1TVGA

X-ray structure of human pp25 gene product, hspc034. northeast structural genomics target hr1958.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHGSATYLRFIIVSAFDHFASVHSVSAEGTVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOC51668 protein
publication title Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1tvgA00
2BBAA 3ACGA 3ETPA 3GXUA 2BZDA 3NJVA 3WF4A 2BGPA 1GNYA 4KI5M 2ZEYA 3D3AA 4DXRA 4BDVB 1OF3A 2YG0A 4UOJA 2B9VA 2VZVA 2VR4A 1W9TA 2V4VA 4ET7A 3W5MA 2Y6KA 1UMHA 4QB6A 5G05L 4A45A 3VD9A 3CIHA 1CX1A 4QX3A 2WO3A 4JKMA 3W5NA 4QDQA 4PQQA 1XNTA 5HPOA 3F2ZA 1R64A 2WUHA 2Z4FA 3MBWA 2Y6JA 1K42A 3K4DA 1HN1A 3I3EA 1EUUA 1O59A 4QB1A 1JZ7A 2WAOA 3LEGA 4QAWA 1YQ2A 1XNAA 3LE0A 3C7FA 3NJXA 3HOBA 4MO3M 3FHQA 4OMCA 4DUVA 2J22A 5LCWL 3HNYM 5FUIA 5EJZB 2JKXA 3CDZB 3OGVA 2W1WA 1EUTA 2BGOA 1NUKA 1US3A 2J7MA 1CZTA 2VZPA 2W5FA 3NNGA 4ARXA 1ULPA 3VD7A 1US2A 2Y6GA 4AG4A 2XOMA 2V5DA 2VZQA 3AC0A 4MADA 1UYYA 4QX1A 1W8NA 3DYMA 3VD5A 2Y64A 2QQNA 1JU3A 2HLEA 5C7GA 5LA1A 4A6OA 3ZM8A 4XUPA 3ACFA 3OG2A 2ORZA 1WCQA 2HYXA 2Y6LA 5JUVA 2X10A 4OYUA 2WO2A 1JU4A 1J84A 1W9WA 3MV11 3T2PA 1JZ4A 3IAQA 4BK4A 4RN5A 5DN2A 2VL4A 2ID4A 3WF1A 1UWWA 1DP0A 2V72A 2YB7A 2W9XA 3WNMA 2XONA 3ECQA 1PMHX 3OEBA 4LQRA 3SEPA 1GOFA 5IFTA 3WF0A 3HNMA 2JD9A 4QDRA 4UAPA 4OZOA 3SKVA 2VZSA 2W46A 1PX4A 4PT6A 3I2KA 4BK5A 4KWUA 2E33A 2RJ2A 3I2GA 2VZ3A 4DEQA 1JYVA 2RVAA 1UYXA 3HEIA 3K4ZA 4QX0A 4P5YA 4JKKA 3I3DA 2QQOA 1W8OA 1H6YA 3IDAA 4D0QA 5IFPA 3HPNA 3C7HA 5EIYB 3ACHA 4DUXA 1OD3A 3K75B 2W94A 4MGSA 3T08A 3IAPA 2YC2A 2J1TA 3NQHA 4M4RA 2W1SA 2Y8KA 1UY4A 2W95A 2VO5A 4L0PA 4OUEA 2VZTA 2EIEA 3UETA 1O8SA 2VMFA 1LNSA 2Y6HA 1O8PA 2WQ8A 3VDAA 3OB8A 3I2HA 3T0BA 1DLCA 2VJXA 1GMMA 3K77A 3JXSA 1JZ8A 3P1IA 4CU8A 1JZ6A 1J83A 1XPWA 4CU7A 2X05A 3CQOA 2W3JA 2BERA 3LPFA 3E1F1 5JXGA 4LPLA 2C26A 4XZUG 3I3BA 1OT5A 1WKYA 3MV01 4CVUA 4FI9A 1UY2A 2J1UA 2RV9A 3C8XA 3UNPA 3I2FA 5CYYA 2VCBA 1GOGA 5G04L 5C70A 1W0NA 3LEKA 2QQJA 2WN2A 3MUY1 3T09A 3EB7A 1UZ0A 3FL7A 5CZKA 2ZEZA 3UESA 2W1UA 1JZ3A 3LPGA 4QPWA 3CZUA 5A1AA 5IJRA 3T0AA 2VC9A 2CDOA 3C7OA 5I0DA 2VQTA 3CKHA 4JKLA 3GGLA 4A44A 4P00B 2YC4A 2ZXQA 1ULOA 2WYSA 5B4NA 1GU3A 2VZOA 3EYPA 2VZRA 4ZZ5A 2QBXA 3WNKA 4P08A 1NAEA 2E31A 2B4KA 3GM8A 4TTGA 1CZVA 2WDBA 3OGRA 3BGAA 4DXTA 5IHRA 2ZEXA 2W91A 3WQBA 2VQUA 2QQKA 4JX0A 2CDPA 2XQXA 1SG3A 3I2JA 4DXSA 2WN3A 2EIDA 3NRUA 1UXXX 2VMDA 2W92A 5C71A 2ZEWA 3SEEA 1DYOA 2EIBA 1UY3A 2DDUA 1TVGA 2VMCA 4LKSA 4XUOA 1TG7A 1L7QA 4QB2A 3T2OA 2J1RA 3BN6A 4ZXEA 3DYOA 3K46A 1JZ5A 1UX7A 4XVHA 4Z2AA 2WAAA 3ACIA 5DPNA 1F4AA 1JYNA 2VCAA 4M4PA 3THCA 3IB3A 3C7EA 3THDA 2J1SA 1P8JA 2X09A 1I5PA 4BJ0A 5JMOA 1UY0A 3I97A 5HXMA 1PMJX 2L9LA 3WEZA 3MO4A 3WNLA 2OKXA 1CZSA 2WZEA 4W50A 3T2QA 2YFUA 2R7EB 3VD4A 2VM9A 1SHWB 4XUQA 4A4AA 2J1VA 3OGSA 3ABZA 3SKJE 1NKGA 2QQMA 3HNBM 5JXIA 4AAXA 1PX3A 5F7UA 2W87A 2WABA 5J1XA 4E8DA 3MUZ1 1NX9A 1CIYA 4DEVA 1JZ2A 4JHZA 4MOAA 3LEIA 5JXJA 2C9KA 3WF2A 1BHGA 1SDDB 5IYYA 3A7QA 2E26A 2VOTA 4CUCA 2VCCA 3HN3A 3PUHA 1GOHA 1MPXA 4IUGA 3GDBA 1KEXA 5LA0A 4RYDA 3A21A 2QQLA 2KD7A 3PUIA 3VDCA 2VMEA 2EICA 3WNPA 1JYXA 3DECA 3LQCA 5JXHA 4GZ9A 4GWJA 3U37A 1F4HA 3OEAA 5DMYA 4MGQA 4CU9A 4CUAA 2VZUA 3A23A 3VDBA 2VTFA 3CMGA 4YPJA 4E8CA 2E32A 4D8MA 1K12A 1L7RA 2DCKA 4W4ZA 4CUBA 4LHSA 2C4XA 2J1EA 3WSOA 1JYWA 4BXSV 1W9SA 5JR2A 2YFZA 4GWIA 4QX2A 4A3ZA 1XC6A 5B4XA 1JI6A 3J7HA 3OBAA 3IIIA 3FN9A 1KGYA 2J1AA 1UXZA 4W8JA 4TXWA 2W47A 3WF3A 4XUTA 1D7PM 3VD3A 4HG6B 4CU6A 3I2IA 1JHJA 1OF4A 4UI9L 4ZY9A 2WZ8A 4PF1A 1K45A 3DYPA 2WBKA 3K4AA 5LA2A 2LW8A 1IQDC 2JDAA 1RYYA 3P6BA 2VZ1A 3WNNA 2ORXA 3WNOA 1GUIA 4A42A 4DUWA 4A41A 2W1QA 2JE8A 4ZZ8A 3T0DA 1W99A 2DCJA 1H6XA 1OH4A 4ARYA 5EJ1B 3C7GA 4QDSA 3HJRA 2PQSA 4OMDA 2XHNA 1UMIA 3CZJA 1GQPA 1T2XA 2QQIA 1UYZA 2WO1A 5DQ0A 4P02B 2LS6A 3A22A 1K3IA 1UY1A 3FHAA 4KMQA 4XUNA 4XURA
chains in the Genus database with same CATH superfamily
1W6NA 2BW8A 3DPRC 2ZGOA 3ACGA 4GA9A 2P6HA 3GXUA 3G7DA 4OHXA 4QXKA 3WF4A 3K48A 1AR92 2ZEYA 2DVGA 4DXRA 5K7PA 3AP6A 3BOPA 3PIGA 4A3XA 2B9VA 2HWF1 4XCAA 1LULA 3QACA 4EQVA 2VR4A 2NM1A 4KWKA 3ALQA 1W9TA 5FP9A 5FPXA 5IK7A 1UO9A 3HBKA 3TEWA 4CCNA 4YW4A 2O8OA 2Y6KA 1X36A 2BBVA 4QB6A 1W6OB 2HKXA 1RUF3 4LLOA 4BXFA 4KQ7A 3AVSA 3CIHA 3NJYA 4QX3A 1N3OA 2RM23 2ZGMA 4AGVA 2WO3A 1W90A 3AMQA 4XAAA 4QHZA 4XFCA 4QPGB 5DUWA 1OHFA 4QDQA 5F3EA 3W5NA 4YW5A 3RZGA 4PQQA 4RS5C 2E7AA 5I8SA 3OJBA 1WCDJ 5HPOA 3LWCA 4Q4W3 1RITA 2WUHA 1GNZA 1W2AX 4FPYA 3B9CA 1XYPA 4EWAA 1AL0G 5C3OA 3RZLA 4FTEA 2Z5WA 2BYVE 3MBWA 5FZ0A 3WVJA 3D5OA 3K4DA 3PUAA 1HN1A 1NY71 1NQJA 4YWAA 3ES1A 5CB7A 4LBKA 3AMMA 4QB1A 2PFWA 4CDQC 5A70A 5C3SA 2AEYA 2WAOA 3LEGA 3AYEA 3ZDVA 5KHGA 1GICA 4QAWA 1XNAA 3LE0A 4E2SA 1FOD1 4FQ4A 4YGEA 3AB0A 3WW2A 1H4HA 3PUQA 4DUVA 1LU2A 5BNNA 5FUIA 2ET1A 4PLNA 1ONAA 2LUWA 2OX0A 3AJYA 2JKXA 3DCQA 3CDZB 3FZ3A 4OUSA 2ADDA 3RVHA 4OI2A 4C0BA 2XMLA 2B9UA 2V09A 1CZTA 4NUBA 1LOAA 2WLPA 3W58A 1YFYA 2XLAA 3DPRA 4Y20B 1HXS2 4K1ZA 5CU1A 1XNDA 1US2A 3VD7A 5F2WA 2Y6GA 4CDUB 1RUH1 2A7AA 2V5DA 3KCCA 4Y22A 1UYYA 4LA3A 3DYMA 1ND3A 4YG0A 3VD5A 3ZLIA 1YCIA 4A6OA 1CIWA 1W6MA 5C9AB 3ACFA 3N7JA 4Q4Y2 4AFCA 1GSLA 4B29A 4W6WA 1AR81 2ORZA 1FOD3 4QD2A 3LA3A 4XJAA 1V9U2 2X10A 2P2KA 5IATA 4OYUA 1RJ8A 4XEZA 1PZ7A 2PHDA 2WO2A 1FPN1 4AI3A 2DVAA 4MGIE 1IS3A 1JN2P 1J84A 1RJ7A 4RS5A 1AF9A 2P34A 3R05A 1K5JA 4XIKA 5K9YA 5KXDA 4HANA 1AYN1 3Q8EA 4A2UA 3PJYA 1X7NA 2AEZA 2OUJA 4BK4A 1PK6B 1T6GC 4RN5A 2CYFA 3ZSKA 2VL4A 3QH6A 5A3NA 3BOWA 2ZGQA 3EXUA 2YPDA 2VQAA 4CDQA 1PGW1 2W9XA 4C0HA 1RUH3 1XNCA 1PMHX 5T50A 4LQRA 3SEPA 1GOFA 5IK5A 5L9VA 2A6ZA 5K8SA 2RM22 5A3UA 5FPUA 3HNMA 4S2GA 1UOFA 4QDRA 3VBSB 1OOPB 4UAPA 1MS1A 5FO7B 4Y5Z0 3UKTA 3S0MA 2RJKA 1S0EA 1VBD2 5LZ6A 2AH2A 1X33A 1CPMA 2CGOA 2D3RA 3I2KA 4KWUA 2RJ2A 2UY9A 1OQEA 3N35A 3I2GA 2VZ3A 3L9JT 2K0GA 3O0WA 4Q4W2 1K5MB 3M2MA 5LASA 1JYVA 5LATA 1UYXA 3HEIA 1GV9A 3PU8A 2WNVB 4QX0A 3HBZA 4U36A 3WY6A 4JDMA 4QPYA 5FYBA 1S55A 2GMMA 2B8MA 2IXLA 2HWF2 3OBTA 3G6JB 4C1WA 1UQXA 3VKMA 4BIFA 1W39A 3O1UA 1EAH1 5CNAA 1XYOA 3ELNA 2G4IA 2ARCA 3S5AA 2DVBA 3U07A 3ME2A 1J3PA 4IQPA 3K75B 4PF5A 2E51A 3SH3A 1GWMA 5J7MA 4QXBA 1CJDA 2E53A 2J1TA 5FMOL 2ZGSA 3EBRA 2W1SA 3HD8B 1UPSA 4L0PA 3OY8A 3H8OA 4FT8A 1WGPA 5FP4A 2R073 1PVXA 4W65A 5L19A 4NIDA 1RC6A 2P5BA 1W6QB 3JB8A 2GMPA 4DOUA 2WR9A 1LCLA 2VOVA 1S0IA 4JTNA 3WW1A 1VJ2A 2VBPA 3RYPA 3I49A 1GBGA 4OI1A 1DLCA 2BNMA 2VJXA 2HWE1 4UFIA 1H1IA 1NY72 5FY9A 4SLIA 1GMMA 4QPIB 3ZXGA 2QZ2A 3JXSA 2QDNA 2CSGA 4CU8A 1WA4A 4GJYA 1QNWA 4XJZA 1MEC1 1J83A 2ZBJA 3ZYIB 5FP3A 1EAH3 1FOD2 3V0BB 2W3JA 5JZGC 1ZA4A 4OHZA 3RMXA 1YXWA 4OULA 4Q4X1 1RUJ1 2XLFA 1FMD2 1W8HA 1XE8A 3JBG2 3E1F1 5HCHA 3ZMOA 4YVSB 1C28A 5EZWA 3N3HA 3CNAA 4EV0A 3B5LB 1CAVA 4XZUG 3USUB 3H3LA 3MV01 4LKFA 2PHRA 1DU3D 3DXUA 1O91A 1DBNA 4XJ8A 2YROA 5JOZA 2JEMA 2IXHA 3UNPA 3J7MA 4A6SA 2JDYA 1C1LA 2CAVA 1I3HA 2VCBA 1W8WA 4LITA 1C1FA 1W0NA 2QQJA 3MUY1 5I0SA 1YQ5A 1MQTB 4I0AA 3WCRA 3T09A 3EB7A 4B7KA 5JOXA 2OUHA 1W6PB 2IUWA 5FZOB 2GH2A 2IXIA 3MIEA 3WQ0A 1QQP1 2RMU1 4QPWA 3CZUA 5FZ1A 2I2SA 1AR82 5IJRA 2WWUA 3T0AA 2VC9A 5A3WA 1QJY1 3IWZA 2R1BA 4Q4X3 4IERA 1RUJ3 4YM0A 1FPN2 5DAVA 4Z8BA 3H8XA 3I7DA 4Q27A 4FFHA 5A7WA 1JOJA 4XFFA 2ZXQA 1ULOA 3C3VA 4BQWA 3APBA 2XUMA 1AYN2 1W9FA 2WYSA 3IDCB 4XXAA 4HVOA 2JD4A 4R8HA 4YM3A 1DGWA 2VZRA 5FMOS 5C9AC 3GCXA 3KWVA 4Q8LA 3ZXAC 2BGCA 1ENXA 1LJ7A 1SDWA 4P08A 3ZYJB 1VAVA 4ES8A 4V1PA 1AR71 1APNA 1NA1B 5AC91 2ET7A 3NV1A 2WDBA 3VBUB 2A5ZA 2D6PA 4NHYA 1A34A 3W9AA 3MI8A 3AM2A 2QE3A 1FYUA 1KQRA 3E6DA 2O14A 2VQUA 4BU2A 5JZGA 1HN0A 4ZXKA 3WLUA 3VBOA 2XQXA 1RL3A 1PZ8A 2RMU3 1URXA 4D7TA 2WN3A 3NRUA 1QJU2 3WP3A 2W92A 4N9IA 4AK3A 4AVAA 5FZLA 5C71A 4N43B 5CKMA 1LHNA 5BNOB 5JPMB 1DYOA 1XXNA 2BUKA 1UY3A 1CAWA 3OTFA 5J48A 4LKSA 1TG7A 2WT1A 3T2OA 4MUVA 5C6CA 2J1RA 2ZA9A 4ZXEA 5JDBA 1G9BA 4R9CA 1F5FA 2KM2A 2WRAA 1POQA 1EAH2 3E97A 2ZS6B 1ULFA 3OUIA 3AL6A 4XF4A 1JZ5A 3CJIC 1D2SA 4XW3A 1DG6A 3AMNA 3BPZA 3NAPB 4JZRA 1HX6A 2B39A 2DU0A 3GJAA 2D97A 3ACLA 1Y3TA 4HKOA 4BJ0A 1UCXA 5EJ3A 3UT0A 3WDUA 5JMOA 3ZXEA 4MXWB 5HXMA 3ZFEB 1RUE1 4RFT0 1BZWA 4KH9A 2ZABA 3WEZA 3KQ4B 4Z92B 1XE0A 1SFYA 3MFCA 5KHHA 1VBA3 2XGXA 2OKXA 1GFF2 4DY3A 5LA9A 3M3QA 4AOCA 1S0CA 3AKPA 1NYWA 3KHBA 2YFUA 4W50A 4UWDA 5AVAA 2H6CA 1SHWB 2HWE2 5IWFA 3VD4A 4CXYA 3O1SA 3FWEA 4NE9A 4ASKA 1CD3G 5LWBA 5H9RA 1FXZA 3J8F1 4QWNA 2A1XA 3OGSA 1REEA 4C1XA 3Q9OA 1C8M2 2VH9A 3EHKA 5JXIA 1E5IA 1MEC2 4AAXA 5LK7B 3A0NA 1PGSA 4QXHA 3PUSA 5FPZA 2A6VA 1PX3A 3NV3A 2NYYA 5A33B 2FCVA 5F7UA 1RUJ2 4RL7A 1ZBA2 4QGMA 1Z7S1 2VOXA 5AFBA 5J1XA 1B35C 2FDGA 1IHMA 1Z0HA 1TNFA 3MUZ1 4IE0A 1AYM3 2WFF1 2D93A 2YMZA 4QPIC 4JHZA 5JXJA 5FO8B 2ATFA 5CIRA 4IE4A 2MHFA 1RUE3 2QQUA 4WVVA 2FCTA 4QU1A 5B2GB 5JCTA 4HKLA 2CGPA 1CJPA 2GDFA 2Q1MA 3A7QA 1OLRA 2XKOA 2VOTA 3UGHA 1WMDA 1J3QA 2A71A 2PAMA 4AFAA 4KGGA 3N9QA 1SLTA 1LR5A 1YJLA 2DVDA 4XBNA 3J8F3 5FYUA 2B46X 1KEXA 3CJIA 4CXXA 3I2DA 4EJRA 1Q8QA 2VUDA 1QQP2 3WG2A 2FD8A 2KD7A 5CKQA 5FP8A 5IT6A 4D94A 4FXKB 1QJY2 1LOEA 4GWNA 1ODMA 4XDQA 1OLME 3DKWA 1PO21 2P3IA 2YY1A 1Z7S3 3AK0A 3H1WA 3UJQA 1J59A 2CHHA 2RG4A 2XL9A 5I93A 2EICA 2JKBA 4D6RA 2W0XA 5I0UA 2JICA 4AQ6A 2WFF3 3DECA 4Y1ZA 1O3TA 3LQCA 5JXHA 1NZIA 3U37A 4DB5A 2OQ6A 4XDOA 1LEDA 2YBSA 1S0JA 4MGQA 2HWC2 1XE7A 1AR72 3ZVXA 5AC92 4QHBA 2VZUA 5FYSA 2R0FA 4CDXA 2VULA 3TN91 3VKNA 5DAQA 5LB6A 4AE2A 3INAA 5JI7A 3HT1A 4D8MA 1E5RA 1K12A 1W3XA 4WM7B 5KHIA 2DCKA 3F95A 1JYCA 4LHSA 1QF3A 3HWJA 4Q0QA 4CP1A 4XMIA 3WSOA 4CEWA 4BXSV 5CFDB 1B35A 4IEXA 3AXDA 3LA2A 4BE3A 1XC6A 3N9PA 1W6NB 4MLOA 3VBUC 3LOIA 3EMRA 3ZYBA 2NN8A 1W2TA 1PO23 5D1IA 4BISA 3ETQA 3OBRA 3OBAA 1REDA 1ENRA 2YDEA 3IMMA 1UZWA 2VXRA 3O1MA 4Y26A 2ZX0A 3KF3A 4Q0VA 5LBEA 4OQ8A 2YXSA 2R041 5CKNA 2BP6A 5A32A 1ULCA 3T4HB 4DINB 5LW9A 5F5AA 1D7PM 4WVMA 3VD3A 5FOBB 4CU6A 3LKJA 3I2IA 4D69A 1LHVA 2DCYA 4N90A 3VB9A 5DZGA 5FK8A 1JHJA 3TN93 3ZKYA 5L73A 1CGPA 1PO11 1MZFA 1DGLA 3DYPA 1D4VB 3K4AA 3GZTB 1AJKA 1RUE2 1XNKA 4CTEA 3TWIA 4ZPIA 2DUQA 2RDRA 1SPPA 1W3VA 2ENRA 3AKQA 3SCGA 5FXVA 3L2YA 2A6YA 2PYTA 1F8VA 2ZPXA 1CN1A 3P6BA 3ZPOA 2ORXA 3H7JA 1ZA7A 4AI1A 4NRPA 5FPBA 4FP3A 1G8WA 1LENA 4UFHA 4FVVA 5BPXA 4OI0A 1GYKA 3ZFEC 2W1QA 3WW4A 3M8LA 3RQ0A 2AZ5A 4ZZ8A 2R043 3ZN6A 3GZAA 3W21A 4B7EA 1VBE3 5EJ1B 1Q8SA 4Q0PA 4QM8A 5BNNB 4AEMA 4AGGA 2A70A 4AEDC 2D6MA 4H7MA 2ZGPA 4P9JA 3TBDA 5C3PA 1Z7S2 5FY8A 3VZKA 1RINA 2Q5TA 3P5BA 4LBQA 5HCBA 4P02B 1PO13 2XVGA 4N7UA 2WFF2 1BEV1 1UY1A 3GZEA 4KMQA 3OYWA 1QY4A 3RI8A 