3VBHC

Crystal structure of formaldehyde treated human enterovirus 71 (space group r32)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbhC00
4RS5C 2HWB1 1RUC1 4PDWC 4RR3C 1VBC2 1K5MB 1PIV2 2X5IB 2RM21 1RB8G 1PO22 3LOBA 1AYM1 1AR61 2XPJA 4JGYA 4CDUB 1AR62 1D4M3 4Q4X3 5C8CB 1RVF1 3FBMA 1F8VA 1AL21 5L7OC 2HWC2 2BFUL 1RUJ3 1AL22 4YVSC 2X5IA 4CDXB 2WZR2 4Z92B 5CFCC 1RHI3 5A33B 5ACA1 5C4WB 1R083 2WLPA 1QJU2 2RS11 5BNOA 2GH8A 3ZFGB 4NWVA 3CJIA 1NG0A 3VBFA 2HWF1 3TN91 1MQTA 1AUYA 4GMP1 5GKAC 1EV11 1Z7S1 4Q4Y3 2XBO2 2WFF1 1Z7S2 2RS31 5FMOL 1RUI3 3NAPB 4WM7B 1NCRB 2RR12 1TMF1 1K5MC 2HWE3 5CFDC 2HWD1 2FZ1A 3JB8A 2RS12 1H8TB 4Q4X2 1RUC2 1HXS2 4QPIA 5C8CC 4CDXA 5C4WA 4AEDC 4Q4V2 1QJY3 1RUF2 1RUH1 2R061 4CEWC 2R073 1AYM2 1D4M1 4BCUA 4JGZB 1RVF3 3ZFEA 4N53C 1VBE3 2HWE2 4IV1A 4N43C 4RHV2 4AEDB 3VBSA 1RUG1 1HXS3 1ZBA1 5A33A 3NAPA 1ND3A 1ZBA2 1WCDJ 3J8F2 3ZXAC 3IDEA 5JZGC 1VBE1 1A6CA 3ZFGC 1B35B 1W39A 1Z7S3 1MEC1 4GMP3 1AR82 4YVWB 3DPRB 1EV12 4Q4Y1 1NY72 1AYN1 4FSJA 1ND3B 1BBT2 1AYN2 1NCRC 1PO12 1QJX1 1PVC1 1TME2 1MEC3 1PIV1 1VBB2 1M06G 2GSYA 1QJY1 2HWD3 4EJRA 2RMU1 1V9U2 2RM23 1AR83 4IV1B 1V9U1 1X36A 4RQPA 4RR3B 5BNNB 4SBVA 2HWB3 1PO13 2VQ0A 2BUKA 5BNOB 1C8M1 1RUH2 1RUF1 4RFT0 4CDQA 1C8NA 1R1A1 3ZFFB 1ZBA3 1RUE3 1VAKA 4YVSB 1PO21 1QQP3 3JBG1 1GFF2 1HRV3 1NCRA 1CD3G 1RUC3 1OPOA 1PGW2 5ABJC 2PLV2 4JGYB 2WFF2 4GB31 4QPGA 1BEV2 1RUE2 5AC93 1RMU2 2RS33 1IHMA 1TMF2 3ZFGA 5J98B 1FPN1 5JZGA 1VBD3 3VBFB 2HWD2 4Q4Y2 5A32B 1BMV1 3JBG2 1ND3C 4QPGC 3NAPC 2RS52 1BMV2 5ABJA 1RUD3 2RS51 1BBT1 3ZFEB 1NA1B 3TN92 1X33A 3VBSC 5AC92 1NOVA 2HWF2 1E57A 1RMU3 1ASJ3 5L7OB 4IV1C 1TMF3 3ZFEC 4GB32 1BEV1 1R091 5J96B 4CEWA 4CDQC 2RS53 2RR11 1C8M3 4AEDA 1EV13 1VRH1 4CDXC 2IZWA 1FMD3 4RHV3 5CFDA 5ACA2 1VBA2 4RQPC 1K5MA 1RUJ1 4GMP0 1RUJ2 2BFUS 2RR13 3J8F3 1DDLA 2HWC3 4Y5Z0 1AR72 1QJU3 3S6PA 1FOD3 3VBFC 1R082 1AL0G 5CFDB 3TN93 1AYM3 5K0UB 3VBSB 1VBE2 1VB2A 2WS91 1HRI2 5FMOS 3VBUB 1TME3 1F2NA 1AR81 2X5IC 4YVSA 1V9U3 1R081 1AR92 4N43A 4N53A 4RHV1 2WS93 1VRH3 4PDWA 1RUG2 4Q4V3 1FMD1 1RUF3 4RS5A 5C4WC 2BPA2 5C8CA 4QPIC 1HRV1 2QQPA 2ZTNA 2R041 5JZGB 4CDWC 1RUE1 3VBHC 1NCQB 4QPGB 1ZBE3 5D8AB 1QJZA 2WFF3 1FPN2 2WZR3 1COV1 2RM22 4PDWB 1VBD1 1RHI2 1VBD2 1MQTC 3VBRA 5AC91 3VBUC 1RUH3 5ACA3 4N53B 4N43B 3CJIC 1OOPA 3JBG3 4FTBA 1COV3 1VBC3 1FPN3 5BNOC 3HAGA 1R092 2R063 1PVC3 1NA1A 1HRI1 1POV1 3JD73 5C9AC 3CJIB 1VBB3 5CFCA 1CJDA 4RQPB 5BNNA 1NY71 4Q4W3 3VDDA 4Q4X1 1RUI2 1B35C 5L7OA 4CDUA 1RUI1 5DDJ3 1R093 2R062 2R043 3VBOA 4CDWB 3DPRC 4JGYC 2RS32 1FMD2 4RS5B 4RR3A 4WM7C 2HWC1 1PGL1 5FOJB 2DF7A 2BBVA 2FZ2A 5DDJ2 1SMVA 5D8AC 3J8F1 4YVWC 1VBA1 4GH4C 3VBOB 1POV0 2WWSA 4GH4B 1AL23 4JGZC 5K0UC 1ND2B 1AR71 4NWWA 4CEWB 1OHFA 1OOPB 2XBO1 3JB4C 2PLV1 2ZZQA 1PO11 5K0UA 4JGZA 1HQNA 1RUD1 1HRI3 1POV3 1RUD2 3JD71 2R072 1VBB1 4CEYC 3VBRB 4Q4W1 4GH4A 1AR73 1QJU1 4YVWA 1MEC2 4WM8A 2WS92 2HWF3 3ZFFC 2MEV1 1ND2A 5D8AA 1ASJ2 3VBHB 1AR93 1NCQC 1QJX3 2MEV2 4Q4V1 5BNPB 1FOD2 4GB33 1C8M2 1VB4A 1EAH3 4WM7A 4IV3A 2RMU3 2HWB2 4QPIB 2TBVA 1R1A2 5BNPC 1PVC2 1H8TA 3JD72 3DPRA 1H8TC 3VDDB 2R071 2HWE1 1MQTB 1VBA3 3VBOC 5BNPA 1PGL2 1QJY2 4IV3C 4Q4W2 4CDUC 1B35A 3VDDC 1RVF2 1PGW1 5BNNC 1ASJ1 1NCQA 1BBT3 1QQP2 1HXS1 1ND2C 1HRV2 1ZBE1 4IV3B 3ZFFA 4CDQB 1PO23 1QQP1 5LK7B 4WM8C 2WZR1 2XBO3 5C9AA 1RMU1 1NA1C 1D4M2 4CEYA 1HX6A 1COV2 1BEV3 1RUG3 1OOPC 4WM8B 2PLV3 4LLFA 2ZAHA 3VBUA 3VBRC 5CFCB 1RHI1 2RS13 5C9AB 1TME1 1VBC1 1QJX2 2MEV3 4CEYB 1AR91 4FTSA 2Y26A 1EAH2 1ZBE2 1EAH1 2RMU2 1PIV3 4FTEA 5A32A 1R1A3 3VBHA 3M8LA 1AR63 4Y4YA 5ABJB 1FOD1 1AYN3 2R042 1VRH2 4CDWA 5DDJ1
chains in the Genus database with same CATH superfamily
2QZ2A 4YLZA 5CVRA 4A6OA 4OI4A 2HWB1 4LBQA 3VZOA 1LU1A 2VE1A 3L2YA 4XIKA 5C6CA 1LEDA 1NQJA 1PVXA 1VBC2 3HQUA 4GA9A 4AGVA 2XL9A 2X5IB 1RB8G 4ZXEA 4A4AA 3LOBA 1DZTA 1ZX5A 3A22A 3J9SA 3RG0A 2GNTA 1W0NA 3OF1A 1AR62 5HXMA 1D4M3 2DU1A 1V0AA 2WR9A 3HBZA 3A7QA 1RVF1 2UURA 4C1WA 5CB7A 4DUVA 3WQ0A 3LEGA 3PVNA 3UGGA 2HWC2 3O12A 1AL22 2X5IA 3AM2A 4N90A 3FLTA 1RITA 2DBIA 2Z2SB 1JYTA 5CFCC 5F5CA 3ACGA 3RWNA 2VOVA 1DYKA 2Y8KA 4K40A 3GHMA 2BVBA 3ZSEA 1R083 1ULDA 2ZKNA 2Q4SA 5FZFA 1W03A 3J26N 5CNAA 4AYUA 3AZVA 2RS11 3GGLA 3OB8A 3IZOA 1PK6B 1KD7A 3CJIA 4XABA 3DYPA 3WDUA 2DTYA 2P2KA 3POBA 2HH9A 3ACHA 5EWSA 3VZLA 3TN91 2ZGNA 1HV0A 2CYFA 3KV6A 1FAYA 2J7MA 1GR3A 2IFWA 2V4AA 1FV3A 1PK6C 2VUJA 1DP0A 1Z7S1 3HJRA 5GLWA 5KXCA 1A34A 2HKXA 2WFF1 3LEIA 5A6ZA 2F4PA 1RUI3 1OD5A 3KVAA 3NAPB 4GD4A 2DVFA 5FMOL 4AVAA 5A70A 3QCWA 5FY1A 2E9QA 1WMEA 1C5HA 4D7YA 4E27A 4EV0A 4AZZA 4CP9B 1TQ5A 4A41A 3RZJA 4Y24A 4KU7A 5T50A 5A6YA 4Q4X2 3SH4A 3CL1A 2TNFA 1RL3A 5FKCA 4PHZA 3VD4A 5C8CC 1UMIA 5T54A 4NO4A 5FYVA 4V2WA 3I3DA 3MFCA 2R061 1OMIA 2XGXA 4HXCA 2R073 2BZDA 1S4CA 3MW3A 1DG6A 4Q2FA 3T3YA 4AXOA 1NYWA 3B93A 5KC6A 1IS6A 4HKOA 4MH0E 2OT7A 4JGZB 4S2FA 4ASLA 3HNYM 4NHYA 3OY8B 3NNMA 4U2AA 3AZWA 1CAXB 5FZLA 3B69A 1N1SA 4RHV2 3VL8A 4AEDB 4BJ0A 1CZSA 4NIDA 1D0GA 1N1YA 5DXDA 3WDWA 4N9HA 1LOCA 2BTVC 4PIYA 4FAHA 3ZIXA 1CPNA 