2DCZA

Thermal stabilization of bacillus subtilis family-11 xylanase by directed evolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWHFWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGCSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Thermal Stabilization of Bacillus subtilis Family-11 Xylanase by Directed Evolution
pubmed doi rcsb
total genus 48
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dczA00
2D97A 1XNCA 3WT3A 4NPRA 3VHOA 2QZ3A 3AKTA 1M4WA 2DFCA 4S2HA 5EJ3A 1BVVA 3LB9A 1UU5A 3WQ1A 2BWAA 4XQDA 4S2GA 1YNAA 3AMPA 4HK9A 3VZKA 2JEMA 3O7OA 3VHPA 3WP3A 1H4GA 2VG9A 3MFAA 3VZOA 3AKPA 1XNBA 2VUJA 3WQ0A 3EXUA 1BCXA 3HD8B 1XYPA 1REEA 3AMQA 4XQ4A 3MFCA 4HK8A 3VZNA 3AKRA 1XNDA 4HKLA 3VL8A 1PVXA 4HKOA 3AMMA 1KS5A 2JICA 1QH7A 1T6GC 1UU6A 3WY6A 2Z79A 1H4HA 3MF6A 5K7PA 2JENA 2B45X 3M4FA 1OA4A 2D98A 3ZSEA 2BWCA 1C5HA 2B42B 1H1AA 3WP4A 1XYNA 1AXKA 2QZ2A 1HIXA 3MF9A 1F5JA 5K9YA 2BVVA 3AMHA 3VZLA 3VLBB 1ENXA 2DFBA 1QH6A 1C5IA 1NLRA 3B7MA 3VZMA 2B46X 2DCKA 1OA3A 1BK1A 1W2UA 3RI9A 1UKRA 1XXNA 1OA2A 3AMNA 1XYOA 1REFA 3WP5A 4H7MA 1XNKA 4S2FA 1HV1A 4S2DA 3VL9A 3WP6A 2DCJA 1IGOA 1OLRA 1HV0A 2F6BA 2NLRA 2C1FA 2VULA 4XQWA 3VHNA 4XPVA 3LGRA 3WR0A 1H8VA 5HXVA 3RI8A 3AKQA 1REDA 1OLQA 2BW8A 3VGIA 3WXPA 3AKSA 3WX5A 4IXLA 2DCYA 1H0BA 3WQ7A 3VZJA 1KS4A 2VGDA 1TE1B 1UU4A 4HKWA 3B5LB 2NQYA 2DCZA
chains in the Genus database with same CATH superfamily
1QOTA 1AL21 3KM5A 3OY8B 3NMBA 1BEV1 1UL9A 3KQ4B 5HCBA 4AI2A 3KT1A 1X9TA 3ETPA 4FTEA 4I3GA 3B3QE 4HLTA 1EP0A 3IWZA 3M8LA 2DUOA 3CEWA 5EJ3A 2C26A 2FZ1A 1W8OA 2RE9A 4AEJA 1WCUA 4EV0A 5FY8A 3PU8A 3OF1A 5FZOA 1AR91 1RINA 2FCVA 2WZR1 3TAYA 5FXWA 4UYBA 2D3RA 3RZGA 1V9U3 2WAOA 4CEYC 1UOFA 1PIV2 1UYXA 2XXZA 3R4DB 4ISQA 3MLLA 3E6CC 3DXTA 2VG9A 3MFAA 5C33A 4GH4B 3JD73 1KEXA 1OFSA 3LWCA 3LE0A 4IEUA 3E97A 1WW6A 5LBEA 3NNFA 2JD4A 2RS51 3CL1A 5LY2A 3T1MA 2TEPA 2VZ1A 2VNGA 3SCFA 4E8CA 3VBFC 1W2NA 2IFRA 3OUIA 1SZBA 4I0AA 1UNBA 1YJKA 1YQCA 3M3OA 4QXKA 4XACA 3TBDA 1CIWA 3OB8A 1YQ2A 1RUC2 5HV0A 1JTZX 4LJHA 1MZFA 2X10A 4TLGA 2WZEA 2JKBA 4Q27A 2UY9A 1NCRC 3U1XA 4XFGA 5JZGB 4LBQD 2EAKA 4KH9A 4QPIC 1AXZA 1R64A 3M2MA 5LRRA 4PIYA 5AC91 3PHMA 3POGA 1MEC2 4QKNA 2WRAA 4D69A 1OMIA 3QH7A 5J1XA 4QX5A 4CDUC 4CCCA 1R1A3 4LO4B 1T6BX 4QHZA 1NUKA 3B9CA 3AP4A 2XJVA 2OT7A 3WP4A 2VOVA 3J26N 3T0DA 3OEAA 1YI9A 3WDWA 4ARYA 2ZEZA 4D6SA 4Y1XA 2G1MA 5GLUA 4JTOA 4Q4X1 4Z1VA 5E6HA 3KLSA 5F5AA 1OLME 5LBBA 1GMMA 2ZMKA 2DFBA 2JECA 3V0BB 1RUJ1 1ZZ7A 3ZMNA 4AZZA 1O3RA 1GICA 1VBA2 2YC0A 3MIHA 