4AQTA 3DGTA 3DPRB 5BUVA 2BU9A 2E7TA 1EP0A 2P1BA 2Z2SB 1PIV2 1W2OA 2BBAA 3RRDA 2VW2A 4EWEA 2ZJCA 3KB5A 1WA6X 4PQ9A 1PHMA 1UNBA 1UZZA 3PURA 3BTZA 3D3AA 2JDHA 4Y22B 4BDVB 1H0BA 4XTPA 3FFZA 4GMP0 3IN9A 4XHXA 4UOJA 1ND3B 1ND2C 3ILFA 3K3NA 4WBBA 5DZEA 5FZEA 4NAOA 2JJ6A 1W6MB 2V4VA 4LBJA 4Y1VA 2F6BA 2CGNA 3VBFC 4Z1VA 1G9FA 1N1SA 4IDZA 3TAYA 1QKQA 5J96B 4AL9A 3VBHC 3FLPA 1PO22 5M0TA 4RS5B 5D2AA 3AKTA 4HPKA 5FZ8A 4BZ4A 2AENA 1XNTA 1VMFA 1AL21 3ON7A 1TZOA 1YEWA 3F2ZA 2I07B 2X5IB 1R64A 3ZFFC 3ROUA 2BQPA 1F2NA 1BYHA 5F5IA 2ES3A 4CDQB 4WZFA 3I3EA 3HIFA 1EUUA 3JCIA 3BTAA 1DQ0A 5FJHA 3TN92 4E4HA 4L11A 4B1LA 3RYRA 2RS51 2YGMA 3FE5A 1W8UA 1GNHA 3O1VA 3NJXA 4YVWC 2VBDA 4MO3M 3FHQA 4AEDA 2XG3A 2EAKA 3HNYM 4H14A 2GP5A 4HOOA 5EHDA 5EJZB 3I3MA 1BMV2 3TOJA 1NT0A 1OQ1A 2FMYA 2W1WA 1OD5A 5EV7A 5FRAA 5LRSA 2BGOA 5LBBA 1NUKA 1US3A 1MZEA 2ETEA 1UIKA 2R0HA 2C24A 2J7MA 2TEPA 4M3CA 1WD4A 3FHIB 4UT5A 2W5FA 5F37A 4YW1A 5KC5A 4TWTA 1AL23 4WM7C 5CFCC 4DMIA 3H0OA 2R042 1UOGA 5CFDC 1X9TA 3NKTA 4E2GA 5FZGA 4NROA 1SLCA 3CJXA 1MS3A 1ND2A 2DCTA 1S0BA 1X82A 2PHTA 4CEYA 2Q1ZB 1PO12 2FZ1A 2RS53 3B02A 4TN7A 5FZAA 3RZMA 3VBFA 2Y6FA 2VNGA 1YIPA 3OPTA 1WCQA 4RGGA 5JUVA 3OY8B 4IEVA 3VBHA 2WC2A 4G3YC 4ASLA 1DQ5A 1XU2A 4XCBA 5A6ZA 4XABA 4HMZA 1IKQA 1NG0A 1DIWA 2JDZA 1OA4A 2GNTA 5FQ0A 3MV11 1JZ4A 4P9LA 1OVPA 1JYTA 3ZFFA 1ST8A 2RE9A 3MGUA 3OUHA 4LKEA 1DYKA 1FX5A 2BNNA 5DUVA 4HK8A 1UWWA 5JR7B 3PVBB 1RUC2 2GSYA 2YB7A 5E8AA 4A7KA 3SH5A 2HBTA 3MIBA 3ECQA 4BCUA 2PA7A 3KV5A 5IFTA 2RJLA 4FPOB 3WF0A 2N7GA 4YVWA 2WQ4A 2JD9A 3BODA 1TME1 4QQHA 3SKVA 2BFUL 2RHPA 1PX4A 3FUOA 2Q4SA 3M3OA 1CAVB 4B8EA 4NIHA 1XU1A 2C0ZA 1X8MA 4BK5A 1BEV2 2E33A 5FZDA 1D4M1 1DZQA 4LK6A 1JYIA 1IS5A 1RUF1 4YZ1A 3LSDA 3O7OA 1FATA 4JDOA 4L2NA 4NRQA 3ORJA 4XOGA 5DUUA 4P9GA 2WZR1 4CCKA 4JKKA 5BNNC 3WZ1A 2HEYF 5E1RA 4YW7A 2QQOA 1QHDA 2R063 3KM5A 5CFCA 4EN9B 3K3OA 5CG9A 4XDPA 3IDAA 3CLPA 1UOBA 4NMIA 3MF6A 5A6XA 5IFPA 5GZGA 1X8EA 2XQRA 3FLTA 1D0HA 3UJOA 3JUUA 4LK7A 4DUXA 1HQWA 5FZ9A 2W94A 5JOYA 4NR1A 1RIRA 1OVSA 4UW3A 4WM8C 2YC2A 1NCQA 2VPVA 1R091 1YJKA 2EF6A 3IBMA 1H2KA 1TME3 2JE7A 2AR6A 3NQHA 2QQVA 1UY4A 3GBWA 3T3YA 3VDDA 3H9AA 1ND3C 2VO5A 3VHNA 3WCSA 3NNJA 3IDEA 1AL22 5FCCA 1VALA 3VHOA 1D4M3 1U0AA 1VRH2 4IESA 1O8PA 3VDAA 1Q43A 5LEKA 3RWNA 2ZTNA 3OB8A 3I2HA 3T0BA 2WZR3 1WCKA 2XVKA 4QQ2A 1W2UA 4ZU4A 4LJHA 3TB0A 1WCUA 3SCFA 1O5LA 3KLSA 5CBLA 2YYOA 1VRBA 5J09A 1W8TA 2JB8A 1HRI1 4NPMA 5IVYA 3ZSJA 2RS52 2UWAA 4RD7A 4XF0A 2XJVA 2HWD3 2YBPA 2A6WA 3DXTA 4Q29A 5JZGB 3LA7A 2X05A 4CU7A 1JZ6A 5IAXA 4XHBA 3VBOB 2X5IC 1LOBA 1Y9GA 4WZCA 3LZZA 2OPWA 1JS9A 3MPBA 3B00A 3Q8FA 3DEMA 1POV0 1AX0A 5DXDA 2JDPA 5JIUA 2FDHA 4BIOA 4PLOA 2C26A 1ZNPA 1H8TC 1I6XA 1PVC1 5FIXA 1R093 1OBNA 1VIWB 3S6PA 2B42B 3GCWA 1CAWB 4FAGA 2LRPA 4AI8A 1NE4A 1OKOA 2BFUS 2RV9A 3LAGA 1TMF1 1YQ8A 1NE6A 2QQWA 5A3OA 4AVVA 2ZCWA 2OZJA 2Q8EA 1GOGA 3V0AA 4MSVA 2XH6A 3QBQA 5CZKA 3PLQA 3LSEA 2ZEZA 1OXCA 2EVXA 1QEXA 2D3SA 1HRI3 1H9PA 1JZ3A 1FNZA 1LHUA 2ILMA 1C3HA 1ASJ1 1WCSA 1Y4WA 4K21A 3MW4A 4WM8A 1H2LA 5ANNA 3R0RA 3I8TA 2BJSA 3VV1A 1WZXA 4FAHA 5I0DA 3ES4A 4I09A 4JKLA 4C91A 1KFUL 4GXLA 2WA3A 1ZBE1 4A44A 2CNAA 4P00B 1R081 2HEVF 3ZN5A 4K1YA 1PVC3 4XE9A 3Q8BA 2BPA2 2VZOA 3CL1A 5FZBA 5TSWA 1NAEA 1TMF3 2DTYA 2ZGTA 3VKOA 1CZVA 2P3KA 3OGRA 5C5UA 2P17A 3MW2A 2YC0A 1HQNA 3NVCA 5IHRA 5KR7A 5FKBA 2W91A 4YARA 3WQBA 1GZWA 2QNKA 4AHZA 4QU2A 2X5IA 1BK1A 4KWJA 2VMIA 2JB4A 2RS31 2UYBA 4NHKA 1SG3A 1O3QA 1O4ZA 4Q1PA 1LGCA 3GJBA 3PDQA 1J1TA 5E16A 3TNPB 1UXXX 4CE8A 2VMDA 1ASJ3 1RUF2 5GZDA 3RZZA 1C5HA 1H8TA 4Q1RA 1MVQA 2RS11 1QDCA 3HMYA 2WZR2 5T54A 1ZBE3 3K51A 4HFSA 1R083 1SFNA 2Z42A 4FPFA 1JOPA 2G9ZA 2R071 2OZ6A 4JV4A 1ULGA 5FK7A 5FMCA 3DYOA 3WDTA 3WOGA 4DS0A 3N9MA 1R1A3 3OSDA 3CJIB 4XVHA 4H55A 4QQOA 3I2OA 2SBAA 3SITA 1PZ9A 2UU8A 1QNYA 3U4SA 4YGDA 1L7LA 1SCSA 4UXAA 1G86A 5DABA 1F4AA 3AX4A 5GALA 2VCAA 1LESA 2PLV1 3ILRA 3CU7A 3MEPA 3IB3A 4LUMA 4M4PA 3THCA 5L7OB 3BU0A 4J25A 5F3CA 5FR3A 1R092 1JHNA 1I5PA 2X09A 3B01A 4YG6A 4UFLA 2HJIA 2UURA 2XJRA 3ZX7A 4YLZA 3OOXA 1BKZA 1PMJX 2RS33 4PIZA 3MIGA 5SV5A 2L9LA 4Y4RA 3OBZA 1GANA 2OA2A 2A3WA 4IEUA 5E88A 1H2MA 1LHWA 5LY2A 4M3CF 5C3QA 1GWKA 1Q56A 2WS91 4K20A 3POWA 5FLJA 4F3JA 1PNGA 1DFQA 2RS13 5HXVA 1DDLA 4FTSA 2R7EB 5C8CC 4CDXB 2QZ3A 2V5YA 4PDWA 3MF9A 3ZXDA 1I1EA 4XILA 5BV6A 5FREA 1HRI2 4LLFA 4AFMA 1LGNA 2ZZJA 1NKGA 1YYNA 4BQ2A 2QQMA 3HNBM 4JAAA 3ATGA 3HVDA 5I8YA 1RUG1 1HRV3 4M01A 4XYXA 4LO6B 4HXCA 2ZX3A 4I3PA 3RSJA 1L3JA 2JDNA 5FUPA 1XQNA 1B35B 1F35A 4PI2A 4CEWB 3RPQA 2WABA 1V6JA 3WP5A 3IZOA 4RQPC 4E8DA 1Q8PA 1ZRIA 2PLV3 5GLZA 2ZMKA 1NX9A 1CIYA 4DEVA 5DG1A 3O0XA 1PVC2 4H3WA 1BQPA 1MZ5A 4LHNA 1AXYA 5HV4A 5DAPA 3GF6A 2DFCA 5DG2A 5GZCA 4AFDA 3E6CC 3VBOC 2JDKA 3LIGA 5A32B 5FBZA 1FNYA 2WT2A 2WS93 4PIXA 2UY8A 4LKDA 2D6KA 3ZR5A 4WVMB 4XTMA 5ABJA 4CUCA 2VCCA 2NMNA 4LHKA 3OF1A 1W0PA 2GZWA 1GOHA 4IUGA 3RZJA 4XJ9A 1E5HA 1LOFC 3DF0A 3PTRB 3BU7A 2XUEA 4EROA 1RUG3 1RUH2 2VVDA 3AXEA 1W05A 4YSFA 3MPPG 5LBCA 5F9TA 1SPPB 1ZZ7A 3KD4A 4HK9A 2HH9A 5FAXA 3VDCA 4S2HA 2VMEA 3GNEA 3S5QA 4R52A 5A6YA 4NN0A 5IW0A 1ZREA 1WWYA 2Q0AA 5IVCA 2Y33A 4IEQA 4XAEA 2FDJA 2MNGA 1XYNA 1SMVA 3NNMA 2NP0A 4DIQA 2WWSA 2OVUA 4R4ZA 2QQPA 5DMYA 4AQSA 5C8CA 3WXPA 1UN1A 3NL1A 4QGLA 4FFIA 4IL7A 5EQUA 3ZN6B 5KXEA 3OUJA 2E9QA 4JHTA 3VDBA 4L8QA 1DGRN 3OGJA 4YNIA 3CMGA 1S2KA 2K46A 4YPJA 4GB33 2BWAA 4JTOA 3ZSMA 3ZYPA 1L7RA 4LBQB 4W4ZA 4YRDA 4Y1YA 4CUBA 2RS32 2J1EA 5T52A 4CSWA 3OYWB 4RQPA 4NIAA 5JR2A 1PGW2 5FTTC 4A3ZA 5JSOA 2FDKA 2QDRA 2F4LA 4Q0SA 2RS12 1SBDA 1QJX1 1JI6A 3J7HA 1CAXA 1OFNA 3H3UA 4N7IA 3FN9A 1KGYA 3N36A 1KDMA 5IVEA 2R072 1UXZA 3LB9A 4BM8A 3H42B 4YZ5A 1VBA1 3R4UA 4JGYA 1W28A 4META 3WF3A 2GC3A 3U14A 5LK5A 4HG6B 4XQWA 3TYJA 4S2DA 4YM1A 1LOFA 2P4EA 2UWCA 1CWPA 3S57A 3A0KA 2PLV2 4MVTA 4UI9L 1UKRA 3BVCA 4OLLA 4PF1A 4HPKB 3RNSA 1UIJA 4K40A 3I54A 3UKVA 3LEMA 4L99A 4XFHA 2LW8A 1UF2C 1H30A 4P14A 5FJKA 3W20A 1IZ3A 1BCXA 1OURA 4LMFA 2WA4A 1IPKA 4D6SA 3O5SA 1RYYA 1QOSA 3JZVA 4MH0E 5C3RA 4FPCA 2WS92 4MGTA 5F1RA 1YI7A 1W06A 1ZZCA 1AYM1 4MX3A 3WNOA 1QJX3 4YGCA 1DF0A 1UX6A 4KG0A 4CDWC 4OHYA 5K0UB 1H4GA 4AHYA 2W2IA 4N9HA 1IQAA 1UPIA 3UK9A 1S2BA 3ZPYA 3T0DA 4R9DA 3RG0A 1W99A 1OH4A 1RUG2 4AEDB 3HJRA 1UMIA 2VXJA 2OXBA 2XXZA 3ZXKA 2GMEA 2OIIA 2HWB1 4QM9A 5DQ0A 2WO1A 4FFGA 1PMIA 3WG1A 4BH9A 4CDXC 5FXXA 1N47A 2LS6A 2VMHA 3O14A 3ZFGC 4E2QA 5I91A 3FHAA 3UL2A 4M3CB 1G9DA 4O65A 5ACA1 1HV0A 4MZUA 5LEJA 3DV8A 3SXWA 1WMFA 1ZZ6A 3ETPA 2BWCA 4Q4X2 2BNOA 2BZDA 5FYMA 4NPLA 4CXWA 4CEWC 1X9PA 2WSVA 2ZACA 2BGPA 3IDBB 4KI5M 4FPJA 5SV8A 1J58A 1UKGA 5FZKA 3M3EA 4FBFA 1ND2B 3MW3A 4KU7A 4NO4A 4MGYE 4LTAA 4Y4YA 2IZWA 4A7ZA 4ZKTB 4CEYB 4BQXA 4QKFA 3AZVA 3KT7A 5IVJA 4ET7A 3VBFB 1A78A 5FY4A 1UMHA 3AJZA 3VBHB 2VE1A 1QJEA 4YW6A 5FZ6A 1HV1A 3VD9A 1CX1A 2W52A 1BK0A 3ZYFA 5FYTA 4JKMA 5DUXA 3WDVA 4N53A 2DBNA 2HWB3 2VCMA 4WV8A 5FQ0B 4UBGA 3AMHA 4GH4C 3USSA 4DRRA 3U10A 4DZGA 1W8FA 3KVBA 4RGKA 3ZFFB 2RMU2 4IEOA 4CCDA 3QLQA 1Y43B 5ACA3 3O12A 5JMCA 3OPWA 2IC1A 3BB6A 4FOQA 5T5PA 1KS5A 2XB6C 1SACA 1IPJA 2XDVA 2Y6JA 4CDWA 3GYDA 5CADA 1K42A 3QCWA 4BOWA 2FDFA 1XB9A 5FY1A 4V2VA 2NPIA 3AFGA 3S7EA 4CCOA 1OLQA 1VB2A 4YVWB 3POSA 1HB4A 3QOPA 1YQ2A 4M00A 3C7FA 2D6NA 4X6QB 3ZIXA 3HOBA 5CEHA 2ZAAA 2JDUA 3ENRA 4KBBA 5DAXA 2G9FA 1UU5A 2VG9A 2CWMA 3ZFGA 2R49A 4K3UA 3ILNA 4AXOA 5FPVA 5FZCA 2BRTA 5FY7A 4E9KA 1QJX2 2R16A 1UU4A 2PMWB 5CFCB 4FPEA 2VZPA 3JU9A 2GNMA 2ZHLA 2WIIB 4LIUA 4ARXA 3IMNA 1GWLA 3DUIA 4EE2A 4HVQA 1W9YA 4AG4A 1VBA2 4WVWA 5J36A 1Q5OA 3AZZA 2VZQA 3AC0A 2IVIB 2PHUA 4YFWA 3ZDSA 4LOSA 3OPZA 4QX1A 1N3PA 5FO9B 4Z82A 2QQNA 1JU3A 2HLEA 4QQPA 4GWMA 4J1WA 3U11A 5C7GA 1NCQB 4RR3C 5LA1A 3T30A 3ZM8A 4UFKA 5EP9A 4IV3C 1DLLA 3OG2A 3VDDB 4PCRA 3VKLA 1V00A 2Y6LA 1EV13 2ZHMA 1VBE1 4W6YA 3N4MA 1SZBA 2VOKA 4RGAA 4LIVA 3WQ7A 1H1AA 2VNVA 2WO7A 4GH4A 1W2NA 4XBQA 3T2PA 1AYM2 1RUI1 3IAQA 1EPWA 5FWJA 5IVFA 3ASIA 5A7NA 1OPMA 4BQ4A 4NHXA 3E6BA 3ZXJA 2KXLA 5DN2A 4Y33A 2VW1A 4AHXA 2ID4A 4QX7A 4Y1XA 1MS0A 1BXHA 2VD7A 4MHRA 4B3NA 2V72A 3AL5A 4LO7A 4QKBA 5FY0A 1OUSA 2PHLA 4LBQD 3T2TA 2XONA 1AVBA 2Y34A 2YU1A 3NO8A 4YW3A 3UV9A 1EPZA 3H1MA 5GJ6A 4XIOA 1HB2A 4OZOA 3J8F2 4PT6A 1GLHA 1AR61 3MZHA 2Q8OA 5K0UC 2LROA 3TRSB 1XSRA 4ORFA 1XNBA 1GZTA 4XMAA 3ZXLA 5ACA2 2ZX2A 2RVAA 3K4ZA 3POGA 5FMBA 4YG3A 1W8ZA 2JX9A 3I3DA 2D5HA 2ERFA 5DAWA 5F6LB 1HKDA 5L9BA 3TNQA 3V0AB 5F39A 1C5IA 2VNOA 1GR3A 1RUD3 3MLKA 1SBFA 3NSTA 4FTBA 5HV0A 1RUI3 2WJSA 4K8FA 4D0QA 1MS9A 3CF6E 4GIQA 2A3XA 2JG9C 2DURA 2TNFA 1NOVA 4UF0A 1S0GA 3R4SA 4PI0A 3WT3A 2PAKA 4WM8B 4MGSA 4RR3A 3AVRA 4B4QA 3IAPA 4IV3A 2ZX4A 4Y1UA 3CBNA 2AREA 2QTWB 1HLCA 3POEA 2W95A 3WNXA 1KD7A 4MV2A 1AR63 2EIEA 3T4VA 4CEYC 3OD0A 1H1MA 3UETA 1O8SA 3I59A 2XHKA 5I8TA 1IPSA 1GKBA 1WW5A 1VBC1 4BQ1A 4BHPA 3LD8A 4ZU5A 1JZ8A 5BNQA 1GZWB 1YWKA 2XLGA 1FAYA 1FT9A 1O4TA 1U5IA 3WQ1A 3VHRA 2ARXA 2D98A 5GKAC 4HONA 1DHKB 2GNBA 5FZ7A 2Q8DA 1SFPA 4QKNA 2JG8C 5T55A 4EYUA 3OGGA 4J6GA 4LO5B 5JXGA 4LPLA 4IEWA 4I2OA 1H8TB 2XJQA 3FC0A 5K0UA 5EWSA 4MGZE 1OT5A 2VQ0A 4AVSA 3RWKX 1IS6A 2PQQA 1LGBA 2WFPA 3LGRA 5AFEA 2J1UA 3C8XA 4LBMA 4CPBD 4PBPA 1HW5A 1IGOA 4XZPA 3I2FA 4HETA 5LBFA 4NAMA 5CYYA 3FMGA 3Q8CA 5CAZA 2VECA 2D6OX 1QH6A 5G04L 5C70A 1YLLA 3LEKA 3LOBA 1YFWA 2WN2A 4KG8A 1VBC3 2R32A 5A80A 2JG9A 3WUDA 4IE7A 2DUOA 3WG3A 1WMXA 3M70A 1OA3A 1V6NA 3NJZA 1JH5A 2AACA 2W39A 2DFBA 2FDIA 2W1UA 1YFXA 5JIAA 4OVEA 1CAUA 4CCLA 3QD6A 3SQOA 3MHZA 1VBE2 2GNDA 2VVEA 1NXD1 3C7OA 2VQTA 1ZM1A 3B3QE 4CPBA 5A7WB 5DDJ1 3ZXFA 1JUIA 2EIGA 2YC4A 1QU0A 2YPJA 4X8NA 4BQ3A 4FO9A 5B4NA 1VPHA 2OYZA 1GU3A 4PDWB 1NCQC 3B9IA 4IE5A 2OT7A 3CHXA 3MYXA 4M0HA 4ZZ5A 1V6LA 4IE6A 3GHMA 2PHWA 3WNKA 4FXGB 5FPAA 3VDDC 3WDXA 1OKQA 3FBYA 4AI2A 2E31A 3EO6A 4DFSA 4FSJA 2B4KA 3I4IA 4MGKE 4UYBA 4Y5SA 2R061 3LFIA 1LKNA 3BGAA 5IAVA 3H50A 2CY6A 4OQ9A 1SQ4A 5EXOA 2E7QA 4PLMA 1O5UA 2QQKA 4JX0A 2FZ2A 5T5LA 1C57A 2JG8A 1AR62 4LO4B 3I2JA 1LU1A 4IEPA 3WINE 3LF7A 1VMHA 5C33A 2WKKA 4IETA 1NZCA 2IFWA 2V73A 2A73B 3T1MA 5FV3A 1CR7A 3UGGA 4LO8A 1I5ZA 1ALYA 2BOIA 1SLLA 2ZEWA 1D2QA 1S2EA 3SEEA 5DDJ3 1ZVFA 4CP0A 3W59A 5ABJB 4QB2A 4PIYA 1QH7A 3VN4A 1DGRA 3MIDA 1PM7A 4Q4Y1 1QXJA 2A6XA 1KS4A 1MS8A 5A3PA 4CP9A 3K46A 4W6XA 1UX7A 2IXKA 4Z2AA 2OW4A 2VBBA 3T1LA 4OI4A 4RFRB 4COZA 2DWRA 3ACIA 3RYKA 1AJOA 1XBFA 2XKPA 3B7MA 2HBUA 2G9GA 1CPNA 4E4DX 2FBEA 2YV8A 3N9NA 4NIIA 4P9XA 5FP7A 3THDA 2EXIA 2HWD1 1WLCA 3HQUA 3VZJA 2J42A 3I97A 1A8DA 4UFMA 2CV6A 2ZMLA 3GALA 2I45A 4F83A 