2PAEA

Structure of a h49n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
136
structure length
136
Chain Sequence
MENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFNAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
molecule tags Isomerase
total genus 29
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2paeA00
3S7EA 4XFCA 3ES4A 3E97A 2PAMA 3S7IA 3H8UA 1I6XA 1WLTA 3NSTA 4XEZA 4XF0A 4MUVA 2F4PA 3H7YA 2IXJA 4JVAA 1RC6A 2GC2A 4N9IA 2QDRA 4BYYA 2EA7A 4IETA 4D7TA 2VPVA 2XL7A 5I0RA 1NYWA 4FBFA 4IEXA 2B5HA 1UIJA 4HBNA 4HVQA 5F1RA 1ZZ6A 2D93A 4KWJA 4BH9A 1FI2A 4IEWA 3ZDSA 2K0GA 4H7LA 1OI6A 1NE6A 4HSJA 5FLJA 3VHRA 2PHLA 3DL3A 2H6BA 4J1WA 4YARA 4YSFA 1EPZA 2EAAA 3H1YA 2D5HA 4YNIA 5HI0A 5C6CA 5JSRA 4BHPA 4XFBA 4IEOA 4GULA 1O4TA 2ET1A 4MGYE 3D82A 1LKNA 4KL1A 1WA4A 4UBHA 4MGIE 2XHKA 3OTFA 1QY4A 2Q0AA 2BNOA 3SXWA 3CL1A 1O5UA 4UXAA 4KWKA 4Q0PA 3CEWA 3NL1A 5I0UA 3LOIA 4L2NA 1ZZBA 4MGZE 1ZRDA 2D40A 3B02A 1CAWB 2HKXA 3WW4A 5E1RA 2DCTA 3MPBA 2BNMA 4IEPA 2XLFA 3D0SA 5I93A 1ZRFA 2XL9A 4IEZA 2IXCA 3RYPA 4J1XA 4I02A 2PYTA 3LA3A 3SHRA 1RUNA 3NW4A 4B29A 1J3PA 4EWEA 1UCXA 1OD5A 1CAVA 1YLLA 3CLPA 2O1QA 1H1MA 1YHFA 4XETA 5K8SA 1FT9A 2XKPA 1JUHA 2MNGA 5I0SA 3FX3A 3LWCA 4DINB 3GBFA 4Q0QA 2PTMA 1OFNA 4HZFA 3FFQA 1DZTA 1WGPA 4KU8A 2OZ6A 4HSLA 3H3ZA 2XLAA 2UYBA 4IESA 1J1LA 5LEJA 2D5FA 2WFPA 4XFFA 2CAUA 1Q43A 4O9GA 4QMAA 5EFUA 1DGWA 5BPXA 4YYOA 2Z69A 4LUMA 3D0JA 4XFHA 3RDIA 3H3UA 3OD0A 2MHFA 4OLLA 3BALA 5LRRA 2UYAA 4N9HA 4X6RB 1NZCA 3NJZA 3NKTA 3M3IA 1UPIA 2PHDA 3PVBB 1ZZCA 4PIYA 4PIZA 4XFAA 1EP0A 2MPFA 3RZZA 3BPZA 2PAKA 3LA7A 2PA7A 4JTOA 1H1IA 4Q0UA 5BV6A 1QXJA 1X7NA 1HW5A 3JZVA 4Z82A 4WVZA 5KHJA 5JAXA 1X82A 4KWLA 4IERA 4MX3A 2XLGA 4R52A 2UY9A 5LRSA 3E6CC 3FHIB 2K9ZA 1QWRA 4IEUA 2B8MA 3ST7A 1SFNA 3I54A 1NXMA 4Q0SA 5KBFA 1V70A 1O3RA 4KU7A 5KHKA 2BEOA 4Q0VA 1X8MA 1Y9QA 4HVOA 4QGNA 3RNSA 1GQGA 3H9AA 1ZZ8A 4MH0E 4E2GA 4I0AA 2IXIA 4A2UA 4E2SA 2IXHA 3ROUA 1ZZ7A 3NVCA 2V09A 4MZUA 1LR5A 3M70A 3I59B 1L3JA 4AXOA 3LAGA 2BYVE 3EQEA 1YFXA 4I01A 3RPQA 5FQ0A 1XRUA 5JCTA 5BY5A 4EROA 5D1IA 1U12A 3DN7A 1VP6A 3IIAA 2H6CA 3PNAA 3O14A 1GQHA 4LEJA 4LULA 3HQXA 3UKTA 2B9UA 4F7ZA 4FT8A 3E5XA 3RYKA 4K8FA 5J3UA 1UIKA 2VQAA 2ETEA 3ACLA 3BCWA 2VECA 3H50A 4ZU5A 1SQ4A 2QCSB 2XKOA 3OCPA 5BXXA 1Q3EA 4LLOA 4OFGA 1DGRA 1CAVB 1CAXA 2EVXA 4XFIA 3CO2A 3MYXA 4EV0A 3E5QA 3BU7A 1I5ZA 1YFWA 2GC0A 3N4MA 5JSOA 3QACA 1J59A 1G6NA 4FAGA 1X8EA 1CAWA 1RGSA 1Q5OA 4ORFA 2WC2A 2UY8A 4EWDA 1O5LA 3ETQA 1J58A 5KHHA 3U0ZA 5KHIA 4HN0A 2ATFA 1ZREA 2Q1ZB 2GAUA 3EO6A 5KHGA 3WW3A 1Y3TA 4TLFA 3FE5A 1FXZA 4ONUA 3WW2A 1VJ2A 2E9QA 5C8WA 4L11A 1IPJA 4HVRA 3C3VA 2H0VA 2PAEA 3E6DA 5FLHA 4META 2QNKA 5I8SA 1O3SA 3R6SA 5FPXA 3GYDA 4P9GA 5FDBA 1PMIA 4ZU7A 2I45A 1TQ5A 5BUVA 2GZWA 3TNPB 1CAUA 1YFUA 1PM7A 4QGMA 3UKVA 4LTAA 2OZJA 2GU9A 2Z2SB 4MV2A 4Z07A 1O3QA 2KXLA 2CAVA 3FWEA 3HT2A 4I09A 3KGZA 2IC1A 3HT1A 4FAHA 1ZRCA 3G7DA 4XF3A 4XF4A 3WW1A 5JR7B 3EHKA 3ES1A 3OGJA 3U10A 4O9EA 1NE4A 2C0ZA 4QM8A 4ZU4A 1YUDA 3DV8A 3H1MA 4LUKA 4NVPA 3EBRA 4HMZA 1J3RA 1XE7A 1XE8A 5FCCA 2QJVA 3IDBB 2ZKLA 3CF6E 3UKNA 2BGCA 1OMIA 4QM9A 3EJKA 5FLIA 4D7SA 2O8QA 1YWKA 5FQ0B 2OYZA 4RD7A 1ZZ9A 4E2QA 4UBGA 3SCFA 1O3TA 1CX4A 3LA2A 3SMHA 2GC1A 2GH2A 3E5UA 2OPKA 2BNNA 2FMYA 4QXKA 1IPKA 3RYRA 1ZX5A 5J7MA 1EY2A 2OA2A 2ZCWA 4QX5A 2Q4SA 3E6BA 4WBBA 5CVRA 3I59A 1DZRA 2PQQA 3BB6A 2CV6A 2ET7A 5CU1A 5FPZA 2CGPA 1ZVFA 4IEQA 4CYDA 3DKWA 3KMHA 2IXKA 3USSA 1CAXB 4JTNA 5E16A 3OF1A 4PIXA 1ZRRA 4AVCA 3ELNA 3SCHA 5I8YA 3IBMA 3S0MA 3H7JA 3H1WA 3CJXA 5CADA 3FJSA 5I91A 4I0BA 1CGPA 1RTVA 2Q30A 1UW8A 2PFWA 1EYBA 5AVPA 2IXLA 3MDPA 4X6QB 5J48A 1J3QA 3FZ3A 4I2OA 4XF1A 3PLQA 2XGXA 3TNQA 2P17A 2GC3A 4JV4A 4LA3A 5T3NA 1RUOA 5LEKA 2QVSB 1SEFA 5I8TA 4IEYA 1QXRA 4I3PA 4YRDA 2HJIA 4HLTA 3L2HA 1YFYA 4MGKE 4AVBA 4AVAA 3U11A 5EZWA 4Q29A 1O7FA 2FQPA 4R8HA 3HIFA 3MZHA 3I7DA 4IEVA 4XFGA 1RL3A 5I0TA 3QOPA 4WZCA 3KCCA 1CAUB 2Y0OA 3KGLA 4QGLA 4EWAA 1LB2A 3KSCA 4HN1A 4AQ6A 3IDCB 4F8AA 4PJYA 1ZNPA 3IWZA 4LA2A 4AQ2A 4BIFA 2N7GA 4XF9A 1VR3A 3LZZA 1LRHA 3SCGA 5JSPA 1UD1A
chains in the Genus database with same CATH superfamily
4P9XA 3S7EA 5FMCA 4BDVB 5FYBA 4CE8A 5FZCA 1H9PA 4LIVA 4KQ7A 1W6PB 4M3CA 2P4EA 5FR3A 1VBB3 5LASA 3Q8EA 1OXCA 3RQ0A 3LSDA 4YFWA 3ZXEA 3H7YA 3WY6A 1AJOA 2WNVC 3LF7A 3RSJA 2IXJA 1MVEA 1T2XA 2OT7A 1BBT1 1RC6A 2GC2A 5FZ0A 3ZXKA 4BYYA 2EA7A 1RYYA 5I0RA 4Q4W3 2WLQA 4JZRA 3ZYFA 1P8JA 2GALA 3VBFA 4IEXA 3ZFFB 2XVLA 2BGPA 1UIJA 5CFCC 4HBNA 1IOAA 5FYHA 4FVVA 2Y33A 1XQNA 4GMP3 5ANQA 3WX5A 4ASLA 3TBDA 2BRTA 4QXBA 2D93A 4CCEA 2FDJA 2DU1A 2RS13 1F9KA 1AR63 1R091 3I2DA 2K0GA 3IB3A 4LORA 1BMV2 1NE6A 3ZKUA 1WUVA 3DYPA 1VPHA 1EPZA 1PX4A 1H2KA 3AYCA 1NUKA 2Y6GA 3H1YA 3POEA 2D5HA 5SV8A 1PGL2 4FFFA 4IL7A 4EJRA 4LQRA 1POV0 4YLZA 2BPA2 3V0BB 4RR3A 3KV9A 3AXDA 4QQLA 1MPXA 4JGZA 4IEOA 5JOWA 3WLUA 1TMF2 1D4VB 4QPIC 4GULA 4RS5C 1ENSA 2ET1A 4OQ8A 2HYXA 4NIDA 1KDMA 1DQ1A 5BNNA 3D82A 1H9WA 1BK1A 1PVC1 3AP6A 2A5ZA 1YQ8A 3LCPA 3WP5A 4ITCA 3ZFEC 2R061 4BISA 3DKQA 4M01A 1CESA 4MGIE 