3A4UA

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
228
structure length
228
Chain Sequence
LPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 54
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3a4uA00
1DHKB 1S0FA 2HYKA 2ZABA 4Q2FA 1QOSA 1G9DA 1IKPA 1NLSA 1PZ8A 2AR6A 5JMCA 4PCRA 4K1YA 1QDOA 2ZACA 1N3PA 3N3HA 2DVFA 4LBOA 2VW0A 3V64A 2VW2A 2JD4A 2JJ6A 3FLTA 2GMEA 4M00A 3FUQA 2ZGSA 1Y7BA 1FYUA 1LEDA 2W39A 3OY8A 1DIWA 1LOAA 5DG2A 4AVVA 3RMXA 4DRVA 1GSLA 3NV2A 4PF5A 4Y1YA 3RMYA 1W6MA 1OQ1A 2DWRA 3ZXLA 2FHRA 4Q1PA 1MS8A 5FRAA 3AZZA 1CPNA 4M3CE 1FNYA 4YGBA 2SBAA 1QU0A 1MS5A 2ZGPA 4BMEA 3HMYA 2ZGLA 2AYHA 1W6QA 5F9TA 2ZGOA 4UW4A 2GNBA 3RQ0A 5KXBA 1FAYA 2W68A 4U36A 3DUIA 5DZGA 3O0WA 4M3CF 1CJPA 5IT6A 1UX6A 3R4SA 1AXZA 1GZCA 2A71A 2A6ZA 2ZAAA 1GV9A 2PHRA 2D6LX 3AP4A 3FFZA 1MACA 4R9DA 1WLDA 1BJQA 5JDBA 4YW2A 1V6JA 1DQ4A 3AYDA 3A0KA 1G86A 2JE7A 2SLIA 2A3XA 3AXEA 5JOZA 1FV3A 1JHNA 2JKBA 2FMDA 4XXPA 5T54A 2V5YA 4CTEA 2ZGNA 5H9SA 1CR7A 1CQ9A 5DZFA 1Q56A 1CN1A 2CYFA 4SLIA 2EAKA 4XTPA 1LOFC 2A6VA 3SNMA 1LHUA 4XJAA 1WW6A 2GMPA 3UK9A 4YM1A 4XJ8A 5GZEA 1JYCA 4Y1UA 1HQLA 1SCSA 1MZ6A 2DU0A 2GNMA 3APBA 4OZXA 4BPZA 1YYNA 1JYIA 2GN3A 1LU2A 1PZ7A 2ARXA 2I2SA 1FNZA 4RA0A 3WDUA 1DGLA 1C1FA 4ASMB 2R1BA 3M3OA 3AK0A 5GZGA 5JLVA 1G9AA 2A75A 1VALA 1D0HA 4LBLA 1X50A 4RL7A 5CBLA 2ZGRA 3INAA 4Y22A 2C9AA 4YZ3A 1AZDA 4YG0A 2ZHMA 2GALA 2H0BA 1VLNA 2DTYA 3ZXKA 3BIWE 1V6LA 2ZMLA 1JW6A 3AYCA 1LOBA 1ONAA 3OJBA 3T1MA 1GICA 5DG1A 2PHTA 3ILNA 1QOTA 1W6NA 1F31A 3ZXFA 1IKQA 1APNA 3WUCA 3AZYA 3LCPA 5KXDA 2V73A 4GKXA 4HL0A 3T2TA 3ZYRA 1S0JA 4XHBA 1I3HA 2RHPA 3KM5A 3NWKA 1KJRA 1N1SA 2DVBA 5HCFA 1LOGA 5EYYA 1F9KA 1YIFA 1NXD1 2NM1A 1BQPA 3ASIA 1QNWA 1OKQA 2YV8A 2DUOA 5SV8A 4XHXA 1GLHA 2NMNA 1GNHA 2ENRA 1S1AA 4ITCA 3POWA 4XBQA 1ULGA 3NV3A 5GZDA 4WVVA 4WZFA 2WSVA 3OBTA 1SLTA 5GALA 1JN2P 3PVEA 1LGCA 1LHWA 1MS9A 2W08A 2VH9A 1AJOA 2XB6C 2ZGTA 4AVTA 1AF9A 3N35A 1QKQA 2LTNA 4Y20A 3OY8B 3VUOA 3MPPG 4GWNA 5GLTA 2A3WA 1LHNA 2UWCA 1H9PA 3VKMA 5GZCA 1RINA 4GWMA 3AJZA 3IN9A 2AREA 1ULFA 3VKLA 4P9YA 4GALA 5JOYA 3FBYA 3SH5A 1VIWB 3AZVA 2VU9A 1S0BA 2A6YA 2P3IA 4PBOA 2P3JA 2DYCA 4CZSA 4FQ4A 2YY1A 1DZQA 4YM3A 1UAIA 2A6WA 3IPVA 2ZA9A 1KDMA 1SLIA 4DQAA 2A7AA 4FPFA 1ZA4A 2ERFA 2AUYA 4DRRA 3AFKA 4LBMA 5L73A 4FPOB 1BKZA 1Z0HA 2GMMA 1Q8OA 3WV6A 2WLQA 3ILFA 4FPLA 1ULEA 3NV4A 1S0GA 3USUB 2WJSA 2TEPA 2NYYA 4JCKA 4Q26A 3POSA 4XE9A 4Y20B 3WDXA 1ULDA 1QMJA 5DUXA 5T52A 2DVAA 5IUQA 5GLZA 1DYKA 1DYPA 3UJQA 4K21A 4YZ1A 1LODA 1SFYA 2ZHKA 1ENQA 1GBGA 3HN1A 4XZPA 4LBJA 4K20A 1MR5A 1HQWA 3AZXA 1DBNA 3IPVB 4YGEA 3ZSJA 4YGDA 3N7KA 3O5SA 4BLIA 4DPNA 4JC1A 1W6QB 5EXOA 2Z42A 4PQ9A 1CPMA 1JUIA 4XBLA 1UN1A 4Q1RA 3ZSLA 2E7TA 1WW7A 2GN7A 3AX4A 2EXIA 1Z78A 4YFWA 3WNXA 1O4YA 5GLVA 2WT2A 5E89A 3V0AA 3ZPYA 4LBKA 1ENSA 3LSDA 2R0HA 5AVAA 3ZYPA 4Y24A 1KRIA 1R1ZA 2P2KA 2A3YA 4TYSA 4Y26A 4AGVA 2ZBJA 3AXDA 1V6NA 2NZ9A 2R1DA 2R16A 1GNZA 2D3PA 1GANA 2ZHNA 4L8QA 2EXKA 1UKGA 5DUUA 4XJZA 4LBNA 4XOGA 2P37A 1D2SA 2BQPA 5KXEA 5GLWA 2DVDA 1W0OA 3I8TA 4YW3A 3ENRA 4GKYA 1O4ZA 4TZDA 1RITA 5FREA 2D6MA 5GM0A 3T1LA 2NN8A 4KBBA 5EWSA 1WW5A 1DLLA 1MVQA 4XJ9A 1G9CA 3MW3A 3TB0A 3PJQA 1HKDA 1LECA 1AX1A 3H0OA 1LENA 3HR9A 3USUA 2ZGUA 1HLCA 2E51A 4WV8A 1KJLA 1WLCA 4R9BA 1CIWA 1AX0A 1SLAA 3B01A 5E88A 2AGSA 3AJYA 3CNAA 4FVVA 3N7MA 4LBQB 4YW1A 3RRDA 1FX5A 2UWAA 3V65A 1QOOA 3ATGA 2ZKNA 4U2AA 1LOFA 2PHUA 3SITA 2AENA 2JDZA 1WBLA 3VKOA 1V6IA 1IS6A 2PHXA 2PHWA 2DVGA 4XBNA 3WHUA 1LGNA 1EPWA 1LGBA 1V6KA 4FPGA 4YGCA 2DURA 2ZGMA 1Q8VA 2LALA 2ARBA 1GZ9A 4FPYA 4LBQA 5JVVA 3SH4A 2GNDA 4IQPA 4FQZA 2EF6A 5E8AA 3MEPA 3PVNA 3B9CA 4YG3A 3V0BB 2OUJA 1QNYA 1G9BA 3L2YA 1IS4A 1WBFA 1W6PA 2CY6A 4I30A 3SH3A 3PMEA 5KXCA 1B09A 4ATFA 2D6KA 2WSUA 3C2UA 4Q8KA 1A78A 1SBFA 1UZZA 2Q5TA 3M1HA 3O0XA 4YG6A 4YW5A 2EALA 3FLPA 4BLJA 1IOAA 1JXNA 3AP9A 1KITA 4M3CB 1AX2A 2W52A 2D43A 4YZ2A 1CONA 1UPSA 1SACA 3BODA 1N3OA 2C5DA 3UJOA 3O0VA 5H9PA 2ZZJA 2AH2A 5IK5A 3VKNA 4YW4A 4P14A 3OGGA 3M2MA 4AWDA 1WCSA 4ISRA 3IMNA 3M3CA 1SCRA 1J1TA 1MVEA 3R05A 1AJKA 2CWSA 1OFSA 5GJ6A 3WG3A 1N1VA 4C1XA 3ZVXA 1W6NB 2OW4A 5DUWA 1I1EA 2UWBA 2JE9A 3OYWB 3TAYA 5BYNA 4M01A 1LCLA 4XDQA 1GZWB 1CVNA 1ENRA 1MS3A 1BYHA 2DV9A 3NV1A 4M3CA 1W6OA 4JRAA 4XMAA 2B7YA 4YM0A 1KDKA 2DUPA 2G4IA 4MYEA 2E53A 2VW1A 3M3QA 4XIOA 2YXSA 4Y1ZA 1AXYA 3VV1A 2DUQA 1FV2A 3U4XA 4Q8LA 4BOWA 3V0AB 2E6VA 3N36A 5CA6A 3WVJA 1LESA 1YO8A 5LK5A 3W58A 4ZKTB 1XQNA 4LBQD 1KQRA 2KM2A 2D44A 3GNEA 1FATA 1N1TA 2UU8A 3KQRA 4FPKA 3WUDA 2NP0A 2CNAA 3MW2A 1DQ6A 1HDKA 3D6EA 3QLQA 1UL9A 1JOJA 1MS0A 4H55A 4XMIA 4NO4A 3WDYA 4AGRA 1W0PA 1MS1A 4ISQA 1Q8SA 4XYXA 5EYXA 3WLUA 1AXKA 2WNEA 4YLZA 5T5OA 1QF3A 2EXHA 3IM0A 4XJUA 1DQ5A 2D7FA 1LJ7A 3UL2A 4FPJA 3JUUA 1S0CA 5JOXA 4YZ5A 3WG1A 4Y1VA 1SLBA 1G8WA 1LULA 1V00A 4Q27A 3Q9OA 1QDCA 1LOCA 4PBPA 5CNAA 5HCBA 2D6OX 3JU9A 1VAVA 1ULCA 2D6PA 3GALA 1H30A 2OUHA 2VY0A 4BMBA 4XIKA 1GYKA 1V6MA 2VUAA 4ZXKA 4DFSA 2XG3A 2R0FA 2YROA 4GXLA 3N7LA 1WLWA 2D3RA 1LHOA 1DQ2A 3BTAA 3I4IA 4K1ZA 1DQ0A 1S0DA 2WT0A 