5L36A

Crystal structure of a human fasl mutant in complex with human dcr3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
139
structure length
138
Chain Sequence
b'LRKVAHLTGKSSRSMPLEWEHELGLALLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor necrosis factor receptor superfamily member 6B
publication title Crystal Structure of the Complex of Human FasL and Its Decoy Receptor DcR3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 138
sequence length 139
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l36A01
4QPYA 4J6GA 2R30A 2AZ5A 3TYJA 1DG6A 3L9JT 4MXVA 2JG8B 4N90A 4KGQA 1KD7A 5KC5A 4HT1T 1PK6B 2OIIA 1C28A 2TUNA 2WNVC 2Q8OA 5L36A 5L19A 1A8MA 1XU2A 4DOUA 1IQAA 4QQPA 2X29A 5BNQA 4OULA 2RJLA 3B9IA 3B93A 3TWIA 2E7AA 4QQ2A 4QQOA 5TSWA 2HEYF 1I9RA 1C3HA 2HEWF 4RSUA 1U5ZA 2WNVB 3MI8A 1XU1A 4E4DX 2QDNA 5KC6A 2Q1MA 1KXGA 2TNFA 4MXWA 3URFA 1RJ8A 2WNUA 3ME2A 1JH5A 2JG9A 2QE3A 1D0GA 3QD6A 4D7YA 4OUSA 3WD5A 1DU3D 1JTZX 4TWTA 1D4VB 3LKJA 1S55A 4E4SA 4KGGA 4OUMA 2RJKA 1ALYA 1TNRA 4EN0A 2JG8A 3K48A 2O0OA 1PK6A 3B94A 1D2QA 3ALQA 2Z5WA 4TSVA 5KWRA 2HEVF 1U5XA 4G4FA 4DB5A 4G3YC 4F3JA 2KA3A 4QQLA 1OSGA 3V56A 4GIQA 1RJ7A 1OQEA 1U5YA 4MXWB 1WCKA 4KG8A 2ZPXA 2WNUB 4NN0A 2JG9B 3K51A 2JG8C 5CIRA 2ZJCA 4QQHA 4MSVA 2R6QA 2WNUC 3IT8A 2JG9C 2RE9A 1GR3A 1PK6C 1O91A 1TNFA 3AB0A 5HBAA 2WNVA 1OQDA 3QBQA 3FC0A 2R32A
chains in the Genus database with same CATH superfamily
3J8F2 2WA3A 5K9YA 1RITA 1G9BA 1KGYA 2YHJA 3VBOB 1MEC2 4XBLA 2F4LA 1GQHA 3I2JA 3ZPYA 1RHI2 3J7LA 1MS3A 1V00A 5E8AA 5BPXA 3WW4A 3LSDA 3VKMA 3ZFFA 1AR83 1JMUB 4S2HA 4E9KA 2D97A 2ETEA 1KFUL 3ZXDA 4QXBA 1WBLA 3FFQA 4AFAA 1VIWB 5FY1A 3AKPA 4NWWA 5BNOB 1QQP3 2HWC2 4PBOA 5JI7A 1UO9A 3ETPA 3ZN6A 1WW4A 2FDGA 1A6CA 1WW6A 4CDXA 5GZEA 4ZPIA 4C91A 3ZR6A 1ZRCA 3S0MA 1Z0HA 3WP3A 1ULEA 4GB32 4L0PA 4BPZA 5JR2A 3VBFA 3WXPA 5JPNB 2EXKA 3ROUA 3O12A 4LNVA 4B7EA 3PDQA 2YFZA 2WDBA 3OCPA 3ZYHA 4B4RA 3NNLA 4CDWA 5FRAA 2HEYF 3RZJA 1IHMA 1MPXA 2VVFA 2ATFA 2EXHA 3OD4A 3RVHA 2DVFA 4BDVB 2QDNA 1UW8A 4YFZA 3I2GA 2ZGRA 3VBUC 1N47A 3J4UH 1BEV3 5I91A 1GQPA 2XBO1 1HQLA 4Y1XA 4EQVA 1SPPA 3IDBB 1OT5A 4OHVA 5FYZA 1R093 4QKBA 2XHKA 5FPUA 5FZ1A 4OUSA 5J48A 1CX1A 2BVBA 1GQGA 5FYIA 4MGTA 2XKOA 3NV3A 4EV0A 4PQQA 1AR81 1OQ1A 2RR12 2JIGA 4AF9A 2VVEA 4YG6A 4MHUA 3ACIA 3OGSA 4IXLA 4TWTA 3WG1A 4BA6A 5IHRA 4D94A 5I8YA 2W1SA 2P5BA 5BNNA 2XQRA 4LBQA 3AYDA 4Z07A 4AVCA 3NJVA 4ZZ5A 1CQ9A 1ALYA 4FQZA 3JUUA 3AMNA 4G9SB 4QGLA 2W08A 4AGRA 4CDUB 4P9XA 2WZ8A 2X5IC 3FUQA 5F2SA 3USUB 3WUDA 1UU6A 3VD7A 2R062 5JDBA 3GF6A 2YC4A 2VOKA 3LGRA 2ZX0A 3LIGA 1OUXA 4HVOA 3ZSJA 4CUCA 1WMEA 3ZFGB 3ACLA 3GCXA 5CFDC 5I0SA 1JBCA 1HDKA 1UCXA 5F8PA 5FYVA 5HV4A 4GMP3 1GOHA 2IXHA 3Q8BA 4I30A 4JQRA 5C9AB 2HWD3 3RPQA 2LRPA 3KCXA 1HW5A 1YQ5A 4FOWA 1V6MA 3RG0A 2CL2A 5HCHA 3PUSA 5EPAA 4GIQA 3IMNA 4L9BA 1CJDA 1O8PA 3I2IA 3AZYA 2XL7A 4XPVA 1IG3A 1US2A 3K3OA 2FBEA 3CU7A 4E4ZA 4FOYA 3WDUA 4CP0A 4Y24A 2WZR3 5F6LB 4UFMA 4RFT0 5K0UC 4AR2A 4U2AA 5F3CA 4LO8A 5L7OB 4ZY9A 4JV4A 1XE8A 4OLLA 3ATGA 3S30A 3C8XA 1W28A 1UX7A 3AYCA 1RUF1 1A34A 4R52A 2VGDA 4QDSA 4C1XA 2ET7A 2WN2A 5FZKA 5IK8A 1VBA3 5JSRA 2JWPA 2BU9A 1JOPA 3T08A 4MXVA 1GLHA 3PU3A 5FYBA 2D5FA 1Y9QA 2X8KA 4Y1ZA 1JI6A 3THCA 1POV3 1COV2 3OD0A 3R4SA 3WNLA 4A44A 4AEDC 1H6XA 2DTWA 5IYYA 5KC5A 1AXYA 1UX6A 3VZJA 3ZR5A 4W8JA 3C2UA 2WWJA 1HXS2 2XOMA 4DY3A 1N1YA 4FPYA 4DY5A 1SACA 2IFWA 4DXSA 4UYBA 4BQXA 3D5OA 2JDPA 4BQ1A 1DDLA 3U75A 3I2OA 5FUPA 4LK7A 2Q8OA 5A70A 1JZ5A 3CDZB 1DYPA 2HWD1 5L19A 3OGVA 1F4HA 4WZFA 4AHXA 3M7AA 4BMEA 3BPZA 2RS32 3ACHA 1RUJ1 3JB8A 4NJ4A 2R072 2V4VA 3ZDSA 4OULA 3W5MA 3KCCA 4JGZB 2DBNA 4IDZA 3LCPA 1GZCA 1W6PA 4LBNA 2WFPA 4JHZA 4CP9B 1K5MA 1VAKA 2WZR1 5FZ4A 4OFGA 2DUQA 4DEVA 5C3QA 5JXJA 1W9WA 2D6LX 2F4PA 4AZZA 4R4XA 4JDOA 1I9RA 5I93A 1W3XA 1LOGA 1KDMA 3S6PA 4TN7A 4UW4A 5JOYA 5JZGA 4FVVA 2IXCA 3I59B 3RJRA 4E4DX 3UESA 3IDEA 5D1IA 5LEKA 1BK1A 3QH6A 2Y33A 4IGPA 4YW3A 1LHVA 3H50A 3RYKA 4CEWC 1RUNA 1VBA1 2HH9A 1F31A 3URFA 2RM22 4XUOA 4AI9A 3FHQA 3IDAA 4CE8A 1DBNA 4AHYA 3POJA 4XUQA 1YQ2A 2ZHLA 5FP9A 5GJ6A 1O6UA 1XQNA 2QVSB 1UD1A 3WOGA 4QX3A 3ZDVA 3RRDA 1N3OA 3SQOA 2Y6LA 4O65A 1BBT3 4UOJA 4J1WA 5FXVA 2YC2A 5FLJA 4BXFA 5AFBA 5KHJA 3JCIA 1RUG3 4E4SA 4CCCA 2RMU3 1XYPA 2PTMA 2ZOEB 4KGGA 2RJKA 3CIHA 3SEEA 1UWWA 3O1OA 1X82A 2VE1A 2PHUA 1Q8QA 3SH5A 2JG8A 1AYN2 4RHV1 3I3MA 5H9RA 4DUWA 5FLIA 1B09A 1KJLA 3TRSB 3EJKA 1NQJA 1QQP2 1SLIA 3OGRA 2B5HA 1O5UA 5LB6A 1G9DA 5H9SA 3B94A 1OPMA 4BB3A 1CN1A 2ZMKA 1PIV3 2A6ZA 2WFF2 3VDDA 4Z2AA 3H3ZA 4C90A 3ZXJA 5IVFA 4IE5A 3DF0A 2XUMA 4Y22B 1LB2A 2RVAA 4IE6A 2DFCA 2WNEA 4FOQA 3ZYBA 1IS3A 1OSGA 3KCYA 1NOVA 4MXWB 1W9SA 1IKQA 4XFHA 1G9FA 4SBVA 1CAXA 4ONUA 1LOAA 2VZVA 2NP0A 3DUIA 2G9FA 2VUDA 4RR3C 3MHZA 2Q8DA 4AQSA 1NLRA 2FDKA 4LITA 1B35C 2BTVC 5CFDB 1BEV2 4MV2A 1GR3A 1PK6C 3IIIA 4HPKB 4YVWC 3VGIA 2VXJA 5JSOA 3WQ1A 1VAMA 1BBT1 1RYYA 1LRHA 5A7QA 5A7WA 1R092 1RUG1 3DYOA 5AC93 1NXMA 3NRUA 4B3NA 4AEMA 4JGYC 3RI8A 1AYM1 5FZ8A 3U1XA 1ZBA1 3B5LB 5D8AC 2IVIB 3TYJA 1CAUA 1XB9A 2JDUA 3LF7A 5FPVA 3THDA 5FMCA 4A7KA 5C6CA 