1RUI1 3VDDA 3IIIA 2WFPA 2JDMA 3WVJA 1HRI1 2UYAA 5ANNA 3PIJA 3EJKA 4UOJA 3BUCA 4UI9L 4GA9A 4N53C 4UBGA 3IB3A 2ADEA 5FYBA 2YPDA 1G9DA 1JH5A 4E2GA 1VBD3 3LIGA 2C5DA 4YGBA 2QQIA 1YJLA 1AR71 3PUQA 2NP0A 4XQWA 4U2AA 4XAAA 4YVSA 5FTTC 4XC9A 4LXLA 4NPLA 1GBGA 3NKTA 5FBJA 3PDQA 2RDQA 5JR2A 2PTMA 1QJU3 3J7NA 3VB9A 4XMIA 4FPFA 5FQ0B 1CVNA 2F4PA 2V5DA 2YMZA 4LBQB 5FMCA 2BUKA 2ZGQA 3WQ7A 1KS4A 1GOGA 1OC1A 2HWB1 3FX3A 1OH4A 1CZSA 4Q4X2 4QHOA 1I5PA 4QXCA 2WQ8A 3ZYRA 5DQ0A 3MV01 1UZZA 4ZS3A 3LKJA 1GNYA 4DQAA 2XH6A 4LHKA 1LHNA 2VD7A 1RHI2 4ZXEA 3JQXA 4AGGA 4MGSA 1XNCA 2G9FA 4QX3A 1QJY3 5FZIA 4A3XA 3AXDA 4NR1A 1DZTA 1RC6A 3WUCA 2P17A 3BKZA 4AHYA 1SEFA 4Q4W2 1W8NA 1S0BA 4QPWA 4Q1RA 3ACGA 5KHKA 4XHBA 3VBFB 1DF0A 5FP9A 1Q3EA 2ZGSA 5E1RA 1M06G 4MXWB 3ZYPA 5FZHA 5ABJB 3CU7A 3O7OA 1NX9A 2VE1A 4IGOA 4UF0B 5IHRA 1B35A 1IG3A 4LO7A 2RVAA 2QQLA 5D21A 4DY3A 1N3QA 5A32A 1TQ5A 4CEWC 4YLZA 1K12A 3GBFA 3NO8A 4GH4C 3WG4A 1AR73 1W8HA 2O0OA 1Y4WA 3AKPA 4FOYA 4IUGA 2HWE1 2WA4A 5ACA3 2VUJA 3KV5A 5IVYA 3VD9A 5F3EA 2ARBA 5A3NA 4HVOA 1WCQA 3GXUA 3HWJA 2ZZJA 5F37A 1Z78A 3AVSA 3WNNA 1Y3TA 4DUVA 3GJBA 1HB4A 4LUKA 4I01A 4LA3A 1VBE3 1PVXA 3VBOB 3B01A 4AI0A 4CDQA 2FQPA 3AB0A 5FY1A 2MPFA 4LPLA 2ZXQA 2VUDA 4MGIE 5FP7A 3WDTA 5T50A 1V6MA 1IS5A 4COVA 2CSGA 3LSEA 5CNAA 4LUMA 5SV8A 1UYYA 2W1SA 3TN93 3QH6A 1V6JA 2J7MA 1G9BA 3T2QA 1W05A 4HOOA 4RHV3 5FRAA 1JZ4A 2CNAA 1N47A 4K21A 1D0HA 1S2BA 2FMDA 3IAQA 5T54A 2RG4A 3JB4C 4Q0VA 4W65A 3VZLA 3H8XA 2HWF3 2BQPA 1CGPA 4FPOB 1AYN1 4UAPA 2XL9A 4PLOA 3A23A 2J42A 1IOAA 1UD1A 4QPIA 3ZM8A 1NLRA 2VMDA 2XKPA 2ZBJA 2YV8A 4WM7B 1YCIA 1WCSA 2XL7A 3M3CA 2H6CA 1W6NB 1OH3A 1SBFA 1CZTA 1RYYA 4Y33A 3LFMA 4CRQA 2C9KA 2HWC1 5D8AA 1LESA 1C3HA 3ZLIA 5GZEA 4NIHA 2ET7A 2DUPA 5DUWA 4DZGA 4O65A 2XUMA 4NUBA 1DP0A 4OYUA 1PVC2 4MGQA 1ND3A 1HX6A 3NWKA 3D6EA 2FZ2A 4FXKB 3VHNA 1MQTC 3VKMA 1JBCA 1UMIA 4BIFA 2Q1ZB 3EHKA 1COV3 2XJSA 4M0NA 2ZHNA 2A3XA 4NVPA 3OGJA 2PLV1 3VGIA 3AKSA 5LK7B 4OVEA 1SCSA 2VBDA 1Q43A 3CLPA 3FL7A 4FI9A 1OBNA 4FQZA 4ZONA 2X09A 4E2QA 1ASJ1 3LDRA 5FPBA 4PIXA 1XB9A 4E27A 3LEGA 1JUIA 3M70A 2VZUA 1IPSA 1J1LA 4LBNA 5FXVA 4N90A 1HRV3 4AI9A 1GWLA 1LHOA 2W68A 1PGW1 3ME2A 3OY8A 2VZRA 1U12A 5KBFA 3GGLA 1DQ6A 5I93A 3O0XA 4BISA 5L73A 1UYZA 2HBTA 1GQHA 1IS6A 2NMOA 3LB9A 1WCKA 1GZCA 5CEHA 2PHWA 3KV4A 3VHRA 1LRHA 1CX1A 2ZGLA 1AF9A 2ZEYA 1ULEA 4HT1T 5FIXA 3UYJA 3ZSLA 4PBPA 4BWOA 4NWWA 2EALA 3T4HB 3JCIA 1SFPA 4ET7A 2WA3A 5JDBA 4BXSV 1W2AX 5EZWA 4OUEA 5CFDB 3CQOA 5CKNA 2QUOA 2E7QA 4URAA 5A7OA 3I3EA 1ZBA3 2DBIA 1RUD3 4LO8A 