3VBHC

Crystal structure of formaldehyde treated human enterovirus 71 (space group r32)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbhC00
4Q4Y2 1MEC3 1MQTB 1FOD2 3VBHC 1HRI1 1PIV3 4CEWB 4Q4X2 1PVC3 2BPA2 1BEV3 1RUI2 2WZR2 2WS92 2RM23 3ZFEA 1DDLA 1QJX3 4PDWC 4RR3A 5AC92 1TME2 1HX6A 1Z7S1 2R071 2WLPA 4N53C 1VAKA 4PDWA 2Y26A 2RS53 1VBA2 1VB2A 5L7OC 1H8TA 4GMP1 1R093 1HXS2 1QJY2 3CJIC 5FMOL 1RUD1 4Q4W1 4CEWC 1MQTA 5GKAC 1RUE1 2MEV3 4CEWA 4BCUA 2RS33 1VBB3 1RUF3 1FMD3 1RHI3 1RUJ3 5C9AB 1NCRB 2ZAHA 4IV3C 4YVWB 5JZGC 4RFT0 3VBOB 1RUG2 3VBRB 2HWB3 1VBC3 4QPIB 1ASJ2 2VQ0A 1MEC2 1C8NA 1CD3G 1EV13 4Q4V1 4CDUA 1RMU2 1BEV2 4N43B 1FPN1 4GB31 1B35C 1POV3 1AR83 1NA1B 1QJU1 5C9AC 5FMOS 4Y5Z0 1NCQB 1D4M3 1NCRA 2RS13 5J98B 4YVWA 3VBOA 5C4WC 1AR61 3VBRA 1PGL1 5A33B 4QPIA 1BMV2 5CFDC 1AL22 1OPOA 4Q4Y3 1FOD3 4GH4C 4JGYB 5ABJB 1AYM1 4Q4X3 4N43C 1V9U2 2RS32 1RUI3 4N43A 1NA1C 2WZR3 2HWD2 1HRI2 1W39A 3VDDC 2WS93 1PO21 4SBVA 1NA1A 2RR11 1RUC1 1AR71 2HWB2 5D8AB 1NOVA 2BUKA 1NCQA 2X5IC 4RS5C 1EV12 3VBHB 5A33A 1HXS3 1QJY3 3JD71 5C8CC 1Z7S2 2R072 5ABJA 4JGYA 1F2NA 2R061 1ZBA1 3FBMA 1RUD2 1A6CA 1RUE2 2HWF1 1D4M2 1RUG3 2HWC1 4RQPB 4N53B 5D8AA 3ZFFB 1ASJ3 2RM21 5L7OB 1C8M1 3M8LA 4QPGB 3TN91 3CJIB 3VBHA 1RMU3 3LOBA 2XBO1 3JB8A 4CDQC 3J8F1 2RS51 1ZBE2 4Q4V2 1RB8G 4AEDC 2XPJA 1ND3B 4IV3B 5JZGB 1VRH1 1PO11 1VBD1 3IDEA 4RQPC 3ZFFC 1QJU2 2BFUS 4CEYB 1HRV3 3ZFGB 4RQPA 4N53A 1X33A 3ZFFA 4QPGC 1AUYA 1AL23 1R083 2ZTNA 5L7OA 1QQP1 1AR62 3CJIA 1SMVA 4RHV3 1AYN2 1V9U3 5K0UC 1B35B 5DDJ1 2QQPA 1AR91 1RVF2 1E57A 2HWD3 1HRI3 3NAPC 1ND3C 4NWVA 1ND3A 4IV3A 5JZGA 5BNNC 5C4WB 4CEYC 5BNOB 3ZFGC 1CJDA 2GSYA 4CEYA 2RR12 5CFDB 3ZFGA 4GH4B 2RMU1 1BBT1 1OOPC 4FSJA 2FZ1A 1Z7S3 2R073 3JBG1 2HWE1 4IV1C 3VDDB 1R1A1 1B35A 1RUD3 4Q4W3 1RUE3 4Q4X1 5C9AA 4GMP0 1AL0G 1ZBA2 2X5IB 4RS5B 5ACA1 1HRV2 5BNOC 5C4WA 5BNOA 1HQNA 1R082 5CFDA 1OHFA 5AC91 2HWC2 5C8CB 4EJRA 4GH4A 1TME1 4RHV2 2BBVA 1COV1 1PGW1 1RUH1 1C8M2 2R041 1VBA1 1ZBE3 3TN92 1VB4A 4Q4V3 1NY71 4FTEA 1VBE1 2XBO2 3VDDA 1ND2B 3J8F2 1FPN3 1EAH1 2PLV1 1QJU3 3VBUB 2WFF1 2X5IA 4RS5A 1VRH2 1PO12 1RUG1 4LLFA 1VBD2 1AR63 4JGZC 4CDQB 5C8CA 1AYN3 3VBSB 1TMF1 3S6PA 1MEC1 2DF7A 4Q4W2 4WM7C 1QQP2 1RVF3 1PIV1 4AEDB 1AYM3 5CFCC 1ND2C 1X36A 1PVC1 1BEV1 5DDJ2 1AR92 3VBUC 1K5MC 2RR13 3VBUA 4CDWC 3JB4C 4YVSB 1QJX1 1AR73 2TBVA 4CDXC 4FTSA 3VBSC 5K0UB 4CDQA 3VBSA 5J96B 1R091 2RMU2 3NAPB 3JD73 2MEV1 4AEDA 1FPN2 4GB32 5BNNB 2HWE2 2RS31 1VBB1 1ZBA3 1R1A2 1RUF1 1FMD1 1RHI1 1RUJ1 2HWD1 2HWF3 5A32B 4Z92B 4YVSC 1NG0A 4QPGA 1OOPB 2HWB1 2HWC3 4YVSA 5ACA2 1VBC1 3ZFEC 1PGL2 4NWWA 1C8M3 4RR3C 1EV11 5K0UA 4IV1B 3TN93 2FZ2A 1AYM2 2XBO3 1COV2 1PGW2 3NAPA 1RUH2 1H8TC 3J8F3 2R042 4CDUB 1MQTC 5BNNA 1POV1 1AR81 1NY72 1PO22 1VBE2 1VRH3 1RUC2 1QJZA 1AR72 1F8VA 1D4M1 1EAH2 2RS11 5A32A 1PO13 2PLV2 1VBD3 1OOPA 2WFF2 4GMP3 4Q4Y1 1FOD1 3JD72 1QQP3 4IV1A 2R062 1TMF2 2ZZQA 4CDUC 1RUI1 5DDJ3 1ZBE1 1AR93 2GH8A 2WZR1 3HAGA 1PIV2 2WS91 2HWF2 4WM8B 4FTBA 1GFF2 1PVC2 3VBFB 1IHMA 4JGZB 2RM22 3DPRB 1NCRC 4YVWC 3ZXAC 1QJX2 3VBOC 2RMU3 4WM7B 1HXS1 1BBT3 1QJY1 3VBRC 1POV0 2IZWA 5CFCB 4QPIC 5FOJB 2RS52 3JBG3 4GB33 5LK7B 1AYN1 2HWE3 1R092 1R1A3 1K5MB 1RVF1 2MEV2 4WM8C 4CDWB 4WM8A 3VBFC 1VBB2 3VBFA 5ACA3 1RUF2 4CDXB 1ASJ1 1FMD2 1RHI2 1RUJ2 3DPRC 4JGZA 3DPRA 1NCQC 5AC93 1RMU1 1WCDJ 1VBC2 1TME3 4WM7A 1COV3 5BNPB 1RUH3 5CFCA 1ND2A 2R043 1VBA3 5ABJC 1M06G 4JGYC 1PO23 1VBE3 1K5MA 1RUC3 1EAH3 2BFUL 4CDWA 2PLV3 1AR82 2WWSA 3ZFEB 1HRV1 2WFF3 4CDXA 4RR3B 1BMV1 1AL21 1R081 1BBT2 2RS12 4PDWB 4Y4YA 5D8AC 3JBG2 4RHV1 5BNPC 1H8TB 1V9U1 2R063 5BNPA 1TMF3
chains in the Genus database with same CATH superfamily
4E8CA 2QUOA 1DIWA 1N47A 1KS5A 1WW5A 2A3WA 2E7AA 3R05A 3FC0A 4HMZA 4QDRA 4ASMB 1ULDA 1H1IA 1WCQA 3ZYGA 3CLPA 4AFCA 4Q4X2 3S7IA 3ETPA 4QPWA 4TTGA 1BEV3 5FZ6A 1FX5A 1YO8A 3K48A 4N9HA 3M70A 2AH2A 4UF0A 2EIGA 1QDCA 2IFWA 2RM23 4RL7A 3WD5A 1WZXA 4Q0SA 3O1MA 3OD4A 1KFUL 2DCZA 3R0RA 4K1YA 4PDWC 4UXAA 1XE7A 4RR3A 1Y3TA 3LA3A 1WLDA 4XEZA 4YFZA 2ARXA 1UKGA 1W8FA 1SZBA 1TVGA 4RGKA 2Y26A 3WG3A 3HOBA 1FATA 4JKLA 1BHGA 1JMUB 1H2NA 1IG3A 2I07B 3BOWA 5I0RA 1H8TA 4OHZA 3PJYA 4NR1A 5BYNA 5KHGA 4Y1XA 2EXHA 1RUD1 4OUMA 4AW7A 2WNUA 1R1ZA 3HPNA 4B1MA 2OQ7A 4MGZE 4CEWA 4MHUA 3MFAA 3ZIXA 4BCUA 5FQ0A 2RS33 4Y33A 2DTYA 2TNFA 1WGPA 1VIWB 1RUJ3 1SLCA 3ENRA 1I9RA 1DQ1A 4IV3C 1G6NA 1W2TA 3C7OA 4M4RA 5FYHA 4XF4A 3VBOB 4YZ1A 2GAUA 1BKZA 4IW3A 2HWB3 3WG4A 3H3ZA 4MGSA 4WVVA 3I3MA 2EXJA 4I02A 3J7NA 4N9IA 2HLEA 1OH4A 4GQ7A 2BV4A 1UY4A 3NNLA 1MEC2 1ZZ7A 4ORFA 1W9SA 3GZUC 4Q4V1 4CDUA 2BWAA 3KHCA 4CRQA 1AJOA 4PLOA 4XJZA 1PZ8A 2J42A 5FMBA 1QXJA 1FPN1 1W6NB 3MEPA 2GU9A 3DECA 1FNZA 3ZXFA 1B35C 1ZZCA 1XNTA 3T2OA 1W8UA 4X6RB 2G9ZA 3VD3A 4N7UA 5I91A 2C9KA 4QXKA 1JZ4A 1ZZ6A 1X7NA 1ZVFA 4Y5Z0 1NCQB 2P3KA 3E5XA 3OYWB 3VV1A 2WUHA 1W6OB 4YVWA 4I0WB 4DEQA 3VZNA 4Y1YA 3NWKA 1SEFA 5LATA 1OLRA 3D6EA 2OXBA 2DFCA 4QPIA 1IS5A 5GZGA 1PVXA 3LZZA 4IEUA 5CFDC 2CNAA 1DG6A 2CGPA 4JGYB 4UFHA 5EV7A 1Q56A 1V70A 1SLIA 2NMNA 1JYTA 3OBZA 