1IS3A 4FPEA 5H9RA 5CB7A 3RG0A 4UW5A 4Z8BA 3R4UA 1QGLA 4UW6A 1N47A 1C1LA 1YXWA 3B3QE 4YFZA 4FOVA 4BM8A 2E7QA 2ZMNA 3A4UA 3B69A 4R9AA 4R9CA 3ZXJA 1S0IA 2EXJA 5DUVA 3RSJA 2PHFA 1WD3A 2WT1A 2D3SA 1IS5A 2JECA 4Y1XA 5H9QA 5T5JA 2DTWA 1WW4A 3MW4A 1LU1A 3WCSA 3AP5A 5IK7A 4P9XA 3FUOA 1WD4A 3SLIA 2ZHLA 4WVWA 1W6OB 2ZGQA 3V0BA 1SBEA 1LHVA 3M3EA 3WG4A 1N1YA 5T50A 3WDVA 2YZ4A 3PVOA 1UMZA 4FOYA 1SLLA 1V6OA 4XXAA 3BOPA 2UURA 2ZGKA 2DU1A 3OPZA 1BXHA 1A3KA 1VAMA 1YRZA 2WKKA 2VXRA 5JOWA 1RIRA 4NOTA 3OBRA 2A70A 4AYUA 1MZ5A 2OVUA 3WZ1A 2D6NA 1MS4A 2GDFA 5T55A 4GA9A 3AYEA 3SISA 1UZYA 3LSEA 3B00A 3ZXEA 5DXDA 1GKBA 2GNTA 3WOGA 4FPHA 4CRQA 1AVBA 4YZ4A 1H9WA 4FOQA 5GLUA 1W6MB 3N7JA 1G9FA 3FLRA 3D4KA 2A6XA 2CL2A 1ZM1A 1GZWA 2ES3A 1Q8PA 2CTVA 5IK4A 1N3QA 2P3KA 3A0NA 1W6PB 3ZSKA 3O12A 2WQZC 1DFQA 4FP3A 1G7YA 4F83A 2YMZA 4P9WA 3WCRA 4ATEA 4XILA 4Y22B 3WHTA 3AZWA 5T5PA 4AVSA 3W59A 3AYAA 1C4RA 5CAZA 1LEMA 3D5OA 4UW3A 3WG2A 5F5QA 1WUVA 4D69A 4XJWA 1Q8QA 4HANA 3DGTA 4BQ1A 4W65A 1S0EA 1F5FA 1DQ1A 1U0AA 1A8DA 5DZEA 1BZWA 2PELA 1URXA 4AGGA 3WDWA 1JBCA 1LOEA 2P34A 4FPCA 1SBDA 1CESA 1SLCA 3ZSMA 4FP2A 3POYA 2CWMA 3WDTA 3VKFC 3AP6A 3AP7A 3RS6A 4DS0A 1YI7A 3ILRA 2NMOA 2EIGA 2A5ZA 4C1WA 4XTMA 5IK8A 1PZ9A 5GZFA 5HCAA 3OYWA 1LTEA 1TEIA 4FOWA 2ZMKA 1C57A 3IKWA 4YM2A 5T5LA 3QCWA 2R49A
chains in the Genus database with same CATH superfamily
1DHKB 3EBRA 4DEVA 4RHV3 1BEV1 3PUHA 3SCGA 4CEWC 2GC3A 3U0ZA 2Q30A 4DXSA 3ACGA 4QHZA 5BPXA 3ZYJB 1POV0 1QJY3 1TMF2 2DVFA 4X6QB 4PDWA 2VW2A 2RS53 2HWF3 2WNVA 3FUQA 1DLCA 2ZGSA 3MIGA 1FT9A 3UKNA 4FFIA 1VRH2 3VBUB 1J59A 3PUAA 5I8SA 3RNSA 3RMXA 4QGNA 5JIUA 2VZRA 3GCWA 3RMYA 1D4M2 2BWAA 4CDWC 4UFJA 5HPOA 2WAAA 3ZXLA 4URTA 3NL1A 1PO12 1RHI3 3R6SA 1UMHA 2Y6FA 2ZEZA 5C4WC 2Y26A 1IQAA 2FBEA 2ZGPA 4CDUC 4E4HA 3KCXA 3HMYA 3UKTA 2AYHA 1YC61 5F9TA 1PIV3 1QY4A 1JHJA 1W8UA 2GNBA 4NHMA 1UD1A 1JZ8A 1GQPA 1WCQA 1AXZA 1GZCA 1B35B 2A71A 4L9BA 5C9AC 3K75B 5FP9A 3W9AA 1NX9A 2D6LX 2MHFA 2VECA 5FZEA 1JI6A 1V6JA 5C8CC 1JOPA 4HN0A 1JTZX 5LZ6A 3C7EA 4P08A 3LEKA 2RS31 2XGXA 1FV3A 3LGRA 2RVAA 4HXCA 5T54A 5C3RA 2ZGNA 3BTYA 5H9SA 5JPNB 1CQ9A 2XJTA 4NE9A 1Q56A 4IEXA 3H7YA 4SLIA 1AR73 4BA6A 4XTPA 5FDBA 3CLPA 1O3SA 1WW6A 2IUWA 3ZDVA 3R0RA 3WXPA 1E5IA 1MEC1 1HQLA 5F6LB 1UY3A 4Q4V3 4O9EA 3H9AA 4N43B 1JYIA 1BBT1 1RUD3 1ND2B 1LU2A 1EY2A 1DGLA 1UU4A 3IZOA 1C1FA 4EN9B 5BNQA 1RC6A 1QH6A 1D4M3 3K3NA 4NMIA 4ZXEA 3WNNA 2ZOEB 5JLVA 2TBVA 2OS2A 2VZ3A 4QX8A 1VALA 1X50A 4V2WA 2ZGRA 3WQ1A 2C9AA 1AZDA 2O1QA 3BALA 4YG0A 2XOMA 2Z69A 2OIIA 4OQ9A 2GAUA 1VLNA 3H50A 3MZHA 1V6LA 3DCQA 2WZ8A 4E9KA 1OHFA 4D7TA 4A42A 4LULA 4NIGA 4EWEA 3MF9A 3VDDA 1XE8A 2ZX2A 2VXJA 3ZXFA 2BOIA 4XFGA 1APNA 1CAVA 3HVDA 3F95A 1COV2 1I9RA 3T2TA 3POEA 3M8LA 1S0JA 1W90A 4XHBA 4YNIA 1I3HA 4BJ0A 4O9GA 3BYWA 1X7NA 1N1SA 1VMJA 2DVBA 5CISA 1LOGA 4PJYA 3ZYHA 1F9KA 3TOJA 1OF3A 5CEHA 5FJKA 3B7MA 3WF4A 1DDLA 2NM1A 2RMU3 3ASIA 1QNWA 4D0QA 5KC6A 3P1IA 2R041 2BZDA 4Z2WA 4K7JA 3T4VA 2NMNA 1AUYA 3FX3A 3GHNA 3JQWA 3EO6A 4AF9A 4W50A 5FZGA 1ULGA 1ZZBA 1NZCA 2WWSA 4WVVA 2HWC3 4LK6A 5FZ8A 3VDDB 5JSPA 3WP6A 5F5CA 1CAVB 2W08A 2WS92 1AJOA 1O5LA 3ACHA 4AVTA 1QKQA 4PHZA 1GOFA 1W39A 4GWNA 1ZVFA 5DDJ3 1ASJ2 2VBDA 3VGIA 1RINA 1RUI2 1O4TA 3VBSA 3KT4A 5ABJB 4GALA 2ZAHA 1UYZA 5FYSA 1AR82 2JDUA 2VU9A 1S0BA 2E9QA 5FY1A 2YDEA 4CZSA 1ZZ7A 2YY1A 1DZQA 1GP4A 2BGCA 3IPVA 4MUVA 1KDMA 1W2NA 4CE8A 1SLIA 4ES8A 4DQAA 3VD9A 1VBE3 2ERFA 2WRAA 3ZOIA 5FOJB 4LBMA 3T2PA 5BNPB 4MGTA 1BKZA 1VJ2A 3NW4A 1CX4A 3JD73 2WLQA 4WVZA 1TNFA 5EJ3A 1S0GA 3RVHA 5HCHA 2TEPA 4Q26A 4K6BA 3VZLA 3PU3A 4BWOA 1JZ6A 1ULDA 1HRI1 2YGLA 4Q4Y2 1QHDA 5GLZA 1DYKA 2CAUA 1ENQA 4V2VA 3ZSEA 3W20A 5JSOA 1HQWA 4HSLA 4TXWA 2G9ZA 2O14A 3C3VA 2VUCA 3EB7A 3I2HA 1POV3 2OA2A 2Q1ZB 3IPVB 3O5SA 4YGDA 4YGEA 3ZYGA 2DBNA 4DPNA 1GZTA 3B02A 4WVMA 4PQ9A 1CPMA 1PX3A 3JBG1 4NVPA 4S2FA 3J8F3 4XBLA 1UN1A 2ID4A 2Q1FA 4RS5B 2GN7A 1OOPA 5E6HA 3Q8EA 4RYDA 1J84A 1O4YA 2BJSA 2FCTA 3DKWA 2WZEA 4GB31 3BU0A 1BCXA 3CKHA 5A7OA 5AVAA 2Z4FA 1R1ZA 3KS7A 3ELNA 3NRUA 2Y6GA 4NRMA 4TYSA 4GJZA 5CFDA 4D6RA 5JZGA 3NJXA 2R1DA 1GQHA 5L7OB 1GANA 3N9QA 1GNYA 1XSRA 1BK1A 3JD72 3IDBB 5FP7A 1KGYA 3B9IA 2YC0A 3RWNA 2XQRA 1W0OA 1UO9A 3ZFEB 3DECA 5FUIA 3H8OA 2VD7A 3I2KA 4LE3A 4N7UA 3LDKA 4TZDA 3PMSA 3ZYIB 5GM0A 2XJSA 5I0TA 3T1LA 5A1LA 2WFF3 1DLLA 3CO2A 1RUG1 1MVQA 3HPNA 2JG8A 1J3RA 1S55A 1XC6A 5F3GA 5FUPA 5LBBA 3PJQA 4MHRA 1XB9A 3KGZA 3GJBA 4WM7C 3WW1A 4AEDB 4LO4B 1M06G 2QE3A 1QJY2 1TMF3 1ZBE2 2MPFA 2W0XA 1Q3EA 4WV8A 2WNUA 5LRRA 3T0AA 3USUA 2YYOA 2XVGA 4CCCA 5CFCB 1EAH2 2HWF2 1F4AA 4XACA 1SLAA 5E88A 1YQ8A 3CNAA 3J8F2 5F6KA 3RRDA 4AI8A 2ORZA 3OB8A 4MGSA 3HT2A 3ST7A 4U2AA 3SITA 2AENA 4JGZA 3VKOA 4EN6B 1V6IA 2PHXA 3WHUA 5FLHA 4BDVB 2VVDA 2W1UA 5LK7B 2LALA 4RSUA 1W8ZA 4GMP1 1KFUL 4AI9A 4KQ7A 1YQ5A 2W2IA 2VMIA 5E8AA 1W9WA 1EUUA 1FOD1 3PIJA 3IAPA 4Q5OA 5FPLA 2OYZA 3W5MA 2OUJA 3RWKX 2O8QA 3OUJA 2JX9A 2IC1A 1G9BA 1C8M3 1GR3A 1WBFA 1W2AX 1E57A 3TWIA 5KXCA 1ZZ6A 4TWTA 4ATFA 2ZKLA 2D6KA 2WSUA 3C2UA 5C70A 3FMGA 1PK6A 1UZZA 2ATFA 