3VDDB 1XNBA 1O4ZA 2VW1A 2WO2A 3NAPC 1F2NA 3K51A 3WW3A 1BCXA 1Y9MA 3B93A 1U5YA 2F17A 3AMQA 4XXAA 4EN6B 5EJ1B 3MFCA 5IW0A 1HN1A 1UY2A 5FY7A 4BJ0A 4HKLA 1O7FA 3PIGA 1RUG1 2WS91 1FX5A 1UOGA 4GWMA 1PO13 1YIFA 4QX1A 3AMMA 5IUQA 3POJA 3NVCA 1CPMA 1CJPA 4NIIA 1CAVB 1WMEA 1H4HA 2Y6JA 3SEEA 2PHXA 1LOFC 1E5SA 1QQP1 1SACA 5FZ1A 3M4FA 3T08A 4HN1A 1OA4A 1VP6A 4LA2A 2PXJA 4Y1YA 1OOPC 4IGQA 2N7GA 4UWDA 2X53S 3I2FA 2D6NA 2B9VA 4W6WA 4I0WB 4V2VA 3WF4A 5C7GA 4QPGA 5AFEA 2J1AA 3LEKA 5DAWA 2P34A 2WNUC 3JUUA 1HIXA 5DZFA 4JKLA 2ILMA 2PHRA 3KZ4C 1X82A 1ZA4A 2ZAHA 3LDBA 3OCPA 4NHMA 4UFMA 4B29A 3LAGA 1O8SA 3D8CA 5FOJB 3HNMA 2HLEA 4PBOA 2J1TA 3OPTA 3B7MA 3SC7X 4A4AA 2BPA2 2R1BA 3UESA 2DWRA 4LKDA 5I0SA 1CAUB 1R092 1WD3A 4LHSA 4B8EA 3N9PA 1NG0A 5A33B 2AREA 2Y33A 3UGFA 5AC92 1GNHA 3I2GA 2DU0A 2FD8A 3MYXA 2E33A 2VXRA 1DGWA 1XE7A 3PUAA 3ZX7A 4COWA 1JMUB 1SLBA 1D4M3 3DPRB 4K40A 2NYYA 4B1LA 3EYPA 5FPVA 1DQ0A 4LITA 3S5AA 2P4EA 1FNZA 3E5QA 1N1VA 1OLRA 2F6BA 2BTVC 2Z4FA 4NRPA 5A32B 1V00A 2BERA 4GB32 1BJQA 4IE5A 3WSOA 1NA1B 4AAXA 3KCYA 1RB8G 2CWSA 2FHRA 4PDWB 4HSLA 1VBB2 4AFCA 3VBHB 1HDKA 3S5QA 1K5MB 1SDWA 1XNTA 2ZGTA 2TUNA 1YO8A 4AQSA 4YPJA 3C7EA 1W6PB 4FBFA 1O6UA 2Q4SA 1COV2 1W90A 4DRRA 3LEIA 4META 1CD3G 3SEPA 4BHPA 3LA2A 2PAMA 5FXZA 5GLZA 1LB2A 2VVEA 5BNQA 1RUJ2 1RHI1 5FPUA 1BHGA 3RDIA 3I2HA 3ILFA 1K42A 2YB7A 1US3A 3OTFA 3B02A 2RM23 4XBNA 3K75B 5T3NA 1PZ7A 3TEXA 4AEKA 3OBRA 2QNKA 4CP9B 1YRZA 4PLMA 1BVVA 3CIHA 4TLFA 1IKPA 4CCKA 5A33A 1LU1A 4AEMA 5K8SA 2XJQA 2XLAA 4DXTA 3H8OA 3NJYA 4FPGA 3KB5A 3FLPA 5IVJA 4LBLA 5EXOA 3H1MA 2AEZA 2YUEA 3W20A 4N53B 1SHWB 1J3RA 4GQ7A 1SBDA 2EIEA 1GANA 2VZPA 3N9LA 4P9JA 2JKXA 1GUIA 1ACCA 5IWFA 2Q8DA 4YFZA 4WM8B 3VV1A 1JYNA 5IJRA 4AI8A 4XUOA 3DV8A 4YW6A 5L9RA 4JDMA 5F32A 4GXLA 3FBYA 5DG1A 1W6QB 1ZZBA 5FYHA 2DURA 4P9LA 4G4FA 3CHXA 4IE7A 1ST8A 2QDRA 3ZYFA 3N4MA 1JZ2A 5J36A 2DU1A 5JSPA 4QDQA 1ZA7A 2L9LA 3V64A 5KC5A 2VZTA 4JDNA 1PK6C 5J3UA 2W3JA 4QD2A 4BCUA 1VBE2 3DKWA 4Q4V3 4TN7A 2R073 2Y6LA 5F5IA 1FOD3 3SKVA 4AWDA 4DY5A 3J7HA 1CN1A 1O91A 5FK7A 2D98A 3WW1A 5L7OB 1NT0A 3DCQA 4AFAA 3UV9A 2FDFA 1SCRA 2HEYF 1OF4A 2Y6FA 1UZVA 4COZA 4XFBA 3FHIB 1MVQA 4L99A 2UWBA 4E2SA 4QB1A 1WZXA 3KQRA 1MS5A 1PGW2 1W28A 4XFCA 3ZFGC 2XMLA 4R9CA 1YHFA 3BYWA 2WO1A 3M3QA 4Y4RA 4Q26A 3WZ1A 4A44A 1OUXA 3SISA 1LECA 3EB7A 3ZPOA 1FV3A 5FWJA 3ZYGA 2ADDA 1RL3A 3EO6A 1V0AA 1MR5A 4K20A 2VVDA 5M0TA 1V6LA 4IGPA 1ZRCA 4D7TA 2AACA 3NV2A 4Q4W3 5C5UA 3ZXDA 5CG9A 1BMV1 4MGZE 5LWBA 2VQTA 2XWJB 1RUNA 4C1XA 4OI1A 5I91A 5LW9A 1W6QA 