5L36A

Crystal structure of a human fasl mutant in complex with human dcr3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
139
structure length
138
Chain Sequence
LRKVAHLTGKSSRSMPLEWEHELGLALLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Complex of Human FasL and Its Decoy Receptor DcR3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 6B
total genus 31
structure length 138
sequence length 139
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l36A01
1S55A 2JG8C 2JG8B 3QD6A 4DOUA 2KA3A 2Z5WA 1U5XA 3V56A 4QPYA 4QQLA 5CIRA 3B94A 2WNUB 3K51A 1OQEA 4MXWB 4D7YA 3K48A 5KWRA 2RE9A 2X29A 4HT1T 2ZPXA 4J6GA 3L9JT 3MI8A 1TNRA 1JTZX 1A8MA 1DU3D 1XU1A 1JH5A 2RJLA 2WNUA 2HEVF 2R32A 3AB0A 1D4VB 4QQ2A 2QDNA 4OUMA 1GR3A 2HEYF 4OUSA 2R30A 1PK6A 4TWTA 2Q8OA 5HBAA 2OIIA 1TNFA 1U5ZA 2QE3A 5KC6A 1C28A 2WNVA 3IT8A 4MXVA 1IQAA 3TYJA 4E4DX 4KG8A 2ZJCA 4G4FA 1O91A 1C3HA 2JG9A 1I9RA 4DB5A 3B93A 4EN0A 5KC5A 1ALYA 2TUNA 4N90A 3TWIA 4TSVA 4MSVA 3URFA 1DG6A 5BNQA 1KXGA 1RJ8A 2O0OA 3WD5A 1D0GA 4OULA 2R6QA 2WNVC 4QQPA 4RSUA 1OSGA 2E7AA 4F3JA 2TNFA 1KD7A 2HEWF 2AZ5A 5TSWA 3B9IA 1PK6C 3ME2A 4NN0A 5L19A 1U5YA 4QQOA 1RJ7A 4QQHA 3QBQA 2JG9B 1XU2A 2RJKA 4G3YC 4MXWA 4GIQA 4KGQA 3ALQA 4E4SA 2WNVB 2JG9C 1OQDA 5L36A 2Q1MA 2WNUC 4KGGA 2JG8A 3FC0A 3LKJA 1WCKA 1D2QA 1PK6B
chains in the Genus database with same CATH superfamily
2F4LA 4OFGA 2ZMKA 4IETA 1AX2A 3RGBA 3WG3A 1W8TA 1G7YA 3ZYBA 2RS52 3NAPC 4BXFA 4OQ8A 2VJXA 5DUXA 2C9AA 4V2WA 2Q8DA 4ES8A 3MIHA 3SKVA 1LGBA 2WNUB 3HVDA 3VZOA 4XABA 2QZ2A 3VL8A 3WVJA 3J8F1 4MXWB 1PX4A 2ZGUA 3UJQA 3USUB 3UKTA 1WA6X 1PHMA 1YC61 3I59A 3K48A 4AFAA 2XWJB 3ACLA 2V5DA 4ZS2A 5ACA1 1F8VA 5GLUA 4HT1T 2DVBA 4ZXKA 4OI1A 4MGQA 2Y60A 1PIV1 1XOYA 1AR71 3JD71 3N9MA 1OVSA 1REFA 3ZOIA 4AQSA 1UXXX 1Q8SA 5CFCA 1Q43A 4QB1A 4D94A 4QDSA 1WLCA 4GAZA 4YGBA 4JKMA 2CGOA 4XBQA 4BCUA 2RJLA 4DUWA 4FPGA 1H9WA 5JXIA 2BYVE 1VRH2 3NV2A 1RVF2 3ORJA 1Z7S1 1E5RA 1HB3A 2Y26A 4H7MA 5F2SA 5LA0A 1NE6A 3GHMA 4MVTA 2PLV3 1DHKB 1IG0A 2YROA 1DQ2A 4NIIA 2Y38A 3VBFB 3CF6E 5J48A 4TWTA 3FUOA 2Q8OA 2VBBA 2NN8A 4KWUA 5DZGA 5JOYA 1V6OA 2QQVA 1PGL2 2WABA 2ZX0A 3LFMA 4KBBA 3TEWA 1O3SA 1LOGA 2BVBA 1RGSA 3WDUA 1RL3A 3LAGA 1PVC1 1WMEA 1QJU3 2VAUA 3AC0A 1O91A 3PMSA 4AR2A 4IEVA 4GMP1 4I0BA 5JI7A 5F6LB 2HLEA 4Q26A 3SCGA 5FJKA 5A6QA 2TUNA 5IVFA 4H3WA 3S57A 1PVC3 2ARAA 3CDZB 5GZEA 2YY1A 2RM22 2O0OA 4N43B 4TTGA 2XMLA 5A3UA 4B29A 4FBFA 4B7EA 1W9WA 2JEMA 5A6ZA 1WD4A 2EIGA 2G4IA 3N3HA 3BCWA 3M2MA 3OPZA 1O3QA 2FMYA 1JU3A 4HETA 1SG3A 1X9TA 2XLGA 1OSGA 5FR3A 3E1F1 2JD4A 1GZ9A 1OKOA 4MYEA 5HCBA 1ZRFA 2IC1A 1OFSA 2W0XA 3K4AA 4P9WA 2WT2A 1AXYA 2X05A 2IXKA 4QQHA 1AHSA 4M3CB 3MFCA 5FZGA 1AR62 4AEJA 2QQMA 3MO4A 1EAH2 1Y7BA 3J9SA 2XGXA 4L99A 5FUIA 4CXWA 3T09A 3VUOA 3HMYA 2CGNA 4H14A 4J25A 4XJ8A 4P14A 1TVGA 2XJSA 2ZKLA 4OCTA 3C7FA 4XFGA 3WP4A 3LF7A 3EJKA 2ZHNA 3OBRA 5T5LA 2E9QA 1Q5OA 1JYNA 1OHFA 4B4QA 3SMHA 4JGYC 2X5IC 2XVKA 1J3PA 1ASJ1 3C8XA 2VC9A 4AI0A 1WA4A 1PO12 4XXAA 4RS5A 2A6YA 3ZFEC 4LBOA 3J7HA 5FXZA 5KHJA 2ZA9A 2ETEA 4IEOA 3TN91 4QPYA 1BQPA 5GZDA 4FP2A 1ENXA 3MBWA 4AF9A 1LHNA 2YDEA 4UT5A 2Y6LA 1LAJA 3K51A 1DZQA 1OUXA 1POV1 3D8CA 1EUTA 1K42A 1PO11 3ZSMA 1KFXL 3P3PA 2XVGA 4XZUG 1L7RA 3A4UA 5BNOC 1WCQA 2FCUA 3THCA 2QCSB 1VBE3 2W91A 1F35A 4IE6A 4J6GA 4K20A 4RGAA 1OVPA 4HL0A 3TN92 3ZN5A 5A3MA 5FZBA 2AYHA 4DXSA 2VZ1A 1WLDA 4RL7A 5FYHA 3WR0A 3C2UA 3GYDA 5FPUA 2XXZA 5A33A 5BNOA 1DU3D 1V9U1 3GALA 4ISQA 1QQP1 3FUQA 1DGRN 1UYZA 2AEYA 3SHRA 4ZU5A 1R081 2V4VA 5I8TA 3B7MA 4N53B 2OA2A 4KG0A 3HBZA 4NROA 2D7FA 1F9KA 2J1EA 4M3CE 2RS33 2YYOA 4C1WA 2BRTA 5FOJB 5IFTA 4XQWA 5A3WA 4NRMA 3RZMA 3NJZA 3B02A 4JX0A 1M06G 4EWDA 2OX0A 2BDRA 4JCKA 4IV1C 5KHHA 1WMXA 2JICA 2Y6HA 2WQ8A 3A23A 3AP5A 4JGYA 5FZEA 2OIIA 1UOGA 3PIGA 1GQGA 5A7OA 5K4LA 4AQTA 1JZ7A 5C4WC 4FSJA 4WM7B 1ULFA 2R7EB 4XF0A 1RUJ2 4MG2A 1WLTA 3R6SA 1IQAA 4Y20A 2CAUA 4JQRA 4XILA 5ABJB 1Q8PA 5JSRA 4DXRA 2GDFA 4XZPA 1JZ8A 1Y9MA 1H2LA 5ABJA 4OHZA 3GZTB 5EHDA 3AYEA 2VMHA 1SLLA 2J1RA 3IB3A 2KD7A 2OW4A 1ZBA3 3MW3A 3NRUA 1AVBA 1RXGA 3B5LB 2VH9A 1ZRDA 2FDIA 4MZUA 5C8WA 3B01A 2HWC1 4CZSA 1COV1 2RS11 1BKZA 4C0BA 3RQ0A 1W6PA 3GZAA 1V6LA 1WW6A 1LCLA 4L11A 4XIOA 5BNPA 3PLQA 1UU6A 4BHPA 4L2NA 5BY5A 1JI6A 4CP1A 2VCMA 2JKXA 2P17A 3NL1A 4N53A 4S2FA 3ZIWA 5AC92 2J1VA 5JSPA 4UWDA 5LZ6A 1PGL1 4LBQB 3IZOA 3KM5A 5D8AC 3ON7A 4KWLA 1VJ2A 1GMMA 2XKOA 3DKWA 1GU3A 5DAWA 3N7JA 4FTBA 1DCSA 5A33B 5BNOB 5LBFA 2VL4A 5FPVA 5KXEA 4IV3A 3IM0A 3VBHB 4LO7A 1TME1 4YGDA 1J59A 4L9BA 2G9ZA 3KMHA 4KH9A 3WG2A 4MHUA 2WJSA 2EICA 3IMNA 3JCIA 4NAMA 3O1UA 3LEIA 2W52A 2IXCA 3U0ZA 4QD2A 2WA4A 1UZZA 2BGOA 3WQ0A 2VTXJ 3RJ2X 2UYBA 2I45A 4Q4Y2 4UBHA 1H0BA 2HKXA 3ZPOA 2DFBA 3FC0A 4Y33A 4Y5Z0 1S1AA 1I1EA 5SV8A 1UO9A 3EYPA 4YVSC 1UPSA 2W2IA 2ADEA 2DDUA 2VZVA 5FZFA 4CPBD 1WW4A 1GZCA 3MF9A 2NQYA 4YZ3A 1RITA 1FXZA 2DCTA 1TG7A 5FXVA 1G9FA 3TAYA 2GC1A 2B9VA 2MEV3 5JCTA 3I3EA 5E8AA 3CHXA 4LORA 2YFZA 4QGMA 3ENRA 4NIHA 4KBZA 4LKFA 2W87A 2HWF2 2HYKA 3OTFA 1LRHA 4FOYA 2BBVA 3E6BA 1RUC2 4AYUA 2XJUA 4BM8A 3T30A 3UKNA 1XYNA 2JDAA 1POQA 