2ZGLA

Crystal structure of recombinant agrocybe aegerita (raal)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
total genus 40
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zglA00
5JVVA 1URXA 2ERFA 4K1YA 1UAIA 4YFWA 4XBNA 2DU0A 4JCKA 3IMNA 5CBLA 4OZXA 1LU1A 3UK9A 2EXKA 4XJ9A 2A6XA 4C1WA 4P14A 4P9XA 2E7TA 3OBRA 1SFYA 1ONAA 1YO8A 2OUJA 4XBLA 2CTVA 4XHBA 5T54A 1V6OA 2W52A 1GKBA 4GWMA 1PZ8A 2OUHA 3V0BB 1FV2A 2E53A 4XTMA 2ES3A 1W0PA 3TAYA 1PZ9A 1AX1A 3ZXEA 2ZZJA 3ILRA 5FRAA 5JOWA 5JLVA 1IS4A 5CAZA 1W6PA 3BODA 2GN7A 2D7FA 3C2UA 2ARBA 2VH9A 1SACA 3D4KA 5L73A 1GZCA 2NMNA 2D6NA 4YFZA 4YW4A 1S0EA 3ZXFA 3MPPG 3OPZA 1CPMA 2GNTA 1J1TA 4FPYA 1MZ5A 2D3SA 1SLLA 1ENQA 2SLIA 1MS9A 2A3YA 4JC1A 1JOJA 4NO4A 4BOWA 2VW2A 4AYUA 2NYYA 4RL7A 2YXSA 4LBQA 2XB6C 2DUQA 1DIWA 1JN2P 5E8AA 2PHTA 3RRDA 1Z78A 1MZ6A 1G9DA 5E88A 3FFZA 3DUIA 3AX4A 2CYFA 4YG6A 3MW4A 4Y20B 3MW2A 3ZSMA 2PELA 5H9PA 4FP2A 4YGBA 3WNXA 3WOGA 3AZVA 1FAYA 2A3WA 1S0IA 1I3HA 2DWRA 3AJYA 1ULCA 5T5PA 3ILNA 2TEPA 3NV3A 1SCSA 2A6WA 3WHUA 1BKZA 5T5OA 3V0BA 3V0AB 4FOYA 4FPOB 2JDZA 4Q8LA 4U36A 4UW3A 4M3CF 3U4XA 2R1BA 4M00A 1G9AA 1DBNA 1QNWA 1UZYA 2DUOA 1RINA 2I2SA 3N35A 3AP6A 1LJ7A 2CNAA 2ENRA 1H30A 3POYA 5DG2A 1UZZA 4WV8A 5AVAA 5H9QA 4YZ4A 4YZ5A 2D3PA 1SLBA 1LOEA 3B01A 1ENRA 2B7YA 1JYCA 1IKPA 1C57A 1YRZA 2A75A 1DFQA 3N3HA 3ZXKA 3O0WA 1LHNA 1DGLA 1DYKA 1OKQA 2D3RA 4FQ4A 4XIOA 1G8WA 1A8DA 2ZGUA 1UPSA 3JUUA 2GN3A 2YROA 2VU9A 2UU8A 3WUCA 5GZCA 1QKQA 1BJQA 1IOAA 4L8QA 1MS1A 3WG2A 1H9WA 2ZGMA 4Y20A 2Q5TA 3RQ0A 2ZAAA 1D0HA 3ZVXA 2D44A 1N1TA 5JDBA 5KXDA 1DHKB 3N7JA 2EXHA 4YGDA 4GKXA 3ZSJA 4CZSA 3IPVB 3O0XA 1C1FA 1WLDA 1NXD1 1V6MA 3T2TA 4SLIA 4AVSA 3AYCA 2UWBA 4H55A 1LESA 4Y1ZA 2A3XA 1LEDA 3V0AA 1GBGA 4W65A 1Q8SA 2ZMLA 3FUOA 1FV3A 3PMEA 4FPEA 1AZDA 4LBOA 4AVVA 3ILFA 2ZGQA 1GICA 1DQ4A 3WDVA 2AH2A 1LECA 2JECA 1OQ1A 4PQ9A 3AYEA 4R9BA 2SBAA 3RG0A 3WG3A 3LSDA 2WT2A 3I8TA 3FBYA 4XE9A 3V65A 4BM8A 3FLRA 1GV9A 3VUOA 3M3EA 3WDWA 1KQRA 1Q8VA 5IK4A 1W6NB 1IS6A 3PVNA 3FLPA 1O4YA 1U0AA 3WLUA 1QOOA 4K21A 4BQ1A 1MS3A 5GLZA 2WSUA 4BLJA 2ARXA 5GZEA 1UN1A 3ZPYA 3W58A 4YG0A 4BLIA 1N3PA 1QDOA 5DG1A 4ATFA 1MS4A 4YGCA 1BQPA 1FYUA 2WT1A 1LOBA 4Q27A 3AFKA 4Y1VA 1LOGA 3AP5A 1Q56A 2DVFA 4LBMA 1W6QB 4TYSA 1JW6A 3UJOA 1HDKA 3PJQA 1DZQA 5F5QA 3ZSLA 1AX0A 1Y7BA 3SNMA 3IPVA 4FVVA 5KXCA 2DTYA 2NZ9A 1DQ1A 1G7YA 2YV8A 2ZGOA 4XJZA 3A4UA 4DS0A 3VKNA 3WG1A 2EIGA 1MS8A 1VAVA 2EAKA 2D43A 4FPJA 2EALA 4K20A 3WG4A 3ZSKA 1LENA 2PHFA 2D6KA 1LGNA 3OBTA 1F9KA 2LALA 3DGTA 2NM1A 1O4ZA 2W68A 3R05A 2D6LX 3LCPA 1LULA 5E89A 3V64A 3ZYPA 5HCBA 1N3QA 2WLQA 3AJZA 4GALA 4ISRA 3SH4A 4GWNA 1HQWA 1WLCA 4XMIA 2A7AA 1W6NA 4ASMB 1Q8PA 4UW4A 4NOTA 1LGCA 2PHRA 3SLIA 1W6MB 2UWCA 3N7MA 1UKGA 5CB7A 2VY0A 1N3OA 3WDYA 2CY6A 2D6OX 5LK5A 4XYXA 1SLAA 5JOZA 5CNAA 2DVDA 1RITA 2ZGRA 3AK0A 4WZFA 4I30A 1S0DA 2VXRA 2WQZC 4GA9A 3VKLA 4BMBA 2DVBA 1W6QA 3AP4A 1N47A 2NP0A 5BYNA 1SLTA 1QF3A 1QGLA 1QDCA 2JE7A 4XIKA 1V6NA 5HCFA 4FOWA 5DUVA 5GALA 1VAMA 1LTEA 2FHRA 4LBQD 1Q8QA 2Z42A 1A3KA 4XHXA 3AXDA 1N1SA 4FPLA 4XJ8A 3N7LA 1HQLA 3B3QE 5T5LA 3TB0A 1WUVA 3AXEA 1JYIA 4Z8BA 1CN1A 1S0JA 1WW7A 2OVUA 1JBCA 4PCRA 1EPWA 5GLVA 1IS3A 4Y1XA 4YM3A 3N36A 1BXHA 1GZ9A 5DZEA 3HN1A 4HANA 5T50A 1APNA 5IT6A 2NMOA 2ZGKA 1W6OB 3WZ1A 4F83A 2E51A 4R9CA 4ATEA 2EXJA 2AENA 3OY8B 4FPGA 2GALA 3APBA 1SBEA 3T1MA 3UJQA 3WUDA 1W6MA 2DTWA 2XG3A 2ZGTA 4PBPA 4GKYA 1LEMA 2CL2A 4FPFA 2C5DA 3HR9A 4DPNA 1X50A 4D69A 1V00A 1H9PA 1F5FA 4Q26A 1SLIA 3OGGA 5SV8A 3W59A 3L2YA 1G9BA 2JD4A 2ZGPA 4ISQA 3QCWA 2ZHKA 4R9AA 1YI7A 4Y1YA 4CRQA 3OJBA 3T1LA 5GLWA 1LODA 2ZGLA 1WLWA 3M2MA 4RA0A 1V6KA 2GNMA 3FUQA 2RHPA 2VUAA 3LSEA 1BZWA 1KDMA 2ZGSA 5EXOA 5T52A 1DQ2A 3MEPA 4DQAA 2FMDA 1ULFA 1I1EA 1ENSA 5IK8A 4ZKTB 1AX2A 1F31A 3KQRA 2A70A 1N1VA 3M3CA 1DQ5A 3WCRA 2R0FA 3NWKA 1GSLA 1SBDA 2YY1A 1D2SA 1S1AA 2BQPA 2D6PA 2P2KA 4ITCA 1DQ6A 5IK7A 3M3OA 3SH5A 2V73A 3WHTA 4LBLA 3WV6A 1LHVA 3NV4A 2P37A 4WVVA 1HKDA 1WBLA 2DV9A 2P3IA 2E7QA 1W6OA 3SISA 4XJWA 2P3JA 3POWA 2ZHMA 4KBBA 5GZDA 3OY8A 3AZWA 1YYNA 1S0BA 2H0BA 3IKWA 1CR7A 1GANA 1AF9A 4XTPA 5JOYA 1AXKA 5GM0A 2G4IA 3VKMA 2GMMA 4P9YA 5GJ6A 1N1YA 2VW1A 3AZZA 4Y24A 4YW2A 4AGGA 2DU1A 2ZBJA 4AWDA 3UL2A 1GNZA 2ZMNA 3O0VA 3D5OA 1IKQA 4Y22B 4XXPA 2WJSA 4MYEA 3VV1A 1V6LA 2CWMA 4Q1PA 4C1XA 1WD3A 3GNEA 1LOCA 4GXLA 1DLLA 4FPCA 5IUQA 1WBFA 3BTAA 1C4RA 1MR5A 4PBOA 4Q8KA 2W39A 4M01A 3JU9A 3BIWE 4YG3A 1G86A 3SH3A 4XBQA 3AZXA 2OW4A 4FOQA 1AXZA 2P3KA 3B00A 4WVWA 3RMYA 4M3CB 3ZYRA 2DYCA 4YM2A 5GLUA 4DRVA 2A5ZA 3H0OA 3ATGA 5DUWA 2D6MA 3R4SA 5DZGA 1GLHA 3USUB 1G9FA 3SITA 1ULEA 3GALA 3IN9A 3AYDA 2JJ6A 2WT0A 3BOPA 1VIWB 3ENRA 1AJOA 4AGRA 3NV2A 4BMEA 5DZFA 5KXEA 4Q2FA 2ZKNA 1Q8OA 2V5YA 2AGSA 4Y26A 3ZXLA 1WD4A 4BPZA 1LHOA 3AP9A 1G9CA 2VW0A 1AXYA 2WKKA 2PHWA 1ULGA 1W0OA 4TZDA 2EXIA 3D6EA 3O5SA 2GNDA 4DFSA 1KJRA 3M1HA 1SLCA 4Y22A 4LBJA 1S0GA 5H9RA 1OFSA 1AVBA 1LHWA 3VKOA 4YZ3A 2JE9A 2AREA 4XMAA 1WW4A 2C9AA 1CQ9A 4YGEA 4YM0A 1LU2A 1CJPA 1CONA 4FPHA 4XILA 1KRIA 2GDFA 4PF5A 2ZGNA 4YZ1A 1MS5A 