5K0UB 3MLLA 4GWIA 1RUC2 1IG0A 4AE2A 3UKTA 4RGGA 3MIHA 5JMCA 2JB4A 1KS4A 4YGDA 1PIV1 4DNYA 4XABA 3BI3A 4AHWA 3KHCA 3WF2A 4XJAA 3TEWA 3T30A 3H0OA 4LTAA 3ZYFA 1ULFA 4NPRA 1QMJA 4CRQA 1Q3EA 4NUBA 1CR7A 3OGJA 3POWA 5I8SA 4XZUG 4QDQA 3POBA 3ZMNA 4DOUA 1YQ8A 1XYOA 2WS93 5FZ7A 4GJYA 3LDRA 3I49A 4YYOA 4FPGA 2QQOA 1KITA 4BQ2A 3KVAA 3HIFA 1ODMA 3Q8EA 3V64A 4Q8KA 5FZAA 2UYAA 4AEDB 1PX4A 2HWD2 2V09A 3U78A 3CBNA 4QB6A 4GZ9A 4OHWA 4EN9B 4HN0A 4IGOA 1P8JA 2FQPA 2XR4A 3U0ZA 3ZKUA 4BIOA 1WZXA 4WM7A 4LQRA 4J25A 2D6KA 5C7GA 4JTOA 2TNFA 2I2SA 4YW4A 5AC91 1CPMA 1LOFA 2ERFA 3WDYA 2WIIB 5EP9A 4UF0A 5BXXA 4QGMA 2XG3A 5BNOA 2YDEA 4PHZA 5JIAA 5C4WC 4OUEA 4I3PA 5IVVA 4Y5TA 3B3QE 1GP4A 2OVUA 4Q0SA 1VBA2 1SDDB 1WW5A 3WV6A 1UIKA 3MBWA 2VVDA 2NM1A 1D4VB 3M3CA 5SV5A 2R7EB 5CYYA 5J37A 3QH7A 3CL1A 3RFRA 1H8TC 4CEWB 1VBD3 1N3QA 1JUHA 4RYDA 2GMEA 4GQ7A 3PTYA 4PLOA 3ASIA 1R083 2WS91 3GZAA 4P9WA 1IPJA 4QX0A 3SKJE 2DVAA 3N9OA 2HWF3 2A3WA 2D93A 1D2SA 5FO8B 5HPOA 3DPRC 2Q1ZB 4PBPA 4FXKB 1PMIA 1H8VA 1UOBA 4Q4X1 3LEMA 2EICA 1C5HA 2CTVA 2VBPA 4GWMA 2FMYA 4C8DA 3RZKA 1W8ZA 1L7QA 5LRRA 5LASA 5FQ0A 2JDHA 1M06G 4LT5A 2VOVA 1OH4A 1F9KA 3RS6A 5ABJC 5IVJA 4FAHA 1APNA 3I3BA 5A33B 4CVUA 1FOD3 4XMAA 5HV0A 5DZGA 5FZOA 4KWJA 2ZHKA 4IL7A 3POFA 4XF1A 2H0VA 1U12A 2B42B 1PMHX 2WYFA 4Y3OA 5JWPA 2XLFA 4D7SA 1DLCA 4NHYA 3TN93 1J3PA 2AACA 1RMU3 4FP3A 4AK3A 2Y8KA 4PQ9A 1A8DA 2NPIA 1O91A 5HBAA 3AB0A 4FPHA 1XJAA 5EIYB 1T2XA 3K4ZA 4KMQA 3WF1A 3VKOA 2FDJA 2B9VA 1RUOA 2QKDA 2CAUA 2W87A 4LA2A 2DFBA 2WINB 1VBD1 3EMRA 1JZ4A 2D3SA 1R1A3 4IUGA 5FBZA 1DG6A 1R081 4NIGA 5FPZA 4DEQA 4NVPA 1WMDA 1JU3A 1W6OA 2HWF1 1KEXA 1BBT2 4LOTA 4PLNA 1CGPA 1RUH3 1YFUA 3A0KA 4YVSA 1YI9A 3TB0A 1ZBE3 2IXJA 2YU1A 1SG3A 2RMU2 4CEYB 3RI9A 4BH9A 3I2FA 3N7KA 4HT1T 1PK6B 4YVWB 1JYVA 1HV0A 3QACA 5EJZB 3FL7A 5LBEA 5LA0A 2OX0A 2PN5A 2F6BA 5C8CB 3WF4A 4JX0A 4OI1A 1UYPA 4XF9A 2VNVA 3VBHC 5A32A 4AVVA 5T5JA 1V6LA 5D8AB 1F5FA 5CB7A 3AYAA 5FR3A 2R0FA 2EAKA 4QXHA 4XE9A 1VALA 1GOGA 2XMLA 5D2AA 2K0GA 3WUCA 1UY3A 2EIGA 4N43A 3TWIA 4CPBA 5F1RA 4ZONA 2RS53 4AFBA 3JBG1 1VPHA 3AFGA 2Q4SA 1JXNA 2YC0A 4XFAA 1EAH1 1X7NA 2X05A 4W4ZA 1U5ZA 1OHFA 1GBGA 1HRI1 3IWZA 2PQSA 4JAAA 3SHRA 4EWAA 5F9TA 1SLTA 5ACA3 1PGL1 3GGLA 5I0DA 1HRV3 2FZ1A 1QWRA 3FJSA 4HKWA 2XVGA 2BJSA 4OVEA 3BIEA 4N7UA 4AOCA 1QJFA 3SXWA 2JG9A 1R1A1 4M3CE 4XIKA 2VD7A 3THTA 2QCSB 3RWKX 1IOAA 3THPA 1MQTB 2E7TA 2NLRA 2B9UA 4WVVA 1FMD1 3K2OA 4EE2A 1XBFA 3R0RA 3T1LA 1NUKA 1ZBE1 2RS13 5FYTA 5AC92 1PGW2 1ST8A 2DTYA 2VNOA 4TYSA 1TZOA 4XCAA 4XTPA 2GNTA 3T09A 1PZ7A 1ND3C 2R1BA 4W50A 4NRQA 1W6NB 3W5NA 2QBXA 2SBAA 2WLPA 1AVBA 2DWRA 4HOOA 4RD7A 5FUIA 5CKMA 2QUOA 4IV1B 3T4VA 1ZZ9A 2EIDA 3MPBA 2E7QA 4LBQD 4CU6A 3SEPA 3OEBA 3LQCA 4Q1PA 2P34A 5DDJ3 4QU1A 5JR7B 1OMIA 2O0OA 2QQUA 2WSVA 1N3PA 5A6XA 4MADA 5FY8A 3K75B 5CG9A 1H2NA 2XJSA 2VMCA 4DFSA 4LHNA 3SC7X 3I4IA 4TXWA 3VKFC 5CVRA 5BYNA 1BK0A 3JXSA 2VTXJ 5FWEA 4GD4A 3WSOA 1H8TB 1LU2A 1RXFA 3TEXA 1D4M3 1S2BA 4LORA 1HRV1 2BQPA 3UK9A 4C1WA 5LRSA 5FY5A 1I1EA 5C33A 4KH9A 4DQAA 2J7MA 4GH4C 4Z1VA 1LKNA 4DXRA 4K20A 2OPKA 2PHXA 1SLAA 3DPRB 3B7MA 4HETA 5FMOL 4YW2A 5JXGA 3VBUA 3IT8A 3WHTA 2RS11 1BJQA 2RE9A 3I97A 3OYWA 3CHXA 5T52A 3MW2A 4QKNA 1MS9A 1LHNA 1AXKA 4WM8C 3ILNA 5ABJB 3KWVA 2JKXA 2BZDA 3C3VA 4GB33 4L2NA 4NHXA 2W9XA 2Q5TA 1SCSA 3BN6A 1VRH3 1PZ9A 1LGBA 3MIBA 1PGSA 4YGBA 2XGXA 4ITCA 2FD8A 2K9ZA 4UFHA 1ZVFA 2DCZA 2ZX1A 5DDJ1 2OZ6A 4RQPC 3BOPA 4NIHA 2AUYA 1VBD2 5H9PA 4P9GA 1DGWA 2X5IA 1AJKA 3RMXA 1QKQA 2A6XA 1YFXA 4QWNA 1MEC1 2QDRA 2HWF2 2DVGA 3NSTA 4QM9A 4MGQA 3ILFA 1O4TA 1QDOA 4IERA 4CP2A 5BNQA 1REEA 4M3CB 4D69A 2RR13 3QCWA 4OMDA 3WLUA 2J22A 2KD7A 3PIJA 2OXBA 2ADDA 1LU1A 4Q4V3 2VR4A 1FOD2 1PVXA 4IGQA 2BPA2 1ZA7A 2WSUA 5F3GA 4S2GA 2ZABA 5IUQA 4M01A 2QFEA 5FP7A 1QDCA 3VBHB 5CG8A 3TN92 3KT4A 4GB31 4AGGA 4AYUA 4HVQA 3HD8B 1RMU2 4Z92B 5FV3A 1QOTA 1PX3A 1J58A 2HYKA 1H9WA 3OOXA 4B8EA 1HQWA 4IW3A 1QXRA 2QQKA 2PHFA 3MLJA 5FPAA 4UW5A 2B4KA 3KZ4C 2FHRA 1AR63 1HKDA 3MW3A 3OBTA 1UF2C 2XONA 4IEZA 3LIHA 5EWSA 4LE3A 1S55A 5C5TA 3MYXA 3P3PA 1ZZCA 4D6RA 2E6VA 4OUMA 1RUH2 1XSQA 1OA3A 2BOIA 3VBRB 4A42A 4FPCA 5FZLA 3ZFEC 4RL7A 3K48A 2SLIA 5D21A 1V70A 3HNYM 2JICA 3PU8A 2RR11 5FAXA 1ZM1A 4HSJA 3MFAA 4PI2A 2AREA 3TEYA 4Q4V1 4FP2A 2QQMA 2WZEA 2Z5WA 3MV01 4CCNA 3H8XA 2V5DA 4AVTA 1ND3B 2YU2A 3HQXA 3ZN5A 1U5XA 2G1MA 1J83A 4G4FA 1W8HA 3ZFGC 3AL6A 3QLQA 1NZIA 2RS52 3SKVA 4XJ8A 4K40A 3SISA 2R061 2E31A 4LPLA 3FHIB 1OQEA 1ZZ8A 3AXDA 3DEMA 3BALA 2ZPXA 4MUVA 3WF3A 4ASKA 3UKNA 3WW3A 4META 3NV1A 2EVXA 2GALA 1LENA 1HXS3 2VZTA 1PMJX 3ZM8A 3WT3A 4A3XA 4BQ3A 3UL2A 2MEV3 1GNZA 4MSVA 5ACA2 3WCSA 5DUVA 3WNXA 1NCRA 3DCQA 3LD8A 3SLIA 5CADA 3CF6E 4OMCA 2E53A 4IESA 1W2TA 1F8VA 4DUVA 3NAPB 5L7OC 1V6OA 1VLNA 4QPYA 2NYYA 3FLPA 5T5LA 3W59A 4AHZA 3HBZA 3MUY1 3JD73 3ES1A 4QMAA 1EUUA 2PA7A 2BGOA 4A2UA 5IK5A 1H9PA 1LGNA 2WNOA 2GZWA 3KQRA 3VZMA 1XRUA 4AFCA 1JYIA 4FFHA 4OYUA 2UY9A 1PVC3 2PELA 1L3JA 2IUWA 2VXRA 2RM23 2TUNA 2WNVC 1Q5OA 4RGKA 4WM8B 1O4YA 3CJIC 3PUQA 3OUIA 5DDJ2 3VL8A 3O1PA 4FOVA 1IQAA 1XNKA 1YEWA 5FZDA 1GNHA 3B93A 4WVMB 3NKGA 