4V1PA 1A8MA 4OMDA 2PHTA 4AEDC 1CZTA 2EVXA 2EXJA 3K46A 3WP5A 3I59B 1WBFA 1US3A 4AWDA 2ZEXA 1HW5A 2EIDA 4YW7A 4AAPA 3PL0A 3PUAA 1UKRA 4BQWA 3FN9A 4NO4A 1WBLA 1YFYA 2VQTA 1F5FA 5BPXA 2VXJA 4RR3B 3VL9A 1SEFA 1AF9A 1IKPA 4S2GA 3RI9A 4C0HA 1RXFA 3SH4A 1B35B 1VBB3 1XBFA 3FFZA 4OUSA 3GZUC 4PCRA 2CDOA 4LKSA 2W5FA 3WCSA 2W46A 1GWMA 4P9XA 2QQLA 1H6YA 3AYDA 4RS5C 3ZM8A 1UQXA 4PLMA 1N47A 1N1TA 1HQLA 4HFSA 4QX5A 3VZNA 2AH2A 4X8NA 5HV0A 4DMIA 1OC1A 3KZ4C 1QOTA 1JUIA 4NRPA 2W39A 2WQZC 4DY3A 3PVBB 5KR7A 1HN0A 3OPWA 4CCCA 1LU1A 2ZZQA 2B7YA 4W6WA 3S5AA 5JMCA 2P1BA 4I3GA 2VE1A 1CX4A 1EP0A 1UOBA 2YFUA 3CO2A 2D3RA 3WDWA 3ZN4A 4ZHNA 4IEWA 3T1LA 2W94A 4TSVA 5FK8A 2ZGNA 3O0WA 3I2FA 4C90A 1MS9A 4Y26A 5JZGC 4O9GA 1W03A 1D4M2 2JDHA 1FI2A 5FZMA 3AZYA 3SITA 3BODA 2ZHLA 3AP9A 2O8QA 3ZX7A 5LK7B 5GJ6A 4XBLA 1H1MA 1ST8A 2DBNA 4PT6A 5CA6A 2WNEA 5FYUA 1KD7A 2YGLA 1GP6A 3OCPA 1WCSA 3POYA 4NN0A 1MS4A 1N3PA 5FMBA 5A80A 1VBE2 3LFIA 5FXXA 2WIIB 5C4WA 1W2TA 4AE2A 1SPPB 4XJ9A 2QQIA 1UAIA 4I3PA 4NHMA 4IEPA 3R4SA 4XFCA 5FZOA 3OEAA 4NUBA 1OH3A 4NWVA 2XLAA 3DPRB 1RUD3 5ANQA 2JD9A 1NZIA 1SLCA 2D3PA 5IVBA 2Q1MA 5J09A 3ILNA 2EAAA 1H2MA 1ULCA 1MEC1 5FRAA 1D7PM 3H8UA 1Q3EA 4QM8A 1CQ9A 4LKDA 4ARYA 4COYA 4HSJA 1YNAA 3W20A 1OF3A 4Y4YA 4CEWC 3BI3A 1NE4A 2FDHA 4I0AA 2CY6A 2Z5WA 1ENQA 4G9SB 1OD3A 2WWJA 3S30A 5C8CA 3BU0A 2QFEA 2XJQA 4HK8A 2ZX1A 4AGVA 2IFRA 1QGLA 2E51A 3B94A 5FZ6A 5A7PA 3RYRA 1AL23 2PXJA 4AVBA 4CP0A 2XBO1 1JYTA 1LENA 4YRDA 3OEBA 1A6CA 1VE0A 2X29A 1BLZA 4EQVA 1GUIA 1VBA1 3ZXLA 1ZA7A 3GGLA 1HQNA 1LESA 1SDDB 3H7JA 3K75B 3T2PA 5AFBA 1QU0A 3O12A 3BN6A 5CG8A 3OJBA 1ASJ3 1W2NA 4GKXA 1FPN1 2ZTNA 4FXKB 4LHNA 1UMIA 3OYWB 5APAA 5C9AC 2VXRA 3EHKA 4ZONA 3D82A 3VDBA 3M70A 4BQ4A 3BALA 1LEDA 1CIWA 2P37A 4UBGA 3LPFA 2A71A 5KHKA 3O1TA 1UZWA 2F17A 1ND2B 2VTXA 4R9AA 3BPZA 4LTAA 1P8JA 3POBA 1S0EA 4AEKA 4QGNA 1O5LA 2WRAA 3J8F3 2Y34A 4JTOA 2AUYA 1MS1A 2E53A 2X8KA 3ACHA 3D6EA 4W8JA 1G9BA 4XUPA 4QX7A 1YFXA 2WO2A 4S2HA 3VD9A 4NVPA 2YZ4A 1FPN3 3ES1A 1CAWB 3EB7A 1RMU1 2ZJCA 4P5YA 3KLSA 4G4FA 3VBOB 1JHNA 4FFFA 2RG4A 2RMU1 4FOWA 3O1RA 3CJIA 2A1XA 1NQJA 4QKFA 3WF0A 3VBHA 3I49A 1R093 2R073 4NAOA 5L9RA 3LGRA 4K6BA 1VB2A 1RYYA 5D8AB 2HWB2 3NKTA 3WD5A 5EPAA 1H1AA 4QX2A 1D2SA 5C6CA 2GC3A 4QB2A 3KB5A 2BNOA 4CCEA 2O1QA 4YZ5A 5J1XA 1TEIA 4XF4A 1O3RA 3PNAA 2WA3A 4MUVA 1QHDA 3ACFA 3N9OA 4FPYA 4WBBA 1A78A 4DEVA 5FYIA 3LSEA 4BQXA 1O7FA 1QJU1 5JR2A 4P9IA 1CESA 2WFF1 4M4RA 2A6XA 4FOQA 3NO8A 5H9PA 1MS8A 3N35A 4CRQA 1MZ5A 1V6KA 2ZEYA 4PQ9A 5JIUA 1R1A2 4CTEA 5JZGB 2CGPA 4GJZA 5FFOC 1G9DA 4KGQA 3ZYGA 5BNNC 4Q4X3 5G05L 1RUI2 3GJBA 2P2KA 4A3XA 3JD72 4LO6B 3QH6A 5C71A 4RGKA 1DF0A 1QXRA 4ORFA 2K0GA 2VMDA 3FBMA 2GH8A 4UFIA 2W47A 1W2AX 4F7ZA 1SZBA 5JWPA 1DYPA 3AKSA 1O8SA 1D2QA 1CJPA 4XFAA 4ASMB 4BK5A 3HBKA 5F6KA 1ACCA 4DOUA 4D69A 1OH4A 3ZYRA 1Y4WA 2VVDA 4R8HA 2JDYA 2DCKA 2WSVA 3AKTA 1U5XA 1VP6A 4XJWA 3EO6A 3KS7A 3U75A 4CEYB 3U37A 2ZZJA 4YW6A 2WN3A 4XPVA 2Z79A 3L2HA 1XE8A 4GWJA 3ST7A 2W95A 4D6RA 5AVPA 3C3VA 3DPRC 2MHFA 3UGHA 2ZPXA 1XYOA 4QHBA 1TNRA 2W1SA 2WFPA 3IBMA 5FYYA 4AVVA 5GZGA 4Q4Y1 2XUEA 1PNFA 2Y6JA 1ENRA 3SCHA 2VU9A 4YVSA 1SFNA 1VAKA 1XU1A 1YQ6A 4LOSA 4QX3A 4XEZA 4LBQD 3JQWA 1H1IA 1IG3A 4LBQA 2RMU3 5C33A 1KGYA 4QPGC 1CONA 4UI9L 1W6OB 5FZ8A 2DCZA 3DEMA 1LOFC 3GDBA 4UAPA 3N9LA 4IE7A 4AAXA 4RS5B 4BQ5A 1CJDA 4O9EA 3FBYA 4MGIE 4QX1A 4LHKA 4LEJA 2WBKA 4UW5A 1NX9A 2BPA2 1JZ3A 1NOVA 2ZGSA 5FZAA 2CWMA 2EXHA 3VDDA 3WF1A 4A7KA 4OVEA 1Q8VA 5T52A 1X33A 3AMPA 2QE3A 1ND2C 2PQSA 1C28A 4XDOA 4XFFA 4XTPA 2OKXA 3HR9A 2WQ4A 3GNEA 3LEKA 2WSUA 4GWMA 5I93A 2E6VA 4EN6B 1PM4A 1MZFA 1AL0G 1PGSA 1XNAA 2SBAA 2XWBB 3GM8A 3MF6A 2Q1FA 4YWAA 4CCLA 4CPBA 5BNNB 3WV6A 1UOJA 1OA3A 3GF6A 5H9RA 2TBVA 1JXNA 5FPAA 4URAA 3PTYA 5A7QA 1UKGA 5BNPC 2EXKA 3JQXA 2WT1A 5CZKA 2R0FA 4ZU7A 2YG0A 2PHRA 3TWIA 5B4NA 2VMIA 1NXD1 2V5YA 1BXHA 3WDVA 4LOTA 4GMP0 5IWFA 1QNWA 1ZRRA 3OB8A 5GLZA 3MDPA 5A3PA 4MOAA 1WLWA 3RYKA 3AFKA 5F3EA 3ACGA 1YQ8A 3VHOA 3I2IA 4NPMA 5LA9A 2WNVC 3ZXFA 3I2JA 1VMHA 3D3AA 4OHXA 5DZEA 4OI0A 4QPIC 2W3JA 5F2WA 3WP3A 2LALA 4F3JA 1KS4A 1JZ4A 1FV3A 4N43A 5GLVA 4XXPA 3MIBA 5HXMA 3MLJA 4LMFA 3AYCA 1FOD1 1L3JA 4AHYA 3UETA 1QKQA 1S0IA 1SBDA 4QDQA 2XLFA 2PFWA 3E6DA 3WNNA 2Y8KA 3DF0A 2GP3A 4META 4NE9A 5JR7B 3KGLA 4MGKE 4N7UA 4XHBA 5ERLA 2ZHKA 5C3QA 1C5IA 4YVWB 4XHXA 1HXS3 4C8DA 3OOXA 4DPNA 1BEV3 1Q8OA 2RMU2 1A8DA 5HV4A 1Q56A 1XNBA 1CAVA 1ND3A 1KDMA 1C8M3 1OKQA 5E1RA 1PO21 5FLIA 5FY0A 1QQP2 1R092 3ZXEA 2RDNA 2PHFA 3LSDA 5CIRA 2A73B 3IKWA 4YARA 4ZZ5A 2RJ2A 4OHWA 2WZR1 3PURA 4LBNA 1DQ6A 1RVF1 2BJSA 2R1DA 3WW1A 2HWE3 2XONA 1K45A 2BVVA 3O5SA 1UZVA 2ZGOA 4QGLA 1W99A 1ZZ7A 3CZJA 3FFQA 4D7TA 3A0NA 1JZ6A 3AM2A 3AJYA 3AVRA 2A70A 3KGZA 1UIJA 1ZZ9A 2WFF2 4W50A 1U5IA 2VO5A 4HOOA 1JOJA 5A32B 3BYWA 3O1OA 3HJRA 1JYVA 4UF0B 4QU1A 1COV3 2RS13 3BU7A 4LO5B 4W4ZA 1QIQA 3VKOA 1CPMA 2BWCA 5LBCA 1KJRA 1UW8A 4JGZA 5IK8A 2Y0IA 5HCHA 4P9GA 1W9YA 3KSCA 5LBBA 2JWPA 3V64A 2XJVA 2D43A 1RVF3 3USUA 2P34A 4CSWA 2PAEA 2WNUA 5FTTC 1NCQB 2R32A 3POWA 1PMHX 1O4ZA 1V6NA 3N9QA 3LE0A 2VCBA 3FL7A 1W90A 4TYSA 