1H6XA

The role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
EPDANGYYYHDTFEGSVGQWTAAGPAEVLLSGRTAYKGSESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQRYDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE Y
publication title Clostridium Thermocellum Xyn10B Carbohydrate-Binding Module 22-2: The Role of Conserved Amino Acids in Ligand Binding
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 33
structure length 159
sequence length 159
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1h6xA00
5J1XA 3SEEA 4BK4A 4QX2A 4Z2AA 3K4ZA 1K42A 4BJ0A 3W5NA 5JMOA 3T2OA 4XUTA 2R7EB 1JHJA 2ZEXA 1ULOA 1UMIA 3GGLA 2Y8KA 3WF2A 1GNYA 4QAWA 4M4RA 5DMYA 4OMCA 3ECQA 3FHAA 3WF3A 3VD9A 2W1QA 1GOFA 5JR2A 3K77A 4IUGA 3VD3A 5A1AA 2VL4A 1WCQA 3K46A 5DN2A 4P02B 2VJXA 5C70A 1OF3A 3BN6A 4XURA 1W0NA 2WBKA 3K4AA 1JZ6A 2QQNA 3I2JA 3EYPA 2WABA 1W8OA 4W8JA 3A21A 5EJ1B 1JI6A 1CZSA 3OGVA 3IAQA 4CU6A 4KWUA 2JKXA 4CVUA 3WNMA 3OBAA 1H6XA 3ACFA 3C7GA 4LKSA 2ZEYA 2YFZA 5JXIA 2W47A 1F4HA 1JZ4A 3VDCA 4DXSA 4XUNA 4QX3A 3I3EA 2WO3A 4E8CA 3CMGA 2XQXA 4KMQA 1GQPA 2W91A 2VMFA 4BXSV 1JU3A 2RVAA 2BGPA 5F7UA 2DCJA 5LA0A 1L7QA 1UY1A 1LNSA 4A6OA 2VZQA 2BGOA 3WEZA 3IB3A 3NRUA 2ZXQA 2WQ8A 4DXRA 4BK5A 2JE8A 1CX1A 1JYNA 4DUWA 2V4VA 3CQOA 2JD9A 2ZEWA 1DP0A 1RYYA 1KGYA 3WF4A 3DYMA 1OD3A 4FI9A 1K45A 5IFPA 3SEPA 2W1SA 2VQTA 3I2IA 1UWWA 3MBWA 2B9VA 1K12A 2VOTA 4MGSA 4XVHA 1JZ7A 2C4XA 2HLEA 5IHRA 3WNOA 3T08A 3MV11 4QDRA 4QPWA 3C7HA 2YC4A 4ARYA 3CIHA 2J1SA 1ULPA 4A42A 4A45A 2QQKA 1OH4A 5CZKA 2J1RA 3HEIA 1L7RA 1NKGA 2L9LA 2WYSA 4A3ZA 3MUZ1 3JXSA 5G05L 2RJ2A 1JYWA 3T09A 4BDVB 4CU9A 5LA1A 1EUTA 4PQQA 4QDSA 1I5PA 3ACIA 2YC2A 1CZTA 1CZVA 1W8NA 3I3BA 4OUEA 2Y6HA 1PX3A 5G04L 3NJXA 1SG3A 3A22A 1W99A 3PUHA 5JUVA 2XONA 5JXHA 2EICA 3ETPA 3UESA 2J1TA 4MGQA 3WNKA 1JZ5A 5JXGA 2DCKA 1WKYA 3FN9A 2C26A 4JKMA 2VCCA 2WZEA 3CKHA 2QQJA 2VM9A 1W9TA 4XUPA 5DPNA 1XC6A 2PQSA 3VD4A 3K75B 3NJVA 2VZUA 4P08A 3T0AA 1US2A 2LS6A 4XUOA 2Z4FA 1JZ2A 3GDBA 1UY4A 1EUUA 2YFUA 2RV9A 2WDBA 2VZSA 1UYZA 3VDBA 2ORZA 4YPJA 3MUY1 3FHQA 4A41A 2V72A 4P5YA 5IYYA 2J1AA 4GZ9A 3F2ZA 3OGSA 2VCBA 4GWIA 2VO5A 4ZXEA 2W94A 5JXJA 1DLCA 1PMHX 2VQUA 3C7OA 3SKVA 2W46A 1SDDB 2HYXA 1UYYA 3ABZA 3P1IA 2VTFA 4QX0A 5I0DA 1JYXA 3E1F1 3A7QA 3HNYM 3HPNA 4QX1A 2J1EA 2BERA 3LEKA 1IQDC 3OG2A 2W5FA 3LPGA 4JKLA 1NAEA 1R64A 4D8MA 2Y6KA 4QDQA 4M4PA 3IDAA 1XNTA 3WF1A 2QQMA 2WZ8A 4RYDA 3IAPA 4ET7A 2WUHA 3T0DA 1O8PA 4A44A 2B4KA 3CZUA 2E26A 3J7HA 3THDA 4QB6A 4XUQA 2EIDA 3T2QA 3LPFA 4UOJA 4CUBA 3CDZB 2XOMA 1TVGA 3UETA 2W1WA 3DECA 3LE0A 3W5MA 1UX7A 2X10A 2VZPA 3ZM8A 1XPWA 2QQIA 4QB1A 1K3IA 2WAOA 3I2FA 1O8SA 1UY3A 2WO1A 2VMEA 4AAXA 3CZJA 2JDAA 1W9SA 2WO2A 3A23A 2ORXA 4A4AA 3OB8A 3AC0A 4GWJA 2V5DA 4DEQA 1P8JA 5LA2A 4CU8A 1HN1A 1TG7A 2OKXA 3D3AA 3GXUA 2BBAA 3NNGA 5EJZB 1UMHA 1GOHA 2Y6JA 2J1VA 2VZ1A 3VD5A 4OYUA 1JZ8A 1US3A 2J7MA 2W9XA 1GMMA 5DQ0A 2VZTA 3SKJE 1UXZA 1KEXA 1UYXA 1J84A 2ID4A 3HJRA 2W95A 4MADA 4XZUG 4JX0A 3OEBA 2VR4A 3VD7A 2X05A 4LHSA 1CIYA 4ZZ5A 3I2GA 1GOGA 5B4XA 5FUIA 4OZOA 3LEIA 3LQCA 5IJRA 3C8XA 3HOBA 4DUXA 2VZ3A 2WN3A 1OF4A 2Y6GA 3GM8A 1UY0A 3HNBM 1XNAA 1NUKA 3I2KA 3WF0A 3OGRA 3HN3A 4ARXA 2W87A 3HNMA 3P6BA 2Y6LA 5LCWL 2VZVA 4ZZ8A 2VCAA 3ACGA 2QQLA 2W1UA 4DEVA 1UZ0A 4OMDA 2CDOA 3C7FA 3FL7A 2WN2A 4E8DA 3VDAA 4QB2A 3ACHA 3EB7A 5IFTA 2YG0A 4MOAA 4RN5A 4CU7A 5C71A 5B4NA 2VZRA 2C9KA 3MO4A 2VMDA 4UI9L 2LW8A 3IIIA 2EIEA 5C7GA 4PF1A 3NQHA 3I2HA 2BZDA 3WSOA 1NX9A 3WNLA 2X09A 2XHNA 4DXTA 1SHWB 1DYOA 1JZ3A 4D0QA 5HPOA 1O59A 3I3DA 3LEGA 2WAAA 1MPXA 4P00B 3MV01 2W92A 1YQ2A 3I97A 3THCA 4AG4A 4CUAA 2W3JA 2QQOA 3OEAA 1F4AA 3T0BA 3WNNA 3WQBA 3BGAA 4TXWA 3U37A 3C7EA 3K4DA 2ZEZA 1D7PM 2VC9A 5CYYA 2EIBA 2YB7A 4KI5M 3UNPA 1J83A 4DUVA 1T2XA 5HXMA 1OT5A 4HG6B 3DYPA 4CUCA 2DDUA 1GU3A 4LQRA 2E31A 5EIYB 4JHZA 4L0PA 1GUIA 3T2PA 1JU4A 1PX4A 2QBXA 1JYVA 2E32A 2E33A 1W9WA 1PMJX 4W4ZA 4PT6A 3PUIA 3WNPA 2J1UA 1UY2A 2J22A 2VMCA 2KD7A 4W50A 4MO3M 3DYOA 4UAPA 2Y64A 4TTGA 2VZOA 1BHGA 4LPLA 1UXXX 4ZY9A 4JKKA 1H6YA 2CDPA
chains in the Genus database with same CATH superfamily
4MXVA 2JB8A 3ZFEC 5J1XA 2GH8A 3ZFFA 4Q8LA 2FDHA 2FHRA 3WW1A 1HLCA 4QX2A 4EV0A 3VZMA 4TLGA 2VD7A 4Z2AA 5LRSA 3AVRA 5F5IA 3ZYIB 2QQUA 1W3VA 4HL0A 4CE8A 1JHJA 2DU1A 4FP3A 4BQ3A 3KF5A 4BISA 1VRH2 4HONA 1POV0 1ASJ3 4Z8BA 1UMIA 3MYXA 2XQRA 3GGLA 1X8EA 1APNA 3IIAA 3WF2A 4A7ZA 4NWVA 4YG3A 2UY8A 3IDEA 4QAWA 5CKMA 4M4RA 4AFDA 1DQ5A 2YY1A 4OMCA 3ECQA 2IWGB 4RFT0 2FMDA 3O1SA 4NO4A 1NCQA 1SCRA 2FZ2A 1GOFA 2ZACA 3ZSEA 2UY9A 4BMBA 1WCQA 1ZA4A 2ES3A 4IERA 4P02B 4YZ4A 1OF3A 2Z2SB 3AZVA 2Q8EA 2MNGA 2QQNA 4M3CE 4Y1ZA 4X8PA 1JMUB 3WG1A 2IXLA 3ZMOA 3S5AA 2OQ7A 4BQ1A 2GN7A 1RUJ2 3MHZA 3OGVA 2DUOA 4BYYA 5BNNA 2PA7A 2VXRA 4EZ4A 5HXVA 4PJYA 4ATFA 1OKOA 5EYYA 2CL2A 1QMJA 4W6WA 1XRUA 2V4AA 2YBPA 2AYHA 4MGTA 1VB4A 4LKSA 2ZEYA 1C5IA 4AAPA 4JHTA 2GALA 1F4HA 3RVHA 3MI8A 2ZX4A 1K5MC 1PGW1 2D3SA 3ZXDA 4DXSA 1J59A 1PM4A 2UWBA 4Y22A 4EQVA 4Y1VA 3SCFA 2CTVA 2XQXA 1KS4A 1JODA 3E97A 5FMCA 5FXXA 4XJUA 2W91A 4YG0A 1Z78A 4XQWA 3AYDA 2NZ9A 3AKPA 5FZIA 2PAMA 4JTNA 4BXSV 4MGKE 4D7YA 1HIXA 1PVC1 4OHWA 1LECA 5FZ8A 1ULFA 3U10A 1XYOA 5F7UA 1VBC2 4QQHA 4EWAA 4AHXA 4CCKA 1PGSA 4A6OA 4FTSA 1Z7S3 1VBA3 3WEZA 3AYEA 5JPMB 1HB1A 2IFWA 2ZXQA 4XACA 2ZPXA 4DXRA 4GMP0 2D6LX 4KH9A 5FY0A 5IAXA 2X5IA 3PNAA 4LLFA 4IV1A 4MXWB 4K1ZA 3T30A 4R4XA 1BKZA 2WKKA 3B93A 3TN92 2OYZA 2F4LA 1GWLA 2OA2A 2RS13 4HOOA 4R8HA 2WINB 4RA0A 2JD9A 2ZEWA 3PU8A 2BFUL 3KD4A 3OYWA 4Q2FA 5C5TA 2G4IA 2H6BA 4RHV1 4EZHA 1X9PA 3H8XA 1OD3A 4YW5A 1HB2A 3RNSA 3ZXEA 4BQWA 4FPOB 1LOBA 1LB2A 1IG0A 3J8F1 3ZFEA 4D6RA 1WLDA 2W1SA 4FT8A 3M3OA 1BQPA 3ZDSA 4HVOA 2EVXA 5IW0A 5A7PA 1GZCA 1AL0G 3PVOA 4XVHA 2XLFA 5IVEA 1ZNPA 2RG4A 3QACA 1NYWA 1W6MA 4META 4BQ2A 2HLEA 1OXCA 3ZXAC 2VBDA 1W2NA 5DXDA 5IHRA 1ZRCA 3O1MA 3WNOA 2N7GA 5GZGA 1BVP1 4FO9A 3I7DA 2D44A 2LTNA 4ARYA 3CIHA 4RS5C 1WBFA 4KWKA 1ULPA 2BQPA 4AEDB 5H9RA 1STMA 2VE1A 1H2KA 2B8MA 4HVRA 1OA3A 1OH4A 2QQVA 5C3RA 5CZKA 3O1VA 4YM3A 1EV12 5AFEA 2A3WA 2J1RA 3UT0A 4LXLA 1CPMA 1OD5A 4K40A 5F3IA 1L7RA 3VZLA 2GMEA 5DZEA 4QQPA 3I49A 1U0AA 4A3ZA 4LE3A 2FDKA 3TEYA 2HWF2 2RJ2A 4EE2A 5LZ6A 1QDCA 3DKWA 5F32A 4CU9A 3DPRB 3PTYA 4YLZA 1RUH2 1CZTA 1CZVA 1W8NA 3H3LA 3VBHB 1FMD1 4IEYA 4KU7A 1MVQA 1IPJA 1GQGA 1NQDA 1H30A 3OPWA 2WQZC 2VPVA 1RUF2 1SFYA 2C24A 2QJVA 4NJ4A 3RG0A 3A22A 5GZFA 3IDCB 1UZVA 2GH2A 2PLV1 3PUHA 4UWDA 3EQEA 5APAA 4AI3A 4BM8A 1HXS3 1MS0A 1K5MA 1X33A 5KHJA 4QMAA 4AGVA 4Z2WA 4R4ZA 1R082 3ZKYA 2J1TA 2VUDA 1JZ5A 4PLOA 2Y0OA 2HWB3 3BODA 3KT1A 4GWNA 2DCKA 4URTA 5LY2A 1WKYA 1RUJ3 3OBZA 5FPBA 2TNFA 3FN9A 1GLHA 2YDEA 4UXAA 5ANQA 2C26A 4JKMA 3CKHA 2QQJA 2GC0A 1XYNA 1MS9A 3OD4A 2RMU2 2ZGOA 1CQ9A 2Z5WA 2V5YA 3BOPA 1AL22 2A6WA 1BK0A 1O5LA 3QH6A 4LK7A 1BXHA 4P08A 1UOFA 4KBBA 2NN8A 3M1HA 5JPNB 2DU0A 3VBHC 3NWKA 4AF9A 2OW4A 2VW2A 1WW6A 3O0XA 4IXLA 3TWIA 3GDBA 1Q8OA 2I45A 5CU1A 3BTAA 2XUMA 3KT7A 4EN6B 1GNZA 3O0VA 4ASKA 4S2HA 1ZREA 3PUQA 2BOJA 1GSLA 1COV1 1VBC3 4Y3OA 3LDRA 1CONA 2FMYA 2NMNA 3PVBB 2B5HA 5FZCA 4E2QA 4CDWC 4GA9A 5D8AC 3K48A 2HBTA 2V72A 4YZ3A 3F2ZA 4HN1A 2B9UA 3IMNA 5BV6A 4OHVA 3WQ7A 5BNQA 4QQ2A 1I1EA 5A3WA 2WZPP 3WP3A 3TN93 4LKEA 1RVF2 5FKBA 2D40A 1N47A 1RITA 3T2TA 4GIQA 4OHXA 1PMHX 2VQUA 5JXJA 3N4MA 3SKVA 2O14A 2JE7A 2GMMA 1W39A 3ABZA 3BTYA 3MLJA 4K7JA 2VTFA 4DRRA 1BEV1 1F8VA 2G9FA 3KGZA 2CU5A 4HETA 5A7OA 1LHWA 4RS5A 3A4UA 3MICA 3HPNA 3USUB 4MG2A 1Q43A 2BERA 2DWRA 4MXWA 4XW3A 3LEKA 5KHIA 3BKZA 3OGGA 4AHZA 1AYM3 1GP6A 2BU9A 1LOAA 2CAUA 2A6ZA 1VAVA 1VE0A 2JB4A 3GCWA 1UU5A 1S0JA 2Y6KA 4M4PA 2ADDA 3S7IA 1HQLA 4HFSA 5BNOC 3WQ1A 2ZGNA 5T52A 2BVBA 4Q4Y1 1R092 4YVSC 1KJRA 2BGCA 4Q4V3 4P14A 3MLKA 2C9AA 3B00A 3CZUA 1SFPA 5ACA1 2WQ4A 4MLOA 2OUHA 3J7HA 1WMDA 2JENA 2WT0A 1PO21 5A6XA 1AX2A 2JJ6A 4XUQA 3LPFA 5LBCA 2HWF3 1FV3A 3HAGA 4PLMA 1OHFA 3KMHA 5JIUA 3POYA 2I2SA 1WBLA 4O9EA 1BZWA 1TME1 1LHUA 3UYJA 4UW3A 1AR72 2HWC1 5JWPA 3M3EA 4AVAA 1QQP1 5FZ9A 3UKTA 1TVGA 4BLIA 4QXBA 1RB8G 2KA3A 3UETA 1AR81 4EN8B 1S0FA 1YQ8A 3AYCA 4I3PA 3N9PA 5H9SA 2W1WA 5EHDA 3DECA 2DBIA 4LR4A 1X8MA 3D0JA 1XNBA 4E2SA 2WA4A 4LBKA 1LHOA 1YFUA 1ZBE3 5K8SA 3CU7A 4FPGA 4QB1A 1W6QA 1J3RA 1V9U1 3VL9A 2OX0A 2RM21 2ET1A 1K3IA 1RHI2 2ZGLA 3CF6E 3JBG2 4RQPB 4TN7A 5F2WA 2GDFA 3VBHA 1KFUL 1UY3A 1FXZA 1Y9MA 5LASA 2VMEA 1CX4A 1TMF3 3CZJA 1HKDA 2P4EA 4YM0A 2JDPA 4AAXA 5IK7A 1VRBA 2ORXA 1OLMA 1M06G 4BWOA 5FMDA 2V5DA 4TSVA 3WLUA 2XMLA 3NV1A 3NV2A 3RI8A 3BALA 1TG7A 2WWSA 5EYXA 4N53A 4P9IA 4HKLA 4CDWA 1A3KA 4JV4A 1AL23 1SFNA 5D8AA 3ST7A 1RUOA 5FZKA 3NNGA 2D93A 5FMOL 1MEC1 2PN5A 3OUJA 2CV6A 2VCMA 1TNFA 5DUUA 4RSUA 3KZ4C 2YGLA 1RGSA 1ZZ9A 2J1VA 3PDQA 3POGA 2KM2A 2RR12 4AFMA 4OYUA 4CP1A 5I0SA 1JZ8A 2J7MA 3O1RA 4CP2A 1LR5A 1CWPA 1VBB1 5LEKA 3POJA 1JUIA 3HJRA 1B35C 2OZJA 2CGPA 1DQ4A 1LJ7A 2XBO2 3B5LB 4GAZA 4JX0A 5FZBA 1W6OB 2P3JA 2WS93 3NSTA 4RQPC 1KD7A 3WCSA 2F17A 2VR4A 4XAEA 3IPVA 4LHSA 4AFBA 4E2GA 2RS53 1CIYA 4ZZ5A 3I2GA 2GN3A 3QOPA 1QJX2 1GOGA 4OZOA 3H50A 3THTA 3LEIA 1HRI3 5FRAA 2ZX3A 4B7KA 5JDBA 1RUC2 4YGBA 1D2QA 2EIGA 4Y5Z0 2EXIA 5FO7B 5FZ4A 3WR0A 2DCYA 2YV8A 1CAWB 4DZGA 1OF4A 3J7MA 3GM8A 1UY0A 1OOPB 4YM1A 5BNOA 1RIRA 1T6BX 3I2KA 5DG1A 3WF0A 2G19A 4ISQA 4G4FA 3AX4A 2PHRA 5K0UB 2JDMA 4FPHA 4YVSA 1R1A1 2BBVA 1X50A 2A71A 2DTYA 3HN3A 1C4RA 4QKFA 2W87A 1VBE1 3ZXKA 3O12A 3R05A 1ZRIA 5LCWL 1VAKA 2IVIB 4ZZ8A 1S55A 1FNZA 3E6DA 4FPFA 1VP6A 3KLSA 4WM7C 1LHVA 1UZ0A 5GKAC 4O61A 2Z79A 3FL7A 1JN2P 4PHZA 4CEWB 2YPDA 1LOFC 5FZEA 3D0SA 1O3SA 1GBGA 2EXKA 3ACHA 4WM8B 1RXGA 2EALA 1W04A 3USUA 2YXSA 3EO6A 4BQ4A 3ZPYA 5C3QA 1ZBA1 2RS31 4RGAA 5FZDA 3WDWA 2GNTA 3K51A 4B3NA 1QJY2 2PTMA 2VMDA 4UI9L 4B29A 5T5JA 1OOPC 2XKPA 4Q4W1 4IESA 3VBRC 2O0OA 3I2HA 1IG3A 5K0UC 1AX0A 2GC3A 3S6PA 4I02A 5IUQA 3G6JB 2ZMLA 3HWJA 2X09A 2XHNA 5DZGA 1AJKA 1DYOA 3GNEA 4D0QA 4GKXA 5HPOA 3VLBB 1JZ3A 3PL0A 1O59A 2EA7A 2WIIB 1W6NA 4BIFA 3LEGA 3M70A 4N43B 1FAYA 5JOWA 2WZR1 4L97A 4AI0A 5KXDA 4K8FA 4UYBA 1OFNA 2X53S 2BOIA 2Z69A 3THCA 4AG4A 2W3JA 4H14A 3OEAA 1OVPA 1V6LA 1OUSA 2V73A 5IATA 3BGAA 1BBT2 2CNAA 1VRH1 4EWEA 4PLNA 1WCUA 2CHHA 2RJLA 3AVSA 3C7EA 2ZEZA 3R4UA 4AGGA 2YZ4A 3TEZA 2YU1A 3B9CA 2XH6A 5CYYA 1PO12 4YW3A 2C1FA 4KI5M 5JLVA 3EMRA 2MEV1 4DUVA 1OVSA 1B35A 1OT5A 1VR3A 4OLLA 5BYNA 1W6PB 4RQPA 1O4ZA 3ZXJA 1PVC3 2ZGUA 4LQRA 3UJOA 5GZCA 1FPN1 5LATA 1DYKA 1DF0A 2E31A 2ZOEB 3N7KA 4LULA 1WCSA 4XJZA 3NKTA 4JHZA 4L0PA 1GUIA 5A3MA 5CB7A 2OUJA 3RMYA 3LAGA 2SLIA 3H9AA 3ZN4A 1PX4A 2Q8OA 4N7UA 5FP4A 1G9CA 