5KWRA 1RUF2 3A21A 2RS52 3O1SA 3VBHC 1L7RA 2FDIA 2P3YA 1WA6X 1XSRA 3D5OA 4KU8A 3CZJA 1NAEA 5D8AB 5CFDA 4OFGA 3H1YA 1L3JA 4J1XA 2IXKA 2DVFA 3UJOA 3U11A 4ATFA 5FY4A 2O8QA 5HXMA 2W52A 3S30A 1QKQA 3WF1A 4YVWA 5FZ3A 3T3YA 3VBOC 1GZTA 5ACA1 5JOZA 4RFT0 4MV2A 3WX5A 4AL9A 4G3YC 4IXLA 4HANA 3IDAA 3T2PA 1GWKA 3UNPA 2PYTA 3FWEA 1ZM1A 4XF3A 2GN3A 1OD3A 5GLTA 4FTBA 2JG8C 2KD7A 3AXEA 3AJZA 4LR4A 2NZ9A 1LOGA 3J8F1 4MHRA 2XBO3 3ZYIB 3POFA 4HSJA 4MUVA 3O1VA 2VZ3A 3J7MA 1OKOA 4O9GA 4Y4YA 4QQOA 3Q8EA 2P5BA 1LJ7A 4IEVA 4HVQA 1LAJA 4SBVA 1EV12 3MEPA 3IN9A 2UURA 4CUCA 2TNFA 2ZAAA 2A6VA 1W8TA 2VO5A 3NQHA 4OI2A 4YG3A 5C71A 3VZKA 5HBAA 3WNPA 2FDKA 3FUQA 1PNGA 3OYWB 5E16A 1NCRA 2VCCA 1QXPA 1EAH3 2ZX4A 4Y20A 4P14A 5J48A 2ZX0A 5FOBB 1BVP1 1GP6A 1LGCA 4AK3A 2W1UA 2GP3A 4I02A 2H0BA 2W5FA 3PUSA 4YW2A 1RUG3 2WS93 4YVWB 4XF0A 2GH2A 1YIPA 5K4LA 1R1A2 4AEDB 5IAXA 1ZRDA 2BRTA 2K2SA 2Q30A 5DXDA 2EF6A 4HK8A 4NMIA 1FOD2 5C3PA 1TG7A 1MACA 5G05L 2GP5A 5FZBA 3TWIA 3BODA 2JXAA 4AGRA 1BQPA 2GNBA 3NNLA 3WDVA 1UOJA 2JIGA 2YROA 5F6LB 4A42A 5LK5A 1PM4A 4J25A 5C4WB 3W59A 5FUIA 3MGUA 3MW2A 3I4IA 2MNGA 3VBHA 3GZTB 4AF9A 4ZS2A 4YZ5A 4LE3A 1IG0A 1S2EA 2XLGA 4WM8C 3H50A 3CJXA 4IEQA 4D6RA 4K1YA 4AI1A 3B00A 1H1AA 4MGYE 1QMJA 1J3PA 3ZXAC 3SH4A 5FO7B 5DDJ1 2P6CA 3RYPA 5FPLA 3ILNA 3BU7A 1DYPA 5LEKA 3PUHA 1DGWX 1VMJA 3PURA 5JI7A 2YGMA 1A8DA 2IVIB 5FZ7A 2TBVA 1LCLA 3VBRC 1JYWA 2ZGKA 1XNAA 1XU1A 5DAVA 3ZXFA 4EROA 1PIV3 1QH6A 2WFF1 1NLQA 3QCWA 2YU2A 4GH4A 4RD7A 5DAXA 4XF4A 4XIKA 3GNEA 4CEWA 3CF6E 4AYUA 3LOIA 2W9XA 1NXD1 3UL2A 1DGRN 4CZSA 3RZKA 3I49A 3IDCB 5FZKA 1KITA 4P00B 4BLJA 2IXCA 4AE2A 1WLCA 4FP2A 2DF7A 3KVAA 4GZ9A 2Y60A 5L19A 3PVOA 4A45A 1D0GA 4GB31 2NLRA 1YQ6A 5IK4A 2QKDA 2C1FA 4Y22A 4F8AA 1RUJ3 2FMYA 3ES4A 4Q0QA 1RUC1 1J84A 1K5JA 3R4SA 2WLPA 2YGLA 3NJXA 2OQ6A 3NRUA 3CJIA 4OMDA 2VC9A 1NY71 3NW4A 4ZHNA 4TXWA 2ARAA 4R9DA 4ZY9A 4YZ2A 3GHMA 1Z7S3 3ACFA 5FMOL 1YFYA 5FZ0A 1HRI2 1H0BA 1W8ZA 2IXLA 2W94A 2RDSA 4NN0A 3VZJA 2Q5TA 4LORA 1VRH1 1IZ3A 4GB33 1LU2A 3HBZA 4MGTA 4INDA 4M01A 1JZ7A 4YG6A 1QOSA 5D2AA 1J58A 4LKSA 1R091 1AR92 2OUJA 3PNAA 4MLOA 1D4M2 1J3QA 4MOAA 2QZ3A 1CZVA 3FUOA 3AKTA 2Q8EA 3WG1A 5L7OA 1F8VA 1DYOA 4NHYA 4S2HA 4X8PA 1PGSA 1CWPA 4CP9A 4CVUA 1FYUA 5DPNA 1UWWA 2IFWA 1NZCA 1UCXA 1Q8VA 1NE6A 1JZ5A 4JRAA 1JU4A 4N53A 4PQ9A 3E6DA 1UZYA 4XTMA 1ODMA 4JKKA 4M3CF 3USUB 3NL1A 5HV4A 3RMXA 3SITA 4Y24A 5C8CB 5AVPA 2ZMLA 3R4UA 1H8TC 3SH5A 3GBGA 3M7AA 4ZKTB 1OOPB 3H1WA 2A75A 3LF7A 4XILA 4EYUA 4ITCA 4X6QB 1ULDA 3ZXJA 1R082 3SKJE 1NQJA 4UT5A 3ZIXA 