1GQPA 4CCEA 4DIQA 3SHRA 4GKYA 2Y6KA 3K2OA 2FDKA 5A33A 3NAPA 3ES4A 5HV0A 3J8F2 4G3YC 4WVZA 2W08A 2B45X 1OURA 2BNMA 2CAVA 3IDEA 5FZMA 4WZFA 2Q8OA 1JH5A 1JOPA 2JDUA 3O0WA 2Q30A 1W39A 2AYHA 2IXHA 2K2SA 2LUWA 1MEC1 4OCTA 1UAIA 3ZYFA 5IVYA 3UETA 1US3A 4CCMA 1APNA 3POEA 1I5PA 2ENRA 5IATA 2PAMA 4LHKA 2JICA 2OW4A 2VQTA 4HETA 2W94A 2VZ3A 4PF5A 3GBFA 4MV2A 4FSJA 1PO12 1BBT2 1NCRC 2P37A 5IYYA 1QJX1 3W58A 1XNCA 4BQ3A 2ZZJA 5JOXA 1MEC3 5DAQA 1ZVFA 5F6LB 3UNPA 4PT6A 3ZYHA 1U5ZA 4OLLA 2XXZA 4COZA 1M06G 2GSYA 3PUSA 5GZFA 3T09A 2OS2A 3HIFA 5CU1A 1XE8A 3JXSA 3L2HA 1AR83 5F2SA 5JOZA 1FX5A 1UX7A 3GBWA 5LA0A 3RWKX 3O1PA 4RQPA 1DQ1A 4UW5A 2ZMNA 1ZZCA 2LRPA 1OUXA 4AEJA 3OEBA 3NWKA 5FBJA 1UY4A 3MICA 1RUF1 1WBLA 2ZHKA 3M3EA 1JI6A 2A7AA 3HEIA 1J58A 1ZBA3 3CO2A 1RUE3 4F8AA 2NPIA 2FDJA 5EQUA 5FR3A 2VOXA 2Q0AA 1W8OA 4FXGB 1RYYA 2IUWA 1QDCA 1RC6A 3EYPA 3Q8CA 1NCRA 1ZA4A 3ETPA 4FPCA 4ZPIA 1CD3G 3WXPA 2PHUA 3MW4A 1UN1A 2BV4A 1OPOA 2QZ3A 4FFIA 2XQXA 2PLV2 4JGYB 3H8RA 4GB31 5IVBA 5DZGA 2G9FA 4Q29A 3TEXA 2RG4A 3VD9A 2PELA 5CIRA 5JPMB 4A3ZA 1D2QA 3K48A 3FHQA 2DURA 1IHMA 4JAAA 4MGZE 4URTA 4P5YA 4Y20A 5JZGA 3WW3A 4L11A 3ATGA 2X53S 2G19A 4B29A 2HWD2 2PAEA 4INDA 5A32B 3LEMA 2ZMKA 5EZWA 3VL9A 3O1UA 2P34A 3NAPC 4D94A 2E33A 1DQ2A 2RS51 2WNUC 4K8FA 3K75B 4NIIA 3TN92 1ZZBA 1KEXA 3WF4A 4EN7B 2WZEA 1CAUB 3EO6A 1AXYA 4IE7A 1E57A 1E5HA 3U78A 4D7SA 1ASJ3 1NLRA 5LK5A 1TMF3 2PHFA 3KLSA 1BEV1 2YROA 4K3UA 2X8KA 3DECA 2Z79A 1AHSA 4IEWA 1N1VA 4IE6A 3JZVA 2YC4A 3AZYA 4A45A 1C8M3 3DKQA 1HW5A 2UYAA 4XCAA 1Q8PA 2ATFA 2ES3A 3OGSA 1NLSA 3BTAA 2WC2A 5DN2A 4Z1VA 4LUMA 2O8QA 3ILNA 2YBKA 1FMD3 2A6WA 3FMGA 3N36A 4PF1A 1CIWA 4UXAA 4CUBA 1JHJA 4B7KA 2Y38A 4P9XA 1JZ7A 4RQPC 2RHPA 1SLIA 4GMP0 5KHKA 2JIGA 1C57A 2QUOA 4XJAA 4JTNA 3BPSA 3WCRA 1H2KA 1UU6A 4Y5Z0 3M7AA 4MGKE 1HKDA 1F5JA 2RE9A 4YARA 4Q1RA 3VZKA 4G4FA 2JB4A 4AE2A 4CXWA 5J36A 1YFUA 4XFIA 1KFUL 4COYA 2Z69A 3S6PA 2JXAA 3BUCA 3VBFC 4MGYE 1AL0G 3A0NA 2ZACA 5CFDB 1GKBA 4YM2A 4DXSA 3TN93 4J6GA 2DCTA 3PLQA 5EJ1B 1AYM3 5C3QA 1K3IA 5K0UB 2ZGOA 3VBSB 1UOGA 4HT1T 4FCAA 4IETA 5GLUA 2ZX2A 2D7FA 1JYCA 4KI5M 1ULPA 1YFXA 2VNGA 3AMQA 1XRUA 3Q8FA 4XFGA 4AFBA 4L92A 4LLOA 1URXA 4NPLA 2WS91 1HRI2 1YQ6A 5C3SA 5FRAA 1F2NA 2BEOA 2WT1A 3K3OA 1OLMA 3WDVA 3ZDSA 2PHLA 4NRMA 5FO9B 2D3PA 1YRZA 4F83A 3WG2A 4FO9A 5FMDA 2AC1A 1U5IA 3RGBA 4QU1A 1I5ZA 2EIDA 4HSLA 1VAVA 2OVUA 1GNYA 1XOYA 1R081 3BODA 4OI2A 1Y7BA 5DZEA 4AHYA 2ARBA 3R0RA 4CA9A 1C3HA 2XLGA 3KT4A 4BWOA 1ZRCA 1VRH3 4KG8A 3W9AA 2VZTA 4M3CB 1XE0A 1WMFA 5F3GA 3UJOA 3MGUA 3EB7A 1QOSA 3CBNA 3H1MA 1BQPA 2BWAA 3PTYA 1RUOA 4JDMA 1AF9A 2BPA2 2E7AA 3H3ZA 5TSWA 1JHNA 1FV2A 1W0OA 1HRV1 2R1BA 5A7WA 2VXRA 2A3YA 2VZOA 4LJHA 4MVTA 4QKNA 3UJQA 4CDWC 5J37A 3EQEA 4QX1A 3T4VA 1RUE1 4DINB 3AMMA 4CCJA 1O3RA 2ETEA 3DGTA 4QGNA 1H9WA 2Z4FA 1MS8A 4BQYA 2WFF3 1FPN2 4MLOA 1OKQA 1SFYA 1COV1 2R0HA 4GZ9A 3BOPA 4R9CA 5FXVA 5HCBA 2G9GA 2JEMA 2LTNA 3UESA 1PK6A 4TN7A 4V1PA 2JG9A 1X8MA 5FLIA 1W0PA 3LSEA 1VBD2 3CNAA 2BNNA 2HYKA 5AC91 3HN1A 2ADEA 3LD8A 5I93A 4LA3A 4MGTA 1X9TA 1W3XA 2QJVA 3HT1A 3HAGA 4NR1A 2D6LX 1ODNA 2GZWA 3ZN6B 3ZSJA 5K9YA 4JKLA 5C9AC 1WMXA 5FY4A 1H4HA 4OZOA 2WUHA 3LDKA 5I0SA 2OUJA 1CJDA 4UFHA 1J59A 3ZOIA 4CUGA 1SDDB 5JSRA 2VCBA 3OTFA 3ZN6A 1UZWA 5DQ0A 5JXGA 3ZMOA 1LENA 4L9BA 4BQWA 2HEWF 4HPKA 3T2QA 5FK7A 3DPRC 5A7QA 2RS32 1DQ5A 4H3WA 1QIQA 1FMD2 3EHKA 4MX3A 4QDSA 4RS5B 4DXZA 4RR3A 3LIGA 4H14A 4I0WB 3U07A 4RD7A 2D6PA 2ERFA 4S2DA 3WNKA 5FOJB 2FZ2A 1U0AA 1ZZ7A 5E6HA 4COWA 4BPZA 1SMVA 2BQPA 3KWVA 4PLNA 4KWLA 1X9PA 2WRAA 5CKMA 5J7MA 3VBOB 4RGKA 4HBNA 2J42A 3BB6A 4PIXA 1POV0 2FCVA 5FPLA 3FC0A 2WN3A 3GBGA 4Q1PA 5EJZB 2EXHA 2WAOA 4HONA 1GLHA 1YYNA 2D44A 3M1HA 4KWJA 5CG9A 3AKPA 2FCTA 2IXIA 3I2KA 5FY0A 5T5OA 1XNKA 1DLCA 2I74A 4B1MA 2ZOEB 2JD4A 2PLV1 1BVVA 2CGOA 3ZKYA 5K0UA 3IDCB 3WY6A 1FNYA 1OPMA 4K8RB 1POV3 4ATEA 3AVRA 3ZYIB 1W6MB 4I3GA 4A7ZA 3LPGA 2VECA 1Y4WA 3GF6A 4P9WA 4LHLA 2J1RA 5DAVA 3I2FA 2CL2A 4BYYA 5C3RA 4IEXA 3S5AA 1AR73 4YVWA 3AK0A 5JVVA 4WM8A 4GIQA 3U37A 4IE5A 2VNOA 2WS92 2HWF3 4LITA 3ZFFC 3ZYJB 4OI0A 2MEV1 1ND2A 4NPRA 2AZ5A 4XFAA 1AR93 4AR2A 1QJX3 2XKOA 1FOD2 5JXHA 3AZXA 4V2VA 3B02A 3UKNA 5F3CA 3O0VA 2DCZA 2QDNA 1OA2A 3W21A 3ZKUA 3BKZA 1GZTA 4XUQA 2IXCA 1FXZA 5B4NA 4D6SA 5FJKA 5AVPA 5LY2A 5C33A 5JMCA 1WW4A 2TBVA 1O5UA 4S2HA 4IUGA 1SLTA 1PVC2 3LA7A 3WG3A 1IPSA 5F5QA 2HWE1 3G6JB 4L2NA 2W95A 3NJYA 5GZEA 3KV5A 1PGL2 3P3PA 4MHUA 1HQLA 4QT6A 2VM9A 4XJ9A 5A7WB 1W6OA 2LS6A 1CAWA 3PMEA 3GZAA 3RPQA 3T30A 4TLFA 4Q4W2 4C1XA 3ZXJA 4DUXA 5E1RA 1I1EA 4LO4B 4B4QA 1PGW1 1GP5A 1XQNA 4AL9A 5BNNC 1SFNA 4K1ZA 4XTPA 3R6SA 1ND2C 1HRV2 3ZFFA 4L99A 4WM8C 1S0BA 4PBOA 4MADA 1CIYA 4KQ7A 2H0VA 1NA1C 2J1UA 2EXKA 3GZUC 1UWWA 2ZEZA 5FMBA 3C7FA 4Q8LA 1COV2 2DBNA 2JG9B 3WCSA 4DO0A 1PMJX 4LUKA 4XACA 4IE4A 4M3CE 4LLFA 4P9YA 5FY7A 3VBUA 3THTA 4Y4RA 1WZXA 3F95A 2QQMA 2RS13 4QM9A 1IKPA 1TME1 3VHNA 4Y1YA 1K45A 5FYIA 3NNFA 2WA3A 4XMIA 3PHMA 2ZCWA 1CAUA 5LA2A 1VR3A 4FTSA 4LORA 4M4RA 4X8NA 3RQ0A 2VU9A 5HI0A 4NIGA 2WNVB 3CLPA 3K4ZA 