3B9CA 3LZZA 4CCOA 3VHPA 1HXS1 2EALA 5DZFA 3IKWA 2VOTA 4RQPB 2AENA 3ZN4A 2CY6A 2MEV1 2ZACA 2ZX2A 1CZVA 1AXZA 1D4M2 3ABZA 4GKXA 2BP6A 4JGZC 4DS0A 3UYJA 1UAIA 4LLFA 2FZ2A 1UKRA 3GXUA 3HWJA 2JE7A 1CESA 4Y26A 2RS31 1H6YA 4Y5SA 1AYN3 4MZUA 2Q1MA 2JX9A 4RR3A 2R071 2YG0A 3LEGA 4QT6A 3EQEA 4CU8A 1ASJ3 3MW4A 1B35A 4UBHA 3VHNA 1QJU3 3JD71 3SMHA 2WUHA 3NQHA 3HN1A 5KR7A 4LHSA 1QOOA 2FCTA 5M0TA 2W39A 2ZEXA 5E89A 4DRVA 3KHBA 2WFF3 1JHJA 2ARBA 1RUI3 3H1MA 5JOWA 2OYZA 3I2DA 5DXDA 4YM3A 5IFTA 1PVC1 4JGYA 5A1LA 5F5QA 2XH6A 2YXSA 5D8AA 1OD5A 3LWCA 1XNCA 1VRH2 5FP3A 2RM21 3ACGA 4E8CA 3I7DA 1SFYA 1US3A 2DVBA 2ORXA 4XQDA 1S0IA 3GJAA 1WGPA 4ZS2A 4UT5A 4BISA 1AUYA 5FZIA 3OJBA 3UNPA 1WKYA 2CYFA 4BM8A 2ZGKA 3AKQA 1JODA 2GU9A 1NG0A 4AI3A 4W6YA 1V9U3 5FYSA 2J1RA 2EAAA 1WA4A 1OC1A 1RB8G 1Y9GA 1TME2 4BE3A 4BK5A 1GU3A 1O3QA 1HJGA 2OUHA 3H3LA 4WVWA 2QQPA 5G05L 1AR73 2YROA 2ID4A 4XEZA 2CU5A 1AYN1 2PLV3 3RZLA 1YC61 1AL0G 4G3YC 3BKZA 1PM7A 1C8M2 2KA3A 2XUEA 4CU9A 2J1EA 1QQP1 3N9NA 4Q4V2 1RUC3 1QJU1 2WO2A 3ZFEB 1S0FA 4QPGA 2C9KA 4HK9A 1LECA 3FBYA 4KWUA 2VO5A 4XXPA 3VUOA 4NAMA 4ARYA 2WFF1 5K8SA 2R6QA 1RUI1 2A73B 2YFUA 4YZ4A 3WW1A 4A7ZA 4AL9A 1BZWA 1LOEA 2JEMA 3O0XA 3ECQA 4YW1A 2YGMA 1CONA 1UIJA 1UPIA 4XMIA 1CAWB 4HN1A 1O59A 1YQCA 2C6SA 5C4WA 3ZO0B 1LTEA 3BGAA 3LE0A 2WO7A 1REDA 1XNDA 3VZKA 1W3VA 5KXCA 4U36A 4OQ8A 4A7YA 1UYZA 1AR62 3ZOIA 4BOWA 1W0OA 3NO8A 1FATA 1N1SA 4OI4A 4UBGA 4XFFA 4YW7A 1BEV1 2P3YA 3FUOA 3H7JA 4KGQA 4YZ3A 1UZWA 5L9VA 2QQIA 2JECA 3GDBA 4A3ZA 2PHDA 2O8OA 2HWB2 2EIBA 4CCKA 3B00A 1GZ9A 1R091 2ZS6B 5FKBA 5T5OA 1FV3A 1EPZA 5E6HA 5C3PA 4ZXEA 4HK8A 5L36A 1PZ8A 1AR71 4LEJA 3WG2A 4Z2WA 2JDZA 5E1RA 2JE8A 1XU2A 1AF9A 4N53A 3ZSLA 4TZDA 2Q8EA 3AMMA 5L9BA 2BW8A 1V6NA 2BV4A 2JENA 1RUC1 2X29A 1RUE3 3VBSA 4DUXA 3ZXKA 4B29A 1FAYA 4JCKA 3ACFA 3MF9A 4QU2A 3O1VA 4Z82A 3U4SA 4O61A 2O1QA 1NA1C 3CZUA 4CPBD 2QQLA 1OOPA 5APAA 1DQ1A 1ND2C 5LATA 1HN0A 2NMOA 4IEXA 2WNVB 1AJOA 5LY1A 3CJIB 1ZRFA 1KXGA 4NIDA 4NOTA 1MZ5A 1XE7A 1RVF3 5A3MA 1OLME 2MEV2 2VUAA 3ME2A 1VB4A 2QE3A 4GMP1 4LOSA 4CDQC 2JD9A 4AVSA 1W6QB 1STMA 4PDWA 4Q26A 3WD5A 4HBNA 2UWBA 1SBEA 5AVPA 3ZIWA 2P37A 4OHXA 3JD72 5A7OA 1C57A 1JN2P 2BVVA 4I02A 1ZRDA 2VCMA 2FCVA 3M4FA 2V72A 3KV5A 3Q8FA 2J1TA 3AC0A 4HZFA 5A80A 4Y20B 4YNIA 1K5JA 3O0WA 4MO3M 4PJYA 1GYKA 1PVC2 1UNBA 2ARCA 3LPGA 1YLLA 3O7OA 2JB8A 4Y1UA 3RZMA 3E6DA 1OPOA 3Q8CA 4GKYA 3E97A 3H42B 2XLGA 4MGKE 3VZNA 1D0HA 1ZA4A 2A6VA 2D5HA 3LEKA 5FLHA 1G86A 5LWBA 1XSRA 1UU5A 2WBKA 2VCBA 4QKDA 3KM5A 3V0BB 4XFBA 4D6QA 2D43A 3AZVA 1CAVB 2NMNA 2VULA 1POV1 2D6MA 3POIA 5B4NA 3NJZA 4BMBA 2XVLA 3O14A 3DGTA 4MH0E 5A3UA 4WZCA 2GNBA 4XFGA 1YHFA 1U5YA 3DKWA 5A1AA 4IEVA 1NAEA 2E33A 2WNUB 3K51A 2Y6JA 5CIRA 1W03A 5J1XA 1NCQB 1GMMA 2Z69A 1IQDC 5BNPA 1S2EA 4BQ4A 1IKPA 1W6MA 1OVPA 2HYXA 2J42A 5FJKA 2AH2A 3OB8A 5CFCA 1ASJ2 3RYRA 1QY4A 4RS5C 3A23A 1QJU2 4BQWA 1ZRRA 4M0NA 1CIWA 1ZRIA 4JRLA 4Q2FA 5GLVA 1UQXA 1IS4A 1PM4A 1BMV1 1LHWA 3T2PA 2PHRA 1WMXA 4IE7A 3P1IA 2RHPA 3V0AB 1Y4WA 4FTBA 1RUI2 2J1SA 1H2MA 5A3NA 4YW6A 1LODA 2BBVA 2VW2A 4LHLA 1O5LA 2VNGA 2UU8A 1GP5A 3AKRA 1ND3A 3BU7A 4FPEA 4P9YA 5LBBA 3IPVA 4AVAA 3H8RA 1W0PA 2Y6KA 1C8NA 4LIUA 4XYXA 1XOYA 1QJY3 2XPJA 4IEWA 2W92A 2I07B 5C70A 1VBC3 1S0DA 1MVQA 2Y6GA 3ZXLA 5F2WA 1GZTA 4CEYC 3IMMA 2FMDA 4MOAA 3J7HA 4KU8A 3J9SA 1ULOA 1URXA 1V9U2 2YBPA 3MIEA 2IFRA 4ZZ8A 3NV4A 2UWCA 5C8CC 2WQZC 2XJVA 2JDKA 1DGRA 3B9IA 2H6CA 3T0AA 2RMU1 3S7IA 2XDVA 1OFNA 2ZX4A 1YO8A 3C7GA 1AR72 3KV9A 2OW4A 2PLV2 4MLOA 5LA9A 4NO4A 2EIEA 1VBE2 3M2MA 5F37A 5BY5A 1SFPA 3VDBA 5ANNA 4GH4A 3K77A 2MNGA 3NL1A 2X53S 5J36A 2CV6A 1EV13 3FN9A 1YWKA 3PUHA 3RYPA 2ADEA 1JH5A 3ZX7A 1OXCA 4IEUA 5FOBB 2RDSA 5J98B 3UETA 2BERA 4HG6B 1E5IA 3H7YA 1X33A 1HV1A 3OY8A 2VZRA 3VZLA 1ONAA 2PAKA 1PHMA 1NA1B 3P5BA 2VM9A 4IEPA 2C0ZA 2DBIA 3EHKA 1MQTC 3PUIA 1ND2B 2KR2A 5IAVA 1GSLA 5DAPA 2AC1A 3U4XA 5F5CA 3APBA 3NJYA 3VBOA 1I5ZA 5A1FA 1O3RA 5FY0A 3MIFA 4CDQB 4FAGA 4MGYE 4XETA 3HT2A 3ORJA 3POEA 5F6KA 1ZZBA 3WNOA 2DU1A 5DPNA 3UJQA 5DQ0A 1PGW1 1IS5A 1V6JA 4P00B 1C4RA 2GH8A 4IV1C 3BVCA 2YYOA 1HIXA 4MGIE 4AG4A 2PAMA 4ARXA 4RGAA 2HEVF 5GZDA 2XB6C 3AJZA 5A6ZA 1JZ7A 1RUE2 1FPN3 1UYYA 2D40A 1DP0A 1UL9A 2BRTA 1YI7A 1EV11 2UY8A 3ZSEA 1F35A 1FYUA 5BNNC 2Y0OA 1RUD3 2V73A 2F17A 1MS8A 1WCKA 4P02B 4MVTA 5LBFA 4QHOA 4BJ0A 2O14A 5FZ9A 4KNCA 1MZFA 4ZS3A 3MUZ1 1YCIA 4N9HA 3ZXEA 3BYWA 2A75A 3K46A 3U11A 1OI6A 1NY71 4N7IA 2CAVA 3TNQA 1R1ZA 1QXPA 1RVF2 1OQDA 4QXKA 3MICA 1E57A 5JLVA 1ZYBA 2QQWA 1K3IA 4P14A 5EHDA 1NYWA 3UT0A 5JAXA 3AL5A 1JZ2A 4GAZA 4ATEA 4JQTA 1QH6A 4R9DA 2GNMA 4K6BA 2DCKA 5DABA 4B1LA 4MG2A 2IXIA 4XDPA 3UV9A 3LA3A 1BMV2 2WAAA 2IXKA 2R042 2OIIA 3G6JB 2BGCA 3POYA 4RS5B 4QB1A 4QX5A 5CU1A 1POQA 1T6GC 1FPN1 1YJLA 3WQ7A 5A3PA 2GAUA 5FYYA 4CDUA 1OLRA 2IVJA 5E16A 4D7TA 3USUA 3AMHA 3AX4A 3OPZA 4Y1VA 2Y38A 1SZBA 4M3CF 3KD4A 1YUDA 3BODA 4QX8A 3AZZA 2LS6A 4XQWA 3B01A 3J7NA 4CXYA 2WABA 3AXEA 3OBZA 3GJBA 3ZFGA 4WVZA 4FXGB 5A3LA 1L7RA 5TSWA 1PO13 4R4ZA 1YJKA 3SCHA 5C9AA 1XU1A 1NX9A 2ZGUA 2I74A 2OA2A 2B45X 2DYCA 4JC1A 1NT0A 3POSA 1WBFA 4GXLA 1Q8OA 4LULA 