1VBC2 1CIYA 5FYSA 4HL0A 4RGKA 4BK4A 3I3DA 4Q4Y1 1XNDA 5FREA 5FYVA 3C3VA 4D3WA 4DMIA 3PJYA 1BXHA 5BNOB 3I2OA 5IK7A 1IHMA 4ZU4A 5EHDA 4DPNA 2CAUA 1PO12 1LEDA 1PIV1 3DYPA 4LIVA 5FMDA 4CXWA 2LRPA 4Y3OA 2D7FA 2WNVA 1D2SA 4Q2FA 1JN2P 4FOVA 2R0HA 3ETQA 3PLQA 3OSDA 5J37A 4CDWB 1RUD2 4D7YA 1AYM1 3L9JT 4O61A 1S0IA 4RR3B 3NV4A 4XE9A 4AEDC 4MXWA 2D5FA 4CCOA 1GR3A 3M1HA 3TEWA 2W91A 3BVCA 5GLWA 1WLTA 3J9SA 3ZN6B 1FT9A 5C8CA 5FYIA 1DQ5A 1C5IA 2OZ6A 2XQRA 3MIGA 3I2IA 5BUVA 4AR2A 1QEXA 5G04L 1XJAA 1VRBA 5J09A 3FLRA 2GC2A 5FJHA 4AGVA 4YGCA 5JR7B 2WYFA 3CJIC 2G9GA 4W50A 5FZOB 1QF3A 4M0HA 2PAKA 5JXGA 1U5IA 1W9FA 3O1MA 3N36A 3ST7A 1AXYA 4JGZB 4AVCA 3PU3A 5CADA 5J7MA 2FCTA 2JWPA 3PMEA 1UX6A 2GAUA 3WNXA 3N7JA 4H7LA 3OYWA 3USSA 4XTPA 4QGLA 2ZHMA 4DS0A 4XJ8A 3PVNA 5T5OA 4Z2AA 3W5MA 4U36A 2ZEXA 2QFEA 4NPRA 1DBNA 4FOQA 1BYHA 3IM0A 2QQMA 5FYCA 4A7KA 4BQ5A 5L36A 4MYEA 5LY1A 4BQ1A 4XF9A 3AKQA 3I54A 1E5RA 5C70A 4CDWC 5GALA 5KC6A 3HVDA 2WT2A 3FN9A 5F1RA 5FO8B 1W6OA 3TEZA 3HAGA 5FY9A 2WZPP 5FV3A 2YDEA 2KR2A 2O14A 3DL3A 1UMHA 3A22A 3S6PA 2BV4A 1LTEA 4MO3M 3H0OA 4YZ3A 2XBO1 3MBWA 1UYPA 3T09A 3MIDA 2WQ4A 3CMGA 4BQWA 1RUF1 3FBMA 4YM3A 2QBXA 3P5BA 3V0AA 1TVGA 2VH9A 1PGL2 3JU9A 4ATEA 4FTSA 3UKTA 1T2XA 3AP7A 5BPXA 2C24A 1ZREA 4HK9A 4LLOA 3I59A 2BP6A 4RGAA 1JI6A 1S4CA 2JIJA 2VZOA 3VUOA 4YG0A 4E8DA 5C8CC 4AI3A 4CU8A 3KD4A 1EUUA 1AVBA 1AX0A 2IXJA 1NCRB 1OT5A 2W47A 4LOTA 1N3OA 3N9OA 4PJYA 4RHV2 2XJRA 2PMWB 4ZPIA 1VAVA 3VDDC 3W21A 4CCJA 1TZOA 5IVEA 1SLLA 2J1RA 1AR81 2BGCA 2RV9A 1QDOA 3ACLA 3NJVA 2WNEA 4R9BA 3HNBM 3J4UH 4N43B 4IETA 1WCDJ 4IV1B 2LW8A 4CXYA 4D8MA 1C8NA 4RN5A 5CVRA 2Z69A 4DEVA 1OKQA 2FDJA 1QJFA 2PQSA 2VNVA 3ZFFC 4N7IA 3WNLA 1WMXA 5FP3A 2EVXA 2P2KA 3RYRA 2WZR3 1XYNA 2R041 2HWE2 2GZWA 3DXUA 1AR72 1CONA 1RJ7A 4BLIA 2JG8A 3OGRA 1LHWA 1POV3 1UW8A 1GWMA 3N7MA 4Z8BA 2BNMA 3BTXA 4XOGA 2G9ZA 4EZHA 4TWTA 1HB2A 2RS33 2VL4A 3FFQA 2Y64A 4EE2A 3INAA 4JGZC 1FAYA 3OOXA 1APNA 4L92A 4NAMA 1I3HA 2WFF3 2YU1A 5F39A 3ZXKA 2ZZQA 1TME2 3GJAA 3IZOA 2ARCA 4YVWC 4EQVA 2B4KA 3ALQA 1ONAA 4AXOA 4CEWB 1UKRA 2CL2A 3JBG3 3OD0A 4YZ1A 5JLVA 1CAUA 2RDNA 2VY0A 3ZFEC 3A7QA 3LPFA 4FPEA 4BB3A 4Y22B 3WP5A 3P1IA 3GYDA 4RYDA 1POV0 3WP6A 4AQ6A 1RHI3 4Y1VA 4BDVB 1UIJA 5JAXA 1NLSA 1XOYA 2W0XA 4N43A 4AQTA 4XPVA 3JBG2 2DBNA 2R062 5DN2A 1C57A 4R4XA 3WR0A 5FYMA 4XABA 3A4UA 4WVMA 3KCCA 3QD6A 2XQXA 4YW7A 3Q8FA 3KHCA 3C7OA 5AVAA 2C4XA 4PDWA 2WFF2 3THTA 1QJU2 3HN1A 1NCQB 4MADA 4X8NA 1GV9A 3P3NA 1UXZA 4IE0A 1V6NA 3PL0A 1MS9A 1KQRA 3QACA 4A2UA 5BNPC 4LBOA 4A41A 2J22A 