3UGHA 4MXWA 4IXLA 5I0DA 3Q8AA 3MHZA 1KDKA 3SCGA 5EP9A 1JZ3A 3VBHA 2BU9A 3VZNA 2DCJA 5E89A 1G9BA 1AR63 2GNBA 1AYN3 3LF7A 4MO3M 4LIUA 5FV3A 1CX4A 5EFUA 4AEMA 4PLOA 5KR7A 4IGQA 4RS5C 1SLCA 2QVSB 4E2QA 3RZZA 1RUC1 1LCLA 5LEJA 3ALQA 1LOAA 5LBFA 4PDWC 2WINB 4PBPA 4RR3C 4CCCA 4CP1A 5KHHA 1PIV2 4LKDA 3AP4A 1ENRA 2RM21 5F32A 4JX0A 1UQXA 5FXZA 1AYM1 3VGIA 2D43A 1MPXA 2XPJA 1VMFA 1REEA 4JGYA 3OSDA 4A44A 4CE8A 1Z0HA 1GQHA 2CHHA 4Q4X3 1PM4A 5C8CB 5KWRA 2YMZA 3DCQA 1IGOA 3I3QA 1YHFA 2BFUL 5FPXA 4BIOA 5F9TA 1GUIA 1QKQA 1BVP1 4YGDA 3T0BA 5D21A 4YZ5A 4PIZA 3S5QA 4Z92B 1L3JA 4LXLA 3MV01 4QQPA 2GN3A 5ACA1 1SBDA 2HEVF 3AXDA 3IM0A 2OZ6A 4AI1A 5AFEA 3HOBA 4FPYA 1QJU2 4NJ4A 4P14A 4TTGA 5JPNB 3ZYBA 1SG3A 2NQYA 5SV8A 4GXLA 3P6BA 3C7OA 3RI9A 3OYWA 1SLBA 4RN5A 2HWF1 5EYYA 1E5IA 3CKHA 1AUYA 3ILFA 5GKAC 3WG1A 2DCKA 4LBQD 5FY8A 4P9JA 3AB0A 3ZXEA 4DPNA 1UIKA 4CYDA 2FCUA 5I8YA 2P3JA 3POSA 2PHXA 1WUVA 1LAJA 4OHZA 2DYCA 4QX3A 4LMFA 4NN0A 5HXVA 2JKXA 3K46A 2F4LA 1EY2A 2XJVA 4EQVA 1MZ5A 1QH7A 4AQTA 4QPWA 5CFDC 2JDKA 1CONA 3JB8A 2RS12 1W8FA 4GWMA 2B8MA 4B8EA 5F6KA 3FZ3A 1BHGA 4MXWB 5KXBA 1S0FA 5DUXA 2JG8A 4CDXA 1QJY3 3N35A 1LULA 4KGQA 4XBNA 1Q8VA 4CEWC 4GULA 3PURA 2WT0A 1D4M1 5CKNA 4GAZA 5J3UA 4DS0A 2G4IA 4JQTA 4Q8KA 2A71A 2FDHA 3ZFEA 2BNOA 2OX0A 2HWE2 3KCCA 2PHTA 3O1SA 3JQXA 4XF3A 3MLKA 5IVCA 3CU7A 5BY5A 2AACA 3VBSA 2CDOA 2R1DA 4JZRA 1D4VB 4AVCA 3FUOA 1GZ9A 2VZUA 2JJ6A 1ZBA1 2JDYA 5JOYA 1WCDJ 3ZXAC 3P5BA 2PHWA 2WYFA 3V65A 5D2AA 4ASKA 4HVOA 4G9SB 2H6BA 5AFBA 5ERLA 3ZFGC 1B35B 2DDUA 3O5SA 2GP3A 1DFQA 4ES9A 3T1LA 2PQQA 2UU8A 4ARXA 4UT5A 2ET1A 4GMP3 3EMRA 2ZABA 4YVWB 2ZBJA 3MPBA 3ZPOA 1EV12 3I8TA 4Q4Y1 4I0BA 4QQ2A 4PJYA 3R4DB 4K7JA 1AX2A 2VQAA 1AYN2 4GWJA 2R6QA 2R32A 1JZ5A 4XQ4A 1TME2 2LM3A 4UBGA 4OZXA 2XHKA 1XYOA 1MZEA 1WW5A 2FHRA 1Q5OA 2YBPA 2HWD3 4ATFA 5FYTA 4EJRA 1OQEA 2CDPA 2WABA 2RM23 4IV1B 1GV9A 4OHYA 1V9U1 1X36A 1JW6A 1SCSA 1KJRA 3ABZA 4RR3B 1DGLA 1DGWA 1D7PM 5CZKA 5FUNA 5FLHA 2X09A 1MVQA 5FK8A 4X6RB 1PO13 3S57A 2EVXA 3LGRA 2BUKA 5BNOB 1LU2A 1RUH2 4LO5B 2ZEYA 1YNAA 2O14A 2OPWA 4EN6B 1YQ8A 2QQKA 1C8NA 5DZFA 3OD0A 3ZFFB 1O7FA 1VMJA 3DYMA 4AVVA 2GNMA 4UWDA 4Z2WA 1O3QA 4R52A 1JBCA 4OULA 2DTWA 4W65A 4EN9B 1H1MA 3ZLIA 1C1LA 3FWEA 4YW7A 1HRV3 4OFGA 1HN1A 2Q1MA 5FP7A 5CEHA 3O1RA 3HNMA 4KMQA 1PGW2 5FY5A 2VNVA 5ABJC 4XETA 2VW0A 2WFF2 2VUDA 4CU7A 2VC9A 3FFZA 3RNSA 4PI0A 3VDCA 2W47A 1OXCA 5FDBA 1MS0A 1XYNA 5HCAA 1K5JA 4UW4A 1HB2A 1N47A 4XF0A 4FPEA 4JCKA 4ES8A 1GSLA 1NT0A 3APBA 4EWDA 1VBD3 2W91A 1YQCA 2TEPA 4YG3A 4XVHA 3NKTA 3FLRA 5JI7A 1WLCA 3JCIA 3MIFA 4YM1A 1ND3C 4XXPA 3WP4A 4AW7A 2VY0A 4A3XA 1BMV2 1YFWA 2YDEA 3WR0A 2NMOA 4XDPA 2L9LA 3B00A 1NA1B 2VMIA 1ACCA 1EYBA 2FBEA 2R16A 1SACA 2HWF2 4UFIA 4J1XA 4TXWA 1HJFA 1CZVA 1ZA7A 1OT5A 1QOTA 2DFBA 4IV1C 2Q1FA 5BV6A 4GB32 4BQXA 4CCLA 1OVSA 1DLLA 2AEYA 1LRHA 4YYOA 1R091 3QBQA 2LALA 2B9UA 2DV9A 4EN0A 2ARXA 3OY8A 3MIHA 4AEDA 3AJZA 4ZKTB 4IEVA 4OI1A 4C0HA 3I3MA 2W68A 4XOGA 2WZPP 3WX5A 2GNDA 2QFEA 3NJXA 3MLJA 1YI9A 1ZREA 1DQ4A 3V0BB 5FREA 3TRSB 1GBGA 1XC6A 3SNMA 1GICA 3OCPA 2BJSA 1W9FA 2PXJA 2NYYA 2WZ8A 4DZGA 1GOFA 3DXUA 1RUJ2 3SKJE 2BOIA 2RR13 4LNVA 1U5YA 1HN0A 4YFWA 2VD7A 4YW2A 3SEEA 3V56A 4FFFA 4E4HA 1NQDA 1PZ7A 2W52A 3I7DA 2BOJA 1LOEA 5A3PA 3I97A 4KWKA 1FOD3 4H55A 2YY1A 2XLFA 5CAZA 2KXLA 4XFBA 5T5JA 5DUUA 2XMLA 4AI8A 5FLJA 5L73A 5A6XA 1LB2A 2K0GA 4HG6B 3WF2A 5B2GB 1DIWA 1NUKA 1W6NA 2H6CA 5IK5A 1G9DA 3E6DA 1DQ0A 1ODMA 4FI9A 1WLDA 4XURA 1JTZX 5FMOS 1H2LA 3OBRA 3LWCA 4YVSA 4OHXA 1GWMA 1UU5A 3IMNA 1W6PB 3WF3A 5I0TA 5A1FA 2E7QA 5FUIA 1C5IA 2BDRA 5FPUA 1WKYA 3E6BA 1AR92 2ZAAA 4N43A 1CJPA 4N53A 1W6QA 2YFZA 2WS93 3H42B 4JDNA 4RHV1 5FXXA 4QQHA 3NNLA 5GJ6A 4YG6A 2GC1A 5FZOB 5LASA 3W5NA 3PUHA 4IERA 5C8WA 4YM0A 3DF0A 4K21A 3IMMA 4Q4V3 2VL4A 3OJBA 4LBOA 5C8CA 2DVGA 4P9GA 2QKDA 3LCPA 4ZS2A 4JKKA 3ZR5A 4NRQA 3O1MA 2B4KA 5CKQA 4Q0SA 2UYBA 4FXKB 3WQ7A 2JDZA 4O9GA 1NCQB 1RJ8A 1H8VA 4IEPA 3O1TA 2JENA 4PQQA 1ZBE3 5D8AB 3ACFA 4CRQA 4GKXA 2WZR3 1V6KA 4NMIA 4LKEA 3AZZA 5C3PA 4JRAA 4EWEA 3TNQA 3H3UA 4KNCA 3GALA 4XUOA 4GWIA 5IT6A 4BK5A 4CTEA 1BK0A 3VBRA 2X05A 3UGFA 1QOOA 5ACA3 4N53B 1TG7A 4N43B 3CJIC 3SISA 1VE0A 3U11A 4FTBA 2Y6LA 1FPN3 2QQWA 2R063 3RYKA 1LHUA 3C7EA 3JD73 2NP0A 5C3OA 4IDZA 3RZMA 1PX4A 1GMMA 4A6SA 3CZJA 1P8JA 2GALA 2QQLA 2Y0IA 3KGZA 4UAPA 1VBB3 5FZIA 4DNYA 5CFCA 5DAWA 4RQPB 4YM3A 5LCWL 2O0OA 4UOJA 5KBFA 4TSVA 1RUI2 1B35C 1EUUA 5LA9A 1VIWB 4Y5SA 5C70A 3BTXA 1UKGA 1OI6A 4I01A 3KB5A 2BW8A 1NAEA 4IGPA 2NN8A 2R043 2WLQA 2XVGA 4MXVA 4QD2A 4YNIA 4ZS3A 3U4SA 4CDWB 2OYZA 4AQ2A 4NIHA 1S2BA 3HPNA 1YIPA 4HLTA 1F31A 3FHAA 4RGAA 4UFKA 2E26A 4DRRA 3CDZB 4YZ1A 1UZ0A 2VQUA 2YGMA 4XUNA 5A1LA 5JOWA 3WHTA 2EF6A 3I3EA 1BKZA 1NZCA 1SZBA 3OGJA 4WM7C 5DG2A 3NL1A 1R1ZA 2D3SA 2VPVA 1S2EA 3P3NA 2UY9A 2DF7A 1Y9MA 4MGIE 4XQWA 3NW4A 4BK4A 1LHWA 1BZWA 3H7YA 4NHLA 4AFMA 2W46A 4CUCA 4XJUA 3CQOA 4COUA 1YI7A 4QX5A 1M4WA 4JKMA 2D93A 4GH4C 4HSJA 1JS9A 3OYWB 3PJQA 4C0BA 1O8PA 1VRBA 3NMBA 4I3PA 4RFRB 4XYXA 3A4UA 3V0AB 1ST8A 4AQSA 2IFRA 3I2HA 