1H6XA

The role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
EPDANGYYYHDTFEGSVGQWTAAGPAEVLLSGRTAYKGSESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQRYDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE Y
publication title Clostridium Thermocellum Xyn10B Carbohydrate-Binding Module 22-2: The Role of Conserved Amino Acids in Ligand Binding
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 33
structure length 159
sequence length 159
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1h6xA00
2DDUA 1CZTA 2VQUA 3LEIA 3OGRA 3C7GA 1I5PA 3E1F1 2Y6HA 1TVGA 2VR4A 2J1AA 3BGAA 1F4AA 2W87A 1P8JA 4OMDA 3MUY1 2KD7A 4ET7A 1PMJX 1SDDB 1UYXA 3ACIA 3WSOA 4A6OA 1K42A 4CU6A 1W9SA 1CX1A 2ORXA 3VDBA 4E8DA 4BDVB 2W5FA 3IAQA 1D7PM 2V72A 2OKXA 3SEEA 5IFPA 2Y6LA 4LPLA 1JZ7A 2WN2A 3WQBA 2VZRA 3IDAA 3HOBA 4XUNA 4GZ9A 2QQIA 2ZEXA 3I3EA 5CYYA 4MO3M 2Z4FA 4CUBA 3K46A 5FUIA 5LCWL 1UY1A 3K75B 2WAAA 2WAOA 2ZXQA 4W50A 1NUKA 4IUGA 4TXWA 4A42A 2J1RA 4OMCA 1H6YA 3HNBM 2YB7A 4XUPA 2VZUA 3GGLA 3D3AA 3DYPA 2VC9A 3I2KA 1W9WA 1NAEA 1K45A 2RV9A 1GUIA 4JKLA 3W5NA 3CZJA 2E32A 5JXHA 2YFUA 3T0BA 4D8MA 1UXXX 3WF2A 3WNKA 1HN1A 3HNMA 3I2FA 4ZZ5A 1PX3A 4KWUA 1GOGA 4QX2A 3VD5A 2QQKA 2YC4A 2VZTA 4XVHA 3WNNA 2J1TA 4RYDA 4CUCA 2ID4A 4DEVA 2YC2A 5JXIA 1CZVA 2WUHA 3T2OA 1UZ0A 4QX1A 1JZ3A 4GWIA 3NNGA 3I2GA 2WDBA 3UETA 2W94A 2XQXA 2W46A 1ULPA 1US2A 2Y64A 5G05L 3DECA 3MUZ1 1O8PA 5JXJA 5HPOA 4A4AA 5JXGA 2J1UA 2BGOA 4MGQA 3T2PA 2VCCA 3IB3A 1SG3A 1XC6A 3F2ZA 4P5YA 2W3JA 2VTFA 2JD9A 4MADA 4QB6A 2VQTA 1UWWA 3NJXA 1OF3A 2PQSA 2VMFA 3I2JA 1PX4A 3T09A 2LW8A 2W1QA 3CMGA 3WF0A 3OG2A 3LE0A 4ARYA 1UY4A 1OT5A 3EYPA 4KMQA 4QDQA 3SEPA 1LNSA 2VJXA 2EIBA 4QPWA 2VZOA 3OEBA 3EB7A 5JR2A 4UAPA 4AG4A 4HG6B 4MGSA 4ZY9A 2L9LA 4W8JA 4QAWA 3J7HA 4MOAA 4DUXA 2ZEWA 2YFZA 3A7QA 3MV11 5IJRA 2QBXA 3K4ZA 2E31A 4OUEA 3IAPA 3LPGA 4LQRA 2Y6KA 1YQ2A 2WO1A 2W92A 2CDPA 1GMMA 4A3ZA 3PUHA 2E26A 3W5MA 3OGVA 2HYXA 2XOMA 3MV01 1UMHA 2X10A 1EUUA 4M4PA 3CIHA 2WYSA 5B4XA 1DP0A 3WF4A 2DCKA 2W95A 4A45A 3A21A 1IQDC 1UXZA 2ORZA 1JU3A 2VMCA 1L7QA 5EIYB 5JMOA 2WZEA 4TTGA 3T0DA 4A44A 4XURA 3GDBA 2J1SA 3GXUA 1US3A 4DUWA 2X09A 5IFTA 2QQNA 4QDSA 4XUTA 2W1WA 2W91A 1JZ8A 3P1IA 3K4DA 1OF4A 3OGSA 3VD9A 4LHSA 2XHNA 2VZ1A 1XNTA 2C26A 3HJRA 1GNYA 5LA2A 4RN5A 2VMEA 4W4ZA 1GOHA 2J22A 4DXRA 5JUVA 1L7RA 1XNAA 3VDCA 1JI6A 2VOTA 4PQQA 5J1XA 4BJ0A 3I3DA 2W47A 3CDZB 3CQOA 1ULOA 2BBAA 3K4AA 1JYXA 4JKKA 2W1UA 1W0NA 3IIIA 1DLCA 2RJ2A 3WNOA 3DYOA 5C70A 1WCQA 3AC0A 1JZ2A 2BERA 2R7EB 3C8XA 2VZVA 4UOJA 2WO2A 4XUOA 1JHJA 2W1SA 1DYOA 3A23A 3UNPA 4D0QA 3OB8A 4P00B 3OEAA 1NX9A 4BK5A 4ZZ8A 3ZM8A 5IHRA 2VO5A 2VCBA 4P02B 5F7UA 4XZUG 3WNMA 5DN2A 3LEGA 3I2HA 5EJ1B 4QX0A 2J1EA 1JZ6A 4DEQA 2BGPA 3T2QA 4QB2A 4M4RA 2JKXA 3NRUA 3WF3A 2QQMA 4FI9A 2W9XA 4AAXA 2JDAA 3LQCA 5C7GA 3ETPA 1OD3A 4P08A 2VCAA 2QQLA 2VZPA 2VMDA 2XONA 3ACFA 1JU4A 1KEXA 1JYNA 2C9KA 5HXMA 4ZXEA 3I97A 4L0PA 3CKHA 4YPJA 2B4KA 2RVAA 3T08A 1J84A 5EJZB 2ZEYA 4GWJA 3NQHA 3SKJE 1WKYA 3WF1A 3HPNA 4DUVA 1EUTA 1K12A 3C7OA 5G04L 1W8NA 4QX3A 3UESA 4ARXA 4DXTA 2VM9A 4JX0A 1PMHX 2YG0A 3FL7A 3BN6A 2Y6GA 1UYZA 2BZDA 4DXSA 5LA1A 1UYYA 5B4NA 3FHAA 5CZKA 2JE8A 5A1AA 1UY3A 5LA0A 1W9TA 1MPXA 2QQJA 5DMYA 1F4HA 3I2IA 2QQOA 3K77A 1R64A 4KI5M 1GU3A 1XPWA 3VD3A 4CVUA 4QB1A 1JYWA 2VL4A 2LS6A 1UMIA 3PUIA 1GOFA 1UX7A 4BK4A 4QDRA 1O59A 4XUQA 3JXSA 4PT6A 3WNPA 1TG7A 3HN3A 1T2XA 2WABA 5I0DA 2EIDA 3T0AA 3WNLA 1O8SA 4CU7A 1JZ5A 2ZEZA 1UY0A 3C7HA 1W99A 3THDA 3FHQA 4LKSA 2WZ8A 4PF1A 3VD4A 3HEIA 2Y8KA 5C71A 4JKMA 3CZUA 2C4XA 4E8CA 1BHGA 1W8OA 2J7MA 3LPFA 3SKVA 1OH4A 4JHZA 1CIYA 1SHWB 1UY2A 2EICA 3ACHA 4OZOA 2V5DA 1JZ4A 2J1VA 3P6BA 2Y6JA 3C7FA 3U37A 4BXSV 3HNYM 3C7EA 3MBWA 2VZSA 4Z2AA 2B9VA 3A22A 2E33A 1JYVA 2V4VA 2WO3A 3GM8A 3ABZA 3NJVA 3ECQA 2HLEA 5IYYA 3OBAA 3MO4A 4CU8A 1GQPA 3I3BA 3FN9A 2WN3A 1RYYA 2DCJA 2VZQA 4UI9L 1CZSA 1K3IA 3VDAA 3THCA 3ACGA 2CDOA 1KGYA 4A41A 2VZ3A 3LEKA 1H6XA 1J83A 1NKGA 2EIEA 2X05A 3DYMA 4CU9A 4OYUA 2WQ8A 3VD7A 3WEZA 4CUAA 5DQ0A 2WBKA 5DPNA
chains in the Genus database with same CATH superfamily
3E5XA 1AR81 2TBVA 1FMD3 2VECA 1UZZA 1ZRRA 3AKTA 2QFEA 3MYXA 4YW6A 5J96B 1RJ8A 1U5IA 5H9SA 5JVVA 5BNPC 1TVGA 4RFRB 2VQ0A 3ROUA 3W59A 3ZPOA 2TUNA 5B2GB 5A7OA 2IC1A 1P8JA 4OMDA 4Q0SA 5L19A 3NV3A 5LBBA 2BW8A 5LK7B 5FMDA 2QE3A 3ZXDA 5FYYA 2QKDA 1IG3A 4GWNA 1PZ9A 1PMJX 1YFXA 4NR1A 3THTA 1QQP3 2JX9A 3KV9A 1WMDA 4JZRA 3M3CA 3DPRC 3PUSA 2E53A 4LHLA 4ORFA 3RMYA 4AXOA 1ZRDA 4NAOA 5IVJA 2NM1A 1MS8A 3DF0A 3VBSB 4CU6A 3ZYJB 3CF6E 4Q4V1 1W39A 1W8FA 1C28A 1W9SA 2DBIA 3BU7A 2YBSA 1FATA 4QPGB 4WVWA 2EXHA 5F5IA 4Y20B 2VUDA 1NOVA 1S0JA 4UXAA 1YXWA 2ZMKA 4TSVA 2CWMA 1ZBE3 5J98B 3K3OA 3SEEA 1Z7S1 2HWC2 4BIOA 5IFPA 4LPLA 4FBFA 4MLOA 3I3MA 4Q4Y1 2HWD1 1ND2A 3I49A 2X8KA 4RHV1 1HX6A 4IV1B 4UBHA 3RPQA 2ZEXA 4AEKA 3RZKA 4FTEA 5D1IA 4MO3M 1HXS2 1PGW1 3CJIC 3POIA 4XFFA 3MW2A 3K46A 5LCWL 4FXKB 3UV9A 4A6SA 3VZLA 4Y5TA 2ZXQA 4NJ4A 4FPCA 3DXTA 3ZXEA 3KF3A 1CD3G 3KGZA 3NV4A 2UY9A 4S2FA 3ILNA 2SBAA 4LEJA 2J1RA 4OMCA 4TXWA 1AZDA 1WW5A 1VBC3 1WLDA 1WW6A 1XNBA 3PVEA 4XUPA 2VZUA 2YGMA 4RR3A 5DZFA 4R52A 1POV0 4CDWB 1ZM1A 1BBT3 5GZDA 2WLQA 2AC1A 2VC9A 3JU9A 1QEXA 1ZZ6A 1W9WA 2OZ6A 4Y3OA 1NAEA 2XPJA 1GUIA 5A3PA 2P5BA 3AFGA 2IVIB 1ND3C 3M3QA 4Z92B 2P37A 2YFUA 1ASJ2 1SBEA 4D8MA 1FNYA 3BOWA 3J26N 1UXXX 2BV4A 4PI2A 5F6KA 3O1TA 3ZN6B 4OHYA 1JMUB 1PNFA 4HKOA 4KGGA 5A7SA 3BTXA 1NCQC 2AGSA 1PIV3 1UO9A 2WINB 2JG9B 3V0AA 2VZTA 4PIXA 4RYDA 4LA2A 5A33A 3U75A 3O0XA 4LULA 2YC2A 1LAJA 3S7IA 3MIDA 2X53S 3UJOA 1CGPA 1H9PA 2WUHA 5FZGA 3T2OA 2E7QA 2ZGSA 4QU1A 3EBRA 1Q8SA 3AP6A 3TN93 4GWIA 4NRPA 4PDWC 2JDZA 4PHZA 2WDBA 2XLAA 5T5OA 5BNPA 1US2A 2ZGNA 4HANA 1MS5A 1GQGA 1WD4A 3AKSA 2PHRA 3ZFGC 5L73A 5JXJA 1MACA 4A4AA 2E9QA 4LOSA 4IEOA 2G9FA 2VCCA 1REEA 1D2QA 1SG3A 1BLZA 1RUI1 3F2ZA 5FY9A 3O1VA 3WDWA 1GNZA 3DPRA 1RHI3 3KLSA 1VBA3 4LUKA 5FP4A 4MADA 2QDRA 2GNBA 4QB6A 2VOWA 1IQAA 1A34A 2PQSA 1AXYA 1FT9A 4UFLA 1U0AA 5KHHA 5C9AC 3NNLA 3ME2A 4HETA 3ZO0B 1RUE1 2HWE3 4RQPB 2D6MA 5FKBA 1OQ1A 4NE9A 4XZPA 4NPRA 2OQ6A 4FAHA 4HK9A 2DVAA 3LDRA 4UW4A 4M3CA 5E89A 4XCAA 1MEC1 3VKLA 1VBD2 1HRV1 3VDDC 1HQLA 1HIXA 3LE0A 4ARYA 3EYPA 4KMQA 4QDQA 2PHUA 2BGCA 1OMIA 3CJIA 3KT7A 5CADA 4FXGB 3LF7A 4AEDB 2V5YA 2VZOA 3EB7A 1QGLA 3O1SA 5JSOA 5K0UB 5JPNB 4YYOA 3USSA 4AG4A 1UOJA 4HG6B 2GN7A 4IE5A 1PVC1 4ISRA 3VL9A 5KHIA 2YPJA 3BCWA 3KWVA 2ZHNA 4Q4X1 4CP1A 3ZFEA 1JW6A 2L9LA 4XXPA 3WT3A 5CFDC 4LMFA 2B45X 1COV2 3PMEA 4GB33 5IK8A 2QQPA 2QZ3A 4MUVA 4K1YA 3A7QA 4HOOA 2ZZJA 5FZDA 1NA1C 3ZYPA 4DS0A 2QBXA 1LHOA 2AUYA 2RHPA 1I6XA 2E31A 4JCKA 3LPGA 3OF1A 1LHNA 1RVF1 2BOJA 3NVCA 3DL3A 4AVSA 5K7PA 2D5FA 1MQTB 2A6YA 1AR83 2EIGA 3O5SA 5FZIA 3IPVA 4B8EA 4EN8B 5B4XA 1YWKA 2NQYA 4OCTA 4Q1PA 3WF4A 1EAH1 2OPWA 3V0BA 2W95A 3VBUB 2XWJB 1JU3A 3FFQA 3MPPG 1LHVA 2VMCA 2P3JA 3ZFFB 1DGWA 1MZ5A 4XAAA 4PDWA 5EIYB 3N9LA 1AYN2 4EWAA 3DKQA 5ANNA 4YM3A 5ISLA 5H9RA 4CCKA 2DYCA 2QCSB 4NHLA 3KF5A 3GXUA 5EYXA 4Y1VA 2RM22 4XFAA 4DUWA 3LD8A 1ZA4A 2X09A 3G7DA 5JOZA 3MFCA 3K2OA 5FIXA 2C0ZA 4Q4V3 4CCJA 4QDSA 3AZXA 4D3WA 1OOPB 3G6JB 2ZABA 3Q9OA 1GICA 1Q5OA 3TNPB 3RG0A 3T2TA 1SLTA 1QJU2 3OGSA 4N9IA 3VD9A 1DYKA 2XHNA 4LHSA 1Z7S3 4QX5A 4PBOA 1XNTA 2RDQA 4Q4W2 3TEYA 4XTPA 1LOCA 1VAKA 2HWD3 2BRTA 4Q4Y3 4MHRA 4FCAA 4RN5A 5GLVA 3D4KA 5C3SA 4N53C 4RHV3 3ZYBA 2J22A 5C9AA 3SH4A 1W6MA 4DXRA 3VDCA 3HT1A 1BK1A 3Q8CA 1JI6A 2VOTA 4PQQA 3NL1A 3MPBA 2DU0A 3HIFA 4BJ0A 3H8RA 3K51A 3CQOA 5FYIA 1JYXA 1Y4WA 4JKKA 2W1UA 1F35A 2DVBA 5FYHA 5HI0A 5A1FA 4U36A 2YC0A 4UWDA 4LITA 3O0WA 3DYOA 3UGHA 3O1PA 4Y22A 4BQ5A 2DCYA 5HCBA 1S4CA 5C8CB 2FMYA 3A0KA 2BJSA 3AC0A 1AHSA 2ZGRA 4TYSA 2QNKA 1C5HA 4YVWB 2WO2A 4XUOA 1JHJA 1HJGA 1NY72 2AEYA 2VW0A 1XNDA 1RMU2 4HXCA 5H9PA 4AFMA 5CFDA 1DYOA 1RUC2 3H8XA 3RJ2X 1BMV1 4KBBA 1E5RA 4XW3A 1CAVB 2RR11 1NA1A 3JCIA 1WCKA 2WFPA 1NQJA 1GWKA 1OI6A 2VO5A 5FZ0A 3WY6A 4AGRA 4A7KA 4M0NA 1BXHA 1XYNA 4XF3A 1SFYA 2R30A 5F2WA 5F7UA 4XZUG 5DN2A 4IV1C 4ZS3A 5EJ1B 4AAPA 3SLIA 3IM0A 1I9RA 2FDIA 2NMNA 5KXCA 1JZ6A 1LGNA 4QGMA 3LOIA 4Q0UA 2RDSA 1Q56A 4CDXC 3AKRA 3WD5A 5AC91 4M4RA 1HRI1 1LGBA 1XYPA 4HVOA 4KL1A 3LQCA 5LW9A 3SH3A 5C7GA 4IXLA 2YHJA 4BISA 2YDEA 4Z2WA 2P6CA 4IE4A 4L11A 4P08A 1YC61 2R071 1O3QA 5A3LA 2BNOA 1G8WA 2VMDA 2XONA 4ZONA 5IUQA 3ACFA 5DUVA 2DBNA 5GKAC 4CDWC 1KEXA 2CYFA 5FY7A 4D69A 4XTMA 1L7LA 3UKTA 2D6KA 5DZEA 4Y1UA 4QGLA 1ZBA3 5LA9A 1H1IA 1PGSA 1WMFA 4BMBA 5C4WA 4M01A 2FDJA 5JOYA 3BTAA 3MLJA 4YPJA 2B4KA 3T08A 1AR61 1JBCA 2ZEYA 1DGLA 3SKJE 4CCDA 3ZKYA 2UWCA 1WKYA 5C71A 1EUTA 2EXJA 1O3SA 1NT0A 3EXUA 4IEUA 2GP5A 3R4DB 5FK8A 5DAQA 2RDRA 1PO12 1RUE3 1VLNA 2BUKA 3NKTA 4ARXA 1DDLA 3SCGA 2ZHLA 3POFA 5F2SA 1HB1A 1OXCA 4GKXA 1UQXA 5FQ0A 5JDBA 2D97A 4KG0A 1PMHX 1V70A 2ZA9A 1QJY1 4BCUA 3MICA 1MEC3 3FL7A 4FTSA 1HRV3 1KFUL 4N53A 3TNQA 3LEMA 1SBDA 3PURA 5CVRA 4CEYB 3PJYA 1UYYA 4I30A 4L8QA 2Q8DA 3FMGA 4DXZA 5FMCA 5A7WB 4QX7A 4DY3A 1SACA 1UY3A 5A1AA 1NLRA 2JIGA 1Y3TA 3WUDA 1IOAA 3LDBA 4RR3B 1YFYA 2WNOA 1CVNA 1PVC3 4KH9A 3VB9A 1AXKA 4Q4X3 1OH3A 4XXAA 2Y26A 5FBJA 5FXVA 2QQUA 4L97A 1XPWA 2G4IA 3PHMA 3PMSA 4CDUC 5HV4A 1JYWA 5FO8B 1MS9A 2UURA 5AVPA 1VPHA 2DTWA 1YEWA 2MEV2 1JTZX 2BFUS 3MDPA 5FXXA 2P4EA 4F3JA 1VMHA 3SMHA 2CGNA 3M2MA 4GIQA 5HV0A 4D7YA 1PNGA 2O1QA 2WNEA 1JYCA 1F5FA 2ZGMA 3KS7A 1O59A 4PT6A 3VBRC 1QNWA 2G1MA 2C1FA 3V0AB 1ENRA 4F8AA 3HN3A 3OJBA 5A33B 2EIDA 1JYTA 5KBFA 1R1A3 2R062 1O8SA 5E6HA 2F6BA 2NLRA 5CU1A 1JZ5A 2PHWA 2B9UA 2ZEZA 1EAH3 3C7HA 3ZVXA 5DG1A 1DQ2A 3MZHA 2ZGUA 1IPJA 1UX6A 5BNPB 4AEDC 2XG3A 2WZ8A 3VD4A 1LKNA 1UF2C 4CDXA 3B3QE 1WMEA 2C24A 3CZUA 4ZU5A 4F7ZA 5K0UC 1X82A 1W8ZA 2C4XA 3V64A 4QKNA 4GWMA 3VKMA 3ZXJA 1OLME 2VTXJ 1ZZCA 2GH2A 1BHGA 2J7MA 5LBEA 4HPKA 1KS4A 3R4UA 5LEJA 3JUUA 5FTTC 3SKVA 2XL9A 2KM2A 3B00A 1OH4A 2WJSA 3DPRB 3GBGA 1SHWB 2LROA 1C1FA 1UY2A 2EICA 2HWC1 5TSWA 1FOD2 4XYXA 3GBFA 4W6XA 2QQVA 4DY5A 3LAGA 3P6BA 4BHPA 3C7FA 3U37A 2HJIA 1T6GC 4HBNA 4BXSV 1YQ5A 1IGOA 2CHHA 4XMIA 1RUH1 3HNYM 5A70A 2JDMA 3MBWA 4AR2A 4N9HA 1HXS1 1UCXA 1X8MA 2RS52 1XE0A 4LK6A 4EV0A 2R32A 1MQTC 2RMU2 2RS32 2E33A 1ULDA 3A22A 4FP2A 2PN5A 1MVEA 4ISQA 3ZN6A 4BH9A 4M3CB 2XLGA 1XSQA 1QJX3 1UU5A 1Z78A 4FOYA 4XABA 4AQ6A 3MLKA 2CSGA 5IWFA 3VBUC 1UL9A 3CJIB 1APNA 1RUD2 1AYM2 3APBA 3MO4A 1H30A 1LOGA 2WL1A 3ZFFC 1H8TC 3I3BA 3GJBA 4P9WA 4EN0A 3SHRA 3ILFA 3RVHA 2W08A 3ZDVA 2NMOA 1RYYA 3WCSA 2VGDA 1J3RA 4NWVA 1C8NA 2VZQA 2ZX2A 3AM2A 2RS12 1YJKA 4LBMA 3CO2A 5IVEA 1CZSA 5FZ1A 1MZFA 1QH7A 2GC3A 