1RUI2 1E57A 2YYOA 2PHTA 1DQ0A 1MS8A 3PUSA 1TNRA 4D69A 1VBD1 4Y5SA 5IVCA 2IFRA 4BA6A 4W50A 2BNMA 4HMZA 3PJQA 1GZWB 3AZYA 3K2OA 1OLRA 4JRAA 3ZSKA 5F37A 4TTGA 5A3TA 4Y33A 2JECA 4ZY9A 2HWE3 2UWAA 3LF7A 4JDNA 4EYUA 4XETA 1H4HA 3EHKA 4QPIB 4XF1A 1AR63 1IZ3A 1DGWX 4WM7A 5T55A 5CAZA 4Q27A 5LW9A 5C6CA 2R49A 3ZFFB 3KVBA 3MZHA 1K42A 4S2DA 4K20A 3W5NA 1LOFA 2R7EB 3ZR5A 2DVBA 4FOYA 3FLTA 3KHBA 5I91A 4XDOA 4CEYC 2H6CA 3QBQA 4D94A 4N7IA 3RZZA 2YU2A 5ISLA 4YZ5A 1RMU1 1QH6A 2AACA 2YMZA 4Y1YA 2Q4SA 3TRSB 5F1RA 4RR3B 1CAWA 1NZCA 1RXFA 3OTFA 5DAPA 1FI2A 3AP4A 5E1RA 1OOPA 1V00A 2HWD3 3VD9A 3VBRA 5DZFA 4XEZA 5JR2A 3HVDA 3K77A 5K0UA 3B69A 4UFLA 4WVVA 1NCQB 2ZGQA 1I6XA 5A1AA 3VKOA 4AXOA 1LRHA 1ZZ7A 4XMIA 4I3GA 4XURA 1E5HA 1KDMA 2IC1A 2JICA 2WBKA 1ASJ2 4ORFA 3V56A 3NNLA 2ZGKA 3EYPA 3B3QE 3V0BB 2W68A 2F4PA 2WABA 3MPPG 1WWYA 3A21A 1CJPA 5EJ1B 3IZOA 4BOWA 3BU0A 3RYRA 1SACA 1OH3A 4KWUA 4RGKA 5I8TA 1ZZBA 3AL5A 4FOVA 1H6XA 3MLLA 3ACFA 2PLV3 4NHXA 1V70A 5FZ0A 2PHDA 1RUG1 4IEUA 5JXIA 3H1MA 5EZWA 3LD8A 2WLQA 4DO0A 5F3EA 3VDCA 2BPA2 4RR3C 3AFGA 4AVCA 1WD4A 3NV3A 5F3GA 5LBFA 5F6KA 5FBZA 3SH4A 4Y22B 1EAH3 2XL9A 2XVLA 1EV11 3O1OA 2VMFA 1NXD1 1G9FA 4A2UA 5A70A 4UFMA 3UV9A 2PXJA 5BUVA 2Y6FA 1JU3A 4LKDA 1MACA 3E5QA 4WV8A 5IVJA 2VAUA 5HCBA 2LUWA 4LHKA 3U78A 1W0OA 2X29A 5A3PA 1L7QA 1LNSA 4SLIA 4AI1A 4NVPA 3PMSA 2VZQA 3IB3A 1RUH1 3NRUA 2NM1A 3GCXA 4H7MA 2IUWA 3RJ2X 2WQ8A 3IMMA 4RFRB 1BLZA 3E6BA 1FNYA 4BK5A 1CX1A 3AZWA 5T54A 1QJEA 2X5IB 4E4ZA 3KQ4B 5CG9A 4IV1B 2RJKA 1RYYA 1KGYA 5FYCA 5CBLA 2Y34A 1AR93 1XYPA 3PJYA 3OYWB 1S4CA 5HCAA 1W28A 1W03A 1Z7S2 1VBA2 1R081 2DCZA 5IFPA 4OQ9A 3ZIWA 3FC0A 1OPOA 3JD73 4QQLA 1O6UA 1YJLA 5H9PA 3ZFEB 2UU8A 5F6LB 1W6PA 3AJYA 2WNVB 5L73A 4YSFA 1V6JA 3C3VA 4FFGA 1QOOA 2B9VA 2VOTA 3LFIA 1VMFA 2G9GA 5TSWA 4MGSA 4G3YC 4AQ6A 2JIGA 4CEYA 2ZHMA 3FMGA 2RS12 3TNQA 4E9KA 1JZ7A 3M3CA 2RMU1 5LRRA 2BV4A 5A6QA 5C8WA 1BEV3 3WZ1A 5KR7A 3MV11 1DIWA 4L9BA 3UGHA 2XPJA 5EP9A 1FOD1 1ZRRA 1E5RA 2QQKA 4ZONA 1PGL1 1YNAA 3CL1A 2X5IC 2GNMA 1GZWA 4RGGA 5FYTA 1DG6A 2GP3A 4C1XA 4R9BA 1NKGA 1SPPA 5FPLA 2L9LA 1VB2A 1GP4A 2DVFA 1ODMA 5FWEA 5GLUA 5JAXA 1JYTA 2PYTA 1IS3A 1PK6C 2DCTA 2E7QA 5FZGA 2JDUA 3HR9A 3N36A 4BDVB 4F3JA 1EUTA 4PQQA 1I5PA 1POV1 1RUD2 1WA4A 4QM9A 1KS5A 4AVVA 4DRVA 3I3BA 1IS4A 5FYUA 3U75A 4XFBA 3NW4A 2OS2A 1JOPA 2WNVC 2P34A 1UL9A 1QXRA 1HRV1 3ZYJB 1AXYA 1PO23 1PX3A 4AEMA 4YW7A 1UZWA 1SG3A 1WD3A 4URAA 1G86A 3FLPA 2W0XA 2ETEA 3AZZA 3PHMA 2XONA 3RMXA 5JUVA 1WLTA 3W21A 5JXHA 4QPGC 1SCSA 2HWC3 4V2WA 3SHRA 4RR3A 1GWMA 4KQ7A 1K5MB 2R6QA 4MGQA 3N9QA 2I74A 2E51A 3POWA 1Y3TA 4JC1A 4NIAA 3ZXLA 1UCXA 1WCKA 2WZEA 1ULEA 1NE4A 2VM9A 3RSJA 4XF0A 2P37A 3FBMA 4P9JA 1V9U3 3IM0A 5IAVA 2HEVF 3K75B 3NJVA 1HXS2 3V0BA 1R091 3GZTB 3VBOB 4NOTA 4LA3A 2LS6A 2Y38A 2HWB2 2ZHLA 4EN7B 5A1FA 2YFUA 2D5HA 3DXUA 3ZLIA 1UD1A 5FYVA 2VZSA 1C8NA 1L7LA 2WL1A 1W2TA 1V6MA 3EBRA 4WZCA 3ZN5A 4Q0SA 1IOAA 1KFXL 3VDBA 3AMPA 1QXJA 3IWZA 4YPJA 3MUY1 4AEJA 1AR71 2ZGMA 3GBGA 1MEC3 1Y9QA 2FQPA 2ZBJA 3FHQA 3NNMA 4A41A 3RYPA 5FTTC 3LGRA 2J1AA 1SLAA 3D82A 1A6CA 3KB5A 4GZ9A 4OFGA 4S2GA 3OGSA 4GWIA 1LKNA 4X6QB 4Y5TA 4ZXEA 3PVEA 3MIDA 2P2KA 3N7MA 4GMP1 3DV8A 5FPVA 1VBB3 1QJZA 1IHMA 1T6GC 4JCKA 1DLCA 3J7NA 4W6XA 3WCRA 3C7OA 3PLQA 1UNBA 1H0BA 3MW3A 2OQ6A 3POEA 1SDDB 2HYXA 4ES8A 3RZJA 3P1IA 4NE9A 4QX0A 5IVYA 3JBG1 3AJZA 5A33A 3I8TA 4K3UA 2XJUA 4XOGA 5DUXA 4ASLA 2QQPA 2WT1A 3VBOC 2P3KA 2VVFA 2XUEA 2VGDA 1QU0A 2J1EA 2R072 1C8M3 2ZGTA 4RS5B 3UGFA 4MX3A 5J09A 3GBFA 1SLBA 5FP3A 3OG2A 2W5FA 3H8UA 3LPGA 4JKLA 1NAEA 1RJ8A 4LBJA 2P17A 2AH2A 4LBNA 5GLTA 3MW2A 1CR7A 1R64A 1EYBA 4QDQA 2VUCA 4BPZA 3IDAA 4UF0B 1PK6A 4D8MA 4Q8KA 5L19A 2B46X 1RUNA 2PFWA 2D98A 2JE9A 1R1A3 5E88A 4W6YA 1Z0HA 4DIQA 3MIBA 4ET7A 2WUHA 1O8PA 1VBE3 3D6EA 3JCIA 1PHMA 4A44A 2RR11 2WNVA 4CPBD 2B4KA 1W8UA 2Q0AA 4CCCA 1AYM2 2ARCA 2O8QA 5JOXA 2WA3A 5FYIA 1PIV3 1QH7A 4BE3A 2JDYA 1UKGA 1ST8A 1IS6A 2XBO1 2A6XA 5K4LA 1V6IA 2WSVA 2ZMKA 4XFAA 4QPGA 3TNPB 4CUBA 3W59A 5JSRA 2R063 4QU1A 2P6HA 2R0HA 1YRZA 3CDZB 1RUD3 5FZ1A 2XOMA 3FZ3A 2BNOA 4Q4V2 2RS33 4XFGA 3ZYFA 1PZ8A 4R9AA 4ZU4A 1YWKA 3BU7A 4E27A 1QY4A 2JWPA 2DF7A 2P5BA 5FLJA 5HV4A 1LULA 4XPVA 4NHMA 3KCXA 5FP9A 4DY3A 2Q1ZB 2VZPA 2GMPA 4LBQA 5J98B 1LEMA 2VH9A 3AZXA 2W39A 1XU1A 4M3CB 1MS3A 1W6QB 2WAOA 5A7SA 1N1TA 5F5QA 5FAXA 3GZEA 1UOBA 1C57A 3KWVA 2XDVA 3N7JA 2JDAA 2R1DA 3POFA 4JAAA 4A4AA 3A23A 1QWRA 2WZR3 3GF6A 3KV4A 4NRQA 5JI9A 4KWJA 2HKXA 2Q1FA 1YO8A 1YQCA 1P8JA 1MS1A 3HBZA 2PELA 2IZWA 3OUIA 1OPMA 4FVVA 1HN1A 4ONUA 2OKXA 1ZBE2 1AYN1 3WY6A 5KC5A 1WLWA 4OVEA 2PMWB 1MZEA 4N53B 1QGLA 2A7AA 5AVPA 2ZS6B 4NAOA 3ZMNA 2WFF2 3H1WA 5DDJ1 2XB6C 2XR4A 5D8AB 4BXFA 4CDWB 2OZ6A 2WNUB 3PURA 1TMF2 3BPSA 1Y43B 3NJYA 4XFIA 4XTPA 3NO8A 2MEV3 2W9XA 3W9AA 1GMMA 1QJY1 4FSJA 1WA6X 3QCWA 3SKJE 1J3QA 4GD4A 4P9GA 3ILNA 4YZ1A 2ID4A 1LOGA 2B42B 2W95A 3PIGA 4OUSA 4QKDA 4LTAA 4MUVA 3LFMA 4QKBA 2X8KA 4XZUG 5H9QA 2DFBA 3D4KA 4CP9B 3OEBA 1FPN3 3DGTA 1MZ6A 4K1YA 3VBOA 2QNKA 3LIHA 5HI0A 4HKWA 1SBFA 1FX5A 4I30A 3IPVB 3ROUA 3CJIB 3T4VA 1XBFA 2G9ZA 5BNPB 4IEPA 1W8ZA 3C8XA 3AMHA 1Q8SA 4XQ4A 4K8RB 3OBRA 4CCDA 2WN3A 2Y6GA 2XVKA 2ZKNA 5B2GB 1VBD3 3HNBM 4WVMA 1NUKA 4YM2A 5FZLA 4N53C 3BCWA 2WS92 4GB32 5LBEA 3S7EA 4YNIA 4E4DX 4XJAA 2VQ0A 4QX8A 3THPA 1AUYA 5BNOB 2QKDA 3AP7A 2WNUC 2RS52 3VHPA 3VL8A 1BMV1 2R073 4YVSB 1IS5A 2ZZJA 1PO11 2VBBA 1HRI2 4EJRA 4ATEA 3CO2A 2FCVA 4FQZA 4IEVA 2VCAA 4I2OA 4WVWA 5FYMA 4C1WA 2Y60A 1WMFA 4QX5A 1CJDA 4OMDA 1PVXA 2QZ2A 1O4TA 2WN2A 4AR2A 4E8DA 4IEZA 5KHHA 3VDAA 3ACLA 4JZRA 4CCLA 3HBKA 2EXHA 3RZKA 2BUKA 2W2IA 4RN5A 1RMU3 3CJIC 5D21A 5AC91 3HIFA 1CAUA 5BNPC 2VZRA 3AP9A 4AI9A 4KBZA 5HCHA 2VMIA 1HX6A 3K3NA 3MO4A 3ME2A 5A7NA 2LW8A 5C3PA 3IIIA 1U5IA 4UF0A 1CESA 5CVRA 2P6CA 5DAVA 2EIEA 1LOEA 4ZU5A 3NQHA 5FY4A 1MS5A 5FZHA 1ONAA 2FCTA 2XJVA 5EPAA 5FV3A 4YYOA 2AZ5A 1NX9A 2CGOA 3JZVA 4QD2A 2QCSB 2D5FA 3O14A 4DXTA 1W8WA 4X8NA 5AFBA 2R16A 2YROA 3VZJA 3I3DA 2R041 1OQDA 1VIWB 1D4M1 1NLQA 1W6NB 2VU9A 5C9AC 3ZN6A 4P00B 1F5JA 3BVCA 2W92A 4CYDA 4K21A 4XE9A 3I97A 1IPKA 1C3HA 4Q26A 5T5OA 1OMIA 4CUAA 1ODNA 3MEPA 5DUWA 1OSGA 1QJU3 1OKQA 1TQ5A 4FXKB 5LK7B 3T0BA 3KVAA 3WQBA 1V6NA 4KWLA 4AW7A 4CCEA 4UW5A 4BZ4A 4JQTA 1REFA 3AP5A 1RC6A 1W9FA 1EY2A 1ZVFA 1ULCA 2XLAA 4HN0A 3UNPA 4LK6A 1J83A 1PM7A 1G9DA 4KNCA 5I0TA 1SEFA 3ZFGC 3BTXA 5EJ3A 1VMHA 1W05A 1RUE1 2AEZA 5CIRA 1B35B 3DYPA 1VALA 4M3CA 2DDUA 4Z1VA 3WV6A 5C8CC 2W52A 4P9LA 4X6RB 1UAIA 4NPMA 4AI2A 3H7YA 3WDVA 1G6NA 1W90A 3IKWA 4N8MA 2WFF3 4J1WA 4XFCA 4GKYA 2BVVA 4XBLA 1DLLA 1TE1B 4H7LA 3T2PA 1UU6A 4LO7A 2E33A 5KHKA 1YFYA 1W9WA 2CWMA 2ENRA 1PMJX 1A78A 3SH3A 2FCUA 3VHOA 3ORJA 3VKMA 2J1UA 5FWJA 1NCRB 2E9QA 1UY2A 2J22A 4IGPA 3RZMA 4AVTA 2VMCA 2JKBA 2ZHNA 1VLNA 1PVC2 3FFZA 2VQAA 2JDZA 2VZOA 2WNUA 1S2EA 1DGRN 5A6ZA 4LPLA 1YIPA 2EF6A 5SV5A 2CDPA 3QH7A 1YHFA 1AF9A 4FAHA 5FPUA 4Z92B 1E5SA 1S0BA 2YHJA 4IEOA 5FLIA 3VKFC 3ZKUA 1JYIA 4PQ9A 4IETA 3KF3A 2CAVA 3AFKA 4IV3B 5FY1A 3ELNA 5FZOB 4CP9A 2A6YA 4WM7B 2VOXA 3T3YA 3AMNA 4BJ0A 3OJBA 1F31A 5L7OB 5JMOA 4XUTA 3MF6A 3D8CA 2ZGRA 1ULDA 1X82A 4GB33 5JZGC 2VTXA 1H2NA 4CDQC 3BTZA 5C5UA 1DZQA 4XF4A 5FPZA 1G8WA 3CJIA 3OOXA 4XJ9A 2A3YA 4MSVA 5BNPA 3VB9A 2FDIA 1FOD3 2HWE2 4XBNA 5LY1A 1WGPA 2ZX0A 1GNYA 4XC9A 1AR62 3JB4C 4PF5A 4O9GA 5DMYA 5J48A 1ENQA 3FHAA 1NCRC 5J3UA 4DPNA 2W1QA 2VVDA 3PTRB 4TYSA 1ENRA 1MS4A 1N1SA 1G9AA 3J7LA 3NNJA 4HK8A 3VBRB 3N35A 5DN2A 1ZA7A 3KV5A 5C70A 5GLVA 3BN6A 4XDQA 1Y4WA 1Z7S1 4XF3A 1VBA1 3K4AA 3ETQA 2Q1MA 1HJFA 2QE3A 3I2JA 5SV8A 3URFA 3UJQA 1OA4A 4F8AA 5M0TA 4ISRA 5C9AA 4IV3C 2HEYF 4ES9A 4Q4X1 1CZSA 5A3OA 4AL9A 4TWTA 5L7OC 2HWD2 2BW8A 4IEXA 2JKXA 4CVUA 2JG9C 1KDKA 3C2UA 2RDSA 2VXJA 4QU2A 5DUVA 3PIJA 3LA7A 1OI6A 3SISA 1ZRDA 4NRPA 2W47A 5CEHA 1JZ4A 2YBSA 1H8VA 3MIFA 5CNAA 1XNKA 2FZ1A 3USSA 4QX3A 4LA2A 2WO3A 3SLIA 1X7NA 3PVNA 5J37A 4J6GA 5IT6A 4CP0A 3ZFGA 1GQPA 1SLIA 1YFXA 2JX9A 4XZPA 4OI2A 5E8AA 5C8CA 1JTZX 1W2OA 4Q1RA 2RVAA 3ZX7A 4LIUA 4UW4A 2PLV2 5LA0A 2D6MA 1NE6A 3I54A 1OFSA 1CIWA 2XG3A 1HJGA 4L92A 4EN0A 3LIGA 5FK7A 3HN1A 4D7TA 4UFHA 2DTWA 3JUUA 3TYJA 3EXUA 1YFWA 1PMIA 1EAH2 4DUWA 3AXEA 4OI0A 3SNMA 2WJSA 2HH9A 3CQOA 3ZSLA 1FT9A 3FBYA 3LA3A 3B01A 3WVJA 5CFCC 1ZX5A 5LK5A 3WXPA 3AMMA 3ZVXA 3WF4A 2RDRA 3DYMA 2JIJA 1OQEA 4NHLA 3HQUA 3ZYBA 3TB0A 1JH5A 3OD0A 3SEPA 5C33A 2FDJA 4OCTA 3I2IA 2DBNA 1J3PA 1ULGA 4GMP3 1C1LA 1GR3A 1EPZA 2ARAA 2ZAHA 3CHXA 5JSPA 1SLCA 2IXCA 2VOKA 1K12A 3B9IA 3ON7A 5JZGA 1HV1A 2C4XA 4CDQA 1QDOA 1COV2 1GWKA 1KXGA 1XOYA 1YYNA 4CEYB 1ZRFA 1A8DA 2P3YA 4I0AA 3T08A 1AR92 4COYA 3WDTA 4NAMA 3KHCA 2NP0A 4P5HA 1H1AA 1ND3B 4A42A 5FXWA 4XCAA 4A45A 2C0ZA 3FE5A 4DINB 5FQ0A 3JD72 1NCRA 1RUJ1 3WHTA 2WC2A 1UU4A 1XE8A 4YVWB 1YUDA 3WDXA 5LEJA 1H1MA 3HEIA 4FQ4A 4MHRA 4MHUA 1GQHA 2ZTNA 5FY8A 3MUZ1 3JXSA 2O1QA 4RHV3 5G05L 1SPPB 4FPKA 5DAQA 1WW5A 1BEV2 2JDNA 1YEWA 4JTOA 3J9SA 2JDHA 3J8F3 4CXYA 1HQWA 3KCCA 1H1IA 3ACIA 4IV3A 5FZOA 4CA9A 2E7TA 1F9KA 5A32B 4IDZA 4LJHA 3AYAA 4NIGA 5L7OA 2Y6HA 3VBSB 2P3IA 4U36A 2HYKA 2JG9A 3NJXA 4MV2A 3DUIA 4UFJA 5GLWA 5IVFA 2A3XA 1U12A 1VBC1 1W2AX 3VDDB 4Q1PA 5E16A 4O65A 1NA1C 1CD3G 1KQRA 3WUDA 2EICA 1ND3C 3ETPA 3WD5A 5F9TA 2F6BA 4MVTA 5JXGA 2Y0IA 2ERFA 2VNRA 1DQ2A 4NPLA 5F8PA 5BPXA 5IK5A 1AVBA 1DGLA 2UURA 4YVWC 5ACA2 1UIJA 4BQYA 3TN91 2VCCA 1PO22 2D7FA 3B7MA 4COZA 5FZAA 2I07B 1W9TA 5F39A 2PQSA 4IE7A 5JMCA 1H8TC 2BP6A 2VTXJ 3P3PA 1Q8PA 4QKNA 2RDNA 2VZUA 2HWC2 5FJKA 1QNWA 3GBWA 1LGCA 4HZFA 1QQP2 5I8SA 3T0AA 2WRAA 4EN9B 2ZCWA 4IW3A 2Z4FA 1JZ2A 1DZRA 1ZYBA 4NIDA 1FMD3 1JUHA 4HSJA 3ZYRA 3VBSC 1EUUA 4PIZA 5A3LA 3J26N 4JDMA 2VW0A 2RV9A 2WDBA 4NPRA 4CSWA 2JEMA 1UYZA 2DUQA 5CFCA 1TEIA 1AYN3 2PHUA 1LTEA 1V9U2 4DS0A 2RM22 3LCPA 5FYYA 3VBFC 3GALA 4OUMA 5DDJ3 4ZS3A 2Q8CA 1MR5A 2H0BA 2IVJA 3ES4A 4CDUC 4Q4V1 1HW5A 3GJAA 3I59B 4IQPA 2VO5A 3NAPB 4PDWC 2W94A 3MIGA 1DQ1A 2WNOA 4IE0A 1LGBA 1F5FA 4QGNA 1N1YA 2DVDA 1VJ2A 3BOWA 2WWUA 2WT2A 2WFPA 1PNFA 2W46A 3ZXFA 1NLRA 2HWF1 1UYYA 5FR3A 5I0DA 3E6CC 1JYXA 2O8OA 1WZXA 1RTVA 2WYFA 1MEC2 3E1F1 1N1VA 2QDRA 5A33B 4RL7A 2MPFA 2W08A 3SMHA 2GSYA 4F7ZA 1MQTB 4XTMA 3T1LA 3ZR6A 4OQ8A 3FWEA 3VBUC 3VHNA 3K3OA 1VBB2 1RUF1 1S0DA 1Y9GA 1CAXA 4CTEA 4B1LA 1COV3 2WNEA 1ZBE1 1I3HA 2VMGA 1XNTA 2VG9A 5K9YA 1OURA 3WF1A 1QF3A 4R52A 1PK6B 4RYDA 5FXZA 3W58A 1GZ9A 4KU8A 1IQAA 5FZ7A 3V65A 4PIYA 4Q0QA 4WBBA 3NAPC 2QDNA 4P9YA 1UW8A 1C8M2 3CJXA 1FV2A 2E26A 1GNHA 2ZGSA 3TEXA 3THDA 4QB6A 2QTWB 4FP2A 3ZO0B 3Q8BA 3T2QA 3WG3A 1UIKA 2BWAA 3OGJA 4UOJA 4O7XA 4P9WA 1JBCA 