1UU4A 3KV9A 2DCJA 4OUMA 5T5JA 3ZMOA 4IEYA 3RJRA 1K5JA 4YW2A 4FTSA 1OXCA 1XJAA 1NZCA 4CXXA 4CDWC 3AL6A 1GSLA 3IDAA 2B9UA 1PGW2 4JRLA 4WVVA 2A75A 1LOEA 2DF7A 1VMJA 3WW4A 1US2A 2DUPA 4A6SA 2XHNA 1GBGA 5LW9A 5KBFA 3ZKUA 2GN7A 5DG2A 3H42B 1GQHA 1HIXA 3V0AA 5FZ0A 4EN7B 4HANA 1UMZA 5L9BA 1BMV1 3BVCA 5F5IA 4LLOA 3WF2A 1WMFA 1X82A 4XAAA 5LBEA 2BFUS 4PHZA 2ZHMA 5FMDA 3DN7A 3PMEA 1C3HA 2VQAA 4I01A 5DDJ1 4Q27A 1JZ2A 2OVUA 3A22A 1CAXA 1GLHA 2C26A 3K2OA 3VD5A 3UYJA 1JZ5A 5LRRA 5FMOL 4XJZA 2QQPA 2A3WA 1MEC3 2ZGTA 4E8DA 2ZCWA 4CA9A 1J83A 5FKCA 4TN7A 4AHXA 5C9AB 4BZ4A 1ZX5A 3H9AA 2P4EA 3SH5A 4Z82A 5D2AA 4Q4V2 2GNDA 3OYWA 2ARBA 4X6QB 1YJKA 3U11A 4B4RA 1OLQA 3J26N 2UURA 3KT7A 4Q8KA 5TSWA 1XB9A 2VOKA 4ISRA 1W6QA 5J96B 3F95A 4QQOA 1GV9A 2XJTA 5BUVA 5BYNA 4QX8A 3PUQA 4ASKA 2JG9B 2D5FA 2P3JA 1F4HA 4Y22A 4AHZA 1GZTA 1RMU2 2RJKA 1UF2C 2VR4A 3FX3A 3DL3A 5DABA 5K0UA 3I3BA 1RUC1 1RC6A 3LWCA 5F5CA 4YFWA 2XL7A 1T6GC 5LY2A 3LB9A 2ORXA 1V0AA 3AXDA 4IEUA 3RWNA 1O59A 3H8XA 3POIA 1OQDA 2WUHA 4CDUA 1ZREA 2YC0A 3TNQA 2WL1A 4GD4A 3VD7A 2Q0AA 2D93A 2LROA 4CDQA 1HV1A 1N1VA 3WX5A 5DG1A 4XUNA 4BA6A 4DUXA 5DMYA 4RGGA 4KQ7A 4A4AA 4Z92B 3WNMA 1Z0HA 4MADA 2W1UA 4BQ2A 3BOWA 3VGIA 1FPN2 1SFPA 5DUUA 1OF4A 2IXIA 3W9AA 5C3OA 2DUQA 2JDUA 2K2SA 2V09A 2WZR3 3DPRA 1D0HA 3H1YA 3U07A 3VZLA 1BJQA 4C91A 1J58A 1H9PA 2WZR2 1JS9A 2NLRA 2XQXA 4LLFA 1VBD1 3VHRA 4HKOA 4BQ3A 4F8AA 4LPLA 1C5HA 5DXDA 4Z8BA 4AEDA 3OUIA 3WZ1A 4V2VA 3MI8A 4QDRA 2V72A 1HB2A 4XQDA 3VBUC 3ZYJB 5CISA 3M3IA 3NJVA 1NA1B 3HN3A 4OHYA 5EV7A 1AYM3 2HWD1 4MX3A 4OMCA 4NR1A 3HIFA 5FQ0B 1PVXA 1EPZA 4LJHA 3RS6A 2LS6A 2XUMA 2R0HA 3ZVXA 1YQCA 2AC1A 2VQUA 4Y1XA 1NAEA 1LNSA 1OA2A 1REDA 4CP9B 3WDXA 2B4KA 2JE7A 2W68A 1R1A3 3HNMA 4NMIA 4UW3A 3UNPA 3OD4A 2BQPA 2YU1A 1GNZA 2R063 3B9CA 2HEYF 1VRBA 4IE5A 4JRAA 4XUTA 5JIAA 4FPLA 1WMDA 3BTYA 4I2OA 5GM0A 5T3NA 3BGAA 1S2KA 4B4PA 4COVA 1M4WA 4COUA 2WWUA 1VBB1 1TNFA 1QJY2 2QKDA 3JBG1 2XG3A 5KC6A 2XJPA 1BBT2 4XDQA 2VOTA 4E2QA 5LY1A 1Z78A 1JOBA 4QPWA 1U12A 1UY0A 2JJ6A 4X8PA 2R042 2HWC2 1O4YA 3ATGA 4IEZA 4LK6A 1UIKA 1BVVA 1NCQC 2RM21 4IL7A 4M0NA 4Y22B 3S6PA 2JG9A 3NKGA 4BISA 4NIGA 4IXLA 2ZGRA 3B93A 4HN0A 4E9KA 3RZHA 3VHNA 2R072 5IATA 1DQ4A 1CWPA 4BK4A 4IV3C 3SKJE 5SV5A 3Q8AA 4LQRA 2NYYA 4BQYA 4UXAA 4HPKB 4Y5TA 1E5IA 4K40A 3PU8A 2R071 4RR3A 3MIFA 1PZ8A 1MPXA 1W0PA 4INDA 5HCAA 2OUJA 3RFRA 2YC2A 4PIXA 4RN5A 4WM8A 4A45A 3HN1A 4JKLA 4BPZA 4XQ4A 3WHTA 3RZKA 4YW4A 2ES3A 4MGTA 3MEPA 2GH2A 1QJX2 5B4XA 3NV3A 5FJHA 3DGTA 4P00B 1Z7S2 3POJA 5FZLA 3BTXA 4QPGB 4MO3M 4Y1ZA 5FYCA 1VBB2 2VUJA 4L8QA 1B09A 5CAZA 1LOCA 3PVOA 4QU2A 5FO9B 1RUF1 4OLLA 3VBSB 4E27A 3I3MA 3SLIA 1CVNA 1VBD2 3WOGA 5K9YA 3R05A 1IS3A 1HN1A 2ET1A 1PIV3 2PN5A 4H7LA 3WY6A 3V0AB 2TEPA 2JG9C 3T4HB 1RHI2 1NLRA 3FHIB 3O7OA 2WNUC 4I0WB 2XHKA 3UGFA 4EWAA 2JG8A 4JZRA 4AI1A 5T55A 2UY8A 1MS5A 3ETQA 1RUG1 2VECA 4FPHA 2C1FA 1DZTA 2EALA 1W8NA 2YPJA 3KQ4B 3S7EA 4LITA 2KR2A 5GZFA 1IHMA 2JDPA 1HQWA 1LOBA 2JKBA 4QPIB 3GCXA 1ZA4A 4XJUA 1UY1A 1V6MA 3K3OA 3ZSEA 5DUVA 2HYXA 3MHZA 5F32A 2NPIA 2Q5TA 3N4MA 2YBSA 5A7NA 4XAEA 5GZCA 2UU8A 3L9JT 5FYSA 4Y4RA 1I3HA 3AP6A 4RA0A 4DXTA 3ZFEB 4COZA 1I5ZA 1TQ5A 4IV3B 4NOTA 4UF0A 4AI9A 2WFF3 4UOJA 3O1PA 1GZWB 5LA2A 2E33A 3ZXAC 1U0AA 4JHTA 1WW5A 1OI6A 4QM9A 4RQPA 3RYPA 4FPCA 3BIWE 4W65A 4C1XA 4CCDA 3MUY1 5L7OA 3VBUA 1N3QA 5A70A 4GH4C 3IDBB 4PF5A 3PHMA 2EAKA 3C7OA 2UYAA 1CR7A 4FPFA 1AR93 3ZDVA 4FXGB 3AZWA 1LEMA 4Q29A 1NY72 2YUEA 5J3UA 2D6NA 1RUF3 3IIIA 3T4VA 3POGA 2DWRA 3EQEA 1ZM1A 4YPJA 3B69A 3QH7A 4MXVA 3TNPB 2E63A 3TYJA 1MZ6A 2HBUA 5FO8B 4NRQA 2MEV2 1S2EA 1C1FA 2C6SA 5EXOA 2VGDA 4Z2AA 2BNNA 5FP9A 4Y20B 5IK4A 1DQ1A 4XW3A 1IOAA 1QDOA 4TXWA 4IV1B 3TOJA 2NMOA 5F5AA 4WM7A 3IN9A 4AFCA 2RHPA 4FFIA 1ALYA 3JUUA 1RINA 2FDGA 1DFQA 1WWYA 3IAQA 3LIGA 1JBCA 5K0UC 4Q4Y3 3SC7X 5IVYA 5ABJC 2H0VA 3JU9A 1N1SA 2JX9A 3A0KA 2WZPP 5K8SA 5EP9A 1IPKA 2BNMA 4JHZA 1OLRA 2VNRA 2A5ZA 5FZ1A 4YZ1A 1SBFA 4CYDA 3RSJA 4BE3A 2EF6A 2GN3A 4BDVB 5JDBA 3A7QA 1R082 2A6WA 3ZFFB 2ARCA 2BV4A 1IPJA 2FBEA 5A6XA 1XYPA 3T2QA 3RWKX 3ZMNA 4W6YA 1HRV3 1YEWA 4GZ9A 4JGZC 2VPVA 1QJY1 1MVEA 5JOZA 2FZ2A 4ZU4A 1OLMA 3GBGA 5A3LA 2ZEZA 3NAPA 4G3YC 3KVAA 4NHXA 4NIAA 1CX1A 1WGPA 2CV6A 3TEXA 2PELA 2E7QA 5IVEA 5JXGA 1ZBE1 1HXS1 1VBC2 3S5QA 4HZFA 1RIRA 2ILMA 4L97A 2WNVB 2BZDA 1VBC3 5IYYA 2D6PA 2G9FA 5B2GB 4QXKA 3M3OA 2XBO3 2ZGQA 5CKNA 2GNMA 4RHV2 3T3YA 2WNOA 3ZIXA 4LT5A 4PJYA 2MPFA 2J1TA 5FZIA 2HWF1 1MVQA 2IXJA 2VM9A 5LRSA 4LHLA 2KA3A 1QEXA 3V56A 1W6OA 5K7PA 4RQPB 1GOGA 2W92A 4IUGA 5C3SA 4BIOA 2BOIA 5FP4A 1W05A 1W0OA 3G7DA 1RUD1 5ACA3 1FYUA 2YB7A 3FLRA 3UT0A 5CFCC 2PAKA 3PJYA 4CVUA 1CAUB 1XC6A 3ZYPA 4LUKA 3OBTA 4NHLA 5A1FA 1NXMA 1XSRA 4MGSA 1OUSA 2VD7A 2ERFA 4Y1UA 4HKWA 1UXZA 2YBPA 4MHRA 1SHWB 3RVHA 3ZSLA 4Q4V1 3E97A 2HJIA 3ZKYA 4CCOA 3IIAA 3VBRB 3HEIA 4QPIA 4AGGA 4Q4X2 2BGPA 5CFDA 4XFHA 2ZAAA 4Z07A 4CEYA 3PUHA 4F83A 1RMU3 5CG9A 3GHNA 1GOFA 3ILFA 3Q8CA 2JB8A 3JB8A 3I2HA 4AFMA 4K9SA 3R0RA 3IPVA 1PZ7A 4IGQA 2VUAA 3J7NA 3GBFA 3JD73 3NSTA 2CU5A 4O65A 2Y64A 4XF3A 1UZYA 4AVTA 1EV12 4ATEA 1U5ZA 5KHIA 2DVAA 2VOXA 