2PAEA

Structure of a h49n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
136
structure length
136
Chain Sequence
MENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFNAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
total genus 29
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2paeA00
1CAXB 4AQ2A 1CAWA 2I45A 3KCCA 2QCSB 5I0UA 1RUNA 3E97A 2XKPA 1YFUA 2BNMA 5C8WA 2B9UA 4JV4A 5EFUA 2H6BA 4CYDA 1O3RA 1O3TA 5I93A 2UY8A 2IXKA 4HN1A 5FLJA 2C0ZA 5I0SA 4QMAA 3BCWA 1ZZBA 4IEYA 4QGMA 4XF3A 5FPXA 1OMIA 2EAAA 2GU9A 1RGSA 3WW1A 4LULA 4NVPA 4GULA 3GBFA 2OPKA 1H1MA 2VPVA 3E6BA 3M3IA 5J3UA 3CL1A 3RZZA 2IXLA 1X8MA 3LZZA 1CAVA 4LLOA 2GC0A 3D82A 4LUKA 3ROUA 4PJYA 5HI0A 3DV8A 5E1RA 4UBGA 3USSA 2MHFA 2PQQA 4KU7A 5KBFA 2BGCA 4Q0UA 4RD7A 3WW2A 2N7GA 2IXCA 4Q0SA 4ORFA 3EO6A 3S0MA 1WGPA 1SFNA 1YLLA 4XFHA 2WC2A 5I91A 2HKXA 3LA2A 4AVAA 4IESA 1V70A 1ZVFA 5FDBA 2B8MA 2V09A 1XE7A 4IEQA 3NSTA 1XRUA 3GYDA 4JVAA 5BPXA 5KHKA 2K9ZA 1GQHA 3NJZA 3ST7A 3I7DA 5FPZA 1O3QA 1UIKA 1QXJA 4QM9A 4MV2A 4N9HA 4D7TA 2XLAA 3ZDSA 3MDPA 1LRHA 1IPJA 2B5HA 1I5ZA 2IXJA 2Q30A 2OZJA 3H50A 5LEJA 2GH2A 4Z07A 1OI6A 1Q5OA 2EA7A 3KMHA 3O14A 3R6SA 2CAUA 3NVCA 4JTOA 4BHPA 5KHGA 4EWDA 1YWKA 4MGKE 1X8EA 4O9GA 5FQ0A 3KSCA 4QXKA 4OLLA 2PAMA 2PHDA 1VR3A 3FFQA 1ZZ9A 4P9GA 2QVSB 3RNSA 4E2QA 3HT2A 3SCGA 4AVBA 5EZWA 4XF4A 5CADA 1FT9A 5K8SA 1EP0A 5BXXA 2Y0OA 5JCTA 4OFGA 2OA2A 3D0SA 4DINB 2IC1A 4XFGA 1J59A 1CX4A 3E6CC 1O3SA 1IPKA 3HIFA 3SMHA 2Q4SA 3SCFA 4XFBA 1NZCA 1DZTA 5FLHA 2XGXA 1RC6A 3EQEA 4LA2A 3IDBB 2CV6A 3LWCA 1YUDA 3E6DA 4BH9A 5CU1A 1NE6A 1CAWB 1UW8A 2CGPA 4EV0A 4MZUA 1LR5A 4KWJA 1CAUA 4HLTA 1X82A 4HZFA 4E2SA 1GQGA 5JSPA 5JAXA 2IXHA 4UBHA 1DGWA 3NKTA 1FXZA 1U12A 3JZVA 4I02A 5I8YA 3IDCB 3L2HA 3N4MA 1XE8A 1NE4A 2MPFA 2K0GA 1VP6A 1UCXA 3I59A 4I09A 2PYTA 2ZCWA 3DKWA 4IEZA 5JR7B 3UKVA 4KL1A 4MUVA 3TNQA 4XEZA 3B02A 1VJ2A 3BALA 1CAXA 5AVPA 2D5FA 1UD1A 3OD0A 3H3ZA 3E5UA 3OTFA 4IEUA 4I3PA 3RPQA 4YSFA 2PAEA 4LTAA 1DZRA 5JSRA 3MPBA 1QWRA 4XETA 3E5QA 3S7EA 1OD5A 1ZRRA 4ZU4A 1ZZCA 3KGZA 1EY2A 2ATFA 3ES4A 4AQ6A 5KHJA 1QXRA 1WA4A 3FHIB 3FWEA 3MZHA 1Q43A 1TQ5A 1O7FA 4R52A 1RUOA 4QGNA 4E2GA 2Z69A 4IETA 3C3VA 5C6CA 3SCHA 3ACLA 2XL9A 3PLQA 3CF6E 4N9IA 1ZRCA 1EYBA 4XF1A 3WW4A 2FQPA 2KXLA 3M70A 1J58A 2E9QA 2UYBA 5LRSA 4IEXA 1J3QA 3CJXA 3VHRA 2DCTA 4IEOA 2D40A 3DL3A 1YFWA 3ETQA 4ZU5A 3MYXA 5FQ0B 1UPIA 5LRRA 2BNNA 3ES1A 2UY9A 3G7DA 5BY5A 4XFCA 1ZZ6A 4Q0QA 5E16A 1L3JA 4FAHA 4WZCA 1UIJA 2P17A 1O5LA 2PA7A 2PTMA 4Q0PA 1LB2A 2ETEA 3LAGA 3LOIA 1YFYA 4LUMA 5J7MA 4UXAA 4META 4XFIA 1Y9QA 5F1RA 1J3PA 2WFPA 3H7JA 1SQ4A 4KU8A 4HSLA 4IEWA 4Q0VA 5BUVA 4A2UA 5FLIA 1RL3A 1J1LA 1NYWA 2F4PA 3U10A 4EROA 3E5XA 3IBMA 3H9AA 1EPZA 3UKNA 2CAVA 3NL1A 2GZWA 4QM8A 5LEKA 1PMIA 1HW5A 4H7LA 2XKOA 5BV6A 4YYOA 5I8SA 4F8AA 1YHFA 2D5HA 3LA3A 3IIAA 4HVRA 4X6RB 5KHHA 3OCPA 5KHIA 2GAUA 1YFXA 4MH0E 2OYZA 4Z82A 4FBFA 3U0ZA 4AVCA 2D93A 4XFAA 3IWZA 3HT1A 1ZZ8A 5I0RA 1JUHA 1PM7A 3BU7A 5CVRA 2OZ6A 2O8QA 4PIYA 2ET7A 4IEPA 4HBNA 2QJVA 2MNGA 2ZKLA 2Q1ZB 1CAVB 2IXIA 3QOPA 4AXOA 1ZREA 4L2NA 1X7NA 4LA3A 2Q0AA 2XL7A 4HN0A 4L11A 4PIZA 2GC3A 1H1IA 4WBBA 2HJIA 4HMZA 4YNIA 4QX5A 3CLPA 2XLFA 3HQXA 4R8HA 3S7IA 4FT8A 4EWAA 4HVOA 2Z2SB 4MX3A 3H1YA 2PFWA 5I8TA 4I01A 5T3NA 4BIFA 2GC1A 3EBRA 3QACA 4K8FA 4MGZE 4Q29A 1ZNPA 3WW3A 3SHRA 3DN7A 4QGLA 3ELNA 4I0AA 4D7SA 2BEOA 4JTNA 3D0JA 1RTVA 1CGPA 3FJSA 1G6NA 4KWLA 3H1WA 4J1WA 4YARA 1O5UA 4IEVA 4YRDA 2VQAA 4LEJA 4EWEA 1FI2A 4B29A 1I6XA 3PNAA 2EVXA 2QDRA 2BNOA 2H0VA 5J48A 1ZRDA 2PAKA 1NXMA 4J1XA 1ZZ7A 4XFFA 2QNKA 3EHKA 4WVZA 3PVBB 3U11A 2UYAA 2XHKA 1LKNA 3FX3A 1SEFA 4O9EA 1O4TA 4HVQA 4ONUA 4BYYA 3I54A 4F7ZA 3SXWA 3H3UA 2GC2A 3RYPA 3FZ3A 3H8UA 1Q3EA 1WLTA 3H7YA 3RYRA 5JSOA 4HSJA 4MGYE 3UKTA 1ZX5A 3FE5A 4X6QB 2ET1A 4MGIE 5I0TA 1Y3TA 1CAUB 2O1QA 3NW4A 1DGRA 2FMYA 4I0BA 4XF0A 3CO2A 1QY4A 2VECA 3CEWA 3OGJA 1ZRFA 3BB6A 4TLFA 4ZU7A 4XF9A 3RDIA 3LA7A 3TNPB 3EJKA 3OF1A 1OFNA 2BYVE 4I2OA 3RYKA 4FAGA 2H6CA 4IERA 3I59B 2PHLA 3H1MA 3BPZA 3KGLA 4PIXA 1J3RA 5D1IA 2XLGA 4KWKA 5FCCA
chains in the Genus database with same CATH superfamily
1CAXB 3IAPA 4AQ2A 4A3ZA 3TN93 3AYAA 4OHYA 5HPOA 1EAH3 2J1RA 2WQ8A 5I0UA 3ZYFA 1WCDJ 4QKFA 1NG0A 3E97A 3OGGA 3ZMNA 4ZU7A 3W58A 3MF9A 5DUXA 2QE3A 2H6BA 5FZ9A 1ULPA 5FYSA 1O3TA 4DY5A 5C3RA 2CL2A 1JHNA 2LALA 1QF3A 4XC9A 4WVMB 2UY8A 5F3EA 4JKMA 1BHGA 5A7WA 4NHXA 3ZR5A 3V56A 4BLJA 3PHMA 1VB2A 4QKBA 1AR82 4N90A 5DPNA 4IEYA 1Q8VA 3MIDA 2Y8KA 1OMIA 2BERA 2ZKNA 3CQOA 4NPRA 1Q8SA 1RUD2 3GALA 2CNAA 4QQHA 4B3NA 4DRVA 5FZ1A 2OPWA 3WW1A 1QJU2 4LULA 4AI1A 3NQHA 2WL1A 4F3JA 1G7YA 1JBCA 2JB8A 4GULA 1Z7S1 2VVEA 1K5MB 4B1LA 3VZJA 4CCEA 1DG6A 3ZFEA 3CL1A 3SISA 3W21A 1W8NA 3LZZA 3AVSA 4CU8A 4LLOA 1W2NA 3H3LA 4I3GA 1VBC3 1VRH2 4NAMA 3ROUA 5SV5A 1IS3A 3UESA 2RM23 4Y5TA 3GJAA 5HI0A 2ZMNA 4DXRA 4OYUA 5E1RA 4UBGA 5J1XA 3USSA 3T0AA 2MHFA 1MVQA 4GAZA 2BGCA 4M3CA 4Q0UA 4MHUA 4A6OA 5F5CA 3N9OA 1RMU1 4Q0SA 2MEV3 2AGSA 3KZ4C 4ORFA 2BRTA 3PVOA 1WGPA 4ASKA 3MI8A 2CU5A 4YW2A 5FZEA 5FY0A 3LA2A 5LY1A 3DPRC 