3A4UA

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
228
structure length
228
Chain Sequence
b'LPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 54
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3a4uA00
3V0BB 3LSEA 1S0IA 3FUOA 1WUVA 3AP9A 3ILNA 3N7LA 5JOZA 4YW5A 1O4YA 1ONAA 5FREA 2WT2A 4Y20A 2PHWA 5GLTA 3GNEA 1CR7A 3WDTA 3B01A 2R49A 3N7MA 3VKMA 1IS3A 2D6KA 2D44A 1SLTA 2D6MA 2E7TA 1DHKB 2WLQA 5CB7A 2ZZJA 3V64A 3ZYRA 4YG0A 2PHUA 3TAYA 1HQWA 3RRDA 3ZXLA 1Q8SA 1ULDA 4D69A 3AZXA 4GKXA 2VH9A 5KXDA 1AJKA 2AYHA 1DLLA 1OFSA 4GWMA 4IQPA 1QDOA 3PJQA 3ZSKA 4XXPA 1DQ5A 3PVEA 3N36A 1AZDA 2A3YA 4XE9A 1X50A 1CN1A 3CNAA 1S0JA 2W08A 4U2AA 3WDUA 2NP0A 1Q8OA 4GA9A 1V6LA 1PZ7A 4CTEA 3JUUA 3RMYA 1HLCA 4FQ4A 3LSDA 1LULA 1QNWA 3ILRA 4DRVA 1ULCA 2ENRA 1AXKA 1AX1A 1F5FA 4Z8BA 1WW5A 2OVUA 3ZXEA 5CAZA 2WSUA 2P3JA 2JE7A 2ZGMA 4YGEA 3PMEA 3O12A 4Q27A 4JCKA 1BQPA 4GALA 2WNEA 1KRIA 2I2SA 1QU0A 3OPZA 2CTVA 4SLIA 5IK7A 4P9YA 1OQ1A 4WV8A 2VU9A 5GZFA 5IT6A 4WZFA 4YW4A 2P2KA 4HANA 2R0FA 5EYYA 2E6VA 3ZPYA 2NMNA 3D6EA 1S0EA 5GZGA 4DFSA 1UX6A 2R1BA 5GM0A 4YZ1A 4XDQA 2AGSA 2CNAA 1RINA 2DTWA 3POSA 2R1DA 3APBA 3R4SA 5DG1A 2DURA 4YFWA 2DV9A 5KXBA 2EXIA 4K21A 1FNYA 2ZMNA 1ULGA 4CRQA 3RG0A 1JW6A 4K1YA 3ZYPA 1V6OA 2ARXA 1BXHA 1WBFA 1FATA 2D3SA 4Y22B 3WV6A 3ZSMA 1G9DA 1QOOA 1FAYA 4RL7A 2EALA 5T5PA 3AP7A 4YLZA 3M3EA 2PHFA 2Q5TA 4XJZA 4AGGA 4BOWA 4R9BA 4R9DA 1CIWA 3M3QA 4AVVA 2V5YA 1MS0A 1QGLA 1F31A 1SCRA 1UKGA 1W6MA 1S0BA 2HYKA 3UJOA 1ZM1A 1WD3A 1HQLA 2AUYA 3ZXFA 4UW4A 1GBGA 4Q8LA 2FHRA 2VUAA 2ZGNA 4XIOA 3I8TA 2WKKA 2ZHMA 3AFKA 4FP3A 3USUB 1GANA 1LESA 5IK4A 2A6ZA 2SLIA 3WG3A 5H9SA 3IPVB 3INAA 2W52A 3VKOA 5FRAA 1GZ9A 4Y1YA 1AX0A 2CWSA 1W6NB 5JOWA 4W65A 1JOJA 1VALA 3T1MA 1ULFA 5T55A 1URXA 4XBLA 4K20A 4YZ4A 3PVNA 3HR9A 5BYNA 1KQRA 5SV8A 2NZ9A 3WUCA 4Y22A 2JECA 1F9KA 1G86A 1A78A 1WD4A 2KM2A 2NYYA 2AR6A 2ZHLA 1LHWA 2ZKNA 1MS9A 3POYA 2EIGA 4Q1RA 5EWSA 1DFQA 2GNTA 2GN7A 4FVVA 4C1XA 4PCRA 1HKDA 1WLCA 2D6LX 1AF9A 4AYUA 4YGCA 4ZKTB 5EXOA 1LHUA 3FFZA 1GZCA 1N3QA 2XB6C 4YW1A 2DTYA 3RS6A 5E89A 4YM0A 2PHXA 4YG3A 1WLWA 3C2UA 1VIWB 1LGNA 1FYUA 1QOTA 2RHPA 3AZWA 4XJWA 1MVQA 4FPJA 4OZXA 5F5QA 4ISRA 2NN8A 1N1YA 2A3WA 2CL2A 2CY6A 4YM2A 3USUA 4Q8KA 4FPFA 4Q26A 5IK5A 2A3XA 3IPVA 4JRAA 2DVGA 1H9WA 2ZABA 3B9CA 1LU1A 3WDYA 4DRRA 3B00A 1QKQA 1W6NA 2P37A 4NO4A 1CESA 1DYPA 3SH5A 3VKNA 4KBBA 1EPWA 3NV1A 2OUHA 5HCBA 1G9BA 3AP4A 1IS6A 2GN3A 2GNBA 3T1LA 2ZAAA 1G7YA 4M3CB 1CPNA 1GKBA 4YW2A 4FPHA 4P14A 3DUIA 1V6IA 1SBFA 3H0OA 4I30A 3FLPA 2DWRA 3AYEA 1N3OA 2DVDA 4Y1XA 4LBLA 5T54A 2YMZA 3WG1A 1GV9A 1UN1A 5E88A 4XTPA 5E8AA 1JYIA 5CNAA 1PZ8A 1Q8PA 1QOSA 2ZBJA 3O0XA 3WNXA 1UMZA 3A4UA 3QCWA 2ZGSA 4FPCA 4FOVA 3N7KA 2W68A 5GLZA 4Q1PA 3O5SA 2D43A 3UK9A 1ENRA 5IK8A 1CVNA 2G4IA 1C1LA 1VAMA 2D3RA 3HMYA 4AWDA 1QMJA 1A8DA 2WSVA 1V6NA 5DXDA 4TYSA 1Z0HA 3WDWA 5DZGA 3WVJA 2V73A 4XMIA 3AYAA 1SLBA 2SBAA 1MR5A 2BQPA 5JOYA 4XXAA 4PQ9A 5CA6A 1BZWA 1ZA4A 2CWMA 4FQZA 2YXSA 1O4ZA 4M3CA 2GMMA 4FPOB 1FV3A 1W6MB 3AX4A 2ZMKA 4YFZA 3V0AB 1QF3A 4P9WA 5LK5A 5GLVA 2ZACA 1D2SA 3FBYA 3OJBA 1ENSA 4M3CE 5JLVA 3AJZA 2DUQA 4PF5A 1BKZA 3D4KA 2GMEA 1AX2A 1R1ZA 1YRZA 2ZGRA 2ERFA 3M2MA 1LOAA 2OUJA 1AJOA 4MYEA 3M1HA 3AYCA 3IM0A 4YM1A 2ARBA 2E51A 4YM3A 4XHXA 2WT1A 3POWA 5DZEA 1V00A 4H55A 4XBNA 5GZDA 3AP5A 1KDMA 3WCSA 1LTEA 1YYNA 4XZPA 4XTMA 3B3QE 1YIFA 3A0NA 2EXHA 1LECA 3A0KA 2DUOA 1G9CA 4FPGA 3WG4A 2EAKA 1S1AA 4YG6A 1Z78A 3ZXJA 1DQ0A 2UU8A 1LENA 1MZ5A 3U4XA 4XJ8A 3AYDA 1JBCA 1IKPA 3V0AA 2R0HA 4XJUA 1GYKA 2YV8A 3OBRA 4LBQB 5KXEA 2H0BA 3AXEA 2UWBA 1MS4A 4FOQA 1OKQA 1WLDA 2ZHKA 4YZ3A 3W59A 4FOYA 3UJQA 4Y1ZA 3N3HA 4YZ2A 2E7QA 4AVTA 3ZSLA 1LOFC 3N7JA 4BMEA 1MS1A 3SNMA 3VKFC 2B7YA 5GZCA 4UW6A 1A3KA 1LCLA 3BTAA 4LBKA 1LGCA 4TZDA 1V6JA 1S0CA 2GNMA 3IKWA 3ILFA 5GJ6A 3ZSJA 3SH4A 3SITA 1SLAA 5T5OA 1LHVA 1MACA 1MS8A 3MW3A 2A70A 5JVVA 2OW4A 2WQZC 3AP6A 3ENRA 3NV3A 1GLHA 4XJAA 2ZGTA 4GWNA 3WHTA 5HCAA 1Q8QA 5IUQA 1LODA 2EF6A 1YXWA 2DUPA 2VXRA 3GALA 3VV1A 3MW2A 3LCPA 4LBQA 4AVSA 1C57A 2PELA 1MVEA 1CQ9A 3WCRA 1D0HA 1LEMA 2UWCA 1NLSA 2WJSA 3R05A 5DUWA 5GLWA 1IOAA 5H9PA 5KXCA 3FUQA 3KQRA 3L2YA 2ZGKA 1GICA 1N1VA 1UZYA 4M00A 1GNZA 4XILA 1LU2A 2JKBA 1CPMA 4XMAA 1WCSA 3WHUA 1UZZA 3Q9OA 2ZA9A 1W6QB 1DQ2A 1LOEA 2C9AA 5T5JA 1GSLA 2LTNA 2DU0A 3ZVXA 1SBEA 2A6WA 1W0PA 1SFYA 2D6PA 2UWAA 2VY0A 1HDKA 1VAVA 3SH3A 4K1ZA 1GZWA 2TEPA 4FPLA 3RMXA 1KJLA 3W58A 5T50A 4Y1VA 3NV2A 5EYXA 1KJRA 1S0FA 4DQAA 3VKLA 3O0VA 1LOFA 1I3HA 1LOBA 2A75A 4YGBA 2A7AA 1LEDA 2R16A 4Q2FA 4Y26A 2D6NA 4NOTA 4XJ9A 2LALA 3AZZA 5DUXA 2P34A 2E53A 2NM1A 4M01A 4WVWA 3RSJA 2DYCA 1MS5A 3OYWB 1DGLA 4UW3A 3ZXKA 1JHNA 4HL0A 4GKYA 2CYFA 4FPKA 1UL9A 4BLIA 2VW1A 3N35A 4XHBA 4Y24A 1SCSA 3WLUA 1BJQA 3IMNA 4ATFA 2GMPA 1FNZA 1LOCA 5DUVA 5T52A 1GNHA 4BM8A 2D7FA 1AVBA 1DQ4A 1C4RA 1TEIA 2ZGQA 4YGDA 1W6QA 1JXNA 3JU9A 1G9FA 1SLLA 1WW6A 2DVFA 4ATEA 1KDKA 3MPPG 2ZGPA 1N47A 4FOWA 4FPYA 1DQ6A 2W39A 4PBPA 1ENQA 1SACA 3IN9A 4DPNA 3OBTA 4M3CF 1WW7A 3V0BA 4RA0A 5DZFA 5GZEA 3AZYA 1RITA 1DQ1A 