3TN93 2QE3A 3KVAA 3KS7A 3CL1A 3POBA 1A34A 1DQ0A 1O5UA 4KWKA 2V72A 5HCAA 2YPDA 4CUGA 4Q8KA 2XONA 5FP4A 2XH6A 5I0UA 2HWF2 3TEXA 4L2NA 3ASIA 4Q4V1 2VZQA 4MGZE 1F5FA 1RUG2 1RHI1 4XURA 2ZXQA 5A3TA 4M4RA 1OLMA 1WD3A 1BJQA 2PELA 4Q1PA 5GLTA 3WW4A 3AX4A 5E1RA 2DCTA 4NR1A 1ZYBA 2VZSA 3GCWA 5A7WB 3V0AB 2Q8CA 5I93A 5C9AB 1UU4A 5CISA 1SDWA 3GXUA 4QX1A 3BODA 1HX6A 2J42A 1ACCA 4PDWC 5FZKA 3VKNA 4AVSA 5D8AC 5FREA 1VAKA 4JRLA 3Q9OA 1QJY3 3RYPA 1JUIA 2A70A 4I02A 4F3JA 1GWKA 4N7IA 3VZLA 5GALA 3T1MA 1JYCA 1WLDA 4B29A 2YZ4A 1GUIA 1WMEA 5F32A 3RZHA 1UCXA 3HR9A 3O0WA 1VLNA 2GMEA 3N7JA 5C3PA 1HDKA 3I3BA 3H8RA 3SQOA 5LCWL 1LJ7A 4BM8A 5L73A 2NMOA 2DFCA 2YBPA 2EIBA 2EXKA 3FUQA 2WNUA 3NNLA 3UJOA 3ZFGC 2MNGA 4PLMA 1HXS2 3TAYA 5C8CC 1IS5A 2D6KA 2LUWA 2XB6C 3GBFA 1OBNA 4K9SA 4Q0QA 1JBCA 1RUH1 3OOXA 5GKAC 2PTMA 4N53A 4ISQA 1DZTA 4CDUB 1W6QB 2RVAA 2JIGA 2XWJB 4AHZA 1DBNA 5FYSA 1U5XA 1PX3A 3JD72 2JDNA 3URFA 1J1LA 4HL0A 2VG9A 2WFPA 2EXJA 4XFFA 3VDDC 3AKRA 2QDNA 3T0BA 4LBQD 5J09A 2FHRA 2J22A 2UWCA 3K48A 4A41A 2OUHA 2RE9A 4O9GA 5KWRA 1WMDA 4KWUA 4QPGC 2W08A 3RFRA 4TYSA 2Z69A 4LUMA 3D0JA 4QQ2A 1ENXA 3VZOA 2AUYA 2RR11 2X5IA 2W95A 2D3PA 2UYAA 4YGEA 2VBBA 1KQRA 2O14A 4FPFA 5GM0A 4X6RB 1XYOA 4FPLA 4FTBA 3V65A 1OFSA 3O12A 3M3IA 3PVBB 5A70A 4BLJA 1VBA3 3GBGA 1Z78A 5C3QA 4E4DX 4XFAA 4FTSA 2PAKA 2VMCA 4XJZA 2AR6A 2PA7A 1JOJA 4UW6A 4YVWC 3KM5A 5FP9A 5JR2A 1QXJA 4S2FA 3POFA 2Q8EA 2ZEWA 5EP9A 2CL2A 1V6NA 2RM22 1SMVA 4WVMB 4Z82A 5APAA 3KLSA 3TYJA 3AP4A 4INDA 5EXOA 3DPRB 4OI2A 2ARAA 4JCKA 2HWF3 2WS93 4KWLA 4R52A 5IVFA 1UZZA 2UY9A 5AVAA 3E6CC 3FHIB 1RUG3 2K9ZA 4DEVA 3NMBA 1QWRA 1UOJA 2VNOA 4BQ5A 1Q8VA 5DDJ2 2ENRA 3ST7A 5KBFA 3GJAA 3X29B 4A44A 1RUI2 3VD5A 2F4LA 3IMMA 3AP7A 1JW6A 1X8MA 4Q0VA 4QGNA 4HG6B 3IKWA 5FO7B 4M4PA 1PO23 2VUDA 4MH0E 4XE9A 4LO6B 4A2UA 2IXIA 2IXHA 3ROUA 4EYUA 5A3OA 1LNSA 2XG3A 3MO4A 1RUD2 2V09A 3T0AA 4BPZA 4CDXA 2E31A 2UWBA 1L3JA 3FBYA 1S0BA 1Q56A 1R1A2 2BYVE 2W52A 3EQEA 4I01A 3RPQA 5DZEA 3VBSA 3U14A 1CD3G 1ZA4A 4P08A 2B42B 5BY5A 3O1OA 5D1IA 4OMDA 1F35A 1LOGA 1YEWA 2R30A 2XJPA 5FO8B 1D7PM 3INAA 3F95A 1HXS3 1Y9GA 3WSOA 3O14A 4AR2A 4LO7A 1SBEA 1ND3C 2UWAA 2YFZA 2ZGQA 3HQXA 3UKTA 1DCSA 4Y1UA 3NAPA 4YW4A 3ZXFA 1R083 2G9FA 4OUSA 4R9AA 5LA0A 4FT8A 1IGOA 4XXAA 3E5XA 1LOFC 1HRV2 3BPSA 5DZFA 3W21A 4B3NA 1YQ2A 2RS33 4K8FA 4QB1A 5GZEA 5F5AA 2OKXA 2W3JA 2BVBA 3WNPA 2K46A 1JHJA 1W2OA 2A6WA 3U4SA 3VGIA 4Z2WA 2ETEA 3KV5A 3NNMA 3I2IA 1ULEA 2VECA 4AFMA 1X33A 1EV11 1QNYA 2YROA 4CEWA 2WNVA 2TEPA 2BP6A 3MUZ1 3ZKYA 3MIBA 3OCPA 2HWB1 4TSVA 3IAQA 2EXHA 2R042 3O0VA 2HWC2 2EVXA 4NROA 3RJ2X 1D0GA 4UFHA 3CO2A 1HJGA 1AYN3 1JZ8A 3E5QA 1CPNA 1U0AA 2OW4A 2V4VA 1I5ZA 2HBTA 4W6YA 4CU8A 3VKFC 2PHXA 4UW5A 1STMA 2NMNA 4AHYA 1G6NA 3C7HA 2DUOA 4R4ZA 4PQ9A 4AAPA 1CAWA 4ORFA 2R0HA 4LMFA 4EWDA 1O5LA 5F6KA 2XWBB 2W1WA 1GYKA 3BYWA 5FBJA 3PL0A 4HN0A 3WG3A 4XMIA 1BQPA 4QPWA 4D6SA 2RM23 1AR83 4HKOA 1G9BA 3LFIA 4NE9A 4QHOA 4QPIA 4RS5A 3I4IA 1W6NA 3KCXA 3WF3A 4CCOA 1Y3TA 3ZXAC 3BUCA 1VMJA 3ON7A 2KR2A 1REDA 2XVGA 4UT5A 5FZAA 5C8WA 1D2QA 3WG4A 1SDDB 3N7LA 3ZFEA 1JXNA 1W6OB 4OYUA 4P5HA 1BMV1 2FDHA 5F9TA 2VMGA 2BJSA 5C33A 3AFKA 3RWNA 4NJ4A 5FZGA 4AFDA 2H0VA 2PAEA 1PGL1 4NMIA 1UZYA 2JDAA 5DABA 4Q4X3 3SKJE 1NCRC 1Z7S1 1O3SA 3T4VA 1RUF1 4AGGA 3GYDA 5AC92 1WW6A 4XTPA 4ARXA 5GZFA 1AR92 1TMF1 2QQLA 4ZU7A 3GHMA 1DZQA 4QXCA 3ZPOA 2DV9A 2E53A 4LE3A 5LB6A 4A6OA 2I45A 2ZACA 4G3YC 4OHXA 1GZWA 4QHBA 1CAUA 3TNPB 1PM7A 1PVXA 3UJQA 1OLRA 2RMU2 4YM1A 3IDEA 3A22A 1H8TB 4QGMA 1XU1A 3UKVA 3ZPYA 4LBLA 2OZJA 5FRAA 1AZDA 2JE9A 3JUUA 5EYYA 4JDNA 4PDWA 3KF3A 2W87A 5D8AA 3CDZB 1Z0HA 4QQPA 1GP5A 5GLVA 4CDQB 1UQXA 1XYPA 2KXLA 4UFJA 5IFTA 1I5PA 2Y60A 3FWEA 3USUB 1AJKA 2BZDA 3I2KA 4OUEA 3AFGA 1WZXA 3WVJA 3KGZA 1RUC3 4DXTA 1HIXA 2IC1A 3HT1A 5EJ3A 1O4YA 2VCCA 1MS0A 1GNZA 2P5BA 1QQP3 4XF3A 1UKRA 4A6SA 3WW1A 3U10A 3ES1A 3J8F3 3OGJA 2C1FA 1WMXA 1AXYA 2C0ZA 3BTZA 1CJPA 3ZYJB 3H1MA 4LUKA 1SG3A 4NVPA 3EBRA 4QD2A 3LD8A 1XE8A 2J1EA 3IDBB 1C1FA 3CF6E 3LFMA 3UKNA 2Y26A 2R043 1A8MA 2DTYA 5JXIA 1RXFA 1JN2P 2GNBA 1LU2A 4IV1C 4MGQA 2QZ2A 2WO1A 3KQRA 1XNBA 3K51A 2JG9C 4ZY9A 4MLOA 2C4XA 3HOBA 1E5HA 1TEIA 2QQKA 4Q4Y3 3ZSMA 1ZZ9A 1W0OA 1F31A 3VDDA 5A6QA 1PO12 2W92A 3ZXLA 2WA3A 4BZ4A 1UZWA 2E26A 2H0BA 3I2JA 4C0HA 4YVSC 4QU1A 3POYA 1O91A 1AXZA 1BVVA 2PHUA 1A8DA 5A3LA 3I3MA 3LQCA 2ZZJA 4YW6A 2Y0IA 2XJSA 4QPGA 3RYRA 2WFF2 5E89A 2W9XA 4TN7A 1U5YA 4Y1ZA 3S30A 1JHNA 2OA2A 2K2SA 3DUIA 4NO4A 4QX5A 1YQ6A 1F8VA 1XJAA 2IFWA 3MIHA 4O7XA 1DYOA 1PM4A 3JD71 4RHV3 2ZEYA 3GCXA 5EHDA 1SACA 2YB7A 4OHYA 2RJLA 5CZKA 3BTYA 4CZSA 1H2LA 3PURA 3HQUA 5A80A 4CYDA 1IS3A 3KMHA 2HWE2 2YGMA 1CAXB 4K1YA 4YVWA 4BMBA 5FLIA 3W59A 3H8XA 2VZVA 2X29A 2NM1A 3OF1A 2RS53 4AEJA 3CJIB 3A4UA 5HBAA 3H8OA 4D8MA 4DS0A 2E33A 4WZFA 3SCHA 3WHTA 3IBMA 1F4AA 3ACIA 3KF5A 1LOBA 1OKOA 5I91A 5IT6A 4KNCA 4XHXA 3IMNA 1EYBA 1COV3 1KJLA 1XOYA 3AP9A 1BZWA 3L9JT 2ZMKA 2YG0A 3HNBM 3N36A 3MF6A 3PVEA 4NAMA 4CCKA 4LOTA 5FFOC 3WUCA 1EUUA 2QZ3A 2GDFA 2IXLA 5L7OB 3IPVB 1CONA 4CEYC 3K3OA 2VTXA 5F8PA 1REEA 1QJU2 