1V70A 1W8TA 5FDBA 4A4AA 1YJKA 1UZWA 1XE7A 5GLVA 5IVCA 2PHTA 3VZMA 2TNFA 1RJ7A 1RUF3 4LOSA 1MQTA 2GP3A 3W9AA 5GZFA 5JI7A 2R32A 1YQ8A 4M00A 5C5UA 3I7DA 5FPZA 5A7QA 1WMXA 1R1ZA 2ZTNA 3VKOA 1DLCA 4KI5M 4QM9A 2B7YA 3JQWA 4P9YA 2RS32 1TME3 1BEV3 3RVHA 2PHXA 2A6WA 4MV2A 4N9HA 2XLAA 4M4RA 2PLV2 3ENRA 4YW5A 5A70A 1R083 5HCFA 1QDOA 1LRHA 3MDPA 1YI7A 1S0JA 2Q8CA 1NA1B 2FD8A 2GP5A 5IVFA 2LROA 3PUHA 3ZXAC 5CZKA 2GH2A 4GA9A 4Z07A 5ABJC 1K42A 1AYM3 5F6KA 3O14A 2CAUA 4CDQA 5JR2A 4OHXA 3TYJA 5A6YA 4BHPA 4AGVA 1WW4A 4KWUA 1RITA 1X8EA 3N7MA 4O9GA 5BNPB 4B7EA 2X5IB 5FQ0A 4QXKA 1IKPA 2QQVA 1EAH2 2JX9A 1VR3A 3FFQA 2BVBA 1VBE2 2QVSB 2W91A 3HT2A 4LT5A 5CKQA 2P2KA 2QTWB 3MFAA 2GH8A 4AVBA 5ABJA 3ZR6A 2BTVC 2I07B 5C8CB 2E26A 4AI9A 1GZCA 2P6HA 4NROA 4Q4W1 1CJDA 1EP0A 5FAXA 2Y0OA 3K51A 3KD4A 2R7EB 4QPIB 2WFF2 1B35A 1AR63 3CU7A 4HFSA 1D2QA 4LOTA 3B69A 4Z92B 4CZSA 1LODA 2IC1A 2UURA 2PELA 2VZRA 1OLQA 4XFGA 5GM0A 3HIFA 4AQTA 1HQWA 1UYYA 2Q4SA 3SCFA 4AVTA 4CDUC 2HEYF 3AJZA 3Q8EA 5LATA 3VN4A 3W20A 2P5BA 1AL0G 5FPUA 4EQVA 2WLPA 4DUVA 1W6MB 2B4KA 3IDBB 4XE9A 1YUDA 3TAYA 4NIGA 4EN7B 2GMMA 3ALQA 1DDLA 2E63A 1W9SA 3ZN4A 1VBC2 3HMYA 3LSDA 1DQ6A 3WSOA 5FR3A 5LK7B 2RM22 5C3PA 2RS52 4ES8A 4AEDA 4M0HA 1H2KA 1KFXL 1JOJA 1LTEA 1UU5A 1WCUA 3AMQA 4DNYA 1GR3A 2IXHA 5I0DA 3J7MA 1KQRA 1S2BA 3AVRA 3EYPA 5DUVA 1MEC2 1UNBA 2WQ4A 4LKSA 5L7OC 4AK3A 3N4MA 2FHRA 1WBLA 1PO11 1CD3G 1QXPA 2J1UA 3VB9A 1NE4A 3JU9A 4CPBD 5ANQA 1VP6A 1W0OA 5EP9A 3DEMA 3MO4A 5EIYB 1CJPA 2JE8A 2VZTA 4E4SA 3JBG1 1RUF2 2A6YA 3ZDVA 2RR12 1TG7A 2ZCWA 3HR9A 3FLTA 3ON7A 4PCRA 2W9XA 4HPKB 3TNQA 2WNUB 3H8XA 3B02A 4J25A 4AQSA 5FMBA 3LCPA 3N9PA 4FFGA 2XBO3 3MF6A 3BALA 1FAYA 1GOHA 1UXZA 2D5FA 3V64A 4RR3A 2W1QA 5LA1A 1G9BA 4FFFA 5FUPA 5KC5A 4UW3A 4LR4A 2ZZJA 4LTAA 1MS3A 2ZGSA 1OA4A 1U5IA 2I74A 1FPN3 4KGGA 3ZN6A 4XETA 3DF0A 1NLQA 3E5QA 3S7EA 5JDBA 4CP0A 4P9IA 1SMVA 1AYM2 3POEA 4QX2A 3MEPA 3I3MA 2Z42A 2DUPA 2I2SA 4AI2A 5CKMA 1PGL2 5GLUA 2ATFA 3ES4A 2RMU1 4B4QA 2HYKA 1OOPC 1QXRA 1LECA 1WA4A 2R30A 4RN5A 2OX0A 4LKFA 4Y4YA 5HCHA 1F31A 3A21A 3NMBA 4CEWC 4DUXA 4KBZA 3PMSA 2HWB3 1B09A 4Q4Y1 1JI6A 1D0HA 3BGAA 3L2YA 1F4HA 2ARAA 3WR0A 3KCYA 3ETPA 5AC91 1PGSA 1H6XA 2IFRA 4OI1A 1FOD1 1PK6B 1KFUL 1IOAA 3ACLA 4Q4X2 1UWWA 3B9CA 5GLTA 4A42A 4N9IA 5F2SA 1UY4A 1DZQA 5F3GA 5IW0A 1ZRCA 3BIEA 1RUI1 1QOTA 1OOPA 1X50A 2KXLA 4WM8C 3HQUA 2R49A 5LRSA 3DUIA 4XJUA 5JIUA 2JG9A 1C3HA 3LQCA 3QD6A 1XXNA 2DVFA 3IMNA 4COUA 4DY3A 4YVWA 5T5LA 5A6ZA 3MYXA 1G9CA 2Y33A 1KJRA 2YU2A 2DVBA 1UPIA 2CDPA 2VC9A 5LRRA 1POV1 4L9BA 2WO3A 5FUIA 2OQ6A 4N7UA 5IVEA 1AL23 3RG0A 1W6NA 3OPTA 2ADDA 3HN3A 4DIQA 4GIQA 4D94A 4BQYA 4CDXC 1MZFA 4XFCA 4Z8BA 1ZZ6A 2JEMA 2YUEA 3KV4A 3S6PA 3GHMA 5DAVA 1SFPA 2ZHNA 1LGCA 2P17A 3VD9A 4FFHA 5BYNA 3TEWA 3ABZA 1V6KA 2IUWA 5A7PA 3AC0A 3LDBA 4ASLA 1ASJ3 4Q0PA 3MFCA 4MO3M 4XTMA 3OSDA 3BTXA 1RVF2 2VY0A 1O4YA 1YFYA 5GZDA 3P6BA 1DF0A 4FPYA 4QPGB 1W04A 3QH6A 5LASA 1IGOA 2EXKA 4CDWB 2UWAA 4C90A 5CAZA 1H9PA 3R4UA 3AZWA 4E4HA 1Y9QA 3AKTA 1J3PA 1OPOA 5FYTA 4NHLA 4DS0A 2WFPA 4YVSC 2A5ZA 4K7JA 1R091 1VE0A 1XNDA 4GH4A 1MR5A 2Q5TA 4QXHA 4Q0VA 3WP4A 3JCIA 5BUVA 1YO8A 1L7LA 1RUE1 2HWD3 4QPYA 3WCRA 1CZVA 5FY8A 3AYDA 1FPN2 1J1LA 5FMOL 5FY1A 5IATA 3U10A 5J96B 1H2LA 5FRAA 3E5XA 1QJX3 4BQ1A 4QD2A 4KG8A 2VL4A 1VMJA 3KHCA 2GZWA 2R0HA 1KDMA 3FBMA 2W2IA 1PMIA 1RUH3 1W0NA 4MGSA 4Y22A 3NAPC 4YVSA 3VZOA 4RS5C 3OUIA 1O59A 4BE3A 2VCMA 3VLBB 3LA3A 4IV1A 3VD4A 2YB7A 1AF9A 4HVRA 2K46A 1ZBA1 2Q8EA 2WIIB 2QQIA 2VMDA 4W6WA 5KHIA 3URFA 1W8OA 2GAUA 3A7QA 4S2DA 5CEHA 5FWJA 4FFIA 3O1TA 1H9WA 3V65A 1JYWA 4Q4V3 1SFYA 4AVCA 4LE3A 3VBHA 3C7FA 3IWZA 1GZWB 3OEAA 5EJ3A 1BBT1 1PM7A 3RZJA 2E7AA 2G19A 4PIYA 3NAPA 5A3PA 5FZOA 1PVXA 1Y4WA 2ADEA 2MNGA 2ZKLA 3LEMA 2Q1ZB 3JD71 2VZVA 3BIWE 4HK9A 1PVC3 5FKBA 2ZGTA 5FWEA 2IXIA 3JB4C 4P5YA 1V9U1 4BQ2A 5KWRA 2A6ZA 1GICA 3ILNA 4BB3A 1A8DA 1C8M1 1ULOA 3LEGA 4PLOA 2R063 2NYYA 4BA6A 4Y5SA 1MS0A 1F8VA 5LA9A 5D8AA 4QKDA 2ZA9A 4ZHNA 4YZ1A 4W50A 3WLUA 4DQAA 3A4UA 1OUXA 3KV5A 4PI2A 4CXXA 3O1UA 5AFBA 1NQDA 2Q0AA 2DU0A 5LB6A 2XL7A 1AL22 3F2ZA 2ES3A 2HEWF 4K1YA 4NE9A 4L11A 1XNAA 4PIZA 1DGLA 2ZX4A 4CCOA 3NNFA 3VDDA 2HJIA 3T3YA 3WF0A 4HMZA 4YNIA 2EF6A 4EWAA 5IVJA 4QXBA 5FK8A 2E31A 1H8TB 3MW2A 5DN2A 3MLKA 2R6QA 3SQOA 4AEKA 4DFSA 1S0GA 2OT7A 4I01A 5I8TA 2PHWA 2ZX3A 4RHV3 3EBRA 3QACA 2DWRA 4A7YA 2VW1A 1ZNPA 1AX2A 4OI2A 3WW3A 1ZRIA 3ZFFC 3SHRA 2OKXA 1D4VB 1HB4A 4QGLA 4LO8A 4Y3OA 1YYNA 3IMMA 1RTVA 4CXWA 4FTEA 2YG0A 2WT0A 4S2GA 3H1WA 4J1WA 3ACHA 2VCAA 3V0BA 1W2OA 4AHYA 4LEJA 2HWD2 4EWEA 1COV3 5A7NA 1FI2A 5EQUA 5FOJB 2BFUS 2WA4A 4MXWB 1VBB3 3P3NA 4GXLA 2Z4FA 2ARCA 1KXGA 4LNVA 1H4HA 2H0VA 4OZOA 3ZFFA 2YGMA 2DBNA 1RUH2 3GCWA 4GKXA 5ANNA 4YW4A 5FZHA 2QNKA 4F83A 3EHKA 5CG8A 3U11A 1NCRC 3ILFA 3KS7A 2UYAA 3TB0A 5IFPA 1QU0A 3SITA 1WW7A 4HVQA 5IWFA 4ZS2A 3I54A 4Y1UA 3GCXA 1FV3A 3MICA 5CFDC 4GQ7A 1FNYA 5JMOA 4YZ4A 1IS5A 5LBFA 3RYPA 3H8OA 4YGDA 1C4RA 2OVUA 2YBPA 3FZ3A 1LJ7A 3HAGA 3ZOIA 4CCNA 1W3XA 3I3EA 5JSOA 4OQ8A 2OS2A 4HETA 3BTZA 3UKTA 2XJSA 5JZGB 3AYEA 1GBGA 