3VBHC

Crystal structure of formaldehyde treated human enterovirus 71 (space group r32)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbhC00
4RHV2 5K0UA 5A33A 2HWE1 1RUE2 3ZFFC 5JZGA 1MEC3 5J96B 5BNOA 1R1A1 1QJY1 4JGZB 1RMU2 4Q4V3 2TBVA 2WS91 4Q4X3 1OOPB 1NA1B 1RHI3 2BFUL 2RS11 1AR91 1QQP1 5CFCB 1ZBE2 5BNPA 4LLFA 1RUF2 4N53B 1AR71 1AR82 3ZFFA 1RUH2 1VBB3 4AEDA 2XBO1 1C8M2 1FMD1 2HWE3 4RHV1 1IHMA 1RUJ3 4N43C 2HWB3 1R1A3 1MQTA 4CDWB 1QJY3 1RUE1 1ND2C 2MEV3 3VBHC 5ABJC 1RMU1 4RQPC 1AR93 1QQP3 1POV1 1NCQC 2R063 4YVWA 1QJU2 3VBRB 5FMOL 1ZBE1 4N43A 1RUF1 1AR81 4Y4YA 1EAH2 1RUH1 5BNNC 1RUC2 4RHV3 1H8TA 1C8M1 4QPGC 1ND3B 4CEYC 1V9U2 1X36A 2RR12 4GMP0 1RUE3 1F8VA 2VQ0A 1NCRC 4NWWA 4PDWB 3JBG3 4FTBA 5L7OC 2BPA2 3VBFB 5GKAC 1POV3 1D4M3 2RM22 4CDQB 2RS53 2HWF2 4WM7C 1E57A 1ZBE3 4QPGA 1RUF3 4QPIB 3VBSC 1AR83 5CFDA 4Q4W2 1QJU1 1RUH3 4JGYC 1C8M3 3ZFEC 1CD3G 5A33B 1FOD2 1EAH1 1RUG2 1RUC1 1NOVA 5JZGB 2RS33 4RR3C 1AR61 2BBVA 1V9U1 5BNOB 2RR11 4WM7A 3LOBA 1HX6A 1TMF1 5C9AA 3VBSA 1ASJ2 1Z7S2 4BCUA 4CEWC 2FZ1A 3ZFEA 5BNPB 4GH4A 2RM21 3S6PA 2DF7A 2HWF1 4FTEA 4AEDB 1M06G 4Q4W1 5C4WB 2WZR2 1RUC3 3HAGA 1PO12 1ZBA2 1FOD1 1RUG1 1VAKA 2R042 1MQTB 4GMP1 3ZFGA 1BMV2 2GH8A 1VBC3 1AL22 1VB2A 3NAPA 2ZAHA 4YVSA 4FTSA 4IV3A 1VBE2 1ASJ1 2RM23 4YVWB 1Z7S1 2HWF3 1HQNA 3VBUC 1EV12 4N43B 2X5IC 3VDDB 1B35C 1VRH2 4WM8C 4IV1C 5A32A 1H8TB 1HRV2 3TN92 1FOD3 2FZ2A 1RUG3 2WZR1 4GMP3 1F2NA 1PO11 4GB32 2BFUS 1X33A 1ZBA1 2PLV2 1VBD2 2R041 3J8F2 3VBUA 1HXS2 2WS93 1AYM2 3VBOB 1B35A 1BMV1 4JGZC 1ASJ3 1AL21 2RS13 4WM8A 1Z7S3 1AR73 1OOPC 1NA1C 5D8AC 1OPOA 1HRI2 1VBE1 5CFDB 1CJDA 5CFCC 4N53C 2XBO3 1EV11 1FMD3 1ND2A 1BBT2 4RS5B 1VRH1 1SMVA 3VBHA 5ABJA 5C8CB 3DPRB 1AR62 1PO13 1K5MB 1PIV2 4RQPA 1HRV1 1ZBA3 3TN91 1RUI2 1TMF2 4EJRA 4WM7B 2R043 4CDUB 5D8AA 1NCQA 5C9AB 2HWC2 4GB31 4CDWC 5CFCA 2PLV1 4N53A 5FMOS 1VBD1 1RMU3 2GSYA 1DDLA 3J8F1 1PGL2 3CJIC 1HXS1 2XPJA 3ZFEB 1AYM1 3JB4C 4GH4B 5BNNA 1VBE3 2ZZQA 3ZXAC 1PVC2 1COV2 4CEYA 1EV13 3VBRC 1HRI1 1MEC2 1NCRA 1VRH3 2R072 1R082 1QJX2 5FOJB 5K0UB 1RUD2 3FBMA 1BBT1 3TN93 5L7OA 3CJIA 2WFF2 2HWD2 4GB33 1PIV1 3ZFGB 2PLV3 1RUI1 1VBD3 3NAPB 5ACA2 3J8F3 4YVSB 4IV3B 1AYM3 1PO22 3VBRA 2HWC1 4JGYA 4PDWC 1VB4A 1PGL1 3VBFC 1R092 4CDQC 4Q4Y2 1QJU3 1RUJ2 3ZFFB 4RR3A 2HWB2 1PVC1 4QPIC 2IZWA 1COV1 5LK7B 1BEV2 1EAH3 3JB8A 1BBT3 1MEC1 2R071 2MEV2 1R081 1QJX1 4CDXC 1RVF2 1FPN2 1AR63 1AUYA 1RUD1 1V9U3 2RR13 4CEWA 5JZGC 1TMF3 1AYN2 1OHFA 3JD72 4Q4X1 3VBUB 2R062 2WLPA 5BNOC 2WFF1 2HWD1 1NG0A 4WM8B 5ACA1 1PO21 2RMU2 2BUKA 1VBB1 4CDXA 5BNPC 1PVC3 1COV3 1R091 4Q4W3 1ND2B 4Q4Y1 1RUJ1 2R073 1R083 4AEDC 2HWB1 4Z92B 1QJX3 5DDJ2 3VBHB 5ABJB 1RUD3 5C4WC 1NY72 1BEV1 3JBG2 4RQPB 2MEV1 1PGW2 1D4M2 5D8AB 1RVF1 1FPN1 1NCQB 2WFF3 2HWD3 2RS52 1MQTC 1AYN1 3JD71 2X5IA 5ACA3 2R061 1PO23 5BNNB 1W39A 4IV1A 1VBA2 4QPGB 5C4WA 4CEYB 1R093 4YVWC 2RMU1 4Q4Y3 2RS32 4SBVA 1NCRB 3VDDC 1BEV3 2WZR3 1H8TC 3CJIB 5L7OB 5DDJ1 4JGZA 1RVF3 5AC92 1FPN3 1NY71 1TME2 3JBG1 1OOPA 1NA1A 1AL0G 1AYN3 1PGW1 3JD73 1D4M1 3VBSB 1GFF2 2RS51 1AL23 3IDEA 4JGYB 1RB8G 3VDDA 3VBOC 2RMU3 2ZTNA 4RR3B 1VBA1 5CFDC 5J98B 4FSJA 2RS31 2WWSA 1C8NA 4CDWA 1VBC2 5DDJ3 4RS5C 4Q4V2 1HRV3 3M8LA 4CEWB 4Q4X2 3VBOA 5C8CC 3DPRC 1ND3C 1RHI2 1K5MC 5AC91 1TME1 4CDUC 4NWVA 5C9AC 1HXS3 1VBB2 4RFT0 4CDXB 2HWE2 4GH4C 4RS5A 1VBA3 1QJZA 1HRI3 1WCDJ 5C8CA 3DPRA 1ND3A 1R1A2 1K5MA 5A32B 1QJY2 1A6CA 4CDUA 2WS92 5K0UC 1VBC1 4PDWA 2RS12 5AC93 1PIV3 1AR92 1QQP2 4Q4V1 1POV0 1RUI3 1TME3 1AR72 3VBFA 1RHI1 4CDQA 2X5IB 3ZFGC 2Y26A 2HWC3 4Y5Z0 1B35B 3NAPC 2XBO2 4QPIA 4YVSC 4IV1B 4IV3C 2QQPA 1FMD2
chains in the Genus database with same CATH superfamily
4AR2A 1VLNA 3FBYA 3IBMA 4D69A 1APNA 1TNRA 2PHXA 5CG8A 3MF9A 4UFIA 2ZZJA 5FQ0B 1O6UA 4JVAA 2HWE1 2YG0A 1VR3A 1RUE2 4GJYA 2Q8EA 3ZFFC 2ID4A 5HBAA 2DV9A 4WV8A 5KR7A 1LJ7A 1BK1A 2EA7A 3WUDA 4IQPA 4JRAA 4FPYA 5BNOA 1US3A 1CAVA 3KHCA 4QQ2A 4YWAA 4JGZB 2D40A 4L92A 2VUJA 1RXGA 1BJQA 1CPNA 2Q0AA 2YC4A 3I2JA 2GC0A 4M3CF 1OOPB 2LALA 2J1UA 5HXVA 2VMDA 4YM1A 4X6QB 3QH7A 2RS11 3WDVA 3Q8FA 5E1RA 4MLOA 2B7YA 3KCCA 1ZREA 1RUOA 1FYUA 1W0NA 3VKNA 3UESA 1S55A 2JG8C 1UXZA 2EVXA 5FKBA 3KVAA 1VBB3 3TRSB 4AEDA 4CU7A 4XFCA 3OD4A 3DGTA 1UW8A 1XB9A 3H3LA 5A7PA 3I3EA 1ZRDA 4RHV1 1N3OA 2GNBA 2ZJCA 4UBHA 3VKMA 4CP1A 2BV4A 5A3LA 2UURA 1OVPA 4R52A 4RGKA 3VL9A 3VD3A 5JOXA 3WNPA 2JD4A 1QJY3 1GZTA 5I93A 3VV1A 2GN7A 2FDGA 2NQYA 5DZEA 5CISA 1WUVA 2MEV3 3WQ0A 4DUXA 2QQLA 2YXSA 3WHTA 1OUXA 5FZDA 4O9GA 3UETA 2PFWA 4LBQB 2VZ3A 3SCFA 2A6XA 3SEPA 3H3UA 1V6IA 2QCSB 3MI8A 5FY8A 2OT7A 4Y20A 1OA4A 3M7AA 4AVTA 3HNYM 1QJU2 4N43A 5A7WA 3GBFA 1RUF1 1KDKA 3PJQA 3O1SA 4K8RB 1DHKB 1AR81 4MSVA 4Y4YA 4H7LA 3GCWA 1X9PA 4BZ4A 4QX5A 2GNMA 2WKKA 1C8M1 2WINB 5FZOB 3TOJA 4OUEA 3MIGA 3VZLA 4XUPA 2PAKA 2WQ8A 5FZ4A 4QD2A 2DFCA 4YARA 1NCRC 1L3JA 3BTAA 2XLGA 3IDAA 2ZMNA 5JMCA 3PLQA 1YLLA 4W50A 3GNEA 3KT1A 3DL3A 1DLLA 3AZYA 5FY0A 4FTBA 4GULA 4W8JA 3VBFB 4OHYA 1POV3 1D4M3 3MLLA 3OGSA 5F37A 4CDQB 4E4SA 1VP6A 4FAGA 5FZ7A 5LY2A 4NN0A 5DQ0A 