1RUF1 3M1HA 5ACA1 5FO7B 2VGDA 3ZYFA 1NCQB 4HG6B 2AEYA 2BFUL 2BBAA 2WAOA 4OLLA 1JXNA 3AP9A 4PI0A 4CP2A 3WSOA 3L2HA 5FMBA 5IAVA 2VQUA 2W52A 1SACA 4LA2A 4Q0QA 4B1MA 3LFIA 2ZZJA 5LA9A 3GGLA 4EN8B 4E4ZA 3ZYBA 1L7RA 3U37A 4AWDA 1Q43A 5JPMB 2RG4A 1PMHX 2VBPA 3CZUA 3M3CA 4MADA 1SCRA 1W2OA 4HVOA 4IEZA 4LO8A 4JGYB 4RHV1 5FYCA 5GJ6A 5LBFA 5F3EA 3VBFA 1W6NB 3GZEA 1I1EA 2UWBA 1OA3A 1HN1A 3KV4A 4NAMA 4M4PA 1YQ6A 3E5UA 4M01A 1LCLA 2BGOA 5KHHA 4QQHA 2Y6JA 3RDIA 1R64A 1YQCA 2DV9A 5IVVA 2B5HA 4J1XA 4YM0A 2W87A 5I93A 5JXIA 3B94A 3KCCA 1PGL2 3M3QA 4L11A 1RUH3 1OVPA 3K3OA 3VV1A 4XAEA 5FZMA 3U4XA 3DXUA 5I8YA 4OVEA 4I2OA 2RR11 5CA6A 1YO8A 4HKOA 2Y34A 5LK5A 1XQNA 4LBQD 1KQRA 2E32A 3U07A 1QJZA 4EWAA 1NY72 3GNEA 2UU8A 5FY9A 5FXWA 2ZZQA 5L9VA 2CNAA 3BN6A 4GZ9A 1UIJA 4ASLA 4RQPB 4H55A 4XMIA 3WDYA 3WP4A 3ZN5A 4AGRA 2VZOA 4L97A 4YVWC 4AVBA 5C8WA 3VBHB 1E5SA 4ISQA 1LB2A 4XYXA 1VBA2 5T5OA 4YLZA 4MG2A 4AL9A 1SFPA 3IM0A 4L92A 4CPBA 4COUA 4IXLA 1ZNPA 1S0CA 4B4PA 4KWKA 4UF0B 5JOXA 4YZ5A 1R083 1DGRN 4AQTA 1G8WA 3O14A 3NAPA 2QJVA 4G4FA 3Q9OA 2YBSA 1LOCA 4PBPA 2D98A 4J6GA 3FBMA 2DFCA 3JU9A 4Z07A 1WCKA 4E4SA 4IE0A 1IGOA 4BMBA 3IIIA 1GYKA 2EIBA 2DCTA 4I3GA 3ETQA 2YROA 5J3UA 2W5FA 3BTAA 4UFIA 5FZOA 4K1ZA 5JIAA 3LIGA 4OHXA 1O91A 3RG0A 1FPN1 2B4KA 1XOYA 3NAPC 1UY1A 2Y38A 4UFLA 2J1UA 1FMD2 3ON7A 1N47A 1UYXA 2WFF2 5DAWA 5IVYA 3K4ZA 4JGZB 4BM8A 1ZBA1 2E7QA 4QHBA 1UMIA 1S0IA 1X36A 4IW3A 1CAXA 5A3OA 5A6XA 1WD3A 5D21A 3MW4A 4B4QA 1AHSA 1UZVA 2Y0OA 4Q4V2 1DP0A 2C9KA 3ZN6A 3AVRA 4JHZA 1W6OB 2I74A 3CJIB 5D8AA 4XFIA 1N1YA 4LKSA 1S4CA 2FCUA 3MFAA 2YZ4A 5FYYA 4LITA 1BVVA 1VBB2 5FPXA 2G9FA 1V6OA 3ACLA 3TRSB 1JUHA 1IPSA 2CGOA 2UURA 5LB6A 3ZMNA 1QQP1 2DU1A 1BXHA 2RDQA 2VPVA 3EQEA 3OPZA 3X29B 1JZ4A 5D8AC 5FP3A 2B39A 2RS33 2XWBB 1O59A 2C6SA 3SKJE 5LBCA 4P5YA 4A7KA 1JU3A 3VHNA 2VJXA 3D8CA 3DN7A 5K8SA 1W3VA 2OVUA 2P5BA 5FUNA 4H7MA 1CAWB 1K5MB 4W6WA 3LSEA 3ZXEA 1S2KA 5DXDA 5LW9A 2QNKA 5CFCA 5IFTA 2QTWB 2Z5WA 3P3NA 4HN1A 2MEV3 1FMD3 3AKSA 2W1WA 3D4KA 2D40A 5I0DA 2ZS6B 1QJU3 1GZWA 2ES3A 1Q8PA 4IEUA 2CTVA 2QQJA 3CMGA 2P3KA 3S57A 1M4WA 1AL22 3KV9A 2AZ5A 4CCEA 4Q0SA 3OUIA 5A7SA 4FP3A 3SHRA 4ASKA 1G7YA 4DEQA 4N9HA 5FYTA 1O8PA 1VAKA 1WMEA 2XDVA 2G9GA 3HNYM 4P9WA 3WHTA 1C3HA 2A1XA 5J1XA 3VZMA 4N53C 1TVGA 2YC2A 4AVSA 1TME2 3AYAA 4QXKA 2PAKA 4XUNA 3D5OA 3UGGA 4UW3A 1WUVA 1E5HA 4XJWA 2GH2A 2RJLA 4W65A 1DQ1A 2J1VA 2VTXA 1JBCA 2P34A 1LOEA 1XJAA 2AC1A 2H6BA 1NQJA 2XONA 3A22A 4KGGA 4AHXA 4NJ4A 2OPWA 4CDQA 4JVAA 5F2WA 2HWE3 5C9AB 3WDTA 3AL5A 3RS6A 4DS0A 5JAXA 4YARA 3ILRA 1YI9A 2R062 2XJQA 4A2UA 3MV01 3WNLA 3LPGA 4AZZA 4DZGA 3AC0A 1ZRDA 3OYWA 3HQUA 4B4RA 1ZBE3 4GWIA 4YM2A 3EMRA 5T5LA 5HV0A 2WIIB 1HRV2 2HYKA 3LIHA 1EV12 3VBOA 1PIV1 3MIFA 4META 4ZU4A 5FPAA 5LWBA 1IKPA 1NLSA 1PZ8A 2ET1A 4K1YA 1QDOA 2ZACA 3OGJA 1N3PA 2VQ0A 3N3HA 3LDRA 1NG0A 4TSVA 4LBOA 5FZCA 4BISA 3O1UA 1AL23 4LA3A 5FZ6A 4MXWA 3MLKA 4LNVA 2HWB2 4IGOA 4AI3A 4IERA 4JGZC 2JG9C 2F17A 2W39A 4UWDA 5FOBB 5JXJA 3IDEA 5KBFA 2VCCA 2WDBA 3D3AA 5BNOC 3E6CC 1W6MA 4H2AA 4N90A 5I0RA 3NVCA 5FYZA 3D0SA 2QQOA 4LHKA 2X5IA 1JMUB 1AYM2 3KD4A 1CPNA 1STMA 2TNFA 2VTXJ 4M3CE 2XJUA 2XUEA 4YGBA 2QQUA 5A32A 1RUJ2 2ZGLA 5KXBA 1J3QA 1FAYA 2W68A 3DUIA 2RDRA 3O0WA 2R30A 2NQYA 1KS4A 1UX6A 4Z92B 1PGW2 4BXFA 2ZAAA 2Y0IA 1J83A 1OOPC 3AP4A 4FFGA 3KZ4C 3FFZA 5F37A 5FIXA 1RUH2 3QACA 5JDBA 4YW2A 1KFXL 3AYDA 4OUEA 4QPIC 3A0KA 1XE7A 3AXEA 4RFRB 2RV9A 1OPOA 5FZBA 2JKBA 1CGPA 4S2GA 2R071 3J9SA 1RVF3 3JB8A 2WUHA 1K5MC 1CR7A 2XLFA 1XYPA 1CN1A 2CYFA 1NCQA 2PN5A 1PVC1 3ZKYA 4M0HA 2A6VA 2XBO1 2JENA 3SNMA 1J3PA 4YM1A 1ENXA 5FYBA 2W92A 2FCVA 3E5QA 3IDCB 5K0UA 4O7XA 2NLRA 2DU0A 2GNMA 3APBA 3OOXA 4OZXA 1YYNA 5IVBA 2I2SA 5DQ0A 3WDUA 4XQWA 1H2LA 3CF6E 2X05A 4COYA 4NPMA 3VN4A 5F5AA 3M3OA 4J1WA 1AYN1 5GZGA 1HXS1 2A75A 3BUCA 4LBLA 4RL7A 1QJX2 3INAA 3FHQA 3I3EA 4YZ3A 1ALYA 4LO7A 2WBKA 3NKGA 1R081 1U5IA 3RZKA 4C0BA 2DTYA 3C7HA 1JW6A 1V9U2 1BBT2 4A41A 1LOBA 3OJBA 4CEWB 1Q5OA 1GICA 1PNFA 2XKOA 4CXXA 3G6JB 4EN0A 1R1A1 2BGPA 2YPDA 3BOWA 1QOTA 3J7NA 1F31A 2QCSB 2CV6A 4L0PA 5FZ7A 3GBGA 4AAXA 1KXGA 4YVWA 4E8CA 1X8EA 4UI9L 2CGPA 2ZX1A 4AK3A 1FPN3 1L3JA 3KVAA 3I3DA 5C3OA 5F8PA 4LKEA 2J1AA 5KXDA 3AM2A 1CAXB 1Y3TA 5FYMA 4QKNA 4LOSA 1KJRA 1YEWA 5EYYA 1WA4A 1ZRRA 1VPHA 3VZOA 3ZR6A 1TME3 2CU5A 3SCFA 4XQDA 1NXD1 3LOIA 1BQPA 1I5PA 5J98B 4LQRA 5C33A 4A3XA 1GLHA 1NLRA 3RZZA 1D7PM 3K4DA 2ENRA 4CU7A 2A73B 1REFA 1H2MA 1SZBA 1R092 2WS93 2E31A 2Y64A 3POWA 4L99A 4R4XA 4RD7A 4XUPA 4CEWA 4XCAA 2YU1A 1SLTA 5GALA 1J1LA 1JN2P 2HLEA 1JYXA 3PVEA 3BI3A 3CHXA 4XETA 4AEMA 4ZZ5A 4DXRA 4N53A 4QMAA 4QQLA 2LTNA 2A3WA 1RHI1 4YWAA 1LHNA 2XKPA 4YPJA 4XF0A 1XYNA 1US2A 3AJZA 3IN9A 1EAH3 3GBWA 1VIWB 1IPJA 2I07B 1ASJ3 2P3IA 4XFFA 5DN2A 4PBOA 2DYCA 2ARCA 4YM3A 1UAIA 2A6WA 3P6BA 3MI8A 1U5XA 5K9YA 1W28A 2QUOA 3JXSA 2XLAA 4BYYA 2A7AA 4FPFA 4R8HA 3Q8BA 4IE6A 4Y5Z0 4CYDA 2YB7A 5KHIA 4AEDA 2G1MA 4FPLA 3KCYA 5JR7B 1V0AA 2BWCA 3USUB 5F2SA 3ZFEC 4LEJA 3S5AA 3POSA 2IXKA 2XVKA 5EIYB 4Q29A 4Y20B 3WDXA 2F6BA 1QMJA 3SKVA 5J09A 5A7WA 