1NA1A 4B1MA 2WO7A 3KQRA 1V0AA 1SDWA 1AL21 1ND3A 2AREA 2DVGA 1R1A2 2PHLA 2XGXA 2YGMA 4FFHA 4QPGB 2JXAA 2QQWA 5EQUA 4C91A 1MQTC 1Q8VA 4FAGA 3JQXA 1VBE2 4YVWA 3H8RA 3N7LA 4LEJA 3VUOA 3NMBA 5FLHA 3U11A 3LE0A 3ZDVA 1V6KA 1MVEA 1UPIA 1DGWA 5FCCA 1PIV2 4XILA 2G1MA 3W5MA 2X10A 4AGRA 3F95A 4DXZA 3ZM8A 4UBHA 1H8TA 2QQIA 3NVCA 4LBQB 3DKQA 4YW2A 2R062 3FX3A 3HQRA 4Q4Y3 3I2FA 2AENA 3W20A 5A32A 3AKTA 2WO1A 2TBVA 2UYAA 3DCQA 3UL2A 1D0GA 1X9TA 3J4UH 1W9SA 2R043 3VBSA 3ZIXA 5FY7A 2RS32 2WO2A 3ZPOA 4Y20B 5ACA3 1D4M3 3OB8A 4Q5OA 2IXHA 5IWFA 4IE6A 3ZYGA 3AC0A 5AVAA 1RVF1 4AEKA 4H3WA 1J1LA 4DEQA 3IT8A 1I5ZA 4ZS2A 3UGGA 1RJ7A 3N9MA 5FXVA 4CU8A 3ZXGA 3D3AA 2PAKA 4AQTA 1TME3 3JU9A 4M0HA 3VBFA 2OXBA 4L8QA 5EJZB 5F5CA 3UKNA 1QQP3 1UMHA 1GOHA 3WHUA 4AQ2A 4CDUA 2OVUA 1AR83 1ZZ8A 2Y6JA 4PDWA 2VZ1A 3VD5A 3WOGA 1H4GA 2WZR2 5DQ0A 4B4RA 2VZTA 4KG0A 4A7KA 3U4SA 1UXZA 2K2SA 4NWWA 3JB8A 2BFUS 2Q5TA 3ZYHA 1RUE3 3RS6A 3MDPA 4AI8A 3CEWA 1NXMA 4JGZB 1CPNA 1YXWA 2RM23 4YWAA 1HV0A 2X05A 4COUA 5CG8A 2CYFA 1X36A 4FBFA 1W8FA 5F2SA 5FUIA 2NYYA 1DFQA 3VGIA 4CXWA 3LOBA 3IN9A 4GULA 3VBUA 5BXXA 3ZYPA 1KRIA 3M3QA 1QEXA 2MEV2 5IJRA 4QQOA 4KGGA 1UO9A 1VMJA 3P5BA 4DUXA 3DF0A 5T5LA 4WVZA 2ARXA 4HPKB 3NV4A 4Q0PA 3WW2A 5FO8B 4UFKA 1FPN2 4M00A 3S0MA 1ZM1A 2K0GA 3GJBA 4WVMB 1K5JA 1UOJA 3I59A 4N90A 3NAPA 4AFAA 4ARXA 5EXOA 4HK9A 1LOCA 3P6BA 1D0HA 3N9LA 5DAWA 2J42A 3RWKX 1TZOA 2VZVA 4J1XA 3LZZA 2XJQA 5GJ6A 4NIIA 1D4VB 3KGLA 4YRDA 2BEOA 2W1UA 4YFZA 5A6YA 2CDOA 5J7MA 1W0PA 4JGZC 5JCTA 1VBD2 4A7YA 1UQXA 1OLME 4QB2A 5JIAA 4Y4YA 3EB7A 3WNXA 5IFTA 1RHI1 2YG0A 4Y4RA 3BUCA 4Z82A 2ILMA 2AEYA 3AM2A 4CU7A 4PCRA 1MQTA 2D3PA 2XJSA 3OSDA 4QXHA 1VAMA 2BTVC 3TBDA 4LHNA 1ENXA 5IVBA 4JGYB 1BCXA 1NQJA 3O1UA 1CAUB 3FLRA 2C9KA 4G9SB 3WG4A 3SCGA 2GU9A 4CZSA 5JOZA 2CSGA 4AQSA 1SLLA 3FUQA 4L99A 4CDXB 5EWSA 5C7GA 4PF1A 4FPEA 1RL3A 2PAEA 2BZDA 3LKJA 3I4IA 4BH9A 1YJKA 5T50A 4XXAA 1OLQA 3WNLA 4NRMA 1SHWB 3MIEA 4LKFA 4LNVA 1RMU2 4XHBA 2R1BA 5FY9A 2VULA 2WAAA 1S0IA 3N3HA 2JD4A 4Q4X3 1CAVA 4LOSA 1MPXA 1O7FA 2XVGA 2V09A 3M8LA 3MV01 1Q5OA 3ZN6B 4BIOA 3GHNA 4XAAA 2WSUA 4B7EA 1WMEA 4QXCA 3OY8A 2FDGA 2E63A 5JI7A 2QQOA 3SQOA 2YPJA 1LENA 4ZXKA 2ZA9A 3I3QA 3N9NA 4TXWA 5FIXA 1QJX1 3PU3A 3K4DA 4HBNA 1D7PM 1YCIA 4INDA 4ZPIA 4JGYC 1ZBA3 2D97A 2HWE1 2IXIA 5FJHA 2EIBA 1RUC1 4Y26A 1S0EA 2BJSA 3A0NA 5LWBA 1AR61 2ZKLA 3KV6A 1T2XA 4KG8A 4E4HA 3QLQA 4CDXC 4BCUA 4LLOA 1EPWA 4CCOA 4HG6B 1WW7A 4Q4W3 1FYUA 1GU3A 4LO6B 1UOGA 1L3JA 1LCLA 1QJU2 1XJAA 1RUG2 1IKPA 3T4HB 4LITA 4Y20A 2VUJA 3RWNA 1JU4A 3I2OA 1JYVA 4PI2A 4Y24A 4QHZA 4QXKA 3H1YA 4PT6A 4AVBA 3PUIA 3WDUA 2HWD1 5GZDA 3HD8B 1W8TA 3WNPA 5IK4A 1KJLA 1C5HA 5CADA 4PBPA 5I93A 4UAPA 2Y64A 4HXCA 1R1ZA 2ADEA 1LGNA 1VRH3 4FPJA 5I8YA 3HT1A 4ZHNA 3DN7A 5LA9A 1UXXX 4JRLA 4JKKA 3RGBA 1YC61 4FOQA 4LO8A 1O5UA 1U5YA 2VMHA 3Q9OA 4IGOA 2A1XA 3SEEA 4BK4A 4NHKA 1WMXA 3K4ZA 4XDPA 4I01A 4JGZA 4CRQA 1WLCA 2GNDA 1GICA 2ZX2A 3T2OA 1XE0A 2XJPA 1SQ4A 1XE7A 1DCSA 2RE9A 4MZUA 2DUPA 3AP6A 2ZEXA 1W06A 3IBMA 3U0ZA 1PNGA 1ULOA 1NY72 4D6QA 5FK8A 1WUVA 2WLPA 4TZDA 4AEDC 3MPBA 4CCJA 2CY6A 1GYKA 3KCYA 3TEWA 2Y8KA 4YW6A 1REDA 1G7YA 2HEWF 3GHMA 4YGDA 3POIA 5EV7A 2EXJA 5A1LA 3MFCA 5CFDB 4HPKA 1EAH1 3WF3A 4GH4B 4OI4A 4IUGA 4V2VA 3PUAA 3AKQA 3VD3A 2D43A 3S57A 2VL4A 3K46A 4ZU7A 2VJXA 1BBT1 5C4WB 3VHRA 4XIOA 3DPRC 3NNFA 1W0NA 2B39A 2Q8DA 3V0AB 4LO4B 3RZLA 2MHFA 3POBA 1Y7BA 2AUYA 4LIVA 3VZNA 1PZ9A 4BHPA 5DABA 1JZ6A 1FOD2 4OI1A 1W8OA 4W8JA 1PGL2 4DFSA 1JI6A 1OUXA 2XXZA 1UMZA 2VW1A 3IAQA 5C9AB 1GKBA 2PQQA 3X29B 4CU6A 2BRTA 2WR9A 5FO9B 3Q8EA 3WNMA 3OBAA 4FCAA 3D5OA 2ZAAA 3C7GA 2Y26A 4C0BA 5A7WB 1XXNA 3RDIA 5FZFA 2YFZA 1AX1A 1ZZCA 4Q0UA 4HVQA 1AR91 1CGPA 3FFQA 4JGYA 3IDBB 1WCDJ 5D1IA 4XUNA 2BWCA 3MW4A 5ANNA 3S30A 3I3EA 5CKNA 1RUI1 4E8CA 3CMGA 2XJRA 5CFDC 3JD71 4NROA 4GH4C 4KMQA 4CDXA 1Q8QA 4NHYA 1UKRA 2OPKA 1HRV2 2GP5A 1BK1A 3ZFGB 4K9SA 2K46A 4XBQA 5FYHA 4LBMA 1IPSA 4BLJA 1J58A 3LA2A 2BGPA 1NG0A 5FMOS 5C4WC 5C8CB 2DCJA 4GJZA 4XFHA 3RRDA 1UY1A 2R0FA 1M4WA 3UKVA 2JDKA 4XF9A 1S1AA 2BGOA 3R0RA 4QGLA 5CISA 4MYEA 5JSOA 3L2YA 5KHGA 5C3SA 1QOTA 2JE8A 3TOJA 1JYNA 5FYZA 3S5QA 5JOYA 2B45X 1XSQA 2H0VA 3BIEA 2V4VA 1KITA 2IXKA 2ZX1A 5FPAA 5FREA 1DP0A 4AYUA 3I3MA 1RUG3 3BYWA 4LMFA 4H55A 2B7YA 3AL6A 3R4DB 5ABJB 4FI9A 1LU1A 5F3CA 1K45A 3FUOA 2SBAA 2OT7A 1O3TA 1OBNA 4K6BA 2VQTA 2VBPA 3H3UA 1JHNA 3VN4A 1AZDA 4HANA 1EV13 4PBOA 4FFFA 4RD7A 3VDDC 1UWWA 2A6VA 3CNAA 3MBWA 3FHIB 3RI9A 4CCNA 1AXZA 3RQ0A 1A8MA 1DU3D 3AKSA 4QT6A 4EWDA 3WUCA 4C0HA 5JZGB 1SMVA 1UN1A 4CDQB 4AEDA 1ASJ1 1RUH3 4QDRA 4QPWA 3C7HA 2YC4A 1PGW2 2J1SA 1NZIA 5DG2A 5F5AA 5L9RA 5C3OA 4YFWA 4FPCA 3KM5A 3H3ZA 5FQ0B 1RUF3 1UZZA 3M2MA 5L9BA 4FPLA 4XYXA 1YI9A 4KL1A 5FFOC 4DNYA 2LROA 2WYSA 3OPTA 3H0OA 5J36A 1XU2A 2A5ZA 1OQ1A 3L2HA 3DPRA 5ABJC 3RFRA 1JYWA 1POQA 2DV9A 2UYBA 3BB6A 2A70A 2AGSA 2RHPA 4XXPA 2DYCA 1AHSA 2D3RA 1R083 2ET7A 5E89A 5GLZA 5LA1A 1JYCA 4QDSA 3G7DA 2NPIA 2JG8B 2YC2A 2A75A 2ARBA 4OUEA 2RDQA 1H9WA 1H2LA 3AB0A 3OBTA 5E6HA 3JQWA 3ZSMA 2ZZQA 3WT3A 5A3UA 4Y1UA 3T1MA 1W3XA 5CA6A 2VY0A 2E7AA 4YGCA 5G04L 3U14A 1GANA 1BYHA 2JG9B 2RMU3 3OPZA 1W99A 1S2KA 1XQNA 2E6VA 4FXGB 5GALA 2IXJA 3KT4A 4RHV2 5DAXA 3FJSA 3OUHA 3UESA 3ITQA 3J8F2 3WNKA 1DGRA 3AMQA 4LOTA 5CFDA 4PIXA 2HBUA 2EAKA 2OPWA 4GH4A 1PZ7A 4IE4A 5K7PA 2XL7A 4MGZE 4S2FA 1DBNA 1QXPA 2FDFA 3E5XA 2VNGA 3LOIA 1JXNA 4DOUA 3Q8CA 5C4WA 1NLSA 4XUPA 5DPNA 1XC6A 3T09A 3V0AA 4NMIA 1HDKA 3WQ0A 3U1XA 1B09A 1JOJA 5FDBA 3VD4A 4PI0A 3CLPA 3V64A 1POV3 2QZ3A 1US2A 2JG8C 5JVVA 3WW3A 4LORA 4XUOA 4UT5A 2CWSA 1C8M1 1UY4A 4YZ2A 1DYPA 3LDKA 1HRV3 1HB3A 1LODA 3MFAA 1RVF3 3O5SA 1YI7A 1BJQA 2HJIA 1AXKA 4IL7A 5FZ3A 4FTEA 3L9JT 5A7WA 2RS11 5A7QA 5KBFA 2XWBB 4NN0A 4COWA 3I2DA 4QGMA 2ORZA 3P3NA 5CFCB 1XNDA 1YIFA 1ACCA 3LSEA 2NQYA 5IYYA 4P5YA 3RJRA 4HKOA 2VCBA 2CGNA 1QOSA 3VDDA 1FMD2 4BB3A 4YW1A 4COVA 2DURA 3BPZA 4YW4A 1WW4A 4LT5A 1PIV1 5FBJA 3CBNA 4FTBA 4DY5A 2D6OX 4D6SA 4MGIE 4LHLA 4OHZA 1AYN2 1IGOA 5FY5A 3LB9A 3O1PA 1CN1A 3SH5A 2PHFA 2R061 4BQ5A 1R093 4HT1T 4XABA 5GZEA 4NIHA 1RUD1 3A7QA 3HNYM 4QHBA 5DDJ2 1D2SA 4QX1A 1OA2A 4B4PA 5KC6A 2OIIA 1GP5A 2A73B 3A0KA 1IQDC 3M3IA 3WG2A 4R9DA 1FATA 3SITA 1U5ZA 4I09A 3RZHA 1HN0A 4I0BA 4AHWA 4AE2A 1URXA 3PMEA 1H9PA 4GALA 3VZOA 1UX6A 3DL3A 4OZXA 1CAXB 5ABJA 2GC1A 5FP7A 4LBQD 2TUNA 3GZAA 3NJZA 4IGQA 4HLTA 1AR73 4N9HA 2QQMA 4MGYE 2WZ8A 3IAPA 2QVSB 2R30A 4AOCA 3APBA 5FPXA 3T0DA 4C8DA 1XNCA 4IE5A 1CVNA 4E4SA 5I0RA 2C5DA 3SCHA 4AWDA 1QJFA 1W2UA 5GM0A 1LHNA 1UZYA 2EIDA 1UPSA 4CEWC 3OF1A 1RINA 1MZFA 1XSRA 3B02A 4WM8C 4HSLA 4XJ8A 2NLRA 3JBG3 1RHI3 3ATGA 1HXS1 1NA1B 1BVVA 5J96B 2ZABA 1BMV2 3LEMA 1VPHA 4QM8A 2HWB1 3MGUA 2VNOA 4M01A 3R4SA 3DEMA 5A80A 4B4QA 3TAYA 5HBAA 3RPQA 4D7SA 1DQ6A 2R32A 4A3XA 3RZGA 3ILRA 4A6SA 1ND2B 1UX7A 2VNVA 4XHXA 3NL1A 1XPWA 2ATFA 1SBDA 4AHYA 1N3PA 5KXCA 1H8TB 2ZJCA 2JG8A 5KXBA 2XWJB 1O8SA 2GZWA 4CPBA 5AC92 4XCBA 2ZMNA 4N43C 2RR13 2QFEA 4KGQA 4NR1A 4H2AA 3Q8AA 2AC1A 4GWJA 2EAAA 4J25A 4Q29A 1N3OA 4JVAA 2VVEA 1ENSA 5EFUA 2XBO3 5LA2A 1S0CA 3GYDA 4QX7A 4W65A 4F83A 1C28A 2UWCA 2BNNA 5KXEA 4JDOA 3GXUA 3ALQA 4UBGA 4AZZA 1LAJA 5HCFA 1E5IA 2BBAA 5A3NA 5FOBB 2DFCA 2YC0A 4C90A 2D6PA 1QJX3 4Q4Y2 3VBFB 2E53A 3BI3A 1EP0A 1O3RA 4NUBA 2PHWA 3R6SA 2R071 1IKQA 3U07A 1U5XA 1RUC3 4CDUB 2R042 1XB9A 4JQRA 1US3A 4IEWA 3Q8FA 4PDWB 3SXWA 1D4M2 4OULA 5IK8A 1Q3EA 4ZKTB 2XHKA 3O1TA 1KEXA 1DDLA 1UYXA 5LB6A 2Y33A 1ND2C 1W6OA 3VKNA 1J84A 3AXDA 4M3CF 4CUGA 4MADA 3OCPA 1F2NA 2WWJA 5LBBA 3E5UA 4YARA 1TME2 2VECA 3VD7A 5BY5A 1O91A 4LO5B 4CXXA 1N3QA 4FFIA 5B4XA 4LBOA 5D2AA 3VV1A 1I9RA 1AR82 1ZZ6A 2XJTA 4OHYA 3H42B 5L9VA 2AR6A 1GFF2 1JW6A 3LQCA 4P9XA 3U4XA 1AYM1 3INAA 5L36A 3HOBA 3SC7X 2QUOA 1ALYA 3VBUB 3LSDA 2VZ3A 2LM3A 2DVAA 4EROA 2YUEA 5FZ6A 1RUE2 2VUAA 2FD8A 4DB5A 1XNAA 2LRPA 5FYBA 4L11A 2LALA 3AK0A 4SBVA 3HT2A 1V6OA 4FPYA 4GWMA 4XJWA 1W9YA 3OGRA 1S0GA 3ES1A 3H7JA 4QHOA 2NMOA 3M7AA 4I0WB 3HNMA 4QPIC 4LE4A 3ENRA 4XMAA 2Y6LA 1QJY3 5ERLA 1GZTA 3LDBA 4TLFA 1QIQA 3B94A 3ACGA 2TEPA 5FP8A 3ZFFC 2QQLA 1O3QA 2BDRA 3GZUC 4CEWA 4DEVA 1NT0A 3C7FA 1JOBA 1SBEA 2PHXA 3DXTA 3MIHA 4WM8A 3O7OA 3RYKA 5BNNB 1DHKB 4LUKA 4BU2A 2FBEA 2GNBA 4D3WA 5I0UA 4XQDA 1S2BA 1HQNA 1QJU1 4MOAA 4QWNA 5FYSA 5FZMA 3WDYA 5FUNA 2KXLA 3QD6A 3UK9A 3VZKA 1MZ5A 1YLLA 4BQXA 5C71A 1J1TA 1W8HA 5B4NA 2Z42A 4WZFA 4MH0E 3HMYA 5FMBA 4Z07A 3ZOIA 4Y1XA 1QNYA 3HQXA 4U2AA 1HB4A 2XKOA 4CCMA 1NCQC 4DQAA 4UFIA 5T3NA 3VKLA 4L2NA 3ZSJA 1NOVA 3WP5A 4YGEA 1BBT3 4GJYA 3WP4A 3WSOA 4DMIA 2WFF1 2D6NA 4N43A 4UW6A 1PO13 1TMF1 3ILFA 1O4YA 3O0WA 1SLTA 1F35A 2XLGA 2YBKA 4ASMB 5T5PA 3H8OA 2Q30A 1YQ2A 3LWCA 3N9OA 5KWRA 3KSCA 1CAVB 5FKCA 5BNNC 2BYVE 1SZBA 4B8EA 4M0NA 3WP6A 1C1FA 1F4AA 1QHDA 3WNNA 3OY8B 3EJKA 4BMEA 3U37A 1A34A 1H2MA 2ZHKA 1DZTA 1NY71 4LUMA 5AC93 4XIKA 2VC9A 1RUI3 2YB7A 4AFCA 2VOWA 1UF2C 1OC1A 4Q4X2 2GC2A 1ND2A 2K9ZA 4GXLA 5HXMA 3ASIA 4AK3A 1YQ5A 5FOJB 1G9BA 1QKQA 4YG6A 4LBLA 3BIWE 4CUCA 4V1PA 2WS91 2ZGPA 4GB31 1UYPA 3WX5A 3WW4A 3POSA 4QPYA 5EIYB 1LESA 4FOWA 1W6MB 2RS51 3KV9A 3NKGA 5HV0A 3AKRA 3M4FA 2QBXA 4XFFA 1HRI1 1ZBA2 2E32A 3MF9A 1Q56A 1LU2A 4W4ZA 5IVVA 4Q0VA 5CKQA 2C6SA 2GAUA 3KS7A 3WINE 4GQ7A 4R9CA 4IV1C 4AVSA 2KR2A 4Q4W2 1LEDA 1AJOA 2KD7A 4MO3M 1YQ6A 3DYOA 1GV9A 2P1BA 5FUPA 1F15A 1BHGA 2VOVA 4IEQA 4QPIA 1H6YA 2D6KA 4N9IA 1JS9A 1REEA 5JR7B 4ITCA
chains in the Genus database with same CATH topology