2R0HA 4XOGA 2WNEA 5JOXA 3OYWB 3QLQA 3M3QA 1RIRA 4M3CA 5DXDA 5EWSA 1LOFC 3B9CA 1NLSA 1LOFA 2AUYA 3MW3A 4FP3A 4K1ZA 4P9WA 4CTEA 2ZMKA 3A0KA 5CA6A 4FQZA 3USUA 5GZGA 1V6JA 3POSA 5EYXA 4U2AA 2DURA 1UMZA 1GZWB 2R16A 1V6IA 2ZABA 4XJAA 5HCAA 2LTNA 1QU0A 2HYKA 4Q1RA 1WCSA 2A6YA 3AZYA 5KXBA 1CIWA 4LBNA 1DYPA 1S0FA 1JHNA 2DUPA 2R49A 4JRAA 2W08A 4UW6A 5DUUA 1R1ZA 2ZACA 3R4UA 4ZXKA 1WW6A 5T5JA 2DVGA 1LHUA 1VALA 1JXNA 2YZ4A 1BYHA 1QNYA 4YLZA 1XQNA 1TEIA 3WDTA 4M3CE 3RSJA 3WCSA 2PHUA 1YXWA 5F9TA 1WW5A 1QMJA 2GNBA 1FNYA 4YW3A 1ZM1A 3Q9OA 1SCRA 3ASIA 3B69A 2A71A 2P34A 2AYHA 2E6VA 1MS0A 3CNAA 5JMCA 5T55A 1VLNA 1CVNA 4FOVA 1DQ0A 3HMYA 1Z0HA 1KDKA 2KM2A 3OYWA 1CPNA 3RMXA 5GZFA 1S0CA 1LGBA 5EYYA 3WDUA 4LBKA 1B09A 1SBFA 4YW5A 4AGVA 2AR6A 3IM0A 3PVOA 1HLCA 1AJKA 2WSVA 3A0NA 4UW5A 4XJUA 5FREA 2UURA 1FNZA 1MVEA 5H9SA 2A6ZA 3O12A 1MACA 1GYKA 1ULDA 2CWSA 1GZWA 4R9DA 1UL9A 2ZHLA 3FLTA 4XXAA 3INAA 2EF6A 4YM1A 1FATA 4XZPA 2PHXA 5DUXA 1W6PB 2ZA9A 1UX6A 3WDXA 3NV1A 1CESA 4HL0A 2R1DA 2GMEA 3RS6A 1GNHA 3KM5A 1MVQA 4FPKA 1YIFA 2UWAA 3AP7A 3WVJA 1IS5A 1KITA 2ZHNA 2NN8A 3N7KA 4YW1A 5GLTA 3PVEA 1KJLA 1QOTA 3VKFC 1LOAA 3ZXJA 4DRRA 5IK5A 1ZA4A 4IQPA 2GMPA 2DVAA 2JKBA 4XDQA 4AVTA 4YZ2A 4LBQB 1A78A 3AYAA 1PZ7A 1C1LA 1JUIA 1QOSA 4Y1UA 1FX5A 2YMZA 2A6VA 3I4IA 1LCLA
chains in the Genus database with same CATH superfamily
1EUTA 5FK7A 2JDPA 5A7WB 4TN7A 4KU8A 2Q1ZB 1LU1A 4NIAA 3K46A 2N7GA 3UT0A 4CDXB 5AFEA 1ONAA 1SPPA 2OUJA 4UXAA 5FKBA 4IE5A 4GIQA 5T54A 4Y5TA 1V6OA 4GB31 4YARA 5JSPA 2QBXA 1GKBA 2HEVF 2HWC3 3V0BB 3RZHA 4GMP1 1AR91 1RUD3 5J98B 1UY4A 3ZXEA 4ZHNA 1GOFA 3ILRA 5IHRA 2Y38A 3HBZA 4LHLA 5BNPA 1ZBE1 4DUWA 3D8CA 2FCTA 3C2UA 3D4KA 4E8CA 2NMNA 4RN5A 1RVF1 2D6NA 3SCGA 3T0BA 4PDWA 2ZXQA 4YW4A 3ZFEA 1D4M2 2WNUB 1HXS2 4HN1A 5FZCA 1NY71 2WA3A 1HV0A 2MEV2 4MGTA 4XQWA 4FPYA 1MZ5A 2D3SA 4QX0A 2A3YA 1C8M3 4NO4A 4CVUA 3ACGA 2P17A 2VW2A 1CGPA 2NYYA 4DZGA 2RVAA 4D3WA 4R8HA 2WWUA 1DIWA 3RRDA 5JSOA 2BU9A 3TEXA 4B7KA 3ZSMA 1CWPA 2R042 3RYRA 4A3ZA 4AVCA 2QQWA 3QD6A 4BQYA 2VL4A 2ET7A 3WNXA 1GR3A 3KVAA 4L11A 4LKSA 2A3WA 3WNOA 4P00B 5F6LB 2XLAA 2B8MA 3KCYA 5J36A 3NV3A 1EPZA 1BKZA 3H42B 4OUSA 4EWDA 3V0AB 5FZ8A 2QKDA 4Q8LA 4U36A 5JXGA 4N53B 1AR72 2VMIA 2HJIA 1R081 3B94A 3DPRA 3NJVA 3TN93 4XFBA 1AR63 5KC6A 3LGRA 4QDRA 3THTA 2I2SA 1OA2A 3N35A 4HT1T 4AOCA 3VDDB 1JZ5A 1PIV2 1P8JA 4CDUC 3H7JA 1ZX5A 1U5XA 4YZ5A 4I01A 3B01A 5JXIA 3NJYA 5FZOB 1VBC1 1QQP3 4DUXA 1JYCA 5F1RA 4KH9A 3ZXKA 4BH9A 3AMPA 2JICA 1DGLA 4FQ4A 2GH8A 1EV11 2WN3A 2ZGUA 4Y5Z0 4D7SA 3JUUA 3NNJA 1OQDA 4EN8B 2NQYA 5GZCA 1YFWA 3WG2A 2WZPP 4IE0A 1KS5A 1H9WA 2W1QA 2R073 3MFAA 1NCQA 5JDBA 3ZVXA 1PMIA 1N1TA 2D44A 2WZR1 5I8TA 5KXDA 5KHHA 2EXHA 4GKXA 1HX6A 1JH5A 2OIIA 5FPLA 1SMVA 3O0XA 3VBOB 1JTZX 5APAA 5FTTC 5K0UA 5A7OA 3VD9A 1GBGA 4LR4A 3BTYA 3FUOA 3VZKA 1AZDA 2FDIA 2IXKA 3VBSA 4WZCA 4X8NA 4QX8A 4MUVA 5A6QA 2AH2A 2PHLA 3FHAA 2JECA 2ADEA 1OQ1A 2VNGA 1XNCA 1O91A 1O8SA 3AYEA 4LE3A 5FYZA 4DY5A 2ZEYA 3E6CC 1Y9MA 1MEC1 2O14A 3WG3A 3LSDA 4I2OA 2WT2A 5DDJ3 5HV0A 1RUH2 3M3EA 5C71A 1W6NB 5LW9A 4TXWA 2JXAA 4OCTA 1YJKA 2VMDA 4K21A 2ZZQA 1MS3A 5FAXA 5LBEA 4XUNA 2ARXA 2OQ6A 5I93A 3HN3A 3OCPA 3ZN6A 4BLIA 4JTNA 4JGZC 4YGCA 3ZMNA 3AM2A 1BQPA 1FYUA 3RI9A 3ZXDA 4B1MA 4Q27A 1VMJA 3C7HA 2XH6A 1O7FA 3AP5A 4PT6A 1H4HA 2Z2SB 1W6QB 1JI6A 4DXZA 4HXCA 1HDKA 5CADA 1RUI1 1H6XA 1W03A 2VULA 2W91A 1KFXL 2I74A 3IPVA 4FVVA 5FO7B 4IEPA 2MPFA 3VHNA 2TNFA 4CEWA 3JBG2 4CDWA 4BQ5A 2ZGOA 4AHWA 3VD7A 1UZ0A 4H7LA 2VM9A 4DS0A 3NNFA 4LPLA 1J59A 4AE2A 3LDBA 2EIGA 1MS8A 4OHXA 2EAKA 2EALA 2WWSA 3EQEA 1OURA 4K20A 3ZSKA 1CAVB 4Q29A 3WNNA 1LGNA 1YQ8A 3OBTA 3RVHA 3K75B 3L9JT 5C9AB 5IJRA 1JZ6A 3MZHA 5FZ7A 4WVMB 2TUNA 1X36A 4UF0A 5FY9A 3S0MA 1ND2C 2W68A 4NIIA 2VZRA 3VN4A 3LCPA 4UI9L 2JWPA 1FMD2 3V64A 5FOJB 3DYMA 5HCBA 4GALA 2AACA 4ISRA 4O61A 1HQWA 1PGW2 4AI3A 2A7AA 1YQ5A 3J7HA 2WWJA 2BRTA 4UW4A 4FSJA 1IPKA 2G9GA 1VR3A 1W6MB 1QJU2 2I45A 2UWCA 1UKGA 4NJ4A 3UV9A 5F5AA 4QKDA 3WDYA 5EJ3A 1X82A 1I6XA 4BHPA 3VBRB 5CNAA 4WZFA 2ZGRA 4AVBA 4I30A 1RUF3 2CSGA 4JV4A 4KG8A 3VHRA 3VKLA 1W9TA 4GH4C 3TBDA 1SFNA 4PF1A 2C1FA 3I59A 2W87A 3Q8CA 4R4XA 1G6NA 1JOBA 3AMHA 2RR13 3W9AA 2NP0A 4RQPB 3NKGA 1QGLA 4JGYB 1AYN3 2BOIA 1K3IA 3GXUA 5FZ9A 1PVXA 3I3MA 5HCFA 2WO3A 4J25A 2FHRA 2W94A 2VECA 1Q8QA 2VJXA 2H6BA 2WS91 2XQXA 4HN0A 4CP2A 2VUDA 1HQLA 4MG2A 5ANNA 3ZXAC 3ZFFB 3VGIA 1DP0A 4Z8BA 5A1LA 5CISA 1T6GC 1JBCA 4PCRA 4KG0A 2PAKA 1EPWA 5GLVA 1S2EA 4UFMA 1IS3A 5JIAA 1FT9A 4Y1XA 2JIJA 4YM3A 5HXMA 1NA1C 3MIFA 3C7OA 4ZXEA 2BNOA 4HANA 5B4XA 5JAXA 4RR3B 3ZFGA 4JHZA 1W6OB 3WZ1A 4UBGA 4XZUG 4Z2WA 1PVC2 1H2KA 1W05A 2AENA 3WR0A 2R062 1SBEA 3WUDA 3O1OA 1ZYBA 4AHXA 5A3TA 4Y3OA 4QDQA 4PBPA 1V9U2 1UYZA 3HR9A 4ORFA 1X50A 4GZ9A 3WP4A 3OGGA 4LORA 4Z82A 5FPAA 3SKVA 1B35B 1G9BA 2ZGPA 4ISQA 4HG6B 4E2SA 3DF0A 1TME3 4CRQA 2XBO1 3KV5A 4LT5A 3GYDA 1TNFA 1PNFA 2IVIB 5GLWA 2Q30A 1HRI2 1UNBA 4BE3A 2JEMA 4RA0A 1V6KA 2GNMA 3FUQA 1DG6A 4KMQA 4Q4X2 2ZGSA 5IVBA 5A3WA 3VBUC 1VAKA 1COV3 1F31A 4DXSA 4CCOA 2A70A 2WDBA 