1TVGA

X-ray structure of human pp25 gene product, hspc034. northeast structural genomics target hr1958.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHGSATYLRFIIVSAFDHFASVHSVSAEGTVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords LOC51668 protein
publication title Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1tvgA00
1PX3A 2WZEA 3T2OA 1W9SA 5C71A 5LA1A 2W87A 3P6BA 2L9LA 4CVUA 2Y6LA 5EIYB 4ZZ5A 2VC9A 4QB1A 4ARXA 3ACHA 2VZ3A 2WQ8A 3OG2A 4A44A 4RYDA 2V4VA 3I3EA 5B4NA 5B4XA 2QQIA 2X05A 1L7QA 1UXXX 2XOMA 2W1QA 1JZ5A 1L7RA 3K46A 1LNSA 5I0DA 4QDRA 3FHAA 2QQOA 3ECQA 1DYOA 2E31A 2VZ1A 4XURA 3PUIA 2W5FA 4CUBA 2QQKA 2B4KA 5A1AA 4W50A 3W5MA 4HG6B 4MOAA 1JYVA 1JZ6A 4FI9A 4Z2AA 3ABZA 3LPFA 3WNOA 5F7UA 1MPXA 3IDAA 3WQBA 2E26A 3ETPA 2PQSA 4JKLA 1GNYA 2J22A 3DECA 2VZUA 4DEVA 1UMHA 3I2IA 2Z4FA 3VD7A 4CU7A 2EIBA 4MADA 1GUIA 2W47A 5J1XA 2VMEA 2V72A 3UNPA 3FHQA 4XUPA 3GDBA 4DEQA 1BHGA 3FN9A 4PQQA 4W8JA 3T09A 5JMOA 4JHZA 2YG0A 2J7MA 1JI6A 4ARYA 4MO3M 3CZUA 4GWJA 4M4PA 2J1AA 4P5YA 3GM8A 4IUGA 3DYMA 3K75B 3WF0A 4DUXA 3ACIA 3VD4A 1K12A 1UY4A 4JX0A 5DQ0A 2HLEA 1EUUA 1GU3A 1TVGA 1WKYA 3OEBA 4A6OA 3LEIA 3WSOA 4DUWA 2J1TA 4DXTA 1P8JA 1NKGA 2J1SA 4A3ZA 4AG4A 1W8NA 1OH4A 2W92A 3WF2A 1F4AA 2YFUA 2W46A 1NX9A 2WYSA 3HNMA 3LPGA 5CZKA 2EICA 3LQCA 2ZEYA 4CU6A 1CZVA 4AAXA 5JUVA 1NUKA 1H6YA 1GQPA 3K4AA 2E32A 1EUTA 5LCWL 4LQRA 4XUOA 3EB7A 1GOGA 2Y6HA 2YFZA 2BZDA 2C26A 3IB3A 2QQLA 2VO5A 1UY0A 2W1SA 4QDQA 3VD9A 3HNYM 3NJVA 2YC2A 3CIHA 4XZUG 5C7GA 1PMHX 4QX3A 4XVHA 3VD3A 1H6XA 4OUEA 3THCA 2WBKA 4MGQA 3OGRA 4KWUA 4TXWA 3GGLA 4DXRA 1W8OA 2WDBA 3SKVA 2VQUA 1K3IA 3WNKA 2BGPA 3I2FA 1UYZA 3MV01 5EJ1B 3NRUA 4M4RA 1J83A 2ZXQA 4KMQA 1WCQA 4TTGA 1W9WA 2OKXA 5IFTA 2Y64A 4QPWA 4P00B 2R7EB 2VR4A 3OBAA 3J7HA 1D7PM 2KD7A 2Y6KA 4CU8A 3T2QA 2B9VA 2CDPA 3I97A 4ZZ8A 2VZQA 3DYPA 1UWWA 5DN2A 2VMFA 4BXSV 4ZXEA 3UETA 2WAAA 2J1VA 4OMCA 3VDBA 2ZEZA 1SG3A 1GMMA 1JYXA 2RJ2A 1JYWA 2C4XA 2WO1A 4UOJA 4A41A 4KI5M 3CZJA 2WO3A 3HEIA 1ULPA 3OGSA 3SEPA 1GOFA 1XNTA 1F4HA 1W9TA 2W9XA 2WABA 5DPNA 2W1UA 1OF4A 1PMJX 3OB8A 2LS6A 3CQOA 2XQXA 3WNMA 5CYYA 4OMDA 2VZRA 3BGAA 4YPJA 4OYUA 4QAWA 2QBXA 2JE8A 1SDDB 2VL4A 2ZEXA 3EYPA 4BK5A 1SHWB 5JXJA 1HN1A 3K4ZA 4BDVB 4D0QA 1JZ3A 2VOTA 3LE0A 4QB6A 3HNBM 5HPOA 4QX2A 2DCKA 2W94A 3W5NA 3WNNA 4MGSA 1UMIA 4RN5A 3UESA 2ORXA 3OGVA 3T2PA 1CIYA 5JXIA 3OEAA 1ULOA 5G04L 3A23A 2VZTA 4ZY9A 4XUQA 1UZ0A 2VM9A 3T0AA 5HXMA 1UYYA 2W3JA 5IFPA 3WNLA 3SEEA 3WF1A 1US3A 1W99A 4W4ZA 2LW8A 3AC0A 3I2GA 4CUAA 2J1RA 3WEZA 1JYNA 2WAOA 4UI9L 3I2JA 3NQHA 5LA0A 2EIDA 1K42A 4A42A 4ET7A 1JZ2A 4P02B 1KGYA 3MV11 4XUTA 1UY1A 1R64A 4LHSA 3MUY1 2ORZA 2VTFA 4L0PA 3ZM8A 3GXUA 5C70A 1DLCA 2VZOA 1XPWA 2CDOA 1NAEA 2YC4A 3THDA 2E33A 2W1WA 1OD3A 3ACFA 3DYOA 4OZOA 2BGOA 2RVAA 2JD9A 1UY2A 4GWIA 4PT6A 3C7GA 2WN2A 1J84A 2ID4A 2WN3A 2VMDA 3LEGA 4QX0A 4JKMA 1UYXA 3I2HA 2W91A 3HN3A 3IAPA 2DDUA 1O8PA 2VCAA 3MO4A 3C7HA 2X10A 2X09A 3A21A 2WZ8A 2C9KA 4LKSA 2VZSA 3D3AA 3C7FA 4A45A 1I5PA 3SKJE 4CU9A 1UY3A 3F2ZA 3A22A 4PF1A 4QB2A 4JKKA 3HJRA 5FUIA 2QQMA 2J1UA 4DXSA 4BK4A 3T08A 2WO2A 3HOBA 5IJRA 4E8CA 1UXZA 2HYXA 2Y6GA 5EJZB 2BBAA 2Y6JA 2ZEWA 4QX1A 1O8SA 3WF4A 3WNPA 1GOHA 1JU3A 1PX4A 3VDAA 1K45A 1JZ7A 2WUHA 5JXGA 2VZVA 4A4AA 3CMGA 2XHNA 3JXSA 2V5DA 1CZSA 3NNGA 2VJXA 2VCCA 2Y8KA 3P1IA 2J1EA 2QQNA 2VCBA 1O59A 4P08A 1TG7A 1KEXA 3C7EA 1IQDC 3K4DA 3C8XA 1RYYA 3MUZ1 3I2KA 1US2A 2QQJA 1CZTA 1YQ2A 3IAQA 3NJXA 4BJ0A 1XNAA 3MBWA 1JZ4A 1JZ8A 1JU4A 5IYYA 3FL7A 3PUHA 3ACGA 2VQTA 3VDCA 2YB7A 2JDAA 4QDSA 4UAPA 5G05L 1UX7A 2W95A 4E8DA 2VZPA 1CX1A 3I3BA 3VD5A 3U37A 3C7OA 3CDZB 3HPNA 1OT5A 3T0DA 4DUVA 1DP0A 4XUNA 3T0BA 2BERA 2XONA 4CUCA 5LA2A 5JR2A 2RV9A 3A7QA 3CKHA 3I3DA 1T2XA 3LEKA 1OF3A 5JXHA 1W0NA 3E1F1 4LPLA 3BN6A 5DMYA 5IHRA 3K77A 4GZ9A 3WF3A 1JHJA 2VMCA 4D8MA 1XC6A 2JKXA 3IIIA 2EIEA 2DCJA
chains in the Genus database with same CATH superfamily
4TYSA 3ZXDA 2WA4A 4LO6B 3WQ0A 5C71A 1W6QA 2E7QA 1CAVA 1EYBA 4QT6A 5A7SA 4CVUA 5FXZA 4IEOA 1PVC2 2PLV3 3ES4A 3O5SA 5FZEA 5BYNA 5EIYB 2OQ7A 5FPVA 4E4SA 2D3PA 4Q0UA 4AQ2A 1QY4A 4JGZB 1EAH3 2JG8A 4O9GA 1GFF2 1HN0A 2Z42A 4D6RA 3IDCB 3X29B 5DAQA 2KM2A 1CAUB 1R082 3AKTA 1KFUL 1UXXX 4JTOA 2W1QA 5FZIA 1BBT1 2NZ9A 1BK0A 1V00A 4GD4A 3OF1A 4MGTA 2E9QA 2P1BA 3K46A 1LNSA 1TME2 5I0DA 2YPJA 2DBNA 4YLZA 5T5OA 2QQOA 3O0VA 5FUPA 5FOJB 1MS0A 2RDNA 2RMU1 4XURA 1XE8A 3VZLA 2WIIB 2ZTNA 4YW1A 4GA9A 4YZ4A 1ASJ2 1RHI1 4I02A 1A78A 1JOJA 1XYNA 1LEMA 2B45X 2CY6A 2FHRA 2YBKA 3M8LA 1PGL1 2PAEA 1NXD1 5EXOA 4ONUA 4KWLA 4HG6B 4Q4Y2 1EV11 2JDUA 4GIQA 4Q1PA 2UWAA 4IV3A 1NY71 3RZGA 3E6DA 4Z2AA 1HQLA 3ABZA 5F1RA 4UFHA 2BFUL 1D0HA 4IE4A 1QMJA 2ZX3A 5F7UA 4FOQA 4LORA 1E5HA 1MS5A 1UU5A 2D5HA 1ODNA 4B4QA 5C8CC 1IZ3A 2ET1A 4O7XA 2LRPA 3N7JA 1Q43A 3MEPA 3PJYA 4RGGA 1OHFA 3BVCA 2HYKA 1OOPB 1W9YA 1PGSA 3PLQA 5ISLA 3ST7A 2LUWA 3LA2A 1C3HA 4YGEA 1FXZA 1GNYA 5F39A 3SISA 2ENRA 2ILMA 1PK6A 3GJAA 4AFBA 1ENXA 4MYEA 1E5SA 1VRH3 3I2IA 2Z4FA 3J7NA 4M3CA 3VD7A 5JSRA 5FP7A 4EN6B 2EIBA 3AZZA 3KV4A 1HXS1 4DPNA 1OLMA 3PMSA 4AHYA 3FUOA 1OVSA 3VN4A 1O5UA 1V9U3 2V72A 2GAUA 4GAZA 4JHTA 4K21A 3OUIA 4NJ4A 4DEQA 4FAHA 1N1VA 2I45A 1S0EA 5FZGA 1H8TC 1SLCA 1RUC1 1SLIA 4ASLA 2YG0A 5CG8A 5FPLA 1IHMA 1LHWA 1Q8QA 3M7AA 4ARYA 4XFGA 4GWJA 2JICA 5FREA 2J1AA 1O3SA 1CIWA 1RUOA 3ZSJA 1IGOA 4HSJA 1R1A3 5LK5A 4Y3OA 1W6OA 2XUEA 2VOVA 4Z1VA 4KL1A 3MIBA 4BQWA 4BHPA 1H8TA 2BEOA 5GLZA 2MEV3 4BQYA 3UKTA 4TWTA 3AMMA 4Q5OA 1UQXA 5DQ0A 4JX0A 4Y33A 2HLEA 3ZYHA 2RM22 3SH5A 2FDHA 1VAKA 1FOD1 1LHOA 2DWRA 3K2OA 5GZGA 1TVGA 1WKYA 1VALA 1W06A 1DZRA 2D5FA 2JJ6A 4LMFA 3RZJA 2J1TA 4RGAA 2VY0A 4DXTA 1SBFA 5IVCA 1CAWB 4LA2A 5SV5A 3HQRA 1HQNA 4AG4A 1WA6X 3ELNA 5JI9A 3ZDVA 3M3OA 5DZEA 1NCRC 2W92A 4NROA 5GLWA 4IE5A 1YFYA 3CJIC 2O8OA 1N3OA 5CZKA 4LUMA 3FJSA 3ZR5A 2LM3A 2HEYF 3B00A 1W8HA 1E5RA 2WZR3 1APNA 4XACA 3VBSB 4CU6A 5JUVA 4M0HA 5FJKA 2G9FA 1DLLA 5A7QA 2ZGUA 2HWC2 3CJIA 3CF6E 2WL1A 4LKEA 4HFSA 1K5MB 3D0SA 1AXKA 5JIAA 1ULEA 5LB6A 4XAAA 1LOAA 3MDPA 2DURA 3H1WA 1LB2A 1VMFA 4M00A 4SBVA 4CTEA 3USUA 4IV1A 5CB7A 2JKBA 3V0AB 1O4YA 4K9SA 3SCHA 3ZYPA 3IB3A 1PGW2 3PVNA 3B3QE 3EO6A 3GZEA 4RR3B 1RUI1 2UU8A 3LFIA 2WKKA 5KXEA 2RS51 1OKOA 3P3PA 1YFXA 4E2QA 3BTYA 1UOFA 4CZSA 1H2LA 3TEYA 3WW3A 3HIFA 1I6XA 2ZGKA 2ZA9A 4WVVA 1ZZ7A 5FQ0A 1VP6A 2A3XA 5JPNB 2R32A 3N7MA 3ZFFB 2AGSA 4XDOA 1QNYA 5FOBB 1F9KA 4L8QA 1JTZX 3O0XA 3MIDA 2IXJA 2PQQA 1GZTA 3MZHA 1HB2A 5FIXA 1OVPA 5L36A 1JYIA 4W6XA 3PURA 2P34A 3UK9A 4AHXA 1GP6A 4RFT0 5CFCC 1MEC1 3OUHA 1I9RA 4CUGA 1UOGA 4BQ2A 4QGMA 4D6SA 1UN1A 1VBB2 1QXRA 4HL0A 2ZGOA 3AP6A 1V6JA 1XYOA 1ZX5A 1LENA 2ES3A 2JB4A 5FLHA 3L2HA 1H2MA 5FYUA 2E6VA 4KMQA 4JTNA 1S0JA 2IXLA 4DRVA 2GH2A 5CFCA 1WW4A 2Y64A 1QU0A 1LKNA 3KHBA 2ZHMA 1V6OA 3URFA 1YUDA 2VR4A 4DNYA 3J7HA 4ITCA 4QXBA 3MIEA 3O12A 4CDWC 1VLNA 3H7YA 4QM9A 2UY9A 2OPWA 2PHWA 2QUOA 4FFFA 5D1IA 2Y6KA 3T2QA 4CXWA 3TN93 1DCSA 1QJY1 1ZVFA 2CDPA 3RDIA 1FV3A 2VZQA 2XUMA 1G9AA 2UYBA 4NE9A 4YW3A 3ZXKA 1ZRIA 3ZOIA 4CCCA 3H1YA 5FRAA 4QD2A 3PUQA 5A32A 5IWFA 1TMF2 4QWNA 2IFWA 1LOEA 4FPHA 1HLCA 2J1VA 1U12A 4I01A 2V73A 1QXPA 2XVLA 1HRI3 4Y1YA 5IUQA 1I1EA 2BU9A 1GMMA 2ARCA 3N4MA 4TZDA 1JYWA 1FATA 2RS31 1RUH1 1RUG1 3AFKA 4KGGA 2C4XA 1W3VA 2CAVA 4BLIA 4CP9B 5A3UA 4A41A 3O1OA 3OCPA 4KI5M 2WT2A 5E6HA 1PM4A 1JMUB 1WW6A 4RS5C 3ZXGA 5K9YA 1RVF3 1ULPA 3OGSA 5JOYA 2WFF1 1GOFA 1U0AA 2YUEA 4MGKE 1WD3A 3WVJA 1W9TA 4KG8A 1CVNA 2QQUA 2RDSA 1OF4A 1PO23 1RUJ1 4DZGA 2WNEA 1HKDA 1RUD3 5A80A 4N53C 1HRV2 2CGOA 3JB8A 4RS5A 4IEPA 2QJVA 5AC91 4JRAA 4MHUA 1X9TA 5C5UA 3U1XA 4OYUA 5I8YA 1W28A 2EXHA 5JI7A 2XJSA 5FP4A 3VBRC 2WNUC 4LHNA 3IT8A 1MS3A 3HAGA 3PUAA 4FPYA 4QGNA 4NHYA 4D3WA 4CCMA 1OA3A 1VBC1 3BIWE 4LBQB 4EROA 2FCVA 2ZABA 2DCZA 4PI0A 5JXJA 3MW4A 1SFPA 1PVC3 2VOTA 1YCIA 1LGCA 1X8MA 4QB6A 4MGIE 4Q29A 4QQLA 4QX2A 4AFDA 3VBRA 1W6NB 5IK5A 3HBKA 5K0UB 5IVEA 4DRRA 5C3OA 3E6BA 4FFIA 2AENA 1Y3TA 4QPIB 2WYFA 4KNCA 4OUSA 4LEJA 2AYHA 1AYN2 1R083 4LR4A 4RN5A 1QWRA 2VUCA 4QKBA 3BU0A 5DDJ1 1ULOA 1TME3 5G04L 5CAZA 1DGLA 3OBRA 4QXKA 2CSGA 4AVAA 5KC6A 4I0BA 1OQEA 5FYSA 1SLAA 3OBTA 4BQXA 5J37A 1VBD1 1IPSA 2GMMA 2QZ3A 2W3JA 2LALA 5IFPA 3WNLA 2DUOA 2F17A 3SEEA 4BWOA 1US3A 2RDQA 3DGTA 2LW8A 3AC0A 4Q4Y3 4CUAA 3H8OA 1JYNA 3J8F1 3BI3A 5SV8A 3WT3A 4NMIA 4DXZA 2EIDA 4IEYA 4IE0A 4PCRA 2D6NA 3VKOA 2VXJA 4OZXA 2YU2A 3LGRA 4ZXKA 4EWDA 5ABJC 2PHDA 1AXYA 1YQ5A 3VDDB 1C28A 3AZVA 3AP9A 3HBZA 4LHSA 3FLTA 4X8PA 5DUUA 5FY0A 5I0UA 4BMEA 4L0PA 1FI2A 1PMIA 1VBE1 5C70A 1FNZA 3QD6A 4P9JA 3VKNA 3WX5A 2VECA 2BWCA 3ZFGA 1IS4A 1DLCA 2VZOA 1W8UA 2YC4A 3THDA 4B4RA 1J1LA 2XJUA 4MV2A 4QKDA 4F3JA 2HBTA 5FY8A 5FO7B 3DYOA 3H0OA 5C6CA 5LBEA 3DPRB 3AKSA 3I8TA 4FP2A 4Y1XA 2DBIA 1JW6A 1RUE2 1KRIA 3HVDA 2ADEA 1AR91 4NO4A 5H9QA 1G6NA 3LEGA 1LOBA 4QX0A 4BPZA 5BNOB 5K7PA 4Y5TA 2YHJA 1VB4A 5IK7A 2EAAA 1POV3 2P37A 4NHXA 5BNPC 1SLLA 3I2HA 4A7YA 1YO8A 2CTVA 4I3GA 1W6QB 1KD7A 3KCCA 1O8PA 1CAVB 3MO4A 1N3QA 1OFSA 4YNIA 2XLFA 1BMV1 2QTWB 2P6HA 2X09A 4XPVA 4FPEA 4KU8A 3T1LA 1AR62 1H1AA 1GSLA 1OFNA 5BNPA 1LEDA 2RM23 2JG8B 4A45A 3MW2A 2ZACA 4Y24A 1I5PA 4A7ZA 5FPAA 5C33A 4L2NA 3LA7A 3M3IA 3ZYRA 3PHMA 4QB2A 4FAGA 1QOSA 2NYYA 4JRLA 2X5IA 4MX3A 2WWSA 4F8AA 1VPHA 3VKLA 2J1UA 5HV4A 4PI2A 3RZLA 2HEVF 1KITA 2HEWF 1UPSA 4N43A 3T08A 3JU9A 2C5DA 3HOBA 3VLBB 5IJRA 3LDKA 4E8CA 1UXZA 3HQUA 4WM7A 1QJZA 1RMU1 2Y6JA 5FCCA 1O8SA 4A2UA 1GWKA 1GOHA 1WLWA 4AGVA 1LOCA 1M4WA 3BIEA 3OBZA 4AGRA 3GZAA 3NJZA 1IS3A 5JXGA 2ZMKA 1N1SA 4LULA 3J26N 4Z92B 2HWC3 2VVFA 4MGYE 3ROUA 2FQPA 2WS92 1OSGA 4X6RB 3JXSA 2OPKA 3CNAA 4HT1T 4KBBA 3GNEA 3NNGA 4H7MA 1ND2C 2SLIA 5LK7B 2YROA 2PLV1 1GZCA 4P08A 5L7OA 4EN8B 2IXCA 3C7EA 4AEDA 1ONAA 3RI9A 4W6YA 1EAH1 1PK6B 3GHNA 2QCSB 2XDVA 5T50A 1MQTC 2RS12 1US2A 5IVFA 5KHGA 2Q30A 1GZ9A 1CZTA 4M3CB 1AX1A 2AR6A 4B3NA 3VGIA 4HKLA 3ZSEA 2G19A 2IZWA 1JZ4A 1Y7BA 2DF7A 1H4GA 4DMIA 3NW4A 4B7KA 2GALA 3HT1A 2PAMA 3AVSA 3NNJA 2H0BA 2H6BA 3AKQA 4CEYC 3K51A 2FCTA 2A7AA 4FQZA 1UF2C 4RHV1 1KS5A 2I07B 5K8SA 3BYWA 1VBB3 5DAWA 3U4XA 3U37A 1X9PA 3CDZB 2WNOA 4BQ3A 3IIAA 3PTYA 4ZU4A 2PHTA 4XBQA 4CEYA 1BQPA 4YW4A 1H8TB 5A7OA 4IW3A 4XC9A 2BQPA 2TEPA 4YM3A 3A7QA 1ZYBA 3LEKA 4XIKA 2FCUA 3JBG2 2H6CA 5JXHA 4U36A 1ZREA 1UW8A 4OQ9A 1C1FA 4EWAA 1FMD2 3E1F1 2OS2A 3AK0A 3BN6A 4Z2WA 3NSTA 2LTNA 3BCWA 3SC7X 3K77A 4IESA 3WF3A 1DGWA 1SFNA 1EY2A 1X36A 4D8MA 2WQZC 3S7EA 4IEXA 1W6PA 2JX9A 2FZ1A 1PX3A 1TMF3 3MLJA 4ISRA 1W9SA 5KBFA 5LA1A 2Q8DA 5FZ6A 5F3IA 2R0HA 2K46A 3KV6A 