1QQP3 4X6QB 2WNEA 1PVC2 1NCRA 1V6NA 3LIGA 4TTGA 1W90A 3W5NA 4BMBA 2DVGA 3KM5A 5A33A 4FSJA 2VUJA 5FZ3A 4WVVA 2CYFA 1PO12 4I0BA 4YPJA 1YNAA 1LCLA 1V6LA 1TZOA 1WW6A 5FZKA 3TN91 4AFAA 1EAH1 3OGJA 4I30A 4A45A 2WNVC 3RJRA 2BOJA 1PHMA 2A6VA 3WQ0A 3LA7A 4HOOA 3APBA 4Y20A 3TNPB 3RS6A 5C71A 1JTZX 1VIWB 3GHNA 4A7ZA 4XBQA 5JXHA 3I2DA 2H6CA 1JZ7A 1JU3A 2DBIA 1JYCA 3PUSA 5BNQA 4PF5A 1KGYA 2W95A 3LPFA 4BISA 4C0BA 3ZYPA 3CJIA 1R1A3 1W0PA 1ENQA 2AH2A 1NLSA 4XBLA 2E6VA 1VBA3 2DCZA 3K46A 4XJWA 1R64A 2I45A 5FY4A 1EPWA 3MLLA 1GQPA 1GKBA 1GNYA 2Y6FA 2VW2A 3Q8AA 5LBBA 3RMYA 1LENA 1LEDA 4FXGB 2ZGUA 4AGGA 3VBRC 3WV6A 5C8WA 4NOTA 5EFUA 2OXBA 1O3RA 2VQTA 2NM1A 3OPZA 1VBC1 5A3UA 4N53C 3N7KA 1UKGA 2RM21 3BTAA 4LBQB 4XABA 4HN1A 3ZFGB 1UMZA 5AC92 1W6QB 5FLJA 2YFUA 4E8CA 5CFCC 5I0SA 5FZDA 3O1RA 1WZXA 1ZZBA 4N43A 4BIOA 2YDEA 3PIJA 5FPXA 1SLAA 5JOYA 2EAAA 1VBB2 4N7IA 1HX6A 2GU9A 1CN1A 2BDRA 4TLGA 1MS9A 2XXZA 4BM8A 5FV3A 4NVPA 5FBJA 2G9GA 4IGQA 3GBFA 4MOAA 2VPVA 2QQUA 3E6BA 4FCAA 1H0BA 3M3IA 3RRDA 4RQPA 1RXGA 4N53A 1RUF1 1IHMA 4DEQA 4JX0A 4LUKA 4PJYA 1L7QA 5DZGA 4K9SA 3UETA 4B4PA 3DV8A 5JI9A 1BQPA 5CFCA 2W1WA 2JENA 4QB1A 4B8EA 3WXPA 3AL5A 5DZEA 2TEPA 2N7GA 3UT0A 1GZ9A 5FZLA 1TME1 1BEV1 2RJLA 4CRQA 3DECA 2EAKA 3LOBA 1R081 3NNLA 1DP0A 1YLLA 4LHLA 4XFHA 1XQNA 2WC2A 3LDKA 5I91A 2HKXA 3NJVA 4AVAA 4PDWC 4CP9B 4IESA 5BNOB 1JZ3A 5C4WC 4WM7B 5FKCA 1YC61 1AYM1 1OH3A 1BJQA 2YC2A 2VULA 3KHBA 5K0UA 3U37A 3USUB 3FUQA 4HG6B 4ARYA 4NHYA 4D6RA 5CG9A 3GYDA 1O6UA 2WAOA 2YC0A 2K9ZA 5KHKA 3HBKA 5F8PA 5BNNC 1E5HA 1AJKA 1XOYA 1O3QA 1UIKA 1ENXA 1QXJA 1W9FA 1WLCA 2IVIB 2RDSA 3OPWA 1OC1A 3NRUA 2EICA 3X29B 1CONA 5DG2A 2DCKA 5FZCA 2XQXA 3ZDSA 4LHKA 3ZXGA 5M0TA 1SHWB 1C1LA 1QJY3 1W99A 4XURA 4CEYC 3W5MA 2P34A 3HEIA 4KGQA 4PDWA 2ZACA 4XCBA 4JGZC 2Y38A 5A32B 1U5YA 2F6BA 1R092 1NCQB 1DQ4A 2IWGB 1Q5OA 2EA7A 2ERFA 1UKRA 3BODA 3KMHA 5A7SA 4D0QA 4ZZ5A 1AR61 1PM4A 3FBYA 1I1EA 1KD7A 3RSJA 4Y24A 1YWKA 2C9KA 4IV3C 3UV9A 2C1FA 4CXYA 2AENA 2ENRA 5FYCA 1AJOA 1LOBA 1UU6A 4OLLA 3WUDA 2PAMA 4QXCA 5GZGA 1AX1A 2KM2A 5KXCA 1PIV3 5LA0A 2K2SA 1H8VA 1ZZ9A 3CNAA 4P9GA 4CEYA 1TEIA 5J09A 3MV11 4LK6A 3VBFA 1JYXA 3M3CA 5JXJA 3M7AA 5J37A 4A6SA 2QUOA 4COWA 4EZ4A 1XYOA 4Q5OA 1ZBA2 1GP5A 3MBWA 3ZYRA 3LSEA 3QLQA 1GV9A 2J7MA 2O8OA 1ND3B 3ACGA 4AEMA 1CPMA 2W08A 2OA2A 1M06G 1UMHA 3AXEA 3WT3A 4DINB 1V6OA 4P00B 4QDSA 4Q1RA 3E6CC 5F3IA 1O3SA 1G9FA 2BPA2 1NZCA 4JRAA 3WP3A 1FMD3 4BDVB 2QQJA 3VBOA 4D6QA 4PLMA 2P3IA 4AG4A 3HD8B 4JGYB 3VD3A 3LWCA 5CA6A 1RVF1 5CBLA 1UZ0A 4NMIA 5CU1A 2JDYA 5IK8A 2BBVA 1UW8A 3I3QA 3J8F3 1MS5A 2ZXQA 3T2PA 4EV0A 4MZUA 2HWC3 2UU8A 4KWJA 4XAAA 1X82A 4R9BA 4NRPA 4IXLA 4ITCA 5SV8A 3BI3A 1PX3A 1XB9A 3NKTA 2FCUA 3NNJA 4YZ5A 5I8YA 3IDCB 3ZFEC 1FPN1 1POQA 2W94A 3EXUA 3QCWA 5C3SA 2MPFA 4AAXA 3UK9A 1W6OA 2DTWA 3KB5A 3KT4A 4JZRA 1PNFA 5A1LA 3OEBA 3I59A 5EHDA 1W05A 1YQ5A 2PYTA 4X8NA 4IEZA 1WD3A 1H1AA 5JVVA 3T0DA 3NV4A 4KL1A 5DG1A 2OW4A 4Y1VA 3PUAA 5L9VA 4IE6A 2ZEXA 2WINB 1S0BA 3SC7X 2HWB1 1CAXA 1O8SA 2VBBA 1UD1A 4LBLA 3FHAA 4CCKA 4BXFA 4YSFA 4I3PA 3AXDA 4UFHA 3U75A 5FYIA 3PURA 2VZPA 3MUZ1 2V5DA 4OHVA 3K4DA 1S0FA 2WS93 3JUUA 3TEYA 1I9RA 1MQTC 4ET7A 3BU0A 3K4AA 1BLZA 4K40A 1OD5A 4Z2AA 3GNEA 3PIGA 4FOYA 3VBUC 1ODNA 1ZZCA 3KGZA 4WVMA 4CTEA 3H42B 3I2IA 4A7KA 1ENRA 1TMF3 1BK1A 2JXAA 2WYFA 3B7MA 2WO2A 5HCBA 1SZBA 4Q8KA 1WD4A 3HJRA 4OI4A 4YM3A 3KV6A 3WNXA 1UXXX 5FYMA 1XE0A 2ZX0A 2J1SA 3D8CA 3WHTA 1UOGA 2Z69A 4CE8A 4O65A 1OLRA 4DEVA 5F37A 1CQ9A 1K5MA 2XL9A 3VKFC 4TXWA 1K3IA 1AL21 4G3YC 1U5XA 3VBUA 4CDQC 2HBTA 2WA3A 3OGRA 1EYBA 1MS1A 4MVTA 2Z5WA 3DPRB 4LO7A 3OBTA 1HQNA 5T5PA 5ACA3 3I8TA 4FOQA 3VHRA 5JUVA 2DCTA 4IEOA 4A3XA 3DL3A 1ASJ1 5JOZA 4IE7A 3ETQA 4HK8A 3ZYBA 1RHI3 2BOIA 3HQRA 3I2HA 1BMV2 3ZLIA 5FQ0B 3A23A 4RL7A 2BNNA 4OI0A 1B35C 4XDOA 2F17A 3HNYM 4XMIA 3ES1A 3B94A 2UY9A 3VD5A 5KR7A 3TWIA 1S0DA 5FY7A 5IK7A 5T50A 1VRBA 3TN92 2ZS6B 2E32A 5DABA 1WLWA 2QZ2A 2QQPA 5ABJB 3IAQA 1L3JA 5E16A 4WZCA 5BNPC 1HB3A 1NAEA 1Z78A 2HWD1 1O5LA 3K3NA 1WMEA 2PTMA 1LB2A 1NA1A 1YXWA 2AUYA 4IE5A 5FMCA 4OHZA 1TNRA 2W1UA 1QJX1 3U14A 3KLSA 4FOVA 4AI0A 3ZSLA 4UXAA 1UYPA 4M01A 2XJVA 4XUOA 1W9WA 2VUDA 1RUH1 3SH4A 4AEDC 1NXD1 1VAVA 1SACA 4NIIA 3V0AB 3H7JA 1CPNA 5IK4A 1LAJA 3GZTB 4AI8A 5IAVA 1Q8PA 4KU8A 1JZ8A 3E1F1 1EUTA 4GMP3 3T09A 2JDMA 2AREA 4B7KA 5BNPA 2X5IA 2JE9A 5H9PA 4QWNA 1YI9A 4D6SA 4H14A 2R043 2DU1A 4Q4V1 1RL3A 3WQ7A 2VOVA 1HB1A 3MHZA 3POJA 1MS4A 2LS6A 4CDUB 1Y9GA 4G4FA 2UWCA 1EPZA 3H9AA 3MIEA 5C8CA 2CAVA 1D4M3 4CU6A 1UOFA 2W46A 1LOFA 5JPNB 1HW5A 2VD7A 4AVSA 5BV6A 4YYOA 1OSGA 3M3QA 2Y6JA 5DAWA 2EXHA 2MEV2 3S5QA 2D5HA 1PVC1 1TMF2 4UAPA 4RR3C 4XZPA 3IIAA 4QX3A 2D6LX 3U78A 1TE1B 3AKQA 4GZ9A 2Y6LA 3OCPA 3PU3A 4W6YA 4Y1ZA 1HB2A 4PQQA 2V4AA 3HNBM 5IJRA 3J9SA 1QHDA 4XTPA 1FNZA 1VAMA 1W6MA 1HQLA 1PZ8A 4KMQA 4AWDA 1YJLA 4XXAA 1ZZ8A 4COYA 5I0RA 5FP4A 4INDA 4GWMA 1AXZA 3BU7A 3VV1A 2UWBA 1IQDC 1Y43B 2ET7A 5L7OB 1FATA 1LOGA 3T2TA 1NOVA 2E7QA 2X10A 1TME2 1BEV2 1CAVB 2VZ1A 2YMZA 4LKDA 5G04L 2VCBA 4BPZA 3DXTA 2BW8A 1R082 3T2OA 1RUG3 3WEZA 