1E57A 1SBDA 3R05A 1ZZBA 5LRRA 3RSJA 3EXUA 3KVBA 2TEPA 4TWTA 1W05A 1W6PB 5DUXA 4PT6A 2RDQA 4Q4W2 4LO4B 1RUH3 5F5AA 3NL1A 2QUOA 3IWZA 4COVA 2QFEA 3K3NA 4LKFA 4YM3A 4RGGA 1NZIA 3I97A 2NPIA 4ZONA 4AZZA 5LB6A 1NKGA 1EAH1 3OJBA 3MICA 1RUC1 2HH9A 1GYKA 1NOVA 1QU0A 2WO3A 2RS33 3MEPA 3WDXA 3MBWA 4COYA 2DCKA 1AR61 3JU9A 3PUAA 1WCSA 4UFMA 2Y0IA 1HX6A 2UWBA 4MXVA 1TMF1 4LULA 5C9AA 3MGUA 1NXD1 5LBEA 1F4AA 1ASJ2 3R4SA 3K4ZA 2VTFA 3ZMOA 5C7GA 1Q8SA 4CXXA 1WW5A 4JQTA 4XUNA 4PLMA 2OUHA 1UOFA 1LHVA 3IT8A 3WP4A 3ZKYA 1OH4A 3LAGA 2C24A 2JE8A 1AX1A 3DEMA 4LE4A 2JDAA 5H9SA 5JPMB 3GJBA 4DEQA 2PN5A 4FTEA 4ZPIA 3RYKA 3VB9A 1CN1A 2ES3A 3I3MA 3E5XA 1GZWB 1BQPA 3A0KA 4WVVA 3I7DA 3ZVXA 1W6NB 4Y4RA 5FY1A 4EQVA 5FPXA 5FYMA 4BA6A 4I0AA 2UY8A 4Q8LA 3CL1A 1H2NA 4CE8A 2XLAA 4QGNA 2ETEA 4K3UA 3IMMA 3C7GA 5FUPA 4NIIA 3SQOA 3ACFA 4CUBA 3KHBA 1MQTB 3ZX7A 4YZ1A 4Q8KA 4JDOA 3UKVA 1UIJA 1JTZX 2XH6A 4GWNA 5T5LA 5D2AA 1DZRA 2HJIA 1BMV2 1KQRA 2A3YA 3K48A 1VB2A 3NAPA 4HKOA 4LJHA 2D44A 2ZAHA 2ZX2A 5FZGA 4MGTA 1LHUA 4KMQA 4PLOA 3I59A 4L11A 5SV8A 3HNMA 1DQ2A 2JENA 2ZGPA 1UZVA 1V00A 2DBNA 1OPMA 2RM23 4TZDA 4BOWA 3N7MA 2PQQA 4DO0A 5GZCA 5K4LA 3VBUC 1OSGA 3ZOIA 3L9JT 2VOXA 2PHRA 3AZWA 3CU7A 2ZKLA 4IEQA 4BYYA 2VUCA 1B35C 3HJRA 4WVMB 1VRH2 1VJ2A 4WM8C 4FQZA 1GWMA 1MPXA 1DYKA 1TNFA 2GZWA 1WD4A 1YI7A 1H8TB 2Y38A 4IV1C 2GALA 5FP7A 2L9LA 1C4RA 3AMQA 1WLCA 3PUQA 4C8DA 1RUG3 4LBLA 4QKFA 1F9KA 2WZR1 4PIYA 2D98A 4NIDA 2R6QA 2BGOA 2YB7A 3CLPA 1MR5A 2UU8A 4GB32 4MGQA 4B4PA 4D3WA 3UGHA 2PLV2 1JMUB 4HSJA 2A6ZA 4M0NA 4P5YA 1QH6A 4AGVA 4XFIA 2WS93 1GNZA 2XJVA 5F5QA 2WLQA 1VAVA 2XJPA 2JG8A 4D0QA 4F83A 1FXZA 4WBBA 1VIWB 1AL21 1UX6A 5CYYA 2NMNA 4PBPA 1Z7S3 4UXAA 3BOPA 4W4ZA 1AR73 1NA1C 1HLCA 5I8TA 1S0DA 1JS9A 5LATA 3LOIA 3ZMNA 2G1MA 2Q30A 1W99A 3BYWA 2XBO3 1Q3EA 3WCRA 1EV11 1LR5A 4DEVA 1FMD3 3W58A 4NAMA 5F32A 4HANA 1A34A 2VR4A 4RS5B 3LKJA 3FFZA 4IUGA 3O1UA 1WA6X 2UWCA 3ZN4A 5LA2A 3H8XA 1I5PA 1PO13 1CGPA 5DAXA 5E6HA 1CAUA 1OQDA 2LTNA 3GALA 4WM7B 5L73A 2R043 4BE3A 2EXHA 1SFPA 4CDUB 5DAPA 4FP2A 2WSVA 2RJLA 4BQ1A 5FZEA 4CDWC 3LEKA 3ZIXA 4FI9A 1UIKA 5FMOS 3E5QA 5KHJA 2GSYA 1HXS1 2VECA 5KXDA 1UOGA 2VMCA 5D1IA 2ZZQA 3MW3A 3ZXAC 3AFGA 1PVC2 3C7EA 1DZTA 3GBGA 5LEJA 1X82A 3O1TA 1NZCA 5I0UA 1LU2A 2KXLA 3VBRC 5JIUA 1T2XA 1MEC2 1NCRA 2OPWA 5A7OA 4CTEA 1QJX2 4UFHA 4YZ2A 5K0UB 4QGLA 2AH2A 2H0VA 2XVLA 4PI2A 3ZSEA 2J1TA 1ZZ7A 4MH0E 2XKOA 1TVGA 3CJIA 1PMJX 1VRBA 3EQEA 2A3XA 3PDQA 4G4FA 3MUZ1 2WFF2 2HWD2 4NE9A 3LA2A 4XCAA 3ZFGB 2XKPA 1WLTA 4K40A 4IETA 1VBD3 1VMFA 1N1VA 5A6YA 5BXXA 1ULOA 1AYM3 4KNCA 2DTWA 3BI3A 1CONA 3U78A 3S30A 3ZYHA 1UZWA 2C26A 3LD8A 3OBTA 1WMEA 4Q0VA 1VB4A 1YRZA 2IFRA 3TNQA 1WLWA 1UX7A 4QU1A 1RUJ2 2P4EA 4OI2A 2W3JA 4QT6A 3ZPYA 2SLIA 4L97A 1NLSA 2AYHA 4QPIC 1N1TA 1W9WA 1COV1 3AL5A 4LORA 1ENRA 3BU7A 4KG0A 4RL7A 5C3OA 5HXMA 3ZYBA 4BPZA 1OQEA 1BBT3 2R071 1KXGA 3OD0A 1DQ6A 3KLSA 4PQ9A 3RMXA 1G9FA 2ZKNA 3D5OA 3QCWA 4XDOA 1JZ4A 2RR13 4UW3A 2LS6A 5JZGC 5IVYA 4EN6B 3JD72 3N3HA 5FZCA 4A7ZA 1LTEA 2R49A 3M2MA 4JKMA 5HCHA 4K6BA 4XXPA 5CU1A 1BVP1 3WNMA 2JG9B 4L2NA 5EQUA 1WGPA 3F2ZA 4NHXA 2Y6JA 5ACA1 5EFUA 2XVGA 1GP6A 4QPYA 2JE7A 2ZEWA 1UD1A 1C1LA 2RMU2 4N7UA 2RG4A 1VBB1 1UOBA 2XG3A 3AKPA 3VD4A 5HV4A 4XBLA 1W6OA 3WNLA 4I3PA 1DZQA 1H2MA 2RDNA 1R091 4UWDA 2QQKA 1SZBA 1ND2B 2AACA 4B29A 5CADA 1KEXA 1ST8A 4UW5A 1R083 1RJ7A 2I74A 3WD5A 1SQ4A 5DDJ2 3WW1A 4XQDA 3IIIA 1RUD3 2R16A 1EYBA 2E63A 5JDBA 4RQPB 2MPFA 5A6QA 2MEV1 1YQCA 3WUCA 5C70A 5D8AB 4Y22B 4MOAA 2RS52 4XURA 5JPNB 1MS4A 4MUVA 2ZMKA 2ARCA 2CGOA 4LHNA 3O1VA 4BQ5A 1CWPA 4RYDA 3E6CC 1HB4A 4BDVB 2YDEA 4XDQA 1J3QA 4XFAA 4PQQA 4YG0A 5T54A 4XJZA 4IV1A 2BZDA 2E32A 2WDBA 1MS0A 4B7KA 3R4UA 4FFHA 1GZWA 2TUNA 4BIOA 4FOWA 1OD3A 3C8XA 4QPGB 5GJ6A 4GXLA 4YVWC 4XFGA 3AYCA 1BLZA 1D0HA 5A3TA 4Q4Y3 4SBVA 2W1UA 1GOFA 4N9HA 2KM2A 2QE3A 3VDDC 1Q8PA 4O65A 4AOCA 3LA7A 1BEV3 3GBWA 2Q1MA 5A70A 5LBBA 1KRIA 1QF3A 1QXPA 5C8WA 2QDNA 1PMHX 4C1XA 2MNGA 1W8OA 1RVF3 1FPN3 3NV1A 1X8MA 1GNHA 1DG6A 1TME2 1HV0A 3QACA 1NA1A 4O61A 1O7FA 4YG6A 3B69A 1AYN3 1PGW1 4QX2A 4ASMB 3ZKUA 4AW7A 4BQXA 1D4M1 1AXKA 3VBSB 2VBBA 2VOWA 4AFAA 2O0OA 5FP4A 1JYWA 1UL9A 1RB8G 1Q56A 2VOVA 1O3RA 2WA3A 3VBOC 1GLHA 1W3XA 4WVMA 3K2OA 3MZHA 2BNNA 3SXWA 2GH2A 3FC0A 1DGLA 1J84A 5F3CA 5JOZA 1PK6C 4DINB 1VBA1 4NHKA 2ZXQA 3HN3A 4JTNA 2UY9A 1H9WA 3BU0A 3CZUA 4FSJA 4L99A 2RS31 2GAUA 2CWMA 3J9SA 1C8NA 3F95A 1HW5A 4CDWA 1V6OA 3P1IA 1Y4WA 3IB3A 3J7MA 3U75A 4Q4V2 1HRV3 1HN1A 3LA3A 4Q4X2 1D4VB 4LMFA 3DPRC 1ND3C 1RHI2 5M0TA 3RJRA 2DVBA 4DY3A 4P5HA 1S0JA 1W6MB 5HI0A 3OUJA 4NWVA 2VC9A 1WW7A 3BVCA 2A3WA 4WVZA 2FMDA 2V09A 1CZTA 1W6QB 3KWVA 3PL0A 1G6NA 4K20A 3U14A 4Y33A 1JZ6A 3EHKA 3ZR6A 5L9VA 4W65A 4I02A 4OHZA 4A44A 2ZGKA 1LGNA 1LNSA 2HWE2 3O1MA 4RS5A 3AVRA 4KGQA 5KBFA 3IPVA 1HRI3 3VKOA 1WCDJ 5T5OA 5I0SA 2A6WA 2LROA 1FAYA 3SITA 4LIUA 3UGFA 4HPKA 3FLPA 3O12A 3N9LA 3KQRA 4CDUA 2EIDA 3GYDA 3NQHA 5F1RA 2BVBA 2WNUB 1V0AA 2VNVA 2BDRA 5FZ9A 2RS12 4MO3M 1LENA 1YJLA 3AVSA 1BCXA 2JIJA 3I2HA 1W2OA 1RUI3 5JOWA 4FOYA 