1X82A 4NUBA 2PFWA 4LJHA 1Q8OA 4XIOA 1DIWA 1RINA 2D97A 3ZLIA 4ZKTB 4FSJA 4RQPA 4ARXA 4S2GA 2VZ3A 3CJIB 3OG2A 4HONA 4RYDA 1UYPA 2PELA 1UIKA 4JAAA 3GALA 5JZGC 5LZ6A 4AI8A 2IXKA 1HJFA 5B4XA 4CYDA 5LY2A 2VQAA 3HQXA 1KDKA 3USUB 5BY5A 5FZ8A 4NHLA 5FLIA 4AI2A 1RL3A 1JZ5A 1ZBA1 3L2YA 4OI4A 4GWNA 3ZXAC 2A6YA 2OT7A 1HRV3 2YY1A 1PZ7A 3ECQA 5HBAA 2E31A 3AVRA 5FV3A 4HBNA 4GALA 5JZGA 1YFWA 4B29A 3AJYA 3S57A 5DG2A 3RJRA 5GJ6A 5FQ0B 1JXNA 1Q8VA 4LBMA 2QQKA 2Q1FA 1J1TA 4GH4C 4CUBA 1H8VA 2ZKNA 4BM8A 3CL1A 4BOWA 4NIIA 4EN0A 2X29A 4P9XA 1JYVA 4Z82A 3N7KA 3TEWA 1K5JA 1MVQA 2R061 4FPFA 4CDXA 2D3SA 1GLHA 4CCOA 5C4WC 4OI0A 3WNXA 1AUYA 3QBQA 1MPXA 5KHJA 3E5XA 4GH4A 4E2GA 4BMBA 3WQBA 3WG4A 1GYKA 4L9BA 1KDMA 4WZFA 1ZZ8A 4LBQA 3UJOA 5A6QA 1WLDA 4XF1A 5EYYA 5L19A 1BZWA 4XTMA 1DDLA 2BOIA 3N36A 3VBUC 1AYN3 4DEVA 5KR7A 5FK8A 5CFCB 1QF3A 5C9AC 1AYM2 4QKNA 2PHLA 1H1MA 3ZSLA 4MZUA 3LOBA 1GUIA 3VBOA 5J1XA 2AREA 2VMEA 1W8WA 1ALYA 3UNPA 1PO11 3AZXA 4P5HA 4YW5A 4FPJA 4AI0A 2A3YA 2ZHLA 3GDBA 4PDWA 1OMIA 2ZGTA 1COV2 1IQAA 4LO5B 1IS5A 4RGKA 1LULA 5A33A 4ATFA 1CR7A 3AXEA 4CDWB 2J7MA 1JI6A 3ZYIB 2XJVA 3HD8B 1YLLA 2ZGNA 1REFA 2Q1ZB 4I09A 3CO2A 4MO3M 5A32B 4PBPA 3KMHA 4P5YA 5GLUA 3SH4A 1OH3A 3SLIA 3GM8A 4IUGA 5KHHA 4LUKA 1ZZ9A 5LRRA 3JD71 4XXAA 4DUXA 5FYYA 3V0BA 1TEIA 5E1RA 1UCXA 2YDEA 4QXHA 4LBQD 5FZ1A 2XHKA 1RC6A 3ZYGA 4NIHA 4KG0A 4OHVA 2KA3A 3JZVA 5BNQA 4LBNA 2RR11 2B42B 2EAKA 1UNBA 4A6OA 4AR2A 3WUDA 3D6EA 3LEIA 2BUKA 3WSOA 4E2SA 4UBHA 1RUF2 2J42A 5BUVA 4SLIA 2J1SA 4A3ZA 4AQTA 5J3UA 4WVZA 1PZ8A 1RUE3 1W8NA 3QACA 1OH4A 4GKXA 5H9RA 4RS5B 1F4AA 2YFUA 5A7NA 4DOUA 5F8PA 3WDWA 2BTVC 2JIGA 2RE9A 1NX9A 5APAA 4NPLA 2WYSA 5FZLA 1HB4A 3HNMA 3LPGA 4E4DX 1KFXL 5FY5A 1W2NA 3TN91 1O7FA 3ZPYA 4GB33 4LK7A 3AP5A 3TWIA 1H6YA 1SQ4A 4N53B 1GQPA 3WDUA 1LHNA 1G8WA 1N3PA 1O5LA 1D2QA 2PHFA 3MW3A 5FMBA 4G4FA 3SITA 5LCWL 1NZIA 1R1ZA 2WT0A 1MS8A 4UFKA 1ENRA 3RFRA 4AL9A 2CL2A 4NPMA 2R072 3ZYJB 1AR63 3RS6A 2XKOA 5DAVA 3VBRB 3WCRA 4NRMA 4CEWC 1FPN1 3BODA 3MFAA 3SXWA 2VO5A 4QPGC 1UY0A 3VL9A 2W1SA 2EXKA 3HNYM 3NJVA 1RXFA 1SFYA 1QJU1 3CIHA 4JDOA 4XZUG 4Z8BA 1PMHX 1RVF1 1NQJA 3WLUA 1WGPA 3GBWA 3WW2A 2OXBA 3VD3A 2HJIA 1BLZA 1D4M3 4R9AA 4CEWA 5C8WA 1BBT2 2DFBA 2WBKA 4OHXA 1RUD1 3J7LA 1QDCA 2ZGQA 4W6WA 2FZ2A 4FTBA 2WNVC 1YHFA 3SMHA 3THTA 3V64A 4DXRA 5HCAA 2BBVA 1HQWA 1AHSA 1NOVA 5FYMA 2YMZA 3KCYA 4F83A 2DVDA 2RMU2 2VQUA 2GSYA 4OHWA 2VBBA 3B5LB 1HV0A 4BE3A 4OUMA 1Q56A 1PGL2 2WS93 5EJ1B 3EHKA 4YARA 4GWMA 4AXOA 2AACA 5A1LA 1EP0A 5I91A 3OJBA 4CCKA 5E8AA 2OW4A 5FBZA 4YGDA 5FYZA 1BJQA 1N1YA 2ZXQA 1IS6A 1OLRA 1SACA 1WCQA 1NY72 4CDUC 1W9WA 5ACA2 5IFTA 4QPWA 2R7EB 2MNGA 4FO9A 1J58A 2XWJB 2X8KA 4TN7A 4HVOA 4XDQA 3EJKA 4YW6A 1HX6A 3DUIA 3B94A 3ZFGB 3ZVXA 2C9AA 3V56A 4COYA 4XF0A 3CLPA 1H9PA 1D7PM 1GP5A 5FKCA 2KD7A 3MIHA 4JZRA 1CD3G 2E63A 5JIUA 4CDQC 2D6KA 1R081 2WT1A 2B9VA 1WBFA 3SHRA 4CPBA 3TRSB 1IKPA 3VB9A 3DYPA 3IPVA 4GJZA 1NT0A 4BIOA 5FMOS 1A8MA 1X50A 4COZA 1LHVA 2PN5A 1C8M1 4J1WA 4NN0A 1HXS2 2VAUA 2VMFA 4XF3A 3UETA 2XBO2 4N9IA 3JCIA 2VUAA 4OMCA 3OSDA 5C8CA 2EALA 5FXWA 4GXLA 3RYKA 1JYXA 2BDRA 2UURA 5FWEA 3KGZA 1C4RA 2XJQA 4IEQA 4M3CF 5I8TA 4XCAA 5L9RA 1Y43B 5IVVA 4UOJA 5D8AC 5C3PA 2GC0A 2P17A 2VBDA 4R52A 4AVBA 5J09A 4Q2FA 1Z0HA 2A70A 3O1UA 3UKVA 5GKAC 2WO3A 3HEIA 1YXWA 3RZMA 3POSA 3VZOA 1NA1C 4XHBA 5FTTC 3BTZA 5EQUA 3MIGA 2W9XA 1LESA 3KZ4C 4N9HA 3JBG3 3FFZA 5DPNA 1PMJX 5BNPB 2ZKLA 3ZFEC 4XBLA 2HWE2 3UYJA 5D8AA 1S0FA 3CQOA 3H1MA 3H8UA 1S4CA 5CKMA 4G9SB 1FMD3 3WNMA 3QLQA 2X5IB 3ZXFA 4COUA 1ODMA 4DB5A 2Y34A 2QBXA 1NA1A 3BOPA 5FZCA 2JE8A 3EMRA 2XLAA 1G7YA 4N43B 1XSQA 3P3NA 3ZFEA 1WW7A 4C0BA 2I74A 4WM7B 1QJX1 4AVSA 3I3QA 1SZBA 3N35A 4RA0A 3K4ZA 4UBGA 3S5AA 1JZ3A 3A0NA 3ON7A 2XH6A 5HPOA 2QFEA 4YW2A 1W9FA 2DCKA 5I0RA 3HN1A 1RGSA 1F35A 1VJ2A 3WHUA 3UL2A 2AH2A 1VE0A 2D6MA 3PNAA 1NLQA 4L97A 5GZEA 3WNNA 3W5NA 2VQ0A 4WV8A 5J36A 1F31A 5AVAA 4ZU5A 2FMDA 2F4PA 5JXIA 5L7OB 2EXIA 1NCRA 1W2UA 4AEDB 4UFIA 2H0VA 3H8XA 3A23A 4IE7A 1V6NA 3E5UA 2PXJA 4XUQA 5TSWA 1ST8A 5IK8A 3T0AA 3RYPA 3A0KA 1NCQC 2DU1A 1UYYA 1AJOA 1RUI2 2A1XA 1QQP1 4C1WA 1UIJA 4YVWC 2CAUA 2CU5A 1QHDA 1PNFA 4N8MA 2VMGA 4C1XA 3GZTB 1VIWB 2DV9A 1UX6A 1H0BA 2IFRA 2IUWA 4W4ZA 4DY3A 2Q1MA 2J1RA 3WEZA 4LITA 5FAXA 2RJKA 3WW4A 2WAOA 3I2JA 3AFGA 4NRPA 1OI6A 1PIV1 1BEV1 1OC1A 1K42A 4Q0PA 2NLRA 4ET7A 3ALQA 4YVWA 1KGYA 3MV11 4CRQA 4FPKA 2GZWA 3M3EA 3ACLA 3ILRA 4RSUA 2VTFA 3K3NA 4OFGA 3ZM8A 1M06G 2DUPA 2JG9C 2HWC1 3OPWA 5FP3A 5FZ7A 4CEYB 3WW1A 5CNAA 1NAEA 2B8MA 2BNOA 1AYM3 2IVJA 1UOJA 4CCEA 2W1WA 1OD3A 3ACFA 4C90A 4OZOA 4LA3A 4EZHA 2DCYA 1PGW1 1DYPA 3KF5A 1REDA 1XU2A 1UY2A 3H9AA 2ZMNA 1D2SA 4INDA 4HKOA 2D98A 3D8CA 1POQA 5CU1A 1COV3 1MS1A 2OX0A 2B9UA 2VMDA 4Q4V1 4E4ZA 1N47A 1G9CA 2NM1A 1DQ0A 4YM2A 4GJYA 5EZWA 4IEWA 1W6PB 1ZBE1 4JKMA 3Q9OA 3WQ7A 1QJY2 1W8TA 5CADA 4AFCA 3ZXJA 4LE3A 1AZDA 1F15A 3HN3A 5C3RA 2LROA 4COWA 3IAPA 2WLPA 4XEZA 1DFQA 5DAXA 4C91A 3U4SA 1DBNA 4YM0A 4RFRB 4DIQA 3OGGA 1CQ9A 1OA4A 3LDRA 3R4UA 1N1TA 4BISA 2C9KA 4MSVA 4LKSA 4QQOA 4OHYA 4CDWA 2OZJA 2OZ6A 4H3WA 4RQPB 5FUNA 3KVBA 3D3AA 3C7FA 5BV6A 2O8QA 3MYXA 4BXFA 2RS32 2Q5TA 3N9PA 4F7ZA 4CU9A 1T6GC 4OULA 4PF5A 2TBVA 3A22A 2IVIB 4ZPIA 1QH7A 1RUF3 4MVTA 5FY4A 3H3ZA 4EYUA 5LWBA 4JKKA 1CONA 3T1MA 2HKXA 3Q8AA 2QQMA 2A6WA 3B02A 4Q8LA 5CFDC 1BCXA 1NG0A 1HB1A 4DXSA 2WFF2 4JDMA 1SBDA 3JQXA 4Y4RA 3OD0A 2VGDA 2IXHA 3R4SA 3PL0A 1RUJ2 5EWSA 5JZGB 2VW2A 1KJLA 1YRZA 4HK8A 5T55A 1JOBA 3ILFA 4BIFA 2JDKA 3LF7A 3OPZA 1H2NA 2K9ZA 2SBAA 1Z7S2 2ZEWA 4QX1A 4UFLA 3RQ0A 3WF4A 3O1PA 1QGLA 3VDAA 2ZGLA 1K45A 1JZ7A 3KQ4B 2WUHA 4BLJA 2VZVA 3FBYA 4CDXB 2VNRA 3CMGA 4MUVA 2R041 2V5DA 4AQSA 1CZSA 4XMAA 2HWF1 4YGCA 5FZ3A 4D6QA 2R073 3P1IA 3PU3A 2J1EA 3FZ3A 2QQNA 2VCBA 4GH4B 3I54A 3GF6A 3UGGA 1O59A 1AR72 1YIPA 3IDBB 4META 1KEXA 4Y22A 4N7IA 4Q4X1 1SPPA 4N53A 2FDKA 5FR3A 2HWB2 1CX4A 1OQ1A 1RYYA 3S30A 3I2KA 3Q8BA 5BNNC 4JV4A 3FE5A 2ERFA 1DQ2A 3NJXA 3BKZA 2WNUA 1W8FA 1XNAA 1JZ8A 3VBOB 1D4VB 1BBT3 2PHRA 2P6CA 4Y1UA 3PUHA 5IYYA 1O6UA 4FOVA 4FCAA 2VQTA 1VMJA 3NMBA 4PDWB 1G86A 2WSUA 1GQGA 2BNMA 1LR5A 5D21A 1Y9QA 4B1LA 3T3YA 2VVEA 1VBD2 1O4ZA 2QZ2A 2RMU3 1BXHA 4UAPA 2Q8OA 5A33B 5CBLA 1ULDA 4JDNA 1WW5A 2WA3A 1UX7A 2W95A 1AL0G 2VZPA 2XL7A 4AOCA 3KLSA 5FP8A 5HCHA 3BB6A 4D7SA 3Q8FA 4PLOA 4K3UA 3HPNA 3NV2A 5A7WA 4K6BA 3T0DA 1O3TA 5JSOA 1B35C 3J8F2 1W2AX 1ASJ3 2QKDA 3LIGA 4JGZC 5ACA3 5FY9A 3U0ZA 3V0BB 3WP5A 1LJ7A 2D6PA 5FLJA 2JWPA 5FYBA 2XPJA 3ZYBA 3CKHA 5GM0A 1Y4WA 3VHRA 3W20A 3OUJA 1WMXA 2P2KA 4P9YA 5FMOL 1NXMA 1B35A 4XFAA 1VBE2 1R092 4KGQA 5FZOA 5DMYA 3ZIXA 5IHRA 3WY6A 1NYWA 4NAOA 1G9DA 4GZ9A 2AEYA 4KWJA 2DCTA 1XC6A 2JKXA 5CA6A 3WDTA 1AX2A 2EIEA 2JENA 2ADDA 2DCJA 1HJGA 1AL22 4YWAA 5FYTA 2JDNA 2XBO3 2WZEA 1H4HA 3T2OA 4FXKB 2Y0OA 2Y26A 2W87A 2JDZA 3WDYA 5ABJA 3PVOA 4HPKA 4KBZA 1SCSA 2GC1A 4MXVA 1AR92 4GULA 5FP9A 2X53S 3TBDA 3OGJA 4ZS3A 3ZKUA 1WA4A 3RWKX 5KC5A 3ACHA 2XL9A 3TEXA 3ES1A 4A44A 5IATA 5KHKA 2E51A 5BPXA 3ZDSA 2V4VA 4YG3A 5B4NA 2VUDA 2UWBA 1OOPC 1B09A 5FMCA 3AYAA 2X05A 2HH9A 1GBGA 2XR4A 1BMV2 2XOMA 3WQ1A 4HN0A 2G1MA 4URTA 5D2AA 1YYNA 4OVEA 2XQRA 2HWE3 2AEZA 4M3CE 2P3IA 4FPCA 2CGPA 4IL7A 1AXZA 4QDRA 4BQ1A 3RZHA 3H3UA 3WP6A 1OLME 1DYOA 3HWJA 4ISQA 2R16A 5FZHA 4NIAA 4AZZA 1T6BX 1D0GA 3PUIA 4R4ZA 2W5FA 5FZKA 1J3PA 3MGUA 4IGOA 4CEWB 5EPAA 4Q8KA 4W50A 5A3WA 3I3MA 4K1YA 1WCKA 4I2OA 1RUE1 3VZJA 1KS4A 1UOBA 1UKRA 1QJEA 1JZ6A 1IG3A 1FT9A 4FI9A 4AI3A 4YVSC 3LPFA 1VBA1 2E7TA 5M0TA 4FT8A 3TEZA 3WNOA 3WINE 2D3RA 1C1LA 5FK7A 4HVRA 4GB31 3GBGA 5C3QA 1WCUA 3IMNA 3IWZA 1SDWA 1H1IA 2E26A 2PYTA 3PIJA 4GQ7A 3IBMA 3ETPA 2PQSA 4IEUA 4JKLA 4XJUA 5T3NA 3ME2A 2J22A 2VH9A 1C5IA 1ZA7A 2VZUA 5F2WA 3R6SA 4CCJA 4YVSA 3AZYA 1IPKA 2R49A 5A3LA 1W03A 5IAXA 1AR61 4HZFA 4V2VA 4S2FA 4CU7A 2DU0A 3THPA 4YZ2A 2W47A 5KWRA 4E27A 3BUCA 5JR7B 4WVMA 3T4HB 4CXXA 3O1SA 1UD1A 4N90A 4XUPA 3FN9A 2EVXA 1QOOA 5JMOA 3IPVB 2DVBA 3POFA 5DABA 3EXUA 3O14A 4BU2A 4YRDA 2XG3A 3ZSKA 1D4M1 3EBRA 3T4VA 2WWUA 1ZNPA 5DZGA 3DKWA 3RWNA 1ND2A 2ZS6B 1DZTA 1DQ1A 1OQDA 4D69A 5C8CB 3WOGA 3DYMA 1UZYA 3WF0A 4P9IA 1ZRCA 5ERLA 2XVGA 2D44A 1DU3D 1GR3A 1S1AA 1RIRA 2IWGB 4BZ4A 3VD4A 1K12A 1Q3EA 2QQVA 3W9AA 1UY4A 1RITA 3GCXA 1WZXA 4RHV2 1AR82 1EUUA 4UW5A 4WVWA 1MQTA 4XF4A 2WS91 5F9TA 1GU3A 1OXCA 4FOYA 4AEMA 1BKZA 2ZJCA 3OEBA 2VBPA 3PIGA 3KQRA 4J1XA 3LIHA 4RR3C 1XQNA 4DUWA 1NE4A 5C3SA 4OCTA 1NKGA 2VNGA 3D0JA 4YW7A 2XJTA 4LO8A 2P3YA 4QU1A 4QMAA 5D8AB 1W3XA 3BALA 4Q4W2 2GU9A 3WF2A 4WM8C 5LBCA 2NN8A 4D7YA 1ND3C 4XFFA 2W46A 1Y9GA 3FHIB 4Y1ZA 2ARAA 1NA1B 5FY1A 1F5FA 4JGYC 4G3YC 1H2KA 5KXDA 2EICA 1QJY3 1GNZA 2ZEYA 3LQCA 4FVVA 1CZVA 1DGWX 1NLRA 1NUKA 2JDMA 4XQWA 4IDZA 1ZZCA 4AAXA 4MGZE 2PHXA 4WM8A 2VUJA 3K4AA 2IXIA 1ND3A 4LQRA 4LTAA 4XUOA 4XBNA 1VRH1 2Y6HA 2ZX1A 1MS4A 3DF0A 2A6VA 2YFZA 4JGYA 2BZDA 3UV9A 3KHCA 3ORJA 3ITQA 1RB8G 1QJFA 1S2EA 1XBFA 4P9LA 4L11A 1RXGA 5J96B 2QQWA 4TSVA 5DXDA 5FYIA 1V9U1 2RS33 3PDQA 4MG2A 2DVAA 2W0XA 3O1VA 4QDQA 3BU7A 2B7YA 3FUQA 3MICA 5I0TA 1UAIA 2N7GA 4M01A 4EWEA 5A1FA 5C7GA 1RJ7A 3PVEA 4ZONA 1NCRB 1S0BA 4IQPA 1JODA 4LBLA 4QX3A 3N9QA 4XVHA 4K20A 1H6XA 2YBSA 5EV7A 3ZPOA 1RUJ3 1ZBA2 3TOJA 1R1A1 4MGQA 3OGRA 4LOTA 4KWUA 4TXWA 5H9PA 2OQ6A 2IC1A 2VPVA 3GGLA 3BPZA 5LEJA 2A75A 1Z7S3 1W8OA 2WDBA 4A7KA 5IK4A 2MEV1 4GMP3 4QPYA 3OY8A 3VKMA 1OPMA 4PHZA 5CVRA 5ANNA 1MZFA 3WNKA 5L9VA 3I2FA 5LRSA 4AGGA 2UYAA 1UYZA 3MV01 4LKFA 1NE6A 3NRUA 1J83A 1ZRDA 1QOTA 3IN9A 3PTRB 4YVWB 3WP4A 1F5JA 2R062 4OLLA 3WDXA 1AR73 4BYYA 4P00B 3ZKYA 1LAJA 2DVFA 3OBAA 1ULFA 2HWB3 3JQWA 1TQ5A 4AAPA 2XMLA 4QHOA 4XOGA 2VOWA 5A7PA 4CU8A 2HBUA 5FY7A 4BQ4A 4AEJA 2W08A 3DCQA 4EJRA 3FLPA 2WZR1 3I97A 4PBOA 4ZZ8A 1BYHA 2GMEA 1OD5A 1IG0A 3D4KA 1UPIA 2TUNA 4XFHA 5DN2A 4BXSV 3TNQA 4ZXEA 2RG4A 2WJSA 1UZWA 2WAAA 4KWKA 5C4WA 5A3TA 4Q1RA 1VBD3 4KQ7A 1PO12 3ZXLA 3AL6A 3U78A 1W05A 1A8DA 2P4EA 1JH5A 1L7LA 3AJZA 4P9GA 3UGHA 4CSWA 4CA9A 3OPTA 4H55A 3ZFEB 1J59A 3VBUA 5F3CA 1GWMA 1X7NA 3J8F3 1S0GA 1JYTA 1WD4A 1JBCA 2JB8A 1RTVA 3A4UA 3NV1A 5C9AA 5K0UC 5JDBA 3SEPA 4P14A 2W52A 3GZUC 2HWD2 4XHXA 1XNTA 4CXYA 4QPIC 5FDBA 3OD4A 3F95A 3JD72 1F4HA 1S2KA 2D6LX 2WABA 2W1UA 3OB8A 2YV8A 2JE9A 2LS6A 1LECA 3WHTA 1POV0 2XQXA 5CIRA 1VBE3 1R093 2CYFA 3POEA 1WCSA 3OTFA 4OMDA 2VZRA 5FBJA 2RR12 3BGAA 4YPJA 5A6YA 3D82A 4QAWA 1O3QA 2D93A 2O1QA 3NV3A 5GZFA 1PHMA 1SDDB 4HSLA 1AL23 2BGCA 3ZX7A 3NAPC 1LTEA 2Y60A 2ZEXA 3EYPA 4BK5A 2GNDA 1SHWB 1UZVA 3I2DA 1HN1A 4Y20B 5FPBA 5F6LB 4D0QA 3POBA 3LE0A 5T52A 1AR93 