4PJYA 3AP5A 3LDBA 3WNLA 4B1MA 3O1OA 2ARAA 3H1YA 3O0VA 1QDOA 1CZSA 5C8CB 3O1TA 4XPVA 5ANQA 2WZEA 1KFXL 3BIWE 4F7ZA 4PHZA 5FY5A 1G9AA 2VM9A 3B93A 3DKQA 4A4AA 5C4WA 3TEXA 2J1VA 5L36A 2Y26A 3HR9A 3NV2A 3ZOIA 5FZHA 3ABZA 3E5XA 2X8KA 4Q4Y3 1DZRA 3SKJE 2XVLA 4XXPA 2XJSA 1LOGA 4FPGA 5JSPA 1RVF1 4URTA 1MZ6A 4C90A 2TUNA 2QUOA 2ZKNA 4RQPB 1UU6A 2BOJA 4QXCA 3RFRA 1V6MA 2PHFA 5HCFA 4L92A 4Q2FA 2XPJA 1TE1B 1REFA 1E5SA 4IW3A 5FFOC 4COWA 1U5YA 1CAXB 3RS6A 4K9SA 1UAIA 1IOAA 5GLUA 4ZS2A 2C9KA 2CAUA 5JPNB 3WF2A 1GZ9A 2JWPA 3VUOA 2VTXA 1FV3A 3BTYA 1BHGA 1RGSA 3PIJA 2XWBB 4JGYB 3HAGA 5BY5A 3U1XA 1KRIA 5BNPC 4XF3A 4HVRA 3HN3A 2VUCA 3VGIA 5F3IA 1VBD3 4UBHA 2GP3A 1SLAA 3AP4A 1ODNA 3A21A 3D8CA 5GZFA 2XJTA 1RVF3 4M0NA 1KITA 5F8PA 5D8AC 2CTVA 2DTWA 2KA3A 4XF1A 4G9SB 5J37A 5DDJ2 3WNPA 1D0GA 5C4WC 1JYXA 4IEZA 4Q26A 4LHLA 2B45X 2JIGA 2XWJB 4BA6A 4E4ZA 1Z78A 2HWF3 3VL8A 1ZRFA 4AI0A 5JVVA 5HI0A 4HBNA 1F4HA 5FYZA 2HEWF 2X53S 2ZGRA 2GAUA 5A1LA 1IG3A 5H9QA 4CU9A 4V2WA 5KXCA 1FMD1 1VAKA 4COYA 3JBG1 3KV6A 1VE0A 1EY2A 2DU1A 3A23A 3L2HA 4CUAA 1NCRC 2R062 1RUOA 4ZU7A 4P9WA 1RXFA 3UGFA 2VTFA 4BQYA 4EWDA 2QKDA 1UW8A 4QX8A 1WBFA 4ISRA 3WR0A 1U5XA 1HIXA 1QOOA 1R1A1 4HZFA 5I0RA 1ZZ9A 1CVNA 3PVOA 4PDWC 4QX5A 5L9RA 5C5TA 1W9SA 2YFZA 3NW4A 4GWIA 1LODA 1UOJA 3I3QA 3PMEA 3KV9A 2WWJA 4JCKA 1YO8A 4AGRA 3NKGA 4GKXA 4Q5OA 1UL9A 4I02A 1ACCA 3M1HA 4HSLA 1OFSA 3WDYA 1TME2 5FZ4A 5GM0A 1VAMA 3IKWA 1GP5A 1YFUA 4YM2A 4E27A 5HCAA 1D4M2 4W8JA 1R1ZA 2W47A 4JC1A 5BNPA 5E6HA 4AR2A 2WLQA 2NLRA 4OHWA 2CWSA 1UYPA 4TLFA 4NJ4A 4XBLA 1FMD3 2H6BA 2RDNA 1VR3A 3JBG3 4NPRA 3BI3A 3U75A 3N9OA 3MIFA 5A7PA 1OF4A 2JE9A 4XFIA 5HBAA 4N53B 3JD71 4BQ5A 5ABJC 2WBKA 1G7YA 1YI9A 2QVSB 2Y0IA 2HWD2 4IXLA 1HRV1 3BKZA 5D8AA 1Y7BA 3H3ZA 2UWBA 4IV1C 5LY1A 2IWGB 1Y9QA 1JMUB 4JGZC 3KT1A 2D7FA 2DYCA 2JIJA 2YZ4A 3H7YA 2VZ1A 3EQEA 2WT0A 3BALA 5BXXA 3WNNA 4CDWB 3LCPA 2P37A 3D0JA 5F5QA 2B7YA 4Y5TA 1GUIA 4HSJA 1GQHA 4LULA 1OPOA 5FWEA 4DQAA 4AVTA 3N7LA 1WMEA 3AYCA 4A41A 3WHUA 2EA7A 3WD5A 4BLIA 3VL9A 1CX4A 2ZOEB 2VTXJ 1QJU1 1NCRA 2AC1A 1AR83 1H6XA 2VVFA 4KL1A 4YFZA 1RVF2 1ZX5A 4OMDA 2XHNA 5ISLA 1GQPA 3ZYRA 1FPN3 2EXKA 3KSCA 1NQDA 1UYZA 3ZFGB 3ZN4A 1BBT1 1C8NA 4O61A 4UW5A 1AYN3 4Y24A 2C1FA 5IVBA 3JD73 1K3IA 2DF7A 3HN1A 4O9GA 1YC61 5FOJB 1JTZX 2VW0A 3V64A 3PMSA 4XURA 2WNUC 1OSGA 3FJSA 2B5HA 5A3LA 4AVCA 4KGQA 3NJVA 1WUVA 3AMPA 4TSVA 5GLVA 2Q8CA 1N1VA 5L7OC 1GNYA 1OI6A 4EN0A 4C8DA 2DVFA 2HYKA 1OF3A 2YG0A 4QHOA 5CISA 2ZGNA 1IG0A 2VZVA 3LFMA 3SHRA 3V56A 2H0BA 4LE4A 2VUAA 1AXKA 2G1MA 1OMIA 1ENQA 1TMF2 5FZ3A 3W5MA 4YZ2A 1QJU3 1G9CA 4LORA 4DRVA 4QQLA 5G05L 2GN3A 2QJVA 4A45A 4MHUA 4GKYA 1NLSA 2IVJA 1S1AA 4JGYC 1DCSA 4XQDA 3S7IA 1GZCA 5KC6A 4GB31 4GH4B 2ZAHA 3WG4A 5A1FA 3J7LA 4MG2A 1BBT3 1DQ4A 3RZKA 4QPGC 3WHTA 2YBKA 1J3RA 3JQWA 4JQTA 4IV1A 4JGZA 3J4UH 1KJRA 1C8M1 3D4KA 4Z2WA 1ASJ2 1F15A 4F8AA 2Z4FA 3TEYA 4XF9A 2R1DA 4COVA 4U2AA 1C4RA 3BYWA 1ZBA1 3B69A 4X6RB 5FBJA 1ZBE2 3POYA 3MDPA 1O59A 1R082 2GC1A 3ZR6A 3MIHA 1MACA 2GN7A 2K2SA 4GQ7A 5H9PA 4AI9A 1JZ7A 2C9AA 3J7NA 3M4FA 1J1LA 3ZSLA 2P6CA 4H2AA 1XSQA 4FPHA 3RDIA 1R1A2 4XETA 3PNAA 1YUDA 4OMCA 5FYHA 2J22A 4I30A 5LCWL 1WBLA 4CYDA 1IS4A 1WLWA 4L9BA 3PTYA 1AX1A 3ZKUA 5JWPA 2BVBA 3OGVA 3B94A 3IPVA 1YHFA 1EUTA 3DL3A 1OUXA 1RMU1 1VB4A 4GD4A 4SBVA 3BPSA 2HWE3 1HB3A 3P3PA 2TBVA 2VOWA 4GMP1 2WNUA 1FV2A 2IFRA 3WDWA 3NNGA 5L7OA 1ULPA 1QWRA 4NOTA 1JODA 4RA0A 5FYIA 4OCTA 1C8M3 3RGBA 3ZIWA 2RDQA 1MEC3 5JSRA 4UF0B 3SMHA 4XFAA 4A7YA 2XOMA 3D6EA 1RB8G 4CDUC 2D3PA 4MADA 4CCEA 1ZBA3 4AFBA 1W8NA 1LB2A 2UYAA 5FYYA 2X29A 4RR3B 2Y64A 1JOBA 1X50A 2BV4A 2VU9A 1GP4A 2OPKA 3C2UA 4IV3B 1COV1 2WSUA 3N9LA 3JD72 1XJAA 1V70A 4LBNA 4R9AA 4XUPA 4XJWA 2HYXA 5FDBA 1HRV2 1W6OA 4FPLA 2AUYA 5KWRA 1QGLA 2HWC1 1JUHA 2E63A 4NRMA 1JU4A 5IVVA 3I59B 2CL2A 4O9EA 4QPGA 3OD4A 1W9WA 2WNEA 2EXJA 1RMU3 1U12A 1VBB1 3KT4A 4JQRA 4MYEA 1LECA 4BYYA 4NWWA 2JDMA 2VAUA 4GMP3 1W0OA 4N53C 4YYOA 4IGQA 4R4XA 2MEV1 3ZO0B 1PK6C 2VMGA 4PBOA 3WF1A 1IKPA 1DP0A 1QQP3 3AP7A 3URFA 5A3MA 1SEFA 4QKDA 4YW2A 2XBO1 3WNMA 3NNLA 3ST7A 4FOVA 3OEBA 1OC1A 1QJY3 1ZRDA 3KQRA 3N7MA 2AYHA 5FYCA 3X29B 4ES9A 2YHJA 4K8RB 1N1YA 1ULEA 2NQYA 3VKFC 3U4XA 3RJ2X 2VZSA 1BBT2 1F5JA 2Q30A 1OOPC 2R30A 2W46A 2XR4A 3VBSC 1COV3 3TEZA 1SBEA 2ZX1A 3S30A 3KCYA 4GJZA 3RJRA 4AEJA 3MLJA 4JVAA 4LEJA 5T5JA 4DEQA 3J9SA 1ZYBA 2HWC3 1K5MC 1AR73 4P5YA 5AC93 2WNVC 3FLRA 4XFBA 1DZTA 3SLIA 2WZPP 4Y20A 1W8OA 2EAAA 1VBB3 1H6YA 1VLNA 2JG9B 5FXZA 3GHNA 2WL1A 5F5CA 2D5FA 4R9BA 2H0VA 2ZKLA 1OQDA 4CDUA 2MEV3 4H7LA 4Y3OA 5EYYA 1V0AA 4JDNA 3VZOA 1PM4A 1WW6A 3PL0A 3HPNA 1CAUB 3PVEA 4CCJA 4CZSA 3C7HA 5EIYB 3ACHA 3AP9A 2XBO3 1OD3A 1A8MA 1GP6A 1CQ9A 2RR11 3T08A 1M4WA 1O6UA 3CO2A 1WLTA 4COUA 4LE3A 4GB32 4LA2A 1STMA 4BMBA 4M4RA 5C9AA 3ITQA 1E57A 2BDRA 2Y8KA 4BPZA 4LT5A 1VP6A 1W04A 2ZGUA 2VZTA 4FCAA 4OUEA 3KV4A 2VMFA 4AW7A 1G6NA 1LNSA 1HB1A 4DY5A 5JI9A 2FQPA 1LRHA 2O1QA 2WQ8A 2Y6HA 4HN1A 4CCCA 4OZXA 4ASMB 2Y0OA 1QJZA 4LNVA 1PK6A 4RSUA 2SLIA 3K77A 2D44A 4MXVA 1QMJA 2Z69A 1DQ6A 3P1IA 5GZEA 1XPWA 1S4CA 3CQOA 2JG8B 4LR4A 3KGLA 1PIV1 1RXGA 2NZ9A 2BERA 2PELA 1ULDA 2GU9A 1KXGA 1S0DA 2Y38A 1HDKA 3M3CA 3M3IA 4ONUA 3LPFA 2D6LX 2BEOA 3J26N 1OOPA 2RR13 3GBFA 3VBSA 4YVSC 1RMU2 4I3GA 3I3BA 5JAXA 2OQ7A 5KHJA 1WKYA 1H8VA 3FX3A 5H9SA 2A75A 4D7YA 1QIQA 3WX5A 4CVUA 3PHMA 2MPFA 5DZFA 4AVBA 1EV11 4FI9A 1K5MA 1UY2A 3NMBA 5T3NA 3AKSA 4KU8A 2KR2A 1TNRA 2WNVA 3AFKA 3GZUC 3JQXA 4EZHA 1XOYA 3POIA 4ATEA 1F9KA 2WYFA 4CP9B 3O1PA 2C5DA 3AZXA 3UYJA 4AF9A 4GAZA 2AGSA 1UZ0A 3FL7A 4FPKA 3NNFA 2A3YA 1DQ1A 1MQTC 4GALA 3UESA 1U5ZA 1WD3A 1COV2 2LTNA 2W08A 4HKWA 3LPGA 3EJKA 5A1AA 4IGOA 4L97A 3QH7A 2R6QA 1ZRRA 4Z07A 4P5HA 1PIV3 1SLIA 1S0FA 2CDOA 3M7AA 5EPAA 1JBCA 3CKHA 4RHV1 2GC2A 4UW4A 3GGLA 4X8PA 3H8RA 1AHSA 4DXZA 2DV9A 5F3GA 1V6IA 1OH3A 2Y60A 2ZGLA 1VBB2 1ZZ8A 3VBRB 2XL7A 4DPNA 5C4WB 3EYPA 2FCUA 3FFQA 2DBIA 1W6QA 2QBXA 4FOYA 3HQXA 2MEV2 4XJUA 5CVRA 3WUCA 3MFAA 4GULA 1F31A 2DUPA 1BMV1 3GM8A 4TTGA 5EYXA 2XBO2 1NA1C 3E5QA 1RUD1 3KF5A 1POV1 1V6KA 2F17A 2OS2A 4QPIA 2IXJA 3SC7X 3VZLA 4DXTA 2ZEXA 1UZVA 4LOTA 4D3WA 1JW6A 4ISQA 3SH4A 3WW3A 4AQ2A 3BUCA 2FHRA 2CDPA 4DNYA 4OFGA 5I0TA 3V0BA 5JOWA 4XFGA 1LEMA 3IM0A 3WP4A 4DXSA 2EIDA 3AKRA 3VLBB 4N8MA 2EXHA 5FKCA 4YVSA 1LOCA 4Q4V1 1RHI1 2EALA 5CA6A 1QXPA 1MS5A 4RHV3 1N1TA 3USUA 1O3RA 1PGL1 1T6BX 2WINB 4AYUA 2HWB2 2EIBA 4TYSA 4NIGA 2DDUA 4N43C 1TVGA 2VMCA 4XUOA 5BNOC 1L7QA 3KZ4C 4CUGA 3BN6A 2WNOA 3SCHA 2FMDA 1OLMA 5IUQA 5A7OA 3FBMA 3NWKA 4CP2A 1FI2A 1YQCA 2LM3A 1MQTA 4HN0A 4CCMA 1XRUA 2WAAA 2PN5A 2C6SA 5DPNA 5JLVA 1W6PA 2RR12 3POFA 5FZOA 1POV3 1JYNA 1UD1A 3NAPC 1LTEA 3BTXA 1CONA 2BTVC 3C7EA 4JRLA 5GLWA 1RTVA 1P8JA 2J1SA 3Q8AA 2ARBA 2F4PA 1UY0A 4J1XA 4M3CE 3FUQA 4YGBA 3NV4A 2QCSB 2E6VA 5AVPA 3MO4A 5GLTA 1RUC1 3SNMA 3THTA 4EN6B 5C8WA 1I9RA 3VZNA 2ZZQA 4Q4V3 1RHI3 4DO0A 1YRZA 2JECA 2W68A 5KBFA 1BLZA 1A6CA 1ZZBA 1NLRA 1QXRA 3T2QA 3P3NA 4XUQA 4INDA 3SISA 4XQ4A 5A3TA 4XC9A 1A3KA 4WVZA 4I0WB 2ZMNA 3A4UA 4FP2A 3ZSEA 1JXNA 2ZHKA 4HT1T 4I0BA 1NA1A 4FOWA 5FYVA 3BIEA 1EYBA 3ZYGA 1TQ5A 3VBUA 2P3YA 3CEWA 1H2NA 4AEKA 4O7XA 1OA2A 2W87A 5F2SA 5BYNA 5FLIA 4ATFA 4IGPA 1KDKA 4CA9A 1JZ2A 1AXZA 3LEIA 4MOAA 3AYAA 3DN7A 3VZMA 4TZDA 1EV12 1Q8OA 2VUJA 4UFJA 4NHLA 4D7SA 1RUC3 4HLTA 1SDDB 1WLDA 1UZYA 2RDSA 4N43A 4P9YA 5BNOA 5IYYA 2E26A 5BNPB 2WQZC 1HJGA 1MVEA 1AR91 2YU2A 2YUEA 3POBA 2PXJA 5FZIA 1O7FA 5FXWA 1DGWX 1W03A 3PUHA 1MS4A 1UMZA 1YQ6A 3IIAA 1BVVA 4FQZA 5FUNA 5A7SA 1MPXA 5E89A 3AZYA 4QMAA 3GDBA 5LRRA 4ZHNA 1BEV3 5LA0A 4RYDA 5CG8A 2QQLA 3WP6A 3HT2A 1VRH1 5FPLA 5D8AB 4TLGA 4CRQA 3NAPA 3PVNA 3KVAA 4KNCA 4NWVA 4XACA 1O4YA 3KGZA 4RHV2 3PUIA 4K6BA 3D0SA 5A7QA 2XJUA 1MR5A 4BWOA 1ZRCA 2BVVA 4OHVA 4MXWA 3ZFEA 1AZDA 2O0OA 1ENSA 1WW7A 1TEIA 3IT8A 1CESA 1BJQA 2JENA 4GWJA 4GZ9A 1YNAA 2CU5A 5F6KA 4KBZA 3OEAA 3AZWA 1NXMA 3V65A 1H9WA 1YIFA 2D43A 3D82A 2V4AA 1NCRB 3U0ZA 3HQRA 4EZ4A 3LDKA 4HL0A 3RI9A 5J3UA 3AYDA 4UW6A 1AR93 4LXLA 3WV6A 1PNFA 1RUD2 1RUI2 3E5UA 4E8CA 1N3QA 1Q8VA 2E32A 2YGLA 5FZMA 3LIHA 1AX2A 4S2FA 4ZONA 3R4DB 1HQLA 4IEYA 1SLBA 3MLLA 3VBRC 3RZHA 5KXBA 2C4XA 4QGNA 1DYPA 4I01A 2NMOA 5FMDA 2I74A 4NHMA 5A33A 4B4PA 1JYWA 1O3SA 4ZS3A 1VRH3 4QX2A 5T5OA 4Q8KA 4Q4V2 1RHI2 4LUKA 1LHOA 4D6QA 1LAJA 5IK4A 5B4XA 1PGL2 2JXAA 2IXCA 1GQGA 1V6OA 4KWLA 3THPA 5APAA 1NLQA 3IIIA 4YZ3A 1HXS1 3VHPA 2J1AA 1BVP1 2ZGKA 4QT6A 4B4RA 1Y9MA 4P9IA 2QFEA 1SCRA 1VMJA 4TXWA 1KJLA 4BMEA 4JRAA 4BB3A 5ERLA 4ITCA 3KHCA 2PAEA 4E4SA 2LALA 5A6QA 4XUTA 1QOTA 5EFUA 1RUNA 2GALA 2P3JA 2Q1FA 3OCPA 5D21A 3BCWA 5F32A 2VNRA 5J98B 3KCXA 1Q3EA 3O1RA 2K9ZA 4AZZA 1DQ2A 4ZY9A 2WZ8A 3N7KA 1K45A 4BLJA 2GH8A 3PU3A 4AAPA 5FZFA 4K7JA 5LA2A 1V9U1 2PTMA 4NVPA 4IV1B 4JGZB 1IQDC 4OUMA 2JDAA 2Z79A 2ADEA 2G19A 5K4LA 2ZHNA 4YZ4A 2XJPA 4FFFA 5IK8A 4Q0UA 4EN7B 4A42A 2VY0A 5FLHA 3KMHA 1HXS3 3JB4C 4DUWA 2PHXA 1WW4A 4LBLA 3GBGA 2DCZA 2JE8A 2VGDA 2D40A 3PJQA 3ZMNA 1M06G 4URAA 2DCJA 4AHWA 1AUYA 4ARYA 5KHKA 3ZYHA 3C7GA 4QDSA 1B09A 2PQSA 1QJFA 3POJA 3CZJA 4AWDA 3KS7A 2RM21 1VBC2 3VBRA 1T2XA 2QQIA 3IPVB 2O8QA 1VBD1 4WM7A 3H8UA 3MICA 3A22A 2GC0A 3RMYA 4LBOA 5CFDA 3UKNA 4EN8B 4Q4W1 2WNUB 4G4FA 3R6SA 3LDRA 3K2OA 4XUNA 1V9U3 3U78A 1HJFA
chains in the Genus database with same CATH topology