4B1MA 3LFIA 4K1ZA 2DCJA 1YYNA 1D7PM 3C7OA 1FOD1 4NROA 4V2VA 4XDQA 1DU3D 5FK8A 5L7OA 2GH2A 3ZFFB 5HCAA 3HR9A 4XAEA 1K5MC 1UPSA 1MS1A 1SLCA 4IE0A 4LXLA 2XL9A 3TN91 3ZPOA 1I5PA 4JZRA 2AGSA 2HWE3 5JZGC 1RMU1 2CNAA 5KBFA 4YARA 1DGWX 5B4XA 5FMDA 3G7DA 5FXZA 1BCXA 4YGEA 1UY2A 3TAYA 4URTA 4NPMA 3ZN6B 3N9PA 4CDXB 5A6YA 2Z4FA 1YRZA 1QJY2 2VPVA 4LKDA 4Q4W3 4D0QA 4QGNA 1NLQA 1VBC2 4UAPA 2W5FA 3VBRC 5JCTA 3WVJA 3WCRA 1NE4A 3W9AA 1QH7A 1N1TA 4XUNA 4PF5A 3GBGA 1WCQA 3E6BA 3AMPA 4TSVA 4ET7A 4F8AA 1PO11 1RTVA 5IWFA 4YM0A 3VD9A 1RUH1 2D6OX 3JZVA 4F7ZA 3PVOA 2OT7A 2VMDA 4IETA 2OPWA 2XWBB 4DINB 2DVDA 3R4DB 3TOJA 4MHRA 2KXLA 3FMGA 4Q27A 1GWMA 4QQLA 5DUWA 4YM2A 4JGZA 1FNZA 5DUUA 1O7FA 2JG8C 3K4DA 3AK0A 1SPPB 3MO4A 1M4WA 3WP4A 3GYDA 4BLIA 4CP9A 3ILRA 2YBKA 2YMZA 5KHGA 1EY2A 1EV12 2JIJA 5C3SA 2VZUA 5LEJA 4UW3A 1BKZA 2RDQA 3HQRA 5HXMA 4TTGA 3I59A 1CPNA 2RS51 3AM2A 5B2GB 4AI0A 1ULPA 3FC0A 2HWE1 3VDDC 1OUSA 2Y64A 5BNNB 2BOJA 4LBQB 4I0BA 1IZ3A 1HN1A 1MS5A 3WG4A 2ZGSA 5DZEA 4YW5A 5FO9B 1NY72 2XVKA 2CWMA 3NAPC 2JJ6A 3GZTB 1VMFA 3KSCA 3ST7A 4BYYA 1UN1A 4KI5M 3H8UA 4YG3A 2WR9A 5EJ1B 3R05A 1KD7A 3GHMA 5HI0A 1LULA 2QQNA 4OQ9A 3LOBA 3PHMA 5A7NA 3DKQA 2B7YA 4FQ4A 2Q1FA 5FOJB 1N1VA 4HKLA 2WYSA 3C7EA 4XXAA 3AP9A 3D8CA 4WV8A 4W6XA 3AFKA 4YLZA 5KHHA 4ASMB 1A8MA 4M4RA 4Q0PA 1ZX5A 2VBBA 4IV3C 2C4XA 3LDBA 4CCJA 5F3EA 1Q56A 2RJLA 5A6QA 1GP6A 3VHRA 3MDPA 4KWLA 3DL3A 4F83A 3PJYA 1FPN2 2A6WA 2VZQA 3VKNA 1WLCA 1J1TA 2VG9A 5A7PA 3T1MA 5KHKA 1RUD2 1DF0A 4RSUA 4DO0A 2EXIA 3N9LA 4R9BA 5JOZA 4XVHA 4Y22A 5A3WA 3E5XA 4EWDA 4MXWA 1PO23 4JKMA 4EN6B 3FHAA 4YWAA 3QD6A 4JKKA 2CHHA 1TME3 1QJX3 1D4M1 2EXJA 2ZEWA 1O8SA 1H1AA 5EXOA 4CCMA 5CFDA 4HPKA 1WA6X 4GALA 4CXWA 1OA2A 3HVDA 3KVBA 4FPOB 5BUVA 4BXSV 3CMGA 1UMHA 1C8M3 1LEDA 2BBAA 3HN3A 4XZPA 1F2NA 4MGSA 1JHNA 1GFF2 2YUEA 1Q8VA 1ZREA 4BWOA 1VMJA 1SBFA 2ZEYA 3LAGA 4FFGA 3RZGA 2W1QA 1W2UA 5FZHA 1H1MA 2TBVA 1LOFC 3USSA 2YPJA 3M3EA 2ORZA 3NKTA 3WP6A 4MGZE 1RL3A 5K4LA 2WT0A 2YPDA 2PFWA 5IT6A 2XJTA 5K0UA 4OZXA 5I0TA 1S0CA 3ZYGA 5DG2A 1W6PB 3A7QA 5I0RA 2A3YA 2BNOA 1K5MB 1VRH1 3I2HA 1D2QA 1QHDA 1J84A 4K3UA 5GZCA 3TEZA 1GWLA 5JZGB 1VMHA 2BGPA 3S5QA 5FY4A 1W8OA 3W58A 4BHPA 5DN2A 1LGCA 2WL1A 4COWA 1PO21 3AZWA 1JS9A 2JDYA 3MV11 4KG8A 4NN0A 1VBB2 2P6HA 2ES3A 1PO12 1ND2A 1TQ5A 2A71A 2HWB3 3LPFA 1TME1 1QJX1 2WA4A 3KF5A 5FK7A 1OF3A 4AEDA 3OBAA 3PJQA 4DRRA 4YZ5A 5KXEA 2VOWA 3Q8AA 4DXTA 5FZGA 1GICA 2KM2A 3D3AA 4Q0VA 3KT1A 3HMYA 1NLSA 3H8OA 1W04A 4NAOA 1KJRA 1DYKA 3B69A 1C8M1 3D0SA 4LBJA 4Q8LA 5EJ3A 4EWEA 1LESA 4FSJA 1AL22 4XUPA 1OD3A 4AGVA 4QDRA 3OF1A 2ZZJA 1YIPA 3HQUA 3WZ1A 2JG8B 3LB9A 4P5YA 2H0BA 4N90A 3WG3A 3UGGA 1Q8PA 2HWE2 4OHYA 1LHOA 2I45A 2VC9A 4QM8A 3H9AA 3R4UA 1AZDA 2ZGNA 5IFPA 4LE4A 3N7JA 3FE5A 4L97A 4AEKA 1C1FA 4L92A 5F3IA 2WZPP 1BVVA 1C28A 2H6BA 4LA3A 4Q4W2 3VDDB 2P3JA 3I2KA 2J1VA 4CEWA 3M3OA 2XWJB 4ORFA 4S2FA 3ZLIA 1AR61 1XNBA 5T54A 1XNTA 2VW0A 2YGLA 3A0NA 1C1LA 3NNMA 4INDA 2RDNA 3K3NA 1JOJA 4QQPA 3SNMA 2LTNA 2OQ7A 3WP5A 4WBBA 5C3OA 2HBTA 2HWB1 1CAXB 3L2YA 4L8QA 2WN3A 1X8MA 3BIWE 4H14A 5C71A 5IAXA 4QQ2A 3U07A 5F7UA 4O7XA 2E32A 1S2KA 2ZCWA 2HEWF 2DCYA 2BEOA 3T2TA 3ZXAC 4P9IA 3BOWA 2K2SA 5A7SA 4IEOA 5A33A 3AP5A 5A7WB 4E4HA 4AWDA 2MHFA 4NIAA 4CUBA 3NV2A 4IV3B 1UKGA 3O1TA 5H9QA 4Y4YA 1CAUB 1IPSA 1FI2A 4NPLA 3ZYIB 4OCTA 4N43C 5HCFA 1WWYA 3V65A 4ATFA 4YZ2A 3HAGA 1HB3A 3N7MA 2BNMA 2ENRA 4NR1A 1WMFA 3IZOA 5DAVA 1V0AA 1TVGA 2GP3A 3DN7A 1LJ7A 5LBCA 4YZ1A 2X09A 3E1F1 3QOPA 1SMVA 4HKOA 2TEPA 4EZHA 1TNRA 2XXZA 2Q30A 2VZSA 3ENRA 1T6BX 3PVEA 1MZ6A 4H55A 4RN5A 3MF6A 1LCLA 3UKVA 1WCUA 2BWCA 1K45A 4CEYA 2ZMNA 5FZCA 4YVWA 1JU4A 1PK6A 3PL0A 4IEYA 3DV8A 3OEAA 3ZYRA 4DXZA 5KWRA 3T3YA 5C8CA 3HJRA 3IB3A 4NE9A 2R16A 3O1RA 3BB6A 2XBO3 2VY0A 1ENQA 4LBKA 2W3JA 1ENRA 4WM7B 1W0NA 4AXOA 4ISRA 2HLEA 2A7AA 2GMPA 4EROA 2AYHA 3M1HA 4P9LA 1EUTA 1EP0A 2NZ9A 1W99A 4QPIC 5C3RA 2FDFA 5C8WA 4UF0B 2GN7A 2WKKA 1W39A 1Z7S3 1LNSA 3DECA 4Q0QA 1UZVA 4BK4A 1UOGA 2WNUC 5J96B 5JUVA 2ZTNA 2VZ3A 1PO22 1NCQC 1SEFA 4H7LA 1JW6A 2ZBJA 1NKGA 4O9EA 3ZSKA 5F5IA 2VW1A 5KXBA 1W2OA 5CA6A 1JYXA 3VD4A 2D3RA 1QJX2 1FXZA 1SQ4A 2J1UA 4XBNA 3VB9A 4QX2A 4AQ6A 4COVA 3U10A 1VRBA 2OS2A 2VMIA 1QJZA 3N35A 4QAWA 1MQTA 3MLKA 3SCFA 4COZA 1QGLA 4XF4A 1VBE3 3RDIA 3AP6A 3CJXA 1ASJ1 1MZEA 3N4MA 3I54A 3OPWA 5FZBA 2E26A 1SLLA 2ZHNA 4FI9A 5FO7B 4CUAA 4OZOA 2VQ0A 4B4PA 1I6XA 3EXUA 5FZ0A 4S2DA 1UY4A 4H2AA 1LHUA 4IQPA 1VAVA 3GCWA 4I0WB 1EYBA 1W6NA 1KS5A 4HXCA 4W6WA 5FQ0B 3A21A 2BFUL 2VTXA 4IV1A 5FPBA 5IVCA 5FWJA 4AQ2A 5FZOB 4I01A 4ASLA 1RUF3 3ELNA 1Z7S1 3H3UA 1I3HA 2C1FA 3H1YA 3DYPA 3LA2A 4K7JA 4CUGA 4K8RB 5IATA 1HX6A 1QU0A 1YXWA 3RZHA 3PMSA 2GNDA 1J59A 1V9U1 1H8TA 2GC1A 2Z42A 5IK7A 2PAEA 1JUIA 4GWJA 5FZFA 4FTSA 3KB5A 5FJHA 2VZPA 2VMFA 2JD4A 1RJ8A 1W05A 3N3HA 2PLV1 1Q43A 2W94A 3DPRA 1W2NA 1VBE1 4XF3A 3S5AA 1U5IA 4FO9A 1W6OB 2L9LA 1S0JA 2BUKA 2OUJA 1JZ6A 4YVSB 4KL1A 5IK4A 5ISLA 4P08A 1XC6A 3LKJA 3WNNA 4CP1A 1RUJ3 5ABJA 4X8PA 3SITA 3JB4C 1HB1A 1S0EA 2W1UA 3M3IA 5J3UA 5DAQA 4A41A 3KF3A 5A32B 3RGBA 2RJ2A 5FCCA 2Q0AA 4FTEA 1UZ0A 1F5JA 5FKCA 4XW3A 