3POWA 1BK0A 3UGGA 1PM7A 5FP9A 4CUGA 1HB2A 4B1LA 2WFPA 3SCHA 4LO4B 4N43A 1GNZA 4Q0UA 2QQKA 2WZR3 3OBAA 2HWD2 1W39A 2UWCA 3P3PA 2VZTA 1PO21 1NA1A 2BGPA 4YYOA 3U4SA 4MGKE 2RR11 4BDVB 3GXUA 1RUC1 4KGGA 5D8AB 5JDBA 4J6GA 3AZVA 3OY8A 4L2NA 1PX4A 2BERA 3GHNA 4AFDA 3FWEA 1YIFA 3OF1A 4XYXA 2UURA 4AHXA 1GQGA 5F39A 4OI2A 1Z0HA 1EV12 5JPNB 1QH6A 3I2DA 3C7FA 4OZOA 4K9SA 4QQOA 3B02A 2B42B 2BBAA 4XPVA 1CAVB 1C57A 3AKPA 3WEZA 1GWMA 4Z8BA 4MH0E 4NHKA 5J7MA 5JPMB 1ULGA 4QGMA 3NV1A 1ZBA1 1QHDA 2DURA 2YGLA 4XUPA 1RUD2 4CCJA 1A6CA 5C8WA 3H1MA 1E5IA 1W8WA 1LTEA 2VBBA 4P5YA 1GANA 1S0EA 2QJVA 3KV4A 5I8YA 1LU2A 2Y0OA 4S2HA 1C1FA 5DG1A 2XXZA 1JZ2A 3V0BA 1BQPA 2C5DA 4KGQA 4BA6A 1ASJ3 4XQ4A 2FDFA 5A7QA 4MGIE 2HJIA 4XFBA 3AYEA 3M8LA 4KI5M 3M7AA 4EN0A 3VBHA 1RMU3 3KCYA 3LOBA 2ZMKA 2PYTA 5H9QA 2WA3A 1ZRCA 3ACIA 1Y7BA 3OGGA 1ZBE2 4DUXA 5LASA 2ZHLA 1UQXA 4Q4V2 2EAKA 3H3LA 4LBOA 3RMYA 2W3JA 1ND3B 5CBLA 5L36A 3I59A 5JZGB 1VRH1 1NLRA 2F4LA 1UCXA 2H6BA 1CX4A 2RDQA 1S2EA 3GYDA 2VTXJ 3V64A 2FBEA 4HG6B 4MXWB 1OKOA 5F5AA 1W2NA 3IDEA 2OUHA 1FYUA 2BFUS 2Q30A 1HRV3 4N53A 5HPOA 2XMLA 1K3IA 1GU3A 4PJYA 4C0BA 2FCVA 5JR7B 2TUNA 1DYOA 4ZZ8A 2NN8A 3CJIA 3FHAA 1QOTA 3JUUA 3Q8EA 4QKNA 4G9SB 3THPA 4FP3A 4CZSA 2K46A 3KSCA 4NO4A 2E9QA 1YFUA 4JDOA 2QQPA 1HRI3 2JICA 1ODMA 3KD4A 1ND3C 3THDA 5K4LA 4OI0A 2WRAA 3BCWA 4I0BA 1POQA 1FI2A 3RGBA 3WINE 4AI8A 3ITQA 4A4AA 5JCTA 1TNRA 3AL6A 5C4WB 5FAXA 5LBFA 2NYYA 1GYKA 3EBRA 1SCSA 2EF6A 1O5UA 3I4IA 4IETA 2RR12 2ZX1A 5B4XA 4CEYA 2F17A 4AK3A 2ILMA 2P6CA 4NN0A 3OBRA 2JDHA 1PNGA 3U14A 2FZ1A 2R073 3EO6A 1T2XA 5IHRA 3RZKA 1HB1A 3HBKA 5FYYA 3OGRA 4GJZA 1PK6A 4QT6A 2BZDA 2BYVE 5T3NA 2O8QA 4Q8KA 2RDRA 4Z2AA 4KBBA 2VXRA 4LBKA 5FBZA 3VDDB 4Q4W3 4BIFA 5F3CA 1JHJA 2WA4A 4LBJA 3B9IA 2LROA 4Y22A 5IK5A 1AL0G 1ZBA2 4RS5B 2VW0A 3HWJA 5ACA1 2AEYA 2V09A 2XJUA 5LA1A 3VUOA 4Q0PA 2VR4A 3WCRA 2YG0A 2E53A 1NQJA 1AXKA 3D3AA 3ZN5A 2BBVA 3BPZA 5J48A 2R041 1DGLA 2ET7A 1VBA1 4P9GA 2OKXA 3EJKA 2JG8A 5FUNA 3U75A 1O6UA 1ENXA 1SDDB 2PN5A 4HZFA 2WABA 4UW4A 1VBE1 3P5BA 3PTYA 1K45A 1WBLA 3ON7A 5H9PA 2JE8A 3HR9A 1AZDA 1T6GC 2GZWA 3I8TA 4LBQD 4HVRA 1EAH1 2VZQA 1GR3A 3M3OA 3V0AB 3TBDA 5E89A 3QACA 4QB2A 4Z1VA 2X5IA 4XDOA 1VRH2 4DNYA 2R0FA 4LKSA 3S0MA 2PA7A 4Y4RA 1RUG1 4RGGA 1D2SA 1A8DA 3AZYA 2JIJA 2FHRA 4QX2A 3RZHA 1AR63 4KNCA 2HH9A 3B69A 1W0OA 1GNHA 4QM9A 5FZ0A 1TMF1 1J3QA 3PVOA 3HT1A 4HVOA 4QX1A 2CHHA 1CAUA 1UMIA 1ZA7A 3PMSA 3PU3A 4YSFA 1W28A 2Y6JA 1AYM3 1UZYA 2JIGA 5FZ1A 3TNPB 5J09A 4RA0A 3O1UA 1UMZA 1BEV1 5FZMA 3L9JT 5FZGA 5FBJA 4U2AA 2ZX0A 3HNYM 1D0GA 3IB3A 4X8PA 3MF9A 3RS6A 2D6PA 4Y20A 1IS6A 1I6XA 4R9DA 3E5QA 4G3YC 2ZXQA 1OA3A 4RD7A 3O1SA 2WT2A 4LBNA 3BU0A 2ZGKA 4XFIA 3USUA 5K0UB 3ES4A 5EJZB 3ZKYA 2UWBA 3OPTA 1PZ7A 3I7DA 3VBSA 4XURA 3FBYA 1QJFA 1OA4A 2YPJA 2ZAAA 3D82A 4BISA 1JUIA 3ZDVA 3I2OA 3VKNA 2E6VA 1F9KA 4AEDA 4GB32 2JJ6A 2XG3A 3MIEA 3OEBA 2RS31 4BIOA 4O61A 2QQLA 5A7OA 4AF9A 2Z4FA 1RUJ1 2AREA 4HANA 1YNAA 1UOBA 4NE9A 2HWF3 4F83A 4LE3A 4LPLA 4W6XA 2QQNA 2A75A 1H8VA 1OLME 3ZXGA 3AP4A 4QPGA 4EN6B 2VY0A 1M06G 5J3UA 4YZ2A 2HWB1 2HWC3 5ANNA 5ACA2 2XH6A 3ZFEC 1LOEA 1JS9A 3RWKX 3GJAA 4MX3A 2D6NA 4OMDA 5CIRA 2UY8A 3LDRA 5SV8A 4TWTA 4LA3A 3FLTA 4HOOA 2FZ2A 2NMOA 2VW1A 1U0AA 3ZYRA 4A44A 4XIOA 4FFHA 5A3OA 2JDAA 4FPJA 2I45A 4W50A 2R042 1DYPA 3AZWA 3CQOA 2GP5A 2PHLA 1MQTC 1RYYA 1WLWA 2VMHA 3WQ1A 2FMYA 4CCCA 5BNNA 5IATA 3KLSA 1QXPA 1VBE2 3AXEA 2MNGA 3ILNA 1YCIA 1NUKA 3T4HB 2W9XA 5KC5A 5J37A 5A3UA 1EAH2 1UY3A 4BHPA 2VJXA 1YLLA 2B4KA 4AQ2A 2WO7A 4ZXEA 1OOPA 1ZZ9A 4XUQA 5SV5A 2VNVA 4C0HA 3A7QA 4K40A 5ISLA 4OHVA 2RG4A 3O1PA 3USSA 3OGSA 3ZIWA 3X29B 4AEMA 3ZSJA 3OD0A 4LHLA 5EXOA 4LKEA 1W3VA 3VD7A 1DF0A 4LIVA 1F5FA 1VAMA 2WQZC 4QX3A 4CXXA 3WOGA 2K9ZA 3WF4A 4CP9A 1FV2A 4XF1A 2WR9A 4LO8A 1KQRA 2PAEA 1TMF2 1OSGA 1UKRA 3FFQA 3AXDA 1YQ2A 3KT4A 4KWJA 5DDJ3 1CAXB 2A70A 1AR93 1HV0A 2WZR1 1OH3A 5AVPA 1IZ3A 1V6KA 1PMIA 3D0SA 3WZ1A 3LSDA 4WM8B 2H0VA 1KXGA 3AB0A 2YU1A 4ITCA 3OGJA 3Q8FA 3B94A 4JGZB 4L99A 2RM22 3FJSA 2WYFA 3KCCA 4B7KA 3O1RA 2C4XA 3OTFA 3U1XA 1LODA 2O1QA 3PVBB 4YG3A 3RQ0A 2D40A 3LQCA 5F9TA 2RMU3 3DGTA 4KWKA 4BZ4A 1L7RA 1J3RA 4PLNA 1W8TA 5CFCB 5I8TA 3D0JA 2V72A 2P5BA 2B39A 4LULA 3LKJA 3JBG3 3MUZ1 3ZN6B 2ZZJA 1GBGA 1SDWA 4CPBA 3I2HA 2HWE3 3ECQA 2VAUA 3MIHA 3ASIA 1ZA4A 1WA6X 3IZOA 4JRAA 2RHPA 1RVF1 1YIPA 1ULOA 1GP5A 4WM8C 4XF3A 3I2IA 3ZR5A 3IDAA 2BDRA 4UW5A 2PXJA 4YFWA 4C1XA 5FXZA 1D7PM 4CDXB 1ASJ1 3AFGA 1RUJ2 1OI6A 1TEIA 4R4ZA 2DVDA 2RE9A 2NM1A 2VE1A 3PMEA 2XJPA 3CBNA 3VD9A 1ENRA 1US3A 3DPRA 2D6OX 2K2SA 2W0XA 3HIFA 4OCTA 5A7WB 2JD9A 3AFKA 5FP7A 1RMU1 3KM5A 1WCDJ 3SISA 5AC93 5LRSA 4CCOA 1LHVA 3K46A 1COV3 2D7FA 4H7MA 1RINA 4A41A 1DLLA 4BM8A 1ND2A 1QIQA 1OPMA 4NIHA 4OVEA 3IIIA 4HK9A 3T1MA 2Y6FA 3WF0A 4QKDA 3IN9A 3Q8AA 3VD5A 1PO23 2QE3A 2QVSB 3GDBA 2B5HA 5EPAA 3RG0A 1K5MA 4I2OA 1RUC3 5CISA 3NKGA 4K7JA 4H55A 3KF5A 4YW1A 3ACLA 1LKNA 1UOGA 4D8MA 3PTRB 1RJ8A 3I2KA 1HRV1 5DAQA 5H9RA 2Q4SA 2VM9A 3VKOA 4QXBA 1O59A 4CA9A 1C5HA 3OG2A 5C5TA 4J1WA 3Q8BA 5L9VA 1PZ9A 1US2A 