2BBAA 3ACGA 3ETPA 3GXUA 2BZDA 3NJVA 3WF4A 2BGPA 1GNYA 4KI5M 2ZEYA 3D3AA 4DXRA 4BDVB 1OF3A 2YG0A 4UOJA 2B9VA 2VZVA 2VR4A 1W9TA 2V4VA 4ET7A 3W5MA 2Y6KA 1UMHA 4QB6A 5G05L 4A45A 3VD9A 3CIHA 1CX1A 4QX3A 2WO3A 4JKMA 3W5NA 4QDQA 4PQQA 1XNTA 5HPOA 3F2ZA 1R64A 2WUHA 2Z4FA 3MBWA 2Y6JA 1K42A 3K4DA 1HN1A 3I3EA 1EUUA 1O59A 4QB1A 1JZ7A 2WAOA 3LEGA 4QAWA 1YQ2A 1XNAA 3LE0A 3C7FA 3NJXA 3HOBA 4MO3M 3FHQA 4OMCA 4DUVA 2J22A 5LCWL 3HNYM 5FUIA 5EJZB 2JKXA 3CDZB 3OGVA 2W1WA 1EUTA 2BGOA 1NUKA 1US3A 2J7MA 1CZTA 2VZPA 2W5FA 3NNGA 4ARXA 1ULPA 3VD7A 1US2A 2Y6GA 4AG4A 2XOMA 2V5DA 2VZQA 3AC0A 4MADA 1UYYA 4QX1A 1W8NA 3DYMA 3VD5A 2Y64A 2QQNA 1JU3A 2HLEA 5C7GA 5LA1A 4A6OA 3ZM8A 4XUPA 3ACFA 3OG2A 2ORZA 1WCQA 2HYXA 2Y6LA 5JUVA 2X10A 4OYUA 2WO2A 1JU4A 1J84A 1W9WA 3MV11 3T2PA 1JZ4A 3IAQA 4BK4A 4RN5A 5DN2A 2VL4A 2ID4A 3WF1A 1UWWA 1DP0A 2V72A 2YB7A 2W9XA 3WNMA 2XONA 3ECQA 1PMHX 3OEBA 4LQRA 3SEPA 1GOFA 5IFTA 3WF0A 3HNMA 2JD9A 4QDRA 4UAPA 4OZOA 3SKVA 2VZSA 2W46A 1PX4A 4PT6A 3I2KA 4BK5A 4KWUA 2E33A 2RJ2A 3I2GA 2VZ3A 4DEQA 1JYVA 2RVAA 1UYXA 3HEIA 3K4ZA 4QX0A 4P5YA 4JKKA 3I3DA 2QQOA 1W8OA 1H6YA 3IDAA 4D0QA 5IFPA 3HPNA 3C7HA 5EIYB 3ACHA 4DUXA 1OD3A 3K75B 2W94A 4MGSA 3T08A 3IAPA 2YC2A 2J1TA 3NQHA 4M4RA 2W1SA 2Y8KA 1UY4A 2W95A 2VO5A 4L0PA 4OUEA 2VZTA 2EIEA 3UETA 1O8SA 2VMFA 1LNSA 2Y6HA 1O8PA 2WQ8A 3VDAA 3OB8A 3I2HA 3T0BA 1DLCA 2VJXA 1GMMA 3K77A 3JXSA 1JZ8A 3P1IA 4CU8A 1JZ6A 1J83A 1XPWA 4CU7A 2X05A 3CQOA 2W3JA 2BERA 3LPFA 3E1F1 5JXGA 4LPLA 2C26A 4XZUG 3I3BA 1OT5A 1WKYA 3MV01 4CVUA 4FI9A 1UY2A 2J1UA 2RV9A 3C8XA 3UNPA 3I2FA 5CYYA 2VCBA 1GOGA 5G04L 5C70A 1W0NA 3LEKA 2QQJA 2WN2A 3MUY1 3T09A 3EB7A 1UZ0A 3FL7A 5CZKA 2ZEZA 3UESA 2W1UA 1JZ3A 3LPGA 4QPWA 3CZUA 5A1AA 5IJRA 3T0AA 2VC9A 2CDOA 3C7OA 5I0DA 2VQTA 3CKHA 4JKLA 3GGLA 4A44A 4P00B 2YC4A 2ZXQA 1ULOA 2WYSA 5B4NA 1GU3A 2VZOA 3EYPA 2VZRA 4ZZ5A 2QBXA 3WNKA 4P08A 1NAEA 2E31A 2B4KA 3GM8A 4TTGA 1CZVA 2WDBA 3OGRA 3BGAA 4DXTA 5IHRA 2ZEXA 2W91A 3WQBA 2VQUA 2QQKA 4JX0A 2CDPA 2XQXA 1SG3A 3I2JA 4DXSA 2WN3A 2EIDA 3NRUA 1UXXX 2VMDA 2W92A 5C71A 2ZEWA 3SEEA 1DYOA 2EIBA 1UY3A 2DDUA 1TVGA 2VMCA 4LKSA 4XUOA 1TG7A 1L7QA 4QB2A 3T2OA 2J1RA 3BN6A 4ZXEA 3DYOA 3K46A 1JZ5A 1UX7A 4XVHA 4Z2AA 2WAAA 3ACIA 5DPNA 1F4AA 1JYNA 2VCAA 4M4PA 3THCA 3IB3A 3C7EA 3THDA 2J1SA 1P8JA 2X09A 1I5PA 4BJ0A 5JMOA 1UY0A 3I97A 5HXMA 1PMJX 2L9LA 3WEZA 3MO4A 3WNLA 2OKXA 1CZSA 2WZEA 4W50A 3T2QA 2YFUA 2R7EB 3VD4A 2VM9A 1SHWB 4XUQA 4A4AA 2J1VA 3OGSA 3ABZA 3SKJE 1NKGA 2QQMA 3HNBM 5JXIA 4AAXA 1PX3A 5F7UA 2W87A 2WABA 5J1XA 4E8DA 3MUZ1 1NX9A 1CIYA 4DEVA 1JZ2A 4JHZA 4MOAA 3LEIA 5JXJA 2C9KA 3WF2A 1BHGA 1SDDB 5IYYA 3A7QA 2E26A 2VOTA 4CUCA 2VCCA 3HN3A 3PUHA 1GOHA 1MPXA 4IUGA 3GDBA 1KEXA 5LA0A 4RYDA 3A21A 2QQLA 2KD7A 3PUIA 3VDCA 2VMEA 2EICA 3WNPA 1JYXA 3DECA 3LQCA 5JXHA 4GZ9A 4GWJA 3U37A 1F4HA 3OEAA 5DMYA 4MGQA 4CU9A 4CUAA 2VZUA 3A23A 3VDBA 2VTFA 3CMGA 4YPJA 4E8CA 2E32A 4D8MA 1K12A 1L7RA 2DCKA 4W4ZA 4CUBA 4LHSA 2C4XA 2J1EA 3WSOA 1JYWA 4BXSV 1W9SA 5JR2A 2YFZA 4GWIA 4QX2A 4A3ZA 1XC6A 5B4XA 1JI6A 3J7HA 3OBAA 3IIIA 3FN9A 1KGYA 2J1AA 1UXZA 4W8JA 4TXWA 2W47A 3WF3A 4XUTA 1D7PM 3VD3A 4HG6B 4CU6A 3I2IA 1JHJA 1OF4A 4UI9L 4ZY9A 2WZ8A 4PF1A 1K45A 3DYPA 2WBKA 3K4AA 5LA2A 2LW8A 1IQDC 2JDAA 1RYYA 3P6BA 2VZ1A 3WNNA 2ORXA 3WNOA 1GUIA 4A42A 4DUWA 4A41A 2W1QA 2JE8A 4ZZ8A 3T0DA 1W99A 2DCJA 1H6XA 1OH4A 4ARYA 5EJ1B 3C7GA 4QDSA 3HJRA 2PQSA 4OMDA 2XHNA 1UMIA 3CZJA 1GQPA 1T2XA 2QQIA 1UYZA 2WO1A 5DQ0A 4P02B 2LS6A 3A22A 1K3IA 1UY1A 3FHAA 4KMQA 4XUNA 4XURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBA A;  3ACG A;  3ETP A;  3GXU A;  2BZD A;  3NJV A;  3WF4 A;  2BGP A;  1GNY A;  4KI5 M;  2ZEY A;  3D3A A;  4DXR A;  4BDV B;  1OF3 A;  2YG0 A;  4UOJ A;  2B9V A;  2VZV A;  2VR4 A;  1W9T A;  2V4V A;  4ET7 A;  3W5M A;  2Y6K A;  1UMH A;  4QB6 A;  5G05 L;  4A45 A;  3VD9 A;  3CIH A;  1CX1 A;  4QX3 A;  2WO3 A;  4JKM A;  3W5N A;  4QDQ A;  4PQQ A;  1XNT A;  5HPO A;  3F2Z A;  1R64 A;  2WUH A;  2Z4F A;  3MBW A;  2Y6J A;  1K42 A;  3K4D A;  1HN1 A;  3I3E A;  1EUU A;  1O59 A;  4QB1 A;  1JZ7 A;  2WAO A;  3LEG A;  4QAW A;  1YQ2 A;  1XNA A;  3LE0 A;  3C7F A;  3NJX A;  3HOB A;  4MO3 M;  3FHQ A;  4OMC A;  4DUV A;  2J22 A;  5LCW L;  3HNY M;  5FUI A;  5EJZ B;  2JKX A;  3CDZ B;  3OGV A;  2W1W A;  1EUT A;  2BGO A;  1NUK A;  1US3 A;  2J7M A;  1CZT A;  2VZP A;  2W5F A;  3NNG A;  4ARX A;  1ULP A;  3VD7 A;  1US2 A;  2Y6G A;  4AG4 A;  2XOM A;  2V5D A;  2VZQ A;  3AC0 A;  4MAD A;  1UYY A;  4QX1 A;  1W8N A;  3DYM A;  3VD5 A;  2Y64 A;  2QQN A;  1JU3 A;  2HLE A;  5C7G A;  5LA1 A;  4A6O A;  3ZM8 A;  4XUP A;  3ACF A;  3OG2 A;  2ORZ A;  1WCQ A;  2HYX A;  2Y6L A;  5JUV A;  2X10 A;  4OYU A;  2WO2 A;  1JU4 A;  1J84 A;  1W9W A;  3MV1 1;  3T2P A;  1JZ4 A;  3IAQ A;  4BK4 A;  4RN5 A;  5DN2 A;  2VL4 A;  2ID4 A;  3WF1 A;  1UWW A;  1DP0 A;  2V72 A;  2YB7 A;  2W9X A;  3WNM A;  2XON A;  3ECQ A;  1PMH X;  3OEB A;  4LQR A;  3SEP A;  1GOF A;  5IFT A;  3WF0 A;  3HNM A;  2JD9 A;  4QDR A;  4UAP A;  4OZO A;  3SKV A;  2VZS A;  2W46 A;  1PX4 A;  4PT6 A;  3I2K A;  4BK5 A;  4KWU A;  2E33 A;  2RJ2 A;  3I2G A;  2VZ3 A;  4DEQ A;  1JYV A;  2RVA A;  1UYX A;  3HEI A;  3K4Z A;  4QX0 A;  4P5Y A;  4JKK A;  3I3D A;  2QQO A;  1W8O A;  1H6Y A;  3IDA A;  4D0Q A;  5IFP A;  3HPN A;  3C7H A;  5EIY B;  3ACH A;  4DUX A;  1OD3 A;  3K75 B;  2W94 A;  4MGS A;  3T08 A;  3IAP A;  2YC2 A;  2J1T A;  3NQH A;  4M4R A;  2W1S A;  2Y8K A;  1UY4 A;  2W95 A;  2VO5 A;  4L0P A;  4OUE A;  2VZT A;  2EIE A;  3UET A;  1O8S A;  2VMF A;  1LNS A;  2Y6H A;  1O8P A;  2WQ8 A;  3VDA A;  3OB8 A;  3I2H A;  3T0B A;  1DLC A;  2VJX A;  1GMM A;  3K77 A;  3JXS A;  1JZ8 A;  3P1I A;  4CU8 A;  1JZ6 A;  1J83 A;  1XPW A;  4CU7 A;  2X05 A;  3CQO A;  2W3J A;  2BER A;  3LPF A;  3E1F 1;  5JXG A;  4LPL A;  2C26 A;  4XZU G;  3I3B A;  1OT5 A;  1WKY A;  3MV0 1;  4CVU A;  4FI9 A;  1UY2 A;  2J1U A;  2RV9 A;  3C8X A;  3UNP A;  3I2F A;  5CYY A;  2VCB A;  1GOG A;  5G04 L;  5C70 A;  1W0N A;  3LEK A;  2QQJ A;  2WN2 A;  3MUY 1;  3T09 A;  3EB7 A;  1UZ0 A;  3FL7 A;  5CZK A;  2ZEZ A;  3UES A;  2W1U A;  1JZ3 A;  3LPG A;  4QPW A;  3CZU A;  5A1A A;  5IJR A;  3T0A A;  2VC9 A;  2CDO A;  3C7O A;  5I0D A;  2VQT A;  3CKH A;  4JKL A;  3GGL A;  4A44 A;  4P00 B;  2YC4 A;  2ZXQ A;  1ULO A;  2WYS A;  5B4N A;  1GU3 A;  2VZO A;  3EYP A;  2VZR A;  4ZZ5 A;  2QBX A;  3WNK A;  4P08 A;  1NAE A;  2E31 A;  2B4K A;  3GM8 A;  4TTG A;  1CZV A;  2WDB A;  3OGR A;  3BGA A;  4DXT A;  5IHR A;  2ZEX A;  2W91 A;  3WQB A;  2VQU A;  2QQK A;  4JX0 A;  2CDP A;  2XQX A;  1SG3 A;  3I2J A;  4DXS A;  2WN3 A;  2EID A;  3NRU A;  1UXX X;  2VMD A;  2W92 A;  5C71 A;  2ZEW A;  3SEE A;  1DYO A;  2EIB A;  1UY3 A;  2DDU A;  1TVG A;  2VMC A;  4LKS A;  4XUO A;  1TG7 A;  1L7Q A;  4QB2 A;  3T2O A;  2J1R A;  3BN6 A;  4ZXE A;  3DYO A;  3K46 A;  1JZ5 A;  1UX7 A;  4XVH A;  4Z2A A;  2WAA A;  3ACI A;  5DPN A;  1F4A A;  1JYN A;  2VCA A;  4M4P A;  3THC A;  3IB3 A;  3C7E A;  3THD A;  2J1S A;  1P8J A;  2X09 A;  1I5P A;  4BJ0 A;  5JMO A;  1UY0 A;  3I97 A;  5HXM A;  1PMJ X;  2L9L A;  3WEZ A;  3MO4 A;  3WNL A;  2OKX A;  1CZS A;  2WZE A;  4W50 A;  3T2Q A;  2YFU A;  2R7E B;  3VD4 A;  2VM9 A;  1SHW B;  4XUQ A;  4A4A A;  2J1V A;  3OGS A;  3ABZ A;  3SKJ E;  1NKG A;  2QQM A;  3HNB M;  5JXI A;  4AAX A;  1PX3 A;  5F7U A;  2W87 A;  2WAB A;  5J1X A;  4E8D A;  3MUZ 1;  1NX9 A;  1CIY A;  4DEV A;  1JZ2 A;  4JHZ A;  4MOA A;  3LEI A;  5JXJ A;  2C9K A;  3WF2 A;  1BHG A;  1SDD B;  5IYY A;  3A7Q A;  2E26 A;  2VOT A;  4CUC A;  2VCC A;  3HN3 A;  3PUH A;  1GOH A;  1MPX A;  4IUG A;  3GDB A;  1KEX A;  5LA0 A;  4RYD A;  3A21 A;  2QQL A;  2KD7 A;  3PUI A;  3VDC A;  2VME A;  2EIC A;  3WNP A;  1JYX A;  3DEC A;  3LQC A;  5JXH A;  4GZ9 A;  4GWJ A;  3U37 A;  1F4H A;  3OEA A;  5DMY A;  4MGQ A;  4CU9 A;  4CUA A;  2VZU A;  3A23 A;  3VDB A;  2VTF A;  3CMG A;  4YPJ A;  4E8C A;  2E32 A;  4D8M A;  1K12 A;  1L7R A;  2DCK A;  4W4Z A;  4CUB A;  4LHS A;  2C4X A;  2J1E A;  3WSO A;  1JYW A;  4BXS V;  1W9S A;  5JR2 A;  2YFZ A;  4GWI A;  4QX2 A;  4A3Z A;  1XC6 A;  5B4X A;  1JI6 A;  3J7H A;  3OBA A;  3III A;  3FN9 A;  1KGY A;  2J1A A;  1UXZ A;  4W8J A;  4TXW A;  2W47 A;  3WF3 A;  4XUT A;  1D7P M;  3VD3 A;  4HG6 B;  4CU6 A;  3I2I A;  1JHJ A;  1OF4 A;  4UI9 L;  4ZY9 A;  2WZ8 A;  4PF1 A;  1K45 A;  3DYP A;  2WBK A;  3K4A A;  5LA2 A;  2LW8 A;  1IQD C;  2JDA A;  1RYY A;  3P6B A;  2VZ1 A;  3WNN A;  2ORX A;  3WNO A;  1GUI A;  4A42 A;  4DUW A;  4A41 A;  2W1Q A;  2JE8 A;  4ZZ8 A;  3T0D A;  1W99 A;  2DCJ A;  1H6X A;  1OH4 A;  4ARY A;  5EJ1 B;  3C7G A;  4QDS A;  3HJR A;  2PQS A;  4OMD A;  2XHN A;  1UMI A;  3CZJ A;  1GQP A;  1T2X A;  2QQI A;  1UYZ A;  2WO1 A;  5DQ0 A;  4P02 B;  2LS6 A;  3A22 A;  1K3I A;  1UY1 A;  3FHA A;  4KMQ A;  4XUN A;  4XUR A; 
#chains in the Genus database with same CATH topology
 1W6N A;  2BW8 A;  3DPR C;  2ZGO A;  3ACG A;  4GA9 A;  2P6H A;  3GXU A;  3G7D A;  4OHX A;  4QXK A;  3WF4 A;  3K48 A;  1AR9 2;  2ZEY A;  2DVG A;  4DXR A;  5K7P A;  3AP6 A;  3BOP A;  3PIG A;  4A3X A;  2B9V A;  2HWF 1;  4XCA A;  1LUL A;  3QAC A;  4EQV A;  2VR4 A;  2NM1 A;  4KWK A;  3ALQ A;  1W9T A;  5FP9 A;  5FPX A;  5IK7 A;  1UO9 A;  3HBK A;  3TEW A;  4CCN A;  4YW4 A;  2O8O A;  2Y6K A;  1X36 A;  2BBV A;  4QB6 A;  1W6O B;  2HKX A;  1RUF 3;  4LLO A;  4BXF A;  4KQ7 A;  3AVS A;  3CIH A;  3NJY A;  4QX3 A;  1N3O A;  2RM2 3;  2ZGM A;  4AGV A;  2WO3 A;  1W90 A;  3AMQ A;  4XAA A;  4QHZ A;  4XFC A;  4QPG B;  5DUW A;  1OHF A;  4QDQ A;  5F3E A;  3W5N A;  4YW5 A;  3RZG A;  4PQQ A;  4RS5 C;  2E7A A;  5I8S A;  3OJB A;  1WCD J;  5HPO A;  3LWC A;  4Q4W 3;  1RIT A;  2WUH A;  1GNZ A;  1W2A X;  4FPY A;  3B9C A;  1XYP A;  4EWA A;  1AL0 G;  5C3O A;  3RZL A;  4FTE A;  2Z5W A;  2BYV E;  3MBW A;  5FZ0 A;  3WVJ A;  3D5O A;  3K4D A;  3PUA A;  1HN1 A;  1NY7 1;  1NQJ A;  4YWA A;  3ES1 A;  5CB7 A;  4LBK A;  3AMM A;  4QB1 A;  2PFW A;  4CDQ C;  5A70 A;  5C3S A;  2AEY A;  2WAO A;  3LEG A;  3AYE A;  3ZDV A;  5KHG A;  1GIC A;  4QAW A;  1XNA A;  3LE0 A;  4E2S A;  1FOD 1;  4FQ4 A;  4YGE A;  3AB0 A;  3WW2 A;  1H4H A;  3PUQ A;  4DUV A;  1LU2 A;  5BNN A;  5FUI A;  2ET1 A;  4PLN A;  1ONA A;  2LUW A;  2OX0 A;  3AJY A;  2JKX A;  3DCQ A;  3CDZ B;  3FZ3 A;  4OUS A;  2ADD A;  3RVH A;  4OI2 A;  4C0B A;  2XML A;  2B9U A;  2V09 A;  1CZT A;  4NUB A;  1LOA A;  2WLP A;  3W58 A;  1YFY A;  2XLA A;  3DPR A;  4Y20 B;  1HXS 2;  4K1Z A;  5CU1 A;  1XND A;  1US2 A;  3VD7 A;  5F2W A;  2Y6G A;  4CDU B;  1RUH 1;  2A7A A;  2V5D A;  3KCC A;  4Y22 A;  1UYY A;  4LA3 A;  3DYM A;  1ND3 A;  4YG0 A;  3VD5 A;  3ZLI A;  1YCI A;  4A6O A;  1CIW A;  1W6M A;  5C9A B;  3ACF A;  3N7J A;  4Q4Y 2;  4AFC A;  1GSL A;  4B29 A;  4W6W A;  1AR8 1;  2ORZ A;  1FOD 3;  4QD2 A;  3LA3 A;  4XJA A;  1V9U 2;  2X10 A;  2P2K A;  5IAT A;  4OYU A;  1RJ8 A;  4XEZ A;  1PZ7 A;  2PHD A;  2WO2 A;  1FPN 1;  4AI3 A;  2DVA A;  4MGI E;  1IS3 A;  1JN2 P;  1J84 A;  1RJ7 A;  4RS5 A;  1AF9 A;  2P34 A;  3R05 A;  1K5J A;  4XIK A;  5K9Y A;  5KXD A;  4HAN A;  1AYN 1;  3Q8E A;  4A2U A;  3PJY A;  1X7N A;  2AEZ A;  2OUJ A;  4BK4 A;  1PK6 B;  1T6G C;  4RN5 A;  2CYF A;  3ZSK A;  2VL4 A;  3QH6 A;  5A3N A;  3BOW A;  2ZGQ A;  3EXU A;  2YPD A;  2VQA A;  4CDQ A;  1PGW 1;  2W9X A;  4C0H A;  1RUH 3;  1XNC A;  1PMH X;  5T50 A;  4LQR A;  3SEP A;  1GOF A;  5IK5 A;  5L9V A;  2A6Z A;  5K8S A;  2RM2 2;  5A3U A;  5FPU A;  3HNM A;  4S2G A;  1UOF A;  4QDR A;  3VBS B;  1OOP B;  4UAP A;  1MS1 A;  5FO7 B;  4Y5Z 0;  3UKT A;  3S0M A;  2RJK A;  1S0E A;  1VBD 2;  5LZ6 A;  2AH2 A;  1X33 A;  1CPM A;  2CGO A;  2D3R A;  3I2K A;  4KWU A;  2RJ2 A;  2UY9 A;  