2WZR2 4OHXA 1VBD2 4M00A 4OUMA 3UK9A 5GZFA 1LHVA 5A3OA 3R6SA 5I8TA 3H7YA 1JXNA 2WZ8A 4JQTA 5FY5A 1IKQA 4LBKA 1RITA 2WINB 1FI2A 2R6QA 2E7AA 2QQUA 4D7SA 1G9FA 1VBB1 3WG3A 2GC1A 1YUDA 4NE9A 1A8MA 5FZ6A 4XQDA 1UF2C 5GZGA 1YNAA 4LKFA 4OULA 1ZBE2 2F4LA 1AZDA 5F3IA 1Q56A 3VHPA 4QB6A 4GAZA 5FWEA 1VJ2A 1WGPA 2Y6GA 2VTFA 1TNFA 2NMNA 2GDFA 1IS3A 5LA9A 5FZ4A 4ZXKA 4ZZ5A 4QDRA 3OJBA 4IV1C 3VBUA 1XSQA 2JDZA 4YM2A 2D44A 1XE0A 2WABA 1UO9A 1MEC3 3GZAA 3BCWA 4AVTA 2CV6A 3KF3A 2GNTA 3KCXA 1DLCA 3BOPA 2YFZA 1K3IA 2IWGB 5BNOA 2EXKA 2RHPA 1UU6A 3AZXA 5T5PA 1LEMA 1W9WA 5DUXA 3LSDA 3SHRA 1C8M3 5JIAA 3CNAA 3MIBA 4GD4A 2JE7A 3EBRA 3LOBA 1BBT1 2RJLA 2WNVB 4QMAA 1NZIA 1UPSA 1C5HA 2Y6KA 2V73A 5JZGC 2OS2A 1AXKA 2D43A 2YBSA 3KWVA 1HXS1 4QWNA 1GP5A 1F5FA 4CCDA 5EYXA 2CGNA 4CP2A 1F5JA 2AH2A 3PJQA 4GJZA 4BQ3A 3T1LA 5FJKA 1PGL1 1ENXA 1W0NA 4KU7A 3RZLA 2VM9A 4IL7A 3VZMA 2ES3A 2VQUA 1FPN2 1MQTA 3VD4A 3VDAA 5HCFA 1RUH3 2YXSA 3E5UA 3T4VA 2GU9A 2CY6A 2SBAA 1MS3A 2XVKA 4H55A 2HYKA 4B1MA 1XXNA 5IVFA 5KHGA 3I3MA 4HZFA 3RS6A 4JC1A 3ZR5A 4QT6A 5A6QA 2K9ZA 2E53A 4NROA 1FV2A 4FVVA 2EXIA 3SQOA 4JGZA 5FZCA 1YLLA 2OPWA 2RS31 4ISRA 2EA7A 4MGKE 3MW3A 2WNUB 4Y5TA 5FZAA 5FDBA 5LA0A 1O5UA 1POV1 1FOD1 4XZPA 1H6XA 1UZ0A 4JX0A 1ND2B 4K8FA 3SCHA 4XEZA 2LM3A 3U0ZA 1ZNPA 4YNIA 1JOJA 1W6OB 1H8TA 1N3PA 2D6MA 4XXPA 3C7FA 3RZMA 2YC4A 5GM0A 3J7LA 1IQAA 3ZXLA 2VXJA 1MVEA 2DCYA 2QQJA 2CYFA 2ZGRA 2JDAA 3M3EA 4NAOA 4NRQA 2XJUA 4HPKA 3O14A 4QB2A 3RNSA 2Q1FA 4XYXA 3UKNA 4CYDA 2Y6HA 1UY4A 3HBKA 3AJYA 1AYN2 5IFTA 3C8XA 3QLQA 1HRV1 2DV9A 2WN3A 1PK6B 1Y7BA 2D6PA 1H6YA 5FCCA 3M3IA 4B4PA 4RR3C 4CCLA 3ZSJA 1UY0A 4CEYA 4AFDA 4K7JA 1C1LA 1YI7A 2QQVA 4TSVA 3OG2A 1W2TA 2GMPA 3PUIA 5EYYA 2WJSA 3RVHA 1ASJ3 2DTWA 5TSWA 4M4PA 3VD3A 4Q0PA 2QJVA 2R043 2A1XA 3AZYA 4QM9A 4QQ2A 4COYA 3WOGA 3MPPG 4JCKA 4M3CE 1YFUA 1DZRA 5C4WC 2YYOA 3AX4A 4QXBA 2W87A 1H4GA 4FPJA 1YQ5A 5DZEA 3I59B 5FZFA 3FMGA 2QDNA 1PX3A 1U5ZA 4IW3A 1FMD1 1KD7A 3MPBA 2ET1A 3SXWA 1R083 4P5HA 4FT8A 1ENQA 4Y20B 5JCTA 4CSWA 5J98B 2IXIA 4PLNA 5FR3A 2PLV2 4CTEA 2A70A 4HN0A 2ZACA 3S0MA 4ARXA 1H2LA 3AP5A 4UFIA 1DQ1A 4PHZA 1Q8QA 5CU1A 3Q8AA 1DIWA 1ALYA 2OX0A 4GMP0 3A0NA 4XDQA 1JW6A 3POSA 4UBHA 3VBUC 3DYOA 2OPKA 3PVBB 2JICA 3ZXGA 1US2A 2VMGA 2Z2SB 2VOWA 2VQ0A 1C8M1 1PK6A 3H3UA 3H8UA 3POYA 4XJUA 1R1ZA 3O5SA 1W8WA 2A3WA 3B69A 2BWCA 2JE9A 1GOHA 5FLIA 4DUWA 1I9RA 2RMU1 1ZRIA 3AK0A 4WM7C 4R52A 4QXHA 2WWSA 2RS13 1XPWA 3HT1A 2E63A 4EN7B 3AZWA 1C1FA 2OXBA 3P3PA 2CTVA 1MZ5A 1PO21 5K9YA 1G7YA 1LULA 3BTYA 3VLBB 5KHJA 2ERFA 