2AZ5A 5F5QA 3THTA 4EN7B 3HBZA 4DUXA 1RUJ2 4YGDA 4YZ4A 5EIYB 1VBC2 4ASMB 4IE7A 4JDOA 2LROA 2YMZA 2P17A 4MSVA 3HNYM 4LHNA 4RFRB 5IK4A 5DAVA 4Z2AA 5T3NA 5F3CA 1RUOA 3MIDA 4KI5M 3LB9A 5FZLA 1XBFA 3IN9A 4IEYA 4M0NA 1YCIA 4NHMA 2ZGTA 4XW3A 3L2HA 1YFYA 5DDJ1 2R16A 4CP2A 3LIGA 4Z1VA 5JXHA 2BTVC 2JEMA 1LCLA 1RMU3 1FX5A 3C2UA 4BXFA 4R8HA 3WUDA 1IPSA 2P6CA 3MI8A 4Q4V2 3MZHA 4J6GA 5C5UA 1JZ7A 1KXGA 1QJZA 1OUXA 4QX2A 5DXDA 3ZFFC 1LAJA 4MG2A 4PI2A 4A7YA 5I0TA 2EIEA 5EV7A 1MQTC 1U5IA 3DECA 4Y5SA 1MEC1 2RV9A 2Y0OA 3U07A 1LOFA 3B01A 1RUD1 3KSCA 4FPHA 5FO9B 2W46A 3PIJA 4AE2A 1R1A1 3N9NA 4FP3A 4W6WA 4F8AA 1OOPB 5DAWA 4AWDA 2AYHA 2P3JA 2Y6HA 2BFUS 3LEGA 3B9CA 1O4ZA 4CDWB 1POV3 4B4QA 4BQ1A 2WAAA 3LZZA 1JU4A 1LRHA 2VXJA 2VOTA 5CFDC 1W9YA 3DXUA 2BDRA 3U37A 2FDGA 1PGW1 3IAPA 1C4RA 5F2SA 2DWRA 5FZ9A 2P3IA 1IS4A 4B1LA 2DTWA 3JU9A 4RGAA 3S7IA 3P3PA 1WLTA 4XEZA 3NSTA 5GLUA 5T5JA 4DMIA 4DY5A 2C9KA 2NQYA 4XF0A 3PMEA 4BCUA 1HV1A 2F4PA 2XJQA 1BBT3 2WWJA 1RUH2 4FFGA 1S0GA 2JG8B 2JDYA 4S2GA 4BQYA 5A32A 4N9IA 4IETA 4D7TA 1NYWA 2ERFA 3APBA 1OQ1A 1RUE3 3G6JB 4LT5A 4HVQA 5F1RA 1R093 1ZZ6A 3B93A 4AI1A 5A6ZA 4BH9A 4MXWA 2QFEA 4O61A 4IEWA 2HWC1 2WYFA 1HN1A 2YYOA 3WR0A 3HN1A 3B3QE 3ZDSA 4MHRA 2JECA 3AP5A 2VXRA 3VHRA 1IHMA 3DF0A 3M3EA 4XJAA 3T2TA 5GZCA 5C4WC 4QPYA 4J1WA 5H9RA 2E7AA 1C5IA 1CZTA 1OH3A 2EAAA 1S0FA 4NOTA 3WF1A 2D97A 1A78A 1Y43B 4IV3A 1S2KA 4GH4B 3ENRA 1V00A 5JIAA 3IZOA 1ULFA 1W3XA 4FOYA 4XFBA 1K45A 3WQ7A 1NXD1 2QQUA 4BHPA 1VRH1 2OUJA 2Y6JA 3LE0A 2ZX3A 3I2HA 4WM8B 3WDUA 3ZM8A 3ZX7A 5JZGA 1NCRA 1O4TA 1PVC3 3AZZA 3ACHA 5JLVA 4N43B 1AVBA 4Y4YA 3WP3A 3O1VA 5KC5A 1LKNA 1VMHA 2R063 1B35B 2ADDA 3PVOA 2Q8OA 4CCLA 4UOJA 4JGYA 3VBRB 1RVF1 4K1ZA 1W8ZA 1E5SA 1ENQA 1AR73 1MS9A 1UY0A 4EZHA 3N7KA 4ZPIA 1JYTA 2XHKA 5K9YA 2VZPA 1MS1A 1W2AX 3MFCA 5A6XA 1QY4A 4C0BA 1PIV2 3OGVA 2A71A 4UXAA 2DUQA 4CPBD 3ZSJA 1GFF2 1C5HA 1I3HA 4BJ0A 5GZGA 4AK3A 3LDRA 4YGCA 1OURA 4Q4V3 4JHZA 1MVQA 3BKZA 2CY6A 1C28A 1RHI3 3LOIA 3WP6A 4GZ9A 1GV9A 4JQRA 1SPPB 2ZHNA 3B02A 4OI0A 1AR91 1T6GC 1YXWA 2HKXA 5IAXA 5L9BA 3LPFA 3WNMA 2DURA 4RQPA 3MPBA 1X9TA 3POWA 4DY3A 1SLTA 2CU5A 5A33A 1FMD2 4IEPA 3T2QA 5HCHA 1ZRFA 2WO7A 2EF6A 5IVVA 2RMU1 3R0RA 4MADA 4XAEA 2R072 2XL9A 2IXCA 2Z42A 3LOBA 3OYWB 3LA3A 4AFBA 5FYYA 2W5FA 2E6VA 3AMNA 3NO8A 3ACGA 4QT6A 4EWEA 1IQDC 1UMZA 1YIPA 2GN3A 2IVJA 1FOD1 3VDBA 4LLFA 2JG9A 5DZGA 1S0CA 1YLLA 4XUQA 2JD9A 3CLPA 1N47A 5FZ7A 4UF0A 4JHTA 3O1TA 2OX0A 4GWNA 2R32A 3S6PA 4FPCA 1J84A 1JUHA 3VZKA 3VDAA 2HBUA 4YVSA 5IVEA 3LWCA 1AYM3 2XJUA 4DINB 5K0UC 3RZGA 5BYNA 4WV8A 3HMYA 4YG0A 1OFNA 2A6XA 1BEV1 1F4HA 1Y9MA 3PHMA 3AK0A 5EPAA 4AEDC 1KFXL 1WGPA 1W05A 3CU7A 3OSDA 3O7OA 2OZ6A 4HSLA 3H3ZA 1AL21 3DPRC 1SLLA 2UYBA 4A3ZA 4IESA 3BI3A 2JXAA 4D3WA 1W6MA 1WBLA 1YYNA 2VUJA 3WG2A 5FJHA 1G7YA 1BVP1 2D6MA 5DN2A 3K77A 5JPNB 2HWB2 2VD7A 2D98A 3RMXA 4HPKA 5EFUA 2DF7A 1QEXA 4YYOA 2RR13 2JDKA 4XFHA 2Q1MA 3BVCA 3D3AA 3OD0A 1OA3A 4E8CA 1C8M1 4NN0A 2VOKA 4DQAA 2QQJA 2WFF1 1LEDA 4OLLA 4XXPA 4Q26A 5FYIA 4M3CB 5JI7A 5LRRA 2QBXA 4GJZA 1N1VA 2O8OA 3A21A 2XR4A 1FYUA 3AZVA 5DG2A 2XJRA 2VMHA 4CRQA 3HAGA 1EP0A 3AL5A 1ASJ1 1XPWA 3RZZA 1N1SA 3VBFB 2XBO1 4Q0UA 5BV6A 4WVVA 4ATFA 2Y6LA 4OCTA 1HW5A 1EAH2 1X36A 1VE0A 5KHJA 3NV2A 2JKBA 3OBAA 2HWE1 2NP0A 3LEMA 1GNHA 5ACA2 1IKQA 1HRI2 2R1BA 4IERA 4MX3A 1W9FA 1NA1C 4I0WB 1Q8PA 2VNRA 5HCFA 2WWSA 2VZ3A 2XVKA 3ZOIA 1PK6C 5KXBA 1SFNA 1LODA 1NXMA 3DYOA 1MS4A 4IGQA 3TEWA 1E57A 1V70A 3QCWA 1GANA 1HV0A 1O3RA 1AX1A 3WDYA 4JGZB 3UK9A 4XIKA 3SITA 1VBE2 2ZEZA 3NV3A 1Z7S2 2VBDA 3H9AA 1RUF2 3R4SA 4GKYA 3KHBA 1ZZ8A 1D4M3 2WR9A 3BOPA 3NJVA 4I0AA 1KGYA 1XYNA 2XMLA 5BNNB 1ZZ7A 3B94A 4XTMA 3ZYPA 3NVCA 1G9DA 2P1BA 1QJU1 3ZFFA 4AL9A 2PHWA 4XVHA 2A6VA 2BERA 1RUJ1 3I59B 1MQTA 1VBC1 4AXOA 1PZ9A 4LK6A 5FQ0A 3FLTA 3ZYIB 2ARBA 4MHUA 3PUQA 5FKBA 3KCYA 4YWAA 3WF0A 4CP1A 2VUAA 3ETPA 2KA3A 4K40A 3E1F1 1VIWB 1PZ7A 2C5DA 2WNOA 3N9LA 4OULA 4QDQA 2KD7A 1ZBA2 1A3KA 2JDMA 5CFDA 4F7ZA 1UWWA 4NWWA 3VLBB 1SLCA 3VD4A 2CSGA 1BHGA 3CZJA 3RYKA 2W0XA 2FBEA 1XXNA 4QKNA 3AZYA 1LEMA 2XQXA 1R64A 2FMDA 1EV13 1NQDA 4NPMA 3BCWA 3JBG1 4PBOA 1ZBE2 1OQDA 2BBAA 2PLV3 2ZX2A 4MO3M 5FY0A 3H50A 1IKPA 1UY2A 3AKTA 4AVTA 2VL4A 2VOXA 4BLIA 4AFAA 5DUVA 1YI9A 1SLIA 5F5CA 3VBHC 4NPLA 2DDUA 3MYXA 4EV0A 1BXHA 3AB0A 2WZEA 1EPWA 4BQ3A 1E5RA 4UFKA 2YUEA 1DIWA 4NRPA 2WNUB 3FMGA 2DBNA 2E7TA 2IWGB 1JYNA 1CZVA 2W1QA 1TG7A 1JS9A 2A6ZA 1DQ4A 5C4WA 2VVDA 2WC2A 4BK5A 5LBBA 4KBBA 1H8TC 4BMEA 4XBNA 4N53B 1J58A 3U0ZA 4JC1A 2QQNA 2WIIB 4EN8B 1JZ3A 2G9GA 5FMBA 2ID4A 2RDNA 1SCSA 1UY3A 2PMWB 5LY1A 2ZABA 5FJKA 1NZIA 2GAUA 1OVPA 2A1XA 4JKMA 3FFZA 3U75A 4CDQC 5BNQA 3C7OA 5KHGA 3WW3A 1JYXA 4MGTA 2CWSA 1FXZA 4ONUA 2PXJA 3WW2A 4MVTA 5CAZA 1UN1A 3Q8CA 3OPTA 4ATEA 2F6BA 3ZXGA 4H14A 4JQTA 3AYDA 4HVRA 3ZMOA 1YQ5A 4D6RA 4QKBA 3C3VA 5FYZA 2VH9A 1QGLA 2X5IB 2MEV2 4XACA 4Z8BA 1U5ZA 1Z7S3 2X10A 1RUF3 4UAPA 4Y22B 2WWUA 2QQIA 2VY0A 4ZKTB 3MHZA 4WM7A 1TMF3 2V4AA 3JQWA 5FAXA 5FPXA 4P9GA 1HB3A 1URXA 1ZM1A 1VBD1 4YW2A 1W6QA 1LHVA 2HWD1 1LULA 4LKDA 4PCRA 5L19A 1TQ5A 