1VBC1 1BVP1 3MGUA 3N9MA 1BEV3 1AR71 3EHKA 4Q4X1 3T4HB 5IUQA 1CD3G 2F4PA 2X8KA 4MH0E 4K21A 4NRPA 4YZ1A 1LODA 2ZHKA 3D82A 3HQRA 1GBGA 1IHMA 4PLMA 4LBJA 4XZPA 5DAPA 2PYTA 4OHZA 2ADEA 5FYUA 1VBE1 4NHKA 4LHLA 4IV1C 3ZSJA 1Z7S1 1VBA3 3N7KA 4BLIA 4CUCA 1HB2A 2VZPA 4JC1A 1MPXA 3MV11 5EJZB 3F2ZA 3PUIA 2Z42A 5FKBA 2P4EA 3LKJA 4Q1RA 3FHIB 3AX4A 1HIXA 1UWWA 2EXIA 2K46A 4IEQA 3FJSA 2RE9A 4Q4Y1 4IV1A 1SDDB 2X5IB 2XH6A 2XL9A 1NUKA 2R0HA 4QGMA 4BB3A 2YFZA 3RYRA 1PK6B 1QIQA 3M3IA 3QOPA 3WD5A 4AGVA 2VC9A 3ZFGB 2BV4A 3KVBA 1V6NA 1K5JA 4ZS2A 1W2TA 2R16A 1ND2C 3U75A 2ZHNA 5DUUA 4XJZA 5C3SA 4MXWB 1C5IA 1PHMA 2P37A 2JG8B 5HXMA 2JD9A 4MXVA 2BQPA 1X8MA 4CDQC 4IEWA 4OQ8A 3VDDC 4NUBA 2K9ZA 4GKYA 4QX5A 5FQ0A 2Q1MA 4ZPIA 4QXCA 4QDRA 5F32A 3PJYA 2VMEA 2VOTA 2WL1A 3I7DA 1WW5A 4KBBA 4P5HA 5EWSA 2WLPA 4QAWA 1G9CA 3MW3A 3DPRA 3TB0A 2WQ8A 4D6QA 5FMDA 1UU6A 3R4DB 1LENA 5FPZA 1OD3A 3AKTA 3I59B 2XVLA 1ZX5A 3HR9A 2E51A 3S6PA 4BK5A 4IV3C 1WLCA 4RFT0 1AX0A 1OLMA 3NO8A 3B01A 5FZAA 5LCWL 2AGSA 4FVVA 1XU2A 4EV0A 4XEZA 2ORXA 2W1SA 1FX5A 2IXCA 2UWAA 3MUZ1 1Y9QA 4YSFA 3VZKA 3ATGA 2CAVA 4QX3A 4KL1A 2FQPA 4AI2A 1WBLA 2PHWA 2RS52 1H1MA 5BNOA 5C5TA 1V6KA 1EPWA 5K0UC 1RUNA 1SFNA 2VUDA 1WCDJ 5FFOC 1W9TA 1MQTB 2ARBA 4JDOA 3T09A 4FPYA 1RUC1 2VO5A 4IQPA 3ZDSA 2WNUC 1RVF1 1VB4A 2ZEXA 2VBBA 3AKRA 3I2JA 4H7LA 3MEPA 3PVNA 4LHNA 1W03A 1MZFA 4K8RB 3I59A 3UYJA 4GH4B 3AKPA 3TEYA 3NNLA 4UBGA 2CY6A 4IE5A 1JZ3A 1PX4A 2RS12 1OLME 4UF0A 5M0TA 2Z79A 1B09A 4X8PA 2Q5TA 1SBFA 4YG6A 5FTTC 1C8M2 4FI9A 1S2BA 5FXZA 3FLPA 3THDA 4FSJA 4UAPA 1YJLA 2KD7A 1HN0A 4M3CB 1AX2A 2BFUS 3DF0A 4IESA 2HWE1 1UPSA 3BODA 1N3OA 5A3MA 3THCA 1W8OA 2VM9A 3PNAA 5FYVA 3BKZA 2AH2A 4LKFA 3VKNA 3RZLA 3MIBA 2E63A 3OGGA 4JX0A 4CDXB 4C91A 4R4ZA 3CU7A 5C6CA 4CDUB 1J1TA 1MVEA 3R05A 2CWSA 4DINB 4E27A 3GF6A 4K3UA 3WG3A 2RMU2 1F8VA 5DUWA 2HBUA 4LLFA 4YVWB 3VBHC 1KS5A 2CGNA 2JG9B 4ES9A 3OGRA 3H42B 2PHLA 3TAYA 5BYNA 2V4VA 5FAXA 1XU1A 3ZN6B 1MS3A 4ZY9A 2PAEA 4M3CA 1W6OA 3PUSA 4PQQA 1VR3A 4QQPA 3VBRC 4MYEA 3NMBA 1BEV2 1VBD2 2Q4SA 3OGVA 1AXYA 3CJIA 3VBOC 3PTRB 1FV2A 4PDWB 2DCJA 4RQPA 3S5QA 1YQ2A 2WABA 1NXMA 3N9OA 2E6VA 5FP8A 4BQWA 5IVEA 1UW8A 3ZFGC 3W58A 4ZKTB 3KB5A 2BBVA 1WMFA 3C8XA 1RMU2 1VMHA 2D44A 3A23A 1FATA 1N1TA 1O7FA 4AQSA 3KQRA 5FMCA 4QPGC 4DMIA 3MW2A 4DOUA 4LO6B 2Q8EA 3D6EA 4KG0A 1JOJA 1D4M1 2AEZA 4NO4A 1W0PA 1MS1A 1WWYA 2Y8KA 1CWPA 4OCTA 3WLUA 5J96B 1AXKA 4OI1A 2EXHA 1DQ5A 2D7FA 4CEYC 4O65A 1RUI1 4QPGA 4CVUA 4KU8A 3OTFA 3K77A 3OG2A 4ET7A 5CG9A 1DCSA 1AR81 1JH5A 2V72A 3VLBB 5AC91 4Z2AA 4D3WA 1VP6A 4HONA 1QDCA 4NRQA 4NROA 4OI4A 2WN3A 5EV7A 1JZ7A 1VAVA 4ARXA 1ZREA 1TZOA 1HV1A 2YC4A 2TUNA 3MHZA 1V6MA 2VUAA 5LATA 1WMXA 2PQSA 4LKDA 2XG3A 4ZXKA 4DFSA 2VZTA 1K42A 3N7LA 4BE3A 1DQ0A 2WT0A 2YGMA 4FPEA 3RPQA 3KV5A 4HPKA 4UYBA 5BNPA 4UW5A 1DU3D 1CZTA 5A7NA 1OVSA 4JTOA 4UW6A 2VOKA 5JZGB 1YXWA 1OSGA 2VNRA 3FN9A 4UFHA 4DRVA 3A4UA 3B69A 4QX0A 5CZKA 3M4FA 5DUVA 5FPBA 5FZIA 1TNRA 3SQOA 2P17A 1ND2A 5L36A 2JECA 4Y1XA 2DTWA 4HLTA 1OA4A 3WCSA 3AP5A 4UFKA 5DAQA 4P9XA 4KI5M 2HEWF 4K9SA 4N53B 1WD4A 4YVSA 1ACCA 2ZHLA 1V70A 1ZA7A 3NNGA 4LJHA 1SBEA 3M3EA 3SEEA 2OT7A 1FPN2 1GWMA 3E6DA 4QB6A 1QH7A 4CCOA 3WDVA 1YJKA 4INDA 4KG8A 5EJ1B 2BOJA 1OLRA 1UMZA 3PVOA 4F7ZA 1QJU1 1SLLA 2QVSB 4FFHA 4A6SA 1UOJA 2ZGKA 4RS5A 1ZZ9A 1VAMA 1RUG3 2VXRA 1VBB3 2PQQA 3CL1A 3GZTB 2A70A 3WP5A 1YFXA 3KT1A 4CDXC 3RZHA 5AFBA 1MZ5A 3FWEA 3WZ1A 4LOTA 1XPWA 3HN3A 1HW5A 2RS13 3UNPA 5T55A 2EVXA 1E5RA 1MZEA 2OZJA 4NPRA 5ABJC 1O5UA 2WO2A 1ODMA 3BCWA 1GKBA 3IAQA 3ACFA 4URAA 1PNGA 2VTFA 1NLQA 3OPWA 1NZIA 1W6MB 3CZJA 3N7JA 4JGYC 1AR61 5A7WB 2MNGA 3FLRA 4JAAA 3ZN4A 4QDQA 4XURA 2CL2A 4HSJA 5FLJA 2VVEA 5CKNA 4ZU5A 3ZSKA 1FI2A 2WWJA 4HVQA 1GWLA 3O12A 5CVRA 2WN2A 2WQZC 5DABA 1DFQA 2QQMA 3MPBA 1VRH3 4QPIA 3WNMA 1RUE2 2D93A 3WCRA 1FOD3 4MLOA 4F8AA 4CCJA 2X53S 4HKWA 5AFEA 3LEMA 2H0VA 5EP9A 3IWZA 2WQ4A 3WG2A 4D69A 3HNMA 2XJVA 2ZEWA 2ETEA 4AAPA 5IHRA 3EJKA 1F5FA 1U0AA 4NHLA 1A8DA 1BZWA 2PELA 1URXA 1WA6X 2O8OA 2VUJA 3WDWA 5A3NA 5KWRA 3JBG3 3UETA 2JWPA 4AFBA 1AL21 1QXRA 5FK8A 3M7AA 4W8JA 1LAJA 3POYA 3AMMA 2ZCWA 3KSCA 2Y6HA 4B8EA 4HFSA 3HEIA 4GB33 1PM7A 1X9TA 5BNNB 5FWEA 2A5ZA 3TBDA 3LEIA 1ST8A 1A34A 1LTEA 4P9IA 4FOWA 2VZ1A 2Z2SB 3QCWA 4N9IA 2R49A 2QDRA 4JTNA 1S0FA 5C71A 5B2GB 1QOSA 1G9DA 1HQNA 2AR6A 5SV5A 2HWB3 4QU2A 2J22A 5JMCA 1NCRC 1TG7A 3E97A 2PHDA 1JS9A 4AFMA 5FYIA 2JDMA 2VW0A 3V64A 5A1AA 1H8TC 1ZRCA 4D8MA 5JZGC 3FLTA 3E1F1 4L2NA 2GMEA 4AVCA 3T0DA 4LPLA 1Y7BA 1FYUA 1RUD2 1AYM3 1DIWA 1LOAA 2IXIA 3FHAA 5DG2A 5F39A 2CSGA 3THPA 4AVVA 5IVJA 3VDCA 4O61A 4PF5A 4GWJA 4Y1YA 5LEKA 5HI0A 2VE1A 2W95A 3DXTA 4AQ6A 4KWUA 1UKRA 5LBEA 2GP3A 1EV11 4FCAA 3BVCA 2SBAA 1TMF1 1MS5A 3I3BA 1W6QA 3ME2A 4DB5A 1UU5A 2BVBA 5I0SA 3RQ0A 3WX5A 2OQ6A 4U36A 4LT5A 5IJRA 5DZGA 3WR0A 1CJPA 2WA4A 3CJIC 5CFCC 2EICA 3WF3A 4YRDA 4GB32 4CA9A 2PHRA 4GD4A 1PO11 5FY8A 1MACA 5FMOL 3WW3A 1BJQA 2GZWA 5KHJA 1QQP3 4IEYA 1W8TA 5BV6A 5C7GA 1PMIA 5JOZA 1HXS3 1BLZA 1A6CA 2FDJA 2P1BA 2RR12 4CTEA 2V5YA 1RUJ1 3HJRA 3AMPA 5DZFA 