3KM5A 5JMCA 1LHOA 2VW0A 3SLIA 3WUDA 4F83A 1JN2P 2EXJA 3AXDA 3HN1A 3WG2A 3D5OA 1V6MA 2DVAA 1C1FA 1U0AA 5JDBA 2YROA 1YO8A 2YZ4A 4LBJA 3SISA 4LBQD 3OYWA 1G9AA 1W6PB 3AJYA 3BIWE 4LBMA 2A6VA 3AZVA 4ZXKA 1ULEA 1MS3A 2ZGLA 3ASIA 3BODA 3OY8B 3B69A 5DG2A 1IS5A 1IS4A 1YI7A 2ZGOA 2ZMLA 3WDXA 1KITA 3R4UA 1XQNA 2D6OX 5GLUA 5F9TA 3FLRA 2VW2A 1V6KA 4PBOA 5JOXA 3NV4A 1H9PA 2A71A 1Q8VA 1SBDA 2EXKA 1DBNA 4R9AA 2XG3A 2PHTA 1S0DA 1QDCA 2FMDA 3BOPA 4LBOA 2ZHNA 2WT0A 3NWKA 2JE9A 4FP2A 1N1TA 3RQ0A 3AK0A 4R9CA 3M3CA 1W6OB 1N3PA 2P3KA 5T5LA 1UPSA 1BYHA 2UURA 1FV2A 2AENA 4XYXA 2PHRA 1APNA 1LGBA 1W6PA 3PVOA 3VUOA 4LBNA 3V65A 1FX5A 1DIWA 1WW4A 2D3PA 2DU1A 3DGTA 3ATGA 5AVAA 2A6YA 3OY8A 4BLJA 1NXD1 5H9RA 3O0WA 3WOGA 2P3IA 3OGGA 4JC1A 3QLQA 1JYCA 2AH2A 4XOGA 3UL2A 1GZWB 1Q56A 1LHNA 2DVBA 2Z42A 2ES3A 1DZQA 4GXLA 4C1WA 2GNDA 5H9QA 1CONA 5CBLA 4AGVA 2ZGUA 1AXYA 3MW4A 5HCFA 4ISQA 5L73A 4BMBA 2JJ6A 1S0GA 5GALA 3MEPA 4Y20B 1B09A 4CZSA 2GALA 4ITCA 2AREA 4YZ5A 1CJPA 4DS0A 1VLNA 1QNYA 4ASMB 5DUUA 2C5DA 2JD4A 1JUIA 3I4IA 4U36A 3TB0A 1N1SA 4UW5A 1W6OA 3FLTA 1SLIA 2YY1A 4L8QA 1LOGA 1PZ9A 4Y1UA 4AGRA 1IKQA 1LJ7A 2A6XA 3T2TA 1SLCA 2A5ZA 3M3OA 1W0OA 1DYKA 2JDZA 3WDVA 4BQ1A 1I1EA 1G8WA 1RIRA 1J1TA 4FPEA 2NMOA 4XIKA 4YW3A 4WVVA 1AXZA 4XBQA 1WBLA 1MZ6A 4BPZA 1UAIA 1Y7BA 3WZ1A 2GDFA 1H30A 4P9XA
chains in the Genus database with same CATH superfamily
3FUOA 3OPWA 4GIQA 5JZGA 5A7SA 3LDRA 4P9IA 1QXRA 1AR61 1O4YA 3ZFGA 5FREA 4IEPA 4FTSA 2YPDA 3GNEA 1US2A 5BV6A 3N7MA 1XC6A 2OIIA 1RUC3 1OF4A 1KS5A 5JR2A 1MQTB 2ZZJA 4AFAA 2VBBA 1HB3A 4ES9A 1JU3A 1W2TA 2JG9A 3M4FA 1ZA7A 5D1IA 3ZXLA 1Z7S2 4D69A 1TME2 3MFCA 5G05L 3SKVA 1IPJA 3AZXA 5HV4A 1CWPA 4D7YA 1AJKA 2PAKA 4GWMA 1ZBE2 2BERA 3A21A 3OTFA 3H9AA 4FFGA 3H42B 3PJQA 2WS93 5C3OA 3KWVA 1UD1A 3N9MA 1NCRA 4BWOA 5JXIA 3GF6A 3P1IA 3PUQA 5JIUA 4XUTA 3WDUA 1C8M3 2YC4A 3WP6A 1EV13 4GA9A 2HEVF 4CTEA 5F1RA 3MLLA 4DO0A 3DKQA 2R041 3F2ZA 4FQ4A 4DRVA 1QNWA 1J3RA 4FO9A 1CAXB 4GQ7A 5FQ0B 5FR3A 1ZX5A 1OOPC 3POBA 4AQ2A 2PMWB 3PMEA 4Z07A 4QPGB 1KRIA 2I2SA 1K3IA 2CTVA 4SLIA 4D6RA 1MQTA 3I2GA 5FK7A 1TQ5A 4QT6A 5IT6A 2DFCA 1IG0A 4PI0A 1GQHA 2R6QA 2G9ZA 5CADA 3GDBA 4Z92B 5FFOC 1RYYA 2E6VA 3CBNA 1NKGA 4IE0A 4ZXEA 4CEYC 3WR0A 1PK6B 4WM8C 3D6EA 1PGW1 4DFSA 2JICA 2E32A 3D0JA 4R8HA 5I0SA 4UYBA 1XYOA 3P5BA 2RS31 4CXWA 4YZ1A 2ZX4A 1I5ZA 3IDBB 5K0UB 2P4EA 1BK1A 2QDNA 3U10A 3R4SA 3VZOA 3IDCB 4K21A 2C0ZA 4CRQA 3FHIB 3RG0A 1F2NA 2BTVC 3B93A 4JKKA 1JU4A 1CAXA 1EAH3 2C26A 4HKWA 5FQ0A 1OA2A 1E5RA 4CUBA 1HRI2 5T5PA 4B4RA 3VBHC 4AFMA 3JB4C 1X33A 2Q5TA 4QPGA 3VD5A 2PXJA 5FZ3A 4R9BA 4OHVA 3OGRA 4Q4W2 5K4LA 2QUOA 1S0BA 4IEOA 3UJOA 2WYFA 1F5JA 3MF9A 2ARAA 1MZFA 4Q4V1 2LRPA 3I3BA 1WD3A 5FJKA 3ZXFA 1GBGA 1UIKA 2MEV2 3AKPA 3BPZA 4Q8LA 3NAPC 1PK6A 1NXMA 3I8TA 1UYXA 1GANA 3ON7A 1ST8A 1VBE3 2SLIA 3GJBA 3IPVB 1W8UA 2VZVA 2Q0AA 3INAA 2W52A 1XE0A 3NJYA 5K0UA 1S55A 3ZR5A 1POQA 4JRLA 3T1MA 1ULFA 1VJ2A 1OSGA 1EPZA 4K20A 2FCVA 2RR11 4OZOA 4YZ4A 3PVNA 5BYNA 3MYXA 2NZ9A 1W2AX 3WQBA 1F9KA 4LITA 2VZPA 5EWSA 1MS9A 2EIGA 4XUPA 1DFQA 2GNTA 4CEWB 1D4M3 1NUKA 4DY3A 4Q4W1 3U11A 4YGCA 4NAMA 4PIYA 5I8TA 1XYNA 1R093 2WLPA 2PHXA 2X53S 4A6SA 4P9GA 2Y6FA 4CU7A 1RHI2 3VDDB 1VIWB 4EN6B 2MEV1 1FYUA 1QOTA 3BALA 4Y4RA 5HV0A 5JSPA 3Q8AA 2FZ2A 4BE3A 4AI8A 4ISRA 2VZUA 4RYDA 3IZOA 1N1YA 4K3UA 1HV0A 2ZEXA 3IPVA 4JRAA 1UU4A 4A2UA 4QX5A 4CDQC 2W0XA 4LULA 5F39A 5F37A 4ZPIA 3FBMA 4NO4A 1CESA 3VKNA 4YNIA 4KBBA 2OQ7A 3I3EA 2DBIA 1FMD3 2XR4A 3AP4A 2VMGA 2GN3A 3KT4A 4GULA 4QB1A 2Q8EA 1QJY1 1H2LA 1XE7A 5IVBA 5J7MA 2W2IA 4Y3OA 1DLCA 2PFWA 4IEUA 4QQOA 4OLLA 2YBPA 1V6IA 3H0OA 4YWAA 2VG9A 4FCAA 5K7PA 2PLV2 2DVDA 3ROUA 3TN91 5T54A 1JYXA 3BB6A 2GAUA 2J42A 2XBO1 5CNAA 4DZGA 3MV01 2DDUA 1PZ8A 1Q8PA 4N43C 4ASLA 3VDDA 2VTXJ 3A4UA 5FY5A 5ABJC 4QKDA 2ZGSA 5BNNA 3O1MA 3MIBA 3N7KA 4RN5A 1IHMA 2D43A 3DYMA 3O5SA 4OVEA 1ENRA 3UNPA 3SCFA 5L19A 3ZYBA 5HCHA 4AWDA 1PO23 2WSVA 1RUE2 5DXDA 5KC6A 2OQ6A 3WDWA 3LAGA 4HPKB 3WVJA 1YJKA 2X5IC 3JQWA 4XMIA 4ZONA 3RZKA 3AYAA 1POV3 2YGLA 2BQPA 3NW4A 1OD5A 5JOYA 5CA6A 2ID4A 4QHOA 4EJRA 5DMYA 2IXCA 5JXGA 2F4LA 1MEC2 3LDBA 2ZMKA 3MBWA 3VL8A 4COYA 4YFZA 3KGZA 4P9WA 2RDQA 5A3PA 5IVJA 2CGPA 1KGYA 1ENSA 1KD7A 1PIV1 2EIEA 5IAVA 1BKZA 3D4KA 1ZZ8A 2GMEA 2WWSA 1XXNA 3N9NA 2Y6HA 1K5MC 2JENA 3LGRA 4NVPA 2ZGRA 1BMV2 1UXXX 2WFF2 2WNOA 1F4AA 1LOAA 1W9WA 3M2MA 4TXWA 3TOJA 2VZSA 1UZVA 4B29A 1VBC3 3AVSA 3M1HA 4LHNA 4YM1A 5KBFA 3CJIB 4YM3A 1CX1A 4IETA 4IL7A 3I2HA 3ZN6B 4H55A 1ZRDA 3BTZA 2P6HA 4HPKA 4C8DA 4XZPA 1YIFA 4AFCA 1RUD3 2V09A 3A0KA 2DUOA 5J96B 4FPGA 3WP4A 1VBA2 4LXLA 5CG9A 1YUDA 4OI2A 3T2QA 1DQ0A 1W8OA 1MEC1 4N8MA 4Q4X3 1IKPA 3WF4A 4XJUA 1W9FA 5KXEA 2H0BA 1NX9A 2UWBA 1MS4A 4UFKA 1OKQA 2ZHKA 1I9RA 3MPBA 4YZ3A 3UJQA 2XJTA 1CIYA 1V0AA 1ASJ3 3TRSB 2WFF1 1LOFC 3THTA 4GD4A 1PVC2 1VBB3 2ZX1A 1MS1A 1QEXA 1V70A 5FP3A 5LW9A 3TWIA 1X7NA 4WVMB 1SDWA 5AFBA 1J3QA 1LCLA 4LBKA 4OMCA 5FKBA 1GP6A 3CJIA 3S7IA 4TZDA 2PHDA 1V6JA 2RM21 4GH4C 4LNVA 5FZIA 1H1MA 5GJ6A 5SV5A 2OYZA 3ZN6A 1W04A 2QQNA 4DOUA 4AI2A 4I09A 4CDUB 