3V65A 4J6GA 3THDA 5EP9A 2ZCWA 2BU9A 2JE8A 4MSVA 3N9NA 5JVVA 4YRDA 3WNKA 4C0BA 2C9AA 3S7EA 1HJGA 2BOJA 2VUAA 2VECA 4XUQA 2DCTA 3JQWA 5A3PA 2WN2A 1ND3C 2XHKA 3AMNA 4KG8A 1CESA 1H30A 1S0EA 4EZ4A 2GNDA 3LA3A 4S2DA 5A7PA 2YC2A 3SH3A 2FCUA 3OBTA 4RQPC 5A1FA 1OLMA 2PHFA 3VBSB 4AAPA 1QGLA 2VMEA 1W3XA 2HWB2 3IDBB 4NHXA 5FYZA 5FQ0A 1RUH2 4DINB 3TEYA 1QJU1 1MS0A 3BOWA 4KBZA 4K9SA 1H1IA 2YPJA 5DG2A 4K3UA 4A3ZA 3TOJA 1QHDA 3ZFEA 3O0WA 2A3YA 1NCQA 2V5YA 2I07B 3OUJA 4HBNA 4QHBA 5FKCA 4BQ2A 4CDXA 3UJQA 2D97A 2DVBA 2W46A 3N3HA 3WT3A 5D8AC 2R7EB 3JZVA 1DZQA 1WLDA 3ILRA 2WDBA 3IDEA 3ZSKA 2PA7A 3OGVA 2EICA 1M4WA 2VCAA 3KGLA 3RYKA 1BBT3 4BOWA 2V4VA 4Q0UA 4XFIA 4BQXA 1RUI3 1UU5A 1OFNA 4AOCA 1PX4A 1EUTA 1SDDB 5CFCB 2I45A 3ORJA 1W9YA 2ZA9A 4FXGB 4S2GA 4YYOA 3NV1A 1RGSA 4IE4A 1TMF2 4PF5A 1V6KA 2OVUA 5IVVA 5JSRA 4IV3A 3ASIA 4BIOA 3HR9A 4CUAA 2JDYA 1AR63 2ZJCA 1B35B 3VZOA 4UXAA 1POQA 4CUBA 1RUG2 2WS92 5A80A 3OPWA 5B4NA 3POEA 1C28A 2W92A 3FLTA 5CKQA 3EXUA 3POWA 5BNNC 1DU3D 1XYPA 1WA4A 3P6BA 3O1OA 2A6YA 2C6SA 4Q4Y3 4XJAA 1H9WA 5L7OC 5BNOC 2NM1A 5K0UC 2D5HA 4KWUA 3VL8A 1OSGA 3N9QA 4L0PA 1FMD2 5F3GA 3WHTA 4QKBA 5DZGA 3URFA 3UT0A 2VZSA 3ZDSA 2X5IA 4HVRA 1VRH3 3ZKUA 4FAHA 1EV13 1S0CA 4CDQB 4WVVA 3O1RA 4OI0A 1CPNA 1LKNA 3WCSA 3DGTA 4GIQA 3VBRA 1H8TB 3ZVXA 1PMJX 2NPIA 1OURA 4P08A 1HW5A 3WNOA 4F83A 5CFCC 4L9BA 2XBO2 4CU9A 5A6YA 1AL22 2VTXJ 4KWJA 3ACIA 4W6YA 3BTZA 1LGNA 4UFLA 4P5YA 3WW2A 3OPZA 3TNQA 3IBMA 5DUVA 5EQUA 3DF0A 4P9WA 4XCBA 4CUGA 1CAXB 3ACHA 1QU0A 1UN1A 4XDOA 1IQDC 1SG3A 2V09A 3BB6A 4QPIB 2LUWA 3HMYA 4I30A 4C8DA 3IMMA 2WO7A 4NIAA 1KRIA 3CZUA 5ERLA 3VD7A 2WUHA 1NA1C 2BNOA 4W6XA 2R063 5FZLA 4KQ7A 4YM1A 3K3NA 2K0GA 3H9AA 2J1VA 3NKGA 3QBQA 4RHV1 1LGBA 4GALA 1K5MC 3AYEA 1MS8A 4AHZA 4KGQA 3TN91 1ND3B 1FXZA 1VMFA 4W4ZA 3LDKA 3HQRA 3T2OA 2OZJA 1W9TA 2RS53 1S55A 1RUF3 2GMEA 2HWC3 2O8OA 2VULA 3FZ3A 3GHNA 3KHBA 2EIDA 4OI4A 4P9IA 4AVBA 4BXFA 3JD71 3LGRA 4PDWC 5CIRA 3GZEA 5F7UA 3K4AA 1KDMA 1Q8PA 4LK6A 4DXSA 2YY1A 3DPRC 1TME3 2D40A 4QQPA 4UW3A 2VJXA 4AEDA 2JDKA 1W0OA 4E4HA 4JZRA 3AYDA 4LTAA 2GALA 3U10A 4IE6A 1DGRA 3ZOIA 2WNVC 1VPHA 4J1WA 5H9PA 4UFJA 2XWBB 4KL1A 2A5ZA 4KWLA 1BZWA 1ZX5A 2DCZA 4H14A 1S0DA 2HWE3 4Z82A 4HPKB 5FPAA 3AFKA 5LBFA 1RTVA 2OW4A 4CEYB 2YBPA 1BEV3 3AZZA 4NWVA 4QKFA 4CPBD 1CAXA 4SLIA 3WF2A 5FO9B 3Q9OA 5KXBA 1AR61 1AYM2 1O3TA 2ZX2A 1E5HA 2AZ5A 2VMFA 3I2DA 4XF1A 2DFCA 1GKBA 1LENA 4I09A 4R8HA 5A1LA 5IK5A 2R072 4JQRA 1E5IA 4K8RB 1GQPA 2EIGA 4Q4V2 4XBQA 4CU7A 2B39A 3UETA 1VR3A 3J8F2 5DDJ3 2VPVA 1VB2A 3IIAA 