1D4VB 1VBC3 2XR4A 2XHNA 2FDIA 2IXHA 2VQAA 3RZGA 1JZ2A 1LHUA 4XJAA 2GMPA 3UK9A 5ISLA 4XJ8A 3PU8A 5C9AA 3E5XA 4Y1UA 5BUVA 2GC1A 2E26A 1PVXA 1MZ6A 4BPZA 1GP6A 2P3YA 2GN3A 3W5NA 4HZFA 4EZ4A 3K46A 4DXTA 1VBA1 1PZ7A 2ARXA 1FNZA 3ETPA 1OPMA 3KGLA 4B29A 4LHSA 2FDFA 3ZX7A 3B93A 3VZJA 5ANNA 1U12A 2HWC2 3AK0A 5E1RA 2D97A 1VB2A 1G9AA 3GZAA 1D0HA 5CBLA 3LE0A 2BERA 4Y22A 5A3PA 4QM8A 4P02B 2IXLA 3GM8A 5DDJ2 2H0BA 3NQHA 4AI0A 2HBTA 3AKQA 1J58A 2QQPA 2FDGA 1OMIA 5I0UA 3ZXKA 4GULA 2ZMLA 2OXBA 3AFGA 1YCIA 3AYCA 1XYOA 3I3MA 1ONAA 4V1PA 3T1MA 3WW4A 3WNPA 2VMGA 2VZQA 4AEKA 5FYHA 5LEJA 4KMQA 3MBWA 1IKQA 1HXS2 1W8NA 2BVVA 4C90A 2MEV2 3LCPA 2HYXA 4WM7A 4GKXA 4HL0A 3ZYRA 3RZJA 1H1IA 2UYBA 4JKKA 2RHPA 3LZZA 2YPJA 1UCXA 1XNAA 3KM5A 3MDPA 4KWJA 2OZ6A 2QQWA 3AMHA 4XZUG 4CXYA 3BTXA 1UZ0A 1YIFA 4IV3A 4NAOA 3MF6A 4XUTA 3WNOA 2KXLA 2YV8A 5APAA 2DUOA 4QM9A 1ASJ1 4PLOA 2ZTNA 4MVTA 3PL0A 1GQGA 2BDRA 2JDKA 4XBQA 3OBZA 3IT8A 3NV3A 2ARAA 3FZ3A 5GZDA 3IIAA 1TQ5A 1W05A 2XLGA 3I2IA 4IV1B 4DO0A 2Q8DA 3ZR5A 5A70A 1LGCA 1LHWA 4WVMB 5EQUA 1OF4A 2VH9A 2XB6C 1WZXA 2VQTA 1AF9A 3MIEA 3BU7A 2RDNA 3H1MA 3ABZA 4P00B 4BCUA 5GLTA 3RYPA 4HBNA 4NHXA 1RGSA 4PDWC 3ZKUA 4PIZA 3SCHA 1H9PA 5GZCA 4B7EA 5T3NA 1OQEA 3T0BA 2AREA 2WZR2 4P9YA 5JOYA 4LXLA 4CP1A 3AMNA 3H7JA 2P3JA 1OQDA 3NNFA 4JZRA 1HRI2 1UYYA 2WS91 3TNQA 5L7OA 1NOVA 1HJGA 4M0NA 2BNMA 4DY3A 4X8NA 4DRRA 1US3A 3AFKA 3VD3A 4LR4A 1Z0HA 2LW8A 1Y4WA 1Q8OA 4CUGA 4NR1A 3KQ4B 4Y5TA 1VBD3 1RUE3 4TN7A 3ILFA 1ULEA 3NV4A 5JWPA 2WJSA 4JCKA 4MOAA 4CP9B 3S0MA 4XE9A 1NY71 4XF3A 1OLQA 3UV9A 3WY6A 4TLFA 5T52A 3TNPB 5KC5A 2DVAA 1UXZA 3BB6A 4OULA 5AVPA 3U11A 1X9PA 4JQTA 3VBUA 2XBO3 4Q4W2 3TN92 1YFYA 3VBHA 1RXGA 1T6BX 5AC93 4OHWA 1SFYA 3HN1A 3CJXA 3I97A 4FFFA 3KT7A 2JDNA 5A6YA 4IEPA 4K20A 5LA1A 4XFAA 5EPAA 4AFDA 3AZXA 3NSTA 3ZXAC 5CADA 4PIYA 3ZFFA 3LEGA 2ILMA 4QD2A 4W4ZA 3MUY1 5EXOA 4D7YA 1S2EA 4E2SA 3VDAA 1JUIA 3QH7A 3GYDA 1AYN3 2LM3A 3G7DA 3ZSLA 3TEZA 3I49A 1F15A 1Z78A 4YFWA 3WNXA 2VMHA 1W3XA 1AR72 2WT2A 5E89A 5GLVA 3T2OA 3V0AA 2FD8A 2YU2A 3WP3A 4LBKA 1ENSA 4LORA 4PLNA 3HBZA 3ZYPA 4Y24A 1KRIA 2QKDA 3NJVA 2PA7A 4A45A 2O0OA 2RS32 5A6QA 2WNUB 2BUKA 3I54A 2ZBJA 4WM8B 1VBE2 4D7SA 4AVAA 5G04L 1FMD1 1GNZA 2YBPA 3JBG2 3PUQA 4HOOA 1Z7S3 2EXKA 1H6XA 4MO3M 1W8FA 2HWB1 2N7GA 2WYFA 4XOGA 5A80A 3U10A 3KHBA 5CU1A 2QQKA 5GLWA 2DVDA 2HWD2 1F5JA 4JV4A 4YW3A 4XF9A 2PLV2 2HWF1 5FZ3A 5TSWA 1O4ZA 2JDAA 2R073 2VAUA 4NIAA 2Y33A 1AYM1 1RITA 5FREA 4COZA 4GQ7A 1UX7A 2NN8A 4IDZA 2VCAA 4XJ9A 5A3UA 1HKDA 3H0OA 1O6UA 2P6CA 3IMMA 3PDQA 4RN5A 2JDHA 2HEVF 4GH4C 1NE6A 4QPWA 4XPVA 3VD4A 3I2OA 4AHZA 5BNNA 1PGW1 1HLCA 1ZZCA 2ZGUA 1KJLA 1B35C 3OBAA 1HRV3 1OH3A 4MZUA 1CIWA 1QQP2 4HETA 4R9BA 4P9JA 5C8CA 3RJRA 5KHKA 3A7QA 3AJYA 3JZVA 4RR3C 4CDUA 5IVFA 1F4HA 1G6NA 4G9SB 2JB8A 4WBBA 3USSA 3HWJA 4XFBA 1IS6A 5CKQA 4JHTA 4XBNA 1Y9MA 2KR2A 4WZCA 3P3PA 1LGBA 4FPGA 4YGCA 3BTZA 2DURA 2FZ1A 3MO4A 1ZBE1 1Q8VA 3VDBA 1DZTA 5ABJA 1GZ9A 4LBQA 3WF2A 1ND3B 1EAH1 1RXFA 2GNDA 1COV1 5JVVA 4B1LA 2EF6A 4QQ2A 1QXPA 5FMOS 2B46X 1W6PA 1W99A 3J4UH 4HKLA 4I30A 2BTVC 5FKCA 2VVFA 1UQXA 1PO22 5HXVA 4QPGB 1VMFA 2JXAA 4Q8KA 1A78A 1NA1B 2R042 3O0XA 4G3YC 3WT3A 3H3ZA 5CG8A 1W8WA 3UESA 1GFF2 1BHGA 1IOAA 1OI6A 3AMQA 4ORFA 1RB8G 1QJX1 4EN7B 4AOCA 2JB4A 4QT6A 4FT8A 1TME1 4YZ2A 1CONA 2XJRA 4XQ4A 4XDOA 3RYKA 3UJOA 3O0VA 1BMV1 3K2OA 3GHMA 5FZLA 2EIDA 4ZU7A 4AW7A 5IK5A 1V9U1 4CU6A 3OCPA 4HPKB 5F3CA 1WCSA 4AE2A 3WF1A 2FMYA 2JICA 3OEAA 1PK6C 2PXJA 1R1A2 2QQVA 2XQXA 4MGYE 5D2AA 2EIEA 3ITQA 3J26N 1YWKA 1HB1A 3FE5A 1SHWB 3ZVXA 3OD4A 5A33B 2OW4A 3H1YA 3VBSB 4AQ2A 2J1RA 5J36A 2JE9A 2IFRA 2Q0AA 1OOPB 1W04A 1GZWB 1CVNA 1ENRA 2PTMA 3EXUA 3WF0A 3H8RA 1LR5A 4JRAA 4BU2A 4NIIA 2B7YA 4YVSB 3T08A 1DG6A 1KDKA 5FPUA 4Q4Y3 2E53A 2VW1A 4OHYA 4HK9A 3DL3A 4OMDA 3HNBM 3WQ0A 4BQ2A 4MSVA 4Q8LA 1F35A 2R063 4BOWA 3WNKA 3V0AB 1SEFA 3MICA 1VE0A 3I2GA 1DZRA 4TLGA 5FXVA 2WNVB 3VBFC 1DGWA 3T2QA 1R091 2RMU1 5FY5A 4A7ZA 4Y3OA 4FPKA 4QB2A 1ZYBA 4KU7A 3RZMA 4MX3A 2NP0A 3NKTA 3LDBA 4P9LA 4XUOA 1MEC2 4MHUA 1UL9A 1MS0A 2ZXQA 4I3PA 1MQTA 2IXJA 5A32B 4OZOA 1Q8SA 2ADDA 4KH9A 3O1VA 5EYXA 2V4AA 4CDQB 1PO13 1RHI2 4W6YA 4PIXA 1LJ7A 3UL2A 4FPJA 5FY7A 2L9LA 2JDYA 2QZ3A 3VHRA 5JUVA 3WG1A 4E2GA 4S2HA 4COWA 1SLBA 4EJRA 1V00A 2D5HA 4B7KA 5CNAA 1HB4A 4GJYA 2D6PA 3I2DA 5C3PA 3GALA 2XL7A 1K3IA 2VY0A 4QGLA 1W8HA 4XIKA 3BPZA 3DKQA 4DY5A 5DMYA 2JG8C 1UXXX 3B5LB 4GXLA 4E4DX 3O1RA 2GU9A 3I4IA 1AR91 1LHOA 1DQ2A 2K0GA 5A7PA 1UY4A 3WEZA 4Z8BA 3O7OA 4AR2A 1BBT3 5J7MA 2R6QA 4XFCA 2ZEYA 1Y9GA 2DDUA 2JEMA 4QX1A 5FK7A 5CFDB 1C1LA 3B3QE 5BXXA 4CDWA 4BK4A 4IE4A 4FTEA 5FLIA 3VD7A 3ZXJA 3U4SA 4R9AA 4R9CA 1SG3A 5C4WB 3ZM8A 5FZ1A 3LA3A 1AR83 2WT1A 2YBKA 2VMDA 5FXXA 5JMOA 4FAGA 4UT5A 1XSQA 5ERLA 1WW4A 5IK7A 2GC0A 3J7HA 4BQ5A 4KBZA 5L9BA 3ZXDA 4CSWA 4K40A 3DYPA 1LHVA 4EWDA 5T50A 3O1PA 1ZBA2 5FZ9A 3PHMA 4SBVA 4N43C 1EUTA 1RUOA 3IDAA 4FOYA 4MGIE 4B3NA 3PLQA 2KA3A 4XXAA 1R082 2B45X 2XWJB 4CDWB 4IL7A 3KLSA 2WKKA 5C4WA 3J8F1 2JIGA 5JOWA 1HV0A 1RIRA 2LS6A 5BNNC 4NOTA 1C28A 3OBRA 1RJ8A 