWA 4ZXEA 3U4SA 4CP9B 3OB8A 5K0UA 3HVDA 3WCRA 2JG8A 3FBYA 1W0OA 4LO5B 3SH5A 4OI0A 2VZ1A 4KNCA 1YWKA 1CGPA 3HNMA 3PUSA 4Q27A 1YC61 3E6BA 1X82A 2ZACA 1YQ5A 1Y4WA 3X29B 1GOHA 1S2KA 4XQDA 4QWNA 4UFLA 1IS6A 3PVBB 1PO21 3WX5A 4QPWA 4R9BA 5DDJ1 1YIFA 3KS7A 5BV6A 4CA9A 2XJPA 1BZWA 1OUXA 4WZFA 2P6CA 5EQUA 3ZO0B 4NUBA 1UOBA 1V6OA 2ES3A 3I2IA 4M0HA 1FX5A 4LKDA 2ZEXA 2ARAA 1NZCA 2E32A 4DO0A 1XE7A 1H30A 4Q4W2 5DAPA 3O1SA 2B4KA 3JQWA 3Q8EA 4QU1A 5L9VA 2PN5A 5FPUA 4L8QA 4FPOB 1LKNA 5C9AA 4FP2A 4GH4C 2HYXA 2YV8A 1RUF3 4BDVB 5FDBA 4AZZA 4BQ3A 2VUJA 4BK4A 1OSGA 1N3PA 4Y22B 4KH9A 1C4RA 2BWAA 3HNBM 1RUF2 2P34A 2ZKLA 4O7XA 2BUKA 2Z4FA 1ND2C 1ZZCA 3QOPA 3S30A 1DGWX 1O6UA 1KFXL 2RE9A 3OYWA 2BRTA 4GIQA 3MV11 5C3SA 4ZZ8A 1XC6A 2QQVA 2GU9A 3DGTA 3M7AA 4QPIC 3VHNA 3H0OA 4CDQC 1O3RA 5LRSA 3M3OA 4YW7A 1N1YA 2ZX3A 1UU4A 5JSOA 1EAH3 3ZVXA 3J8F3 3TBDA 2I2SA 4ZU7A 1F9KA 1YI9A 3ETQA 5JXJA 1PGL2 4OFGA 2ARXA 3ZYJB 2VMHA 3P3PA 1EAH2 5C3PA 3J8F2 1WUVA 5K0UC 3OD0A 2QQIA
chains in the Genus database with same CATH topology
1LHUA 1R1ZA 1UL9A 1U5ZA 4OHZA 4GKYA 3NWKA 1PMIA 4I09A 2DTWA 4BOWA 4LO7A 2VMIA 1HQWA 4AE2A 2WIIB 4P9LA 1YJLA 2CNAA 1XE8A 4XQ4A 1HIXA 1X50A 1GQHA 3VBUA 5EYXA 1HXS3 1RUJ3 3ZXFA 5J36A 3WHUA 2DVGA 2R063 2C5DA 2E51A 1SACA 5H9RA 2RS31 4GB31 1HXS2 2RM23 4CEYA 2R062 1RITA 2D93A 4XETA 3WCSA 2HEYF 4LE4A 2CWMA 1LTEA 2XLGA 4RQPB 1H4GA 5C9AC 4HSJA 1FXZA 1RUH2 1XU1A 2GDFA 3V0AA 5LEJA 2V09A 3M4FA 3RI9A 4LBLA 4YZ2A 1RUG1 3OBTA 2VW1A 4ATEA 2LUWA 4EWAA 4MV2A 1ND3B 1UD1A 2D43A 3V56A 1NCQA 2EIGA 1XXNA 4OHWA 1YFUA 4META 5F1RA 1UU6A 1OLRA 1X33A 3ZSJA 1U0AA 5JI7A 4IEUA 1PVXA 1PZ9A 4LBKA 3RPQA 2ERFA 4HANA 4RSUA 3ZN6B 3W9AA 4L2NA 2WSUA 5DUWA 4FAHA 5A32A 1PNGA 3OPZA 1H8TB 1Z7S3 4H55A 2XG3A 3ZXGA 2A3WA 1UPIA 1VAVA 1MVQA 5I0SA 3U4XA 3ZXDA 4X6QB 1CONA 3NV4A 3N7KA 1Y7BA 1ALYA 1Z7S2 2BW8A 