3V0BB 3I3BA 2ZGQA 4E4ZA 1GUIA 2BBAA 2VQAA 2ADEA 3VZOA 3HWJA 2Y26A 2HWC3 4TN7A 3WY6A 1H2KA 3WF2A 2CGPA 4QPIA 1XC6A 3FUOA 4YVSC 4IV3C 4AAXA 1XYNA 3K3OA 2H6CA 3ETPA 4RHV2 2OX0A 3AZVA 3POJA 5K0UA 3OOXA 1IS3A 5A33A 1SACA 2CY6A 1YI9A 1PVXA 1QOTA 1ZZ9A 2EIEA 5JZGA 2HKXA 1AHSA 2BJSA 2EIBA 3DN7A 3AK0A 3D4KA 3NVCA 4AFBA 3RI8A 1DLCA 5J96B 1FNZA 1R1A1 4DZGA 4D7SA 1VALA 3SEEA 5FMDA 1QXJA 1OA3A 4YYOA 4R8HA 2WS91 2VW2A 2W1WA 4LK6A 4AWDA 4CU8A 4DIQA 5EZWA 1QNYA 5L19A 2DU1A 5CFCB 1V6JA 1WCQA 5LRSA 1RUF2 3B02A 1AR71 4TLGA 1US2A 4AF9A 2V73A 4AI1A 1AR82 3PIJA 2DTYA 2I45A 3K51A 4FFIA 3W21A 3VUOA 1UAIA 2VG9A 1CAWB 3PU3A 5A7NA 1DQ4A 1W28A 2XBO1 3PHMA 2WC2A 1C8M2 1ZM1A 2OPKA 4LHLA 4NPRA 5CAZA 5A3UA 2YPDA 4UI9L 1FMD1 4LXLA 3ZR5A 4FXGB 4HONA 1V70A 3AZZA 1WMFA 4QXBA 1MS8A 2DVFA 3UL2A 1BYHA 3K46A 3OG2A 4N43C 2HWB3 2ZX0A 4R9CA 3VHOA 4E4DX 1UMZA 2X8KA 4FPKA 3HEIA 2H0BA 5F9TA 1OXCA 4K1YA 4Q0QA 2CNAA 5EV7A 4XCBA 2VD7A 2VOKA 2CYFA 3EMRA 3MYXA 4MGKE 4OFGA 4H14A 3VBHC 2JG9A 2BGPA 4X8NA 3S57A 1NX9A 3NJYA 4H3WA 1AR93 3WINE 1QQP3 2VAUA 3I54A 4K21A 4FAHA 2CAVA 4YVWA 5KC6A 3RPQA 3OGGA 3S7EA 4AL9A 2VJXA 1CQ9A 1ZYBA 5FMOL 1ZBE1 4LBMA 4LKSA 1A8MA 1CX4A 4LUKA 1V6NA 3PMEA 1EAH2 3BPSA 3OPTA 4LOSA 3T0AA 3PTRB 1RUC2 3CDZB 3OUIA 3L2YA 2CWSA 2DVGA 1L7QA 2ERFA 5FMBA 5EXOA 4KG8A 2FDIA 1JOJA 5EP9A 3RG0A 4GMP0 4IGPA 1GBGA 1RUE3 2R7EB 2NLRA 1W8HA 1RJ8A 2LM3A 2XWBB 3FMGA 4DXRA 2UWAA 4XF9A 5AVPA 3MIDA 4L8QA 3ZYRA 1JUIA 4OULA 2D6PA 3THDA 3UKTA 3JBG3 1ACCA 2OS2A 2BPA2 3B9IA 1XE8A 4ISQA 5GKAC 5FY5A 1HB1A 1RINA 4UW4A 4ARYA 4QPGA 1PK6A 1I1EA 1EUUA 2JD9A 4P14A 3M3QA 1JU3A 3ACGA 3PUHA 4A42A 4L9BA 3KCXA 5DABA 5T52A 4JGYC 4CCOA 1PHMA 4W6XA 3USUB 4ASLA 2V4AA 5CIRA 5FXWA 4OI1A 4A3XA 4E9KA 4F3JA 1W9TA 1YJKA 3HT1A 1V6KA 3NKGA 4XIOA 2BERA 1QIQA 3JUUA 1SLBA 1JZ5A 5IVFA 5FYIA 3APBA 1H0BA 4ASKA 3T0BA 2A75A 4LHKA 4RR3C 2JIGA 4XF3A 1FNYA 3WNOA 5CKQA 1NXMA 2RR11 4K7JA 4XJWA 3LWCA 3AC0A 1XE7A 2Q1ZB 4LBOA 2ARXA 3VBSA 3H1MA 4QB2A 1NE4A 4LEJA 4YFWA 1IQAA 2ARAA 3SKVA 1P8JA 1QOSA 1UN1A 3GCXA 4NRPA 4BCUA 2FZ1A 4D7TA 1I5ZA 4BH9A 3ZFEA 3UKNA 1HV1A 2QNKA 5BNPB 3OBZA 5KHGA 3NMBA 1QJFA 5I0RA 3VKFC 2WRAA 5L9BA 4Y1XA 4XACA 4ET7A 5LA1A 1AJKA 1RC6A 2DF7A 4NHYA 3NNGA 2HWF1 3AYEA 3CNAA 5CKNA 1AJOA 2ZABA 3MPBA 2YYOA 2VVFA 4CCLA 2A7AA 4H7MA 5FYBA 4M3CA 5JCTA 2W95A 4AE2A 3WSOA 1MZ6A 3JXSA 4XIKA 4GALA 2WZR2 3TYJA 4DXZA 4HK8A 1LOGA 1UU5A 4P9JA 5FKCA 2XQRA 3P5BA 4GJZA 1UWWA 2VPVA 1TZOA 2OVUA 1FOD1 4JQRA 5HV0A 4Y5SA 4GMP1 2VM9A 2ZHMA 1DU3D 3ABZA 2W68A 2WNVA 3VDAA 1VBC3 2Y6HA 1AL22 4DOUA 4GIQA 2JDYA 2PELA 1WW6A 3MIBA 4YVSA 2ATFA 3OY8A 4IV3A 3OEBA 2P2KA 4XXAA 5BV6A 4IGQA 2AEYA 1XNTA 2B46X 4AHYA 5FK8A 3ZO0B 2AC1A 4DRRA 2B39A 3Q8AA 4INDA 2CSGA 1EV12 2G9ZA 3BGAA 3JZVA 2X5IC 1FI2A 4BQ4A 1MACA 2B45X 1KFUL 1LB2A 1UKGA 2P37A 4NOTA 1IG3A 4C0BA 1W06A 1LAJA 2X29A 3ZYJB 3KZ4C 2Q8DA 4RFRB 1WMXA 4HSLA 2RE9A 1SLCA 1J3RA 3I8TA 4IEPA 1Q8QA 3UYJA 4CYDA 4FFGA 2PAEA 5KHHA 4BJ0A 4XF4A 2BFUS 1ZBA1 1X50A 4XJ9A 3PIGA 4ZZ5A 1O59A 2VZTA 5JLVA 1S2BA 4XZUG 4NIGA 1HXS2 4YG3A 3SKJE 1T6BX 3J7NA 4UYBA 2VZRA 4JGZC 1ASJ3 2SBAA 3UT0A 2G4IA 3OYWB 5DAVA 5FPZA 3VZNA 1QMJA 2JDMA 1OOPC 5FZBA 1W8NA 3FHAA 4V2VA 1UU6A 1OPOA 3BTZA 3RRDA 4EZ4A 1VBE1 4P02B 3B93A 5CFDB 1CJDA 5A7QA 2VNOA 4AG4A 4XMAA 4HT1T 1PM7A 2O14A 4IE6A 4LO8A 1UZ0A 2IXJA 3DYPA 3POIA 4XC9A 1W9FA 3W9AA 2AUYA 2DURA 2YROA 2VCCA 5GLTA 2B8MA 3VBHA 5ABJA 1YQ8A 1C1FA 4XZPA 5IK5A 1K5MB 1H6YA 2KR2A 1JZ2A 1HRV1 5FP3A 3TN91 4M4RA 1ZRCA 2QQIA 3H1YA 4CCMA 3C7OA 5LBFA 5FUNA 4KBBA 5FYVA 4IE4A 3AYAA 4S2HA 4AHWA 4TTGA 4AFCA 1GR3A 5IAVA 5CFCA 4C90A 5DN2A 4QHZA 5E16A 1RMU3 3N36A 4C1WA 4LUMA 2HYXA 3J8F1 3PU8A 3CJIC 1DP0A 3OPWA 4P9IA 4GH4B 5F8PA 3ATGA 1QY4A 3GZEA 1QHDA 4JV4A 2Q1FA 2VE1A 3SH5A 1COV2 2VNRA 4ZS3A 2QQNA 1HRI1 1DQ1A 1E5IA 2R072 1VRH3 3DV8A 4XFFA 5F3EA 5FYTA 4AVBA 3A23A 3POFA 5F3IA 3VDBA 3BTYA 2BW8A 2ADDA 2W94A 3FBMA 3OCPA 4ZU7A 3WP6A 1SLIA 1XNCA 2YBKA 3ACIA 3S7IA 3RZGA 2IXCA 5KWRA 2Z5WA 3N9MA 3L2HA 5IFPA 1C5IA 1F5FA 2JX9A 2E7QA 4NIAA 4GB33 1WWYA 3G7DA 2PLV3 2XVKA 2AREA 1RUI1 2ZGOA 2G9GA 4JKKA 3WG1A 5ACA2 1OF3A 1BK0A 2VZ1A 4UF0A 3W20A 5DMYA 2HWC1 4JGYA 1KJRA 5IAXA 1W04A 2JICA 4OYUA 3IMNA 3V0AB 1W8ZA 2ZOEB 4MX3A 5KHKA 4R9DA 4ZU4A 3VBFC 1R092 5DZGA 5J3UA 3H8RA 2ZHNA 4AFMA 3BIEA 4NPLA 2XHNA 1O91A 2GMEA 4CDQC 3HMYA 3R6SA 3TB0A 2DUPA 4RR3A 2BEOA 2LRPA 3PNAA 4BU2A 2BTVC 4LIVA 1XNBA 4EWDA 4PIXA 2D93A 2HBTA 5J09A 3POYA 2MEV2 3D0JA 1EP0A 4OUSA 1AUYA 1V9U3 1KJLA 2ET7A 3SISA 2OIIA 1SCRA 1OHFA 3CQOA 4XABA 5CZKA 3VBUB 3RZHA 1WKYA 2E6VA 1ZNPA 4ITCA 1WA4A 4EWAA 5H9PA 5D21A 4DQAA 5BYNA 4CU9A 1E5HA 1NG0A 2FCUA 4WM8B 5FOBB 1RUNA 1UYXA 3DYOA 1TE1B 3RYRA 1PO21 2XB6C 1W0OA 4LQRA 4QGMA 2WQ4A 4IEWA 4R9AA 2ZAAA 1REFA 5FTTC 4BM8A 1IQDC 4CDXA 1Z0HA 1PVC3 1DIWA 1W8FA 2QJVA 1IPSA 2VZQA 5JR2A 3I2KA 2FDHA 3NRUA 1N1SA 2J1SA 2EXIA 1GANA 3D8CA 4OLLA 3VD5A 4DB5A 1XRUA 2HWB1 4Z92B 1QJX3 5JSOA 3KQ4B 4B4RA 1O4TA 3ZN6A 4XAAA 3H8UA 4KQ7A 5FYYA 2K0GA 4NO4A 4ZXKA 5SV5A 3O0XA 1QDOA 1OQ1A 1PGW2 1CAXA 1QKQA 2JDHA 3M3CA 