1J3QA 1DQ5A 3GBFA 2XQRA 3WCRA 2P3YA 4BIFA 4E4SA 5CFDB 1PGL1 1PK6B 2WR9A 2WZEA 4XUQA 4ASLA 4BDVB 1RXFA 1SBDA 5JPMB 4EROA 4RHV3 2Q8CA 5FZKA 5FY0A 3U4SA 4IEQA 3VBFC 1H1IA 1NAEA 1ULPA 3I54A 5A32B 1D0GA 3FJSA 3T0DA 2DV9A 1BLZA 1HRV2 2PA7A 4RYDA 3IIIA 1CAXB 3POWA 4A41A 2WQ4A 4NROA 4KBBA 1ZVFA 5EHDA 1JS9A 1YYNA 4IERA 2HEYF 1AF9A 4YNIA 5FLJA 1XRUA 1YWKA 2BV4A 2OZ6A 1JUHA 2HEWF 2ZOEB 2B39A 5CKQA 4AQSA 2W9XA 3J8F1 4ASKA 4MLOA 4JKKA 4FCAA 4AGGA 5F6KA 2X5IB 2RS52 1GNZA 5F5IA 3O0VA 4QMAA 1CAUB 4Y22B 4XXPA 4QX3A 1V6LA 1ASJ2 3ZMOA 4MOAA 4L9BA 5DPNA 4IEZA 2LS6A 5IUQA 2JDNA 1WBFA 3VZOA 3BTAA 1OI6A 3CF6E 2JG9B 3WNKA 3EBRA 2PFWA 4PBOA 3FHIB 3I2HA 3JU9A 3BIWE 1OOPB 4FFFA 1W04A 1VRH1 3K4DA 1AXZA 3LPFA 3B00A 4PJYA 4UFLA 1Q3EA 3ZYRA 4TWTA 1VE0A 3B7MA 4ARYA 1AL23 4A6OA 3WF3A 3AB0A 3GHMA 3OBZA 2XONA 4RS5C 3ATGA 1H8TC 4L0PA 1GLHA 1QXRA 3USUB 5CEHA 4UFJA 3VZMA 5BPXA 4ES8A 3AYDA 2WT0A 3CMGA 1AJOA 2P6CA 2RMU2 5AC93 5FUIA 4Q2FA 1UF2C 1GUIA 2QQLA 3ZIXA 1Q8OA 2CDPA 2D98A 3AMMA 2QZ2A 1VRBA 3PDQA 5LA9A 4BPZA 3VD5A 4S2DA 1BEV2 1NCRA 2CDOA 4TZDA 1W0OA 2V4AA 2EXIA 3D6EA 5FY4A 5JIUA 1GU3A 5K7PA 2GNDA 4QHBA 4DFSA 2BWAA 4QPIB 5FLIA 2D5HA 3WX5A 5D1IA 1O3TA 1FOD1 1S0GA 5J1XA 5C5UA 3POBA 3AL6A 1LHWA 4HSLA 3RZJA 1UYXA 1EAH2 2GC0A 5IATA 2C9AA 3LOIA 4GQ7A 3ALQA 4YM0A 1LU2A 4PLOA 3ECQA 5BV6A 2E7AA 3CDZB 4YZ1A 4QHZA 1MS5A 4QM8A 3OUHA 4BK5A 3OGVA 5FMOL 3M3QA 3HIFA 4HMZA 3WW2A 4M3CA 3BOWA 2K46A 3LDRA 1MQTC 2GP3A 5I0SA 2AUYA 5ACA2 4P9WA 2ZMKA 3T4VA 1ACCA 3M4FA 3POSA 1UOJA 1ND3A 2DURA 1UMZA 1GZWB 3BYWA 4XETA 4BQ4A 4JTOA 1QIQA 3TEZA 3BVCA 1W3VA 1S4CA 1RUNA 1O3QA 2HKXA 5F39A 3ACIA 2WNVC 5IFTA 2A6YA 4RSUA 4TSVA 1PNGA 1DYPA 5FWEA 3VBSB 1S0FA 1TMF2 5FXXA 4CCEA 2GC2A 3WEZA 4IGOA 1UOFA 2CGOA 2DUPA 3ACHA 3EB7A 4LA3A 5FKCA 2ZACA 4LMFA 2DVGA 5FQ0B 1VALA 1XNTA 4NUBA 3O1SA 1HW5A 3JD71 1QNYA 1UZWA 1PO12 4PI2A 3U07A 4DNYA 2GNBA 1WW5A 5CFCB 2WLPA 5IAVA 1F35A 1BVVA 1QJEA 1SCRA 1XYPA 2A71A 2P34A 1JU4A 1A6CA 2E6VA 2JG8C 1OF4A 4LULA 4OUEA 2XPJA 2B5HA 2RJKA 4LNVA 5L7OB 1PO21 3KCXA 3RMXA 5EYYA 1Z7S2 1SBFA 2OS2A 2IWGB 3IM0A 4NIHA 1QJX1 2XJTA 4DEQA 2WSVA 1GWMA 3JQWA 4GJYA 4OI4A 3CL1A 2UURA 4GB33 4QKFA 3O12A 3I3DA 1ULDA 1AYM1 2YBSA 5IVCA 3A23A 2BGOA 1AR93 1C28A 3IB3A 2UYBA 1RUOA 2WC2A 1H2NA 2VUCA 3FLTA 3INAA 1VBB1 4YM1A 3MLLA 4A2UA 3I3QA 2PLV2 2Z4FA 2ZEXA 1K5MA 1ZBE3 2GH2A 1W6PB 1WCQA 4OI2A 4Q4Y2 3K2OA 1ZBA2 2ARCA 2ZA9A 3NL1A 4QB1A 1CESA 1RVF3 1XB9A 3ZYGA 4HL0A 2PAEA 2R1DA 4J1WA 1GNHA 4CDQA 1R092 4V2WA 4XF3A 4QPGC 1TME1 2UWAA 3AL5A 4E8DA 1RUJ1 1SFPA 5B2GB 2JDHA 2NN8A 3HQUA 3N7KA 4YW1A 2WN2A 3ZR5A 3ZXJA 2WQ8A 3GJBA 4DRRA 2PN5A 1ZA4A 5FO8B 1O6UA 1WCUA 2WZ8A 3PJYA 4LBQB 3AYAA 5FZ0A 1PZ7A 2JENA 4KWUA 1FPN1 1JUIA 4QD2A 1H1AA 1VBA1 4NE9A 2YMZA 2JX9A 3ETPA 1UY3A 1UAIA 4YFWA 3LEGA 3JB8A 4OI0A 3H1WA 4JCKA 1RUC1 1ZZ8A 5CBLA 4OZXA 5F7UA 2P6HA 2WFPA 2HWC2 2GC1A 2CU5A 3CZUA 5LWBA 3GBWA 2ZX1A 5J48A 1RUD2 3GF6A 2CTVA 2JKXA 4XHBA 1Y43B 5G04L 1U5YA 5LBBA 3K3NA 1YQ6A 4LIUA 4E4HA 4QDSA 1UCXA 2BVVA 2B42B 4J1XA 1W0PA 4K3UA 4FTEA 3ZOIA 3I7DA 1R083 1CJDA 3H1MA 4EN6B 5JOWA 2XXZA 5BNPC 1SZBA 4KWJA 2FZ1A 5CAZA 2OXBA 1BBT1 3BODA 2GN7A 3C8XA 3VZNA 1OSGA 4PLNA 3TEWA 1W3XA 4PDWC 3ZFEC 5J37A 3GHNA 4D6RA 4CDUB 1C8M2 1L3JA 2FZ2A 1VBC3 3LAGA 3OPZA 4XC9A 4L2NA 1XJAA 3NSTA 3RI8A 2PQQA 1PGSA 2IZWA 1MS9A 1QH7A 5JXHA 2PHDA 1WLTA 4QQOA 3MIHA 4AYUA 2KR2A 1EV13 4RL7A 5LEJA 5LRRA 3PNAA 2YFZA 2XB6C 5EZWA 1XNDA 1VB4A 1CZTA 1VBE1 1Y9QA 4MGSA 3POIA 1OLME 1MZ6A 4W6WA 1G9DA 5E88A 3DUIA 2ZX3A 4KQ7A 4YG6A 2WZR3 2QQJA 1NG0A 5IVVA 5H9PA 4FP2A 4X6RB 4YGBA 5F32A 5FZ1A 3WOGA 2BTVC 3VHOA 2BPA2 5A7NA 1I3HA 4XF0A 3BPZA 1ULCA 3P3NA 4WM7A 1SCSA 3TN92 3HQRA 5T5OA 3KZ4C 4HVQA 2VCBA 1QJZA 4FOYA 4NHYA 1AR62 2JDZA 4CEYA 3DPRC 2RS31 2R6QA 4CYDA 3I49A 5D8AA 5FXWA 4QXBA 1BMV1 4CUAA 1DBNA 1QNWA 1UZYA 3I2KA 2DUOA 4AR2A 2ZX4A 4NRPA 1UYYA 5E1RA 2E26A 3AP6A 4HK9A 1QQP2 3POYA 1OVSA 1H30A 4KGGA 1MEC3 2WA4A 1LKNA 2D3PA 1SLBA 4I3GA 4YZ4A 5F3EA 1LOEA 2BUKA 3VBHA 4B4RA 4CP9A 1ENRA 3RYPA 3OG2A 3DYOA 1IKPA 1YRZA 2A1XA 2A75A 2RDRA 3TOJA 4A6SA 2OX0A 3O0WA 3N9LA 3BB6A 1LHNA 1CAWB 1S55A 1OKQA 2D3RA 1NKGA 4XIOA 1IHMA 5FV3A 1I1EA 2ZPXA 4IETA 3THCA 2HBTA 4BQXA 1A8DA 1DCSA 3I2IA 3HAGA 2R072 4HVRA 2JDAA 1I5ZA 4LK6A 2VU9A 2HH9A 4AEDA 1QKQA 1IOAA 4L8QA 1NCQC 1NLQA 2Q1FA 4Y20A 3LD8A 3RQ0A 3VDAA 1D0HA 4AAPA 1O3SA 4AHZA 1YQ2A 4CZSA 1H0BA 2P5BA 1J83A 1NXD1 4MGIE 4AVSA 5K0UC 3PUIA 3AYCA 5DAQA 2PTMA 4H55A 4Y1ZA 1LEDA 2A3XA 4DO0A 4AFCA 1GOHA 3H3UA 4O9GA 5FPZA 5FZ3A 1X9PA 5DABA 3VBSC 2ZMLA 4CCKA 1FV3A 2JDYA 3MICA 5JR7B 1HQNA 5J3UA 2CHHA 4GWJA 5DDJ2 3AMQA 3AFGA 4FAHA 1NLRA 2VQ0A 2P1BA 1DF0A 1DYOA 1S2BA 2Y0IA 3HQXA 2UYAA 4OHWA 2SBAA 2RS11 1BK0A 3AC0A 3GBGA 1ND2B 3FBYA 3T3YA 3V65A 3ZKYA 1DDLA 3VD3A 4XURA 2XJPA 3VUOA 4FTSA 1KQRA 1Q8VA 5IK4A 1IS6A 3S30A 1CX4A 3LA7A 3FLPA 3PVNA 5G05L 4C0BA 4LA2A 3FZ3A 1O4YA 1U0AA 2Y6LA 1VMFA 4XPVA 4BQ2A 1QOOA 2VNRA 4BQ1A 2WSUA 3POFA 3ZPYA 2FDFA 3W58A 1N3PA 1GP6A 4K6BA 4ATFA 1NCRB 4ZS2A 5TSWA 1LOGA 1YJLA 4LIVA 5LA0A 1W2AX 4GH4B 3UJOA 3SC7X 