3PVBB 1PNGA 4N43B 1X8EA 3VDAA 4XHBA 1OURA 1DQ6A 3X29B 4GULA 3A22A 3ALQA 1ACCA 3LSEA 2W47A 3P3NA 4AI1A 1JOBA 3WY6A 1OKOA 3KV6A 1NZCA 2XKPA 4AFDA 2ZGQA 3ZKYA 4LO4B 3VLBB 3WQ0A 4B7KA 5FZ6A 1W8FA 5L73A 1UOJA 3ZMOA 2AR6A 2GC2A 3RNSA 5CEHA 5FBJA 1S4CA 4XOGA 4M3CA 3O1UA 2JG9B 4ZKTB 1YFYA 2R043 4HLTA 5LA2A 1CZTA 1TE1B 2PHWA 4NRMA 4UFIA 3MPPG 2R1DA 2NQYA 4PIXA 1RUE1 5GM0A 2HBUA 3WINE 1KRIA 1YNAA 4K8FA 4LJHA 1QOSA 4AVBA 1AX0A 4A45A 4HVRA 3VBHA 2P4EA 2WWUA 2R32A 4RHV3 4CCEA 1XE0A 1HB4A 4K9SA 1JYNA 1X36A 4AAXA 1XXNA 4XBQA 4IE4A 4A4AA 5JMOA 1G9CA 4QKFA 3F2ZA 3CO2A 2ZHMA 4QPIB 2CGPA 4A6SA 3KLSA 4PLMA 1X50A 2P1BA 5FMBA 4PT6A 2VL4A 1RVF1 1W9TA 2V4AA 4XFCA 4KWKA 5HXVA 5K7PA 3CZJA 1WD4A 1NCRC 1EPWA 4BU2A 4Y1YA 4I0AA 2G19A 4JDNA 3KT7A 4E2SA 4NHMA 1XYNA 2D6NA 5CBLA 5F5AA 1JZ3A 2W2IA 1AR93 3KV4A 5EYYA 2D3PA 4R8HA 3VBRA 2XHNA 3FX3A 4E8DA 1UOFA 2GP5A 2GSYA 4M00A 4BCUA 4QHZA 2BWAA 3HOBA 4PIZA 3IAPA 1J1LA 5IVEA 2Y34A 1YIFA 2A5ZA 2OQ6A 2R041 2XBO2 3NNGA 5DAWA 5GLWA 1W9FA 2VCCA 1MVEA 3IN9A 4KBZA 5E88A 5EQUA 3VBUB 4UI9L 4L11A 3W20A 1RC6A 1AYM3 1SHWB 3BCWA 1ZBA3 1AR82 1OH3A 2DCTA 3MI8A 2LW8A 2Q8CA 3OYWB 5IVYA 4UFJA 4CTEA 1YQ6A 1Z7S2 1WUVA 2HKXA 2WQ8A 1DHKB 2BFUS 1VE0A 2OZJA 2ARAA 1D0GA 2WAOA 1GNYA 5A3TA 1NQDA 4ZXKA 4D6SA 3UGHA 1DQ5A 4KQ7A 1WLTA 3N9MA 4XCBA 1JTZX 3GNEA 1DCSA 1PNFA 1S0GA 4COYA 4KU7A 3NAPA 2X5IB 4E2QA 4QXCA 1H4GA 1UY0A 2PMWB 1UMIA 3ZFFC 2VAUA 1OBNA 2P3IA 5JI9A 1AX2A 2B8MA 1AR91 4R9AA 1LAJA 2E51A 2IWGB 4DPNA 4DMIA 3WNPA 3E6CC 4LO7A 4XFIA 3WW2A 5C5UA 5LW9A 4YPJA 4NMIA 4CDXC 4LBOA 5GLZA 4AAPA 1GOFA 3ZSMA 2W95A 4IV3A 2B46X 4LKEA 2WO1A 3VBFC 2PXJA 3WR0A 4WM8A 4BZ4A 2VQAA 4Q5OA 4YRDA 3BU0A 1QJY1 1RUF2 5I0UA 4CDWC 1JYTA 5CZKA 3NW4A 4ZHNA 1VBC1 3PNAA 4XIOA 3BTAA 2ZGPA 4WVMA 3RJ2X 3RQ0A 1V6KA 2E9QA 1SLBA 1W8UA 1QJEA 3ITQA 3I3EA 4CSWA 2A6YA 3D0JA 1FT9A 4RQPA 2JDNA 4FPKA 5FY9A 2GMMA 1Y3TA 2QQVA 4O9GA 3SH3A 1W06A 4DZGA 1ODNA 1DIWA 3ETQA 2ZZQA 3FLTA 3ZYPA 4OHZA 4Y33A 4XAAA 3HPNA 4YM1A 3CKHA 3D82A 4FFFA 4R9CA 2R30A 1GZWB 2AZ5A 2DF7A 2WO3A 2JXAA 1Z78A 3ON7A 4FPLA 2D44A 3L9JT 4Q4X3 5DAXA 2G9GA 3PTRB 2VMGA 2VU9A 3WDVA 1Y9MA 3VD3A 3KS7A 4JVAA 4Q1RA 4LHKA 5JOXA 2VTFA 1ZNPA 1DZTA 2XQXA 4QPGC 1RUJ2 1FNYA 1HB2A 3I3DA 3KGZA 4QX7A 4RA0A 3JU9A 2JE9A 2J1AA 3OSDA 2WZR2 1UZZA 1JZ8A 4YFWA 4NWVA 2DU0A 5FYUA 5AFEA 3BTZA 1K42A 2PHLA 1LOCA 2MPFA 3Q9OA 4LK6A 4LO5B 4X6QB 3KGLA 3ZIXA 2ZGLA 4OI0A 1TMF3 1BHGA 3AMQA 1AX1A 4FCAA 2E7AA 3GBFA 2VZ1A 3N7LA 2RG4A 1SFNA 1H0BA 1HQNA 2CDPA 2VMHA 5T3NA 2Y60A 3PUAA 2BYVE 4N8MA 3OG2A 4LIVA 4KBBA 1NCRB 1S0BA 2BDRA 4GJZA 2VECA 5F39A 4GWNA 4I09A 5FTTC 2HJIA 2Y26A 4LMFA 2ZMLA 4YSFA 2X10A 4TLGA 2GDFA 3ZFEA 4XJ9A 2JDMA 2W52A 4N53C 4PF1A 3FBMA 1U0AA 1ULDA 5ANQA 3M3QA 3WDXA 3VBSC 1QIQA 3HEIA 1TG7A 4HANA 1RUD1 4RHV2 1ENSA 4LUMA 1ENXA 3R6SA 4FT8A 4CCLA 1G8WA 2N7GA 4XDOA 5ERLA 3JQXA 4PCRA 4L99A 1OOPC 3ES4A 3MIDA 3UJOA 3WNKA 4K1YA 1CAWA 2C24A 2Y6FA 4YGCA 1VBB3 2FDIA 3RSJA 4XUTA 1RGSA 3VN4A 1WCDJ 3VHOA 3JBG3 2D98A 3PMEA 2XJRA 4XJWA 1EAH3 1TMF1 4CA9A 3FLRA 1W8NA 1Y43B 2UYBA 4PDWC 1HRI3 3I8TA 4B4QA 1DQ4A 3GM8A 1AHSA 3WF0A 1V6IA 1J3RA 1AR92 4MYEA 4ZU7A 5JIUA 1AL23 4RFRB 1WLDA 2ZAHA 1OLQA 1W8TA 2QNKA 4GA9A 4AI8A 2Z79A 4LR4A 1BQPA 1QNYA 3DXUA 4XHXA 1FMD3 1IS6A 2XLAA 4RR3B 2YV8A 2AEYA 2W91A 2YB7A 3V56A 4CYDA 1IPKA 5IJRA 5BV6A 3C7HA 2ZX3A 1RUG2 2VOXA 1B35B 2WT1A 5JSPA 4ZU5A 1OKQA 1CD3G 2IXLA 4FPJA 3T2QA 3VDCA 5FYCA 5FXWA 2ZJCA 1AYM2 3EO6A 3OPTA 1ZBA2 4CXXA 1CVNA 1QF3A 3MGUA 2ZKLA 3C7FA 4M4PA 5F32A 1FX5A 2QQJA 2CSGA 2ZKNA 3O1SA 2IC1A 2WNVA 2LROA 4JGYB 2PYTA 3VBFB 3JQWA 4JKLA 1CZSA 1QEXA 3CJIA 4BQYA 5FZEA 4QB2A 3RZZA 2ILMA 3UGFA 3M70A 1VJ2A 1WCSA 5CNAA 1PIV2 1VBB1 2WJSA 2XJQA 3N9QA 4CDWB 3SCGA 3HT1A 3VKLA 5GZGA 4PIYA 5T55A 1REFA 1W6QA 1H2LA 3MFCA 4C0HA 2ZGMA 2ET1A 2QZ2A 5FPXA 2O8QA 1DYOA 2W46A 1VR3A 3P6BA 5DUXA 5JXHA 3AYEA 2Y6HA 5EYXA 2YBSA 1WD3A 2LALA 5BNPC 3FFZA 3LEIA 4FFIA 2VMEA 3BPSA 3OTFA 4AFMA 1G9AA 1AL21 5IW0A 1GWKA 4XJUA 5CFCC 1KDKA 1VP6A 2CGOA 2P6CA 3D6EA 3FWEA 4XILA 2V5YA 1O4ZA 2A70A 3CQOA 4Y20A 3KQ4B 4EN7B 5J7MA 1IGOA 2BNNA 2C5DA 1S1AA 4I2OA 3AVRA 1CIYA 2CWSA 3I3QA 5FYMA 3ZVXA 4HL0A 3T0DA 1GKBA 1K12A 4H7MA 4EN8B 4K21A 4QPGB 4NHLA 1WLWA 3ZXFA 5LK5A 4Q4Y3 1H2KA 4UXAA 4ES9A 3V0BA 1FV2A 2Z2SB 4Q4W1 3DXTA 1C5IA 1CAVA 2VNRA 2ZEZA 2FDHA 1C3HA 3INAA 3WHUA 4QPIA 2PQQA 1VB2A 4GMP0 5SV8A 2WRAA 3POGA 5KC6A 1LEMA 4Q29A 2DV9A 1MS0A 3TNPB 3WDWA 5C4WB 2D7FA 3AJYA 4BQ5A 5CAZA 2WNUA 3NVCA 4NHKA 2PHTA 3IAQA 4A6OA 2ZA9A 2ZAAA 3CEWA 3WX5A 4Y5Z0 4E2GA 4IEQA 1NCQA 4D7YA 1WW7A 1CWPA 1GV9A 3J8F3 4LO6B 2W0XA 3BUCA 2WS92 1O3TA 2ZGOA 1DFQA 2WT2A 1MACA 3NNFA 3GZUC 1MEC3 1W2AX 2ZGTA 3WNMA 2VJXA 4V2WA 4ZU4A 3PLQA 4JHTA 2A3XA 4QX1A 5LZ6A 1RHI3 3U14A 4P5HA 5FP8A 4Q4X2 2WC2A 4D3WA 4LBMA 3A4UA 4HONA 1DLLA 3VL9A 2XJPA 4FPFA 3V0AA 3RMYA 2VBDA 3L2HA 3B02A 3J7MA 1XPWA 1TEIA 1DQ0A 4LUKA 3ZYJB 1SCRA 4N53B 5FZ3A 4CCDA 3LA7A 3H1WA 2HWC3 5LY2A 5T5PA 3TBDA 2UWAA 1RXGA 3GZEA 3VBSB 2ZXQA 1E5RA 1OF4A 2DUPA 1UY1A 3T4HB 2IZWA 1POV0 4Q4Y1 1CJPA 4YG0A 5AVAA 3O0VA 2QTWB 4V1PA 4AQTA 2A1XA 1OOPB 5LK7B 5L9RA 1TMF2 5GKAC 1E5SA 