2XXZA 5ACA1 4DXTA 3OG2A 5LBBA 3I97A 4TN7A 3G7DA 1VBA1 2VD7A 2W94A 5CKNA 4AHWA 5CEHA 4AFDA 4QQPA 4LE3A 2EF6A 1R1A1 2BJSA 2WN2A 5AC92 4CCKA 1O3QA 3LCPA 1ZRCA 2YGMA 2R072 5FZHA 2PELA 2CSGA 3LWCA 2HWB3 3WCRA 1D0HA 4NHKA 5AVPA 1WA4A 2UWCA 2WJSA 5GLWA 3O1SA 1RMU2 1ZRIA 4XABA 3KQRA 5A7OA 4AI0A 1JMUB 1UYYA 5IATA 4AZZA 3AC0A 4M00A 5FKCA 4QXBA 3C7FA 4F7ZA 2WINB 1OLRA 1OVPA 4PQQA 2G19A 3QD6A 3ZXDA 4C0BA 3KD4A 4E9KA 1W6QB 2P3YA 4URAA 2C9AA 1WLTA 3N9QA 1T6BX 1HRV3 1SBEA 2DU0A 3MI8A 2RJLA 1W0PA 4XDPA 4CDUA 3HIFA 1CJDA 1Y43B 5FYHA 3T2PA 1TMF3 4AI3A 1GZWA 3ZXAC 1ND3B 2QQPA 2B8MA 1HB4A 3HNMA 3K75B 4NPMA 3W9AA 2WL1A 1RUC2 1HN0A 5D21A 5FDBA 2DCKA 3C7EA 2Q1FA 4YGBA 5D8AA 1GOGA 2XKOA 3KV9A 1YQ2A 3OGJA 2EIBA 4P02B 2WAOA 3UGFA 4H7MA 2LALA 1ZZCA 3AZZA 3DV8A 5DUXA 2E53A 3IMMA 4WVWA 3OYWB 1MS5A 3JZVA 1DGLA 2WNVB 3IWZA 4H14A 4UW3A 3V56A 3J8F3 3VBRB 4FPKA 3KT1A 2JDAA 5FMOL 2P1BA 4RS5B 2VW1A 3N35A 4CP2A 1BJQA 4QGLA 5A70A 3BN6A 1GR3A 3D8CA 1C8M2 1RXGA 3WNOA 1GNHA 2XJRA 5FYBA 5F3IA 1EV12 4NE9A 4DXZA 2Y6KA 3JQXA 1W6QA 1JXNA 3JU9A 5FPUA 2LROA 5BY5A 2DVFA 4ATEA 3PL0A 5EZWA 5FXXA 3WF3A 3R0RA 4FOWA 2A1XA 4FPYA 1DQ6A 4CXXA 4QB6A 5CFDB 1ENQA 4KBZA 1AL21 2ZX0A 1ZVFA 1QQP1 4Z2AA 3V0BA 1X9PA 5E16A 1Q5OA 5DZFA 1XJAA 2B42B 5JMCA 1DQ1A 1Y3TA 1LHOA 3H7JA 1JN2P 5LRRA 5IYYA 3HN1A 1D4VB 2XLAA 5JDBA 1YO8A 2YZ4A 4LBJA 1NY72 3NRUA 2VAUA 1NG0A 1H4HA 3OYWA 2RDRA 2WNVA 3AJYA 3BIWE 2RVAA 1RVF3 4MLOA 3VBRA 3ASIA 1IG3A 2IVJA 1CAUB 3B69A 3GHMA 4RS5A 1H8TB 1OH3A 1IS4A 4I02A 1XSRA 1O59A 2ZMLA 3WDXA 2UYBA 1CZVA 2FDIA 4NR1A 2VMEA 2HJIA 1RJ8A 3U37A 5JOXA 4CPBA 1YQ6A 2A71A 3NSTA 3SEPA 1Q8VA 1DBNA 1EAH2 1W8ZA 5A3NA 3QACA 1S0DA 1QDCA 2ATFA 2EA7A 3BU7A 5LA9A 2VOVA 2YPJA 2HBUA 4XF4A 3BKZA 4LBOA 1UOFA 5CFDA 2QKDA 2H6BA 3NWKA 4HBNA 3U1XA 2WZ8A 4JTNA 4AI1A 2XLFA 2ZXQA 4R9CA 5A1AA 2X29A 1U12A 5T5LA 2VMDA 3PUHA 2BWCA 5JZGC 4LT5A 1DDLA 5EJ3A 2UURA 4NIDA 3PU3A 3KZ4C 5LY2A 1NY71 3H1YA 2O8QA 2PHRA 3WD5A 3PMSA 2VECA 4CU9A 2E7AA 1W2NA 3E5UA 1FX5A 1VBE2 1WW4A 1CAUA 4JQRA 5C3PA 1H8TA 1M06G 1NXD1 5FP9A 2JG9C 1UW8A 3O0WA 3WOGA 4NIHA 2IFWA 4XOGA 3UL2A 4Q4Y3 5FY8A 2FZ1A 4BISA 4EN8B 5FIXA 2ET7A 1DZQA 5FP7A 4GXLA 5CZKA 5IVFA 3POIA 4BA6A 1CONA 4MVTA 5CBLA 4XAAA 4AAXA 5HCFA 2BOIA 5C6CA 1NCRC 3ZXGA 2YYOA 5FBJA 3SHRA 3VBFB 1S0GA 2VPVA 3MEPA 4GMP3 5GALA 4LHKA 4J6GA 3H1MA 1NAEA 1ZZBA 2AREA 1C5HA 3NJXA 3T08A 1D4M2 1QNYA 4B1MA 1JZ4A 5FZEA 2C5DA 2VOWA 4BIOA 2GH2A 1NA1B 1JUIA 1WKYA 3BI3A 3DECA 1N1SA 5FXZA 4CXYA 5L9RA 4LK6A 1SLIA 3SEEA 2YHJA 1R092 2KA3A 2DF7A 2YY1A 4OHZA 4Z2WA 1PZ9A 2HBTA 3KT7A 1ALYA 5K9YA 4XF0A 2BGCA 1QY4A 1PGSA 1WCQA 4EZHA 4HVQA 3WSOA 1W0OA 3WDVA 3PUIA 4N7IA 4UF0B 2G1MA 4Q5OA 1R083 4CYDA 4QX7A 2BP6A 2O1QA 5F5AA 1QJX3 4MH0E 2R061 3GZAA 4XCAA 2VNRA 1PX3A 2QBXA 5L9BA 2VQTA 4A6OA 4W6YA 3EBRA 3M7AA 1PMHX 2WQ4A 2OKXA 5C71A 1YHFA 1VR3A 4N7UA 1FMD2 1QJU3 2GDFA 2PAEA 4NWWA 1FPN1 4P9XA 5F5IA 3LSEA 4EWEA 1X9TA 3G6JB 5M0TA 3DF0A 1WUVA 3N7LA 2VNVA 1U5ZA 3VBFA 4D3WA 1GWLA 4AK3A 2PHWA 3RZLA 2BVBA 3N4MA 2LUWA 5FPXA 4UFLA 5F6LB 1G6NA 2OX0A 1NA1A 2RJ2A 2E7TA 1DHKB 2W46A 3IIAA 4QHZA 5CB7A 3V64A 3VZLA 3ZYRA 2PHUA 3VD4A 2WN3A 4HZFA 2VNGA 3RRDA 1VRH3 2PQSA 1X36A 2RDSA 1E5HA 4YYOA 4BIFA 1Q8SA 1TNFA 2DCTA 5I8SA 1JOBA 4GKXA 5F3GA 4QPGC 4DB5A 1YFUA 1OFSA 1B35B 2J1SA 4UF0A 3WF2A 1E5IA 4OHWA 1QDOA 4DEVA 4MHUA 2WUHA 1ZZ6A 4X8PA 3AVRA 1PO22 5A3UA 3GZUC 5A3LA 3ZN4A 1X50A 2KXLA 4U2AA 5J37A 2XJSA 1Q8OA 1PK6C 4A44A 2WIIB 2NPIA 1YEWA 3JUUA 3J7LA 3RMYA 1OVSA 4EROA 1LKNA 5FZGA 1D0GA 4CCDA 1VBD3 2BNOA 4I0AA 4IGOA 1F5FA 4NN0A 3MIEA 2ZOEB 5FLIA 2ZGMA 5DDJ3 5A33B 5K0UC 4Q27A 4JCKA 1BQPA 3J7MA 1OFNA 3KCXA 4W6XA 4E2GA 2V4AA 3ES4A 5IK7A 1O8PA 4ORFA 3LEIA 2IVIB 5GZFA 4WV8A 4LIUA 3WP5A 4HKLA 3H8UA 1H4GA 2HWE3 2R0FA 5EYYA 2Y0OA 2L9LA 3KQ4B 1S0EA 5GZGA 1B35A 1VBC2 3Q8FA 2BOJA 5FP8A 3UKTA 2HWC3 4MGTA 2R1BA 4EQVA 2VCAA 3RYRA 5IFTA 1POV1 3POSA 3APBA 3LOBA 1PX4A 4YFWA 2VXJA 5KXBA 2EXIA 4O9GA 5FZBA 3JCIA 1FNYA 1PO12 4IEZA 4K7JA 1J83A 1NQDA 2P5BA 1DZRA 4QGNA 3NJVA 3IT8A 4TSVA 3ZSMA 1QOOA 4N53C 3DEMA 5FYYA 3VBOB 5A33A 1AR71 1CAVB 2FCUA 1XNTA 5FCCA 4V2VA 4XJZA 1NLRA 1VMJA 2ORXA 1VP6A 1JZ5A 1W8WA 4A45A 1LRHA 3DYPA 3ZFEB 4DIQA 1CIWA 2HYXA 2JDUA 2V5YA 1UKGA 1QGLA 1F31A 2HYKA 1VB4A 1W6MA 4LO8A 1ASJ2 1A6CA 1VBB2 1HQLA 1ZBA1 3MICA 3FX3A 2VUAA 2ZGNA 3HBZA 4CEWC 1A34A 3USUB 1LESA 3OEBA 2JDPA 2W87A 2B9UA 2ZEWA 3BYWA 4BK4A 4Z82A 2PHLA 4M0NA 4FAGA 4AL9A 2VO5A 2AACA 2CDOA 2VZTA 3VDDC 3U75A 3ZFGB 1W6NB 3QH6A 5JOWA 2Y33A 2XH6A 3BU0A 3O1TA 4P5YA 1PO11 4YVWB 5T55A 4BH9A 3TNPB 4XBLA 4GJYA 1W2OA 5CISA 3WUCA 1BK0A 1RUF1 2JECA 2YUEA 1A78A 2IUWA 4QPWA 3VBOA 5C5TA 2ZKNA 3PDQA 1YQ5A 1CAVA 5LBCA 2WO3A 3JBG1 5C8CB 4G4FA 3CJXA 1WLCA 2HWB2 3SXWA 5L9VA 2AEZA 1GZCA 1N3QA 4YW1A 3U14A 3OUHA 1GOFA 2XWBB 5E89A 5JI9A 2ZTNA 1WLWA 1OC1A 3C2UA 3AZWA 4HFSA 4QGMA 4DUVA 1MVQA 2ZS6B 4FPJA 4OZXA 3PURA 1OA4A 3H7YA 1L7LA 5A3MA 3USUA 4YM2A 1RUJ1 1UU5A 4ZY9A 2XVLA 5FTTC 3OUIA 1AR93 2VOKA 3O1VA 4OYUA 3RDIA 2Y60A 1H9WA 3B9CA 1H1IA 3WDYA 1POV0 5KC5A 3B00A 1OUXA 1OD3A 1QKQA 