3IDEA 1GWLA 4LBKA 4RD7A 5CFDB 3VUOA 5T5PA 3POGA 1NZCA 4ZS2A 4UFMA 4CP0A 1GANA 5JPMB 3VDDC 3ZXEA 3DXTA 3NAPA 2YXSA 4UT5A 1UMIA 3WR0A 4PIZA 2XKPA 3VBHC 1LOGA 4QQ2A 2A71A 4ATEA 1A3KA 3UESA 2ORXA 3PMEA 4HKWA 3AYCA 2VULA 3UJQA 2W68A 5F5QA 1MZ5A 3T2PA 1CIYA 4Y22B 5IVJA 1SPPB 2WZPP 4QGLA 1W90A 3MPBA 3N9LA 3RVHA 2VZTA 2ZAHA 5LA9A 2R1DA 3DPRC 4K40A 1FPN2 2ZX4A 4I3PA 2R30A 4YZ5A 1S2BA 3VBHA 5A6ZA 3KT1A 1CN1A 3KS7A 3LSEA 5HXMA 2EXJA 1HRI1 2WNUB 3RG0A 4KU7A 3HT2A 1QJU2 1XJAA 4Y1VA 2ARXA 3IM0A 4CP2A 5H9SA 3WF1A 4XCBA 4XJ9A 5DZFA 3I2GA 3ASIA 5BNOC 1XNKA 3LSDA 1LU2A 5A6XA 3OYWA 2JDPA 2GMPA 3AP4A 4XETA 2FDIA 4XQDA 5FJHA 1JZ2A 4LLOA 4P02B 2VW1A 4XUTA 4P9WA 1QIQA 5FO9B 2CGNA 2XB6C 4Q0VA 1PO21 1TZOA 4LBJA 4TLGA 2D43A 2JXAA 4NRQA 4QPGA 5A7WB 3IZOA 1HB3A 4MXWB 2BVBA 3Q8EA 3FMGA 3K48A 4FTSA 4EE2A 2W2IA 3NO8A 3NWKA 4NAMA 1XPWA 2JG8C 2CDOA 2FD8A 5FZ0A 3AKPA 3L9JT 3NVCA 2E33A 2R071 4XAEA 1RHI2 1O3RA 2OVUA 4O65A 5FPUA 1UO9A 2JD9A 1JOPA 3S6PA 3U10A 1EV12 1B35B 2WNVA 2WN2A 5FZOB 1J84A 1JS9A 1GNHA 1FNYA 3M2MA 5EJ3A 1XYPA 2GC3A 2ID4A 1PVC1 2WN3A 4FPOB 2Q8CA 4LT5A 3WDVA 1S0CA 4AHWA 5JOXA 4Y5Z0 3W21A 1UYXA 1WBLA 3J7MA 1U5IA 2W91A 2RS13 3ILNA 1LODA 1WMFA 3NNFA 2DDUA 4CDUA 1OUSA 3RMXA 1C8M2 1EPZA 2VCAA 3LKJA 5ABJB 2QE3A 4HPKB 2C6SA 3ZN4A 4IV3C 2X10A 1LOFC 4IXLA 2ZGPA 3B69A 1TME1 4K8FA 4RHV3 1TNRA 3FFQA 2OA2A 1AR83 4M0NA 4N7UA 4XW3A 4U2AA 4ZU7A 3SKJE 5DUWA 3LCPA 3AZWA 4ASKA 5IAVA 5JMCA 2BPA2 4CDQA 1UY3A 2QDNA 3F2ZA 3NJYA 5A3MA 4PF1A 1ASJ1 2V09A 3RRDA 3LWCA 1LOFA 1PK6C 3VV1A 5ACA1 3SH3A 1RUC2 2CWMA 4NWWA 1V0AA 1WMEA 4Q4Y1 3H8RA 1ZA4A 1F2NA 1PVXA 2D7FA 3H50A 4Q4W3 3KV5A 4Z07A 5T5JA 4BK4A 2K0GA 1DYKA 5JOWA 1AJKA 1ZZ6A 4K7JA 4QQPA 2BRTA 5FYCA 2KXLA 5B2GB 2ZMLA 2Y6GA 3DKQA 5EJZB 3WNPA 3LA3A 4HN1A 5FPZA 1JU3A 1PX4A 3AKRA 3WCSA 4BH9A 2ZZJA 5JSPA 4YG6A 5J48A 2WRAA 1SBEA 3DN7A 4A4AA 3GCWA 4GMP0 5FZDA 1FOD2 4LLFA 4CPBD 1XXNA 2XBO1 2VJXA 1ENQA 1QJX2 1W04A 2VCCA 1VAVA 3CU7A 5IW0A 4UYBA 2PHUA 4IERA 1OBNA 2RJLA 4XJ8A 4K1ZA 1OKQA 1F8VA 4OQ8A 1VRBA 1IQDC 2ZHNA 3GHMA 3LZZA 5DG1A 4B4PA 2PAKA 5GLVA 3MUZ1 5FZFA 5CISA 4YVSB 2BNNA 3JB4C 1GKBA 1XE7A 1DF0A 2FDJA 5FXVA 5FZMA 5HV0A 4BJ0A 4V1PA 1POV1 1YQCA 3MBWA 4YG0A 2NP0A 4C8DA 2XLGA 4WVMB 3E97A 2HWE1 4LO4B 1ZBA3 3RYRA 4CCDA 5C5TA 5GALA 4E4HA 1PM7A 5LW9A 4NHMA 5I93A 1FV2A 2FDGA 4PQ9A 4E8DA 1QQP2 1CX1A 2Z79A 3CEWA 4UF0A 1YI7A 2RM21 3I3BA 1JN2P 4ZHNA 5A3PA 3N3HA 1GQHA 4XMIA 2QQPA 4HMZA 3O1TA 1ND2B 1OT5A 4DUVA 4AI9A 4URAA 1DP0A 4XUNA 2R063 3HMYA 2RS52 1W6MA 1AX0A 5T5LA 3FLRA 3T0BA 1PIV2 2XONA 1BEV2 5JR2A 5LA2A 2RV9A 2DTWA 1OPOA 4R8HA 2PA7A 1OF3A 3NNLA 3MIFA 1AF9A 1MQTB 4IV1C 3N9OA 2ZHKA 1W0NA 1EPWA 1NCQA 3I4IA 4YGBA 4GKYA 4H2AA 4FOWA 3BPSA 1JHJA 2VMCA 2A73B 4XF9A 1MEC2 1JUHA 2ZX0A 3IIIA 1QH6A 3KWVA 3UKNA 3ZIWA 2C1FA 4L92A 3KCXA 4L99A 4ES9A 1PO13 2BV4A 3P6BA 4YFWA 2L9LA 4LHKA 3OOXA 2Y6LA 1BVVA 2W39A 5LBBA 4Q4V2 5EP9A 3KVAA 4ZZ5A 5FPXA 3QOPA 2VC9A 4QB1A 2JG9A 1IPJA 1MS9A 4WM8B 4X8NA 4PIYA 1ZBE2 1ND3B 2WQ8A 2BVVA 3I3EA 5KHIA 3RMYA 2D40A 5F2SA 2HWD3 1FYUA 2QQIA 3EQEA 4JGYB 1L7QA 3RZKA 4EN7B 2A6ZA 3JD73 2Y6FA 1AVBA 1YNAA 3KB5A 1L7RA 5K4LA 3AMQA 5I0SA 4B7EA 1TE1B 4Y5SA 5J7MA 2EIGA 1OLQA 3NV4A 2B39A 2OIIA 5F3EA 4WZCA 3FHAA 2YPDA 4CP1A 1W8ZA 1Q5OA 4LHLA 2VZ1A 3POYA 4XABA 4B8EA 2RR13 4XZPA 1LHUA 3CJXA 3V65A 3KV9A 2BP6A 2B4KA 2VD7A 3B93A 5DAPA 1GZWB 1VBB1 1SEFA 5A1AA 5LEKA 4V2WA 1LGBA 1RUH2 1RUG2 3W5MA 4QQHA 4MOAA 1ZM1A 1X8EA 2K2SA 3WG1A 3MPPG 3VHOA 3ZSMA 1U5XA 3C3VA 4ORFA 2PTMA 5EYXA 4OHZA 2FDFA 3OY8B 1STMA 3WV6A 3MLLA 1W39A 3IDAA 1WUVA 1QNWA 2VTXJ 2VVDA 5F37A 5GZCA 4HANA 2Y33A 4J6GA 3BTXA 4K8RB 4FFHA 4I0WB 4UW6A 2GN7A 4Y20A 4EV0A 3DECA 3W59A 5AC92 4FBFA 2TNFA 2R042 3PVBB 4LK6A 1KQRA 5CFDA 5HXVA 4EN9B 1UMHA 3GJBA 4AI1A 3I59A 4IE6A 2HWF2 3KF3A 3B01A 3TNPB 4MADA 5T54A 3WG3A 2Q0AA 5F32A 1TMF1 2JIJA 4WBBA 5ANQA 1FPN3 4Q4X2 1VBC2 3VBFC 3FHQA 1CWPA 1CAXB 1BHGA 4PQQA 4W8JA 3U11A 1QJU3 3T09A 3DL3A 4JHZA 4QKFA 1H30A 4BA6A 4XILA 2NMNA 4LOSA 3CZUA 4M4PA 5C4WB 2AUYA 3J9SA 3VBFA 4LO7A 5E16A 3E6CC 4D94A 5LATA 3WUCA 3K75B 1Z7S1 3SCGA 5LY1A 2YYOA 3ACIA 4GMP1 5EFUA 5DDJ2 3VBUB 1X33A 2JECA 1HRV1 5GZDA 2VE1A 1CGPA 1FAYA 3ZMNA 5C9AB 5BNNA 2WSVA 5CG9A 3AMPA 3D5OA 1WMDA 3S7IA 1ZZBA 3MI8A 1RHI3 2VCMA 2AC1A 1P8JA 4RL7A 1AR71 1JUIA 1UU4A 2D6OX 2Y38A 4ASMB 5FZ9A 4UW3A 1E57A 3B9IA 4O9EA 4AEKA 4MXWA 1EV13 2VXRA 2Z2SB 2HWB1 4DQAA 2YBPA 2E53A 3MHZA 3PU8A 3TYJA 1C57A 3RPQA 2ZPXA 3ENRA 1YFUA 3DV8A 4QX7A 4FP3A 2B5HA 1JHNA 3H42B 5LASA 4NOTA 4XJAA 5IT6A 2OUHA 2MHFA 3CHXA 3NKTA 2E32A 1EUTA 1C8M3 3APBA 1AYN1 4JGZA 4TLFA 5A3OA 5IVYA 1ZRRA 4NVPA 2Z69A 2UY8A 3EB7A 1UZZA 1GOGA 2GNTA 3PJQA 1W0PA 3R4DB 1SMVA 1NQDA 4Y4YA 1CAUA 3TAYA 2WINB 1HXS3 2C26A 4UW4A 3WZ1A 2O0OA 2NMOA 4BB3A 4QXCA 3NAPB 2QQLA 3RNSA 2GDFA 1QKQA 2GH8A 3QCWA 5J98B 5FZBA 3ZMOA 4R9CA 3ZR6A 3VD9A 2YC2A 4AVVA 3ZO0B 3ZFGC 3FWEA 4H7LA 1RUC3 4IGQA 1VB2A 5EHDA 3H7JA 1IOAA 2V4AA 5GLTA 1HW5A 2BOJA 3W58A 4OUEA 3THCA 3R0RA 1FX5A 3VBHB 2ZX2A 1R091 3DXUA 3SCFA 5FXXA 2VU9A 5FWJA 2VMHA 2ZGRA 4DS0A 1NLSA 3S0MA 3SKVA 3M1HA 2YC0A 3LDBA 5FKBA 1S0DA 2KR2A 1CJPA 2ZZQA 3ATGA 3ZN6B 1K3IA 5FYHA 1XB9A 2BGPA 2ETEA 1OA2A 3T30A 1AL21 3KD4A 2JEMA 1FOD3 1YQ8A 3NNMA 3OYWB 1OOPA 1XSRA 2BJSA 4HXCA 1XU1A 1KJRA 4M4RA 2C0ZA 4MHRA 1ULGA 1MZEA 1QJX3 2VNOA 3FC0A 5HI0A 4TTGA 4CE8A 1HIXA 1MZ6A 2OKXA 2WO7A 2VTXA 1VBA2 4QPGB 4XJZA 1WWYA 5L73A 1Q8SA 2WR9A 4GB32 3AP7A 3AM2A 3BTAA 4HLTA 4LBOA 4Q0QA 3ZN5A 2JE7A 2XGXA 1DZQA 4X6QB 3LAGA 4YM1A 3VKFC 1Q8PA 4AYUA 1H9WA 1IKQA 1QDOA 1RMU2 4W65A 3NL1A 2X5IC 2FBEA 4HVQA 4MLOA 1LU1A 2Y0IA 1UWWA 1GICA 3T2TA 3SQOA 2WNVB 3GYDA 2PMWB 5KXBA 3O0WA 4N43C 2Q4SA 3VZMA 4QX5A 5FZAA 3M3QA 3VDBA 2ZEZA 4WM7C 3I49A 1REEA 1SG3A 2YGMA 1QQP3 4YYOA 3IMMA 2A6XA 2PLV2 2DTYA 2RJ2A 4FFGA 4JCKA 1YJLA 5E88A 4DO0A 2QVSB 3LOIA 4LKDA 4PIXA 2WO1A 3RZZA 4CDUB 5JLVA 2G4IA 1RUI3 3CZJA 4UFJA 1D4M2 1EAH2 3VHNA 2RS53 5KXCA 1XNCA 1PIV3 3QH7A 4OI1A 1BEV3 2I2SA 3LD8A 3HR9A 2VG9A 2OUJA 1CAWA 2F6BA 4C0HA 3USSA 5JAXA 3VBSC 3POJA 4E9KA 4YZ1A 5L7OC 4AEDC 1C8NA 1SLBA 3ZYFA 4CDQB 5CYYA 4FPLA 4IV3B 4XXPA 4DINB 3E5QA 1K5MC 2DUQA 4FPGA 1YQ6A 2NQYA 1DG6A 4CCLA 4FTEA 1MEC3 2BWAA 4PLNA 2JD4A 2VMIA 2RDRA 2E7AA 3I2OA 4PLMA 2P3JA 2WLQA 1Z78A 3LFMA 4PJYA 3VBSA 2VL4A 2ET7A 3AMNA 2DFCA 1YC61 1URXA 5HCBA 1K5MA 4BDVB 3JUUA 1CESA 4Q4V3 4LXLA 5I8SA 3HNBM 1V6MA 3WG2A 4NHKA 3VZNA 5IVBA 5F3GA 3V0AA 4AF9A 1ZBE3 1JYCA 1WLTA 2QNKA 4I0AA 3ZFFC 2W94A 4YZ3A 5DUXA 2RS11 3H3LA 3ETQA 4MGSA 2BFUS 4RR3A 3WXPA 4A6SA 3O1MA 2DVGA 1E5IA 3M4FA 5HCFA 2ZCWA 4COVA 2V5YA 1CJDA 1VRH2 2GP5A 3OGVA 3OEAA 1ENSA 2Q8EA 4YSFA 1YWKA 2EF6A 3KT7A 3ZFFA 3BOWA 1AR81 1OUXA 2XJRA 4ZY9A 3RGBA 4FXGB 1V9U2 4AE2A 1UZ0A 2VM9A 1YJKA 1W6OB 3PUSA 1DQ4A 3N7LA 3S5QA 1QXJA 3UT0A 1YI9A 2WC2A 4MH0E 3WP3A 2GN3A 1WCDJ 1GV9A 1RUH3 1RUG3 4H14A 1W99A 4XQ4A 5JWPA 4Q4W1 1XRUA 4UI9L 2GC2A 1TNFA 3NQHA 5CKQA 5LA0A 3K3OA 3FX3A 4NR1A 1BK1A 1MR5A 1R1A2 4YFZA 2FMYA 1ZRFA 4A42A 4J25A 2WFF3 1XNBA 3CBNA 1Y9MA 2JDYA 1GZWA 1W2OA 1UY1A 3FBMA 3JBG1 2GNMA 3Q8CA 4UF0B 2MEV2 1R64A 3NKGA 3MUY1 4BQ5A 2ORZA 4XFBA 3GXUA 1CPNA 1FMD1 2JDHA 1RJ8A 1OURA 1SLTA 4HK9A 4IGPA 4RQPC 5E89A 5AC93 4AWDA 1W6MB 2F4LA 2R043 1VAMA 3U07A 3INAA 4UWDA 3M3CA 4LIVA 2HWF3 4Y26A 1HV1A 2MPFA 4Q27A 2BGOA 2RVAA 4IEZA 4AQ6A 4JQRA 2ZOEB 4Q4X3 4XFIA 1NCQB 1VBC3 4GWIA 4JVAA 3C7GA 4PT6A 1PNGA 1UL9A 5JCTA 1I3HA 2B46X 3B7MA 3TB0A 2GP3A 2WWJA 2WFPA 2R1BA 1A6CA 1LCLA 4QHZA 3KM5A 1UMZA 5JVVA 1J3QA 4QM8A 4Q0SA 4IV1B 4XDPA 3AYEA 2WZR2 4Q26A 1VMHA 2AZ5A 3GBFA 4CP9A 1CAXA 3AB0A 2XWBB 1DGRN 3LB9A 3C7HA 1DQ6A 4CDXC 2VNVA 3A21A 1I5ZA 2WZ8A 2XXZA 4S2HA 5DDJ3 2JG9B 2C24A 2VZSA 1UKGA 1WLCA 1U5ZA 2ZGMA 4R9DA 4QX8A 3U75A 3RI8A 1A34A 1W2TA 4I30A 3AL5A 5AFBA 1XE0A 1G9FA 4R9BA 1S55A 1BVP1 1YEWA 2VOXA 3G7DA 4AHZA 2DYCA 4IETA 4XFCA 1QEXA 2ARBA 2O14A 3HJRA 5FUIA 1RUNA 3U14A 5CKNA 1KXGA 2VW0A 4R4XA 4UXAA 3G6JB 2XJPA 5F6KA 1V6LA 2RHPA 4JQTA 3M70A 2WO2A 2ZGSA 3MF6A 3VBOC 3VL8A 1HDKA 1J3RA 2XVKA 2HYXA 2BBAA 3VHPA 4PDWC 4EZ4A 1CPMA 2R6QA 2YZ4A 1MVEA 3AXDA 3N9NA 2P5BA 1V70A 3KT4A 1W6NA 1MACA 1GP4A 4NIDA 5FZ4A 2CV6A 4NPRA 1L3JA 2XHNA 3QH6A 5DUVA 5K0UA 1AYM1 3R05A 1SCRA 3RJ2X 1PZ9A 4QPIA 5CEHA 3RSJA 2Y8KA 3AX4A 3B9CA 3I7DA 2CNAA 3AMHA 1O4TA 5F5CA 1S0IA 3KGLA 4XE9A 1TG7A 4AVTA 3POIA 2ATFA 4LE4A 4AFAA 4B1MA 2ZAAA 4LNVA 4A3XA 3K4DA 1ULCA 2QDRA 3C8XA 5A70A 4AW7A 1COV1 4JC1A 5LBFA 4QU2A 3J4UH 4D7TA 1DGRA 3C2UA 2QQJA 1YQ2A 3I59B 1XNDA 3SNMA 2HWD1 3IAQA 3N9MA 5FYVA 2ZBJA 3TN92 1ACCA 1V6IA 1V6KA 2G9ZA 2YGLA 5AFEA 3LEMA 1JU4A 3KSCA 3MLKA 1LGNA 5FO8B 3FL7A 2BYVE 4HETA 3ACGA 2OYZA 3VDCA 4AVCA 2YB7A 4LIUA 1O91A 5AVPA 2WQ4A 2JDAA 4QDSA 1U5YA 2A5ZA 4KH9A 3VZKA 2CHHA 2GNBA 2EA7A 5JOZA 2YU1A 1DQ5A 2VOKA 5G05L 1HRI2 1XOYA 4S2DA 3VDDA 3VD5A 2P3KA 1G9BA 3WD5A 4XTPA 5FMDA 3C7OA 4O61A 3VBFB 4IEVA 4XJWA 4XYXA 4DY5A 1LRHA 5BXXA 4CCNA 4ES8A 4NIGA 1RUF1 3UGFA 1VR3A 1UU6A 2G9GA 3O1RA 1RVF2 4NWVA 1VBA3 2BERA 3DEMA 2BW8A 2Z5WA 5L9BA 1DHKB 2UWCA 3ZN6A 4HOOA 4CUCA 3I3DA 1T2XA 4FQ4A 3DPRA 1PO22 1W0OA 1C5HA 4EQVA 5BNNB 4OI2A 4BCUA 1RUD2 3AYDA 3O7OA 5F5IA 5FFOC 3P5BA 3MFCA 4LPLA 2A3WA 4QHBA 1RMU3 2NPIA 2R0FA 5F5AA 4AK3A 5A3NA 3IKWA 2CWSA 5BNOA 1YIFA 4AFMA 3POWA 4DFSA 3MF9A
chains in the Genus database with same CATH topology