5J1XA 3SEEA 4BK4A 4QX2A 4Z2AA 3K4ZA 1K42A 4BJ0A 3W5NA 5JMOA 3T2OA 4XUTA 2R7EB 1JHJA 2ZEXA 1ULOA 1UMIA 3GGLA 2Y8KA 3WF2A 1GNYA 4QAWA 4M4RA 5DMYA 4OMCA 3ECQA 3FHAA 3WF3A 3VD9A 2W1QA 1GOFA 5JR2A 3K77A 4IUGA 3VD3A 5A1AA 2VL4A 1WCQA 3K46A 5DN2A 4P02B 2VJXA 5C70A 1OF3A 3BN6A 4XURA 1W0NA 2WBKA 3K4AA 1JZ6A 2QQNA 3I2JA 3EYPA 2WABA 1W8OA 4W8JA 3A21A 5EJ1B 1JI6A 1CZSA 3OGVA 3IAQA 4CU6A 4KWUA 2JKXA 4CVUA 3WNMA 3OBAA 1H6XA 3ACFA 3C7GA 4LKSA 2ZEYA 2YFZA 5JXIA 2W47A 1F4HA 1JZ4A 3VDCA 4DXSA 4XUNA 4QX3A 3I3EA 2WO3A 4E8CA 3CMGA 2XQXA 4KMQA 1GQPA 2W91A 2VMFA 4BXSV 1JU3A 2RVAA 2BGPA 5F7UA 2DCJA 5LA0A 1L7QA 1UY1A 1LNSA 4A6OA 2VZQA 2BGOA 3WEZA 3IB3A 3NRUA 2ZXQA 2WQ8A 4DXRA 4BK5A 2JE8A 1CX1A 1JYNA 4DUWA 2V4VA 3CQOA 2JD9A 2ZEWA 1DP0A 1RYYA 1KGYA 3WF4A 3DYMA 1OD3A 4FI9A 1K45A 5IFPA 3SEPA 2W1SA 2VQTA 3I2IA 1UWWA 3MBWA 2B9VA 1K12A 2VOTA 4MGSA 4XVHA 1JZ7A 2C4XA 2HLEA 5IHRA 3WNOA 3T08A 3MV11 4QDRA 4QPWA 3C7HA 2YC4A 4ARYA 3CIHA 2J1SA 1ULPA 4A42A 4A45A 2QQKA 1OH4A 5CZKA 2J1RA 3HEIA 1L7RA 1NKGA 2L9LA 2WYSA 4A3ZA 3MUZ1 3JXSA 5G05L 2RJ2A 1JYWA 3T09A 4BDVB 4CU9A 5LA1A 1EUTA 4PQQA 4QDSA 1I5PA 3ACIA 2YC2A 1CZTA 1CZVA 1W8NA 3I3BA 4OUEA 2Y6HA 1PX3A 5G04L 3NJXA 1SG3A 3A22A 1W99A 3PUHA 5JUVA 2XONA 5JXHA 2EICA 3ETPA 3UESA 2J1TA 4MGQA 3WNKA 1JZ5A 5JXGA 2DCKA 1WKYA 3FN9A 2C26A 4JKMA 2VCCA 2WZEA 3CKHA 2QQJA 2VM9A 1W9TA 4XUPA 5DPNA 1XC6A 2PQSA 3VD4A 3K75B 3NJVA 2VZUA 4P08A 3T0AA 1US2A 2LS6A 4XUOA 2Z4FA 1JZ2A 3GDBA 1UY4A 1EUUA 2YFUA 2RV9A 2WDBA 2VZSA 1UYZA 3VDBA 2ORZA 4YPJA 3MUY1 3FHQA 4A41A 2V72A 4P5YA 5IYYA 2J1AA 4GZ9A 3F2ZA 3OGSA 2VCBA 4GWIA 2VO5A 4ZXEA 2W94A 5JXJA 1DLCA 1PMHX 2VQUA 3C7OA 3SKVA 2W46A 1SDDB 2HYXA 1UYYA 3ABZA 3P1IA 2VTFA 4QX0A 5I0DA 1JYXA 3E1F1 3A7QA 3HNYM 3HPNA 4QX1A 2J1EA 2BERA 3LEKA 1IQDC 3OG2A 2W5FA 3LPGA 4JKLA 1NAEA 1R64A 4D8MA 2Y6KA 4QDQA 4M4PA 3IDAA 1XNTA 3WF1A 2QQMA 2WZ8A 4RYDA 3IAPA 4ET7A 2WUHA 3T0DA 1O8PA 4A44A 2B4KA 3CZUA 2E26A 3J7HA 3THDA 4QB6A 4XUQA 2EIDA 3T2QA 3LPFA 4UOJA 4CUBA 3CDZB 2XOMA 1TVGA 3UETA 2W1WA 3DECA 3LE0A 3W5MA 1UX7A 2X10A 2VZPA 3ZM8A 1XPWA 2QQIA 4QB1A 1K3IA 2WAOA 3I2FA 1O8SA 1UY3A 2WO1A 2VMEA 4AAXA 3CZJA 2JDAA 1W9SA 2WO2A 3A23A 2ORXA 4A4AA 3OB8A 3AC0A 4GWJA 2V5DA 4DEQA 1P8JA 5LA2A 4CU8A 1HN1A 1TG7A 2OKXA 3D3AA 3GXUA 2BBAA 3NNGA 5EJZB 1UMHA 1GOHA 2Y6JA 2J1VA 2VZ1A 3VD5A 4OYUA 1JZ8A 1US3A 2J7MA 2W9XA 1GMMA 5DQ0A 2VZTA 3SKJE 1UXZA 1KEXA 1UYXA 1J84A 2ID4A 3HJRA 2W95A 4MADA 4XZUG 4JX0A 3OEBA 2VR4A 3VD7A 2X05A 4LHSA 1CIYA 4ZZ5A 3I2GA 1GOGA 5B4XA 5FUIA 4OZOA 3LEIA 3LQCA 5IJRA 3C8XA 3HOBA 4DUXA 2VZ3A 2WN3A 1OF4A 2Y6GA 3GM8A 1UY0A 3HNBM 1XNAA 1NUKA 3I2KA 3WF0A 3OGRA 3HN3A 4ARXA 2W87A 3HNMA 3P6BA 2Y6LA 5LCWL 2VZVA 4ZZ8A 2VCAA 3ACGA 2QQLA 2W1UA 4DEVA 1UZ0A 4OMDA 2CDOA 3C7FA 3FL7A 2WN2A 4E8DA 3VDAA 4QB2A 3ACHA 3EB7A 5IFTA 2YG0A 4MOAA 4RN5A 4CU7A 5C71A 5B4NA 2VZRA 2C9KA 3MO4A 2VMDA 4UI9L 2LW8A 3IIIA 2EIEA 5C7GA 4PF1A 3NQHA 3I2HA 2BZDA 3WSOA 1NX9A 3WNLA 2X09A 2XHNA 4DXTA 1SHWB 1DYOA 1JZ3A 4D0QA 5HPOA 1O59A 3I3DA 3LEGA 2WAAA 1MPXA 4P00B 3MV01 2W92A 1YQ2A 3I97A 3THCA 4AG4A 4CUAA 2W3JA 2QQOA 3OEAA 1F4AA 3T0BA 3WNNA 3WQBA 3BGAA 4TXWA 3U37A 3C7EA 3K4DA 2ZEZA 1D7PM 2VC9A 5CYYA 2EIBA 2YB7A 4KI5M 3UNPA 1J83A 4DUVA 1T2XA 5HXMA 1OT5A 4HG6B 3DYPA 4CUCA 2DDUA 1GU3A 4LQRA 2E31A 5EIYB 4JHZA 4L0PA 1GUIA 3T2PA 1JU4A 1PX4A 2QBXA 1JYVA 2E32A 2E33A 1W9WA 1PMJX 4W4ZA 4PT6A 3PUIA 3WNPA 2J1UA 1UY2A 2J22A 2VMCA 2KD7A 4W50A 4MO3M 3DYOA 4UAPA 2Y64A 4TTGA 2VZOA 1BHGA 4LPLA 1UXXX 4ZY9A 4JKKA 1H6YA 2CDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1X A;  3SEE A;  4BK4 A;  4QX2 A;  4Z2A A;  3K4Z A;  1K42 A;  4BJ0 A;  3W5N A;  5JMO A;  3T2O A;  4XUT A;  2R7E B;  1JHJ A;  2ZEX A;  1ULO A;  1UMI A;  3GGL A;  2Y8K A;  3WF2 A;  1GNY A;  4QAW A;  4M4R A;  5DMY A;  4OMC A;  3ECQ A;  3FHA A;  3WF3 A;  3VD9 A;  2W1Q A;  1GOF A;  5JR2 A;  3K77 A;  4IUG A;  3VD3 A;  5A1A A;  2VL4 A;  1WCQ A;  3K46 A;  5DN2 A;  4P02 B;  2VJX A;  5C70 A;  1OF3 A;  3BN6 A;  4XUR A;  1W0N A;  2WBK A;  3K4A A;  1JZ6 A;  2QQN A;  3I2J A;  3EYP A;  2WAB A;  1W8O A;  4W8J A;  3A21 A;  5EJ1 B;  1JI6 A;  1CZS A;  3OGV A;  3IAQ A;  4CU6 A;  4KWU A;  2JKX A;  4CVU A;  3WNM A;  3OBA A;  1H6X A;  3ACF A;  3C7G A;  4LKS A;  2ZEY A;  2YFZ A;  5JXI A;  2W47 A;  1F4H A;  1JZ4 A;  3VDC A;  4DXS A;  4XUN A;  4QX3 A;  3I3E A;  2WO3 A;  4E8C A;  3CMG A;  2XQX A;  4KMQ A;  1GQP A;  2W91 A;  2VMF A;  4BXS V;  1JU3 A;  2RVA A;  2BGP A;  5F7U A;  2DCJ A;  5LA0 A;  1L7Q A;  1UY1 A;  1LNS A;  4A6O A;  2VZQ A;  2BGO A;  3WEZ A;  3IB3 A;  3NRU A;  2ZXQ A;  2WQ8 A;  4DXR A;  4BK5 A;  2JE8 A;  1CX1 A;  1JYN A;  4DUW A;  2V4V A;  3CQO A;  2JD9 A;  2ZEW A;  1DP0 A;  1RYY A;  1KGY A;  3WF4 A;  3DYM A;  1OD3 A;  4FI9 A;  1K45 A;  5IFP A;  3SEP A;  2W1S A;  2VQT A;  3I2I A;  1UWW A;  3MBW A;  2B9V A;  1K12 A;  2VOT A;  4MGS A;  4XVH A;  1JZ7 A;  2C4X A;  2HLE A;  5IHR A;  3WNO A;  3T08 A;  3MV1 1;  4QDR A;  4QPW A;  3C7H A;  2YC4 A;  4ARY A;  3CIH A;  2J1S A;  1ULP A;  4A42 A;  4A45 A;  2QQK A;  1OH4 A;  5CZK A;  2J1R A;  3HEI A;  1L7R A;  1NKG A;  2L9L A;  2WYS A;  4A3Z A;  3MUZ 1;  3JXS A;  5G05 L;  2RJ2 A;  1JYW A;  3T09 A;  4BDV B;  4CU9 A;  5LA1 A;  1EUT A;  4PQQ A;  4QDS A;  1I5P A;  3ACI A;  2YC2 A;  1CZT A;  1CZV A;  1W8N A;  3I3B A;  4OUE A;  2Y6H A;  1PX3 A;  5G04 L;  3NJX A;  1SG3 A;  3A22 A;  1W99 A;  3PUH A;  5JUV A;  2XON A;  5JXH A;  2EIC A;  3ETP A;  3UES A;  2J1T A;  4MGQ A;  3WNK A;  1JZ5 A;  5JXG A;  2DCK A;  1WKY A;  3FN9 A;  2C26 A;  4JKM A;  2VCC A;  2WZE A;  3CKH A;  2QQJ A;  2VM9 A;  1W9T A;  4XUP A;  5DPN A;  1XC6 A;  2PQS A;  3VD4 A;  3K75 B;  3NJV A;  2VZU A;  4P08 A;  3T0A A;  1US2 A;  2LS6 A;  4XUO A;  2Z4F A;  1JZ2 A;  3GDB A;  1UY4 A;  1EUU A;  2YFU A;  2RV9 A;  2WDB A;  2VZS A;  1UYZ A;  3VDB A;  2ORZ A;  4YPJ A;  3MUY 1;  3FHQ A;  4A41 A;  2V72 A;  4P5Y A;  5IYY A;  2J1A A;  4GZ9 A;  3F2Z A;  3OGS A;  2VCB A;  4GWI A;  2VO5 A;  4ZXE A;  2W94 A;  5JXJ A;  1DLC A;  1PMH X;  2VQU A;  3C7O A;  3SKV A;  2W46 A;  1SDD B;  2HYX A;  1UYY A;  3ABZ A;  3P1I A;  2VTF A;  4QX0 A;  5I0D A;  1JYX A;  3E1F 1;  3A7Q A;  3HNY M;  3HPN A;  4QX1 A;  2J1E A;  2BER A;  3LEK A;  1IQD C;  3OG2 A;  2W5F A;  3LPG A;  4JKL A;  1NAE A;  1R64 A;  4D8M A;  2Y6K A;  4QDQ A;  4M4P A;  3IDA A;  1XNT A;  3WF1 A;  2QQM A;  2WZ8 A;  4RYD A;  3IAP A;  4ET7 A;  2WUH A;  3T0D A;  1O8P A;  4A44 A;  2B4K A;  3CZU A;  2E26 A;  3J7H A;  3THD A;  4QB6 A;  4XUQ A;  2EID A;  3T2Q A;  3LPF A;  4UOJ A;  4CUB A;  3CDZ B;  2XOM A;  1TVG A;  3UET A;  2W1W A;  3DEC A;  3LE0 A;  3W5M A;  1UX7 A;  2X10 A;  2VZP A;  3ZM8 A;  1XPW A;  2QQI A;  4QB1 A;  1K3I A;  2WAO A;  3I2F A;  1O8S A;  1UY3 A;  2WO1 A;  2VME A;  4AAX A;  3CZJ A;  2JDA A;  1W9S A;  2WO2 A;  3A23 A;  2ORX A;  4A4A A;  3OB8 A;  3AC0 A;  4GWJ A;  2V5D A;  4DEQ A;  1P8J A;  5LA2 A;  4CU8 A;  1HN1 A;  1TG7 A;  2OKX A;  3D3A A;  3GXU A;  2BBA A;  3NNG A;  5EJZ B;  1UMH A;  1GOH A;  2Y6J A;  2J1V A;  2VZ1 A;  3VD5 A;  4OYU A;  1JZ8 A;  1US3 A;  2J7M A;  2W9X A;  1GMM A;  5DQ0 A;  2VZT A;  3SKJ E;  1UXZ A;  1KEX A;  1UYX A;  1J84 A;  2ID4 A;  3HJR A;  2W95 A;  4MAD A;  4XZU G;  4JX0 A;  3OEB A;  2VR4 A;  3VD7 A;  2X05 A;  4LHS A;  1CIY A;  4ZZ5 A;  3I2G A;  1GOG A;  5B4X A;  5FUI A;  4OZO A;  3LEI A;  3LQC A;  5IJR A;  3C8X A;  3HOB A;  4DUX A;  2VZ3 A;  2WN3 A;  1OF4 A;  2Y6G A;  3GM8 A;  1UY0 A;  3HNB M;  1XNA A;  1NUK A;  3I2K A;  3WF0 A;  3OGR A;  3HN3 A;  4ARX A;  2W87 A;  3HNM A;  3P6B A;  2Y6L A;  5LCW L;  2VZV A;  4ZZ8 A;  2VCA A;  3ACG A;  2QQL A;  2W1U A;  4DEV A;  1UZ0 A;  4OMD A;  2CDO A;  3C7F A;  3FL7 A;  2WN2 A;  4E8D A;  3VDA A;  4QB2 A;  3ACH A;  3EB7 A;  5IFT A;  2YG0 A;  4MOA A;  4RN5 A;  4CU7 A;  5C71 A;  5B4N A;  2VZR A;  2C9K A;  3MO4 A;  2VMD A;  4UI9 L;  2LW8 A;  3III A;  2EIE A;  5C7G A;  4PF1 A;  3NQH A;  3I2H A;  2BZD A;  3WSO A;  1NX9 A;  3WNL A;  2X09 A;  2XHN A;  4DXT A;  1SHW B;  1DYO A;  1JZ3 A;  4D0Q A;  5HPO A;  1O59 A;  3I3D A;  3LEG A;  2WAA A;  1MPX A;  4P00 B;  3MV0 1;  2W92 A;  1YQ2 A;  3I97 A;  3THC A;  4AG4 A;  4CUA A;  2W3J A;  2QQO A;  3OEA A;  1F4A A;  3T0B A;  3WNN A;  3WQB A;  3BGA A;  4TXW A;  3U37 A;  3C7E A;  3K4D A;  2ZEZ A;  1D7P M;  2VC9 A;  5CYY A;  2EIB A;  2YB7 A;  4KI5 M;  3UNP A;  1J83 A;  4DUV A;  1T2X A;  5HXM A;  1OT5 A;  4HG6 B;  3DYP A;  4CUC A;  2DDU A;  1GU3 A;  4LQR A;  2E31 A;  5EIY B;  4JHZ A;  4L0P A;  1GUI A;  3T2P A;  1JU4 A;  1PX4 A;  2QBX A;  1JYV A;  2E32 A;  2E33 A;  1W9W A;  1PMJ X;  4W4Z A;  4PT6 A;  3PUI A;  3WNP A;  2J1U A;  1UY2 A;  2J22 A;  2VMC A;  2KD7 A;  4W50 A;  4MO3 M;  3DYO A;  4UAP A;  2Y64 A;  4TTG A;  2VZO A;  1BHG A;  4LPL A;  1UXX X;  4ZY9 A;  4JKK A;  1H6Y A;  2CDP A; 
#chains in the Genus database with same CATH topology
 4MXV A;  2JB8 A;  3ZFE C;  5J1X A;  2GH8 A;  3ZFF A;  4Q8L A;  2FDH A;  2FHR A;  3WW1 A;  1HLC A;  4QX2 A;  4EV0 A;  3VZM A;  4TLG A;  2VD7 A;  4Z2A A;  5LRS A;  3AVR A;  5F5I A;  3ZYI B;  2QQU A;  1W3V A;  4HL0 A;  4CE8 A;  1JHJ A;  2DU1 A;  4FP3 A;  4BQ3 A;  3KF5 A;  4BIS A;  1VRH 2;  4HON A;  1POV 0;  1ASJ 3;  4Z8B A;  1UMI A;  3MYX A;  2XQR A;  3GGL A;  1X8E A;  1APN A;  3IIA A;  3WF2 A;  4A7Z A;  4NWV A;  4YG3 A;  2UY8 A;  3IDE A;  4QAW A;  5CKM A;  4M4R A;  4AFD A;  1DQ5 A;  2YY1 A;  4OMC A;  3ECQ A;  2IWG B;  4RFT 0;  2FMD A;  3O1S A;  4NO4 A;  1NCQ A;  1SCR A;  2FZ2 A;  1GOF A;  2ZAC A;  3ZSE A;  2UY9 A;  4BMB A;  1WCQ A;  1ZA4 A;  2ES3 A;  4IER A;  4P02 B;  4YZ4 A;  1OF3 A;  2Z2S B;  3AZV A;  2Q8E A;  2MNG A;  2QQN A;  4M3C E;  4Y1Z A;  4X8P A;  1JMU B;  3WG1 A;  2IXL A;  3ZMO A;  3S5A A;  2OQ7 A;  4BQ1 A;  2GN7 A;  1RUJ 2;  3MHZ A;  3OGV A;  2DUO A;  4BYY A;  5BNN A;  2PA7 A;  2VXR A;  4EZ4 A;  5HXV A;  4PJY A;  4ATF A;  1OKO A;  5EYY A;  2CL2 A;  1QMJ A;  4W6W A;  1XRU A;  2V4A A;  2YBP A;  2AYH A;  4MGT A;  1VB4 A;  4LKS A;  2ZEY A;  1C5I A;  4AAP A;  4JHT A;  2GAL A;  1F4H A;  3RVH A;  3MI8 A;  2ZX4 A;  1K5M C;  1PGW 1;  2D3S A;  3ZXD A;  4DXS A;  1J59 A;  1PM4 A;  2UWB A;  4Y22 A;  4EQV A;  4Y1V A;  3SCF A;  2CTV A;  2XQX A;  1KS4 A;  1JOD A;  3E97 A;  5FMC A;  5FXX A;  4XJU A;  2W91 A;  4YG0 A;  1Z78 A;  4XQW A;  3AYD A;  2NZ9 A;  3AKP A;  5FZI A;  2PAM A;  4JTN A;  4BXS V;  4MGK E;  4D7Y A;  1HIX A;  1PVC 1;  4OHW A;  1LEC A;  5FZ8 A;  1ULF A;  3U10 A;  1XYO A;  5F7U A;  1VBC 2;  4QQH A;  4EWA A;  4AHX A;  4CCK A;  1PGS A;  4A6O A;  4FTS A;  1Z7S 3;  1VBA 3;  3WEZ A;  3AYE A;  5JPM B;  1HB1 A;  2IFW A;  2ZXQ A;  4XAC A;  2ZPX A;  4DXR A;  4GMP 0;  2D6L X;  4KH9 A;  5FY0 A;  5IAX A;  2X5I A;  3PNA A;  4LLF A;  4IV1 A;  4MXW B;  4K1Z A;  3T30 A;  4R4X A;  1BKZ A;  2WKK A;  3B93 A;  3TN9 2;  2OYZ A;  2F4L A;  1GWL A;  2OA2 A;  2RS1 3;  4HOO A;  4R8H A;  2WIN B;  4RA0 A;  2JD9 A;  2ZEW A;  3PU8 A;  2BFU L;  3KD4 A;  3OYW A;  4Q2F A;  5C5T A;  2G4I A;  2H6B A;  4RHV 1;  4EZH A;  1X9P A;  3H8X A;  1OD3 A;  4YW5 A;  1HB2 A;  3RNS A;  3ZXE A;  4BQW A;  4FPO B;  1LOB A;  1LB2 A;  1IG0 A;  3J8F 1;  3ZFE A;  4D6R A;  1WLD A;  2W1S A;  4FT8 A;  3M3O A;  1BQP A;  3ZDS A;  4HVO A;  2EVX A;  5IW0 A;  5A7P A;  1GZC A;  1AL0 G;  3PVO A;  4XVH A;  2XLF A;  5IVE A;  1ZNP A;  2RG4 A;  3QAC A;  1NYW A;  1W6M A;  4MET A;  4BQ2 A;  2HLE A;  1OXC A;  3ZXA C;  2VBD A;  1W2N A;  5DXD A;  5IHR A;  1ZRC A;  3O1M A;  3WNO A;  2N7G A;  5GZG A;  1BVP 1;  4FO9 A;  3I7D A;  2D44 A;  2LTN A;  4ARY A;  3CIH A;  4RS5 C;  1WBF A;  4KWK A;  