2YHJA 3O1MA 3AL6A 1XNTA 2VOXA 2JDPA 2D6NA 1ULPA 3K4AA 2GDFA 3LFMA 1CX1A 3MLJA 4GA9A 2DCKA 3UKVA 1GUIA 4A7YA 4CU9A 5FWJA 4RGKA 4DNYA 3WOGA 2R043 1BK0A 1H9WA 2PLV3 4Q0UA 3ZMOA 3OGSA 1HJFA 3AVSA 1REDA 5EFUA 4QKBA 2A6XA 1ZM1A 3KF3A 2RM22 3ALQA 4GH4A 4ONUA 1GWKA 4MGQA 2UY9A 1WCUA 5IWFA 3N9NA 3I2FA 1RUC3 4CEYB 2YMZA 3VBRB 1JYTA 2RJKA 3AZWA 1XNKA 3VBOB 1GP5A 3VB9A 5FV3A 5CAZA 5CIRA 1LEMA 5EHDA 4QKDA 1NYWA 5F5QA 4AHYA 4HANA 3C7OA 3DGTA 4BQ1A 1S0EA 4FXKB 5DAXA 5DZEA 4BIFA 1OH4A 3LA2A 4AGGA 4CCNA 5IAXA 3LOBA 2JIJA 4JKLA 2W91A 1HRV1 4ZZ8A 1TE1B 1JYWA 4JRLA 2RS51 4A44A 1NAEA 4FP2A 1H0BA 3QH6A 2J1EA 4XABA 3AP7A 1QXJA 1VRH1 2VNGA 5JI7A 3ZO0B 5C3QA 5JSRA 2WZR3 2EIGA 1W0NA 2RJ2A 4C1WA 3POIA 2WNOA 1PZ9A 5GZFA 3WQBA 2JG9A 1ODNA 5IK8A 3RJ2X 5E16A 1CZVA 1OXCA 2OX0A 1HRI3 3BPSA 1O3QA 1H4GA 5I8TA 5L9RA 2ZABA 4Q2FA 2GC2A 3ZIWA 5FO9B 4PCRA 3H1WA 3SXWA 1Y43B 1WKYA 5F3IA 2C4XA 1C8M1 4FBFA 5FZDA 3VHPA 1UY2A 2IVIB 4COVA 1XE0A 1H8VA 1QJFA 2JD4A 2JJ6A 3MFCA 4LE4A 4M00A 3RI8A 2VULA 4F3JA 1LEDA 3OY8A 3POFA 4M4RA 2YFUA 4Z82A 5A3TA 1JYVA 1U5ZA 1XNCA 1GSLA 3NV2A 3U1XA 1UPIA 2J1TA 2RDSA 3I3QA 4OMCA 1OQ1A 1PIV2 2DWRA 3POJA 2FHRA 3HIFA 3VD5A 1POQA 4Q1PA 3DYOA 2VCBA 2X29A 1MS8A 3MLLA 3AZZA 3NNJA 3NNMA 4OHVA 1FNYA 5FRAA 1SQ4A 4DXZA 1QU0A 3HT1A 4WM8C 5IATA 1NT0A 5FCCA 4BMEA 4CDXA 4CCMA 2Y60A 3VL9A 1XXNA 2ZGOA 4UW4A 2V09A 2VL4A 5LASA 2K2SA 2HWD3 3T3YA 1C5HA 3PTYA 1QJY1 4M3CF 1EP0A 1H6YA 1QJEA 2J7MA 3R4SA 5IT6A 3JCIA 1PVC2 2JE8A 1ND3A 2A6ZA 4IV3B 4N8MA 1GV9A 2YG0A 3M70A 3SLIA 5A6ZA 4R9DA 1WLDA 1VBD1 1DQ4A 3VBUC 4H14A 1G86A 2JE7A 2SLIA 2A3XA 4MV2A 5F1RA 1JHNA 4RGAA 2B8MA 2FMDA 4XXPA 1DGRA 5LRSA 4EYUA 1HB3A 1MQTC 1W2UA 2EAKA 4QKFA 2LROA 1LOFC 3DPRC 4X6RB 1IPKA 5F5IA 2IWGB 2QQLA 5LA0A 2VZSA 5GZEA 1JYCA 1UF2C 2R7EB 1FOD2 1SCSA 1UOBA 4K8FA 2QQNA 5CYYA 5JXHA 5L7OC 2CHHA 1CIYA 3WINE 4RA0A 4XVHA 4FTSA 4ASMB 3SEPA 1I6XA 1OKOA 2R1BA 3OF1A 5ACA2 1YFWA 3GBFA 4DIQA 3O1TA 3NJYA 3Q8CA 5L19A 4FAHA 2XBO2 1AL0G 4Q4W3 3TN93 5C8CB 2LUWA 4KGQA 5AC92 2OQ7A 4I0AA 4NPLA 4XF1A 5F7UA 1IG3A 1UOGA 2ZHMA 3VL8A 2GALA 4EE2A 4UXAA 2BU9A 1PO23 2VOVA 2BNNA 1PMJX 3BIWE 3HBKA 5K4LA 2XHKA 4H3WA 1XBFA 4RR3A 2BP6A 1A8MA 2ZPXA 3CDZB 4I02A 4AXOA 5IFPA 1AYN2 5DG1A 1OURA 2PHTA 2VCMA 2RM23 2VZVA 3ILNA 1W6NA 1JOBA 5CKMA 1NCRB 2E33A 4CP9A 1CAUB 2FDHA 3K48A 2HWC1 1DGWX 1K5MA 1CAWA 2BPA2 3ZFFC 3WUCA 4PI2A 2W46A 3AZYA 3LPFA 4ZONA 2V73A 5LY2A 4CCDA 1RVF2 1REEA 3O1OA 1IG0A 5FQ0B 3NWKA 1GOGA 5J37A 5HCFA 5FY4A 1UYPA 5G05L 4HK8A 3NJZA 3GZUC 3OEBA 1CZSA 1B35A 2RS11 4AEDC 4JKMA 2P6HA 5IVCA 2WO7A 1PGL1 3ZLIA 3ZIXA 2VNOA 1OKQA 2AACA 2DF7A 1XNDA 1ZRIA 5SV8A 4XHXA 4EQVA 1GNHA 1FXZA 5FZ4A 1S1AA 4IETA 4ITCA 2R32A 2IZWA 2WSVA 4WZFA 3D0JA 2UYAA 4FXGB 3OBTA 4NWVA 3HQXA 3URFA 4LO5B 1MS9A 2WYSA 1H8TB 4IEVA 3ZPOA 2C0ZA 2ZGTA 1RUI3 2GSYA 1ULOA 3IB3A 3N35A 4I09A 3H8XA 4Y20A 3OY8B 1UIKA 3C7FA 3VUOA 3MPPG 5JCTA 5A33A 4QPYA 5JXGA 2UWCA 3VKMA 4Z1VA 3VBRA 4GWMA 2QDNA 3LA7A 4JQRA 4QHOA 1ULFA 3VKLA 3ZFEA 2WO3A 2BNOA 3FBYA 3SH5A 1QWRA 3AZVA 3OUHA 2R061 1QEXA 5LA2A 2A6YA 2RR13 1W9YA 4FQ4A 4IE7A 3BIEA 1KEXA 2ZA9A 2WFPA 1ZA4A 4PT6A 2AUYA 1POV1 2W1QA 3OSDA 5DAVA 1RJ7A 5L73A 2W3JA 2GMMA 4FPOB 3WV6A 4NIHA 4OYUA 4DUXA 3ROUA 2B9UA 2FZ2A 2NYYA 1RMU1 4KWLA 5DUXA 1L7LA 1JODA 3DPRB 3W21A 1WGPA 2J42A 5C5UA 3CEWA 1DYPA 3UJQA 1OUSA 3V56A 1MEC3 2B42B 1MR5A 4Q4V1 3UT0A 3ES1A 1DBNA 3GXUA 4LUMA 3H8UA 4GMP0 1NCQC 1PGSA 2WC2A 4QX7A 1W6QB 3JD71 1AR93 4AI1A 4RQPC 3KMHA 2PMWB 5BNPC 1H2KA 4FO9A 4OUMA 3L9JT 4WM8A 1VBB1 2E7TA 1WW7A 4J25A 2HEYF 2VNVA 2BRTA 3CQOA 5J48A 4BIOA 5FZFA 2DCYA 4BQ4A 3O1SA 1RUH1 3ZPYA 1DYOA 3LSDA 3VHOA 5FP4A 2P2KA 1Z7S2 3LF7A 1RUG2 1ND3C 2A3YA 1NA1A 1UY0A 4Y26A 4A6OA 3AXDA 2NZ9A 4HVRA 5FZ0A 1AR63 1H4HA 1T6GC 2D3PA 4L8QA 4E8DA 4RR3B 1UKGA 2X10A 3ES4A 4EROA 4LK7A 4LBNA 3OD0A 4XUQA 2DBIA 4BQ3A 1D2SA 2W47A 3J7MA 4I01A 4Y33A 5KXEA 1RYYA 2ZJCA 4JDNA 2V5DA 1NA1C 3I8TA 3ENRA 3N9PA 5BNOB 4JGYA 3Q8FA 1P8JA 1RUJ3 2QBXA 4DUWA 2D6MA 4RS5C 2CDPA 1O3RA 3Q8AA 1O3TA 1OBNA 3LD8A 4CCLA 1EPZA 4QXHA 1LECA 1AX1A 1OFNA 3FFQA 2BW8A 1C8NA 1QJU2 4Y4RA 3UGFA 3WW2A 3UGHA 1SMVA 3AB0A 3QBQA 5KR7A 2HWD1 1CJDA 3N9LA 4LBQB 4LLOA 3VKFC 3N7MA 4YW1A 2PLV1 4P9GA 3V65A 1QOOA 2VMCA 5FZHA 2ZKNA 5A7QA 1LOFA 2PHUA 2W9XA 2XJPA 2JDZA 3MIDA 4BHPA 1RUF2 5A1FA 2DVGA 1LGNA 4D6SA 3S7EA 4YYOA 2ZGMA 1YFUA 3TEXA 4BQXA 2G19A 3A21A 3SH4A 3KF5A 5FY0A 3U14A 3JQXA 4FQZA 2HJIA 3H3LA 3B9CA 4YG3A 3V0BB 4AHWA 1QNYA 2X09A 1PVC3 2NPIA 1IS4A 3L2YA 4CU8A 3DEMA 3RI9A 3SH3A 3E6BA 3PMEA 1T2XA 3GJAA 1ZRFA 4RHV2 2HH9A 4YW5A 2EALA 2OKXA 4RGGA 4QQOA 1RUE1 2W94A 4FTBA 4BLJA 1RUC2 1U5YA 4NHYA 1KITA 1W06A 2YUEA 4QDSA 3THTA 5GKAC 2D43A 2ZX3A 4TTGA 3GDBA 2C5DA 1YLLA 1EV13 2QQIA 2XXZA 5H9PA 4GMP3 1OT5A 2WINB 4I0WB 4IGQA 1COV3 4OI2A 3RFRA 1PM4A 3S30A 4PF1A 4BH9A 3ACIA 1GMMA 4XF4A 4P14A 4YW4A 3M2MA 3S7IA 4C0HA 1JZ5A 1IZ3A 4ISRA 5FZKA 4AFCA 3IMNA 5A3LA 4IEOA 2C1FA 1W9FA 1PO21 1LNSA 1RL3A 2VZUA 1AJKA 3KWVA 3LQCA 3H3UA 3PVBB 4XC9A 1OFSA 5HBAA 1N1VA 2XMLA 4C1XA 1CAUA 2HWE2 2HKXA 4Q0PA 4C8DA 2MEV1 