4X6RB 1DZRA 1DGRN 1KFXL 1KQRA 2NN8A 3MEPA 4CZSA 4F3JA 3HBKA 1OLMA 1UZYA 4LKSA 4LKFA 1JYCA 4TLFA 1RJ7A 3VBOC 4EN0A 1HJFA 2CGNA 4H3WA 4C0BA 1BXHA 3EBRA 3OGGA 4WM7C 1DQ2A 2E63A 1QXJA 2B39A 3WQBA 5CKQA 1X9TA 1XNAA 2LM3A 4XF0A 4HMZA 4PDWB 3J8F1 5FFOC 1R082 1DGLA 3PURA 5A3OA 2P17A 3OBRA 4AEJA 2QJVA 2VCAA 3IIAA 5G04L 1TNFA 3SH4A 3QBQA 5BNOC 1MR5A 5FDBA 1RHI1 1A3KA 3E5QA 3GBWA 5GALA 3HNMA 2JKBA 4J6GA 2CDOA 3CLPA 1BLZA 3AVSA 2D6PA 4AI2A 4COUA 1W9YA 3N36A 1G7YA 3LFMA 2HWC1 1G6NA 4XQ4A 3NJXA 1GANA 1UXZA 1JYWA 3EB7A 3DYMA 5GLUA 1NA1A 1ULGA 2VQUA 1UU4A 2WLQA 4EJRA 5JPMB 4P9JA 1ZZ6A 1OA4A 4D8MA 5DMYA 3AKSA 5GZFA 3VV1A 5ACA1 1NE6A 2R063 3JBG2 2XJUA 3S7EA 3NMBA 1F4AA 1F15A 5CISA 2R0HA 1EAH2 4BIFA 4CDQA 4EYUA 1HRI2 4KG0A 4UFKA 4XURA 5FPLA 1SBDA 1PGL2 3VD5A 3S57A 3EYPA 3OUJA 3LDKA 1MS4A 3AZXA 1UYXA 2AEZA 3O1MA 2P3KA 5FIXA 4W65A 1R1A2 3T0BA 4NRPA 2VUJA 5EFUA 5FZMA 3RWNA 1H1IA 5BNPB 1W6MB 1GZWA 1LR5A 1FMD2 1Q8SA 3F95A 4QQOA 2K46A 2VUCA 5FY7A 5KXDA 2DURA 1R64A 4HSLA 5FREA 4I3GA 5CFCB 1H4HA 1ZBE2 4UWDA 2GC3A 2JDAA 2UURA 1ULCA 5T50A 1BVP1 1RIRA 2Y0IA 3GHNA 5IVBA 4LLOA 1RINA 4QHBA 5GLTA 2G4IA 4CDUC 2VZOA 4HFSA 4Y4RA 5JXIA 1QNWA 1NXD1 4SLIA 1W90A 2R49A 4FBFA 2WQ4A 2C9AA 2GC0A 1E5HA 3E5UA 3PIGA 2EF6A 5FXXA 5I8TA 5HCBA 3BTXA 1UXXX 2YZ4A 2W1WA 3IPVB 3LOIA 1ZZ7A 2G9ZA 4XACA 4E27A 3KMHA 1HLCA 3BTYA 3O5SA 3T2OA 2FCUA 4AW7A 1LOBA 3GALA 2RV9A 1COV3 2DUOA 3IDCB 4QD2A 4YVSC 2QZ3A 5EZWA 5C9AC 1SDWA 3MIGA 4OI2A 5FUNA 2P2KA 1J3QA 4Z8BA 4ES8A 5EV7A 1W8WA 4N9IA 2OKXA 2VH9A 3K4AA 3W21A 3J26N 1HRV2 4X8NA 1H30A 4UFLA 1UMZA 3D4KA 3U37A 4EZ4A 4XC9A 4CU7A 3NWKA 4JTNA 1L7LA 3WDTA 2RS33 1Y7BA 2VQTA 3NNJA 3M8LA 4UW6A 4JDMA 1X9PA 2WWSA 3CNAA 2R073 4RS5A 3MZHA 5J09A 1GUIA 1OFSA 2DDUA 3AKTA 4PI0A 2YY1A 2GN3A 1CX4A 3OUHA 5FP4A 4LBLA 2RS12 4DB5A 3PVNA 4GH4B 4URAA 5DG1A 2RDRA 2W68A 3AP4A 4XTMA 3AP7A 2LUWA 4ISQA 4Q4Y2 1OVSA 4NIIA 4DIQA 5JVVA 4BLJA 3IBMA 5LCWL 4M0HA 1YFWA 4JRAA 1O3SA 1DZQA 4Q0UA 5FMOS 3FZ3A 4MX3A 4QPWA 4QQHA 3VZOA 5KHIA 3HNBM 5LA1A 3OY8B 2EA7A 1A78A 2JG9C 3ZXGA 5FYHA 3IM0A 3WEZA 4XJZA 5CKNA 1BYHA 2C26A 2ARXA 1COV1 4J1XA
chains in the Genus database with same CATH topology
3J8F2 2WA3A 1RITA 1G9BA 2YHJA 3VBOB 1MEC2 4XBLA 1GQHA 3ZPYA 1RHI2 1MS3A 1V00A 5E8AA 5BPXA 3WW4A 3LSDA 3VKMA 3ZFFA 1AR83 4E9KA 4S2HA 2D97A 2ETEA 1KFUL 3ZXDA 1WBLA 3FFQA 4AFAA 1VIWB 5BNOB 3AKPA 4NWWA 1QQP3 2HWC2 4PBOA 5JI7A 3ZN6A 1WW4A 1A6CA 1WW6A 4CDXA 5GZEA 4C91A 1ZRCA 3S0MA 1Z0HA 3WP3A 1ULEA 4GB32 4BPZA 3VBFA 3WXPA 5JPNB 2EXKA 3ROUA 3O12A 4LNVA 4B7EA 4B4RA 3OCPA 4CDWA 5FRAA 2HEYF 1IHMA 2VVFA 2ATFA 2EXHA 3OD4A 2DVFA 2QDNA 1UW8A 4YFZA 2ZGRA 3VBUC 1N47A 3J4UH 1BEV3 5I91A 2XBO1 1HQLA 4Y1XA 3IDBB 4OHVA 1R093 2XHKA 5J48A 4OUSA 2BVBA 1GQGA 2XKOA 3NV3A 4EV0A 1AR81 1OQ1A 2RR12 4AF9A 2VVEA 4YG6A 3WG1A 4IXLA 4TWTA 4BA6A 4D94A 5I8YA 5BNNA 4LBQA 3AYDA 4Z07A 4AVCA 1CQ9A 1ALYA 4FQZA 3JUUA 3AMNA 4G9SB 4QGLA 2W08A 4AGRA 4CDUB 4P9XA 2X5IC 3FUQA 3USUB 3WUDA 1UU6A 2R062 5JDBA 3GF6A 3LGRA 2VOKA 4HVOA 2ZX0A 3ZSJA 1WMEA 3ZFGB 3ACLA 5CFDC 5I0SA 1JBCA 1HDKA 1UCXA 4GMP3 2IXHA 4I30A 4JQRA 5C9AB 2HWD3 3RPQA 3KCXA 4FOWA 1HW5A 3RG0A 1V6MA 2CL2A 4GIQA 3IMNA 4L9BA 1CJDA 3AZYA 2XL7A 4XPVA 4E4ZA 2FBEA 3CU7A 4FOYA 3WDUA 4CP0A 4Y24A 2WZR3 5F6LB 5K0UC 4RFT0 4U2AA 4LO8A 5L7OB 4JV4A 1XE8A 4OLLA 3ATGA 3S30A 3AYCA 1RUF1 4R52A 2VGDA 4C1XA 2ET7A 5IK8A 1VBA3 5JSRA 4MXVA 1GLHA 2D5FA 1Y9QA 2X8KA 4Y1ZA 1POV3 1COV2 3OD0A 3R4SA 5KC5A 4AEDC 2DTWA 1AXYA 1UX6A 3VZJA 3C2UA 1HXS2 4DY3A 1N1YA 4FPYA 4DY5A 1SACA 2IFWA 3D5OA 4BQ1A 1DDLA 2Q8OA 1DYPA 2HWD1 5L19A 4WZFA 4AHXA 3M7AA 4BMEA 3BPZA 2RS32 1RUJ1 3JB8A 2R072 3ZDSA 4OULA 3KCCA 4JGZB 3LCPA 1GZCA 1W6PA 4LBNA 2WFPA 1K5MA 1VAKA 2WZR1 4OFGA 2DUQA 5I93A 2D6LX 2F4PA 4R4XA 4JDOA 1I9RA 5JZGA 1LOGA 1KDMA 3S6PA 4UW4A 5JOYA 4FVVA 2IXCA 3I59B 3RJRA 4E4DX 5LEKA 3IDEA 5D1IA 1BK1A 3QH6A 4YW3A 3RYKA 1LHVA 3H50A 4CEWC 1RUNA 1VBA1 1F31A 3URFA 2RM22 1DBNA 4AHYA 2ZHLA 5GJ6A 1XQNA 2QVSB 1UD1A 3WOGA 3RRDA 1N3OA 5AFBA 1BBT3 4J1WA 5KHJA 3JCIA 1RUG3 4E4SA 2RMU3 1XYPA 2PTMA 2ZOEB 4KGGA 2RJKA 1X82A 2PHUA 1Q8QA 3SH5A 2JG8A 1AYN2 4RHV1 5H9RA 5FLIA 1B09A 1KJLA 3TRSB 3EJKA 1NQJA 1QQP2 1SLIA 2B5HA 1O5UA 1G9DA 5H9SA 3B94A 1OPMA 1CN1A 2ZMKA 1PIV3 2A6ZA 2WFF2 3VDDA 3H3ZA 4C90A 3ZXJA 1LB2A 3DF0A 2XUMA 4Y22B 2DFCA 2WNEA 4FOQA 1IS3A 1OSGA 3KCYA 1NOVA 4MXWB 1IKQA 4XFHA 1G9FA 4SBVA 1CAXA 4ONUA 1LOAA 2NP0A 3DUIA 2G9FA 4RR3C 4AQSA 1NLRA 1B35C 2BTVC 5CFDB 1BEV2 4MV2A 1GR3A 1PK6C 4YVWC 4HPKB 3VGIA 5JSOA 3WQ1A 1VAMA 1BBT1 1LRHA 1R092 1RUG1 5AC93 1NXMA 4B3NA 4AEMA 4JGYC 3RI8A 1AYM1 1ZBA1 3B5LB 5D8AC 3TYJA 1CAUA 4A7KA 5C6CA 5K0UB 3MLLA 1RUC2 4AE2A 3UKTA 4RGGA 3MIHA 5JMCA 1KS4A 4YGDA 1PIV1 4DNYA 4AHWA 4XJAA 3H0OA 4LTAA 1ULFA 4NPRA 1QMJA 4CRQA 1Q3EA 5I8SA 1CR7A 3OGJA 3POWA 3ZMNA 4DOUA 2WS93 1XYOA 4YYOA 4FPGA 1KITA 3V64A 3HIFA 4Q8KA 2UYAA 4AEDB 2HWD2 2V09A 4EN9B 4OHWA 4HN0A 3U0ZA 2FQPA 4BIOA 4WM7A 2D6KA 4JTOA 2TNFA 2I2SA 4YW4A 5AC91 1CPMA 1LOFA 2ERFA 3WDYA 2WIIB 5BXXA 4QGMA 2XG3A 5BNOA 2YDEA 5JIAA 5C4WC 4I3PA 3B3QE 2OVUA 4Q0SA 1VBA2 1WW5A 3WV6A 1UIKA 2VVDA 2NM1A 1D4VB 