1QNWA 2RS13 1KRIA 4L2NA 2C9AA 1QDCA 4JRLA 4PBOA 5EV7A 5FZ7A 3WDXA 5GZCA 4TZDA 1W8WA 2VOWA 4RHV1 1RHI2 4P14A 4TYSA 2XJTA 2HWE3 1W2UA 5T52A 1BVP1 2PQSA 1J83A 2YY1A 3IN9A 5JIAA 2Y64A 4YGCA 3AL6A 3ITQA 4HN0A 5B4NA 3H8RA 2WZPP 2A1XA 2LM3A 4HPKA 1HV0A 2JG9C 4WBBA 4YM0A 5IT6A 1Y9MA 1NQJA 2WRAA 1DGWX 3HQXA 4O61A 2CTVA 4R8HA 2XJQA 3O0XA 3OJBA 1V6MA 3OY8B 4HVOA 4MX3A 4YVWC 5EJ1B 2PFWA 1COV1 3N35A 3U4SA 2A6XA 3K4ZA 1OOPB 2D3SA 2XUEA 5F3CA 1VBB1 1GP4A 1NY72 1WA6X 4CEWB 5C33A 1HXS3 2PHFA 1AR62 5FYBA 5FYVA 1YRZA 2WZEA 3IPVB 3DN7A 4MSVA 4LITA 4HT1T 4DUWA 3ELNA 4I0AA 2BEOA 5CISA 1KS4A 1ZBE3 4XVHA 3ACFA 1CGPA 1BZWA 1Z7S3 4NWVA 1G6NA 2DTYA 4K3UA 1N3OA 4MGTA 1NUKA 4XIOA 4IEVA 2VMIA 5JPMB 4YRDA 1VAKA 3NV2A 3AP4A 1W6NB 3GBGA 4WM8B 2AYHA 3RI8A 2XPJA 4B29A 4YG0A 3ZSEA 4D7YA 2EIBA 2EVXA 4TSVA 1SLTA 1W03A 5T5OA 3I3BA 4P9XA 2RDNA 3LFMA 3VZLA 3B9IA 1ND2B 3NJYA 1NXMA 4J1XA 2CDOA 1TVGA 1DQ2A 4GH4C 3INAA 4YZ3A 4WVZA 1TNFA 1S2KA 2RDRA 4FP2A 4YGEA 1LKNA 1Q56A 3ZMOA 2JG8B 1BVVA 1QNYA 3FFZA 1O4TA 4BYYA 3T08A 4F7ZA 3SXWA 3POYA 4CDXB 2EXJA 2VE1A 2VNOA 2XVKA 4DMIA 5JOWA 1GYKA 2VMEA 5ERLA 3WHUA 2RV9A 2VVDA 4AEJA 3RZLA 2V72A 1UAIA 3RWKX 3AFKA 1Q3EA 1WLTA 3FL7A 2W68A 3H7YA 3H8UA 4U2AA 3P1IA 1W39A 2JD9A 3RYRA 2VMHA 2XBO2 4IV1C 2ZGPA 2ZZQA 3CZUA 3FE5A 2JDPA 1YIPA 2D43A 4UI9L 5FYHA 2VM9A 4RGKA 1W9TA 5A3TA 2FDFA 2QQOA 4SBVA 5I0TA 1Y3TA 1REDA 1CAUB 2O1QA 2YFZA 3NW4A 1R1A1 4QQLA 2OUHA 3I49A 3ZXDA 4MADA 1LU2A 5KXEA 4XF0A 3VBHC 1VBA1 2SBAA 3LD8A 4YVSB 2JIGA 3R0RA 1RUC3 3AP7A 1QY4A 3VDCA 3ATGA 1SDWA 1GP6A 1LHVA 3JB8A 4DRRA 1E5IA 3BB6A 3GZEA 5FY5A 1ZRFA 5IVVA 5A7OA 5EYYA 2VR4A 1XJAA 2BZDA 4QPGA 4W65A 3C7HA 4CDWA 3EJKA 5L9BA 2WKKA 2ZMLA 3OF1A 1OFNA 3BOPA 3IB3A 4HONA 4L97A 4I2OA 3PJQA 4R9CA 1JYTA 1V00A 4YW1A 2HWB2 2HYXA 2NN8A 4IERA 1ODMA 2ZGLA 2RJKA 4YWAA 1SG3A 3VD7A 1K12A 2NMOA 4RFRB 4Y33A 1BYHA 4PIXA 5EWSA 5D8AC 1UL9A 4YW3A 2XLGA 2F4LA 1AHSA 4Q4W3 3JXSA 5C3OA 3I2JA 3NAPB 2HH9A 5FZOB 1PO23 2VZUA 2Y26A 4RS5B 5FCCA 3AP6A 5LWBA 1CAWA 5F2WA 2QCSB 2LUWA 3NV3A 1HXS2 1H4GA 1UZYA 1H6YA 2BVVA 2ZGMA 1YFUA 5C9AB 2BNMA 5L36A 4QX1A 3VDDC 3RZMA 1UZVA 2B9UA 4JV4A 2PN5A 5FPAA 4UF0B 1ZBE2 4QHZA 2ZHMA 2ZHKA 4GJYA 4FTBA 5DUWA 5FO8B 3AMHA 3FMGA 4CCDA 2BGPA 2IXKA 2QFEA 4AGRA 1RXFA 1P8JA 2JKXA 1VLNA 2C0ZA 3M8LA 3EMRA 1ZA7A 3BCWA 4GWNA 1XC6A 4QGMA 3OBAA 1HN0A 1URXA 1HRI3 1JW6A 3N7LA 4P9LA 3BTYA 3HPNA 1RGSA 4QDQA 5FZ4A 3C7GA 4V1PA 2VXJA 3T1LA 5A6XA 1QGLA 2P1BA 3DYPA 1OT5A 4LPLA 5J3UA 3GDBA 3OUJA 2A3YA 1AVBA 3MLJA 4NIDA 3RZZA 5FXVA 3BVCA 4ASMB 5FZ0A 2GC0A 3WNOA 3ZPYA 3ZSMA 1ASJ2 1LESA 1SPPB 2VUAA 3VGIA 2PQQA 1JHJA 2P3KA 4KU7A 1IG0A 5KBFA 1SLIA 1VALA 5E8AA 2IXCA 1JZ2A 2C26A 3O7OA 2ZMKA 5E6HA 3EO6A 3C8XA 1XYNA 1YQ2A 3P5BA 2J1EA 2JDAA 2EXIA 1DIWA 2ZOEB 2PXJA 4JKKA 3OGVA 1Q8QA 1JMUB 5FYYA 3ZN5A 4G9SB 2B8MA 1CESA 2QQLA 4OVEA 1SCSA 2Y0IA 4EYUA 2YROA 1ONAA 1D0GA 2RG4A 4XXPA 4IW3A 4PLNA 2LW8A 3O12A 4NIAA 2VNRA 3ZFFB 4FP3A 3NJZA 3RWNA 3ST7A 1QJX2 2FMDA 5CIRA 2A7AA 2P6CA 5GLWA 1JUIA 4E8DA 1SLCA 2VBPA 1PIV1 3EB7A 5FPLA 3TEXA 4LORA 4PBPA 2VTXA 1IPJA 1EV13 2B5HA 2OIIA 3PDQA 1IQAA 2IXJA 2Q30A 4MXVA 3POSA 4W4ZA 5LEJA 3C7OA 5FMOS 1LU1A 1ULDA 3O5SA 1Q8OA 3J7HA 3R6SA 2NQYA 3O1PA 4B4RA 1RYYA 4Q4V2 1LHNA 2FBEA 3S30A 1BXHA 3NVCA 3OBZA 1JZ4A 3N7JA 4EWDA 1PO22 4MGKE 5DZFA 3NWKA 2J22A 4LBJA 3MIFA 4ZY9A 1STMA 1WMFA 2PHDA 4MXWA 2ZEZA 3AYCA 4U36A 3GM8A 1X33A 3WVJA 3AZXA 4WVWA 5DAQA 2R1BA 4YW7A 3RNSA 3ZYIB 5CFDB 1OKQA 3C2UA 1ULFA 1Z0HA 1UPSA 1BMV1 4BCUA 3WF1A 4PI0A 2ZAHA 3J8F1 3THCA 4D3WA 4OQ9A 3R4SA 5CADA 2R062 3CJIC 1FT9A 5BXXA 2HWC1 3Q9OA 5JCTA 5LY2A 4JDOA 4OFGA 4Y20B 3D0SA 3PUIA 5FBZA 5GALA 1J59A 3MV01 2JDUA 4QKNA 5TSWA 3SMHA 1XSRA 4XFBA 1HRI2 3U07A 1QJEA 3DGTA 4A41A 1W8UA 4XUTA 4YG6A 2E51A 3HOBA 2CV6A 2FDHA 1SLBA 5A1AA 4BH9A 1NE6A 2ORZA 4XIKA 1GOGA 4EZHA 2B42B 1S0CA 5F7UA 2WNVB 5KXBA 1OQ1A 3MIGA 2VNGA 2W52A 4XJZA 5HV4A 1N1SA 5L9RA 4EE2A 2KA3A 4CSWA 4N43C 2ZX1A 4RHV2 1DFQA 2Y6KA 1DBNA 4HZFA 4E2SA 1AR73 4UBHA 2WZ8A 2ZGQA 2VZSA 4GJZA 3M3EA 1U12A 3JZVA 3N36A 4I02A 1XNCA 4RYDA 3L2HA 2VO5A 3PMEA 4R9AA 4RQPC 2OUJA 3Q8BA 4IUGA 4QDRA 5KXDA 3O1VA 2WS91 3K48A 1XE8A 4UW4A 3P3PA 5FZ6A 3KVAA 2K0GA 1RUE3 3AKRA 2ZGOA 3WQBA 1NKGA 5K9YA 4K20A 3A22A 5AFEA 3VHOA 3K75B 4I0WB 3AMPA 3DCQA 1COV2 4Y4RA 2VBDA 4C1WA 2MEV1 5DDJ3 3UKVA 3VBRB 2YV8A 2G9FA 1TMF1 1VBD3 2DVAA 4OZXA 4QT6A 5LA2A 4Q27A 2DYCA 1C5IA 4FVVA 4XCAA 4C91A 3H0OA 4N8MA 1ACCA 5AVPA 4GKYA 4IE4A 3H3ZA 3OTFA 3I4IA 4IEUA 3RPQA 2BWCA 3I2FA 5E88A 1EV12 3KQRA 3N9NA 2G1MA 1DZRA 2O0OA 1REEA 5JSRA 4QB2A 3WF2A 3MPBA 5CFCB 1HJGA 4TN7A 2ZAAA 2W92A 4LHSA 5K0UC 4QX8A 2WAAA 2WWSA 1HLCA 1T6GC 2FZ1A 1F2NA 3POFA 1EUUA 5A6QA 4LBQA 2HBUA 1EY2A 2YBSA 2XR4A 3IDEA 5GZEA 2ARBA 3HN1A 5CNAA 2GMEA 3MIBA 3MIHA 4AQ6A 3AP5A 4ZKTB 1OURA 3OUHA 4ZPIA 4V2VA 4AF9A 5ACA1 3FHIB 5E89A 1RIRA 5FZIA 5EYXA 4UFKA 2R0FA 4XHBA 3WG1A 4R52A 1V9U3 4Q8LA 1RUOA 4QGNA 4E2GA 1QQP2 3FUOA 1RHI1 3AKSA 4S2FA 4LO5B 3J26N 2JB4A 1C1FA 1C5HA 3LDRA 3PLQA 3PTYA 3AFGA 3WDVA 3AM2A 3CF6E 2ARXA 4OUMA 3G6JB 1HDKA 5HBAA 4XF1A 