1W6NA 2P37A 3DN7A 4Q29A 3CO2A 4W6WA 1DYPA 1TMF2 4LO4B 4YVWA 3T0AA 3NV1A 1OF3A 4IGPA 2CGNA 2GNBA 3PTRB 3T1LA 2GH8A 4M3CB 1CPNA 1GKBA 4HN0A 2MHFA 4P14A 4PHZA 5EV7A 2K2SA 3AYEA 1N3OA 4BXFA 1OUSA 4MGYE 4WVZA 3T3YA 1GV9A 1UN1A 5C8CA 5LY1A 1IZ3A 3NNMA 5F32A 5E8AA 2VVEA 4RGKA 2WC2A 2NQYA 4LTAA 1DP0A 4SBVA 4GB31 3J8F2 1L7RA 2ZBJA 5IJRA 1RUI3 4YRDA 1W3VA 2QQIA 2EAAA 2ADEA 3CF6E 5GLZA 1X8MA 4Q1PA 4PDWB 4W50A 2FCTA 2JIJA 1OLQA 2J1RA 1OA3A 2G4IA 1C1LA 3POGA 3HMYA 2ZEZA 4QHBA 5IVYA 3EB7A 3LZZA 4NPRA 5DZGA 2GZWA 2FDGA 5JXHA 3R4DB 4NHXA 2QE3A 3LA3A 5FBZA 3FHAA 2Y6JA 3L2HA 1ZA4A 5CU1A 2JDYA 2ZX2A 2Q8DA 4JHTA 2VE1A 5C9AB 1UYZA 4F8AA 3CJIC 5HXVA 4PLNA 4M3CA 3NQHA 1Z7S1 2QQLA 3AX4A 1TME1 5FPVA 1QF3A 4XFHA 2Q8CA 4B8EA 3CKHA 3S5QA 3LEGA 1D2SA 3FBYA 4XFAA 2C6SA 1DU3D 2QQMA 3FHQA 1ZBE1 2DUQA 3LE0A 4M3CE 1UY3A 1XRUA 3AFGA 2VNOA 1RVF2 5EP9A 1YWKA 3HOBA 1R1ZA 4QDSA 4ARYA 3KHBA 2XKPA 2EVXA 4PF1A 2QQWA 4XUQA 4MYEA 4PDWA 1AYM3 3LKJA 2ARBA 2W5FA 5FYIA 3ZDVA 2ORZA 4XHXA 2DFBA 3POWA 1VE0A 4M4RA 3JD73 3AP5A 2FBEA 2WWJA 1KDMA 4AOCA 1LTEA 1WCUA 1YYNA 4K9SA 2XHKA 3B3QE 3A0NA 1G9CA 5C9AA 4I3PA 1BVP1 1Z78A 4YPJA 2GP3A 3ACFA 2UU8A 1RUG3 4XJ8A 4Y33A 4MGKE 3LFIA 1JBCA 1XPWA 3OBZA 1UO9A 3LFMA 2R0HA 4NIGA 1GYKA 2YV8A 4JAAA 4LBQB 1NT0A 3LB9A 3MF6A 2BV4A 3CL1A 2X8KA 3Q8CA 4FOQA 2WABA 1XNKA 3WW1A 3WNNA 1GP4A 1NOVA 2BFUL 2MPFA 1WLDA 1HV1A 2B4KA 3O7OA 2E7QA 4AVTA 3ZSLA 3C7GA 2J7MA 4MOAA 3HQRA 2HWF3 4A7KA 4FFFA 2B7YA 3VKFC 5GZCA 2E33A 3N9PA 5FMBA 3B7MA 4Q4Y2 1A3KA 5L36A 4N9IA 1HXS3 2GNMA 1I5PA 4Q0UA 4B7KA 1HRI1 4HG6B 4RFT0 5FUNA 4EN0A 2IXKA 4ZU4A 1LHVA 1MACA 3MW3A 3FWEA 1AYN2 1COV3 1QJEA 3OCPA 3VDCA 2OW4A 2WQZC 4JDNA 4Q0SA 5IVCA 3AP6A 4XJAA 1K42A 1WMDA 2ZGTA 1GU3A 1Y4WA 4GWNA 3WHTA 4OFGA 1Q8QA 1LODA 3DCQA 1NE4A 2Q30A 2E26A 3GALA 3P3NA 4LBQA 1C57A 3B9IA 1NCQB 4LLOA 5BNNB 1ACCA 1MVEA 1ND3C 1RXFA 4S2DA 3HQXA 5LB6A 2BRTA 3S7EA 3R05A 5LASA 5DUWA 5IVVA 5CKMA 3FUQA 4CDWB 5EPAA 1R082 3L2YA 3S5AA 4IESA 1QJX2 2VULA 2VGDA 1OT5A 4UT5A 5A3WA 1CPMA 2VR4A 4XMAA 1WCSA 4B1LA 2WNVC 1QJU2 1GWMA 3VBRC 4AXOA 1GSLA 4RS5C 1FXZA 2A6WA 2WWUA 3ACGA 2D6PA 5D2AA 1AYN1 1HDKA 2XHNA 4CCEA 3RMXA 1YC61 4QPIB 4LR4A 3HVDA 3NV2A 2RMU3 3VKLA 3O0VA 4RR3B 1I3HA 3RZJA 1NQJA 3LD8A 2A7AA 1RHI1 2RS13 5LA2A 1LEDA 4IV1B 4C91A 1VRH2 1KEXA 1IPSA 3PIJA 4NOTA 5FZLA 2GP5A 1NCQA 2P34A 4M01A 3GCXA 1MPXA 4MGSA 2UY9A 3ZXKA 3JXSA 1NZCA 4HL0A 1BBT3 4AEKA 1R081 4CDWA 4YVSA 2HEWF 4CUAA 4LA2A 2GMPA 4DXRA 3ELNA 4LHLA 2W9XA 2QQVA 3M3IA 4DMIA 2ZCWA 5EFUA 1C4RA 1QJU1 3LA7A 4YGDA 3VZKA 4OHYA 1C5IA 1HJGA 1UOGA 1SLLA 4HMZA 1U5XA 1VBD2 3ACIA 1H8TC 3MPPG 5CIRA 2PLV1 3J4UH 2AEYA 1BEV3 1N47A 3D82A 3D3AA 5LRSA 2HLEA 3A7QA 2W39A 3PJYA 4HETA 2OPKA 2Z5WA 3OUJA 4XVHA 3IN9A 4JX0A 4NHYA 4QPIA 4A7YA 4B4QA 4M3CF 1YCIA 1VRBA 3EMRA 1UZWA 4RR3A 3WQ7A 1RITA 5IAXA 1GUIA 1QH7A 1MZEA 4IV1A 2JX9A 1OKOA 2HWE2 4IEVA 2GU9A 1NZIA 5IHRA 3K48A 1IPKA 3KHCA 1QJZA 1QWRA 4LO6B 3N9OA 1W6PB 4ONUA 5DAVA 1AR82 3AZVA 3OSDA 1ULEA 1MS3A 4ZXKA 3T2OA 3BODA 3VV1A 1K5JA 1RUE1 3OY8B 4K6BA 2HWC2 4Y5TA 5DG2A 2PA7A 4HKOA 1IS5A 1H2NA 3NNGA 4QXHA 1YI7A 1V9U3 3I2FA 3ZIXA 3WNMA 3R4UA 3SKJE 4DNYA 2GC3A 4MHRA 4IDZA 3GBGA 4CP0A 5GLUA 1UIJA 1V6KA 2VW2A 2Z4FA 3NV4A 4PBOA 3RJ2X 1DGRA 2VVDA 4GMP0 2EXKA 3GZTB 2FD8A 5FZMA 1GMMA 2XG3A 2PHTA 4CUGA 3BOPA 2O0OA 3ALQA 3HNYM 4GZ9A 4KL1A 4IV3B 3U4SA 4XFGA 2P6CA 4AVCA 2ZHNA 1CAWB 2WT0A 2JE9A 4FP2A 3RQ0A 2PYTA 1SZBA 3AKTA 2W3JA 1OBNA 3M3CA 4L99A 1BMV1 2FQPA 2JDHA 5A7QA 3ETQA 1FV2A 3VBFC 4FFHA 5J98B 3BGAA 4ZU5A 2JG8B 2BGOA 1T2XA 1AR81 1APNA 1W6PA 1XU1A 4FXGB 4N90A 4NROA 2BPA2 1FOD3 5DPNA 4BM8A 3OGVA 2A6YA 3OY8A 3EJKA 3FZ3A 1UQXA 2P3IA 2E31A 3QLQA 1JYCA 1DGWX 1XB9A 2YBKA 5FY0A 4BDVB 1GZWB 2NLRA 2VZ1A 4E27A 1Q56A 3AKRA 2K9ZA 2WDBA 1DZTA 2ES3A 1W06A 2Z42A 4K8FA 4C1WA 1VPHA 3I49A 4L9BA 2ZGUA 4RHV3 5FWJA 5D8AB 4CU6A 4BMBA 5FPZA 1RUH3 5FO7B 3DYOA 4TLGA 1B09A 2ADDA 2ZEYA 3GZEA 4H7LA 4IV3A 4MADA 2V4VA 1BCXA 4DS0A 1VLNA 1CAWA 3RZHA 4BQ5A 1HQNA 1H6XA 4FTBA 2JD9A 3O1UA 3I4IA 4D0QA 4NAOA 1REFA 1PVC1 2YFZA 3C3VA 1AR63 4Y1UA 5F3CA 5TSWA 3HBKA 1XE8A 1LJ7A 3T2TA 4IGQA 2JG8A 4WZCA 4XQ4A 5DAPA 1NE6A 1DYKA 2JDZA 5B4NA 3E6BA 1RIRA 1I1EA 1AR92 4TWTA 3DKWA 5J36A 3ES1A 4WVVA 4LOSA 1BLZA 1WBLA 4WM7B 2VMHA 1MZ6A 4BPZA 4A41A 1UAIA 3UV9A 4C90A 3VD7A 5IWFA 1B35C 5LATA 3WZ1A 3V0BB 4AEMA 1S0IA 2D5HA 3KSCA 4J1XA 4YW5A 5AC91 1ONAA 3ZYJB 2WT2A 2WZPP 2R071 2ARCA 3PVBB 4ZU7A 1CR7A 3WDTA 3B01A 1RJ7A 2R49A 3VKMA 1IS3A 1E57A 1TZOA 1NYWA 3ECQA 5BUVA 3K46A 1SLTA 2BWAA 2R043 1RMU1 2E63A 1OMIA 1HB2A 2WS92 1RUI2 4L11A 4IE6A 2VH9A 2AYHA 1DLLA 2QZ3A 3ZPOA 1WGPA 2VUJA 3ZSKA 4XXPA 3T4VA 1AZDA 2CAUA 2R7EB 4FSJA 3E6CC 4WM7A 2W08A 2Y6LA 3OD4A 4M4PA 5FY9A 1U5YA 2QVSB 5I0UA 1V6LA 5F6KA 4XZUG 4IE5A 1RUC1 4RGAA 4EV0A 1HLCA 5BNOB 3FL7A 1ODNA 1PGL2 2W1UA 1WCKA 1LULA 3ILRA 3LSDA 2ENRA 1AXKA 2RS33 3I59B 1WW5A 2OVUA 4HSLA 3ZFFB 1PHMA 2WSUA 4YGEA 4MO3M 1UPIA 3I2DA 5CAZA 4AEDB 1JOPA 4IEYA 4KQ7A 1C3HA 2WNEA 4RQPB 1ENXA 2PQQA 3VZJA 3OPZA 1H1AA 2B45X 4CCLA 1UY4A 4N43B 4B7EA 5DN2A 4AG4A 2WS91 