3LZZA 5FZLA 4QKDA 1LOBA 1ASJ1 1C5IA 2HEYF 2CDOA 2WT0A 2YU1A 5FY8A 1MS4A 5E1RA 1EP0A 1OOPC 2ZX0A 3LEKA 2AREA 4CDUA 1DBNA 1NKGA 4ZS2A 4CPBD 5DUWA 2RR13 1AJOA 2AENA 2ARCA 2RG4A 3AP7A 2A6ZA 1H2NA 2UY8A 1XYOA 4ASMB 5A6QA 4N7IA 1UAIA 4B1MA 5DQ0A 2VVDA 1YI9A 5JI9A 2VZSA 2WT1A 1S0BA 4AI8A 1S0IA 4LO6B 1CZTA 3LEIA 2D6NA 1A78A 3GZUC 1AR91 4X6RB 5CKQA 2JE9A 3AX4A 3E1F1 4UW6A 3VBRA 1TME2 3NW4A 4CA9A 2VOKA 1ENQA 4L99A 3V0BB 3OPTA 1DGRN 1UIJA 3N9MA 5AC93 4GMP0 4LBOA 3BGAA 2ZMLA 1PVXA 1F4AA 1HRI3 1VALA 2OS2A 2W87A 3WP6A 3MUY1 3MIEA 4NIDA 2WNVC 5EZWA 4DQAA 1O91A 4FOQA 2JENA 4PDWB 4AFAA 1QF3A 3RZLA 1DQ1A 1SDDB 2R073 4QXHA 4AEDA 1QOTA 4AI1A 4AFCA 1HN0A 2YBPA 1UYXA 1WLWA 4AFBA 2AZ5A 5FOJB 4XFIA 1AL22 4P14A 5CB7A 2MHFA 4XQDA 3ZIXA 1K42A 1QIQA 4XCBA 2HWB3 4QU2A 2N7GA 4HSJA 4E8DA 1AR63 4AVVA 2ZKNA 1WLTA 3SCFA 4PIZA 3BALA 2R6QA 1MS3A 5FR3A 2JKBA 2UYBA 2NYYA 2WN2A 3WQBA 1TMF2 4XUNA 4OI4A 1SFPA 2DURA 2QQIA 1CIWA 5CYYA 1W6MB 4CUBA 4YVSA 2WAAA 2JXAA 4XIKA 5ANQA 1OUXA 2ARXA 5FO7B 4W50A 4XEZA 3UGGA 2CL2A 4IUGA 1OQDA 2VOXA 2DF7A 1X8EA 1OLQA 3VBUA 1H6YA 2GNMA 1SBFA 2JD4A 3DEMA 2ATFA 2YB7A 3HNBM 5FY1A 4URAA 1COV1 4YRDA 3RFRA 1F9KA 2VNVA 1H8TA 4QQHA 5FP3A 2RE9A 3QH7A 1O4YA 1MS1A 1F2NA 2XJSA 3CBNA 1QOOA 3W5NA 4JKLA 2AH2A 3OUJA 3ELNA 1DGRA 2JDYA 1Y43B 4YW1A 3O1MA 3N7KA 5JI7A 3OGJA 3ZSLA 5BUVA 4MGZE 3FUOA 4QQOA 4XQ4A 2A6WA 4ZKTB 4ZZ5A 2IVJA 1GOGA 3KHCA 2WZR2 3ILRA 3KMHA 1QXPA 2YC4A 4XVHA 4LLFA 3WNNA 1H4HA 4CUCA 1O3RA 1W05A 2D6PA 4LE3A 1BEV2 3KT1A 5L9BA 3LOBA 2BU9A 4MHUA 2GC1A 5LY2A 1OHFA 3AKPA 5DDJ2 4N43A 4CEYC 1V6IA 3NNGA 5F39A 2WSVA 1AYN1 3R6SA 2XQXA 3GHMA 2W46A 4A7ZA 3H8OA 3OOXA 4COVA 3MUZ1 2IXIA 2XR4A 2ILMA 1VBE1 2VW2A 5FV3A 5BY5A 2VPVA 3AZZA 5DAWA 2CGOA 2WNVA 1ENSA 2PLV1 4NHYA 5HPOA 4HVRA 1OLRA 5DXDA 1VIWB 3T2PA 1EV12 2O0OA 4QPYA 1KITA 4NHMA 5C4WB 1QJU1 1LRHA 4MGYE 4GKYA 2VTFA 1Q3EA 4Q27A 4XJAA 3GCXA 3UK9A 4OUSA 4Q4W1 2VQTA 1C4RA 2DV9A 4H14A 1YQ8A 5FMOL 5A3UA 5BXXA 3NNJA 3VZNA 1DG6A 5EPAA 3THPA 5A1LA 5FZ7A 4M00A 1RUH3 4QHBA 5JLVA 1PMIA 1NE6A 4CZSA 3I2DA 4R9AA 1CAVA 3POSA 1TQ5A 3LIGA 5FQ0B 3WHUA 3BIEA 2VUJA 2W1QA 4FFIA 5KHJA 3WF0A 3QH6A 1KJLA 4L9BA 4WM7B 1LU1A 4N53B 4UYBA 2EAKA 1OT5A 3TWIA 4I3GA 5EV7A 3SEPA 3WUCA 4L92A 1WBLA 4QPWA 2GZWA 4E4DX 1IS3A 3OEBA 1PM7A 1QOSA 2Q8EA 3RSJA 2D98A 4UAPA 3HMYA 5J7MA 4QHZA 4C1XA 5FZ8A 1WLCA 4K3UA 1Y9QA 1NY71 1V0AA 4K8FA 1RMU1 2ZGQA 1Q43A 4ZY9A 1KJRA 4W8JA 1CWPA 2K2SA 4MOAA 1G9FA 2IXKA 2ZEWA 5FWEA 3NWKA 1ASJ3 3HQUA 3MV11 1UYPA 1BQPA 2HH9A 2Q0AA 4UW5A 5F1RA 2ZX1A 3JQXA 3K4ZA 1EY2A 4YW5A 1AR72 5I8YA 5FPAA 4LQRA 4AEJA 2WO1A 2CDPA 4KBZA 2JWPA 3KHBA 4JRLA 1UOGA 3WG3A 3PUHA 3RI9A 5LEKA 4JVAA 3O0VA 1UZVA 1JN2P 2J42A 5A3MA 3MV01 4NPLA 4AOCA 1EUUA 1UZWA 2RJKA 1AR93 3CEWA 4UT5A 5JWPA 1D4M2 3U07A 3R0RA 4XDOA 1QHDA 1JYIA 2DCKA 1DYPA 2VTXA 4EZHA 3AXEA 5FYBA 1N47A 1VMJA 2XH6A 5H9QA 1UXZA 1QU0A 4F83A 3JD72 4OHWA 1FX5A 4JTNA 2V73A 3S30A 1BCXA 3LWCA 4YM2A 4COYA 4CDXB 1W8HA 2PAMA 4CEYA 1URXA 2WZEA 5D8AC 3QLQA 1E5HA 2BNMA 1V9U1 4XURA 3VBOA 2J1SA 5FZ4A 4D6RA 1PO22 1H1AA 5A7WA 5A3TA 5F5QA 4HPKB 4HSLA 5FZOA 1HB4A 1YFWA 1N1YA 3ETQA 4XF9A 4D94A 3AXDA 5A6XA 4PBPA 5IATA 1YYNA 4GJYA 3ZXKA 1JZ8A 1RXFA 2VY0A 1LHWA 2W1WA 2W91A 2ZPXA 4OUMA 2LALA 3P1IA 4XC9A 2VH9A 5T5JA 1S0FA 3TEZA 2OT7A 2YY1A 4I0BA 4O9GA 3WP5A 1GNYA 4NRQA 2E7TA 5DUXA 4D7TA 5C3PA 1A6CA 2VU9A 5K8SA 5EYYA 1G7YA 4FQZA 1VRH2 1XNAA 1EYBA 2VNGA 2VUCA 4S2GA 1RTVA 1GKBA 1VBB2 1MR5A 2G9GA 1DQ6A 3CDZB 1ULOA 4XACA 2FDHA 4PIYA 1IPKA 1W0NA 3QCWA 1QMJA 3GYDA 4HK8A 2ZAHA 3SCHA 3ZSJA 4LR4A 2D6LX 3IIIA 2RJ2A 1WW7A 1U12A 4LE4A 5F8PA 3VHPA 2CY6A 1YFUA 2B46X 1C1LA 2VBDA 4G3YC 3B94A 4BQWA 3FX3A 5IT6A 2VNOA 3AL5A 1PM4A 3C8XA 1M06G 2VZVA 1T6BX 2MEV1 2Z79A 4H3WA 2C6SA 2W1SA 3M3IA 5FZKA 3WP4A 1K5JA 2JIJA 3AP4A 4AVAA 2XDVA 2ZACA 4CDUB 3UNPA 2VE1A 3AP9A 5F37A 3B01A 4D0QA 3ITQA 2IWGB 3POYA 1ZX5A 1H0BA 1QXRA 2WQ4A 4B4QA 4IDZA 1LODA 3BI3A 2VCBA 4P02B 2FCVA 1NLQA 3FBMA 4JGYB 1SCRA 2R061 3WNMA 3CJXA 2ZHKA 4XJZA 4H55A 3I2HA 2ARAA 2WS91 4AHXA 4GMP1 4QX0A 3PTRB 2Y60A 2J1EA 1OSGA 3VBRB 3H8UA 3GZAA 4GAZA 3MFAA 3FFZA 5F3IA 2DVFA 3WINE 5GZGA 1OLMA 4FI9A 4YZ5A 3MEPA 2JDNA 4J1WA 1AYN3 3H3ZA 1H4GA 1QWRA 2TEPA 2FDGA 2BWCA 3R05A 2P3KA 3BODA 3ETPA 1VJ2A 1OD3A 3TEXA 3U0ZA 2D6OX 3B9CA 3PU3A 1VBE3 2VXRA 3VGIA 3ZYFA 3Q8BA 2PHLA 2VAUA 5FP9A 2PLV3 1CJDA 1JYNA 1SQ4A 2BWAA 5D8AA 2ZJCA 1FOD1 1AVBA 5JR7B 5HXMA 5LRRA 1IS5A 1S55A 3VHRA 4L0PA 3MLLA 5CAZA 3CU7A 4JRAA 1QJU3 2A70A 4QWNA 4GWJA 5EJZB 4QM9A 4P9IA 3WF1A 3N35A 2PELA 2RS51 1JHNA 4DUVA 5C8WA 5FREA 4RA0A 2RMU1 4COUA 1RUG2 1RUJ2 1RIRA 1K12A 4JGZC 1HKDA 2XJTA 2EALA 1W8NA 2JDPA 3DCQA 2ZOEB 1ALYA 4JV4A 3E5UA 5G04L 4AQSA 2D3RA 3SITA 4EQVA 5KXBA 2VM9A 1W2AX 4OFGA 1GP6A 5F32A 2LRPA 4YVSB 2NN8A 2Q8CA 1JODA 1RUD1 1AYM1 3FJSA 4QPIB 2XUEA 4IE6A 4WVVA 4OI1A 3TN92 4CCLA 4DXSA 1WCDJ 5LA1A 4RSUA 4Q5OA 1JUHA 2LM3A 2XWBB 5IVVA 5B4NA 3S57A 4NOTA 3BUCA 3L9JT 2FHRA 2D43A 2RS11 4XJ9A 3RYRA 3WX5A 2QVSB 2QQJA 2WWUA 5DMYA 1GSLA 4PLOA 3I2IA 1CESA 1H8TB 2QQOA 2WT2A 4KU7A 1RITA 4XBQA 5GJ6A 4YFZA 1RC6A 1IS6A 1BVVA 1QXJA 4QB1A 5J09A 5LATA 2I45A 5C4WC 4A7YA 2NP0A 2XKPA 4IW3A 1AJKA 1SLBA 2LS6A 3D5OA 3PUIA 3SQOA 3MW4A 2OA2A 2H0BA 4BLIA 2K46A 2W2IA 3I2OA 1OPMA 4XJUA 4E2GA 2HWE2 3D6EA 1MS0A 4D6SA 4W65A 3PUQA 4XUQA 5FZCA 1RGSA 2H6CA 4AGVA 5J36A 2WIIB 1TME1 5JSPA 3GZTB 1TG7A 2Q1FA 3FUQA 5FZHA 1C57A 5I0DA 1GZTA 3FWEA 1YJLA 2FQPA 4WM7C 2K0GA 4X8PA 3ZXGA 3ORJA 1PZ7A 4NROA 1W99A 2NPIA 4PI0A 4N43B 2KA3A 4MXVA 3FHQA 3AKQA 4XAEA 4PF1A 2XJVA 1BK0A 4XQWA 3RZGA 4FPKA 5I93A 3POEA 2JEMA 1AL21 3O1OA 3POWA 5LZ6A 3KZ4C 4PLMA 5DAVA 2WNVB 3SC7X 1V9U3 2XJUA 4YZ2A 4COWA 2ZTNA 2ZGPA 2A3YA 4J1XA 4LOTA 3NAPA 2FBEA 4OI2A 2WFF2 2VG9A 3S6PA 2AR6A 4I09A 3L2HA 2JB4A 2B42B 5A7QA 1OFNA 3ACHA 4CCNA 4YZ3A 5GM0A 1QY4A 3OGGA 5FY4A 4FPJA 5IVBA 4QMAA 4FOWA 1WMXA 1TMF1 2B39A 4TLGA 5FK7A 1SLCA 2A1XA 4Q0PA 4AF9A 3U4XA 3VUOA 3I54A 1LB2A 3BKZA 3C7EA 4CCOA 1WGPA 1W90A 4Z2AA 2B9VA 4OHXA 1AR82 4XOGA 1OC1A 1JYVA 2R16A 3QACA 4IEWA 2O8QA 3GM8A 4JGZA 1SLLA 2GMMA 4LA3A 5FYMA 3KD4A 4HZFA 2XLFA 4FQ4A 3AVSA 3ECQA 4IETA 2VXJA 3B9IA 1CAWA 4XF1A 5FOBB 3ATGA 1N3OA 1U5ZA 3ZFGA 1AX1A 2O14A 3WV6A 5EFUA 2QUOA 2Y38A 1X9PA 3GHNA 3VBFC 3OPZA 2ZGTA 4Z82A 1PZ8A 3BTZA 3ENRA 4NUBA 4TN7A 1AF9A 5FP8A 2BYVE 2UU8A 3LFMA 3VDAA 3ACGA 1LEMA 4LO4B 1L3JA 2DUOA 3ON7A 4LBKA 4RS5C 2VZ3A 4AHWA 3S5AA 1H6XA 1WWYA 4HLTA 4OULA 1RUI3 2WZR1 4LBNA 1MZEA 4PCRA 4PQ9A 4TLFA 4XPVA 4CU9A 3OY8A 4OYUA 4AVBA 2XQRA 3WEZA 4CUAA 1SLAA 4Q1RA 2DVDA 1BEV1 1H9WA 4RHV2 2D3SA 1YIFA 2DDUA 4ASLA 2VQUA 3F95A 2WS93 2P3YA 3ASIA 1I5PA 1Q8OA 3ZOIA 4I0WB 3PNAA 2ZGLA 3AJZA 2Y6HA 4XILA 5FWJA 1RUOA 2P2KA 1V6JA 4XETA 2WRAA 2ZAAA 3E6DA 5DAPA 1CJPA 3VZKA 4YSFA 4WM7A 4FP3A 4BXFA 2R49A 1FPN2 2D5HA 3ZXAC 4B3NA 3PL0A 4YG3A 1W2OA 3WG2A 1SCSA 4SBVA 2VQAA 1EV11 5FXZA 1POV1 3VBOB 2ZZQA 4URTA 1XB9A 5F9TA 4YGBA 3NJZA 3KVBA 3ACIA 4LO5B 5FZOB 4EN7B 3Q8FA 3IMNA 3IIAA 5FMOS 5FYZA 1FOD3 2Y6FA 4A6OA 4NIHA 2X5IA 4ZU7A 1J3QA 4AVTA 1CX1A 3WW4A 2ORXA 4C0BA 3KCXA 3BPSA 4BDVB 2W5FA 4AGGA 1E5SA 1D7PM 2V72A 3IAQA 4LTAA 4B1LA 2Z2SB 3N7MA 4H7MA 2OW4A 3O1UA 1H8VA 3WP3A 2RMU3 1ULCA 1N1VA 3H3LA 3IDAA 3PLQA 4JHTA 4JGYC 4UFIA 2A73B 4QQ2A 4BQYA 3I3EA 4IQPA 1RVF3 4X6QB 3SNMA 1ZRFA 4CP0A 3SISA 1OKQA 4MYEA 3M70A 3K75B 1RUD3 5KXDA 1AYM3 2ETEA 1W9FA 5FYTA 4HN0A 5E16A 4G9SB 1NUKA 2XJQA 3FZ3A 3ES4A 4C90A 3H42B 3B69A 1Y9GA 2ADDA 3HD8B 4N90A 4Q2FA 2RS13 5IAVA 1IKQA 3NO8A 3ZR6A 1XNCA 3GGLA 4AI0A 4E4SA 5CNAA 3VBFA 3J9SA 2OIIA 1GNHA 1ZBA2 1YRZA 3KGLA 3DYPA 4Y26A 2XBO2 1AR71 1G6NA 4NIGA 4C0HA 4UBGA 3RI8A 2AEZA 4FPLA 2RV9A 3J8F2 4Y1XA 4WZFA 2E32A 4NIAA 1FI2A 4DMIA 5FBZA 3T0BA 3N7LA 4RGAA 4YZ4A 4AL9A 2VVEA 4Y5SA 3WF2A 3WNKA 1HN1A 3HNMA 4IE7A 1I3HA 3QOPA 1UN1A 4RS5A 1OA4A 1W6OB 1V6OA 3I2FA 3MIHA 1ZA7A 4YW3A 1PGL2 5SV8A 2XVLA 3VD5A 3ZPYA 1A3KA 4NAMA 1JOPA 2QQKA 4AWDA 3VZJA 1FV3A 4LT5A 2E6VA 1SFNA 2ID4A 4DEVA 3P3NA 3ZX7A 5CKNA 3H50A 4YVSC 1CZVA 3JD71 3W58A 5A32A 5I91A 5C3OA 4QPIC 4AHYA 4AYUA 5FMBA 3U11A 2ZX4A 1JZ3A 3ZXLA 4Q29A 3NNFA 1EPWA 3UETA 4J6GA 1ULPA 5G05L 5I0RA 2HKXA 3DECA 1F31A 3M3OA 1PO21 2HBUA 4YWAA 1VB4A 2BVBA 2FD8A 4QQPA 3FC0A 4BQ2A 5BNQA 2ZX3A 4NMIA 1CAXB 2WNUC 5JXGA 4HT1T 3MIFA 2J1UA 2BGOA 1QKQA 4K40A 4LK7A 5D8AB 3UKVA 3IB3A 5F3CA 1XC6A 4IGPA 2OYZA 2WO7A 4BYYA 4B7EA 1JUIA 4BQXA 4Y1ZA 3AVRA 4P5YA 4BB3A 5CISA 3OBZA 5KHKA 1S2BA 5FCCA 2JD9A 2CAVA 1NZCA 1XXNA 2K9ZA 2BQPA 3M4FA 4B4PA 1B35C 4ZPIA 2WSUA 4DOUA 3I4IA 5FZ6A 1TMF3 1GANA 3PUAA 3BYWA 1PHMA 1SPPA 2XUMA 3I2JA 5E88A 1REFA 1VRH1 3DV8A 3ZKUA 4RFT0 2ENRA 2W39A 3BB6A 4P9JA 4FAGA 1VBB1 2C9AA 4ONUA 3D0JA 1QNYA 1W8UA 1R1A2 4M0HA 5BNNB 3WNXA 3CNAA 5C5TA 3OG2A 4JGYA 1GZ9A 1X33A 4P9GA 3QD6A 1YNAA 1UY4A 3H0OA 3ZN4A 4IEVA 4S2DA 5T5LA 4N43C 4KG8A 3GF6A 2VJXA 1PK6C 2QDNA 4XHXA 1R082 4XF4A 3VKFC 4CE8A 5JR2A 3N36A 3VLBB 1XRUA 4CXYA 4MGSA 4XF0A 3CL1A 4IL7A 1DZTA 2PXJA 4YW4A 3WG4A 2BTVC 2PTMA 4HN1A 4KWLA 4XBLA 3KQRA 2YUEA 3B7MA 1XNKA 3S0MA 1DLLA 1C8M2 2Y6KA 2W92A 1XE7A 1IZ3A 1WA6X 3HWJA 4UF0A 2ZCWA 4A3ZA 4JC1A 1HLCA 1G9BA 1HQNA 4DZGA 2E26A 4K21A 3OGVA 1CPMA 2HYXA 4KWKA 3RWKX 2FZ2A 1QJX2 4AVCA 3RZZA 2BPA2 1ZNPA 1GV9A 2WYSA 1TNFA 1VBD1 2GN3A 5CA6A 2B8MA 5L36A 2ET7A 1YIPA 1YO8A 5L9RA 2VNRA 4UFMA 4A45A 1GWLA 3EJKA 3PTYA 2ORZA 4MV2A 2X29A 1GYKA 1QJY3 1A8MA 3CLPA 4QPIA 5JZGC 3ZFEC 1ZZBA 1I5ZA 2NZ9A 5JMOA 2VCMA 4XBNA 3OPWA 1XSRA 3PU8A 1EV13 4FFGA 5LK5A 1POV3 3H3UA 1JS9A 1G86A 2CNAA 3LA7A 5FJHA 1US3A 3AYCA 2HWF2 2H0VA 4DB5A 3NAPB 5HBAA 4HKLA 2ES3A 5IFTA 3S7EA 2WNUA 3KM5A 1W9YA 1IKPA 4NVPA 1GFF2 1OA2A 1W0OA 2DCTA 3AL6A 4Q26A 1RUG1 1RUJ1 3RMXA 1VE0A 2A75A 5T55A 3USUA 2D3PA 4S2HA 4BQ3A 1XU2A 4NN0A 2D40A 4JTOA 2JG8C 4I01A 5I0TA 3HJRA 1B35A 5BNOA 5LA2A 2W0XA 2VMEA 4W4ZA 2VOVA 3NKGA 4IEQA 4R4ZA 2V4AA 1FXZA 1SLIA 1GOHA 4FPEA 5FPBA 3TN91 2B7YA 1V6MA 3MW3A 1CN1A 5JUVA 1R092 4JGZB 5FPLA 1BZWA 5KWRA 5CFCC 5FPZA 5HCAA 4KU8A 4QGNA 5FJKA 2G19A 3HQXA 5D21A 3POBA 5AC92 5ACA2 2R042 3TAYA 5J1XA 2BVVA 1CAWB 5K9YA 2GALA 2OUHA 1KXGA 3K4AA 3M8LA 3UT0A 1W2NA 3ZFGB 2OXBA 2PA7A 4FPFA 3RGBA 3WNOA 2WA3A 2R072 2XXZA 3ACLA 3KV6A 5FPXA 1PK6A 2FZ1A 3U14A 4AI2A 2PHXA 1IPSA 5C70A 3VBOC 5JMCA 1LOFC 2Q1ZB 2XVGA 1JZ2A 1JOJA 2BERA 4HVQA 4OHZA 5EHDA 2A3XA 2BNNA 2RM21 4FO9A 4LHNA 4O7XA 4Y24A 2HWB2 4UOJA 5FRAA 5FZFA 3ZMOA 1AR73 4DRRA 4R8HA 1Q8PA 3LA2A 1RUF2 2HWE1 2VMHA 1W6QA 2WWSA 3OB8A 3OEAA 1NX9A 1UOBA 3OY8B 5FLHA 1D0GA 3ZM8A 3NV1A 4DNYA 2HWC3 3EQEA 3JZVA 4CCEA 4CEWC 1KRIA 5T54A 2JE7A 1W04A 3JBG2 3A0NA 3LEGA 