1OQE A;  3N35 A;  3I2G A;  2VZ3 A;  3L9J T;  2K0G A;  3O0W A;  4Q4W 2;  1K5M B;  3M2M A;  5LAS A;  1JYV A;  5LAT A;  1UYX A;  3HEI A;  1GV9 A;  3PU8 A;  2WNV B;  4QX0 A;  3HBZ A;  4U36 A;  3WY6 A;  4JDM A;  4QPY A;  5FYB A;  1S55 A;  2GMM A;  2B8M A;  2IXL A;  2HWF 2;  3OBT A;  3G6J B;  4C1W A;  1UQX A;  3VKM A;  4BIF A;  1W39 A;  3O1U A;  1EAH 1;  5CNA A;  1XYO A;  3ELN A;  2G4I A;  2ARC A;  3S5A A;  2DVB A;  3U07 A;  3ME2 A;  1J3P A;  4IQP A;  3K75 B;  4PF5 A;  2E51 A;  3SH3 A;  1GWM A;  5J7M A;  4QXB A;  1CJD A;  2E53 A;  2J1T A;  5FMO L;  2ZGS A;  3EBR A;  2W1S A;  3HD8 B;  1UPS A;  4L0P A;  3OY8 A;  3H8O A;  4FT8 A;  1WGP A;  5FP4 A;  2R07 3;  1PVX A;  4W65 A;  5L19 A;  4NID A;  1RC6 A;  2P5B A;  1W6Q B;  3JB8 A;  2GMP A;  4DOU A;  2WR9 A;  1LCL A;  2VOV A;  1S0I A;  4JTN A;  3WW1 A;  1VJ2 A;  2VBP A;  3RYP A;  3I49 A;  1GBG A;  4OI1 A;  1DLC A;  2BNM A;  2VJX A;  2HWE 1;  4UFI A;  1H1I A;  1NY7 2;  5FY9 A;  4SLI A;  1GMM A;  4QPI B;  3ZXG A;  2QZ2 A;  3JXS A;  2QDN A;  2CSG A;  4CU8 A;  1WA4 A;  4GJY A;  1QNW A;  4XJZ A;  1MEC 1;  1J83 A;  2ZBJ A;  3ZYI B;  5FP3 A;  1EAH 3;  1FOD 2;  3V0B B;  2W3J A;  5JZG C;  1ZA4 A;  4OHZ A;  3RMX A;  1YXW A;  4OUL A;  4Q4X 1;  1RUJ 1;  2XLF A;  1FMD 2;  1W8H A;  1XE8 A;  3JBG 2;  3E1F 1;  5HCH A;  3ZMO A;  4YVS B;  1C28 A;  5EZW A;  3N3H A;  3CNA A;  4EV0 A;  3B5L B;  1CAV A;  4XZU G;  3USU B;  3H3L A;  3MV0 1;  4LKF A;  2PHR A;  1DU3 D;  3DXU A;  1O91 A;  1DBN A;  4XJ8 A;  2YRO A;  5JOZ A;  2JEM A;  2IXH A;  3UNP A;  3J7M A;  4A6S A;  2JDY A;  1C1L A;  2CAV A;  1I3H A;  2VCB A;  1W8W A;  4LIT A;  1C1F A;  1W0N A;  2QQJ A;  3MUY 1;  5I0S A;  1YQ5 A;  1MQT B;  4I0A A;  3WCR A;  3T09 A;  3EB7 A;  4B7K A;  5JOX A;  2OUH A;  1W6P B;  2IUW A;  5FZO B;  2GH2 A;  2IXI A;  3MIE A;  3WQ0 A;  1QQP 1;  2RMU 1;  4QPW A;  3CZU A;  5FZ1 A;  2I2S A;  1AR8 2;  5IJR A;  2WWU A;  3T0A A;  2VC9 A;  5A3W A;  1QJY 1;  3IWZ A;  2R1B A;  4Q4X 3;  4IER A;  1RUJ 3;  4YM0 A;  1FPN 2;  5DAV A;  4Z8B A;  3H8X A;  3I7D A;  4Q27 A;  4FFH A;  5A7W A;  1JOJ A;  4XFF A;  2ZXQ A;  1ULO A;  3C3V A;  4BQW A;  3APB A;  2XUM A;  1AYN 2;  1W9F A;  2WYS A;  3IDC B;  4XXA A;  4HVO A;  2JD4 A;  4R8H A;  4YM3 A;  1DGW A;  2VZR A;  5FMO S;  5C9A C;  3GCX A;  3KWV A;  4Q8L A;  3ZXA C;  2BGC A;  1ENX A;  1LJ7 A;  1SDW A;  4P08 A;  3ZYJ B;  1VAV A;  4ES8 A;  4V1P A;  1AR7 1;  1APN A;  1NA1 B;  5AC9 1;  2ET7 A;  3NV1 A;  2WDB A;  3VBU B;  2A5Z A;  2D6P A;  4NHY A;  1A34 A;  3W9A A;  3MI8 A;  3AM2 A;  2QE3 A;  1FYU A;  1KQR A;  3E6D A;  2O14 A;  2VQU A;  4BU2 A;  5JZG A;  1HN0 A;  4ZXK A;  3WLU A;  3VBO A;  2XQX A;  1RL3 A;  1PZ8 A;  2RMU 3;  1URX A;  4D7T A;  2WN3 A;  3NRU A;  1QJU 2;  3WP3 A;  2W92 A;  4N9I A;  4AK3 A;  4AVA A;  5FZL A;  5C71 A;  4N43 B;  5CKM A;  1LHN A;  5BNO B;  5JPM B;  1DYO A;  1XXN A;  2BUK A;  1UY3 A;  1CAW A;  3OTF A;  5J48 A;  4LKS A;  1TG7 A;  2WT1 A;  3T2O A;  4MUV A;  5C6C A;  2J1R A;  2ZA9 A;  4ZXE A;  5JDB A;  1G9B A;  4R9C A;  1F5F A;  2KM2 A;  2WRA A;  1POQ A;  1EAH 2;  3E97 A;  2ZS6 B;  1ULF A;  3OUI A;  3AL6 A;  4XF4 A;  1JZ5 A;  3CJI C;  1D2S A;  4XW3 A;  1DG6 A;  3AMN A;  3BPZ A;  3NAP B;  4JZR A;  1HX6 A;  2B39 A;  2DU0 A;  3GJA A;  2D97 A;  3ACL A;  1Y3T A;  4HKO A;  4BJ0 A;  1UCX A;  5EJ3 A;  3UT0 A;  3WDU A;  5JMO A;  3ZXE A;  4MXW B;  5HXM A;  3ZFE B;  1RUE 1;  4RFT 0;  1BZW A;  4KH9 A;  2ZAB A;  3WEZ A;  3KQ4 B;  4Z92 B;  1XE0 A;  1SFY A;  3MFC A;  5KHH A;  1VBA 3;  2XGX A;  2OKX A;  1GFF 2;  4DY3 A;  5LA9 A;  3M3Q A;  4AOC A;  1S0C A;  3AKP A;  1NYW A;  3KHB A;  2YFU A;  4W50 A;  4UWD A;  5AVA A;  2H6C A;  1SHW B;  2HWE 2;  5IWF A;  3VD4 A;  4CXY A;  3O1S A;  3FWE A;  4NE9 A;  4ASK A;  1CD3 G;  5LWB A;  5H9R A;  1FXZ A;  3J8F 1;  4QWN A;  2A1X A;  3OGS A;  1REE A;  4C1X A;  3Q9O A;  1C8M 2;  2VH9 A;  3EHK A;  5JXI A;  1E5I A;  1MEC 2;  4AAX A;  5LK7 B;  3A0N A;  1PGS A;  4QXH A;  3PUS A;  5FPZ A;  2A6V A;  1PX3 A;  3NV3 A;  2NYY A;  5A33 B;  2FCV A;  5F7U A;  1RUJ 2;  4RL7 A;  1ZBA 2;  4QGM A;  1Z7S 1;  2VOX A;  5AFB A;  5J1X A;  1B35 C;  2FDG A;  1IHM A;  1Z0H A;  1TNF A;  3MUZ 1;  4IE0 A;  1AYM 3;  2WFF 1;  2D93 A;  2YMZ A;  4QPI C;  4JHZ A;  5JXJ A;  5FO8 B;  2ATF A;  5CIR A;  4IE4 A;  2MHF A;  1RUE 3;  2QQU A;  4WVV A;  2FCT A;  4QU1 A;  5B2G B;  5JCT A;  4HKL A;  2CGP A;  1CJP A;  2GDF A;  2Q1M A;  3A7Q A;  1OLR A;  2XKO A;  2VOT A;  3UGH A;  1WMD A;  1J3Q A;  2A71 A;  2PAM A;  4AFA A;  4KGG A;  3N9Q A;  1SLT A;  1LR5 A;  1YJL A;  2DVD A;  4XBN A;  3J8F 3;  5FYU A;  2B46 X;  1KEX A;  3CJI A;  4CXX A;  3I2D A;  4EJR A;  1Q8Q A;  2VUD A;  1QQP 2;  3WG2 A;  2FD8 A;  2KD7 A;  5CKQ A;  5FP8 A;  5IT6 A;  4D94 A;  4FXK B;  1QJY 2;  1LOE A;  4GWN A;  1ODM A;  4XDQ A;  1OLM E;  3DKW A;  1PO2 1;  2P3I A;  2YY1 A;  1Z7S 3;  3AK0 A;  3H1W A;  3UJQ A;  1J59 A;  2CHH A;  2RG4 A;  2XL9 A;  5I93 A;  2EIC A;  2JKB A;  4D6R A;  2W0X A;  5I0U A;  2JIC A;  4AQ6 A;  2WFF 3;  3DEC A;  4Y1Z A;  1O3T A;  3LQC A;  5JXH A;  1NZI A;  3U37 A;  4DB5 A;  2OQ6 A;  4XDO A;  1LED A;  2YBS A;  1S0J A;  4MGQ A;  2HWC 2;  1XE7 A;  1AR7 2;  3ZVX A;  5AC9 2;  4QHB A;  2VZU A;  5FYS A;  2R0F A;  4CDX A;  2VUL A;  3TN9 1;  3VKN A;  5DAQ A;  5LB6 A;  4AE2 A;  3INA A;  5JI7 A;  3HT1 A;  4D8M A;  1E5R A;  1K12 A;  1W3X A;  4WM7 B;  5KHI A;  2DCK A;  3F95 A;  1JYC A;  4LHS A;  1QF3 A;  3HWJ A;  4Q0Q A;  4CP1 A;  4XMI A;  3WSO A;  4CEW A;  4BXS V;  5CFD B;  1B35 A;  4IEX A;  3AXD A;  3LA2 A;  4BE3 A;  1XC6 A;  3N9P A;  1W6N B;  4MLO A;  3VBU C;  3LOI A;  3EMR A;  3ZYB A;  2NN8 A;  1W2T A;  1PO2 3;  5D1I A;  4BIS A;  3ETQ A;  3OBR A;  3OBA A;  1RED A;  1ENR A;  2YDE A;  3IMM A;  1UZW A;  2VXR A;  3O1M A;  4Y26 A;  2ZX0 A;  3KF3 A;  4Q0V A;  5LBE A;  4OQ8 A;  2YXS A;  2R04 1;  5CKN A;  2BP6 A;  5A32 A;  1ULC A;  3T4H B;  4DIN B;  5LW9 A;  5F5A A;  1D7P M;  4WVM A;  3VD3 A;  5FOB B;  4CU6 A;  3LKJ A;  3I2I A;  4D69 A;  1LHV A;  2DCY A;  4N90 A;  3VB9 A;  5DZG A;  5FK8 A;  1JHJ A;  3TN9 3;  3ZKY A;  5L73 A;  1CGP A;  1PO1 1;  1MZF A;  1DGL A;  3DYP A;  1D4V B;  3K4A A;  3GZT B;  1AJK A;  1RUE 2;  1XNK A;  4CTE A;  3TWI A;  4ZPI A;  2DUQ A;  2RDR A;  1SPP A;  1W3V A;  2ENR A;  3AKQ A;  3SCG A;  5FXV A;  3L2Y A;  2A6Y A;  2PYT A;  1F8V A;  2ZPX A;  1CN1 A;  3P6B A;  3ZPO A;  2ORX A;  3H7J A;  1ZA7 A;  4AI1 A;  4NRP A;  5FPB A;  4FP3 A;  1G8W A;  1LEN A;  4UFH A;  4FVV A;  5BPX A;  4OI0 A;  1GYK A;  3ZFE C;  2W1Q A;  3WW4 A;  3M8L A;  3RQ0 A;  2AZ5 A;  4ZZ8 A;  2R04 3;  3ZN6 A;  3GZA A;  3W21 A;  4B7E A;  1VBE 3;  5EJ1 B;  1Q8S A;  4Q0P A;  4QM8 A;  5BNN B;  4AEM A;  4AGG A;  2A70 A;  4AED C;  2D6M A;  4H7M A;  2ZGP A;  4P9J A;  3TBD A;  5C3P A;  1Z7S 2;  5FY8 A;  3VZK A;  1RIN A;  2Q5T A;  3P5B A;  4LBQ A;  5HCB A;  4P02 B;  1PO1 3;  2XVG A;  4N7U A;  2WFF 2;  1BEV 1;  1UY1 A;  3GZE A;  4KMQ A;  3OYW A;  1QY4 A;  3RI8 A;  4AQT A;  3DGT A;  3DPR B;  5BUV A;  2BU9 A;  2E7T A;  1EP0 A;  2P1B A;  2Z2S B;  1PIV 2;  1W2O A;  2BBA A;  3RRD A;  2VW2 A;  4EWE A;  2ZJC A;  3KB5 A;  1WA6 X;  4PQ9 A;  1PHM A;  1UNB A;  1UZZ A;  3PUR A;  3BTZ A;  3D3A A;  2JDH A;  4Y22 B;  4BDV B;  1H0B A;  4XTP A;  3FFZ A;  4GMP 0;  3IN9 A;  4XHX A;  4UOJ A;  1ND3 B;  1ND2 C;  3ILF A;  3K3N A;  4WBB A;  5DZE A;  5FZE A;  4NAO A;  2JJ6 A;  1W6M B;  2V4V A;  4LBJ A;  4Y1V A;  2F6B A;  2CGN A;  3VBF C;  4Z1V A;  1G9F A;  1N1S A;  4IDZ A;  3TAY A;  1QKQ A;  5J96 B;  4AL9 A;  3VBH C;  3FLP A;  1PO2 2;  5M0T A;  4RS5 B;  5D2A A;  3AKT A;  4HPK A;  5FZ8 A;  4BZ4 A;  2AEN A;  1XNT A;  1VMF A;  1AL2 1;  3ON7 A;  1TZO A;  1YEW A;  3F2Z A;  2I07 B;  2X5I B;  1R64 A;  3ZFF C;  3ROU A;  2BQP A;  1F2N A;  1BYH A;  5F5I A;  2ES3 A;  4CDQ B;  4WZF A;  3I3E A;  3HIF A;  1EUU A;  3JCI A;  3BTA A;  1DQ0 A;  5FJH A;  3TN9 2;  4E4H A;  4L11 A;  4B1L A;  3RYR A;  2RS5 1;  2YGM A;  3FE5 A;  1W8U A;  1GNH A;  3O1V A;  3NJX A;  4YVW C;  2VBD A;  4MO3 M;  3FHQ A;  4AED A;  2XG3 A;  2EAK A;  3HNY M;  4H14 A;  2GP5 A;  4HOO A;  5EHD A;  5EJZ B;  3I3M A;  1BMV 2;  3TOJ A;  1NT0 A;  1OQ1 A;  2FMY A;  2W1W A;  1OD5 A;  5EV7 A;  5FRA A;  5LRS A;  2BGO A;  5LBB A;  1NUK A;  1US3 A;  1MZE A;  2ETE A;  1UIK A;  2R0H A;  2C24 A;  2J7M A;  2TEP A;  4M3C A;  1WD4 A;  3FHI B;  4UT5 A;  2W5F A;  5F37 A;  4YW1 A;  5KC5 A;  4TWT A;  1AL2 3;  4WM7 C;  5CFC C;  4DMI A;  3H0O A;  2R04 2;  1UOG A;  5CFD C;  1X9T A;  3NKT A;  4E2G A;  5FZG A;  4NRO A;  1SLC A;  3CJX A;  1MS3 A;  1ND2 A;  2DCT A;  1S0B A;  1X82 A;  2PHT A;  4CEY A;  2Q1Z B;  1PO1 2;  2FZ1 A;  2RS5 3;  3B02 A;  4TN7 A;  5FZA A;  3RZM A;  3VBF A;  2Y6F A;  2VNG A;  1YIP A;  3OPT A;  1WCQ A;  4RGG A;  5JUV A;  3OY8 B;  4IEV A;  3VBH A;  2WC2 A;  4G3Y C;  4ASL A;  1DQ5 A;  1XU2 A;  4XCB A;  5A6Z A;  4XAB A;  4HMZ A;  1IKQ A;  1NG0 A;  1DIW A;  2JDZ A;  1OA4 A;  2GNT A;  5FQ0 A;  3MV1 1;  1JZ4 A;  4P9L A;  1OVP A;  1JYT A;  3ZFF A;  1ST8 A;  2RE9 A;  3MGU A;  3OUH A;  4LKE A;  1DYK A;  1FX5 A;  2BNN A;  5DUV A;  4HK8 A;  1UWW A;  5JR7 B;  3PVB B;  1RUC 2;  2GSY A;  2YB7 A;  5E8A A;  4A7K A;  3SH5 A;  2HBT A;  3MIB A;  3ECQ A;  4BCU A;  2PA7 A;  3KV5 A;  5IFT A;  2RJL A;  4FPO B;  3WF0 A;  2N7G A;  4YVW A;  2WQ4 A;  2JD9 A;  3BOD A;  1TME 1;  4QQH A;  3SKV A;  2BFU L;  2RHP A;  1PX4 A;  3FUO A;  2Q4S A;  3M3O A;  1CAV B;  4B8E A;  4NIH A;  1XU1 A;  2C0Z A;  1X8M A;  4BK5 A;  1BEV 2;  2E33 A;  5FZD A;  1D4M 1;  1DZQ A;  4LK6 A;  1JYI A;  1IS5 A;  1RUF 1;  4YZ1 A;  3LSD A;  3O7O A;  1FAT A;  4JDO A;  4L2N A;  4NRQ A;  3ORJ A;  4XOG A;  5DUU A;  4P9G A;  2WZR 1;  4CCK A;  4JKK A;  5BNN C;  3WZ1 A;  2HEY F;  5E1R A;  4YW7 A;  2QQO A;  1QHD A;  2R06 3;  3KM5 A;  5CFC A;  4EN9 B;  3K3O A;  5CG9 A;  4XDP A;  3IDA A;  3CLP A;  1UOB A;  4NMI A;  3MF6 A;  5A6X A;  5IFP A;  5GZG A;  1X8E A;  2XQR A;  3FLT A;  1D0H A;  3UJO A;  3JUU A;  4LK7 A;  4DUX A;  1HQW A;  5FZ9 A;  2W94 A;  5JOY A;  4NR1 A;  1RIR A;  1OVS A;  4UW3 A;  4WM8 C;  2YC2 A;  1NCQ A;  2VPV A;  1R09 1;  1YJK A;  2EF6 A;  3IBM A;  1H2K A;  1TME 3;  2JE7 A;  2AR6 A;  3NQH A;  2QQV A;  1UY4 A;  3GBW A;  3T3Y A;  3VDD A;  3H9A A;  1ND3 C;  2VO5 A;  3VHN A;  3WCS A;  3NNJ A;  3IDE A;  1AL2 2;  5FCC A;  1VAL A;  3VHO A;  1D4M 3;  1U0A A;  1VRH 2;  4IES A;  1O8P A;  3VDA A;  1Q43 A;  5LEK A;  3RWN