3I7DA 3EXUA 3SCGA 3HAGA 3B94A 4O65A 4YW4A 2P2KA 2IC1A 4XUNA 4HANA 1W90A 4OI1A 2WA4A 1OPMA 3VBOC 1C8M1 4QX0A 1SQ4A 4XEZA 2NMNA 1EV11 3HNBM 1W8HA 2Y0IA 4PI2A 4LOTA 4MV2A 1AYM2 3FJSA 4E8DA 1UX6A 3ZMOA 1P8JA 1WMFA 2F4PA 3ZFEC 4YARA 3K4AA 3ORJA 5GM0A 3CHXA 2UYAA 4HXCA 2RDNA 4Q4V3 1YQCA 3JD72 3ZM8A 4QMAA 1F35A 2DURA 3WNPA 2DV9A 4COWA 4AAPA 1PGL1 2ZMNA 5BNOA 1H0BA 1JW6A 2Y26A 3CZJA 3VZMA 2BVVA 3ZYPA 5A1FA 2D3SA 1BXHA 1WBFA 3WV6A 3I59A 4Y22B 3ZDSA 1RUG2 1FAYA 3ZFFA 4RL7A 2EALA 4OUMA 5F2SA 3ZFGC 4YLZA 4AEDA 2PHFA 5JUVA 4RQPA 1SPPB 4YVWC 2BNMA 3LEMA 2RR13 4IEXA 1WCDJ 1K5MB 3M3QA 2VMIA 4N43A 4OULA 4AVVA 4RGGA 4QU1A 3E6DA 5FY1A 5FK8A 2HWF2 1ZM1A 2AUYA 1WMXA 3H3LA 4D6QA 4J1WA 2FHRA 4ET7A 4XIOA 5C8CC 2WKKA 3AFKA 1UNBA 4FP3A 4Q4W3 5IK4A 5FZ1A 1JZ2A 2A6ZA 2WR9A 3K3NA 1XU2A 4B3NA 5KHJA 3CQOA 2Y64A 1HXS2 2IXIA 1EAH1 2W1QA 1AX0A 2CWSA 1F8VA 1JZ3A 1JOJA 1W0NA 1COV2 1QJFA 4OQ9A 4ARXA 1L7QA 2QZ2A 2HH9A 3BCWA 1DF0A 3BIEA 1KQRA 4KU8A 5SV8A 3RYPA 1LAJA 3AL5A 4Y22A 1G86A 4UFMA 2AR6A 1LHWA 3POYA 4IEWA 3KS7A 3D0SA 5CKQA 4C1XA 1HKDA 3NL1A 1SPPA 1AF9A 4XQDA 4ZKTB 1VBE1 4LKFA 2XDVA 1QJY3 1LHUA 1K5MA 1S4CA 2KR2A 3FFZA 1CGPA 3VDAA 2WFPA 1MQTC 4YG3A 2IXJA 4G9SB 2Z2SB 2RHPA 4KWLA 4IEQA 4L92A 3AKSA 4XFCA 4XJWA 5FMDA 2VVFA 3TN93 3WNLA 5LEJA 2JDKA 5F5QA 1O3RA 1H2MA 2NN8A 2A3WA 2CY6A 2XBO3 5JWPA 4I3GA 4Q26A 5IK5A 2DVGA 2C1FA 2ZABA 2BDRA 4QDQA 4DRRA 5FLJA 3HD8B 2VZ3A 3J26N 4A3XA 1JZ7A 4MX3A 4X6RB 1D4M1 3SH5A 2OUHA 4PDWC 5HCBA 1G9BA 1IS6A 5J48A 1W9TA 1UKRA 2RMU2 4NHLA 4YW2A 1R091 3IAQA 1CD3G 4FPHA 5BNQA 2VM9A 4C0HA 4CCNA 3RI8A 4I30A 2RS12 4B4PA 4EN7B 3RZGA 1OHFA 4Y1XA 1HJFA 2YMZA 3MIHA 4I0WB 4Y4YA 4AHZA 4CP9B 5E88A 4XTPA 4L0PA 3ZX7A 5JR7B 3NNJA 5F2WA 1WWYA 4AR2A 5C9AC 4OUSA 1J84A 1BBT2 3RFRA 3LPGA 3P3PA 3NKGA 5GKAC 4LK7A 3CLPA 4UFHA 4XFBA 5FOJB 1GOHA 4CCOA 1EY2A 4ZZ5A 2TUNA 3H50A 4FPCA 5FUPA 3BVCA 5A6YA 2W68A 2B9VA 4I2OA 3H8RA 3K4ZA 1PIV3 1FMD1 1CZTA 1CVNA 1VAMA 3AMMA 2D3RA 4RSUA 5FWEA 3EYPA 1QMJA 4FI9A 3M8LA 1A8DA 4KGGA 1V6NA 4UI9L 3FC0A 4KWUA 4YW7A 4TYSA 3ACLA 5ANNA 4JGZB 4XUOA 2WO7A 4FTEA 1SLBA 1BEV2 2YB7A 2ETEA 3EQEA 4NWVA 1BZWA 2IWGB 2ZZQA 2JDMA 3T0DA 3S30A 2IXLA 1EYBA 5LBEA 5ANQA 4FQZA 2YXSA 3MIGA 4IE7A 1W6MB 2D98A 3WQ0A 3W5NA 2VZQA 5JMOA 2VBPA 5JCTA 5GLVA 2ZACA 3OJBA 4CP9A 1XNDA 4HK8A 5JLVA 3AJZA 3UKVA 4MSVA 3SQOA 1PO21 4NJ4A 5I0TA 2EICA 3O14A 1VMHA 2OUJA 1S2BA 1V9U2 4KMQA 4Q0PA 4BU2A 5FOBB 3QH7A 4K40A 3X29B 4JGYB 4QD2A 3AYCA 1RUD2 5JPNB 5G04L 5I93A 2WQ8A 4QKFA 2WT1A 1KFXL 2C4XA 5FO9B 4LLFA 4XBNA 3ZR6A 2VBDA 4JGZA 1BEV1 1PMIA 4Q4X2 5GZDA 2RJKA 3WCSA 2PTMA 1UOJA 4KG0A 2BYVE 4XTMA 1XYPA 5LBFA 1WZXA 4MXVA 2EXHA 3Q8EA 4XETA 1JI6A 1LECA 5LWBA 3H3ZA 4BQ4A 2RV9A 2EAKA 4YG6A 4META 2RM23 3E5QA 3MLKA 3U4XA 1MZ5A 4NRQA 3AYDA 2OS2A 1KXGA 3C7OA 5F7UA 1OPOA 3OOXA 3UKNA 5C70A 1QXPA 3IBMA 4UAPA 5ACA3 3AXEA 5HXMA 5FYUA 3S57A 1J3PA 1VBC1 3WNKA 3EHKA 4Y1ZA 4QU2A 1FOD2 2LW8A 1H8VA 5K8SA 3VDBA 1QHDA 5A3OA 4NIIA 5J1XA 4BMEA 1R1A3 4NUBA 3SNMA 3BTYA 3F95A 1O3TA 2H6CA 3W20A 2D97A 4V2WA 1NCQC 5BNNC 1RUD1 2XWJB 3BTAA 4JGYA 4XFFA 1GQPA 3USSA 1QXJA 1QH6A 4MXWB 3PHMA 1S0CA 1OXCA 1Y9GA 3ILFA 4CDWC 4RHV2 3VHNA 4Q4X1 2LS6A 2WO2A 5T5OA 4A4AA 1RUH2 1MS8A 4CDXB 5C5UA 2A70A 1JYWA 3NO8A 2F6BA 2O8OA 3ENRA 2XL7A 5HCAA 3KF3A 1ASJ1 1ZREA 5IUQA 1YXWA 2DUPA 1VBB1 1R64A 2VXRA 1AR62 3I2OA 1F15A 5C4WB 5KWRA 3NMBA 4AQTA 3OF1A 1REEA 1LEMA 4XCBA 4QPIC 1NLSA 2JB8A 2JB4A 5H9PA 5KXCA 4RR3C 5CFCB 4EN9B 4XQWA 1GFF2 1JTZX 1N1VA 1HRV2 1UZYA 2OA2A 2ZGKA 4IV1C 5T3NA 3WF0A 4BXSV 1ZRFA 1IGOA 1PM7A 2JKBA 3OD0A 3UYJA 3WXPA 4L97A 3K77A 5FPBA 5LA1A 1UZZA 1BVVA 1YFYA 2XONA 3JB8A 4MXWA 3DL3A 3RI9A 3OBAA 2LTNA 1RUH1 5EIYB 2UWAA 4IUGA 5FMCA 2VY0A 3POEA 3WEZA 1VAVA 4CDXA 4K1ZA 2TEPA 4FPLA 4JZRA 2HWB1 5A32B 3K4DA 5T50A 4Y1VA 3ZO0B 2J1EA 3I54A 5EYXA 5JXJA 1S0FA 4DQAA 3A23A 2KD7A 2R042 1YNAA 3J7NA 1LOBA 3FE5A 4MZUA 1ZNPA 2PAMA 1OI6A 2BUKA 3VBUB 4Q2FA 2XL9A 2B39A 3ABZA 2WRAA 4JQTA 5C4WA 4UXAA 1ND2B 1S2EA 3RSJA 2D40A 2DYCA 2V5DA 1AL23 3DPRB 3LDKA 1QQP3 4HT1T 1JZ8A 3B5LB 4GKYA 2CYFA 4AQ6A 2WO1A 2BBVA 2GSYA 3VBSB 5CFCA 3WLUA 1HRV1 3ST7A 4W4ZA 2I07B 4ZS2A 4XAEA 1FNZA 1LOCA 1TMF1 5DUVA 3MDPA 2YC0A 5T52A 1S2KA 4LHSA 1DQ4A 2VTFA 1PGW2 1TEIA 2ZGQA 4D94A 3ZYGA 2F17A 2WNUB 4P5HA 1TVGA 4JHZA 4CUCA 1WW6A 2UY8A 2IXHA 1KDKA 2GC1A 2RS32 2ZGPA 4QX8A 3W21A 2VQ0A 2I74A 3VN4A 3VD3A 4DINB 1T6GC 3RWKX 2VMCA 4PBPA 4JTOA 3ME2A 5A32A 3ZKUA 1VMFA 3UGGA 4BQ3A 1L3JA 3J8F1 5GZEA 4XF1A 2VW0A 3SLIA 4YSFA 3VBUA 3T09A 3WG2A 3TBDA 3D5OA 1V6MA 2DVAA 1KFUL 3I3DA 1C1FA 3SISA 2YDEA 4CP1A 4IV3C 1ND2A 4NPLA 3GBWA 4LBQD 4PLMA 1G9AA 1NLQA 2R32A 3DPRA 4LBMA 1O8SA 2A6VA 3KCYA 4QWNA 4XF9A 4ZHNA 2WZR3 4IW3A 5A7WB 2QTWB 2EIDA 3PIGA 3VBSA 4GWIA 1JS9A 3P6BA 2ZGOA 4Q4V2 4A3ZA 4D6SA 1SMVA 5FPLA 3KMHA 3R6SA 1W9YA 2D93A 2A73B 2JG8C 3AMPA 2DCZA 1W8NA 3FLRA 3QOPA 3U0ZA 1H9PA 2WNUA 4JVAA 5FAXA 2ZX3A 2QQOA 2DCYA 1E5SA 3KLSA 4R9AA 2W91A 2QNKA 4LQRA 2FMDA 4O9EA 2X05A 2CHHA 4NIAA 3MGUA 5LA0A 1N1TA 3CMGA 1US3A 1RVF1 1GNYA 3AK0A 2OXBA 2RR12 1W6OB 1X8EA 2P3KA 