3ZIXA 4FQZA 3Q9OA 2ZGNA 1TMF2 3VBRA 3AFGA 2R073 4ITCA 2D6OX 3MLLA 4NHKA 4H7LA 1I9RA 1SEFA 5KXCA 1ULEA 1F5JA 2R072 4NOTA 4X8NA 4Q0UA 4Q4Y3 3VBOA 2WZR3 2X5IB 2C0ZA 4Q4Y2 5FREA 2I07B 1REEA 4P9WA 4OUMA 3N36A 3VKFC 1BYHA 3WDVA 1CX4A 1HRV2 2A6ZA 2VNGA 5BXXA 1J59A 1MZ6A 2PAKA 4URTA 3A0KA 2HWB3 4IV3A 2GMPA 1UAIA 4HLTA 5DUXA 1RINA 3AYDA 4XMAA 1RGSA 3VBFB 4R9CA 3BIWE 4LBJA 4XJ8A 4E2GA 2D6LX 2GALA 3HBZA 3OGGA 1RUNA 4CTEA 2YXSA 4HN0A 2K0GA 3MFCA 4Y24A 5GZFA 1OKQA 5I93A 3FJSA 1GR3A 1C8M1 3POWA 5KWRA 4NPRA 5ACA1 1RC6A 3AX4A 3OY8B 1GZWB 1VLNA 3H1MA 4F8AA 3DL3A 2DCTA 5GZEA 2A6WA 5FBZA 2XLAA 2QZ2A 5GLZA 1CPNA 5FAXA 3ZXEA 1QWRA 4MH0E 5FOBB 1U5IA 2WLPA 4PDWA 3VL9A 3AXDA 2B42B 4FPFA 1D2SA 3NV2A 3AP9A 4Q29A 4HL0A 4WM8A 5HXVA 5CA6A 4EN7B 2JX9A 5BNNA 1TEIA 1H2KA 4ES9A 2XPJA 4O9EA 3UV9A 3I7DA 4YVWB 4YW4A 5I8YA 1C8NA 2DWRA 1GNHA 2WFF3 4E4SA 3MEPA 5KHKA 4ASMB 2XJTA 3E5QA 1AHSA 5EXOA 2WFF2 1VBC3 4RHV3 1FATA 5CB7A 2SLIA 4IV3C 1MEC1 2QFEA 4AG4A 5FLIA 4W6YA 3TOJA 4EWEA 3ZIWA 2FZ1A 2XL7A 2XBO1 2ZGMA 4FPCA 2KA3A 4J1XA 3ILNA 3AYAA 1QY4A 3O0WA 4DY3A 2D6MA 5EV7A 1ND3C 2K2SA 4NHMA 1R083 2ZX2A 3FLPA 3AP4A 3RDIA 4LBOA 2QDNA 3VZLA 2FHRA 1IS5A 5T3NA 1OPMA 4V1PA 1R082 2YZ4A 3LKJA 3NAPA 5C8CA 3AJZA 4N53C 4HVQA 2K9ZA 5T52A 1DGLA 3M1HA 1Q43A 3LAGA 4XIOA 2NP0A 4FOQA 4KG0A 1RUJ1 1ZBE3 1IOAA 4AVAA 5BY5A 1DHKB 3RQ0A 3AP7A 1SCSA 4XFFA 4M3CF 5BNPA 3D8CA 1ZBE2 2RM21 2UWAA 4IEXA 4PDWC 3JU9A 4QQ2A 2JG9A 2PLV3 4GMP3 4QPGB 4EROA 2WA4A 4YM2A 1UKGA 3JBG2 2D5FA 1PO11 4LLFA 1QQP1 1AR61 2Z5WA 3KGLA 3KGZA 1U5YA 1VBB3 4OHXA 2D3SA 1AYN3 2A6XA 1KFUL 2XVLA 4AEMA 5HCFA 3HWJA 4PBOA 4AXOA 4BLIA 1VBB2 1AR91 1I6XA 2OUJA 4Q2FA 2MPFA 2X5IC 2BNMA 4A2UA 1COV3 2TBVA 3NKTA 1MR5A 3ZYPA 1UPSA 1CAVB 3EO6A 4RR3A 1RL3A 2IWGB 1H1AA 1COV2 3GZAA 3ZFGB 2AREA 1NY71 2FMYA 5J37A 1BBT1 4Y20A 4QQHA 3RI8A 2EAKA 2Z42A 3RYRA 