1HB1A 3MLKA 3BOPA 2VZOA 5I0RA 4OZXA 3CL1A 2F6BA 2ZBJA 2VMFA 1LKNA 4BIFA 5CU1A 2WO1A 5LEJA 3VBSA 2EA7A 4NWWA 3WUDA 3ZXGA 2W9XA 3H7YA 2EIEA 3P3NA 5AVAA 1SLTA 1QJU2 5FWJA 1W8UA 5F7UA 5IVJA 4EV0A 1B35C 1O6UA 2IVIB 2Z2SB 1PO23 3URFA 3VDDC 1OPMA 2BU9A 4IEXA 1CZVA 1HRV2 3VBHC 1AJOA 3P1IA 1E57A 3PJQA 4GULA 1MACA 3AXEA 4LR4A 4Q2FA 3NMBA 5FZKA 1BYHA 3VBUB 3U4SA 3ROUA 2E7AA 4XF9A 2VBDA 2XJRA 1NCRC 4AEMA 4NPRA 2D6MA 3WCRA 3WDYA 3VHPA 5HXVA 2FDFA 5CFCB 5IAXA 2OQ6A 2UY9A 4JTNA 4A44A 1RJ7A 2IVJA 2LRPA 1RUJ1 2QTWB 3QBQA 2E31A 4NJ4A 3CJIB 3MV11 2VOWA 4AK3A 1DQ5A 1EV11 1S0GA 1AR72 4LNVA 5FMCA 2VW2A 1HJFA 5FOBB 1E5HA 3I3DA 1DZRA 3S7IA 1RHI3 1SFYA 1AR81 3CMGA 1RUD2 2F4PA 4P02B 1ZNPA 4P5HA 3GXUA 3VKMA 3I2OA 1VBD3 2Z4FA 4FQZA 5EJ1B 3AKPA 4R9CA 1TZOA 2DURA 1DP0A 2VMCA 4AXOA 2VNVA 1SBEA 1WCKA 1SCSA 4XC9A 4TLGA 3ZFFC 1ND2A 2SLIA 3WQBA 3AK0A 5A7SA 4U2AA 2D5HA 3J4UH 4LBKA 5CADA 4BMEA 3VZMA 4M3CF 2WS92 3WW2A 3NQHA 5CNAA 5L9VA 5ANNA 5FY7A 3TEZA 5GLTA 1OOPC 2VBPA 4RYDA 4YVWC 4JDNA 4ATFA 3KT1A 1PO13 1QNYA 4PDWB 1ZBE3 5I0SA 2HWB3 1WUVA 1REEA 2VMGA 4MV2A 1JTZX 1AL22 1AYN1 1TMF1 3KHBA 3WQ7A 1KJLA 2OYZA 1Y9GA 4URTA 2RDSA 3VKNA 4DRVA 4YSFA 1K3IA 5I8YA 5JLVA 4P9YA 3X29B 1RB8G 2VVFA 2YMZA 2YU2A 3M3EA 4LXLA 4WM8B 1W6NB 3ZFGB 3M1HA 1SACA 1W0NA 1AR82 5FYZA 3RMXA 1DGWX 2OPKA 3KF3A 3M7AA 4K1ZA 4A42A 5J7MA 1XE0A 3V0BA 4ZKTB 1SLIA 1NLSA 5E6HA 2PYTA 5IK5A 5LCWL 5L73A 3K77A 3DKQA 3BPSA 4OI2A 5A6YA 5DN2A 4DEQA 1SCRA 1O4TA 3RZLA 1YI7A 1W9TA 2P3YA 1MQTA 2QQKA 3NNJA 4PIYA 3WNLA 1VAVA 3H0OA 5A7WB 4FO9A 4CU7A 5HBAA 4HXCA 1PNGA 3MLLA 3CJIC 3ES4A 3OY8A 1YO8A 5FREA 4E4DX 4R52A 4XDPA 2YXSA 2ZGPA 4M00A 5FP3A 5KXCA 2P3KA 5K0UB 2ADDA 3LOIA 1FMD1 2Z69A 4AQ6A 5C70A 5FBJA 5LASA 4X6RB 1SPPA 1OA4A 3OY8B 4GB32 3MIGA 2BTVC 4LBLA 2RR11 4EN0A 1CGPA 2WO3A 2X10A 5DDJ2 4ZXEA 4FT8A 1VBA3 1MQTB 4DINB 2LUWA 1W6QB 1W9FA 1OPOA 5FMOS 2HWB1 4OQ9A 3WUCA 3AP7A 3HD8B 3I2DA 4IQPA 4Q4X1 4FCAA 4KWKA 5L19A 1RUE1 2P6CA 4K7JA 3LQCA 1XNKA 3O0VA 2R6QA 2D98A 3CJXA 3V0BB 3AL5A 2QQUA 4HN1A 1AR91 4Q0SA 1KRIA 2Q1ZB 4L0PA 4LA3A 4FQ4A 3ZLIA 4PQQA 2MEV1 4LIVA 1XRUA 5T54A 3LOBA 1GNHA 3AMHA 1OT5A 3DYOA 4FPEA 2D97A 3RNSA 2FCTA 1JHJA 3MIDA 2Q4SA 3EMRA 2VTFA 4WVMB 4PDWA 3IDEA 4HKLA 3PDQA 4Q4W3 1DGRA 1YUDA 1LU2A 3ITQA 5LA1A 2V73A 1IS4A 4JVAA 5FO7B 3WNKA 1OOPA 1RUI3 4CEWB 2RS51 5A3NA 4XACA 4NPLA 1AXKA 3RDIA 5FCCA 1YWKA 5E89A 2WAAA 1W8OA 4AGRA 1FMD2 3WLUA 3KHCA 3MW4A 1F31A 3WT3A 3RG0A 1XXNA 2VNGA 2BEOA 2FCVA 1X50A 2VZQA 3IPVB 5DDJ3 3ZXKA 1TME3 2CHHA 3DECA 3THTA 5F37A 4GKYA 5JAXA 1PIV2 2GU9A 2W1QA 2VZUA 3DYPA 1H2KA 2J1UA 4CDUB 3V65A 4O61A 4Q5OA 2PA7A 2D6KA 3M8LA 1W8ZA 3H3ZA 2VZRA 1YFUA 4K21A 1J3QA 4RD7A 5FK7A 4QT6A 4A7YA 1Y9QA 3ZSJA 2RE9A 4FPKA 5EJZB 2UWAA 4B7KA 3I97A 4ZZ8A 1QJEA 4BH9A 4FVVA 1BK0A 1IPSA 4JGZB 4XYXA 4Y5SA 2AEZA 1EPWA 5DQ0A 2R49A 2WZ8A 2Q8CA 4XUQA 2D3SA 4EN9B 3MPPG 3VBFC 5A1LA 1RUG2 4LBJA 3UK9A 1C57A 4AFBA 3KCXA 3T2OA 1W2OA 4BU2A 1HLCA 2BP6A 4E2SA 3NNLA 2HEVF 3HNYM 5F1RA 2VCAA 3DXTA 3POFA 4YG6A 5FZ3A 1IZ3A 2FZ1A 1NT0A 3QCWA 5FLJA 5JUVA 4KMQA 4QQ2A 3VZKA 2IZWA 3C7HA 2LM3A 3DV8A 5FP7A 5IK7A 1T6BX 4PIZA 2WS91 4AI2A 2EXIA 4CUBA 3OBZA 5LWBA 3K4ZA 1RUF2 2XKPA 5C8CC 4YM1A 4PDWC 1BK1A 4Y3OA 1CAXB 4IESA 3TRSB 5JSOA 3R4UA 2GMMA 4CU6A 3W5NA 1HRI2 4LKEA 5EYYA 2KM2A 2WNVA 4NHKA 1UYYA 2D40A 3GBWA 1CIYA 5DUWA 3PVEA 2HWE1 1GYKA 3W58A 5FPXA 1YQ5A 1VALA 2PQQA 4R9BA 4UW4A 2DUOA 3FHAA 4CXYA 2QBXA 3D5OA 4XUOA 5AC93 1J3RA 2ZABA 1SDWA 1HKDA 1S0BA 4CUAA 2VMEA 1OMIA 1AZDA 2VZPA 3JBG3 1PVC2 4CU8A 5JPMB 5L7OC 5HI0A 1RJ8A 1ZBA2 1ULEA 3OSDA 1NCRB 2IWGB 3P5BA 4HMZA 2ZX4A 5H9SA 3SISA 5FIXA 1DGWA 1ZZ6A 5LB6A 3LDKA 5GKAC 4HVRA 1AJKA 4D7SA 2R061 3QACA 4QHOA 2FQPA 1OURA 5T50A 3RZZA 1NCRA 2D6OX 2ORZA 1XNCA 3MIEA 2MNGA 5KXDA 4YG3A 1QDCA 4UFLA 2ARXA 4IV1A 3WP6A 1UL9A 2Y0OA 1MQTC 4AL9A 3E5XA 3U78A 4CU9A 1LHOA 4QB6A 4EZ4A 1R64A 4R4XA 2UWBA 1CN1A 3WNOA 5A32A 2O14A 4B3NA 1JYCA 3KCCA 4CDWB 3ALQA 4ZPIA 3U14A 3WG1A 3MPBA 1H2NA 2ZEWA 1W8FA 2PHWA 1STMA 4RFT0 5L36A 2BUKA 1JYWA 4KGGA 2YGMA 1LODA 3H1MA 3VDDB 3WNXA 2CYFA 5D21A 2WO7A 3MZHA 2AR6A 1C8M2 5DPNA 4B8EA 3CKHA 4GB33 2Z42A 1ULPA 3PUIA 3D0SA 1VLNA 3E6CC 3T0DA 2PHLA 1BEV2 1YIFA 2GALA 2B42B 4Q8LA 3Q8FA 4FP3A 4Z2WA 5C3RA 4YM3A 3ZDSA 2VZ3A 2I2SA 2WN2A 1HRI3 5CB7A 4Q1PA 2ZOEB 5CKQA 4YVWA 3ABZA 1ZZ8A 1ZZBA 1GZWA 4KU8A 2ATFA 2RS53 3WEZA 3U4XA 3ZFEA 1A3KA 1XSQA 5JOXA 2WINB 3KD4A 5CFDC 2FD8A 1IQDC 2PAMA 2WAOA 5EYXA 1DDLA 4Q4W1 3D0JA 4ZS3A 2X5IA 4HG6B 4QKNA 4XVHA 5FY9A 1ULGA 3ZFFA 4ET7A 1FOD2 1SQ4A 3T1MA 1JH5A 3LEGA 2DVGA 3AVSA 5J36A 4O7XA 4LE4A 2JENA 1D4M1 2GZWA 1S0CA 1NUKA 2CSGA 3AB0A 3FMGA 5J98B 1UNBA 2IUWA 2FMDA 3AYAA 3OGVA 4KWJA 5FXWA 5FUNA 3OBAA 4CCJA 4QX0A 1DGLA 5CBLA 5A3OA 2NMNA 1QQP3 3DCQA 2R30A 3K3NA 3OUJA 2IFWA 2J7MA 2ZX2A 1RUOA 1G9CA 3KV5A 3OG2A 4IGPA 3RRDA 4JQTA 3L2YA 1N1YA 5FZ7A 5M0TA 3LIHA 4S2DA 1PM7A 2UWCA 4FAHA 1VBE1 2WR9A 4WM7C 1K5MA 1VB4A 1DYOA 4CUGA 1YI9A 1YIPA 1POV3 3RZGA 2DTYA 1S0DA 3WQ1A 1OOPB 2B5HA 4WV8A 3IMMA 1POV0 1W2UA 2ZMNA 3AMMA 1PGW1 1I9RA 5AC91 1GP5A 1W06A 1LJ7A 2J42A 1QY4A 4N90A 2QUOA 4LK7A 2FDKA 