3KF5A 1LESA 2BGPA 4GH4B 2XWJB 1SHWB 1XBFA 2GH2A 3WQ1A 3VDAA 3IB3A 4AGRA 1WCSA 4KWUA 2W1UA 3GCXA 3AKSA 3O1OA 1UPSA 4CEWB 2NLRA 4UFLA 1LECA 3H1YA 4IL7A 2OQ6A 1RUD1 4HKLA 1QNYA 4JGZA 2YHJA 3PIGA 1HRI3 4ZU5A 4XPVA 5GZCA 2EXIA 2R072 2Z5WA 1PZ8A 3RYRA 3BN6A 1POQA 1VBB1 1LHOA 4CEYC 1H6YA 3AMPA 2C0ZA 3N7MA 2JG8B 1WCKA 4FPKA 4TLGA 3VBRB 1ALYA 4B1LA 4BMEA 2XKPA 3R4UA 1MS5A 4IW3A 1W6PA 4XXAA 2OKXA 2AUYA 1DGRA 1XYPA 4C91A 1MS3A 3C2UA 5FQ0A 5FWJA 5G05L 4DEVA 3PVEA 2E63A 3KHBA 2HLEA 2BGCA 2GMMA 1C8M2 2W39A 2ZXQA 4IEQA 4WM7A 4IV3A 4XEZA 4FFHA 1VMHA 2RMU3 2HWB2 1MZFA 4UFJA 1R1A2 5BNPC 2ZGMA 4QX0A 5FP9A 5ANNA 1V6IA 1GWKA 4LOTA 2WL1A 1H8TC 3ZPYA 3ACLA 3QH7A 3WDTA 2XB6C 1QJY2 4XQDA 4TYSA 4LULA 3KVBA 3S7EA 2C9KA 3HNBM 4Y1VA 1AXZA 1UKRA 4CDUC 4YFZA 1B35A 1PNGA 1WLTA 3NNJA 4RGGA 1RVF2 4XE9A 4D0QA 3IBMA 2BBAA 5K8SA 3PL0A 1NCQA 1JZ4A 2NM1A 3GM8A 1QQP2 2GC0A 1HXS1 1ZBE1 2N7GA 4FOYA 4A42A 4E8DA 1QY4A 3WEZA 5JUVA 5FZGA 1YJLA 5LK7B 3J7LA 1X82A 3M3QA 2QQVA 1N3OA 3J7NA 2RJ2A 1ZZ6A 5GALA 3WW2A 3QD6A 4Q26A 3SH5A 1IPKA 1KXGA 2YC2A 3E5XA 1OOPC 1H30A 1LR5A 2KM2A 1W90A 2PLV3 3A23A 3HWJA 2HJIA 5F1RA 5IVEA 2VGDA 2X29A 1J3RA 2P4EA 2ZX0A 5BNQA 1SPPB 1QNWA 1W2OA 3K51A 4MSVA 3RS6A 1GOHA 3V0AA 1W6MA 3MDPA 2MEV3 3DN7A 3NVCA 2ZGRA 1EAH2 3LOIA 3ZYPA 3C7HA 4UBHA 3VD5A 1JZ2A 2RMU2 3RSJA 4Y1XA 1PIV3 1T6BX 4M0NA 4FTEA 1R1A3 1Y3TA 3LA2A 3VZJA 3UL2A 5L36A 4XHBA 1I9RA 4WVMA 5ABJB 1DGWX 1LOBA 1B09A 3AP6A 1VRH2 1CN1A 3PU3A 4A2UA 5FZ4A 1LKNA 1EUTA 2WJSA 1RIRA 3BGAA 1NKGA 3INAA 5C5UA 5DMYA 1WWYA 3ZSKA 4YW3A 3SH3A 3FL7A 4HK9A 5FMCA 2ID4A 4YZ2A 2C6SA 3FN9A 4MHRA 4F3JA 1YJKA 3I2JA 2GMEA 1REFA 1AR61 1TNFA 2VMCA 4CDUB 2YXSA 4JC1A 1JN2P 2XH6A 2W5FA 4LO7A 5IK4A 4H2AA 2JIJA 5K4LA 4AVBA 3FBMA 5FP3A 4D69A 1GZWB 1F8VA 1HB1A 2VVEA 1JUIA 1IQAA 4Q0QA 1AL21 3M4FA 2XUEA 4IEOA 1WA6X 3THDA 1RUJ3 4JVAA 4R9DA 1Q3EA 2W0XA 3C3VA 1MS1A 2WZR2 4E4ZA 2V72A 4ZY9A 1RHI3 2P6CA 2WSUA 1UF2C 4LHNA 5C5TA 4LE4A 4LBJA 5C7GA 5C4WB 3POYA 4B4PA 1IOAA 5FUPA 2FMYA 1UXXX 2XUMA 3DL3A 3H8OA 2YUEA 4OMCA 4YW5A 2GH8A 1WCUA 3MIBA 3OPTA 1XXNA 1W3VA 3SQOA 2DUQA 3LFIA 1ZRFA 3WNMA 1MQTA 5A7NA 4GMP1 3BU0A 2IWGB 1O4TA 2WNVA 1LGCA 4N7IA 4Q4Y3 1Z7S2 2RJKA 2RS31 4CDQA 2E6VA 3CZUA 3KZ4C 1NCRB 2BYVE 4JQRA 2GC2A 3AC0A 1TMF1 3KMHA 2XVKA 4N7UA 1K5MC 5T55A 3PUAA 3M3OA 2CGNA 2HWE3 1Q8OA 2A70A 2ZX1A 1S0IA 4P02B 5A3WA 3O7OA 3OPWA 1H8TB 2O1QA 1WW6A 3LAGA 1IG3A 1CESA 1D0HA 1QWRA 1QXPA 1YWKA 2D6MA 2GMPA 4Y1ZA 5C4WA 1RINA 3ZYRA 4AEDC 4XW3A 1RUF2 2GP5A 1Y9GA 3WV6A 2K9ZA 3M2MA 4AQ6A 4BCUA 3USUA 4IQPA 1PGSA 2XQRA 2A6ZA 5FYSA 3VKFC 3SMHA 3ZO0B 1YIFA 2PN5A 3GDBA 3ZXLA 4S2GA 2PYTA 2Y60A 2WBKA 2ZKLA 3HN3A 3KT7A 1RUG1 2VMDA 5AVAA 3IAQA 3W59A 1N3QA 2AREA 1OQDA 5EIYB 1ND3A 4C90A 2YGLA 1SQ4A 2VO5A 3I59B 2PFWA 1VBE1 2CSGA 4FVVA 4CPBA 3BU7A 3C8XA 4XAAA 4HK8A 3U14A 1AVBA 4I09A 3RZGA 4OVEA 4DQAA 4E8CA 1X8EA 3OBAA 1OC1A 4ZZ8A 1WMDA 5IK8A 2A6VA 3DPRB 1N3PA 1VPHA 1W2TA 2D97A 4XDOA 3IKWA 4Z8BA 2FDFA 2RDRA 2W3JA 4CP0A 3WF1A 1ZRRA 3CHXA 4QPYA 1W2UA 4KBZA 5JXJA 1PVC1 1W9TA 3BTZA 2OA2A 3E5QA 1PIV1 1VBB2 1HJGA 5F7UA 1OA3A 5JAXA 1WLWA 3AYDA 2IXKA 1HB4A 4UW3A 1VP6A 2RMU1 2TUNA 3PJYA 5ANQA 4EE2A 4F7ZA 4CU8A 3IAPA 5FZCA 3PU8A 3MI8A 3OBZA 4QB1A 3LIHA 2B46X 4SBVA 3SXWA 5BNNB 1LOFC 1XPWA 5GZGA 2HEYF 5DUWA 3PMSA 2HWB3 2FD8A 2WDBA 5APAA 2VMHA 3ELNA 5FO7B 2VBDA 1C8M1 5EV7A 1H2MA 4J1WA 3OGGA 2WA4A 1Y9QA 3IPVB 4QMAA 5JXIA 3BTYA 3ZXKA 2VMEA 4JDOA 4N8MA 1R1A1 3N7LA 1F4AA 1BLZA 3FE5A 3PVOA 1DZQA 2A3XA 1UXZA 3JBG1 4XTMA 2KR2A 4DY3A 4XJWA 5FYCA 3ZXGA 1AX0A 2ZEWA 3SCHA 5EPAA 1U12A 3WD5A 2VW2A 3HR9A 3N9QA 1RUC3 4MGSA 4AAXA 2QQIA 4LQRA 4WVVA 5A7SA 4QPGA 4LK6A 3GNEA 2ZHMA 2HYXA 5AC93 1YEWA 3ACIA 1AZDA 5FZ9A 1UIJA 5FCCA 4YPJA 2PHRA 2RS33 1ULOA 2VCAA 5J98B 3FJSA 2O8OA 2AENA 4XUPA 5A3LA 3M3IA 3USSA 2XJRA 4B7EA 1IS4A 4K6BA 4QPGC 2RS52 5FFOC 1W2AX 4WVMB 1BBT1 4O7XA 2JECA 2C4XA 3ZVXA 1X33A 1SCRA 1UZZA 2VAUA 4B4RA 4HFSA 4Q5OA 4AOCA 5L7OB 2XG3A 4GQ7A 4DEQA 4AI3A 2JDNA 1S1AA 2KD7A 3N4MA 4P9LA 1V6LA 3Q8EA 2QBXA 4FT8A 1WD3A 4D6QA 1UZVA 5J96B 1HQWA 5LRRA 2BWCA 1MS4A 3K3NA 1JMUB 5F39A 4LO6B 3WW4A 1EV13 1O4ZA 1VRH1 2WO2A 1J84A 2JG8C 4CDXC 2VCMA 2Q8DA 2BRTA 2WNOA 3MO4A 4LKFA 4YRDA 4D3WA 5IHRA 2LW8A 1UYZA 3QACA 1CAXA 2G9ZA 2WYSA 3W20A 1GNHA 2JE9A 4DMIA 2V5YA 5ACA2 1R64A 3USUB 1VBA2 3FFQA 5DAXA 1W9SA 1K5MA 3ZIWA 3E6CC 3MF9A 2C5DA 3S7IA 5KXDA 2BFUS 3RVHA 4CU9A 1UL9A 1ONAA 5FPAA 3MIGA 2D5FA 2IC1A 2E31A 3VKNA 4XMAA 1YUDA 3WNNA 2C24A 2VXJA 1AR72 4LBNA 1JOJA 1IS5A 3UK9A 2WNVC 3EJKA 4N9IA 3F2ZA 3ZR6A 2B7YA 2RVAA 1SLLA 1UOJA 1ULFA 1NE6A 1QJU3 4NAOA 4AWDA 5JSPA 2VOTA 3GXUA 1W8TA 4QXBA 3HMYA 3QOPA 2CGPA 1UYXA 5IAXA 4EZ4A 4QXCA 4EZHA 1H0BA 5C71A 2R7EB 5EJ3A 5FWEA 2JDHA 1UCXA 5J1XA 2V4VA 5F2WA 1TZOA 1XU2A 2WO1A 4FOQA 3VKLA 2ZEXA 2D98A 1OFNA 2C1FA 2DWRA 3KQ4B 3WZ1A 5IFTA 1VBE2 3VB9A 1VB2A 2OUHA 2Q1ZB 3SCFA 2XJPA 3MFAA 2JE8A 5HBAA 1IZ3A 2A6YA 4XHXA 3ROUA 1KS4A 2R0FA 4UF0B 2QNKA 1BXHA 4BH9A 1V9U3 3UV9A 2W92A 1S0CA 4XBLA 5FZ6A 3I2IA 5I0RA 1C28A 1I3HA 1IG0A 1NXD1 1QH6A 2ZGUA 2ZJCA 2PHDA 