1ULP A;  2BQP A;  4AED B;  5H9R A;  1STM A;  2VE1 A;  1H2K A;  2B8M A;  4HVR A;  1OA3 A;  1OH4 A;  2QQV A;  5C3R A;  5CZK A;  3O1V A;  4YM3 A;  1EV1 2;  5AFE A;  2A3W A;  2J1R A;  3UT0 A;  4LXL A;  1CPM A;  1OD5 A;  4K40 A;  5F3I A;  1L7R A;  3VZL A;  2GME A;  5DZE A;  4QQP A;  3I49 A;  1U0A A;  4A3Z A;  4LE3 A;  2FDK A;  3TEY A;  2HWF 2;  2RJ2 A;  4EE2 A;  5LZ6 A;  1QDC A;  3DKW A;  5F32 A;  4CU9 A;  3DPR B;  3PTY A;  4YLZ A;  1RUH 2;  1CZT A;  1CZV A;  1W8N A;  3H3L A;  3VBH B;  1FMD 1;  4IEY A;  4KU7 A;  1MVQ A;  1IPJ A;  1GQG A;  1NQD A;  1H30 A;  3OPW A;  2WQZ C;  2VPV A;  1RUF 2;  1SFY A;  2C24 A;  2QJV A;  4NJ4 A;  3RG0 A;  3A22 A;  5GZF A;  3IDC B;  1UZV A;  2GH2 A;  2PLV 1;  3PUH A;  4UWD A;  3EQE A;  5APA A;  4AI3 A;  4BM8 A;  1HXS 3;  1MS0 A;  1K5M A;  1X33 A;  5KHJ A;  4QMA A;  4AGV A;  4Z2W A;  4R4Z A;  1R08 2;  3ZKY A;  2J1T A;  2VUD A;  1JZ5 A;  4PLO A;  2Y0O A;  2HWB 3;  3BOD A;  3KT1 A;  4GWN A;  2DCK A;  4URT A;  5LY2 A;  1WKY A;  1RUJ 3;  3OBZ A;  5FPB A;  2TNF A;  3FN9 A;  1GLH A;  2YDE A;  4UXA A;  5ANQ A;  2C26 A;  4JKM A;  3CKH A;  2QQJ A;  2GC0 A;  1XYN A;  1MS9 A;  3OD4 A;  2RMU 2;  2ZGO A;  1CQ9 A;  2Z5W A;  2V5Y A;  3BOP A;  1AL2 2;  2A6W A;  1BK0 A;  1O5L A;  3QH6 A;  4LK7 A;  1BXH A;  4P08 A;  1UOF A;  4KBB A;  2NN8 A;  3M1H A;  5JPN B;  2DU0 A;  3VBH C;  3NWK A;  4AF9 A;  2OW4 A;  2VW2 A;  1WW6 A;  3O0X A;  4IXL A;  3TWI A;  3GDB A;  1Q8O A;  2I45 A;  5CU1 A;  3BTA A;  2XUM A;  3KT7 A;  4EN6 B;  1GNZ A;  3O0V A;  4ASK A;  4S2H A;  1ZRE A;  3PUQ A;  2BOJ A;  1GSL A;  1COV 1;  1VBC 3;  4Y3O A;  3LDR A;  1CON A;  2FMY A;  2NMN A;  3PVB B;  2B5H A;  5FZC A;  4E2Q A;  4CDW C;  4GA9 A;  5D8A C;  3K48 A;  2HBT A;  2V72 A;  4YZ3 A;  3F2Z A;  4HN1 A;  2B9U A;  3IMN A;  5BV6 A;  4OHV A;  3WQ7 A;  5BNQ A;  4QQ2 A;  1I1E A;  5A3W A;  2WZP P;  3WP3 A;  3TN9 3;  4LKE A;  1RVF 2;  5FKB A;  2D40 A;  1N47 A;  1RIT A;  3T2T A;  4GIQ A;  4OHX A;  1PMH X;  2VQU A;  5JXJ A;  3N4M A;  3SKV A;  2O14 A;  2JE7 A;  2GMM A;  1W39 A;  3ABZ A;  3BTY A;  3MLJ A;  4K7J A;  2VTF A;  4DRR A;  1BEV 1;  1F8V A;  2G9F A;  3KGZ A;  2CU5 A;  4HET A;  5A7O A;  1LHW A;  4RS5 A;  3A4U A;  3MIC A;  3HPN A;  3USU B;  4MG2 A;  1Q43 A;  2BER A;  2DWR A;  4MXW A;  4XW3 A;  3LEK A;  5KHI A;  3BKZ A;  3OGG A;  4AHZ A;  1AYM 3;  1GP6 A;  2BU9 A;  1LOA A;  2CAU A;  2A6Z A;  1VAV A;  1VE0 A;  2JB4 A;  3GCW A;  1UU5 A;  1S0J A;  2Y6K A;  4M4P A;  2ADD A;  3S7I A;  1HQL A;  4HFS A;  5BNO C;  3WQ1 A;  2ZGN A;  5T52 A;  2BVB A;  4Q4Y 1;  1R09 2;  4YVS C;  1KJR A;  2BGC A;  4Q4V 3;  4P14 A;  3MLK A;  2C9A A;  3B00 A;  3CZU A;  1SFP A;  5ACA 1;  2WQ4 A;  4MLO A;  2OUH A;  3J7H A;  1WMD A;  2JEN A;  2WT0 A;  1PO2 1;  5A6X A;  1AX2 A;  2JJ6 A;  4XUQ A;  3LPF A;  5LBC A;  2HWF 3;  1FV3 A;  3HAG A;  4PLM A;  1OHF A;  3KMH A;  5JIU A;  3POY A;  2I2S A;  1WBL A;  4O9E A;  1BZW A;  1TME 1;  1LHU A;  3UYJ A;  4UW3 A;  1AR7 2;  2HWC 1;  5JWP A;  3M3E A;  4AVA A;  1QQP 1;  5FZ9 A;  3UKT A;  1TVG A;  4BLI A;  4QXB A;  1RB8 G;  2KA3 A;  3UET A;  1AR8 1;  4EN8 B;  1S0F A;  1YQ8 A;  3AYC A;  4I3P A;  3N9P A;  5H9S A;  2W1W A;  5EHD A;  3DEC A;  2DBI A;  4LR4 A;  1X8M A;  3D0J A;  1XNB A;  4E2S A;  2WA4 A;  4LBK A;  1LHO A;  1YFU A;  1ZBE 3;  5K8S A;  3CU7 A;  4FPG A;  4QB1 A;  1W6Q A;  1J3R A;  1V9U 1;  3VL9 A;  2OX0 A;  2RM2 1;  2ET1 A;  1K3I A;  1RHI 2;  2ZGL A;  3CF6 E;  3JBG 2;  4RQP B;  4TN7 A;  5F2W A;  2GDF A;  3VBH A;  1KFU L;  1UY3 A;  1FXZ A;  1Y9M A;  5LAS A;  2VME A;  1CX4 A;  1TMF 3;  3CZJ A;  1HKD A;  2P4E A;  4YM0 A;  2JDP A;  4AAX A;  5IK7 A;  1VRB A;  2ORX A;  1OLM A;  1M06 G;  4BWO A;  5FMD A;  2V5D A;  4TSV A;  3WLU A;  2XML A;  3NV1 A;  3NV2 A;  3RI8 A;  3BAL A;  1TG7 A;  2WWS A;  5EYX A;  4N53 A;  4P9I A;  4HKL A;  4CDW A;  1A3K A;  4JV4 A;  1AL2 3;  1SFN A;  5D8A A;  3ST7 A;  1RUO A;  5FZK A;  3NNG A;  2D93 A;  5FMO L;  1MEC 1;  2PN5 A;  3OUJ A;  2CV6 A;  2VCM A;  1TNF A;  5DUU A;  4RSU A;  3KZ4 C;  2YGL A;  1RGS A;  1ZZ9 A;  2J1V A;  3PDQ A;  3POG A;  2KM2 A;  2RR1 2;  4AFM A;  4OYU A;  4CP1 A;  5I0S A;  1JZ8 A;  2J7M A;  3O1R A;  4CP2 A;  1LR5 A;  1CWP A;  1VBB 1;  5LEK A;  3POJ A;  1JUI A;  3HJR A;  1B35 C;  2OZJ A;  2CGP A;  1DQ4 A;  1LJ7 A;  2XBO 2;  3B5L B;  4GAZ A;  4JX0 A;  5FZB A;  1W6O B;  2P3J A;  2WS9 3;  3NST A;  4RQP C;  1KD7 A;  3WCS A;  2F17 A;  2VR4 A;  4XAE A;  3IPV A;  4LHS A;  4AFB A;  4E2G A;  2RS5 3;  1CIY A;  4ZZ5 A;  3I2G A;  2GN3 A;  3QOP A;  1QJX 2;  1GOG A;  4OZO A;  3H50 A;  3THT A;  3LEI A;  1HRI 3;  5FRA A;  2ZX3 A;  4B7K A;  5JDB A;  1RUC 2;  4YGB A;  1D2Q A;  2EIG A;  4Y5Z 0;  2EXI A;  5FO7 B;  5FZ4 A;  3WR0 A;  2DCY A;  2YV8 A;  1CAW B;  4DZG A;  1OF4 A;  3J7M A;  3GM8 A;  1UY0 A;  1OOP B;  4YM1 A;  5BNO A;  1RIR A;  1T6B X;  3I2K A;  5DG1 A;  3WF0 A;  2G19 A;  4ISQ A;  4G4F A;  3AX4 A;  2PHR A;  5K0U B;  2JDM A;  4FPH A;  4YVS A;  1R1A 1;  2BBV A;  1X50 A;  2A71 A;  2DTY A;  3HN3 A;  1C4R A;  4QKF A;  2W87 A;  1VBE 1;  3ZXK A;  3O12 A;  3R05 A;  1ZRI A;  5LCW L;  1VAK A;  2IVI B;  4ZZ8 A;  1S55 A;  1FNZ A;  3E6D A;  4FPF A;  1VP6 A;  3KLS A;  4WM7 C;  1LHV A;  1UZ0 A;  5GKA C;  4O61 A;  2Z79 A;  3FL7 A;  1JN2 P;  4PHZ A;  4CEW B;  2YPD A;  1LOF C;  5FZE A;  3D0S A;  1O3S A;  1GBG A;  2EXK A;  3ACH A;  4WM8 B;  1RXG A;  2EAL A;  1W04 A;  3USU A;  2YXS A;  3EO6 A;  4BQ4 A;  3ZPY A;  5C3Q A;  1ZBA 1;  2RS3 1;  4RGA A;  5FZD A;  3WDW A;  2GNT A;  3K51 A;  4B3N A;  1QJY 2;  2PTM A;  2VMD A;  4UI9 L;  4B29 A;  5T5J A;  1OOP C;  2XKP A;  4Q4W 1;  4IES A;  3VBR C;  2O0O A;  3I2H A;  1IG3 A;  5K0U C;  1AX0 A;  2GC3 A;  3S6P A;  4I02 A;  5IUQ A;  3G6J B;  2ZML A;  3HWJ A;  2X09 A;  2XHN A;  5DZG A;  1AJK A;  1DYO A;  3GNE A;  4D0Q A;  4GKX A;  5HPO A;  3VLB B;  1JZ3 A;  3PL0 A;  1O59 A;  2EA7 A;  2WII B;  1W6N A;  4BIF A;  3LEG A;  3M70 A;  4N43 B;  1FAY A;  5JOW A;  2WZR 1;  4L97 A;  4AI0 A;  5KXD A;  4K8F A;  4UYB A;  1OFN A;  2X53 S;  2BOI A;  2Z69 A;  3THC A;  4AG4 A;  2W3J A;  4H14 A;  3OEA A;  1OVP A;  1V6L A;  1OUS A;  2V73 A;  5IAT A;  3BGA A;  1BBT 2;  2CNA A;  1VRH 1;  4EWE A;  4PLN A;  1WCU A;  2CHH A;  2RJL A;  3AVS A;  3C7E A;  2ZEZ A;  3R4U A;  4AGG A;  2YZ4 A;  3TEZ A;  2YU1 A;  3B9C A;  2XH6 A;  5CYY A;  1PO1 2;  4YW3 A;  2C1F A;  4KI5 M;  5JLV A;  3EMR A;  2MEV 1;  4DUV A;  1OVS A;  1B35 A;  1OT5 A;  1VR3 A;  4OLL A;  5BYN A;  1W6P B;  4RQP A;  1O4Z A;  3ZXJ A;  1PVC 3;  2ZGU A;  4LQR A;  3UJO A;  5GZC A;  1FPN 1;  5LAT A;  1DYK A;  1DF0 A;  2E31 A;  2ZOE B;  3N7K A;  4LUL A;  1WCS A;  4XJZ A;  3NKT A;  4JHZ A;  4L0P A;  1GUI A;  5A3M A;  5CB7 A;  2OUJ A;  3RMY A;  3LAG A;  2SLI A;  3H9A A;  3ZN4 A;  1PX4 A;  2Q8O A;  4N7U A;  5FP4 A;  1G9C A;  1RUI 2;  1E57 A;  2YYO A;  2PHT A;  1DQ0 A;  1MS8 A;  3PUS A;  1TNR A;  4D69 A;  1VBD 1;  4Y5S A;  5IVC A;  2IFR A;  4BA6 A;  4W50 A;  2BNM A;  4HMZ A;  3PJQ A;  1GZW B;  3AZY A;  3K2O A;  1OLR A;  4JRA A;  3ZSK A;  5F37 A;  4TTG A;  5A3T A;  4Y33 A;  2JEC A;  4ZY9 A;  2HWE 3;  2UWA A;  3LF7 A;  4JDN A;  4EYU A;  4XET A;  1H4H A;  3EHK A;  4QPI B;  4XF1 A;  1AR6 3;  1IZ3 A;  1DGW X;  4WM7 A;  5T55 A;  5CAZ A;  4Q27 A;  5LW9 A;  5C6C A;  2R49 A;  3ZFF B;  3KVB A;  3MZH A;  1K42 A;  4S2D A;  4K20 A;  3W5N A;  1LOF A;  2R7E B;  3ZR5 A;  2DVB A;  4FOY A;  3FLT A;  3KHB A;  5I91 A;  4XDO A;  4CEY C;  2H6C A;  3QBQ A;  4D94 A;  4N7I A;  3RZZ A;  2YU2 A;  5ISL A;  4YZ5 A;  1RMU 1;  1QH6 A;  2AAC A;  2YMZ A;  4Y1Y A;  2Q4S A;  3TRS B;  5F1R A;  4RR3 B;  1CAW A;  1NZC A;  1RXF A;  3OTF A;  5DAP A;  1FI2 A;  3AP4 A;  5E1R A;  1OOP A;  1V00 A;  2HWD 3;  3VD9 A;  3VBR A;  5DZF A;  4XEZ A;  5JR2 A;  3HVD A;  3K77 A;  5K0U A;  3B69 A;  4UFL A;  4WVV A;  1NCQ B;  2ZGQ A;  1I6X A;  5A1A A;  3VKO A;  4AXO A;  1LRH A;  1ZZ7 A;  4XMI A;  4I3G A;  4XUR A;  1E5H A;  1KDM A;  2IC1 A;  2JIC A;  2WBK A;  1ASJ 2;  4ORF A;  3V56 A;  3NNL A;  2ZGK A;  3EYP A;  3B3Q E;  3V0B B;  2W68 A;  2F4P A;  2WAB A;  3MPP G;  1WWY A;  3A21 A;  1CJP A;  5EJ1 B;  3IZO A;  4BOW A;  3BU0 A;  3RYR A;  1SAC A;  1OH3 A;  4KWU A;  4RGK A;  5I8T A;  1ZZB A;  3AL5 A;  4FOV A;  1H6X A;  3MLL A;  3ACF A;  2PLV 3;  4NHX A;  1V70 A;  5FZ0 A;  2PHD A;  1RUG 1;  4IEU A;  5JXI A;  3H1M A;  5EZW A;  3LD8 A;  2WLQ A;  4DO0 A;  5F3E A;  3VDC A;  2BPA 2;  4RR3 C;  3AFG A;  4AVC A;  1WD4 A;  3NV3 A;  5F3G A;  5LBF A;  5F6K A;  5FBZ A;  3SH4 A;  4Y22 B;  1EAH 3;  2XL9 A;  2XVL A;  1EV1 1;  3O1O A;  2VMF A;  1NXD 1;  1G9F A;  4A2U A;  5A70 A;  4UFM A;  3UV9 A;  2PXJ A;  5BUV A;  2Y6F A;  1JU3 A;  4LKD A;  1MAC A;  3E5Q A;  4WV8 A;  5IVJ A;  2VAU A;  5HCB A;  2LUW A;  4LHK A;  3U78 A;  1W0O A;  2X29 A;  5A3P A;  1L7Q A;  1LNS A;  4SLI A;  4AI1 A;  4NVP A;  3PMS A;  2VZQ A;  3IB3 A;  1RUH 1;  3NRU A;  2NM1 A;  3GCX A;  4H7M A;  2IUW A;  3RJ2 X;  2WQ8 A;  3IMM A;  4RFR B;  1BLZ A;  3E6B A;  1FNY A;  4BK5 A;  1CX1 A;  3AZW A;  5T54 A;  1QJE A;  2X5I B;  4E4Z A;  3KQ4 B;  5CG9 A;  4IV1 B;  2RJK A;  1RYY A;  1KGY A;  5FYC A;  5CBL A;  2Y34 A;  1AR9 3;  1XYP A;  3PJY A;  3OYW B;  1S4C A;  5HCA A;  1W28 A;  1W03 A;  1Z7S 2;  1VBA 2;  1R08 1;  2DCZ A;  5IFP A;  4OQ9 A;  3ZIW A;  3FC0 A;  1OPO A;  3JD7 3;  4QQL A;  1O6U A;  1YJL A;  5H9P A;  3ZFE B;  2UU8 A;  5F6L B;  1W6P A;  3AJY A;  2WNV B;  5L73 A;  4YSF A;  1V6J A;  3C3V A;  4FFG A;  1QOO A;  2B9V A;  2VOT A;  3LFI A;  1VMF A;  2G9G A;  5TSW A;  4MGS A;  4G3Y C;  4AQ6 A;  2JIG A;  4CEY A;  2ZHM A;  3FMG A;  2RS1 2;  3TNQ A;  4E9K A;  1JZ7 A;  3M3C A;  2RMU 1;  5LRR A;  2BV4 A;  5A6Q A;  5C8W A;  1BEV 3;  3WZ1 A;  5KR7 A;  3MV1 1;  1DIW A;  4L9B A;  3UGH A;  2XPJ A;  5EP9 A;  1FOD 1;  1ZRR A;  1E5R A;  2QQK A;  4ZON A;  1PGL 1;  1YNA A;  3CL1 A;  2X5I C;  2GNM A;  1GZW A;  4RGG A;  5FYT A;  1DG6 A;  2GP3 A;  4C1X A;  4R9B A;  1NKG A;  1SPP A;  5FPL A;  2L9L A;  1VB2 A;  1GP4 A;  2DVF A;  1ODM A;  5FWE A;  5GLU A;  5JAX A;  1JYT A;  2PYT A;  1IS3 A;  1PK6 C;  2DCT A;  2E7Q A;  5FZG A;  2JDU A;  3HR9 A;  3N36 A;  4BDV B;  4F3J A;  1EUT A;  4PQQ A;  1I5P A;  1POV 1;  1RUD 2;  1WA4 A;  4QM9 A;  1KS5 A;  4AVV A;  4DRV A;  3I3B A;  1IS4 A;  5FYU A;  3U75 A;  4XFB A;  3NW4 A;  2OS2 A;  1JOP A;  2WNV C;  2P34 A;  1UL9 A;  1QXR A;  1HRV 1;  3ZYJ B;  1AXY A;  1PO2 3;  1PX3 A;  4AEM A;  4YW7 A;  1UZW A;  1SG3 A;  