4MGKE 1RUF3 1XRUA 2EAAA 4R52A 3OYWB 2WWUA 3WQ7A 1H8TA 4N7IA 4XDQA 3NV1A 5D8AB 1BYHA 3ECQA 3LWCA 2F4LA 5FPVA 4D94A 1BMV2 2H6CA 4XMAA 2Q8CA 3U78A 3HD8B 2DUPA 2G4IA 4Y1ZA 2DCZA 4XIOA 2YXSA 2DUQA 2GP5A 2QZ2A 4CP0A 4HT1T 3N36A 2R072 3P5BA 2WO1A 1D2QA 4IGPA 1LESA 3WVJA 1EYBA 2IVJA 2KM2A 4QXBA 1YUDA 4KNCA 1RUD1 3FC0A 3WUDA 3OPTA 1VBC2 5DPNA 5HV4A 1DQ6A 1HDKA 5FO8B 5FBZA 4Q4X2 1F2NA 4BQYA 4CUAA 3QLQA 4YFZA 3C7GA 2IFWA 5CFDC 4LIUA 3ZXGA 1VRBA 2BYVE 4QX2A 5I91A 4OI0A 3K51A 2WNEA 4S2DA 1QF3A 4XJUA 1WMDA 1K12A 2OPKA 5JI9A 3LAGA 3ORJA 1O8SA 2D5FA 3JUUA 4BXSV 4E2QA 2WFF1 2WZR1 1UNBA 1NCRA 4Y1VA 2FDKA 1L7QA 1LULA 3FL7A 3PIGA 4Q27A 4CPBD 5HCBA 2D6OX 4ZS3A 1R093 4XW3A 1ULCA 2VMFA 3DYMA 1SDWA 1H30A 2OUHA 2PFWA 1HX6A 2ZX0A 1H1AA 2R0FA 1NE4A 3GCXA 1WLWA 2D3RA 5ANQA 4CCKA 3LB9A 5H9RA 5CB7A 1S0DA 4AG4A 2Y6LA 1IS3A 2XPJA 5KHGA 4OUSA 5FBJA 4CEYA 1GU3A 4HMZA 3R4UA 4I0BA 1QGLA 3ZFGA 3SMHA 2EA7A 4LIVA 4FOVA 2ZMNA 3CIHA 3BGAA 4QPIB 2EXJA 3RSJA 2PHFA 4Q4W1 4YW7A 3TN91 4UFMA 1GOHA 1I5ZA 1YIPA 2D3SA 1IS5A 1RMU3 4XCBA 4Y5SA 5H9QA 5T5JA 1LU1A 1X82A 5BY5A 4JDMA 2ET7A 3FUOA 1SPPA 1XNBA 2JKXA 4Q4X3 2QFEA 4WVWA 4QWNA 1AR92 2ZGQA 5FJHA 4CXWA 2E7AA 3V0BA 3WG4A 1IQDC 1DF0A 4A3ZA 3SC7X 3ZFFB 1D0GA 1NQDA 1OD5A 5JR2A 4LTAA 1R1A3 4CUBA 2LRPA 3PURA 3N4MA 1QJX3 3BOPA 5DDJ1 1ZBA3 1A3KA 1WLTA 1YRZA 4AEJA 2X5IC 3EYPA 2CDOA 3POGA 3VZNA 1JU4A 4YVSC 1UOFA 4AYUA 4XDPA 1V9U3 1JYNA 1UZWA 3T30A 4EZHA 1MS4A 2C24A 2BEOA 3AYEA 3DV8A 4WM7B 1UZYA 1SPPB 2I45A 3B00A 3SISA 5FR3A 4N43A 2GNTA 4BZ4A 1OUXA 4FPHA 1AVBA 4CRQA 4YZ4A 3TEWA 5K7PA 1LKNA 2VG9A 2Y6KA 3NAPB 3QD6A 4FOQA 1KD7A 4MGZE 1RTVA 5GLUA 1G9FA 3HOBA 1OA2A 5IK4A 5D1IA 1N3QA 3A0NA 4Y4YA 1W6PB 2C26A 1W9SA 5B4NA 1H2NA 3POBA 2WA3A 4UBHA 1K45A 5B4XA 4A4AA 5FZOB 2GH8A 5LY1A 4F83A 4NWWA 4GIQA 5IYYA 4ATEA 4XILA 4Y22B 4AFAA 2Q8OA 3IBMA 5T5PA 4LUKA 4W6XA 1AR62 4QU1A 3W59A 1C4RA 4IUGA 4OFGA 2ZX4A 4YW6A 1NKGA 3TYJA 2VR4A 3MIHA 3RGBA 1Q8QA 3MYXA 3KV6A 3VBSC 2VOWA 4DUVA 1LRHA 5ACA3 1ZZ8A 4XAAA 3CBNA 2J1SA 2RM21 3HAGA 3JB4C 4FPCA 1SBDA 1OC1A 2XUMA 1CESA 1SLCA 3ZSMA 1YHFA 4ARYA 3J7LA 4NIDA 2DFBA 2CWMA 3AP6A 5K0UB 2B9VA 4ZHNA 3KHCA 2WZPP 4NN0A 1YI7A 2NMOA 2UY8A 1X33A 4XTMA 5IW0A 5A3WA 5HCAA 4UOJA 5EZWA 4QB1A 1TEIA 2WR9A 2ZMKA 4GAZA 2PAMA 1C57A 2WNVC 3VBFB 3IKWA 4LMFA 4Q0VA 4XFHA 1YNAA
chains in the Genus database with same CATH topology
1DHKB 3EBRA 4RHV3 1BEV1 3SCGA 4CEWC 2GC3A 3U0ZA 2Q30A 5BPXA 3ZYJB 1POV0 1QJY3 1TMF2 2DVFA 4X6QB 4PDWA 2VW2A 2RS53 2HWF3 2WNVA 3FUQA 2ZGSA 3MIGA 3VBUB 1FT9A 3UKNA 1J59A 1VRH2 5I8SA 3RNSA 3RMXA 4QGNA 5JIUA 3RMYA 1D4M2 2BWAA 4CDWC 3ZXLA 4URTA 3NL1A 1PO12 1RHI3 3R6SA 5C4WC 2Y26A 1IQAA 2FBEA 2ZGPA 4CDUC 3KCXA 3HMYA 3UKTA 2AYHA 5F9TA 1PIV3 1QY4A 2GNBA 4NHMA 1UD1A 1AXZA 1GZCA 1B35B 2A71A 4L9BA 5C9AC 3W9AA 2D6LX 2MHFA 2VECA 1V6JA 5C8CC 4HN0A 1JTZX 2RS31 2XGXA 1FV3A 3LGRA 5T54A 2ZGNA 5H9SA 5JPNB 1CQ9A 2XJTA 1Q56A 4IEXA 3H7YA 4SLIA 1AR73 4BA6A 4XTPA 5FDBA 3CLPA 1O3SA 1WW6A 3R0RA 3WXPA 1MEC1 1HQLA 5F6LB 4Q4V3 4O9EA 3H9AA 4N43B 1JYIA 1BBT1 1RUD3 1ND2B 1LU2A 1EY2A 1DGLA 1UU4A 4EN9B 1C1FA 5BNQA 1RC6A 1QH6A 1D4M3 2ZOEB 5JLVA 2TBVA 1VALA 1X50A 2ZGRA 3WQ1A 2C9AA 1AZDA 2O1QA 3BALA 4YG0A 2Z69A 2OIIA 2GAUA 1VLNA 3H50A 3MZHA 1V6LA 4E9KA 1OHFA 4D7TA 4LULA 4EWEA 3MF9A 3VDDA 1XE8A 2ZX2A 3ZXFA 4XFGA 1APNA 1CAVA 1COV2 1I9RA 3T2TA 3M8LA 1S0JA 4XHBA 4YNIA 1I3HA 4O9GA 1X7NA 1N1SA 2DVBA 1LOGA 4PJYA 1F9KA 3TOJA 3B7MA 1DDLA 2NM1A 2RMU3 3ASIA 1QNWA 5KC6A 2R041 4Z2WA 4K7JA 2NMNA 1AUYA 3FX3A 3GHNA 3JQWA 3EO6A 4AF9A 1ULGA 1ZZBA 1NZCA 2WWSA 4WVVA 2HWC3 3VDDB 5JSPA 3WP6A 1CAVB 2W08A 2WS92 1AJOA 1O5LA 4AVTA 1QKQA 1W39A 4GWNA 1ZVFA 5DDJ3 1ASJ2 3VGIA 1RINA 1RUI2 1O4TA 3VBSA 3KT4A 5ABJB 4GALA 2ZAHA 1AR82 2VU9A 1S0BA 2E9QA 2YDEA 4CZSA 1ZZ7A 2YY1A 1DZQA 2BGCA 3IPVA 4MUVA 1KDMA 4ES8A 1SLIA 4DQAA 1VBE3 2ERFA 5FOJB 4LBMA 5BNPB 1BKZA 1VJ2A 3NW4A 1CX4A 3JD73 2WLQA 4WVZA 1TNFA 5EJ3A 1S0GA 2TEPA 4Q26A 4K6BA 3VZLA 4BWOA 1ULDA 1HRI1 2YGLA 4Q4Y2 1QHDA 5GLZA 1DYKA 2CAUA 1ENQA 3ZSEA 5JSOA 1HQWA 4HSLA 3IPVB 3C3VA 1RB8G 4YGEA 1POV3 2OA2A 2Q1ZB 4YGDA 3O5SA 3ZYGA 4DPNA 3B02A 4WVMA 4PQ9A 1CPMA 3JBG1 4NVPA 4S2FA 3J8F3 4XBLA 1UN1A 4RS5B 2GN7A 1OOPA 1O4YA 3DKWA 4GB31 1BCXA 5AVAA 1R1ZA 3KS7A 3ELNA 4TYSA 5CFDA 5JZGA 2R1DA 1GQHA 5L7OB 1GANA 1BK1A 3JD72 3IDBB 3B9IA 2YC0A 3RWNA 1W0OA 3ZFEB 4LE3A 4N7UA 4TZDA 3PMSA 3ZYIB 5GM0A 2XJSA 5I0TA 3T1LA 2WFF3 1DLLA 3CO2A 1RUG1 1MVQA 2JG8A 1J3RA 1S55A 3PJQA 3KGZA 4WM7C 3WW1A 4AEDB 4LO4B 1M06G 2QE3A 1QJY2 1TMF3 1ZBE2 2MPFA 2W0XA 1Q3EA 4WV8A 2WNUA 5LRRA 3USUA 4I2OA 2YYOA 2XVGA 5CFCB 1EAH2 2HWF2 1SLAA 5E88A 3CNAA 3J8F2 5F6KA 3RRDA 4AI8A 3HT2A 3ST7A 4U2AA 3SITA 2AENA 4JGZA 3VKOA 4EN6B 1V6IA 2PHXA 3WHUA 5FLHA 2VVDA 5LK7B 2LALA 4RSUA 4GMP1 1KFUL 4KQ7A 2VMIA 5E8AA 1FOD1 2OYZA 2OUJA 2O8QA 2IC1A 2JX9A 1G9BA 1C8M3 1GR3A 1WBFA 1E57A 3TWIA 5KXCA 1ZZ6A 4TWTA 4ATFA 2ZKLA 2D6KA 2WSUA 3C2UA 3FMGA 1PK6A 1UZZA 2ATFA 1RUF1 3M1HA 5ACA1 5FO7B 2VGDA 1NCQB 2BFUL 4OLLA 1JXNA 3AP9A 4CP2A 3L2HA 2W52A 1SACA 4LA2A 4Q0QA 2ZZJA 4EN8B 4E4ZA 4AWDA 