3SHRA 2HJIA 4BCUA 4YRDA 3PLQA 4BWOA 1DGWA 1Q56A 5T5OA 4CRQA 4JGYA 3L9JT 3IWZA 5GKAC 2P2KA 3BTAA 2ZAAA 2ZGTA 5C8CC 2OW4A 2VUAA 4I01A 1HRI3 4AVBA 2EXHA 2BWCA 1KITA 3U0ZA 4E2SA 1VRH3 2PELA 4NHLA 3VKLA 3ZN5A 2A5ZA 4AI2A 1AX2A 1VRH2 3AMNA 2PHWA 1PK6A 4J1WA 5FLJA 2DUPA 4XE9A 2WZR1 3KB5A 1DQ4A 4I0WB 1NA1B 2X8KA 2ZGKA 5CFCA 2JG9C 2CGNA 4XF0A 2WL1A 2Y38A 2IFWA 3RJ2X 1G9BA 2YYOA 4WVZA 4IEZA 3J4UH 4M3CA 5IK7A 4ISRA 1AZDA 4M00A 2HWE1 3KZ4C 3V0BA 1N3OA 5K8SA 4XF4A 1LESA 4TWTA 2HWB1 3AZVA 3VHOA 1FI2A 2GAUA 4IEYA 1FMD3 4N7IA 1VP6A 1V9U1 4Z8BA 5AVAA 3WD5A 4FOVA 5A3MA 4Q4X3 4XF1A 5CFDC 2PQQA 3VBSB 2LM3A 2Q1ZB 4NWVA 1RUD3 5JOXA 4NN0A 1LHVA 5K7PA 4Q4V1 2GC3A 3R4SA 4N43A 5C4WA 2DVDA 4UW4A 4GALA 1W0PA 4QHBA 1AR81 2E63A 4YZ1A 1WW7A 4AEDC 3R4DB 4MLOA 4QX5A 2PHLA 2YPJA 1J1TA 3AKPA 1CN1A 2PHFA 4AI0A 1DG6A 1PZ8A 3VKMA 4YM3A 1VBD2 5L7OA 3CJXA 2OZ6A 5I0TA 1LOFA 5CU1A 3D0SA 4K8FA 1EPZA 1HV1A 1NCRA 3KD4A 3POSA 3MDPA 3FWEA 2ZMNA 1JXNA 4FTSA 1IZ3A 2VVEA 2HYKA 3QD6A 3ECQA 4LT5A 4G9SB 1RMU3 2E6VA 2RS53 1GZCA 1C3HA 2GNBA 4BM8A 4AGVA 1GBGA 3K48A 2H0VA 4X6RB 4BMBA 1FOD1 3EBRA 1ZBA3 2WT2A 3K51A 1CVNA 4PLMA 2WZPP 1VBC1 3OD4A 4QPGC 2B5HA 5AC93 3UKTA 4BLJA 1ZRFA 1ZBA2 2PFWA 5IK5A 3E5UA 3BALA 5JCTA 4MUVA 4SLIA 5FLHA 3VZKA 5AC92 4OUSA 2JXAA 4FQ4A 1XNCA 3VZOA 3I54A 2XGXA 3VV1A 3CNAA 4M3CE 1VBE1 4DFSA 4LUMA 2UURA 1ND2B 1O3TA 1EPWA 4MGIE 4UW6A 1WLCA 4XMIA 4Y1UA 4AI1A 2ENRA 1YNAA 4CDQB 4E2QA 3M2MA 1ZZBA 2CYFA 2D3RA 1EY2A 1M4WA 1GICA 2VOWA 5BYNA 2ET7A 4R4ZA 1KS5A 5A33B 3LCPA 4LNVA 4E9KA 2VECA 3DUIA 5C8WA 4FVVA 5L7OC 5K0UB 3KT4A 4AQ6A 1LOFC 3HT1A 4DZGA 2AENA 3PTYA 3BPZA 1NCRC 2XJUA 4HKWA 5GLWA 5JDBA 4B4RA 3GYDA 1QJU3 3ZSMA 3CLPA 4QGMA 4XTPA 4AF9A 4CYDA 3ACLA 3RMXA 2XJRA 3W59A 2DTYA 4EWDA 4R52A 1RVF3 4IESA 1Q8QA 1O7FA 1YRZA 3IKWA 1I5ZA 5KXBA 1UN1A 4AQ2A 2WQZC 1QJX3 1X36A 2Z69A 3FC0A 1RVF2 