1PX3A 2WZEA 3T2OA 1W9SA 5C71A 5LA1A 2W87A 3P6BA 2L9LA 4CVUA 2Y6LA 5EIYB 4ZZ5A 2VC9A 4QB1A 4ARXA 3ACHA 2VZ3A 2WQ8A 3OG2A 4A44A 4RYDA 2V4VA 3I3EA 5B4NA 5B4XA 2QQIA 2X05A 1L7QA 1UXXX 2XOMA 2W1QA 1JZ5A 1L7RA 3K46A 1LNSA 5I0DA 4QDRA 3FHAA 2QQOA 3ECQA 1DYOA 2E31A 2VZ1A 4XURA 3PUIA 2W5FA 4CUBA 2QQKA 2B4KA 5A1AA 4W50A 3W5MA 4HG6B 4MOAA 1JYVA 1JZ6A 4FI9A 4Z2AA 3ABZA 3LPFA 3WNOA 5F7UA 1MPXA 3IDAA 3WQBA 2E26A 3ETPA 2PQSA 4JKLA 1GNYA 2J22A 3DECA 2VZUA 4DEVA 1UMHA 3I2IA 2Z4FA 3VD7A 4CU7A 2EIBA 4MADA 1GUIA 2W47A 5J1XA 2VMEA 2V72A 3UNPA 3FHQA 4XUPA 3GDBA 4DEQA 1BHGA 3FN9A 4PQQA 4W8JA 3T09A 5JMOA 4JHZA 2YG0A 2J7MA 1JI6A 4ARYA 4MO3M 3CZUA 4GWJA 4M4PA 2J1AA 4P5YA 3GM8A 4IUGA 3DYMA 3K75B 3WF0A 4DUXA 3ACIA 3VD4A 1K12A 1UY4A 4JX0A 5DQ0A 2HLEA 1EUUA 1GU3A 1TVGA 1WKYA 3OEBA 4A6OA 3LEIA 3WSOA 4DUWA 2J1TA 4DXTA 1P8JA 1NKGA 2J1SA 4A3ZA 4AG4A 1W8NA 1OH4A 2W92A 3WF2A 1F4AA 2YFUA 2W46A 1NX9A 2WYSA 3HNMA 3LPGA 5CZKA 2EICA 3LQCA 2ZEYA 4CU6A 1CZVA 4AAXA 5JUVA 1NUKA 1H6YA 1GQPA 3K4AA 2E32A 1EUTA 5LCWL 4LQRA 4XUOA 3EB7A 1GOGA 2Y6HA 2YFZA 2BZDA 2C26A 3IB3A 2QQLA 2VO5A 1UY0A 2W1SA 4QDQA 3VD9A 3HNYM 3NJVA 2YC2A 3CIHA 4XZUG 5C7GA 1PMHX 4QX3A 4XVHA 3VD3A 1H6XA 4OUEA 3THCA 2WBKA 4MGQA 3OGRA 4KWUA 4TXWA 3GGLA 4DXRA 1W8OA 2WDBA 3SKVA 2VQUA 1K3IA 3WNKA 2BGPA 3I2FA 1UYZA 3MV01 5EJ1B 3NRUA 4M4RA 1J83A 2ZXQA 4KMQA 1WCQA 4TTGA 1W9WA 2OKXA 5IFTA 2Y64A 4QPWA 4P00B 2R7EB 2VR4A 3OBAA 3J7HA 1D7PM 2KD7A 2Y6KA 4CU8A 3T2QA 2B9VA 2CDPA 3I97A 4ZZ8A 2VZQA 3DYPA 1UWWA 5DN2A 2VMFA 4BXSV 4ZXEA 3UETA 2WAAA 2J1VA 4OMCA 3VDBA 2ZEZA 1SG3A 1GMMA 1JYXA 2RJ2A 1JYWA 2C4XA 2WO1A 4UOJA 4A41A 4KI5M 3CZJA 2WO3A 3HEIA 1ULPA 3OGSA 3SEPA 1GOFA 1XNTA 1F4HA 1W9TA 2W9XA 2WABA 5DPNA 2W1UA 1OF4A 1PMJX 3OB8A 2LS6A 3CQOA 2XQXA 3WNMA 5CYYA 4OMDA 2VZRA 3BGAA 4YPJA 4OYUA 4QAWA 2QBXA 2JE8A 1SDDB 2VL4A 2ZEXA 3EYPA 4BK5A 1SHWB 5JXJA 1HN1A 3K4ZA 4BDVB 4D0QA 1JZ3A 2VOTA 3LE0A 4QB6A 3HNBM 5HPOA 4QX2A 2DCKA 2W94A 3W5NA 3WNNA 4MGSA 1UMIA 4RN5A 3UESA 2ORXA 3OGVA 3T2PA 1CIYA 5JXIA 3OEAA 1ULOA 5G04L 3A23A 2VZTA 4ZY9A 4XUQA 1UZ0A 2VM9A 3T0AA 5HXMA 1UYYA 2W3JA 5IFPA 3WNLA 3SEEA 3WF1A 1US3A 1W99A 4W4ZA 2LW8A 3AC0A 3I2GA 4CUAA 2J1RA 3WEZA 1JYNA 2WAOA 4UI9L 3I2JA 3NQHA 5LA0A 2EIDA 1K42A 4A42A 4ET7A 1JZ2A 4P02B 1KGYA 3MV11 4XUTA 1UY1A 1R64A 4LHSA 3MUY1 2ORZA 2VTFA 4L0PA 3ZM8A 3GXUA 5C70A 1DLCA 2VZOA 1XPWA 2CDOA 1NAEA 2YC4A 3THDA 2E33A 2W1WA 1OD3A 3ACFA 3DYOA 4OZOA 2BGOA 2RVAA 2JD9A 1UY2A 4GWIA 4PT6A 3C7GA 2WN2A 1J84A 2ID4A 2WN3A 2VMDA 3LEGA 4QX0A 4JKMA 1UYXA 3I2HA 2W91A 3HN3A 3IAPA 2DDUA 1O8PA 2VCAA 3MO4A 3C7HA 2X10A 2X09A 3A21A 2WZ8A 2C9KA 4LKSA 2VZSA 3D3AA 3C7FA 4A45A 1I5PA 3SKJE 4CU9A 1UY3A 3F2ZA 3A22A 4PF1A 4QB2A 4JKKA 3HJRA 5FUIA 2QQMA 2J1UA 4DXSA 4BK4A 3T08A 2WO2A 3HOBA 5IJRA 4E8CA 1UXZA 2HYXA 2Y6GA 5EJZB 2BBAA 2Y6JA 2ZEWA 4QX1A 1O8SA 3WF4A 3WNPA 1GOHA 1JU3A 1PX4A 3VDAA 1K45A 1JZ7A 2WUHA 5JXGA 2VZVA 4A4AA 3CMGA 2XHNA 3JXSA 2V5DA 1CZSA 3NNGA 2VJXA 2VCCA 2Y8KA 3P1IA 2J1EA 2QQNA 2VCBA 1O59A 4P08A 1TG7A 1KEXA 3C7EA 1IQDC 3K4DA 3C8XA 1RYYA 3MUZ1 3I2KA 1US2A 2QQJA 1CZTA 1YQ2A 3IAQA 3NJXA 4BJ0A 1XNAA 3MBWA 1JZ4A 1JZ8A 1JU4A 5IYYA 3FL7A 3PUHA 3ACGA 2VQTA 3VDCA 2YB7A 2JDAA 4QDSA 4UAPA 5G05L 1UX7A 2W95A 4E8DA 2VZPA 1CX1A 3I3BA 3VD5A 3U37A 3C7OA 3CDZB 3HPNA 1OT5A 3T0DA 4DUVA 1DP0A 4XUNA 3T0BA 2BERA 2XONA 4CUCA 5LA2A 5JR2A 2RV9A 3A7QA 3CKHA 3I3DA 1T2XA 3LEKA 1OF3A 5JXHA 1W0NA 3E1F1 4LPLA 3BN6A 5DMYA 5IHRA 3K77A 4GZ9A 3WF3A 1JHJA 2VMCA 4D8MA 1XC6A 2JKXA 3IIIA 2EIEA 2DCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PX3 A;  2WZE A;  3T2O A;  1W9S A;  5C71 A;  5LA1 A;  2W87 A;  3P6B A;  2L9L A;  4CVU A;  2Y6L A;  5EIY B;  4ZZ5 A;  2VC9 A;  4QB1 A;  4ARX A;  3ACH A;  2VZ3 A;  2WQ8 A;  3OG2 A;  4A44 A;  4RYD A;  2V4V A;  3I3E A;  5B4N A;  5B4X A;  2QQI A;  2X05 A;  1L7Q A;  1UXX X;  2XOM A;  2W1Q A;  1JZ5 A;  1L7R A;  3K46 A;  1LNS A;  5I0D A;  4QDR A;  3FHA A;  2QQO A;  3ECQ A;  1DYO A;  2E31 A;  2VZ1 A;  4XUR A;  3PUI A;  2W5F A;  4CUB A;  2QQK A;  2B4K A;  5A1A A;  4W50 A;  3W5M A;  4HG6 B;  4MOA A;  1JYV A;  1JZ6 A;  4FI9 A;  4Z2A A;  3ABZ A;  3LPF A;  3WNO A;  5F7U A;  1MPX A;  3IDA A;  3WQB A;  2E26 A;  3ETP A;  2PQS A;  4JKL A;  1GNY A;  2J22 A;  3DEC A;  2VZU A;  4DEV A;  1UMH A;  3I2I A;  2Z4F A;  3VD7 A;  4CU7 A;  2EIB A;  4MAD A;  1GUI A;  2W47 A;  5J1X A;  2VME A;  2V72 A;  3UNP A;  3FHQ A;  4XUP A;  3GDB A;  4DEQ A;  1BHG A;  3FN9 A;  4PQQ A;  4W8J A;  3T09 A;  5JMO A;  4JHZ A;  2YG0 A;  2J7M A;  1JI6 A;  4ARY A;  4MO3 M;  3CZU A;  4GWJ A;  4M4P A;  2J1A A;  4P5Y A;  3GM8 A;  4IUG A;  3DYM A;  3K75 B;  3WF0 A;  4DUX A;  3ACI A;  3VD4 A;  1K12 A;  1UY4 A;  4JX0 A;  5DQ0 A;  2HLE A;  1EUU A;  1GU3 A;  1TVG A;  1WKY A;  3OEB A;  4A6O A;  3LEI A;  3WSO A;  4DUW A;  2J1T A;  4DXT A;  1P8J A;  1NKG A;  2J1S A;  4A3Z A;  4AG4 A;  1W8N A;  1OH4 A;  2W92 A;  3WF2 A;  1F4A A;  2YFU A;  2W46 A;  1NX9 A;  2WYS A;  3HNM A;  3LPG A;  5CZK A;  2EIC A;  3LQC A;  2ZEY A;  4CU6 A;  1CZV A;  4AAX A;  5JUV A;  1NUK A;  1H6Y A;  1GQP A;  3K4A A;  2E32 A;  1EUT A;  5LCW L;  4LQR A;  4XUO A;  3EB7 A;  1GOG A;  2Y6H A;  2YFZ A;  2BZD A;  2C26 A;  3IB3 A;  2QQL A;  2VO5 A;  1UY0 A;  2W1S A;  4QDQ A;  3VD9 A;  3HNY M;  3NJV A;  2YC2 A;  3CIH A;  4XZU G;  5C7G A;  1PMH X;  4QX3 A;  4XVH A;  3VD3 A;  1H6X A;  4OUE A;  3THC A;  2WBK A;  4MGQ A;  3OGR A;  4KWU A;  4TXW A;  3GGL A;  4DXR A;  1W8O A;  2WDB A;  3SKV A;  2VQU A;  1K3I A;  3WNK A;  2BGP A;  3I2F A;  1UYZ A;  3MV0 1;  5EJ1 B;  3NRU A;  4M4R A;  1J83 A;  2ZXQ A;  4KMQ A;  1WCQ A;  4TTG A;  1W9W A;  2OKX A;  5IFT A;  2Y64 A;  4QPW A;  4P00 B;  2R7E B;  2VR4 A;  3OBA A;  3J7H A;  1D7P M;  2KD7 A;  2Y6K A;  4CU8 A;  3T2Q A;  2B9V A;  2CDP A;  3I97 A;  4ZZ8 A;  2VZQ A;  3DYP A;  1UWW A;  5DN2 A;  2VMF A;  4BXS V;  4ZXE A;  3UET A;  2WAA A;  2J1V A;  4OMC A;  3VDB A;  2ZEZ A;  1SG3 A;  1GMM A;  1JYX A;  2RJ2 A;  1JYW A;  2C4X A;  2WO1 A;  4UOJ A;  4A41 A;  4KI5 M;  3CZJ A;  2WO3 A;  3HEI A;  1ULP A;  3OGS A;  3SEP A;  1GOF A;  1XNT A;  1F4H A;  1W9T A;  2W9X A;  2WAB A;  5DPN A;  2W1U A;  1OF4 A;  1PMJ X;  3OB8 A;  2LS6 A;  3CQO A;  2XQX A;  3WNM A;  5CYY A;  4OMD A;  2VZR A;  3BGA A;  4YPJ A;  4OYU A;  4QAW A;  2QBX A;  2JE8 A;  1SDD B;  2VL4 A;  2ZEX A;  3EYP A;  4BK5 A;  1SHW B;  5JXJ A;  1HN1 A;  3K4Z A;  4BDV B;  4D0Q A;  1JZ3 A;  2VOT A;  3LE0 A;  4QB6 A;  3HNB M;  5HPO A;  4QX2 A;  2DCK A;  2W94 A;  3W5N A;  3WNN A;  4MGS A;  1UMI A;  4RN5 A;  3UES A;  2ORX A;  3OGV A;  3T2P A;  1CIY A;  5JXI A;  3OEA A;  1ULO A;  5G04 L;  3A23 A;  2VZT A;  4ZY9 A;  4XUQ A;  1UZ0 A;  2VM9 A;  3T0A A;  5HXM A;  1UYY A;  2W3J A;  5IFP A;  3WNL A;  3SEE A;  3WF1 A;  1US3 A;  1W99 A;  4W4Z A;  2LW8 A;  3AC0 A;  3I2G A;  4CUA A;  2J1R A;  3WEZ A;  1JYN A;  2WAO A;  4UI9 L;  3I2J A;  3NQH A;  5LA0 A;  2EID A;  1K42 A;  4A42 A;  4ET7 A;  1JZ2 A;  4P02 B;  1KGY A;  3MV1 1;  4XUT A;  1UY1 A;  1R64 A;  4LHS A;  3MUY 1;  2ORZ A;  2VTF A;  4L0P A;  3ZM8 A;  3GXU A;  5C70 A;  1DLC A;  2VZO A;  1XPW A;  2CDO A;  1NAE A;  2YC4 A;  3THD A;  2E33 A;  2W1W A;  1OD3 A;  3ACF A;  3DYO A;  4OZO A;  2BGO A;  2RVA A;  2JD9 A;  1UY2 A;  4GWI A;  4PT6 A;  3C7G A;  2WN2 A;  1J84 A;  2ID4 A;  2WN3 A;  2VMD A;  3LEG A;  4QX0 A;  4JKM A;  1UYX A;  3I2H A;  2W91 A;  3HN3 A;  3IAP A;  2DDU A;  1O8P A;  2VCA A;  3MO4 A;  3C7H A;  2X10 A;  2X09 A;  3A21 A;  2WZ8 A;  2C9K A;  4LKS A;  2VZS A;  3D3A A;  3C7F A;  4A45 A;  1I5P A;  3SKJ E;  4CU9 A;  1UY3 A;  3F2Z A;  3A22 A;  4PF1 A;  4QB2 A;  4JKK A;  3HJR A;  5FUI A;  2QQM A;  2J1U A;  4DXS A;  4BK4 A;  3T08 A;  2WO2 A;  3HOB A;  5IJR A;  4E8C A;  1UXZ A;  2HYX A;  2Y6G A;  5EJZ B;  2BBA A;  2Y6J A;  2ZEW A;  4QX1 A;  1O8S A;  3WF4 A;  3WNP A;  1GOH A;  1JU3 A;  1PX4 A;  3VDA A;  1K45 A;  1JZ7 A;  2WUH A;  5JXG A;  2VZV A;  4A4A A;  3CMG A;  2XHN A;  3JXS A;  2V5D A;  1CZS A;  3NNG A;  2VJX A;  2VCC A;  2Y8K A;  3P1I A;  2J1E A;  2QQN A;  2VCB A;  1O59 A;  4P08 A;  1TG7 A;  1KEX A;  3C7E A;  1IQD C;  3K4D A;  3C8X A;  1RYY A;  3MUZ 1;  3I2K A;  1US2 A;  2QQJ A;  1CZT A;  1YQ2 A;  3IAQ A;  3NJX A;  4BJ0 A;  1XNA A;  3MBW A;  1JZ4 A;  1JZ8 A;  1JU4 A;  5IYY A;  3FL7 A;  3PUH A;  3ACG A;  2VQT A;  3VDC A;  2YB7 A;  2JDA A;  4QDS A;  4UAP A;  5G05 L;  1UX7 A;  2W95 A;  4E8D A;  2VZP A;  1CX1 A;  3I3B A;  3VD5 A;  3U37 A;  3C7O A;  3CDZ B;  3HPN A;  1OT5 A;  3T0D A;  4DUV A;  1DP0 A;  4XUN A;  3T0B A;  2BER A;  2XON A;  4CUC A;  5LA2 A;  5JR2 A;  2RV9 A;  3A7Q A;  3CKH A;  3I3D A;  1T2X A;  3LEK A;  1OF3 A;  5JXH A;  1W0N A;  3E1F 1;  4LPL A;  3BN6 A;  5DMY A;  5IHR A;  3K77 A;  4GZ9 A;  3WF3 A;  1JHJ A;  2VMC A;  4D8M A;  1XC6 A;  2JKX A;  3III A;  2EIE A;  2DCJ A; 
#chains in the Genus database with same CATH topology
 4TYS A;  3ZXD A;  2WA4 A;  4LO6 B;  3WQ0 A;  5C71 A;  1W6Q A;  2E7Q A;  1CAV A;  1EYB A;  4QT6 A;  5A7S A;  4CVU A;  5FXZ A;  4IEO A;  1PVC 2;  2PLV 3;  3ES4 A;  3O5S A;  5FZE A;  5BYN A;  5EIY B;  2OQ7 A;  5FPV A;  4E4S A;  2D3P A;  4Q0U A;  4AQ2 A;  1QY4 A;  4JGZ B;  1EAH 3;  2JG8 A;  4O9G A;  1GFF 2;  1HN0 A;  2Z42 A;  4D6R A;  3IDC B;  3X29 B;  5DAQ A;  2KM2 A;  1CAU B;  1R08 2;  3AKT A;  1KFU L;  1UXX X;  4JTO A;  2W1Q A;  5FZI A;  1BBT 1;  2NZ9 A;  1BK0 A;  1V00 A;  4GD4 A;  3OF1 A;  4MGT A;  2E9Q A;  2P1B A;  3K46 A;  1LNS A;  1TME 2;  5I0D A;  2YPJ A;  2DBN A;  4YLZ A;  5T5O A;  2QQO A;  3O0V A;  5FUP A;  5FOJ B;  1MS0 A;  2RDN A;  2RMU 1;  4XUR A;  1XE8 A;  3VZL A;  2WII B;  2ZTN A;  4YW1 A;  4GA9 A;  4YZ4 A;  1ASJ 2;  1RHI 1;  4I02 A;  1A78 A;  1JOJ A;  1XYN A;  1LEM A;  2B45 X;  2CY6 A;  2FHR A;  2YBK A;  3M8L A;  1PGL 1;  2PAE A;  1NXD 1;  5EXO A;  4ONU A;  4KWL A;  4HG6 B;  4Q4Y 2;  1EV1 1;  2JDU A;  4GIQ A;  4Q1P A;  2UWA A;  4IV3 A;  1NY7 1;  3RZG A;  3E6D A;  4Z2A A;  1HQL A;  3ABZ A;  5F1R A;  4UFH A;  2BFU L;  1D0H A;  4IE4 A;  1QMJ A;  2ZX3 A;  5F7U A;  4FOQ A;  4LOR A;  1E5H A;  1MS5 A;  1UU5 A;  2D5H A;  1ODN A;  4B4Q A;  5C8C C;  1IZ3 A;  2ET1 A;  4O7X A;  2LRP A;  3N7J A;  1Q43 A;  3MEP A;  3PJY A;  4RGG A;  1OHF A;  3BVC A;  2HYK A;  1OOP B;  1W9Y A;  1PGS A;  3PLQ A;  5ISL A;  3ST7 A;  2LUW A;  3LA2 A;  1C3H A;  4YGE A;  1FXZ A;  1GNY A;  5F39 A;  3SIS A;  2ENR A;  2ILM A;  1PK6 A;  3GJA A;  4AFB A;  1ENX A;  4MYE A;  1E5S A;  1VRH 3;  3I2I A;  2Z4F A;  3J7N A;  4M3C A;  3VD7 A;  5JSR A;  5FP7 A;  4EN6 B;  2EIB A;  3AZZ A;  3KV4 A;  1HXS 1;  4DPN A;  1OLM A;  3PMS A;  4AHY A;  3FUO A;  1OVS A;  3VN4 A;  1O5U A;  1V9U 3;  2V72 A;  2GAU A;  4GAZ A;  4JHT A;  4K21 A;  3OUI A;  4NJ4 A;  4DEQ A;  4FAH A;  1N1V A;  2I45 A;  1S0E A;  5FZG A;  1H8T C;  1SLC A;  1RUC 1;  1SLI A;  4ASL A;  2YG0 A;  5CG8 A;  5FPL A;  1IHM A;  1LHW A;  1Q8Q A;  3M7A A;  4ARY A;  4XFG A;  4GWJ A;  2JIC A;  5FRE A;  2J1A A;  1O3S A;  1CIW A;  1RUO A;  3ZSJ A;  1IGO A;  4HSJ A;  1R1A 3;  5LK5 A;  4Y3O A;  1W6O A;  2XUE A;  2VOV A;  4Z1V A;  4KL1 A;  3MIB A;  4BQW A;  4BHP A;  1H8T A;  2BEO A;  5GLZ A;  2MEV 3;  4BQY A;  3UKT A;  4TWT A;  3AMM A;  4Q5O A;  1UQX A;  5DQ0 A;  4JX0 A;  4Y33 A;  2HLE A;  3ZYH A;  2RM2 2;  3SH5 A;  2FDH A;  1VAK A;  1FOD 1;  1LHO A;  2DWR A;  3K2O A;  5GZG A;  1TVG A;  1WKY A;  1VAL A;  1W06 A;  1DZR A;  2D5F A;  2JJ6 A;  4LMF A;  3RZJ A;  2J1T A;  4RGA A;  2VY0 A;  4DXT A;  1SBF A;  5IVC A;  1CAW B;  4LA2 A;  5SV5 A;  3HQR A;  1HQN A;  4AG4 A;  1WA6 X;  3ELN A;  5JI9 A;  3ZDV A;  3M3O A;  5DZE A;  1NCR C;  2W92 A;  4NRO A;  5GLW A;  4IE5 A;  1YFY A;  3CJI C;  2O8O A;  1N3O A;  5CZK A;  