5FAXA 1W6NA 4BPZA 1WZXA 1DZRA 4XFBA 4YG0A 1HXS3 2ADEA 3JD73 4LBQA 3WQ1A 3Q8EA 3T2QA 2Y0IA 5GZEA 4E27A 2JKXA 5JCTA 3NRUA 1VMFA 2F17A 3IBMA 3WHTA 2W9XA 3WF3A 3IN9A 2CAUA 5C33A 2D44A 2JDAA 4K1ZA 5JIAA 4E4HA 3WZ1A 4R9CA 2PAEA 1PO23 2GC0A 2VCAA 1ZVFA 3O12A 1NG0A 1STMA 4NPMA 4WVMA 5FDBA 2WFF1 2CU5A 4LO7A 5JZGA 1JU4A 4E9KA 1QDOA 4XHBA 3E97A 5CIRA 1CR7A 2YU2A 4BLJA 1SEFA 3IDCB 1VB2A 2KR2A 3ZSEA 4AI3A 4CYDA 2X5IB 3I97A 4EZ4A 3CKHA 1X36A 2RVAA 3KCYA 1J84A 4MGKE 1C3HA 2HEWF 2ZKLA 3NQHA 2YBKA 3O7OA 4CDQC 1RUC1 1NXMA 3ZLIA 4N7UA 3AMNA 4OHVA 1OPOA 3HPNA 2DWRA 1LOAA 1D2SA 2DTYA 3J7LA 3JB8A 4Q0VA 1YHFA 4O61A 4QXBA 3VHNA 1VRH3 1LCLA 2W68A 3Q8AA 5FP7A 3UESA 3WXPA 1DCSA 4EJRA 5DABA 4B29A 2OPKA 4JX0A 1DGWX 2JG8A 1VBB3 1S2KA 3IZOA 3ZDSA 1SMVA 3BN6A 2Y6GA 2WWJA 4OVEA 1VR3A 2OZJA 2BZDA 5CFCA 1ONAA 3TRSB 2DUPA 4XDPA 1CONA 1ZZ8A 4ATEA 1W06A 5LA0A 4ZHNA 5FUPA 4ATFA 4HKWA 5LBFA 3W21A 2PFWA 1MPXA 4KWJA 4LO8A 4TZDA 2JDKA 2P1BA 3NV2A 3VBFB 3K77A 4DINB 3N9OA 3HVDA 1W8WA 3O14A 3DUIA 4G4FA 4CVUA 3PIGA 1LOFA 4LKDA 5FZBA 4C1WA 5C3QA 3DKWA 5SV5A 5FKCA 3LGRA 1DQ4A 1RL3A 1BVP1 3SH5A 5DUUA 5A3WA 4UFKA 1OUSA 3KV4A 1TZOA 4RS5B 5I0SA 4BU2A 1GOFA 1RUH2 2V09A 5L7OC 2XJPA 2ZMNA 3AK0A 3MIGA 5A7NA 2H6BA 3KVAA 1PO11 4J25A 4IV3C 3WNPA 3D0SA 5ABJC 1POQA 4IEZA 1T2XA 5J37A 5HCFA 1NYWA 4GH4A 3TB0A 3WNLA 4CEWA 3AYAA 5BNNC 5A32B 4AE2A 1FMD2 2I07B 1VBD3 1FPN1 4LXLA 1ODMA 1UY0A 5GZCA 4MG2A 1V6NA 4NHKA 4QKBA 2GC2A 3LB9A 4O9EA 3OTFA 5J3UA 2XJRA 2PMWB 3PIJA 3HEIA 2Y8KA 4JDOA 1DQ5A 2BDRA 1TEIA 1ZYBA 3C2UA 4LHKA 5DAXA 2RJLA 5F5AA 2JICA 5C5UA 3LKJA 1OFSA 3CHXA 4YNIA 4MX3A 4CP9A 4E8CA 1QQP2 1V00A 3LPFA 4ES9A 4CXWA 3E6CC 4JHZA 1COV3 1UNBA 3WOGA 5IK7A 2B5HA 5A3NA 4B7KA 4LORA 4NO4A 2WLPA 3T4HB 4M3CF 1RUG3 1RUJ3 3M1HA 2PHDA 4LIVA 2V5DA 1LTEA 5LB6A 1XJAA 2J1VA 4BQ4A 1JZ4A 1LULA 3V56A 2A7AA 1MVQA 1SPPB 4CDQA 5LRSA 4IEXA 1ZBE2 4FFFA 1W6PB 2DVGA 1AUYA 2Z5WA 1HW5A 3HT2A 2CGPA 1N1SA 1ULFA 1AR92 1W6OA 4EN6B 1EPZA 1GBGA 3BPZA 4GQ7A 4YGEA 1AXZA 3S5QA 3PJQA 1X50A 2XGXA 2HLEA 5LASA 3OUIA 5IYYA 2A3WA 4TWTA 3T4VA 4ZXKA 3OBAA 4RGGA 2WZPP 4EYUA 3WR0A 1LGCA 1F8VA 2WR9A 5KR7A 1OA3A 2IXLA 3HAGA 1ZBA1 3FN9A 2DU1A 2WN3A 4AZZA 2XBO1 1U5XA 1G9AA 3AMQA 1VBC2 1FAYA 2IXJA 1DZQA 3BU0A 1F5JA 1XOYA 3J8F1 4Z8BA 3NAPC 1K3IA 3THCA 2GP3A 2RM23 1BBT2 1W03A 4DIQA 3GJAA 1CAXA 1Q8VA 2VW1A 1GZCA 4ES8A 2Q4SA 1VP6A 2Q1MA 4PJYA 3WG1A 3U4SA 2D7FA 2LUWA 2Z42A 4WV8A 1J83A 2EIEA 1PGL1 1HV0A 3ZSKA 5JAXA 3DYMA 1DF0A 4UF0B 5GLTA 2WQ8A 5IVCA 4Q4W3 3FLRA 3ALQA 2WBKA 5DPNA 2RS31 1WUVA 1LEDA 3E5QA 3VL8A 5L7OA 1RUNA 1PIV2 3OGRA 3C7GA 2IFRA 4Y4RA 1H2MA 4IV3A 5I8SA 5ABJA 2VR4A 3K48A 1CAUA 1NCRC 3J7NA 3M7AA 2J1AA 3ZYRA 5BNNA 1LECA 3B93A 3X29B 2UWBA 2BOIA 3WW2A 2KD7A 4YLZA 4ET7A 5T5PA 2VMGA 4P5HA 4C8DA 2AACA 1KD7A 1LR5A 2LTNA 3INAA 1OQEA 2WFF3 5FY0A 1K5MC 2W52A 3I59A 1RB8G 3JQWA 1YLLA 3WSOA 3FLTA 1UZYA 1IS4A 3PDQA 2WNUB 1KQRA 1VAVA 4D7SA 1RMU3 3VDBA 1ND3A 5AFEA 1RUC3 1IHMA 1RHI2 4R4XA 1VBA2 3VBHC 3D82A 5KC5A 5AVAA 3AYEA 2OKXA 3USUB 1LJ7A 4L2NA 2GNTA 3WQ0A 2ZS6B 1B09A 1NCQA 2VMIA 2Y6LA 1JZ7A 1B35B 5BNOB 1R1A1 2VZRA 3HOBA 3NNMA 1UIKA 4Z1VA 4GZ9A 4WZCA 1JXNA 3AFKA 4YFWA 1KDKA 3BIWE 2ARBA 2VUAA 2I2SA 2DCZA 4O65A 5I8TA 2Z4FA 1J1TA 5FUIA 1TNRA 5KXEA 1H2KA 4Q8KA 1UY1A 4E2SA 4LKFA 2Y0OA 1UPSA 1R081 2Y33A 5JOXA 2YXSA 4IE0A 1GLHA 2WAOA 5IK5A 1OBNA 1UW8A 3AMHA 4WM8C 5EXOA 3WDVA 4K8RB 4EE2A 2HYKA 1W28A 4IEYA 4A42A 2GH8A 1GWMA 2JB8A 4PLNA 2CV6A 1VBE2 3AZVA 1PK6B 1RXGA 4D6QA 2PLV2 4FT8A 3D3AA 2JDUA 1TE1B 2CTVA 5A6YA 3DN7A 3LDKA 3GCWA 3H7YA 1C8M1 3I2KA 5GLZA 2X5IC 1RJ7A 1O7FA 1K45A 3K3NA 4INDA 2P17A 3C3VA 1FV2A 4GB32 1HV1A 4QXKA 3CZJA 1W6QB 3VHOA 4BQ1A 4CUGA 4DFSA 5JXHA 5K4LA 3RS6A 1DIWA 1QJX1 1PX3A 2GU9A 4KWUA 3RNSA 5C6CA 4QX2A 2OVUA 5FZ3A 1F15A 3BTYA 2BBVA 3A4UA 1NQDA 1PO13 1SDWA 4HMZA 5IVFA 1W6NB 1QH6A 2SLIA 4GA9A 2J1TA 4U2AA 1S0DA 5FY5A 1N1TA 3OYWA 5JXIA 3VDDA 1WBFA 2EF6A 3T1LA 1Y7BA 4BE3A 4LBQB 1UZ0A 2R0FA 1FPN3 3AP5A 4QX1A 4JDMA 3WW1A 2XVKA 4JQRA 3I2GA 3IT8A 1BYHA 2W94A 4GXLA 3HBKA 4MXWA 3ZYGA 4I2OA 4Q8LA 2Y64A 5LBCA 1ENXA 3MHZA 4GULA 1NCRA 3R4SA 4MGIE 5I0UA 3VV1A 3H1WA 2HWF1 4RD7A 5DG2A 2WQZC 4WVMB 1MZ6A 1O8PA 3HN1A 3VBSC 5JZGB 1G9CA 3H1YA 2MPFA 1O4ZA 3N9PA 5EWSA 4MGQA 1AL0G 4QPGC 4X8NA 4OLLA 3MIBA 4P9YA 1W3VA 5FYVA 4KGQA 4YW2A 2XMLA 2DFBA 4V2WA 2AYHA 3AZYA 3L2YA 5BYNA 1K5MA 2W3JA 4I3PA 2GMPA 4LNVA 4GD4A 5IVYA 1UU4A 3B5LB 2QZ2A 4Q4V2 2ZGOA 3ZYIB 4SLIA 4FTBA 1UWWA 2MEV3 1O5LA 1OF3A 3NJXA 4QQLA 5FYCA 2VMFA 3ZMNA 1QJEA 4CCMA 2E7AA 1PX4A 1Y9MA 3N9QA 3VKOA 1R091 3VBHA 3POGA 4DO0A 5T50A 1Z7S2 3GALA 5FYUA 3AZWA 1HB3A 3T09A 3WQ7A 2F4PA 1FNZA 2LW8A 2JG8B 5ACA1 2R041 4Q4Y2 2HWD2 3CMGA 3QBQA 1NLSA 2R0HA 1U5YA 2R063 3WCRA 4W6YA 2FCUA 1PGW2 2A6VA 1UU6A 3NSTA 4GMP3 5DDJ1 2A5ZA 5BPXA 2EXKA 5BV6A 1LNSA 5CFCB 2EIBA 2C5DA 5J48A 3RWNA 2EAAA 2GSYA 1S0GA 2Z69A 5JSRA 4XFCA 4FPYA 4JDNA 1R1ZA 4WM8A 4NRMA 3FBYA 4BM8A 4W6WA 1J3PA 1V9U2 2PAKA 2PQQA 4LBLA 2HWB1 1GZWA 1XU1A 2XBO3 4V1PA 4OI0A 4QAWA 3BOPA 4V2VA 1RUF1 1XE8A 3AMMA 3I7DA 3J7HA 3J8F3 5EP9A 4A3XA 1ZRIA 3KT4A 3HBZA 4DUXA 4R9BA 1HB2A 4META 2YFZA 4QT6A 1GR3A 1O5UA 3T30A 5IJRA 4LJHA 1GQHA 5GZFA 1DFQA 4AQ2A 1YI7A 3PVBB 4OUEA 2WYFA 1ND2B 3IAPA 5GLUA 5CKMA 1YQ2A 5HCHA 4IEPA 3J4UH 3JBG1 3VN4A 2JG9C 3J7MA 1GMMA 2WKKA 2IFWA 5L9VA 2BP6A 2OUJA 1ST8A 4I0AA 4KNCA 4MZUA 3WDXA 3N4MA 3W5MA 2RS53 1XBFA 2RS33 2XOMA 3IMMA 1UMHA 2X10A 5CBLA 2KXLA 4GH4B 4CEWB 2XL7A 4M4PA 3CIHA 1I1EA 2VBPA 1DP0A 2UYAA 1OKOA 5JIUA 1J59A 1YQ6A 3ZXFA 3H7JA 5IAXA 2A6XA 3A21A 1IQDC 1Z0HA 4EROA 3GZEA 1L7QA 2YROA 3WDTA 2P6HA 4TTGA 4E4ZA 5APAA 3T0DA 3OUHA 3ZYHA 4A44A 5HXVA 3GDBA 3I8TA 4LIUA 4CP9B 4AI9A 1KDMA 2WC2A 5F3EA 4QKFA 4YZ1A 2YZ4A 4YGCA 3VBSA 4BWOA 3V65A 1WCUA 2QQNA 5M0TA 1CQ9A 4QPGA 4XUTA 4XMAA 5E8AA 1RUI2 2XB6C 1BJQA 3K4DA 4RQPC 1OF4A 3IKWA 1HJFA 4Y20A 1NE4A 5DZGA 4IESA 4CRQA 3W9AA 2VZ1A 4I02A 2YYOA 2C26A 4CDQB 5FUNA 5AFBA 1O6UA 4P9XA 3VZMA 1UKGA 3EMRA 4IV1A 3WDUA 2WS92 4HL0A 5FLJA 5FO9B 1RUE2 1L7RA 5FZ9A 2IXCA 5IK4A 1M4WA 1D4M1 3U1XA 5KHGA 1AX2A 4A2UA 1TME3 3RRDA 1YUDA 1R083 1MEC2 1N3PA 2W47A 3I3DA 3KSCA 3RQ0A 1HRV2 2BBAA 2XHKA 2F4LA 3UJQA 4M3CE 2HBTA 1QJZA 4MH0E 3AYDA 3RYKA 1DLCA 4QM8A 3EO6A 3PVOA 3RYPA 1CX4A 3ZIWA 4P9LA 4CXXA 5FPUA 3TOJA 4FFHA 3VKNA 4CDWA 1WCQA 5C3RA 2R7EB 1W0PA 1PVC2 4BZ4A 1AL23 4MSVA 1BKZA 4YGDA 3SXWA 1C8M3 4Q4X2 2GAUA 1ULGA 2FDKA 2FCTA 1ZREA 5EJ3A 1J1LA 2VVFA 4QD2A 3A23A 3FHIB 1HDKA 3EHKA 2DFCA 4LBJA 5JOWA 2XKOA 4P00B 4CSWA 4BK5A 4ZZ8A 2PYTA 5JPMB 2QJVA 5BNOC 1S1AA 3URFA 1RVF2 2JG9A 5L7OB 1FMD1 2O8OA 4UW3A 1JH5A 5T52A 4EN9B 1WA4A 5F6LB 5FPVA 3UGFA 4UFJA 1VAMA 1W2UA 5GLWA 4CTEA 4DEQA 1W6PA 3U78A 3ZN5A 1O3TA 4IV3B 3GNEA 5IW0A 5ABJB 2BGPA 1CAUB 2ERFA 3OD0A 4QB2A 4BA6A 5A3OA 4NIIA 2QQMA 5F3GA 4AAXA 1EAH2 2YMZA 1ACCA 4IGQA 3ES1A 1W3XA 2A71A 4HFSA 3E6BA 3KB5A 3TYJA 3ZFEB 4LUMA 1QQP1 3RZJA 2QQLA 2GMEA 4IGOA 2HWF3 2VZPA 2ET1A 4XDQA 4LBQD 3T1MA 4QHOA 1Q8QA 3I59B 2QTWB 3O1RA 4C91A 2C9KA 1DHKB 4MVTA 2FDFA 2ZHMA 3P5BA 4K7JA 1YCIA 2EXIA 4N8MA 4JQTA 3LSDA 1E5IA 3DGTA 3H9AA 4ZXEA 1FYUA 3UKNA 4YARA 1REDA 4FSJA 4Y4YA 1ND3B 1OD5A 3UYJA 1ODNA 2YGLA 5FZEA 4COZA 2IUWA 5CG9A 1ZBE1 1A8DA 3FE5A 3WVJA 3OD4A 4Y5Z0 2OX0A 4OZXA 2ZGKA 3ZR5A 1NCQB 4BOWA 2YPDA 1NXD1 3C7OA 3IPVB 4RQPA 5GALA 4RGKA 1R093 4QX3A 3NJYA 3AJYA 1RINA 2WZR3 4XIOA 4DXTA 1QDCA 1V6LA 4NWWA 4AK3A 1DQ0A 2PHTA 2E63A 3KV5A 4Z07A 5ACA3 4UFHA 1S2EA 2R043 2YG0A 3N7JA 3I3QA 3RDIA 4AHZA 3T3YA 4CP2A 1BEV3 1X9TA 1UYZA 2GNDA 4Y1YA 4YM0A 4Q0QA 5A7PA 4GALA 4GJZA 5DDJ3 2HEVF 3VZOA 2EVXA 2GDFA 5C8CC 2BEOA 1VBC1 1S0EA 1ZZ7A 3FHAA 2JE8A 5CZKA 4ASKA 5K0UA 1G9DA 5T3NA 1W9TA 1WCSA 4YVWC 3IDEA 1F4HA 1GP5A 1BBT1 4XFHA 3RZHA 2VBBA 4Y33A 1YQCA 1R64A 4KI5M 3B02A 1GU3A 1RUF3 3VD3A 4YW7A 2JJ6A 2VL4A 5FYSA 1J58A 3TBDA 3W20A 1UMIA 3MGUA 4QXCA 2YV8A 3OBTA 2IZWA 2Y34A 1S0CA 3MF9A 4DRVA 3JBG3 2I74A 1UX7A 5C9AB 4BK4A 3WW3A 1BMV2 1PIV1 2FMDA 4QDRA 3JXSA 2RR12 4FOVA 1MQTA 4E2QA 1NZIA 5CG8A 2Q8OA 5FXWA 4XE9A 4HONA 2WABA 3KQ4B 5FLIA 3MI8A 3T0AA 3OYWB 4BIFA 3VDDB 4YG6A 4CU7A 5LWBA 2JDHA 4NHXA 4PF5A 3THDA 1HQWA 3RZMA 4FPGA 1UD1A 4Y22B 2Q30A 3KCCA 4MXWB 4K20A 2TNFA 3JB4C 4LKSA 3ZFFA 1NCRB 1N3QA 1ZZ9A 2R1BA 2P3IA 4DPNA 1DU3D 1HRI2 1O4TA 2QQWA 2UWAA 4K6BA 4JKMA 1IG0A 2PHFA 3M3EA 4LLOA 3OCPA 4QX8A 5FZMA 3U10A 4JAAA 1LENA 3TEWA 4AFDA 4AEMA 1VRBA 1W8OA 3D8CA 3P3PA 3PVNA 4K9SA 4EWEA 5D2AA 5CFDB 3LFIA 1LU2A 1GP4A 4IERA 4YM1A 1RHI1 4OQ8A 1CIYA 1K5MB 1NA1B 1VBA1 2VULA 4EWDA 3OSDA 4ITCA 1OOPA 5F5CA 1QJFA 4RL7A 4CCCA 2EA7A 4OZOA 1D0HA 1ND2C 1AX0A 4B4RA 2Y6JA 4XFGA 1AR62 5EQUA 3UL2A 5IHRA 3OBRA 3N3HA 5CEHA 1ZRCA 1XQNA 3VBHB 2MNGA 3HQRA 1W8TA 1X7NA 5ERLA 2RDNA 1ULEA 3LA3A 1W2TA 2G9ZA 2V4VA 3AB0A 2WO3A 3LIHA 4GH4C 3ABZA 3NJVA 4FPOB 5FZAA 1OVSA 1H1MA 2CWSA 1D4M3 2E51A 5A6ZA 4WVZA 4MGTA 1LESA 2OQ7A 1QJY2 4FVVA 1KS5A 1V6KA 3IDBB 4ZU4A 3MF6A 4RR3C 4CU8A 3AMPA 1UPIA 2ZBJA 1GQPA 3GBWA 5A80A 3LSEA 2D93A 4WM8B 2P34A 3NMBA 3ZSMA 3HR9A 3WLUA 4KQ7A 4FPHA 4CPBA 1UMZA 2DCJA 1GZWB 1JOBA 4WBBA 5C8CA 1LHUA 1CPNA 1WD3A 3IWZA 2VD7A 4GB31 4UI9L 4R9DA 1KFXL 4XJ8A 4YVWA 4BMEA 5KC6A 2JECA 1D4VB 4H2AA 2WA4A 3DXUA 3RJRA 1E57A 1KGYA 1OURA 2IXHA 4AQTA 4A41A 3BVCA 4H7LA 4AW7A 1WW4A 1H2LA 5LY1A 4OQ9A 2X05A 1OVPA 1UKRA 1LOEA 1SZBA 2R1DA 3ST7A 3WDYA 3POJA 2Q5TA 3N9NA 4LKEA 3FLPA 4XJWA 3VD7A 3LCPA 2BFUL 5FFOC 3H1MA 1UOFA 2DUQA
chains in the Genus database with same CATH topology