1D4M2 5FREA 3IZOA 4MXWA 1NCQB 2WFF3 1GZCA 1YQ5A 2HWD3 1SPPB 4HKLA 1RGSA 1MQTC 2VH9A 2XDVA 5JAXA 5EJ1B 1ODNA 3KS7A 4EZHA 2X5IA 1ALYA 1S0EA 1I6XA 5J7MA 4EROA 3LQCA 2HEVF 3I4IA 5BNNB 4Q1RA 2ZGMA 3VD9A 3RWNA 2D43A 3E97A 2CU5A 1J59A 3OSDA 5FPVA 4GWJA 1I3HA 1VBA2 2Y6LA 4LO7A 5C4WA 4CEYB 4E2SA 3HPNA 1DYOA 2RS32 1O8SA 4KU7A 5FQ0A 3I2DA 5F39A 2IXIA 1G9BA 3FL7A 5IK8A 1FV3A 2WSUA 1REDA 4FPFA 4TYSA 5F3GA 4EN7B 3Q8CA 2A71A 2R0HA 3HIFA 3LFMA 4FT8A 2Q8OA 3AL6A 2YGMA 3FFQA 4A3ZA 1H8TC 5L7OB 4JGZA 4R4XA 1X7NA 4NVPA 4P9YA 1LHOA 1G7YA 1NQJA 1NT0A 1NY71 2P3KA 2ZHKA 3JBG1 1MS1A 2XR4A 1OOPA 2GNTA 1XQNA 4YW4A 2Y64A 3KF5A 3JD73 1RYYA 4Z82A 3KT7A 5FPLA 3KGZA 5F7UA 4P9GA 4FPEA 4FOVA 4I3GA 4KL1A 5IYYA 1R1ZA 1ENQA 3HBZA 2C0ZA 3LEIA 5H9RA 3AX4A 3THCA 4A6SA 2RMU3 4FCAA 4HVRA 2VGDA 4D7YA 4CPBA 3I2GA 4OCTA 2W92A 5FLHA 3M1HA 4IERA 5B2GB 3TWIA 1JBCA 3WQBA 5J98B 3RMYA 2WQZC 1ZX5A 1WW4A 4NROA 3ZXGA 4ORFA 5DDJ3 1VMHA 1GZ9A 1S0IA 3QLQA 1KS5A 4RS5C 4HETA 3M8LA 4CEWB 4IW3A 4QX7A 4RN5A 3WDUA 1OKOA 4RSUA 4MHRA 4LBQA 2GN3A 1JXNA 4Q5OA 3HBKA 5AC91 3T1LA 3H7YA 1CIWA 2J42A 4E2GA 4CDUC 4PBOA 2B9UA 5JXHA 1L7LA 5DAWA 3OPZA 4H55A 2YV8A 2YGLA 1XU2A 4YW7A 1NQDA 2RV9A 4IEXA 4RFT0 1MZEA 5FK7A 1W2UA 4QX0A 5A1LA 4UOJA 4QB1A 5FZOA 3B3QE 5T3NA 1R1A2 5T5JA 1K5MA 3D6EA 5L36A 4YM0A 5FDBA 1Y43B 1JN2P 2XL9A 1JYTA 4CP9B 5IHRA 4A7YA 1MVEA 1DFQA 3N7KA 3C7FA 4KWUA 5FRAA 1SFNA 2WS92 4QKNA 2JWPA 2WAOA 5A3NA 2B9VA 5JWPA 1IS4A 2C5DA 4Q1PA 4FPHA 5K0UC 1JW6A 3ETQA 5AFEA 1VBC1 2G9FA 1W2AX 4EN8B 1PIV3 1S2KA 3ZXFA 1CX1A 4QQHA 3I2FA 1POV0 1Y3TA 1TME3 1AR72 5K8SA 3TEXA 3VBFA 4CU6A 1IOAA 4WZFA 5EJZB 4AGGA 1JYXA 1VPHA 4CDQA 2OUJA 2WZEA 3IAQA 1OVSA 4XUQA 2I07B 4Y5Z0 3RI9A 3WQ1A 3ZFGC 1W8UA 2XBO2 2ZGUA 2JKBA 1HB3A 4MV2A 1W6PA 3SCHA 2E7TA 1FMD2 5GLWA 3GZTB 4QDQA 1CR7A 2VMGA 4QM8A 5FYCA 1UY1A 1GWKA 4PIZA 4E8DA 5IK4A 2XLFA 3OTFA 2W5FA 1YFYA 5FZMA 4KI5M 3VL8A 5IUQA 2VTXJ 4EYUA 1D2QA 2JKXA 1S4CA 5J1XA 2WO1A 1CPMA 3WG3A 5C3RA 1BZWA 1QJY1 5A80A 4Q0PA 4GKXA 4Q4V3 2NZ9A 2C4XA 1XBFA 3QH6A 4Q4X3 1U5YA 1QH7A 1HIXA 1GQPA 1OUSA 1RHI3 2E26A 2BFUL 1A3KA 4ES9A 1ZBE2 4N53B 4UT5A 1U5IA 3ZDVA 3IDBB 3SNMA 2FHRA 2X53S 2D7FA 3SCGA 2HYKA 1TEIA 1YC61 2JG9C 2JDUA 2A6VA 1UU4A 4OMCA 5FYHA 2BRTA 3T3YA 3P3NA 3POEA 1W6NA 4CZSA 2HWE3 3ECQA 3ZXLA 1XNAA 2AR6A 2NYYA 4AI2A 3NV3A 2QKDA 3AP6A 4M0HA 5T50A 3N9PA 2A5ZA 4GKYA 4LE3A 1JZ7A 1GWLA 2IVIB 4MGSA 1MQTA 1N47A 1ND2C 1DQ0A 5EJ3A 4AI9A 2HBUA 4A41A 2WL1A 1H6XA 5DG2A 3MV01 4XTPA 1XNDA 1YFWA 2Q8CA 1W90A 1RMU1 1GP5A 4RQPC 1YWKA 2ET1A 4HOOA 4D6SA 2ZBJA 1E5SA 1RIRA 1VMJA 4QQPA 1POV1 3ZYIB 4B4QA 5ABJC 2R063 4QWNA 1DGRN 1H1MA 1OLMA 5APAA 4QM9A 4UW6A 3AXDA 2A70A 4Q2FA 1D0GA 3HOBA 2D6MA 2DYCA 2ZX3A 3FJSA 4NR1A 1LODA 1RUH1 2OQ6A 4CUCA 3IAPA 3AP7A 1GNYA 4RHV3 1H8TA 3HVDA 1OURA 2VMEA 3RZZA 4QPGC 1ND3B 2ZEXA 1X36A 3WVJA 4HVQA 2JDPA 2RR12 4M01A 1D7PM 2QQUA 1W8TA 5A3WA 3LE0A 5FYZA 1UZZA 2VQ0A 1CZSA 3E5UA 3H1WA 3VN4A 4Y1YA 2D6OX 2VMFA 4IEYA 1HQWA 5C3QA 3U4XA 2Y6KA 3ILFA 3LDRA 2WO7A 2FDFA 3KD4A 4PDWB 3N7JA 2DVDA 1YYNA 2BP6A 5DUWA 1H9PA 2QBXA 1W9SA 1XE0A 2QVSB 4D8MA 4YSFA 5GZGA 2ZPXA 2QQJA 4YW5A 2HWF2 1LOFA 4RGAA 1RUF3 4QKDA 4JAAA 1LGBA 3Q8BA 3VBSC 1GKBA 1AR83 2A73B 2ZX1A 3LSEA 3HQUA 1W2TA 3CF6E 4XF0A 4ZHNA 4MG2A 3BIWE 3EO6A 1C8M3 3ZFEC 4JX0A 5DUVA 1LU1A 4XHXA 1FOD2 3PUIA 4HN0A 3LDKA 3VGIA 3M70A 3ZSKA 2D3PA 4Q27A 1POQA 3BB6A 1ZA4A 1LHWA 1V9U1 2VVDA 1LOCA 1G86A 2RDRA 3LPFA 4D6QA 1CAVB 3J4UH 2D3RA 4WM7A 2PYTA 3LOBA 4N9IA 1KS4A 2UYAA 2WNOA 2PA7A 3FHIB 1KITA 3T08A 4AVCA 2VW0A 4B3NA 5J37A 2RHPA 4PI0A 3IN9A 2O8QA 4CA9A 1UY4A 3Q8EA 1WCKA 3PMSA 4FO9A 4COWA 3ROUA 4HL0A 2ENRA 2D6KA 1AX0A 2ZS6B 5FY9A 2RM21 2WNVC 2IC1A 4LO6B 5I8SA 1H4GA 1F15A 3INAA 5EYXA 3WQ7A 2PAMA 1HKDA 4KBZA 4AEDB 2KD7A 2YFUA 3TNPB 4U36A 3K77A 2J1EA 1M06G 5HCBA 4CCNA 2ZGRA 3TEZA 1RUC3 5JSPA 3RVHA 4QAWA 2J1RA 3VZJA 4S2GA 1NAEA 1ZBA2 3ZXDA 3PTYA 3HN1A 1XOYA 1RUG1 2QQVA 3U10A 5CEHA 1OFSA 3WW3A 3ZYPA 3CZJA 3URFA 2R32A 5A1FA 1ONAA 3JCIA 1TQ5A 4A6OA 2W2IA 5FPUA 4FVVA 3M4FA 4XBNA 3ZFGA 4A2UA 4FPJA 2OZ6A 3CEWA 3RGBA 4FTSA 4BXFA 2WNUC 1JYIA 5KHIA 3EJKA 1VBE2 2VO5A 4Y20B 4F7ZA 4S2FA 3WNXA 3WLUA 1W9YA 1SHWB 2FDJA 2QZ2A 4MZUA 4XQWA 1Z7S1 3OF1A 2WUHA 3RNSA 3J7LA 4N43B 5A7WB 1Q43A 4URAA 3T09A 3GM8A 5IFTA 2YBPA 4OHVA 3PUSA 3KT4A 1DCSA 1CJPA 4XUOA 4MGYE 4FQ4A 4OQ8A 5JXJA 2A6YA 3WZ1A 2IVJA 1HRV2 4X8PA 3TN92 4QKBA 4AQ2A 4NMIA 4JDNA 4XJ8A 1K12A 1OKQA 3OGJA 1F2NA 1YCIA 4V2WA 1PO11 1LGCA 1X33A 1BHGA 2R041 3J8F2 4QDSA 3WP3A 5BY5A 3BALA 1C57A 4A7KA 5F5CA 4BQWA 5FWJA 2VTXA 3D3AA 1I9RA 1UY0A 2F17A 4P9WA 2WNEA 3B9CA 5C3SA 3OB8A 4GWMA 2YUEA 3RYPA 1HRI2 2VCAA 4O7XA 3KV9A 4BWOA 2Y6GA 4LTAA 4CXWA 5CFCC 2DCTA 3AKSA 4XBQA 3GHNA 4QXHA 1W3VA 3SLIA 5IT6A 3TEYA 2YPJA 1CESA 4QQLA 2VZOA 1J83A 1MS3A 1ND2A 5EWSA 1IS5A 3NNJA 1STMA 3ORJA 1SMVA 2FBEA 2N7GA 1YIFA 5C8CB 1AR62 4YZ4A 5FZKA 4OZXA 4RQPA 5FR3A 1RUI2 1TMF2 5FUIA 3T1MA 3B00A 4EJRA 1LCLA 2ZX4A 3DKQA 4Y22A 1AVBA 3ILNA 5D8AA 5C9AB 1UYYA 1H8VA 1W03A 3ZDSA 4D6RA 2HWC2 4XDPA 1UYPA 1JUHA 2P5BA 1VBD1 2VCMA 