3WP3A 2W1WA 1AUYA 4P00B 1UPSA 2J1AA 5D8AC 5JI7A 4LKSA 5C8WA 5A80A 4NRMA 4XYXA 2J22A 3MIFA 5C3QA 1STMA 1LGBA 4LBNA 3GM8A 1DIWA 2D3PA 2DU1A 2TNFA 3ATGA 5AVAA 5A7WA 3S6PA 1HIXA 5FZFA 1ZZ7A 4JDMA 4JC1A 2N7GA 4S2GA 2AH2A 1HW5A 3TNQA 1VB2A 4PLOA 3AMQA 1JYTA 1LHNA 3POFA 1DCSA 3H8XA 4QQ2A 5H9QA 4PJYA 1Q43A 4AGVA 2WZEA 3T4HB 3MW4A 4N53B 1UZ0A 2JJ6A 5F3EA 2R063 3SCHA 2ZAHA 3AKQA 4Y20B 4PIXA 4CZSA 4WM7C 4ITCA 3NKTA 1DGRN 4YZ5A 1CJPA 3E5XA 5FY4A 5DUUA 4ASMB 1IQDC 2JD4A 4OHXA 5BNPB 5C7GA 2XLGA 4A7ZA 1FPN3 4HSJA 4U36A 3TB0A 1QJY2 3FN9A 1W6OA 4CA9A 3T0BA 4Y5SA 2OZ6A 2VC9A 4LUKA 3VB9A 4YVSB 1LOGA 4CCJA 3Q8BA 5FZAA 2A6XA 4Q4Y1 3TN92 1SEFA 4BHPA 1SLCA 2A5ZA 3AMHA 3RZZA 3M3OA 2WA3A 2XBO2 3NVCA 3U78A 1SG3A 1J1TA 4FPEA 5FLHA 3W5MA 3IIIA 3ITQA 3PTYA 1O6UA 4R52A 4GMP1 3KVAA 1LR5A 4QX2A 3GCWA 5LK7B 1Y7BA 4XURA 3GXUA 5FZ7A 1H30A 2C9KA 1UY1A 4ZZ8A 4E4SA 5L7OB 2QJVA 4N53A 1ZRRA 1RL3A 3AP9A 1QIQA 3ILNA 3RWNA 4BCUA 5JOZA 2FDKA 5DAQA 1RUNA 3GGLA 3CZUA 4Y20A 3J9SA 1PNGA 5GLTA 4AI9A 5FYVA 1UYPA 5BNPA 2D6KA 3TEXA 5CFDC 2HEYF 2D44A 2D6MA 2WLQA 3E97A 3LOIA 4K8RB 5BNOC 4DEQA 1JYNA 4YG0A 3TAYA 4E2QA 5FZ4A 1HQWA 1QJX1 5C3SA 1ULDA 2VZOA 3ZFFC 2WYSA 4CEWA 3HT2A 4AEDC 4QKNA 5KXDA 2J1UA 4RQPC 1PIV2 4BQXA 3PUAA 1W8TA 4IQPA 4UWDA 2VQUA 4IXLA 1DQ5A 3PVEA 3N36A 4XE9A 2A3YA 2C24A 5IW0A 4LA3A 1OH4A 3VL9A 1CN1A 3CNAA 1S0JA 5FZCA 1YQ8A 5DDJ2 5FY7A 2XQXA 1SFNA 3LA2A 2BFUS 4BQYA 2NP0A 3HPNA 4XFIA 1PZ7A 3M70A 1HB1A 3ZKYA 5L7OA 4QDRA 1ULCA 1AX1A 4Z8BA 1UY0A 1VRH1 2XMLA 2P3JA 2JE7A 2Q1ZB 3O12A 1DYOA 4XPVA 4GALA 1QU0A 4E4ZA 3MUY1 4LO7A 3UGHA 4GWJA 4P9YA 3VHPA 1SDDB 1YFXA 1UMHA 1YFWA 1OQ1A 5F8PA 2VU9A 4P08A 4WZFA 3KV6A 1XNBA 4D7SA 3POJA 1W8FA 1AR73 1CX4A 3ZPYA 4YW6A 2QQUA 3ETPA 5A7NA 3LQCA 4JKLA 1I6XA 3LIHA 4LEJA 1VBD1 1O7FA 4XDQA 2AGSA 1OOPB 1RINA 2CNAA 2HWD3 1ZBA3 5DDJ1 2DTWA 2ZKLA 3KF5A 2R1DA 5DG1A 2CDPA 2RG4A 3ZXEA 4EWAA 4A42A 1ULGA 4P9LA 2CU5A 4K1YA 2XUMA 3QBQA 5IFPA 2MNGA 1V6OA 2ARXA 2RM22 4QXKA 1FATA 3TEZA 1G9DA 1RTVA 3IAPA 5FPAA 2HWE1 3URFA 1LNSA 3AP7A 4X6QB 3M3EA 4CEYB 5ACA2 4WM8B 4CDUC 3PLQA 4AGGA 1PO13 2VCCA 4BOWA 1ULOA 1IQAA 2RS53 5JSOA 1J59A 4R9DA 5DABA 1NA1C 1MS0A 1SCRA 1ZYBA 2HWC1 2XOMA 4QKBA 1LB2A 1RUF3 2GC0A 4QQHA 5I8YA 1W28A 2W95A 2YC2A 4HVOA 5B4XA 3CDZB 1R1A2 4XC9A 4TTGA 4UW4A 3JBG3 5BXXA 1XNCA 3HWJA 4RFRB 5ERLA 2ZHMA 1UXZA 2CV6A 2FDFA 1RGSA 3WG3A 4KU7A 4JKMA 3ACHA 5H9SA 2R30A 5A6QA 3THDA 4BZ4A 5APAA 4LUMA 3VKOA 2JDNA 5FRAA 3ZLIA 1GZ9A 1OOPA 4Y1YA 3U07A 2QQKA 3K3OA 3EO6A 3VBHB 1AL0G 3DXTA 2LM3A 4W65A 3I2JA 3I2KA 2XVGA 1VALA 4N9HA 4PIZA 4UFJA 1JODA 5FXWA 1D2QA 1RUJ3 4LKDA 1URXA 3MIDA 1AHSA 3HR9A 4UBHA 3LEKA 4G3YC 4QQLA 4URTA 1RC6A 5B2GB 1TG7A 1WD4A 2KM2A 2NYYA 2ZHLA 4OI4A 3GYDA 4Q1RA 3NAPB 2BZDA 4CEYA 4WM8A 2GN7A 2XJVA 4FVVA 4PCRA 5CYYA 3UETA 2V72A 3VGIA 1DG6A 2D6LX 5FXVA 4AYUA 1UCXA 5EXOA 1XNAA 3AM2A 2XB6C 5DQ0A 1GWKA 1W05A 2DTYA 1RUOA 5A3TA 3RS6A 4CVUA 2Q4SA 4GAZA 4XACA 1UMIA 4YM0A 3OEAA 3HT1A 2IZWA 1LGNA 1K45A 2VUCA 2FDHA 3T30A 4BYYA 2CL2A 4Q8KA 2K0GA 4FPFA 4INDA 2A3XA 4GB33 4HK9A 1LU1A 3MV11 3O1OA 1J58A 4IE4A 4D8MA 4E8CA 3AB0A 4CPBD 3KB5A 1XOYA 4LMFA 4DY5A 3VBHA 4UBGA 4IERA 1HN1A 4WVMA 4R4XA 4V1PA 4DUWA 2BGPA 1ULPA 2Q8OA 3TEWA 1EPWA 1O3SA 2Y8KA 5F5CA 2K46A 2ZJCA 2ZAAA 1G7YA 3DUIA 1SBFA 1PNFA 3IDEA 3FLPA 2DWRA 3HEIA 4JGZC 2JXAA 4HLTA 4LBLA 4Z1VA 3NAPA 3PU8A 3WG1A 3DXUA 3RYKA 3H1WA 3LPFA 3KVBA 1JYIA 1AL22 4FBFA 4LPLA 1AR91 1QQP2 5A7PA 2VZRA 3O1RA 2OPWA 1QOSA 1Z7S3 3O0XA 3PUSA 4Q0QA 3B02A 3WNXA 1TME3 1UMZA 3KGLA 3THPA 4CDQB 3QCWA 5CG8A 2J1VA 4FOVA 4NRPA 1OURA 1J1LA 5FYCA 3UK9A 1ZBE3 4BQWA 2XUEA 1OQDA 5IK8A 4UOJA 1GQGA 2YU1A 5FYMA 1UX7A 2QCSB 1Z0HA 3WT3A 4EWDA 4BQ2A 1U5IA 3NJZA 2V73A 1C28A 2SBAA 1MR5A 1EUUA 2PN5A 4XXAA 4PQ9A 4E2SA 2XVKA 2CWMA 3ZMNA 2FMYA 4JGYC 2W92A 1KS4A 2I45A 4HVRA 4P9JA 5FYZA 4EYUA 1O4ZA 2DCJA 2GMMA 4FPOB 1FV3A 4MGQA 2CAVA 4LORA 1RUI1 5ABJB 1A8MA 5FV3A 3V0AB 3LIGA 5LK5A 1PMJX 4MG2A 1ND3A 3MZHA 4PF5A 3I3MA 4AVBA 5KHGA 1OQEA 1AX2A 1TNRA 1W3XA 4JDOA 3RNSA 2WZR2 1YRZA 2OT7A 3C7HA 1W9SA 2ERFA 1DGWA 2X5IB 1M4WA 4KWKA 4L2NA 3FMGA 4XF3A 4CDQA 5LEKA 3BTXA 1AJOA 2VJXA 1W99A 2VCBA 4CE8A 2BBAA 2BEOA 4LO5B 3J7HA 2VL4A 5I0DA 3IM0A 2E51A 4QM9A 3KV4A 2VCMA 3WW3A 3FFQA 5DZEA 1O5LA 1V00A 3L9JT 4M0HA 1Y9QA 1WA6X 4XW3A 4MGIE 1GZTA 2JE8A 3ZYIB 2QFEA 2D5FA 4BK5A 1YI9A 2VQAA 3WG4A 5EHDA 1H2KA 1S1AA 3ZXJA 2X10A 2TBVA 4CSWA 1LENA 2G9GA 4XDOA 1HRI3 3SC7X 5ABJA 3V0AA 4QB2A 4AEJA 3OBRA 5E1RA 3WY6A 4FFIA 4CDXC 3ZYHA 2AZ5A 1AYM1 3W59A 4FOYA 4YZ2A 3N3HA 2WZR1 5ISLA 2G9FA 5FZOB 3RVHA 3N7JA 2X5IA 2Y38A 4COZA 3JD71 2MEV3 5I0RA 3AMNA 3E1F1 5C4WC 2P17A 4UW6A 4NMIA 3ZIWA 3UT0A 3CU7A 4I01A 5KHHA 4LE4A 3RJRA 5C33A 1LGCA 5LCWL 4RD7A 3BUCA 3MUZ1 3IKWA 5FMOS 1RUG1 1UOBA 3BOWA 5CFCC 4KH9A 3SH4A 3ZSJA 3SITA 1SLAA 2JWPA 2VOTA 3PNAA 3ZSEA 2XPJA 2R062 3WW2A 1RB8G 1JUHA 5JVVA 4Q0VA 3HN3A 3NV3A 1GLHA 5JPMB 1W39A 5JSRA 1FPN2 3OB8A 1D7PM 2HWF1 2VOXA 1UU6A 2BW8A 1AYN3 2B46X 2BNNA 2H0VA 2QQJA 3MW2A 4JV4A 4QXCA 4AVSA 4CCCA 1CQ9A 2X09A 3NNFA 3N9LA 2ZPXA 1UWWA 5HBAA 1IOAA 