2DDUA 1CZTA 2VQUA 3LEIA 3OGRA 3C7GA 1I5PA 3E1F1 2Y6HA 1TVGA 2VR4A 2J1AA 3BGAA 1F4AA 2W87A 1P8JA 4OMDA 3MUY1 2KD7A 4ET7A 1PMJX 1SDDB 1UYXA 3ACIA 3WSOA 4A6OA 1K42A 4CU6A 1W9SA 1CX1A 2ORXA 3VDBA 4E8DA 4BDVB 2W5FA 3IAQA 1D7PM 2V72A 2OKXA 3SEEA 5IFPA 2Y6LA 4LPLA 1JZ7A 2WN2A 3WQBA 2VZRA 3IDAA 3HOBA 4XUNA 4GZ9A 2QQIA 2ZEXA 3I3EA 5CYYA 4MO3M 2Z4FA 4CUBA 3K46A 5FUIA 5LCWL 1UY1A 3K75B 2WAAA 2WAOA 2ZXQA 4W50A 1NUKA 4IUGA 4TXWA 4A42A 2J1RA 4OMCA 1H6YA 3HNBM 2YB7A 4XUPA 2VZUA 3GGLA 3D3AA 3DYPA 2VC9A 3I2KA 1W9WA 1NAEA 1K45A 2RV9A 1GUIA 4JKLA 3W5NA 3CZJA 2E32A 5JXHA 2YFUA 3T0BA 4D8MA 1UXXX 3WF2A 3WNKA 1HN1A 3HNMA 3I2FA 4ZZ5A 1PX3A 4KWUA 1GOGA 4QX2A 3VD5A 2QQKA 2YC4A 2VZTA 4XVHA 3WNNA 2J1TA 4RYDA 4CUCA 2ID4A 4DEVA 2YC2A 5JXIA 1CZVA 2WUHA 3T2OA 1UZ0A 4QX1A 1JZ3A 4GWIA 3NNGA 3I2GA 2WDBA 3UETA 2W94A 2XQXA 2W46A 1ULPA 1US2A 2Y64A 5G05L 3DECA 3MUZ1 1O8PA 5JXJA 5HPOA 4A4AA 5JXGA 2J1UA 2BGOA 4MGQA 3T2PA 2VCCA 3IB3A 1SG3A 1XC6A 3F2ZA 4P5YA 2W3JA 2VTFA 2JD9A 4MADA 4QB6A 2VQTA 1UWWA 3NJXA 1OF3A 2PQSA 2VMFA 3I2JA 1PX4A 3T09A 2LW8A 2W1QA 3CMGA 3WF0A 3OG2A 3LE0A 4ARYA 1UY4A 1OT5A 3EYPA 4KMQA 4QDQA 3SEPA 1LNSA 2VJXA 2EIBA 4QPWA 2VZOA 3OEBA 3EB7A 5JR2A 4UAPA 4AG4A 4HG6B 4MGSA 4ZY9A 2L9LA 4W8JA 4QAWA 3J7HA 4MOAA 4DUXA 2ZEWA 2YFZA 3A7QA 3MV11 5IJRA 2QBXA 3K4ZA 2E31A 4OUEA 3IAPA 3LPGA 4LQRA 2Y6KA 1YQ2A 2WO1A 2W92A 2CDPA 1GMMA 4A3ZA 3PUHA 2E26A 3W5MA 3OGVA 2HYXA 2XOMA 3MV01 1UMHA 2X10A 1EUUA 4M4PA 3CIHA 2WYSA 5B4XA 1DP0A 3WF4A 2DCKA 2W95A 4A45A 3A21A 1IQDC 1UXZA 2ORZA 1JU3A 2VMCA 1L7QA 5EIYB 5JMOA 2WZEA 4TTGA 3T0DA 4A44A 4XURA 3GDBA 2J1SA 3GXUA 1US3A 4DUWA 2X09A 5IFTA 2QQNA 4QDSA 4XUTA 2W1WA 2W91A 1JZ8A 3P1IA 3K4DA 1OF4A 3OGSA 3VD9A 4LHSA 2XHNA 2VZ1A 1XNTA 2C26A 3HJRA 1GNYA 5LA2A 4RN5A 2VMEA 4W4ZA 1GOHA 2J22A 4DXRA 5JUVA 1L7RA 1XNAA 3VDCA 1JI6A 2VOTA 4PQQA 5J1XA 4BJ0A 3I3DA 2W47A 3CDZB 3CQOA 1ULOA 2BBAA 3K4AA 1JYXA 4JKKA 2W1UA 1W0NA 3IIIA 1DLCA 2RJ2A 3WNOA 3DYOA 5C70A 1WCQA 3AC0A 1JZ2A 2BERA 2R7EB 3C8XA 2VZVA 4UOJA 2WO2A 4XUOA 1JHJA 2W1SA 1DYOA 3A23A 3UNPA 4D0QA 3OB8A 4P00B 3OEAA 1NX9A 4BK5A 4ZZ8A 3ZM8A 5IHRA 2VO5A 2VCBA 4P02B 5F7UA 4XZUG 3WNMA 5DN2A 3LEGA 3I2HA 5EJ1B 4QX0A 2J1EA 1JZ6A 4DEQA 2BGPA 3T2QA 4QB2A 4M4RA 2JKXA 3NRUA 3WF3A 2QQMA 4FI9A 2W9XA 4AAXA 2JDAA 3LQCA 5C7GA 3ETPA 1OD3A 4P08A 2VCAA 2QQLA 2VZPA 2VMDA 2XONA 3ACFA 1JU4A 1KEXA 1JYNA 2C9KA 5HXMA 4ZXEA 3I97A 4L0PA 3CKHA 4YPJA 2B4KA 2RVAA 3T08A 1J84A 5EJZB 2ZEYA 4GWJA 3NQHA 3SKJE 1WKYA 3WF1A 3HPNA 4DUVA 1EUTA 1K12A 3C7OA 5G04L 1W8NA 4QX3A 3UESA 4ARXA 4DXTA 2VM9A 4JX0A 1PMHX 2YG0A 3FL7A 3BN6A 2Y6GA 1UYZA 2BZDA 4DXSA 5LA1A 1UYYA 5B4NA 3FHAA 5CZKA 2JE8A 5A1AA 1UY3A 5LA0A 1W9TA 1MPXA 2QQJA 5DMYA 1F4HA 3I2IA 2QQOA 3K77A 1R64A 4KI5M 1GU3A 1XPWA 3VD3A 4CVUA 4QB1A 1JYWA 2VL4A 2LS6A 1UMIA 3PUIA 1GOFA 1UX7A 4BK4A 4QDRA 1O59A 4XUQA 3JXSA 4PT6A 3WNPA 1TG7A 3HN3A 1T2XA 2WABA 5I0DA 2EIDA 3T0AA 3WNLA 1O8SA 4CU7A 1JZ5A 2ZEZA 1UY0A 3C7HA 1W99A 3THDA 3FHQA 4LKSA 2WZ8A 4PF1A 3VD4A 3HEIA 2Y8KA 5C71A 4JKMA 3CZUA 2C4XA 4E8CA 1BHGA 1W8OA 2J7MA 3LPFA 3SKVA 1OH4A 4JHZA 1CIYA 1SHWB 1UY2A 2EICA 3ACHA 4OZOA 2V5DA 1JZ4A 2J1VA 3P6BA 2Y6JA 3C7FA 3U37A 4BXSV 3HNYM 3C7EA 3MBWA 2VZSA 4Z2AA 2B9VA 3A22A 2E33A 1JYVA 2V4VA 2WO3A 3GM8A 3ABZA 3NJVA 3ECQA 2HLEA 5IYYA 3OBAA 3MO4A 4CU8A 1GQPA 3I3BA 3FN9A 2WN3A 1RYYA 2DCJA 2VZQA 4UI9L 1CZSA 1K3IA 3VDAA 3THCA 3ACGA 2CDOA 1KGYA 4A41A 2VZ3A 3LEKA 1H6XA 1J83A 1NKGA 2EIEA 2X05A 3DYMA 4CU9A 4OYUA 2WQ8A 3VD7A 3WEZA 4CUAA 5DQ0A 2WBKA 5DPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DDU A;  1CZT A;  2VQU A;  3LEI A;  3OGR A;  3C7G A;  1I5P A;  3E1F 1;  2Y6H A;  1TVG A;  2VR4 A;  2J1A A;  3BGA A;  1F4A A;  2W87 A;  1P8J A;  4OMD A;  3MUY 1;  2KD7 A;  4ET7 A;  1PMJ X;  1SDD B;  1UYX A;  3ACI A;  3WSO A;  4A6O A;  1K42 A;  4CU6 A;  1W9S A;  1CX1 A;  2ORX A;  3VDB A;  4E8D A;  4BDV B;  2W5F A;  3IAQ A;  1D7P M;  2V72 A;  2OKX A;  3SEE A;  5IFP A;  2Y6L A;  4LPL A;  1JZ7 A;  2WN2 A;  3WQB A;  2VZR A;  3IDA A;  3HOB A;  4XUN A;  4GZ9 A;  2QQI A;  2ZEX A;  3I3E A;  5CYY A;  4MO3 M;  2Z4F A;  4CUB A;  3K46 A;  5FUI A;  5LCW L;  1UY1 A;  3K75 B;  2WAA A;  2WAO A;  2ZXQ A;  4W50 A;  1NUK A;  4IUG A;  4TXW A;  4A42 A;  2J1R A;  4OMC A;  1H6Y A;  3HNB M;  2YB7 A;  4XUP A;  2VZU A;  3GGL A;  3D3A A;  3DYP A;  2VC9 A;  3I2K A;  1W9W A;  1NAE A;  1K45 A;  2RV9 A;  1GUI A;  4JKL A;  3W5N A;  3CZJ A;  2E32 A;  5JXH A;  2YFU A;  3T0B A;  4D8M A;  1UXX X;  3WF2 A;  3WNK A;  1HN1 A;  3HNM A;  3I2F A;  4ZZ5 A;  1PX3 A;  4KWU A;  1GOG A;  4QX2 A;  3VD5 A;  2QQK A;  2YC4 A;  2VZT A;  4XVH A;  3WNN A;  2J1T A;  4RYD A;  4CUC A;  2ID4 A;  4DEV A;  2YC2 A;  5JXI A;  1CZV A;  2WUH A;  3T2O A;  1UZ0 A;  4QX1 A;  1JZ3 A;  4GWI A;  3NNG A;  3I2G A;  2WDB A;  3UET A;  2W94 A;  2XQX A;  2W46 A;  1ULP A;  1US2 A;  2Y64 A;  5G05 L;  3DEC A;  3MUZ 1;  1O8P A;  5JXJ A;  5HPO A;  4A4A A;  5JXG A;  2J1U A;  2BGO A;  4MGQ A;  3T2P A;  2VCC A;  3IB3 A;  1SG3 A;  1XC6 A;  3F2Z A;  4P5Y A;  2W3J A;  2VTF A;  2JD9 A;  4MAD A;  4QB6 A;  2VQT A;  1UWW A;  3NJX A;  1OF3 A;  2PQS A;  2VMF A;  3I2J A;  1PX4 A;  3T09 A;  2LW8 A;  2W1Q A;  3CMG A;  3WF0 A;  3OG2 A;  3LE0 A;  4ARY A;  1UY4 A;  1OT5 A;  3EYP A;  4KMQ A;  4QDQ A;  3SEP A;  1LNS A;  2VJX A;  2EIB A;  4QPW A;  2VZO A;  3OEB A;  3EB7 A;  5JR2 A;  4UAP A;  4AG4 A;  4HG6 B;  4MGS A;  4ZY9 A;  2L9L A;  4W8J A;  4QAW A;  3J7H A;  4MOA A;  4DUX A;  2ZEW A;  2YFZ A;  3A7Q A;  3MV1 1;  5IJR A;  2QBX A;  3K4Z A;  2E31 A;  4OUE A;  3IAP A;  3LPG A;  4LQR A;  2Y6K A;  1YQ2 A;  2WO1 A;  2W92 A;  2CDP A;  1GMM A;  4A3Z A;  3PUH A;  2E26 A;  3W5M A;  3OGV A;  2HYX A;  2XOM A;  3MV0 1;  1UMH A;  2X10 A;  1EUU A;  4M4P A;  3CIH A;  2WYS A;  5B4X A;  1DP0 A;  3WF4 A;  2DCK A;  2W95 A;  4A45 A;  3A21 A;  1IQD C;  1UXZ A;  2ORZ A;  1JU3 A;  2VMC A;  1L7Q A;  5EIY B;  5JMO A;  2WZE A;  4TTG A;  3T0D A;  4A44 A;  4XUR A;  3GDB A;  2J1S A;  3GXU A;  1US3 A;  4DUW A;  2X09 A;  5IFT A;  2QQN A;  4QDS A;  4XUT A;  2W1W A;  2W91 A;  1JZ8 A;  3P1I A;  3K4D A;  1OF4 A;  3OGS A;  3VD9 A;  4LHS A;  2XHN A;  2VZ1 A;  1XNT A;  2C26 A;  3HJR A;  1GNY A;  5LA2 A;  4RN5 A;  2VME A;  4W4Z A;  1GOH A;  2J22 A;  4DXR A;  5JUV A;  1L7R A;  1XNA A;  3VDC A;  1JI6 A;  2VOT A;  4PQQ A;  5J1X A;  4BJ0 A;  3I3D A;  2W47 A;  3CDZ B;  3CQO A;  1ULO A;  2BBA A;  3K4A A;  1JYX A;  4JKK A;  2W1U A;  1W0N A;  3III A;  1DLC A;  2RJ2 A;  3WNO A;  3DYO A;  5C70 A;  1WCQ A;  3AC0 A;  1JZ2 A;  2BER A;  2R7E B;  3C8X A;  2VZV A;  4UOJ A;  2WO2 A;  4XUO A;  1JHJ A;  2W1S A;  1DYO A;  3A23 A;  3UNP A;  4D0Q A;  3OB8 A;  4P00 B;  3OEA A;  1NX9 A;  4BK5 A;  4ZZ8 A;  3ZM8 A;  5IHR A;  2VO5 A;  2VCB A;  4P02 B;  5F7U A;  4XZU G;  3WNM A;  5DN2 A;  3LEG A;  3I2H A;  5EJ1 B;  4QX0 A;  2J1E A;  1JZ6 A;  4DEQ A;  2BGP A;  3T2Q A;  4QB2 A;  4M4R A;  2JKX A;  3NRU A;  3WF3 A;  2QQM A;  4FI9 A;  2W9X A;  4AAX A;  2JDA A;  3LQC A;  5C7G A;  3ETP A;  1OD3 A;  4P08 A;  2VCA A;  2QQL A;  2VZP A;  2VMD A;  2XON A;  3ACF A;  1JU4 A;  1KEX A;  1JYN A;  2C9K A;  5HXM A;  4ZXE A;  3I97 A;  4L0P A;  3CKH A;  4YPJ A;  2B4K A;  2RVA A;  3T08 A;  1J84 A;  5EJZ B;  2ZEY A;  4GWJ A;  3NQH A;  3SKJ E;  1WKY A;  3WF1 A;  3HPN A;  4DUV A;  1EUT A;  1K12 A;  3C7O A;  5G04 L;  1W8N A;  4QX3 A;  3UES A;  4ARX A;  4DXT A;  2VM9 A;  4JX0 A;  1PMH X;  2YG0 A;  3FL7 A;  3BN6 A;  2Y6G A;  1UYZ A;  2BZD A;  4DXS A;  5LA1 A;  1UYY A;  5B4N A;  3FHA A;  5CZK A;  2JE8 A;  5A1A A;  1UY3 A;  5LA0 A;  1W9T A;  1MPX A;  2QQJ A;  5DMY A;  1F4H A;  3I2I A;  2QQO A;  3K77 A;  1R64 A;  4KI5 M;  1GU3 A;  1XPW A;  3VD3 A;  4CVU A;  4QB1 A;  1JYW A;  2VL4 A;  2LS6 A;  1UMI A;  3PUI A;  1GOF A;  1UX7 A;  4BK4 A;  4QDR A;  1O59 A;  4XUQ A;  3JXS A;  4PT6 A;  3WNP A;  1TG7 A;  3HN3 A;  1T2X A;  2WAB A;  5I0D A;  2EID A;  3T0A A;  3WNL A;  1O8S A;  4CU7 A;  1JZ5 A;  2ZEZ A;  1UY0 A;  3C7H A;  1W99 A;  3THD A;  3FHQ A;  4LKS A;  2WZ8 A;  4PF1 A;  3VD4 A;  3HEI A;  2Y8K A;  5C71 A;  4JKM A;  3CZU A;  2C4X A;  4E8C A;  1BHG A;  1W8O A;  2J7M A;  3LPF A;  3SKV A;  1OH4 A;  4JHZ A;  1CIY A;  1SHW B;  1UY2 A;  2EIC A;  3ACH A;  4OZO A;  2V5D A;  1JZ4 A;  2J1V A;  3P6B A;  2Y6J A;  3C7F A;  3U37 A;  4BXS V;  3HNY M;  3C7E A;  3MBW A;  2VZS A;  4Z2A A;  2B9V A;  3A22 A;  2E33 A;  1JYV A;  2V4V A;  2WO3 A;  3GM8 A;  3ABZ A;  3NJV A;  3ECQ A;  2HLE A;  5IYY A;  3OBA A;  3MO4 A;  4CU8 A;  1GQP A;  3I3B A;  3FN9 A;  2WN3 A;  1RYY A;  2DCJ A;  2VZQ A;  4UI9 L;  1CZS A;  1K3I A;  3VDA A;  3THC A;  3ACG A;  2CDO A;  1KGY A;  4A41 A;  2VZ3 A;  3LEK A;  1H6X A;  1J83 A;  1NKG A;  2EIE A;  2X05 A;  3DYM A;  4CU9 A;  4OYU A;  2WQ8 A;  3VD7 A;  3WEZ A;  4CUA A;  5DQ0 A;  2WBK A;  5DPN A; 
#chains in the Genus database with same CATH topology
 3E5X A;  1AR8 1;  2TBV A;  1FMD 3;  2VEC A;  1UZZ A;  1ZRR A;  3AKT A;  2QFE A;  3MYX A;  4YW6 A;  5J96 B;  1RJ8 A;  1U5I A;  5H9S A;  5JVV A;  5BNP C;  1TVG A;  4RFR B;  2VQ0 A;  3ROU A;  3W59 A;  3ZPO A;  2TUN A;  5B2G B;  5A7O A;  2IC1 A;  1P8J A;  4OMD A;  4Q0S A;  5L19 A;  3NV3 A;  5LBB A;  2BW8 A;  5LK7 B;  5FMD A;  2QE3 A;  3ZXD A;  5FYY A;  2QKD A;  1IG3 A;  4GWN A;  1PZ9 A;  1PMJ X;  1YFX A;  4NR1 A;  3THT A;  1QQP 3;  2JX9 A;  3KV9 A;  1WMD A;  4JZR A;  3M3C A;  3DPR C;  3PUS A;  2E53 A;  4LHL A;  4ORF A;  3RMY A;  4AXO A;  1ZRD A;  4NAO A;  5IVJ A;  2NM1 A;  1MS8 A;  3DF0 A;  3VBS B;  4CU6 A;  3ZYJ B;  3CF6 E;  4Q4V 1;  1W39 A;  1W8F A;  1C28 A;  1W9S A;  2DBI A;  3BU7 A;  2YBS A;  1FAT A;  4QPG B;  4WVW A;  2EXH A;  5F5I A;  4Y20 B;  2VUD A;  1NOV A;  1S0J A;  4UXA A;  1YXW A;  2ZMK A;  4TSV A;  2CWM A;  1ZBE 3;  5J98 B;  3K3O A;  3SEE A;  1Z7S 1;  2HWC 2;  4BIO A;  5IFP A;  4LPL A;  4FBF A;  4MLO A;  3I3M A;  4Q4Y 1;  2HWD 1;  1ND2 A;  3I49 A;  2X8K A;  4RHV 1;  1HX6 A;  4IV1 B;  4UBH A;  3RPQ A;  2ZEX A;  4AEK A;  3RZK A;  4FTE A;  5D1I A;  4MO3 M;  1HXS 2;  1PGW 1;  3CJI C;  3POI A;  4XFF A;  3MW2 A;  3K46 A;  5LCW L;  4FXK B;  3UV9 A;  4A6S A;  3VZL A;  4Y5T A;  2ZXQ A;  4NJ4 A;  4FPC A;  3DXT A;  3ZXE A;  3KF3 A;  1CD3 G;  3KGZ A;  3NV4 A;  2UY9 A;  4S2F A;  3ILN A;  2SBA A;  4LEJ A;  2J1R A;  4OMC A;  4TXW A;  1AZD A;  1WW5 A;  1VBC 3;  1WLD A;  1WW6 A;  1XNB A;  3PVE A;  4XUP A;  2VZU A;  2YGM A;  4RR3 A;  5DZF A;  4R52 A;  1POV 0;  4CDW B;  1ZM1 A;  1BBT 3;  5GZD A;  2WLQ A;  2AC1 A;  2VC9 A;  3JU9 A;  1QEX A;  1ZZ6 A;  1W9W A;  2OZ6 A;  4Y3O A;  1NAE A;  2XPJ A;  1GUI A;  5A3P A;  2P5B A;  3AFG A;  2IVI B;  1ND3 C;  3M3Q A;  4Z92 B;  2P37 A;  2YFU A;  1ASJ 2;  1SBE A;  4D8M A;  1FNY A;  3BOW A;  3J26 N;  1UXX X;  2BV4 A;  4PI2 A;  5F6K A;  3O1T A;  3ZN6 B;  4OHY A;  1JMU B;  1PNF A;  4HKO A;  4KGG A;  5A7S A;  3BTX A;  1NCQ C;  2AGS A;  1PIV 3;  1UO9 A;  2WIN B;  2JG9 B;  3V0A A;  2VZT A;  4PIX A;  4RYD A;  4LA2 A;  5A33 A;  3U75 A;  3O0X A;  4LUL A;  2YC2 A;  1LAJ A;  3S7I A;  3MID A;  2X53 S;  3UJO A;  1CGP A;  1H9P A;  2WUH A;  5FZG A;  3T2O A;  2E7Q A;  2ZGS A;  4QU1 A;  3EBR A;  1Q8S A;  3AP6 A;  3TN9 3;  4GWI A;  4NRP A;  4PDW C;  2JDZ A;  4PHZ A;  2WDB A;  2XLA A;  5T5O A;  5BNP A;  1US2 A;  2ZGN A;  4HAN A;  1MS5 A;  1GQG A;  1WD4 A;  3AKS A;  2PHR A;  3ZFG C;  5L73 A;  5JXJ A;  1MAC A;  4A4A A;  2E9Q A;  4LOS A;  4IEO A;  2G9F A;  2VCC A;  1REE A;  1D2Q A;  1SG3 A;  1BLZ A;  1RUI 1;  3F2Z A;  5FY9 A;  3O1V A;  3WDW A;  1GNZ A;  3DPR A;  1RHI 3;  3KLS A;  1VBA 3;  4LUK A;  5FP4 A;  4MAD A;  