4LUM A;  3FJS A;  3ZR5 A;  2LM3 A;  2HEY F;  3B00 A;  1W8H A;  1E5R A;  2WZR 3;  1APN A;  4XAC A;  3VBS B;  4CU6 A;  5JUV A;  4M0H A;  5FJK A;  2G9F A;  1DLL A;  5A7Q A;  2ZGU A;  2HWC 2;  3CJI A;  3CF6 E;  2WL1 A;  4LKE A;  4HFS A;  1K5M B;  3D0S A;  1AXK A;  5JIA A;  1ULE A;  5LB6 A;  4XAA A;  1LOA A;  3MDP A;  2DUR A;  3H1W A;  1LB2 A;  1VMF A;  4M00 A;  4SBV A;  4CTE A;  3USU A;  4IV1 A;  5CB7 A;  2JKB A;  3V0A B;  1O4Y A;  4K9S A;  3SCH A;  3ZYP A;  3IB3 A;  1PGW 2;  3PVN A;  3B3Q E;  3EO6 A;  3GZE A;  4RR3 B;  1RUI 1;  2UU8 A;  3LFI A;  2WKK A;  5KXE A;  2RS5 1;  1OKO A;  3P3P A;  1YFX A;  4E2Q A;  3BTY A;  1UOF A;  4CZS A;  1H2L A;  3TEY A;  3WW3 A;  3HIF A;  1I6X A;  2ZGK A;  2ZA9 A;  4WVV A;  1ZZ7 A;  5FQ0 A;  1VP6 A;  2A3X A;  5JPN B;  2R32 A;  3N7M A;  3ZFF B;  2AGS A;  4XDO A;  1QNY A;  5FOB B;  1F9K A;  4L8Q A;  1JTZ X;  3O0X A;  3MID A;  2IXJ A;  2PQQ A;  1GZT A;  3MZH A;  1HB2 A;  5FIX A;  1OVP A;  5L36 A;  1JYI A;  4W6X A;  3PUR A;  2P34 A;  3UK9 A;  4AHX A;  1GP6 A;  4RFT 0;  5CFC C;  1MEC 1;  3OUH A;  1I9R A;  4CUG A;  1UOG A;  4BQ2 A;  4QGM A;  4D6S A;  1UN1 A;  1VBB 2;  1QXR A;  4HL0 A;  2ZGO A;  3AP6 A;  1V6J A;  1XYO A;  1ZX5 A;  1LEN A;  2ES3 A;  2JB4 A;  5FLH A;  3L2H A;  1H2M A;  5FYU A;  2E6V A;  4KMQ A;  4JTN A;  1S0J A;  2IXL A;  4DRV A;  2GH2 A;  5CFC A;  1WW4 A;  2Y64 A;  1QU0 A;  1LKN A;  3KHB A;  2ZHM A;  1V6O A;  3URF A;  1YUD A;  2VR4 A;  4DNY A;  3J7H A;  4ITC A;  4QXB A;  3MIE A;  3O12 A;  4CDW C;  1VLN A;  3H7Y A;  4QM9 A;  2UY9 A;  2OPW A;  2PHW A;  2QUO A;  4FFF A;  5D1I A;  2Y6K A;  3T2Q A;  4CXW A;  3TN9 3;  1DCS A;  1QJY 1;  1ZVF A;  2CDP A;  3RDI A;  1FV3 A;  2VZQ A;  2XUM A;  1G9A A;  2UYB A;  4NE9 A;  4YW3 A;  3ZXK A;  1ZRI A;  3ZOI A;  4CCC A;  3H1Y A;  5FRA A;  4QD2 A;  3PUQ A;  5A32 A;  5IWF A;  1TMF 2;  4QWN A;  2IFW A;  1LOE A;  4FPH A;  1HLC A;  2J1V A;  1U12 A;  4I01 A;  2V73 A;  1QXP A;  2XVL A;  1HRI 3;  4Y1Y A;  5IUQ A;  1I1E A;  2BU9 A;  1GMM A;  2ARC A;  3N4M A;  4TZD A;  1JYW A;  1FAT A;  2RS3 1;  1RUH 1;  1RUG 1;  3AFK A;  4KGG A;  2C4X A;  1W3V A;  2CAV A;  4BLI A;  4CP9 B;  5A3U A;  4A41 A;  3O1O A;  3OCP A;  4KI5 M;  2WT2 A;  5E6H A;  1PM4 A;  1JMU B;  1WW6 A;  4RS5 C;  3ZXG A;  5K9Y A;  1RVF 3;  1ULP A;  3OGS A;  5JOY A;  2WFF 1;  1GOF A;  1U0A A;  2YUE A;  4MGK E;  1WD3 A;  3WVJ A;  1W9T A;  4KG8 A;  1CVN A;  2QQU A;  2RDS A;  1OF4 A;  1PO2 3;  1RUJ 1;  4DZG A;  2WNE A;  1HKD A;  1RUD 3;  5A80 A;  4N53 C;  1HRV 2;  2CGO A;  3JB8 A;  4RS5 A;  4IEP A;  2QJV A;  5AC9 1;  4JRA A;  4MHU A;  1X9T A;  5C5U A;  3U1X A;  4OYU A;  5I8Y A;  1W28 A;  2EXH A;  5JI7 A;  2XJS A;  5FP4 A;  3VBR C;  2WNU C;  4LHN A;  3IT8 A;  1MS3 A;  3HAG A;  3PUA A;  4FPY A;  4QGN A;  4NHY A;  4D3W A;  4CCM A;  1OA3 A;  1VBC 1;  3BIW E;  4LBQ B;  4ERO A;  2FCV A;  2ZAB A;  2DCZ A;  4PI0 A;  5JXJ A;  3MW4 A;  1SFP A;  1PVC 3;  2VOT A;  1YCI A;  1LGC A;  1X8M A;  4QB6 A;  4MGI E;  4Q29 A;  4QQL A;  4QX2 A;  4AFD A;  3VBR A;  1W6N B;  5IK5 A;  3HBK A;  5K0U B;  5IVE A;  4DRR A;  5C3O A;  3E6B A;  4FFI A;  2AEN A;  1Y3T A;  4QPI B;  2WYF A;  4KNC A;  4OUS A;  4LEJ A;  2AYH A;  1AYN 2;  1R08 3;  4LR4 A;  4RN5 A;  1QWR A;  2VUC A;  4QKB A;  3BU0 A;  5DDJ 1;  1ULO A;  1TME 3;  5G04 L;  5CAZ A;  1DGL A;  3OBR A;  4QXK A;  2CSG A;  4AVA A;  5KC6 A;  4I0B A;  1OQE A;  5FYS A;  1SLA A;  3OBT A;  4BQX A;  5J37 A;  1VBD 1;  1IPS A;  2GMM A;  2QZ3 A;  2W3J A;  2LAL A;  5IFP A;  3WNL A;  2DUO A;  2F17 A;  3SEE A;  4BWO A;  1US3 A;  2RDQ A;  3DGT A;  2LW8 A;  3AC0 A;  4Q4Y 3;  4CUA A;  3H8O A;  1JYN A;  3J8F 1;  3BI3 A;  5SV8 A;  3WT3 A;  4NMI A;  4DXZ A;  2EID A;  4IEY A;  4IE0 A;  4PCR A;  2D6N A;  3VKO A;  2VXJ A;  4OZX A;  2YU2 A;  3LGR A;  4ZXK A;  4EWD A;  5ABJ C;  2PHD A;  1AXY A;  1YQ5 A;  3VDD B;  1C28 A;  3AZV A;  3AP9 A;  3HBZ A;  4LHS A;  3FLT A;  4X8P A;  5DUU A;  5FY0 A;  5I0U A;  4BME A;  4L0P A;  1FI2 A;  1PMI A;  1VBE 1;  5C70 A;  1FNZ A;  3QD6 A;  4P9J A;  3VKN A;  3WX5 A;  2VEC A;  2BWC A;  3ZFG A;  1IS4 A;  1DLC A;  2VZO A;  1W8U A;  2YC4 A;  3THD A;  4B4R A;  1J1L A;  2XJU A;  4MV2 A;  4QKD A;  4F3J A;  2HBT A;  5FY8 A;  5FO7 B;  3DYO A;  3H0O A;  5C6C A;  5LBE A;  3DPR B;  3AKS A;  3I8T A;  4FP2 A;  4Y1X A;  2DBI A;  1JW6 A;  1RUE 2;  1KRI A;  3HVD A;  2ADE A;  1AR9 1;  4NO4 A;  5H9Q A;  1G6N A;  3LEG A;  1LOB A;  4QX0 A;  4BPZ A;  5BNO B;  5K7P A;  4Y5T A;  2YHJ A;  1VB4 A;  5IK7 A;  2EAA A;  1POV 3;  2P37 A;  4NHX A;  5BNP C;  1SLL A;  3I2H A;  4A7Y A;  1YO8 A;  2CTV A;  4I3G A;  1W6Q B;  1KD7 A;  3KCC A;  1O8P A;  1CAV B;  3MO4 A;  1N3Q A;  1OFS A;  4YNI A;  2XLF A;  1BMV 1;  2QTW B;  2P6H A;  2X09 A;  4XPV A;  4FPE A;  4KU8 A;  3T1L A;  1AR6 2;  1H1A A;  1GSL A;  1OFN A;  5BNP A;  1LED A;  2RM2 3;  2JG8 B;  4A45 A;  3MW2 A;  2ZAC A;  4Y24 A;  1I5P A;  4A7Z A;  5FPA A;  5C33 A;  4L2N A;  3LA7 A;  3M3I A;  3ZYR A;  3PHM A;  4QB2 A;  4FAG A;  1QOS A;  2NYY A;  4JRL A;  2X5I A;  4MX3 A;  2WWS A;  4F8A A;  1VPH A;  3VKL A;  2J1U A;  5HV4 A;  4PI2 A;  3RZL A;  2HEV F;  1KIT A;  2HEW F;  1UPS A;  4N43 A;  3T08 A;  3JU9 A;  2C5D A;  3HOB A;  3VLB B;  5IJR A;  3LDK A;  4E8C A;  1UXZ A;  3HQU A;  4WM7 A;  1QJZ A;  1RMU 1;  2Y6J A;  5FCC A;  1O8S A;  4A2U A;  1GWK A;  1GOH A;  1WLW A;  4AGV A;  1LOC A;  1M4W A;  3BIE A;  3OBZ A;  4AGR A;  3GZA A;  3NJZ A;  1IS3 A;  5JXG A;  2ZMK A;  1N1S A;  4LUL A;  3J26 N;  4Z92 B;  2HWC 3;  2VVF A;  4MGY E;  3ROU A;  2FQP A;  2WS9 2;  1OSG A;  4X6R B;  3JXS A;  2OPK A;  3CNA A;  4HT1 T;  4KBB A;  3GNE A;  3NNG A;  4H7M A;  1ND2 C;  2SLI A;  5LK7 B;  2YRO A;  2PLV 1;  1GZC A;  4P08 A;  5L7O A;  4EN8 B;  2IXC A;  3C7E A;  4AED A;  1ONA A;  3RI9 A;  4W6Y A;  1EAH 1;  1PK6 B;  3GHN A;  2QCS B;  2XDV A;  5T50 A;  1MQT C;  2RS1 2;  1US2 A;  5IVF A;  5KHG A;  2Q30 A;  1GZ9 A;  1CZT A;  4M3C B;  1AX1 A;  2AR6 A;  4B3N A;  3VGI A;  4HKL A;  3ZSE A;  2G19 A;  2IZW A;  1JZ4 A;  1Y7B A;  2DF7 A;  1H4G A;  4DMI A;  3NW4 A;  4B7K A;  2GAL A;  3HT1 A;  2PAM A;  3AVS A;  3NNJ A;  2H0B A;  2H6B A;  3AKQ A;  4CEY C;  3K51 A;  2FCT A;  2A7A A;  4FQZ A;  1UF2 C;  4RHV 1;  1KS5 A;  2I07 B;  5K8S A;  3BYW A;  1VBB 3;  5DAW A;  3U4X A;  3U37 A;  1X9P A;  3CDZ B;  2WNO A;  4BQ3 A;  3IIA A;  3PTY A;  4ZU4 A;  2PHT A;  4XBQ A;  4CEY A;  1BQP A;  4YW4 A;  1H8T B;  5A7O A;  4IW3 A;  4XC9 A;  2BQP A;  2TEP A;  4YM3 A;  3A7Q A;  1ZYB A;  3LEK A;  4XIK A;  2FCU A;  3JBG 2;  2H6C A;  5JXH A;  4U36 A;  1ZRE A;  1UW8 A;  4OQ9 A;  1C1F A;  4EWA A;  1FMD 2;  3E1F 1;  2OS2 A;  3AK0 A;  3BN6 A;  4Z2W A;  3NST A;  2LTN A;  3BCW A;  3SC7 X;  3K77 A;  4IES A;  3WF3 A;  1DGW A;  1SFN A;  1EY2 A;  1X36 A;  4D8M A;  2WQZ C;  3S7E A;  4IEX A;  1W6P A;  2JX9 A;  2FZ1 A;  1PX3 A;  1TMF 3;  3MLJ A;  4ISR A;  1W9S A;  5KBF A;  5LA1 A;  2Q8D A;  5FZ6 A;  5F3I A;  2R0H A;  2K46 A;  3KV6 A;  1X82 A;  4NUB A;  2PFW A;  4LJH A;  1Q8O A;  4XIO A;  1DIW A;  1RIN A;  2D97 A;  3ZLI A;  4ZKT B;  4FSJ A;  4RQP A;  4ARX A;  4S2G A;  2VZ3 A;  3CJI B;  3OG2 A;  4HON A;  4RYD A;  1UYP A;  2PEL A;  1UIK A;  4JAA A;  3GAL A;  5JZG C;  5LZ6 A;  4AI8 A;  2IXK A;  1HJF A;  5B4X A;  4CYD A;  5LY2 A;  2VQA A;  3HQX A;  1KDK A;  3USU B;  5BY5 A;  5FZ8 A;  4NHL A;  5FLI A;  4AI2 A;  1RL3 A;  1JZ5 A;  1ZBA 1;  3L2Y A;  4OI4 A;  4GWN A;  3ZXA C;  2A6Y A;  2OT7 A;  1HRV 3;  2YY1 A;  1PZ7 A;  3ECQ A;  5HBA A;  2E31 A;  3AVR A;  5FV3 A;  4HBN A;  4GAL A;  5JZG A;  1YFW A;  4B29 A;  3AJY A;  3S57 A;  5DG2 A;  3RJR A;  5GJ6 A;  5FQ0 B;  1JXN A;  1Q8V A;  4LBM A;  2QQK A;  2Q1F A;  1J1T A;  4GH4 C;  4CUB A;  1H8V A;  2ZKN A;  4BM8 A;  3CL1 A;  4BOW A;  4NII A;  4EN0 A;  2X29 A;  4P9X A;  1JYV A;  4Z82 A;  3N7K A;  3TEW A;  1K5J A;  1MVQ A;  2R06 1;  4FPF A;  4CDX A;  2D3S A;  1GLH A;  4CCO A;  5C4W C;  4OI0 A;  3WNX A;  1AUY A;  3QBQ A;  1MPX A;  5KHJ A;  3E5X A;  4GH4 A;  4E2G A;  4BMB A;  3WQB A;  3WG4 A;  1GYK A;  4L9B A;  1KDM A;  4WZF A;  1ZZ8 A;  4LBQ A;  3UJO A;  5A6Q A;  1WLD A;  4XF1 A;  5EYY A;  5L19 A;  1BZW A;  4XTM A;  1DDL A;  2BOI A;  3N36 A;  3VBU C;  1AYN 3;  4DEV A;  5KR7 A;  5FK8 A;  5CFC B;  1QF3 A;  5C9A C;  1AYM 2;  4QKN A;  2PHL A;  1H1M A;  3ZSL A;  4MZU A;  3LOB A;  1GUI A;  3VBO A;  5J1X A;  2ARE A;  2VME A;  1W8W A;  1ALY A;  3UNP A;  1PO1 1;  3AZX A;  4P5H A;  4YW5 A;  4FPJ A;  4AI0 A;  2A3Y A;  2ZHL A;  3GDB A;  4PDW A;  1OMI A;  2ZGT A;  1COV 2;  1IQA A;  4LO5 B;  1IS5 A;  4RGK A;  1LUL A;  5A33 A;  4ATF A;  1CR7 A;  3AXE A;  4CDW B;  2J7M A;  1JI6 A;  3ZYI B;  2XJV A;  3HD8 B;  1YLL A;  2ZGN A;  1REF A;  2Q1Z B;  4I09 A;  3CO2 A;  4MO3 M;  5A32 B;  4PBP A;  3KMH A;  4P5Y A;  5GLU A;  3SH4 A;  1OH3 A;  3SLI A;  3GM8 A;  4IUG A;  5KHH A;  4LUK A;  1ZZ9 A;  5LRR A;  3JD7 1;  4XXA A;  4DUX A;  5FYY A;  3V0B A;  1TEI A;  5E1R A;  1UCX A;  2YDE A;  4QXH A;  4LBQ D;  5FZ1 A;  2XHK A;  1RC6 A;  3ZYG A;  4NIH A;  4KG0 A;  4OHV A;  2KA3 A;  3JZV A;  5BNQ A;  4LBN A;  2RR1 1;  2B42 B;  2EAK A;  1UNB A;  4A6O A;  4AR2 A;  3WUD A;  3D6E A;  3LEI A;  2BUK A;  3WSO A;  4E2S A;  4UBH A;  1RUF 2;  2J42 A;  5BUV A;  4SLI A;  2J1S A;  4A3Z A;  4AQT A;  5J3U A;  4WVZ A;  1PZ8 A;  1RUE 3;  1W8N A;  3QAC A;  1OH4 A;  4GKX A;  5H9R A;  4RS5 B;  1F4A A;  2YFU A;  5A7N A;  4DOU A;  5F8P A;  3WDW A;  2BTV C;  2JIG A;  2RE9 A;  1NX9 A;  5APA A;  4NPL A;  2WYS A;  5FZL A;  1HB4 A;  3HNM A;  3LPG A;  4E4D X;  1KFX L;  5FY5 A;  1W2N A;  3TN9 1;  1O7F A;  3ZPY A;  4GB3 3;  4LK7 A;  3AP5 A;  3TWI A;  1H6Y A;  1SQ4 A;  4N53 B;  1GQP A;  3WDU A;  1LHN A;  1G8W A;  1N3P A;  1O5L A;  1D2Q A;  2PHF A;  3MW3 A;  5FMB A;  4G4F A;  3SIT A;  5LCW L;  1NZI A;  1R1Z A;  2WT0 A;  1MS8 A;  4UFK A;  1ENR A;  3RFR A;  4AL9 A;  2CL2 A;  4NPM A;  2R07 2;  3ZYJ B;  1AR6 3;  3RS6 A;  2XKO A;  5DAV A;  3VBR B;  3WCR A;  4NRM A;  4CEW C;  1FPN 1;  3BOD A;  3MFA A;  3SXW A;  2VO5 A;  4QPG C;  1UY0 A;  3VL9 A;  2W1S A;  2EXK A;  3HNY M;  3NJV A;  1RXF A;  1SFY A;  1QJU 1;  3CIH A;  4JDO A;  4XZU G;  4Z8B A;  1PMH X;  1RVF 1;  1NQJ A;  3WLU A;  1WGP A;  3GBW A;  3WW2 A;  2OXB A;  3VD3 A;  2HJI A;  1BLZ A;  1D4M 3;  4R9A A;  4CEW A;  5C8W A;  1BBT 2;  2DFB A;  2WBK A;  4OHX A;  1RUD 1;  3J7L A;  1QDC A;  2ZGQ A;  4W6W A;  2FZ2 A;  4FTB A;  2WNV C;  1YHF A;  3SMH