4N53A 1WBLA 1SLTA 1DDLA 1O5UA 2BVVA 4Y26A 1AYM1 4YFZA 1GSLA 3JB4C 2P6HA 1QGLA 2WN2A 2VCBA 2ZHLA 3X29B 2VL4A 5BPXA 4QHOA 3MF6A 3ZXJA 4ES8A 1ULEA 1EV13 5C5UA 3WDTA 1J1LA 2ZGTA 3LDBA 2VZSA 1Y7BA 2DCJA 4HFSA 5FMCA 4DFSA 2W91A 5F6KA 4PLNA 1DYPA 5FOJB 4CXYA 1LEDA 1FX5A 3MUY1 3UJQA 3VD7A 3DCQA 5EIYB 1K45A 4XFHA 1S0FA 1BBT1 4LO5B 3AP9A 1LKNA 3OUHA 2VQUA 2P6CA 4LNVA 5GALA 4BXSV 1LOBA 5LK5A 4OI0A 5DZFA 1F31A 1LOAA 2VUAA 3MV11 1JYNA 1PIV1 2GMPA 2AEZA 2EXKA 4HVOA 3NAPB 4IEVA 1F35A 5IVVA 2FQPA 1PMIA 3I59B 1DGWX 1PO22 3EBRA 4LLOA 5FWEA 3VKLA 1Q8OA 1R64A 3HR9A 4IE0A 3HT2A 3GGLA 3IIAA 1ZZ6A 1SG3A 2D3SA 3WR0A 1O3SA 1PGL1 4OHXA 3ZIWA 1Q5OA 3HD8B 3A21A 3AXEA 3GF6A 1QJU3 1UCXA 5G05L 3ZFFB 4K9SA 4BIFA 2HWB2 1G8WA 3MLJA 5LY1A 2IZWA 5LK7B 4HN1A 1WLDA 2PHUA 2VW1A 2IXLA 5FY4A 4H2AA 1R081 4KWLA 2D6NA 1GV9A 4CDXC 1HJFA 1FATA 3ASIA 3ELNA 4QB6A 1RUD1 1DF0A 2W39A 5DXDA 3AB0A 4CUGA 2NM1A 1EPZA 2ZGSA 2VQTA 1A8DA 1AXZA 1IS6A 1DQ5A 1W0PA 4FPCA 4Q4X1 2XGXA 2HLEA 1K3IA 3BPZA 1W6MA 4Z8BA 3BUCA 2JG8B 4ATEA 4QX3A 1Q8VA 4EN0A 1UZYA 3NNFA 2B5HA 2DDUA 1QNWA 2NN8A 2AGSA 4OQ9A 1W6QA 1QOOA 2BUKA 2YU1A 1PNGA 5ERLA 4K1ZA 3NKTA 3RQ0A 4DNYA 5FO8B 5BNPC 5GLZA 1COV3 2GNDA 3GHMA 3GXUA 4KGGA 4CRQA 2Y0OA 5IK7A 2O8OA 4QU2A 5J48A 4B8EA 4Q4W3 2W47A 4Q4Y1 2XUMA 4Z1VA 1ZZCA 2NP0A 2R073 1K42A 2CGNA 2V5YA 5EPAA 5FJKA 1YEWA 2EICA 1RTVA 2E7AA 3NJXA 2QZ3A 3FZ3A 4XHBA 1NY72 4YW2A 1BEV1 3JBG2 2J22A 3WDYA 5C4WC 1PZ8A 1CAUB 4JDMA 2WNUA 3ST7A 4AQTA 1CVNA 1O3TA 3AJZA 5FZ3A 1RVF1 4X6RB 2EAAA 1FPN1 2EIGA 3V0BA 4GAZA 5KXBA 4XETA 5GZDA 1AYN1 1ZZ8A 5ACA3 5LWBA 2R061 5LEKA 3I3QA 3KM5A 3W5MA 2CV6A 4GA9A 1AZDA 3NO8A 5FO7B 1SLAA 1F4HA 3AP5A 4SLIA 4LT5A 4WZCA 4J1WA 2Y8KA 1ULDA 3CJXA 1R093 1MS5A 1ZRFA 2IXKA 1Z78A 5FFOC 3BOWA 1HB2A 1NCRB 5CA6A 5FLJA 1C3HA 3E1F1 2BGCA 4MGIE 1OF4A 2I2SA 1PX4A 2NMOA 1UPIA 2JECA 3CJIB 3DUIA 3WW4A 5DG1A 2H6BA 1OH3A 5AC92 5K7PA 4AI8A 2RJ2A 1SFYA 5FAXA 4BLJA 2EAKA 5JI7A 2BOJA 1N3QA 3KCYA 3U11A 5LBCA 1AL0G 1H30A 3MHZA 4URTA 2JDKA 4Q0SA 1LEMA 2P34A 5JXGA 1UYZA 2EALA 2VZVA 2VOTA 2Y33A 5A3MA 3IDEA 3NW4A 5DUUA 3VHNA 3M3EA 4E27A 1NYWA 2B4KA 2X05A 2HEWF 1T6GC 5FPAA 2Y60A 1CAWA 4XW3A 3V64A 4JCKA 4CSWA 4GZ9A 4RA0A 2ZTNA 4AQ6A 4ZZ8A 3UNPA 4M4PA 2XJRA 2Q5TA 2WYFA 4W6YA 2C9AA 2GC2A 4P00B 5C5TA 1NLRA 5IWFA 2OZJA 2WT0A 3NNLA 5CFDC 1ENXA 5CG9A 4OUMA 2XMLA 2E31A 2XQXA 2GU9A 4CCJA 4R4ZA 1M4WA 2MHFA 1B09A 2WT1A 3FLRA 3WX5A 1VBC2 3K75B 5KXEA 3LFIA 5BNOB 2CTVA 2YMZA 3FE5A 2JJ6A 5C33A 3SH4A 1HN0A 5FZIA 3MW4A 1GMMA 1K5MC 2P3IA 5E89A 1O8PA 4P08A 2R30A 2DCZA 1PZ9A 3WG4A 4UFJA 5BNQA 1VBB2 4JRLA 3SH3A 4Z07A 2PHLA 3S5QA 5EYYA 1W6OB 2VMHA 4GH4C 2FCTA 3I3DA 1VBA3 3FHQA 2ZACA 4OHWA 4RD7A 3I2OA 4NHMA 5C8CA 4IEZA 4I30A 4AVVA 4P9LA 3RZMA 1LHNA 2DFBA 5A32B 4G9SB 5JXIA 5HCFA 1QJY2 4AVAA 2XJQA 2PMWB 3H3ZA 3SHRA 4CP2A 1VAMA 4JHZA 3H0OA 2D5FA 3PVOA 5CVRA 3AKQA 4B1MA 1QEXA 3U07A 4Y1VA 4O9EA 2RVAA 4DXSA 4Q0UA 2WWJA 5FZLA 2Z79A 1QJEA 4IE5A 5E88A 1B35B 1GQGA 4NPMA 3KGLA 1EUTA 4IV1B 2GC3A 4LITA 2QQPA 2BWAA 3OGRA 4V1PA 5JSRA 1H4HA 1UY2A 3ZPOA 4TXWA 4S2DA 4XILA 3USUA 1XSQA 3EYPA 4OMDA 4GWIA 1NLQA 3N7LA 4BK4A 4A4AA 3B01A 4XPVA 1MEC3 5TSWA 1UO9A 4YGDA 3ZYGA 2OXBA 3ZXKA 1X9TA 2XJUA 4IGOA 3MIHA 5A3PA 1RMU2 1U0AA 3O14A 3P3PA 4JC1A 4OVEA 2W52A 3KV5A 3KV6A 5I0TA 4YPJA 2TBVA 4IE7A 1SEFA 2XUEA 1LECA 1NA1B 2DWRA 2OYZA 5JMOA 4BHPA 4YGEA 2E51A 1IKPA 1AR91 1QQP1 3O7OA 4J25A 4XYXA 3T2TA 3OBRA 4LLFA 4DUWA 3AFKA 5BNPA 1GOHA 3WHUA 4I09A 3U4SA 1XYOA 1GU3A 3ZFFA 4BQ3A 5GZFA 1RUH2 1JOPA 4Z2AA 5AC93 2GP3A 4M3CE 3PURA 2P17A 2QQMA 2ZGLA 1SCSA 3WDWA 2FMYA 2X09A 4DRVA 1ULGA 1O4ZA 2GMMA 2VU9A 3W59A 1IHMA 1RUJ3 4Y3OA 3ITQA 4CVUA 4TSVA 4HK9A 1R1A3 2BYVE 3BCWA 1J3PA 2PTMA 3O5SA 3O1RA 4CDWB 3O1OA 1RUE1 3DECA 3K4AA 3S0MA 3THPA 1FV2A 2WIIB 4XJUA 5IVCA 3AMNA 3USSA 4YZ5A 5AVAA 2O1QA 3V56A 1UMHA 1CZVA 3BODA 1XJAA 3N9OA 2B42B 4QXCA 3DKWA 3ZYFA 3RZKA 4QHBA 4Y24A 1NCQC 3QBQA 4FFFA 2VXRA 3LIGA 3VBRB 1H2LA 3G6JB 3R4DB 3WF1A 2CDPA 1ZVFA 2K9ZA 2P3JA 1N1YA 4BLIA 2JEMA 4N7IA 3WV6A 4NIHA 2IUWA 2VBPA 3D82A 1LULA 4I01A 4YM2A 1AF9A 5FLIA 2ZCWA 5GM0A 3VHRA 4LBNA 5BNNC 4AEKA 4IEUA 1ULFA 4LPLA 1LOEA 3IPVB 1WD3A 2TNFA 1LOFC 1OD5A 1U5XA 5T5PA 3HNBM 1H1IA 3C2UA 4CEYC 1V9U2 2W46A 4HPKB 5FP9A 1PM4A 2WAAA 4U2AA 1F8VA 2PQSA 1V6LA 4YW6A 4NWWA 3TAYA 4C91A 2GP5A 4FXKB 3H8OA 1G9AA 3H9AA 2PXJA 1J1TA 3I2IA 1YQ2A 3UGGA 4AI3A 2OW4A 3RZJA 1UXXX 4OZOA 4ATFA 5L7OC 1OLRA 1XSRA 2R0FA 4Q29A 4YW1A 5FZ8A 1MZFA 5FZ0A 5L9RA 3C7HA 3THTA 2RM22 3AP4A 2CAUA 5FBZA 1V6MA 3OYWA 2VULA 5GLVA 1JI6A 2RS53 5JI9A 4NJ4A 4WM7C 4CP0A 2Z2SB 1ZBE3 4QPIB 1GP4A 4PHZA 4AHZA 2FDKA 5J36A 3PVNA 5CFDA 2XHKA 5FJHA 1QJU1 2J1AA 1FT9A 5F5IA 3POSA 1SDWA 1NE6A 2ZGNA 3RWKX 3H42B 4F8AA 2RDSA 3H50A 1CD3G 5A33B 3LEMA 1RUG2 1BKZA 1UY3A 2K2SA 3MFAA 3WF0A 3O1PA 4XVHA 2W1SA 5JZGB 3B94A 5JOYA 3ME2A 4AGRA 5KXCA 1ZA7A 3MO4A 4BISA 1JHNA 5A6XA 2BBVA 2J7MA 3VZMA 1IZ3A 1F5JA 1AX2A 4BMBA 2WN3A 4ZXEA 1GICA 1XXNA 4NHLA 3T2OA 1S0GA 3ACHA 3IDCB 2DU0A 3U1XA 1JH5A 3B5LB 2FD8A 4CCKA 1A78A 2HEYF 2WZPP 4CCEA 2FCVA 1Z7S2 