2QDR A;  2GNB A;  4QB6 A;  2VOW A;  1IQA A;  1A34 A;  2PQS A;  1AXY A;  1FT9 A;  4UFL A;  1U0A A;  5KHH A;  5C9A C;  3NNL A;  3ME2 A;  4HET A;  3ZO0 B;  1RUE 1;  2HWE 3;  4RQP B;  2D6M A;  5FKB A;  1OQ1 A;  4NE9 A;  4XZP A;  4NPR A;  2OQ6 A;  4FAH A;  4HK9 A;  2DVA A;  3LDR A;  4UW4 A;  4M3C A;  5E89 A;  4XCA A;  1MEC 1;  3VKL A;  1VBD 2;  1HRV 1;  3VDD C;  1HQL A;  1HIX A;  3LE0 A;  4ARY A;  3EYP A;  4KMQ A;  4QDQ A;  2PHU A;  2BGC A;  1OMI A;  3CJI A;  3KT7 A;  5CAD A;  4FXG B;  3LF7 A;  4AED B;  2V5Y A;  2VZO A;  3EB7 A;  1QGL A;  3O1S A;  5JSO A;  5K0U B;  5JPN B;  4YYO A;  3USS A;  4AG4 A;  1UOJ A;  4HG6 B;  2GN7 A;  4IE5 A;  1PVC 1;  4ISR A;  3VL9 A;  5KHI A;  2YPJ A;  3BCW A;  3KWV A;  2ZHN A;  4Q4X 1;  4CP1 A;  3ZFE A;  1JW6 A;  2L9L A;  4XXP A;  3WT3 A;  5CFD C;  4LMF A;  2B45 X;  1COV 2;  3PME A;  4GB3 3;  5IK8 A;  2QQP A;  2QZ3 A;  4MUV A;  4K1Y A;  3A7Q A;  4HOO A;  2ZZJ A;  5FZD A;  1NA1 C;  3ZYP A;  4DS0 A;  2QBX A;  1LHO A;  2AUY A;  2RHP A;  1I6X A;  2E31 A;  4JCK A;  3LPG A;  3OF1 A;  1LHN A;  1RVF 1;  2BOJ A;  3NVC A;  3DL3 A;  4AVS A;  5K7P A;  2D5F A;  1MQT B;  2A6Y A;  1AR8 3;  2EIG A;  3O5S A;  5FZI A;  3IPV A;  4B8E A;  4EN8 B;  5B4X A;  1YWK A;  2NQY A;  4OCT A;  4Q1P A;  3WF4 A;  1EAH 1;  2OPW A;  3V0B A;  2W95 A;  3VBU B;  2XWJ B;  1JU3 A;  3FFQ A;  3MPP G;  1LHV A;  2VMC A;  2P3J A;  3ZFF B;  1DGW A;  1MZ5 A;  4XAA A;  4PDW A;  5EIY B;  3N9L A;  1AYN 2;  4EWA A;  3DKQ A;  5ANN A;  4YM3 A;  5ISL A;  5H9R A;  4CCK A;  2DYC A;  2QCS B;  4NHL A;  3KF5 A;  3GXU A;  5EYX A;  4Y1V A;  2RM2 2;  4XFA A;  4DUW A;  3LD8 A;  1ZA4 A;  2X09 A;  3G7D A;  5JOZ A;  3MFC A;  3K2O A;  5FIX A;  2C0Z A;  4Q4V 3;  4CCJ A;  4QDS A;  3AZX A;  4D3W A;  1OOP B;  3G6J B;  2ZAB A;  3Q9O A;  1GIC A;  1Q5O A;  3TNP B;  3RG0 A;  3T2T A;  1SLT A;  1QJU 2;  3OGS A;  4N9I A;  3VD9 A;  1DYK A;  2XHN A;  4LHS A;  1Z7S 3;  4QX5 A;  4PBO A;  1XNT A;  2RDQ A;  4Q4W 2;  3TEY A;  4XTP A;  1LOC A;  1VAK A;  2HWD 3;  2BRT A;  4Q4Y 3;  4MHR A;  4FCA A;  4RN5 A;  5GLV A;  3D4K A;  5C3S A;  4N53 C;  4RHV 3;  3ZYB A;  2J22 A;  5C9A A;  3SH4 A;  1W6M A;  4DXR A;  3VDC A;  3HT1 A;  1BK1 A;  3Q8C A;  1JI6 A;  2VOT A;  4PQQ A;  3NL1 A;  3MPB A;  2DU0 A;  3HIF A;  4BJ0 A;  3H8R A;  3K51 A;  3CQO A;  5FYI A;  1JYX A;  1Y4W A;  4JKK A;  2W1U A;  1F35 A;  2DVB A;  5FYH A;  5HI0 A;  5A1F A;  4U36 A;  2YC0 A;  4UWD A;  4LIT A;  3O0W A;  3DYO A;  3UGH A;  3O1P A;  4Y22 A;  4BQ5 A;  2DCY A;  5HCB A;  1S4C A;  5C8C B;  2FMY A;  3A0K A;  2BJS A;  3AC0 A;  1AHS A;  2ZGR A;  4TYS A;  2QNK A;  1C5H A;  4YVW B;  2WO2 A;  4XUO A;  1JHJ A;  1HJG A;  1NY7 2;  2AEY A;  2VW0 A;  1XND A;  1RMU 2;  4HXC A;  5H9P A;  4AFM A;  5CFD A;  1DYO A;  1RUC 2;  3H8X A;  3RJ2 X;  1BMV 1;  4KBB A;  1E5R A;  4XW3 A;  1CAV B;  2RR1 1;  1NA1 A;  3JCI A;  1WCK A;  2WFP A;  1NQJ A;  1GWK A;  1OI6 A;  2VO5 A;  5FZ0 A;  3WY6 A;  4AGR A;  4A7K A;  4M0N A;  1BXH A;  1XYN A;  4XF3 A;  1SFY A;  2R30 A;  5F2W A;  5F7U A;  4XZU G;  5DN2 A;  4IV1 C;  4ZS3 A;  5EJ1 B;  4AAP A;  3SLI A;  3IM0 A;  1I9R A;  2FDI A;  2NMN A;  5KXC A;  1JZ6 A;  1LGN A;  4QGM A;  3LOI A;  4Q0U A;  2RDS A;  1Q56 A;  4CDX C;  3AKR A;  3WD5 A;  5AC9 1;  4M4R A;  1HRI 1;  1LGB A;  1XYP A;  4HVO A;  4KL1 A;  3LQC A;  5LW9 A;  3SH3 A;  5C7G A;  4IXL A;  2YHJ A;  4BIS A;  2YDE A;  4Z2W A;  2P6C A;  4IE4 A;  4L11 A;  4P08 A;  1YC6 1;  2R07 1;  1O3Q A;  5A3L A;  2BNO A;  1G8W A;  2VMD A;  2XON A;  4ZON A;  5IUQ A;  3ACF A;  5DUV A;  2DBN A;  5GKA C;  4CDW C;  1KEX A;  2CYF A;  5FY7 A;  4D69 A;  4XTM A;  1L7L A;  3UKT A;  2D6K A;  5DZE A;  4Y1U A;  4QGL A;  1ZBA 3;  5LA9 A;  1H1I A;  1PGS A;  1WMF A;  4BMB A;  5C4W A;  4M01 A;  2FDJ A;  5JOY A;  3BTA A;  3MLJ A;  4YPJ A;  2B4K A;  3T08 A;  1AR6 1;  1JBC A;  2ZEY A;  1DGL A;  3SKJ E;  4CCD A;  3ZKY A;  2UWC A;  1WKY A;  5C71 A;  1EUT A;  2EXJ A;  1O3S A;  1NT0 A;  3EXU A;  4IEU A;  2GP5 A;  3R4D B;  5FK8 A;  5DAQ A;  2RDR A;  1PO1 2;  1RUE 3;  1VLN A;  2BUK A;  3NKT A;  4ARX A;  1DDL A;  3SCG A;  2ZHL A;  3POF A;  5F2S A;  1HB1 A;  1OXC A;  4GKX A;  1UQX A;  5FQ0 A;  5JDB A;  2D97 A;  4KG0 A;  1PMH X;  1V70 A;  2ZA9 A;  1QJY 1;  4BCU A;  3MIC A;  1MEC 3;  3FL7 A;  4FTS A;  1HRV 3;  1KFU L;  4N53 A;  3TNQ A;  3LEM A;  1SBD A;  3PUR A;  5CVR A;  4CEY B;  3PJY A;  1UYY A;  4I30 A;  4L8Q A;  2Q8D A;  3FMG A;  4DXZ A;  5FMC A;  5A7W B;  4QX7 A;  4DY3 A;  1SAC A;  1UY3 A;  5A1A A;  1NLR A;  2JIG A;  1Y3T A;  3WUD A;  1IOA A;  3LDB A;  4RR3 B;  1YFY A;  2WNO A;  1CVN A;  1PVC 3;  4KH9 A;  3VB9 A;  1AXK A;  4Q4X 3;  1OH3 A;  4XXA A;  2Y26 A;  5FBJ A;  5FXV A;  2QQU A;  4L97 A;  1XPW A;  2G4I A;  3PHM A;  3PMS A;  4CDU C;  5HV4 A;  1JYW A;  5FO8 B;  1MS9 A;  2UUR A;  5AVP A;  1VPH A;  2DTW A;  1YEW A;  2MEV 2;  1JTZ X;  2BFU S;  3MDP A;  5FXX A;  2P4E A;  4F3J A;  1VMH A;  3SMH A;  2CGN A;  3M2M A;  4GIQ A;  5HV0 A;  4D7Y A;  1PNG A;  2O1Q A;  2WNE A;  1JYC A;  1F5F A;  2ZGM A;  3KS7 A;  1O59 A;  4PT6 A;  3VBR C;  1QNW A;  2G1M A;  2C1F A;  3V0A B;  1ENR A;  4F8A A;  3HN3 A;  3OJB A;  5A33 B;  2EID A;  1JYT A;  5KBF A;  1R1A 3;  2R06 2;  1O8S A;  5E6H A;  2F6B A;  2NLR A;  5CU1 A;  1JZ5 A;  2PHW A;  2B9U A;  2ZEZ A;  1EAH 3;  3C7H A;  3ZVX A;  5DG1 A;  1DQ2 A;  3MZH A;  2ZGU A;  1IPJ A;  1UX6 A;  5BNP B;  4AED C;  2XG3 A;  2WZ8 A;  3VD4 A;  1LKN A;  1UF2 C;  4CDX A;  3B3Q E;  1WME A;  2C24 A;  3CZU A;  4ZU5 A;  4F7Z A;  5K0U C;  1X82 A;  1W8Z A;  2C4X A;  3V64 A;  4QKN A;  4GWM A;  3VKM A;  3ZXJ A;  1OLM E;  2VTX J;  1ZZC A;  2GH2 A;  1BHG A;  2J7M A;  5LBE A;  4HPK A;  1KS4 A;  3R4U A;  5LEJ A;  3JUU A;  5FTT C;  3SKV A;  2XL9 A;  2KM2 A;  3B00 A;  1OH4 A;  2WJS A;  3DPR B;  3GBG A;  1SHW B;  2LRO A;  1C1F A;  1UY2 A;  2EIC A;  2HWC 1;  5TSW A;  1FOD 2;  4XYX A;  3GBF A;  4W6X A;  2QQV A;  4DY5 A;  3LAG A;  3P6B A;  4BHP A;  3C7F A;  3U37 A;  2HJI A;  1T6G C;  4HBN A;  4BXS V;  1YQ5 A;  1IGO A;  2CHH A;  4XMI A;  1RUH 1;  3HNY M;  5A70 A;  2JDM A;  3MBW A;  4AR2 A;  4N9H A;  1HXS 1;  1UCX A;  1X8M A;  2RS5 2;  1XE0 A;  4LK6 A;  4EV0 A;  2R32 A;  1MQT C;  2RMU 2;  2RS3 2;  2E33 A;  1ULD A;  3A22 A;  4FP2 A;  2PN5 A;  1MVE A;  4ISQ A;  3ZN6 A;  4BH9 A;  4M3C B;  2XLG A;  1XSQ A;  1QJX 3;  1UU5 A;  1Z78 A;  4FOY A;  4XAB A;  4AQ6 A;  3MLK A;  2CSG A;  5IWF A;  3VBU C;  1UL9 A;  3CJI B;  1APN A;  1RUD 2;  1AYM 2;  3APB A;  3MO4 A;  1H30 A;  1LOG A;  2WL1 A;  3ZFF C;  1H8T C;  3I3B A;  3GJB A;  4P9W A;  4EN0 A;  3SHR A;  3ILF A;  3RVH A;  2W08 A;  3ZDV A;  2NMO A;  1RYY A;  3WCS A;  2VGD A;  1J3R A;  4NWV A;  1C8N A;  2VZQ A;  2ZX2 A;  3AM2 A;  2RS1 2;  1YJK A;  4LBM A;  3CO2 A;  5IVE A;  1CZS A;  5FZ1 A;  1MZF A;  1QH7 A;  2GC3 A;  3LZZ A;  5FZL A;  4QKD A;  1LOB A;  1ASJ 1;  1C5I A;  2HEY F;  2CDO A;  2WT0 A;  2YU1 A;  5FY8 A;  1MS4 A;  5E1R A;  1EP0 A;  1OOP C;  2ZX0 A;  3LEK A;  2ARE A;  4CDU A;  1DBN A;  1NKG A;  4ZS2 A;  4CPB D;  5DUW A;  2RR1 3;  1AJO A;  2AEN A;  2ARC A;  2RG4 A;  3AP7 A;  2A6Z A;  1H2N A;  2UY8 A;  1XYO A;  4ASM B;  5A6Q A;  4N7I A;  1UAI A;  4B1M A;  5DQ0 A;  2VVD A;  1YI9 A;  5JI9 A;  2VZS A;  2WT1 A;  1S0B A;  4AI8 A;  1S0I A;  4LO6 B;  1CZT A;  3LEI A;  2D6N A;  1A78 A;  3GZU C;  1AR9 1;  4X6R B;  5CKQ A;  2JE9 A;  3AX4 A;  3E1F 1;  4UW6 A;  3VBR A;  1TME 2;  3NW4 A;  4CA9 A;  2VOK A;  1ENQ A;  4L99 A;  3V0B B;  3OPT A;  1DGR N;  1UIJ A;  3N9M A;  5AC9 3;  4GMP 0;  4LBO A;  3BGA A;  2ZML A;  1PVX A;  1F4A A;  1HRI 3;  1VAL A;  2OS2 A;  2W87 A;  3WP6 A;  3MUY 1;  3MIE A;  4NID A;  2WNV C;  5EZW A;  4DQA A;  1O91 A;  4FOQ A;  2JEN A;  4PDW B;  4AFA A;  1QF3 A;  3RZL A;  1DQ1 A;  1SDD B;  2R07 3;  4QXH A;  4AED A;  1QOT A;  4AI1 A;  4AFC A;  1HN0 A;  2YBP A;  1UYX A;  1WLW A;  4AFB A;  2AZ5 A;  5FOJ B;  4XFI A;  1AL2 2;  4P14 A;  5CB7 A;  2MHF A;  4XQD A;  3ZIX A;  1K42 A;  1QIQ A;  4XCB A;  2HWB 3;  4QU2 A;  2N7G A;  4HSJ A;  4E8D A;  1AR6 3;  4AVV A;  2ZKN A;  1WLT A;  3SCF A;  4PIZ A;  3BAL A;  2R6Q A;  1MS3 A;  5FR3 A;  2JKB A;  2UYB A;  2NYY A;  2WN2 A;  3WQB A;  1TMF 2;  4XUN A;  4OI4 A;  1SFP A;  2DUR A;  2QQI A;  1CIW A;  5CYY A;  1W6M B;  4CUB A;  4YVS A;  2WAA A;  2JXA A;  4XIK A;  5ANQ A;  1OUX A;  2ARX A;  5FO7 B;  4W50 A;  4XEZ A;  3UGG A;  2CL2 A;  4IUG A;  1OQD A;  2VOX A;  2DF7 A;  1X8E A;  1OLQ A;  3VBU A;  1H6Y A;  2GNM A;  1SBF A;  2JD4 A;  3DEM A;  2ATF A;  2YB7 A;  3HNB M;  5FY1 A;  4URA A;  1COV 1;  4YRD A;  3RFR A;  1F9K A;  2VNV A;  1H8T A;  4QQH A;  5FP3 A;  2RE9 A;  3QH7 A;  1O4Y A;  1MS1 A;  1F2N A;  2XJS A;  3CBN A;  1QOO A;  3W5N A;  4JKL A;  2AH2 A;  3OUJ A;  3ELN A;  1DGR A;  2JDY A;  1Y43 B;  4YW1 A;  3O1M A;  3N7K A;  5JI7 A;  3OGJ A;  3ZSL A;  5BUV A;  4MGZ E;  3FUO A;  4QQO A;  4XQ4 A;  2A6W A;  4ZKT B;  4ZZ5 A;  2IVJ A;  1GOG A;  3KHC A;  2WZR 2;  3ILR A;  3KMH A;  1QXP A;  2YC4 A;  4XVH A;  4LLF A;  3WNN A;  1H4H A;  4CUC A;  1O3R A;  1W05 A;  2D6P A;  4LE3 A;  1BEV 2;  3KT1 A;  5L9B A;  3LOB A;  2BU9 A;  4MHU A;  2GC1 A;  5LY2 A;  1OHF A;  3AKP A;  5DDJ 2;  4N43 A;  4CEY C;  1V6I A;  3NNG A;  5F39 A;  2WSV A;  1AYN 1;  3R6S A;  2XQX A;  3GHM A;  2W46 A;  4A7Z A;  3H8O A;  3OOX A;  4COV A;  3MUZ 1;  2IXI A;  2XR4 A;  2ILM A;  1VBE 1;  2VW2 A;  5FV3 A;  5BY5 A;  2VPV A;  3AZZ A;  5DAW A;  2CGO A;  2WNV A;  1ENS A;  2PLV 1;  4NHY A;  5HPO A;  4HVR A;  1OLR A;  5DXD A;  1VIW B;  3T2P A;  1EV1 2;  2O0O A;  4QPY A;  1KIT A;  4NHM A;  5C4W B;  1QJU 1;  1LRH A;  4MGY E;  4GKY A;  2VTF A;  1Q3E A;  4Q27 A;  4XJA A;  3GCX A;  3UK9 A;  4OUS A;  4Q4W 1;  2VQT A;  1C4R A;  2DV9 A;  4H14 A;  1YQ8 A;  5FMO L;  5A3U A;  5BXX A;  3NNJ A;  3VZN A;  1DG6 A;  5EPA A;  3THP A;  5A1L A;  5FZ7 A;  4M00 A;  1RUH 3;  4QHB A;  5JLV A;  1PMI A;  1NE6 A;  4CZS A;  3I2D A;  4R9A A;  1CAV A;  3POS A;  1TQ5 A;  3LIG A;  5FQ0 B;  3WHU A;  3BIE A;  2VUJ A;  2W1Q A;  4FFI A;  5KHJ A;  3WF0 A;  3QH6 A;  1KJL A;  4L9B A;  4WM7 B;  1LU1 A;  4N53 B;  4UYB A;  2EAK A;  1OT5 A;  3TWI A;  4I3G A;  5EV7 A;  3SEP A;  3WUC A;  4L92 A;  1WBL A;  4QPW A;  2GZW A;  4E4D X;  1IS3 A;  3OEB A;  1PM7 A;  1QOS A;  2Q8E A;  3RSJ A;  2D98 A;  4UAP A;  3HMY A;  5J7M A;  4QHZ A;  4C1X A;  5FZ8 A;  1WLC A;  4K3U A;  1Y9Q A;  1NY7 1;  1V0A A;  4K8F A;  1RMU 1;  2ZGQ A;  1Q43 A;  4ZY9 A;  1KJR A;  4W8J A;  