4TWTA 2BBVA 5EJ1B 2Z79A 1OT5A 3OPWA 1YFUA 4M3CE 3ATGA 2DVAA 1UYPA 3PJQA 3MEPA 1ND2A 4CPBA 2R0FA 3M3QA 4FPKA 2BOJA 2Z2SB 4KH9A 2YC2A 2DYCA 5GLZA 5KC6A 5J37A 5IJRA 1H4GA 3U78A 3FLPA 4U36A 3H42B 1PIV1 3OG2A 4Z07A 4QDRA 5F7UA 1O3QA 1XE0A 3FN9A 3O1MA 2VNVA 2JJ6A 2AEYA 2VQUA 5B4XA 3AJZA 2GNMA 4GQ7A 1H8VA 4EN9B 4FAHA 1ZRCA 1YO8A 3PU3A 2ARXA 3OY8B 3TWIA 5FOJB 1NLSA 2XHNA 4B4PA 3I97A 3EHKA 4HFSA 4O9EA 2DUPA 1NE4A 2WT2A 4P14A 1YUDA 2AACA 4SLIA 1SFYA 2B7YA 5K0UA 2CYFA 1FMD1 4GB32 2BUKA 2VO5A 2V5YA 3D5OA 1ULOA 1V9U2 3J7HA 4V2WA 4YGBA 5FCCA 2P3YA 1MEC2 4CDXB 4QKFA 2JDZA 3T0DA 2R071 3EYPA 4AEDA 4A7KA 3EJKA 2BU9A 3CJIC 4GMP1 2G9ZA 2VZ1A 3VBSB 3DPRA 2D7FA 1AR61 4RD7A 4E2QA 2R49A 1NCQC 5C5TA 1O3TA 5FZFA 4UW4A 4XCBA 3SMHA 5SV5A 1HLCA 3E5UA 1KJRA 2BNNA 4YM0A 2FMYA 3NAPB 4QXKA 5CKQA 1PGW2 1IPKA 2I2SA 4NRMA 5BNOC 1NKGA 3P3NA 1SBDA 4DFSA 5ABJA 4EQVA 5J7MA 4LBNA 2D43A 1WW5A 3V64A 5F2WA 1G8WA 1HN0A 3E6BA 3JD73 2WYSA 4WBBA 4K20A 3WOGA 1OLME 3POJA 1DZRA 1UAIA 1POQA 2AREA 3BB6A 3GGLA 4WVWA 2ET7A 5CU1A 1NQJA 5FPZA 2WNVB 3VV1A 4CEWB 3SEPA 1ZVFA 4NAOA 4LIUA 3FL7A 1TME2 1GOFA 1KEXA 1N3QA 3TN91 3USSA 1ODNA 1QNWA 1OF3A 1BKZA 4BXSV 1AUYA 2DCKA 5A1AA 1ALYA 1YJLA 1JH5A 2EXIA 4IGOA 1ZRRA 4P9JA 4OHZA 1W8UA 3I3DA 5CFCA 1M06G 3KQ4B 4YM3A 5A7QA 2HEYF 5CNAA 2C24A 2QKDA 3LDBA 5C7GA 5JOZA 1NA1A 3H1WA 4S2HA 5CADA 3A0KA 1CGPA 1RTVA 1SCRA 1RJ7A 1XNTA 1UW8A 1MS3A 1PK6A 1GR3A 5AVPA 1RB8G 1FV3A 3VDCA 3ZO0B 3J7MA 1VRH2 4RN5A 4GXLA 1ST8A 1WA6X 1KS4A 4XMAA 2EIGA 4QPIB 4RS5B 4XQWA 1W6NB 4X6QB 4AF9A 1Y7BA 4CDWC 5T5LA 5J48A 1J3QA 3FZ3A 3W5MA 1JYIA 5A3NA 3K4DA 3PLQA 5FZOA 1EAH1 2XPJA 2GC3A 2JDPA 4BQ2A 2WA4A 4QXHA 1RVF2 3ZFEB 1ULCA 4W50A 4BIOA 5ACA1 5LEKA 1HRI1 2WQ8A 5I8TA 3F2ZA 4XBQA 4RGKA 5DDJ3 1QXRA 4I3PA 4YRDA 5A7PA 3VBOC 4AAXA 3RZLA 4XDPA 1RUI3 4V1PA 4QWNA 3GJBA 3VZNA 4AVAA 3K46A 4QKDA 5ERLA 3FLRA 1O7FA 5J36A 1IS6A 3OBZA 1AHSA 1H30A 1VBE1 3JXSA 3O0XA 4XFGA 1MZ6A 3MGUA 4JKKA 4URTA 1V6KA 1REFA 3AL6A 2AEZA 3N9MA 3OEAA 3QOPA 1RUD3 2ZHLA 1GWLA 1CAUB 1UOGA 4QGLA 1DF0A 4TLGA 3WZ1A 4AEMA 4LO8A 4Q2FA 1R1A3 1LHOA 1JTZX 4COZA 3C7EA 3IDCB 4GWIA 3KHCA 2R6QA 4CCNA 2A6YA 2WRAA 3GZTB 3ZR5A 4FXKB 1VAVA 1ZNPA 3NNGA 4PDWB 3IWZA 4DEQA 4KGQA 5D8AB 2WABA 5A3PA 4BIFA 1E5IA 1GU3A 1VB2A 4GH4C 2XUMA 4HETA 4FFIA 4C1WA 1FOD2 4L8QA 3SCGA 4WM8C 2HLEA 4Y4RA 4XC9A 5JSPA 3W5NA 3VBHA 1XNDA 4Y5TA 1ZBA1 3E97A 5DUUA 1HRV3 2PAMA 2ZHMA 3H8UA 5DG1A 3KV6A 4YW7A 4K8RB 1LOAA 2VOVA 3RI9A 3WQ0A 3ZSKA 1V6MA 4MUVA 1FPN2 3VD3A 4COWA 2X09A 2WT0A 1OQEA 4W6XA 2DBIA 3WNKA 1RITA 3KZ4C 1BEV2 4JVAA 2QDRA 3ZFGA 5BNPC 3CIHA 4M00A 2VPVA 2XL7A 1ZBE1 3HVDA 4PBPA 5FMOL 5C8CA 1AL22 3HWJA 3NV4A 2HWC3 5JVVA 4CCMA 1FI2A 3VDDB 3THDA 1B09A 2OQ6A 2RJKA 1OI6A 4HSJA 1QOSA 3TEZA 2ZKNA 4CXYA 3AKPA 3DL3A 4KMQA 4ES8A 2WQZC 4YARA 4YSFA 1TNRA 2CDOA 2D6LX 2E63A 3RS6A 4YNIA 1W8WA 4QPGB 3PUHA 5JSRA 3JB8A 1UY1A 1VRH3 2IFRA 1C8M2 4NHXA 5LA2A 2RDQA 4EN6B 3WG1A 1HB4A 1D0HA 2VUCA 3M2MA 1EUTA 3ZSLA 4CP9B 5T50A 2LW8A 4MGYE 4R9CA 4QX3A 3HD8B 5JPMB 2BVVA 4OUMA 4LBQA 4AHWA 2YDEA 5FZMA 1G9CA 2YHJA 1WA4A 1ASJ2 5J96B 3O1SA 4UBHA 2XBO2 4AHXA 4IUGA 3JQXA 4A45A 4EN0A 2ORXA 1NOVA 2BNOA 3SXWA 1WBFA 4X8PA 3NV1A 1GOHA 2ZMNA 2RDSA 1CN1A 3J7LA 1QDCA 5EQUA 1WLCA 3CEWA 5FUPA 2WL1A 1K5MC 3NL1A 1DYPA 2MEV1 4NIAA 3TEYA 5FZDA 5FV3A 1ZZBA 4OI4A 5AC93 4HK9A 1R081 1AR93 1BK0A 3BIEA 2D40A 3AMHA 3MIGA 2ZX4A 5JUVA 1CWPA 2P6HA 1OA2A 1OPMA 3RWKX 1UX7A 4OMCA 2RS31 4S2DA 4UFMA 1O8PA 5DAQA 5CG8A 2BNMA 1WCKA 2RMU3 5FPLA 5T54A 5G05L 1K5JA 3WP4A 1NT0A 3MLKA 4LR4A 2IUWA 4LBMA 2L9LA 3POSA 5E8AA 5G04L 2BWCA 2VW2A 2XJTA 4J1XA 4IE4A 5HXMA 1H6YA 4Y1YA 5L9RA 4BWOA 3NW4A 2AH2A 2YPJA 5GLWA 1J3PA 2CHHA 2VCAA 2X53S 4XUTA 1OD5A 1CAVA 3NNFA 4P5YA 1AYN1 3KT7A 5F3GA 3ABZA 2DU0A 4NHKA 4PQQA 3OUIA 4MYEA 2O1QA 1N1TA 1YHFA 3DGTA 1NCQA 4XJ9A 5K8SA 4ZHNA 4A7ZA 4BOWA 5B2GB 1H2NA 5I0SA 2JENA 3FX3A 5L36A 1BEV3 3VBFC 4OZOA 3KT1A 3MBWA 3U4XA 2J1UA 1WWYA 1UOFA 3OEBA 5JOYA 4QAWA 4H3WA 4CSWA 1ND3A 4DXSA 5BNOA 3WXPA 1W04A 4GB31 5FY9A 4KU8A 2D6NA 4Q1RA 4HKWA 1YQCA 5DAPA 1V9U1 5IW0A 2XLAA 1SLBA 2GP3A 4R9BA 2QQWA 2C9AA 3I49A 1UX6A 3JBG2 3ZDVA 2QTWB 4YPJA 2ZPXA 1PO13 1GLHA 4LITA 2D44A 5FWEA 1Q43A 4JGZC 2ADEA 4UI9L 3WT3A 4D69A 1WD4A 1DGWA 3FHAA 4IDZA 2B4KA 5FMDA 5BPXA 3RDIA 1C8M3 2IZWA 1D2SA 3UV9A 2WFF3 4LO4B 3ZN5A 1JODA 2RDRA 4Q5OA 4Q4X1 3R4UA 3ZN6A 5BNNC 1YNAA 3ZIWA 4NIIA 3SH5A 2RHPA 4N9HA 2KM2A 1NZCA 3WF4A 5HV0A 3C7FA 5KXEA 5FXZA 1DQ2A 2NPIA 1XB9A 1UPIA 2PHDA 4Q8LA 1ZZCA 5A32B 4Z92B 3THCA 3MW2A 1OUSA 1W9SA 4OHWA 3AZXA 3CBNA 1PMHX 1TE1B 3BPZA 4FPOB 4ZZ8A 1W8FA 1YRZA 1W90A 2BGOA 3BGAA 2CNAA 2HWE3 3IDAA 4PHZA 2YU1A 1TME1 4KG0A 1ZA7A 3O5SA 5JAXA 2WLPA 3SISA 4AI3A 4ZXKA 2VULA 1JZ2A 1GNYA 5LRSA 1OKQA 4IEUA 2B8MA 4IV3B 2G4IA 4P02B 2LS6A 4QX0A 1AXKA 2ZAHA 2YGLA 1ULPA 4KU7A 4XZUG 3VBOA 1QQP1 2PQSA 4HVOA 3RNSA 4J25A 5C9AC 1GQGA 3J8F1 2FZ1A 5HXVA 3ACFA 4CCJA 5JZGB 1UYXA 2B39A 1MZFA 1QJU3 4E2GA 1VBD2 4E2SA 4D0QA 1RUJ3 2ES3A 2HWD2 2W1UA 1VBC3 4MZUA 2BOIA 4SBVA 4JGYB 2O0OA 1H4HA 3PUSA 1PNFA 4JAAA 1NX9A 4XJUA 4FQ4A 5T52A 