A;  2ZTN A;  3OB8 A;  3I2H A;  3T0B A;  2WZR 3;  1WCK A;  2XVK A;  4QQ2 A;  1W2U A;  4ZU4 A;  4LJH A;  3TB0 A;  1WCU A;  3SCF A;  1O5L A;  3KLS A;  5CBL A;  2YYO A;  1VRB A;  5J09 A;  1W8T A;  2JB8 A;  1HRI 1;  4NPM A;  5IVY A;  3ZSJ A;  2RS5 2;  2UWA A;  4RD7 A;  4XF0 A;  2XJV A;  2HWD 3;  2YBP A;  2A6W A;  3DXT A;  4Q29 A;  5JZG B;  3LA7 A;  2X05 A;  4CU7 A;  1JZ6 A;  5IAX A;  4XHB A;  3VBO B;  2X5I C;  1LOB A;  1Y9G A;  4WZC A;  3LZZ A;  2OPW A;  1JS9 A;  3MPB A;  3B00 A;  3Q8F A;  3DEM A;  1POV 0;  1AX0 A;  5DXD A;  2JDP A;  5JIU A;  2FDH A;  4BIO A;  4PLO A;  2C26 A;  1ZNP A;  1H8T C;  1I6X A;  1PVC 1;  5FIX A;  1R09 3;  1OBN A;  1VIW B;  3S6P A;  2B42 B;  3GCW A;  1CAW B;  4FAG A;  2LRP A;  4AI8 A;  1NE4 A;  1OKO A;  2BFU S;  2RV9 A;  3LAG A;  1TMF 1;  1YQ8 A;  1NE6 A;  2QQW A;  5A3O A;  4AVV A;  2ZCW A;  2OZJ A;  2Q8E A;  1GOG A;  3V0A A;  4MSV A;  2XH6 A;  3QBQ A;  5CZK A;  3PLQ A;  3LSE A;  2ZEZ A;  1OXC A;  2EVX A;  1QEX A;  2D3S A;  1HRI 3;  1H9P A;  1JZ3 A;  1FNZ A;  1LHU A;  2ILM A;  1C3H A;  1ASJ 1;  1WCS A;  1Y4W A;  4K21 A;  3MW4 A;  4WM8 A;  1H2L A;  5ANN A;  3R0R A;  3I8T A;  2BJS A;  3VV1 A;  1WZX A;  4FAH A;  5I0D A;  3ES4 A;  4I09 A;  4JKL A;  4C91 A;  1KFU L;  4GXL A;  2WA3 A;  1ZBE 1;  4A44 A;  2CNA A;  4P00 B;  1R08 1;  2HEV F;  3ZN5 A;  4K1Y A;  1PVC 3;  4XE9 A;  3Q8B A;  2BPA 2;  2VZO A;  3CL1 A;  5FZB A;  5TSW A;  1NAE A;  1TMF 3;  2DTY A;  2ZGT A;  3VKO A;  1CZV A;  2P3K A;  3OGR A;  5C5U A;  2P17 A;  3MW2 A;  2YC0 A;  1HQN A;  3NVC A;  5IHR A;  5KR7 A;  5FKB A;  2W91 A;  4YAR A;  3WQB A;  1GZW A;  2QNK A;  4AHZ A;  4QU2 A;  2X5I A;  1BK1 A;  4KWJ A;  2VMI A;  2JB4 A;  2RS3 1;  2UYB A;  4NHK A;  1SG3 A;  1O3Q A;  1O4Z A;  4Q1P A;  1LGC A;  3GJB A;  3PDQ A;  1J1T A;  5E16 A;  3TNP B;  1UXX X;  4CE8 A;  2VMD A;  1ASJ 3;  1RUF 2;  5GZD A;  3RZZ A;  1C5H A;  1H8T A;  4Q1R A;  1MVQ A;  2RS1 1;  1QDC A;  3HMY A;  2WZR 2;  5T54 A;  1ZBE 3;  3K51 A;  4HFS A;  1R08 3;  1SFN A;  2Z42 A;  4FPF A;  1JOP A;  2G9Z A;  2R07 1;  2OZ6 A;  4JV4 A;  1ULG A;  5FK7 A;  5FMC A;  3DYO A;  3WDT A;  3WOG A;  4DS0 A;  3N9M A;  1R1A 3;  3OSD A;  3CJI B;  4XVH A;  4H55 A;  4QQO A;  3I2O A;  2SBA A;  3SIT A;  1PZ9 A;  2UU8 A;  1QNY A;  3U4S A;  4YGD A;  1L7L A;  1SCS A;  4UXA A;  1G86 A;  5DAB A;  1F4A A;  3AX4 A;  5GAL A;  2VCA A;  1LES A;  2PLV 1;  3ILR A;  3CU7 A;  3MEP A;  3IB3 A;  4LUM A;  4M4P A;  3THC A;  5L7O B;  3BU0 A;  4J25 A;  5F3C A;  5FR3 A;  1R09 2;  1JHN A;  1I5P A;  2X09 A;  3B01 A;  4YG6 A;  4UFL A;  2HJI A;  2UUR A;  2XJR A;  3ZX7 A;  4YLZ A;  3OOX A;  1BKZ A;  1PMJ X;  2RS3 3;  4PIZ A;  3MIG A;  5SV5 A;  2L9L A;  4Y4R A;  3OBZ A;  1GAN A;  2OA2 A;  2A3W A;  4IEU A;  5E88 A;  1H2M A;  1LHW A;  5LY2 A;  4M3C F;  5C3Q A;  1GWK A;  1Q56 A;  2WS9 1;  4K20 A;  3POW A;  5FLJ A;  4F3J A;  1PNG A;  1DFQ A;  2RS1 3;  5HXV A;  1DDL A;  4FTS A;  2R7E B;  5C8C C;  4CDX B;  2QZ3 A;  2V5Y A;  4PDW A;  3MF9 A;  3ZXD A;  1I1E A;  4XIL A;  5BV6 A;  5FRE A;  1HRI 2;  4LLF A;  4AFM A;  1LGN A;  2ZZJ A;  1NKG A;  1YYN A;  4BQ2 A;  2QQM A;  3HNB M;  4JAA A;  3ATG A;  3HVD A;  5I8Y A;  1RUG 1;  1HRV 3;  4M01 A;  4XYX A;  4LO6 B;  4HXC A;  2ZX3 A;  4I3P A;  3RSJ A;  1L3J A;  2JDN A;  5FUP A;  1XQN A;  1B35 B;  1F35 A;  4PI2 A;  4CEW B;  3RPQ A;  2WAB A;  1V6J A;  3WP5 A;  3IZO A;  4RQP C;  4E8D A;  1Q8P A;  1ZRI A;  2PLV 3;  5GLZ A;  2ZMK A;  1NX9 A;  1CIY A;  4DEV A;  5DG1 A;  3O0X A;  1PVC 2;  4H3W A;  1BQP A;  1MZ5 A;  4LHN A;  1AXY A;  5HV4 A;  5DAP A;  3GF6 A;  2DFC A;  5DG2 A;  5GZC A;  4AFD A;  3E6C C;  3VBO C;  2JDK A;  3LIG A;  5A32 B;  5FBZ A;  1FNY A;  2WT2 A;  2WS9 3;  4PIX A;  2UY8 A;  4LKD A;  2D6K A;  3ZR5 A;  4WVM B;  4XTM A;  5ABJ A;  4CUC A;  2VCC A;  2NMN A;  4LHK A;  3OF1 A;  1W0P A;  2GZW A;  1GOH A;  4IUG A;  3RZJ A;  4XJ9 A;  1E5H A;  1LOF C;  3DF0 A;  3PTR B;  3BU7 A;  2XUE A;  4ERO A;  1RUG 3;  1RUH 2;  2VVD A;  3AXE A;  1W05 A;  4YSF A;  3MPP G;  5LBC A;  5F9T A;  1SPP B;  1ZZ7 A;  3KD4 A;  4HK9 A;  2HH9 A;  5FAX A;  3VDC A;  4S2H A;  2VME A;  3GNE A;  3S5Q A;  4R52 A;  5A6Y A;  4NN0 A;  5IW0 A;  1ZRE A;  1WWY A;  2Q0A A;  5IVC A;  2Y33 A;  4IEQ A;  4XAE A;  2FDJ A;  2MNG A;  1XYN A;  1SMV A;  3NNM A;  2NP0 A;  4DIQ A;  2WWS A;  2OVU A;  4R4Z A;  2QQP A;  5DMY A;  4AQS A;  5C8C A;  3WXP A;  1UN1 A;  3NL1 A;  4QGL A;  4FFI A;  4IL7 A;  5EQU A;  3ZN6 B;  5KXE A;  3OUJ A;  2E9Q A;  4JHT A;  3VDB A;  4L8Q A;  1DGR N;  3OGJ A;  4YNI A;  3CMG A;  1S2K A;  2K46 A;  4YPJ A;  4GB3 3;  2BWA A;  4JTO A;  3ZSM A;  3ZYP A;  1L7R A;  4LBQ B;  4W4Z A;  4YRD A;  4Y1Y A;  4CUB A;  2RS3 2;  2J1E A;  5T52 A;  4CSW A;  3OYW B;  4RQP A;  4NIA A;  5JR2 A;  1PGW 2;  5FTT C;  4A3Z A;  5JSO A;  2FDK A;  2QDR A;  2F4L A;  4Q0S A;  2RS1 2;  1SBD A;  1QJX 1;  1JI6 A;  3J7H A;  1CAX A;  1OFN A;  3H3U A;  4N7I A;  3FN9 A;  1KGY A;  3N36 A;  1KDM A;  5IVE A;  2R07 2;  1UXZ A;  3LB9 A;  4BM8 A;  3H42 B;  4YZ5 A;  1VBA 1;  3R4U A;  4JGY A;  1W28 A;  4MET A;  3WF3 A;  2GC3 A;  3U14 A;  5LK5 A;  4HG6 B;  4XQW A;  3TYJ A;  4S2D A;  4YM1 A;  1LOF A;  2P4E A;  2UWC A;  1CWP A;  3S57 A;  3A0K A;  2PLV 2;  4MVT A;  4UI9 L;  1UKR A;  3BVC A;  4OLL A;  4PF1 A;  4HPK B;  3RNS A;  1UIJ A;  4K40 A;  3I54 A;  3UKV A;  3LEM A;  4L99 A;  4XFH A;  2LW8 A;  1UF2 C;  1H30 A;  4P14 A;  5FJK A;  3W20 A;  1IZ3 A;  1BCX A;  1OUR A;  4LMF A;  2WA4 A;  1IPK A;  4D6S A;  3O5S A;  1RYY A;  1QOS A;  3JZV A;  4MH0 E;  5C3R A;  4FPC A;  2WS9 2;  4MGT A;  5F1R A;  1YI7 A;  1W06 A;  1ZZC A;  1AYM 1;  4MX3 A;  3WNO A;  1QJX 3;  4YGC A;  1DF0 A;  1UX6 A;  4KG0 A;  4CDW C;  4OHY A;  5K0U B;  1H4G A;  4AHY A;  2W2I A;  4N9H A;  1IQA A;  1UPI A;  3UK9 A;  1S2B A;  3ZPY A;  3T0D A;  4R9D A;  3RG0 A;  1W99 A;  1OH4 A;  1RUG 2;  4AED B;  3HJR A;  1UMI A;  2VXJ A;  2OXB A;  2XXZ A;  3ZXK A;  2GME A;  2OII A;  2HWB 1;  4QM9 A;  5DQ0 A;  2WO1 A;  4FFG A;  1PMI A;  3WG1 A;  4BH9 A;  4CDX C;  5FXX A;  1N47 A;  2LS6 A;  2VMH A;  3O14 A;  3ZFG C;  4E2Q A;  5I91 A;  3FHA A;  3UL2 A;  4M3C B;  1G9D A;  4O65 A;  5ACA 1;  1HV0 A;  4MZU A;  5LEJ A;  3DV8 A;  3SXW A;  1WMF A;  1ZZ6 A;  3ETP A;  2BWC A;  4Q4X 2;  2BNO A;  2BZD A;  5FYM A;  4NPL A;  4CXW A;  4CEW C;  1X9P A;  2WSV A;  2ZAC A;  2BGP A;  3IDB B;  4KI5 M;  4FPJ A;  5SV8 A;  1J58 A;  1UKG A;  5FZK A;  3M3E A;  4FBF A;  1ND2 B;  3MW3 A;  4KU7 A;  4NO4 A;  4MGY E;  4LTA A;  4Y4Y A;  2IZW A;  4A7Z A;  4ZKT B;  4CEY B;  4BQX A;  4QKF A;  3AZV A;  3KT7 A;  5IVJ A;  4ET7 A;  3VBF B;  1A78 A;  5FY4 A;  1UMH A;  3AJZ A;  3VBH B;  2VE1 A;  1QJE A;  4YW6 A;  5FZ6 A;  1HV1 A;  3VD9 A;  1CX1 A;  2W52 A;  1BK0 A;  3ZYF A;  5FYT A;  4JKM A;  5DUX A;  3WDV A;  4N53 A;  2DBN A;  2HWB 3;  2VCM A;  4WV8 A;  5FQ0 B;  4UBG A;  3AMH A;  4GH4 C;  3USS A;  4DRR A;  3U10 A;  4DZG A;  1W8F A;  3KVB A;  4RGK A;  3ZFF B;  2RMU 2;  4IEO A;  4CCD A;  3QLQ A;  1Y43 B;  5ACA 3;  3O12 A;  5JMC A;  3OPW A;  2IC1 A;  3BB6 A;  4FOQ A;  5T5P A;  1KS5 A;  2XB6 C;  1SAC A;  1IPJ A;  2XDV A;  2Y6J A;  4CDW A;  3GYD A;  5CAD A;  1K42 A;  3QCW A;  4BOW A;  2FDF A;  1XB9 A;  5FY1 A;  4V2V A;  2NPI A;  3AFG A;  3S7E A;  4CCO A;  1OLQ A;  1VB2 A;  4YVW B;  3POS A;  1HB4 A;  3QOP A;  1YQ2 A;  4M00 A;  3C7F A;  2D6N A;  4X6Q B;  3ZIX A;  3HOB A;  5CEH A;  2ZAA A;  2JDU A;  3ENR A;  4KBB A;  5DAX A;  2G9F A;  1UU5 A;  2VG9 A;  2CWM A;  3ZFG A;  2R49 A;  4K3U A;  3ILN A;  4AXO A;  5FPV A;  5FZC A;  2BRT A;  5FY7 A;  4E9K A;  1QJX 2;  2R16 A;  1UU4 A;  2PMW B;  5CFC B;  4FPE A;  2VZP A;  3JU9 A;  2GNM A;  2ZHL A;  2WII B;  4LIU A;  4ARX A;  3IMN A;  1GWL A;  3DUI A;  4EE2 A;  4HVQ A;  1W9Y A;  4AG4 A;  1VBA 2;  4WVW A;  5J36 A;  1Q5O A;  3AZZ A;  2VZQ A;  3AC0 A;  2IVI B;  2PHU A;  4YFW A;  3ZDS A;  4LOS A;  3OPZ A;  4QX1 A;  1N3P A;  5FO9 B;  4Z82 A;  2QQN A;  1JU3 A;  2HLE A;  4QQP A;  4GWM A;  4J1W A;  3U11 A;  5C7G A;  1NCQ B;  4RR3 C;  5LA1 A;  3T30 A;  3ZM8 A;  4UFK A;  5EP9 A;  4IV3 C;  1DLL A;  3OG2 A;  3VDD B;  4PCR A;  3VKL A;  1V00 A;  2Y6L A;  1EV1 3;  2ZHM A;  1VBE 1;  4W6Y A;  3N4M A;  1SZB A;  2VOK A;  4RGA A;  4LIV A;  3WQ7 A;  1H1A A;  2VNV A;  2WO7 A;  4GH4 A;  1W2N A;  4XBQ A;  3T2P A;  1AYM 2;  1RUI 1;  3IAQ A;  1EPW A;  5FWJ A;  5IVF A;  3ASI A;  5A7N A;  1OPM A;  4BQ4 A;  4NHX A;  3E6B A;  3ZXJ A;  2KXL A;  5DN2 A;  4Y33 A;  2VW1 A;  4AHX A;  2ID4 A;  4QX7 A;  4Y1X A;  1MS0 A;  1BXH A;  2VD7 A;  4MHR A;  4B3N A;  2V72 A;  3AL5 A;  4LO7 A;  4QKB A;  5FY0 A;  1OUS A;  2PHL A;  4LBQ D;  3T2T A;  2XON A;  1AVB A;  2Y34 A;  2YU1 A;  3NO8 A;  4YW3 A;  3UV9 A;  1EPZ A;  3H1M A;  5GJ6 A;  4XIO A;  1HB2 A;  4OZO A;  3J8F 2;  4PT6 A;  1GLH A;  1AR6 1;  3MZH A;  2Q8O A;  5K0U C;  2LRO A;  3TRS B;  1XSR A;  4ORF A;  1XNB A;  1GZT A;  4XMA A;  3ZXL A;  5ACA 2;  2ZX2 A;  2RVA A;  3K4Z A;  3POG A;  5FMB A;  4YG3 A;  1W8Z A;  2JX9 A;  3I3D A;  2D5H A;  2ERF A;  5DAW A;  5F6L B;  1HKD A;  5L9B A;  3TNQ A;  3V0A B;  5F39 A;  1C5I A;  2VNO A;  1GR3 A;  1RUD 3;  3MLK A;  1SBF A;  3NST A;  4FTB A;  5HV0 A;  1RUI 3;  2WJS A;  4K8F A;  4D0Q A;  1MS9 A;  3CF6 E;  4GIQ A;  2A3X A;  2JG9 C;  2DUR A;  2TNF A;  1NOV A;  4UF0 A;  1S0G A;  3R4S A;  4PI0 A;  3WT3 A;  2PAK A;  4WM8 B;  4MGS A;  4RR3 A;  3AVR A;  4B4Q A;  3IAP A;  4IV3 A;  2ZX4 A;  4Y1U A;  3CBN A;  2ARE A;  2QTW B;  1HLC A;  3POE A;  2W95 A;  3WNX A;  1KD7 A;  4MV2 A;  1AR6 3;  2EIE A;  3T4V A;  4CEY C;  3OD0 A;  1H1M A;  3UET A;  1O8S A;  3I59 A;  2XHK A;  5I8T A;  1IPS A;  1GKB A;  1WW5 A;  1VBC 1;  4BQ1 A;  4BHP A;  3LD8 A;  4ZU5 A;  1JZ8 A;  5BNQ A;  1GZW B;  1YWK A;  2XLG A;  1FAY A;  1FT9 A;  1O4T A;  1U5I A;  3WQ1 A;  3VHR A;  2ARX A;  2D98 A;  5GKA C;  4HON A;  1DHK B;  2GNB A;  5FZ7 A;  2Q8D A;  1SFP A;  4QKN A;  2JG8 C;  5T55 A;  4EYU A;  3OGG A;  4J6G A;  4LO5 B;  5JXG A;  4LPL A;  4IEW A;  4I2O A;  1H8T B;  2XJQ A;  3FC0 A;  5K0U A;  5EWS A;  4MGZ E;  1OT5 A;  2VQ0 A;  4AVS A;  3RWK X;  1IS6 A;  2PQQ A;  1LGB A;  2WFP A;  3LGR A;  5AFE A;  2J1U A;  3C8X A;  4LBM A;  4CPB D;  4PBP A;  1HW5 A;  1IGO A;  4XZP A;  3I2F A;  4HET A;  5LBF A;  4NAM A;  5CYY A;  3FMG A;  3Q8C A;  5CAZ A;  2VEC A;  2D6O X;  1QH6 A;  5G04 L;  5C70 A;  1YLL A;  3LEK A;  3LOB A;  1YFW A;  2WN2 A;  4KG8 A;  1VBC 3;  2R32 A;  5A80 A;  