1DZQA 5F5QA 2B9UA 3ZSLA 1AX0A 1Y7BA 2W1SA 1F5JA 3SNMA 4CDWC 4DY3A 4Q4W1 2NZ9A 5IW0A 3FC0A 4XJZA 1AHSA 1Y9GA 4Y33A 4QT6A 2WS93 2X05A 3VKNA 3WG1A 4CEWC 4FPJA 3LA3A 2X10A 3KT1A 2EIBA 4IXLA 4B4PA 2EA7A 4W6YA 1UY1A 2V72A 1IG3A 1F9KA 1YFXA 1SHWB 2LALA 3EXUA 2J1AA 5FWJA 5IVJA 3C7GA 3KHCA 1LULA 3CU7A 3JB4C 1NA1B 1W8TA 1DZRA 2CV6A 3M70A 3AJZA 5E89A 5FZMA 3SH4A 4A45A 4GWNA 1WLCA 3HT2A 4XMIA 2OZJA 4ASMB 5LK7B 1LGCA 2GAUA 5FUNA 3N7MA 5CB7A 1RUF2 1WA6X 1JU3A 5FY8A 1BK1A 4LJHA 3WNLA 4I0AA 4NPLA 4XYXA 4XFAA 1H6YA 2XMLA 1RITA 5LBFA 2RR12 4GA9A 1E5IA 3RPQA 4AL9A 4QX7A 3P1IA 2XBO3 1RHI1 1AYN2 2DVBA 2DCJA 3NNLA 5HPOA 3CEWA 2FQPA 2CGNA 4IL7A 1N47A 4IE4A 3WSOA 1US2A 2JDUA 3CO2A 2VZUA 5JSRA 2J42A 3J26N 5A3NA 1V6NA 5FP7A 5FYTA 1EUUA 3PTYA 1LTEA 4IEYA 4NWVA 4B4QA 3RZGA 5FMCA 1YEWA 2VTXJ 1A3KA 4Z92B 1W8ZA 2QFEA 1N1SA 3VBUB 4XJ8A 3O1RA 3I2OA 3B3QE 1WUVA 3AXEA 2VZOA 2OVUA 4BB3A 3FHQA 2E32A 3N36A 1GZ9A 3VBFB 3MF6A 1VB2A 3ZFGC 3E5UA 5IT6A 2ZX0A 1H1MA 2W5FA 4F83A 1VMHA 5KC5A 2E51A 1Y4WA 1GZTA 2AZ5A 2W0XA 3NW4A 1OXCA 1I9RA 3OY8B 3RZMA 3OF1A 3UJQA 4N43A 2XG3A 3RZKA 4IE7A 3BU0A 5A33B 1K5MB 2JDMA 3J8F3 3NJZA 1W8FA 3I2DA 5CIRA 1TME2 3EMRA 5FP8A 5EPAA 3KWVA 1NOVA 2BVBA 1H9PA 3IDCB 5SV8A 3OUIA 1R1A1 3W21A 5IVFA 1US3A 4BK4A 3L2YA 2JD4A 2ZEWA 3QCWA 1WMDA 4GULA 4R9AA 4Y1YA 4E4DX 5ISLA 3MIDA 4BJ0A 1RYYA 3U11A 3O1TA 4G3YC 2K2SA 1WLWA 2XLFA 1COV2 1KFUL 4IV3A 5LA2A 2RHPA 3LSEA 2VCMA 4BU2A 3MEPA 1RXGA 5C4WA 5A7QA 2OT7A 3MLJA 1VRH3 4ZKTB 4CCJA 4RHV2 5BUVA 3KQRA 1N1VA 3JQXA 1RMU1 3DV8A 3H8XA 2W3JA 3CHXA 5CYYA 1GSLA 2YY1A 1D2SA 1S1AA 3M7AA 5FZ4A 1OA3A 1DQ6A 1VBD1 4O65A 3SH5A 1NQDA 3RJ2X 3WHTA 3A7QA 1HB4A 2ILMA 4RS5B 4AQTA 4FT8A 1H8TB 5LBCA 1HKDA 1WBLA 3MUZ1 2P3IA 4XQDA 3GZEA 4WBBA 2FCUA 4QPWA 2IC1A 4W50A 2Z69A 1W8HA 5F3IA 2RM23 3CIHA 4XFCA 3PUQA 4KNCA 4CPBD 2H0BA 2YYOA 1CR7A 1NZCA 4XCBA 4EQVA 2HWD1 1GP4A 2WNOA 2ATFA 1W9SA 4OMCA 3VKMA 4MHRA 3U75A 4E2QA 1N1YA 2VW1A 3UGGA 1WCKA 2B4KA 4CUBA 2BGCA 4QU2A 1SDDB 2Q8OA 2KD7A 1FOD3 2LW8A 1C5IA 4MYEA 3ZKUA 2Y6HA 4ZU5A 4Q1PA 1OUSA 1WD3A 2VZQA 3H1YA 1QHDA 2J1RA 3B02A 4WVZA 2YBKA 1UU6A 2P4EA 5KR7A 2NLRA 4M01A 1W2OA 3RZLA 3POJA 1AL22 4B8EA 1UXXX 2P3KA 4RGAA 1RL3A 4IESA 4AI0A 1MZFA 1XC6A 1QJY1 5L9BA 4DRVA 4MSVA 1GNYA 1MQTB 1J3PA 2WUHA 2Z5WA 1OVPA 5DUWA 4A7ZA 3PUAA 4AQ2A 5AC92 3ABZA 1SQ4A 1JHJA 3B93A 1HB1A 4YYOA 3SITA 4WM7B 3ENRA 3BOPA 1VIWB 4IV1A 3TNQA 3WNMA 2BEOA 3BI3A 1ZRFA 2XR4A 1STMA 2B9VA 4MX3A 3N9NA 1W06A 1AR81 5D8AB 5FP4A 1RUE3 1PMHX 2WNVB 3M3IA 3J7LA 2ZS6B 1NCRC 2XL9A 5A3PA 3AP9A 1G9CA 2VW0A 2WKKA 2YBPA 4QGLA 1ULGA 5FK8A 3E6DA 1TQ5A 3BKZA 2BERA 1SLCA 3JD73 2PQSA 3POGA 4I09A 2TBVA 3OEAA 4JKMA 5H9RA 2VTFA 3ORJA 3GM8A 3ITQA 4HKOA 2XJRA 2FDJA 1AVBA 4JKLA 3VKOA 2BFUL 2JE9A 4YZ3A 2AREA 3PU3A 2G9ZA 4O9EA 4OULA 2RE9A 3DKWA 5JI7A 4PLMA 1UIKA 2YG0A 3MYXA 2GDFA 2YC2A 5J96B 2YPDA 4Q5OA 2R0HA 3MO4A 3NAPA 2JG8B 5JOXA 5ABJA 1PO23 3OYWB 3QLQA 5FIXA 4AQ6A 5F2WA 3JZVA 5DXDA 3X29B 1NZIA 2QQMA 1H2LA 2XVKA 4Q0SA 1QJX3 3HPNA 5FYSA 1KD7A 4K1ZA 3VL9A 1X8EA 5IFPA 1IQAA 3I3BA 5CA6A 2WO1A 4HPKA 4Y4RA 1ND3C 1AYM3 1V6JA 3LEKA 2R16A 4PI0A 1NE4A 1J1LA 1V6IA 2PYTA 4MZUA 4XJAA 4D6SA 1VBB3 5HCAA 1QU0A 3AKPA 3S5AA 4NN0A 4LQRA 4P9IA 3KLSA 3PU8A 1CIWA 4LBNA 1EY2A 1H2MA 2UY9A 1V0AA 3H3LA 4FAGA 1U5IA 5M0TA 5EJ1B 5KHGA 1IPJA 5FOBB 5FY1A 4UW6A 2DCKA 5DUUA 1W90A 3R4UA 1WW6A 4PIZA 2VAUA 5AVPA 3UETA 5DMYA 4I3PA 1JXNA 2A73B 2YZ4A 3OEBA 4NAOA 1RUJ3 4UFHA 2ZJCA 3LE0A 4CU8A 4QPGB 1ZZ9A 3WDTA 4LO5B 1VP6A 3ZDVA 4D8MA 5BY5A 2CAVA 5LATA 4LLOA 4M3CE 3RSJA 2PHUA 2ZAHA 1QMJA 1ZZBA 1FNYA 2G19A 2QTWB 1XE7A 4MGYE 4COWA 3Q9OA 3H9AA 1OLRA 1GWKA 1ZZ7A 1FPN3 1VBA3 3O1UA 5JMCA 4L97A 4AEMA 5C3RA 4Q4V1 4FOVA 3LB9A 3HMYA 1KDKA 1RUC3 1CPNA 4FFHA 4GB32 2ORZA 2VVDA 2EVXA 3BCWA 2AR6A 4IDZA 3M8LA 3WP5A 3PVOA 1AR92 1RB8G 2JE8A 1AJKA 1SPPB 2XDVA 4IEWA 4UW5A 2C24A 4XJUA 3W5MA 1QY4A 2YPJA 4LLFA 4IEXA 1WA4A 4FFGA 1GYKA 4IUGA 1ZBE2 1UOBA 5F37A 4NHMA 4R9DA 1UL9A 2RJ2A 2NPIA 4XXAA 1RVF2 5FZHA 5IVEA 1K5MC 3IBMA 1FATA 4XZPA 2HWE1 1BBT3 1NY72 1QWRA 5BNPB 1S2KA 3WDXA 1UX6A 1X33A 1RJ8A 3NV1A 4CA9A 4CDQC 2HWF1 2F17A 4NHLA 4LHNA 4PDWB 1OMIA 2XHKA 3ZFEB 2VOVA 3UGHA 4FPKA 3WVJA 1JZ3A 4M0NA 1E5RA 1KITA 1RUG1 2VVFA 2JDKA 3PVEA 1QOTA 4KL1A 2IXHA 1LOAA 4NRMA 3UKVA 5IK5A 4TTGA 1IQDC 4I0BA 2JKBA 3WP3A 1BHGA 2QZ3A 1A78A 1YIPA 4LO7A 3KQ4B 4QB6A 5CZKA 3C3VA 3QH7A 1VBE3 1C1LA 3K48A 1QOSA 3NNMA 4CU9A 1FX5A 2DCTA 2A6VA 2ZGLA 4YVWA 3AMNA 2ERFA 3E6BA 2HWB1 4XBNA 2BP6A 1L7LA 2DU0A 2CGPA 4ZY9A 3IMNA 1DGWX 3UK9A 1JODA 4C1WA 1OD5A 4P14A 4P9XA 1W2NA 4UWDA 2XKOA 4MXWA 4XBLA 3QBQA 4X8PA 3E97A 4HZFA 4NVPA 1R082 2W52A 2QVSB 3PL0A 4R52A 1JYTA 4HKLA 3AKTA 4GWMA 1FV2A 2E53A 4XTMA 2RM21 4YVSA 3SCFA 2RS33 5F2SA 3O14A 1PZ9A 3MF9A 3H3ZA 5FP3A 5BNOB 5C8CA 3DPRB 1AUYA 2GP5A 5FYYA 4ZPIA 1YHFA 2ZCWA 1VBC2 4RFT0 2ARBA 4MV2A 1SACA 1TE1B 2J1SA 5L73A 4DUVA 1GZCA 1YQCA 4EV0A 4WM8A 5JWPA 3SEPA 1JYNA 3UESA 4YFZA 5EV7A 4AFAA 5C70A 1S0EA 3ZXFA 3MPPG 2ZX2A 4HETA 4B1LA 1CPMA 4UFKA 1EV12 2QUOA 3KT7A 2GNTA 3L2HA 1J1TA 1TNRA 