1GFF2 2GDFA 3M1HA 2FQPA 4OULA 1J58A 2E9QA 1JZ5A 5AVAA 5C4WB 2UYBA 2XB6C 1C57A 4XJ9A 3SEPA 1GUIA 4DXTA 3J7NA 1J3QA 2ZEWA 3CJXA 4EN9B 2VOTA 3BN6A 1DU3D 5HXVA 1OQEA 2A70A 1JODA 4ISRA 3VBFC 1C8NA 1UY3A 5A3MA 2D40A 4AZZA 3ZSKA 2BWAA 4BXSV 1V6IA 4ZU5A 5A3LA 5BNNB 3UNPA 4QU1A 1NY71 4CP9A 5BNOA 1G86A 1AR83 1XSQA 4WM7A 3TEZA 1A34A 1PGW1 5FZAA 2WABA 1WBFA 3VDBA 1R1A2 3OYWB 1RUD3 2R073 4JHTA 1E5SA 3USUA 2JICA 2WNOA 1NT0A 1VBA2 3ZSJA 1QJU3 4CEYB 3G7DA 5F32A 1KITA 3QBQA 2VXRA 4JGZB 1L7RA 1XNBA 2A75A 2AEZA 3CMGA 5LBCA 5BY5A 1PNGA 4GMP1 4LE4A 4UFLA 1SBEA 3POGA 1DYKA 1AR72 2BQPA 4UFJA 4FAHA 3VBOC 1UIJA 4XUQA 3BKZA 1MVEA 1DCSA 1VRH3 1GWMA 3VKNA 2R041 4M4PA 4QB6A 2ETEA 4IV3B 3LAGA 5A32A 1F5FA 4AFCA 1NCQA 1D4M1 1BKZA 5J98B 4AAPA 4DXSA 3WDTA 2VAUA 3AMNA 4XFIA 5F1RA 2PHRA 4PHZA 3HBZA 3I3DA 1ULGA 5FMDA 1VBD2 1XU1A 2YXSA 1SQ4A 3KF3A 2D44A 4NR1A 4XUNA 3HWJA 2QBXA 1H2MA 2P4EA 2VUCA 2WR9A 4HSLA 4IEWA 2JDKA 1LOAA 4NHKA 1W6PB 1CZSA 1REFA 1S55A 1JZ6A 4DB5A 5EXOA 5FP9A 1NYWA 2W3JA 2HWF3 2F4PA 4L8QA 4EROA 3IBMA 1CR7A 4YGBA 1OA2A 4MGQA 3UKNA 2RS33 3MGUA 4HXCA 2D6PA 2PLV3 2XBO1 2XKOA 1ND3A 4FI9A 4H7LA 2XJPA 4MLOA 2JDHA 5I8SA 4F8AA 1YHFA 2RHPA 2AR6A 4C1XA 2QDNA 1JOBA 2CGNA 2W1SA 4NWWA 2XG3A 3NO8A 5A7WB 1OQDA 1F4AA 4LIUA 2HEVF 1XNKA 2RS11 1A78A 2XWJB 4QQOA 3UYJA 1HN1A 1FX5A 5C3QA 4BWOA 1G8WA 2AACA 4UFIA 5IVYA 5K4LA 1OA3A 2D97A 2GNTA 2W0XA 4NPMA 4Z82A 1RINA 4XFAA 2D3RA 2HWE1 3HT1A 2GNBA 2WWUA 1JUHA 5CVRA 2D7FA 3LFIA 2VQUA 3WF3A 2O8QA 3WX5A 2GSYA 3ZFEB 2DUOA 3WD5A 1VBE3 2ILMA 4YFWA 1SBDA 4KNCA 3VBSC 5APAA 2WWJA 3BOWA 3GZAA 3QOPA 3GZUC 1QJY2 4BJ0A 1PMJX 5FFOC 2DURA 1ZREA 2BP6A 4M3CB 1K5MC 3IZOA 2WFF3 4KG0A 1WCSA 2HLEA 3BYWA 4FQ4A 2DFCA 4C8DA 1ZYBA 4LBOA 3RFRA 3O1SA 1I5PA 1HXS1 2Y34A 4XPVA 3ZM8A 4KQ7A 4XBNA 1NZIA 2R072 3VZKA 2EALA 2CHHA 1LOCA 2D6KA 1WKYA 5EPAA 1OLMA 5CYYA 1WCQA 1ZBE1 2GC3A 2AZ5A 4Q2FA 3VBSA 3WZ1A 4DXZA 1MQTB 5C7GA 4QX5A 1PIV2 2XLFA 3CLPA 5GKAC 1QMJA 5LK5A 3TBDA 3VBUB 2DUQA 1LHOA 3WNLA 1MZEA 3C7EA 3CBNA 1YCIA 2BBAA 2RS53 2WO7A 1ZM1A 4XMAA 1JYIA 1AYN3 2JECA 2GMPA 1OF3A 2Z79A 3R4DB 1GOFA 2GALA 1IG3A 4MGZE 3J4UH 4Q29A 5IUQA 2JDNA 5FYUA 3WNMA 1IKQA 4CCCA 5FTTC 2ZABA 5FPBA 3WG3A 1UZZA 1C28A 2DF7A 2BU9A 2X09A 1HIXA 1MEC3 2YBKA 2YGLA 3WCSA 4AFBA 1QJFA 1FMD2 2E53A 2WZR3 3FJSA 4KWLA 4CDQB 1O5UA 2VQAA 4GB33 1NA1C 2GNDA 2RR13 2WT2A 4CUAA 5HV0A 1LNSA 5DAPA 3J8F2 2HWF2 4RGGA 4IE0A 3T0BA 5FXZA 1I6XA 3PNAA 3UJQA 2HWC2 4SLIA 4NUBA 4XJ8A 4UWDA 3TRSB 5F9TA 1MZ5A 2PAKA 5FIXA 3ZXJA 3KV9A 4URTA 2ZPXA 1ZZ7A 1N1TA 3HVDA 3VHPA 3AX4A 3DPRA 4LK7A 2X5IC 4P9WA 2A73B 3RGBA 2VOXA 4WZFA 3ZO0B 4BQWA 4OHWA 2XHKA 2WN3A 1B35B 2BV4A 4BZ4A 1MZ6A 3AZYA 3MPPG 4NN0A 3GXUA 4E4DX 1GANA 4ONUA 2Q1MA 4BQ5A 1U5ZA 3D6EA 4NHMA 4CU7A 2LTNA 2PMWB 3MW3A 1RUC1 3B93A 1F35A 5C8CC 1W9YA 2GC2A 2P37A 4RGAA 5T55A 4K1ZA 1KEXA 2BGOA 2G9ZA 2IFWA 1LOFC 1OLME 3IKWA 3WNKA 3RQ0A 3DKQA 4QPIC 3I2OA 5ISLA 2D6MA 2Q1FA 2JWPA 2YPDA 3AJYA 3NKGA 3FC0A 4MGYE 3KT7A 5DQ0A 1ZX5A 5KC6A 2WQZC 1VB4A 1QEXA 3D5OA 1W2TA 4YM1A 2ET1A 4MGIE 4Q4X3 1KJLA 3K2OA 3ZXKA 4AEDB 1F5JA 2DDUA 3FLRA 4M3CE 1S1AA 2WS92 1PO21 2DCYA 1ULEA 1XYPA 1T6BX 3B01A 3ZYHA 2CWSA 1HRV3 3CEWA 4Z1VA 4AE2A 2J1AA 2W47A 4QPIA 1I3HA 1US3A 4CCJA 1HJFA 4EN8B 3PVNA 3RDIA 2TBVA 1O91A 5FREA 4Q26A 2JE7A 4XDPA 5T54A 3K77A 4ZXKA 5JLVA 3OOXA 4FPCA 3WP5A 1OPMA 3V0AA 1IZ3A 4XILA 5IAXA 4LO6B 2QQMA 2R061 1NX9A 1RUJ3 2WN2A 3KGLA 4LXLA 4OUSA 1QOOA 3ZKYA 2AEYA 4Y5Z0 4H55A 4QX0A 4ARXA 3OBRA 4KWKA 1GNZA 1AYN2 1HRI1 2WBKA 2FDKA 3CDZB 3KCCA 3GGLA 2VNVA 3KF5A 4RR3B 2KR2A 2XONA 2QQNA 2R16A 3SKVA 4M0NA 4CDUA 1RUNA 4AFDA 1WUVA 2XKPA 4J6GA 3ZXFA 5IVBA 3WNPA 1GWLA 3JQXA 4ISQA 3ZN6B 1VMHA 2WO1A 3UGHA 4FTSA 1E57A 2WNUC 5ACA2 1N1VA 2Q8DA 4CYDA 5IYYA 1UY1A 4K6BA 4D69A 3PJYA 1JU4A 2WZR2 5I93A 1RVF3 2RE9A 4R4ZA 2YPJA 3FHQA 4DO0A 3ZVXA 1QKQA 1OH4A 4GB32 3B5LB 1K45A 2CGOA 4GWIA 4MYEA 4QMAA 1AR93 1UYZA 3AB0A 4XF3A 4MHRA 5IK5A 4QX7A 1AZDA 1WMDA 4URAA 4AHXA 4HKWA 4PQ9A 4BK4A 2JDZA 4K8RB 2B39A 4AW7A 2X05A 4BOWA 5FOBB 2WNUA 2OPKA 1H1MA 3UL2A 1OKOA 5L7OA 2P3YA 2ORXA 2IXLA 1X8MA 3Q8FA 4CUGA 1CAVA 1S0EA 4L92A 5IFTA 4OMCA 3D82A 2V4VA 4HANA 1KS5A 1GMMA 5GLZA 2B45X 1JXNA 1PK6C 4RD7A 4YLZA 3WW2A 4XZUG 2JG9B 1PGW2 3T4HB 5FZBA 1UOBA 1A6CA 2JIJA 2WSVA 3R05A 5DUUA 4FPKA 4WV8A 1JH5A 4R9DA 4EN0A 3S0MA 1EV11 1SFNA 4EN6B 4YVWB 4AHWA 1GSLA 2FCVA 4YFZA 1ZVFA 4NPLA 2V09A 5FY9A 4IEQA 4H2AA 4RFT0 5FJHA 4BQ4A 3NSTA 1CIWA 1XRUA 4NO4A 3ILRA 4RSUA 2VOKA 2R042 4PT6A 4JVAA 5BPXA 4LMFA 3POBA 1GQHA 3OY8A 3HNMA 3J7LA 1PK6A 3WNNA 2VG9A 1UY2A 1D4M2 1RMU3 1SLLA 1HRV2 3TOJA 4FXKB 4D7TA 1M4WA 2WUHA 1J1TA 4CEWA 4D8MA 2ZGKA 4GMP0 3UGFA 1QQP1 5FZ8A 1I5ZA 3SLIA 1QH6A 3H50A 1A3KA 1ND2C 2OZJA 3IPVA 1ST8A 4HL0A 2DV9A 2R1DA 4UOJA 3AKPA 1OI6A 1OVSA 4CCMA 3ASIA 3BPSA 1RUJ2 3POIA 4L99A 3UJOA 3KT1A 3SNMA 5FXXA 5A1FA 1O8PA 4QAWA 1UO9A 3KCXA 4Y1XA 4JTOA 2JG8C 1IS6A 2G4IA 5KHGA 4GH4B 5K7PA 4WM8A 4LBKA 3VDAA 2J42A 3KSCA 2ID4A 3B3QE 3WF4A 1D7PM 1S4CA 2YU1A 3IM0A 4QPGC 4Q1PA 5F39A 1N3QA 2NPIA 3GJBA 4CDWC 2WSUA 3N9MA 4R4XA 2NP0A 2LRPA 