1OXCA 5DAVA 3ZXDA 1BBT2 2AR6A 2VNOA 4A7YA 3SCFA 3CJXA 4KG0A 2JG9A 3O0WA 1DCSA 2XUMA 3ZDSA 2VOWA 3WCSA 2FDGA 1R64A 2VZVA 4ZXKA 2X09A 2GDFA 1F15A 1MVEA 1HRI1 1QKQA 3I2FA 2VBPA 5GJ6A 4BQYA 4HPKA 1S4CA 2PHRA 3WHTA 4XFHA 4RGAA 3ZYFA 2YMZA 4JHTA 1OVPA 5J36A 2W68A 2WZR2 2VMEA 1S0GA 3K4ZA 3LOIA 2DFBA 2PHUA 1XSRA 4QMAA 4XJAA 4WVMB 2VMFA 2YBKA 4AI0A 4C91A 1TME2 3WP3A 3WR0A 2HKXA 2R071 1HB4A 4PDWA 5FK8A 3NV4A 1UD1A 3ZXEA 2X10A 4EZHA 1YJKA 5HV0A 4IE0A 3CU7A 5L7OC 3AP6A 1UZZA 3KV5A 4XXPA 3UGFA 3POEA 1S0CA 4YARA 4R9AA 4CU8A 4JDNA 1ZRIA 3ES1A 1YWKA 2W1UA 4Q4W1 5FMOL 2ADDA 1LOFC 5FLHA 5GKAC 4D7TA 2DDUA 3PNAA 4DB5A 4L97A 3FL7A 1W6PB 2E31A 3H1YA 4AVSA 4DRVA 3W5MA 1UMHA 3VKMA 3MFCA 2AZ5A 2VULA 3KQ4B 1RUF3 3ZOIA 3IT8A 3TAYA 4CP0A 5LWBA 3AKSA 1NCRB 2ZAHA 3MLLA 1DFQA 1LENA 3PHMA 3SKJE 3ZM8A 3VBRB 4NIGA 3FUOA 3A23A 4IEOA 3WUDA 4BE3A 1OBNA 1ASJ2 2ARAA 2W87A 4XJ9A 2ZEWA 2XR4A 3UK9A 1WMEA 1QMJA 2EVXA 3Q8CA 4E2QA 2Q0AA 1RMU2 4K20A 4HT1T 4FOQA 4FFGA 1V6IA 2VZOA 2JXAA 5F8PA 1OQDA 1VALA 4XJUA 5JMCA 3ORJA 3A0NA 3TYJA 2CGNA 3K3NA 4MHRA 3VDCA 1O3SA 4JCKA 3MIFA 4AGRA 1UX6A 5CKQA 2QTWB 3N9QA 3POBA 1CVNA 5FZDA 4BU2A 1AX0A 2XJRA 4DXZA 1DHKB 1JHNA 2X29A 2X8KA 5FMOS 1D4M3 2GALA 4R9CA 4XC9A 5J98B 3VBOA 3DF0A 3VHPA 1AR61 1FAYA 3WG1A 3ZMOA 1YYNA 2XB6C 4QX8A 2A7AA 4B7EA 1UIKA 3AZXA 3K3OA 5EJ1B 2ZGRA 4UOJA 2D97A 1FOD3 2BQPA 2PAMA 2ZCWA 4GH4C 2BTVC 2WNVC 3MPBA 4JQRA 4QM8A 5LB6A 5DUWA 4ZS2A 1AYM1 1N3OA 3DYMA 3POYA 4MVTA 4Y5SA 2VMCA 1QGLA 4LE4A 4BQ2A 4HN0A 2BNNA 2VVFA 1VP6A 5H9SA 3VDAA 2WYSA 2R16A 3MBWA 1RUI3 4AEJA 3B01A 4E8DA 1W6NA 5JI9A 2W39A 1HRI2 1BJQA 2WS93 1ZZ8A 4SBVA 4YGBA 1AXZA 1C28A 3KHBA 1LR5A 1NZIA 3AYCA 1NCQA 2W1QA 3LGRA 2FCTA 3ALQA 3OYWA 3UV9A 3KWVA 1W6OA 2CDPA 5A3PA 2CU5A 5F6LB 4AVAA 2XDVA 2VQUA 5FY9A 3J7HA 4OMCA 1Q8OA 1KJRA 2VOXA 1DLCA 3CL1A 4N8MA 4NMIA 3PUQA 5LK5A 2R072 5C8CC 4NROA 5T5OA 4JGYA 4QQ2A 1CZTA 1OLMA 1VPHA 4W6WA 5K9YA 2QCSB 3NVCA 4LLOA 2XLFA 4B4QA 2R061 4GA9A 5A1FA 4OHXA 3AMQA 5FR3A 1O3QA 4HSLA 5T5LA 3VGIA 1DQ4A 2HWF1 3BOPA 5K8SA 3UKTA 5A7SA 3PVNA 3ZSLA 2Q8EA 1JYXA 1RUG3 2OIIA 2HWC1 1I3HA 4A7ZA 5D8AA 1LEMA 2WBKA 2TEPA 1UOJA 1O4YA 2A6WA 1ALYA 3EB7A 2XLAA 4P02B 4LBLA 4ZY9A 3WQBA 5HV4A 1RL3A 2ZGMA 5FPAA 2A6VA 1BZWA 4XMIA 4AEKA 3O0VA 4D6RA 1JODA 3JB8A 4CDQC 2VCCA 2RS51 1CAVA 2ZGNA 2AYHA 1PMHX 4O9GA 1RB8G 2YC0A 2XPJA 4IV3B 1H9WA 5D2AA 4FFIA 5A3NA 5GALA 1N3QA 3AMHA 4B29A 4AI9A 3S30A 3ZFGB 1OQEA 5A1LA 2BJSA 4DXTA 2WNOA 3RFRA 2RDNA 4NIAA 1AL23 5F37A 2JB8A 1SHWB 4QQHA 4UW3A 4NIDA 5C3PA 2VUJA 1UY1A 1DQ0A 1L7LA 1AR62 1V00A 2XHKA 1SMVA 2WINB 3QH7A 4M3CF 4DRRA 1JYNA 1YQCA 4AI3A 2VTXA 4DO0A 5E8AA 1B35B 2Y6GA 5DDJ1 3MI8A 1CN1A 4SLIA 4CCKA 1AR91 2UYBA 1E57A 2ID4A 3NAPC 5FLJA 5KC6A 2Z5WA 4QXHA 1HQWA 4P9IA 3BI3A 1ND3A 4MGQA 1BCXA 3PURA 4XQWA 5JZGA 5KHJA 1KGYA 4CUBA 4NRPA 3RYKA 3BIEA 4QGLA 5FLIA 3KS7A 3S7EA 1EUUA 4MXWA 5BNOB 5FPLA 3ZFGC 1V6NA 1H2MA 1CIYA 2IVIB 2GSYA 1J83A 1JU4A 2Y6KA 3DKWA 1OMIA 3HD8B 3NNJA 4XETA 3H0OA 3H1WA 5CFDB 4BQ3A 2RMU1 4CU9A 5J1XA 1UWWA 3ZN4A 1I1EA 4FSJA 2W46A 1UW8A 1XB9A 1W8OA 3JBG1 1KEXA 2ENRA 4LUMA 2HWE1 4BYYA 1IS3A 1UZ0A 4DIQA 1OD5A 3AC0A 2ZEYA 5F5CA 4IV1C 2WWUA 5EYYA 5FO9B 4LBQB 2VW2A 5TSWA 2P4EA 3EYPA 5C9AA 2FDIA 2ZGLA 3PUHA 4GMP0 1A3KA 5BNOC 4CUAA 5C4WA 3NSTA 1G9DA 1IKPA 5FZOB 1R082 2HEYF 3PDQA 3WDYA 3LSEA 3UNPA 2FD8A 1O4ZA 3LE0A 2DCKA 2HWC2 2YY1A 4KMQA 5AC91 5BV6A 4RHV2 2CDOA 1COV1 1PGW1 1VMFA 1YQ8A 3K4DA 5CKMA 5JIAA 1S0JA 5IT6A 3BODA 3FN9A 1CESA 1SLTA 2QFEA 1YUDA 3TNQA 5LA0A 5IK8A 2C1FA 4J25A 2WL1A 2ZGPA 4CUCA 3VDDA 1LEDA 5GZEA 4M01A 3OPWA 3KGZA 4EE2A 2DCTA 2ZPXA 3TRSB 2ES3A 3H42B 4QU1A 4FAGA 5C5UA 3VBUB 1W9TA 4RS5A 4XFCA 3PIGA 4YW3A 4TSVA 2VO5A 4QD2A 2AENA 4COVA 2YPDA 4P9LA 3SLIA 2ZKNA 2WAOA 1W06A 3D4KA 3I2JA 4XVHA 5LY2A 4U36A 2KM2A 5AFBA 4FQZA 1QEXA 4Q26A 1FNYA 3U07A 3V65A 1LHWA 4ZZ5A 4AFAA 3S6PA 2WO2A 2DVBA 4MO3M 4WM7C 1RVF3 1Y9MA 2XWBB 2KXLA 1LOAA 4LA2A 1LNSA 1NE4A 1X36A 4KWLA 1SPPB 2P3IA 4NPRA 2CL2A 4PHZA 1HQLA 3CZJA 4YNIA 4Q1PA 3M3IA 5DDJ2 1W6MB 2EIBA 2ZHMA 3N36A 3ZX7A 2VUDA 1AR92 1H1MA 1CAWB 2DCJA 3TB0A 3VBUC 3H3UA 3V0AA 1CX1A 1GZCA 3SQOA 3O7OA 3SEPA 4CDWC 1LB2A 1OA2A 1X82A 4XAEA 2G1MA 1AR73 3RWNA 1JTZX 2VMGA 3FZ3A 4LMFA 3WDXA 2GC0A 2JE9A 2BU9A 1Y43B 2VMIA 4O9EA 1FV3A 3QBQA 1NAEA 4XDPA 4M0HA 1GQHA 1UXZA 4B3NA 3VDBA 5T52A 1T6BX 2RMU2 2PHFA 2VZPA 3NQHA 3JD73 2VBDA 4DINB 2JB4A 1H6YA 3KZ4C 1FPN2 4QKBA 2HWE2 2OW4A 3MLJA 1QNWA 3BPSA 4EROA 3HJRA 5DZFA 1RUF1 4UWDA 4AFMA 4BOWA 4BQ5A 1REEA 3IPVB 1HN1A 5A7PA 5ANQA 2QQOA 2ADEA 3KVAA 1QOSA 4ARXA 4QKFA 2JX9A 4I30A 1OFSA 1UO9A 3ZVXA 4HKWA 2QQIA 2XKPA 2JKBA 5FKCA 5I0SA 2XJQA 2DU1A 1UU4A 3LDBA 5KWRA 2ZEXA 1JW6A 2VQTA 2ZKLA 1C8M3 2D44A 3MW4A 1D2QA 3NMBA 3PUSA 4RR3C 2EA7A 4GULA 5K0UA 3FHIB 3TN93 4E4HA 1TG7A 5EIYB 5F3IA 1COV2 1PGW2 1UXXX 5LCWL 1H8TC 2XJTA 1J84A 1HJGA 2DVFA 2HEWF 3E6BA 1C1LA 4CDUB 1XU1A 4UFIA 2WNUC 2GC3A 1YQ6A 3UJQA 1PO22 3TEZA 4FPLA 3VD4A 3GALA 4WVZA 3TEYA 2DYCA 1RUC2 1SG3A 1F8VA 1D4M1 1DQ2A 1PO13 4XHXA 5FPBA 5F2SA 1VBD3 3WNXA 3PUIA 4BK5A 