4CEWC 1ZRIA 2A1XA 4UBGA 1YFUA 2VMIA 3SC7X 2WJSA 4GH4A 3WW2A 3OEAA 4B7EA 4JZRA 3S6PA 1IG0A 4MGZE 1REEA 5A7SA 4K8FA 5IW0A 5FXZA 4HXCA 1DBNA 2Z4FA 4HZFA 1JZ8A 3AKRA 3VZKA 4Q4W1 5ANNA 4EWEA 2GC1A 3HAGA 1JODA 4L0PA 4I2OA 4M00A 3ZSLA 1QXRA 1SDDB 2D6LX 1UOJA 1PO12 1UKRA 2XONA 3N35A 3O0VA 1IPJA 1OBNA 4Y1ZA 4LK7A 4Y1UA 3ZLIA 1BXHA 1VAKA 2Z42A 4QXKA 5JR7B 2R042 2YHJA 4A45A 4AVSA 4QX8A 5G04L 3WT3A 4J6GA 5CNAA 2GH8A 4MYEA 5CBLA 2VY0A 1JHJA 2V5DA 4N8MA 5FYUA 3TEWA 1W8WA 2BQPA 3VHPA 4LKEA 1ASJ1 4YVWB 3V0AA 1GQHA 2HWF3 2JXAA 1HQNA 4NUBA 5C3PA 4CUAA 5JVVA 3LSDA 2Q4SA 3DYMA 1MS9A 3VDDB 5FO9B 5FZ1A 5ANQA 2P1BA 5A6ZA 1XU1A 5A32A 2ORXA 1YQ6A 1HQLA 1ENSA 3QD6A 5DPNA 5FBJA 3POWA 3DF0A 3T4VA 1FOD3 2QDRA 5FCCA 2CDOA 3CHXA 3VDCA 2FZ2A 4ZY9A 3VLBB 2ZEYA 1OA2A 2XWJB 3HQXA 1RL3A 2AENA 4GMP3 4XOGA 2Z69A 4NRQA 4YGCA 4MVTA 4ZU5A 1WCUA 2C6SA 3ZSMA 4EE2A 4KU8A 4YRDA 1VBD2 4AI0A 5JIAA 3VBUA 4LKDA 3C3VA 1NUKA 1AYM2 5FZHA 3LIHA 2ZMLA 3VBOB 1B35A 2BOIA 1JZ3A 1BMV1 3FX3A 3S5AA 4WM8A 2RS13 5EHDA 1HDKA 3NWKA 5D8AC 3V65A 3W5NA 3ES4A 1PK6B 2G19A 3CBNA 4TLFA 3AMPA 3N9NA 1RXFA 5GZEA 2WABA 4DMIA 4N53C 1SLLA 2K46A 3CO2A 4QMAA 3A7QA 4GD4A 5E8AA 1D2SA 3POBA 1S0CA 4QQOA 3ES1A 3PVBB 4D94A 4DY5A 4Y5TA 1BBT2 1C5HA 1VRH1 1KDMA 3KMHA 4MADA 3AJYA 3DXUA 1Y9GA 2R1BA 3T4HB 3WOGA 5ISLA 3DPRB 4I0WB 1PIV2 5FY7A 1JOBA 3ZN5A 4HBNA 1ZBA3 4B1LA 2BWCA 1CIYA 5HPOA 5IVJA 1OT5A 1PZ7A 4LHSA 2W08A 4COZA 3SMHA 1NCQA 5A3OA 4CCDA 1Y9QA 2BNMA 2VXJA 1SPPA 3AZXA 1ODMA 4GB31 1MVQA 4UFLA 2BNOA 3JQWA 2PLV1 3RS6A 4DUVA 3WG2A 3CKHA 1G9CA 3GJAA 1PGL2 2XPJA 2UYBA 3ZFEB 1ZRRA 2WWUA 2IXHA 3DXTA 4JTOA 4XE9A 5BNNA 1VBE3 4Z2WA 1JU4A 4FOQA 2PHDA 2W9XA 2VZUA 3CIHA 4CEYA 2F4LA 2XOMA 4NAOA 1SBEA 4E4HA 2DUQA 4XF1A 4M3CB 4WVWA 1R082 2E53A 4CCCA 1U12A 2VZPA 1S0BA 3RZLA 1L7RA 1RUD2 4AQSA 3P6BA 3TN93 5L7OA 1GOGA 1QWRA 3TBDA 2XXZA 3LB9A 2VUDA 1ULPA 3LZZA 2WNVB 4KWJA 1DGRA 3J8F3 4PF1A 4YVSB 3OY8B 2W0XA 4IV3B 5FP8A 3VBRA 2WT2A 4BQ2A 1OC1A 2DCYA 3FLTA 4PDWC 3QOPA 1AXYA 5FPBA 5A1AA 4LA3A 3H7JA 4W6WA 3POGA 3NJVA 4LA2A 1URXA 4AK3A 2R1DA 3T2QA 4Q4Y2 4XUTA 2QQOA 4QDRA 2PHFA 1PVC1 3WXPA 2QQWA 1YNAA 1TG7A 4UAPA 3MFCA 5DAQA 2JB4A 4J1XA 1BEV2 1EAH3 3OBAA 3JB8A 1MEC1 1SBFA 2EF6A 2YBSA 3ILRA 4HLTA 4AEMA 2DVAA 1QJX1 1RVF2 1FPN2 1AR63 1LESA 2AZ5A 1QDCA 3J26N 2BU9A 4KH9A 4AEJA 3J7HA 4BK5A 4CEWA 3RJ2X 2WYSA 4IESA 1TMF3 1AYN2 3ON7A 2YC0A 4YLZA 1KGYA 1YIPA 2R062 2WLPA 3D0SA 4JHTA 2WFF1 5BNOC 2HWD1 4IL7A 1H1AA 3LGRA 1N3PA 4XTMA 4BQYA 1WBFA 3ENRA 1LRHA 2C1FA 2XJSA 5CB7A 3WF4A 3KB5A 4C0HA 5IATA 1YXWA 4I0BA 4UFKA 4FBFA 3UK9A 1YO8A 3WCSA 3MPPG 5FXVA 3WNNA 5I91A 1E5RA 2LW8A 2DUOA 1XYPA 2YC2A 5I8YA 4JKLA 5IVEA 3NJZA 1RUJ1 3KF3A 3UV9A 4ONUA 3CMGA 2ARBA 3OGVA 4AEDC 2RJKA 4YNIA 4CP9A 3VBHB 1U5ZA 4ZKTB 3MIEA 5ABJB 1WZXA 3BKZA 2ILMA 3N4MA 3E6DA 2W1QA 5FZFA 5FYSA 3MDPA 5FIXA 2Y6FA 1IPKA 2YU2A 2ZEZA 4DXTA 4EN9B 3BTXA 3M3OA 3MW2A 3JD71 4HKWA 3WEZA 2KA3A 1K5JA 3PJYA 1JYCA 4N90A 1PO23 3WP5A 3NV4A 3PVEA 4PF5A 3O0WA 3MLKA 1W39A 3A22A 4MHUA 3NNMA 3T0DA 2VVEA 4CPBD 3LPGA 3A4UA 3EB7A 2E33A 2V4VA 2WR9A 4FPLA 2RMU1 5F2WA 4AAPA 4EV0A 3K4DA 2YFZA 4NRMA 1X8EA 1RITA 2F4PA 2YZ4A 5B4XA 5LA9A 2JDZA 3BN6A 1O4YA 4XFBA 3GZUC 2D5HA 4AXOA 1MZ5A 1S2EA 2PHWA 2WZR3 2YY1A 3FWEA 5C71A 4YW3A 2X10A 2OKXA 1WMDA 4DS0A 2QTWB 1JYVA 4LBQD 5DDJ1 4AYUA 1O3QA 1O5LA 1XPWA 4OI4A 4E8CA 3RDIA 4LOTA 2W87A 4IEOA 1YFXA 5C6CA 1PGSA 1VE0A 3JQXA 3AKTA 1KD7A 2CL2A 3ZM8A 2WBKA 1GFF2 2RS51 4UF0B 1AL23 2GDFA 5JUVA 2JE9A 4IXLA 4JGYB 4KWKA 1G9DA 2IFWA 4YZ3A 4HMZA 3ZXEA 4Q26A 4FP3A 4YGBA 3VDDA 5BUVA 5B4NA 4AHXA 3B7MA 1UNBA 4META 5K9YA 3AMMA 3LEGA 4GQ7A 3IKWA 5FV3A 3UJOA 4BB3A 2V72A 2CHHA 3NSTA 4RR3B 2VBDA 4AFDA 1OMIA 3ACLA 1HJGA 2PHTA 2F6BA 3LF7A 3FN9A 2VNGA 1W2NA 2WWSA 4PJYA 1ULCA 3AM2A 1J58A 2OQ7A 2WFPA 5CKMA 3KV4A 4COUA 4XJAA 5T55A 1PNFA 5F2SA 2XJTA 1EY2A 3M3IA 1Y9MA 3U0ZA 3VBOA 5C8CC 1OI6A 5LASA 3WF3A 1XNKA 2DBIA 4G3YC 3NV2A 2ZA9A 4IDZA 1TME1 1YHFA 5IVBA 1OLME 4E2QA 5C9AC 1HXS3 1UF2C 1IKQA 2J1VA 4LBJA 5LZ6A 4PCRA 4R9BA 3AYDA 3IM0A 4HG6B 1IGOA 5F6LB 5AFBA 1UPSA 3N9QA 2Y34A 4CDXB 3MIFA 1UMIA 1S1AA 2ORZA 3GDBA 4FPGA 3E6BA 1QJZA 4QX1A 3T30A 3A0NA 4LBKA 3RFRA 5LCWL 1EPWA 5FZ6A 3DPRA 1ND3A 1BVVA 5LW9A 2OA2A 4ISRA 5KC5A 3ZSJA 1A6CA 3KSCA 3ZN6B 4ARXA 4DPNA 1DGWA 1PX3A 4P9XA 4XMIA 4ZS2A 1KFXL 4XQ4A 2D97A 1OFNA 2IWGB 1CAXB 3I49A 4FPOB 3FUQA 4PDWA 3ALQA 4MXWB 5IJRA 1AR92 4QPWA 1QQP2 1YUDA 4Q4V1 4XAEA 2E9QA 2EXJA 3U37A 5I0DA 1UQXA 2JDNA 2JB8A 2LUWA 2WA4A 5HCAA 1C28A 3HQRA 1RHI1 4BMEA 2X5IB 2WZ8A 3AMHA 3WNKA 2P3YA 5LA0A 2C9KA 3NAPC 5FZAA 3T2PA 2WO2A 5H9QA 4LR4A 5GLUA 2XL7A 3GZAA 3LCPA 3Q9OA 4XEZA 5FXXA 3R0RA 5C4WB 1OLQA
chains in the Genus database with same CATH topology