5C3RA 4Y24A 2VZUA 1XRUA 3B7MA 5JCTA 1SFPA 3RG0A 1C3HA 2VAUA 3R4DB 3DN7A 3RVHA 3M3CA 3IIAA 1QJX2 2ZJCA 4XABA 5A3MA 3AMQA 4AEKA 4LULA 3K4AA 3VUOA 5FK7A 4CDUC 3AYAA 3WF2A 4IE6A 4WM8A 4RQPB 4F83A 1KD7A 2D6OX 5A33B 1UIKA 1GMMA 1VBB2 3PUIA 3JBG3 1DG6A 2VQAA 2EIDA 1RXGA 2VOWA 2G19A 1L7QA 3ACLA 4JKLA 4RHV1 1JZ4A 3MF9A 1WCDJ 3BOWA 3OUJA 3M7AA 4ZU5A 2QCSB 5ANNA 5FP7A 4Q4W2 5IVJA 2XKOA 3MUY1 1CZSA 1N1YA 1Q3EA 1W2TA 4G4FA 4LKFA 5TSWA 1HQLA 2VGDA 4LLOA 3K3NA 5BNPA 4OFGA 4FTEA 2YV8A 1V6JA 1DHKB 2JG9B 2RS12 2RS51 1AR62 1KDKA 3W20A 1UU5A 1BCXA 2GC0A 1YFWA 4IV1A 4P9YA 1FATA 1FV2A 4UF0B 1F2NA 5JSOA 5CG9A 1W8NA 2ZGSA 3QACA 3UGGA 1J59A 3Q8BA 1SPPA 2DCYA 1UF2C 4XJWA 4YVSB 2QQPA 1TNFA 1X8EA 2UURA 4FO9A 4YW5A 1RGSA 3RZJA 2A3WA 5F3EA 2VC9A 5JMCA 5FYVA 3ZIXA 3FHQA 1RUH3 3ETQA 4FPEA 1FPN1 3A7QA 2JE8A 2LM3A 3HEIA 5KHIA 5FWJA 2ATFA 1ZREA 2Q1ZB 3J9SA 3POIA 1W6MB 1W0PA 1APNA 2W47A 5FKCA 4XYXA 1VJ2A 3T2PA 2E9QA 1MR5A 2OQ7A 2P3KA 2ZGOA 3AVRA 4HPKB 4IE0A 5FUNA 3TN92 4BQWA 3N9QA 4NIHA 2E7QA 3VBUB 1YC61 2ZGNA 5H9PA 4Y33A 3KWVA 5EYXA 1UXXX 5GZDA 4QB2A 3J26N 4Q27A 2CDPA 5HV4A 1GZCA 1RMU1 1GKBA 4META 4Y20B 1WMFA 1OC1A 3CZUA 2Q1FA 1K5MA 5FXVA 1CJDA 2FDKA 2HWD3 1PMIA 3P5BA 1WW7A 1H6XA 4LE4A 2TBVA 5LK5A 3AYEA 5BUVA 1MZ5A 5IATA 2GZWA 2Y6KA 3T08A 3CHXA 4XZPA 3RRDA 4L0PA 1I1EA 4TXWA 2GU9A 5A7SA 1PIV3 3MW3A 1QJY2 5M0TA 1UMIA 5LA9A 1OD3A 3VKMA 1GZTA 3OUHA 4FOQA 4GALA 4MV2A 4AGRA 4CEYA 5FZ3A 1W8OA 3OGGA 4H55A 2CAVA 2JICA 3WDTA 3HT2A 3O1RA 2Y38A 5LATA 5FZ1A 3UYJA 4I09A 5JXGA 1WCUA 3N9PA 4IQPA 4HT1T 4D6QA 3HN3A 3V56A 3G7DA 4L92A 5FZIA 4XF4A 3QH7A 4RR3B 1AL0G 3K4ZA 1W6PA 5JR7B 4GWMA 4CEWC 1CVNA 2VTFA 1FMD3 5T55A 5DUXA 4ZU4A 4QM8A 3WD5A 5LW9A 3U1XA 2ZMLA 1G9FA 4CU6A 1VALA 5FIXA 1XE7A 2R073 4TTGA 5DAXA 1DP0A 1JMUB 2VMEA 3GZAA 3VZJA 2WZR1 4W4ZA 2OXBA 1MQTB 2BGCA 1RUE1 1IG0A 1O59A 3MFAA 4QM9A 1GOGA 5FPBA 4DB5A 1DQ6A 4D7SA 5C3SA 1SHWB 5FQ0B 3CQOA 4W8JA 5JIUA 3BIWE 1R1ZA 4RSUA 4NHLA 4TZDA 4E4ZA 1N3OA 5FP8A 3BTAA 3LA2A 4C8DA 2GC1A 5C71A 1HB1A 3L2YA 3EXUA 1I9RA 1LECA 2DVFA 1QDOA 3KD4A 2OPKA 4P9LA 3PMSA 1XC6A 3GALA 4FOWA 1UMHA 2A3XA 5CFDB 1UZ0A 3ZYBA 3CKHA 3I3EA 3V0BA 3B5LB 1W2UA 1ZX5A 5LBCA 1QXPA 1EY2A 1N3PA 2CGOA 2ZCWA 4LKEA 1W8HA 4ZXEA 5CA6A 5CVRA 1G86A 5K7PA 3KV4A 5CYYA 4ZZ5A 3I59A 1VBA2 3EMRA 4B8EA 2CV6A 1S4CA 3Q8AA 2VU9A 1AR71 1V6LA 2HWB3 3ZVXA 3ZYRA 1ENRA 2IXKA 4DRRA 5FZ6A 5IWFA 4JTNA 3VHPA 5E16A 5A7NA 2YU2A 1NG0A 1O8SA 4PIXA 2XQRA 3NJXA 3IM0A 3D6EA 3PJYA 2VQTA 1DLLA 2WS92 2J1SA 4DXRA 4XJ8A 5I8YA 2WNEA 3PVNA 4AI0A 3H7JA 3S0MA 3WNXA 1HB2A 1PZ8A 4I0BA 5C4WB 2WDBA 3WINE 1H1AA 1ULDA 3UGFA 2WUHA 3ILNA 3DXTA 5A7WA 1VMFA 1IQAA 2JE7A 3V0AA 1PO22 3TRSB 2NLRA 1UPSA 5C9AA 2JWPA 5CB7A 1EAH3 2EALA 5LWBA 1QKQA 2XGXA 2ZBJA 4EE2A 4FPJA 3OPZA 5ACA3 5JMOA 3ZYGA 5FPVA 4C90A 1HRI3 4Y3OA 4LA3A 2LTNA 2PHFA 1YIFA 5A7OA 4UFIA 2VVEA 4CTEA 2VW1A 3WQBA 5FXWA 1LGBA 2HJIA 2BW8A 2R7EB 3ILRA 4HLTA 4L99A 4CCCA 4AVBA 1WCQA 3RZKA 2HYKA 3LPGA 3U11A 5FY1A 1DGRN 4Q29A 1W2NA 4WM7B 1VBE3 3HIFA 1CIWA 3NRUA 1AYM1 4QQHA 4AI2A 4YFZA 2GMMA 4DXZA 1CR7A 3I7DA 4JDMA 3M4FA 4CP9A 1R082 4IEVA 1H0BA 4BK4A 5B4NA 1YJKA 4WZCA 3MV11 4CDUA 3KCCA 4EWAA 1TVGA 3KGLA 5FYCA 2RS32 2Z5WA 4DZGA 1ND2B 4HN1A 1ODMA 1WCSA 4MGSA 2G1MA 3TOJA 3VHNA 5ISLA 4AQ6A 1W03A 5FBZA 2GNDA 4W65A 1F5JA 2W39A 1NY72 3GZEA 3UETA 4AQ2A 2N7GA 4LHLA 1OPOA 3WDVA 1VR3A 1K42A 2VJXA 5JWPA 4YZ3A 1QJX1 1C8NA 1AYN2 4Y22A 3B00A 3AMPA 3WNLA 1ZBA3 1UD1A 4OQ9A 2JKXA 5IFPA 2SBAA 3ES4A 2WKKA 3MIEA 4XFCA 4CVUA 4FSJA 4COUA 2RG4A 4YG3A 3PUAA 1I6XA 4QX8A 1LHNA 2A73B 4FOVA 2J1VA 1VBB1 1QJEA 3LDKA 5K0UB 2B46X 4D7YA 4FFHA 2ZTNA 1AF9A 3HNMA 1ZBE3 4OZXA 2J1TA 1LENA 3P1IA 3NKGA 2ARCA 3KT4A 1W06A 4AEDB 1AR82 2A3YA 4FBFA 4B7EA 2B5HA 2RJ2A 1S2EA 2C6SA 3K2OA 4JX0A 4Q4W1 4A3XA 4LBKA 5A3UA 4IE5A 4KWJA 4WVMA 1CPMA 2WAOA 3WDXA 4CCDA 5FXXA 4H7LA 2VQ0A 2RS11 5EJZB 5FLJA 3B9IA 4A4AA 2QUOA 4COYA 2PHLA 5CFCB 5CKMA 3SH3A 5CKNA 5JDBA 2H6BA 1K3IA 4K7JA 1XNAA 1DDLA 3GNEA 4DUVA 4K21A 4AZZA 5HI0A 3OY8A 4OVEA 4XQ4A 5FP3A 5C6CA 5IYYA 1UO9A 1OA4A 2BQPA 1O6UA 1JYVA 5ABJB 5DQ0A 3TB0A 2ORZA 4NHYA 1DU3D 4HONA 4YW1A 4AYUA 4Q4X2 5L7OC 4PF1A 2ZGMA 2V5DA 1IZ3A 2ZGRA 4CUBA 1D4M1 3NQHA 1T6BX 3ILFA 4XQDA 2JDUA 2ZX1A 1MZEA 2OS2A 5F5IA 1QOOA 1JI6A 4QDSA 4KL1A 5IK7A 3AMMA 1UY4A 1UOBA 2P34A 1SBFA 4LHKA 5KXDA 3AXEA 1GP6A 2D6PA 3I3QA 2JD4A 3OTFA 5IUQA 3ZSEA 2Q0AA 3A23A 2LRPA 4HOOA 4RFT0 3A0NA 3I8TA 1XSRA 3GBWA 2MEV3 2Q5TA 4GAZA 1S1AA 3RI8A 2XXZA 4AI8A 3IIIA 4GMP0 1LHWA 2NYYA 4Q0PA 5FZ4A 1QH6A 3SC7X 1NA1B 1A6CA 2C26A 2WSUA 1X9PA 4D94A 1RUC2 1ZRDA 3S5AA 3QD6A 1HQNA 3WCSA 2X05A 4EZ4A 4PI0A 1PK6B 3MW4A 5E6HA 1CAWB 1UXZA 4KBZA 1NLRA 4XAAA 3WEZA 1QQP2 3H3LA 3O1UA 4CXXA 1HQWA 1VRBA 3J8F2 3MV01 4LOSA 2XLFA 3D0SA 1DFQA 1MS8A 1OOPC 2GNTA 2XUEA 3VL8A 2PLV1 5FZOB 4IEZA 1MACA 2PYTA 3SHRA 1RUNA 3I2OA 1QJY1 4A42A 4AG4A 5FZ8A 2CTVA 5FZEA 1GBGA 4Q4Y2 4DIQA 3AKQA 2VTXJ 2VW0A 1Q8SA 4K3UA 4XPVA 2JX9A 2JDHA 1H1MA 3VKLA 3ZR6A 4XETA 4XUNA 4NRQA 1FT9A 1KFUL 1X50A 2XKPA 3SKVA 4BQ4A 4GD4A 1L7LA 1S0IA 1W9TA 1BYHA 1C1LA 3B69A 3RMYA 5FY7A 