2VW1A 4K20A 3U0ZA 2Y34A 3KM5A 5F3IA 5A80A 1SBEA 3POWA 4FPJA 5T5PA 5CBLA 3O1VA 2HBUA 3O14A 1JYWA 3D4KA 1UX6A 2VH9A 3TEWA 3AL5A 4PDWA 2V73A 3HT2A 4BZ4A 1FMD1 3AYEA 3NV4A 4XJ8A 4AI0A 5DAPA 1RUF3 3ECQA 1VLNA 4H7MA 1CWPA 1HLCA 3ORJA 4QPIC 2VTXA 4OHVA 2ZTNA 2R041 5JZGB 2OZJA 2A5ZA 4QDRA 5JI9A 1DF0A 2MPFA 4RSUA 2KA3A 4W8JA 5LW9A 4AHXA 3POFA 3VBHC 4YGCA 4BQ4A 1S0DA 4CU6A 1W04A 1Y43B 2BGOA 1SPPA 1GQGA 2IVJA 4BDVB 4CVUA 3T1MA 1TE1B 3TOJA 2VR4A 1KITA 2WFPA 1S2KA 4JTOA 1GANA 3VHPA 5L9VA 1VBD1 4AFCA 5BXXA 5F3EA 3THCA 1EPZA 1G9CA 3CIHA 4R4XA 4YGBA 1KJLA 5FPZA 4BXFA 1SEFA 1MQTC 3KD4A 3B9CA 3VBUC 1RUH3 2R30A 3NKGA 3AJYA 4QX2A 1XJAA 5EHDA 4DUWA 1OOPA 2GU9A 4KGGA 5IFPA 5BNOC 3I3BA 4FPHA 3RJ2X 1R092 2VVDA 3MUY1 1HRI1 1CQ9A 3D8CA 3MZHA 3GCWA 3N9PA 3BI3A 2VZ1A 2FDIA 3WP3A 2QTWB 3JU9A 4YW6A 2UWCA 2XJTA 5JR2A 3SITA 4E4DX 5L7OA 1A8DA 4CDUA 3J4UH 1ZM1A 1UD1A 2EIGA 2P6HA 3KGLA 2YFUA 4ITCA 4XUTA 1R093 3H9AA 1F4HA 3UKVA 3ZX7A 2V09A 4QXHA 1MZ6A 1CAVB 3AP5A 1Q43A 4PLMA 3BPZA 3MW2A 2F6BA 2PA7A 4C8DA 5CA6A 3B01A 4P9IA 1CX1A 3VKOA 1WW7A 1UZYA 1PGL1 1Q56A 2B9VA 5JLVA 3PNAA 2DUPA 1UY0A 5DDJ2 1DHKB 1RTVA 4Y5TA 4DXTA 2XOMA 4KBBA 4KH9A 4RL7A 4YVWC 1VBA1 2CY6A 3MBWA 4ISRA 1D2SA 3WINE 3FBYA 5GLTA 1JYVA 2Y33A 2DCYA 5GLZA 3ME2A 2WIIB 2CTVA 2CWMA 2VZQA 2ZMLA 1GP6A 2RJLA 4L0PA 1F35A 4ISQA 3T4HB 3G7DA 3ZDVA 2J1TA 3KSCA 4JGZC 5DG1A 5K0UC 1ZNPA 4UI9L 4D6RA 1AR71 2PMWB 4FFGA 4XDQA 5FP8A 3ZM8A 1UY2A 5J48A 2XBO1 1Q8QA 3OD4A 3JB4C 5HV4A 5L9BA 2B5HA 3UKTA 3JD71 4XZUG 1G8WA 4AF9A 5H9SA 3C7GA 1S0JA 3ES1A 3I54A 4M01A 2UWBA 1F15A 4UF0A 3W5MA 1UMHA 4GH4A 3DYOA 1MEC2 3SLIA 1PHMA 4BMBA 4LBMA 1QXRA 3TEZA 5SV5A 1ASJ2 2ZX4A 1NCQC 2MEV2 2XWBB 4Q4V1 3ZSMA 4GB33 1K42A 4P00B 3LKJA 1JYIA 4JV4A 4BQ1A 2W87A 1VB4A 1O59A 4NUBA 1LOGA 3H7JA 2A6XA 1RXGA 2E32A 4ZONA 3WUDA 1XSQA 1YXWA 3LDRA 4HL0A 4AVTA 4QPIB 2XJUA 3MEPA 2P17A 3K4DA 2E53A 4FQ4A 2DFCA 4AHWA 1S55A 3H1WA 2R071 5CISA 1VBA3 5L19A 3FUQA 2EAKA 1OA4A 4Y1UA 4IV3C 5FQ0B 3ZYGA 2WO7A 3KV9A 4DOUA 1DQ6A 1MR5A 2QQUA 1JODA 3V64A 5IVJA 4CCOA 1W8UA 3AL6A 2VVFA 4HANA 5LZ6A 4IV3B 1XNBA 2W1WA 3X29B 4NOTA 3UT0A 4LHSA 5BYNA 2XBO3 3WNLA 5C9AA 4FPLA 4OQ9A 1RMU1 5LRSA 2JX9A 3J7HA 1YO8A 4IESA 3U10A 5IW0A 3MYXA 1HX6A 1BEV3 4U36A 4YSFA 4SLIA 3VUOA 4RYDA 4WM8B 4WBBA 2E7TA 1IPJA 5I91A 2A73B 5A7OA 4O61A 3HBKA 3VBRC 3WNPA 5CFCB 4GJZA 1LHNA 3AKQA 4QQOA 5C9AB 4GALA 2JG9C 3GZTB 2PQSA 5HCFA 1VBC1 3I4IA 1UY1A 1AR91 3LB9A 4Q0PA 1SFPA 1QDOA 2RDQA 2LROA 3AFKA 3H8UA 4Q27A 1ZBE2 3N7KA 2Q5TA 1NE4A 3OEAA 5FKBA 3D5OA 3OPZA 5DUVA 1UMZA 3N9NA 3IN9A 1MVEA 4YW4A 3WP5A 4CCDA 4DXRA 3EXUA 5A6QA 3WVJA 2PAKA 4Y4YA 1FOD1 1W2NA 4WV8A 3OOXA 1O91A 1W8ZA 2XL7A 3WDYA 4CP9A 3WOGA 3D6EA 2OPKA 2A1XA 4OMDA 4FQZA 4KU8A 2G1MA 1A3KA 4L8QA 3CJXA 2W1QA 3TBDA 2CNAA 1KQRA 1C4RA 1DYPA 1K5MB 4LKSA 3M3CA 1UOBA 4EYUA 1PO22 1QU0A 1DGRN 4R9BA 1DU3D 5A7PA 1OQ1A 5LEKA 1BK1A 1L7LA 1H9PA 2ZHNA 3WG4A 5FYHA 1UU4A 2J22A 3QH6A 3AMHA 2W9XA 4Y22A 1L7RA 5GZDA 3GYDA 5L7OC 1SDWA 3WUCA 2W2IA 2VUAA 4YVSC 1RJ7A 2P3YA 4CDXB 3MV11 4Z82A 2WNEA 2JDAA 4UW6A 3RZKA 1CZTA 5A33B 4NROA 3VD3A 3KCYA 4Y3OA 5D1IA 1H2NA 2WLPA 1CPMA 1LHVA 3CEWA 2ZS6B 4RA0A 2Q8CA 5BNOA 3ZXFA 3A21A 2ZHLA 4XIOA 1W9YA 5E88A 3ZFGB 4CCKA 4NWVA 3URFA 2ADDA 1NG0A 1OBNA 4UYBA 1E5SA 5F5AA 3VBFA 4OUEA 2QQOA 3AXEA 2IVIB 4COVA 1EV11 3ITQA 2QDRA 1J3QA 4XJZA 1OKOA 2BP6A 4MOAA 4CZSA 4FOWA 2XBO2 1ENSA 4QKFA 4PI2A 3U75A 4WM7B 1HB3A 3WF0A 1IQDC 2D6NA 2RR12 3AYCA 3P1IA 2WT2A 2YPDA 1G86A 3IWZA 5CADA 3KF3A 4QWNA 3U4XA 2HWD1 2FZ1A 3TAYA 5H9PA 3H8XA 1UYPA 2OXBA 2EAAA 3WLUA 2J1EA 1RUC2 4QX7A 4PQ9A 1HXS2 2AEZA 5IK7A 4QPIA 4E2GA 4W6XA 2JDMA 2A75A 3ON7A 4XILA 4Q4V2 4OHWA 1RUH1 1J1LA 4QAWA 5I8SA 1AYM2 4QDQA 5E16A 3THPA 5F37A 3B94A 3N9LA 3A0KA 1RVF3 2B39A 1HIXA 2BVVA 3HVDA 2FDGA 1OD3A 1VBE3 1LEMA 2ZX3A 4IV1A 4N53C 1HDKA 4N43C 4ZHNA 4ZZ5A 1BJQA 4AFDA 5H9QA 2VBBA 5FIXA 4URAA 3M70A 4BQ2A 2V5DA 1BYHA 1HXS3 2WNUA 1VAMA 4UFMA 2YV8A 3MLLA 3VD7A 4CP2A 2YPJA 1LJ7A 1OLQA 2FMDA 5LY1A 5A3MA 2P1BA 1ZBA2 4OUMA 3ILRA 4QU2A 4BLJA 2YB7A 1S0GA 2RDSA 4LTAA 5JZGC 4FP3A 1GP4A 1Q8SA 3D82A 1JYXA 1A6CA 3RJRA 5JSOA 4MUVA 1F9KA 4LBKA 1Z7S3 4Y22B 4P5HA 5LBBA 3ZXDA 2B42B 1ULEA 1A8MA 3BVCA 3T2OA 3GJBA 2XR4A 1AR82 5FZ8A 1QJFA 4JHTA 1N1TA 4NRPA 2IXLA 2J1AA 1GOGA 1NY72 4LEJA 2VJXA 4R4ZA 5FYBA 3HQXA 4HN1A 1AYN1 1T2XA 1W9WA 3T0DA 2VUCA 5BUVA 1ND3B 4WZCA 5JCTA 2J1SA 1LGNA 1KFXL 5LB6A 4HVQA 3I59A 1JUHA 4ONUA 3AKRA 2I07B 4PCRA 1CGPA 4QKDA 2JDPA 1LTEA 4R9AA 1QJY1 4QXKA 1V9U2 5F5IA 4NAMA 1G9AA 2WNUB 1REDA 3IDAA 1YC61 3OUIA 1CR7A 2HBTA 5B4XA 1U5XA 1ENQA 5L9RA 1QJEA 2VQ0A 1K12A 4DY5A 1GWLA 5LWBA 5IVVA 4RFT0 5FZOA 2QE3A 5JDBA 3FLPA 3NRUA 3EBRA 2A3WA 2ZGLA 1UO9A 4K1YA 2QQNA 3POJA 1E5RA 2C26A 1OLME 3DEMA 5DPNA 4YWAA 1TEIA 3BCWA 3N3HA 4A7YA 1VAKA 4YVSB 1PO21 1OH3A 1QQP3 1GFF2 2SBAA 3AX4A 3LSDA 4WVWA 5E8AA 5FP4A 2ZGTA 1YCIA 4Y20B 4BE3A 4AI2A 3K77A 3E97A 4NHMA 2JB8A 4ZU7A 4NHXA 1OFSA 5FAXA 1HV1A 2CV6A 4LPLA 2GN7A 3LZZA 4A7KA 3L9JT 5BNPB 2WQ8A 1W8WA 3OGVA 3WDXA 2FQPA 1QXJA 1UOFA 4LR4A 4O9EA 1BEV2 