A;  3THT A;  3V64 A;  4DXR A;  5HCA A;  2BBV A;  1HQW A;  1AHS A;  1NOV A;  5FYM A;  2YMZ A;  3KCY A;  4F83 A;  2DVD A;  2RMU 2;  2VQU A;  2GSY A;  4OHW A;  2VBB A;  3B5L B;  1HV0 A;  4BE3 A;  4OUM A;  1Q56 A;  1PGL 2;  2WS9 3;  5EJ1 B;  3EHK A;  4YAR A;  4GWM A;  4AXO A;  2AAC A;  5A1L A;  1EP0 A;  5I91 A;  3OJB A;  4CCK A;  5E8A A;  2OW4 A;  5FBZ A;  4YGD A;  5FYZ A;  1BJQ A;  1N1Y A;  2ZXQ A;  1IS6 A;  1OLR A;  1SAC A;  1WCQ A;  1NY7 2;  4CDU C;  1W9W A;  5ACA 2;  5IFT A;  4QPW A;  2R7E B;  2MNG A;  4FO9 A;  1J58 A;  2XWJ B;  2X8K A;  4TN7 A;  4HVO A;  4XDQ A;  3EJK A;  4YW6 A;  1HX6 A;  3DUI A;  3B94 A;  3ZFG B;  3ZVX A;  2C9A A;  3V56 A;  4COY A;  4XF0 A;  3CLP A;  1H9P A;  1D7P M;  1GP5 A;  5FKC A;  2KD7 A;  3MIH A;  4JZR A;  1CD3 G;  2E63 A;  5JIU A;  4CDQ C;  2D6K A;  1R08 1;  2WT1 A;  2B9V A;  1WBF A;  3SHR A;  4CPB A;  3TRS B;  1IKP A;  3VB9 A;  3DYP A;  3IPV A;  4GJZ A;  1NT0 A;  4BIO A;  5FMO S;  1A8M A;  1X50 A;  4COZ A;  1LHV A;  2PN5 A;  1C8M 1;  4J1W A;  4NN0 A;  1HXS 2;  2VAU A;  2VMF A;  4XF3 A;  3UET A;  2XBO 2;  4N9I A;  3JCI A;  2VUA A;  4OMC A;  3OSD A;  5C8C A;  2EAL A;  5FXW A;  4GXL A;  3RYK A;  1JYX A;  2BDR A;  2UUR A;  5FWE A;  3KGZ A;  1C4R A;  2XJQ A;  4IEQ A;  4M3C F;  5I8T A;  4XCA A;  5L9R A;  1Y43 B;  5IVV A;  4UOJ A;  5D8A C;  5C3P A;  2GC0 A;  2P17 A;  2VBD A;  4R52 A;  4AVB A;  5J09 A;  4Q2F A;  1Z0H A;  2A70 A;  3O1U A;  3UKV A;  5GKA C;  2WO3 A;  3HEI A;  1YXW A;  3RZM A;  3POS A;  3VZO A;  1NA1 C;  4XHB A;  5FTT C;  3BTZ A;  5EQU A;  3MIG A;  2W9X A;  1LES A;  3KZ4 C;  4N9H A;  3JBG 3;  3FFZ A;  5DPN A;  1PMJ X;  5BNP B;  2ZKL A;  3ZFE C;  4XBL A;  2HWE 2;  3UYJ A;  5D8A A;  1S0F A;  3CQO A;  3H1M A;  3H8U A;  1S4C A;  5CKM A;  4G9S B;  1FMD 3;  3WNM A;  3QLQ A;  2X5I B;  3ZXF A;  4COU A;  1ODM A;  4DB5 A;  2Y34 A;  2QBX A;  1NA1 A;  3BOP A;  5FZC A;  2JE8 A;  3EMR A;  2XLA A;  1G7Y A;  4N43 B;  1XSQ A;  3P3N A;  3ZFE A;  1WW7 A;  4C0B A;  2I74 A;  4WM7 B;  1QJX 1;  4AVS A;  3I3Q A;  1SZB A;  3N35 A;  4RA0 A;  3K4Z A;  4UBG A;  3S5A A;  1JZ3 A;  3A0N A;  3ON7 A;  2XH6 A;  5HPO A;  2QFE A;  4YW2 A;  1W9F A;  2DCK A;  5I0R A;  3HN1 A;  1RGS A;  1F35 A;  1VJ2 A;  3WHU A;  3UL2 A;  2AH2 A;  1VE0 A;  2D6M A;  3PNA A;  1NLQ A;  4L97 A;  5GZE A;  3WNN A;  3W5N A;  2VQ0 A;  4WV8 A;  5J36 A;  1F31 A;  5AVA A;  4ZU5 A;  2FMD A;  2F4P A;  5JXI A;  5L7O B;  2EXI A;  1NCR A;  1W2U A;  4AED B;  4UFI A;  2H0V A;  3H8X A;  3A23 A;  4IE7 A;  1V6N A;  3E5U A;  2PXJ A;  4XUQ A;  5TSW A;  1ST8 A;  5IK8 A;  3T0A A;  3RYP A;  3A0K A;  1NCQ C;  2DU1 A;  1UYY A;  1AJO A;  1RUI 2;  2A1X A;  1QQP 1;  4C1W A;  1UIJ A;  4YVW C;  2CAU A;  2CU5 A;  1QHD A;  1PNF A;  4N8M A;  2VMG A;  4C1X A;  3GZT B;  1VIW B;  2DV9 A;  1UX6 A;  1H0B A;  2IFR A;  2IUW A;  4W4Z A;  4DY3 A;  2Q1M A;  2J1R A;  3WEZ A;  4LIT A;  5FAX A;  2RJK A;  3WW4 A;  2WAO A;  3I2J A;  3AFG A;  4NRP A;  1OI6 A;  1PIV 1;  1BEV 1;  1OC1 A;  1K42 A;  4Q0P A;  2NLR A;  4ET7 A;  3ALQ A;  4YVW A;  1KGY A;  3MV1 1;  4CRQ A;  4FPK A;  2GZW A;  3M3E A;  3ACL A;  3ILR A;  4RSU A;  2VTF A;  3K3N A;  4OFG A;  3ZM8 A;  1M06 G;  2DUP A;  2JG9 C;  2HWC 1;  3OPW A;  5FP3 A;  5FZ7 A;  4CEY B;  3WW1 A;  5CNA A;  1NAE A;  2B8M A;  2BNO A;  1AYM 3;  2IVJ A;  1UOJ A;  4CCE A;  2W1W A;  1OD3 A;  3ACF A;  4C90 A;  4OZO A;  4LA3 A;  4EZH A;  2DCY A;  1PGW 1;  1DYP A;  3KF5 A;  1RED A;  1XU2 A;  1UY2 A;  3H9A A;  2ZMN A;  1D2S A;  4IND A;  4HKO A;  2D98 A;  3D8C A;  1POQ A;  5CU1 A;  1COV 3;  1MS1 A;  2OX0 A;  2B9U A;  2VMD A;  4Q4V 1;  4E4Z A;  1N47 A;  1G9C A;  2NM1 A;  1DQ0 A;  4YM2 A;  4GJY A;  5EZW A;  4IEW A;  1W6P B;  1ZBE 1;  4JKM A;  3Q9O A;  3WQ7 A;  1QJY 2;  1W8T A;  5CAD A;  4AFC A;  3ZXJ A;  4LE3 A;  1AZD A;  1F15 A;  3HN3 A;  5C3R A;  2LRO A;  4COW A;  3IAP A;  2WLP A;  4XEZ A;  1DFQ A;  5DAX A;  4C91 A;  3U4S A;  1DBN A;  4YM0 A;  4RFR B;  4DIQ A;  3OGG A;  1CQ9 A;  1OA4 A;  3LDR A;  3R4U A;  1N1T A;  4BIS A;  2C9K A;  4MSV A;  4LKS A;  4QQO A;  4OHY A;  4CDW A;  2OZJ A;  2OZ6 A;  4H3W A;  4RQP B;  5FUN A;  3KVB A;  3D3A A;  3C7F A;  5BV6 A;  2O8Q A;  3MYX A;  4BXF A;  2RS3 2;  2Q5T A;  3N9P A;  4F7Z A;  4CU9 A;  1T6G C;  4OUL A;  4PF5 A;  2TBV A;  3A22 A;  2IVI B;  4ZPI A;  1QH7 A;  1RUF 3;  4MVT A;  5FY4 A;  3H3Z A;  4EYU A;  5LWB A;  4JKK A;  1CON A;  3T1M A;  2HKX A;  3Q8A A;  2QQM A;  2A6W A;  3B02 A;  4Q8L A;  5CFD C;  1BCX A;  1NG0 A;  1HB1 A;  4DXS A;  2WFF 2;  4JDM A;  1SBD A;  3JQX A;  4Y4R A;  3OD0 A;  2VGD A;  2IXH A;  3R4S A;  3PL0 A;  1RUJ 2;  5EWS A;  5JZG B;  2VW2 A;  1KJL A;  1YRZ A;  4HK8 A;  5T55 A;  1JOB A;  3ILF A;  4BIF A;  2JDK A;  3LF7 A;  3OPZ A;  1H2N A;  2K9Z A;  2SBA A;  1Z7S 2;  2ZEW A;  4QX1 A;  4UFL A;  3RQ0 A;  3WF4 A;  3O1P A;  1QGL A;  3VDA A;  2ZGL A;  1K45 A;  1JZ7 A;  3KQ4 B;  2WUH A;  4BLJ A;  2VZV A;  3FBY A;  4CDX B;  2VNR A;  3CMG A;  4MUV A;  2R04 1;  2V5D A;  4AQS A;  1CZS A;  4XMA A;  2HWF 1;  4YGC A;  5FZ3 A;  4D6Q A;  2R07 3;  3P1I A;  3PU3 A;  2J1E A;  3FZ3 A;  2QQN A;  2VCB A;  4GH4 B;  3I54 A;  3GF6 A;  3UGG A;  1O59 A;  1AR7 2;  1YIP A;  3IDB B;  4MET A;  1KEX A;  4Y22 A;  4N7I A;  4Q4X 1;  1SPP A;  4N53 A;  2FDK A;  5FR3 A;  2HWB 2;  1CX4 A;  1OQ1 A;  1RYY A;  3S30 A;  3I2K A;  3Q8B A;  5BNN C;  4JV4 A;  3FE5 A;  2ERF A;  1DQ2 A;  3NJX A;  3BKZ A;  2WNU A;  1W8F A;  1XNA A;  1JZ8 A;  3VBO B;  1D4V B;  1BBT 3;  2PHR A;  2P6C A;  4Y1U A;  3PUH A;  5IYY A;  1O6U A;  4FOV A;  4FCA A;  2VQT A;  1VMJ A;  3NMB A;  4PDW B;  1G86 A;  2WSU A;  1GQG A;  2BNM A;  1LR5 A;  5D21 A;  1Y9Q A;  4B1L A;  3T3Y A;  2VVE A;  1VBD 2;  1O4Z A;  2QZ2 A;  2RMU 3;  1BXH A;  4UAP A;  2Q8O A;  5A33 B;  5CBL A;  1ULD A;  4JDN A;  1WW5 A;  2WA3 A;  1UX7 A;  2W95 A;  1AL0 G;  2VZP A;  2XL7 A;  4AOC A;  3KLS A;  5FP8 A;  5HCH A;  3BB6 A;  4D7S A;  3Q8F A;  4PLO A;  4K3U A;  3HPN A;  3NV2 A;  5A7W A;  4K6B A;  3T0D A;  1O3T A;  5JSO A;  1B35 C;  3J8F 2;  1W2A X;  1ASJ 3;  2QKD A;  3LIG A;  4JGZ C;  5ACA 3;  5FY9 A;  3U0Z A;  3V0B B;  3WP5 A;  1LJ7 A;  2D6P A;  5FLJ A;  2JWP A;  5FYB A;  2XPJ A;  3ZYB A;  3CKH A;  5GM0 A;  1Y4W A;  3VHR A;  3W20 A;  3OUJ A;  1WMX A;  2P2K A;  4P9Y A;  5FMO L;  1NXM A;  1B35 A;  4XFA A;  1VBE 2;  1R09 2;  4KGQ A;  5FZO A;  5DMY A;  3ZIX A;  5IHR A;  3WY6 A;  1NYW A;  4NAO A;  1G9D A;  4GZ9 A;  2AEY A;  4KWJ A;  2DCT A;  1XC6 A;  2JKX A;  5CA6 A;  3WDT A;  1AX2 A;  2EIE A;  2JEN A;  2ADD A;  2DCJ A;  1HJG A;  1AL2 2;  4YWA A;  5FYT A;  2JDN A;  2XBO 3;  2WZE A;  1H4H A;  3T2O A;  4FXK B;  2Y0O A;  2Y26 A;  2W87 A;  2JDZ A;  3WDY A;  5ABJ A;  3PVO A;  4HPK A;  4KBZ A;  1SCS A;  2GC1 A;  4MXV A;  1AR9 2;  4GUL A;  5FP9 A;  2X53 S;  3TBD A;  3OGJ A;  4ZS3 A;  3ZKU A;  1WA4 A;  3RWK X;  5KC5 A;  3ACH A;  2XL9 A;  3TEX A;  3ES1 A;  4A44 A;  5IAT A;  5KHK A;  2E51 A;  5BPX A;  3ZDS A;  2V4V A;  4YG3 A;  5B4N A;  2VUD A;  2UWB A;  1OOP C;  1B09 A;  5FMC A;  3AYA A;  2X05 A;  2HH9 A;  1GBG A;  2XR4 A;  1BMV 2;  2XOM A;  3WQ1 A;  4HN0 A;  2G1M A;  4URT A;  5D2A A;  1YYN A;  4OVE A;  2XQR A;  2HWE 3;  2AEZ A;  4M3C E;  2P3I A;  4FPC A;  2CGP A;  4IL7 A;  1AXZ A;  4QDR A;  4BQ1 A;  3RZH A;  3H3U A;  3WP6 A;  1OLM E;  1DYO A;  3HWJ A;  4ISQ A;  2R16 A;  5FZH A;  4NIA A;  4AZZ A;  1T6B X;  1D0G A;  3PUI A;  4R4Z A;  2W5F A;  5FZK A;  1J3P A;  3MGU A;  4IGO A;  4CEW B;  5EPA A;  4Q8K A;  4W50 A;  5A3W A;  3I3M A;  4K1Y A;  1WCK A;  4I2O A;  1RUE 1;  3VZJ A;  1KS4 A;  1UOB A;  1UKR A;  1QJE A;  1JZ6 A;  1IG3 A;  1FT9 A;  4FI9 A;  4AI3 A;  4YVS C;  3LPF A;  1VBA 1;  2E7T A;  5M0T A;  4FT8 A;  3TEZ A;  3WNO A;  3WIN E;  2D3R A;  1C1L A;  5FK7 A;  4HVR A;  4GB3 1;  3GBG A;  5C3Q A;  1WCU A;  3IMN A;  3IWZ A;  1SDW A;  1H1I A;  2E26 A;  2PYT A;  3PIJ A;  4GQ7 A;  3IBM A;  3ETP A;  2PQS A;  4IEU A;  4JKL A;  4XJU A;  5T3N A;  3ME2 A;  2J22 A;  2VH9 A;  1C5I A;  1ZA7 A;  2VZU A;  5F2W A;  3R6S A;  4CCJ A;  4YVS A;  3AZY A;  1IPK A;  2R49 A;  5A3L A;  1W03 A;  5IAX A;  1AR6 1;  4HZF A;  4V2V A;  4S2F A;  4CU7 A;  2DU0 A;  3THP A;  4YZ2 A;  2W47 A;  5KWR A;  4E27 A;  3BUC A;  5JR7 B;  4WVM A;  3T4H B;  4CXX A;  3O1S A;  1UD1 A;  4N90 A;  4XUP A;  3FN9 A;  2EVX A;  1QOO A;  5JMO A;  3IPV B;  2DVB A;  3POF A;  5DAB A;  3EXU A;  3O14 A;  4BU2 A;  4YRD A;  2XG3 A;  3ZSK A;  1D4M 1;  3EBR A;  3T4V A;  2WWU A;  1ZNP A;  5DZG A;  3DKW A;  3RWN A;  1ND2 A;  2ZS6 B;  1DZT A;  1DQ1 A;  1OQD A;  4D69 A;  5C8C B;  3WOG A;  3DYM A;  1UZY A;  3WF0 A;  4P9I A;  1ZRC A;  5ERL A;  2XVG A;  2D44 A;  1DU3 D;  1GR3 A;  1S1A A;  1RIR A;  2IWG B;  4BZ4 A;  3VD4 A;  1K12 A;  1Q3E A;  2QQV A;  3W9A A;  1UY4 A;  1RIT A;  3GCX A;  1WZX A;  4RHV 2;  1AR8 2;  1EUU A;  4UW5 A;  4WVW A;  1MQT A;  4XF4 A;  2WS9 1;  5F9T A;  1GU3 A;  1OXC A;  4FOY A;  4AEM A;  1BKZ A;  2ZJC A;  3OEB A;  2VBP A;  3PIG A;  3KQR A;  4J1X A;  3LIH A;  4RR3 C;  1XQN A;  4DUW A;  1NE4 A;  5C3S A;  4OCT A;  1NKG A;  2VNG A;  3D0J A;  4YW7 A;  2XJT A;  4LO8 A;  2P3Y A;  4QU1 A;  4QMA A;  5D8A B;  1W3X A;  3BAL A;  4Q4W 2;  2GU9 A;  3WF2 A;  4WM8 C;  5LBC A;  2NN8 A;  4D7Y A;  1ND3 C;  4XFF A;  2W46 A;  1Y9G A;  3FHI B;  4Y1Z A;  2ARA A;  1NA1 B;  5FY1 A;  1F5F A;  4JGY C;  4G3Y C;  1H2K A;  5KXD A;  2EIC A;  1QJY 3;  1GNZ A;  2ZEY A;  3LQC A;  4FVV A;  1CZV A;  1DGW X;  1NLR A;  1NUK A;  2JDM A;  4XQW A;  4IDZ A;  1ZZC A;  4AAX A;  4MGZ E;  2PHX A;  4WM8 A;  2VUJ A;  3K4A A;  2IXI A;  1ND3 A;  4LQR A;  4LTA A;  4XUO A;  4XBN A;  1VRH 1;  2Y6H A;  2ZX1 A;  1MS4 A;  3DF0 A;  2A6V A;  2YFZ A;  4JGY A;  2BZD A;  3UV9 A;  3KHC A;  3ORJ A;  3ITQ A;  1RB8 G;  1QJF A;  1S2E A;  1XBF A;  4P9L A;  4L11 A;  1RXG A;  5J96 B;  2QQW A;  4TSV A;  5DXD A;  5FYI A;  1V9U 1;  2RS3 3;  3PDQ A;  4MG2 A;  2DVA A;  2W0X A;  3O1V A;  4QDQ A;  3BU7 A;  2B7Y A;  3FUQ A;  3MIC A;  5I0T A;  1UAI A;  2N7G A;  4M01 A;  4EWE A;  5A1F A;  5C7G A;  1RJ7 A;  3PVE A;  4ZON A;  1NCR B;  1S0B A;  4IQP A;  1JOD A;  4LBL A;  4QX3 A;  3N9Q A;  4XVH A;  4K20 A;  1H6X A;  2YBS A;  5EV7 A;  3ZPO A;  1RUJ 3;  1ZBA 2;  3TOJ A;  1R1A 1;  4MGQ A;  3OGR A;  4LOT A;  4KWU A;  4TXW A;  5H9P A;  2OQ6 A;  2IC1 A;  2VPV A;  3GGL A;  3BPZ A;  5LEJ A;  2A75 A;  1Z7S 3;  1W8O A;  2WDB A;  4A7K A;  5IK4 A;  2MEV 1;  4GMP 3;  4QPY A;  3OY8 A;  