3ALQA 2JG8C 4YW3A 4HK8A 3JCIA 4XDOA 4GB33 4ZS2A 4HZFA 4Y26A 3FFQA 4QU2A 1V9U3 1DQ5A 3WDWA 2CWMA 1MEC3 4BQXA 1QJFA 1GZWB 2WO3A 4FPYA 3QH6A 3LGRA 4XDQA 2D5FA 5LEJA 2GSYA 2FCUA 4RHV2 3HJRA 3OD4A 1LHUA 2CAUA 4IV3C 2YBKA 3ZXJA 2ZGPA 4N7UA 1BLZA 2WO2A 1W6OA 4QMAA 4H2AA 5F3IA 4OHVA 4C1XA 5IVCA 3H3UA 4C91A 2RS52 5JZGC 3VBHB 5FOBB 2BWAA 1PGSA 2MHFA 1FNYA 1DYKA 4E27A 3BALA 2WBKA 2W68A 2FDIA 3OGSA 5FUIA 1M4WA 1JU3A 5EWSA 3NJZA 3NKTA 4JGYC 4N43C 1J83A 5LBFA 4COVA 1G9AA 3FUOA 1COV2 4PIYA 5GJ6A 3WNOA 1B35C 2I07B 4PIZA 3VBRC 4E4HA 2QQMA 3ZFGB 1QU0A 1XNKA 2MPFA 3PTYA 5C8CB 1JZ6A 1VBA1 4UWDA 3LA7A 2A7AA 4JTOA 1H1IA 1ONAA 2EICA 1QOTA 1V6OA 3WCRA 1TME3 4LNVA 1H8TA 4E9KA 1X7NA 2ZA9A 3MICA 4H7MA 3JZVA 4QQOA 3LIHA 4WVZA 3VZMA 1OH4A 1KITA 5T5OA 2YFUA 3Q8FA 1X82A 4PF5A 4ES9A 2XLGA 4CDQA 2AENA 3S5QA 2HWF1 2WS91 3USUA 4GA9A 4RQPC 2ZGLA 5FZHA 1RUG1 4AFCA 3GDBA 3I54A 4XUPA 3M1HA 4Q0SA 2VCBA 1Q8OA 2PHRA 2B9VA 2WN2A 4ISRA 3T30A 5KHKA 2BEOA 1Y9QA 4CU7A 4HKLA 5C70A 1W99A 4YG6A 4AI9A 1RMU2 3M3OA 1C57A 2J1RA 4FQZA 5FK8A 4BU2A 1HJFA 2GH8A 3QLQA 3PDQA 3OGRA 4FP2A 2W91A 2VE1A 4GWJA 5CIRA 3WQ1A 1JYWA 2YC4A 3ITQA 1PO21 4LBQB 3D8CA 1AX0A 3H0OA 5F6LB 1XSQA 3BN6A 1LR5A 4GJYA 3M70A 4G9SB 4B1MA 3LEIA 2VVFA 1RVF3 3LAGA 2E51A 3SNMA 4AGVA 2WT1A 1YFXA 4NIGA 5J98B 2YY1A 5JI9A 3I2GA 4RYDA 4MXVA 4DNYA 3OBRA 4YVWB 4EROA 1LGCA 3ZN4A 5J1XA 1U12A 1VP6A 2FCVA 4E8DA 3WHUA 2H6CA 1HKDA 2WINB 3PNAA 3RGBA 5FPUA 5IHRA 1GQHA 4LEJA 2VZTA 4I30A 1HXS1 4UW3A 3O1PA 4AQSA 4ZONA 3ME2A 2B9UA 2B45X 2DCZA 4E4SA 5IVBA 1OLQA 4Y5Z0 2VZRA 3I2FA 3C8XA 3NJYA 4FXGB 3HQRA 2PN5A 4P00B 5J3UA 5C3OA 1JOPA 2VCMA 2ZHKA 1BBT2 3ECQA 3MLJA 4UFLA 4AQTA 4ARYA 3J7NA 2VMFA 1KS5A 1TZOA 5FMOS 1GP4A 3BTXA 3VBUC 1QIQA 1Q8QA 1S55A 1SQ4A 4R9DA 2GN7A 2WZR2 5BXXA 1NY71 1RUE2 2DVBA 2VR4A 1US2A 2BFUL 3POGA 4R4XA 3VN4A 1DGRA 1R092 1CAVB 1CAXA 1DGWX 1UNBA 3GZUC 4GIQA 3JB4C 4XFIA 1FOD3 1DGLA 1UYZA 3BU7A 4GKXA 3CJIA 3MPPG 4AVVA 5H9QA 3N4MA 1NCQB 1YI7A 2Y34A 2NZ9A 4HANA 4FAGA 4N8MA 1LESA 4V2VA 3VB9A 4RGGA 2ZZQA 1V6IA 1CQ9A 1Q5OA 2XDVA 1FPN3 4CU9A 1SZBA 2UY8A 4IXLA 4ET7A 2Z4FA 5A3WA 2OIIA 2NN8A 3NNJA 1ND3B 3OBTA 4N90A 5KHHA 5BNOB 2Y64A 3T3YA 5L7OA 3IPVA 1AL23 4IGPA 1PVC2 3EO6A 1W8TA 3T1LA 1W3VA 1AR81 2RM21 1UYYA 1OHFA 5FYMA 3CNAA 4TLFA 5K4LA 1CIYA 3FE5A 5JXJA 2R062 3R05A 2A75A 2VNGA 2WSVA 3AJYA 5HPOA 4L11A 1GZ9A 5FPAA 1AR72 2HH9A 2YBSA 1SLAA 1IPJA 4FPGA 4BE3A 4L9BA 1S0JA 2DVGA 4HXCA 4RR3C 4XCAA 2OVUA 1LTEA 1RUI1 4LBJA 3FC0A 4KGGA 2WQ4A 3ZN6B 4CUAA 1ULGA 3E6DA 5FLHA 5H9SA 2QNKA 1DLCA 4ZS3A 4KG8A 1RHI2 5I8SA 5F37A 3R6SA 4FI9A 1RJ8A 4P9IA 5FDBA 3RZMA 1NAEA 1WKYA 3N3HA 1UKGA 3SH4A 3THPA 1UU6A 4BA6A 4YZ1A 3PTRB 1ASJ3 1XU2A 4YZ5A 2X8KA 3N9OA 5T5PA 2XBO3 4DUWA 1QMJA 1OSGA 3J4UH 3PU8A 4XIOA 4FCAA 4LTAA 1LOCA 4YM2A 1W9WA 1Y4WA 5A1LA 1W28A 5I0DA 1AX2A 3W58A 1OOPA 2XJVA 4MXWB 4CDWA 1CX1A 3RJRA 3SLIA 2XOMA 5IK5A 5CBLA 5LY2A 3GM8A 4XUOA 2V73A 5DUWA 5FY4A 1RUC1 5LK7B 3VBOB 5AFEA 1HRV1 2J1AA 4I3GA 4QX7A 1L7RA 4LO5B 4PT6A 4YZ2A 1AYM2 3LEKA 3ORJA 5L9VA 2FD8A 4LJHA 2P37A 3DV8A 2JIJA 3AM2A 1NCRB 5KR7A 2DFBA 2VZOA 2DVDA 2JG8A 1J3RA 2WZR3 4HMZA 1W39A 3UGHA 2QJVA 2WJSA 4L97A 2ZKLA 3T2OA 3VHOA 3OJBA 3BU0A 1RIRA 2R1DA 2PHTA 2Y6FA 5DPNA 1OMIA 2VMDA 1K12A 2VM9A 2R041 3DYMA 2O8QA 4M0HA 1YWKA 3UESA 5F39A 4URAA 5IK8A 2ZOEB 2OYZA 4Y1VA 3GHNA 4DRVA 1WLWA 1WW4A 3AZWA 4CA9A 4UBGA 3SCFA 4Q4Y1 1S0EA 2D3SA 2WNUC 1CX4A 3DEMA 3HPNA 5JOXA 2GH2A 2ZAAA 1H2MA 4RL7A 3AVSA 5DMYA 2GP5A 1ZRIA 4DPNA 1IG3A 2RR12 3DCQA 2F17A 2VBPA 2J7MA 4N53C 2ILMA 3D4KA 1VB4A 3GF6A 3ZXDA 4BB3A 4GH4A 3KVBA 5KXCA 1UL9A 2W1SA 2EAKA 3ZMNA 4LBOA 1US3A 3CMGA 2LALA 3PIGA 2Q4SA 1LU1A 3OB8A 4NUBA 4AOCA 3VD9A 5HCBA 3HBKA 3WV6A 3K75B 1OF4A 1QHDA 4N43A 2PQQA 3VKOA 3VD7A 1PNGA 4JRAA 1GICA 1S2BA 4NWVA 1B35A 3N7MA 2CGPA 3P6BA 3VBRA 3KB5A 4IEQA 3ZLIA 4QB6A 5BNPB 2DCJA 3DKWA 2W94A 4K6BA 5CEHA 3FBMA 2P2KA 4OI1A 4ASKA 4LXLA 4WM7C 2X5IC 2ZEXA 2QQVA 3T09A 4NPRA 2BV4A 4IV1B 4PLOA 4XHBA 4CXWA 1VAMA 4AVCA 3AC0A 3ELNA 5LBEA 5A1FA 3WNNA 4LHSA 5AC91 3CJXA 2HEVF 1OVSA 3FJSA 3NWKA 3ZYHA 1QF3A 3W9AA 2Q30A 1ND2C 2AGSA 1JOBA 2PFWA 4UYBA 5LZ6A 2TUNA 1LGNA 4DO0A 5IAVA 1COV1 3UNPA 3MIFA 5FZBA 2QQOA 2ZGKA 4CP0A 2FZ2A 2GMPA 1D4M2 2JB4A 2VMIA 3MDPA 4Y1XA 4LKSA 2I74A 1W0NA 4LPLA 2D3RA 4I2OA 4XF1A 4PLNA 1FAYA 2ZGUA 5FY5A 3OYWA 3TNQA 5AFBA 2YC0A 4JV4A 5FY8A 1S0DA 3C7GA 1NLQA 2Q8DA 3QBQA 4O65A 4AW7A 2WZPP 1MS5A 2QVSB 1SEFA 2HEWF 1V0AA 3UT0A 4B7KA 5LA1A 2WZ8A 2E32A 1JZ5A 2UU8A 2TNFA 2Y8KA 4U2AA 4MGKE 4P9WA 5EZWA 1RINA 2FQPA 1GWMA 2CGNA 5FYTA 5FYUA 5IVYA 1K5MB 5D21A 1UZVA 1F15A 2FCTA 4RA0A 3EB7A 1VBD3 3SEEA 3N35A 4M3CF 4CDXC 4IW3A 1RL3A 5A6YA 1FNZA 1LOEA 1PMJX 2JB8A 1KRIA 3T4HB 4B4RA 1LB2A 2FDFA 3VBSC 2W2IA 3IT8A 4CUCA 2IVIB 1J1TA 4XOGA 5D2AA 1EV12 5FTTC 3LKJA 1QH7A 2PLV2 3M8LA 4PJYA 3S57A 4CEYB 4LA2A 1GQPA 1PO11 4X8NA 5E88A 1QJX3 3LSEA 4MOAA 4LK7A 4XF9A 3MLLA 3UL2A 4XBLA 3VBUA 2OPWA 1GSLA 3NAPC 2ZS6B 1POV1 5ABJC 4XILA 1PHMA 2AC1A 2SLIA 2YXSA 4DOUA 2WN3A 4QHZA 1XNCA 3AKSA 2ZX0A 3VL9A 4Y20A
chains in the Genus database with same CATH topology