2VH9A 2WO1A 4JHZA 1UZWA 4DY5A 3NNGA 4MGYE 4H2AA 5HI0A 4Z82A 1FOD1 1UY2A 2XJVA 4UYBA 4I3GA 4QPYA 1RIRA 2VD7A 1CR7A 2XVGA 4HVQA 3P1IA 4YW6A 5F5QA 4CCLA 3WDTA 4CDUC 1RUI1 3POIA 2YDEA 2GH8A 4N90A 2GNTA 2BGCA 2I2SA 1Q5OA 2WS91 1AJKA 1GOFA 1WMXA 1PM4A 2CAVA 2IXIA 4MADA 1GFF2 4S2GA 3ZSEA 4AVVA 4HL0A 3LEIA 2HEVF 4R52A 1JZ6A 4E9KA 2OS2A 2OZ6A 4XF0A 3ZXJA 1S0DA 3VZJA 3OGVA 3U78A 2PHDA 3W59A 3IAQA 2J1TA 4YVWC 3NV2A 5FTTC 2VOKA 5FDBA 5FY1A 1POV0 4GWNA 5A6ZA 4FPEA 1GP6A 4QPIC 1VR3A 1YEWA 1MACA 2W95A 4YPJA 4CE8A 2OZJA 1JZ5A 2R0HA 1AYN1 2DVAA 5C70A 4FO9A 3I3QA 4JKKA 2JDNA 4META 1AF9A 1O91A 3I3DA 1R1A3 1YQ5A 2MHFA 4KU8A 1RUNA 1CAXA 1D0HA 1AX2A 4LTAA 2XONA 2WZ8A 2Y64A 5BXXA 4C90A 4EV0A 3MW3A 3KCXA 4QB6A 4WM8A 4BXSV 3E5UA 3UKVA 2Y0IA 3VHRA 3C2UA 5JLVA 3HQXA 5C3SA 1RUF2 2JDKA 3BTAA 4JGZA 4NUBA 3OUHA 5E6HA 2JKXA 3NO8A 3CDZB 4S2DA 1C5IA 3DCQA 1UU6A 1YXWA 1ENQA 3ETQA 5C3QA 1G9CA 2Q1ZB 3JXSA 4XBNA 5BNPB 1IGOA 2Z42A 1RUH3 2WKKA 3RSJA 1E5SA 2HBUA 4V2WA 1CZSA 1XNCA 5CNAA 4BMBA 5CFCA 5CVRA 3AL5A 5FYSA 5FZFA 3ZN6A 2QQMA 1I5PA 2LM3A 3SH4A 2B9UA 4YW4A 5GLVA 2VMDA 5HBAA 5L19A 1W3XA 3TWIA 2BW8A 4AHZA 5BUVA 4CTEA 4MSVA 4CU6A 4UFKA 1W9WA 3MF6A 4FT8A 5GLUA 1RGSA 2PLV3 5AVAA 3ZFEB 5GZCA 4INDA 5JXJA 2AEZA 4XFAA 3ZYIB 4NAOA 2ZABA 2WFF3 1X8EA 4CDXA 1XNKA 2IXCA 5JXGA 2CTVA 1AL21 1N1YA 5FP8A 3T2QA 3T09A 5FK7A 1H4HA 3K77A 5A7WA 3ZMNA 4A6OA 5BNPC 3IKWA 4YM0A 1JYWA 3BUCA 1UPIA 4A7KA 4WV8A 5L9RA 2R063 2P3YA 5DZGA 2ZEZA 4KG8A 4BB3A 4EN9B 1MEC3 1MQTB 1FOD2 2ZHNA 2DVGA 3E97A 4OI1A 5F32A 3VBHC 1SFPA 2ZGUA 1PIV3 2LS6A 3ZSKA 5A6XA 5I0DA 4D6QA 5CYYA 3OBTA 1L3JA 3ABZA 3VZOA 3JZVA 1RUI2 3HNMA 4NHMA 5LA9A 4IEPA 3BGAA 1N3PA 3AMMA 3PIJA 5GZFA 2WS92 3RRDA 3ZYJB 1LOBA 3V56A 2VZUA 3WQ0A 4AR2A 5FUPA 5BPXA 1APNA 5KXEA 1DDLA 1UL9A 4EN7B 2FDJA 5T55A 4V1PA 1QJX3 1GMMA 3B9CA 3EHKA 3ZLIA 3EQEA 5FYIA 1HX6A 3N7KA 4N53C 1VAKA 2O0OA 2E32A 1IG0A 2RS53 1VBA2 1VB2A 3RYRA 4DXRA 4IGPA 1S2BA 4GMP1 4NVPA 1LU1A 3CJIC 3THTA 1XU2A 2DBNA 4RFRB 1JI6A 1VMJA 1HKDA 1LOFA 1RXFA 4CSWA 3M2MA 4FXKB 4RYDA 3VLBB 4PT6A 4XHBA 4K3UA 4Y1VA 1VBB3 1J58A 3LWCA 4LHKA 3N3HA 4WBBA 2A5ZA 1FMD3 1RHI3 3ST7A 3LB9A 4M3CE 5JVVA 4BLJA 3H8RA 3GNEA 3S57A 2EALA 5FXWA 5FWEA 1ODNA 2WIIB 4C8DA 1RUG2 1UYXA 2LRPA 4TLFA 4WVMA 3BYWA 1YHFA 3N9PA 3UL2A 1OVSA 4AYUA 1XYNA 2QQUA 2VZSA 4BQWA 2JE7A 4UBHA 1C8NA 1EV13 1YFXA 3DKQA 2VZ3A 4XACA 4IQPA 1PK6C 4E4SA 3AP7A 1BEV2 5KHIA 2NP0A 2YFUA 3ZKUA 2P3JA 5FOBB 4UAPA 3URFA 2J1AA 3QOPA 1W6PA 2A3XA 1AR83 2WZPP 4CXWA 2YBPA 1F31A 2Y38A 4LIUA 1H2LA 3E1F1 4KU7A 1GUIA 1X8MA 1X9TA 3JU9A 1NCRA 2RS13 4OYUA 5FIXA 3ZXKA 2BVBA 3TEXA 1LGBA 3VBRA 2R1DA 2E7QA 1DU3D 3MGUA 3NL1A 4O7XA 5A33B 1PGL1 3ELNA 1J3PA 1S2KA 4ATFA 4LORA 2R1BA 1AL22 1OPOA 4Q4Y3 3IIAA 1ZYBA 4BWOA 2CYFA 4LO7A 2C26A 1OUSA 2CWMA 4NHXA 1C3HA 3QLQA 4PBPA 1X50A 4AOCA 2RS32 2JG8C 1HN0A 5DUUA 1JZ8A 1LECA 1K12A 4JX0A 1YFWA 3DV8A 4LITA 4EWEA 3WQ7A 5FZ9A 3POFA 2R30A 3AKTA 3HBZA 3K4AA 2I74A 3IM0A 3BTZA 3WDWA 2GNDA 1AR71 2HWB2 2JDUA 4K6BA 1NOVA 3CEWA 2QBXA 2X5IC 2B9VA 2G4IA 2EXIA 3A22A 2FMDA 3AM2A 3HQRA 2WZEA 4AGVA 2ZMLA 1NE6A 1HXS3 1QJY3 2KA3A 3JD71 1LHOA 5IVFA 3HT2A 4GKYA 5ABJA 5K7PA 1SBFA 4BQ4A 4Q8LA 2F4PA 4XZUG 2AUYA 2JWPA 4HXCA 2PELA 1U5ZA 2WDBA 3MUY1 2BRTA 4QDSA 5JOWA 3ME2A 4LOSA 5C3RA 4BPZA 5FZLA 1JYIA 5IVVA 1MS3A 4B4RA 2IXJA 4DOUA 5FPVA 4Y26A 3IMNA 3M3EA 4URTA 4YG0A 4LBMA 5FZ4A 3RVHA 4RQPB 5FZ3A 2ERFA 5FMDA 4OUEA 2Q8DA 3ZFFB 2CV6A 5CADA 2FQPA 1XJAA 1G8WA 2YV8A 3ATGA 4UBGA 5DUXA 3J7MA 2ZOEB 1NLSA 1C8M1 4NJ4A 1C4RA 3VKLA 4ZKTB 5L7OB 3EXUA 4QPGB 1WUVA 3N9NA 1OF3A 3TN91 2J1UA 5FZHA 1QNYA 5JMOA 4W65A 1WMFA 3POJA 3DXTA 5DG2A 2IVJA 5IUQA 2DU0A 2KD7A 4ZU7A 4XUTA 1G7YA 3AJZA 4DZGA 2N7GA 4RN5A 3JQWA 3MZHA 5DZEA 2XVLA 2VU9A 4AEDC 4DXSA 5FPXA 3NRUA 4L8QA 2PHWA 1Y9QA 5IVJA 4FPHA 5FZIA 4FOWA 1PO11 4FVVA 2QDRA 5F1RA 5FJKA 1VBD1 1YFYA 4RQPC 2CGOA 4BK4A 1H2KA 3ZFFC 1IS4A 1EPZA 3AVRA 4OHYA 2YUEA 2WO3A 4CCEA 1X33A 2QQWA 4LKFA 3U11A 4NOTA 1XQNA 3RDIA 3P6BA 4QPGC 1IPJA 4E27A 1REFA 4OLLA 1OT5A 4IEWA 1I5ZA 4LQRA 1DGWX 1V9U3 2YROA 4IE5A 1P8JA 2BNMA 1W05A 3CMGA 4IEVA 5FKBA 4CVUA 5FYTA 4PCRA 3RJRA 1H9PA 1RVF2 2VNRA 3I97A 4P00B 3H9AA 4XZPA 1KS4A 5FZKA 1SLBA 1XRUA 2Z69A 4NWVA 3S5QA 2D43A 1W6QB 2Z79A 4IV3A 2PMWB 5BNNC 2DTWA 4G4FA 1H30A 4DEVA 4PQ9A 1G9BA 4XMAA 2P17A 1MS1A 3O0XA 5A3MA 3RZMA 3R4UA 1J1TA 4LUKA 3CO2A 3ZFGA 2VCMA 3GBWA 4QDQA 3UGHA 4GH4B 3GCWA 1ZZBA 5F6KA 2WNVB 2ZX3A 3BU7A 5IAVA 1OOPC 1OQ1A 3LF7A 4M0NA 1Z7S3 5EQUA 1EP0A 3DYOA 5T54A 1WD4A 1Y9GA 4IEXA 2FCUA 5FY0A 3BVCA 4QWNA 5FFOC 2F6BA 4XILA 4COUA 1OUXA 1UYYA 4ES9A 1R1A1 1B35A 1RUOA 1MZFA 5JUVA 4LHSA 1NXMA 1RUE3 3C7EA 1WKYA 3IBMA 5D21A 3N4MA 4Q4X1 2D6MA 2DUPA 2D3SA 3WDVA 1EUTA 1HRV2 2WT0A 1EYBA 2QQJA 4V2VA 3LEKA 3TEWA 4NHYA 1XE8A 1HQNA 5F5IA 5BNOA 4K21A 1TZOA 5GZDA 4ISQA 3M3QA 3LAGA 5CFDA 4CXYA 1OHFA 1QDOA 5C8CB 3GF6A 1O8PA 4EJRA 2W52A 1A34A 1NZCA 2UWAA 1ENSA 1VAVA 4YW7A 4F8AA 1RUH1 4FPGA 1C8M2 1PMJX 3ILFA 3AMPA 4AG4A 5L73A 3TN92 1VB4A 2YC4A 3O14A 1NY71 4FTEA 4IGOA 4IE7A 3KF3A 1JH5A 2BP6A 