2JG9 A;  3WUD A;  4IE7 A;  2DUO A;  3WG3 A;  1WMX A;  3M70 A;  1OA3 A;  1V6N A;  3NJZ A;  1JH5 A;  2AAC A;  2W39 A;  2DFB A;  2FDI A;  2W1U A;  1YFX A;  5JIA A;  4OVE A;  1CAU A;  4CCL A;  3QD6 A;  3SQO A;  3MHZ A;  1VBE 2;  2GND A;  2VVE A;  1NXD 1;  3C7O A;  2VQT A;  1ZM1 A;  3B3Q E;  4CPB A;  5A7W B;  5DDJ 1;  3ZXF A;  1JUI A;  2EIG A;  2YC4 A;  1QU0 A;  2YPJ A;  4X8N A;  4BQ3 A;  4FO9 A;  5B4N A;  1VPH A;  2OYZ A;  1GU3 A;  4PDW B;  1NCQ C;  3B9I A;  4IE5 A;  2OT7 A;  3CHX A;  3MYX A;  4M0H A;  4ZZ5 A;  1V6L A;  4IE6 A;  3GHM A;  2PHW A;  3WNK A;  4FXG B;  5FPA A;  3VDD C;  3WDX A;  1OKQ A;  3FBY A;  4AI2 A;  2E31 A;  3EO6 A;  4DFS A;  4FSJ A;  2B4K A;  3I4I A;  4MGK E;  4UYB A;  4Y5S A;  2R06 1;  3LFI A;  1LKN A;  3BGA A;  5IAV A;  3H50 A;  2CY6 A;  4OQ9 A;  1SQ4 A;  5EXO A;  2E7Q A;  4PLM A;  1O5U A;  2QQK A;  4JX0 A;  2FZ2 A;  5T5L A;  1C57 A;  2JG8 A;  1AR6 2;  4LO4 B;  3I2J A;  1LU1 A;  4IEP A;  3WIN E;  3LF7 A;  1VMH A;  5C33 A;  2WKK A;  4IET A;  1NZC A;  2IFW A;  2V73 A;  2A73 B;  3T1M A;  5FV3 A;  1CR7 A;  3UGG A;  4LO8 A;  1I5Z A;  1ALY A;  2BOI A;  1SLL A;  2ZEW A;  1D2Q A;  1S2E A;  3SEE A;  5DDJ 3;  1ZVF A;  4CP0 A;  3W59 A;  5ABJ B;  4QB2 A;  4PIY A;  1QH7 A;  3VN4 A;  1DGR A;  3MID A;  1PM7 A;  4Q4Y 1;  1QXJ A;  2A6X A;  1KS4 A;  1MS8 A;  5A3P A;  4CP9 A;  3K46 A;  4W6X A;  1UX7 A;  2IXK A;  4Z2A A;  2OW4 A;  2VBB A;  3T1L A;  4OI4 A;  4RFR B;  4COZ A;  2DWR A;  3ACI A;  3RYK A;  1AJO A;  1XBF A;  2XKP A;  3B7M A;  2HBU A;  2G9G A;  1CPN A;  4E4D X;  2FBE A;  2YV8 A;  3N9N A;  4NII A;  4P9X A;  5FP7 A;  3THD A;  2EXI A;  2HWD 1;  1WLC A;  3HQU A;  3VZJ A;  2J42 A;  3I97 A;  1A8D A;  4UFM A;  2CV6 A;  2ZML A;  3GAL A;  2I45 A;  4F83 A;  4PJY A;  3AP5 A;  3LDB A;  3WNL A;  4B1M A;  3O1O A;  2ARA A;  3H1Y A;  3O0V A;  1QDO A;  1CZS A;  5C8C B;  3O1T A;  4XPV A;  5ANQ A;  2WZE A;  1KFX L;  3BIW E;  4F7Z A;  4PHZ A;  5FY5 A;  1G9A A;  2VM9 A;  3B93 A;  3DKQ A;  4A4A A;  5C4W A;  3TEX A;  2J1V A;  5L36 A;  2Y26 A;  3HR9 A;  3NV2 A;  3ZOI A;  5FZH A;  3ABZ A;  3E5X A;  2X8K A;  4Q4Y 3;  1DZR A;  3SKJ E;  2XVL A;  4XXP A;  2XJS A;  1LOG A;  4FPG A;  5JSP A;  1RVF 1;  4URT A;  1MZ6 A;  4C90 A;  2TUN A;  2QUO A;  2ZKN A;  4RQP B;  1UU6 A;  2BOJ A;  4QXC A;  3RFR A;  1V6M A;  2PHF A;  5HCF A;  4L92 A;  4Q2F A;  2XPJ A;  1TE1 B;  1REF A;  1E5S A;  4IW3 A;  5FFO C;  4COW A;  1U5Y A;  1CAX B;  3RS6 A;  4K9S A;  1UAI A;  1IOA A;  5GLU A;  4ZS2 A;  2C9K A;  2CAU A;  5JPN B;  3WF2 A;  1GZ9 A;  2JWP A;  3VUO A;  2VTX A;  1FV3 A;  3BTY A;  1BHG A;  1RGS A;  3PIJ A;  2XWB B;  4JGY B;  3HAG A;  5BY5 A;  3U1X A;  1KRI A;  5BNP C;  4XF3 A;  4HVR A;  3HN3 A;  2VUC A;  3VGI A;  5F3I A;  1VBD 3;  4UBH A;  2GP3 A;  1SLA A;  3AP4 A;  1ODN A;  3A21 A;  3D8C A;  5GZF A;  2XJT A;  1RVF 3;  4M0N A;  1KIT A;  5F8P A;  5D8A C;  2CTV A;  2DTW A;  2KA3 A;  4XF1 A;  4G9S B;  5J37 A;  5DDJ 2;  3WNP A;  1D0G A;  5C4W C;  1JYX A;  4IEZ A;  4Q26 A;  4LHL A;  2B45 X;  2JIG A;  2XWJ B;  4BA6 A;  4E4Z A;  1Z78 A;  2HWF 3;  3VL8 A;  1ZRF A;  4AI0 A;  5JVV A;  5HI0 A;  4HBN A;  1F4H A;  5FYZ A;  2HEW F;  2X53 S;  2ZGR A;  2GAU A;  5A1L A;  1IG3 A;  5H9Q A;  4CU9 A;  4V2W A;  5KXC A;  1FMD 1;  1VAK A;  4COY A;  3JBG 1;  3KV6 A;  1VE0 A;  1EY2 A;  2DU1 A;  3A23 A;  3L2H A;  4CUA A;  1NCR C;  2R06 2;  1RUO A;  4ZU7 A;  4P9W A;  1RXF A;  3UGF A;  2VTF A;  4BQY A;  4EWD A;  2QKD A;  1UW8 A;  4QX8 A;  1WBF A;  4ISR A;  3WR0 A;  1U5X A;  1HIX A;  1QOO A;  1R1A 1;  4HZF A;  5I0R A;  1ZZ9 A;  1CVN A;  3PVO A;  4PDW C;  4QX5 A;  5L9R A;  5C5T A;  1W9S A;  2YFZ A;  3NW4 A;  4GWI A;  1LOD A;  1UOJ A;  3I3Q A;  3PME A;  3KV9 A;  2WWJ A;  4JCK A;  1YO8 A;  4AGR A;  3NKG A;  4GKX A;  4Q5O A;  1UL9 A;  4I02 A;  1ACC A;  3M1H A;  4HSL A;  1OFS A;  3WDY A;  1TME 2;  5FZ4 A;  5GM0 A;  1VAM A;  3IKW A;  1GP5 A;  1YFU A;  4YM2 A;  4E27 A;  5HCA A;  1D4M 2;  4W8J A;  1R1Z A;  2W47 A;  4JC1 A;  5BNP A;  5E6H A;  4AR2 A;  2WLQ A;  2NLR A;  4OHW A;  2CWS A;  1UYP A;  4TLF A;  4NJ4 A;  4XBL A;  1FMD 3;  2H6B A;  2RDN A;  1VR3 A;  3JBG 3;  4NPR A;  3BI3 A;  3U75 A;  3N9O A;  3MIF A;  5A7P A;  1OF4 A;  2JE9 A;  4XFI A;  5HBA A;  4N53 B;  3JD7 1;  4BQ5 A;  5ABJ C;  2WBK A;  1G7Y A;  1YI9 A;  2QVS B;  2Y0I A;  2HWD 2;  4IXL A;  1HRV 1;  3BKZ A;  5D8A A;  1Y7B A;  3H3Z A;  2UWB A;  4IV1 C;  5LY1 A;  2IWG B;  1Y9Q A;  1JMU B;  4JGZ C;  3KT1 A;  2D7F A;  2DYC A;  2JIJ A;  2YZ4 A;  3H7Y A;  2VZ1 A;  3EQE A;  2WT0 A;  3BAL A;  5BXX A;  3WNN A;  4CDW B;  3LCP A;  2P37 A;  3D0J A;  5F5Q A;  2B7Y A;  4Y5T A;  1GUI A;  4HSJ A;  1GQH A;  4LUL A;  1OPO A;  5FWE A;  4DQA A;  4AVT A;  3N7L A;  1WME A;  3AYC A;  4A41 A;  3WHU A;  2EA7 A;  3WD5 A;  4BLI A;  3VL9 A;  1CX4 A;  2ZOE B;  2VTX J;  1QJU 1;  1NCR A;  2AC1 A;  1AR8 3;  1H6X A;  2VVF A;  4KL1 A;  4YFZ A;  1RVF 2;  1ZX5 A;  4OMD A;  2XHN A;  5ISL A;  1GQP A;  3ZYR A;  1FPN 3;  2EXK A;  3KSC A;  1NQD A;  1UYZ A;  3ZFG B;  3ZN4 A;  1BBT 1;  1C8N A;  4O61 A;  4UW5 A;  1AYN 3;  4Y24 A;  2C1F A;  5IVB A;  3JD7 3;  1K3I A;  2DF7 A;  3HN1 A;  4O9G A;  1YC6 1;  5FOJ B;  1JTZ X;  2VW0 A;  3V64 A;  3PMS A;  4XUR A;  2WNU C;  1OSG A;  3FJS A;  2B5H A;  5A3L A;  4AVC A;  4KGQ A;  3NJV A;  1WUV A;  3AMP A;  4TSV A;  5GLV A;  2Q8C A;  1N1V A;  5L7O C;  1GNY A;  1OI6 A;  4EN0 A;  4C8D A;  2DVF A;  2HYK A;  1OF3 A;  2YG0 A;  4QHO A;  5CIS A;  2ZGN A;  1IG0 A;  2VZV A;  3LFM A;  3SHR A;  3V56 A;  2H0B A;  4LE4 A;  2VUA A;  1AXK A;  2G1M A;  1OMI A;  1ENQ A;  1TMF 2;  5FZ3 A;  3W5M A;  4YZ2 A;  1QJU 3;  1G9C A;  4LOR A;  4DRV A;  4QQL A;  5G05 L;  2GN3 A;  2QJV A;  4A45 A;  4MHU A;  4GKY A;  1NLS A;  2IVJ A;  1S1A A;  4JGY C;  1DCS A;  4XQD A;  3S7I A;  1GZC A;  5KC6 A;  4GB3 1;  4GH4 B;  2ZAH A;  3WG4 A;  5A1F A;  3J7L A;  4MG2 A;  1BBT 3;  1DQ4 A;  3RZK A;  4QPG C;  3WHT A;  2YBK A;  1J3R A;  3JQW A;  4JQT A;  4IV1 A;  4JGZ A;  3J4U H;  1KJR A;  1C8M 1;  3D4K A;  4Z2W A;  1ASJ 2;  1F15 A;  4F8A A;  2Z4F A;  3TEY A;  4XF9 A;  2R1D A;  4COV A;  4U2A A;  1C4R A;  3BYW A;  1ZBA 1;  3B69 A;  4X6R B;  5FBJ A;  1ZBE 2;  3POY A;  3MDP A;  1O59 A;  1R08 2;  2GC1 A;  3ZR6 A;  3MIH A;  1MAC A;  2GN7 A;  2K2S A;  4GQ7 A;  5H9P A;  4AI9 A;  1JZ7 A;  2C9A A;  3J7N A;  3M4F A;  1J1L A;  3ZSL A;  2P6C A;  4H2A A;  1XSQ A;  4FPH A;  3RDI A;  1R1A 2;  4XET A;  3PNA A;  1YUD A;  4OMC A;  5FYH A;  2J22 A;  4I30 A;  5LCW L;  1WBL A;  4CYD A;  1IS4 A;  1WLW A;  4L9B A;  3PTY A;  1AX1 A;  3ZKU A;  5JWP A;  2BVB A;  3OGV A;  3B94 A;  3IPV A;  1YHF A;  1EUT A;  3DL3 A;  1OUX A;  1RMU 1;  1VB4 A;  4GD4 A;  4SBV A;  3BPS A;  2HWE 3;  1HB3 A;  3P3P A;  2TBV A;  2VOW A;  4GMP 1;  2WNU A;  1FV2 A;  2IFR A;  3WDW A;  3NNG A;  5L7O A;  1ULP A;  1QWR A;  4NOT A;  1JOD A;  4RA0 A;  5FYI A;  4OCT A;  1C8M 3;  3RGB A;  3ZIW A;  2RDQ A;  1MEC 3;  5JSR A;  4UF0 B;  3SMH A;  4XFA A;  4A7Y A;  2XOM A;  3D6E A;  1RB8 G;  4CDU C;  2D3P A;  4MAD A;  4CCE A;  1ZBA 3;  4AFB A;  1W8N A;  1LB2 A;  2UYA A;  5FYY A;  2X29 A;  4RR3 B;  2Y64 A;  1JOB A;  1X50 A;  2BV4 A;  2VU9 A;  1GP4 A;  2OPK A;  3C2U A;  4IV3 B;  1COV 1;  2WSU A;  3N9L A;  3JD7 2;  1XJA A;  1V70 A;  4LBN A;  4R9A A;  4XUP A;  4XJW A;  2HYX A;  5FDB A;  1HRV 2;  1W6O A;  4FPL A;  2AUY A;  5KWR A;  1QGL A;  2HWC 1;  1JUH A;  2E63 A;  4NRM A;  1JU4 A;  5IVV A;  3I59 B;  2CL2 A;  4O9E A;  4QPG A;  3OD4 A;  1W9W A;  2WNE A;  2EXJ A;  1RMU 3;  1U12 A;  1VBB 1;  3KT4 A;  4JQR A;  4MYE A;  1LEC A;  4BYY A;  4NWW A;  2JDM A;  2VAU A;  4GMP 3;  1W0O A;  4N53 C;  4YYO A;  4IGQ A;  4R4X A;  2MEV 1;  3ZO0 B;  1PK6 C;  2VMG A;  4PBO A;  3WF1 A;  1IKP A;  1DP0 A;  1QQP 3;  3AP7 A;  3URF A;  5A3M A;  1SEF A;  4QKD A;  4YW2 A;  2XBO 1;  3WNM A;  3NNL A;  3ST7 A;  4FOV A;  3OEB A;  1OC1 A;  1QJY 3;  1ZRD A;  3KQR A;  3N7M A;  2AYH A;  5FYC A;  3X29 B;  4ES9 A;  2YHJ A;  4K8R B;  1N1Y A;  1ULE A;  2NQY A;  3VKF C;  3U4X A;  3RJ2 X;  2VZS A;  1BBT 2;  1F5J A;  2Q30 A;  1OOP C;  2R30 A;  2W46 A;  2XR4 A;  3VBS C;  1COV 3;  3TEZ A;  1SBE A;  2ZX1 A;  3S30 A;  3KCY A;  4GJZ A;  3RJR A;  4AEJ A;  3MLJ A;  4JVA A;  4LEJ A;  5T5J A;  4DEQ A;  3J9S A;  1ZYB A;  2HWC 3;  1K5M C;  1AR7 3;  4P5Y A;  5AC9 3;  2WNV C;  3FLR A;  4XFB A;  1DZT A;  3SLI A;  2WZP P;  4Y20 A;  1W8O A;  2EAA A;  1VBB 3;  1H6Y A;  1VLN A;  2JG9 B;  5FXZ A;  3GHN A;  2WL1 A;  5F5C A;  2D5F A;  4R9B A;  2H0V A;  2ZKL A;  1OQD A;  4CDU A;  2MEV 3;  4H7L A;  4Y3O A;  5EYY A;  1V0A A;  4JDN A;  3VZO A;  1PM4 A;  1WW6 A;  3PL0 A;  3HPN A;  1CAU B;  3PVE A;  4CCJ A;  4CZS A;  3C7H A;  5EIY B;  3ACH A;  3AP9 A;  2XBO 3;  1OD3 A;  1A8M A;  1GP6 A;  1CQ9 A;  2RR1 1;  3T08 A;  1M4W A;  1O6U A;  3CO2 A;  1WLT A;  4COU A;  4LE3 A;  4GB3 2;  4LA2 A;  1STM A;  4BMB A;  4M4R A;  5C9A A;  3ITQ A;  1E57 A;  2BDR A;  2Y8K A;  4BPZ A;  4LT5 A;  1VP6 A;  1W04 A;  2ZGU A;  2VZT A;  4FCA A;  4OUE A;  3KV4 A;  2VMF A;  4AW7 A;  1G6N A;  1LNS A;  1HB1 A;  4DY5 A;  5JI9 A;  2FQP A;  1LRH A;  2O1Q A;  2WQ8 A;  2Y6H A;  4HN1 A;  4CCC A;  4OZX A;  4ASM B;  2Y0O A;  1QJZ A;  4LNV A;  1PK6 A;  4RSU A;  2SLI A;  3K77 A;  2D44 A;  4MXV A;  1QMJ A;  2Z69 A;  1DQ6 A;  3P1I A;  5GZE A;  1XPW A;  1S4C A;  3CQO A;  2JG8 B;  4LR4 A;  3KGL A;  1PIV 1;  1RXG A;  2NZ9 A;  2BER A;  2PEL A;  1ULD A;  2GU9 A;  1KXG A;  1S0D A;  2Y38 A;  1HDK A;  3M3C A;  3M3I A;  4ONU A;  3LPF A;  2D6L X;  2BEO A;  3J26 N;  1OOP A;  2RR1 3;  3GBF A;  3VBS A;  4YVS C;  1RMU 2;  4I3G A;  3I3B A;  5JAX A;  2OQ7 A;  5KHJ A;  1WKY A;  1H8V A;  3FX3 A;  5H9S A;  2A75 A;  4D7Y A;  1QIQ A;  3WX5 A;  4CVU A;  3PHM A;  2MPF A;  5DZF A;  4AVB A;  1EV1 1;  4FI9 A;  1K5M A;  1UY2 A;  3NMB A;  5T3N A;  3AKS A;  4KU8 A;  2KR2 A;  1TNR A;  2WNV A;  3AFK A;  3GZU C;  3JQX A;  4EZH A;  1XOY A;  3POI A;  4ATE A;  1F9K A;  2WYF A;  4CP9 B;  3O1P A;  2C5D A;  3AZX A;  3UYJ A;  4AF9 A;  4GAZ A;  2AGS A;  1UZ0 A;  3FL7 A;  4FPK A;  3NNF A;  2A3Y A;  1DQ1 A;  1MQT C;  4GAL A;  3UES A;  1U5Z A;  1WD3 A;  1COV 2;  2LTN A;  2W08 A;  4HKW A;  3LPG A;  3EJK A;  5A1A A;  4IGO A;  4L97 A;  3QH7 A;  2R6Q A;  1ZRR A;  4Z07 A;  4P5H A;  1PIV 3;  1SLI A;  1S0F A;  2CDO A;  3M7A A;  5EPA A;  1JBC A;  3CKH A;  4RHV 1;  2GC2 A;  4UW4 A;  3GGL A;  4X8P A;  3H8R A;  1AHS A;  4DXZ A;  2DV9 