1CWP A;  2K2S A;  4MOA A;  1G9F A;  2IXK A;  2ZEW A;  5FWE A;  3NWK A;  1ASJ 3;  3HQU A;  3MV1 1;  1UYP A;  1BQP A;  2HH9 A;  2Q0A A;  4UW5 A;  5F1R A;  2ZX1 A;  3JQX A;  3K4Z A;  1EY2 A;  4YW5 A;  1AR7 2;  5I8Y A;  5FPA A;  4LQR A;  4AEJ A;  2WO1 A;  2CDP A;  4KBZ A;  2JWP A;  3KHB A;  4JRL A;  1UOG A;  3WG3 A;  3PUH A;  3RI9 A;  5LEK A;  4JVA A;  3O0V A;  1UZV A;  1JN2 P;  2J42 A;  5A3M A;  3MV0 1;  4NPL A;  4AOC A;  1EUU A;  1UZW A;  2RJK A;  1AR9 3;  3CEW A;  4UT5 A;  5JWP A;  1D4M 2;  3U07 A;  3R0R A;  4XDO A;  1QHD A;  1JYI A;  2DCK A;  1DYP A;  2VTX A;  4EZH A;  3AXE A;  5FYB A;  1N47 A;  1VMJ A;  2XH6 A;  5H9Q A;  1UXZ A;  1QU0 A;  4F83 A;  3JD7 2;  4OHW A;  1FX5 A;  4JTN A;  2V73 A;  3S30 A;  1BCX A;  3LWC A;  4YM2 A;  4COY A;  4CDX B;  1W8H A;  2PAM A;  4CEY A;  1URX A;  2WZE A;  5D8A C;  3QLQ A;  1E5H A;  2BNM A;  1V9U 1;  4XUR A;  3VBO A;  2J1S A;  5FZ4 A;  4D6R A;  1PO2 2;  1H1A A;  5A7W A;  5A3T A;  5F5Q A;  4HPK B;  4HSL A;  5FZO A;  1HB4 A;  1YFW A;  1N1Y A;  3ETQ A;  4XF9 A;  4D94 A;  3AXD A;  5A6X A;  4PBP A;  5IAT A;  1YYN A;  4GJY A;  3ZXK A;  1JZ8 A;  1RXF A;  2VY0 A;  1LHW A;  2W1W A;  2W91 A;  2ZPX A;  4OUM A;  2LAL A;  3P1I A;  4XC9 A;  2VH9 A;  5T5J A;  1S0F A;  3TEZ A;  2OT7 A;  2YY1 A;  4I0B A;  4O9G A;  3WP5 A;  1GNY A;  4NRQ A;  2E7T A;  5DUX A;  4D7T A;  5C3P A;  1A6C A;  2VU9 A;  5K8S A;  5EYY A;  1G7Y A;  4FQZ A;  1VRH 2;  1XNA A;  1EYB A;  2VNG A;  2VUC A;  4S2G A;  1RTV A;  1GKB A;  1VBB 2;  1MR5 A;  2G9G A;  1DQ6 A;  3CDZ B;  1ULO A;  4XAC A;  2FDH A;  4PIY A;  1IPK A;  1W0N A;  3QCW A;  1QMJ A;  3GYD A;  4HK8 A;  2ZAH A;  3SCH A;  3ZSJ A;  4LR4 A;  2D6L X;  3III A;  2RJ2 A;  1WW7 A;  1U12 A;  4LE4 A;  5F8P A;  3VHP A;  2CY6 A;  1YFU A;  2B46 X;  1C1L A;  2VBD A;  4G3Y C;  3B94 A;  4BQW A;  3FX3 A;  5IT6 A;  2VNO A;  3AL5 A;  1PM4 A;  3C8X A;  1M06 G;  2VZV A;  1T6B X;  2MEV 1;  2Z79 A;  4H3W A;  2C6S A;  2W1S A;  3M3I A;  5FZK A;  3WP4 A;  1K5J A;  2JIJ A;  3AP4 A;  4AVA A;  2XDV A;  2ZAC A;  4CDU B;  3UNP A;  2VE1 A;  3AP9 A;  5F37 A;  3B01 A;  4D0Q A;  3ITQ A;  2IWG B;  3POY A;  1ZX5 A;  1H0B A;  1QXR A;  2WQ4 A;  4B4Q A;  4IDZ A;  1LOD A;  3BI3 A;  2VCB A;  4P02 B;  2FCV A;  1NLQ A;  3FBM A;  4JGY B;  1SCR A;  2R06 1;  3WNM A;  3CJX A;  2ZHK A;  4XJZ A;  4H55 A;  3I2H A;  2ARA A;  2WS9 1;  4AHX A;  4GMP 1;  4QX0 A;  3PTR B;  2Y60 A;  2J1E A;  1OSG A;  3VBR B;  3H8U A;  3GZA A;  4GAZ A;  3MFA A;  3FFZ A;  5F3I A;  2DVF A;  3WIN E;  5GZG A;  1OLM A;  4FI9 A;  4YZ5 A;  3MEP A;  2JDN A;  4J1W A;  1AYN 3;  3H3Z A;  1H4G A;  1QWR A;  2TEP A;  2FDG A;  2BWC A;  3R05 A;  2P3K A;  3BOD A;  3ETP A;  1VJ2 A;  1OD3 A;  3TEX A;  3U0Z A;  2D6O X;  3B9C A;  3PU3 A;  1VBE 3;  2VXR A;  3VGI A;  3ZYF A;  3Q8B A;  2PHL A;  2VAU A;  5FP9 A;  2PLV 3;  1CJD A;  1JYN A;  1SQ4 A;  2BWA A;  5D8A A;  2ZJC A;  1FOD 1;  1AVB A;  5JR7 B;  5HXM A;  5LRR A;  1IS5 A;  1S55 A;  3VHR A;  4L0P A;  3MLL A;  5CAZ A;  3CU7 A;  4JRA A;  1QJU 3;  2A70 A;  4QWN A;  4GWJ A;  5EJZ B;  4QM9 A;  4P9I A;  3WF1 A;  3N35 A;  2PEL A;  2RS5 1;  1JHN A;  4DUV A;  5C8W A;  5FRE A;  4RA0 A;  2RMU 1;  4COU A;  1RUG 2;  1RUJ 2;  1RIR A;  1K12 A;  4JGZ C;  1HKD A;  2XJT A;  2EAL A;  1W8N A;  2JDP A;  3DCQ A;  2ZOE B;  1ALY A;  4JV4 A;  3E5U A;  5G04 L;  4AQS A;  2D3R A;  3SIT A;  4EQV A;  5KXB A;  2VM9 A;  1W2A X;  4OFG A;  1GP6 A;  5F32 A;  2LRP A;  4YVS B;  2NN8 A;  2Q8C A;  1JOD A;  1RUD 1;  1AYM 1;  3FJS A;  4QPI B;  2XUE A;  4IE6 A;  4WVV A;  4OI1 A;  3TN9 2;  4CCL A;  4DXS A;  1WCD J;  5LA1 A;  4RSU A;  4Q5O A;  1JUH A;  2LM3 A;  2XWB B;  5IVV A;  5B4N A;  3S57 A;  4NOT A;  3BUC A;  3L9J T;  2FHR A;  2D43 A;  2RS1 1;  4XJ9 A;  3RYR A;  3WX5 A;  2QVS B;  2QQJ A;  2WWU A;  5DMY A;  1GSL A;  4PLO A;  3I2I A;  1CES A;  1H8T B;  2QQO A;  2WT2 A;  4KU7 A;  1RIT A;  4XBQ A;  5GJ6 A;  4YFZ A;  1RC6 A;  1IS6 A;  1BVV A;  1QXJ A;  4QB1 A;  5J09 A;  5LAT A;  2I45 A;  5C4W C;  4A7Y A;  2NP0 A;  2XKP A;  4IW3 A;  1AJK A;  1SLB A;  2LS6 A;  3D5O A;  3PUI A;  3SQO A;  3MW4 A;  2OA2 A;  2H0B A;  4BLI A;  2K46 A;  2W2I A;  3I2O A;  1OPM A;  4XJU A;  4E2G A;  2HWE 2;  3D6E A;  1MS0 A;  4D6S A;  4W65 A;  3PUQ A;  4XUQ A;  5FZC A;  1RGS A;  2H6C A;  4AGV A;  5J36 A;  2WII B;  1TME 1;  5JSP A;  3GZT B;  1TG7 A;  2Q1F A;  3FUQ A;  5FZH A;  1C57 A;  5I0D A;  1GZT A;  3FWE A;  1YJL A;  2FQP A;  4WM7 C;  2K0G A;  4X8P A;  3ZXG A;  3ORJ A;  1PZ7 A;  4NRO A;  1W99 A;  2NPI A;  4PI0 A;  4N43 B;  2KA3 A;  4MXV A;  3FHQ A;  3AKQ A;  4XAE A;  4PF1 A;  2XJV A;  1BK0 A;  4XQW A;  3RZG A;  4FPK A;  5I93 A;  3POE A;  2JEM A;  1AL2 1;  3O1O A;  3POW A;  5LZ6 A;  3KZ4 C;  4PLM A;  5DAV A;  2WNV B;  3SC7 X;  1V9U 3;  2XJU A;  4YZ2 A;  4COW A;  2ZTN A;  2ZGP A;  2A3Y A;  4J1X A;  4LOT A;  3NAP A;  2FBE A;  4OI2 A;  2WFF 2;  2VG9 A;  3S6P A;  2AR6 A;  4I09 A;  3L2H A;  2JB4 A;  2B42 B;  5A7Q A;  1OFN A;  3ACH A;  4CCN A;  4YZ3 A;  5GM0 A;  1QY4 A;  3OGG A;  5FY4 A;  4FPJ A;  5IVB A;  4QMA A;  4FOW A;  1WMX A;  1TMF 1;  2B39 A;  4TLG A;  5FK7 A;  1SLC A;  2A1X A;  4Q0P A;  4AF9 A;  3U4X A;  3VUO A;  3I54 A;  1LB2 A;  3BKZ A;  3C7E A;  4CCO A;  1WGP A;  1W90 A;  4Z2A A;  2B9V A;  4OHX A;  1AR8 2;  4XOG A;  1OC1 A;  1JYV A;  2R16 A;  3QAC A;  4IEW A;  2O8Q A;  3GM8 A;  4JGZ A;  1SLL A;  2GMM A;  4LA3 A;  5FYM A;  3KD4 A;  4HZF A;  2XLF A;  4FQ4 A;  3AVS A;  3ECQ A;  4IET A;  2VXJ A;  3B9I A;  1CAW A;  4XF1 A;  5FOB B;  3ATG A;  1N3O A;  1U5Z A;  3ZFG A;  1AX1 A;  2O14 A;  3WV6 A;  5EFU A;  2QUO A;  2Y38 A;  1X9P A;  3GHN A;  3VBF C;  3OPZ A;  2ZGT A;  4Z82 A;  1PZ8 A;  3BTZ A;  3ENR A;  4NUB A;  4TN7 A;  1AF9 A;  5FP8 A;  2BYV E;  2UU8 A;  3LFM A;  3VDA A;  3ACG A;  1LEM A;  4LO4 B;  1L3J A;  2DUO A;  3ON7 A;  4LBK A;  4RS5 C;  2VZ3 A;  4AHW A;  3S5A A;  1H6X A;  1WWY A;  4HLT A;  4OUL A;  1RUI 3;  2WZR 1;  4LBN A;  1MZE A;  4PCR A;  4PQ9 A;  4TLF A;  4XPV A;  4CU9 A;  3OY8 A;  4OYU A;  4AVB A;  2XQR A;  3WEZ A;  4CUA A;  1SLA A;  4Q1R A;  2DVD A;  1BEV 1;  1H9W A;  4RHV 2;  2D3S A;  1YIF A;  2DDU A;  4ASL A;  2VQU A;  3F95 A;  2WS9 3;  2P3Y A;  3ASI A;  1I5P A;  1Q8O A;  3ZOI A;  4I0W B;  3PNA A;  2ZGL A;  3AJZ A;  2Y6H A;  4XIL A;  5FWJ A;  1RUO A;  2P2K A;  1V6J A;  4XET A;  2WRA A;  2ZAA A;  3E6D A;  5DAP A;  1CJP A;  3VZK A;  4YSF A;  4WM7 A;  4FP3 A;  4BXF A;  2R49 A;  1FPN 2;  2D5H A;  3ZXA C;  4B3N A;  3PL0 A;  4YG3 A;  1W2O A;  3WG2 A;  1SCS A;  4SBV A;  2VQA A;  1EV1 1;  5FXZ A;  1POV 1;  3VBO B;  2ZZQ A;  4URT A;  1XB9 A;  5F9T A;  4YGB A;  3NJZ A;  3KVB A;  3ACI A;  4LO5 B;  5FZO B;  4EN7 B;  3Q8F A;  3IMN A;  3IIA A;  5FMO S;  5FYZ A;  1FOD 3;  2Y6F A;  4A6O A;  4NIH A;  2X5I A;  4ZU7 A;  1J3Q A;  4AVT A;  1CX1 A;  3WW4 A;  2ORX A;  4C0B A;  3KCX A;  3BPS A;  4BDV B;  2W5F A;  4AGG A;  1E5S A;  1D7P M;  2V72 A;  3IAQ A;  4LTA A;  4B1L A;  2Z2S B;  3N7M A;  4H7M A;  2OW4 A;  3O1U A;  1H8V A;  3WP3 A;  2RMU 3;  1ULC A;  1N1V A;  3H3L A;  3IDA A;  3PLQ A;  4JHT A;  4JGY C;  4UFI A;  2A73 B;  4QQ2 A;  4BQY A;  3I3E A;  4IQP A;  1RVF 3;  4X6Q B;  3SNM A;  1ZRF A;  4CP0 A;  3SIS A;  1OKQ A;  4MYE A;  3M70 A;  3K75 B;  1RUD 3;  5KXD A;  1AYM 3;  2ETE A;  1W9F A;  5FYT A;  4HN0 A;  5E16 A;  4G9S B;  1NUK A;  2XJQ A;  3FZ3 A;  3ES4 A;  4C90 A;  3H42 B;  3B69 A;  1Y9G A;  2ADD A;  3HD8 B;  4N90 A;  4Q2F A;  2RS1 3;  5IAV A;  1IKQ A;  3NO8 A;  3ZR6 A;  1XNC A;  3GGL A;  4AI0 A;  4E4S A;  5CNA A;  3VBF A;  3J9S A;  2OII A;  1GNH A;  1ZBA 2;  1YRZ A;  3KGL A;  3DYP A;  4Y26 A;  2XBO 2;  1AR7 1;  1G6N A;  4NIG A;  4C0H A;  4UBG A;  3RI8 A;  2AEZ A;  4FPL A;  2RV9 A;  3J8F 2;  4Y1X A;  4WZF A;  2E32 A;  4NIA A;  1FI2 A;  4DMI A;  5FBZ A;  3T0B A;  3N7L A;  4RGA A;  4YZ4 A;  4AL9 A;  2VVE A;  4Y5S A;  3WF2 A;  3WNK A;  1HN1 A;  3HNM A;  4IE7 A;  1I3H A;  3QOP A;  1UN1 A;  4RS5 A;  1OA4 A;  1W6O B;  1V6O A;  3I2F A;  3MIH A;  1ZA7 A;  4YW3 A;  1PGL 2;  5SV8 A;  2XVL A;  3VD5 A;  3ZPY A;  1A3K A;  4NAM A;  1JOP A;  2QQK A;  4AWD A;  3VZJ A;  1FV3 A;  4LT5 A;  2E6V A;  1SFN A;  2ID4 A;  4DEV A;  3P3N A;  3ZX7 A;  5CKN A;  3H50 A;  4YVS C;  1CZV A;  3JD7 1;  3W58 A;  5A32 A;  5I91 A;  5C3O A;  4QPI C;  4AHY A;  4AYU A;  5FMB A;  3U11 A;  2ZX4 A;  1JZ3 A;  3ZXL A;  4Q29 A;  3NNF A;  1EPW A;  3UET A;  4J6G A;  1ULP A;  5G05 L;  5I0R A;  2HKX A;  3DEC A;  1F31 A;  3M3O A;  1PO2 1;  2HBU A;  4YWA A;  1VB4 A;  2BVB A;  2FD8 A;  4QQP A;  3FC0 A;  4BQ2 A;  5BNQ A;  2ZX3 A;  4NMI A;  1CAX B;  2WNU C;  5JXG A;  4HT1 T;  3MIF A;  2J1U A;  2BGO A;  1QKQ A;  4K40 A;  4LK7 A;  5D8A B;  3UKV A;  3IB3 A;  5F3C A;  1XC6 A;  4IGP A;  2OYZ A;  2WO7 A;  4BYY A;  4B7E A;  1JUI A;  4BQX A;  4Y1Z A;  3AVR A;  4P5Y A;  4BB3 A;  5CIS A;  3OBZ A;  5KHK A;  1S2B A;  5FCC A;  2JD9 A;  2CAV A;  1NZC A;  1XXN A;  2K9Z A;  2BQP A;  3M4F A;  4B4P A;  1B35 C;  4ZPI A;  2WSU A;  4DOU A;  3I4I A;  5FZ6 A;  1TMF 3;  1GAN A;  3PUA A;  3BYW A;  1PHM A;  1SPP A;  2XUM A;  3I2J A;  5E88 A;  1REF A;  1VRH 1;  3DV8 A;  3ZKU A;  4RFT 0;  2ENR A;  2W39 A;  3BB6 A;  4P9J A;  4FAG A;  1VBB 1;  2C9A A;  4ONU A;  3D0J A;  1QNY A;  1W8U A;  1R1A 2;  4M0H A;  5BNN B;  3WNX A;  3CNA A;  5C5T A;  3OG2 A;  4JGY A;  1GZ9 A;  1X33 A;  4P9G A;  3QD6 A;  1YNA A;  1UY4 A;  3H0O A;  3ZN4 A;  4IEV A;  4S2D A;  5T5L A;  4N43 C;  4KG8 A;  3GF6 A;  2VJX A;  1PK6 C;  2QDN A;  4XHX A;  1R08 2;  4XF4 A;  3VKF C;  4CE8 A;  5JR2 A;  3N36 A;  3VLB B;  1XRU A;  4CXY A;  4MGS A;  4XF0 A;  3CL1 A;  4IL7 A;  1DZT A;  2PXJ A;  4YW4 A;  3WG4 A;  2BTV C;  2PTM A;  4HN1 A;  4KWL A;  4XBL A;  3KQR A;  2YUE A;  3B7M A;  1XNK A;  3S0M A;  1DLL A;  1C8M 2;  2Y6K A;  2W92 A;  1XE7 A;  1IZ3 A;  1WA6 X;  3HWJ A;  4UF0 A;  2ZCW A;  4A3Z A;  4JC1 A;  1HLC A;  1G9B A;  1HQN A;  4DZG A;  2E26 A;  4K21 A;  3OGV A;  1CPM A;  2HYX A;  4KWK A;  3RWK X;  2FZ2 A;  1QJX 2;  4AVC A;  3RZZ A;  2BPA 2;  1ZNP A;  1GV9 A;  2WYS A;  1TNF A;  1VBD 1;  2GN3 A;  5CA6 A;  2B8M A;  5L36 A;  2ET7 A;  1YIP A;  1YO8 A;  5L9R A;  2VNR A;  4UFM A;  4A45 A;  1GWL A;  3EJK A;  3PTY A;  2ORZ A;  4MV2 A;  2X29 A;  1GYK A;  1QJY 3;  1A8M A;  3CLP A;  4QPI A;  5JZG C;  3ZFE C;  1ZZB A;  1I5Z A;  2NZ9 A;  5JMO A;  2VCM A;  4XBN A;  3OPW A;  1XSR A;  3PU8 A;  1EV1 3;  4FFG A;  5LK5 A;  1POV 3;  3H3U A;  1JS9 A;  1G86 A;  