1ND2B 1OURA 4GWIA 5HCHA 1NQDA 3VN4A 1CWPA 2OX0A 4LBQA 4JAAA 5HCFA 3ACGA 5LEJA 2GC2A 4AFBA 4LKDA 1QOOA 2PLV1 3WP6A 4B4PA 1QJU3 4AGGA 2WFF1 4R9BA 1IOAA 3A21A 2W08A 2VPVA 4OI4A 1OFNA 4X6QB 5FY7A 5FZOA 1PO12 2Y6HA 2VNGA 4XF9A 3WW3A 4LLFA 1VBD2 5B4NA 2UU8A 5IFPA 5JSOA 4GAZA 5LEKA 1MS0A 2GMEA 4F3JA 4CDQB 3U10A 1LCLA 1AYN3 4JZRA 5T50A 1W8ZA 1QXRA 3WW2A 1MEC1 1VMHA 2V5YA 4Q4W2 5GLZA 3SMHA 1GLHA 1PIV1 3GJBA 4JQTA 1OD3A 4OULA 3WNPA 2A1XA 1ND2C 1AHSA 1NLQA 1XSQA 2JECA 2OQ6A 4MLOA 2ORXA 4A45A 1ZRRA 2Q1MA 2Q5TA 4ZONA 5JSPA 3UYJA 4IDZA 1QWRA 4Q29A 4LJHA 1K5MC 4XXAA 4DUWA 3WXPA 4HPKB 3KQRA 3SC7X 3VBUA 4BJ0A 5G04L 4YVSB 1QJX1 4OZXA 2TBVA 3RPQA 2Y6LA 4M00A 4HN1A 3HVDA 5LBBA 3T1LA 1SCRA 4IEYA 2P34A 2E51A 3KB5A 5FP3A 4XAAA 1X9PA 5F3GA 3NJVA 4GD4A 1UF2C 3DUIA 4XCAA 3RI8A 4D7SA 5FZ8A 5J96B 2JG9C 4WZCA 4PQQA 5G05L 4COZA 1SACA 3NAPB 1ZRDA 3MO4A 5FYMA 1BXHA 2QZ2A 2A6XA 4XFFA 5FY8A 5GLWA 1F4AA 1LJ7A 1SPPA 1VBB1 1O3RA 1ST8A 1W03A 3T2PA 1S1AA 5HCBA 1R1A2 2GH2A 1W6MA 2P2KA 1FMD1 1RHI1 3RZLA 2HWD1 1YJLA 2XQXA 1KRIA 5A32B 1CAWA 1Q8VA 1XYPA 4S2FA 5FCCA 4DY3A 4UFMA 4GWJA 1WCSA 1G9FA 4MXVA 4YVSC 4LO5B 2A6ZA 2ZX4A 1U5XA 3O12A 3WHUA 3APBA 3NNFA 3T3YA 4Q5OA 3GHMA 3MPPG 2DCYA 5CZKA 1BYHA 2ZX2A 2IXLA 2VVEA 3N9LA 2H6CA 1EV11 4URAA 2V5DA 4IV1B 4OQ9A 4AWDA 1AYM2 5EFUA 4QB1A 4B8EA 2XBO3 3AYDA 1BVVA 1RUH2 4K8FA 3O1OA 3J8F3 1AVBA 5C3OA 1GZ9A 2ARCA 1URXA 3LEGA 5JOYA 1IQDC 1S0BA 1OF4A 2OUJA 1AR81 1NY72 5DPNA 3W9AA 4EWDA 4H3WA 5CAZA 2JDYA 3M3CA 3W21A 5IVEA 5FYVA 1ZM1A 3IPVA 1QJZA 2QZ3A 4IERA 2RS11 1GZWB 2Y8KA 1WD3A 1W04A 2ZJCA 1CZVA 2XVKA 4KWUA 5IAXA 2PLV2 2V73A 4MV2A 3T4VA 1DZQA 5CB7A 3SEEA 2WFF2 3P3NA 5I8SA 2J1EA 3FLPA 3NNMA 4HETA 4P08A 4YZ3A 4COYA 1WA4A 4GMP3 5A6YA 4Q4Y1 5FYZA 2DWRA 5IK7A 1XPWA 1QQP3 1G86A 5T5PA 4AL9A 1YC61 5HCAA 2R062 2WT1A 4P9XA 4L11A 2ZZQA 5JSRA 1H1AA 3CKHA 5A6QA 1W2UA 1ZBE1 1VE0A 2RJLA 3AP9A 3HAGA 1PIV2 3GZAA 3W5NA 4A2UA 2HWF2 1AX1A 3WX5A 2BOIA 1DP0A 4FPYA 2YB7A 3IWZA 4IEZA 3VBFB 3K75B 1MZ5A 1DGRA 3ZYPA 1DZRA 4CP1A 2OVUA 2H0BA 1SBEA 5CEHA 1EPWA 1XNBA 5IK4A 2R7EB 1QJX2 3VBOC 4BH9A 4WM7B 1HXS1 1BBT3 1QJY1 1LRHA 4Q0VA 4UW6A 4A3ZA 2IZWA 2QKDA 3J26N 3U0ZA 1W0NA 2VZRA 2RS52 4CPBD 5A1AA 1NKGA 1UNBA 2EIEA 4IXLA 1U12A 1N1VA 1F5JA 4AVTA 5APAA 3MV01 3BTXA 4CDWB 2O14A 5AFEA 1VRBA 3WF3A 3VBFC 4MYEA 1VBB2 1GNYA 2VGDA 1A78A 4XTPA 4COWA 2AACA 5CG8A 5FXXA 1FMD2 1RHI2 4QX0A 1CIWA 3WF1A 3GGLA 4M3CB 3VL9A 1QU0A 2ZBJA 4XJ8A 1WMDA 1NCQC 2WQ4A 3AKQA 4MUVA 1GWLA 2WJSA 1TME3 2LTNA 3BB6A 2ORZA 2IC1A 3F2ZA 4QHBA 4EN8B 1O7FA 2YFZA 3AYAA 2E63A 3MW2A 4FPOB 2ET1A 3H50A 3HN3A 4JGYC 2YBSA 5A3WA 2NZ9A 2E33A 5IWFA 4QGNA 3VZKA 4D6SA 2P1BA 1XNAA 4XIKA 3ZPYA 4HBNA 1JN2P 2Q1FA 3F95A 3MDPA 2BFUL 3G7DA 3GZEA 4UF0B 1F4HA 4LHNA 3ZR6A 4YZ5A 3DL3A 5JAXA 1AR82 2WWSA 2J22A 4O65A 4YGDA 4YG6A 3UETA 1JBCA 3NV3A 5A80A 5CKNA 4RR3B 1BMV1 4NPMA 1SFYA 3WNOA 4QQLA 1OC1A 2RS12 4DPNA 5LA2A 4Y4YA 4OUSA 5D8AC 3N35A 4E2GA 1GZTA 3JBG2 1H8TB 4HFSA 4PBOA 1STMA 2RVAA 4AVCA 1V9U1 4YM2A 3D5OA 3U37A 3CZUA 4L9BA 4FCAA 5BNPA 5KR7A 3SH3A 4Q4Y2 3KT7A 2DV9A 2WNUB 3OEAA 1XE0A 4MZUA 2V4VA 3AK0A 3Q9OA 5DN2A 4CEWB 5FQ0B 5F2WA 1V6JA 3FLRA 3VL8A 3WLUA 1JZ3A 4FP2A 1L7QA 1G9AA 4ISRA 2NPIA 1H6XA 3QH6A 1PVC3 2BPA2 3C8XA 1CPMA 1AXYA 2VTFA 3C7HA 4FOVA 4AHYA 5HXMA 1E5HA 1LHUA 4LK6A 2HYKA 3NJZA 4FFFA 4JRLA 1U5YA 4PIZA 3ZFEA 4ATEA 4QHZA 4CP2A 1IPSA 3OOXA 5AC92 3UKNA 3VZMA 1SLAA 1Z7S1 2WLPA 5E1RA 5EP9A 2BVVA 3JQXA 5JXHA 2ZACA 2VZ1A 5DUVA 2EIDA 4LXLA 1Q43A 2YXSA 1R093 2XKOA 4XBLA 1HXS2 1QJY2 4AQ6A 3WF2A 4CEWC 3CF6E 1MQTA 2WAAA 1RUE1 2MEV3 3M4FA 5E88A 1O3TA 1S0IA 3SHRA 2X05A 1REDA 3FUQA 5FYCA 3AKRA 1DGRN 2WC2A 4AI1A 1KDKA 1WW4A 3POGA 4FPFA 5FZ7A 3OUIA 5HXVA 4P9WA 3KT1A 5C9AB 1MPXA 4YVWB 5JZGC 4HKOA 4RFT0 5CU1A 2JDPA 4DFSA 4ASLA 5FYBA 1Z78A 5GM0A 3ACFA 1KFXL 1VBC3 4QPIB 5IVCA 3SNMA 3IMMA 2VQ0A 4KQ7A 2ZGQA 3L2HA 1S0FA 2Q8OA 4BQXA 2V4AA 1CD3G 5FZAA 4E4DX 5FZBA 2QNKA 1UPSA 4I3PA 1JUHA 1UZVA 4XOGA 5LBCA 4N43B 5FWJA 4GB31 1J1LA 2XQRA 4XBQA 5FREA 3WNLA 2WN3A 1MR5A 1HW5A 1K42A 1N1TA 4Y3OA 1POV3 5DABA 1NA1B 3GBGA 1QJU1 1MZ6A 3H8XA 2D6LX 5C9AC 2Z2SB 5DAPA 4H14A 3I49A 3I54A 3OY8B 1ZRFA 2D93A 1IQAA 4FOYA 1ULCA 2PTMA 3G6JB 5C4WC 3ILRA 2E7TA 3HQUA 4KH9A 3A0KA 3VB9A 4R8HA 3ZYBA 2W1SA 3GM8A 4AVBA 2J1VA 1BMV2 2D3RA 4XABA 3RI9A 1W2AX 2OPKA 3GCXA 2IFRA 1NT0A 2JEMA 4QXCA 3FMGA 4DQAA 4Q4X3 4N43C 1V9U2 4YLZA 4OFGA 4FPKA 2VOVA 4NRQA 4XW3A 1NA1C 2BNOA 2XHNA 1O5LA 2DUQA 3VDDC 1Q3EA 2CAUA 2B7YA 3OJBA 5IVYA 2YHJA 1HB3A 3V0BB 5CG9A 5LZ6A 3LIGA 3MICA 4ZU4A 3LA7A 5BY5A 2BUKA 5FO7B 1JU3A 3NJXA 4RS5C 1TNFA 3QD6A 4FPCA 4TLGA 1Q8QA 4Y5TA 1XNDA 4Q1RA 3RZGA 3E6CC 1RTVA 2WLQA 1PNFA 3NKTA 4LOTA 5DMYA 3VBHB 1UX7A 4QHOA 5A33A 3KVBA 1UY0A 2XOMA 3MV11 2VQAA 1Z7S2 5JWPA 4WZFA 1F2NA 5IYYA 4AAPA 4HLTA 4ET7A 4P9YA 3FX3A 3NJYA 2ATFA 4AQSA 4MGTA 2EXKA 3AVSA 1GV9A 3I3EA 3FBMA 3B7MA 3I59B 4MOAA 3WY6A 1LHNA 1RUE2 2LW8A 3A4UA 5KXDA 1WWYA 1F35A 4ASKA 1D4M2 3B00A 4BQ1A 3W20A 3WV6A 1HDKA 4FXGB 3WNNA 1JZ7A 2GC1A 2WSUA 1LOGA 4N53B 1V6OA 1UAIA 2CY6A 2LALA 4IE6A 