4K1YA 3G6JB 1F2NA 4MSVA 1GFF2 4RHV3 1DBNA 2OQ7A 2CDPA 2GMPA 3VN4A 3ZPYA 3OD0A 3H3LA 3KV6A 4YNIA 3VDCA 3FE5A 3ZFGC 1D0GA 4WZCA 1X36A 2BBAA 4CCMA 2Y6GA 3HT1A 2GC2A 2BFUL 1QXJA 1AX0A 1H8TC 2DVDA 1BBT1 3FJSA 3MV01 3MFAA 3OGRA 1J1TA 2VZTA 4QQPA 5DAVA 5L7OB 3O1VA 5FUPA 3CQOA 5BV6A 5F9TA 5D8AA 3UKVA 2R041 2PTMA 3INAA 3VBSC 1LHUA 4RFRB 3UGGA 5JPNB 4DUVA 1J84A 3E5UA 3CNAA 4N53C 3WSOA 3NNMA 5H9QA 1QH7A 3NJXA 2A6VA 4Q0UA 1X7NA 3KQRA 3VKLA 1V6IA 4K3UA 1FNZA 1JN2P 1FNYA 3VB9A 1R083 2N7GA 1EUUA 1ODNA 1X8MA 1XU2A 3IAPA 1ULDA 3VZJA 4COWA 2FHRA 5KXBA 2JB4A 2NZ9A 1A34A 1LGCA 3P6BA 5FP8A 3N7KA 5LATA 1JYXA 1CAWA 1URXA 3I4IA 1QOSA 2ZGMA 2X09A 4OHVA 3UJOA 1LB2A 1ZYBA 4JDMA 1GP4A 5HPOA 5LEKA 2K46A 2H6BA 4CDUC 1QXPA 1EAH3 2WS93 3F2ZA 5D1IA 1G8WA 2DU0A 3FHQA 3J7MA 3ZSKA 5FAXA 4IEQA 1MS0A 3Q8EA 3VBFA 1W28A 4XETA 4EJRA 4LIUA 4KNCA 4DIQA 3KV4A 2JG8C 3DUIA 4IE4A 3IWZA 2ZACA 4QHZA 2WDBA 5FV3A 1ONAA 4LO4B 1EY2A 4QQLA 3FLPA 4CP9A 1UY3A 2E7TA 2W1WA 1OLME 3E5QA 4BXSV 1AR61 1C8M1 2OPWA 4CEWA 1H6XA 1FATA 2IXLA 4CCKA 2ET7A 3GZEA 2OT7A 3VD4A 1Y43B 3AZVA 3SNMA 1BEV1 1GANA 1NYWA 1RHI1 1NA1A 5DZFA 2VULA 3NNFA 1Q8QA 2JIGA 3LDBA 4AEDB 4A7ZA 2RS31 4Q0PA 2CWSA 2PMWB 4XF1A 1AR92 1JOPA 2K9ZA 2BOJA 5I0DA 3DXUA 3I3QA 3THDA 5IUQA 3LPGA 5IFPA 2CL2A 1KS5A 4JC1A 2QQJA 2XR4A 3USSA 3ZR5A 4BB3A 5ACA2 1UZ0A 3I54A 4AVCA 5F8PA 3MUZ1 1H8TB 3PTRB 1NG0A 1PMIA 1V9U3 4QKBA 1FOD3 4SLIA 2BWAA 1AXZA 5FY8A 1UOFA 2DU1A 3PUSA 1LR5A 1AUYA 2OS2A 3VD3A 1WKYA 3LA3A 2A7AA 1YQ2A 1DLLA 1WCDJ 4PLOA 1X8EA 1AYM1 1QH6A 2HWD3 3QLQA 1F15A 1JU4A 3ZN6B 3VDAA 3OUHA 2PLV1 1RUI1 2ID4A 1NQDA 3IT8A 3ETPA 3TEYA 4DO0A 1R1A1 2DCYA 4YLZA 3MW2A 2ZAHA 2ZGLA 2QNKA 4KG8A 4A3ZA 5FPBA 5CKMA 4CDXB 1PX3A 1ZVFA 2AENA 2ZKNA 3KCYA 5FYVA 4DB5A 1ODMA 4BJ0A 4N7IA 5G04L 4I09A 3LCPA 5FZ4A 5C4WB 5KC5A 5A7WA 4FFHA 4U36A 3ZN6A 2DVFA 1GOHA 5I0TA 4YW5A 1ZRIA 2D6LX 1O3TA 2JDNA 1COV2 2RS12 4EYUA 2FDJA 1SLBA 4FFGA 4OULA 3HQRA 3M3CA 2XQRA 4LULA 1I6XA 1H8TA 3O14A 4RSUA 2GC0A 2ENRA 1HRI1 4YGCA 1KEXA 1W6NA 3T0BA 3WF4A 3ZFGA 4ASLA 2I74A 2XDVA 3FZ3A 4UFHA 3TB0A 3NVCA 3ME2A 4QWNA 1U5YA 5FQ0A 1G6NA 1Z7S3 3BIEA 3LA7A 4RR3C 3WXPA 1UN1A 2Y6KA 5C5UA 2OUHA 2G19A 3KF5A 2PHDA 4LA2A 3AKQA 2PLV2 3C7GA 2QZ3A 1N3OA 2OXBA 4Q0QA 5F3CA 1LECA 3HOBA 1ULOA 1H30A 1GNYA 2NP0A 2C4XA 4BYYA 2EIBA 1F5JA 3J8F2 4OYUA 4SBVA 4UFMA 5F3GA 1OBNA 1S0JA 3SH3A 3WHUA 3ZYFA 5JXJA 1ZZCA 2AACA 2B45X 5DAQA 1K5MC 1O8PA 2J22A 2WLQA 2WYFA 4CE8A 2CTVA 1VIWB 2QQOA 4RQPC 3HWJA 2GNBA 2OZ6A 4QAWA 1VR3A 2XBO2 3BB6A 1F4AA 3CZUA 4HK9A 1EV13 4J1XA 4PI0A 3WNPA 4Z1VA 4LBMA 3HQXA 1QOOA 2KXLA 2WLPA 5IAVA 3JXSA 3LZZA 1LTEA 3W5MA 5FWEA 5GALA 3ECQA 1HDKA 2VVEA 5FY4A 5C7GA 1FT9A 2PHUA 3OF1A 4I30A 3T0AA 3NV4A 5CFDB 3CIHA 4J1WA 4YW1A 1J1LA 5C5TA 3UV9A 5FPZA 4XMAA 3VBRA 1OQEA 1VBC1 5FZOB 4D7YA 5KWRA 1JUHA 1WZXA 2JE9A 2WZEA 4CCNA 5FYTA 1HB4A 2O8OA 3RPQA 1CAUA 3J7LA 2YPDA 4M0HA 5I8SA 1EYBA 4H2AA 4P08A 1QJX1 1UWWA 5JXHA 1JODA 2IXHA 2JDMA 1IKQA 2ZS6B 4JKKA 3O1SA 2BERA 2CAVA 1D4VB 1D4M3 2P3IA 4JV4A 2L9LA 2JE8A 2Q30A 2ZGKA 3BUCA 2I07B 2B46X 1JYIA 1KITA 1GR3A 3S0MA 4OZOA 1PK6A 1PMJX 4GA9A 2G1MA 1W3VA 4Y1VA 2VY0A 3H3UA 2ZX3A 4N9IA 3DYMA 3OGGA 4PBPA 4XFBA 3C7EA 4FTEA 3RMYA 3N9NA 1KFUL 1XNDA 1YJLA 5IHRA 4Q0VA 2HWC3 4A6OA 3WINE 1CAVB 1ND3B 2LW8A 2E32A 4GH4B 4XE9A 3MICA 4EWEA 2R16A 5LK5A 3BKZA 4TLFA 1KDKA 1ZBA1 5FPLA 5FZHA 3TBDA 4CDQC 2RDRA 1RUH1 4MLOA 4XURA 3NAPB 3AZZA 3VBOC 3SEEA 1W04A 3I7DA 1HJGA 4BQ1A 4CUCA 3N7LA 1K5MB 2BGCA 1WD3A 4GB31 2C5DA 5EIYB 3JBG2 2XOMA 1RUH3 2JXAA 2RR12 4AOCA 1V00A 2GP5A 2Y6FA 1RUH2 2DBIA 4W6XA 4A2UA 1LHWA 1UD1A 1W3XA 5IVCA 4HVOA 1QJZA 1UX7A 4ZY9A 1B35A 4NIDA 1NLQA 1RUC3 1VAMA 2HH9A 4HBNA 1GWKA 2YHJA 1UY2A 3ZXDA 1W9SA 3FLTA 3HPNA 4HSLA 5BNPB 1S2BA 5DAPA 1NCQA 5FBZA 2ZXQA 1XPWA 1W6PB 3ZO0B 4GMP3 2AZ5A 3ELNA 3B9IA 5FY5A 1PK6C 4XIKA 4BOWA 2X5IB 2W08A 4QMAA 4R9DA 4EE2A 4PBOA 2VUCA 2WT0A 2OZJA 1QJX3 5HCFA 1O5UA 4EZHA 1FAYA 1DYKA 1DQ0A 2RV9A 5JVVA 4ARXA 4FI9A 4XBNA 3AP4A 1R1ZA 4ITCA 5E16A 1VRH3 5F39A 2JDZA 4YM2A 4HVQA 4YZ4A 2CNAA 1AYN3 1TMF3 1MS3A 1VMFA 2JDKA 3HQUA 4KU7A 3ZYHA 4AI3A 4XJAA 1AL21 1AYN2 1TMF2 4AW7A 4I02A 4IE0A 4CEYC 4UYBA 4DFSA 5ISLA 3PU3A 2GNTA 4RHV1 1VRH1 5A3TA 1MEC2 3U10A 4AQ2A 3T08A 3NW4A 4CDXA 1PZ9A 5DAXA 3UESA 3RZJA 2Y33A 4M01A 1QJY3 1WCUA 1W39A 2XH6A 1S55A 3ASIA 3AKRA 3QD6A 4GWNA 4Q1RA 1ZBE2 3AJZA 1OD5A 3JB4C 5E88A 4AZZA 1NA1C 1CZSA 4YW3A 1GWLA 2VCCA 4CDWA 2YBKA 4UW6A 5T5OA 3HT2A 5T5PA 5FY1A 4B1MA 1ASJ2 3B3QE 4BMBA 2BW8A 1VPHA 4DY5A 1ENSA 5I91A 1ZRCA 5F5QA 2PHXA 3GJAA 4D3WA 1WW7A 4FPJA 4LO8A 4MH0E 1BCXA 2R062 3CBNA 1UU5A 2JIJA 2XVLA 3R4DB 3D4KA 4L92A 2C0ZA 4PLNA 4XTMA 2GSYA 4AHWA 4OI4A 3M4FA 4GALA 4KI5M 3WG4A 4PF1A 2HWF3 1G86A 1YHFA 1EAH1 2G9GA 2QDNA 2B39A 1S4CA 3SQOA 1DIWA 4FOVA 3VKFC 2J1SA 5AFEA 2GMEA 4GWIA 3OGSA 4N8MA 5EJ3A 3I8TA 1MR5A 1MZEA 3KWVA 4BWOA 1SLAA 3FWEA 4QKDA 2AGSA 5BNNA 2HBTA 5FKBA 3LA2A 5IVVA 5JZGA 3BTAA 4DS0A 4E4ZA 2WC2A 2AREA 1HRV1 2HWE2 3MYXA 1YXWA 2R043 3MGUA 1ND3C 3AFGA 4GXLA 2A3YA 4M3CA 4ONUA 4XMIA 4DZGA 1BBT3 4D6QA 3OPTA 2D44A 4JGYB 2H0BA 4YM0A 3THPA 4XCAA 1W8HA 1DG6A 