4P9XA 3S7EA 1H9PA 4KQ7A 1W6PB 4M3CA 1VBB3 3RQ0A 3LSDA 4YFWA 3ZXEA 3H7YA 3WY6A 1AJOA 2WNVC 3RSJA 2IXJA 1MVEA 1BBT1 1RC6A 2GC2A 3ZXKA 4BYYA 2EA7A 5I0RA 4Q4W3 2WLQA 2GALA 3VBFA 3ZFFB 4IEXA 2XVLA 1UIJA 5CFCC 4HBNA 1IOAA 3WX5A 4FVVA 4GMP3 1XQNA 4ASLA 3TBDA 2D93A 2DU1A 2RS13 1F9KA 1AR63 1R091 3I2DA 2K0GA 1BMV2 1NE6A 1WUVA 1EPZA 3AYCA 1H2KA 5SV8A 3H1YA 2D5HA 1PGL2 4IL7A 4EJRA 1POV0 4YLZA 2BPA2 3V0BB 4RR3A 3AXDA 4QQLA 4JGZA 5JOWA 4IEOA 3WLUA 1TMF2 1D4VB 4QPIC 4GULA 4RS5C 1ENSA 2ET1A 1KDMA 1DQ1A 5BNNA 3D82A 1H9WA 1BK1A 1PVC1 3AP6A 2A5ZA 3LCPA 3WP5A 4ITCA 3ZFEC 2R061 4M01A 1CESA 4MGIE 3TN93 2QE3A 3KS7A 3CL1A 1DQ0A 1O5UA 4KWKA 5HCAA 4Q8KA 2XH6A 5I0UA 2HWF2 4L2NA 3ASIA 4Q4V1 4MGZE 1F5FA 1RUG2 1RHI1 1WD3A 1BJQA 2PELA 4Q1PA 5GLTA 3WW4A 3AX4A 5E1RA 2DCTA 4NR1A 1ZYBA 3V0AB 5I93A 5C9AB 1UU4A 1SDWA 3BODA 1HX6A 4PDWC 3VKNA 4AVSA 5D8AC 5FREA 1VAKA 4JRLA 3Q9OA 1QJY3 3RYPA 1JUIA 2A70A 4I02A 4F3JA 4N7IA 3VZLA 5GALA 3T1MA 1JYCA 1WLDA 4B29A 2YZ4A 1WMEA 1UCXA 3HR9A 3O0WA 1VLNA 2GMEA 3N7JA 1HDKA 1LJ7A 4BM8A 5L73A 2NMOA 2DFCA 2EXKA 3FUQA 2WNUA 3UJOA 3ZFGC 2MNGA 4PLMA 1HXS2 3TAYA 5C8CC 1IS5A 2D6KA 2LUWA 2XB6C 3GBFA 4K9SA 4Q0QA 5GKAC 1JBCA 1RUH1 2PTMA 4N53A 4ISQA 1DZTA 4CDUB 1W6QB 2XWJB 4AHZA 1DBNA 1U5XA 3JD72 3URFA 1J1LA 4HL0A 2VG9A 2WFPA 2EXJA 4XFFA 3VDDC 3AKRA 2QDNA 4LBQD 5J09A 2FHRA 3K48A 2UWCA 2OUHA 2RE9A 4O9GA 5KWRA 1WMDA 4QPGC 2W08A 4TYSA 2Z69A 4LUMA 3D0JA 4QQ2A 1ENXA 3VZOA 2AUYA 2RR11 2X5IA 2D3PA 2UYAA 4YGEA 1KQRA 4FPFA 5GM0A 4X6RB 1XYOA 4FPLA 4FTBA 3V65A 1OFSA 3O12A 3M3IA 3PVBB 4BLJA 1VBA3 3GBGA 1Z78A 4E4DX 4XFAA 4FTSA 2PAKA 4XJZA 2AR6A 2PA7A 1JOJA 4UW6A 4YVWC 3KM5A 1QXJA 4S2FA 2CL2A 1V6NA 2RM22 1SMVA 4WVMB 4Z82A 3KLSA 3TYJA 3AP4A 4INDA 5EXOA 3DPRB 4OI2A 4JCKA 2HWF3 2WS93 4KWLA 4R52A 3E6CC 1UZZA 2UY9A 5AVAA 3FHIB 1RUG3 2K9ZA 1QWRA 2VNOA 1Q8VA 5DDJ2 2ENRA 3ST7A 5KBFA 3X29B 1RUI2 3AP7A 1JW6A 1X8MA 4Q0VA 4QGNA 5FO7B 3IKWA 1PO23 4MH0E 4XE9A 4LO6B 4A2UA 2IXIA 2IXHA 3ROUA 4BPZA 2XG3A 1RUD2 2V09A 4CDXA 2UWBA 1L3JA 3FBYA 1S0BA 1Q56A 1R1A2 2BYVE 2W52A 3EQEA 4I01A 3RPQA 5DZEA 3VBSA 1CD3G 1ZA4A 5BY5A 2B42B 5D1IA 1LOGA 2R30A 2XJPA 5FO8B 3INAA 1HXS3 3O14A 4LO7A 1SBEA 1ND3C 2UWAA 2ZGQA 3HQXA 3UKTA 4YW4A 4Y1UA 3NAPA 3ZXFA 1R083 2G9FA 4OUSA 4R9AA 4FT8A 1IGOA 4XXAA 3E5XA 1LOFC 1HRV2 4B3NA 5DZFA 2RS33 4K8FA 5GZEA 2BVBA 2A6WA 3VGIA 4Z2WA 2ETEA 1ULEA 2VECA 4AFMA 1X33A 1EV11 1QNYA 2YROA 4CEWA 2WNVA 2TEPA 3MIBA 3OCPA 2HWB1 4TSVA 2EXHA 2R042 3O0VA 2HWC2 2EVXA 3RJ2X 1D0GA 3CO2A 1AYN3 3E5QA 1CPNA 1U0AA 2OW4A 1I5ZA 4W6YA 3VKFC 2PHXA 4UW5A 2NMNA 4AHYA 1G6NA 4R4ZA 2DUOA 4PQ9A 1CAWA 4ORFA 2R0HA 4EWDA 1O5LA 5F6KA 2XWBB 1GYKA 3WG3A 4HN0A 4XMIA 1BQPA 2RM23 1AR83 4HKOA 1G9BA 4QPIA 4RS5A 3I4IA 1W6NA 3KCXA 1Y3TA 3ZXAC 1REDA 2XVGA 5C8WA 1D2QA 3WG4A 3N7LA 3ZFEA 1JXNA 1W6OB 4P5HA 1BMV1 5F9TA 2VMGA 5C33A 3AFKA 3RWNA 4AFDA 2H0VA 2PAEA 1PGL1 1UZYA 4Q4X3 1NCRC 1Z7S1 1O3SA 4AGGA 1RUF1 3GYDA 5AC92 1WW6A 4XTPA 5GZFA 1AR92 1TMF1 4ZU7A 3GHMA 1DZQA 2DV9A 2E53A 4LE3A 2I45A 2ZACA 4G3YC 4OHXA 1GZWA 4QHBA 1CAUA 3TNPB 1PM7A 1PVXA 3UJQA 1OLRA 2RMU2 4YM1A 3IDEA 1H8TB 4QGMA 1XU1A 3UKVA 3ZPYA 4LBLA 2OZJA 5FRAA 1AZDA 2JE9A 3JUUA 5EYYA 4JDNA 4PDWA 5D8AA 4QQPA 1Z0HA 5GLVA 4CDQB 1XYPA 2KXLA 3FWEA 3USUB 1AJKA 3AFGA 3WVJA 3KGZA 1RUC3 1HIXA 2IC1A 3HT1A 5EJ3A 1O4YA 1MS0A 1GNZA 1QQP3 4XF3A 1UKRA 3WW1A 3U10A 3ES1A 3J8F3 3OGJA 2C1FA 1AXYA 2C0ZA 1CJPA 3ZYJB 3H1MA 4LUKA 4NVPA 3EBRA 4QD2A 1XE8A 3IDBB 1C1FA 3CF6E 3UKNA 2Y26A 2R043 1A8MA 2DTYA 1JN2P 2GNBA 1LU2A 4IV1C 5FLIA 2QZ2A 3KQRA 1XNBA 3K51A 2JG9C 4MLOA 1TEIA 4Q4Y3 3ZSMA 1ZZ9A 1W0OA 1F31A 3VDDA 1PO12 3ZXLA 4BZ4A 2WA3A 2H0BA 4C0HA 4YVSC 3POYA 1O91A 1AXZA 1BVVA 2PHUA 1A8DA 5A3LA 2ZZJA 2Y0IA 2XJSA 4QPGA 3RYRA 2WFF2 5E89A 1U5YA 4Y1ZA 3S30A 1JHNA 2OA2A 2K2SA 3DUIA 4NO4A 4QX5A 1F8VA 2IFWA 3MIHA 3JD71 4RHV3 1SACA 4OHYA 2RJLA 4CZSA 1H2LA 4CYDA 1IS3A 3KMHA 2HWE2 2YGMA 1CAXB 4K1YA 4YVWA 4BMBA 3W59A 2X29A 2NM1A 3OF1A 2RS53 4AEJA 3CJIB 3A4UA 5HBAA 4DS0A 4WZFA 3SCHA 3WHTA 3IBMA 1LOBA 5I91A 5IT6A 4KNCA 4XHXA 3IMNA 1EYBA 1COV3 1KJLA 3AP9A 3L9JT 1BZWA 3N36A 2ZMKA 3PVEA 3MF6A 5FFOC 3WUCA 2QZ3A 2GDFA 2IXLA 5L7OB 3IPVB 1CONA 4CEYC 1REEA 1QJU2 2AZ5A 5F5QA 3THTA 4EN7B 3HBZA 1RUJ2 4YGDA 4YZ4A 1VBC2 4ASMB 4JDOA 2YMZA 2P17A 4MSVA 4LHNA 5IK4A 5T3NA 1RUOA 3MIDA 3LB9A 3IN9A 4IEYA 4M0NA 1YCIA 4NHMA 2ZGTA 4XW3A 3L2HA 1YFYA 5DDJ1 2R16A 4CP2A 4Z1VA 2BTVC 2JEMA 1LCLA 1RMU3 1FX5A 3C2UA 4R8HA 3WUDA 3MI8A 4Q4V2 3MZHA 4J6GA 1KXGA 1QJZA 5DXDA 3ZFFC 4A7YA 5I0TA 5EV7A 1MQTC 1U5IA 1MEC1 2Y0OA 3U07A 1LOFA 3B01A 1RUD1 3KSCA 4FPHA 5FO9B 4AE2A 1R1A1 4FP3A 4W6WA 4F8AA 1OOPB 4AWDA 2AYHA 2P3JA 2BFUS 3B9CA 1O4ZA 4CDWB 1POV3 4B4QA 4BQ1A 3LZZA 1LRHA 5CFDC 1PGW1 1C4RA 2DWRA 2P3IA 1IS4A 2DTWA 3JU9A 4RGAA 3S7IA 3P3PA 1WLTA 4XEZA 3NSTA 5GLUA 5T5JA 4DMIA 4DY5A 2NQYA 4XF0A 4BCUA 3PMEA 1HV1A 2F4PA 2XJQA 1BBT3 1RUH2 1S0GA 2JG8B 5A32A 4S2GA 4N9IA 4IETA 4D7TA 1NYWA 2ERFA 3APBA 1OQ1A 1RUE3 3G6JB 4LT5A 4HVQA 5F1RA 1R093 1ZZ6A 3B93A 4AI1A 4BH9A 4MXWA 2QFEA 3WR0A 4IEWA 2HWC1 4BMEA 2YYOA 