2ZGOA 3UESA 1SFNA 3WSOA 2MPFA 2J1SA 2RM21 3VKFC 4D3WA 1ONAA 4Q2FA 2FDKA 2GMMA 2VC9A 3CJIB 3LPGA 4CCDA 2A73B 1CQ9A 4IGQA 4QAWA 3THCA 2AGSA 3I2GA 4AXOA 1LULA 2XBO1 1VJ2A 3LPFA 3MIGA 4QX7A 3TOJA 4PIYA 3J8F1 5L9BA 4C1WA 2VVDA 1MS8A 4YGCA 4CU7A 1RXGA 2DBIA 3T0DA 1BVP1 4HONA 2JENA 4ZS3A 4QQPA 1BK1A 1U5IA 1SQ4A 4QX5A 1ZREA 1LESA 3R4SA 2PQSA 5JOZA 5FV3A 4RSUA 2ZA9A 4XE9A 1KD7A 3SKVA 4YM1A 3T08A 2B46X 3HN1A 3WP5A 1JOJA 3RYPA 4AAXA 1GSLA 3U4XA 1TQ5A 5JIUA 1QJU2 4CEYB 4NHLA 3O1VA 1MS4A 4RQPA 3MIDA 5DAWA 5E16A 5FYUA 4GWMA 3ZFFA 1AUYA 2RJKA 2ZTNA 1R083 2PAKA 4PI0A 4EYUA 5L7OA 1JOBA 1QQP1 1W8HA 3L2YA 3POSA 2HBTA 3DEMA 4XUNA 1PK6B 4RHV3 1FT9A 4E4ZA 1J59A 1AYN2 2XLGA 3J9SA 4NRMA 5K0UC 2IWGB 2K0GA 3BTYA 3ZO0B 1HIXA 2A6YA 2VECA 2HWD3 4Y22B 3MIBA 1DQ5A 2GN3A 4N7IA 3K51A 1SBDA 4DMIA 4PF1A 4Y1UA 3WNMA 5EJ3A 4E2SA 5EWSA 2Y34A 4FQ4A 4GZ9A 2BGOA 4LK7A 2XL7A 4CEYC 4BMEA 2W5FA 4L0PA 1CJDA 3MLKA 2RDSA 3B93A 1RJ7A 3K2OA 3PVEA 4OQ8A 1BBT1 3R4DB 3INAA 3HMYA 3UT0A 3CNAA 2JG8B 3J4UH 2OT7A 1JOPA 3CHXA 3FE5A 4YGEA 1KDMA 1PGSA 1NYWA 2Q8CA 5FP4A 3SCGA 2JD4A 5EZWA 1LOCA 1QJEA 1LGNA 1RUD3 3H7YA 4UI9L 2VG9A 1DZTA 1NX9A 2GP3A 3R6SA 2G9FA 2JDMA 3T0BA 1UN1A 1W6QA 2EAAA 2X5IB 4FAHA 3WP4A 4P14A 2W92A 2Y60A 3M1HA 3ROUA 3WW4A 1UU5A 3SITA 2JDZA 3VZLA 2YC2A 2IUWA 1V0AA 3LD8A 2OYZA 3AMNA 4Z07A 2IXKA 2BWCA 5T5JA 1HV1A 2YYOA 1XYOA 4EWAA 4IL7A 4GH4A 5KHKA 1TME1 5LY1A 3LIHA 2WNVA 1CGPA 3E6DA 4A42A 5DXDA 4JVAA 1V6MA 3T2TA 3O1TA 1CAUB 2VXJA 3HEIA 5B2GB 4M4PA 4TN7A 5LW9A 5FZEA 1ZBE3 2VCAA 1DYKA 1RC6A 1XC6A 1YRZA 3N9MA 3DXUA 3KGLA 4JV4A 4LR4A 4Q4V3 2E26A 4CCMA 2R32A 2XBO2 2L9LA 1DGWA 4XCBA 1ACCA 2XWJB 3J8F2 4TZDA 4TYSA 1FPN3 5I0UA 1WW6A 3N7JA 3N9OA 1Q8SA 2ZS6B 5KHHA 3OB8A 4I0AA 5F7UA 2ARBA 5FPUA 5KXBA 1HJFA 2D6KA 4Y20B 2XGXA 5DAXA 3MYXA 4W8JA 3S5AA 3RNSA 2GMPA 2ZMNA 4XDQA 1PHMA 1ULPA 1Y4WA 2J7MA 5BNQA 1UOFA 3BKZA 5FPZA 3WUCA 1W99A 4IESA 2W1WA 2VUCA 3AX4A 4F7ZA 3USUB 2YGMA 2VOTA 2C6SA 5DQ0A 4YWAA 2OPWA 4JGZC 2VCBA 4P9JA 3CIHA 3DYPA 5FZCA 3UJOA 5FRAA 5C8CA 3QCWA 3VBSB 3OCPA 4W4ZA 2RV9A 4A6SA 3N7LA 2G19A 4XQDA 3VHNA 1D4VB 2X53S 1WLCA 2DF7A 5CA6A 2VUAA 2IXHA 1QQP2 4AEDB 1XXNA 5GLTA 1QH7A 3BIWE 4OHWA 5CFCC 3LFMA 1LGCA 2WN2A 1PVC1 2FDHA 3PUAA 5F3EA 4Y24A 1ZNPA 2D5FA 2GNBA 4PLMA 5A3LA 1ULEA 1A8MA 2W47A 2BOJA 4PIXA 5A3TA 1K5JA 3KV9A 4ZHNA 5ABJB 2XL9A 2RR13 3JB4C 1CPNA 2NLRA 4H7LA 4K1ZA 5ERLA 4DS0A 5I93A 4LNVA 1O8SA 2ZGSA 3OPZA 5FUIA 4CDXC 3LCPA 4FTSA 1VLNA 3RZJA 1H4GA 3VBSC 2ZGTA 4Z2WA 4NPLA 4CDQA 3ACHA 4YRDA 1R091 3KV6A 2WWJA 2R6QA 2GNMA 2MEV1 5FO8B 4FBFA 4DUVA 5JOXA 5C7GA 3LDKA 3T30A 5BNNB 3AP5A 2D5HA 4UT5A 2ZHKA 4XFGA 1ZBA3 4CYDA 4NIIA 4A3XA 5M0TA 3RJ2X 1RITA 1E5RA 2W2IA 1B09A 1DBNA 5JI7A 2ETEA 5A70A 2A71A 2YZ4A 3D8CA 4Z92B 1NG0A 4XUOA 4I01A 3BN6A 1OOPB 2VL4A 3WT3A 4YVSA 1VBC1 3IDCB 4R4XA 1PGL2 4NWWA 2W91A 1XOYA 3H8OA 1FXZA 1QF3A 5FJHA 1S55A 3NW4A 5JR2A 4CP9B 4J1XA 5FXVA 3NAPA 2B8MA 2XUEA 3I3BA 3IAPA 4NAMA 2GN7A 2UY9A 4JDMA 4UFJA 1Q8PA 2PHXA 2HYXA 1POV1 1DQ6A 3WG2A 3B5LB 2QDNA 2A3YA 4QU2A 4WVWA 1SLLA 1VRH3 2C24A 1GQPA 3RZZA 4AE2A 4D0QA 4YM3A 1W9YA 1YI7A 1JXNA 1AR72 5I0TA 3WDUA 5A32A 1W0PA 5EYXA 2P6HA 2PHTA 4W6YA 4XTMA 4YW2A 3ZPOA 1KITA 2C9AA 1LAJA 3IDBB 4D7YA 1CJPA 2UYAA 2B45X 2WQ8A 1GP4A 3JD72 4P5HA 2C0ZA 3ZYHA 4JC1A 2NQYA 4JTNA 4IV1A 2W94A 4JKMA 3AJYA 3ZSMA 4AZZA 3H8UA 4GXLA 4ES8A 2Y33A 2SBAA 5C6CA 4PI2A 5EHDA 4HKLA 2G9GA 4MG2A 4KL1A 1M4WA 2R49A 1KJLA 4LO6B 3AZZA 1PX3A 1GWKA 5LRRA 3FFZA 4GIQA 4K8RB 4CCNA 4Y1ZA 3LFIA 4FTBA 1PVC2 2KR2A 3PL0A 3EMRA 4PF5A 5IFTA 1GKBA 4Q27A 4L92A 1IHMA 2PFWA 3J7LA 5D1IA 1GZWA 4JTOA 1UYPA 3GZTB 4GJYA 5KXCA 3DPRB 4IEQA 1MS9A 1HLCA 1MVQA 3PLQA 1NCRC 3ZXLA 3ZXAC 5IW0A 1CONA 2WSVA 3W58A 3SXWA 1N1SA 2XJSA 2O8OA 4Q0QA 5JXIA 5IVBA 1GOHA 3VBRC 1WCKA 4EQVA 4LT5A 1ULFA 3H7JA 5FOJB 2D98A 5LBEA 4GB33 5LK7B 2AC1A 1JYVA 1IKQA 4LEJA 1R092 2LUWA 4BLIA 5C71A 1K5MB 4D69A 2MEV2 1QY4A 1WLTA 1WBFA 4YZ4A 2J1RA 4HK8A 3C3VA 2WNEA 3C7GA 2DUOA 2P37A 2YU2A 3B3QE 4TXWA 3RMXA 1W2OA 3VBFA 5ACA3 1EY2A 4AI2A 1OLQA 3DPRC 3PU8A 4D94A 1JYCA 1XBFA 2CSGA 4UFLA 2JG9B 4YW5A 1H0BA 2QQVA 3LA2A 1MZEA 5FY4A 1GOGA 1V6LA 3JCIA 4IUGA 5IJRA 3VHOA 2BEOA 1ZX5A 3GBFA 1VBC2 4X8NA 4WM7A 4BXFA 3BALA 4XJWA 4IE4A 3OUJA 2EICA 2R043 2RJ2A 3OSDA 1VBA3 1GICA 5FY5A 4FI9A 4I09A 3MHZA 2PQQA 5ABJC 1W8NA 4EZ4A 3PJQA 5C33A 1W90A 5A7NA 3N7MA 1VBE3 4HSJA 3WVJA 3FHQA 4KBZA 1UIJA 4ARYA 1EAH3 4CDWA 1WCUA 1BLZA 1WW7A 1O4TA 1OKQA 3WNKA 4GKXA 1TE1B 2D3PA 4AQTA 2CWSA 1MS5A 1YI9A 3T0AA 5KBFA 4GALA 1W9FA 3O5SA 4ZU5A 3WW1A 3SH5A 1IPKA 3DN7A 1R081 3LEMA 4PDWB 4M3CA 4AHWA 3KMHA 5FMCA 1NXD1 1UYZA 4ONUA 4ZPIA 4RHV1 2OA2A 2SLIA 1TMF3 3HNBM
chains in the Genus database with same CATH topology