1WD3 A;  4URA A;  1G86 A;  3FLP A;  2W0X A;  2ETE A;  3AZZ A;  3PHM A;  2XON A;  3RMX A;  5JUV A;  1WLT A;  3W21 A;  5JXH A;  4QPG C;  1SCS A;  2HWC 3;  4V2W A;  3SHR A;  4RR3 A;  1GWM A;  4KQ7 A;  1K5M B;  2R6Q A;  4MGQ A;  3N9Q A;  2I74 A;  2E51 A;  3POW A;  1Y3T A;  4JC1 A;  4NIA A;  3ZXL A;  1UCX A;  1WCK A;  2WZE A;  1ULE A;  1NE4 A;  2VM9 A;  3RSJ A;  4XF0 A;  2P37 A;  3FBM A;  4P9J A;  1V9U 3;  3IM0 A;  5IAV A;  2HEV F;  3K75 B;  3NJV A;  1HXS 2;  3V0B A;  1R09 1;  3GZT B;  3VBO B;  4NOT A;  4LA3 A;  2LS6 A;  2Y38 A;  2HWB 2;  2ZHL A;  4EN7 B;  5A1F A;  2YFU A;  2D5H A;  3DXU A;  3ZLI A;  1UD1 A;  5FYV A;  2VZS A;  1C8N A;  1L7L A;  2WL1 A;  1W2T A;  1V6M A;  3EBR A;  4WZC A;  3ZN5 A;  4Q0S A;  1IOA A;  1KFX L;  3VDB A;  3AMP A;  1QXJ A;  3IWZ A;  4YPJ A;  3MUY 1;  4AEJ A;  1AR7 1;  2ZGM A;  3GBG A;  1MEC 3;  1Y9Q A;  2FQP A;  2ZBJ A;  3FHQ A;  3NNM A;  4A41 A;  3RYP A;  5FTT C;  3LGR A;  2J1A A;  1SLA A;  3D82 A;  1A6C A;  3KB5 A;  4GZ9 A;  4OFG A;  4S2G A;  3OGS A;  4GWI A;  1LKN A;  4X6Q B;  4Y5T A;  4ZXE A;  3PVE A;  3MID A;  2P2K A;  3N7M A;  4GMP 1;  3DV8 A;  5FPV A;  1VBB 3;  1QJZ A;  1IHM A;  1T6G C;  4JCK A;  1DLC A;  3J7N A;  4W6X A;  3WCR A;  3C7O A;  3PLQ A;  1UNB A;  1H0B A;  3MW3 A;  2OQ6 A;  3POE A;  1SDD B;  2HYX A;  4ES8 A;  3RZJ A;  3P1I A;  4NE9 A;  4QX0 A;  5IVY A;  3JBG 1;  3AJZ A;  5A33 A;  3I8T A;  4K3U A;  2XJU A;  4XOG A;  5DUX A;  4ASL A;  2QQP A;  2WT1 A;  3VBO C;  2P3K A;  2VVF A;  2XUE A;  2VGD A;  1QU0 A;  2J1E A;  2R07 2;  1C8M 3;  2ZGT A;  4RS5 B;  3UGF A;  4MX3 A;  5J09 A;  3GBF A;  1SLB A;  5FP3 A;  3OG2 A;  2W5F A;  3H8U A;  3LPG A;  4JKL A;  1NAE A;  1RJ8 A;  4LBJ A;  2P17 A;  2AH2 A;  4LBN A;  5GLT A;  3MW2 A;  1CR7 A;  1R64 A;  1EYB A;  4QDQ A;  2VUC A;  4BPZ A;  3IDA A;  4UF0 B;  1PK6 A;  4D8M A;  4Q8K A;  5L19 A;  2B46 X;  1RUN A;  2PFW A;  2D98 A;  2JE9 A;  1R1A 3;  5E88 A;  4W6Y A;  1Z0H A;  4DIQ A;  3MIB A;  4ET7 A;  2WUH A;  1O8P A;  1VBE 3;  3D6E A;  3JCI A;  1PHM A;  4A44 A;  2RR1 1;  2WNV A;  4CPB D;  2B4K A;  1W8U A;  2Q0A A;  4CCC A;  1AYM 2;  2ARC A;  2O8Q A;  5JOX A;  2WA3 A;  5FYI A;  1PIV 3;  1QH7 A;  4BE3 A;  2JDY A;  1UKG A;  1ST8 A;  1IS6 A;  2XBO 1;  2A6X A;  5K4L A;  1V6I A;  2WSV A;  2ZMK A;  4XFA A;  4QPG A;  3TNP B;  4CUB A;  3W59 A;  5JSR A;  2R06 3;  4QU1 A;  2P6H A;  2R0H A;  1YRZ A;  3CDZ B;  1RUD 3;  5FZ1 A;  2XOM A;  3FZ3 A;  2BNO A;  4Q4V 2;  2RS3 3;  4XFG A;  3ZYF A;  1PZ8 A;  4R9A A;  4ZU4 A;  1YWK A;  3BU7 A;  4E27 A;  1QY4 A;  2JWP A;  2DF7 A;  2P5B A;  5FLJ A;  5HV4 A;  1LUL A;  4XPV A;  4NHM A;  3KCX A;  5FP9 A;  4DY3 A;  2Q1Z B;  2VZP A;  2GMP A;  4LBQ A;  5J98 B;  1LEM A;  2VH9 A;  3AZX A;  2W39 A;  1XU1 A;  4M3C B;  1MS3 A;  1W6Q B;  2WAO A;  5A7S A;  1N1T A;  5F5Q A;  5FAX A;  3GZE A;  1UOB A;  1C57 A;  3KWV A;  2XDV A;  3N7J A;  2JDA A;  2R1D A;  3POF A;  4JAA A;  4A4A A;  3A23 A;  1QWR A;  2WZR 3;  3GF6 A;  3KV4 A;  4NRQ A;  5JI9 A;  4KWJ A;  2HKX A;  2Q1F A;  1YO8 A;  1YQC A;  1P8J A;  1MS1 A;  3HBZ A;  2PEL A;  2IZW A;  3OUI A;  1OPM A;  4FVV A;  1HN1 A;  4ONU A;  2OKX A;  1ZBE 2;  1AYN 1;  3WY6 A;  5KC5 A;  1WLW A;  4OVE A;  2PMW B;  1MZE A;  4N53 B;  1QGL A;  2A7A A;  5AVP A;  2ZS6 B;  4NAO A;  3ZMN A;  2WFF 2;  3H1W A;  5DDJ 1;  2XB6 C;  2XR4 A;  5D8A B;  4BXF A;  4CDW B;  2OZ6 A;  2WNU B;  3PUR A;  1TMF 2;  3BPS A;  1Y43 B;  3NJY A;  4XFI A;  4XTP A;  3NO8 A;  2MEV 3;  2W9X A;  3W9A A;  1GMM A;  1QJY 1;  4FSJ A;  1WA6 X;  3QCW A;  3SKJ E;  1J3Q A;  4GD4 A;  4P9G A;  3ILN A;  4YZ1 A;  2ID4 A;  1LOG A;  2B42 B;  2W95 A;  3PIG A;  4OUS A;  4QKD A;  4LTA A;  4MUV A;  3LFM A;  4QKB A;  2X8K A;  4XZU G;  5H9Q A;  2DFB A;  3D4K A;  4CP9 B;  3OEB A;  1FPN 3;  3DGT A;  1MZ6 A;  4K1Y A;  3VBO A;  2QNK A;  3LIH A;  5HI0 A;  4HKW A;  1SBF A;  1FX5 A;  4I30 A;  3IPV B;  3ROU A;  3CJI B;  3T4V A;  1XBF A;  2G9Z A;  5BNP B;  4IEP A;  1W8Z A;  3C8X A;  3AMH A;  1Q8S A;  4XQ4 A;  4K8R B;  3OBR A;  4CCD A;  2WN3 A;  2Y6G A;  2XVK A;  2ZKN A;  5B2G B;  1VBD 3;  3HNB M;  4WVM A;  1NUK A;  4YM2 A;  5FZL A;  4N53 C;  3BCW A;  2WS9 2;  4GB3 2;  5LBE A;  3S7E A;  4YNI A;  4E4D X;  4XJA A;  2VQ0 A;  4QX8 A;  3THP A;  1AUY A;  5BNO B;  2QKD A;  3AP7 A;  2WNU C;  2RS5 2;  3VHP A;  3VL8 A;  1BMV 1;  2R07 3;  4YVS B;  1IS5 A;  2ZZJ A;  1PO1 1;  2VBB A;  1HRI 2;  4EJR A;  4ATE A;  3CO2 A;  2FCV A;  4FQZ A;  4IEV A;  2VCA A;  4I2O A;  4WVW A;  5FYM A;  4C1W A;  2Y60 A;  1WMF A;  4QX5 A;  1CJD A;  4OMD A;  1PVX A;  2QZ2 A;  1O4T A;  2WN2 A;  4AR2 A;  4E8D A;  4IEZ A;  5KHH A;  3VDA A;  3ACL A;  4JZR A;  4CCL A;  3HBK A;  2EXH A;  3RZK A;  2BUK A;  2W2I A;  4RN5 A;  1RMU 3;  3CJI C;  5D21 A;  5AC9 1;  3HIF A;  1CAU A;  5BNP C;  2VZR A;  3AP9 A;  4AI9 A;  4KBZ A;  5HCH A;  2VMI A;  1HX6 A;  3K3N A;  3MO4 A;  3ME2 A;  5A7N A;  2LW8 A;  5C3P A;  3III A;  1U5I A;  4UF0 A;  1CES A;  5CVR A;  2P6C A;  5DAV A;  2EIE A;  1LOE A;  4ZU5 A;  3NQH A;  5FY4 A;  1MS5 A;  5FZH A;  1ONA A;  2FCT A;  2XJV A;  5EPA A;  5FV3 A;  4YYO A;  2AZ5 A;  1NX9 A;  2CGO A;  3JZV A;  4QD2 A;  2QCS B;  2D5F A;  3O14 A;  4DXT A;  1W8W A;  4X8N A;  5AFB A;  2R16 A;  2YRO A;  3VZJ A;  3I3D A;  2R04 1;  1OQD A;  1VIW B;  1D4M 1;  1NLQ A;  1W6N B;  2VU9 A;  5C9A C;  3ZN6 A;  4P00 B;  1F5J A;  3BVC A;  2W92 A;  4CYD A;  4K21 A;  4XE9 A;  3I97 A;  1IPK A;  1C3H A;  4Q26 A;  5T5O A;  1OMI A;  4CUA A;  1ODN A;  3MEP A;  5DUW A;  1OSG A;  1QJU 3;  1OKQ A;  1TQ5 A;  4FXK B;  5LK7 B;  3T0B A;  3KVA A;  3WQB A;  1V6N A;  4KWL A;  4AW7 A;  4CCE A;  4UW5 A;  4BZ4 A;  4JQT A;  1REF A;  3AP5 A;  1RC6 A;  1W9F A;  1EY2 A;  1ZVF A;  1ULC A;  2XLA A;  4HN0 A;  3UNP A;  4LK6 A;  1J83 A;  1PM7 A;  1G9D A;  4KNC A;  5I0T A;  1SEF A;  3ZFG C;  3BTX A;  5EJ3 A;  1VMH A;  1W05 A;  1RUE 1;  2AEZ A;  5CIR A;  1B35 B;  3DYP A;  1VAL A;  4M3C A;  2DDU A;  4Z1V A;  3WV6 A;  5C8C C;  2W52 A;  4P9L A;  4X6R B;  1UAI A;  4NPM A;  4AI2 A;  3H7Y A;  3WDV A;  1G6N A;  1W90 A;  3IKW A;  4N8M A;  2WFF 3;  4J1W A;  4XFC A;  4GKY A;  2BVV A;  4XBL A;  1DLL A;  1TE1 B;  4H7L A;  3T2P A;  1UU6 A;  4LO7 A;  2E33 A;  5KHK A;  1YFY A;  1W9W A;  2CWM A;  2ENR A;  1PMJ X;  1A78 A;  3SH3 A;  2FCU A;  3VHO A;  3ORJ A;  3VKM A;  2J1U A;  5FWJ A;  1NCR B;  2E9Q A;  1UY2 A;  2J22 A;  4IGP A;  3RZM A;  4AVT A;  2VMC A;  2JKB A;  2ZHN A;  1VLN A;  1PVC 2;  3FFZ A;  2VQA A;  2JDZ A;  2VZO A;  2WNU A;  1S2E A;  1DGR N;  5A6Z A;  4LPL A;  1YIP A;  2EF6 A;  5SV5 A;  2CDP A;  3QH7 A;  1YHF A;  1AF9 A;  4FAH A;  5FPU A;  4Z92 B;  1E5S A;  1S0B A;  2YHJ A;  4IEO A;  5FLI A;  3VKF C;  3ZKU A;  1JYI A;  4PQ9 A;  4IET A;  3KF3 A;  2CAV A;  3AFK A;  4IV3 B;  5FY1 A;  3ELN A;  5FZO B;  4CP9 A;  2A6Y A;  4WM7 B;  2VOX A;  3T3Y A;  3AMN A;  4BJ0 A;  3OJB A;  1F31 A;  5L7O B;  5JMO A;  4XUT A;  3MF6 A;  3D8C A;  2ZGR A;  1ULD A;  1X82 A;  4GB3 3;  5JZG C;  2VTX A;  1H2N A;  4CDQ C;  3BTZ A;  5C5U A;  1DZQ A;  4XF4 A;  5FPZ A;  1G8W A;  3CJI A;  3OOX A;  4XJ9 A;  2A3Y A;  4MSV A;  5BNP A;  3VB9 A;  2FDI A;  1FOD 3;  2HWE 2;  4XBN A;  5LY1 A;  1WGP A;  2ZX0 A;  1GNY A;  4XC9 A;  1AR6 2;  3JB4 C;  4PF5 A;  4O9G A;  5DMY A;  5J48 A;  1ENQ A;  3FHA A;  1NCR C;  5J3U A;  4DPN A;  2W1Q A;  2VVD A;  3PTR B;  4TYS A;  1ENR A;  1MS4 A;  1N1S A;  1G9A A;  3J7L A;  3NNJ A;  4HK8 A;  3VBR B;  3N35 A;  5DN2 A;  1ZA7 A;  3KV5 A;  5C70 A;  5GLV A;  3BN6 A;  4XDQ A;  1Y4W A;  1Z7S 1;  4XF3 A;  1VBA 1;  3K4A A;  3ETQ A;  2Q1M A;  1HJF A;  2QE3 A;  3I2J A;  5SV8 A;  3URF A;  3UJQ A;  1OA4 A;  4F8A A;  5M0T A;  4ISR A;  5C9A A;  4IV3 C;  2HEY F;  4ES9 A;  4Q4X 1;  1CZS A;  5A3O A;  4AL9 A;  4TWT A;  5L7O C;  2HWD 2;  2BW8 A;  4IEX A;  2JKX A;  4CVU A;  2JG9 C;  1KDK A;  3C2U A;  2RDS A;  2VXJ A;  4QU2 A;  5DUV A;  3PIJ A;  3LA7 A;  1OI6 A;  3SIS A;  1ZRD A;  4NRP A;  2W47 A;  5CEH A;  1JZ4 A;  2YBS A;  1H8V A;  3MIF A;  5CNA A;  1XNK A;  2FZ1 A;  3USS A;  4QX3 A;  4LA2 A;  2WO3 A;  3SLI A;  1X7N A;  3PVN A;  5J37 A;  4J6G A;  5IT6 A;  4CP0 A;  3ZFG A;  1GQP A;  1SLI A;  1YFX A;  2JX9 A;  4XZP A;  4OI2 A;  5E8A A;  5C8C A;  1JTZ X;  1W2O A;  4Q1R A;  2RVA A;  3ZX7 A;  4LIU A;  4UW4 A;  2PLV 2;  5LA0 A;  2D6M A;  1NE6 A;  3I54 A;  1OFS A;  1CIW A;  2XG3 A;  1HJG A;  4L92 A;  4EN0 A;  3LIG A;  5FK7 A;  3HN1 A;  4D7T A;  4UFH A;  2DTW A;  3JUU A;  3TYJ A;  3EXU A;  1YFW A;  1PMI A;  1EAH 2;  4DUW A;  3AXE A;  4OI0 A;  3SNM A;  2WJS A;  2HH9 A;  3CQO A;  3ZSL A;  1FT9 A;  3FBY A;  3LA3 A;  3B01 A;  3WVJ A;  5CFC C;  1ZX5 A;  5LK5 A;  3WXP A;  3AMM A;  3ZVX A;  3WF4 A;  2RDR A;  3DYM A;  2JIJ A;  1OQE A;  4NHL A;  3HQU A;  3ZYB A;  3TB0 A;  1JH5 A;  3OD0 A;  3SEP A;  5C33 A;  2FDJ A;  4OCT A;  3I2I A;  2DBN A;  1J3P A;  1ULG A;  4GMP 3;  1C1L A;  1GR3 A;  1EPZ A;  2ARA A;  2ZAH A;  3CHX A;  5JSP A;  1SLC A;  2IXC A;  2VOK A;  1K12 A;  3B9I A;  3ON7 A;  5JZG A;  1HV1 A;  2C4X A;  4CDQ A;  1QDO A;  1COV 2;  1GWK A;  1KXG A;  1XOY A;  1YYN A;  4CEY B;  1ZRF A;  1A8D A;  2P3Y A;  4I0A A;  3T08 A;  1AR9 2;  4COY A;  3WDT A;  4NAM A;  3KHC A;  2NP0 A;  4P5H A;  1H1A A;  1ND3 B;  4A42 A;  5FXW A;  4XCA A;  4A45 A;  2C0Z A;  3FE5 A;  4DIN B;  5FQ0 A;  3JD7 2;  1NCR A;  1RUJ 1;  3WHT A;  2WC2 A;  1UU4 A;  1XE8 A;  4YVW B;  1YUD A;  3WDX A;  5LEJ A;  1H1M A;  3HEI A;  4FQ4 A;  4MHR A;  4MHU A;  1GQH A;  2ZTN A;  5FY8 A;  3MUZ 1;  3JXS A;  2O1Q A;  4RHV 3;  5G05 L;  1SPP B;  4FPK A;  5DAQ A;  1WW5 A;  1BEV 2;  2JDN A;  1YEW A;  4JTO A;  3J9S A;  2JDH A;  3J8F 3;  4CXY A;  1HQW A;  3KCC A;  1H1I A;  3ACI A;  4IV3 A;  5FZO A;  4CA9 A;  2E7T A;  1F9K A;  5A32 B;  4IDZ A;  4LJH A;  3AYA A;  4NIG A;  5L7O A;  2Y6H A;  3VBS B;  2P3I A;  4U36 A;  2HYK A;  2JG9 A;  3NJX A;  4MV2 A;  3DUI A;  4UFJ A;  5GLW A;  5IVF A;  2A3X A;  1U12 A;  1VBC 1;  1W2A X;  3VDD B;  4Q1P A;  5E16 A;  4O65 A;  1NA1 C;  1CD3 G;  1KQR A;  3WUD A;  2EIC A;  1ND3 C;  3ETP A;  3WD5 A;  5F9T A;  2F6B A;  4MVT A;  5JXG A;  2Y0I A;  2ERF A;  2VNR A;  1DQ2 A;  4NPL A;  5F8P A;  5BPX A;  5IK5 A;  1AVB A;  1DGL A;  2UUR A;  4YVW C;  5ACA 2;  1UIJ A;  4BQY A;  3TN9 1;  2VCC A;  1PO2 2;  2D7F A;  3B7M A;  4COZ A;  5FZA A;  2I07 B;  1W9T A;  5F39 A;  2PQS A;  4IE7 A;  5JMC A;  1H8T C;  2BP6 A;  2VTX J;  3P3P A;  1Q8P A;  4QKN A;  2RDN A;  2VZU A;  2HWC 2;  5FJK A;  