3ZLIA 1BCXA 1ENQA 2SLIA 4QX1A 1GQGA 4BOWA 3LFIA 3VDCA 1HN1A 3S57A 5FDBA 5A3LA 2DUQA 4AVAA 1JN2P 4AEJA 2PHTA 2WZR2 4F8AA 2LM3A 4XF9A 3T09A 2BYVE 2VZPA 4IE6A 5FZGA 5L19A 3FFZA 3KSCA 3AX4A 4M4RA 5FBJA 4EJRA 5FPXA 5A7WA 3MW4A 3MW2A 1NCQB 3N4MA 3LIGA 1LRHA 2J1TA 4DOUA 4M0HA 5HI0A 5I8SA 1H8VA 3CJIA 4CDXA 2GSYA 2BNMA 1FAYA 3KHBA 4WM7C 5C7GA 1UYPA 1X8MA 2DWRA 1XSQA 2J1EA 2TEPA 3ILNA 2JB8A 4IV3B 4M4PA 2LUWA 1E5HA 1F4AA 4HVOA 3WHUA 4CEYC 5K0UB 3V0BA 4GAZA 3KS7A 1FI2A 4FPOB 4QKBA 5D8AC 4XDPA 2VTXA 5ABJB 3UYJA 5JMOA 2R1BA 5LCWL 1YLLA 3H8UA 4YW7A 1G9AA 1RUE1 1MEC2 2JB4A 3IDBB 4NHXA 5JZGA 1RINA 1UX7A 4OUMA 4TLFA 5DG2A 3UKNA 4LO8A 2RS13 4WV8A 5AVAA 5H9QA 1O5UA 3VBHC 2WNUA 1U5ZA 2C6SA 4IEOA 1U12A 3ZR6A 4MGKE 3U78A 2B7YA 5LASA 1O3RA 1DFQA 5B4NA 5C8WA 3BUCA 2Y60A 3DYPA 3PUSA 1D4M1 1DYKA 1HXS1 5DQ0A 1G8WA 4EYUA 2VNVA 3W20A 1QXPA 1C5HA 1ENXA 4LHSA 4XDOA 4AEDC 2GN3A 3ZN6B 3VD4A 1RUI2 3WUCA 1BJQA 1MS1A 2ZGMA 3KMHA 1GOGA 2Q5TA 1V9U3 4XCAA 3KF5A 2EIDA 2XJUA 4Q4W3 3IPVB 5F8PA 1GFF2 3LA2A 1C1FA 1WLDA 1V6MA 3RGBA 4CEWB 4CDWB 5A6XA 5C3SA 2R041 4ZU4A 5EFUA 4KWKA 2RDNA 1DU3D 3KV4A 4N7IA 4CPBA 3V0AA 2XWBB 4FXKB 1HRI3 4W65A 3LF7A 4N53A 1TVGA 1CZVA 4FPEA 4AXOA 4LBOA 2XGXA 4JDMA 3PIJA 5BNQA 2E63A 2ZGQA 4OVEA 4NPRA 3WDVA 3ZXGA 2VZVA 4NHKA 3VDDA 1AR71 1LECA 5F3CA 4MHUA 4UF0B 3T4HB 3GCXA 3RG0A 2DBNA 3WY6A 4XE9A 5FZOA 3TRSB 2OPKA 1DGWA 1PX4A 3FLRA 4D7TA 2ARAA 4Y4YA 3WDWA 1JZ4A 1PIV1 1OPOA 2YB7A 4IV1B 5FZDA 2F4PA 3WLUA 4H14A 3MDPA 2VZSA 3J4UH 5GLZA 5LRSA 1UN1A 3BTXA 5DG1A 1MS4A 5J09A 5FYIA 4Y1VA 2GZWA 1RHI3 2F6BA 2C4XA 3PHMA 3LIHA 4LBMA 1JW6A 3I59B 3PJQA 4XUPA 3RYKA 2QJVA 2WS92 4H7MA 5E16A 5A7PA 2DTYA 3T2PA 3VBOA 3WQ0A 2Y0OA 3EJKA 1DQ1A 4MGQA 4BIOA 2B46X 1KS4A 2YV8A 4JVAA 5I0UA 4AI8A 1IGOA 1YUDA 3A4UA 4IW3A 3P3PA 3GDBA 1VAVA 4EE2A 3FX3A 4L92A 4XF1A 4OHVA 1LENA 4NWWA 4Q0UA 2VQAA 5FYVA 3N9PA 3DGTA 4AF9A 2NM1A 1O4ZA 4JAAA 4EN0A 3ELNA 3QOPA 3U10A 5F5CA 4NIGA 4AFBA 2HLEA 2WLQA 1UQXA 3ZFGB 4AZZA 1HV1A 4XFGA 1W6NA 4P02B 1Q8PA 4NOTA 3CBNA 4LHKA 3ZYHA 2KXLA 5FYBA 2PHRA 1RUH1 3ZYIB 5A6ZA 1N3OA 2CY6A 2XBO2 3O1MA 1O4TA 1EP0A 1NXMA 2AEZA 1R1A3 4IEVA 1SLAA 2VBBA 3UKTA 5FR3A 2DVDA 3AK0A 4B29A 4H3WA 1S0DA 2WQZC 3IAQA 1W6QA 5FJKA 1W39A 3U1XA 1M06G 3IAPA 4E4ZA 1YI9A 1KXGA 4Y5SA 1I5PA 1QF3A 2BW8A 1QEXA 1QDCA 3HNMA 1PGL2 3D82A 1UXZA 4FOWA 4W6XA 5DUVA 3AVSA 1VAMA 2VOXA 3KB5A 2Z42A 4LBQD 4COVA 2XVLA 4FPLA 1RMU3 3IMMA 3JBG1 4KI5M 1CAVA 1F15A 4URTA 5FO9B 1CN1A 1S0JA 1VBD3 2QQNA 2QQOA 2Q8EA 5C9AA 4WVMA 4OQ9A 3WQBA 4D7YA 4KGQA 4XFFA 4FTBA 5FJHA 1BXHA 2WIIB 5EQUA 2BJSA 2Q0AA 1O8PA 1UW8A 2QE3A 3HN1A 2NMOA 4ZU7A 2ZGKA 3WF0A 3RWKX 3UNPA 4R9CA 4ATEA 3J8F2 2EXJA 3FE5A 2CAUA 4FPGA 1H4GA 4N43C 2RG4A 5FFOC 3APBA 5K9YA 3MIGA 2HWD3 3T2QA 3ZYFA 1FMD1 1W6MA 2DTWA 2ID4A 4GKYA 1PGW1 4FPFA 5A3OA 3WXPA 4I0WB 3D0SA 4UOJA 2LROA 1WKYA 4N7UA 4K9SA 1SLIA 4NRQA 4P9JA 3VBRA 1REFA 4XFHA 2WO7A 1QJU1 2Y6GA 4JDNA 2ZHKA 1YI7A 5JCTA 3B9IA 3ACLA 2Y6FA 3IZOA 5I91A 3T1LA 1SEFA 4L99A 5T3NA 4IV3C 4BXFA 1LODA 1WWYA 2VC9A 4RQPA 4AEKA 3RFRA 1VRH2 2D97A 4JGYA 2RJLA 4MH0E 4DIQA 1WZXA 3OPWA 4K40A 5C4WC 4MXVA 1DQ2A 1UPIA 5IK8A 1AX2A 3K3OA 1ZRCA 1AL0G 3M3CA 3ON7A 4QXHA 3SQOA 2Y6JA 2W2IA 2R0FA 3R4DB 1QJY3 2IUWA 3ST7A 3T0AA 2W46A 3NWKA 3ZFFA 1RGSA 2D6PA 2P2KA 2V73A 4HONA 4K8RB 1CD3G 2RM22 4LBLA 3WV6A 2FDHA 3NV4A 4JX0A 2QDNA 4RR3A 2E7QA 4LUKA 1W6OA 1WGPA 4XJWA 2P3JA 2ZHMA 5GZDA 3FFQA 3AZWA 1AR83 1S0BA 4F7ZA 1CZSA 2E9QA 3IKWA 4XTPA 4DEVA 1JZ2A 5CG9A 3KGLA 1AXKA 4LOTA 5FXVA 2H0VA 2G4IA 3BIEA 1FOD2 1PVC1 4P9YA 1W8WA 1E57A 1K5JA 4YW2A 2R061 3OD0A 3W5NA 3N9QA 2DU1A 2IFWA 1B35A 2VO5A 4V1PA 3GZUC 3UL2A 2IXLA 2ZMNA 4AWDA 3VV1A 1V9U1 1UMIA 2WJSA 3CLPA 4B3NA 4EZ4A 1HB3A 1LOCA 2V09A 2AC1A 4AAXA 1C4RA 4CP1A 3PTRB 4CUCA 5KBFA 2PXJA 1C3HA 4QWNA 4BA6A 3I2FA 2W39A 3WQ7A 4YG3A 1HRI1 2R30A 2XWJB 3KVBA 4XBQA 4LXLA 4DINB 2OQ7A 4JQRA 3FN9A 4WVWA 5CFDA 3RMYA 4M3CB 4QXCA 1PK6A 4Q4X1 3NO8A 5GLUA 3TNPB 4LO4B 5CKNA 2A5ZA 4ET7A 2MNGA 3CJIB 1HJFA 4K8FA 5DZGA 1XE8A 1WCDJ 4K7JA 5A32A 4IV1C 5GKAC 2XJQA 1OLMA 3IN9A 1ND3B 1CAXA 4AGRA 1RUE2 4BMEA 4QB2A 2WFF3 3NV2A 4QQPA 4Z1VA 4CXWA 2VOWA 3T08A 3ZYBA 5LY2A 1HRV1 2WRAA 1ZREA 2AGSA 3ZM8A 1OC1A 3JD72 3MUY1 5JZGB 1WMXA 5FMOS 2PHWA 3R0RA 2WAAA 3ROUA 2X5IA 3HT1A 3O5SA 5FZAA 1CAUA 3M1HA 4LE4A 4Y22A 1QJFA 4XACA 5LZ6A 1LR5A 2K9ZA 1Q43A 4ONUA 2O8QA 5FZBA 2MHFA 3HEIA 3OB8A 1PM4A 4FFIA 5JI9A 1WW4A 2RS51 5DAWA 1PO22 4LEJA 2JG9A 1CJPA 4FPHA 1UIJA 4XILA 1KRIA 1ASJ1 3NAPC 2ZGNA 3QACA 5ABJC 4Q4V3 1OOPA 1YFUA 1QJX2 2WNEA 1ODNA 3DECA 1T2XA 3Q8BA 1RIRA 4BQ3A 2VMCA 1AYM2 5EWSA 1Q5OA 5FZ6A 3S7EA 3FMGA 3B9CA 1LOFA 4FP3A 3MW3A 1GQHA 3MV01 4CTEA 3A0KA 5BNNA 4MADA 3USUA 1VBB2 5GZGA 3G6JB 3CQOA 5FYMA 4U2AA 3RDIA 1NX9A 1REEA 2OYZA 3DN7A 1OLQA 2LTNA 1QH6A 4UT5A 4JQTA 3FWEA 1WCSA 3OOXA 5JXJA 4DB5A 2HWE3 2YGMA 2YGLA 2YUEA 3AZYA 4XQ4A 2UY8A 3Q8AA 5KXCA 3KV9A 4CCNA 4V2VA 2RMU1 1RUJ2 1JHNA 2HWF3 4LKFA 2ORXA 2R49A 4O7XA 2I07B 4NMIA 4CUGA 3ZIWA 2VG9A 4AG4A 4C91A 1R1ZA 4CDQB 4N9IA 3LZZA 4QPIA 3WNPA 1RUG3 1BYHA 4YLZA 