1Q43A 5JPMB 3M3CA 1SCRA 4HVOA 4IEZA 4LO8A 4JGYB 4RHV1 5GJ6A 3VBFA 1W6NB 1I1EA 2UWBA 1OA3A 3E5UA 4M01A 1LCLA 5KHHA 3RDIA 4QQHA 2DV9A 2B5HA 4J1XA 4YM0A 5I93A 3B94A 3KCCA 1PGL2 3M3QA 4L11A 1RUH3 3VV1A 3U4XA 5I8YA 4OVEA 2RR11 5CA6A 1YO8A 4HKOA 5LK5A 1XQNA 4LBQD 1KQRA 3U07A 4EWAA 1QJZA 1NY72 3GNEA 2UU8A 2ZZQA 2CNAA 1UIJA 4ASLA 4RQPB 4H55A 4XMIA 3WDYA 3WP4A 3ZN5A 4AGRA 4L97A 4YVWC 4AVBA 5C8WA 3VBHB 4ISQA 1LB2A 4XYXA 1VBA2 5T5OA 4YLZA 3IM0A 4L92A 4COUA 4IXLA 1ZNPA 1S0CA 4B4PA 4KWKA 5JOXA 4YZ5A 1R083 1DGRN 4AQTA 1G8WA 3O14A 3NAPA 2QJVA 4G4FA 3Q9OA 4PBPA 1LOCA 2D98A 4J6GA 3FBMA 2DFCA 3JU9A 4Z07A 1WCKA 4E4SA 1IGOA 4BMBA 1GYKA 4I3GA 2DCTA 3ETQA 2YROA 5J3UA 3BTAA 4K1ZA 5JIAA 3RG0A 4OHXA 1O91A 1FPN1 3NAPC 2Y38A 1FMD2 1N47A 2WFF2 4JGZB 4BM8A 1ZBA1 2E7QA 4QHBA 1S0IA 1X36A 1CAXA 1WD3A 3MW4A 4B4QA 1AHSA 2Y0OA 4Q4V2 3ZN6A 1W6OB 2I74A 3CJIB 5D8AA 4XFIA 1N1YA 3MFAA 2YZ4A 1BVVA 1VBB2 5FPXA 2G9FA 1V6OA 3ACLA 3TRSB 1JUHA 2CGOA 3ZMNA 2UURA 1QQP1 2VPVA 1BXHA 2DU1A 3EQEA 3OPZA 3X29B 5D8AC 2B39A 2RS33 2XWBB 4A7KA 3VHNA 3D8CA 3DN7A 5K8SA 2OVUA 4H7MA 1CAWB 1K5MB 4W6WA 3LSEA 3ZXEA 1S2KA 5DXDA 2QNKA 5CFCA 2Z5WA 3P3NA 4HN1A 2MEV3 1FMD3 3AKSA 3D4KA 2D40A 2ZS6B 1QJU3 1GZWA 2ES3A 1Q8PA 4IEUA 2CTVA 2P3KA 1M4WA 1AL22 2AZ5A 4Q0SA 4FP3A 3SHRA 1G7YA 4N9HA 1VAKA 1WMEA 4P9WA 2G9GA 3WHTA 1C3HA 3VZMA 4N53C 4AVSA 1TME2 3AYAA 4QXKA 2PAKA 3D5OA 4UW3A 1WUVA 4XJWA 2GH2A 2RJLA 4W65A 1DQ1A 1JBCA 1LOEA 2H6BA 2P34A 1NQJA 4KGGA 4AHXA 4CDQA 4JVAA 2HWE3 5C9AB 3WDTA 3RS6A 4DS0A 5JAXA 4YARA 3ILRA 1YI9A 2R062 2XJQA 4A2UA 4DZGA 1ZRDA 3OYWA 4B4RA 1ZBE3 4YM2A 5T5LA 2WIIB 1HRV2 2HYKA 1EV12 3VBOA 1PIV1 3MIFA 4META 4ZU4A 1IKPA 1NLSA 1PZ8A 2ET1A 4K1YA 1QDOA 2ZACA 3OGJA 1N3PA 2VQ0A 3N3HA 4TSVA 1NG0A 4LBOA 1AL23 4LA3A 4MXWA 3MLKA 4LNVA 2HWB2 4AI3A 4IERA 4JGZC 2JG9C 2W39A 5FOBB 3IDEA 5KBFA 5BNOC 3E6CC 1W6MA 4N90A 5I0RA 3NVCA 3D0SA 4LHKA 2X5IA 1AYM2 3KD4A 1CPNA 2TNFA 4M3CE 4YGBA 2XJUA 5A32A 1RUJ2 2ZGLA 5KXBA 1J3QA 1FAYA 2W68A 3DUIA 3O0WA 2R30A 2NQYA 1KS4A 1UX6A 4Z92B 1PGW2 2ZAAA 2Y0IA 1OOPC 3AP4A 3KZ4C 3FFZA 1RUH2 3QACA 5JDBA 4YW2A 1KFXL 3AYDA 4QPIC 3A0KA 1XE7A 3AXEA 1OPOA 2JKBA 4S2GA 2R071 3J9SA 1RVF3 3JB8A 1K5MC 1CR7A 2XLFA 1XYPA 1CN1A 2CYFA 1NCQA 2PN5A 1PVC1 4M0HA 2A6VA 2XBO1 2JENA 3SNMA 1J3PA 4YM1A 1ENXA 3E5QA 3IDCB 5K0UA 2NLRA 2DU0A 2GNMA 3APBA 4OZXA 1YYNA 2I2SA 3WDUA 4XQWA 1H2LA 3CF6E 4COYA 3VN4A 3M3OA 4J1WA 1AYN1 5GZGA 1HXS1 2A75A 4LBLA 4RL7A 1QJX2 3INAA 4YZ3A 1ALYA 4LO7A 3NKGA 1R081 1U5IA 4C0BA 2DTYA 1JW6A 1V9U2 1BBT2 1LOBA 3OJBA 4CEWB 1Q5OA 1GICA 1PNFA 2XKOA 4EN0A 3G6JB 1R1A1 3BOWA 1QOTA 1F31A 2QCSB 2CV6A 3GBGA 1KXGA 4YVWA 1X8EA 2CGPA 2ZX1A 4AK3A 1FPN3 1L3JA 5KXDA 3AM2A 1CAXB 1Y3TA 1KJRA 5EYYA 1WA4A 1ZRRA 3VZOA 1TME3 3SCFA 4XQDA 1NXD1 3LOIA 1BQPA 5J98B 5C33A 4A3XA 1GLHA 1NLRA 3RZZA 2ENRA 2A73B 1REFA 1H2MA 2WS93 1R092 3POWA 4L99A 4R4XA 4CEWA 4RD7A 1SLTA 5GALA 1J1LA 1JN2P 3PVEA 4XETA 4AEMA 4N53A 4QMAA 4QQLA 2LTNA 2A3WA 1RHI1 1LHNA 2XKPA 4XF0A 1XYNA 3AJZA 3IN9A 1EAH3 3GBWA 1VIWB 1IPJA 2I07B 1ASJ3 2P3IA 4XFFA 4PBOA 2DYCA 4YM3A 1UAIA 2A6WA 3MI8A 1U5XA 5K9YA 2QUOA 2XLAA 4BYYA 2A7AA 4FPFA 4R8HA 4Y5Z0 4CYDA 5KHIA 4AEDA 4FPLA 3KCYA 5JR7B 2BWCA 3USUB 3ZFEC 4LEJA 3POSA 2IXKA 2XVKA 4Q29A 4Y20B 3WDXA 2F6BA 1QMJA 5J09A 1VBC1 1BVP1 3MGUA 1BEV3 1AR71 3EHKA 4Q4X1 5IUQA 1CD3G 2F4PA 2X8KA 4MH0E 4K21A 4YZ1A 1LODA 2ZHKA 3D82A 1GBGA 1IHMA 4PLMA 4LBJA 4XZPA 2PYTA 4OHZA 1VBE1 4NHKA 4LHLA 4IV1C 3ZSJA 1Z7S1 1VBA3 3N7KA 4BLIA 4JC1A 2Z42A 3LKJA 4Q1RA 3FHIB 3AX4A 1HIXA 2EXIA 4IEQA 3FJSA 2RE9A 4Q4Y1 4IV1A 2X5IB 2XH6A 2XL9A 2R0HA 4QGMA 3RYRA 1PK6B 3M3IA 3QOPA 3WD5A 4AGVA 3ZFGB 1V6NA 2R16A 1ND2C 2ZHNA 5DUUA 4XJZA 4MXWB 1C5IA 1PHMA 2P37A 2JG8B 4MXVA 2BQPA 1X8MA 4CDQC 4IEWA 3VDDC 2K9ZA 4GKYA 4QX5A 5FQ0A 2Q1MA 3PJYA 2WL1A 3I7DA 4KBBA 1WW5A 4P5HA 5EWSA 2WLPA 1G9CA 3MW3A 3DPRA 3TB0A 1UU6A 3R4DB 1LENA 5FPZA 3AKTA 3I59B 2XVLA 1ZX5A 3HR9A 2E51A 3S6PA 4IV3C 1WLCA 4RFT0 1AX0A 3NO8A 3B01A 2AGSA 4FVVA 1XU2A 4EV0A 4XEZA 1FX5A 2IXCA 2UWAA 1Y9QA 4YSFA 3VZKA 3ATGA 2CAVA 4AI2A 4KL1A 2FQPA 1WBLA 2PHWA 2RS52 1H1MA 5BNOA 1V6KA 1EPWA 5K0UC 1SFNA 1WCDJ 5FFOC 1MQTB 2ARBA 4JDOA 4FPYA 1RUC1 4IQPA 3ZDSA 2WNUC 1RVF1 1VB4A 3AKRA 4H7LA 3MEPA 3PVNA 4LHNA 1MZFA 3I59A 4GH4B 3AKPA 4UBGA 2CY6A 2RS12 2Z79A 1B09A 4X8PA 2Q5TA 1SBFA 4YG6A 5FTTC 1C8M2 1S2BA 3FLPA 4FSJA 1YJLA 4M3CB 1AX2A 2BFUS 3DF0A 4IESA 2HWE1 1UPSA 3BODA 1N3OA 5A3MA 3PNAA 2AH2A 3VKNA 3MIBA 2E63A 3OGGA 4CDXB 4C91A 4R4ZA 3CU7A 5C6CA 4CDUB 1J1TA 1MVEA 3R05A 2CWSA 4DINB 4E27A 3GF6A 4K3UA 3WG3A 2RMU2 1F8VA 5DUWA 4LLFA 4YVWB 3VBHC 1KS5A 2CGNA 2JG9B 4ES9A 2PHLA 3TAYA 5BYNA 5FAXA 1XU1A 3ZN6B 1MS3A 2PAEA 4M3CA 1W6OA 4QQPA 1VR3A 3VBRC 4MYEA 1BEV2 1VBD2 2Q4SA 1AXYA 3CJIA 3VBOC 1FV2A 4PDWB 2DCJA 4RQPA 1NXMA 2E6VA 1UW8A 3ZFGC 3W58A 4ZKTB 3KB5A 2BBVA 1WMFA 1RMU2 2D44A 4CDUA 1FATA 1N1TA 1O7FA 4AQSA 3KQRA 4QPGC 4DMIA 3MW2A 4DOUA 4LO6B 3D6EA 4KG0A 1JOJA 1D4M1 4NO4A 1W0PA 1MS1A 3WLUA 5J96B 1AXKA 4OI1A 2EXHA 1DQ5A 2D7FA 4CEYC 1RUI1 4QPGA 4KU8A 3OTFA 5CG9A 1AR81 1JH5A 3VLBB 5AC91