1QNW A;  3GBW A;  1LGC A;  4HZF A;  1QQP 2;  5I8S A;  3T0A A;  2WRA A;  4EN9 B;  2ZCW A;  4IW3 A;  2Z4F A;  1JZ2 A;  1DZR A;  1ZYB A;  4NID A;  1FMD 3;  1JUH A;  4HSJ A;  3ZYR A;  3VBS C;  1EUU A;  4PIZ A;  5A3L A;  3J26 N;  4JDM A;  2VW0 A;  2RV9 A;  2WDB A;  4NPR A;  4CSW A;  2JEM A;  1UYZ A;  2DUQ A;  5CFC A;  1TEI A;  1AYN 3;  2PHU A;  1LTE A;  1V9U 2;  4DS0 A;  2RM2 2;  3LCP A;  5FYY A;  3VBF C;  3GAL A;  4OUM A;  5DDJ 3;  4ZS3 A;  2Q8C A;  1MR5 A;  2H0B A;  2IVJ A;  3ES4 A;  4CDU C;  4Q4V 1;  1HW5 A;  3GJA A;  3I59 B;  4IQP A;  2VO5 A;  3NAP B;  4PDW C;  2W94 A;  3MIG A;  1DQ1 A;  2WNO A;  4IE0 A;  1LGB A;  1F5F A;  4QGN A;  1N1Y A;  2DVD A;  1VJ2 A;  3BOW A;  2WWU A;  2WT2 A;  2WFP A;  1PNF A;  2W46 A;  3ZXF A;  1NLR A;  2HWF 1;  1UYY A;  5FR3 A;  5I0D A;  3E6C C;  1JYX A;  2O8O A;  1WZX A;  1RTV A;  2WYF A;  1MEC 2;  3E1F 1;  1N1V A;  2QDR A;  5A33 B;  4RL7 A;  2MPF A;  2W08 A;  3SMH A;  2GSY A;  4F7Z A;  1MQT B;  4XTM A;  3T1L A;  3ZR6 A;  4OQ8 A;  3FWE A;  3VBU C;  3VHN A;  3K3O A;  1VBB 2;  1RUF 1;  1S0D A;  1Y9G A;  1CAX A;  4CTE A;  4B1L A;  1COV 3;  2WNE A;  1ZBE 1;  1I3H A;  2VMG A;  1XNT A;  2VG9 A;  5K9Y A;  1OUR A;  3WF1 A;  1QF3 A;  4R52 A;  1PK6 B;  4RYD A;  5FXZ A;  3W58 A;  1GZ9 A;  4KU8 A;  1IQA A;  5FZ7 A;  3V65 A;  4PIY A;  4Q0Q A;  4WBB A;  3NAP C;  2QDN A;  4P9Y A;  1UW8 A;  1C8M 2;  3CJX A;  1FV2 A;  2E26 A;  1GNH A;  2ZGS A;  3TEX A;  3THD A;  4QB6 A;  2QTW B;  4FP2 A;  3ZO0 B;  3Q8B A;  3T2Q A;  3WG3 A;  1UIK A;  2BWA A;  3OGJ A;  4UOJ A;  4O7X A;  4P9W A;  1JBC A;  1NA1 A;  4B1M A;  2WO7 A;  3KQR A;  1V0A A;  1SDW A;  1AL2 1;  1ND3 A;  2ARE A;  2DVG A;  1R1A 2;  2PHL A;  2XGX A;  2YGM A;  4FFH A;  4QPG B;  2JXA A;  2QQW A;  5EQU A;  4C91 A;  1MQT C;  1Q8V A;  4FAG A;  3JQX A;  1VBE 2;  4YVW A;  3H8R A;  3N7L A;  4LEJ A;  3VUO A;  3NMB A;  5FLH A;  3U11 A;  3LE0 A;  3ZDV A;  1V6K A;  1MVE A;  1UPI A;  1DGW A;  5FCC A;  1PIV 2;  4XIL A;  2G1M A;  3W5M A;  2X10 A;  4AGR A;  3F95 A;  4DXZ A;  3ZM8 A;  4UBH A;  1H8T A;  2QQI A;  3NVC A;  4LBQ B;  3DKQ A;  4YW2 A;  2R06 2;  3FX3 A;  3HQR A;  4Q4Y 3;  3I2F A;  2AEN A;  3W20 A;  5A32 A;  3AKT A;  2WO1 A;  2TBV A;  2UYA A;  3DCQ A;  3UL2 A;  1D0G A;  1X9T A;  3J4U H;  1W9S A;  2R04 3;  3VBS A;  3ZIX A;  5FY7 A;  2RS3 2;  2WO2 A;  3ZPO A;  4Y20 B;  5ACA 3;  1D4M 3;  3OB8 A;  4Q5O A;  2IXH A;  5IWF A;  4IE6 A;  3ZYG A;  3AC0 A;  5AVA A;  1RVF 1;  4AEK A;  4H3W A;  1J1L A;  4DEQ A;  3IT8 A;  1I5Z A;  4ZS2 A;  3UGG A;  1RJ7 A;  3N9M A;  5FXV A;  4CU8 A;  3ZXG A;  3D3A A;  2PAK A;  4AQT A;  1TME 3;  3JU9 A;  4M0H A;  3VBF A;  2OXB A;  4L8Q A;  5EJZ B;  5F5C A;  3UKN A;  1QQP 3;  1UMH A;  1GOH A;  3WHU A;  4AQ2 A;  4CDU A;  2OVU A;  1AR8 3;  1ZZ8 A;  2Y6J A;  4PDW A;  2VZ1 A;  3VD5 A;  3WOG A;  1H4G A;  2WZR 2;  5DQ0 A;  4B4R A;  2VZT A;  4KG0 A;  4A7K A;  3U4S A;  1UXZ A;  2K2S A;  4NWW A;  3JB8 A;  2BFU S;  2Q5T A;  3ZYH A;  1RUE 3;  3RS6 A;  3MDP A;  4AI8 A;  3CEW A;  1NXM A;  4JGZ B;  1CPN A;  1YXW A;  2RM2 3;  4YWA A;  1HV0 A;  2X05 A;  4COU A;  5CG8 A;  2CYF A;  1X36 A;  4FBF A;  1W8F A;  5F2S A;  5FUI A;  2NYY A;  1DFQ A;  3VGI A;  4CXW A;  3LOB A;  3IN9 A;  4GUL A;  3VBU A;  5BXX A;  3ZYP A;  1KRI A;  3M3Q A;  1QEX A;  2MEV 2;  5IJR A;  4QQO A;  4KGG A;  1UO9 A;  1VMJ A;  3P5B A;  4DUX A;  3DF0 A;  5T5L A;  4WVZ A;  2ARX A;  4HPK B;  3NV4 A;  4Q0P A;  3WW2 A;  5FO8 B;  4UFK A;  1FPN 2;  4M00 A;  3S0M A;  1ZM1 A;  2K0G A;  3GJB A;  4WVM B;  1K5J A;  1UOJ A;  3I59 A;  4N90 A;  3NAP A;  4AFA A;  4ARX A;  5EXO A;  4HK9 A;  1LOC A;  3P6B A;  1D0H A;  3N9L A;  5DAW A;  2J42 A;  3RWK X;  1TZO A;  2VZV A;  4J1X A;  3LZZ A;  2XJQ A;  5GJ6 A;  4NII A;  1D4V B;  3KGL A;  4YRD A;  2BEO A;  2W1U A;  4YFZ A;  5A6Y A;  2CDO A;  5J7M A;  1W0P A;  4JGZ C;  5JCT A;  1VBD 2;  4A7Y A;  1UQX A;  1OLM E;  4QB2 A;  5JIA A;  4Y4Y A;  3EB7 A;  3WNX A;  5IFT A;  1RHI 1;  2YG0 A;  4Y4R A;  3BUC A;  4Z82 A;  2ILM A;  2AEY A;  3AM2 A;  4CU7 A;  4PCR A;  1MQT A;  2D3P A;  2XJS A;  3OSD A;  4QXH A;  1VAM A;  2BTV C;  3TBD A;  4LHN A;  1ENX A;  5IVB A;  4JGY B;  1BCX A;  1NQJ A;  3O1U A;  1CAU B;  3FLR A;  2C9K A;  4G9S B;  3WG4 A;  3SCG A;  2GU9 A;  4CZS A;  5JOZ A;  2CSG A;  4AQS A;  1SLL A;  3FUQ A;  4L99 A;  4CDX B;  5EWS A;  5C7G A;  4PF1 A;  4FPE A;  1RL3 A;  2PAE A;  2BZD A;  3LKJ A;  3I4I A;  4BH9 A;  1YJK A;  5T50 A;  4XXA A;  1OLQ A;  3WNL A;  4NRM A;  1SHW B;  3MIE A;  4LKF A;  4LNV A;  1RMU 2;  4XHB A;  2R1B A;  5FY9 A;  2VUL A;  2WAA A;  1S0I A;  3N3H A;  2JD4 A;  4Q4X 3;  1CAV A;  4LOS A;  1MPX A;  1O7F A;  2XVG A;  2V09 A;  3M8L A;  3MV0 1;  1Q5O A;  3ZN6 B;  4BIO A;  3GHN A;  4XAA A;  2WSU A;  4B7E A;  1WME A;  4QXC A;  3OY8 A;  2FDG A;  2E63 A;  5JI7 A;  2QQO A;  3SQO A;  2YPJ A;  1LEN A;  4ZXK A;  2ZA9 A;  3I3Q A;  3N9N A;  4TXW A;  5FIX A;  1QJX 1;  3PU3 A;  3K4D A;  4HBN A;  1D7P M;  1YCI A;  4IND A;  4ZPI A;  4JGY C;  1ZBA 3;  2D97 A;  2HWE 1;  2IXI A;  5FJH A;  2EIB A;  1RUC 1;  4Y26 A;  1S0E A;  2BJS A;  3A0N A;  5LWB A;  1AR6 1;  2ZKL A;  3KV6 A;  1T2X A;  4KG8 A;  4E4H A;  3QLQ A;  4CDX C;  4BCU A;  4LLO A;  1EPW A;  4CCO A;  4HG6 B;  1WW7 A;  4Q4W 3;  1FYU A;  1GU3 A;  4LO6 B;  1UOG A;  1L3J A;  1LCL A;  1QJU 2;  1XJA A;  1RUG 2;  1IKP A;  3T4H B;  4LIT A;  4Y20 A;  2VUJ A;  3RWN A;  1JU4 A;  3I2O A;  1JYV A;  4PI2 A;  4Y24 A;  4QHZ A;  4QXK A;  3H1Y A;  4PT6 A;  4AVB A;  3PUI A;  3WDU A;  2HWD 1;  5GZD A;  3HD8 B;  1W8T A;  3WNP A;  5IK4 A;  1KJL A;  1C5H A;  5CAD A;  4PBP A;  5I93 A;  4UAP A;  2Y64 A;  4HXC A;  1R1Z A;  2ADE A;  1LGN A;  1VRH 3;  4FPJ A;  5I8Y A;  3HT1 A;  4ZHN A;  3DN7 A;  5LA9 A;  1UXX X;  4JRL A;  4JKK A;  3RGB A;  1YC6 1;  4FOQ A;  4LO8 A;  1O5U A;  1U5Y A;  2VMH A;  3Q9O A;  4IGO A;  2A1X A;  3SEE A;  4BK4 A;  4NHK A;  1WMX A;  3K4Z A;  4XDP A;  4I01 A;  4JGZ A;  4CRQ A;  1WLC A;  2GND A;  1GIC A;  2ZX2 A;  3T2O A;  1XE0 A;  2XJP A;  1SQ4 A;  1XE7 A;  1DCS A;  2RE9 A;  4MZU A;  2DUP A;  3AP6 A;  2ZEX A;  1W06 A;  3IBM A;  3U0Z A;  1PNG A;  1ULO A;  1NY7 2;  4D6Q A;  5FK8 A;  1WUV A;  2WLP A;  4TZD A;  4AED C;  3MPB A;  4CCJ A;  2CY6 A;  1GYK A;  3KCY A;  3TEW A;  2Y8K A;  4YW6 A;  1RED A;  1G7Y A;  2HEW F;  3GHM A;  4YGD A;  3POI A;  5EV7 A;  2EXJ A;  5A1L A;  3MFC A;  5CFD B;  4HPK A;  1EAH 1;  3WF3 A;  4GH4 B;  4OI4 A;  4IUG A;  4V2V A;  3PUA A;  3AKQ A;  3VD3 A;  2D43 A;  3S57 A;  2VL4 A;  3K46 A;  4ZU7 A;  2VJX A;  1BBT 1;  5C4W B;  3VHR A;  4XIO A;  3DPR C;  3NNF A;  1W0N A;  2B39 A;  2Q8D A;  3V0A B;  4LO4 B;  3RZL A;  2MHF A;  3POB A;  1Y7B A;  2AUY A;  4LIV A;  3VZN A;  1PZ9 A;  4BHP A;  5DAB A;  1JZ6 A;  1FOD 2;  4OI1 A;  1W8O A;  4W8J A;  1PGL 2;  4DFS A;  1JI6 A;  1OUX A;  2XXZ A;  1UMZ A;  2VW1 A;  3IAQ A;  5C9A B;  1GKB A;  2PQQ A;  3X29 B;  4CU6 A;  2BRT A;  2WR9 A;  5FO9 B;  3Q8E A;  3WNM A;  3OBA A;  4FCA A;  3D5O A;  2ZAA A;  3C7G A;  2Y26 A;  4C0B A;  5A7W B;  1XXN A;  3RDI A;  5FZF A;  2YFZ A;  1AX1 A;  1ZZC A;  4Q0U A;  4HVQ A;  1AR9 1;  1CGP A;  3FFQ A;  4JGY A;  3IDB B;  1WCD J;  5D1I A;  4XUN A;  2BWC A;  3MW4 A;  5ANN A;  3S30 A;  3I3E A;  5CKN A;  1RUI 1;  4E8C A;  3CMG A;  2XJR A;  5CFD C;  3JD7 1;  4NRO A;  4GH4 C;  4KMQ A;  4CDX A;  1Q8Q A;  4NHY A;  1UKR A;  2OPK A;  1HRV 2;  2GP5 A;  1BK1 A;  3ZFG B;  4K9S A;  2K46 A;  4XBQ A;  5FYH A;  4LBM A;  1IPS A;  4BLJ A;  1J58 A;  3LA2 A;  2BGP A;  1NG0 A;  5FMO S;  5C4W C;  5C8C B;  2DCJ A;  4GJZ A;  4XFH A;  3RRD A;  1UY1 A;  2R0F A;  1M4W A;  3UKV A;  2JDK A;  4XF9 A;  1S1A A;  2BGO A;  3R0R A;  4QGL A;  5CIS A;  4MYE A;  5JSO A;  3L2Y A;  5KHG A;  5C3S A;  1QOT A;  2JE8 A;  3TOJ A;  1JYN A;  5FYZ A;  3S5Q A;  5JOY A;  2B45 X;  1XSQ A;  2H0V A;  3BIE A;  2V4V A;  1KIT A;  2IXK A;  2ZX1 A;  5FPA A;  5FRE A;  1DP0 A;  4AYU A;  3I3M A;  1RUG 3;  3BYW A;  4LMF A;  4H55 A;  2B7Y A;  3AL6 A;  3R4D B;  5ABJ B;  4FI9 A;  1LU1 A;  5F3C A;  1K45 A;  3FUO A;  2SBA A;  2OT7 A;  1O3T A;  1OBN A;  4K6B A;  2VQT A;  2VBP A;  3H3U A;  1JHN A;  3VN4 A;  1AZD A;  4HAN A;  1EV1 3;  4PBO A;  4FFF A;  4RD7 A;  3VDD C;  1UWW A;  2A6V A;  3CNA A;  3MBW A;  3FHI B;  3RI9 A;  4CCN A;  1AXZ A;  3RQ0 A;  1A8M A;  1DU3 D;  3AKS A;  4QT6 A;  4EWD A;  3WUC A;  4C0H A;  5JZG B;  1SMV A;  1UN1 A;  4CDQ B;  4AED A;  1ASJ 1;  1RUH 3;  4QDR A;  4QPW A;  3C7H A;  2YC4 A;  1PGW 2;  2J1S A;  1NZI A;  5DG2 A;  5F5A A;  5L9R A;  5C3O A;  4YFW A;  4FPC A;  3KM5 A;  3H3Z A;  5FQ0 B;  1RUF 3;  1UZZ A;  3M2M A;  5L9B A;  4FPL A;  4XYX A;  1YI9 A;  4KL1 A;  5FFO C;  4DNY A;  2LRO A;  2WYS A;  3OPT A;  3H0O A;  5J36 A;  1XU2 A;  2A5Z A;  1OQ1 A;  3L2H A;  3DPR A;  5ABJ C;  3RFR A;  1JYW A;  1POQ A;  2DV9 A;  2UYB A;  3BB6 A;  2A70 A;  2AGS A;  2RHP A;  4XXP A;  2DYC A;  1AHS A;  2D3R A;  1R08 3;  2ET7 A;  5E89 A;  5GLZ A;  5LA1 A;  1JYC A;  4QDS A;  3G7D A;  2NPI A;  2JG8 B;  2YC2 A;  2A75 A;  2ARB A;  4OUE A;  2RDQ A;  1H9W A;  1H2L A;  3AB0 A;  3OBT A;  5E6H A;  3JQW A;  3ZSM A;  2ZZQ A;  3WT3 A;  5A3U A;  4Y1U A;  3T1M A;  1W3X A;  5CA6 A;  2VY0 A;  2E7A A;  4YGC A;  5G04 L;  3U14 A;  1GAN A;  1BYH A;  2JG9 B;  2RMU 3;  3OPZ A;  1W99 A;  1S2K A;  1XQN A;  2E6V A;  4FXG B;  5GAL A;  2IXJ A;  3KT4 A;  4RHV 2;  5DAX A;  3FJS A;  3OUH A;  3UES A;  3ITQ A;  3J8F 2;  3WNK A;  1DGR A;  3AMQ A;  4LOT A;  5CFD A;  4PIX A;  2HBU A;  2EAK A;  2OPW A;  4GH4 A;  1PZ7 A;  4IE4 A;  5K7P A;  2XL7 A;  4MGZ E;  4S2F A;  1DBN A;  1QXP A;  2FDF A;  3E5X A;  2VNG A;  3LOI A;  1JXN A;  4DOU A;  3Q8C A;  5C4W A;  1NLS A;  4XUP A;  5DPN A;  1XC6 A;  3T09 A;  3V0A A;  4NMI A;  1HDK A;  3WQ0 A;  3U1X A;  1B09 A;  1JOJ A;  5FDB A;  3VD4 A;  4PI0 A;  3CLP A;  3V64 A;  1POV 3;  2QZ3 A;  1US2 A;  2JG8 C;  5JVV A;  3WW3 A;  4LOR A;  4XUO A;  4UT5 A;  2CWS A;  1C8M 1;  1UY4 A;  4YZ2 A;  1DYP A;  3LDK A;  1HRV 3;  1HB3 A;  1LOD A;  3MFA A;  1RVF 3;  3O5S A;  1YI7 A;  1BJQ A;  2HJI A;  1AXK A;  4IL7 A;  5FZ3 A;  4FTE A;  3L9J T;  5A7W A;  2RS1 1;  5A7Q A;  5KBF A;  2XWB B;  4NN0 A;  4COW A;  3I2D A;  4QGM A;  2ORZ A;  3P3N A;  5CFC B;  1XND A;  1YIF A;  1ACC A;  3LSE A;  2NQY A;  5IYY A;  4P5Y A;  3RJR A;  4HKO A;  2VCB A;  2CGN A;  1QOS A;  3VDD A;  1FMD 2;  4BB3 A;  4YW1 A;  4COV A;  2DUR A;  3BPZ A;  4YW4 A;  1WW4 A;  4LT5 A;  1PIV 1;  5FBJ A;  3CBN