1POV1 1TEIA 1BEV1 5IWFA 1FPN2 1W9YA 4QQHA 1VBA2 3WCSA 1YXWA 4QX5A 1OKOA 4HKWA 4YW3A 1F8VA 2VUJA 1XU2A 2XL7A 1L7QA 2QDRA 1RUC2 2H6CA 2BGPA 3H50A 2AYHA 1MS0A 1EAH1 3KF3A 3BGAA 4UYBA 1VLNA 1CVNA 2O8OA 2HWB3 1DQ0A 4RFRB 5T55A 5KWRA 4GD4A 2KM2A 3ZPOA 2Z79A 5GZFA 1LGBA 3AVRA 3S7IA 1DZTA 4LBKA 5FMDA 5FY5A 4YW5A 4AGVA 3KD4A 2R7EB 2Y26A 3THDA 3F95A 1HN0A 1HLCA 1JZ7A 3A0NA 4EWEA 2J7MA 4OLLA 1FNZA 1MVEA 5K4LA 2A6ZA 1MACA 3D3AA 4PIXA 1GZWA 4P9GA 2IVJA 4YWAA 1BBT2 5ACA1 3PURA 2J1UA 2ZHLA 3ME2A 2FBEA 2J1VA 4CCMA 4EWAA 4QX2A 4DXTA 3MIEA 1XYNA 2VOKA 5A70A 2G9FA 5BNOA 3KT4A 2GMEA 3RS6A 3SCHA 5HV4A 2DFBA 1MVQA 2OA2A 3LKJA 4P9LA 5FQ0A 4QKNA 1TMF1 1YIFA 3AP7A 4C90A 4FI9A 1IS5A 4QU1A 2VQUA 3VKFC 1VBE2 3NKTA 4LK7A 1A34A 5CFCA 4EZHA 2D40A 2GMPA 3IDEA 3SXWA 3A22A 5DAPA 2O0OA 4ES9A 1PO11 5FUPA 3NVCA 4Y1UA 4YVWC 2ZEZA 1LCLA 3I4IA 5FZLA 5JVVA 1URXA 4K1YA 2DCYA 5L7OA 3BTZA 5FYCA 2EXKA 4XJ9A 2A6XA 2BWCA 2W47A 2WABA 2E7TA 3OBRA 1SFYA 5FY7A 5C5TA 1YO8A 5DAVA 5IYYA 2RS32 4H2AA 4JRLA 4D94A 1RC6A 3PMSA 1BMV2 1Z7S1 2VZ3A 4YVSC 1PZ8A 2OUHA 5LY1A 5C8CC 2ES3A 3TAYA 4CEYB 4G9SB 1AX1A 3LDKA 1F2NA 2ZZJA 2XVGA 3MGUA 4JHTA 3Q8EA 5FRAA 2VE1A 5JLVA 3BN6A 4XAAA 1IS4A 1XBFA 1A8MA 3JXSA 3ZN5A 1W6PA 4AFDA 2D7FA 2WYSA 4WM8C 2VH9A 1UD1A 2IXIA 4IGQA 5ERLA 3OGJA 2VXJA 2Y64A 3SHRA 2PLV1 4CP9B 3ES1A 3VBHB 3ZO0B 4Q4Y1 1W2TA 1ZBA1 5SV5A 1SLLA 4Q0VA 4JC1A 1D4M3 1JOJA 1HXS3 3IDAA 1R091 4GWIA 3USSA 2YDEA 2YXSA 2MEV3 4LBQA 1C8NA 4MGZE 1W28A 5E8AA 1Z78A 2BNNA 5FP9A 3J7NA 3LPGA 4AEDB 4RGGA 2X53S 2VMGA 1DLCA 1TZOA 3LFMA 2CYFA 1YC61 4A3XA 4Y20B 5FZIA 2VD7A 2PELA 3CJIC 4A7KA 1GQPA 4KBZA 4CDXC 1OH4A 1Y3TA 4E27A 1K42A 1D4VB 1PMJX 4AW7A 5HXVA 1T6BX 3AZVA 4E2GA 2VR4A 3E1F1 4W4ZA 4P5HA 1S0IA 1XPWA 2R043 3AJYA 4PHZA 5T5PA 3R6SA 5C6CA 5D2AA 2VGDA 2A6WA 1SDWA 2HWC1 5FXZA 2WFF1 5LA1A 2Q1MA 4UW3A 3U4XA 1RUD1 4M3CF 1J3RA 1F4HA 4QAWA 4M00A 1UU5A 2RS12 5JZGC 4G4FA 3HNBM 4KU7A 3JCIA 2V5DA 1AR73 1LJ7A 2CNAA 2ENRA 1OBNA 1UZZA 2WNUC 4EN9B 2DBIA 1J84A 4DMIA 3PIGA 4CDUA 1XU1A 4OFGA 3ZDSA 4BISA 3O1VA 4UFIA 5EP9A 1PIV3 1C57A 1NUKA 3N3HA 1ZRDA 1R64A 1RTVA 2Q8DA 1C8M1 4GJZA 4COZA 1JYVA 2DCZA 5FPUA 5IAXA 1CX1A 4LITA 3WF1A 5FZEA 5JUVA 1ST8A 1UPSA 4COUA 4COYA 4OMDA 2YROA 2UU8A 4GMP0 1OT5A 4Q4W2 5I0TA 3ZSEA 2ZAAA 2X29A 1DHKB 3IWZA 3N7JA 1HIXA 4YGDA 3ZSJA 2YU1A 3T2OA 5K8SA 1CIYA 4QQ2A 1UOGA 3T2TA 4SLIA 4A44A 4J6GA 1QXJA 1OH3A 4AI9A 3RJRA 2UWBA 1LESA 4X6QB 1OA4A 3GGLA 3MLKA 4N53C 4PQQA 4QXKA 2VZTA 1Q8SA 2XUEA 4NAMA 2QCSB 3PMEA 4AVVA 1DGRA 3ILFA 3ZN4A 2OPWA 3TN91 1GICA 1AR61 3Q8FA 4HOOA 1DQ4A 3VDDC 1LB2A 2R32A 4PQ9A 4NIDA 3U0ZA 2XOMA 1VJ2A 3NMBA 3FBMA 4R9BA 1W9WA 4URAA 3I8TA 4Z07A 4S2GA 1OPMA 1GV9A 3ACFA 4BM8A 1QQP1 1ODMA 3N9MA 1CAWA 3EO6A 3AKQA 3RWNA 3NJXA 1RUH3 3TEYA 3DXTA 3MPBA 2WO2A 5FYUA 2W92A 4BLJA 5L36A 1RHI2 3GJAA 5GZEA 5C3OA 4YG0A 1QDOA 3K4ZA 3RNSA 2WT1A 3H7YA 1LOBA 4JGZA 3KV6A 3AFKA 2JD9A 3SEEA 4Z2AA 1LAJA 3HNYM 4AK3A 2OKXA 1Q56A 2R071 3BALA 2DVFA 3KCCA 4BZ4A 1REDA 4CU6A 4TYSA 3I3EA 4P08A 3VBOC 1WMEA 3OSDA 4AI2A 3F2ZA 2EAAA 2X8KA 3POEA 3I2JA 1G7YA 4CP0A 3SKJE 2LRPA 4R4ZA 4XUOA 1IZ3A 3WT3A 5EIYB 2QQUA 3VZLA 1POV0 1LNSA 2C9KA 3DCQA 2D43A 2ETEA 3JBG3 3GCWA 1NQJA 4W8JA 4PIYA 3WG4A 5C33A 1DGRN 2PHFA 3AKRA 5FPVA 2D6KA 2XKPA 1UKRA 2FMYA 4CSWA 2GU9A 4LO6B 5E6HA 4OHYA 1RJ7A 3R05A 3K4AA 4HK8A 2D6LX 5BNNB 3DKQA 1ND2A 3J7MA 2QQPA 2WL1A 4NR1A 3ZYPA 1N3QA 1ZZCA 5DDJ1 1BVP1 4TLGA 3V56A 2VPVA 4MVTA 2BZDA 1IG0A 3VLBB 4ZZ8A 5AFBA 3OPTA 1FMD3 1R1A2 3SLIA 4N43B 2YC0A 2J22A 2EICA 2VY0A 1XNAA 2D6OX 5LK5A 4KWLA 5JOZA 2YU2A 4YRDA 4HFSA 4IEUA 3WQ1A 1QJU3 1KEXA 3QH6A 2VXRA 1WMFA 4D6QA 4BMBA 3P5BA 3UGFA 4GH4A 4INDA 5F3GA 2QNKA 3AP4A 2DF7A 1OD3A 5BYNA 2D5FA 1SLTA 2IXCA 3SMHA 3DXUA 1RMU2 2JE7A 4XIKA 4S2FA 1K45A 5GALA 2D93A 4BWOA 2O1QA 5C4WB 1YFYA 1VBD2 4FXGB 4I02A 3AXDA 1X7NA 4XHXA 5A80A 3G7DA 3DL3A 2QQKA 5FPBA 2VMEA 1HJGA 3N7LA 5T5LA 3TB0A 3WW4A 2DDUA 3CZJA 2L9LA 5C9AC 2KA3A 4DXRA 1WW7A 4Q0PA 3S6PA 3IIAA 3ZX7A 1J58A 2VZ1A 3EHKA 3O7OA 1OUXA 5DZEA 2RV9A 2FCVA 4HBNA 1JYIA 5T50A 1APNA 1NA1A 2HWD2 3GZAA 1OF3A 5A7SA 1D2QA 1IPSA 2GALA 3NNGA 3OGSA 3T1MA 1MPXA 1D7PM 2MEV1 1XE0A 2QQIA 2ZGTA 2IFRA 5FMBA 4F3JA 2BBAA 1PVC3 1LEMA 2CL2A 3VBRC 3HD8B 2C5DA 3LEIA 2R063 4DPNA 4D69A 1V00A 1F5FA 4Q26A 3I97A 2W95A 3W59A 3WF2A 1VPHA 1OQEA 4HSJA 4XUTA 3BPSA 1XNBA 3MBWA 3P6BA 1RUF1 1UZVA 3OUJA 3RZZA 2ZTNA 4JZRA 3MI8A 3OJBA 4JDOA 4RQPC 4OI1A 1UY0A 4JGYC 1W99A 2RR11 3M2MA 1GWLA 4CXYA 5LEKA 3I2GA 3WW1A 1AYN1 2VUAA 5A1AA 3E5QA 1BZWA 1KDMA 1W0NA 2C26A 4LUMA 1QJY2 3EYPA 5EXOA 2FMDA 1ULFA 5T52A 4DQAA 1ENSA 4FBFA 5A1FA 3VBUA 4AHYA 3ZFFC 3S5QA 4Q4X3 3T30A 1JMUB 4YPJA 1SG3A 2BQPA 4ITCA 5IK7A 3M3OA 5CKMA 2XJSA 1POQA 3VBFA 3K77A 1LHVA 4RR3C 4XW3A 4LOSA 4YW6A 2P37A 4WVVA 1AR82 4CCLA 2Y33A 3ETQA 3SISA 3WP6A 3U37A 1ZRIA 4GMP3 4C8DA 2W1UA 3OY8A 3U14A 1HRV3 2E33A 4OYUA 1GMMA 1GANA 5JOYA 5GM0A 5I8YA 3ZYJB 1V70A 5A33A 2GMMA 3HVDA 1UU4A 1W8UA 4BXSV 3LQCA 5GJ6A 3KGZA 4CE8A 1B35C 3AZZA 4Y24A 2ZBJA 5HCHA 4E9KA 3ES4A 3A21A 5IVYA 5KHKA 3D5OA 1IKQA 4XFIA 