1L7QA 4Y1YA 1TE1B 4YGEA 5BNQA 1QWRA 2J1AA 1X9PA 1LHVA 5CYYA 2C9KA 4YZ2A 5J37A 3PIJA 5EQUA 1RUE2 4AFDA 1LOFA 3A21A 2P6HA 3LDRA 4DXZA 3SXWA 3W59A 1V6JA 4Q4W2 3UL2A 1JW6A 4XFIA 1AYM2 1FX5A 4N43C 2TNFA 3WW3A 4AI8A 2HEWF 4E8CA 3H50A 3KVBA 4IDZA 4KL1A 4DNYA 4YVSB 2H6CA 4K8RB 1G9AA 1OQ1A 1XE7A 4WZFA 3GCWA 1UY4A 5JMOA 5FDBA 1RUG3 1UPIA 2HWD2 2E26A 3JZVA 2RVAA 4FPOB 2Q8EA 3APBA 5I0UA 5FYBA 3Q8BA 2VW1A 4WVZA 4Q4V3 4IERA 4GIQA 2QJVA 3N9PA 4HONA 1V9U2 2A6ZA 1OFNA 1JMUB 2RDQA 4GH4A 2WKKA 2QQNA 4H55A 4IW3A 1IS6A 3EXUA 2XPJA 4EN8B 2QQWA 1H4HA 1C4RA 3LKJA 1BMV2 2DFCA 4M4PA 1AR63 2R1BA 4NHYA 2RS32 1AX1A 1PK6B 4DRRA 3HAGA 3CU7A 4QXBA 4CDXC 4CP2A 1BHGA 2JG8B 2XL9A 3LEMA 4PI2A 5FZCA 4TZDA 3NJYA 5IJRA 3ILRA 4EROA 2DTWA 3WF3A 4A41A 5KHGA 4AVAA 4YG0A 3I2KA 1RUE3 3VBRC 1W8WA 3LD8A 3AMNA 3NWKA 4N9HA 5CVRA 2WWSA 3U1XA 3OGJA 4D8MA 5FZ9A 4DQAA 1UMHA 2P5BA 4WVMA 4HLTA 3N36A 3SCFA 4QPGA 1XNTA 5JI9A 1YCIA 4D0QA 1S0FA 2RR13 3NV1A 1CPNA 3POSA 4K8FA 4R4ZA 5JOWA 3H8RA 1IS5A 3POEA 4WVWA 5EZWA 1XQNA 3TN93 5A1AA 4GQ7A 4P9LA 1FMD3 3T2TA 5CEHA 4UFKA 4UFJA 1QF3A 2DV9A 3K4DA 3VV1A 2VUDA 2QDRA 1LULA 2VQ0A 2DYCA 3H8OA 5C3PA 3EBRA 5FZDA 1YYNA 1YRZA 2X53S 4HPKA 1AR73 4D6SA 1H4GA 3ZR6A 3SEPA 1RTVA 1UYXA 2GAUA 4CDQB 1C8NA 1SMVA 1W6MB 3AZXA 1GICA 2VOVA 3PVNA 5F3IA 2VG9A 5GLWA 4LE3A 4B1LA 4QXCA 5FLHA 5EWSA 2JECA 3KT4A 1CD3G 3VBOA 1UCXA 4BLIA 1IGOA 1GQPA 1UYPA 1NKGA 4ES9A 4WM8C 2VW0A 1L7LA 4Y24A 3M3QA 4IGOA 3VLBB 1GKBA 3O0XA 4AG4A 4YYOA 1TME2 2V4AA 3AX4A 1QJFA 1C1LA 1HXS2 4LHSA 5BXXA 1RUNA 2YV8A 3I2GA 4MGZE 1V70A 3NNGA 4JDOA 2ZMLA 3ZXJA 3CEWA 4BLJA 1I5PA 3ACIA 4JAAA 1KXGA 3O1MA 4YFZA 3HNBM 4LUMA 1BVP1 1YFWA 3RI8A 1Y3TA 2VNOA 5C9AA 4P9JA 1T2XA 1NY71 1UX6A 1HX6A 4AVSA 2QVSB 4E2GA 1YLLA 5IT6A 1LGNA 3WDTA 3H1WA 2VZSA 1K12A 4QXHA 1DLCA 2RM23 1QMJA 5FYMA 1KQRA 3N7MA 3QOPA 4XCBA 5IW0A 1FV2A 2A3XA 4MXWA 4MGYE 4GJYA 1BZWA 1AR83 4FAGA 2NM1A 3IDCB 4OUEA 2C24A 3W21A 3ZYIB 4E4SA 5C8CB 2WYSA 2B8MA 3BTZA 2XB6C 3CLPA 3B00A 4XOGA 2YC4A 1R091 1H8VA 5EFUA 1VBA2 1RUJ3 1W6MA 1PO22 3AMQA 1HV0A 1LOAA 1APNA 4E4HA 2LTNA 3Q9OA 1E5SA
chains in the Genus database with same CATH topology
4OFGA 2ZMKA 4IETA 1AX2A 3WG3A 1G7YA 2RS52 3NAPC 5DUXA 2C9AA 4ES8A 3MIHA 1LGBA 2WNUB 3VZOA 2QZ2A 3VL8A 3WVJA 3J8F1 4MXWB 2ZGUA 3UJQA 3USUB 3UKTA 4D7YA 1PHMA 3I59A 3K48A 4AFAA 5ACA1 2XWJB 3ACLA 1F8VA 5GLUA 4HT1T 2DVBA 4ZXKA 4OI1A 1PIV1 1AR71 3JD71 1REFA 4AQSA 1Q8SA 5CFCA 1Q43A 4D94A 1WLCA 4YGBA 2CGOA 4XBQA 4BCUA 2RJLA 4FPGA 1H9WA 2BYVE 1VRH2 3NV2A 1RVF2 1Z7S1 2Y26A 4H7MA 1NE6A 3GHMA 4MVTA 2PLV3 1DHKB 2YROA 1DQ2A 2Y38A 3VBFB 3CF6E 5J48A 4TWTA 3FUOA 2Q8OA 2NN8A 5DZGA 5JOYA 1V6OA 1PGL2 2ZX0A 4KBBA 1O3SA 1LOGA 2BVBA 1RGSA 3WDUA 1RL3A 3LAGA 1PVC1 1WMEA 1QJU3 1O91A 3PMSA 4IEVA 4GMP1 4I0BA 5JI7A 5F6LB 4Q26A 3SCGA 2TUNA 4H3WA 1PVC3 5GZEA 2YY1A 2RM22 2O0OA 4N43B 4B29A 4FBFA 4B7EA 2JEMA 1WD4A 2EIGA 2G4IA 3N3HA 3BCWA 3M2MA 3OPZA 1O3QA 2FMYA 4HETA 2XLGA 1OSGA 2JD4A 1GZ9A 4MYEA 5HCBA 1ZRFA 2IC1A 1OFSA 2W0XA 4P9WA 2WT2A 1AXYA 2IXKA 4QQHA 1AHSA 4M3CB 3MFCA 1AR62 4AEJA 1EAH2 1Y7BA 3J9SA 2XGXA 4L99A 3VUOA 3HMYA 2CGNA 4H14A 4XJ8A 4P14A 2ZKLA 2XJSA 4XFGA 3WP4A 3EJKA 2ZHNA 3OBRA 5T5LA 2E9QA 1Q5OA 1OHFA 4B4QA 3SMHA 4JGYC 2X5IC 2XVKA 1J3PA 1ASJ1 4AI0A 1WA4A 1PO12 4XXAA 4RS5A 2A6YA 3ZFEC 4LBOA 5KHJA 2ZA9A 2ETEA 4IEOA 3TN91 4QPYA 1BQPA 5GZDA 4FP2A 1ENXA 4AF9A 1LHNA 2YDEA 3K51A 1DZQA 1POV1 3D8CA 1PO11 3ZSMA 1KFXL 3P3PA 2XVGA 5BNOC 3A4UA 2QCSB 1VBE3 4J6GA 4K20A 3ZN5A 4RGAA 4HL0A 3TN92 5A3MA 2AYHA 1WLDA 4RL7A 3WR0A 3C2UA 3GYDA 5A33A 5BNOA 1DU3D 1V9U1 3GALA 4ISQA 1QQP1 3FUQA 1DGRN 3SHRA 4ZU5A 1R081 5I8TA 3B7MA 4N53B 2OA2A 4KG0A 3HBZA 2D7FA 1F9KA 4M3CE 2RS33 2YYOA 4C1WA 5FOJB 4XQWA 3NJZA 3B02A 1M06G 4EWDA 4JCKA 4IV1C 5KHHA 2JICA 4CDXB 4JGYA 3AP5A 4AQTA 2OIIA 4FSJA 1GQGA 5C4WC 4WM7B 1ULFA 4XF0A 1RUJ2 1WLTA 3R6SA 1IQAA 4Y20A 2CAUA 4JQRA 4XILA 5ABJB 1Q8PA 5JSRA 2GDFA 4XZPA 1H2LA 5ABJA 4OHZA 3GZTB 3AYEA 2VMHA 1SLLA 2OW4A 1ZBA3 3MW3A 1AVBA 3B5LB 2VH9A 1ZRDA 4MZUA 5C8WA 3B01A 2HWC1 4CZSA 1COV1 2RS11 1BKZA 4C0BA 3RQ0A 1W6PA 3GZAA 1V6LA 1WW6A 1LCLA 4L11A 4XIOA 5BNPA 3PLQA 1UU6A 4BHPA 4L2NA 5BY5A 4CP1A 2P17A 3NL1A 4N53A 4S2FA 3ZIWA 5AC92 5JSPA 1PGL1 4LBQB 3KM5A 5D8AC 4KWLA 1VJ2A 2XKOA 3DKWA 3N7JA 4FTBA 5A33B 5BNOB 5KXEA 4IV3A 3IM0A 3VBHB 4LO7A 1TME1 4YGDA 4L9BA 3KMHA 4KH9A 3WG2A 2WJSA 3IMNA 3JCIA 2W52A 2IXCA 3U0ZA 4QD2A 2WA4A 1UZZA 3WQ0A 3RJ2X 2UYBA 2I45A 4Q4Y2 4UBHA 1H0BA 2HKXA 2DFBA 3FC0A 4Y5Z0 1S1AA 1I1EA 5SV8A 4YVSC 1UPSA 1WW4A 1GZCA 3MF9A 2NQYA 4YZ3A 1RITA 1FXZA 2DCTA 5JCTA 1G9FA 3TAYA 2GC1A 2MEV3 5E8AA 4QGMA 3ENRA 2HWF2 2HYKA 3OTFA 1LRHA 4FOYA 2BBVA 3E6BA 1RUC2 4AYUA 2XJUA 4BM8A 3UKNA 1XYNA 4V1PA 1A8MA 2PHTA 4AEDC 2EVXA 2EXJA 3WP5A 4AWDA 3I59B 1WBFA 1HW5A 1UKRA 4NO4A 1WBLA 1YFYA 1F5FA 5BPXA 4RR3B 3VL9A 1SEFA 1AF9A 1IKPA 4S2GA 3RI9A 4C0HA 3SH4A 1B35B 1VBB3 3FFZA 4OUSA 3GZUC 4PCRA 3WCSA 4P9XA 3AYDA 4RS5C 4PLMA 1N47A 1N1TA 1HQLA 4HFSA 4QX5A 3VZNA 2AH2A 4X8NA 4DMIA 3KZ4C 1QOTA 1JUIA 2W39A 2WQZC 4DY3A 3PVBB 2ZZQA 1LU1A 2B7YA 4W6WA 5JMCA 4I3GA 1CX4A 1EP0A 3CO2A 3WDWA 2D3RA 