4FOWA 2WT1A 4E2QA 1DQ5A 3RJ2X 1ND2A 3SCGA 1IPSA 5EZWA 4FPJA 2A71A 5LW9A 1RUG2 2NMNA 4XF4A 2RS12 3PTRB 4YW6A 5K8SA 1DQ1A 2BJSA 4Y22B 4ATEA 4GD4A 2VGDA 3WG4A 3MW4A 3KQ4B 3VKMA 2JG8A 4LKEA 2XVLA 2JD4A 2BFUL 4IV1B 1QIQA 3VL8A 4E4ZA 1CX4A 1AR71 1AR92 2HWE2 2O14A 1IPKA 3T30A 4CDXA 4CU9A 3F95A 1DZTA 3B00A 5FLHA 2XGXA 1W2AX 3M3OA 2WJSA 5FPVA 1RC6A 3EQEA 4LA2A 3VBHB 3E6DA 1PZ7A 1LGNA 1CAWB 4E9KA 2CGPA 4FPHA 1XPWA 2JJ6A 1XBFA 1IS4A 4QQ2A 5DDJ1 1LR5A 4XQ4A 1CAUA 1VBD1 4HLTA 2WLQA 3WDYA 4BK5A 1GQGA 5F6LB 1UQXA 4QU2A 3SKJE 2AC1A 3D4KA 4LBMA 4OMDA 2XQRA 5JAXA 1N1YA 2VMGA 5JSPA 1DGWA 1FXZA 1F9KA 1V0AA 5H9QA 1JS9A 2Y6GA 3OB8A 1U0AA 2ZBJA 5D8AB 3M2MA 1CWPA 5LCWL 1OFSA 1O4ZA 3T4VA 4JDNA 1G9AA 2EIDA 1Z7S2 4UFMA 4XW3A 4XQDA 2KD7A 2YC4A 5C9AC 3GF6A 3ZX7A 3D3AA 1UCXA 2VTFA 1QJZA 4JQRA 2CWMA 2VTXJ 3DXUA 4I09A 4O7XA 3DYOA 3DKWA 2VZ3A 4DPNA 1HKDA 1LHUA 5JR7B 4MUVA 3VDDB 2A3WA 4XEZA 1GWKA 1VJ2A 4CPBA 4RS5A 2D6OX 1GZWA 3LPGA 4CCLA 5HCAA 1OBNA 1RMU2 4W8JA 1OVPA 3OD0A 1YQCA 3Q8CA 3E5UA 4LBQD 2E7TA 2PAEA 2YHJA 4ZZ8A 4AR2A 4P02B 5C9AA 1QWRA 5T5JA 1PO13 4XYXA 4TWTA 4A44A 3WQ1A 1ZRRA 1DYPA 4UF0A 2VH9A 5FO7B 3IIIA 3JBG3 4ZU4A 1H8TC 1LULA 3N3HA 2PHUA 2VCCA 2BUKA 2Y60A 3POWA 3QH7A 3THDA 2DVDA 2VZQA 3AZZA 1WLDA 4XJAA 5KHJA 3CKHA 1DHKB 4LLFA 4LQRA 1QJY1 4BQXA 3FWEA 1SDDB 3MZHA 2C4XA 1GNHA 3O0WA 1XNTA 1Q43A 2W39A 4B1MA 4BQ3A 1JYNA 3V0BB 1JN2P 2Q8OA 1TQ5A 1O7FA 1LOEA 4ZS3A 5HXMA 3LE0A 4IETA 2TUNA 3C3VA 4X8PA 5J36A 5C6CA 3THPA 3O1OA 3SCHA 4FPGA 1AR81 2NLRA 3OD4A 3W59A 5FZMA 1WW5A 1RUD1 2R071 3VUOA 1H8TA 4NRQA 5B4XA 3WW4A 1QJU1 4S2HA 1BK0A 4FO9A 4CVUA 1RUC2 3M70A 2RMU3 1SPPA 1DYOA 5FYZA 3ZIWA 4FPEA 2JKBA 4AHZA 3U4XA 1FYUA 3NJXA 4IEXA 4YZ2A 1YEWA 3PUQA 4IGPA 1VRH1 4P9JA 4Q4Y3 4ES9A 2C24A 4CUBA 4NIHA 5IHRA 4XAEA 5AC93 3IT8A 1YFWA 2VZOA 1VPHA 2W5FA 1W8FA 5D2AA 1FOD3 2XOMA 3NNGA 5FJKA 3S57A 3WDUA 4Q4W2 5FP8A 1SBFA 1AXKA 1MACA 1Y7BA 3RZKA 1RUI3 2P3JA 1NCRB 2X53S 1FMD1 4Q0QA 3ORJA 3GBWA 1UMIA 3M4FA 4GALA 5A33B 4RA0A 3WOGA 4LBNA 4FPLA 5FZFA 4Z2WA 4FPOB 2V73A 5C5TA 2PA7A 4JC1A 1F15A 2ZEYA 4JAAA 2HWF1 4AL9A 4COZA 5A3NA 5JZGC 2D3PA 2ZGNA 3LOIA 1RJ8A 3FN9A 3N9LA 3PU8A 4LUMA 2XJRA 5J7MA 3T1MA 1UX7A 2GNMA 2RS31 4IL7A 4BU2A 1POV3 4NRMA 4CUCA 4QHBA 5EJZB 4META 2PLV1 1GU3A 4QPWA 5FP7A 3LF7A 1ALYA 1MS8A 3MUY1 4AI3A 1UU4A 2QQWA 4E27A 5L73A 5CKNA 5B2GB 3CJIB 1J84A 1K5JA 3AZVA 4A2UA 1KDKA 1OD3A 1QOSA 2L9LA 5FLIA 4CP1A 3WG2A 5JZGA 2RVAA 2VQ0A 5CFDA 1HV1A 3BUCA 4JDMA 3PVEA 4KBBA 1UY0A 2XWBB 3CZJA 1SCRA 4XQWA 3NL1A 2CY6A 3FLPA 5JXGA 5LEKA 4QM8A 3JBG2 3ZKUA 1VBE1 3IDAA 1AUYA 1W8ZA 2XMLA 2RJ2A 2QKDA 1DQ0A 4HKLA 1H2NA 1R093 4FPFA 2FDJA 4X6RB 4Y1YA 1FV2A 3KWVA 4H7MA 4HKOA 4AOCA 3THTA 5LZ6A 4NAOA 5KHHA 3O1MA 1G9DA 2EIEA 2WFF1 1YFXA 2E33A 4JQTA 3DYMA 4MH0E 4N43B 2OYZA 3WDWA 4FBFA 4CP2A 3U0ZA 1CX1A 3T2QA 1APNA 2D93A 4JHZA 3LIHA 1QH7A 1LHWA 2ZGRA 3L9JT 2V5YA 5DAXA 5F5AA 4JKLA 5DXDA 5JWPA 3ZFGC 2OZ6A 5FUNA 2WNVA 3ZXEA 1CIYA 3ACIA 4XACA 3WINE 2VMFA 4IEPA 4HBNA 4L0PA 4RQPB 2QJVA 2RMU2 4LJHA 2OQ7A 4N53B 2EIGA 3A0KA 2GN7A 2CSGA 2X29A 2WYSA 4AXOA 4EJRA 1W8HA 4P5HA 5JXIA 1ZBA3 4IQPA 4Q4Y2 3ZXLA 1CZTA 2RS51 1X7NA 4PF1A 4V2WA 1AYN1 2X8KA 3ECQA 4LA3A 2GN3A 3LEKA 5C70A 1FOD2 2B9VA 1LEMA 2VJXA 2FZ2A 3CIHA 1LGBA 3WUCA 4ATFA 3ZFGA 1BBT3 1W6QA 1X36A 1E5RA 2D98A 2D6NA 3AMMA 3LKJA 4UT5A 1MEC1 2ZX2A 1RUI2 5FZGA 2VU9A 3VBRA 1H1IA 3O0VA 3JD73 2WZR1 4IDZA 3VKLA 4COVA 5K0UB 2H0BA 5CB7A 1PMHX 3S7IA 3I2KA 4FT8A 1S2EA 1OHFA 1WCKA 1C8M3 2Z2SB 4GB31 1JYVA 3H1YA 2RR11 3CHXA 5BNOC 2IZWA 4YM2A 2XDVA 4JCKA 4WM7C 3SH3A 3WP6A 5FK7A 1ENSA 5T3NA 4BIFA 3VBSB 4DOUA 2GC1A 4K8FA 2B46X 2XHNA 5H9RA 3ZIXA 4PDWB 1UYXA 3LEIA 1OF4A 4UW5A 5D21A 1NLRA 3RI9A 1AXYA 2XH6A 2W87A 4D7SA 1W06A 4JTNA 3D0JA 1RB8G 3K3OA 3PL0A 5JOXA 4XDQA 3SEEA 4AYUA 1US2A 2SLIA 1UN1A 4KH9A 3UGGA 4YARA 2RDQA 3OG2A 3AP9A 1WWYA 3N9QA 4BMEA 3RZHA 2QQKA 1PGL1 2C5DA 1A8MA 1XU2A 1YIFA 3NNMA 5FP3A 1NCQC 1CVNA 5FO9B 1POV0 1BCXA 2DCJA 3A0NA 2XVGA 2ZHLA 2A3XA 2QDRA 4C0HA 2BNOA 5J48A 1ZRDA 3VBFB 4AVVA 5A3OA 3S5AA 5LBEA 3LB9A 4XFFA 4NJ4A 4LHNA 4UYBA 5H9SA 3PVBB 4LO4B 5C4WA 4Q4X1 1X9TA 2VVFA 1YQ6A 3FX3A 5FXWA 1UF2C 4OCTA 1SEFA 1GLHA 1ZA4A 4XOGA 1N3PA 4O9EA 5F5IA 3VZNA 5JMCA 2VW0A 1N47A 2XUMA 1T2XA 1RUE2 1UOJA 2FCTA 3H3UA 4P08A 4QQPA 4CA9A 2FDIA 1HRV1 5BNNA 1W28A 2FDGA 4YG3A 1GZTA 3VBOB 1UX6A 3LGRA 3KVBA 5DDJ2 1ND3C 2NZ9A 2VMCA 3VHNA 1DGRN 4Y26A 3OYWA 5GJ6A 4HSJA 4DZGA 1W3VA 3ZPOA 4BLIA 1AX0A 3ME2A 4JGZA 3I97A 5F5QA 4ZONA 3ZYJB 1RUJ1 3I2GA 5A3WA 3U1XA 1MPXA 3ZYGA 1JOPA 1OUSA 5L19A 4FQZA 1PX4A 4LIVA 1DGRA 2FMYA 4JGYC 4UW6A 1S0IA 3CO2A 3OGSA 4GWJA 2XJUA 3NV1A 4AFMA 2VECA 3AK0A 5A80A 4IV3A 1D2SA 4XUPA 1H30A 4TLFA 4ZXEA 4MG2A 4XF9A 1BBT2 4M3CF 1V6JA 2QZ3A 1X9PA 2BYVE 2YYOA 1OXCA 4OUEA 2J1TA 4W6XA 3RYKA 3VL9A 5DMYA 1W6OB 4FAGA 1PZ9A 1RUG1 2IVJA 2Y6HA 3RMXA 2C6SA 3JD72 2WDBA 1ULCA 3I59B 4QHOA 2PHLA 3H1MA 3BPZA 2DFBA 1V9U2 4IGOA 5G05L 3SH5A 3WY6A 3RZGA 2YZ4A 4K21A 1J3RA 4XHXA 1C8M2 4H3WA 5D1IA 2ZJCA 4JGYA 1AR91 2J1VA 1VMFA 1W6PA 1DLLA
chains in the Genus database with same CATH topology