2QUOA 1DIWA 1N47A 1KS5A 1WW5A 2A3WA 2E7AA 3R05A 3FC0A 4HMZA 4ASMB 1ULDA 1H1IA 3ZYGA 3CLPA 4AFCA 4Q4X2 3S7IA 1BEV3 1FX5A 1YO8A 3K48A 4N9HA 3M70A 2AH2A 2EIGA 1QDCA 2IFWA 2RM23 4RL7A 3WD5A 4Q0SA 3OD4A 1KFUL 2DCZA 3R0RA 4K1YA 4PDWC 4UXAA 1XE7A 4RR3A 1Y3TA 3LA3A 1WLDA 4XEZA 4YFZA 2ARXA 1UKGA 2Y26A 3WG3A 1FATA 3BOWA 1H2NA 2I07B 5I0RA 1H8TA 4OHZA 3PJYA 4NR1A 5BYNA 5KHGA 4Y1XA 2EXHA 1RUD1 4OUMA 4AW7A 2WNUA 1R1ZA 4MGZE 4CEWA 3MFAA 3ZIXA 4BCUA 5FQ0A 2RS33 2DTYA 2TNFA 1WGPA 1VIWB 1RUJ3 1SLCA 3ENRA 1I9RA 1DQ1A 4IV3C 1G6NA 4XF4A 3VBOB 4YZ1A 2GAUA 1BKZA 2HWB3 3WG4A 3H3ZA 4WVVA 2EXJA 4I02A 4N9IA 4GQ7A 1MEC2 1ZZ7A 4ORFA 3GZUC 4Q4V1 4CDUA 2BWAA 4CRQA 1AJOA 4PLOA 4XJZA 1PZ8A 1QXJA 1FPN1 1W6NB 3MEPA 2GU9A 1FNZA 3ZXFA 1B35C 1ZZCA 4X6RB 5I91A 4N7UA 4QXKA 1ZZ6A 1X7NA 1ZVFA 4Y5Z0 1NCQB 2P3KA 3E5XA 3OYWB 3VV1A 4YVWA 1W6OB 4I0WB 3VZNA 4Y1YA 3NWKA 1SEFA 1OLRA 3D6EA 2DFCA 4QPIA 1IS5A 5GZGA 1PVXA 3LZZA 4IEUA 5CFDC 2CNAA 1DG6A 2CGPA 4JGYB 5EV7A 1Q56A 1V70A 1SLIA 2NMNA 3POWA 1PM7A 2WFPA 3SCHA 4LO4B 4N43A 1GNZA 4Q0UA 2WZR3 2HWD2 1W39A 2UWCA 3P3PA 1PO21 1NA1A 4YYOA 4MGKE 2RR11 1RUC1 4KGGA 5D8AB 5JDBA 4J6GA 3AZVA 3OY8A 4L2NA 3GHNA 4AFDA 3FWEA 1YIFA 3OF1A 4XYXA 2UURA 4AHXA 1GQGA 4OI2A 1Z0HA 1EV12 5JPNB 1QH6A 3I2DA 4K9SA 4QQOA 3B02A 2B42B 4XPVA 1CAVB 1C57A 3AKPA 4Z8BA 4MH0E 4NHKA 5J7MA 5JPMB 1ULGA 4QGMA 3NV1A 1ZBA1 1QHDA 2DURA 2YGLA 1RUD2 1A6CA 5C8WA 3H1MA 1LTEA 1GANA 1S0EA 2QJVA 5I8YA 1LU2A 2Y0OA 4S2HA 1C1FA 5DG1A 3V0BA 1BQPA 2C5DA 4KGQA 4BA6A 1ASJ3 4XQ4A 4MGIE 2HJIA 4XFBA 3AYEA 3M8LA 3M7AA 4EN0A 3VBHA 1RMU3 3KCYA 3LOBA 2ZMKA 2PYTA 5H9QA 2WA3A 1ZRCA 1Y7BA 3OGGA 1ZBE2 2ZHLA 4Q4V2 2EAKA 4LBOA 3RMYA 1ND3B 5CBLA 5L36A 3I59A 5JZGB 1VRH1 1NLRA 2H6BA 1UCXA 1CX4A 3GYDA 3V64A 2FBEA 4MXWB 3IDEA 2OUHA 1FYUA 2BFUS 2Q30A 1HRV3 4N53A 4PJYA 4C0BA 5JR7B 2TUNA 2NN8A 3CJIA 1QOTA 3JUUA 4G9SB 3THPA 4FP3A 4CZSA 3KSCA 4NO4A 2E9QA 1YFUA 4JDOA 2QQPA 1HRI3 2JICA 3KD4A 1ND3C 4OI0A 3BCWA 4I0BA 4AI8A 3WINE 1FI2A 5JCTA 1TNRA 5C4WB 5FAXA 2NYYA 1GYKA 3EBRA 1SCSA 2EF6A 1O5UA 3I4IA 4IETA 2RR12 2ZX1A 4CEYA 4AK3A 2ILMA 4NN0A 3OBRA 1PNGA 2FZ1A 2R073 3EO6A 1PK6A 4QT6A 2BYVE 5T3NA 2O8QA 4Q8KA 4KBBA 2VXRA 4LBKA 5FBZA 3VDDB 4Q4W3 4BIFA 2WA4A 4LBJA 3B9IA 4Y22A 5IK5A 1AL0G 1ZBA2 4RS5B 2VW0A 3HWJA 5ACA1 2V09A 2XJUA 3VUOA 4Q0PA 3WCRA 2E53A 1NQJA 1AXKA 3ZN5A 2BBVA 3BPZA 5J48A 2R041 1DGLA 2ET7A 1VBA1 4P9GA 3EJKA 2JG8A 1ENXA 2PN5A 4HZFA 4UW4A 5H9PA 1VBE1 3PTYA 1WBLA 3HR9A 1AZDA 1T6GC 2GZWA 3I8TA 4LBQD 4HVRA 1EAH1 1GR3A 3M3OA 3V0AB 3TBDA 5E89A 3QACA 4Z1VA 2X5IA 1VRH2 4DNYA 2R0FA 3S0MA 2PA7A 1RUG1 4RGGA 1D2SA 1A8DA 3AZYA 2FHRA 1AR63 4KNCA 3B69A 1W0OA 1GNHA 4QM9A 1TMF1 1J3QA 3PVOA 3HT1A 4HVOA 1CAUA 3PMSA 4YSFA 1AYM3 1UZYA 5J09A 3TNPB 4RA0A 1UMZA 1BEV1 3L9JT 4U2AA 2ZX0A 1D0GA 4X8PA 3MF9A 3RS6A 2D6PA 4Y20A 1IS6A 1I6XA 4R9DA 3E5QA 4G3YC 1OA3A 4RD7A 2WT2A 4LBNA 2ZGKA 4XFIA 3USUA 5K0UB 3ES4A 2UWBA 1PZ7A 3I7DA 3VBSA 3FBYA 1OA4A 2YPJA 2ZAAA 3D82A 1JUIA 3VKNA 2E6VA 1F9KA 4AEDA 4GB32 2JJ6A 2XG3A 3MIEA 2RS31 4BIOA 4AF9A 1RUJ1 2AREA 4HANA 1YNAA 2HWF3 4F83A 4LE3A 4W6XA 2A75A 1H8VA 3ZXGA 3AP4A 4QPGA 4EN6B 2VY0A 5J3UA 4YZ2A 2HWB1 2HWC3 5ACA2 2XH6A 3ZFEC 1LOEA 4MX3A 2D6NA 5CIRA 2UY8A 5SV8A 4TWTA 4LA3A 3FLTA 2FZ2A 2NMOA 2VW1A 1U0AA 3ZYRA 4XIOA 4FPJA 2I45A 2R042 1DYPA 3AZWA 2PHLA 1MQTC 1WLWA 5BNNA 2VMHA 3WQ1A 2FMYA 3KLSA 1QXPA 1VBE2 3AXEA 2MNGA 3ILNA 1YCIA 5KC5A 1EAH2 4BHPA 1YLLA 4AQ2A 1OOPA 1ZZ9A 5SV5A 4C0HA 4K40A 4OHVA 3USSA 3ZIWA 3X29B 4AEMA 3ZSJA 3OD0A 4LHLA 5EXOA 1DF0A 1F5FA 1VAMA 2WQZC 3WOGA 2K9ZA 1FV2A 4XF1A 4LO8A 1KQRA 2PAEA 1TMF2 1OSGA 1UKRA 3FFQA 3AXDA 3KT4A 5DDJ3 4KWJA 1CAXB 2A70A 1AR93 1HV0A 2WZR1 5AVPA 1IZ3A 1V6KA 1PMIA 3D0SA 3WZ1A 3LSDA 4WM8B 2H0VA 1KXGA 3AB0A 4ITCA 3OGJA 3B94A 4JGZB 4L99A 2RM22 3FJSA 3KCCA 4B7KA 3OTFA 1LODA 2O1QA 3PVBB 4YG3A 3RQ0A 2D40A 5F9TA 2RMU3 3DGTA 4KWKA 4BZ4A 1J3RA 4PLNA 5CFCB 5I8TA 3D0JA 2B39A 4LULA 3LKJA 3JBG3 3ZN6B 2ZZJA 1GBGA 1SDWA 3ECQA 2HWE3 3MIHA 3ASIA 1ZA4A 4JRAA 2RHPA 1RVF1 1YIPA 4WM8C 4XF3A 4UW5A 4YFWA 4C1XA 4CDXB 4DY5A 1ASJ1 3AFGA 1RUJ2 1OI6A 1TEIA 4R4ZA 2DVDA 2RE9A 2NM1A 3PMEA 2XJPA 1ENRA 3DPRA 2D6OX 2K2SA 2W0XA 3HIFA 5LRSA 3AFKA 3SISA 1RMU1 3KM5A 1WCDJ 5AC93 1LHVA 1COV3 2D7FA 4H7MA 1RINA 4BM8A 1DLLA 1ND2A 1OPMA 4OVEA 4HK9A 3T1MA 3IN9A 1PO23 2QE3A 2QVSB 2B5HA 3RG0A 4I2OA 1K5MA 1RUC3 3NKGA 4K7JA 4H55A 4YW1A 3ACLA 1LKNA 1RJ8A 1HRV1 5H9RA 2Q4SA 3VKOA 1C5HA 4J1WA 1PZ9A 3ZXDA 1BBT2 2AR6A 2VNOA 4A7YA 3SCFA 3CJXA 4KG0A 2JG9A 3O0WA 2XUMA 3ZDSA 2VOWA 3WCSA 4ZXKA 2GDFA 1MVEA 1HRI1 1QKQA 5GJ6A 4HPKA 2PHRA 3WHTA 4XFHA 4RGAA 2YMZA 5J36A 2W68A 2WZR2 1S0GA 3LOIA 2DFBA 2PHUA 4QMAA 4XJAA 4WVMB 4AI0A 4C91A 1TME2 3WP3A 3WR0A 2HKXA 2R071 4PDWA 3NV4A 1UD1A 3ZXEA 1YJKA 3CU7A 5L7OC 3AP6A 1UZZA 4XXPA 1S0CA 4YARA 4R9AA 4JDNA 3ES1A 1YWKA 5FMOL 4Q4W1 1LOFC 5FLHA 5GKAC 4D7TA 3PNAA 4DB5A 4L97A 1W6PB 3H1YA 4AVSA 4DRVA 3VKMA 3MFCA 2AZ5A 2VULA 1RUF3 3IT8A 3TAYA 4CP0A 3AKSA 1NCRB 2ZAHA 3MLLA 1DFQA 1LENA 3PHMA 3VBRB 3FUOA 4IEOA 3WUDA 4BE3A 1ASJ2 4XJ9A 3UK9A 1WMEA 1QMJA 2EVXA 4E2QA 2Q0AA 1RMU2 4K20A 4HT1T 4FOQA 1V6IA 2JXAA 1OQDA 1VALA 4XJUA 5JMCA 3A0NA 3TYJA 2CGNA 1O3SA 4JCKA 3MIFA 4AGRA 1UX6A 1CVNA 1AX0A 2XJRA 4DXZA 1DHKB 1JHNA 2X29A 2X8KA 5FMOS 1D4M3 2GALA 4R9CA 5J98B 3VBOA 3DF0A 3VHPA 1AR61 1FAYA 3WG1A 3ZMOA 1YYNA 2XB6C 2A7AA 4B7EA 1UIKA 3AZXA 2ZGRA 2D97A 1FOD3 2BQPA 2PAMA 2ZCWA 