2CNA A;  3LA7 A;  5FJH A;  1US3 A;  3AYC A;  2HWF 2;  2H0V A;  4DB5 A;  3NAP B;  5HBA A;  4HKL A;  2ES3 A;  5IFT A;  3S7E A;  2WNU A;  3KM5 A;  1W9Y A;  1IKP A;  4NVP A;  1GFF 2;  1OA2 A;  1W0O A;  2DCT A;  3AL6 A;  4Q26 A;  1RUG 1;  1RUJ 1;  3RMX A;  1VE0 A;  2A75 A;  5T55 A;  3USU A;  2D3P A;  4S2H A;  4BQ3 A;  1XU2 A;  4NN0 A;  2D40 A;  4JTO A;  2JG8 C;  4I01 A;  5I0T A;  3HJR A;  1B35 A;  5BNO A;  5LA2 A;  2W0X A;  2VME A;  4W4Z A;  2VOV A;  3NKG A;  4IEQ A;  4R4Z A;  2V4A A;  1FXZ A;  1SLI A;  1GOH A;  4FPE A;  5FPB A;  3TN9 1;  2B7Y A;  1V6M A;  3MW3 A;  1CN1 A;  5JUV A;  1R09 2;  4JGZ B;  5FPL A;  1BZW A;  5KWR A;  5CFC C;  5FPZ A;  5HCA A;  4KU8 A;  4QGN A;  5FJK A;  2G19 A;  3HQX A;  5D21 A;  3POB A;  5AC9 2;  5ACA 2;  2R04 2;  3TAY A;  5J1X A;  2BVV A;  1CAW B;  5K9Y A;  2GAL A;  2OUH A;  1KXG A;  3K4A A;  3M8L A;  3UT0 A;  1W2N A;  3ZFG B;  2OXB A;  2PA7 A;  4FPF A;  3RGB A;  3WNO A;  2WA3 A;  2R07 2;  2XXZ A;  3ACL A;  3KV6 A;  5FPX A;  1PK6 A;  2FZ1 A;  3U14 A;  4AI2 A;  2PHX A;  1IPS A;  5C70 A;  3VBO C;  5JMC A;  1LOF C;  2Q1Z B;  2XVG A;  1JZ2 A;  1JOJ A;  2BER A;  4HVQ A;  4OHZ A;  5EHD A;  2A3X A;  2BNN A;  2RM2 1;  4FO9 A;  4LHN A;  4O7X A;  4Y24 A;  2HWB 2;  4UOJ A;  5FRA A;  5FZF A;  3ZMO A;  1AR7 3;  4DRR A;  4R8H A;  1Q8P A;  3LA2 A;  1RUF 2;  2HWE 1;  2VMH A;  1W6Q A;  2WWS A;  3OB8 A;  3OEA A;  1NX9 A;  1UOB A;  3OY8 B;  5FLH A;  1D0G A;  3ZM8 A;  3NV1 A;  4DNY A;  2HWC 3;  3EQE A;  3JZV A;  4CCE A;  4CEW C;  1KRI A;  5T54 A;  2JE7 A;  1W04 A;  3JBG 2;  3A0N A;  3LEG A;  5FAX A;  1W6N A;  4BPZ A;  1WZX A;  1DZR A;  4XFB A;  4YG0 A;  1HXS 3;  2ADE A;  3JD7 3;  4LBQ A;  3WQ1 A;  3Q8E A;  3T2Q A;  2Y0I A;  5GZE A;  4E27 A;  2JKX A;  5JCT A;  3NRU A;  1VMF A;  2F17 A;  3IBM A;  3WHT A;  2W9X A;  3WF3 A;  3IN9 A;  2CAU A;  5C33 A;  2D44 A;  2JDA A;  4K1Z A;  5JIA A;  4E4H A;  3WZ1 A;  4R9C A;  2PAE A;  1PO2 3;  2GC0 A;  2VCA A;  1ZVF A;  3O12 A;  1NG0 A;  1STM A;  4NPM A;  4WVM A;  5FDB A;  2WFF 1;  2CU5 A;  4LO7 A;  5JZG A;  1JU4 A;  4E9K A;  1QDO A;  4XHB A;  3E97 A;  5CIR A;  1CR7 A;  2YU2 A;  4BLJ A;  1SEF A;  3IDC B;  1VB2 A;  2KR2 A;  3ZSE A;  4AI3 A;  4CYD A;  2X5I B;  3I97 A;  4EZ4 A;  3CKH A;  1X36 A;  2RVA A;  3KCY A;  1J84 A;  4MGK E;  1C3H A;  2HEW F;  2ZKL A;  3NQH A;  2YBK A;  3O7O A;  4CDQ C;  1RUC 1;  1NXM A;  3ZLI A;  4N7U A;  3AMN A;  4OHV A;  1OPO A;  3HPN A;  2DWR A;  1LOA A;  1D2S A;  2DTY A;  3J7L A;  3JB8 A;  4Q0V A;  1YHF A;  4O61 A;  4QXB A;  3VHN A;  1VRH 3;  1LCL A;  2W68 A;  3Q8A A;  5FP7 A;  3UES A;  3WXP A;  1DCS A;  4EJR A;  5DAB A;  4B29 A;  2OPK A;  4JX0 A;  1DGW X;  2JG8 A;  1VBB 3;  1S2K A;  3IZO A;  3ZDS A;  1SMV A;  3BN6 A;  2Y6G A;  2WWJ A;  4OVE A;  1VR3 A;  2OZJ A;  2BZD A;  5CFC A;  1ONA A;  3TRS B;  2DUP A;  4XDP A;  1CON A;  1ZZ8 A;  4ATE A;  1W06 A;  5LA0 A;  4ZHN A;  5FUP A;  4ATF A;  4HKW A;  5LBF A;  3W21 A;  2PFW A;  1MPX A;  4KWJ A;  4LO8 A;  4TZD A;  2JDK A;  2P1B A;  3NV2 A;  3VBF B;  3K77 A;  4DIN B;  3N9O A;  3HVD A;  1W8W A;  3O14 A;  3DUI A;  4G4F A;  4CVU A;  3PIG A;  1LOF A;  4LKD A;  5FZB A;  4C1W A;  5C3Q A;  3DKW A;  5SV5 A;  5FKC A;  3LGR A;  1DQ4 A;  1RL3 A;  1BVP 1;  3SH5 A;  5DUU A;  5A3W A;  4UFK A;  1OUS A;  3KV4 A;  1TZO A;  4RS5 B;  5I0S A;  4BU2 A;  1GOF A;  1RUH 2;  2V09 A;  5L7O C;  2XJP A;  2ZMN A;  3AK0 A;  3MIG A;  5A7N A;  2H6B A;  3KVA A;  1PO1 1;  4J25 A;  4IV3 C;  3WNP A;  3D0S A;  5ABJ C;  1POQ A;  4IEZ A;  1T2X A;  5J37 A;  5HCF A;  1NYW A;  4GH4 A;  3TB0 A;  3WNL A;  4CEW A;  3AYA A;  5BNN C;  5A32 B;  4AE2 A;  1FMD 2;  2I07 B;  1VBD 3;  1FPN 1;  4LXL A;  1ODM A;  1UY0 A;  5GZC A;  4MG2 A;  1V6N A;  4NHK A;  4QKB A;  2GC2 A;  3LB9 A;  4O9E A;  3OTF A;  5J3U A;  2XJR A;  2PMW B;  3PIJ A;  3HEI A;  2Y8K A;  4JDO A;  1DQ5 A;  2BDR A;  1TEI A;  1ZYB A;  3C2U A;  4LHK A;  5DAX A;  2RJL A;  5F5A A;  2JIC A;  5C5U A;  3LKJ A;  1OFS A;  3CHX A;  4YNI A;  4MX3 A;  4CP9 A;  4E8C A;  1QQP 2;  1V00 A;  3LPF A;  4ES9 A;  4CXW A;  3E6C C;  4JHZ A;  1COV 3;  1UNB A;  3WOG A;  5IK7 A;  2B5H A;  5A3N A;  4B7K A;  4LOR A;  4NO4 A;  2WLP A;  3T4H B;  4M3C F;  1RUG 3;  1RUJ 3;  3M1H A;  2PHD A;  4LIV A;  2V5D A;  1LTE A;  5LB6 A;  1XJA A;  2J1V A;  4BQ4 A;  1JZ4 A;  1LUL A;  3V56 A;  2A7A A;  1MVQ A;  1SPP B;  4CDQ A;  5LRS A;  4IEX A;  1ZBE 2;  4FFF A;  1W6P B;  2DVG A;  1AUY A;  2Z5W A;  1HW5 A;  3HT2 A;  2CGP A;  1N1S A;  1ULF A;  1AR9 2;  1W6O A;  4EN6 B;  1EPZ A;  1GBG A;  3BPZ A;  4GQ7 A;  4YGE A;  1AXZ A;  3S5Q A;  3PJQ A;  1X50 A;  2XGX A;  2HLE A;  5LAS A;  3OUI A;  5IYY A;  2A3W A;  4TWT A;  3T4V A;  4ZXK A;  3OBA A;  4RGG A;  2WZP P;  4EYU A;  3WR0 A;  1LGC A;  1F8V A;  2WR9 A;  5KR7 A;  1OA3 A;  2IXL A;  3HAG A;  1ZBA 1;  3FN9 A;  2DU1 A;  2WN3 A;  4AZZ A;  2XBO 1;  1U5X A;  1G9A A;  3AMQ A;  1VBC 2;  1FAY A;  2IXJ A;  1DZQ A;  3BU0 A;  1F5J A;  1XOY A;  3J8F 1;  4Z8B A;  3NAP C;  1K3I A;  3THC A;  2GP3 A;  2RM2 3;  1BBT 2;  1W03 A;  4DIQ A;  3GJA A;  1CAX A;  1Q8V A;  2VW1 A;  1GZC A;  4ES8 A;  2Q4S A;  1VP6 A;  2Q1M A;  4PJY A;  3WG1 A;  3U4S A;  2D7F A;  2LUW A;  2Z42 A;  4WV8 A;  1J83 A;  2EIE A;  1PGL 1;  1HV0 A;  3ZSK A;  5JAX A;  3DYM A;  1DF0 A;  4UF0 B;  5GLT A;  2WQ8 A;  5IVC A;  4Q4W 3;  3FLR A;  3ALQ A;  2WBK A;  5DPN A;  2RS3 1;  1WUV A;  1LED A;  3E5Q A;  3VL8 A;  5L7O A;  1RUN A;  1PIV 2;  3OGR A;  3C7G A;  2IFR A;  4Y4R A;  1H2M A;  4IV3 A;  5I8S A;  5ABJ A;  2VR4 A;  3K48 A;  1CAU A;  1NCR C;  3J7N A;  3M7A A;  2J1A A;  3ZYR A;  5BNN A;  1LEC A;  3B93 A;  3X29 B;  2UWB A;  2BOI A;  3WW2 A;  2KD7 A;  4YLZ A;  4ET7 A;  5T5P A;  2VMG A;  4P5H A;  4C8D A;  2AAC A;  1KD7 A;  1LR5 A;  2LTN A;  3INA A;  1OQE A;  2WFF 3;  5FY0 A;  1K5M C;  2W52 A;  3I59 A;  1RB8 G;  3JQW A;  1YLL A;  3WSO A;  3FLT A;  1UZY A;  1IS4 A;  3PDQ A;  2WNU B;  1KQR A;  1VAV A;  4D7S A;  1RMU 3;  3VDB A;  1ND3 A;  5AFE A;  1RUC 3;  1IHM A;  1RHI 2;  4R4X A;  1VBA 2;  3VBH C;  3D82 A;  5KC5 A;  5AVA A;  3AYE A;  2OKX A;  3USU B;  1LJ7 A;  4L2N A;  2GNT A;  3WQ0 A;  2ZS6 B;  1B09 A;  1NCQ A;  2VMI A;  2Y6L A;  1JZ7 A;  1B35 B;  5BNO B;  1R1A 1;  2VZR A;  3HOB A;  3NNM A;  1UIK A;  4Z1V A;  4GZ9 A;  4WZC A;  1JXN A;  3AFK A;  4YFW A;  1KDK A;  3BIW E;  2ARB A;  2VUA A;  2I2S A;  2DCZ A;  4O65 A;  5I8T A;  2Z4F A;  1J1T A;  5FUI A;  1TNR A;  5KXE A;  1H2K A;  4Q8K A;  1UY1 A;  4E2S A;  4LKF A;  2Y0O A;  1UPS A;  1R08 1;  2Y33 A;  5JOX A;  2YXS A;  4IE0 A;  1GLH A;  2WAO A;  5IK5 A;  1OBN A;  1UW8 A;  3AMH A;  4WM8 C;  5EXO A;  3WDV A;  4K8R B;  4EE2 A;  2HYK A;  1W28 A;  4IEY A;  4A42 A;  2GH8 A;  1GWM A;  2JB8 A;  4PLN A;  2CV6 A;  1VBE 2;  3AZV A;  1PK6 B;  1RXG A;  4D6Q A;  2PLV 2;  4FT8 A;  3D3A A;  2JDU A;  1TE1 B;  2CTV A;  5A6Y A;  3DN7 A;  3LDK A;  3GCW A;  3H7Y A;  1C8M 1;  3I2K A;  5GLZ A;  2X5I C;  1RJ7 A;  1O7F A;  1K45 A;  3K3N A;  4IND A;  2P17 A;  3C3V A;  1FV2 A;  4GB3 2;  1HV1 A;  4QXK A;  3CZJ A;  1W6Q B;  3VHO A;  4BQ1 A;  4CUG A;  4DFS A;  5JXH A;  5K4L A;  3RS6 A;  1DIW A;  1QJX 1;  1PX3 A;  2GU9 A;  4KWU A;  3RNS A;  5C6C A;  4QX2 A;  2OVU A;  5FZ3 A;  1F15 A;  3BTY A;  2BBV A;  3A4U A;  1NQD A;  1PO1 3;  1SDW A;  4HMZ A;  5IVF A;  1W6N B;  1QH6 A;  2SLI A;  4GA9 A;  2J1T A;  4U2A A;  1S0D A;  5FY5 A;  1N1T A;  3OYW A;  5JXI A;  3VDD A;  1WBF A;  2EF6 A;  3T1L A;  1Y7B A;  4BE3 A;  4LBQ B;  1UZ0 A;  2R0F A;  1FPN 3;  3AP5 A;  4QX1 A;  4JDM A;  3WW1 A;  2XVK A;  4JQR A;  3I2G A;  3IT8 A;  1BYH A;  2W94 A;  4GXL A;  3HBK A;  4MXW A;  3ZYG A;  4I2O A;  4Q8L A;  2Y64 A;  5LBC A;  1ENX A;  3MHZ A;  4GUL A;  1NCR A;  3R4S A;  4MGI E;  5I0U A;  3VV1 A;  3H1W A;  2HWF 1;  4RD7 A;  5DG2 A;  2WQZ C;  4WVM B;  1MZ6 A;  1O8P A;  3HN1 A;  3VBS C;  5JZG B;  1G9C A;  3H1Y A;  2MPF A;  1O4Z A;  3N9P A;  5EWS A;  4MGQ A;  1AL0 G;  4QPG C;  4X8N A;  4OLL A;  3MIB A;  4P9Y A;  1W3V A;  5FYV A;  4KGQ A;  4YW2 A;  2XML A;  2DFB A;  4V2W A;  2AYH A;  3AZY A;  3L2Y A;  5BYN A;  1K5M A;  2W3J A;  4I3P A;  2GMP A;  4LNV A;  4GD4 A;  5IVY A;  1UU4 A;  3B5L B;  2QZ2 A;  4Q4V 2;  2ZGO A;  3ZYI B;  4SLI A;  4FTB A;  1UWW A;  2MEV 3;  1O5L A;  1OF3 A;  3NJX A;  4QQL A;  5FYC A;  2VMF A;  3ZMN A;  1QJE A;  4CCM A;  2E7A A;  1PX4 A;  1Y9M A;  3N9Q A;  3VKO A;  1R09 1;  3VBH A;  3POG A;  4DO0 A;  5T50 A;  1Z7S 2;  3GAL A;  5FYU A;  3AZW A;  1HB3 A;  3T09 A;  3WQ7 A;  2F4P A;  1FNZ A;  2LW8 A;  2JG8 B;  5ACA 1;  2R04 1;  4Q4Y 2;  2HWD 2;  3CMG A;  3QBQ A;  1NLS A;  2R0H A;  1U5Y A;  2R06 3;  3WCR A;  4W6Y A;  2FCU A;  1PGW 2;  2A6V A;  1UU6 A;  3NST A;  4GMP 3;  5DDJ 1;  2A5Z A;  5BPX A;  2EXK A;  5BV6 A;  1LNS A;  5CFC B;  2EIB A;  2C5D A;  5J48 A;  3RWN A;  2EAA A;  2GSY A;  1S0G A;  2Z69 A;  5JSR A;  4XFC A;  4FPY A;  4JDN A;  1R1Z A;  4WM8 A;  4NRM A;  3FBY A;  4BM8 A;  4W6W A;  1J3P A;  1V9U 2;  2PAK A;  2PQQ A;  4LBL A;  2HWB 1;  1GZW A;  1XU1 A;  2XBO 3;  4V1P A;  4OI0 A;  4QAW A;  3BOP A;  4V2V A;  1RUF 1;  1XE8 A;  3AMM A;  3I7D A;  3J7H A;  3J8F 3;  5EP9 A;  4A3X A;  1ZRI A;  3KT4 A;  3HBZ A;  4DUX A;  4R9B A;  1HB2 A;  4MET A;  2YFZ A;  4QT6 A;  1GR3 A;  1O5U A;  3T30 A;  5IJR A;  4LJH A;  1GQH A;  5GZF A;  1DFQ A;  4AQ2 A;  1YI7 A;  3PVB B;  4OUE A;  2WYF A;  1ND2 B;  3IAP A;  5GLU A;  5CKM A;  1YQ2 A;  5HCH A;  4IEP A;  3J4U H;  3JBG 1;  3VN4 A;  2JG9 C;  3J7M A;  1GMM A;  2WKK A;  2IFW A;  5L9V A;  2BP6 A;  2OUJ A;  1ST8 A;  4I0A A;  4KNC A;  4MZU A;  3WDX A;  3N4M A;  3W5M A;  2RS5 3;  1XBF A;  2RS3 3;  2XOM A;  3IMM A;  1UMH A;  2X10 A;  5CBL A;  2KXL A;  4GH4 B;  4CEW B;  2XL7 A;  4M4P A;  3CIH A;  1I1E A;  2VBP A;  1DP0 A;  2UYA A;  1OKO A;  5JIU A;  1J59 A;  1YQ6 A;  3ZXF A;  3H7J A;  5IAX A;  2A6X A;  3A21 A;  1IQD C;  1Z0H A;  4ERO A;  3GZE A;  1L7Q A;  2YRO A;  3WDT A;  2P6H A;  4TTG A;  4E4Z A;  5APA A;  3T0D A;  3OUH A;  3ZYH A;  4A44 A;  5HXV A;  3GDB A;  3I8T A;  4LIU A;  4CP9 B;  4AI9 A;  1KDM A;  2WC2 A;  5F3E A;  4QKF A;  4YZ1 A;  2YZ4 A;  4YGC A;  3VBS A;  4BWO A;  3V65 A;  1WCU A;  2QQN A;  5M0T A;  1CQ9 A;  4QPG A;  4XUT A;  4XMA A;  5E8A A;  1RUI 2;  2XB6 C;  1BJQ A;  3K4D A;  4RQP C;  1OF4 A;  3IKW A;  1HJF A;  4Y20 A;  1NE4 A;  5DZG A;  4IES A;  4CRQ A;  3W9A A;  2VZ1 A;  4I02 A;  2YYO A;  2C26 A;  4CDQ B;  5FUN A;  5AFB A;  1O6U A;  4P9X A;  3VZM