4TLFA 4LHLA 1BJQA 2D3PA 2D6NA 2LALA 3LWCA 2EF6A 3CF6E 2RR12 1NA1C 1QJX2 5E88A 1RUG2 4LR4A 3ALQA 1CAWA 1H0BA 2MEV1 3PVOA 4WVMA 1R093 5E8AA 3GZTB 3DPRA 4GWNA 5C9AB 1FV3A 1OMIA 4IV1C 3M3IA 5J98B 1J3RA 1R092 5FRAA 4I0AA 3CU7A 2XLFA 1DGRN 1G86A 1WW5A 1NE4A 2VG9A 4XILA 1B35A 4HZFA 1AJOA 3GHMA 1QGLA 3M8LA 2IXHA 4YM0A 4FCAA 3PVEA 2AYHA 5EWSA 2VVDA 3OYWB 4WM7C 1GKBA 2WNEA 5CNAA 1ASJ1 2BEOA 3WY6A 4D7TA 2VH9A 1S1AA 1HRI1 2EALA 4CP1A 5T50A 4R8HA 3O12A 4Y1YA 1LOGA 1OLQA 2PYTA 1LOBA 5JPMB 1PIV3 4DS0A 3L2HA 1PM7A 3MIHA 5E1RA 4BQ1A 1NXD1 2ZCWA 5F6KA 1SLAA 1NLSA 1SLTA 2VNRA 3FZ3A 2JKBA 4IEQA 3TYJA 1V6IA 4CDXA 4Q1RA 4CDWA 3SCFA 4LBQD 2BNNA 4INDA 5DZFA 1F8VA 2R043 1ENSA 2WT1A 1V6JA 4FBFA 1V6LA 2HWC1 4XF3A 4X8PA 3R0RA 1MS0A 2R042 3OBRA 4LHKA 3VBUB 1QU0A 3D0JA 1FMD1 3IDBB 2ZPXA 1CIWA 3U07A 4COUA 4Z07A 1AYM2 5CADA 4BPZA 2VW0A 2RS11 5FFOC 4Q4X1 1BEV1 3H3UA 2CTVA 1AL0G 4CEYB 4SBVA 2RMU3 3JD72 4Q4W3 2DU0A 4JAAA 1OFNA 5D8AA 1ZX5A 2RMU2 1AXKA 5DUUA 3VHRA 5IK8A 4BHPA 1DQ1A 4B29A 3PHMA 1XYNA 3WP6A 4QGNA 3BU7A 3V0AB 4ATFA 1RUC1 1CR7A 2WNVA 4XJWA 1H4HA 3TAYA 4K9SA 1WBFA 1L3JA 1K5MA 2VVFA 1PGW2 2Y0IA 3HAGA 4AFAA 1NCQB 4AYUA 2WS91 4B3NA 3B94A 2CAVA 3MLJA 4JRLA 1KJLA 4AVSA 1UIKA 5JZGA 4A7ZA 3BOWA 2GC0A 5F5QA 1LGCA 1LOCA 4XFHA 5FO7B 2B8MA 1LR5A 1TME3 3MPPG 1F2NA 2R0FA 5A32B 1BMV2 1NOVA 5KHHA 5E16A 1O5UA 1O4TA 1ZZ9A 5SV8A 1TME2 4CDXC 3MIFA 4DRVA 4ES8A 5B2GB 4CDWC 1AXYA 2Q30A 2VPVA 2WSVA 1Y43B 2ZBJA 1WCSA 2JG8C 4K1ZA 4MGYE 1EYBA 5GLVA 4AHXA 1KQRA 2D44A 2ZX1A 3R05A 4K6BA 4PLOA 5FPXA 1UZYA 1QF3A 1RUI1 2WINB 4LLOA 3EXUA 2IZWA 4MGZE 3SMHA 3PJQA 5HI0A 4QQLA 4Y1VA 3VBOB 3KQRA 1OA3A 1WD3A 2WJSA 2XJVA 3AYCA 4PF5A 1JHNA 4ASLA 5F9TA 5D8AC 2XHKA 3ZDSA 1CAXA 4YZ4A 1JTZX 1RUH3 1WBLA 2YUEA 5CBLA 4MZUA 1RUE1 2YROA 1Q8SA 1XQNA 1VBA3 2ATFA 4IV3B 1URXA 2WNVC 1XNDA 1JBCA 4XBNA 1BQPA 1VBA2 