1CAXB 4AQ2A 3TN93 3AYAA 4OHYA 1EAH3 5I0UA 1WCDJ 1NG0A 3E97A 3OGGA 3ZMNA 3W58A 3MF9A 5DUXA 2QE3A 2H6BA 1O3TA 2CL2A 1JHNA 2LALA 1QF3A 4WVMB 2UY8A 3V56A 4BLJA 3PHMA 1VB2A 1AR82 4N90A 4IEYA 1Q8VA 3MIDA 2ZKNA 1OMIA 4NPRA 3VBSB 4DRVA 1Q8SA 1RUD2 3GALA 2CNAA 4QQHA 4B3NA 3WW1A 1QJU2 4LULA 4AI1A 2WL1A 4F3JA 1G7YA 1JBCA 4GULA 1Z7S1 2VVEA 1K5MB 3VZJA 1DG6A 3ZFEA 3CL1A 3SISA 3LZZA 4LLOA 4I3GA 1VBC3 1VRH2 3ROUA 5SV5A 1IS3A 2RM23 5HI0A 2ZMNA 5E1RA 4UBGA 3USSA 2MHFA 1MVQA 2BGCA 4M3CA 4Q0UA 1RMU1 4Q0SA 2MEV3 2AGSA 3KZ4C 4ORFA 3PVOA 1WGPA 3MI8A 4YW2A 3LA2A 3DPRC 1V70A 5FDBA 1YJKA 5GLVA 1XE7A 2PHTA 3VZMA 2TNFA 1RJ7A 1RUF3 1MQTA 3W9AA 5GZFA 5JI7A 2R32A 4M00A 3I7DA 5FPZA 1R1ZA 2ZTNA 3VKOA 4QM9A 2B7YA 3JQWA 4P9YA 2RS32 1TME3 1BEV3 2PHXA 2A6WA 4MV2A 4N9HA 2XLAA 4YW5A 2PLV2 3ENRA 1R083 5HCFA 1QDOA 1LRHA 3MDPA 1YI7A 1S0JA 1NA1B 5ABJC 3ZXAC 2GH2A 4GA9A 4Z07A 1AYM3 5F6KA 3O14A 2CAUA 4CDQA 4OHXA 3TYJA 4BHPA 4AGVA 1WW4A 1RITA 1X8EA 3N7MA 4O9GA 5BNPB 4B7EA 2X5IB 5FQ0A 4QXKA 1IKPA 1EAH2 2JX9A 1VR3A 3FFQA 2BVBA 1VBE2 2QVSB 3HT2A 4LT5A 2P2KA 3MFAA 2GH8A 4AVBA 5ABJA 5C8CB 2BTVC 2I07B 1GZCA 4Q4W1 1CJDA 1EP0A 5FAXA 2Y0OA 3K51A 3KD4A 4QPIB 2WFF2 1B35A 1AR63 3CU7A 4HFSA 1D2QA 4Z92B 3B69A 4CZSA 1LODA 2IC1A 2UURA 2PELA 4XFGA 1OLQA 5GM0A 4AVTA 3HIFA 4AQTA 1HQWA 2Q4SA 3SCFA 4CDUC 2HEYF 3AJZA 3VN4A 1AL0G 2WLPA 1W6MB 3IDBB 4XE9A 1YUDA 3TAYA 4EN7B 2GMMA 3ALQA 1DDLA 2E63A 3ZN4A 1VBC2 3HMYA 3LSDA 1DQ6A 5LK7B 2RM22 2RS52 4ES8A 4AEDA 4M0HA 1H2KA 1KFXL 1JOJA 1LTEA 1UU5A 3AMQA 4DNYA 1GR3A 2IXHA 1KQRA 1S2BA 5DUVA 1MEC2 2WQ4A 5L7OC 4AK3A 3N4MA 2FHRA 1WBLA 1PO11 1CD3G 1QXPA 1NE4A 3JU9A 1VP6A 1W0OA 1CJPA 4E4SA 3JBG1 1RUF2 2A6YA 2RR12 2ZCWA 3HR9A 3FLTA 4PCRA 4HPKB 3TNQA 2WNUB 3B02A 4AQSA 3LCPA 2XBO3 3MF6A 3BALA 1FAYA 2D5FA 3V64A 4RR3A 1G9BA 5KC5A 4UW3A 4LR4A 2ZZJA 4LTAA 1MS3A 2ZGSA 1OA4A 1U5IA 2I74A 1FPN3 4KGGA 3ZN6A 4XETA 3DF0A 3E5QA 3S7EA 5JDBA 4CP0A 4P9IA 1SMVA 1AYM2 3MEPA 2Z42A 2DUPA 2I2SA 4AI2A 1PGL2 5GLUA 2ATFA 3ES4A 2RMU1 4B4QA 2HYKA 1OOPC 1QXRA 1LECA 1WA4A 2R30A 4Y4YA 1F31A 4CEWC 3PMSA 2HWB3 1B09A 4Q4Y1 1D0HA 3L2YA 3WR0A 3KCYA 5AC91 1PGSA 2IFRA 4OI1A 1FOD1 1PK6B 1KFUL 1IOAA 3ACLA 4Q4X2 3B9CA 5GLTA 4N9IA 1DZQA 1ZRCA 1RUI1 1QOTA 1OOPA 1X50A 2KXLA 4WM8C 2R49A 5LRSA 3DUIA 4XJUA 5JIUA 2JG9A 1C3HA 3QD6A 1XXNA 2DVFA 3IMNA 4COUA 4DY3A 4YVWA 5T5LA 3MYXA 1G9CA 1KJRA 2DVBA 1UPIA 5LRRA 1POV1 4L9BA 4N7UA 1AL23 3RG0A 1W6NA 4GIQA 4D94A 4CDXC 1MZFA 4XFCA 4Z8BA 1ZZ6A 2JEMA 2YUEA 3S6PA 3GHMA 2ZHNA 1LGCA 2P17A 5BYNA 1V6KA 4ASLA 1ASJ3 4Q0PA 3MFCA 4XTMA 1RVF2 2VY0A 1O4YA 1YFYA 5GZDA 1DF0A 4FPYA 4QPGB 4CDWB 3QH6A 4C90A 1IGOA 2EXKA 5CAZA 2UWAA 1H9PA 3R4UA 3AZWA 1Y9QA 3AKTA 1J3PA 1OPOA 4DS0A 4NHLA 2WFPA 4YVSC 2A5ZA 4K7JA 1R091 1XNDA 4GH4A 1MR5A 2Q5TA 4Q0VA 3WP4A 3JCIA 5BUVA 1YO8A 1RUE1 2HWD3 4QPYA 3WCRA 3AYDA 1FPN2 1J1LA 5FMOL 3U10A 5J96B 1H2LA 5FRAA 3E5XA 1QJX3 4BQ1A 4QD2A 4KG8A 2GZWA 2R0HA 1KDMA 3FBMA 1PMIA 1RUH3 4Y22A 3NAPC 4YVSA 3VZOA 4RS5C 4BE3A 3VLBB 3LA3A 4IV1A 1AF9A 4HVRA 1ZBA1 2WIIB 4W6WA 5KHIA 3URFA 2GAUA 4S2DA 1H9WA 3V65A 4Q4V3 1SFYA 4AVCA 4LE3A 3VBHA 3IWZA 1GZWB 5EJ3A 1BBT1 1PM7A 2E7AA 4PIYA 3NAPA 1PVXA 2ZKLA 2MNGA 2Q1ZB 3JD71 4HK9A 3BIWE 1PVC3 2ZGTA 2IXIA 3JB4C 5KWRA 1V9U1 2A6ZA 1GICA 3ILNA 1A8DA 1C8M1 4PLOA 2R063 2NYYA 4BA6A 1MS0A 1F8VA 5D8AA 2ZA9A 4YZ1A 3WLUA 4DQAA 3A4UA 5AFBA 1NQDA 2Q0AA 2DU0A 2XL7A 1AL22 2ES3A 2HEWF 4K1YA 4L11A 4PIZA 1DGLA 2ZX4A 3VDDA 2HJIA 4HMZA 4YNIA 2EF6A 4EWAA 1H8TB 3MW2A 3MLKA 2R6QA 4AEKA 4DFSA 1S0GA 5I8TA 4I01A 2PHWA 2ZX3A 4RHV3 3EBRA 3QACA 2DWRA 4A7YA 2VW1A 1ZNPA 1AX2A 4OI2A 3WW3A 3ZFFC 3SHRA 1D4VB 4QGLA 4LO8A 1YYNA 1RTVA 4FTEA 2WT0A 4S2GA 3H1WA 4J1WA 3V0BA 4AHYA 4LEJA 2HWD2 4EWEA 1COV3 1FI2A 5FOJB 2BFUS 2WA4A 4MXWB 1VBB3 3P3NA 4GXLA 4LNVA 1KXGA 1H4HA 2H0VA 3ZFFA 2YGMA 1RUH2 4GKXA 4YW4A 2QNKA 4F83A 3EHKA 5CG8A 3U11A 1NCRC 3ILFA 3KS7A 2UYAA 3TB0A 1QU0A 3SITA 1WW7A 4HVQA 5CFDC 3I54A 4Y1UA 1FV3A 3MICA 4GQ7A 1FNYA 4YZ4A 1IS5A 3RYPA 4YGDA 1C4RA 2OVUA 3FZ3A 1LJ7A 3HAGA 5JSOA 4HETA 3UKTA 2XJSA 5JZGB 3AYEA 1GBGA 1QQP3 4X6QB 2WNEA 1PVC2 1NCRA 1V6NA 4BMBA 2DVGA 3KM5A 5A33A 4FSJA 2VUJA 4WVVA 2CYFA 1PO12 4I0BA 1YNAA 1LCLA 1V6LA 1WW6A 3TN91 4AFAA 1EAH1 3OGJA 4I30A 2WNVC 3RJRA 1PHMA 2A6VA 3WQ0A 3LA7A 3APBA 4Y20A 3TNPB 3RS6A 1JTZX 1VIWB 3GHNA 4A7ZA 4XBQA 3I2DA 2H6CA 1JYCA 5BNQA 4PF5A 4C0BA 3ZYPA 3CJIA 1R1A3 1W0PA 1ENQA 2AH2A 1NLSA 4XBLA 2E6VA 1VBA3 2DCZA 4XJWA 2I45A 1EPWA 3MLLA 1GKBA 2VW2A 3RMYA 1LENA 1LEDA 4FXGB 2ZGUA 4AGGA 3VBRC 3WV6A 5C8WA 4NOTA 5EFUA 1O3RA 2NM1A 3OPZA 1VBC1 4N53C 3N7KA 1UKGA 2RM21 3BTAA 4LBQB 4HN1A 3ZFGB 1UMZA 5AC92 1W6QB 5FLJA 5CFCC 5I0SA 1ZZBA 4N43A 4BIOA 2YDEA 5FPXA 1SLAA 5JOYA 2EAAA 1VBB2 4N7IA 1HX6A 2GU9A 1CN1A 1MS9A 4BM8A 4NVPA 2G9GA 3RRDA 3GBFA 2VPVA 3E6BA 4FCAA 1H0BA 3M3IA 4RQPA 4N53A 1RUF1 1IHMA 4LUKA 4PJYA 5DZGA 4K9SA 4B4PA 3DV8A 5JI9A 1BQPA 5CFCA 2JENA 4B8EA 3WXPA 5DZEA 2TEPA 2N7GA 1GZ9A 1TME1 1BEV1 2RJLA 4CRQA 2EAKA 3LOBA 1R081 4LHLA 1YLLA 4XFHA 1XQNA 2WC2A 5I91A 2HKXA 4AVAA 4PDWC 5BNOB 4IESA 5C4WC 