A;  1UKG A;  3EMR A;  4IV1 A;  3WDU A;  2WS9 2;  4HL0 A;  5FLJ A;  5FO9 B;  1RUE 2;  1L7R A;  5FZ9 A;  2IXC A;  5IK4 A;  1M4W A;  1D4M 1;  3U1X A;  5KHG A;  1AX2 A;  4A2U A;  1TME 3;  3RRD A;  1YUD A;  1R08 3;  1MEC 2;  1N3P A;  2W47 A;  3I3D A;  3KSC A;  3RQ0 A;  1HRV 2;  2BBA A;  2XHK A;  2F4L A;  3UJQ A;  4M3C E;  2HBT A;  1QJZ A;  4MH0 E;  3AYD A;  3RYK A;  1DLC A;  4QM8 A;  3EO6 A;  3PVO A;  3RYP A;  1CX4 A;  3ZIW A;  4P9L A;  4CXX A;  5FPU A;  3TOJ A;  4FFH A;  3VKN A;  4CDW A;  1WCQ A;  5C3R A;  2R7E B;  1W0P A;  1PVC 2;  4BZ4 A;  1AL2 3;  4MSV A;  1BKZ A;  4YGD A;  3SXW A;  1C8M 3;  4Q4X 2;  2GAU A;  1ULG A;  2FDK A;  2FCT A;  1ZRE A;  5EJ3 A;  1J1L A;  2VVF A;  4QD2 A;  3A23 A;  3FHI B;  1HDK A;  3EHK A;  2DFC A;  4LBJ A;  5JOW A;  2XKO A;  4P00 B;  4CSW A;  4BK5 A;  4ZZ8 A;  2PYT A;  5JPM B;  2QJV A;  5BNO C;  1S1A A;  3URF A;  1RVF 2;  2JG9 A;  5L7O B;  1FMD 1;  2O8O A;  4UW3 A;  1JH5 A;  5T52 A;  4EN9 B;  1WA4 A;  5F6L B;  5FPV A;  3UGF A;  4UFJ A;  1VAM A;  1W2U A;  5GLW A;  4CTE A;  4DEQ A;  1W6P A;  3U78 A;  3ZN5 A;  1O3T A;  4IV3 B;  3GNE A;  5IW0 A;  5ABJ B;  2BGP A;  1CAU B;  2ERF A;  3OD0 A;  4QB2 A;  4BA6 A;  5A3O A;  4NII A;  2QQM A;  5F3G A;  4AAX A;  1EAH 2;  2YMZ A;  1ACC A;  4IGQ A;  3ES1 A;  1W3X A;  2A71 A;  4HFS A;  3E6B A;  3KB5 A;  3TYJ A;  3ZFE B;  4LUM A;  1QQP 1;  3RZJ A;  2QQL A;  2GME A;  4IGO A;  2HWF 3;  2VZP A;  2ET1 A;  4XDQ A;  4LBQ D;  3T1M A;  4QHO A;  1Q8Q A;  3I59 B;  2QTW B;  3O1R A;  4C91 A;  2C9K A;  1DHK B;  4MVT A;  2FDF A;  2ZHM A;  3P5B A;  4K7J A;  1YCI A;  2EXI A;  4N8M A;  4JQT A;  3LSD A;  1E5I A;  3DGT A;  3H9A A;  4ZXE A;  1FYU A;  3UKN A;  4YAR A;  1RED A;  4FSJ A;  4Y4Y A;  1ND3 B;  1OD5 A;  3UYJ A;  1ODN A;  2YGL A;  5FZE A;  4COZ A;  2IUW A;  5CG9 A;  1ZBE 1;  1A8D A;  3FE5 A;  3WVJ A;  3OD4 A;  4Y5Z 0;  2OX0 A;  4OZX A;  2ZGK A;  3ZR5 A;  1NCQ B;  4BOW A;  2YPD A;  1NXD 1;  3C7O A;  3IPV B;  4RQP A;  5GAL A;  4RGK A;  1R09 3;  4QX3 A;  3NJY A;  3AJY A;  1RIN A;  2WZR 3;  4XIO A;  4DXT A;  1QDC A;  1V6L A;  4NWW A;  4AK3 A;  1DQ0 A;  2PHT A;  2E63 A;  3KV5 A;  4Z07 A;  5ACA 3;  4UFH A;  1S2E A;  2R04 3;  2YG0 A;  3N7J A;  3I3Q A;  3RDI A;  4AHZ A;  3T3Y A;  4CP2 A;  1BEV 3;  1X9T A;  1UYZ A;  2GND A;  4Y1Y A;  4YM0 A;  4Q0Q A;  5A7P A;  4GAL A;  4GJZ A;  5DDJ 3;  2HEV F;  3VZO A;  2EVX A;  2GDF A;  5C8C C;  2BEO A;  1VBC 1;  1S0E A;  1ZZ7 A;  3FHA A;  2JE8 A;  5CZK A;  4ASK A;  5K0U A;  1G9D A;  5T3N A;  1W9T A;  1WCS A;  4YVW C;  3IDE A;  1F4H A;  1GP5 A;  1BBT 1;  4XFH A;  3RZH A;  2VBB A;  4Y33 A;  1YQC A;  1R64 A;  4KI5 M;  3B02 A;  1GU3 A;  1RUF 3;  3VD3 A;  4YW7 A;  2JJ6 A;  2VL4 A;  5FYS A;  1J58 A;  3TBD A;  3W20 A;  1UMI A;  3MGU A;  4QXC A;  2YV8 A;  3OBT A;  2IZW A;  2Y34 A;  1S0C A;  3MF9 A;  4DRV A;  3JBG 3;  2I74 A;  1UX7 A;  5C9A B;  4BK4 A;  3WW3 A;  1BMV 2;  1PIV 1;  2FMD A;  4QDR A;  3JXS A;  2RR1 2;  4FOV A;  1MQT A;  4E2Q A;  1NZI A;  5CG8 A;  2Q8O A;  5FXW A;  4XE9 A;  4HON A;  2WAB A;  3KQ4 B;  5FLI A;  3MI8 A;  3T0A A;  3OYW B;  4BIF A;  3VDD B;  4YG6 A;  4CU7 A;  5LWB A;  2JDH A;  4NHX A;  4PF5 A;  3THD A;  1HQW A;  3RZM A;  4FPG A;  1UD1 A;  4Y22 B;  2Q30 A;  3KCC A;  4MXW B;  4K20 A;  2TNF A;  3JB4 C;  4LKS A;  3ZFF A;  1NCR B;  1N3Q A;  1ZZ9 A;  2R1B A;  2P3I A;  4DPN A;  1DU3 D;  1HRI 2;  1O4T A;  2QQW A;  2UWA A;  4K6B A;  4JKM A;  1IG0 A;  2PHF A;  3M3E A;  4LLO A;  3OCP A;  4QX8 A;  5FZM A;  3U10 A;  4JAA A;  1LEN A;  3TEW A;  4AFD A;  4AEM A;  1VRB A;  1W8O A;  3D8C A;  3P3P A;  3PVN A;  4K9S A;  4EWE A;  5D2A A;  5CFD B;  3LFI A;  1LU2 A;  1GP4 A;  4IER A;  4YM1 A;  1RHI 1;  4OQ8 A;  1CIY A;  1K5M B;  1NA1 B;  1VBA 1;  2VUL A;  4EWD A;  3OSD A;  4ITC A;  1OOP A;  5F5C A;  1QJF A;  4RL7 A;  4CCC A;  2EA7 A;  4OZO A;  1D0H A;  1ND2 C;  1AX0 A;  4B4R A;  2Y6J A;  4XFG A;  1AR6 2;  5EQU A;  3UL2 A;  5IHR A;  3OBR A;  3N3H A;  5CEH A;  1ZRC A;  1XQN A;  3VBH B;  2MNG A;  3HQR A;  1W8T A;  1X7N A;  5ERL A;  2RDN A;  1ULE A;  3LA3 A;  1W2T A;  2G9Z A;  2V4V A;  3AB0 A;  2WO3 A;  3LIH A;  4GH4 C;  3ABZ A;  3NJV A;  4FPO B;  5FZA A;  1OVS A;  1H1M A;  2CWS A;  1D4M 3;  2E51 A;  5A6Z A;  4WVZ A;  4MGT A;  1LES A;  2OQ7 A;  1QJY 2;  4FVV A;  1KS5 A;  1V6K A;  3IDB B;  4ZU4 A;  3MF6 A;  4RR3 C;  4CU8 A;  3AMP A;  1UPI A;  2ZBJ A;  1GQP A;  3GBW A;  5A80 A;  3LSE A;  2D93 A;  4WM8 B;  2P34 A;  3NMB A;  3ZSM A;  3HR9 A;  3WLU A;  4KQ7 A;  4FPH A;  4CPB A;  1UMZ A;  2DCJ A;  1GZW B;  1JOB A;  4WBB A;  5C8C A;  1LHU A;  1CPN A;  1WD3 A;  3IWZ A;  2VD7 A;  4GB3 1;  4UI9 L;  4R9D A;  1KFX L;  4XJ8 A;  4YVW A;  4BME A;  5KC6 A;  2JEC A;  1D4V B;  4H2A A;  2WA4 A;  3DXU A;  3RJR A;  1E57 A;  1KGY A;  1OUR A;  2IXH A;  4AQT A;  4A41 A;  3BVC A;  4H7L A;  4AW7 A;  1WW4 A;  1H2L A;  5LY1 A;  4OQ9 A;  2X05 A;  1OVP A;  1UKR A;  1LOE A;  1SZB A;  2R1D A;  3ST7 A;  3WDY A;  3POJ A;  2Q5T A;  3N9N A;  4LKE A;  3FLP A;  4XJW A;  3VD7 A;  3LCP A;  2BFU L;  5FFO C;  3H1M A;  1UOF A;  2DUQ A; 
#chains in the Genus database with same CATH homology
 2DDU A;  1CZT A;  2VQU A;  3LEI A;  3OGR A;  3C7G A;  1I5P A;  3E1F 1;  2Y6H A;  1TVG A;  2VR4 A;  2J1A A;  3BGA A;  1F4A A;  2W87 A;  1P8J A;  4OMD A;  3MUY 1;  2KD7 A;  4ET7 A;  1PMJ X;  1SDD B;  1UYX A;  3ACI A;  3WSO A;  4A6O A;  1K42 A;  4CU6 A;  1W9S A;  1CX1 A;  2ORX A;  3VDB A;  4E8D A;  4BDV B;  2W5F A;  3IAQ A;  1D7P M;  2V72 A;  2OKX A;  3SEE A;  5IFP A;  2Y6L A;  4LPL A;  1JZ7 A;  2WN2 A;  3WQB A;  2VZR A;  3IDA A;  3HOB A;  4XUN A;  4GZ9 A;  2QQI A;  2ZEX A;  3I3E A;  5CYY A;  4MO3 M;  2Z4F A;  4CUB A;  3K46 A;  5FUI A;  5LCW L;  1UY1 A;  3K75 B;  2WAA A;  2WAO A;  2ZXQ A;  4W50 A;  1NUK A;  4IUG A;  4TXW A;  4A42 A;  2J1R A;  4OMC A;  1H6Y A;  3HNB M;  2YB7 A;  4XUP A;  2VZU A;  3GGL A;  3D3A A;  3DYP A;  2VC9 A;  3I2K A;  1W9W A;  1NAE A;  1K45 A;  2RV9 A;  1GUI A;  4JKL A;  3W5N A;  3CZJ A;  2E32 A;  5JXH A;  2YFU A;  3T0B A;  4D8M A;  1UXX X;  3WF2 A;  3WNK A;  1HN1 A;  3HNM A;  3I2F A;  4ZZ5 A;  1PX3 A;  4KWU A;  1GOG A;  4QX2 A;  3VD5 A;  2QQK A;  2YC4 A;  2VZT A;  4XVH A;  3WNN A;  2J1T A;  4RYD A;  4CUC A;  2ID4 A;  4DEV A;  2YC2 A;  5JXI A;  1CZV A;  2WUH A;  3T2O A;  1UZ0 A;  4QX1 A;  1JZ3 A;  4GWI A;  3NNG A;  3I2G A;  2WDB A;  3UET A;  2W94 A;  2XQX A;  2W46 A;  1ULP A;  1US2 A;  2Y64 A;  5G05 L;  3DEC A;  3MUZ 1;  1O8P A;  5JXJ A;  5HPO A;  4A4A A;  5JXG A;  2J1U A;  2BGO A;  4MGQ A;  3T2P A;  2VCC A;  3IB3 A;  1SG3 A;  1XC6 A;  3F2Z A;  4P5Y A;  2W3J A;  2VTF A;  2JD9 A;  4MAD A;  4QB6 A;  2VQT A;  1UWW A;  3NJX A;  1OF3 A;  2PQS A;  2VMF A;  3I2J A;  1PX4 A;  3T09 A;  2LW8 A;  2W1Q A;  3CMG A;  3WF0 A;  3OG2 A;  3LE0 A;  4ARY A;  1UY4 A;  1OT5 A;  3EYP A;  4KMQ A;  4QDQ A;  3SEP A;  1LNS A;  2VJX A;  2EIB A;  4QPW A;  2VZO A;  3OEB A;  3EB7 A;  5JR2 A;  4UAP A;  4AG4 A;  4HG6 B;  4MGS A;  4ZY9 A;  2L9L A;  4W8J A;  4QAW A;  3J7H A;  4MOA A;  4DUX A;  2ZEW A;  2YFZ A;  3A7Q A;  3MV1 1;  5IJR A;  2QBX A;  3K4Z A;  2E31 A;  4OUE A;  3IAP A;  3LPG A;  4LQR A;  2Y6K A;  1YQ2 A;  2WO1 A;  2W92 A;  2CDP A;  1GMM A;  4A3Z A;  3PUH A;  2E26 A;  3W5M A;  3OGV A;  2HYX A;  2XOM A;  3MV0 1;  1UMH A;  2X10 A;  1EUU A;  4M4P A;  3CIH A;  2WYS A;  5B4X A;  1DP0 A;  3WF4 A;  2DCK A;  2W95 A;  4A45 A;  3A21 A;  1IQD C;  1UXZ A;  2ORZ A;  1JU3 A;  2VMC A;  1L7Q A;  5EIY B;  5JMO A;  2WZE A;  4TTG A;  3T0D A;  4A44 A;  4XUR A;  3GDB A;  2J1S A;  3GXU A;  1US3 A;  4DUW A;  2X09 A;  5IFT A;  2QQN A;  4QDS A;  4XUT A;  2W1W A;  2W91 A;  1JZ8 A;  3P1I A;  3K4D A;  1OF4 A;  3OGS A;  3VD9 A;  4LHS A;  2XHN A;  2VZ1 A;  1XNT A;  2C26 A;  3HJR A;  1GNY A;  5LA2 A;  4RN5 A;  2VME A;  4W4Z A;  1GOH A;  2J22 A;  4DXR A;  5JUV A;  1L7R A;  1XNA A;  3VDC A;  1JI6 A;  2VOT A;  4PQQ A;  5J1X A;  4BJ0 A;  3I3D A;  2W47 A;  3CDZ B;  3CQO A;  1ULO A;  2BBA A;  3K4A A;  1JYX A;  4JKK A;  2W1U A;  1W0N A;  3III A;  1DLC A;  2RJ2 A;  3WNO A;  3DYO A;  5C70 A;  1WCQ A;  3AC0 A;  1JZ2 A;  2BER A;  2R7E B;  3C8X A;  2VZV A;  4UOJ A;  2WO2 A;  4XUO A;  1JHJ A;  2W1S A;  1DYO A;  3A23 A;  3UNP A;  4D0Q A;  3OB8 A;  4P00 B;  3OEA A;  1NX9 A;  4BK5 A;  4ZZ8 A;  3ZM8 A;  5IHR A;  2VO5 A;  2VCB A;  4P02 B;  5F7U A;  4XZU G;  3WNM A;  5DN2 A;  3LEG A;  3I2H A;  5EJ1 B;  4QX0 A;  2J1E A;  1JZ6 A;  4DEQ A;  2BGP A;  3T2Q A;  4QB2 A;  4M4R A;  2JKX A;  3NRU A;  3WF3 A;  2QQM A;  4FI9 A;  2W9X A;  4AAX A;  2JDA A;  3LQC A;  5C7G A;  3ETP A;  1OD3 A;  4P08 A;  2VCA A;  2QQL A;  2VZP A;  2VMD A;  2XON A;  3ACF A;  1JU4 A;  1KEX A;  1JYN A;  2C9K A;  5HXM A;  4ZXE A;  3I97 A;  4L0P A;  3CKH A;  4YPJ A;  2B4K A;  2RVA A;  3T08 A;  1J84 A;  5EJZ B;  2ZEY A;  4GWJ A;  3NQH A;  3SKJ E;  1WKY A;  3WF1 A;  3HPN A;  4DUV A;  1EUT A;  1K12 A;  3C7O A;  5G04 L;  1W8N A;  4QX3 A;  3UES A;  4ARX A;  4DXT A;  2VM9 A;  4JX0 A;  1PMH X;  2YG0 A;  3FL7 A;  3BN6 A;  2Y6G A;  1UYZ A;  2BZD A;  4DXS A;  5LA1 A;  1UYY A;  5B4N A;  3FHA A;  5CZK A;  2JE8 A;  5A1A A;  1UY3 A;  5LA0 A;  1W9T A;  1MPX A;  2QQJ A;  5DMY A;  1F4H A;  3I2I A;  2QQO A;  3K77 A;  1R64 A;  4KI5 M;  1GU3 A;  1XPW A;  3VD3 A;  4CVU A;  4QB1 A;  1JYW A;  2VL4 A;  2LS6 A;  1UMI A;  3PUI A;  1GOF A;  1UX7 A;  4BK4 A;  4QDR A;  1O59 A;  4XUQ A;  3JXS A;  4PT6 A;  3WNP A;  1TG7 A;  3HN3 A;  1T2X A;  2WAB A;  5I0D A;  2EID A;  3T0A A;  3WNL A;  1O8S A;  4CU7 A;  1JZ5 A;  2ZEZ A;  1UY0 A;  3C7H A;  1W99 A;  3THD A;  3FHQ A;  4LKS A;  2WZ8 A;  4PF1 A;  3VD4 A;  3HEI A;  2Y8K A;  5C71 A;  4JKM A;  3CZU A;  2C4X A;  4E8C A;  1BHG A;  1W8O A;  2J7M A;  3LPF A;  3SKV A;  1OH4 A;  4JHZ A;  1CIY A;  1SHW B;  1UY2 A;  2EIC A;  3ACH A;  4OZO A;  2V5D A;  1JZ4 A;  2J1V A;  3P6B A;  2Y6J A;  3C7F A;  3U37 A;  4BXS V;  3HNY M;  3C7E A;  3MBW A;  2VZS A;  4Z2A A;  2B9V A;  3A22 A;  2E33 A;  1JYV A;  2V4V A;  2WO3 A;  3GM8 A;  3ABZ A;  3NJV A;  3ECQ A;  2HLE A;  5IYY A;  3OBA A;  3MO4 A;  4CU8 A;  1GQP A;  3I3B A;  3FN9 A;  2WN3 A;  1RYY A;  2DCJ A;  2VZQ A;  4UI9 L;  1CZS A;  1K3I A;  3VDA A;  3THC A;  3ACG A;  2CDO A;  1KGY A;  4A41 A;  2VZ3 A;  3LEK A;  1H6X A;  1J83 A;  1NKG A;  2EIE A;  2X05 A;  3DYM A;  4CU9 A;  4OYU A;  2WQ8 A;  3VD7 A;  3WEZ A;  4CUA A;  5DQ0 A;  2WBK A;  5DPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...