1QDOA 3GALA 4XJZA 1AL21 4O9GA 1N1VA 3TN91 5JZGC 2GZWA 3A0NA 4OI2A 4EV0A 5AVPA 2ZOEB 1IKQA 3VHPA 1QJU1 4YG3A 3O5SA 1LHWA 1Y9QA 3IDCB 2VXRA 2ETEA 1U12A 2AZ5A 4Q8LA 1MS5A 4K21A 4CDUA 4N53B 1ZM1A 2OIIA 4XXPA 3H7YA 4DPNA 1CD3G 1PGSA 5D1IA 4YG6A 5CG8A 1QJY2 4PLNA 1D4VB 1SFYA 3U10A 2D40A 1TMF3 1DLLA 1BKZA 1EV11 3AFKA 2WNUA 2XJSA 4PDWB 5EZWA 4AVTA 5GZGA 1AR92 1FPN2 1W6MA 1C5HA 4IERA 1D0HA 4JV4A 2UYAA 2DURA 4WM8B 2ZZQA 1KD7A 4IEVA 4MGKE 4KGGA 1VB2A 3ZN4A 3ZFFA 4K1YA 4A7KA 1C1LA 2W52A 1MQTA 2PHDA 3VBUC 4DB5A 4AI3A 2ZS6B 3UKNA 4BE3A 3MYXA 2VY0A 1AR71 4F3JA 1D4M1 2Q5TA 3VZMA 2NLRA 2Q1MA 4KQ7A 4D69A 1HRV3 4CEYC 4TZDA 4KWKA 1LU1A 2DYCA 2Z2SB 3BCWA 4P9IA 2IXLA 4GKXA 2A7AA 3FMGA 4K40A 5JIUA 5SV5A 1XYPA 4D7YA 1UZZA 2FMDA 5C6CA 4DXZA 4F83A 4YVSA 4FPKA 1ZNPA 4DNYA 2I45A 4K7JA 3RYPA 3PNAA 1IGOA 5GALA 3WZ1A 3WINE 1S0IA 1NCQC 2P3JA 4HFSA 3VDDA 2R49A 1DZRA 1DU3D 2EXKA 3NO8A 4NVPA 1FYUA 1G9FA 2QQPA 3NAPB 2W08A 5C8CB 1JW6A 3E97A 1VB4A 2JDZA 3ELNA 5EYYA 4RQPA 1NLRA 3MFAA 1YYNA 4XHXA 5A3LA 4KU7A 4S2HA 4AVCA 4JGZA 3H1YA 2H6BA 1BXHA 4HMZA 4COYA 2DUOA 3RRDA 2WNUC 3I4IA 2JG9B 5FPZA 3VBRC 3SH4A 1KXGA 4H14A 4ZU4A 1APNA 4AFBA 5JVVA 4FSJA 1IPKA 2R32A 5ABJA 5C33A 4S2FA 4YM1A 1QH6A 3O7OA 4L97A 1Q8OA 4Q4V2 5HCBA 1BVP1 3WDTA 1N1TA 2XWJB 3TNPB 1RUF1 3VBOC 2KM2A 3H9AA 1AR82 4YFWA 1W6OA 4HETA 1W6PB 2W0XA 3MPBA 1H8TA 5CFDB 4Q0VA 4JC1A 5J48A 4RR3B 4HVRA 2ZHNA 1CQ9A 1M06G 1V70A 4YW2A 3RWNA 3ASIA 1PGL1 1Q8PA 3LOIA 1EAH1 3J8F1 4AEDB 4HPKA 5JI9A 2OZJA 1ULCA 4K20A 5JIAA 2R6QA 4JCKA 1VR3A 4L11A 3JUUA 2ZTNA 4AW7A 3OGJA 3RMYA 3ZSKA 4LEJA 4MXVA 4ZU5A 1MZFA 4AGGA 2G9GA 1NE6A 2UU8A 3MIEA 3EHKA 4HSLA 5TSWA 4BA6A 1IPJA 2BVBA 1HQLA 1DFQA 1PK6B 4W6WA 4WVWA 1DZTA 1PVC3 2FBEA 1J58A 4E4DX 1HXS1 1SLLA 2R061 4AI8A 1CAUB 4PIZA 1ULDA 1PVC2 3UL2A 4M3CB 3JBG3 1I3HA 2VOKA 3VUOA 1RUH1 3FBMA 3V0BB 4COVA 