3HN1A 3B3QE 3ZDSA 2JECA 3AP5A 2VXRA 3VHRA 1IHMA 3DF0A 3M3EA 4XJAA 3T2TA 5GZCA 5C4WC 4QPYA 4J1WA 5H9RA 2E7AA 1C5IA 2EAAA 1S0FA 4NOTA 2D97A 1A78A 1Y43B 4IV3A 1S2KA 4GH4B 3ENRA 1V00A 5JIAA 1ULFA 4FOYA 4BHPA 4XFBA 3WQ7A 1NXD1 1VRH1 2OUJA 2ZX3A 4WM8B 3WDUA 3ZX7A 5JZGA 1NCRA 1O4TA 1PVC3 3AZZA 5JLVA 4N43B 1AVBA 4Y4YA 3WP3A 5KC5A 1LKNA 2R063 1B35B 3PVOA 2Q8OA 4JGYA 3VBRB 1RVF1 4K1ZA 1ENQA 1MS9A 1AR73 3N7KA 2XHKA 5K9YA 1MS1A 3MFCA 1QY4A 4C0BA 1PIV2 2A71A 4UXAA 2DUQA 3ZSJA 1GFF2 1C5HA 1I3HA 5GZGA 4AK3A 4YGCA 4Q4V3 1MVQA 2CY6A 1C28A 1RHI3 3LOIA 3WP6A 1GV9A 4JQRA 2ZHNA 3B02A 4OI0A 1AR91 1T6GC 1YXWA 2HKXA 2DURA 4RQPA 3MPBA 3POWA 4DY3A 1SLTA 5A33A 1FMD2 4IEPA 1ZRFA 2EF6A 2RMU1 3R0RA 2R072 2XL9A 2IXCA 2Z42A 3LOBA 3OYWB 3LA3A 4AFBA 2E6VA 3AMNA 3NO8A 4QT6A 4EWEA 1UMZA 1YIPA 2GN3A 1FOD1 4LLFA 2JG9A 5DZGA 1S0CA 1YLLA 3CLPA 1N47A 4GWNA 2R32A 3S6PA 4FPCA 1JUHA 3VZKA 4YVSA 5K0UC 3LWCA 1AYM3 2XJUA 4DINB 5BYNA 4WV8A 3HMYA 4YG0A 1OFNA 2A6XA 1BEV1 3PHMA 3AK0A 4AEDC 1KFXL 1WGPA 3CU7A 3O7OA 2OZ6A 4HSLA 3H3ZA 1AL21 3DPRC 1SLLA 2UYBA 4IESA 2JXAA 4D3WA 1W6MA 1WBLA 1YYNA 2VUJA 3WG2A 1G7YA 1BVP1 2D6MA 5JPNB 2HWB2 2D98A 3RMXA 4HPKA 5EFUA 2DF7A 4YYOA 2RR13 4XFHA 2Q1MA 3OD0A 1OA3A 1C8M1 4NN0A 2VOKA 4DQAA 4OLLA 2WFF1 1LEDA 4XXPA 5JI7A 4Q26A 5LRRA 4M3CB 1N1VA 2O8OA 1FYUA 3AZVA 5DG2A 2XJRA 2VMHA 4CRQA 3HAGA 1EP0A 1ASJ1 3RZZA 1N1SA 3VBFB 2XBO1 4Q0UA 5BV6A 4WVVA 4ATFA 1HW5A 1EAH2 1X36A 5KHJA 3NV2A 2JKBA 2NP0A 2HWE1 1GNHA 5ACA2 1IKQA 1HRI2 2R1BA 4IERA 4MX3A 4I0WB 1NA1C 1Q8PA 2VNRA 5HCFA 2WWSA 2XVKA 1PK6C 5KXBA 1SFNA 1LODA 1NXMA 1MS4A 1E57A 1V70A 3QCWA 1GANA 1HV0A 1O3RA 1AX1A 3WDYA 4JGZB 3UK9A 4XIKA 3SITA 1VBE2 3NV3A 1Z7S2 3H9AA 1RUF2 3R4SA 4GKYA 1ZZ8A 1D4M3 3BOPA 4I0AA 1XYNA 5BNNB 1ZZ7A 3B94A 4XTMA 3ZYPA 3NVCA 1G9DA 1QJU1 3ZFFA 2PHWA 2A6VA 1RUJ1 3I59B 1MQTA 1VBC1 4AXOA 1PZ9A 5FQ0A 3FLTA 3ZYIB 2ARBA 3KCYA 4CP1A 2VUAA 4K40A 2KA3A 1VIWB 1PZ7A 2C5DA 4OULA 1ZBA2 1A3KA 5CFDA 4F7ZA 4NWWA 3VLBB 1SLCA 3RYKA 2W0XA 2FBEA 1XXNA 3AZYA 1LEMA 2FMDA 1EV13 1NQDA 3BCWA 3JBG1 4PBOA 1ZBE2 1OQDA 2PLV3 2ZX2A 3H50A 1IKPA 3AKTA 4AVTA 2VOXA 4BLIA 4AFAA 5DUVA 1YI9A 1SLIA 3VBHC 3MYXA 4EV0A 1BXHA 3AB0A 1EPWA 2YUEA 1DIWA 2WNUB 3FMGA 2E7TA 2IWGB 2A6ZA 1DQ4A 5C4WA 2VVDA 2WC2A 4KBBA 1H8TC 4XBNA 4N53B 1J58A 3U0ZA 4JC1A 2WIIB 4EN8B 2G9GA 1SCSA 2ZABA 2GAUA 3FFZA 4CDQC 5BNQA 5KHGA 3WW3A 2CWSA 1FXZA 4ONUA 3WW2A 4MVTA 5CAZA 1UN1A 4ATEA 2F6BA 3ZXGA 4H14A 3AYDA 4HVRA 3ZMOA 3C3VA 2VH9A 1QGLA 2X5IB 2MEV2 4Z8BA 1U5ZA 1Z7S3 4Y22B 1RUF3 2VY0A 4ZKTB 4WM7A 1TMF3 5FAXA 3JQWA 5FPXA 4P9GA 1URXA 1ZM1A 1VBD1 4YW2A 1W6QA 1LHVA 2HWD1 1LULA 4PCRA 5L19A 1TQ5A 4TWTA 2BBVA 2Z79A 1YFUA 4M3CE 3ATGA 2DVAA 3PJQA 3MEPA 1ND2A 2R0FA 3M3QA 4FPKA 2Z2SB 4KH9A 5GLZA 2DYCA 5J37A 5KC6A 1H4GA 3FLPA 4U36A 4Z07A 1PIV1 1O3QA 2JJ6A 3AJZA 2GNMA 4GQ7A 1H8VA 4EN9B 4FAHA 1ZRCA 1YO8A 2ARXA 3OY8B 3TWIA 5FOJB 1NLSA 4B4PA 3EHKA 4HFSA 4O9EA 2DUPA 1NE4A 2WT2A 4P14A 1YUDA 4SLIA 1SFYA 2B7YA 5K0UA 2CYFA 1FMD1 4GB32 2BUKA 3D5OA 2V5YA 4CDXB 1V9U2 5FCCA 4YGBA 1MEC2 2JDZA 2R071 4AEDA 4A7KA 3EJKA 3CJIC 4GMP1 3VBSB 3DPRA 2D7FA 1AR61 4RD7A 4E2QA 2R49A 1NCQC 1O3TA 4UW4A 3SMHA 5SV5A 1HLCA 3E5UA 1KJRA 2BNNA 4YM0A 2FMYA 3NAPB 4QXKA 1PGW2 1IPKA 2I2SA 5BNOC 3P3NA 1SBDA 4DFSA 5ABJA 5J7MA 4LBNA 2D43A 1WW5A 3V64A 1G8WA 3E6BA 3JD73 4WBBA 4K20A 3WOGA 1DZRA 1UAIA 2AREA 3BB6A 4WVWA 2ET7A 5CU1A 1NQJA 5FPZA 2WNVB 3VV1A 4CEWB 1ZVFA 1TME2 1N3QA 3TN91 3USSA 1QNWA 1BKZA 1AUYA 2DCKA 1ALYA 1YJLA 1JH5A 2EXIA 1ZRRA 4P9JA 4OHZA 5CFCA 1M06G 4YM3A 2HEYF 5CNAA 2QKDA 5JOZA 1NA1A 3H1WA 4S2HA 5CADA 3A0KA 1CGPA 1RTVA 1SCRA 1RJ7A 1UW8A 1MS3A 1PK6A 1GR3A 5AVPA 1RB8G 1FV3A 3ZO0B 1VRH2 4GXLA 1KS4A 4XMAA 2EIGA 4QPIB 4RS5B 4XQWA 1W6NB 4X6QB 4AF9A 1Y7BA 4CDWC 5T5LA 5J48A 1J3QA 3FZ3A 1JYIA 3PLQA 1EAH1 2XPJA 2GC3A 2WA4A 1RVF2 3ZFEB 1ULCA 5ACA1 4BIOA 5LEKA 1HRI1 5I8TA 4XBQA 5DDJ3 1QXRA 4I3PA 4YRDA 3VBOC 1RUI3 4V1PA 3VZNA 4AVAA 3FLRA 1O7FA 5J36A 1IS6A 1AHSA 1H30A 1VBE1 3O0XA 4XFGA 1MZ6A 3MGUA 4URTA 1V6KA 1REFA 3QOPA 1RUD3 2ZHLA 1CAUB 4QGLA 1DF0A 4AEMA 3WZ1A 4LO8A 4Q2FA 1R1A3 1LHOA 1JTZX 4COZA 3IDCB 2R6QA 2A6YA 3GZTB 4FXKB 1VAVA 1ZNPA 4PDWB 3IWZA 4KGQA 5D8AB 4BIFA 1VB2A 4GH4C 2XUMA 4HETA 4C1WA 1FOD2 4L8QA 3SCGA 4WM8C 5JSPA 3VBHA 1XNDA 1ZBA1 3E97A 5DUUA 1HRV3 2PAMA 2ZHMA 3H8UA 5DG1A 3RI9A 1LOAA 2VOVA 3WQ0A 3ZSKA 1V6MA 4MUVA 1FPN2 4COWA 2WT0A 1OQEA 4W6XA 1RITA 3KZ4C 1BEV2 4JVAA 2QDRA 3ZFGA 5BNPC 4M00A 5FMOL 2VPVA 2XL7A 1ZBE1 4PBPA 5C8CA 1AL22 3HWJA 3NV4A 2HWC3 5JVVA 1FI2A 3VDDB 1B09A 2RJKA 1OI6A 4HSJA 1QOSA 2ZKNA 3AKPA 3DL3A 4ES8A 2WQZC 4YARA 4YSFA 1TNRA 2D6LX 2E63A 3RS6A 4YNIA 4QPGB 5JSRA 3JB8A 2IFRA 1VRH3 1C8M2 4EN6B 3WG1A 1D0HA 3M2MA 3ZSLA 5T50A 4MGYE 4R9CA 3HD8B 5JPMB 2BVVA 4OUMA 4LBQA 4AHWA 2YDEA 1G9CA 2YHJA 1WA4A 1ASJ2 5J96B 4UBHA 2XBO2 4AHXA 3JQXA 4EN0A 1NOVA 2BNOA 3SXWA 1WBFA 4X8PA 3NV1A 2ZMNA 1CN1A 1QDCA 1WLCA 3CEWA 2WL1A 1K5MC 3NL1A 1DYPA 2MEV1 1ZZBA 4OI4A 5AC93 4HK9A 1R081 1AR93 2D40A 3AMHA 3MIGA 2ZX4A 1OA2A 1OPMA 2RS31 4S2DA 5CG8A 2BNMA 1WCKA 2RMU3 5T54A 3WP4A 3MLKA 4LR4A