4GH4B 5C3RA 1HXS1 5EJ1B 5KR7A 1WMEA 1RHI3 3IB3A 5FZOA 3VZNA 3VBUC 1GICA 1GNZA 1CZSA 1SFPA 4OUEA 4XILA 1LU2A 2B5HA 1COV1 3SMHA 1ND2C 4EZ4A 2BU9A 3DPRC 3I3QA 4FT8A 3TYJA 3Q9OA 2ZA9A 3WHUA 3AL6A 1DQ2A 1LOEA 3MO4A 3NNLA 4HN1A 4E4HA 4QAWA 5T5JA 3VBSC 3ZVXA 4AF9A 4F3JA 3GBFA 3RPQA 1X82A 2XJUA 3UESA 2HKXA 1SFYA 2Z69A 4AVAA 2FDJA 3SH3A 1F4HA 4CU8A 5A6XA 3CEWA 1O5UA 1KJLA 3W58A 4H2AA 3BPSA 1XBFA 5FP4A 5E6HA 2Y6GA 1KJRA 1JH5A 5I91A 2WNUC 1LOFA 2A75A 4AFBA 4COVA 1UF2C 1YJLA 2PLV3 2R16A 2YG0A 4Y26A 5FZ8A 2D6NA 4XJ9A 3OGSA 3WQ1A 3H8OA 5EQUA 2AC1A 4KG8A 2NM1A 5DAWA 4TLFA 3WINE 1FI2A 3RZMA 1JHNA 4GH4A 1UL9A 4BLIA 4AHYA 2VTXA 4Y24A 4XHBA 1SCSA 3IMNA 4ATFA 1O4TA 3KV5A 4S2HA 4KNCA 1Q3EA 4KWJA 1H6YA 1AVBA 2D7FA 4MGZE 5FJHA 5BPXA 4O61A 3RGBA 2RMU1 4LJHA 2DBNA 4LKEA 4DUXA 2Y34A 1JZ6A 1RUE3 3HJRA 4LIVA 1G9FA 4AQSA 3CIHA 2RS11 3MLJA 5DAXA 5KHKA 2O14A 2YBSA 4FAHA 1SACA 4BJ0A 3OBTA 4DPNA 4PT6A 1PVXA 1WW7A 5A1LA 4WBBA 4RA0A 2J1TA 1BBT1 3O1PA 5FZKA 3WX5A 3AZYA 3KM5A 5KHIA 1MEC3 3WUDA 4F83A 4GJZA 3MFAA 2EXJA 4D7TA 3AXDA 4W8JA 1JHJA 1U0AA 3H3UA 1AR72 1ODMA 2W47A 2YROA 4I0BA 4ES8A 2YU2A 5FZ0A 2OZJA 1PM4A 2YFUA 3THCA 1FT9A 2ZGLA 1YLLA 3ZYFA 2CGOA 1JYVA 4E4DX 2JKXA 2RE9A 2WFF3 4CCMA 4OCTA 3KCCA 5A6ZA 5LZ6A 1W03A 1TE1B 1UY2A 2HWD2 2Q1MA 1KITA 1ZBA2 4KI5M 1XQNA 2D6OX 1XSQA 1AR83 1EP0A 3WF1A 3WW4A 4QPYA 5F9TA 1EUTA 4AE2A 1SBDA 2WAAA 4O7XA 4OMDA 5FZDA 4COUA 2W1SA 4KGQA 2VUDA 3IDAA 4NHMA 5HPOA 4HONA 2GC2A 1O91A 1C8NA 1VBA3 3K2OA 4AHXA 4BB3A 2RS52 3I2IA 3LF7A 4H3WA 1N3PA 3VHRA 4S2FA 4AW7A 1BYHA 1RUF2 5JAXA 4ASKA 1ZZ9A 1V9U1 1SHWB 3K51A 2AENA 1BHGA 2WBKA 3ZN5A 3JBG2 5HI0A 4QX1A 1Y9MA 5BNPC 3PVOA 1VAKA 5AFEA 2E9QA 3V65A 3VUOA 2ET1A 3VD9A 3DGTA 4BLJA 1PVC3 3A22A 5H9RA 2HWD1 4YVSC 3OGGA 3VLBB 4J25A 4X8NA 5CVRA 4Y5Z0 1W2UA 2DVBA 4HOOA 1RUJ2 2GNDA 3S0MA 1AXYA 2XQRA 5JZGB 2QDRA 4ISQA 5L73A 2VMFA 5FZ6A 4UFIA 2GALA 4DXSA 4OQ8A 5IVEA 5FUIA 2ILMA 2RS51 3VHOA 1FOD1 5J3UA 3ZOIA 4UW5A 1HX6A 3FLTA 5L7OC 2JG9B 3GJAA 4L8QA 5AC93 3TEYA 1OLMA 2IFRA 3GHNA 1REDA 5EJZB 4FXKB 2R073 5FO8B 4AGRA 5J09A 1IKQA 2JEMA 4QM8A 1GP5A 5FZ9A 4BQ1A 2XGXA 3ZFEA 2JIGA 2XJPA 1RMU3 1OLME 1G8WA 3OPTA 4RHV1 2NMOA 4GB32 3HQUA 5FYSA 1NCRB 1K12A 4XIKA 4YW3A 5JIAA 2Z79A 1AXZA 4XBQA 4ZS3A 2XJQA 4QX3A 4EE2A 1YIPA 4R4ZA 4OI0A 3C8XA 5FYTA 3MHZA 4MUVA
chains in the Genus database with same CATH topology
3FUOA 4GIQA 5JZGA 4P9IA 1QXRA 1AR61 1O4YA 3ZFGA 5FREA 4IEPA 4FTSA 3GNEA 5BV6A 3N7MA 2OIIA 1RUC3 1KS5A 1MQTB 2ZZJA 4AFAA 4ES9A 5D1IA 3M4FA 2JG9A 3ZXLA 1Z7S2 4D69A 1TME2 3MFCA 1IPJA 3AZXA 4D7YA 1AJKA 2PAKA 4GWMA 1ZBE2 3OTFA 3H9AA 3PJQA 2WS93 1UD1A 1NCRA 4BWOA 3GF6A 5JIUA 3WDUA 1C8M3 3WP6A 1EV13 4GA9A 2HEVF 4CTEA 5F1RA 3MLLA 2R041 4FQ4A 4DRVA 1QNWA 1J3RA 4FO9A 1CAXB 4GQ7A 5FQ0B 1ZX5A 1OOPC 4AQ2A 4Z07A 3PMEA 4QPGB 1KRIA 2I2SA 2CTVA 4SLIA 1MQTA 1TQ5A 4QT6A 5IT6A 2DFCA 1GQHA 2R6QA 5CADA 4Z92B 5FFOC 2E6VA 4CEYC 3WR0A 1PK6B 4WM8C 3D6EA 1PGW1 4DFSA 2JICA 4R8HA 3D0JA 5I0SA 1XYOA 2RS31 4YZ1A 2ZX4A 1I5ZA 3IDBB 5K0UB 3U10A 1BK1A 2QDNA 3R4SA 3VZOA 3IDCB 4K21A 2C0ZA 4CRQA 3FHIB 3RG0A 1F2NA 2BTVC 3B93A 1CAXA 1EAH3 4HKWA 5FQ0A 1OA2A 1HRI2 5T5PA 4B4RA 3VBHC 4AFMA 3JB4C 1X33A 2Q5TA 4QPGA 4R9BA 4OHVA 4Q4W2 2QUOA 1S0BA 4IEOA 3UJOA 1F5JA 3MF9A 1MZFA 4Q4V1 1WD3A 3ZXFA 1GBGA 1UIKA 2MEV2 3AKPA 3BPZA 4Q8LA 3NAPC 1PK6A 1NXMA 3I8TA 1GANA 1VBE3 2SLIA 3IPVB 2Q0AA 3INAA 2W52A 5K0UA 1S55A 4JRLA 3T1MA 1ULFA 1VJ2A 1OSGA 1EPZA 4K20A 2RR11 4YZ4A 3PVNA 5BYNA 3MYXA 2NZ9A 1F9KA 5EWSA 1MS9A 2EIGA 1DFQA 2GNTA 4CEWB 1D4M3 4DY3A 4Q4W1 3U11A 4YGCA 4PIYA 5I8TA 1XYNA 1R093 2WLPA 2PHXA 2X53S 5JPMB 4P9GA 1RHI2 3VDDB 1VIWB 4EN6B 2MEV1 1FYUA 1QOTA 3BALA 5JSPA 2FZ2A 4BE3A 4AI8A 4ISRA 1N1YA 4K3UA 1HV0A 3IPVA 4JRAA 1UU4A 4A2UA 4QX5A 4CDQC 2W0XA 4LULA 3FBMA 4NO4A 1CESA 3VKNA 4YNIA 4KBBA 1FMD3 3AP4A 2VMGA 2GN3A 3KT4A 4GULA 1QJY1 1H2LA 1XE7A 5J7MA 2PFWA 4IEUA 4QQOA 4OLLA 3H0OA 1V6IA 2VG9A 4FCAA 5K7PA 2PLV2 2DVDA 3ROUA 3TN91 5T54A 3BB6A 2GAUA 2XBO1 5CNAA 4DZGA 1PZ8A 1Q8PA 4N43C 4ASLA 3VDDA 3A4UA 5ABJC 2ZGSA 5BNNA 3MIBA 3N7KA 1IHMA 2D43A 3O5SA 4OVEA 1ENRA 3SCFA 5L19A 4AWDA 1PO23 2WSVA 1RUE2 5DXDA 5KC6A 3WDWA 3LAGA 4HPKB 3WVJA 1YJKA 2X5IC 3JQWA 4XMIA 3AYAA 1POV3 2YGLA 2BQPA 3NW4A 1OD5A 5JOYA 5CA6A 4EJRA 2IXCA 1MEC2 3VL8A 2ZMKA 4COYA 4YFZA 2CGPA 3KGZA 4P9WA 1ENSA 1KD7A 1PIV1 1BKZA 3D4KA 2WWSA 1ZZ8A 2GMEA 1XXNA 1K5MC 2JENA 3LGRA 4NVPA 2ZGRA 1BMV2 2WFF2 3M2MA 1LOAA 3TOJA 4B29A 1VBC3 3M1HA 4LHNA 4YM1A 5KBFA 3CJIB 4YM3A 4IETA 4IL7A 3ZN6B 4H55A 1ZRDA 4HPKA 4XZPA 1YIFA 4AFCA 1RUD3 2V09A 3A0KA 2DUOA 5J96B 4FPGA 3WP4A 1VBA2 1YUDA 4OI2A 1DQ0A 1MEC1 4Q4X3 1IKPA 4XJUA 5KXEA 2H0BA 2UWBA 1MS4A 1OKQA 2ZHKA 1I9RA 3MPBA 4YZ3A 3UJQA 2XJTA 1ASJ3 3TRSB 2WFF1 1LOFC 3THTA 1PVC2 1VBB3 2ZX1A 1MS1A 1V70A 3TWIA 1X7NA 4WVMB 1SDWA 5AFBA 1J3QA 1LCLA 4LBKA 3CJIA 3S7IA 4TZDA 2PHDA 1V6JA 2RM21 4GH4C 4LNVA 5GJ6A 1H1MA 5SV5A 2OYZA 3ZN6A 4BCUA 4DOUA 4AI2A 4I09A 4CDUB 5ACA1 3G7DA 1VBA1 4AHWA 4AFDA 4QQPA 4LE3A 2EF6A 1R1A1 5AC92 1O3QA 3LCPA 1ZRCA 2YGMA 2R072 2PELA 3LWCA 2HWB3 