3M3CA 5SV5A 5J37A 3QH7A 3CL1A 1H8TC 4CEWB 1VBD3 1N3QA 1JUHA 2GMEA 4GQ7A 3PTYA 4PLOA 3ASIA 1R083 2WS91 3GZAA 4P9WA 1IPJA 2DVAA 2HWF3 2A3WA 2D93A 1D2SA 5FO8B 3DPRC 2Q1ZB 4PBPA 4FXKB 1PMIA 1H8VA 4Q4X1 1C5HA 2CTVA 4GWMA 2FMYA 5LRRA 5FQ0A 1M06G 4LT5A 2VOVA 3RS6A 1F9KA 5ABJC 4FAHA 1APNA 5A33B 1FOD3 4XMAA 5DZGA 4KWJA 2ZHKA 4IL7A 4XF1A 1U12A 2B42B 2H0VA 5JWPA 2XLFA 4D7SA 3TN93 1J3PA 1RMU3 4FP3A 4AK3A 4PQ9A 1A8DA 2NPIA 1O91A 5HBAA 3AB0A 4FPHA 3VKOA 1RUOA 2QKDA 2CAUA 4LA2A 2DFBA 2WINB 1VBD1 2D3SA 1R1A3 5FBZA 1DG6A 1R081 5FPZA 4NVPA 1WMDA 1W6OA 2HWF1 4PLNA 1BBT2 1CGPA 1RUH3 1YFUA 3A0KA 4YVSA 1YI9A 3TB0A 1ZBE3 2IXJA 4CEYB 2RMU2 3RI9A 4BH9A 4YVWB 3N7KA 4HT1T 1PK6B 1HV0A 3QACA 2PN5A 5C8CB 2F6BA 4OI1A 4XF9A 3VBHC 5A32A 4AVVA 5T5JA 1V6LA 5D8AB 1F5FA 5CB7A 3AYAA 2R0FA 2EAKA 4XE9A 1VALA 2K0GA 3WUCA 2EIGA 4N43A 3TWIA 5F1RA 2RS53 4AFBA 3JBG1 3AFGA 2Q4SA 1JXNA 2YC0A 4XFAA 1EAH1 1X7NA 1U5ZA 1OHFA 1GBGA 1HRI1 3IWZA 4JAAA 3SHRA 4EWAA 5F9TA 1SLTA 5ACA3 1PGL1 1HRV3 2FZ1A 1QWRA 3FJSA 4HKWA 2XVGA 4OVEA 4N7UA 3SXWA 2JG9A 1R1A1 4M3CE 4XIKA 3THTA 2QCSB 1IOAA 3THPA 1MQTB 2E7TA 2NLRA 2B9UA 4WVVA 1FMD1 3R0RA 3T1LA 1ZBE1 2RS13 5AC92 1PGW2 2VNOA 2DTYA 4TYSA 4XTPA 2GNTA 1PZ7A 1ND3C 2R1BA 1W6NB 2SBAA 2WLPA 1AVBA 2DWRA 4RD7A 2QUOA 4IV1B 1ZZ9A 3MPBA 2E7QA 4LBQD 4Q1PA 2P34A 5DDJ3 5JR7B 1OMIA 2O0OA 2WSVA 1N3PA 5CG9A 1H2NA 2XJSA 4DFSA 4LHNA 3I4IA 3VKFC 5CVRA 5BYNA 1H8TB 1LU2A 3UK9A 4C1WA 1D4M3 1S2BA 5ACA1 1HRV1 2BQPA 5LRSA 1I1EA 5C33A 4KH9A 4DQAA 4GH4C 4Z1VA 1LKNA 4K20A 2OPKA 2PHXA 1SLAA 3DPRB 3B7MA 4HETA 5FMOL 4YW2A 3VBUA 3IT8A 3WHTA 2RS11 1BJQA 2RE9A 3OYWA 5T52A 3MW2A 1MS9A 1AXKA 1LHNA 4WM8C 3ILNA 5ABJB 4GB33 3C3VA 4L2NA 2Q5TA 1SCSA 1VRH3 1PZ9A 1LGBA 3MIBA 1PGSA 4YGBA 2XGXA 4ITCA 2K9ZA 1ZVFA 2DCZA 2ZX1A 5DDJ1 2OZ6A 4RQPC 3BOPA 2AUYA 1VBD2 5H9PA 4P9GA 1DGWA 2X5IA 1AJKA 3RMXA 1QKQA 2A6XA 1YFXA 1MEC1 2QDRA 2HWF2 2DVGA 3NSTA 4QM9A 3ILFA 1O4TA 1QDOA 4IERA 4CP2A 5BNQA 1REEA 4M3CB 4D69A 2RR13 3QCWA 3WLUA 1LU1A 4Q4V3 1FOD2 1PVXA 2BPA2 2WSUA 4S2GA 2ZABA 5IUQA 4M01A 2QFEA 1QDCA 3VBHB 5CG8A 3TN92 3KT4A 4GB31 4AGGA 4AYUA 4HVQA 3HD8B 1RMU2 4Z92B 1QOTA 2HYKA 1J58A 1H9WA 4B8EA 1HQWA 1QXRA 2PHFA 3MLJA 4UW5A 3KZ4C 2FHRA 1AR63 1HKDA 3MW3A 3OBTA 1UF2C 4IEZA 5EWSA 4LE3A 1S55A 3MYXA 3P3PA 1ZZCA 2E6VA 4OUMA 1RUH2 1OA3A 3VBRB 4FPCA 3ZFEC 4RL7A 3K48A 2SLIA 1V70A 2JICA 2RR11 5FAXA 1ZM1A 4HSJA 3MFAA 2AREA 4Q4V1 4FP2A 2Z5WA 4AVTA 1ND3B 3HQXA 3ZN5A 1U5XA 4G4FA 3ZFGC 3QLQA 2RS52 4XJ8A 4K40A 3SISA 2R061 3FHIB 1OQEA 1ZZ8A 3AXDA 4MUVA 3BALA 2ZPXA 3UKNA 3WW3A 4META 3NV1A 2EVXA 1LENA 2GALA 1HXS3 4A3XA 3WT3A 3UL2A 2MEV3 1GNZA 4MSVA 5ACA2 3WCSA 5DUVA 3WNXA 1NCRA 3SLIA 5CADA 3CF6E 2E53A 4IESA 1F8VA 3NAPB 5L7OC 1V6OA 1VLNA 4QPYA 2NYYA 3FLPA 5T5LA 3W59A 4AHZA 3HBZA 3JD73 3ES1A 4QMAA 2PA7A 4A2UA 1H9PA 1LGNA 2GZWA 3KQRA 3VZMA 1XRUA 4AFCA 1JYIA 2UY9A 1PVC3 2PELA 1L3JA 2VXRA 2RM23 2TUNA 2WNVC 1Q5OA 4WM8B 1O4YA 3CJIC 5DDJ2 3VL8A 4FOVA 1IQAA 1XNKA 1GNHA 3B93A 4WVMB 3NKGA 3B9CA 3LZZA 3VHPA 1HXS1 2EALA 5DZFA 3IKWA 3ZN4A 4RQPB 2AENA 2CY6A 2MEV1 2ZACA 2ZX2A 1AXZA 1D4M2 4JGZC 4GKXA 4DS0A 1UAIA 4LLFA 2FZ2A 1UKRA 3HWJA 2JE7A 1CESA 4Y26A 2RS31 1AYN3 4MZUA 2Q1MA 2JX9A 4RR3A 2R071 4QT6A 3EQEA 1ASJ3 3MW4A 1B35A 4UBHA 3VHNA 1QJU3 3JD71 3SMHA 3HN1A 1QOOA 2W39A 5E89A 4DRVA 2WFF3 2ARBA 1RUI3 3H1MA 5JOWA 2OYZA 3I2DA 5DXDA 4YM3A 1PVC1 4JGYA 5F5QA 2XH6A 2YXSA 5D8AA 1OD5A 3LWCA 1XNCA 1VRH2 2RM21 3I7DA 1SFYA 2DVBA 4XQDA 1S0IA 1WGPA 1AUYA 3OJBA 2CYFA 4BM8A 2ZGKA 3AKQA 2GU9A 4AI3A 1NG0A 4W6YA 1V9U3 2EAAA 1WA4A 1RB8G 1TME2 4BE3A 1O3QA 2OUHA 4WVWA 2QQPA 1AR73 2YROA 4XEZA 2PLV3 1AYN1 1AL0G 4G3YC 1PM7A 1C8M2 2KA3A 1QQP1 3ZFEB 4Q4V2 1RUC3 1QJU1 1S0FA 4QPGA 4HK9A 1LECA 3FBYA 4XXPA 3VUOA 2WFF1 5K8SA 2R6QA 1RUI1 2A73B 4YZ4A 3WW1A 4A7ZA 1BZWA 1LOEA 2JEMA 3O0XA 3ECQA 4YW1A 2YGMA 1CONA 1UIJA 1UPIA 4XMIA 1CAWB 4HN1A 3ZO0B 5C4WA 1LTEA 1REDA 1XNDA 3VZKA 5KXCA 4U36A 4A7YA 1AR62 4BOWA 1W0OA 3NO8A 1FATA 1N1SA 4OI4A 4UBGA 4XFFA 1BEV1 4KGQA 3FUOA 3H7JA 4YZ3A 2JECA 2PHDA 2O8OA 2HWB2 3B00A 1GZ9A 1R091 2ZS6B 5T5OA 1FV3A 1EPZA 4HK8A 5L36A 1PZ8A 1AR71 4LEJA 3WG2A 4Z2WA 2JDZA 5E1RA 1XU2A 1AF9A 4N53A 3ZSLA 4TZDA 3AMMA 2BW8A 1V6NA 2JENA 1RUC1 2X29A 1RUE3 3VBSA 3ZXKA 4B29A 1FAYA 4JCKA 3MF9A 4QU2A 4Z82A 2O1QA 1NA1C 1OOPA 1DQ1A 1ND2C 2NMOA 4IEXA 2WNVB 1AJOA 3CJIB 1ZRFA 1KXGA 4NOTA 1MZ5A 1XE7A 1RVF3 5A3MA 2VUAA 2MEV2 3ME2A 4GMP1 1VB4A 2QE3A 4CDQC 1J59A 4AVSA 1W6QB 4PDWA 4Q26A 3WD5A 4HBNA 2UWBA 1SBEA 5AVPA 3ZIWA 2P37A 4OHXA 3JD72 1C57A 1JN2P 2BVVA 4I02A 1ZRDA 3M4FA 4HZFA 4Y20B 4YNIA 3O0WA 4PJYA 1GYKA 1PVC2 3O7OA 4Y1UA 1YLLA 3E6DA 1OPOA 4GKYA 3E97A 2XLGA 4MGKE 3VZNA 1D0HA 1ZA4A 2A6VA 2D5HA 5FLHA 1G86A 1UU5A 3KM5A 3V0BB 4XFBA 2D43A 3AZVA 1CAVB 2NMNA 2VULA 1POV1 2D6MA 3NJZA 4BMBA 2XVLA 3O14A 3DGTA 4MH0E 4WZCA 2GNBA 4XFGA 1YHFA 1U5YA 3DKWA 4IEVA 2WNUB 3K51A 5CIRA 1NCQB 2Z69A 5BNPA 1IKPA 1W6MA 2AH2A 5CFCA 1ASJ2 3RYRA 1QY4A 4RS5C 1QJU2 1ZRRA 4M0NA 1CIWA 4JRLA 4Q2FA 5GLVA 1BMV1 1IS4A 1LHWA 2PHRA 3V0AB 2RHPA 4FTBA 1RUI2 1H2MA 1LODA 2BBVA 2VW2A 4LHLA 1O5LA 2VNGA 2UU8A 3AKRA 3BU7A 1ND3A 4P9YA 