1VLNA 3FBYA 3IBMA 4D69A 1APNA 1TNRA 2PHXA 5CG8A 3MF9A 2ZZJA 5FQ0B 4JVAA 2HWE1 1VR3A 1RUE2 3ZFFC 5HBAA 2DV9A 4WV8A 1LJ7A 1BK1A 2EA7A 3WUDA 4IQPA 4JRAA 4FPYA 5BNOA 1CAVA 4QQ2A 4JGZB 2D40A 4L92A 2VUJA 1BJQA 1CPNA 2Q0AA 4M3CF 2GC0A 1OOPB 2LALA 5HXVA 4YM1A 4X6QB 3QH7A 2RS11 3WDVA 5E1RA 4MLOA 2B7YA 3KCCA 1ZREA 1RUOA 1FYUA 3VKNA 1S55A 2JG8C 2EVXA 1VBB3 3TRSB 4AEDA 4XFCA 3OD4A 3DGTA 1UW8A 1ZRDA 4RHV1 1N3OA 2GNBA 2ZJCA 4UBHA 3VKMA 4CP1A 5A3LA 2UURA 4R52A 3VL9A 5JOXA 2JD4A 1QJY3 5I93A 3VV1A 2GN7A 2NQYA 5DZEA 1WUVA 2MEV3 3WQ0A 2YXSA 3WHTA 4O9GA 2PFWA 4LBQB 3SCFA 2A6XA 3H3UA 1V6IA 2QCSB 3MI8A 4Y20A 1OA4A 3M7AA 4AVTA 1QJU2 4N43A 3GBFA 1RUF1 1KDKA 3PJQA 1DHKB 1AR81 4MSVA 4Y4YA 4H7LA 4BZ4A 4QX5A 2GNMA 2WKKA 1C8M1 2WINB 3TOJA 3MIGA 3VZLA 2PAKA 4QD2A 2DFCA 4YARA 1NCRC 1L3JA 3BTAA 2XLGA 2ZMNA 5JMCA 3PLQA 1YLLA 3GNEA 3KT1A 3DL3A 1DLLA 3AZYA 4FTBA 4GULA 3VBFB 4OHYA 1POV3 1D4M3 3MLLA 4CDQB 4E4SA 1VP6A 4FAGA 4NN0A 1E57A 1SBDA 3R05A 1ZZBA 5LRRA 3RSJA 3EXUA 4TWTA 2TEPA 5DUXA 1W6PB 4Q4W2 4LO4B 1RUH3 3NL1A 2QUOA 3IWZA 4COVA 2QFEA 4YM3A 4RGGA 2NPIA 1EAH1 3OJBA 3MICA 1RUC1 1GYKA 1NOVA 1QU0A 3MEPA 2RS33 3WDXA 4COYA 2DCKA 1AR61 3JU9A 1WCSA 2Y0IA 1HX6A 2UWBA 4MXVA 1TMF1 4LULA 5C9AA 3MGUA 1NXD1 1ASJ2 3R4SA 3ZMOA 1Q8SA 1WW5A 4PLMA 2OUHA 3WP4A 1LHVA 3IT8A 3LAGA 1AX1A 4LE4A 5H9SA 5JPMB 2PN5A 4FTEA 3RYKA 1CN1A 2ES3A 3E5XA 1GZWB 1BQPA 3A0KA 4WVVA 3I7DA 3ZVXA 1W6NB 5FPXA 4BA6A 4I0AA 2UY8A 4Q8LA 3CL1A 1H2NA 2XLAA 4QGNA 2ETEA 4K3UA 3ZX7A 1MQTB 4YZ1A 4Q8KA 4JDOA 3UKVA 1UIJA 1JTZX 2XH6A 4GWNA 5T5LA 1DZRA 2HJIA 1BMV2 1KQRA 2A3YA 3K48A 1VB2A 3NAPA 4HKOA 2D44A 2ZAHA 2ZX2A 1LHUA 4PLOA 3I59A 4L11A 5SV8A 1DQ2A 2JENA 2ZGPA 1V00A 2RM23 1OPMA 4TZDA 4BOWA 3N7MA 2PQQA 5GZCA 3VBUC 1OSGA 3L9JT 2VOXA 2PHRA 3AZWA 3CU7A 2ZKLA 4IEQA 4BYYA 1B35C 4WVMB 1VRH2 1VJ2A 4WM8C 4FQZA 2Y38A 1DYKA 1TNFA 1WD4A 1YI7A 2GZWA 1H8TB 4IV1C 4BMEA 2GALA 1C4RA 3AMQA 1WLCA 1RUG3 4LBLA 1F9KA 2WZR1 4PIYA 2D98A 2R6QA 3CLPA 1MR5A 2UU8A 4GB32 4B4PA 4D3WA 2PLV2 4HSJA 2A6ZA 4M0NA 4AGVA 1QH6A 4XFIA 2WS93 1GNZA 2XJVA 5F5QA 2WLQA 1VAVA 2XJPA 2JG8A 4F83A 1FXZA 4WBBA 1VIWB 1AL21 1UX6A 2NMNA 4PBPA 1Z7S3 4UXAA 3BOPA 1AR73 1NA1C 1HLCA 5I8TA 1S0DA 3LOIA 3ZMNA 2Q30A 2XBO3 1Q3EA 3WCRA 1EV11 1LR5A 1FMD3 3W58A 4HANA 4RS5B 3LKJA 3FFZA 2UWCA 3ZN4A 1PO13 1CGPA 1CAUA 1OQDA 2LTNA 3GALA 4WM7B 5L73A 2R043 4BE3A 2EXHA 4CDUB 4FP2A 2WSVA 2RJLA 4BQ1A 4CDWC 3ZIXA 1UIKA 5FMOS 3E5QA 5KHJA 2GSYA 1HXS1 2VECA 5KXDA 5D1IA 2ZZQA 3MW3A 3ZXAC 3AFGA 1PVC2 1DZTA 3GBGA 5LEJA 1X82A 1NZCA 5I0UA 1LU2A 2KXLA 3VBRC 5JIUA 1MEC2 1NCRA 4CTEA 1QJX2 4YZ2A 5K0UB 4QGLA 2AH2A 2H0VA 2XVLA 3ZSEA 4MH0E 1ZZ7A 2XKOA 3CJIA 3EQEA 4G4FA 2A3XA 2WFF2 2HWD2 3LA2A 3ZFGB 2XKPA 1WLTA 4K40A 4IETA 1VBD3 1N1VA 5BXXA 1AYM3 4KNCA 2DTWA 1CONA 3S30A 3OBTA 1WMEA 4Q0VA 1VB4A 1YRZA 2IFRA 3TNQA 1WLWA 1RUJ2 4OI2A 4QT6A 3ZPYA 2SLIA 4L97A 1NLSA 2AYHA 4QPIC 1N1TA 1COV1 1ENRA 3BU7A 4KG0A 4RL7A 4BPZA 1OQEA 1BBT3 2R071 1KXGA 3OD0A 1DQ6A 3KLSA 4PQ9A 3RMXA 1G9FA 2ZKNA 3D5OA 3QCWA 2RR13 4UW3A 5JZGC 4EN6B 3JD72 3N3HA 4A7ZA 1LTEA 2R49A 3M2MA 4K6BA 4XXPA 5CU1A 1BVP1 2JG9B 4L2NA 1WGPA 5ACA1 5EFUA 2XVGA 4QPYA 2JE7A 1UD1A 1C1LA 2RMU2 4N7UA 1VBB1 2XG3A 3AKPA 4XBLA 1W6OA 4I3PA 1DZQA 1H2MA 1R091 1ND2B 4B29A 5CADA 4UW5A 1R083 1RJ7A 2I74A 3WD5A 1SQ4A 5DDJ2 3WW1A 4XQDA 1RUD3 2R16A 1EYBA 2E63A 5JDBA 4RQPB 2MPFA 2MEV1 3WUCA 5D8AB 4Y22B 2RS52 5JPNB 1MS4A 4MUVA 2ZMKA 2CGOA 4LHNA 3E6CC 2YDEA 4XDQA 1J3QA 4XFAA 4YG0A 5T54A 4XJZA 4IV1A 1MS0A 4B7KA 3R4UA 1GZWA 2TUNA 4BIOA 4FOWA 4QPGB 5GJ6A 4GXLA 4YVWC 4XFGA 3AYCA 1D0HA 4Q4Y3 4SBVA 4N9HA 2KM2A 2QE3A 3VDDC 1Q8PA 3LA7A 1BEV3 3GBWA 2Q1MA 1KRIA 1QF3A 1QXPA 5C8WA 2QDNA 4C1XA 2MNGA 1RVF3 1FPN3 3NV1A 1X8MA 1GNHA 1DG6A 1TME2 1HV0A 3QACA 1NA1A 1O7FA 4YG6A 3B69A 1AYN3 1PGW1 4ASMB 4AW7A 1D4M1 1AXKA 3VBSB 2VOWA 4AFAA 2O0OA 1UL9A 1RB8G 1Q56A 2VOVA 1O3RA 2WA3A 3VBOC 1GLHA 4WVMA 3MZHA 2BNNA 3SXWA 2GH2A 3FC0A 1DGLA 5JOZA 1PK6C 4DINB 1VBA1 4NHKA 4JTNA 2UY9A 1H9WA 4FSJA 4L99A 2RS31 2GAUA 2CWMA 3J9SA 1C8NA 1HW5A 4CDWA 1V6OA 4Q4V2 1HRV3 3LA3A 4Q4X2 1D4VB 3DPRC 1ND3C 1RHI2 3RJRA 2DVBA 4DY3A 4P5HA 1S0JA 1W6MB 5HI0A 4NWVA 1WW7A 2A3WA 4WVZA 2FMDA 2V09A 1W6QB 4K20A 1G6NA 3EHKA 4W65A 4I02A 4OHZA 2ZGKA 1LGNA 2HWE2 4RS5A 4KGQA 5KBFA 3IPVA 1HRI3 3VKOA 1WCDJ 5T5OA 5I0SA 2A6WA 1FAYA 3SITA 4HPKA 3FLPA 3O12A 3KQRA 4CDUA 3GYDA 5F1RA 2BVBA 2WNUB 2RS12 1LENA 1YJLA 1BCXA 1RUI3 5JOWA 4FOYA 3V0BB 2ZGQA 4E4ZA 3VZOA 2VQAA 3HWJA 2Y26A 2HWC3 3WY6A 1H2KA 2CGPA 4QPIA 4YVSC 3FUOA 4IV3C 1XYNA 2H6CA 4RHV2 3AZVA 5K0UA 1IS3A 5A33A 1SACA 2CY6A 1YI9A 1PVXA 1QOTA 1ZZ9A 5JZGA 2HKXA 1AHSA 3DN7A 4AFBA 3AK0A 3D4KA 3NVCA 3RI8A 5J96B 1FNZA 1R1A1 4DZGA 4D7SA 1VALA 1QXJA 1OA3A 4YYOA 4R8HA 2WS91 2VW2A 4AWDA 5EZWA 1QNYA 5L19A 2DU1A 5CFCB 1V6JA 5LRSA 1RUF2 3B02A 1AR71 4AF9A 4AI1A 2V73A 1AR82 2DTYA 2I45A 3K51A 3VUOA 1UAIA 2VG9A 1CAWB 1DQ4A 2XBO1 3PHMA 2WC2A 1C8M2 1ZM1A 2OPKA 4LHLA 4NPRA 5CAZA 1FMD1 4FXGB 1V70A 3AZZA 1WMFA 3UL2A 1MS8A 2DVFA 1BYHA 4N43C 2HWB3 2ZX0A 4R9CA 3VHOA 4E4DX 1UMZA 2X8KA 4FPKA 2H0BA 5F9TA 4K1YA 4Q0QA 2CNAA 5EV7A 4OFGA 2VOKA 2CYFA 4MGKE 3MYXA 3VBHC 5ABJC 4H14A 2JG9A 4X8NA 4H3WA 1AR93 3WINE 1QQP3 3I54A 4K21A 4FAHA 2CAVA 4YVWA 5KC6A 3RPQA 3OGGA 3S7EA 1CQ9A 1ZYBA 5FMOL 1ZBE1 4LBMA 1A8MA 1CX4A 4LUKA 1V6NA 3PMEA 1EAH2 1RUC2 3L2YA 2CWSA 2DVGA 2ERFA 5EXOA 4KG8A 1JOJA 3RG0A 4GMP0 1GBGA 1RUE3 