1JOPA 4C1XA 2CWMA 3GNEA 1XNKA 5D21A 1UY2A 4GXLA 1DLLA 4QHOA 2RS53 4FPCA 4ZZ5A 5I0RA 1GP5A 1ULOA 1ASJ3 1MR5A 4P5YA 1NE6A 4NPMA 1XYOA 2F4LA 2JIGA 2Y34A 4QQLA 3HBKA 4A7YA 4Q8KA 3GZTB 3NAPB 1G86A 3SH3A 1COV1 3AZXA 1UO9A 2OW4A 4FOQA 1PK6C 2GC3A 5CFDC 1NT0A 3MFCA 4CXXA 2ZKLA 2XLGA 5FYHA 4ARXA 2DYCA 4XVHA 4YM2A 4BQWA 4UBHA 4B7EA 4BCUA 3FL7A 3H0OA 4RHV1 5CG8A 2VBPA 2WFF2 2D6MA 3R4SA 2EIEA 4RS5A 4HPKB 1H8TA 3PLQA 1G9FA 2C0ZA 4BYYA 1ULEA 3D0JA 3GALA 5JPNB 4OQ8A 1PM7A 2JJ6A 1ZA7A 2BFUS 2PMWB 1O59A 1ZRRA 5DZFA 3H8OA 2VCCA 5CU1A 5KXEA 5DAXA 1ZNPA 2ZKNA 2WBKA 3E5XA 3MIBA 5L9RA 5JR2A 1XOYA 2VBDA 1TG7A 2V5YA 2YFUA 4Y26A 3TWIA 3ZXLA 5J7MA 1WD4A 4XAEA 1LHOA 2RMU3 1AXYA 2X5IC 4OZOA 3LOBA 4XEZA 3THPA 3WW3A 1JYWA 3OTFA 1E5SA 3OGRA 1KJRA 5C3PA 1UMHA 4LBJA 1POV3 3C7EA 1BEV3 2G1MA 1OFSA 1W8OA 3HWJA 5FBZA 5A3UA 4XMAA 5KHJA 4Q4V2 4QGNA 4C0HA 1CQ9A 2JG9C 4YGEA 5EJZB 3IT8A 3NRUA 3BU7A 2XUMA 1CONA 1O5LA 3VDBA 1ZZ6A 2BOJA 4PF5A 5KHIA 1OOPC 1YNAA 2VMFA 1EAH3 4XOGA 2B45X 3WD5A 1M4WA 1XSRA 3PUHA 4OHZA 1K12A 3VB9A 1OHFA 4N9HA 3O1PA 2VVEA 5ANQA 1L7RA 3OBAA 5HBAA 1LOFC 2WYFA 4XF4A 1MQTA 1NLSA 1AL21 5BNNC 2BDRA 4FQZA 2VNOA 2FDGA 5EYXA 5DN2A 4A42A 2HWE2 1W8NA 5ACA3 3CJXA 2ZABA 4LTAA 2IXJA 2HYKA 3AKSA 3LWCA 1MZEA 2HWF2 4HLTA 4Q1RA 4A4AA 5AC91 5KXBA 2WNVA 4XABA 2QQVA 1YCIA 2Y8KA 5BXXA 1RUG2 3MHZA 1EYBA 4JRAA 2XHNA 4MO3M 2DFCA 5L9VA 2W08A 4QPIC 3HJRA 3OD4A 4ZONA 4ZXKA 1NYWA 2V4VA 5T5JA 1TMF3 1LHUA 2FD8A 1XXNA 2K0GA 1HB2A 2VOTA 2HYXA 1XQNA 4LKEA 4CCDA 3H8RA 3B5LB 4AFMA 5FZFA 5F9TA 2E31A 3TYJA 1ZM1A 2HWB2 2RDQA 2HBUA 1PO13 3VHPA 1W9FA 2VMHA 5CVRA 4N8MA 3ASIA 3B69A 1JZ8A 3MV11 5A3MA 3CNAA 2AEYA 1KGYA 4UAPA 5FCCA 2JG8A 4YVWB 3WINE 4QPYA 2XJVA 3URFA 1Z0HA 3OYWA 1ALYA 4JGZB 1S0CA 3WDUA 2FDKA 2WAOA 1B09A 2W1WA 4QM9A 4ZS3A 4D0QA 2X09A 4YSFA 2RDSA 1RUI3 4S2HA 2YHJA 5FLHA 4MXWB 5FREA 4QGMA 4CCCA 2YC4A 3J9SA 1Z7S3 5H9SA 4FO9A 2CWSA 1OFNA 4EN7B 4YVSB 3NQHA 4N90A 3VZJA 5C8CB 1FXZA 2EF6A 4IGPA 1PHMA 1JYXA 2ET1A 2PHXA 3C7FA 5DUXA 3WF4A 4RGKA 4AI1A 2WINB 5BNOC 5I0DA 1UWWA 5LB6A 2Y6KA 4WM8B 2PLV3 4CU7A 3DEMA 3KM5A 4Q0QA 4Q4Y3 2BBVA 3HOBA 1ZBA3 2Q4SA 5A6YA 4SBVA 4LKDA 4QPGA 2ZHNA 5GLTA 4RD7A 5CFCC 1KJLA 2VQTA 1R093 5C3QA 3K51A 3N9OA 4IQPA 3VL8A 1PX3A 4YZ2A 2DVAA 4XDQA 4AVTA 4META 2ADDA 1W2UA 2VCAA 3LEMA 3CKHA 1X9TA 3PVBB 2PAMA 5L7OC
chains in the Genus database with same CATH topology
4KU8A 2Q1ZB 1LU1A 2N7GA 4CDXB 5AFEA 1ONAA 2OUJA 4UXAA 4GIQA 5T54A 4YARA 1V6OA 4GB31 5JSPA 1GKBA 2HEVF 2HWC3 3V0BB 4GMP1 1AR91 1RUD3 5J98B 3ZXEA 3ILRA 2Y38A 3HBZA 4LHLA 5BNPA 1ZBE1 3D8CA 3C2UA 3D4KA 2NMNA 1RVF1 2D6NA 3SCGA 4PDWA 4YW4A 3ZFEA 1D4M2 2WNUB 1HXS2 4HN1A 1NY71 2WA3A 1HV0A 2MEV2 4XQWA 4FPYA 1MZ5A 2D3SA 2A3YA 1C8M3 4NO4A 2P17A 2VW2A 1CGPA 2NYYA 4DZGA 4D3WA 4R8HA 1DIWA 3RRDA 5JSOA 4B7KA 3ZSMA 2R042 3RYRA 4AVCA 3QD6A 2ET7A 3WNXA 1GR3A 4L11A 2A3WA 5F6LB 2XLAA 2B8MA 3KCYA 5J36A 3NV3A 1EPZA 1BKZA 4OUSA 4EWDA 3V0AB 2QKDA 4Q8LA 4U36A 4N53B 1AR72 2VMIA 2HJIA 1R081 3B94A 3DPRA 3TN93 4XFBA 1AR63 5KC6A 3LGRA 3THTA 2I2SA 1OA2A 3N35A 4HT1T 3VDDB 1PIV2 4CDUC 3H7JA 1ZX5A 1U5XA 4YZ5A 4I01A 3B01A 1VBC1 1QQP3 1JYCA 5F1RA 4KH9A 3ZXKA 4BH9A 3AMPA 2JICA 1DGLA 4FQ4A 2GH8A 1EV11 2ZGUA 4Y5Z0 4D7SA 3JUUA 4EN8B 1OQDA 2NQYA 5GZCA 1YFWA 3WG2A 2WZPP 1KS5A 1H9WA 2R073 3MFAA 1NCQA 5JDBA 3ZVXA 1PMIA 1N1TA 2D44A 2WZR1 5I8TA 5KXDA 5KHHA 2EXHA 4GKXA 1HX6A 1JH5A 2OIIA 1SMVA 3O0XA 3VBOB 1JTZX 5FTTC 5K0UA 1GBGA 4LR4A 3FUOA 3VZKA 1AZDA 2IXKA 3VBSA 4WZCA 4X8NA 4MUVA 2AH2A 2PHLA 2VNGA 2JECA 1OQ1A 4LE3A 1XNCA 1O91A 3AYEA 4DY5A 3E6CC 1MEC1 3WG3A 3LSDA 4I2OA 2WT2A 5DDJ3 1RUH2 3M3EA 1W6NB 2JXAA 1YJKA 5FAXA 4K21A 2ZZQA 1MS3A 2ARXA 5I93A 3OCPA 4BLIA 3ZN6A 4JTNA 4JGZC 4YGCA 3ZMNA 3AM2A 1BQPA 1FYUA 3RI9A 3ZXDA 4Q27A 2XH6A 1O7FA 3AP5A 1H4HA 2Z2SB 1W6QB 4DXZA 5CADA 1HDKA 1RUI1 2VULA 1KFXL 2I74A 3IPVA 4FVVA 5FO7B 4IEPA 2MPFA 3VHNA 2TNFA 4CEWA 3JBG2 4CDWA 2ZGOA 4AHWA 1J59A 4H7LA 4DS0A 4AE2A 4OHXA 2EIGA 1MS8A 2EAKA 2EALA 2WWSA 3EQEA 4K20A 3ZSKA 1CAVB 4Q29A 1LGNA 3OBTA 5C9AB 3L9JT 3MZHA 3S0MA 4WVMB 2TUNA 1X36A 1ND2C 2W68A 3VN4A 3LCPA 1FMD2 3V64A 5FOJB 5HCBA 4GALA 4ISRA 1HQWA 1PGW2 4AI3A 2A7AA 4UW4A 4FSJA 1IPKA 2G9GA 1VR3A 1W6MB 1QJU2 2I45A 2UWCA 1UKGA 3UV9A 3WDYA 5EJ3A 1X82A 1I6XA 4BHPA 3VBRB 5CNAA 4WZFA 2ZGRA 4AVBA 4I30A 1RUF3 4JV4A 4KG8A 3VHRA 3VKLA 4GH4C 3TBDA 1SFNA 2C1FA 3I59A 3W9AA 4R4XA 1G6NA 3AMHA 2RR13 2NP0A 4RQPB 3NKGA 1QGLA 4JGYB 1AYN3 1PVXA 5HCFA 2FHRA 2VECA 1Q8QA 2WS91 2H6BA 4HN0A 4CP2A 1HQLA 3ZXAC 3ZFFB 3VGIA 4Z8BA 1T6GC 1JBCA 4PCRA 4KG0A 2PAKA 1EPWA 5GLVA 1IS3A 5JIAA 1FT9A 4Y1XA 4YM3A 1NA1C 3MIFA 2BNOA 4HANA 5JAXA 4RR3B 3ZFGA 3WZ1A 1W6OB 4UBGA 4Z2WA 1PVC2 1H2KA 2AENA 3WR0A 2R062 1SBEA 3WUDA 1ZYBA 4AHXA 4PBPA 1V9U2 3HR9A 4ORFA 1X50A 3WP4A 3OGGA 4Z82A 1B35B 1G9BA 2ZGPA 4ISQA 3DF0A 1TME3 4CRQA 2XBO1 4LT5A 3GYDA 1TNFA 1PNFA 5GLWA 2Q30A 1HRI2 4BE3A 2JEMA 4RA0A 1V6KA 2GNMA 3FUQA 1DG6A 4Q4X2 2ZGSA 3VBUC 1VAKA 1COV3 1F31A 2A70A 1J3QA 1DQ5A 3GBFA 3WCRA 4BIFA 4E4SA 1PGL1 5CFDB 1PK6B 4ASLA 1SBDA 5JPMB 4EROA 