3V65A 1MVEA 2E53A 2JEMA 1O5LA 4MVTA 4WM8C 4AFCA 1TNFA 2XJQA 3AXEA 5BNNC 2NZ9A 1JOJA 4KG8A 4YNIA 5CG9A 1R1A2 4IEOA 1GYKA 1PZ7A 4PQ9A 1LEMA 1DBNA 4JDOA 1YUDA 5BNOA 4XBQA 3CJIA 1YXWA 1QOOA 3IDEA 2ZGSA 1AVBA 2NN8A 2WA3A 1D2QA 2BGCA 1IS4A 4HBNA 3PMSA 4C0HA 5EJ3A 5C4WB 1KRIA 5HBAA 2D6PA 4XIKA 4PBPA 2NQYA 4QM8A 4H7MA 2EVXA 5JSRA 3H50A 1J3PA 2YHJA 1C5IA 2RJLA 2B9UA 3TWIA 4I02A 5JMCA 2CAUA 5FQ0B 2YDEA 2EXIA 1WD4A 3IT8A 3JB4C 1Z7S1 2UYBA 1VIWB 4QGLA 4Q26A 5L7OB 4YVWA 1ZVFA 1IS3A 1TMF1 3ATGA 1NCRB 2BFUS 3VBHA 4LO8A 3IBMA 2ILMA 3NAPC 1S0EA 3BOPA 2R071 1ENRA 5HCAA 1W6NA 4XBLA 2PTMA 1SQ4A 5I91A 3M3CA 4EN6B 1HW5A 3GZUC 4M01A 4Q4Y1 1JUIA 5T5PA 2VNOA 1RHI2 4P5HA 4OI1A 5BNPC 1ENQA 3MW4A 3NV3A 2IXJA 5I8SA 2LTNA 2DF7A 1FNZA 2JICA 4RGAA 4FTEA 1H9PA 4D3WA 2HWF3 3D5OA 4QU2A 2EAAA 4R4XA 2DCJA 2EXJA 1X7NA 2HWF2 3S7EA 4IV1B 3ZXLA 3MIDA 2F4PA 5BNOC 3IIAA 1UX6A 4IL7A 1G9DA 2HWD3 1YFYA 1ONAA 4QQOA 4C0BA 1OQEA 2YY1A 5LEKA 2HWD2 1DYKA 5GJ6A 3ZFEA 2EA7A 4WM7B 4BYYA 4KBBA 2VQAA 4RR3C 5FTTC 3KT1A 4G3YC 1KS4A 1ZA4A 3NSTA 4P9XA 3GBGA 5FMOS 5IUQA 4E27A 1FNYA 1GQGA 3AP6A 4FO9A 1UMZA 2BVVA 4KU8A 2AUYA 2XB6C 3WW3A 1FAYA 1PO23 1VBD3 1GV9A 4BH9A 1ENXA 4FT8A 4JGYC 2E7AA 3UKVA 3LSEA 1W6QB 1PO22 2NPIA 5L36A 5DDJ2 3RSJA 4QM9A 1BEV2 1OQ1A 4EJRA 4I2OA 2B39A 3QCWA 3WW1A 4Q0SA 1JYCA 4WZCA 2XKPA 2E7QA 1KDMA 1PK6C 1UKRA 2XKOA 5GLTA 4YZ5A 5CFCC 4HK8A 2WFF1 1CAWB 5I8TA 5GZDA 5KC5A 5DZEA 1SBEA 2D5HA 2DVFA 3MZHA 3MLKA 2A71A 1Z78A 3EQEA 3DPRB 3R6SA 5AFEA 4Q0PA 4FAGA 4RHV1 4KWLA 4EN8B 3I59A 4YZ3A 3MF9A 1QOSA 5E89A 4KL1A 1QNWA 4K3UA 2CWSA 1SMVA 4FPJA 2QDRA 1B35B 1SBFA 3C2UA 2DVAA 3CO2A 1LODA 3ZFEC 4RD7A 1HLCA 3ZSEA 5KC6A 1R081 1WLWA 2Y0OA 2A6VA 3PMEA 3AKTA 3WQ7A 1ZZ6A 4LE3A 4N43C 5C4WC 3LA3A 4XYXA 2VU9A 3ST7A 4D7SA 1IHMA 2MNGA 1LOAA 3JB8A 1BVVA 4BZ4A 4FPHA 4YFZA 1OOPA 1F31A 1JN2P 1RUI2 3B5LB 4LBNA