3VKM A;  1OPM A;  4PHZ A;  5CVR A;  5ANN A;  1MZF A;  3WNK A;  5L9V A;  3I2F A;  5LRS A;  4AGG A;  2UYA A;  1UYZ A;  3MV0 1;  4LKF A;  1NE6 A;  3NRU A;  1J83 A;  1ZRD A;  1QOT A;  3IN9 A;  3PTR B;  4YVW B;  3WP4 A;  1F5J A;  2R06 2;  4OLL A;  3WDX A;  1AR7 3;  4BYY A;  4P00 B;  3ZKY A;  1LAJ A;  2DVF A;  3OBA A;  1ULF A;  2HWB 3;  3JQW A;  1TQ5 A;  4AAP A;  2XML A;  4QHO A;  4XOG A;  2VOW A;  5A7P A;  4CU8 A;  2HBU A;  5FY7 A;  4BQ4 A;  4AEJ A;  2W08 A;  3DCQ A;  4EJR A;  3FLP A;  2WZR 1;  3I97 A;  4PBO A;  4ZZ8 A;  1BYH A;  2GME A;  1OD5 A;  1IG0 A;  3D4K A;  1UPI A;  2TUN A;  4XFH A;  5DN2 A;  4BXS V;  3TNQ A;  4ZXE A;  2RG4 A;  2WJS A;  1UZW A;  2WAA A;  4KWK A;  5C4W A;  5A3T A;  4Q1R A;  1VBD 3;  4KQ7 A;  1PO1 2;  3ZXL A;  3AL6 A;  3U78 A;  1W05 A;  1A8D A;  2P4E A;  1JH5 A;  1L7L A;  3AJZ A;  4P9G A;  3UGH A;  4CSW A;  4CA9 A;  3OPT A;  4H55 A;  3ZFE B;  1J59 A;  3VBU A;  5F3C A;  1GWM A;  1X7N A;  3J8F 3;  1S0G A;  1JYT A;  1WD4 A;  1JBC A;  2JB8 A;  1RTV A;  3A4U A;  3NV1 A;  5C9A A;  5K0U C;  5JDB A;  3SEP A;  4P14 A;  2W52 A;  3GZU C;  2HWD 2;  4XHX A;  1XNT A;  4CXY A;  4QPI C;  5FDB A;  3OD4 A;  3F95 A;  3JD7 2;  1F4H A;  1S2K A;  2D6L X;  2WAB A;  2W1U A;  3OB8 A;  2YV8 A;  2JE9 A;  2LS6 A;  1LEC A;  3WHT A;  1POV 0;  2XQX A;  5CIR A;  1VBE 3;  1R09 3;  2CYF A;  3POE A;  1WCS A;  3OTF A;  4OMD A;  2VZR A;  5FBJ A;  2RR1 2;  3BGA A;  4YPJ A;  5A6Y A;  3D82 A;  4QAW A;  1O3Q A;  2D93 A;  2O1Q A;  3NV3 A;  5GZF A;  1PHM A;  1SDD B;  4HSL A;  1AL2 3;  2BGC A;  3ZX7 A;  3NAP C;  1LTE A;  2Y60 A;  2ZEX A;  3EYP A;  4BK5 A;  2GND A;  1SHW B;  1UZV A;  3I2D A;  1HN1 A;  4Y20 B;  5FPB A;  5F6L B;  4D0Q A;  3POB A;  3LE0 A;  5T52 A;  1AR9 3;  3IDE A;  1GWL A;  4LBK A;  4RD7 A;  5CFD B;  3VUO A;  5T5P A;  3POG A;  1NZC A;  4ZS2 A;  4UFM A;  4CP0 A;  1GAN A;  5JPM B;  3VDD C;  3ZXE A;  3DXT A;  3NAP A;  2YXS A;  4UT5 A;  1UMI A;  3WR0 A;  4PIZ A;  2XKP A;  3VBH C;  1LOG A;  4QQ2 A;  2A71 A;  4ATE A;  1A3K A;  3UES A;  2ORX A;  3PME A;  4HKW A;  3AYC A;  2VUL A;  3UJQ A;  2W68 A;  5F5Q A;  1MZ5 A;  3T2P A;  1CIY A;  4Y22 B;  5IVJ A;  1SPP B;  2WZP P;  4QGL A;  1W90 A;  3MPB A;  3N9L A;  3RVH A;  2VZT A;  2ZAH A;  5LA9 A;  2R1D A;  3DPR C;  4K40 A;  1FPN 2;  2ZX4 A;  4I3P A;  2R30 A;  4YZ5 A;  1S2B A;  3VBH A;  5A6Z A;  3KT1 A;  1CN1 A;  3KS7 A;  3LSE A;  5HXM A;  2EXJ A;  1HRI 1;  2WNU B;  3RG0 A;  4KU7 A;  3HT2 A;  1QJU 2;  1XJA A;  4Y1V A;  2ARX A;  3IM0 A;  4CP2 A;  5H9S A;  3WF1 A;  4XCB A;  4XJ9 A;  5DZF A;  3I2G A;  3ASI A;  5BNO C;  1XNK A;  3LSD A;  1LU2 A;  5A6X A;  3OYW A;  2JDP A;  2GMP A;  3AP4 A;  4XET A;  2FDI A;  4XQD A;  5FJH A;  1JZ2 A;  4LLO A;  4P02 B;  2VW1 A;  4XUT A;  4P9W A;  1QIQ A;  5FO9 B;  2CGN A;  2XB6 C;  4Q0V A;  1PO2 1;  1TZO A;  4LBJ A;  4TLG A;  2D43 A;  2JXA A;  4NRQ A;  4QPG A;  5A7W B;  3IZO A;  1HB3 A;  4MXW B;  2BVB A;  3Q8E A;  3FMG A;  3K48 A;  4FTS A;  4EE2 A;  2W2I A;  3NO8 A;  3NWK A;  4NAM A;  1XPW A;  2JG8 C;  2CDO A;  2FD8 A;  5FZ0 A;  3AKP A;  3L9J T;  3NVC A;  2E33 A;  2R07 1;  4XAE A;  1RHI 2;  1O3R A;  2OVU A;  4O65 A;  5FPU A;  1UO9 A;  2JD9 A;  1JOP A;  3S6P A;  3U10 A;  1EV1 2;  1B35 B;  2WNV A;  2WN2 A;  5FZO B;  1J84 A;  1JS9 A;  1GNH A;  1FNY A;  3M2M A;  5EJ3 A;  1XYP A;  2GC3 A;  2ID4 A;  1PVC 1;  2WN3 A;  4FPO B;  2Q8C A;  4LT5 A;  3WDV A;  1S0C A;  4AHW A;  5JOX A;  4Y5Z 0;  3W21 A;  1UYX A;  1WBL A;  3J7M A;  1U5I A;  2W91 A;  2RS1 3;  3ILN A;  1LOD A;  1WMF A;  3NNF A;  2DDU A;  4CDU A;  1OUS A;  3RMX A;  1C8M 2;  1EPZ A;  2VCA A;  3LKJ A;  5ABJ B;  2QE3 A;  4HPK B;  2C6S A;  3ZN4 A;  4IV3 C;  2X10 A;  1LOF C;  4IXL A;  2ZGP A;  3B69 A;  1TME 1;  4K8F A;  4RHV 3;  1TNR A;  3FFQ A;  2OA2 A;  1AR8 3;  4M0N A;  4N7U A;  4XW3 A;  4U2A A;  4ZU7 A;  3SKJ E;  5DUW A;  3LCP A;  3AZW A;  4ASK A;  5IAV A;  5JMC A;  2BPA 2;  4CDQ A;  1UY3 A;  2QDN A;  3F2Z A;  3NJY A;  5A3M A;  4PF1 A;  1ASJ 1;  2V09 A;  3RRD A;  3LWC A;  1LOF A;  1PK6 C;  3VV1 A;  5ACA 1;  3SH3 A;  1RUC 2;  2CWM A;  4NWW A;  1V0A A;  1WME A;  4Q4Y 1;  3H8R A;  1ZA4 A;  1F2N A;  1PVX A;  2D7F A;  3H50 A;  4Q4W 3;  3KV5 A;  4Z07 A;  5T5J A;  4BK4 A;  2K0G A;  1DYK A;  5JOW A;  1AJK A;  1ZZ6 A;  4K7J A;  4QQP A;  2BRT A;  5FYC A;  2KXL A;  5B2G B;  2ZML A;  2Y6G A;  3DKQ A;  5EJZ B;  3WNP A;  3LA3 A;  4HN1 A;  5FPZ A;  1JU3 A;  1PX4 A;  3AKR A;  3WCS A;  4BH9 A;  2ZZJ A;  5JSP A;  4YG6 A;  5J48 A;  2WRA A;  1SBE A;  3DN7 A;  4A4A A;  3GCW A;  4GMP 0;  5FZD A;  1FOD 2;  4LLF A;  4CPB D;  1XXN A;  2XBO 1;  2VJX A;  1ENQ A;  1QJX 2;  1W04 A;  2VCC A;  1VAV A;  3CU7 A;  5IW0 A;  4UYB A;  2PHU A;  4IER A;  1OBN A;  2RJL A;  4XJ8 A;  4K1Z A;  1OKQ A;  1F8V A;  4OQ8 A;  1VRB A;  1IQD C;  2ZHN A;  3GHM A;  3LZZ A;  5DG1 A;  4B4P A;  2PAK A;  5GLV A;  3MUZ 1;  5FZF A;  5CIS A;  4YVS B;  2BNN A;  3JB4 C;  1GKB A;  1XE7 A;  1DF0 A;  2FDJ A;  5FXV A;  5FZM A;  5HV0 A;  4BJ0 A;  4V1P A;  1POV 1;  1YQC A;  3MBW A;  4YG0 A;  2NP0 A;  4C8D A;  2XLG A;  4WVM B;  3E97 A;  2HWE 1;  4LO4 B;  1ZBA 3;  3RYR A;  4CCD A;  5C5T A;  5GAL A;  4E4H A;  1PM7 A;  5LW9 A;  4NHM A;  5I93 A;  1FV2 A;  2FDG A;  4PQ9 A;  4E8D A;  1QQP 2;  1CX1 A;  2Z79 A;  3CEW A;  4UF0 A;  1YI7 A;  2RM2 1;  3I3B A;  1JN2 P;  4ZHN A;  5A3P A;  3N3H A;  1GQH A;  4XMI A;  2QQP A;  4HMZ A;  3O1T A;  1ND2 B;  1OT5 A;  4DUV A;  4AI9 A;  4URA A;  1DP0 A;  4XUN A;  2R06 3;  3HMY A;  2RS5 2;  1W6M A;  1AX0 A;  5T5L A;  3FLR A;  3T0B A;  1PIV 2;  2XON A;  1BEV 2;  5JR2 A;  5LA2 A;  2RV9 A;  2DTW A;  1OPO A;  4R8H A;  2PA7 A;  1OF3 A;  3NNL A;  3MIF A;  1AF9 A;  1MQT B;  4IV1 C;  3N9O A;  2ZHK A;  1W0N A;  1EPW A;  1NCQ A;  3I4I A;  4YGB A;  4GKY A;  4H2A A;  4FOW A;  3BPS A;  1JHJ A;  2VMC A;  2A73 B;  4XF9 A;  1MEC 2;  1JUH A;  2ZX0 A;  3III A;  1QH6 A;  3KWV A;  3UKN A;  3ZIW A;  2C1F A;  4L92 A;  3KCX A;  4L99 A;  4ES9 A;  1PO1 3;  2BV4 A;  3P6B A;  4YFW A;  2L9L A;  4LHK A;  3OOX A;  2Y6L A;  1BVV A;  2W39 A;  5LBB A;  4Q4V 2;  5EP9 A;  3KVA A;  4ZZ5 A;  5FPX A;  3QOP A;  2VC9 A;  4QB1 A;  2JG9 A;  1IPJ A;  1MS9 A;  4WM8 B;  4X8N A;  4PIY A;  1ZBE 2;  1ND3 B;  2WQ8 A;  2BVV A;  3I3E A;  5KHI A;  3RMY A;  2D40 A;  5F2S A;  2HWD 3;  1FYU A;  2QQI A;  3EQE A;  4JGY B;  1L7Q A;  3RZK A;  4EN7 B;  2A6Z A;  3JD7 3;  2Y6F A;  1AVB A;  1YNA A;  3KB5 A;  1L7R A;  5K4L A;  3AMQ A;  5I0S A;  4B7E A;  1TE1 B;  4Y5S A;  5J7M A;  2EIG A;  1OLQ A;  3NV4 A;  2B39 A;  2OII A;  5F3E A;  4WZC A;  3FHA A;  2YPD A;  4CP1 A;  1W8Z A;  1Q5O A;  4LHL A;  2VZ1 A;  3POY A;  4XAB A;  4B8E A;  2RR1 3;  4XZP A;  1LHU A;  3CJX A;  3V65 A;  3KV9 A;  2BP6 A;  2B4K A;  2VD7 A;  3B93 A;  5DAP A;  1GZW B;  1VBB 1;  1SEF A;  5A1A A;  5LEK A;  4V2W A;  1LGB A;  1RUH 2;  1RUG 2;  3W5M A;  4QQH A;  4MOA A;  1ZM1 A;  1X8E A;  2K2S A;  3WG1 A;  3MPP G;  3VHO A;  3ZSM A;  1U5X A;  3C3V A;  4ORF A;  2PTM A;  5EYX A;  4OHZ A;  2FDF A;  3OY8 B;  1STM A;  3WV6 A;  3MLL A;  1W39 A;  3IDA A;  1WUV A;  1QNW A;  2VTX J;  2VVD A;  5F37 A;  5GZC A;  4HAN A;  2Y33 A;  4J6G A;  3BTX A;  4K8R B;  4FFH A;  4I0W B;  4UW6 A;  2GN7 A;  4Y20 A;  4EV0 A;  3DEC A;  3W59 A;  5AC9 2;  4FBF A;  2TNF A;  2R04 2;  3PVB B;  4LK6 A;  1KQR A;  5CFD A;  5HXV A;  4EN9 B;  1UMH A;  3GJB A;  4AI1 A;  3I59 A;  4IE6 A;  2HWF 2;  3KF3 A;  3B01 A;  3TNP B;  4MAD A;  5T54 A;  3WG3 A;  2Q0A A;  5F32 A;  1TMF 1;  2JIJ A;  4WBB A;  5ANQ A;  1FPN 3;  4Q4X 2;  1VBC 2;  3VBF C;  3FHQ A;  1CWP A;  1CAX B;  1BHG A;  4PQQ A;  4W8J A;  3U11 A;  1QJU 3;  3T09 A;  3DL3 A;  4JHZ A;  4QKF A;  1H30 A;  4BA6 A;  4XIL A;  2NMN A;  4LOS A;  3CZU A;  4M4P A;  5C4W B;  2AUY A;  3J9S A;  3VBF A;  4LO7 A;  5E16 A;  3E6C C;  4D94 A;  5LAT A;  3WUC A;  3K75 B;  1Z7S 1;  3SCG A;  5LY1 A;  2YYO A;  3ACI A;  4GMP 1;  5EFU A;  5DDJ 2;  3VBU B;  1X33 A;  2JEC A;  1HRV 1;  5GZD A;  2VE1 A;  1CGP A;  1FAY A;  3ZMN A;  5C9A B;  5BNN A;  2WSV A;  5CG9 A;  3AMP A;  3D5O A;  1WMD A;  3S7I A;  1ZZB A;  3MI8 A;  1RHI 3;  2VCM A;  2AC1 A;  1P8J A;  4RL7 A;  1AR7 1;  1JUI A;  1UU4 A;  2D6O X;  2Y38 A;  4ASM B;  5FZ9 A;  4UW3 A;  1E57 A;  3B9I A;  4O9E A;  4AEK A;  4MXW A;  1EV1 3;  2VXR A;  2Z2S B;  2HWB 1;  4DQA A;  2YBP A;  2E53 A;  3MHZ A;  3PU8 A;  3TYJ A;  1C57 A;  3RPQ A;  2ZPX A;  3ENR A;  1YFU A;  3DV8 A;  4QX7 A;  4FP3 A;  2B5H A;  1JHN A;  3H42 B;  5LAS A;  4NOT A;  4XJA A;  5IT6 A;  2OUH A;  2MHF A;  3CHX A;  3NKT A;  2E32 A;  1EUT A;  1C8M 3;  3APB A;  1AYN 1;  4JGZ A;  4TLF A;  5A3O A;  5IVY A;  1ZRR A;  4NVP A;  2Z69 A;  2UY8 A;  3EB7 A;  1UZZ A;  1GOG A;  2GNT A;  3PJQ A;  1W0P A;  3R4D B;  1SMV A;  1NQD A;  4Y4Y A;  1CAU A;  3TAY A;  2WIN B;  1HXS 3;  2C26 A;  4UW4 A;  3WZ1 A;  2O0O A;  2NMO A;  4BB3 A;  4QXC A;  3NAP B;  2QQL A;  3RNS A;  2GDF A;  1QKQ A;  2GH8 A;  3QCW A;  5J98 B;  5FZB A;  3ZMO A;  4R9C A;  3ZR6 A;  3VD9 A;  2YC2 A;  4AVV A;  3ZO0 B;  3ZFG C;  3FWE A;  4H7L A;  1RUC 3;  4IGQ A;  1VB2 A;  5EHD A;  3H7J A;  1IOA A;  2V4A A;  5GLT A;  1HW5 A;  2BOJ A;  3W58 A;  4OUE A;  3THC A;  3R0R A;  1FX5 A;  3VBH B;  2ZX2 A;  1R09 1;  3DXU A;  3SCF A;  5FXX A;  2VU9 A;  5FWJ A;  2VMH A;  2ZGR A;  4DS0 A;  1NLS A;  3S0M A;  3SKV A;  3M1H A;  2YC0 A;  3LDB A;  5FKB A;  1S0D A;  2KR2 A;  1CJP A;  2ZZQ A;  3ATG A;  3ZN6 B;  1K3I A;  5FYH A;  1XB9 A;  2BGP A;  2ETE A;  1OA2 A;  3T30 A;  1AL2 1;  3KD4 A;  2JEM A;  1FOD 3;  1YQ8 A;  3NNM A;  3OYW B;  1OOP A;  1XSR A;  2BJS A;  4HXC A;  1XU1 A;  1KJR A;  4M4R A;  2C0Z A;  4MHR A;  1ULG A;  1MZE A;  1QJX 3;  2VNO A;  3FC0 A;  5HI0 A;  4TTG A;  4CE8 A;  1HIX A;  1MZ6 A;  2OKX A;  2WO7 A;  2VTX A;  1VBA 2;  4QPG B;  4XJZ A;  1WWY A;  5L73 A;  1Q8S A;  2WR9 A;  4GB3 2;  3AP7 A;  3AM2 A;  3BTA A;  4HLT A;  4LBO A;  4Q0Q A;  3ZN5 A;  2JE7 A;  2XGX A;  1DZQ A;  4X6Q B;  3LAG A;  4YM1 A;  3VKF C;  1Q8P A;  4AYU A;  1H9W A;  1IKQ A;  1QDO A;  1RMU 2;  4W65 A;  3NL1 A;  2X5I C;  2FBE A;  4HVQ A;  4MLO A;  1LU1 A;  2Y0I A;  1UWW A;  1GIC A;  3T2T A;  3SQO A;  2WNV B;  3GYD A;  2PMW B;  5KXB A;  3O0W A;  4N43 C;  2Q4S A;  3VZM A;  4QX5 A;  5FZA A;  3M3Q A;  3VDB A;  2ZEZ A;  4WM7 C;  3I49 A;  1REE A;  1SG3 A;  2YGM A;  1QQP 3;  4YYO A;  3IMM A;  2A6X A;  2PLV 2;  2DTY A;  2RJ2 A;  4FFG A;  4JCK A;  1YJL A;  5E88 A;  4DO0 A;  