3ZN4A 4IEWA 3T1LA 4TSVA 2ZGNA 3O0WA 4C90A 1MS9A 4Y26A 5JZGC 4O9GA 1D4M2 1FI2A 3AZYA 3SITA 3BODA 2ZHLA 3AP9A 2O8QA 3ZX7A 5LK7B 5GJ6A 4XBLA 1H1MA 5CA6A 2WNEA 1KD7A 2YGLA 3OCPA 3POYA 1WCSA 4NN0A 1MS4A 1N3PA 1VBE2 2WIIB 5C4WA 4AE2A 4XJ9A 1UAIA 4I3PA 4NHMA 4IEPA 3R4SA 4XFCA 4NWVA 2XLAA 3DPRB 1RUD3 1SLCA 2D3PA 5J09A 2Q1MA 3ILNA 2EAAA 1H2MA 1ULCA 1MEC1 5FRAA 3H8UA 1Q3EA 4QM8A 1CQ9A 4COYA 4HSJA 1YNAA 4Y4YA 4CEWC 1NE4A 4I0AA 2CY6A 2Z5WA 1ENQA 4G9SB 3S30A 5C8CA 2QFEA 2XJQA 4HK8A 2ZX1A 4AGVA 2IFRA 1QGLA 2E51A 3B94A 3RYRA 1AL23 4AVBA 4CP0A 2XBO1 1LENA 4YRDA 1A6CA 2X29A 1VBA1 3ZXLA 1HQNA 1LESA 3H7JA 5AFBA 1QU0A 3O12A 5CG8A 3OJBA 1ASJ3 4GKXA 2ZTNA 1FPN1 4FXKB 4LHNA 5C9AC 3OYWB 2VXRA 3EHKA 3D82A 3M70A 3BALA 1LEDA 1CIWA 2P37A 4UBGA 2A71A 5KHKA 1ND2B 4R9AA 3BPZA 4LTAA 1S0EA 4AEKA 4QGNA 1O5LA 3J8F3 4JTOA 2AUYA 1MS1A 2E53A 2X8KA 3D6EA 1G9BA 1YFXA 4S2HA 4NVPA 2YZ4A 1FPN3 3ES1A 1CAWB 1RMU1 2ZJCA 3KLSA 4G4FA 3VBOB 1JHNA 4FOWA 2RMU1 3CJIA 1NQJA 3VBHA 1R093 2R073 3LGRA 4K6BA 1VB2A 5D8AB 2HWB2 3NKTA 3WD5A 1H1AA 1D2SA 5C6CA 2GC3A 3KB5A 2BNOA 4YZ5A 2O1QA 1TEIA 4XF4A 1O3RA 3PNAA 2WA3A 4MUVA 1QHDA 4FPYA 4WBBA 1A78A 3LSEA 1O7FA 1QJU1 4P9IA 1CESA 2WFF1 2A6XA 4FOQA 3NO8A 5H9PA 1MS8A 3N35A 4CRQA 1MZ5A 1V6KA 4PQ9A 5JIUA 1R1A2 4CTEA 5JZGB 2CGPA 5FFOC 1G9DA 4KGQA 3ZYGA 5BNNC 4Q4X3 1RUI2 2P2KA 4A3XA 3JD72 4LO6B 3QH6A 1DF0A 1QXRA 4ORFA 2K0GA 3FBMA 2GH8A 4F7ZA 5JWPA 1DYPA 3AKSA 1D2QA 1CJPA 4XFAA 4ASMB 5F6KA 4DOUA 4D69A 3ZYRA 2VVDA 4R8HA 2DCKA 2WSVA 3AKTA 1U5XA 1VP6A 4XJWA 3EO6A 3KS7A 4CEYB 2ZZJA 4XPVA 2Z79A 3L2HA 1XE8A 3ST7A 5AVPA 3C3VA 3DPRC 2MHFA 2ZPXA 1XYOA 4QHBA 1TNRA 2WFPA 3IBMA 4AVVA 5GZGA 4Q4Y1 1PNFA 1ENRA 3SCHA 2VU9A 4YVSA 1SFNA 1VAKA 1XU1A 4XEZA 4LBQD 3JQWA 1H1IA 4LBQA 2RMU3 5C33A 4QPGC 1CONA 1W6OB 2DCZA 1LOFC 4RS5B 1CJDA 4O9EA 3FBYA 4MGIE 4LHKA 4LEJA 4UW5A 2BPA2 1NOVA 2ZGSA 2CWMA 2EXHA 3VDDA 4A7KA 4OVEA 1Q8VA 5T52A 1X33A 3AMPA 2QE3A 1ND2C 1C28A 4XFFA 4XTPA 3HR9A 2WQ4A 3GNEA 4GWMA 2WSUA 5I93A 2E6VA 4EN6B 2SBAA 1MZFA 1AL0G 1PGSA 2XWBB 3MF6A 5BNNB 3WV6A 3GF6A 1OA3A 5H9RA 2TBVA 1JXNA 3PTYA 1UKGA 5BNPC 2EXKA 3JQXA 2WT1A 2R0FA 4ZU7A 2PHRA 3TWIA 2VMIA 1NXD1 2V5YA 1BXHA 3WDVA 4GMP0 1QNWA 1ZRRA 5GLZA 3MDPA 1WLWA 3RYKA 3AFKA 3VHOA 3ZXFA 2WNVC 4OHXA 4OI0A 5DZEA 4QPIC 3WP3A 2LALA 4F3JA 1KS4A 1FV3A 4N43A 5GLVA 4XXPA 3MIBA 3MLJA 3AYCA 1FOD1 1L3JA 4AHYA 1QKQA 1S0IA 1SBDA 2XLFA 2PFWA 3E6DA 3DF0A 4META 5JR7B 3KGLA 4MGKE 4N7UA 4XHBA 2ZHKA 1C5IA 4YVWB 4XHXA 1HXS3 4DPNA 1BEV3 1Q8OA 2RMU2 1A8DA 1Q56A 1XNBA 1CAVA 1ND3A 1KDMA 1C8M3 1OKQA 5E1RA 1PO21 5FLIA 1QQP2 1R092 3ZXEA 2PHFA 3LSDA 5CIRA 2A73B 3IKWA 4YARA 4OHWA 2WZR1 4LBNA 1DQ6A 1RVF1 2R1DA 3WW1A 2HWE3 4YFWA 2BVVA 3O5SA 4QGLA 2ZGOA 4D7TA 5K9YA 3FFQA 1ZZ7A 3A0NA 3AM2A 3AJYA 2A70A 3KGZA 1UIJA 1ZZ9A 2WFF2 1U5IA 5A32B 1JOJA 1COV3 2RS13 3BU7A 4LO5B 3VKOA 1CPMA 2BWCA 1KJRA 1UW8A 4JGZA 5IK8A 2Y0IA 4P9GA 3KSCA 3V64A 2XJVA 2D43A 1RVF3 3USUA 2P34A 2PAEA 2WNUA 5FTTC 1NCQB 2R32A 3POWA 1O4ZA 1V6NA 4TYSA 1UU4A 4OUMA 2DCJA 5T5JA 3ZMOA 4IEYA 3RJRA 4YW2A 4FTSA 1NZCA 4CDWC 1GSLA 4JRLA 2B9UA 1PGW2 4WVVA 2A75A 1LOEA 2DF7A 3WW4A 2DUPA 1GBGA 5KBFA 2GN7A 5DG2A 1GQHA 1HIXA 3V0AA 4EN7B 4HANA 1UMZA 1BMV1 4LLOA 1WMFA 1X82A 2BFUS 2ZHMA 3DN7A 3PMEA 1C3HA 2VQAA 4I01A 5DDJ1 4Q27A 2OVUA 1CAXA 1GLHA 5LRRA 5FMOL 4XJZA 2QQPA 2A3WA 1MEC3 2ZGTA 2ZCWA 4AHXA 5C9AB 4BZ4A 1ZX5A 3H9AA 3SH5A 4Z82A 4Q4V2 2GNDA 3OYWA 2ARBA 4X6QB 1YJKA 3U11A 4B4RA 1OLQA 3J26N 2UURA 3KT7A 4Q8KA 5TSWA 2VOKA 4ISRA 1W6QA 5J96B 4QQOA 1GV9A 2XJTA 5BUVA 5BYNA 2JG9B 2D5FA 2P3JA 4Y22A 4AHZA 1RMU2 2RJKA 1UF2C 3FX3A 3DL3A 5K0UA 1RUC1 1RC6A 3LWCA 2XL7A 1T6GC 3LB9A 3AXDA 4IEUA 3RWNA 1OQDA 4CDUA 1ZREA 2YC0A 3TNQA 2WL1A 2Q0AA 2D93A 4CDQA 1HV1A 1N1VA 3WX5A 5DG1A 4BA6A 4RGGA 4KQ7A 4Z92B 1Z0HA 3BOWA 3VGIA 1FPN2 5DUUA 3W9AA 2IXIA 2DUQA 2V09A 2K2SA 2WZR3 3DPRA 3H1YA 1D0HA 3U07A 3VZLA 1BJQA 4C91A 1J58A 1H9PA 2WZR2 2NLRA 4LLFA 1VBD1 3VHRA 4HKOA 4F8AA 4Z8BA 1C5HA 5DXDA 4AEDA 3WZ1A 4XQDA 3MI8A 3VBUC 4OHYA 3ZYJB 3M3IA 1NA1B 5EV7A 1AYM3 2HWD1 4MX3A 4NR1A 3HIFA 5FQ0B 1PVXA 1EPZA 3RS6A 2XUMA 2R0HA 3ZVXA 4Y1XA 1REDA 1OA2A 3WDXA 2JE7A 2W68A 1R1A3 4UW3A 3OD4A 2BQPA 1GNZA 2R063 3B9CA 2HEYF 4JRAA 5JIAA 4I2OA 4FPLA 1WMDA 5GM0A 5T3NA 1S2KA 4B4PA 4COVA 1M4WA 4COUA 1VBB1 1TNFA 1QJY2 2QKDA 3JBG1 2XG3A 5KC6A 2XJPA 1BBT2 4XDQA 4E2QA 1Z78A 1U12A 2JJ6A 4X8PA 2R042 2HWC2 1O4YA 3ATGA 4IEZA 1UIKA 1BVVA 1NCQC 2RM21 4IL7A 4M0NA 4Y22B 3S6PA 2JG9A 3NKGA 4IXLA 2ZGRA 3B93A 4HN0A 4E9KA 3VHNA 2R072 1DQ4A 4IV3C 5SV5A 2NYYA 4UXAA 4HPKB 4K40A 2R071 4RR3A 3MIFA 1PZ8A 1W0PA 4INDA 5HCAA 2OUJA 4PIXA 4WM8A 3HN1A 4BPZA 4XQ4A 3WHTA 4YW4A 2ES3A 3MEPA 2GH2A 1QJX2 3NV3A 3DGTA 1Z7S2 4QPGB 4Y1ZA 1VBB2 2VUJA 4L8QA 1B09A 5CAZA 1LOCA 3PVOA 4QU2A 5FO9B 1RUF1 4OLLA 3VBSB 4E27A 3SLIA 1CVNA 1VBD2 3WOGA 3R05A 1IS3A 2PN5A 2ET1A 1PIV3 4H7LA 3WY6A 3V0AB 2TEPA 2JG9C 1RHI2 1NLRA 3FHIB 3O7OA 2WNUC 4I0WB 2XHKA 4EWAA 2JG8A 4AI1A 5T55A 2UY8A 1MS5A 3ETQA 1RUG1 2VECA 4FPHA 2C1FA 1DZTA 2EALA 2YPJA 3S7EA 5GZFA 1IHMA 1HQWA 1LOBA 2JKBA 4QPIB 1ZA4A 4XJUA 1V6MA 3ZSEA 5DUVA 2NPIA 2Q5TA 