A;  5F3G A;  1V6I A;  1OH3 A;  2Y60 A;  2ZGL A;  1VBB 2;  1ZZ8 A;  3VBR B;  2XL7 A;  4DPN A;  5C4W B;  3EYP A;  2FCU A;  3FFQ A;  2DBI A;  1W6Q A;  2QBX A;  4FOY A;  3HQX A;  2MEV 2;  4XJU A;  5CVR A;  3WUC A;  3MFA A;  4GUL A;  1F31 A;  2DUP A;  1BMV 1;  3GM8 A;  4TTG A;  5EYX A;  2XBO 2;  1NA1 C;  3E5Q A;  1RUD 1;  3KF5 A;  1POV 1;  1V6K A;  2F17 A;  2OS2 A;  4QPI A;  2IXJ A;  3SC7 X;  3VZL A;  4DXT A;  2ZEX A;  1UZV A;  4LOT A;  4D3W A;  1JW6 A;  4ISQ A;  3SH4 A;  3WW3 A;  4AQ2 A;  3BUC A;  2FHR A;  2CDP A;  4DNY A;  4OFG A;  5I0T A;  3V0B A;  5JOW A;  4XFG A;  1LEM A;  3IM0 A;  3WP4 A;  4DXS A;  2EID A;  3AKR A;  3VLB B;  4N8M A;  2EXH A;  5FKC A;  4YVS A;  1LOC A;  4Q4V 1;  1RHI 1;  2EAL A;  5CA6 A;  1QXP A;  1MS5 A;  4RHV 3;  1N1T A;  3USU A;  1O3R A;  1PGL 1;  1T6B X;  2WIN B;  4AYU A;  2HWB 2;  2EIB A;  4TYS A;  4NIG A;  2DDU A;  4N43 C;  1TVG A;  2VMC A;  4XUO A;  5BNO C;  1L7Q A;  3KZ4 C;  4CUG A;  3BN6 A;  2WNO A;  3SCH A;  2FMD A;  1OLM A;  5IUQ A;  5A7O A;  3FBM A;  3NWK A;  4CP2 A;  1FI2 A;  1YQC A;  2LM3 A;  1MQT A;  4HN0 A;  4CCM A;  1XRU A;  2WAA A;  2PN5 A;  2C6S A;  5DPN A;  5JLV A;  1W6P A;  2RR1 2;  3POF A;  5FZO A;  1POV 3;  1JYN A;  1UD1 A;  3NAP C;  1LTE A;  3BTX A;  1CON A;  2BTV C;  3C7E A;  4JRL A;  5GLW A;  1RTV A;  1P8J A;  2J1S A;  3Q8A A;  2ARB A;  2F4P A;  1UY0 A;  4J1X A;  4M3C E;  3FUQ A;  4YGB A;  3NV4 A;  2QCS B;  2E6V A;  5AVP A;  3MO4 A;  5GLT A;  1RUC 1;  3SNM A;  3THT A;  4EN6 B;  5C8W A;  1I9R A;  3VZN A;  2ZZQ A;  4Q4V 3;  1RHI 3;  4DO0 A;  1YRZ A;  2JEC A;  2W68 A;  5KBF A;  1BLZ A;  1A6C A;  1ZZB A;  1NLR A;  1QXR A;  3T2Q A;  3P3N A;  4XUQ A;  4IND A;  3SIS A;  4XQ4 A;  5A3T A;  4XC9 A;  1A3K A;  4WVZ A;  4I0W B;  2ZMN A;  3A4U A;  4FP2 A;  3ZSE A;  1JXN A;  2ZHK A;  4HT1 T;  4I0B A;  1NA1 A;  4FOW A;  5FYV A;  3BIE A;  1EYB A;  3ZYG A;  1TQ5 A;  3VBU A;  2P3Y A;  3CEW A;  1H2N A;  4AEK A;  4O7X A;  1OA2 A;  2W87 A;  5F2S A;  5BYN A;  5FLI A;  4ATF A;  4IGP A;  1KDK A;  4CA9 A;  1JZ2 A;  1AXZ A;  3LEI A;  4MOA A;  3AYA A;  3DN7 A;  3VZM A;  4TZD A;  1EV1 2;  1Q8O A;  2VUJ A;  4UFJ A;  4NHL A;  4D7S A;  1RUC 3;  4HLT A;  1SDD B;  1WLD A;  1UZY A;  2RDS A;  4N43 A;  4P9Y A;  5BNO A;  5IYY A;  2E26 A;  5BNP B;  2WQZ C;  1HJG A;  1MVE A;  1AR9 1;  2YU2 A;  2YUE A;  3POB A;  2PXJ A;  5FZI A;  1O7F A;  5FXW A;  1DGW X;  1W03 A;  3PUH A;  1MS4 A;  1UMZ A;  1YQ6 A;  3IIA A;  1BVV A;  4FQZ A;  5FUN A;  5A7S A;  1MPX A;  5E89 A;  3AZY A;  4QMA A;  3GDB A;  5LRR A;  4ZHN A;  1BEV 3;  5LA0 A;  4RYD A;  5CG8 A;  2QQL A;  3WP6 A;  3HT2 A;  1VRH 1;  5FPL A;  5D8A B;  4TLG A;  4CRQ A;  3NAP A;  3PVN A;  3KVA A;  4KNC A;  4NWV A;  4XAC A;  1O4Y A;  3KGZ A;  4RHV 2;  3PUI A;  4K6B A;  3D0S A;  5A7Q A;  2XJU A;  1MR5 A;  4BWO A;  1ZRC A;  2BVV A;  4OHV A;  4MXW A;  3ZFE A;  1AZD A;  2O0O A;  1ENS A;  1WW7 A;  1TEI A;  3IT8 A;  1CES A;  1BJQ A;  2JEN A;  4GWJ A;  4GZ9 A;  1YNA A;  2CU5 A;  5F6K A;  4KBZ A;  3OEA A;  3AZW A;  1NXM A;  3V65 A;  1H9W A;  1YIF A;  2D43 A;  3D82 A;  2V4A A;  1NCR B;  3U0Z A;  3HQR A;  4EZ4 A;  3LDK A;  4HL0 A;  3RI9 A;  5J3U A;  3AYD A;  4UW6 A;  1AR9 3;  4LXL A;  3WV6 A;  1PNF A;  1RUD 2;  1RUI 2;  3E5U A;  4E8C A;  1N3Q A;  1Q8V A;  2E32 A;  2YGL A;  5FZM A;  3LIH A;  1AX2 A;  4S2F A;  4ZON A;  3R4D B;  1HQL A;  4IEY A;  1SLB A;  3MLL A;  3VBR C;  3RZH A;  5KXB A;  2C4X A;  4QGN A;  1DYP A;  4I01 A;  2NMO A;  5FMD A;  2I74 A;  4NHM A;  5A33 A;  4B4P A;  1JYW A;  1O3S A;  4ZS3 A;  1VRH 3;  4QX2 A;  5T5O A;  4Q8K A;  4Q4V 2;  1RHI 2;  4LUK A;  1LHO A;  4D6Q A;  1LAJ A;  5IK4 A;  5B4X A;  1PGL 2;  2JXA A;  2IXC A;  1GQG A;  1V6O A;  4KWL A;  3THP A;  5APA A;  1NLQ A;  3III A;  4YZ3 A;  1HXS 1;  3VHP A;  2J1A A;  1BVP 1;  2ZGK A;  4QT6 A;  4B4R A;  1Y9M A;  4P9I A;  2QFE A;  1SCR A;  1VMJ A;  4TXW A;  1KJL A;  4BME A;  4JRA A;  4BB3 A;  5ERL A;  4ITC A;  3KHC A;  2PAE A;  4E4S A;  2LAL A;  5A6Q A;  4XUT A;  1QOT A;  5EFU A;  1RUN A;  2GAL A;  2P3J A;  2Q1F A;  3OCP A;  5D21 A;  3BCW A;  5F32 A;  2VNR A;  5J98 B;  3KCX A;  1Q3E A;  3O1R A;  2K9Z A;  4AZZ A;  1DQ2 A;  4ZY9 A;  2WZ8 A;  3N7K A;  1K45 A;  4BLJ A;  2GH8 A;  3PU3 A;  4AAP A;  5FZF A;  4K7J A;  5LA2 A;  1V9U 1;  2PTM A;  4NVP A;  4IV1 B;  4JGZ B;  1IQD C;  4OUM A;  2JDA A;  2Z79 A;  2ADE A;  2G19 A;  5K4L A;  2ZHN A;  4YZ4 A;  2XJP A;  4FFF A;  5IK8 A;  4Q0U A;  4EN7 B;  4A42 A;  2VY0 A;  5FLH A;  3KMH A;  1HXS 3;  3JB4 C;  4DUW A;  2PHX A;  1WW4 A;  4LBL A;  3GBG A;  2DCZ A;  2JE8 A;  2VGD A;  2D40 A;  3PJQ A;  3ZMN A;  1M06 G;  4URA A;  2DCJ A;  4AHW A;  1AUY A;  4ARY A;  5KHK A;  3ZYH A;  3C7G A;  4QDS A;  1B09 A;  2PQS A;  1QJF A;  3POJ A;  3CZJ A;  4AWD A;  3KS7 A;  2RM2 1;  1VBC 2;  3VBR A;  1T2X A;  2QQI A;  3IPV B;  2O8Q A;  1VBD 1;  4WM7 A;  3H8U A;  3MIC A;  3A22 A;  2GC0 A;  3RMY A;  4LBO A;  5CFD A;  3UKN A;  4EN8 B;  4Q4W 1;  2WNU B;  4G4F A;  3R6S A;  3LDR A;  3K2O A;  4XUN A;  1V9U 3;  3U78 A;  1HJF A; 
#chains in the Genus database with same CATH homology
 2BBA A;  3ACG A;  3ETP A;  3GXU A;  2BZD A;  3NJV A;  3WF4 A;  2BGP A;  1GNY A;  4KI5 M;  2ZEY A;  3D3A A;  4DXR A;  4BDV B;  1OF3 A;  2YG0 A;  4UOJ A;  2B9V A;  2VZV A;  2VR4 A;  1W9T A;  2V4V A;  4ET7 A;  3W5M A;  2Y6K A;  1UMH A;  4QB6 A;  5G05 L;  4A45 A;  3VD9 A;  3CIH A;  1CX1 A;  4QX3 A;  2WO3 A;  4JKM A;  3W5N A;  4QDQ A;  4PQQ A;  1XNT A;  5HPO A;  3F2Z A;  1R64 A;  2WUH A;  2Z4F A;  3MBW A;  2Y6J A;  1K42 A;  3K4D A;  1HN1 A;  3I3E A;  1EUU A;  1O59 A;  4QB1 A;  1JZ7 A;  2WAO A;  3LEG A;  4QAW A;  1YQ2 A;  1XNA A;  3LE0 A;  3C7F A;  3NJX A;  3HOB A;  4MO3 M;  3FHQ A;  4OMC A;  4DUV A;  2J22 A;  5LCW L;  3HNY M;  5FUI A;  5EJZ B;  2JKX A;  3CDZ B;  3OGV A;  2W1W A;  1EUT A;  2BGO A;  1NUK A;  1US3 A;  2J7M A;  1CZT A;  2VZP A;  2W5F A;  3NNG A;  4ARX A;  1ULP A;  3VD7 A;  1US2 A;  2Y6G A;  4AG4 A;  2XOM A;  2V5D A;  2VZQ A;  3AC0 A;  4MAD A;  1UYY A;  4QX1 A;  1W8N A;  3DYM A;  3VD5 A;  2Y64 A;  2QQN A;  1JU3 A;  2HLE A;  5C7G A;  5LA1 A;  4A6O A;  3ZM8 A;  4XUP A;  3ACF A;  3OG2 A;  2ORZ A;  1WCQ A;  2HYX A;  2Y6L A;  5JUV A;  2X10 A;  4OYU A;  2WO2 A;  1JU4 A;  1J84 A;  1W9W A;  3MV1 1;  3T2P A;  1JZ4 A;  3IAQ A;  4BK4 A;  4RN5 A;  5DN2 A;  2VL4 A;  2ID4 A;  3WF1 A;  1UWW A;  1DP0 A;  2V72 A;  2YB7 A;  2W9X A;  3WNM A;  2XON A;  3ECQ A;  1PMH X;  3OEB A;  4LQR A;  3SEP A;  1GOF A;  5IFT A;  3WF0 A;  3HNM A;  2JD9 A;  4QDR A;  4UAP A;  4OZO A;  3SKV A;  2VZS A;  2W46 A;  1PX4 A;  4PT6 A;  3I2K A;  4BK5 A;  4KWU A;  2E33 A;  2RJ2 A;  3I2G A;  2VZ3 A;  4DEQ A;  1JYV A;  2RVA A;  1UYX A;  3HEI A;  3K4Z A;  4QX0 A;  4P5Y A;  4JKK A;  3I3D A;  2QQO A;  1W8O A;  1H6Y A;  3IDA A;  4D0Q A;  5IFP A;  3HPN A;  3C7H A;  5EIY B;  3ACH A;  4DUX A;  1OD3 A;  3K75 B;  2W94 A;  4MGS A;  3T08 A;  3IAP A;  2YC2 A;  2J1T A;  3NQH A;  4M4R A;  2W1S A;  2Y8K A;  1UY4 A;  2W95 A;  2VO5 A;  4L0P A;  4OUE A;  2VZT A;  2EIE A;  3UET A;  1O8S A;  2VMF A;  1LNS A;  2Y6H A;  1O8P A;  2WQ8 A;  3VDA A;  3OB8 A;  3I2H A;  3T0B A;  1DLC A;  2VJX A;  1GMM A;  3K77 A;  3JXS A;  1JZ8 A;  3P1I A;  4CU8 A;  1JZ6 A;  1J83 A;  1XPW A;  4CU7 A;  2X05 A;  3CQO A;  2W3J A;  2BER A;  3LPF A;  3E1F 1;  5JXG A;  4LPL A;  2C26 A;  4XZU G;  3I3B A;  1OT5 A;  1WKY A;  3MV0 1;  4CVU A;  4FI9 A;  1UY2 A;  2J1U A;  2RV9 A;  3C8X A;  3UNP A;  3I2F A;  5CYY A;  2VCB A;  1GOG A;  5G04 L;  5C70 A;  1W0N A;  3LEK A;  2QQJ A;  2WN2 A;  3MUY 1;  3T09 A;  3EB7 A;  1UZ0 A;  3FL7 A;  5CZK A;  2ZEZ A;  3UES A;  2W1U A;  1JZ3 A;  3LPG A;  4QPW A;  3CZU A;  5A1A A;  5IJR A;  3T0A A;  2VC9 A;  2CDO A;  3C7O A;  5I0D A;  2VQT A;  3CKH A;  4JKL A;  3GGL A;  4A44 A;  4P00 B;  2YC4 A;  2ZXQ A;  1ULO A;  2WYS A;  5B4N A;  1GU3 A;  2VZO A;  3EYP A;  2VZR A;  4ZZ5 A;  2QBX A;  3WNK A;  4P08 A;  1NAE A;  2E31 A;  2B4K A;  3GM8 A;  4TTG A;  1CZV A;  2WDB A;  3OGR A;  3BGA A;  4DXT A;  5IHR A;  2ZEX A;  2W91 A;  3WQB A;  2VQU A;  2QQK A;  4JX0 A;  2CDP A;  2XQX A;  1SG3 A;  3I2J A;  4DXS A;  2WN3 A;  2EID A;  3NRU A;  1UXX X;  2VMD A;  2W92 A;  5C71 A;  2ZEW A;  3SEE A;  1DYO A;  2EIB A;  1UY3 A;  2DDU A;  1TVG A;  2VMC A;  4LKS A;  4XUO A;  1TG7 A;  1L7Q A;  4QB2 A;  3T2O A;  2J1R A;  3BN6 A;  4ZXE A;  3DYO A;  3K46 A;  1JZ5 A;  1UX7 A;  4XVH A;  4Z2A A;  2WAA A;  3ACI A;  5DPN A;  1F4A A;  1JYN A;  2VCA A;  4M4P A;  3THC A;  3IB3 A;  3C7E A;  3THD A;  2J1S A;  1P8J A;  2X09 A;  1I5P A;  4BJ0 A;  5JMO A;  1UY0 A;  3I97 A;  5HXM A;  1PMJ X;  2L9L A;  3WEZ A;  3MO4 A;  3WNL A;  2OKX A;  1CZS A;  2WZE A;  4W50 A;  3T2Q A;  2YFU A;  2R7E B;  3VD4 A;  2VM9 A;  1SHW B;  4XUQ A;  4A4A A;  2J1V A;  3OGS A;  3ABZ A;  3SKJ E;  1NKG A;  2QQM A;  3HNB M;  5JXI A;  4AAX A;  1PX3 A;  5F7U A;  2W87 A;  2WAB A;  5J1X A;  4E8D A;  3MUZ 1;  1NX9 A;  1CIY A;  4DEV A;  1JZ2 A;  4JHZ A;  4MOA A;  3LEI A;  5JXJ A;  2C9K A;  3WF2 A;  1BHG A;  1SDD B;  5IYY A;  3A7Q A;  2E26 A;  2VOT A;  4CUC A;  2VCC A;  3HN3 A;  3PUH A;  1GOH A;  1MPX A;  4IUG A;  3GDB A;  1KEX A;  5LA0 A;  4RYD A;  3A21 A;  2QQL A;  2KD7 A;  3PUI A;  3VDC A;  2VME A;  2EIC A;  3WNP A;  1JYX A;  3DEC A;  3LQC A;  5JXH A;  4GZ9 A;  4GWJ A;  3U37 A;  1F4H A;  3OEA A;  5DMY A;  4MGQ A;  4CU9 A;  4CUA A;  2VZU A;  3A23 A;  3VDB A;  2VTF A;  3CMG A;  4YPJ A;  4E8C A;  2E32 A;  4D8M A;  1K12 A;  1L7R A;  2DCK A;  4W4Z A;  4CUB A;  4LHS A;  2C4X A;  2J1E A;  3WSO A;  1JYW A;  4BXS V;  1W9S A;  5JR2 A;  2YFZ A;  4GWI A;  4QX2 A;  4A3Z A;  1XC6 A;  5B4X A;  1JI6 A;  3J7H A;  3OBA A;  3III A;  3FN9 A;  1KGY A;  2J1A A;  1UXZ A;  4W8J A;  4TXW A;  2W47 A;  3WF3 A;  4XUT A;  1D7P M;  3VD3 A;  4HG6 B;  4CU6 A;  3I2I A;  1JHJ A;  1OF4 A;  4UI9 L;  4ZY9 A;  2WZ8 A;  4PF1 A;  1K45 A;  3DYP A;  2WBK A;  3K4A A;  5LA2 A;  2LW8 A;  1IQD C;  2JDA A;  1RYY A;  3P6B A;  2VZ1 A;  3WNN A;  2ORX A;  3WNO A;  1GUI A;  4A42 A;  4DUW A;  4A41 A;  2W1Q A;  2JE8 A;  4ZZ8 A;  3T0D A;  1W99 A;  2DCJ A;  1H6X A;  1OH4 A;  4ARY A;  5EJ1 B;  3C7G A;  4QDS A;  3HJR A;  2PQS A;  4OMD A;  2XHN A;  1UMI A;  3CZJ A;  1GQP A;  1T2X A;  2QQI A;  1UYZ A;  2WO1 A;  5DQ0 A;  4P02 B;  2LS6 A;  3A22 A;  1K3I A;  1UY1 A;  3FHA A;  4KMQ A;  4XUN A;  4XUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...