4GH4C 2BTVC 2WNVC 3MPBA 4JQRA 4QM8A 5J37A 5DUWA 1AYM1 1N3OA 3POYA 4MVTA 1QGLA 4LE4A 4HN0A 2BNNA 2VVFA 1VP6A 5H9SA 2R16A 1RUI3 4AEJA 3B01A 5JI9A 1W6NA 2W39A 1HRI2 1BJQA 2WS93 1ZZ8A 4SBVA 4YGBA 1AXZA 1C28A 1LR5A 3AYCA 1NCQA 3LGRA 3ALQA 3OYWA 3UV9A 1W6OA 5F6LB 4AVAA 1Q8OA 1KJRA 2VOXA 3CL1A 5LK5A 5C8CC 2R072 5T5OA 4JGYA 4QQ2A 5K9YA 4W6WA 2QCSB 3NVCA 4LLOA 2XLFA 4B4QA 2R061 4GA9A 1O3QA 4OHXA 3AMQA 4HSLA 5T5LA 3VGIA 1DQ4A 2HWF1 3BOPA 5K8SA 3UKTA 3ZSLA 3PVNA 1RUG3 2OIIA 2HWC1 1I3HA 4A7ZA 5D8AA 1LEMA 2TEPA 1O4YA 2A6WA 1ALYA 2XLAA 4LBLA 1RL3A 2ZGMA 2A6VA 1BZWA 4XMIA 4AEKA 3O0VA 3JB8A 4CDQC 2RS51 1CAVA 2ZGNA 2AYHA 4O9GA 1RB8G 2YC0A 2XPJA 4IV3B 1H9WA 5GALA 1N3QA 3AMHA 4B29A 3S30A 3ZFGB 1OQEA 1AL23 4QQHA 4UW3A 2VUJA 1DQ0A 1AR62 1V00A 2XHKA 1SMVA 2WINB 3QH7A 4M3CF 4DRRA 4AI3A 5E8AA 1B35B 5DDJ1 3MI8A 1CN1A 4SLIA 1AR91 2UYBA 1E57A 3NAPC 5FLJA 5KC6A 2Z5WA 1HQWA 4P9IA 1ND3A 4XQWA 1BCXA 5JZGA 5KHJA 3RYKA 4QGLA 5FLIA 3KS7A 3S7EA 4MXWA 5BNOB 3ZFGC 1V6NA 1H2MA 2GSYA 3DKWA 5CFDB 1OMIA 3HD8B 4XETA 3H0OA 3H1WA 2RMU1 3ZN4A 4FSJA 1I1EA 1UW8A 3JBG1 2ENRA 4LUMA 4BYYA 2HWE1 1IS3A 1OD5A 4IV1C 5EYYA 5FO9B 4LBQB 2VW2A 5TSWA 5C9AA 2ZGLA 4GMP0 1A3KA 5BNOC 5C4WA 3NSTA 1G9DA 1IKPA 1R082 2HEYF 3WDYA 3LSEA 1O4ZA 2DCKA 2HWC2 2YY1A 5AC91 5BV6A 4RHV2 1COV1 1PGW1 5JIAA 1S0JA 5IT6A 3BODA 1CESA 1SLTA 2QFEA 1YUDA 3TNQA 5IK8A 2C1FA 2WL1A 2ZGPA 3VDDA 1LEDA 5GZEA 4M01A 3KGZA 2DCTA 2ZPXA 3TRSB 2ES3A 4FAGA 3VBUB 4RS5A 4XFCA 4YW3A 4TSVA 4QD2A 2AENA 4COVA 4P9LA 3SLIA 2ZKNA 3D4KA 5AFBA 4U36A 2KM2A 4FQZA 4Q26A 1FNYA 3U07A 3V65A 1LHWA 4AFAA 3S6PA 2DVBA 4WM7C 1RVF3 2XWBB 2KXLA 1LOAA 4LA2A 1NE4A 4KWLA 1X36A 4NPRA 2P3IA 2CL2A 1HQLA 4YNIA 4Q1PA 3M3IA 5DDJ2 1W6MB 3N36A 2ZHMA 3ZX7A 1AR92 1H1MA 1CAWB 2DCJA 3TB0A 3VBUC 3H3UA 3V0AA 1GZCA 3O7OA 4CDWC 1LB2A 1OA2A 1X82A 1AR73 3RWNA 1JTZX 2VMGA 3FZ3A 3WDXA 2GC0A 2JE9A 1Y43B 2VMIA 4O9EA 1FV3A 3QBQA 4M0HA 1GQHA 4B3NA 5T52A 2RMU2 2PHFA 3JD73 4DINB 3KZ4C 1FPN2 2HWE2 2OW4A 3MLJA 1QNWA 4EROA 5DZFA 1RUF1 4AFMA 4BOWA 1REEA 3IPVB 1QOSA 2JX9A 4I30A 1OFSA 3ZVXA 4HKWA 2XKPA 2JKBA 5I0SA 2XJQA 2DU1A 1UU4A 5KWRA 1JW6A 2ZKLA 1C8M3 2D44A 3MW4A 1D2QA 4RR3C 2EA7A 4GULA 5K0UA 3FHIB 3TN93 1COV2 1PGW2 1H8TC 2XJTA 3E6BA 2DVFA 2HEWF 1C1LA 4CDUB 1XU1A 2WNUC 2GC3A 3UJQA 1PO22 4FPLA 3GALA 4WVZA 2DYCA 1RUC2 1F8VA 1D4M1 1DQ2A 1PO13 4XHXA 3WNXA 1VBD3 2VH9A 4MGYE 5HI0A 4Z82A 1FOD1 2XJVA 4I3GA 4QPYA 1RIRA 1CR7A 2XVGA 4HVQA 5F5QA 3WDTA 4CDUC 1RUI1 2YDEA 2GH8A 4N90A 2BGCA 2GNTA 2I2SA 1Q5OA 2WS91 1AJKA 2CAVA 2IXIA 4S2GA 3ZSEA 1GFF2 4AVVA 4HL0A 2HEVF 4R52A 4E9KA 2OZ6A 4XF0A 3ZXJA 1S0DA 3VZJA 2PHDA 3W59A 4YVWC 3NV2A 5FTTC 2VOKA 5FDBA 1POV0 4GWNA 4FPEA 4QPIC 1VR3A 1MACA 2OZJA 2R0HA 1AYN1 2DVAA 4FO9A 4META 1AF9A 1O91A 1R1A3 2MHFA 4KU8A 1RUNA 1CAXA 1D0HA 1AX2A 4LTAA 5BXXA 4C90A 4EV0A 3MW3A 3KCXA 4WM8A 3E5UA 3UKVA 2Y0IA 3VHRA 3C2UA 5JLVA 3HQXA 1RUF2 3BTAA 4JGZA 3NO8A 4S2DA 1C5IA 1UU6A 1YXWA 1ENQA 3ETQA 1G9CA 2Q1ZB 4XBNA 5BNPB 1IGOA 2Z42A 1RUH3 2WKKA 3RSJA 5CFCA 1XNCA 5CNAA 4BMBA 5CVRA 3ZN6A 2LM3A 3SH4A 2B9UA 4YW4A 5GLVA 5HBAA 5L19A 3TWIA 2BW8A 4AHZA 5BUVA 4CTEA 4MSVA 3MF6A 4FT8A 5GLUA 1RGSA 2PLV3 5AVAA 3ZFEB 5GZCA 4INDA 3ZYIB 4XFAA 2ZABA 2WFF3 1X8EA 4CDXA 1XNKA 2IXCA 2CTVA 1AL21 1N1YA 1H4HA 3ZMNA 5BNPC 3IKWA 4YM0A 1UPIA 4A7KA 4WV8A 2R063 5DZGA 4KG8A 4EN9B 1MEC3 1MQTB 1FOD2 2ZHNA 2DVGA 3E97A 4OI1A 3VBHC 2ZGUA 1PIV3 3ZSKA 3OBTA 1L3JA 3VZOA 3JZVA 1RUI2 4NHMA 4IEPA 1N3PA 3AMMA 5GZFA 2WS92 3RRDA 3ZYJB 1LOBA 3V56A 3WQ0A 5BPXA 1APNA 5KXEA 1DDLA 1UL9A 4EN7B 5T55A 4V1PA 1QJX3 3B9CA 3EHKA 3EQEA 1HX6A 3N7KA 4N53C 1VAKA 2O0OA 2RS53 1VBA2 1VB2A 3RYRA 1S2BA 4GMP1 4NVPA 1LU1A 3CJIC 3THTA 1XU2A 1HKDA 1LOFA 3M2MA 4FXKB 3VLBB 4XHBA 4Y1VA 4K3UA 1VBB3 1J58A 3LWCA 4LHKA 3N3HA 4WBBA 2A5ZA 1FMD3 1RHI3 3ST7A 3LB9A 4M3CE 5JVVA 4BLJA 3GNEA 2EALA 2WIIB 1RUG2 4TLFA 4WVMA 1YHFA 3UL2A 4AYUA 1XYNA 2JE7A 4UBHA 1C8NA 1EV13 1YFXA 4IQPA 1PK6C 4E4SA 3AP7A 1BEV2 5KHIA 2NP0A 2P3JA 5FOBB 3URFA 3QOPA 1W6PA 2A3XA 1AR83 2WZPP 1F31A 2Y38A 1H2LA 4KU7A 1X8MA 3JU9A 1NCRA 2RS13 3ZXKA 2BVBA 1LGBA 3VBRA 2R1DA 2E7QA 1DU3D 3MGUA 3NL1A 5A33B 1PGL1 3ELNA 1J3PA 1S2KA 4ATFA 2R1BA 1AL22 1OPOA 4Q4Y3 3IIAA 1ZYBA 4BWOA 2CYFA 4LO7A 2CWMA 1C3HA 3QLQA 4PBPA 1X50A 2RS32 2JG8C 5DUUA 1LECA 1YFWA 3DV8A 4EWEA 3WQ7A 2R30A 3AKTA 3HBZA 2I74A 3IM0A 3WDWA 2GNDA 1AR71 2HWB2 4K6BA 1NOVA 3CEWA 2X5IC 2G4IA 2EXIA 2FMDA 3AM2A 4AGVA 2ZMLA 1NE6A 1HXS3 1QJY3 2KA3A 3JD71 1LHOA 3HT2A 4GKYA 5ABJA 5K7PA 1SBFA 4Q8LA 2F4PA 2AUYA 2PELA 1U5ZA 5JOWA 3ME2A 4BPZA 1JYIA 1MS3A 4B4RA 2IXJA 4DOUA 4Y26A 3IMNA 3M3EA 4URTA 4YG0A 4LBMA 4RQPB 2ERFA 3ZFFB 5CADA 2CV6A 2FQPA 4UBGA 1G8WA 2YV8A 3ATGA 5DUXA 3VKLA 2ZOEB 1NLSA 1C8M1 5L7OB 1C4RA 4ZKTB 3EXUA 4QPGB 1WUVA 3TN91 1QNYA 4W65A 1WMFA 5DG2A 5IUQA 2DU0A 4ZU7A 1G7YA 3AJZA 4DZGA 2N7GA 3JQWA 3MZHA 5DZEA 2XVLA 2VU9A 4AEDC 5FPXA 4L8QA 2PHWA 1Y9QA 4FPHA 4FOWA 1PO11 4FVVA 2QDRA 5F1RA 1VBD1 1YFYA 4RQPC 2CGOA 1H2KA 3ZFFC 1IS4A 1EPZA 4OHYA 2YUEA 1X33A 3U11A 4NOTA 1XQNA 3RDIA 4QPGC 1IPJA 4E27A 1REFA 4OLLA