3FMGA 2NLRA 2LM3A 1RJ8A 2XWBB 2UWAA 4XF9A 5AVPA 3MIDA 4L8QA 3ZYRA 1JUIA 4OULA 2D6PA 3UKTA 3JBG3 2BPA2 3B9IA 1XE8A 4ISQA 5GKAC 1RINA 4UW4A 4QPGA 1PK6A 1I1EA 4P14A 3M3QA 4L9BA 3KCXA 5T52A 4JGYC 1PHMA 4W6XA 3USUB 4ASLA 5CIRA 4OI1A 4E9KA 4A3XA 4F3JA 1YJKA 3HT1A 1V6KA 3NKGA 4XIOA 3JUUA 1SLBA 3APBA 1H0BA 2A75A 4LHKA 4RR3C 4XF3A 1FNYA 1NXMA 2RR11 4K7JA 4XJWA 3LWCA 1XE7A 2Q1ZB 4LBOA 2ARXA 3VBSA 3H1MA 1NE4A 4LEJA 4YFWA 1IQAA 1QOSA 1UN1A 4BCUA 4D7TA 2FZ1A 1I5ZA 4BH9A 3ZFEA 3UKNA 1HV1A 2QNKA 5BNPB 5KHGA 5I0RA 3VKFC 4Y1XA 1AJKA 1RC6A 2DF7A 2HWF1 3AYEA 3CNAA 1AJOA 2ZABA 3MPBA 2YYOA 2VVFA 2A7AA 4H7MA 5JCTA 4M3CA 4AE2A 5C4WB 1MZ6A 4XIKA 3TYJA 4GALA 2WZR2 4DXZA 4HK8A 1LOGA 1UU5A 4P9JA 2VPVA 2OVUA 1FOD1 4JQRA 4GMP1 2ZHMA 1DU3D 2W68A 2WNVA 1VBC3 4DOUA 1AL22 2PELA 1WW6A 3MIBA 4YVSA 2ATFA 3OY8A 4IV3A 2P2KA 4XXAA 5BV6A 2B46X 4AHYA 3ZO0B 4DRRA 2B39A 4INDA 1EV12 3JZVA 2X5IC 1FI2A 1MACA 2B45X 1KFUL 1LB2A 1UKGA 2P37A 4NOTA 4C0BA 2X29A 3ZYJB 3KZ4C 4HSLA 2RE9A 1SLCA 1J3RA 3I8TA 4IEPA 1Q8QA 4CYDA 2PAEA 5KHHA 4XF4A 2BFUS 1ZBA1 1X50A 4XJ9A 5JLVA 1S2BA 1HXS2 4YG3A 4JGZC 1ASJ3 2SBAA 2G4IA 3OYWB 5FPZA 3VZNA 1QMJA 1OOPC 1UU6A 1OPOA 3RRDA 1VBE1 3B93A 5CFDB 1CJDA 2VNOA 4AG4A 4XMAA 4HT1T 1PM7A 4LO8A 2IXJA 3W9AA 2AUYA 2DURA 2YROA 5GLTA 2B8MA 3VBHA 5ABJA 1C1FA 4XZPA 5IK5A 1K5MB 1HRV1 3TN91 1ZRCA 3H1YA 4KBBA 4AHWA 3AYAA 4S2HA 4AFCA 1GR3A 5CFCA 4C90A 5E16A 1RMU3 3N36A 4C1WA 4LUMA 3J8F1 3CJIC 4P9IA 4GH4B 3ATGA 1QY4A 1QHDA 4JV4A 3SH5A 1COV2 2VNRA 1HRI1 1DQ1A 2R072 1VRH3 3DV8A 4XFFA 4AVBA 2BW8A 3FBMA 3OCPA 4ZU7A 3WP6A 1SLIA 1XNCA 3S7IA 2IXCA 5KWRA 2Z5WA 3L2HA 1C5IA 1F5FA 2JX9A 2E7QA 4GB33 3G7DA 2PLV3 2XVKA 2AREA 1RUI1 2ZGOA 2G9GA 3WG1A 5ACA2 2HWC1 4JGYA 1KJRA 2JICA 3IMNA 3V0AB 2ZOEB 4MX3A 5KHKA 4R9DA 4ZU4A 3VBFC 1R092 5DZGA 5J3UA 2ZHNA 4AFMA 1O91A 2GMEA 4CDQC 3HMYA 3R6SA 3TB0A 2DUPA 4RR3A 2BEOA 3PNAA 2BTVC 1XNBA 4EWDA 4PIXA 2D93A 5J09A 3POYA 2MEV2 3D0JA 1EP0A 4OUSA 1AUYA 1V9U3 1KJLA 2ET7A 3SISA 2OIIA 1SCRA 1OHFA 3VBUB 2E6VA 1ZNPA 4ITCA 1WA4A 4EWAA 5H9PA 4DQAA 5BYNA 1NG0A 4WM8B 5FOBB 1RUNA 1TE1B 3RYRA 1PO21 2XB6C 1W0OA 4QGMA 2WQ4A 4IEWA 4R9AA 2ZAAA 1REFA 5FTTC 4BM8A 4CDXA 1PVC3 1DIWA 1Z0HA 2QJVA 1N1SA 2EXIA 1GANA 3D8CA 4OLLA 4DB5A 1XRUA 2HWB1 4Z92B 1QJX3 5JSOA 4B4RA 1O4TA 3ZN6A 3H8UA 4KQ7A 2K0GA 4NO4A 4ZXKA 5SV5A 3O0XA 1QDOA 1OQ1A 1PGW2 1CAXA 1QKQA 3M3CA 1D4M2 5FREA 4MXWA 1NCQB 2WFF3 1GZCA 2HWD3 4HKLA 1RGSA 1MQTC 2VH9A 5JAXA 3KS7A 2X5IA 1ALYA 1S0EA 1I6XA 5J7MA 4EROA 2HEVF 3I4IA 5BNNB 4Q1RA 2ZGMA 3RWNA 2D43A 3E97A 1J59A 1I3HA 1VBA2 5C4WA 4LO7A 4CEYB 4E2SA 2RS32 4KU7A 5FQ0A 3I2DA 1G9BA 2IXIA 5IK8A 1FV3A 2WSUA 1REDA 4FPFA 4TYSA 4EN7B 4FT8A 2A71A 2R0HA 3HIFA 2Q8OA 2YGMA 3FFQA 1H8TC 5L7OB 4JGZA 4R4XA 1X7NA 4NVPA 4P9YA 1LHOA 1G7YA 1NQJA 1NY71 2P3KA 2ZHKA 3JBG1 4FPJA 1MS1A 4GIQA 1OOPA 2GNTA 1XQNA 4YW4A 3JD73 4Z82A 3KT7A 3KGZA 4P9GA 4FPEA 4FOVA 4I3GA 4KL1A 1R1ZA 1ENQA 3HBZA 2C0ZA 5H9RA 3AX4A 2RMU3 4FCAA 4HVRA 2VGDA 4D7YA 5FLHA 3M1HA 4IERA 5B2GB 3TWIA 1JBCA 5J98B 3RMYA 2WQZC 1ZX5A 1WW4A 3ZXGA 4ORFA 5DDJ3 1GZ9A 1S0IA 3QLQA 1KS5A 4RS5C 4HETA 3M8LA 4CEWB 3WDUA 4RSUA 4LBQA 2GN3A 1JXNA 5AC91 3T1LA 3H7YA 1CIWA 4E2GA 4CDUC 4PBOA 2B9UA 3OPZA 4H55A 2YV8A 2YGLA 1XU2A 1NQDA 4IEXA 4RFT0 1MZEA 1W2UA 3B3QE 5T3NA 1R1A2 5T5JA 1K5MA 3D6EA 5L36A 4YM0A 5FDBA 1Y43B 1JN2P 2XL9A 4A7YA 1MVEA 1DFQA 3N7KA 5FRAA 1SFNA 2WS92 5JWPA 1IS4A 2C5DA 4Q1PA 4FPHA 5K0UC 1JW6A 3ETQA 5AFEA 1VBC1 2G9FA 4EN8B 1PIV3 1S2KA 3ZXFA 4QQHA 1POV0 1Y3TA 1TME3 1AR72 5K8SA 3VBFA 1IOAA 4WZFA 4AGGA 4CDQA 2OUJA 3WQ1A 3ZFGC 4Y5Z0 2I07B 3RI9A 2XBO2 2ZGUA 2JKBA 4MV2A 1W6PA 3SCHA 2E7TA 1FMD2 5GLWA 3GZTB 1CR7A 2VMGA 4QM8A 4PIZA 5IK4A 2XLFA 3OTFA 1YFYA 3VL8A 5IUQA 1D2QA 1CPMA 3WG3A 1BZWA 1QJY1 4Q0PA 4GKXA 4Q4V3 2NZ9A 3QH6A 4Q4X3 1U5YA 1QH7A 1HIXA 1RHI3 2BFUL 1A3KA 4ES9A 1ZBE2 4N53B 1U5IA 3IDBB 3SNMA 2FHRA 2X53S 2D7FA 3SCGA 2HYKA 1TEIA 2JG9C 2A6VA 1UU4A 3P3NA 1W6NA 4CZSA 2HWE3 3ECQA 3ZXLA 2AR6A 2NYYA 4AI2A 3NV3A 2QKDA 3AP6A 4M0HA 5T50A 4LE3A 2A5ZA 4GKYA 1MQTA 1N47A 1ND2C 1DQ0A 5EJ3A 2WL1A 5DG2A 4XTPA 1XNDA 1YFWA 1RMU1 4RQPC 1YWKA 2ET1A 2ZBJA 4QQPA 1RIRA 3ZYIB 4B4QA 1POV1 2R063 1DGRN 1H1MA 4QM9A 4UW6A 3AXDA 2A70A 4Q2FA 1D0GA 2D6MA 2DYCA 2ZX3A 3FJSA 4NR1A 1LODA 1RUH1 3AP7A 4RHV3 1H8TA 3RZZA 4QPGC 1ND3B 4HVQA 1X36A 3WVJA 2RR12 4M01A 1UZZA 2VQ0A 3E5UA 3H1WA 3VN4A 4Y1YA 2D6OX 4IEYA 1HQWA 3U4XA 3ILFA 3KD4A 4PDWB 3N7JA 2DVDA 1YYNA 5DUWA 1H9PA 2QVSB 4YSFA 5GZGA 2ZPXA 4YW5A 2HWF2 1LOFA 4RGAA 1RUF3 4JAAA 1LGBA 3VBSC 1GKBA 1AR83 2A73B 2ZX1A 3LSEA 3CF6E 4XF0A 3BIWE 3EO6A 1C8M3 3ZFEC 5DUVA 1LU1A 4XHXA 1FOD2 4HN0A 3VGIA 3M70A 3ZSKA 2D3PA 4Q27A 3BB6A 1ZA4A 1LHWA 1V9U1 2VVDA 1LOCA 1G86A 5BNOB 1CAVB 3J4UH 2D3RA 4WM7A 2PYTA 3LOBA 4N9IA 2UYAA 1KS4A 3FHIB 2PA7A 1KITA 4AVCA 2VW0A 4B3NA 5J37A 2RHPA 3IN9A 2O8QA 1WCKA 3PMSA 4FO9A 4COWA 3ROUA 4HL0A 2ENRA 2D6KA 1AX0A 2ZS6B 2RM21 2WNVC 2IC1A 4LO6B 5I8SA 1H4GA 3INAA 5EYXA 3WQ7A 2PAMA 1HKDA 4AEDB 3TNPB 4U36A 1M06G 5HCBA 2ZGRA 1RUC3 5JSPA 3VZJA 4S2GA 1ZBA2 3ZXDA 3PTYA 3HN1A 1RUG1