1OF3A 1YQ5A 2P3KA 1RUE2 4GJYA 4AFAA 5FZ0A 4Z07A 3ASIA 1NXMA 4OYUA 1W28A 1RMU2 4LIVA 3JQWA 1ULGA 4MZUA 3VKMA 4AI9A 2ZGSA 5GM0A 3ZFGA 1TMF2 2K46A 5FXWA 5IWFA 1IKQA 2DVAA 2EIBA 2WAAA 5LATA 1FPN1 5IUQA 3DXTA 2WQ4A 4NIAA 3VBFB 4Q4Y2 4D8MA 1BMV1 3JBG2 1US2A 5FZKA 4DB5A 5FZ3A 1PX3A 3T08A 2MHFA 2PTMA 5ABJA 1CAVA 1RUD3 3ZFEB 5M0TA 3BALA 4XFCA 1J1TA 1MS9A 4HOOA 4M0HA 3VBSC 3VLBB 5A1AA 3OGRA 2R49A 3VV1A 1NOVA 4E4SA 5AC92 3KHCA 1RMU3 3DUIA 3GHNA 3NV3A 2WSVA 2E51A 3VHRA 3MIDA 1PZ9A 2MNGA 3ZFEC 1WCQA 1CVNA 2UWAA 3FHIB 4LBLA 1DBNA 1QEXA 5LA1A 4CEWA 1ENXA 4CDQC 2RS53 5KHJA 1G9FA 2RR11 3J7MA 3AVSA 4QGMA 1LNSA 1MACA 1X7NA 5G04L 4D7TA 1DZRA 2IXJA 4ORFA 2IZWA 3H0OA 1YFYA 3I2GA 3LQCA 4LBQB 2D3RA 2ILMA 3WHUA 1JZ6A 4RHV3 4HVRA 3NJZA 2WQZC 4NHKA 1LOFA 5CFDA 2DVDA 1RUJ1 5FJHA 2VOWA 4M4PA 5KHGA 1VJ2A 2DUOA 4XBQA 3N9OA 1GNZA 3J8F3 5EYXA 1DDLA 1H1AA 3TEYA 2HWC3 5CG8A 1W6OB 3LPFA 5JIAA 1RGSA 1VALA 4IGOA 5FZEA 4FAGA 1KGYA 3OUHA 1PM7A 2QCSB 3KS7A 5KHIA 2ARAA 4QM8A 5KXEA 3NQHA 2VOKA 4M3CF 4AK3A 4LK7A 1R082 4XF9A 5KC5A 3N9MA 4XF4A 4Y26A 1H1IA 1NLQA 3R05A 4ASMB 1WA4A 4LE3A 1OLRA 3LFMA 2JWPA 1OF4A 1O8SA 1RXFA 2VTXJ 2YZ4A 4LOSA 4QQLA 3I2OA 5IJRA 4YZ4A 4QB6A 1AJOA 1FATA 2NMNA 4Q0UA 4ZXKA 4J25A 2VG9A 4IEUA 3VBUB 1TME3 4AVSA 1BCXA 3D0JA 1AR81 4BQ5A 4X8PA 4ET7A 2X5IC 1PMIA 3H50A 4NVPA 3TNPB 3DKWA 4EN8B 2ET7A 2DVBA 4E9KA 4FPGA 4FPOB 2YYOA 3ZN4A 4EWAA 3D0SA 1JYNA 3RRDA 5T5LA 1KDMA 4FP2A 3VHOA 1UW8A 1A78A 4BHPA 1ZRIA 3AP9A 1L7QA 2XONA 3RDIA 5FZ7A 1W8HA 2OQ7A 2XVLA 1YLLA 3LE0A 3NO8A 4L97A 4QHOA 4R8HA 2XHNA 4HZFA 4CPBD 5FYUA 5I8TA 1RUG2 4QHBA 3KT1A 1O6UA 3I2DA 2Y6JA 3RMXA 2D6KA 2GDFA 4X6QB 1I6XA 4RS5A 3IIIA 4M00A 4W50A 4XCBA 3WSOA 5C4WC 4MGQA 3SC7X 3T2TA 2QQPA 1KS5A 1QF3A 1XNAA 3VN4A 4FOVA 2Z42A 1ZYBA 2W1SA 3WQBA 4BB3A 3ST7A 3JUUA 2YG0A 1W8NA 4IE0A 4QPGB 4NPMA 1QJZA 3MPPG 4CUAA 3QLQA 4YZ3A 2Q8EA 5JIUA 4GWNA 4PDWB 2RM22 1G7YA 2CWSA 1V6OA 1UY3A 2J1VA 3B5LB 4ARYA 4HMZA 3T2PA 3SKVA 2AR6A 3D3AA 1RHI2 2YC0A 3AFGA 4QB2A 5FYMA 5A3OA 2RV9A 1WBFA 4QGLA 2C9AA 2JD9A 3OBTA 5LBEA 3AYAA 3DV8A 4BISA 3GZEA 5K7PA 3RMYA 3JBG3 2I2SA 1GZCA 3BYWA 1COV3 1VBC3 2JKBA 3OUJA 4HPKB 2VTFA 4HKWA 1TVGA 4ZU4A 3TB0A 1PVC3 1NA1A 4E2SA 1FI2A 1V6MA 1POV1 2WWUA 3KQRA 2SLIA 4CCNA 5IAVA 3CJIB 4LO8A 4YW1A 3ZN5A 1FYUA 1OUSA 1W05A 2DU0A 2NZ9A 3LA3A 4W6YA 1KRIA 2WKKA 1QGLA 5FZDA 3BOWA 4LA2A 5BNNA 1NY71 3HQRA 4Q4W3 3VDDA 4Q4X1 4JHZA 4BLIA 1RUI1 1Z78A 2X10A 5DDJ3 4P08A 4DFSA 5CYYA 4XZPA 2QQJA 4BA6A 5FY9A 2R062 4TZDA 3VBOA 5FTTC 1TNRA 4XAEA 3BIEA 4JGYC 1XB9A 3IDBB 2XLAA 4IEZA 4K9SA 3E5UA 4OQ8A 4XFHA 5JR7B 1LGBA 2XDVA 3CF6E 1FT9A 5FZBA 4DRVA 1XSRA 4XC9A 3TYJA 2HWC1 2VCCA 3K4AA 5J09A 3NV2A 3RYPA 2BBVA 1JZ8A 3SEPA 1XNTA 2Y6GA 3WNOA 2WWJA 4AG4A 3B7MA 1DYOA 5HCHA 3ENRA 3KCXA 4KL1A 4H7LA 5D8AC 5FZHA 2XJSA 3LEKA 3WP6A 3J8F1 2JE7A 3NV1A 4FBFA 1UNBA 3B9IA 3PTRB 3TWIA 3PIJA 1ULCA 5I0UA 3POIA 2CAUA 4BIFA 1UYYA 2YBSA 3B3QE 1STMA 2WWSA 4I0AA 5FZAA 4I2OA 2VZSA 1IS3A 1DCSA 4QX8A 5FBZA 3VDBA 1QHDA 3N7JA 1JU4A 3LDBA 1AL23 2Y6FA 4NE9A 1NX9A 3UYJA 3CMGA 1W6QB 1ND2B 4NWWA 2ORZA 2D40A 2Y64A 3PUQA 1OHFA 1W6NB 2VBPA 1OOPB 4XFFA 4HN0A 3RZHA 1LODA 5FYZA 5IVFA 2ZZQA 1PO11 1WD4A 5F8PA 1HQNA 1UPIA 4BXSV 4I02A 1JXNA 1G6NA 4XF1A 3WNXA 1RUD2 3RI8A 2UY8A 4OUSA 4W6WA 4BOWA 3S0MA 1V00A 2D5HA 3PDQA 4FPFA 2VZPA 1W06A 2ZGKA 2RDNA 3NJVA 3NNGA 5T52A 5A3NA 2WN2A 1GZWA 3IPVA 4Z2AA 1C1FA 1O4YA 3KV4A 1J3PA 4Q4W1 2D6OX 1QJU1 3O0XA 4CXXA 3IIAA 1CAWB 1JU3A 4I30A 5D8AA 2VULA 3VBHB 5A3UA 2ARCA 1OSGA 2VMFA 2I45A 4JRLA 2BERA 4W4ZA 3PVBB 5FYYA 3RFRA 3WW1A 3ZSLA 1XNDA 4BU2A 5H9RA 5FOBB 3I49A 3RZLA 1W99A 1EAH3 1OVPA 1GU3A 2ZGQA 4IEYA 4MYEA 3MIEA 1OH4A 1JOBA 3ETQA 5HPOA 2ZA9A 3AP7A 2EICA 3Q8BA 2Y6HA 1H8TA 3JD72 4LT5A 1X50A 1XU1A 3DPRA 5EXOA 1J83A 4QKBA 3VDDB 2EIEA 1MQTB 1PMHX 1SBFA 3GJAA 3VBOC 5BNPA 1O5LA 3T0AA 4META 2CU5A 1H4GA 2EA7A 3ZMNA 4AEKA 4MG2A 5FZ1A 3MUZ1 3U1XA 4B3NA 4CSWA 1AXKA 4Y33A 5GLVA 4AAPA 3AKTA 1S0EA 3VDDC 4O65A 2VMGA 1ZZ8A 3PUIA 1ASJ1 4M3CA 1BBT3 1FNZA 1PNFA 2VZRA 4AHZA 3IT8A 1GYKA 1AJKA 1PO23 1QQP1 2EALA 4CDQB 2WZR1 3NSTA 2VZVA 2Y0OA 2WO3A 1D4M2 2XJQA 3BIWE 4CXYA 1V70A 3FX3A 4CEYA 5A3TA 5JWPA 5JMOA 1RUG3 3V0BA 1H6XA 1QMJA 1T6GC 2ZAHA 5FO8B 5FPVA 4BM8A 2P3IA 3MF6A 1RHI1 3VZMA 1AX1A 2ORXA 3HD8B 3Q9OA 4EROA 2GC3A 4YGEA 1RUNA 2P5BA 1QJX2 2YU1A 1F5FA 1SLAA 3R4SA 3S30A 2ZPXA 4CEYB 1O3TA 5FPBA 2EXJA 2AGSA 2Y26A 4YG0A 2OIIA 5DABA 5BPXA 4AGGA 1ZZ9A 1O3SA 4KG0A 1V6NA 1EPWA 1EAH1 1WGPA 2F17A 2H0BA 3POGA 5A32A 3OG2A 2YU2A 4QHZA 3AMNA 3H3LA 3M8LA 5T3NA 3WT3A 5ISLA 4Q0VA 1NZIA 2R042 1EP0A 5LBCA 4CDWA 2GAUA 2ZGPA 3E1F1 5DDJ1 4TWTA 1V6JA 2AH2A 1YQ2A 1ZRDA 1XE7A 2VNRA
chains in the Genus database with same CATH topology