3N4MA 5GZCA 2UU8A 3L9JT 1I3HA 3AP6A 4RA0A 3ZFEB 4COZA 1I5ZA 1TQ5A 4IV3B 4NOTA 2WFF3 1GZWB 3ZXAC 1U0AA 1WW5A 1OI6A 4QM9A 4RQPA 3RYPA 4FPCA 3BIWE 4W65A 4C1XA 5L7OA 3VBUA 1N3QA 4GH4C 3IDBB 4PF5A 3PHMA 2EAKA 2UYAA 1CR7A 4FPFA 1AR93 4FXGB 3AZWA 1LEMA 4Q29A 1NY72 2YUEA 5J3UA 2D6NA 1RUF3 2DWRA 3EQEA 1ZM1A 3B69A 3QH7A 4MXVA 3TNPB 2E63A 3TYJA 1MZ6A 5FO8B 2MEV2 1C1FA 5EXOA 2VGDA 2BNNA 4Y20B 5IK4A 1DQ1A 4XW3A 1IOAA 1QDOA 3TOJA 4IV1B 2NMOA 4AFCA 4WM7A 3IN9A 2RHPA 1ALYA 3JUUA 1RINA 1DFQA 1JBCA 5K0UC 4Q4Y3 5ABJC 2H0VA 3JU9A 1N1SA 2JX9A 3A0KA 2WZPP 5K8SA 1IPKA 2BNMA 2VNRA 1OLRA 2A5ZA 4YZ1A 1SBFA 4CYDA 3RSJA 4BE3A 2EF6A 2GN3A 5JDBA 1R082 2A6WA 3ZFFB 1IPJA 2FBEA 1XYPA 3ZMNA 4W6YA 1HRV3 4JGZC 2VPVA 1QJY1 1MVEA 5JOZA 2FZ2A 4ZU4A 3GBGA 5A3LA 3NAPA 4G3YC 1WGPA 2CV6A 2PELA 2E7QA 1ZBE1 1HXS1 1VBC2 4HZFA 1RIRA 2ILMA 4L97A 2WNVB 1VBC3 2D6PA 2G9FA 5B2GB 4QXKA 3M3OA 2XBO3 2ZGQA 2GNMA 4RHV2 3ZIXA 4LT5A 4PJYA 2MPFA 2HWF1 1MVQA 2IXJA 5LRSA 4LHLA 2KA3A 3V56A 1W6OA 5K7PA 4RQPB 4BIOA 3G7DA 1W0OA 1RUD1 5ACA3 1FYUA 3FLRA 5CFCC 2PAKA 3PJYA 1CAUB 3ZYPA 4LUKA 3OBTA 4NHLA 1NXMA 2ERFA 4Y1UA 4HKWA 3ZSLA 4Q4V1 3E97A 2HJIA 3IIAA 3VBRB 4QPIA 4AGGA 4Q4X2 5CFDA 4XFHA 2ZAAA 4Z07A 4CEYA 4F83A 1RMU3 5CG9A 3GHNA 3ILFA 3JB8A 4AFMA 4K9SA 3R0RA 3IPVA 1PZ7A 2VUAA 3GBFA 3JD73 3NSTA 4XF3A 4AVTA 1J59A 1UZYA 1EV12 4ATEA 1U5ZA 5KHIA 2DVAA 2VOXA 3MLKA 3BOPA 5I0RA 4OZXA 3CL1A 2F6BA 2ZBJA 1LKNA 4BIFA 5CU1A 5LEJA 3VBSA 2EA7A 4NWWA 3WUDA 3ZXGA 3H7YA 3P3NA 5AVAA 1SLTA 1QJU2 4EV0A 1B35C 2Z2SB 1PO23 3URFA 3VDDC 1OPMA 4IEXA 1HRV2 3VBHC 1AJOA 1E57A 3PJQA 4GULA 1MACA 3AXEA 4LR4A 4Q2FA 3VBUB 1BYHA 3ROUA 2E7AA 4XF9A 2XJRA 1NCRC 4AEMA 4NPRA 2D6MA 3WCRA 3WDYA 3VHPA 5HXVA 5CFCB 2UY9A 4JTNA 1RJ7A 1RUJ1 3QBQA 3CJIB 2VOWA 4AK3A 1DQ5A 1EV11 1S0GA 1AR72 4LNVA 2VW2A 5FOBB 3S7IA 1DZRA 1RHI3 1SFYA 1AR81 1RUD2 2F4PA 1ZNPA 4P5HA 3VKMA 1VBD3 4FQZA 3AKPA 4R9CA 2DURA 4AXOA 1SBEA 1WCKA 1SCSA 3ZFFC 1ND2A 2SLIA 3AK0A 4U2AA 2D5HA 3J4UH 4LBKA 5CADA 4BMEA 3VZMA 4M3CF 2WS92 3WW2A 5CNAA 5GLTA 1OOPC 4ATFA 4YVWC 4JDNA 3KT1A 1PO13 1QNYA 4PDWB 1ZBE3 5I0SA 2HWB3 1WUVA 1REEA 2VMGA 4MV2A 1JTZX 1AL22 1AYN1 1TMF1 3WQ7A 1KJLA 2OYZA 4URTA 3VKNA 4DRVA 4YSFA 1RB8G 5I8YA 5JLVA 4P9YA 3X29B 2VVFA 2YMZA 3M3EA 4WM8B 1W6NB 3ZFGB 3M1HA 1SACA 1AR82 3RMXA 5J7MA 1DGWX 2OPKA 3M7AA 4K1ZA 3V0BA 4ZKTB 1SLIA 1NLSA 5IK5A 2PYTA 5L73A 4OI2A 1SCRA 1O4TA 1YI7A 1MQTA 4PIYA 5HBAA 1VAVA 3H0OA 4FO9A 1PNGA 3MLLA 3CJIC 3ES4A 3OY8A 1YO8A 5FREA 4E4DX 4R52A 2YXSA 2ZGPA 4M00A 5KXCA 2P3KA 5K0UB 3LOIA 1FMD1 2Z69A 4AQ6A 4X6RB 1OA4A 3OY8B 4GB32 3MIGA 2BTVC 4LBLA 2RR11 4EN0A 1CGPA 5DDJ2 4FT8A 1VBA3 1MQTB 4DINB 2LUWA 1W6QB 1OPOA 5FMOS 2HWB1 3WUCA 3AP7A 3HD8B 3I2DA 4IQPA 4Q4X1 4FCAA 4KWKA 1RUE1 4K7JA 1XNKA 3O0VA 2R6QA 2D98A 3CJXA 3V0BB 4HN1A 1AR91 4Q0SA 1KRIA 2Q1ZB 4LA3A 4FQ4A 2MEV1 1XRUA 5T54A 3LOBA 1GNHA 3AMHA 4FPEA 3RNSA 2D97A 3MIDA 2Q4SA 4WVMB 4PDWA 3IDEA 4HKLA 4Q4W3 1DGRA 1YUDA 1LU2A 2V73A 1IS4A 4JVAA 5FO7B 1OOPA 1RUI3 4CEWB 2RS51 1AXKA 3RDIA 5FCCA 1YWKA 5E89A 4AGRA 1FMD2 3WLUA 3MW4A 1F31A 3WT3A 3RG0A 1XXNA 2VNGA 2BEOA 1X50A 3IPVB 5DDJ3 3ZXKA 1TME3 5JAXA 3THTA 4GKYA 1PIV2 2GU9A 1H2KA 4CDUB 3V65A 2PA7A 2D6KA 3M8LA 3H3ZA 1YFUA 4K21A 1J3QA 4RD7A 4QT6A 4A7YA 1Y9QA 3ZSJA 2RE9A 4FPKA 4B7KA 2UWAA 4BH9A 4FVVA 4XYXA 4JGZB 1EPWA 2R49A 2D3SA 4EN9B 3MPPG 3VBFC 1RUG2 4LBJA 3UK9A 1C57A 4AFBA 3KCXA 4E2SA 5F1RA 1HLCA 2HEVF 4YG6A 1IZ3A 2FZ1A 3QCWA 5FLJA 4QQ2A 3VZKA 2IZWA 2LM3A 3DV8A 5IK7A 4PIZA 4AI2A 2WS91 2EXIA 1RUF2 2XKPA 5C8CC 4YM1A 4PDWC 1BK1A 1CAXB 4IESA 3TRSB 5JSOA 3R4UA 2GMMA 1HRI2 5EYYA 2KM2A 2WNVA 4NHKA 2D40A 3GBWA 5DUWA 3PVEA 2HWE1 1GYKA 3W58A 5FPXA 1VALA 2PQQA 4R9BA 4UW4A 2DUOA 3D5OA 5AC93 1J3RA 2ZABA 1SDWA 1HKDA 1S0BA 1OMIA 1AZDA 3JBG3 5L7OC 1PVC2 5JPMB 5HI0A 1RJ8A 1ZBA2 1ULEA 4HMZA 1NCRB 2IWGB 5H9SA 2ZX4A 3SISA 1DGWA 1ZZ6A 5GKAC 4HVRA 1AJKA 4D7SA 2R061 3QACA 2FQPA 5T50A 3RZZA 1NCRA 2D6OX 1XNCA 3MIEA 2MNGA 5KXDA 4YG3A 1QDCA 2ARXA 4IV1A 3WP6A 1UL9A 2Y0OA 1MQTC 3E5XA 1LHOA 4R4XA 2UWBA 1CN1A 5A32A 4B3NA 1JYCA 3KCCA 4CDWB 3ALQA 3WG1A 3MPBA 1H2NA 2PHWA 4RFT0 5L36A 2BUKA 4KGGA 2YGMA 1LODA 3H1MA 3VDDB 3WNXA 2CYFA 3MZHA 2AR6A 1C8M2 4B8EA 4GB33 2Z42A 3D0SA 1VLNA 3E6CC 2PHLA 1BEV2 1YIFA 2GALA 2B42B 4Q8LA 4FP3A 4Z2WA 4YM3A 3ZDSA 2I2SA 1HRI3 5CB7A 4Q1PA 2ZOEB 4YVWA 1ZZ8A 1ZZBA 1GZWA 4KU8A 2ATFA 2RS53 3U4XA 3ZFEA 1A3KA 5JOXA 2WINB 3KD4A 5CFDC 2PAMA 5EYXA 1DDLA 4Q4W1 3D0JA 2X5IA 1ULGA 3ZFFA 1FOD2 1SQ4A 3T1MA 1JH5A 2DVGA 5J36A 4LE4A 2JENA 1D4M1 2GZWA 1S0CA 3FMGA 3AB0A 5J98B 3AYAA 4KWJA 2FMDA 1DGLA 5CBLA 2NMNA 1QQP3 2R30A 2IFWA 1RUOA 2ZX2A 1G9CA 3RRDA 3L2YA 1N1YA 4S2DA 1PM7A 2UWCA 4FAHA 1VBE1 4WM7C 1K5MA 1VB4A 1YI9A 1YIPA 1POV3 2DTYA 1S0DA 3WQ1A 1OOPB 2B5HA 4WV8A 1POV0 1W2UA 2ZMNA 3AMMA 1PGW1 1I9RA 5AC91 1LJ7A 1QY4A 4N90A 2QUOA 4K1YA 3G6JB 1F2NA 4MSVA 1GFF2 4RHV3 1DBNA 3ZPYA 2GMPA 3VN4A 3OD0A 4YNIA 3FE5A 3ZFGC 1D0GA 4WZCA 1X36A 3HT1A 2GC2A 2BFUL 1QXJA 1AX0A 1H8TC 2DVDA 1BBT1 3FJSA 4QQPA 3MFAA 5L7OB 1J1TA 5BV6A 5F9TA 5D8AA 3UKVA 2R041 2PTMA 3INAA 3VBSC 1LHUA 5JPNB 5L19A 3E5UA 3CNAA 4N53C 5H9QA 1QH7A