4WM7B 1AYM1 1BJQA 3USUB 2VULA 5K0UA 5CG9A 3FUQA 3GYDA 2YC0A 5KHKA 2K9ZA 5BNNC 1AJKA 1O3QA 1UIKA 1ENXA 1QXJA 1WLCA 3X29B 1CONA 5DG2A 2DCKA 3ZDSA 4LHKA 3ZXGA 1C1LA 1QJY3 4CEYC 2P34A 4KGQA 4PDWA 2ZACA 4JGZC 2Y38A 5A32B 1U5YA 2F6BA 1R092 1NCQB 1DQ4A 2IWGB 1Q5OA 2EA7A 2ERFA 1UKRA 3BODA 3KMHA 1AR61 3FBYA 1I1EA 1KD7A 3RSJA 4Y24A 1YWKA 4IV3C 3UV9A 2C1FA 2AENA 2ENRA 1LOBA 1AJOA 1UU6A 4OLLA 3WUDA 2PAMA 5GZGA 1AX1A 2KM2A 5KXCA 1PIV3 2K2SA 1H8VA 1ZZ9A 3CNAA 4P9GA 4CEYA 1TEIA 5J09A 3VBFA 3M3CA 3M7AA 5J37A 2QUOA 4COWA 1XYOA 1ZBA2 3ZYRA 3LSEA 3QLQA 1GV9A 2O8OA 1ND3B 4AEMA 1CPMA 2W08A 2OA2A 1M06G 3AXEA 3WT3A 4DINB 1V6OA 3E6CC 4Q1RA 1O3SA 1G9FA 2BPA2 1NZCA 4JRAA 3WP3A 1FMD3 3VBOA 4PLMA 2P3IA 4AG4A 3HD8B 4JGYB 3LWCA 5CA6A 1RVF1 5CBLA 5CU1A 2BBVA 5IK8A 1UW8A 3J8F3 1MS5A 4EV0A 4MZUA 2HWC3 2UU8A 4KWJA 1X82A 4R9BA 4IXLA 4ITCA 5SV8A 3NKTA 4YZ5A 5I8YA 3IDCB 3ZFEC 1FPN1 3EXUA 3QCWA 2MPFA 3UK9A 1W6OA 2DTWA 3KB5A 3KT4A 1PNFA 3I59A 4X8NA 2PYTA 4IEZA 1WD3A 1H1AA 5JVVA 3NV4A 4KL1A 5DG1A 2OW4A 4Y1VA 2WINB 1S0BA 2HWB1 1CAXA 4LBLA 1UD1A 4YSFA 4I3PA 3AXDA 4OHVA 1S0FA 2WS93 3JUUA 1I9RA 1MQTC 4K40A 1OD5A 3GNEA 4FOYA 3VBUC 1ZZCA 3KGZA 4WVMA 4CTEA 4A7KA 1ENRA 1TMF3 1BK1A 2JXAA 3B7MA 5HCBA 4Q8KA 1WD4A 4OI4A 4YM3A 3WNXA 2ZX0A 3D8CA 3WHTA 2Z69A 1OLRA 1CQ9A 1K5MA 2XL9A 3VKFC 1AL21 4G3YC 1U5XA 3VBUA 4CDQC 2WA3A 1EYBA 1MS1A 4MVTA 2Z5WA 3DPRB 4LO7A 3OBTA 1HQNA 5T5PA 5ACA3 3I8TA 4FOQA 3VHRA 2DCTA 4IEOA 4A3XA 3DL3A 1ASJ1 5JOZA 3ETQA 4HK8A 1RHI3 1BMV2 5FQ0B 4RL7A 2BNNA 4OI0A 1B35C 4XMIA 3ES1A 3B94A 2UY9A 3TWIA 1S0DA 5IK7A 5T50A 3TN92 2ZS6B 2QQPA 1WLWA 2QZ2A 5ABJB 5E16A 1L3JA 4WZCA 5BNPC 1Z78A 2HWD1 1O5LA 1WMEA 2PTMA 1LB2A 1NA1A 1YXWA 2AUYA 4OHZA 1TNRA 1QJX1 3KLSA 4FOVA 4AI0A 3ZSLA 4UXAA 4M01A 3SH4A 2XJVA 1RUH1 4AEDC 1NXD1 1VAVA 1SACA 3V0AB 3H7JA 1CPNA 5IK4A 3GZTB 4AI8A 1Q8PA 4KU8A 4GMP3 2AREA 4B7KA 5BNPA 2X5IA 2JE9A 5H9PA 1YI9A 4H14A 2R043 2DU1A 4Q4V1 1RL3A 3WQ7A 2VOVA 1MS4A 4CDUB 4G4FA 2UWCA 1EPZA 3H9AA 3MIEA 5C8CA 2CAVA 1D4M3 1LOFA 5JPNB 1HW5A 4AVSA 5BV6A 4YYOA 1OSGA 3M3QA 2EXHA 2MEV2 2D5HA 1PVC1 1TMF2 4XZPA 4RR3C 3IIAA 2D6LX 1TE1B 3AKQA 3OCPA 4W6YA 4Y1ZA 3J9SA 1QHDA 4XTPA 1FNZA 1VAMA 1W6MA 1HQLA 1PZ8A 4AWDA 1YJLA 4XXAA 1ZZ8A 4COYA 5I0RA 4INDA 4GWMA 1AXZA 3BU7A 3VV1A 2UWBA 1Y43B 2ET7A 5L7OB 1FATA 1LOGA 3T2TA 1NOVA 2E7QA 2YMZA 1TME2 1BEV2 1CAVB 4BPZA 2BW8A 1R082 1RUG3 1QNWA 2RS13 1KRIA 4L2NA 2C9AA 1QDCA 4JRLA 4PBOA 5EV7A 3WDXA 5GZCA 4TZDA 2VOWA 4RHV1 1RHI2 4P14A 4TYSA 2XJTA 2HWE3 1W2UA 5T52A 1BVP1 2YY1A 3IN9A 5JIAA 4YGCA 4HN0A 2WZPP 2LM3A 4HPKA 1HV0A 2JG9C 4WBBA 4YM0A 5IT6A 1NQJA 1DGWX 3HQXA 2CTVA 4R8HA 2XJQA 3O0XA 3OJBA 1V6MA 3OY8B 4HVOA 4MX3A 4YVWC 2PFWA 1COV1 3N35A 2A6XA 1OOPB 2D3SA 1VBB1 1NY72 4CEWB 5C33A 1HXS3 2PHFA 1AR62 1YRZA 3IPVB 3DN7A 4MSVA 4HT1T 3ELNA 4I0AA 2BEOA 1KS4A 1ZBE3 1CGPA 1BZWA 1Z7S3 4NWVA 1G6NA 2DTYA 4K3UA 1N3OA 4XIOA 4IEVA 2VMIA 5JPMB 4YRDA 1VAKA 3NV2A 3AP4A 1W6NB 3GBGA 4WM8B 2AYHA 3RI8A 2XPJA 4B29A 4YG0A 3ZSEA 4D7YA 2EVXA 4TSVA 1SLTA 5T5OA 4P9XA 3VZLA 3B9IA 1ND2B 1NXMA 4J1XA 1DQ2A 4GH4C 3INAA 4YZ3A 4WVZA 1TNFA 1S2KA 4FP2A 4YGEA 1LKNA 1Q56A 3ZMOA 2JG8B 1BVVA 1QNYA 3FFZA 1O4TA 4BYYA 4F7ZA 3SXWA 3POYA 4CDXB 2EXJA 2VNOA 2XVKA 4DMIA 5JOWA 1GYKA 3WHUA 2VVDA 4AEJA 1UAIA 3AFKA 1Q3EA 1WLTA 3H7YA 2W68A 3H8UA 4U2AA 3RYRA 3VGIA 1W39A 2VMHA 2XBO2 4IV1C 2ZGPA 2ZZQA 3FE5A 1YIPA 2D43A 4SBVA 5I0TA 1Y3TA 1REDA 1CAUB 2O1QA 3NW4A 4QQLA 1R1A1 2OUHA 3ZXDA 5KXEA 1LU2A 4XF0A 3VBHC 1VBA1 2SBAA 4YVSB 3R0RA 1RUC3 3AP7A 1QY4A 3ATGA 1SDWA 4DRRA 1LHVA 3JB8A 1ZRFA 3BB6A 5EYYA 4QPGA 4W65A 4CDWA 3EJKA 2WKKA 2ZMLA 3OF1A 1OFNA 3BOPA 4L97A 4I2OA 3PJQA 4R9CA 1V00A 4YW1A 2HWB2 2NN8A 4IERA 2ZGLA 2RJKA 2NMOA 1BYHA 4PIXA 5EWSA 5D8AC 1UL9A 4YW3A 2XLGA 1AHSA 4Q4W3 3NAPB 2Y26A 1PO23 4RS5B 5FCCA 3AP6A 1CAWA 2QCSB 2LUWA 3NV3A 1HXS2 1H4GA 1UZYA 2BVVA 2ZGMA 1YFUA 5C9AB 2BNMA 5L36A 3VDDC 2B9UA 4JV4A 2PN5A 1ZBE2 2ZHMA 2ZHKA 4FTBA 5DUWA 5FO8B 3AMHA 3FMGA 2IXKA 4AGRA 2QFEA 1VLNA 2C0ZA 3M8LA 3BCWA 4GWNA 4QGMA 1URXA 1HRI3 1JW6A 3N7LA 4P9LA 1RGSA 4V1PA 3T1LA 1QGLA 5J3UA 2A3YA 1AVBA 3MLJA 3RZZA 4ASMB 2GC0A 3ZPYA 3ZSMA 1ASJ2 1LESA 2VUAA 2PQQA 4KU7A 2P3KA 5KBFA 1SLIA 1VALA 5E8AA 2IXCA 3O7OA 2ZMKA 3EO6A 1XYNA 2EXIA 1DIWA 2ZOEB 1Q8QA 3ZN5A 4G9SB 2B8MA 1CESA 4OVEA 1SCSA 2Y0IA 2YROA 1ONAA 1D0GA 4XXPA 4PLNA 3O12A 2VNRA 3ZFFB 4FP3A 3NJZA 3RWNA 3ST7A 1QJX2 2FMDA 5CIRA 2A7AA 5GLWA 1JUIA 1SLCA 1PIV1 4PBPA 1IPJA 1EV13 2B5HA 2OIIA 1IQAA 2IXJA 2Q30A 4MXVA 3POSA 5LEJA 5FMOS 1LU1A 1ULDA 3O5SA 1Q8OA 3R6SA 2NQYA 4B4RA 4Q4V2 1LHNA 2FBEA 3S30A 1BXHA 3NVCA 3N7JA 4EWDA 1PO22 4MGKE 5DZFA 3NWKA 4LBJA 3MIFA 1WMFA 2PHDA 4MXWA 4U36A 3AYCA 1X33A 3WVJA 3AZXA 4WVWA 3RNSA 2R1BA 3ZYIB 5CFDB 1OKQA 3C2UA 1ULFA 1Z0HA 1UPSA 1BMV1 4BCUA 2ZAHA 3J8F1 4D3WA 3R4SA 5CADA 2R062 3CJIC 1FT9A 5BXXA 2HWC1 3Q9OA 5JCTA 4JDOA 4OFGA 4Y20B 3D0SA 5FBZA 5GALA 1J59A 5TSWA 3SMHA 4XFBA 1HRI2 3U07A 3DGTA 4YG6A 2E51A 2CV6A 1SLBA 4BH9A 1NE6A 4XIKA 2B42B 1S0CA 2WNVB 5KXBA 1OQ1A 3MIGA 2VNGA 2W52A 4XJZA 1N1SA 2KA3A 4N43C 2ZX1A 4RHV2 1DFQA 1DBNA