2QZ2A 4YLZA 5CVRA 4OI4A 2HWB1 4LBQA 3VZOA 1LU1A 3L2YA 4XIKA 5C6CA 1LEDA 1NQJA 1PVXA 1VBC2 4AGVA 4GA9A 2XL9A 2X5IB 1RB8G 3LOBA 1DZTA 1ZX5A 3J9SA 3RG0A 2GNTA 3OF1A 1AR62 1D4M3 2DU1A 3HBZA 1RVF1 2UURA 4C1WA 5CB7A 3WQ0A 3PVNA 2HWC2 3O12A 1AL22 2X5IA 3AM2A 4N90A 3FLTA 1RITA 2Z2SB 5CFCC 3RWNA 2VOVA 1DYKA 4K40A 3GHMA 2BVBA 3ZSEA 1R083 1ULDA 2ZKNA 2Q4SA 3J26N 5CNAA 4AYUA 3AZVA 2RS11 1PK6B 1KD7A 3CJIA 3WDUA 2DTYA 2P2KA 3VZLA 5EWSA 3TN91 2ZGNA 1HV0A 2CYFA 1FAYA 1GR3A 2IFWA 1FV3A 1PK6C 2VUJA 1Z7S1 5GLWA 5KXCA 2HKXA 2WFF1 2F4PA 1RUI3 1OD5A 5FMOL 3NAPB 4AVAA 2DVFA 3QCWA 2E9QA 1WMEA 1C5HA 4D7YA 4E27A 4EV0A 1TQ5A 4Y24A 4KU7A 5T50A 4Q4X2 3SH4A 3CL1A 2TNFA 1RL3A 5C8CC 5T54A 4NO4A 3MFCA 2R061 1OMIA 2XGXA 2R073 3MW3A 4Q2FA 4AXOA 1DG6A 1NYWA 3B93A 5KC6A 1IS6A 4HKOA 4MH0E 4JGZB 4ASLA 4S2FA 3OY8B 4U2AA 3AZWA 1CAXB 4AEDB 3B69A 1N1SA 4RHV2 3VL8A 1D0GA 1N1YA 5DXDA 3WDWA 4N9HA 1LOCA 2BTVC 4PIYA 4FAHA 3ZIXA 1CPNA 3SHRA 4GKYA 5A33A 3NAPA 3ES4A 3J8F2 4G3YC 4WVZA 2W08A 2B45X 2BNMA 2CAVA 3ZSJA 3IDEA 2Q8OA 4WZFA 1JH5A 3O0WA 2Q30A 1W39A 2AYHA 2IXHA 2K2SA 2LUWA 1MEC1 1UAIA 1APNA 2ENRA 2PAMA 4LHKA 2JICA 2OW4A 4HETA 4PF5A 3GBFA 4MV2A 4FSJA 1PO12 1BBT2 1NCRC 2P37A 1QJX1 3W58A 1XNCA 5JOXA 2ZZJA 1MEC3 5F6LB 1ZVFA 1U5ZA 4OLLA 4COZA 1M06G 2GSYA 5GZFA 3HIFA 5CU1A 1XE8A 3L2HA 5JOZA 1AR83 1FX5A 3GBWA 4RQPA 1DQ1A 4UW5A 2ZMNA 1ZZCA 4AEJA 3NWKA 3MICA 1RUF1 1WBLA 2ZHKA 3M3EA 2A7AA 1J58A 1ZBA3 3CO2A 1RUE3 4F8AA 2NPIA 2VOXA 2Q0AA 4FXGB 4AF9A 1QDCA 1RC6A 1NCRA 1ZA4A 4FPCA 1CD3G 3WXPA 2PHUA 3MW4A 1UN1A 1OPOA 2QZ3A 2PLV2 4JGYB 4GB31 5DZGA 2G9FA 4Q29A 2PELA 5CIRA 5JPMB 1D2QA 3K48A 4MGZE 2DURA 1IHMA 4JAAA 4URTA 4Y20A 5JZGA 3WW3A 4L11A 3ATGA 2X53S 4B29A 2HWD2 2PAEA 4INDA 5A32B 5EZWA 2ZMKA 3VL9A 2P34A 3NAPC 4D94A 1DQ2A 2RS51 2WNUC 4K8FA 3TN92 1ZZBA 4EN7B 1CAUB 3EO6A 1AXYA 1E57A 4D7SA 1ASJ3 1NLRA 5LK5A 1TMF3 2PHFA 3KLSA 1BEV1 2YROA 4K3UA 2X8KA 2Z79A 1AHSA 4IEWA 1N1VA 3JZVA 3AZYA 1C8M3 1HW5A 2UYAA 1Q8PA 2ATFA 2ES3A 1NLSA 3BTAA 2WC2A 4Z1VA 4LUMA 2O8QA 3ILNA 4UXAA 1FMD3 2A6WA 3FMGA 3N36A 1CIWA 4B7KA 2Y38A 4P9XA 4RQPC 2RHPA 1SLIA 4GMP0 5KHKA 4XJAA 1C57A 2QUOA 4JTNA 3WCRA 1H2KA 1UU6A 4Y5Z0 3M7AA 4MGKE 1HKDA 1F5JA 2RE9A 4YARA 4Q1RA 3VZKA 4G4FA 4AE2A 5J36A 1YFUA 4XFIA 1KFUL 4COYA 2Z69A 3S6PA 2JXAA 3VBFC 4MGYE 1AL0G 3A0NA 2ZACA 5CFDB 1GKBA 4YM2A 3TN93 4J6GA 2DCTA 3PLQA 1AYM3 5K0UB 2ZGOA 3VBSB 4HT1T 4FCAA 4IETA 5GLUA 2ZX2A 2D7FA 1JYCA 3AMQA 1YFXA 2VNGA 1XRUA 4AFBA 4XFGA 4L92A 4LLOA 1URXA 2WS91 1HRI2 5FRAA 1F2NA 2BEOA 2WT1A 3WDVA 3ZDSA 2PHLA 5FO9B 2D3PA 1YRZA 4F83A 3WG2A 4FO9A 1U5IA 1I5ZA 4HSLA 1VAVA 2OVUA 1R081 3BODA 4OI2A 1Y7BA 5DZEA 4AHYA 2ARBA 3R0RA 1C3HA 2XLGA 3KT4A 4BWOA 1ZRCA 1VRH3 4KG8A 3W9AA 4M3CB 1WMFA 3UJOA 3MGUA 1QOSA 3H1MA 1BQPA 2BWAA 3PTYA 1RUOA 4JDMA 1AF9A 2BPA2 2E7AA 3H3ZA 5TSWA 1JHNA 1FV2A 1W0OA 1HRV1 2R1BA 2VXRA 2A3YA 4MVTA 4CDWC 3UJQA 5J37A 3EQEA 1RUE1 4DINB 3AMMA 1O3RA 2ETEA 3DGTA 4QGNA 1H9WA 1MS8A 2WFF3 1FPN2 4MLOA 1OKQA 1SFYA 1COV1 2R0HA 3BOPA 4R9CA 5HCBA 2G9GA 2JEMA 2LTNA 1PK6A 4V1PA 2JG9A 1X8MA 5FLIA 1W0PA 3LSEA 1VBD2 3CNAA 2BNNA 2HYKA 5AC91 3HN1A 5I93A 4LA3A 2QJVA 3HT1A 3HAGA 4NR1A 2D6LX 2GZWA 3ZN6B 5K9YA 5C9AC 1H4HA 5I0SA 2OUJA 1CJDA 1J59A 5JSRA 3OTFA 3ZN6A 3ZMOA 1LENA 4L9BA 2HEWF 4HPKA 3DPRC 2RS32 1DQ5A 4H3WA 3EHKA 1FMD2 4MX3A 4DXZA 4RS5B 4RR3A 4H14A 4I0WB 3U07A 4RD7A 2D6PA 2ERFA 4S2DA 5FOJB 2FZ2A 1U0AA 1ZZ7A 4COWA 4BPZA 1SMVA 2BQPA 4PLNA 4KWLA 5J7MA 3VBOB 4HBNA 3BB6A 4PIXA 1POV0 3FC0A 3GBGA 4Q1PA 2EXHA 1GLHA 1YYNA 2D44A 3M1HA 4KWJA 5CG9A 3AKPA 2IXIA 5T5OA 1XNKA 2I74A 2ZOEB 2JD4A 2PLV1 1BVVA 2CGOA 5K0UA 3IDCB 3WY6A 1FNYA 1OPMA 4ATEA 1POV3 3ZYIB 1W6MB 4I3GA 4A7ZA 2VECA 3GF6A 4P9WA 4LHLA 2CL2A 4BYYA 4IEXA 1AR73 4YVWA 3AK0A 5JVVA 4WM8A 4GIQA 2VNOA 2WS92 2HWF3 3ZFFC 3ZYJB 4OI0A 2MEV1 1ND2A 4NPRA 2AZ5A 4XFAA 1AR93 1QJX3 2XKOA 1FOD2 3AZXA 3UKNA 3B02A 3O0VA 2DCZA 2QDNA 1OA2A 2IXCA 1FXZA 5AVPA 5C33A 5JMCA 1WW4A 2TBVA 1O5UA 4S2HA 1SLTA 1PVC2 3LA7A 3WG3A 5F5QA 2HWE1 3G6JB 4L2NA 5GZEA 1PGL2 3P3PA 4QT6A 1HQLA 4XJ9A 1W6OA 3PMEA 1CAWA 3GZAA 3RPQA 4TLFA 4Q4W2 4C1XA 3ZXJA 5E1RA 1I1EA 4LO4B 4B4QA 1PGW1 1XQNA 5BNNC 1SFNA 4K1ZA 4XTPA 3R6SA 1ND2C 1HRV2 3ZFFA 4L99A 4WM8C 1S0BA 4PBOA 4KQ7A 2H0VA 1NA1C 2EXKA 3GZUC 4Q8LA 1COV2 2JG9B 3WCSA 4LUKA 4M3CE 4LLFA 4P9YA 3VBUA 3THTA 4QM9A 2RS13 1IKPA 1TME1 3VHNA 4Y1YA 2WA3A 4XMIA 3PHMA 2ZCWA 1CAUA 4FTSA 1VR3A 4X8NA 3RQ0A 2VU9A 5HI0A 2WNVB 3CLPA 4MXWA 4IXLA 1KDKA 3SCGA 3VBHA 3VZNA 2DCJA 5E89A 1G9BA 1AR63 2GNBA 1AYN3 1CX4A 5EFUA 4AEMA 4PLOA 4RS5C 1SLCA 2QVSB 4E2QA 3RZZA 1RUC1 1LCLA 5LEJA 3ALQA 1LOAA 4PDWC 2WINB 4PBPA 4RR3C 4CP1A 5KHHA 1PIV2 3AP4A 1ENRA 2RM21 3VGIA 1AYM1 2D43A 2XPJA 4JGYA 1REEA 1Z0HA 1GQHA 4Q4X3 5C8CB 5KWRA 2YMZA 1IGOA 1YHFA 2BFUL 5FPXA 4BIOA 5F9TA 1QKQA 1BVP1 4YGDA 4YZ5A 4PIZA 4Z92B 1L3JA 4QQPA 2GN3A 5ACA1 1SBDA 2HEVF 3AXDA 3IM0A 2OZ6A 4AI1A 5AFEA 4FPYA 1QJU2 4P14A 5JPNB 2NQYA 5SV8A 4GXLA 3RI9A 3OYWA 1SLBA 5EYYA 2HWF1 1AUYA 3ILFA 5GKAC 3WG1A 2DCKA 4LBQD 4P9JA 3AB0A 3ZXEA 4DPNA 1UIKA 4CYDA 5I8YA 2P3JA 3POSA 2PHXA 1WUVA 4OHZA 2DYCA 4NN0A 5HXVA 1EY2A 2XJVA 1MZ5A 1QH7A 4AQTA 5CFDC 1CONA 3JB8A 2RS12 4GWMA 2B8MA 4B8EA 5F6KA 3FZ3A 5KXBA 4MXWB 1S0FA 5DUXA 2JG8A 4CDXA 1QJY3 3N35A 1LULA 4KGQA 4XBNA 1Q8VA 4CEWC 4GULA 2WT0A 1D4M1 5J3UA 4DS0A 2G4IA 4Q8KA 2A71A 3ZFEA 2BNOA 2HWE2 3KCCA 2PHTA 3JQXA 4XF3A 3MLKA 3CU7A 5BY5A 