4FPEA 5IK5A 3IPVA 4AVAA 1W0PA 1C8NA 4XYXA 1QJY3 2XPJA 4IEWA 2I07B 1VBC3 1S0DA 1MVQA 3ZXLA 4CEYC 2FMDA 4KU8A 3J9SA 1URXA 1V9U2 3MIEA 2IFRA 5C8CC 3NV4A 2UWCA 2WQZC 2XJVA 1DGRA 3B9IA 2H6CA 2RMU1 3S7IA 1OFNA 2ZX4A 1YO8A 1AR72 2OW4A 2PLV2 4MLOA 4NO4A 1VBE2 3M2MA 5BY5A 4GH4A 2MNGA 3NL1A 2X53S 5J36A 2CV6A 1EV13 1YWKA 3RYPA 1JH5A 3ZX7A 4IEUA 5FOBB 5J98B 3H7YA 1X33A 1HV1A 3OY8A 3VZLA 1ONAA 2PAKA 1PHMA 1NA1B 4IEPA 2C0ZA 3EHKA 1MQTC 1ND2B 1GSLA 3U4XA 3APBA 3VBOA 1I5ZA 1O3RA 3MIFA 4CDQB 4FAGA 4MGYE 4XETA 3HT2A 5F6KA 1ZZBA 2DU1A 3UJQA 1PGW1 1IS5A 1V6JA 1C4RA 2GH8A 4IV1C 2YYOA 1HIXA 4MGIE 4AG4A 2PAMA 4RGAA 2HEVF 5GZDA 2XB6C 3AJZA 1RUE2 1FPN3 2D40A 1UL9A 1YI7A 1EV11 2UY8A 3ZSEA 5BNNC 1FYUA 2Y0OA 1RUD3 2V73A 1MS8A 1WCKA 4MVTA 4KNCA 1MZFA 1YCIA 4N9HA 3ZXEA 2A75A 3U11A 1OI6A 1NY71 4N7IA 2CAVA 3TNQA 1R1ZA 1QXPA 1RVF2 1OQDA 4QXKA 3MICA 1E57A 5JLVA 1ZYBA 4P14A 1NYWA 5JAXA 4ATEA 1QH6A 4R9DA 2GNMA 4K6BA 2DCKA 2IXIA 3UV9A 3LA3A 1BMV2 2IXKA 2R042 2OIIA 3G6JB 2BGCA 3POYA 4RS5B 4QX5A 5CU1A 1T6GC 1FPN1 1YJLA 3WQ7A 2GAUA 4CDUA 1OLRA 5E16A 4D7TA 3USUA 3AMHA 3AX4A 3OPZA 4Y1VA 2Y38A 4M3CF 3KD4A 1YUDA 3BODA 3AZZA 4XQWA 3B01A 3AXEA 3ZFGA 4WVZA 4FXGB 5A3LA 5TSWA 1PO13 4R4ZA 1YJKA 3SCHA 5C9AA 1XU1A 2ZGUA 2I74A 2OA2A 2B45X 2DYCA 4JC1A 3POSA 1WBFA 4GXLA 1Q8OA 4LULA 4K1ZA 2DCJA 1YYNA 1FOD1 4XDQA 1DU3D 5L7OA 2GH2A 3ZFFB 5HCAA 3HR9A 1K5MC 1UPSA 1MS1A 1SLCA 2XL9A 3TN91 2AGSA 2HWE3 5JZGC 1RMU1 2CNAA 5KBFA 4YARA 1DGWX 3G7DA 1BCXA 4YGEA 3TAYA 4URTA 3ZN6B 4CDXB 1YRZA 1QJY2 2VPVA 4Q4W3 4QGNA 1VBC2 3VBRC 5JCTA 3WVJA 3WCRA 1NE4A 3W9AA 1QH7A 1N1TA 4PF5A 3GBGA 3E6BA 4TSVA 3AMPA 4F8AA 1PO11 1RTVA 4YM0A 1RUH1 2D6OX 3JZVA 4F7ZA 3PVOA 4IETA 2XWBB 4DINB 2DVDA 3R4DB 3TOJA 4QQLA 2KXLA 3FMGA 4Q27A 5DUWA 4YM2A 4JGZA 1FNZA 5DUUA 1O7FA 2JG8C 3AK0A 1M4WA 3WP4A 3GYDA 4BLIA 3ILRA 2YMZA 5KHGA 1EY2A 1EV12 5LEJA 4UW3A 1BKZA 3I59A 1CPNA 2RS51 3AM2A 5B2GB 4AI0A 3FC0A 2HWE1 3VDDC 5BNNB 4LBQB 4I0BA 1IZ3A 3WG4A 1MS5A 5FO9B 2ZGSA 5DZEA 4YW5A 1NY72 2XVKA 2CWMA 3NAPC 2JJ6A 3GZTB 3KSCA 3ST7A 4BYYA 1UN1A 3H8UA 4YG3A 3R05A 1KD7A 3GHMA 5HI0A 1LULA 3LOBA 3PHMA 2B7YA 4FQ4A 5FOJB 1N1VA 4HKLA 4XXAA 3AP9A 3D8CA 4WV8A 4W6XA 3AFKA 4YLZA 5KHHA 4ASMB 1A8MA 4Q0PA 1ZX5A 4IV3C 1Q56A 2RJLA 3VHRA 3MDPA 4KWLA 3DL3A 4F83A 3PJYA 1FPN2 2A6WA 3VKNA 1WLCA 1J1TA 2VG9A 5KHKA 3T1MA 1RUD2 1DF0A 4RSUA 2EXIA 4R9BA 5JOZA 4Y22A 3E5XA 4EWDA 4MXWA 1PO23 4EN6B 3QD6A 1TME3 1QJX3 1D4M1 2EXJA 1H1AA 5EXOA 5CFDA 4HPKA 4GALA 5BUVA 1OA2A 4FPOB 1C8M3 1LEDA 4XZPA 1F2NA 1JHNA 1GFF2 2YUEA 1Q8VA 1ZREA 4BWOA 1SBFA 3LAGA 1W2UA 1H1MA 2TBVA 1LOFC 3USSA 2YPJA 3M3EA 3NKTA 3WP6A 5IT6A 4MGZE 1RL3A 2WT0A 2PFWA 2XJTA 5K0UA 4OZXA 5I0TA 1S0CA 3ZYGA 5DG2A 1W6PB 5I0RA 2A3YA 2BNOA 1K5MB 1VRH1 1D2QA 1QHDA 4K3UA 5GZCA 5JZGB 3W58A 4BHPA 1LGCA 2WL1A 4COWA 1PO21 3AZWA 4KG8A 4NN0A 1VBB2 2ES3A 1PO12 1ND2A 1TQ5A 2A71A 2HWB3 1TME1 1QJX1 2WA4A 4AEDA 4YZ5A 5KXEA 3PJQA 4DRRA 2VOWA 1GICA 2KM2A 4Q0VA 3KT1A 3HMYA 1NLSA 1KJRA 1DYKA 3B69A 1C8M1 3D0SA 4LBJA 4Q8LA 5EJ3A 4EWEA 1LESA 4FSJA 1AL22 4AGVA 3OF1A 2ZZJA 1YIPA 3WZ1A 2JG8B 3LB9A 2H0BA 4N90A 3WG3A 1Q8PA 2HWE2 4OHYA 1LHOA 2I45A 4QM8A 3H9AA 3R4UA 1AZDA 2ZGNA 4LE4A 3N7JA 3FE5A 4L97A 4AEKA 1C1FA 4L92A 2WZPP 1BVVA 1C28A 2H6BA 4LA3A 4Q4W2 3VDDB 2P3JA 4CEWA 3M3OA 2XWJB 4ORFA 4S2FA 1AR61 1XNBA 5T54A 2VW0A 2YGLA 3A0NA 1C1LA 4INDA 4QQPA 1JOJA 3SNMA 2LTNA 3WP5A 4WBBA 2HWB1 1CAXB 3L2YA 4L8QA 1X8MA 3BIWE 4H14A 4QQ2A 3U07A 1S2KA 2ZCWA 2HEWF 2DCYA 2BEOA 3T2TA 3ZXAC 4P9IA 3BOWA 2K2SA 4IEOA 5A33A 3AP5A 4AWDA 2MHFA 3NV2A 4IV3B 1UKGA 5H9QA 4Y4YA 1CAUB 1FI2A 3ZYIB 4N43C 5HCFA 3V65A 4ATFA 4YZ2A 3HAGA 3N7MA 2BNMA 2ENRA 4NR1A 1WMFA 3DN7A 1LJ7A 4YZ1A 3QOPA 1SMVA 4HKOA 2TEPA 1TNRA 2Q30A 3ENRA 3PVEA 1MZ6A 4H55A 3MF6A 1LCLA 3UKVA 2BWCA 4CEYA 2ZMNA 4YVWA 1PK6A 4IEYA 3DV8A 4DXZA 3ZYRA 5KWRA 5C8CA 2R16A 3BB6A 2XBO3 2VY0A 1ENQA 4LBKA 1ENRA 4WM7B 4AXOA 4ISRA 2A7AA 2GMPA 4EROA 2AYHA 3M1HA 4P9LA 1EP0A 2NZ9A 4QPIC 5C8WA 2GN7A 2WKKA 1W39A 1Z7S3 4Q0QA 2WNUC 5J96B 2ZTNA 1PO22 1NCQC 1SEFA 4H7LA 1JW6A 2ZBJA 4O9EA 3ZSKA 5KXBA 2VW1A 5CA6A 2D3RA 1QJX2 1FXZA 1SQ4A 4XBNA 4AQ6A 4COVA 3U10A 2VMIA 1QJZA 3N35A 1MQTA 3MLKA 3SCFA 4COZA 1QGLA 4XF4A 1VBE3 3RDIA 3AP6A 3CJXA 1ASJ1 1MZEA 3N4MA 3I54A 1SLLA 2ZHNA 5FO7B 2VQ0A 4B4PA 1I6XA 3EXUA 4S2DA 1LHUA 4IQPA 1VAVA 4I0WB 1EYBA 1W6NA 1KS5A 4W6WA 5FQ0B 2BFUL 4IV1A 4AQ2A 4I01A 4ASLA 1RUF3 3ELNA 1Z7S1 3H3UA 1I3HA 2C1FA 3H1YA 4K7JA 3LA2A 1HX6A 1QU0A 1YXWA 3PMSA 2GNDA 1V9U1 1H8TA 2GC1A 2Z42A 5IK7A 2PAEA 1JUIA 4FTSA 3KB5A 2JD4A 1RJ8A 3N3HA 2PLV1 1Q43A 3DPRA 4XF3A 1VBE1 1U5IA 4FO9A 1W6OB 1S0JA 2BUKA 2OUJA 4YVSB 4KL1A 5IK4A 3LKJA 4CP1A 1RUJ3 5ABJA 4X8PA 3SITA 3JB4C 1S0EA 5J3UA 3M3IA 5A32B 5FCCA 2Q0AA 4FTEA 1F5JA 4XW3A 3PVBB 1PNGA 4N43B 1X8EA 4XHBA 1DQ6A 3X29B 4GULA 3ALQA 3LSEA 3P3NA 4AI1A 3WY6A 1NZCA 2XKPA 4AFDA 2ZGQA 4LO4B 3VLBB 3WQ0A 4B7KA 5L73A 3ZMOA 2AR6A 2GC2A 3RNSA 4XOGA 4M3CA 2JG9B 4ZKTB 1YFYA 2R043 4HLTA 1TE1B 2PHWA 3MPPG 2R1DA 2NQYA 4PIXA 1RUE1 5GM0A 1KRIA 1YNAA 4K8FA 1QOSA 4AVBA 1AX0A 4HVRA 3VBHA 4RHV3 2R32A 4K9SA 1X36A 1XXNA 4XBQA 1G9CA 3CO2A 2ZHMA