4RHV3 4IEQA 3VBFC 1H1IA 3I54A 5A32B 1D0GA 3FJSA 2DV9A 1HRV2 2PA7A 1CAXB 3POWA 2WQ4A 4KBBA 1ZVFA 1YYNA 4IERA 2HEYF 1AF9A 4YNIA 5FLJA 1XRUA 1YWKA 2OZ6A 1JUHA 2HEWF 2ZOEB 2B39A 4AQSA 3J8F1 4MLOA 4FCAA 4AGGA 5F6KA 2X5IB 2RS52 1GNZA 3O0VA 4QMAA 1CAUB 4Y22B 4XXPA 1V6LA 1ASJ2 3ZMOA 4L9BA 4IEZA 5IUQA 3VZOA 1WBFA 3BTAA 1OI6A 3CF6E 2JG9B 3EBRA 2PFWA 4PBOA 3FHIB 3JU9A 3BIWE 1OOPB 1VRH1 1AXZA 3B00A 4PJYA 3ZYRA 1Q3EA 4TWTA 3B7MA 1AL23 3AB0A 3GHMA 4RS5C 3ATGA 1H8TC 1GLHA 1QXRA 3USUB 3VZMA 5BPXA 4ES8A 3AYDA 2WT0A 1AJOA 2RMU2 5AC93 4Q2FA 1UF2C 3ZIXA 1Q8OA 2D98A 3AMMA 2QZ2A 4BPZA 4S2DA 1BEV2 1NCRA 4TZDA 1W0OA 2EXIA 3D6EA 5K7PA 5JIUA 2GNDA 4QHBA 4DFSA 2BWAA 4QPIB 5FLIA 2D5HA 3WX5A 5D1IA 1O3TA 1FOD1 1S0GA 1LHWA 4HSLA 1EAH2 2GC0A 2C9AA 3LOIA 4GQ7A 3ALQA 4YM0A 1LU2A 4PLOA 3ECQA 2E7AA 4YZ1A 1MS5A 4QM8A 5FMOL 3M3QA 3HIFA 4HMZA 3WW2A 4M3CA 3BOWA 1MQTC 5I0SA 2AUYA 5ACA2 4P9WA 2ZMKA 3M4FA 3POSA 1ND3A 2DURA 1UMZA 1GZWB 4XETA 4JTOA 1RUNA 1O3QA 2HKXA 2WNVC 2A6YA 4RSUA 4TSVA 1PNGA 1DYPA 3VBSB 1S0FA 1TMF2 2GC2A 2CGOA 2DUPA 4LA3A 2ZACA 2DVGA 5FQ0B 1VALA 1HW5A 3JD71 1QNYA 1PO12 3U07A 4DNYA 1WW5A 2GNBA 5CFCB 2WLPA 1BVVA 1SCRA 1XYPA 2A71A 2P34A 2JG8C 1A6CA 2E6VA 4LULA 2XPJA 2B5HA 2RJKA 4LNVA 5L7OB 1PO21 3KCXA 3RMXA 5EYYA 1Z7S2 1SBFA 2IWGB 3IM0A 1QJX1 2XJTA 2WSVA 3JQWA 4OI4A 3CL1A 2UURA 4GB33 3O12A 1ULDA 1AYM1 1C28A 1AR93 1RUOA 2UYBA 2WC2A 1H2NA 3FLTA 3INAA 1VBB1 4YM1A 3MLLA 4A2UA 2PLV2 1K5MA 1ZBE3 2GH2A 1W6PB 4OI2A 4Q4Y2 1ZBA2 2ZA9A 3NL1A 1CESA 1RVF3 3ZYGA 4HL0A 2PAEA 2R1DA 4J1WA 1GNHA 4CDQA 1R092 4XF3A 4QPGC 1TME1 2UWAA 1RUJ1 5B2GB 2NN8A 3N7KA 4YW1A 4DRRA 3ZXJA 5FO8B 2PN5A 1ZA4A 3PJYA 4LBQB 3AYAA 1PZ7A 2JENA 1FPN1 1JUIA 4QD2A 1H1AA 1VBA1 2YMZA 2JX9A 1UAIA 4YFWA 3JB8A 4OI0A 3H1WA 4JCKA 1RUC1 1ZZ8A 5CBLA 4OZXA 2WFPA 2HWC2 2GC1A 3GBWA 2ZX1A 5J48A 1RUD2 3GF6A 2CTVA 4XHBA 1Y43B 1U5YA 1UCXA 2BVVA 2B42B 4J1XA 1W0PA 4K3UA 4FTEA 3I7DA 1R083 1CJDA 3H1MA 4EN6B 5JOWA 5BNPC 4KWJA 2FZ1A 5CAZA 1BBT1 3BODA 2GN7A 3VZNA 1OSGA 4PLNA 4PDWC 3ZFEC 5J37A 3GHNA 4CDUB 1C8M2 1L3JA 2FZ2A 1VBC3 3LAGA 3OPZA 4L2NA 3NSTA 3RI8A 2PQQA 1PGSA 2IZWA 1MS9A 1QH7A 2PHDA 1WLTA 4QQOA 3MIHA 4AYUA 4RL7A 1EV13 5LEJA 5LRRA 3PNAA 2XB6C 5EZWA 1XNDA 1VB4A 1Y9QA 1VBE1 1MZ6A 4W6WA 1G9DA 5E88A 3DUIA 2ZX3A 4KQ7A 4YG6A 2WZR3 1NG0A 5H9PA 4FP2A 4X6RB 4YGBA 3WOGA 2BTVC 3VHOA 2BPA2 1I3HA 4XF0A 3BPZA 1ULCA 3P3NA 4WM7A 1SCSA 3TN92 5T5OA 3KZ4C 4HVQA 4FOYA 1QJZA 1AR62 2JDZA 4CEYA 3DPRC 2RS31 2R6QA 4CYDA 5D8AA 1BMV1 1DBNA 1QNWA 1UZYA 2DUOA 2ZX4A 5E1RA 3AP6A 4HK9A 1QQP2 3POYA 1H30A 4KGGA 1MEC3 2WA4A 1LKNA 2D3PA 1SLBA 4I3GA 4YZ4A 5BV6A 1LOEA 2BUKA 3VBHA 4B4RA 1ENRA 3RYPA 1IKPA 1YRZA 3TOJA 2A75A 3O0WA 3BB6A 1LHNA 1CAWB 1S55A 1OKQA 2D3RA 4XIOA 1IHMA 2ZPXA 4IETA 1A8DA 3HAGA 2R072 4HVRA 1I5ZA 2VU9A 4AEDA 1QKQA 1IOAA 4L8QA 1NCQC 4Y20A 3RQ0A 1D0HA 1O3SA 4AHZA 4CZSA 1H0BA 4MGIE 1NXD1 4AVSA 5K0UC 3AYCA 2PTMA 4H55A 4Y1ZA 1LEDA 2A3XA 4AFCA 5FPZA 3H3UA 4O9GA 3VBSC 2ZMLA 1FV3A 3MICA 5JR7B 1HQNA 5J3UA 5DDJ2 3AMQA 3AFGA 4FAHA 1NLRA 2VQ0A 1DF0A 2Y0IA 1S2BA 3HQXA 4OHWA 2UYAA 2SBAA 2RS11 3GBGA 1ND2B 3FBYA 3V65A 1DDLA 4FTSA 3VUOA 2XJPA 1KQRA 1Q8VA 5IK4A 1IS6A 3S30A 1CX4A 3LA7A 3FLPA 3PVNA 4C0BA 4LA2A 3FZ3A 1O4YA 1U0AA 4XPVA 1QOOA 2VNRA 4BQ1A 2WSUA 3ZPYA 3W58A 1N3PA 4K6BA 4ATFA 1NCRB 5TSWA 1LOGA 1YJLA 4GH4B 3UJOA 1DZQA 5F5QA 2B9UA 3ZSLA 1AX0A 1Y7BA 3SNMA 1F5JA 4CDWC 4DY3A 4CEWC 4Q4W1 2NZ9A 3FC0A 4XJZA 1AHSA 4QT6A 2WS93 3VKNA 3WG1A 4FPJA 3LA3A 3KT1A 4IXLA 4B4PA 2EA7A 4W6YA 1F9KA 1YFXA 2LALA 3EXUA 1LULA 3CU7A 3JB4C 1NA1B 2CV6A 1DZRA 5E89A 3M70A 3AJZA 4E9KA 3SH4A 4GWNA 1WLCA 3HT2A 4XMIA 2OZJA 4ASMB 5LK7B 1LGCA 2GAUA 3N7MA 5CB7A 1RUF2 1BK1A 4I0AA 4XYXA 4XFAA 1RITA 2RR12 4GA9A 3RPQA 2XBO3 1RHI1 1AYN2 2DVBA 2DCJA 3CEWA 2FQPA 2CGNA 4IL7A 1N47A 3CO2A 5JSRA 3J26N 1V6NA 3PTYA 1LTEA 4IEYA 4NWVA 4B4QA 4Z92B 1A3KA 3VBUB 2QFEA 1N1SA 4XJ8A 3B3QE 1WUVA 3AXEA 2OVUA 3N36A 1GZ9A 3VBFB 3MF6A 1VB2A 3ZFGC 3E5UA 5IT6A 2ZX0A 1H1MA 4F83A 5KC5A 2E51A 2AZ5A 2W0XA 3NW4A 3OY8B 1I9RA 3OF1A 3UJQA 4N43A 2XG3A 5A33B 1K5MB 3J8F3 3NJZA 5CIRA 3I2DA 1TME2 1NOVA 2BVBA 1H9PA 3IDCB 5SV8A 1R1A1 3L2YA 2JD4A 3QCWA 1WMDA 4GULA 4R9AA 4Y1YA 4E4DX 3MIDA 3U11A 4G3YC 2K2SA 1WLWA 2XLFA 1COV2 1KFUL 4IV3A 2RHPA 3LSEA 3MEPA 5C4WA 3MLJA 1VRH3 4ZKTB 4RHV2 5BUVA 3KQRA 1N1VA 3JQXA 1RMU1 3DV8A 1GSLA 2YY1A 1D2SA 1S1AA 3M7AA 1OA3A 1DQ6A 1VBD1 3SH5A 1NQDA 3RJ2X 3WHTA 2ILMA 4RS5B 4AQTA 4FT8A 1H8TB 1HKDA 1WBLA 2P3IA 4XQDA 4WBBA 2IC1A 2Z69A 2RM23 4XFCA 4KNCA 2H0BA 2YYOA 1CR7A 1NZCA 2HWD1 2ATFA 3VKMA 4E2QA 1N1YA 2VW1A 1WCKA 2BGCA 4QU2A 2Q8OA 1FOD3 1C5IA 4MYEA 4ZU5A 4Q1PA 1WD3A 3H1YA 1QHDA 3B02A 4WVZA 1UU6A 2NLRA 4M01A 1AL22 4B8EA 2P3KA 4RGAA 1RL3A 4IESA 4AI0A 1MZFA 1QJY1 4DRVA 4MSVA 1MQTB 1J3PA 2Z5WA 5DUWA 4A7ZA 4AQ2A 5AC92 1SQ4A 3B93A 4YYOA 3SITA 4WM7B 3ENRA 3BOPA 1VIWB 4IV1A 3TNQA 2BEOA 1ZRFA 4MX3A 1AR81 5D8AB 1RUE3 2WNVB 3M3IA 2ZS6B 1NCRC 2XL9A 3AP9A 1G9CA 2VW0A 2WKKA 4QGLA 1ULGA 3E6DA 1TQ5A 1SLCA 3JD73 4I09A 2TBVA 5H9RA 4HKOA 2XJRA 1AVBA 3VKOA 2BFUL 2JE9A 4YZ3A 2AREA