2QVS B;  3LOI A;  4LKD A;  4PIX A;  2WO1 A;  3RZZ A;  4CDU B;  5JLV A;  2G4I A;  1RUI 3;  3CZJ A;  4UFJ A;  1D4M 2;  1EAH 2;  3VHN A;  2RS5 3;  5KXC A;  1XNC A;  1PIV 3;  3QH7 A;  4OI1 A;  1BEV 3;  2I2S A;  3LD8 A;  3HR9 A;  2VG9 A;  2OUJ A;  1CAW A;  2F6B A;  4C0H A;  3USS A;  5JAX A;  3VBS C;  3POJ A;  4E9K A;  4YZ1 A;  5L7O C;  4AED C;  1C8N A;  1SLB A;  3ZYF A;  4CDQ B;  5CYY A;  4FPL A;  4IV3 B;  4XXP A;  4DIN B;  3E5Q A;  1K5M C;  2DUQ A;  4FPG A;  1YQ6 A;  2NQY A;  1DG6 A;  4CCL A;  4FTE A;  1MEC 3;  2BWA A;  4PLN A;  2JD4 A;  2VMI A;  2RDR A;  2E7A A;  3I2O A;  4PLM A;  2P3J A;  2WLQ A;  1Z78 A;  3LFM A;  4PJY A;  3VBS A;  2VL4 A;  2ET7 A;  3AMN A;  2DFC A;  1YC6 1;  1URX A;  5HCB A;  1K5M A;  4BDV B;  3JUU A;  1CES A;  4Q4V 3;  4LXL A;  5I8S A;  3HNB M;  1V6M A;  3WG2 A;  4NHK A;  3VZN A;  5IVB A;  5F3G A;  3V0A A;  4AF9 A;  1ZBE 3;  1JYC A;  1WLT A;  2QNK A;  4I0A A;  3ZFF C;  2W94 A;  4YZ3 A;  5DUX A;  2RS1 1;  3H3L A;  3ETQ A;  4MGS A;  2BFU S;  4RR3 A;  3WXP A;  4A6S A;  3O1M A;  2DVG A;  1E5I A;  3M4F A;  5HCF A;  2ZCW A;  4COV A;  2V5Y A;  1CJD A;  1VRH 2;  2GP5 A;  3OGV A;  3OEA A;  1ENS A;  2Q8E A;  4YSF A;  1YWK A;  2EF6 A;  3KT7 A;  3ZFF A;  3BOW A;  1AR8 1;  1OUX A;  2XJR A;  4ZY9 A;  3RGB A;  4FXG B;  1V9U 2;  4AE2 A;  1UZ0 A;  2VM9 A;  1YJK A;  1W6O B;  3PUS A;  1DQ4 A;  3N7L A;  3S5Q A;  1QXJ A;  3UT0 A;  1YI9 A;  2WC2 A;  4MH0 E;  3WP3 A;  2GN3 A;  1WCD J;  1GV9 A;  1RUH 3;  1RUG 3;  4H14 A;  1W99 A;  4XQ4 A;  5JWP A;  4Q4W 1;  1XRU A;  4UI9 L;  2GC2 A;  1TNF A;  3NQH A;  5CKQ A;  5LA0 A;  3K3O A;  3FX3 A;  4NR1 A;  1BK1 A;  1MR5 A;  1R1A 2;  4YFZ A;  2FMY A;  1ZRF A;  4A42 A;  4J25 A;  2WFF 3;  1XNB A;  3CBN A;  1Y9M A;  2JDY A;  1GZW A;  1W2O A;  1UY1 A;  3FBM A;  3JBG 1;  2GNM A;  3Q8C A;  4UF0 B;  2MEV 2;  1R64 A;  3NKG A;  3MUY 1;  4BQ5 A;  2ORZ A;  4XFB A;  3GXU A;  1CPN A;  1FMD 1;  2JDH A;  1RJ8 A;  1OUR A;  1SLT A;  4HK9 A;  4IGP A;  4RQP C;  5E89 A;  5AC9 3;  4AWD A;  1W6M B;  2F4L A;  2R04 3;  1VAM A;  3U07 A;  3INA A;  4UWD A;  3M3C A;  4LIV A;  2HWF 3;  4Y26 A;  1HV1 A;  2MPF A;  4Q27 A;  2BGO A;  2RVA A;  4IEZ A;  4AQ6 A;  4JQR A;  2ZOE B;  4Q4X 3;  4XFI A;  1NCQ B;  1VBC 3;  4GWI A;  4JVA A;  3C7G A;  4PT6 A;  1PNG A;  1UL9 A;  5JCT A;  1I3H A;  2B46 X;  3B7M A;  3TB0 A;  2GP3 A;  2WWJ A;  2WFP A;  2R1B A;  1A6C A;  1LCL A;  4QHZ A;  3KM5 A;  1UMZ A;  5JVV A;  1J3Q A;  4QM8 A;  4Q0S A;  4IV1 B;  4XDP A;  3AYE A;  2WZR 2;  4Q26 A;  1VMH A;  2AZ5 A;  3GBF A;  4CP9 A;  1CAX A;  3AB0 A;  2XWB B;  1DGR N;  3LB9 A;  3C7H A;  1DQ6 A;  4CDX C;  2VNV A;  3A21 A;  1I5Z A;  2WZ8 A;  2XXZ A;  4S2H A;  5DDJ 3;  2JG9 B;  2C24 A;  2VZS A;  1UKG A;  1WLC A;  1U5Z A;  2ZGM A;  4R9D A;  4QX8 A;  3U75 A;  3RI8 A;  1A34 A;  1W2T A;  4I30 A;  3AL5 A;  5AFB A;  1XE0 A;  1G9F A;  4R9B A;  1S55 A;  1BVP 1;  1YEW A;  2VOX A;  3G7D A;  4AHZ A;  2DYC A;  4IET A;  4XFC A;  1QEX A;  2ARB A;  2O14 A;  3HJR A;  5FUI A;  1RUN A;  3U14 A;  5CKN A;  1KXG A;  2VW0 A;  4R4X A;  4UXA A;  3G6J B;  2XJP A;  5F6K A;  1V6L A;  2RHP A;  4JQT A;  3M70 A;  2WO2 A;  2ZGS A;  3MF6 A;  3VBO C;  3VL8 A;  1HDK A;  1J3R A;  2XVK A;  2HYX A;  2BBA A;  3VHP A;  4PDW C;  4EZ4 A;  1CPM A;  2R6Q A;  2YZ4 A;  1MVE A;  3AXD A;  3N9N A;  2P5B A;  1V70 A;  3KT4 A;  1W6N A;  1MAC A;  1GP4 A;  4NID A;  5FZ4 A;  2CV6 A;  4NPR A;  1L3J A;  2XHN A;  3QH6 A;  5DUV A;  5K0U A;  1AYM 1;  3R05 A;  1SCR A;  3RJ2 X;  1PZ9 A;  4QPI A;  5CEH A;  3RSJ A;  2Y8K A;  3AX4 A;  3B9C A;  3I7D A;  2CNA A;  3AMH A;  1O4T A;  5F5C A;  1S0I A;  3KGL A;  4XE9 A;  1TG7 A;  4AVT A;  3POI A;  2ATF A;  4LE4 A;  4AFA A;  4B1M A;  2ZAA A;  4LNV A;  4A3X A;  3K4D A;  1ULC A;  2QDR A;  3C8X A;  5A70 A;  4AW7 A;  1COV 1;  4JC1 A;  5LBF A;  4QU2 A;  3J4U H;  4D7T A;  1DGR A;  3C2U A;  2QQJ A;  1YQ2 A;  3I59 B;  1XND A;  3SNM A;  2HWD 1;  3IAQ A;  3N9M A;  5FYV A;  2ZBJ A;  3TN9 2;  1ACC A;  1V6I A;  1V6K A;  2G9Z A;  2YGL A;  5AFE A;  3LEM A;  1JU4 A;  3KSC A;  3MLK A;  1LGN A;  5FO8 B;  3FL7 A;  2BYV E;  4HET A;  3ACG A;  2OYZ A;  3VDC A;  4AVC A;  2YB7 A;  4LIU A;  1O91 A;  5AVP A;  2WQ4 A;  2JDA A;  4QDS A;  1U5Y A;  2A5Z A;  4KH9 A;  3VZK A;  2CHH A;  2GNB A;  2EA7 A;  5JOZ A;  2YU1 A;  1DQ5 A;  2VOK A;  5G05 L;  1HRI 2;  1XOY A;  4S2D A;  3VDD A;  3VD5 A;  2P3K A;  1G9B A;  3WD5 A;  4XTP A;  5FMD A;  3C7O A;  4O61 A;  3VBF B;  4IEV A;  4XJW A;  4XYX A;  4DY5 A;  1LRH A;  5BXX A;  4CCN A;  4ES8 A;  4NIG A;  1RUF 1;  3UGF A;  1VR3 A;  1UU6 A;  2G9G A;  3O1R A;  1RVF 2;  4NWV A;  1VBA 3;  2BER A;  3DEM A;  2BW8 A;  2Z5W A;  5L9B A;  1DHK B;  2UWC A;  3ZN6 A;  4HOO A;  4CUC A;  3I3D A;  1T2X A;  4FQ4 A;  3DPR A;  1PO2 2;  1W0O A;  1C5H A;  4EQV A;  5BNN B;  4OI2 A;  4BCU A;  1RUD 2;  3AYD A;  3O7O A;  5F5I A;  5FFO C;  3P5B A;  3MFC A;  4LPL A;  2A3W A;  4QHB A;  1RMU 3;  2NPI A;  2R0F A;  5F5A A;  4AK3 A;  5A3N A;  3IKW A;  2CWS A;  5BNO A;  1YIF A;  4AFM A;  3POW A;  4DFS A;  3MF9 A; 
#chains in the Genus database with same CATH homology
 1PX3 A;  2WZE A;  3T2O A;  1W9S A;  5C71 A;  5LA1 A;  2W87 A;  3P6B A;  2L9L A;  4CVU A;  2Y6L A;  5EIY B;  4ZZ5 A;  2VC9 A;  4QB1 A;  4ARX A;  3ACH A;  2VZ3 A;  2WQ8 A;  3OG2 A;  4A44 A;  4RYD A;  2V4V A;  3I3E A;  5B4N A;  5B4X A;  2QQI A;  2X05 A;  1L7Q A;  1UXX X;  2XOM A;  2W1Q A;  1JZ5 A;  1L7R A;  3K46 A;  1LNS A;  5I0D A;  4QDR A;  3FHA A;  2QQO A;  3ECQ A;  1DYO A;  2E31 A;  2VZ1 A;  4XUR A;  3PUI A;  2W5F A;  4CUB A;  2QQK A;  2B4K A;  5A1A A;  4W50 A;  3W5M A;  4HG6 B;  4MOA A;  1JYV A;  1JZ6 A;  4FI9 A;  4Z2A A;  3ABZ A;  3LPF A;  3WNO A;  5F7U A;  1MPX A;  3IDA A;  3WQB A;  2E26 A;  3ETP A;  2PQS A;  4JKL A;  1GNY A;  2J22 A;  3DEC A;  2VZU A;  4DEV A;  1UMH A;  3I2I A;  2Z4F A;  3VD7 A;  4CU7 A;  2EIB A;  4MAD A;  1GUI A;  2W47 A;  5J1X A;  2VME A;  2V72 A;  3UNP A;  3FHQ A;  4XUP A;  3GDB A;  4DEQ A;  1BHG A;  3FN9 A;  4PQQ A;  4W8J A;  3T09 A;  5JMO A;  4JHZ A;  2YG0 A;  2J7M A;  1JI6 A;  4ARY A;  4MO3 M;  3CZU A;  4GWJ A;  4M4P A;  2J1A A;  4P5Y A;  3GM8 A;  4IUG A;  3DYM A;  3K75 B;  3WF0 A;  4DUX A;  3ACI A;  3VD4 A;  1K12 A;  1UY4 A;  4JX0 A;  5DQ0 A;  2HLE A;  1EUU A;  1GU3 A;  1TVG A;  1WKY A;  3OEB A;  4A6O A;  3LEI A;  3WSO A;  4DUW A;  2J1T A;  4DXT A;  1P8J A;  1NKG A;  2J1S A;  4A3Z A;  4AG4 A;  1W8N A;  1OH4 A;  2W92 A;  3WF2 A;  1F4A A;  2YFU A;  2W46 A;  1NX9 A;  2WYS A;  3HNM A;  3LPG A;  5CZK A;  2EIC A;  3LQC A;  2ZEY A;  4CU6 A;  1CZV A;  4AAX A;  5JUV A;  1NUK A;  1H6Y A;  1GQP A;  3K4A A;  2E32 A;  1EUT A;  5LCW L;  4LQR A;  4XUO A;  3EB7 A;  1GOG A;  2Y6H A;  2YFZ A;  2BZD A;  2C26 A;  3IB3 A;  2QQL A;  2VO5 A;  1UY0 A;  2W1S A;  4QDQ A;  3VD9 A;  3HNY M;  3NJV A;  2YC2 A;  3CIH A;  4XZU G;  5C7G A;  1PMH X;  4QX3 A;  4XVH A;  3VD3 A;  1H6X A;  4OUE A;  3THC A;  2WBK A;  4MGQ A;  3OGR A;  4KWU A;  4TXW A;  3GGL A;  4DXR A;  1W8O A;  2WDB A;  3SKV A;  2VQU A;  1K3I A;  3WNK A;  2BGP A;  3I2F A;  1UYZ A;  3MV0 1;  5EJ1 B;  3NRU A;  4M4R A;  1J83 A;  2ZXQ A;  4KMQ A;  1WCQ A;  4TTG A;  1W9W A;  2OKX A;  5IFT A;  2Y64 A;  4QPW A;  4P00 B;  2R7E B;  2VR4 A;  3OBA A;  3J7H A;  1D7P M;  2KD7 A;  2Y6K A;  4CU8 A;  3T2Q A;  2B9V A;  2CDP A;  3I97 A;  4ZZ8 A;  2VZQ A;  3DYP A;  1UWW A;  5DN2 A;  2VMF A;  4BXS V;  4ZXE A;  3UET A;  2WAA A;  2J1V A;  4OMC A;  3VDB A;  2ZEZ A;  1SG3 A;  1GMM A;  1JYX A;  2RJ2 A;  1JYW A;  2C4X A;  2WO1 A;  4UOJ A;  4A41 A;  4KI5 M;  3CZJ A;  2WO3 A;  3HEI A;  1ULP A;  3OGS A;  3SEP A;  1GOF A;  1XNT A;  1F4H A;  1W9T A;  2W9X A;  2WAB A;  5DPN A;  2W1U A;  1OF4 A;  1PMJ X;  3OB8 A;  2LS6 A;  3CQO A;  2XQX A;  3WNM A;  5CYY A;  4OMD A;  2VZR A;  3BGA A;  4YPJ A;  4OYU A;  4QAW A;  2QBX A;  2JE8 A;  1SDD B;  2VL4 A;  2ZEX A;  3EYP A;  4BK5 A;  1SHW B;  5JXJ A;  1HN1 A;  3K4Z A;  4BDV B;  4D0Q A;  1JZ3 A;  2VOT A;  3LE0 A;  4QB6 A;  3HNB M;  5HPO A;  4QX2 A;  2DCK A;  2W94 A;  3W5N A;  3WNN A;  4MGS A;  1UMI A;  4RN5 A;  3UES A;  2ORX A;  3OGV A;  3T2P A;  1CIY A;  5JXI A;  3OEA A;  1ULO A;  5G04 L;  3A23 A;  2VZT A;  4ZY9 A;  4XUQ A;  1UZ0 A;  2VM9 A;  3T0A A;  5HXM A;  1UYY A;  2W3J A;  5IFP A;  3WNL A;  3SEE A;  3WF1 A;  1US3 A;  1W99 A;  4W4Z A;  2LW8 A;  3AC0 A;  3I2G A;  4CUA A;  2J1R A;  3WEZ A;  1JYN A;  2WAO A;  4UI9 L;  3I2J A;  3NQH A;  5LA0 A;  2EID A;  1K42 A;  4A42 A;  4ET7 A;  1JZ2 A;  4P02 B;  1KGY A;  3MV1 1;  4XUT A;  1UY1 A;  1R64 A;  4LHS A;  3MUY 1;  2ORZ A;  2VTF A;  4L0P A;  3ZM8 A;  3GXU A;  5C70 A;  1DLC A;  2VZO A;  1XPW A;  2CDO A;  1NAE A;  2YC4 A;  3THD A;  2E33 A;  2W1W A;  1OD3 A;  3ACF A;  3DYO A;  4OZO A;  2BGO A;  2RVA A;  2JD9 A;  1UY2 A;  4GWI A;  4PT6 A;  3C7G A;  2WN2 A;  1J84 A;  2ID4 A;  2WN3 A;  2VMD A;  3LEG A;  4QX0 A;  4JKM A;  1UYX A;  3I2H A;  2W91 A;  3HN3 A;  3IAP A;  2DDU A;  1O8P A;  2VCA A;  3MO4 A;  3C7H A;  2X10 A;  2X09 A;  3A21 A;  2WZ8 A;  2C9K A;  4LKS A;  2VZS A;  3D3A A;  3C7F A;  4A45 A;  1I5P A;  3SKJ E;  4CU9 A;  1UY3 A;  3F2Z A;  3A22 A;  4PF1 A;  4QB2 A;  4JKK A;  3HJR A;  5FUI A;  2QQM A;  2J1U A;  4DXS A;  4BK4 A;  3T08 A;  2WO2 A;  3HOB A;  5IJR A;  4E8C A;  1UXZ A;  2HYX A;  2Y6G A;  5EJZ B;  2BBA A;  2Y6J A;  2ZEW A;  4QX1 A;  1O8S A;  3WF4 A;  3WNP A;  1GOH A;  1JU3 A;  1PX4 A;  3VDA A;  1K45 A;  1JZ7 A;  2WUH A;  5JXG A;  2VZV A;  4A4A A;  3CMG A;  2XHN A;  3JXS A;  2V5D A;  1CZS A;  3NNG A;  2VJX A;  2VCC A;  2Y8K A;  3P1I A;  2J1E A;  2QQN A;  2VCB A;  1O59 A;  4P08 A;  1TG7 A;  1KEX A;  3C7E A;  1IQD C;  3K4D A;  3C8X A;  1RYY A;  3MUZ 1;  3I2K A;  1US2 A;  2QQJ A;  1CZT A;  1YQ2 A;  3IAQ A;  3NJX A;  4BJ0 A;  1XNA A;  3MBW A;  1JZ4 A;  1JZ8 A;  1JU4 A;  5IYY A;  3FL7 A;  3PUH A;  3ACG A;  2VQT A;  3VDC A;  2YB7 A;  2JDA A;  4QDS A;  4UAP A;  5G05 L;  1UX7 A;  2W95 A;  4E8D A;  2VZP A;  1CX1 A;  3I3B A;  3VD5 A;  3U37 A;  3C7O A;  3CDZ B;  3HPN A;  1OT5 A;  3T0D A;  4DUV A;  1DP0 A;  4XUN A;  3T0B A;  2BER A;  2XON A;  4CUC A;  5LA2 A;  5JR2 A;  2RV9 A;  3A7Q A;  3CKH A;  3I3D A;  1T2X A;  3LEK A;  1OF3 A;  5JXH A;  1W0N A;  3E1F 1;  4LPL A;  3BN6 A;  5DMY A;  5IHR A;  3K77 A;  4GZ9 A;  3WF3 A;  1JHJ A;  2VMC A;  4D8M A;  1XC6 A;  2JKX A;  3III A;  2EIE A;  2DCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...