A;  4FTB A;  4DY5 A;  2D6O X;  4D6S A;  4MGI E;  4LHL A;  4OHZ A;  1AYN 2;  1IGO A;  5FY5 A;  3LB9 A;  3O1P A;  1CN1 A;  3SH5 A;  2PHF A;  2R06 1;  4BQ5 A;  1R09 3;  4HT1 T;  4XAB A;  5GZE A;  4NIH A;  1RUD 1;  3A7Q A;  3HNY M;  4QHB A;  5DDJ 2;  1D2S A;  4QX1 A;  1OA2 A;  4B4P A;  5KC6 A;  2OII A;  1GP5 A;  2A73 B;  3A0K A;  1IQD C;  3M3I A;  3WG2 A;  4R9D A;  1FAT A;  3SIT A;  1U5Z A;  4I09 A;  3RZH A;  1HN0 A;  4I0B A;  4AHW A;  4AE2 A;  1URX A;  3PME A;  1H9P A;  4GAL A;  3VZO A;  1UX6 A;  3DL3 A;  4OZX A;  1CAX B;  5ABJ A;  2GC1 A;  5FP7 A;  4LBQ D;  2TUN A;  3GZA A;  3NJZ A;  4IGQ A;  4HLT A;  1AR7 3;  4N9H A;  2QQM A;  4MGY E;  2WZ8 A;  3IAP A;  2QVS B;  2R30 A;  4AOC A;  3APB A;  5FPX A;  3T0D A;  4C8D A;  1XNC A;  4IE5 A;  1CVN A;  4E4S A;  5I0R A;  2C5D A;  3SCH A;  4AWD A;  1QJF A;  1W2U A;  5GM0 A;  1LHN A;  1UZY A;  2EID A;  1UPS A;  4CEW C;  3OF1 A;  1RIN A;  1MZF A;  1XSR A;  3B02 A;  4WM8 C;  4HSL A;  4XJ8 A;  2NLR A;  3JBG 3;  1RHI 3;  3ATG A;  1HXS 1;  1NA1 B;  1BVV A;  5J96 B;  2ZAB A;  1BMV 2;  3LEM A;  1VPH A;  4QM8 A;  2HWB 1;  3MGU A;  2VNO A;  4M01 A;  3R4S A;  3DEM A;  5A80 A;  4B4Q A;  3TAY A;  5HBA A;  3RPQ A;  4D7S A;  1DQ6 A;  2R32 A;  4A3X A;  3RZG A;  3ILR A;  4A6S A;  1ND2 B;  1UX7 A;  2VNV A;  4XHX A;  3NL1 A;  1XPW A;  2ATF A;  1SBD A;  4AHY A;  1N3P A;  5KXC A;  1H8T B;  2ZJC A;  2JG8 A;  5KXB A;  2XWJ B;  1O8S A;  2GZW A;  4CPB A;  5AC9 2;  4XCB A;  2ZMN A;  4N43 C;  2RR1 3;  2QFE A;  4KGQ A;  4NR1 A;  4H2A A;  3Q8A A;  2AC1 A;  4GWJ A;  2EAA A;  4J25 A;  4Q29 A;  1N3O A;  4JVA A;  2VVE A;  1ENS A;  5EFU A;  2XBO 3;  5LA2 A;  1S0C A;  3GYD A;  4QX7 A;  4W65 A;  4F83 A;  1C28 A;  2UWC A;  2BNN A;  5KXE A;  4JDO A;  3GXU A;  3ALQ A;  4UBG A;  4AZZ A;  1LAJ A;  5HCF A;  1E5I A;  2BBA A;  5A3N A;  5FOB B;  2DFC A;  2YC0 A;  4C90 A;  2D6P A;  1QJX 3;  4Q4Y 2;  3VBF B;  2E53 A;  3BI3 A;  1EP0 A;  1O3R A;  4NUB A;  2PHW A;  3R6S A;  2R07 1;  1IKQ A;  3U07 A;  1U5X A;  1RUC 3;  4CDU B;  2R04 2;  1XB9 A;  4JQR A;  1US3 A;  4IEW A;  3Q8F A;  4PDW B;  3SXW A;  1D4M 2;  4OUL A;  5IK8 A;  1Q3E A;  4ZKT B;  2XHK A;  3O1T A;  1KEX A;  1DDL A;  1UYX A;  5LB6 A;  2Y33 A;  1ND2 C;  1W6O A;  3VKN A;  1J84 A;  3AXD A;  4M3C F;  4CUG A;  4MAD A;  3OCP A;  1F2N A;  2WWJ A;  5LBB A;  3E5U A;  4YAR A;  1TME 2;  2VEC A;  3VD7 A;  5BY5 A;  1O91 A;  4LO5 B;  4CXX A;  1N3Q A;  4FFI A;  5B4X A;  4LBO A;  5D2A A;  3VV1 A;  1I9R A;  1AR8 2;  1ZZ6 A;  2XJT A;  4OHY A;  3H42 B;  5L9V A;  2AR6 A;  1GFF 2;  1JW6 A;  3LQC A;  4P9X A;  3U4X A;  1AYM 1;  3INA A;  5L36 A;  3HOB A;  3SC7 X;  2QUO A;  1ALY A;  3VBU B;  3LSD A;  2VZ3 A;  2LM3 A;  2DVA A;  4ERO A;  2YUE A;  5FZ6 A;  1RUE 2;  2VUA A;  2FD8 A;  4DB5 A;  1XNA A;  2LRP A;  5FYB A;  4L11 A;  2LAL A;  3AK0 A;  4SBV A;  3HT2 A;  1V6O A;  4FPY A;  4GWM A;  4XJW A;  1W9Y A;  3OGR A;  1S0G A;  3ES1 A;  3H7J A;  4QHO A;  2NMO A;  3M7A A;  4I0W B;  3HNM A;  4QPI C;  4LE4 A;  3ENR A;  4XMA A;  2Y6L A;  1QJY 3;  5ERL A;  1GZT A;  3LDB A;  4TLF A;  1QIQ A;  3B94 A;  3ACG A;  2TEP A;  5FP8 A;  3ZFF C;  2QQL A;  1O3Q A;  2BDR A;  3GZU C;  4CEW A;  4DEV A;  1NT0 A;  3C7F A;  1JOB A;  1SBE A;  2PHX A;  3DXT A;  3MIH A;  4WM8 A;  3O7O A;  3RYK A;  5BNN B;  1DHK B;  4LUK A;  4BU2 A;  2FBE A;  2GNB A;  4D3W A;  5I0U A;  4XQD A;  1S2B A;  1HQN A;  1QJU 1;  4MOA A;  4QWN A;  5FYS A;  5FZM A;  3WDY A;  5FUN A;  2KXL A;  3QD6 A;  3UK9 A;  3VZK A;  1MZ5 A;  1YLL A;  4BQX A;  5C71 A;  1J1T A;  1W8H A;  5B4N A;  2Z42 A;  4WZF A;  4MH0 E;  3HMY A;  5FMB A;  4Z07 A;  3ZOI A;  4Y1X A;  1QNY A;  3HQX A;  4U2A A;  1HB4 A;  2XKO A;  4CCM A;  1NCQ C;  4DQA A;  4UFI A;  5T3N A;  3VKL A;  4L2N A;  3ZSJ A;  1NOV A;  3WP5 A;  4YGE A;  1BBT 3;  4GJY A;  3WP4 A;  3WSO A;  4DMI A;  2WFF 1;  2D6N A;  4N43 A;  4UW6 A;  1PO1 3;  1TMF 1;  3ILF A;  1O4Y A;  3O0W A;  1SLT A;  1F35 A;  2XLG A;  2YBK A;  4ASM B;  5T5P A;  3H8O A;  2Q30 A;  1YQ2 A;  3LWC A;  3N9O A;  5KWR A;  3KSC A;  1CAV B;  5FKC A;  5BNN C;  2BYV E;  1SZB A;  4B8E A;  4M0N A;  3WP6 A;  1C1F A;  1F4A A;  1QHD A;  3WNN A;  3OY8 B;  3EJK A;  4BME A;  3U37 A;  1A34 A;  1H2M A;  2ZHK A;  1DZT A;  1NY7 1;  4LUM A;  5AC9 3;  4XIK A;  2VC9 A;  1RUI 3;  2YB7 A;  4AFC A;  2VOW A;  1UF2 C;  1OC1 A;  4Q4X 2;  2GC2 A;  1ND2 A;  2K9Z A;  4GXL A;  5HXM A;  3ASI A;  4AK3 A;  1YQ5 A;  5FOJ B;  1G9B A;  1QKQ A;  4YG6 A;  4LBL A;  3BIW E;  4CUC A;  4V1P A;  2WS9 1;  2ZGP A;  4GB3 1;  1UYP A;  3WX5 A;  3WW4 A;  3POS A;  4QPY A;  5EIY B;  1LES A;  4FOW A;  1W6M B;  2RS5 1;  3KV9 A;  3NKG A;  5HV0 A;  3AKR A;  3M4F A;  2QBX A;  4XFF A;  1HRI 1;  1ZBA 2;  2E32 A;  3MF9 A;  1Q56 A;  1LU2 A;  4W4Z A;  5IVV A;  4Q0V A;  5CKQ A;  2C6S A;  2GAU A;  3KS7 A;  3WIN E;  4GQ7 A;  4R9C A;  4IV1 C;  4AVS A;  2KR2 A;  4Q4W 2;  1LED A;  1AJO A;  2KD7 A;  4MO3 M;  1YQ6 A;  3DYO A;  1GV9 A;  2P1B A;  5FUP A;  1F15 A;  1BHG A;  2VOV A;  4IEQ A;  4QPI A;  1H6Y A;  2D6K A;  4N9I A;  1JS9 A;  1REE A;  5JR7 B;  4ITC A; 
#chains in the Genus database with same CATH homology
 5J1X A;  3SEE A;  4BK4 A;  4QX2 A;  4Z2A A;  3K4Z A;  1K42 A;  4BJ0 A;  3W5N A;  5JMO A;  3T2O A;  4XUT A;  2R7E B;  1JHJ A;  2ZEX A;  1ULO A;  1UMI A;  3GGL A;  2Y8K A;  3WF2 A;  1GNY A;  4QAW A;  4M4R A;  5DMY A;  4OMC A;  3ECQ A;  3FHA A;  3WF3 A;  3VD9 A;  2W1Q A;  1GOF A;  5JR2 A;  3K77 A;  4IUG A;  3VD3 A;  5A1A A;  2VL4 A;  1WCQ A;  3K46 A;  5DN2 A;  4P02 B;  2VJX A;  5C70 A;  1OF3 A;  3BN6 A;  4XUR A;  1W0N A;  2WBK A;  3K4A A;  1JZ6 A;  2QQN A;  3I2J A;  3EYP A;  2WAB A;  1W8O A;  4W8J A;  3A21 A;  5EJ1 B;  1JI6 A;  1CZS A;  3OGV A;  3IAQ A;  4CU6 A;  4KWU A;  2JKX A;  4CVU A;  3WNM A;  3OBA A;  1H6X A;  3ACF A;  3C7G A;  4LKS A;  2ZEY A;  2YFZ A;  5JXI A;  2W47 A;  1F4H A;  1JZ4 A;  3VDC A;  4DXS A;  4XUN A;  4QX3 A;  3I3E A;  2WO3 A;  4E8C A;  3CMG A;  2XQX A;  4KMQ A;  1GQP A;  2W91 A;  2VMF A;  4BXS V;  1JU3 A;  2RVA A;  2BGP A;  5F7U A;  2DCJ A;  5LA0 A;  1L7Q A;  1UY1 A;  1LNS A;  4A6O A;  2VZQ A;  2BGO A;  3WEZ A;  3IB3 A;  3NRU A;  2ZXQ A;  2WQ8 A;  4DXR A;  4BK5 A;  2JE8 A;  1CX1 A;  1JYN A;  4DUW A;  2V4V A;  3CQO A;  2JD9 A;  2ZEW A;  1DP0 A;  1RYY A;  1KGY A;  3WF4 A;  3DYM A;  1OD3 A;  4FI9 A;  1K45 A;  5IFP A;  3SEP A;  2W1S A;  2VQT A;  3I2I A;  1UWW A;  3MBW A;  2B9V A;  1K12 A;  2VOT A;  4MGS A;  4XVH A;  1JZ7 A;  2C4X A;  2HLE A;  5IHR A;  3WNO A;  3T08 A;  3MV1 1;  4QDR A;  4QPW A;  3C7H A;  2YC4 A;  4ARY A;  3CIH A;  2J1S A;  1ULP A;  4A42 A;  4A45 A;  2QQK A;  1OH4 A;  5CZK A;  2J1R A;  3HEI A;  1L7R A;  1NKG A;  2L9L A;  2WYS A;  4A3Z A;  3MUZ 1;  3JXS A;  5G05 L;  2RJ2 A;  1JYW A;  3T09 A;  4BDV B;  4CU9 A;  5LA1 A;  1EUT A;  4PQQ A;  4QDS A;  1I5P A;  3ACI A;  2YC2 A;  1CZT A;  1CZV A;  1W8N A;  3I3B A;  4OUE A;  2Y6H A;  1PX3 A;  5G04 L;  3NJX A;  1SG3 A;  3A22 A;  1W99 A;  3PUH A;  5JUV A;  2XON A;  5JXH A;  2EIC A;  3ETP A;  3UES A;  2J1T A;  4MGQ A;  3WNK A;  1JZ5 A;  5JXG A;  2DCK A;  1WKY A;  3FN9 A;  2C26 A;  4JKM A;  2VCC A;  2WZE A;  3CKH A;  2QQJ A;  2VM9 A;  1W9T A;  4XUP A;  5DPN A;  1XC6 A;  2PQS A;  3VD4 A;  3K75 B;  3NJV A;  2VZU A;  4P08 A;  3T0A A;  1US2 A;  2LS6 A;  4XUO A;  2Z4F A;  1JZ2 A;  3GDB A;  1UY4 A;  1EUU A;  2YFU A;  2RV9 A;  2WDB A;  2VZS A;  1UYZ A;  3VDB A;  2ORZ A;  4YPJ A;  3MUY 1;  3FHQ A;  4A41 A;  2V72 A;  4P5Y A;  5IYY A;  2J1A A;  4GZ9 A;  3F2Z A;  3OGS A;  2VCB A;  4GWI A;  2VO5 A;  4ZXE A;  2W94 A;  5JXJ A;  1DLC A;  1PMH X;  2VQU A;  3C7O A;  3SKV A;  2W46 A;  1SDD B;  2HYX A;  1UYY A;  3ABZ A;  3P1I A;  2VTF A;  4QX0 A;  5I0D A;  1JYX A;  3E1F 1;  3A7Q A;  3HNY M;  3HPN A;  4QX1 A;  2J1E A;  2BER A;  3LEK A;  1IQD C;  3OG2 A;  2W5F A;  3LPG A;  4JKL A;  1NAE A;  1R64 A;  4D8M A;  2Y6K A;  4QDQ A;  4M4P A;  3IDA A;  1XNT A;  3WF1 A;  2QQM A;  2WZ8 A;  4RYD A;  3IAP A;  4ET7 A;  2WUH A;  3T0D A;  1O8P A;  4A44 A;  2B4K A;  3CZU A;  2E26 A;  3J7H A;  3THD A;  4QB6 A;  4XUQ A;  2EID A;  3T2Q A;  3LPF A;  4UOJ A;  4CUB A;  3CDZ B;  2XOM A;  1TVG A;  3UET A;  2W1W A;  3DEC A;  3LE0 A;  3W5M A;  1UX7 A;  2X10 A;  2VZP A;  3ZM8 A;  1XPW A;  2QQI A;  4QB1 A;  1K3I A;  2WAO A;  3I2F A;  1O8S A;  1UY3 A;  2WO1 A;  2VME A;  4AAX A;  3CZJ A;  2JDA A;  1W9S A;  2WO2 A;  3A23 A;  2ORX A;  4A4A A;  3OB8 A;  3AC0 A;  4GWJ A;  2V5D A;  4DEQ A;  1P8J A;  5LA2 A;  4CU8 A;  1HN1 A;  1TG7 A;  2OKX A;  3D3A A;  3GXU A;  2BBA A;  3NNG A;  5EJZ B;  1UMH A;  1GOH A;  2Y6J A;  2J1V A;  2VZ1 A;  3VD5 A;  4OYU A;  1JZ8 A;  1US3 A;  2J7M A;  2W9X A;  1GMM A;  5DQ0 A;  2VZT A;  3SKJ E;  1UXZ A;  1KEX A;  1UYX A;  1J84 A;  2ID4 A;  3HJR A;  2W95 A;  4MAD A;  4XZU G;  4JX0 A;  3OEB A;  2VR4 A;  3VD7 A;  2X05 A;  4LHS A;  1CIY A;  4ZZ5 A;  3I2G A;  1GOG A;  5B4X A;  5FUI A;  4OZO A;  3LEI A;  3LQC A;  5IJR A;  3C8X A;  3HOB A;  4DUX A;  2VZ3 A;  2WN3 A;  1OF4 A;  2Y6G A;  3GM8 A;  1UY0 A;  3HNB M;  1XNA A;  1NUK A;  3I2K A;  3WF0 A;  3OGR A;  3HN3 A;  4ARX A;  2W87 A;  3HNM A;  3P6B A;  2Y6L A;  5LCW L;  2VZV A;  4ZZ8 A;  2VCA A;  3ACG A;  2QQL A;  2W1U A;  4DEV A;  1UZ0 A;  4OMD A;  2CDO A;  3C7F A;  3FL7 A;  2WN2 A;  4E8D A;  3VDA A;  4QB2 A;  3ACH A;  3EB7 A;  5IFT A;  2YG0 A;  4MOA A;  4RN5 A;  4CU7 A;  5C71 A;  5B4N A;  2VZR A;  2C9K A;  3MO4 A;  2VMD A;  4UI9 L;  2LW8 A;  3III A;  2EIE A;  5C7G A;  4PF1 A;  3NQH A;  3I2H A;  2BZD A;  3WSO A;  1NX9 A;  3WNL A;  2X09 A;  2XHN A;  4DXT A;  1SHW B;  1DYO A;  1JZ3 A;  4D0Q A;  5HPO A;  1O59 A;  3I3D A;  3LEG A;  2WAA A;  1MPX A;  4P00 B;  3MV0 1;  2W92 A;  1YQ2 A;  3I97 A;  3THC A;  4AG4 A;  4CUA A;  2W3J A;  2QQO A;  3OEA A;  1F4A A;  3T0B A;  3WNN A;  3WQB A;  3BGA A;  4TXW A;  3U37 A;  3C7E A;  3K4D A;  2ZEZ A;  1D7P M;  2VC9 A;  5CYY A;  2EIB A;  2YB7 A;  4KI5 M;  3UNP A;  1J83 A;  4DUV A;  1T2X A;  5HXM A;  1OT5 A;  4HG6 B;  3DYP A;  4CUC A;  2DDU A;  1GU3 A;  4LQR A;  2E31 A;  5EIY B;  4JHZ A;  4L0P A;  1GUI A;  3T2P A;  1JU4 A;  1PX4 A;  2QBX A;  1JYV A;  2E32 A;  2E33 A;  1W9W A;  1PMJ X;  4W4Z A;  4PT6 A;  3PUI A;  3WNP A;  2J1U A;  1UY2 A;  2J22 A;  2VMC A;  2KD7 A;  4W50 A;  4MO3 M;  3DYO A;  4UAP A;  2Y64 A;  4TTG A;  2VZO A;  1BHG A;  4LPL A;  1UXX X;  4ZY9 A;  4JKK A;  1H6Y A;  2CDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...