3VBSA 2R1DA 1D4VB 4AVCA 3FUOA 1GZ9A 2JJ6A 1ZBA1 5JOYA 1WCDJ 3ZXAC 2PHWA 3V65A 4HVOA 4G9SB 2H6BA 5AFBA 3ZFGC 1B35B 3O5SA 1DFQA 4ES9A 3T1LA 2PQQA 2UU8A 2ET1A 4GMP3 2ZABA 4YVWB 2ZBJA 3MPBA 1EV12 3I8TA 4Q4Y1 4I0BA 4QQ2A 4PJYA 3R4DB 4K7JA 1AX2A 2VQAA 1AYN2 2R6QA 2R32A 4XQ4A 1TME2 2LM3A 4UBGA 4OZXA 2XHKA 1XYOA 1MZEA 1WW5A 2FHRA 1Q5OA 4ATFA 2HWD3 4EJRA 1OQEA 2RM23 4IV1B 1GV9A 4OHYA 1V9U1 1X36A 1JW6A 1SCSA 1KJRA 4RR3B 1DGLA 1DGWA 5FLHA 1MVQA 4X6RB 1PO13 2EVXA 3LGRA 2BUKA 5BNOB 1LU2A 1RUH2 4LO5B 1YNAA 4EN6B 4CDQA 1C8NA 5DZFA 3OD0A 3ZFFB 1O7FA 4Z2WA 4AVVA 2GNMA 1O3QA 4R52A 1JBCA 4OULA 2DTWA 4W65A 4EN9B 1H1MA 1C1LA 3FWEA 1HRV3 4OFGA 2Q1MA 1PGW2 5ABJC 4XETA 2VW0A 2WFF2 3FFZA 3RNSA 5FDBA 1MS0A 1XYNA 5HCAA 4UW4A 1N47A 4XF0A 4FPEA 4JCKA 4ES8A 1GSLA 3APBA 4EWDA 1VBD3 2TEPA 4YG3A 5JI7A 3NKTA 3FLRA 1WLCA 3JCIA 3MIFA 4YM1A 1ND3C 4XXPA 3WP4A 4AW7A 2VY0A 4A3XA 1BMV2 1YFWA 2YDEA 3WR0A 2NMOA 3B00A 1NA1B 2VMIA 1EYBA 2FBEA 2R16A 1SACA 2HWF2 4J1XA 4IV1C 1QOTA 2DFBA 5BV6A 4GB32 1DLLA 4YYOA 1LRHA 1R091 3QBQA 2LALA 2B9UA 2DV9A 4EN0A 2ARXA 3OY8A 3MIHA 4AEDA 3AJZA 4ZKTB 4IEVA 4OI1A 4C0HA 2W68A 4XOGA 2WZPP 3WX5A 2GNDA 2QFEA 3MLJA 1YI9A 1ZREA 1DQ4A 3V0BB 5FREA 3TRSB 1GBGA 3SNMA 1GICA 3OCPA 2NYYA 4DZGA 1RUJ2 2RR13 4LNVA 1U5YA 4YFWA 4YW2A 3V56A 1NQDA 1PZ7A 2W52A 3I7DA 1LOEA 4KWKA 1FOD3 4H55A 2YY1A 2XLFA 5CAZA 2KXLA 4XFBA 5T5JA 5DUUA 4AI8A 5FLJA 5L73A 1LB2A 2K0GA 5B2GB 1DIWA 1W6NA 2H6CA 5IK5A 1G9DA 3E6DA 1DQ0A 1WLDA 1JTZX 5FMOS 1H2LA 3OBRA 3LWCA 4YVSA 4OHXA 1UU5A 3IMNA 1W6PB 5I0TA 2E7QA 1C5IA 3E6BA 1AR92 2ZAAA 4N43A 1CJPA 4N53A 1W6QA 4RHV1 2WS93 4JDNA 4QQHA 5GJ6A 4YG6A 2GC1A 4IERA 5C8WA 4YM0A 3DF0A 4K21A 4Q4V3 3OJBA 4LBOA 5C8CA 2DVGA 4P9GA 2QKDA 3LCPA 4Q0SA 2UYBA 4FXKB 3WQ7A 2JDZA 4O9GA 1NCQB 1RJ8A 1H8VA 4IEPA 2JENA 1ZBE3 5D8AB 4CRQA 4GKXA 2WZR3 1V6KA 3AZZA 4JRAA 4EWEA 3TNQA 3H3UA 4KNCA 3GALA 5IT6A 4CTEA 3VBRA 1QOOA 5ACA3 4N53B 4N43B 3CJIC 3SISA 3U11A 4FTBA 1FPN3 2R063 3RYKA 1LHUA 3JD73 2NP0A 2Y0IA 2GALA 4DNYA 3KGZA 1VBB3 5CFCA 4RQPB 4YM3A 2O0OA 5KBFA 4TSVA 1RUI2 1B35C 1VIWB 1UKGA 1OI6A 4I01A 3KB5A 2BW8A 4YNIA 2NN8A 2R043 2WLQA 2XVGA 4MXVA 4QD2A 4CDWB 2OYZA 4AQ2A 1S2BA 1YIPA 4HLTA 1F31A 4RGAA 4DRRA 4YZ1A 5JOWA 2YGMA 3WHTA 2EF6A 4WM7C 1BKZA 1NZCA 3OGJA 5DG2A 3NL1A 1R1ZA 2D3SA 2VPVA 3P3NA 2UY9A 2DF7A 4MGIE 4XQWA 3NW4A 1LHWA 1BZWA 3H7YA 4NHLA 4AFMA 4XJUA 4COUA 1YI7A 4QX5A 1M4WA 2D93A 4GH4C 4HSJA 3OYWB 3PJQA 4C0BA 4I3PA 4XYXA 3A4UA 3V0AB 4AQSA 2IFRA 1LESA 4GH4B 2XWJB 3WQ1A 2GH2A 4AGRA 1WCSA 3AKSA 1UPSA 4CEWB 2NLRA 1LECA 3H1YA 4IL7A 4JGZA 1RUD1 4HKLA 1QNYA 2YHJA 1HRI3 4ZU5A 4XPVA 5GZCA 2EXIA 2R072 2Z5WA 1PZ8A 3RYRA 1VBB1 1LHOA 4CEYC 3AMPA 3N7MA 2C0ZA 2JG8B 1WCKA 4FPKA 3VBRB 1ALYA 4BMEA 2XKPA 3R4UA 1MS5A 1W6PA 4XXAA 2AUYA 1DGRA 1XYPA 4C91A 3C2UA 1MS3A 5FQ0A 3PVEA 2E63A 2BGCA 2GMMA 1C8M2 2W39A 4IEQA 4WM7A 4IV3A 4XEZA 2RMU3 2HWB2 1MZFA 1R1A2 5BNPC 2ZGMA 1V6IA 2WL1A 1H8TC 3ZPYA 3ACLA 3QH7A 3WDTA 2XB6C 1QJY2 4XQDA 4TYSA 4LULA 3S7EA 4Y1VA 1AXZA 1UKRA 4CDUC 4YFZA 1B35A 1PNGA 1WLTA 4RGGA 1RVF2 4XE9A 3IBMA 5K8SA 1NCQA 2NM1A 1QQP2 2GC0A 1HXS1 1ZBE1 2N7GA 4FOYA 1QY4A 1YJLA 5LK7B 1X82A 3M3QA 1N3OA 1ZZ6A 5GALA 3WW2A 3QD6A 4Q26A 3SH5A 1IPKA 1KXGA 3E5XA 1OOPC 1H30A 1LR5A 2KM2A 3HWJA 2PLV3 2HJIA 5F1RA 2VGDA 2X29A 1J3RA 2ZX0A 5BNQA 4MSVA 1QNWA 3K51A 3RS6A 3V0AA 1W6MA 3MDPA 2MEV3 3DN7A 3NVCA 2ZGRA 1EAH2 3LOIA 3ZYPA 4UBHA 2RMU2 3RSJA 4Y1XA 1PIV3 4M0NA 4FTEA 1R1A3 1Y3TA 3LA2A 3VZJA 3UL2A 5L36A 4XHBA 1I9RA 4WVMA 5ABJB 1DGWX 1LOBA 1B09A 3AP6A 1VRH2 1CN1A 4A2UA 1LKNA 2WJSA 1RIRA 3INAA 3ZSKA 4YW3A 3SH3A 4HK9A 4YZ2A 4F3JA 1YJKA 2GMEA 1REFA 1AR61 1TNFA 4CDUB 2YXSA 4JC1A 1JN2P 2XH6A 5IK4A 4LO7A 4AVBA 4D69A 3FBMA 1GZWB 1F8VA 2VVEA 1JUIA 1IQAA 4Q0QA 1AL21 3M4FA 4IEOA 1RUJ3 4JVAA 4R9DA 1Q3EA 2W0XA 3C3VA 1MS1A 2WZR2 4E4ZA 1RHI3 2WSUA 1UF2C 4LHNA 4LE4A 4LBJA 5C4WB 3POYA 4B4PA 1IOAA 2FMYA 3DL3A 2XUMA 2YUEA 4YW5A 2GH8A 3MIBA 1XXNA 2DUQA 1ZRFA 1MQTA 4GMP1 2IWGB 1O4TA 2WNVA 1LGCA 4N7IA 4Q4Y3 1Z7S2 2RJKA 2RS31 2E6VA 3KZ4C 1NCRB 2BYVE 4JQRA 2GC2A 1TMF1 3KMHA 2XVKA 4N7UA 1K5MC 5T55A 3M3OA 2CGNA 2HWE3 1Q8OA 2A70A 2ZX1A 1S0IA 3O7OA 1H8TB 2O1QA 1WW6A 3LAGA 1CESA 1D0HA 1QWRA 1QXPA 1YWKA 2D6MA 2GMPA 4Y1ZA 5C4WA 1RINA 3ZYRA 4AEDC 4XW3A 1RUF2 3WV6A 2K9ZA 3M2MA 4AQ6A 4BCUA 3USUA 4IQPA 1PGSA 2A6ZA 3VKFC 3SMHA 3ZO0B 1YIFA 2PN5A 3ZXLA 4S2GA 2PYTA 2ZKLA 3KT7A 1RUG1 5AVAA 3W59A 1N3QA 2AREA 1OQDA 1ND3A 4C90A 2YGLA 1SQ4A 3I59B 2PFWA 1VBE1 4FVVA 3BU7A 4HK8A 1AVBA 4I09A 4OVEA 4DQAA 1X8EA 5IK8A 1WMDA 2A6VA 3DPRB 1N3PA 2D97A 3IKWA 4Z8BA 4CP0A 1ZRRA 4QPYA 1W2UA 1PVC1 2OA2A 3E5QA 1PIV1 1VBB2 1OA3A 5JAXA 1WLWA 3AYDA 2IXKA 4UW3A 1VP6A 2RMU1 2TUNA 3PJYA 4F7ZA 3MI8A 5BNNB 2B46X 4SBVA 3SXWA 5GZGA 1LOFC 2HEYF 5DUWA 3PMSA 2HWB3 2VMHA 3ELNA 5FO7B 1C8M1 5EV7A 1H2MA 4J1WA 3OGGA 2WA4A 1Y9QA 3IPVB 4QMAA 3ZXKA 4JDOA 1R1A1 3N7LA 3FE5A 3PVOA 1DZQA 2A3XA 3JBG1 4XTMA 4DY3A 4XJWA 3ZXGA 1AX0A 3SCHA 1U12A 3WD5A 2VW2A 3HR9A 1RUC3 4WVVA 4QPGA 3GNEA 2ZHMA 5AC93 1AZDA 1UIJA 5FCCA 2PHRA 2RS33 5J98B 3FJSA 2O8OA 2AENA