3WCRA 1D0HA 4NHKA 5AVPA 1WA4A 2UWCA 2WJSA 5GLWA 1RMU2 3KQRA 4AI0A 4M00A 4F7ZA 2WINB 1OLRA 3QD6A 3ZXDA 4C0BA 3KD4A 4E9KA 1W6QB 2C9AA 1WLTA 2DU0A 1HRV3 1SBEA 3MI8A 2RJLA 1W0PA 4CDUA 3HIFA 1CJDA 1Y43B 1TMF3 4AI3A 1GZWA 3ZXAC 1ND3B 2QQPA 2B8MA 3W9AA 2WL1A 1RUC2 5FDBA 2DCKA 4YGBA 5D8AA 2XKOA 3OGJA 4H7MA 2LALA 1ZZCA 3AZZA 3DV8A 5DUXA 2E53A 4WVWA 3OYWB 1MS5A 3JZVA 1DGLA 2WNVB 3IWZA 4H14A 4UW3A 3V56A 3J8F3 3VBRB 4FPKA 3KT1A 5FMOL 4RS5B 2VW1A 3N35A 4CP2A 1BJQA 4QGLA 1GR3A 3D8CA 1C8M2 1GNHA 2XJRA 1EV12 4DXZA 3JQXA 1W6QA 1JXNA 3JU9A 5BY5A 2DVFA 4ATEA 5EZWA 3R0RA 4FOWA 4FPYA 1DQ6A 5CFDB 1ENQA 1AL21 2ZX0A 1ZVFA 1QQP1 3V0BA 5E16A 1Q5OA 5DZFA 2B42B 5JMCA 1DQ1A 1Y3TA 1LHOA 3H7JA 1JN2P 5LRRA 3HN1A 1D4VB 2XLAA 5JDBA 1YO8A 2YZ4A 4LBJA 1NY72 1NG0A 1H4HA 3OYWA 2WNVA 3AJYA 3BIWE 4MLOA 1RVF3 3VBRA 3ASIA 1CAUB 3B69A 3GHMA 4RS5A 1H8TB 1IS4A 4I02A 2ZMLA 3WDXA 2UYBA 4NR1A 2HJIA 1RJ8A 5JOXA 2A71A 3NSTA 1Q8VA 1DBNA 1EAH2 3QACA 1S0DA 1QDCA 2ATFA 2EA7A 3BU7A 2VOVA 2YPJA 4XF4A 4LBOA 5CFDA 2QKDA 2H6BA 3NWKA 4HBNA 4JTNA 4AI1A 2XLFA 4R9CA 2X29A 1U12A 5T5LA 4LT5A 2BWCA 5JZGC 1DDLA 5EJ3A 2UURA 3KZ4C 1NY71 3H1YA 2O8QA 2PHRA 3WD5A 3PMSA 2VECA 2E7AA 3E5UA 1FX5A 1VBE2 1WW4A 1CAUA 4JQRA 1H8TA 1M06G 1NXD1 2JG9C 1UW8A 3O0WA 3WOGA 2IFWA 4XOGA 3UL2A 4Q4Y3 2FZ1A 4EN8B 2ET7A 1DZQA 4GXLA 4BA6A 1CONA 4MVTA 5CBLA 5HCFA 5C6CA 1NCRC 3ZXGA 2YYOA 3SHRA 3VBFB 1S0GA 2VPVA 3MEPA 4GMP3 5GALA 4LHKA 4J6GA 3H1MA 1ZZBA 2AREA 1C5HA 1D4M2 1QNYA 2C5DA 2VOWA 4BIOA 2GH2A 1NA1B 1JUIA 1N1SA 1SLIA 2YHJA 2YY1A 1R092 2KA3A 2DF7A 4OHZA 4Z2WA 1PZ9A 3KT7A 1ALYA 5K9YA 4XF0A 2BGCA 1QY4A 1PGSA 4HVQA 1W0OA 3WDVA 4N7IA 1R083 4CYDA 2O1QA 1QJX3 4MH0E 2R061 3GZAA 2VNRA 4W6YA 3EBRA 3M7AA 2WQ4A 1YHFA 1VR3A 4N7UA 1FMD2 1QJU3 2PAEA 2GDFA 4NWWA 1FPN1 4P9XA 4EWEA 3LSEA 3G6JB 3DF0A 1WUVA 3N7LA 1U5ZA 3VBFA 4D3WA 4AK3A 2PHWA 2BVBA 3N4MA 2LUWA 5FPXA 5F6LB 1G6NA 1NA1A 3IIAA 2E7TA 1DHKB 5CB7A 3V64A 3ZYRA 3VZLA 2PHUA 4HZFA 2VNGA 3RRDA 1VRH3 4BIFA 1X36A 4YYOA 1Q8SA 1TNFA 2DCTA 5I8SA 4GKXA 4QPGC 4DB5A 1YFUA 1OFSA 1B35B 4OHWA 1QDOA 1ZZ6A 4X8PA 1PO22 3GZUC 5A3LA 3ZN4A 1X50A 2KXLA 4U2AA 5J37A 2XJSA 1Q8OA 1PK6C 2WIIB 2NPIA 3JUUA 3RMYA 4EROA 1LKNA 1D0GA 1VBD3 2BNOA 4I0AA 1F5FA 4NN0A 3MIEA 2ZOEB 5FLIA 2ZGMA 5DDJ3 5A33B 5K0UC 4Q27A 4JCKA 1BQPA 3KCXA 1OFNA 4W6XA 4E2GA 3ES4A 5IK7A 4ORFA 5GZFA 4WV8A 3WP5A 4HKLA 3H8UA 1H4GA 2HWE3 2R0FA 5EYYA 2Y0OA 1S0EA 5GZGA 1B35A 1VBC2 3UKTA 2HWC3 2R1BA 3RYRA 1POV1 3POSA 3APBA 3LOBA 4YFWA 5KXBA 2EXIA 4O9GA 3JCIA 1FNYA 1PO12 4IEZA 4K7JA 1NQDA 1DZRA 4QGNA 3IT8A 4TSVA 3ZSMA 1QOOA 4N53C 3VBOB 5A33A 1AR71 1CAVB 5FCCA 4XJZA 1NLRA 1VP6A 1LRHA 3ZFEB 1CIWA 2V5YA 1UKGA 1QGLA 1F31A 2HYKA 1VB4A 1W6MA 4LO8A 1ASJ2 1A6CA 1VBB2 1HQLA 1ZBA1 3MICA 3FX3A 2VUAA 2ZGNA 3HBZA 4CEWC 3USUB 1LESA 2B9UA 4Z82A 2PHLA 4M0NA 4FAGA 3VDDC 3ZFGB 1W6NB 3QH6A 5JOWA 2XH6A 4YVWB 1PO11 5T55A 4BH9A 3TNPB 4XBLA 3WUCA 2JECA 1RUF1 2YUEA 1A78A 3VBOA 2ZKNA 1CAVA 3JBG1 5C8CB 4G4FA 3CJXA 1WLCA 2HWB2 3SXWA 1GZCA 1N3QA 4YW1A 2XWBB 5E89A 5JI9A 2ZTNA 1WLWA 3C2UA 3AZWA 4HFSA 4QGMA 1MVQA 2ZS6B 4FPJA 4OZXA 1OA4A 3H7YA 5A3MA 3USUA 4YM2A 1RUJ1 1UU5A 2XVLA 5FTTC 1AR93 2VOKA 3RDIA 1H9WA 3B9CA 1H1IA 3WDYA 1POV0 5KC5A 3B00A 1QKQA 1W6NA 2P37A 3DN7A 4Q29A 3CO2A 4W6WA 1DYPA 1TMF2 4LO4B 4YVWA 3NV1A 2CGNA 2GNBA 3T1LA 2GH8A 4M3CB 1CPNA 1GKBA 4HN0A 2MHFA 4P14A 5EV7A 2K2SA 3AYEA 1N3OA 4MGYE 4WVZA 1GV9A 1UN1A 5C8CA 1IZ3A 5E8AA 2VVEA 2WC2A 2NQYA 4LTAA 4SBVA 4GB31 3J8F2 2ZBJA 1RUI3 4YRDA 2EAAA 3CF6E 5GLZA 1X8MA 4Q1PA 4PDWB 1OLQA 1OA3A 2G4IA 1C1LA 3HMYA 4QHBA 3LZZA 4NPRA 5DZGA 2GZWA 3R4DB 2QE3A 3LA3A 5FBZA 3L2HA 1ZA4A 5CU1A 2ZX2A 5C9AB 4F8AA 3CJIC 5HXVA 4PLNA 4M3CA 1Z7S1 3AX4A 1TME1 1QF3A 4XFHA 4B8EA 1D2SA 3FBYA 4XFAA 1DU3D 4M3CE 1ZBE1 2DUQA 1XRUA 3AFGA 2VNOA 1RVF2 1YWKA 1R1ZA 2XKPA 2EVXA 4MYEA 4PDWA 1AYM3 3LKJA 2ARBA 4XHXA 2DFBA 3POWA 3JD73 3AP5A 2FBEA 1KDMA 1LTEA 1YYNA 4K9SA 2XHKA 3B3QE 3A0NA 1G9CA 5C9AA 4I3PA 1BVP1 1Z78A 2UU8A 1RUG3 4XJ8A 4MGKE 1JBCA 2R0HA 1GYKA 2YV8A 4JAAA 4LBQB 3MF6A 3LB9A 3WW1A 4CDUC 3CL1A 2X8KA 4FOQA 1XNKA 1NOVA 2BFUL 2MPFA 1WLDA 1HV1A 3O7OA 2E7QA 4AVTA 3ZSLA 2HWF3 4A7KA 3VKFC 2B7YA 5GZCA 3B7MA 4Q4Y2 1A3KA 5L36A 4N9IA 1HXS3 2GNMA 4Q0UA 4B7KA 1HRI1 4RFT0 4EN0A 2IXKA 4ZU4A 1LHVA 1MACA 3MW3A 3FWEA 1AYN2 1COV3 3OCPA 2OW4A 2WQZC 4JDNA 4Q0SA 3AP6A 4XJAA 1WMDA 2ZGTA 4GWNA 3WHTA 4OFGA 1Q8QA 1LODA 1NE4A 2Q30A 3GALA 3P3NA 4LBQA 1C57A 3B9IA 1NCQB 4LLOA 5BNNB 1MVEA 1ND3C 4S2DA 3HQXA 3S7EA 3R05A 5DUWA 3FUQA 4CDWB 1R082 3L2YA 4IESA 1QJX2 2VULA 2VGDA 1CPMA 4XMAA 1WCSA 2WNVC 1QJU2 3VBRC 4AXOA 1GSLA 4RS5C 1FXZA 2A6WA 2D6PA 1AYN1 1HDKA 3RMXA 4QPIB 4LR4A 3NV2A 2RMU3 3VKLA 3O0VA 4RR3B 1I3HA 1NQJA 2A7AA 2RS13 1RHI1 1LEDA 4IV1B 4C91A 1VRH2 4NOTA 1NCQA 2P34A 4M01A 2UY9A 3ZXKA 4HL0A 1NZCA 1BBT3 4AEKA 1R081 4CDWA 4YVSA 2HEWF 4LA2A 2GMPA 3ELNA 4LHLA 3M3IA 4DMIA 2ZCWA 5EFUA 1C4RA 1QJU1 3LA7A 4YGDA 3VZKA 4OHYA 1C5IA 1SLLA 4HMZA 1U5XA 1VBD2 1H8TC 3MPPG 5CIRA 2PLV1 3J4UH 1BEV3 1N47A 3D82A 5LRSA 3PJYA 2W39A 4HETA 2OPKA 2Z5WA 4B4QA 3IN9A 4A7YA 4QPIA