4IEOA 2JDHA 2Y26A 2JEMA 5FUNA 2A71A 4N9HA 4EN0A 1DYKA 1VBE1 4X6RB 1JS9A 2JDNA 1VBC1 1QJY1 2HH9A 1H2NA 3KV9A 3FHAA 5H9QA 2CGPA 4HETA 4Q0SA 1IPKA 4OQ8A 4IESA 5CYYA 3FJSA 1LR5A 5KHIA 4GWNA 3S7IA 5LZ6A 1BMV2 1LODA 2J1UA 4KBBA 4LK7A 4DO0A 3FFZA 1REEA 3O1PA 3D0SA 4AFBA 4Z07A 3VZNA 1KJRA 3LEMA 3T2TA 1CAWA 5FMOS 4EWEA 5F2WA 5A6XA 1ULCA 4YFWA 1CAVA 2GMMA 5JIUA 2R1DA 1EPWA 4BZ4A 2I74A 1X36A 3W5NA 2Y0IA 4QPYA 3C7GA 1T6GC 3DKQA 1RIRA 5C6CA 3MF6A 2VZQA 5K7PA 1UXXX 4CDQC 1I5ZA 1UZWA 1HLCA 5FZDA 2XDVA 3L2YA 3WCRA 3MW4A 1TNRA 3ZSMA 2BFUS 4Y5Z0 1X8EA 4WBBA 3RZZA 2JG9B 1ULGA 4V2WA 1VBD1 2V4AA 2R32A 4PI0A 3B94A 1Q8OA 1NKGA 1ULPA 4FO9A 4GWJA 5LBCA 4YARA 1RMU3 5LATA 1AUYA 1X8MA 2ETEA 3MLKA 4OZOA 4DEQA 4C1WA 2B7YA 2E32A 4M4RA 3BPZA 4CDXB 5ISLA 4BM8A 4OCTA 2ZHKA 3BTAA 4A6OA 4EN8B 1JZ6A 4GKXA 5FZGA 2ZGMA 1GZWA 2VMIA 3J8F3 4TYSA 3W58A 2IZWA 4XJWA 3MIEA 5CA6A 4D6QA 4CU6A 1W0PA 1STMA 5A7NA 2CU5A 3T0BA 1MEC1 3E5XA 1X7NA 3DPRA 1KFUL 2AUYA 2P1BA 4MG2A 3VDBA 1GNZA 3HQUA 4M3CB 5C3SA 2ARXA 2RS11 2WYSA 4ES9A 3MV11 1LOEA 2W95A 4ASLA 3U4XA 1PNFA 2Y0OA 4QM8A 4NIDA 3NNGA 3ROUA 4IV3B 2RMU3 1S1AA 2R30A 1QJX1 1FATA 2X05A 1IGOA 2WT1A 3VBSA 4G9SB 3GCWA 1YXWA 4UFHA 3OD4A 4CA9A 1F15A 2RJKA 3WV6A 5AC93 4URTA 3HEIA 1K5MA 4ORFA 3THCA 1R093 1WMFA 5HXVA 4LKEA 2XJTA 2MEV3 2B9UA 2Q8OA 1QXJA 3HNYM 4QX8A 4WVMB 1WMDA 1SLCA 2DDUA 5LRSA 5HPOA 2BJSA 5KHHA 4ES8A 1GU3A 3OEBA 4CDUB 3RZJA 1Y9GA 1PMHX 3ELNA 4Q1PA 3C2UA 2ORXA 4Y5SA 3I8TA 2BYVE 3NV3A 3ZFEB 3GF6A 1HB1A 4P02B 4BU2A 3OBAA 3HJRA 3S57A 3VHOA 1EPZA 5IYYA 4LT5A 4WV8A 5A3TA 4NIGA 1LNSA 2WR9A 4Q5OA 1XRUA 3E1F1 5SV5A 2A6WA 3VBSC 4EWAA 2ENRA 3ZYBA 5CFCA 4FPLA 5IFPA 3N9MA 5AFBA 4F7ZA 3FC0A 4NO4A 2BBVA 3ZFFB 2QVSB 4GMP3 2VQAA 1MPXA 2BWAA 4CE8A 4IEXA 5T55A 3OGSA 2ZGNA 4A7ZA 4WZFA 1S0FA 4YGEA 3E6BA 4FAGA 1DQ4A 2HEWF 3ZDVA 2HKXA 3WD5A 5JMOA 1VBC3 4ASKA 2R071 2ZTNA 4KI5M 4NHKA 4TZDA 5C3QA 1AL23 5IT6A 1Z7S1 3I3QA 4LQRA 5GJ6A 3WQ0A 1O8PA 1SPPB 1ZBA2 1ZRRA 2CDPA 2YG0A 3HD8B 4OUSA 1H9PA 2JDUA 2UWCA 2LS6A 1AJKA 4D94A 1AHSA 3JBG1 3AKRA 4JDOA 3H3LA 1OPMA 5FLHA 1AX2A 1AX1A 2X5IB 4CDUA 2UWAA 5BYNA 4IEPA 1AL0G 3A0KA 4IV3C 2VCMA 1J59A 2IUWA 2VZVA 1UIKA 1O3QA 5B4XA 4XAEA 1N1TA 2ZGPA 4BH9A 3BIWE 4OMCA 5FPXA 2WAAA 4LULA 5H9RA 1HRV2 2OIIA 3K48A 2B8MA 3V56A 1JU3A 2Z42A 1KFXL 5FYUA 3ZFFA 1QQP2 1JZ3A 2V72A 1AR62 3VBFA 5FP4A 1JYIA 2WWUA 4L8QA 3IPVB 3VBRB 3ON7A 2P3JA 3TNPB 1PO22 1RUE3 2VNOA 2K46A 4DXZA 2XB6C 2XVGA 4UF0A 3MUY1 5JXIA 1TMF3 4FPHA 4Y1UA 2JDPA 5BNPB 4O9EA 1UX7A 3RJ2X 2RM21 1GYKA 2CWMA 3WDXA 1F4AA 1EAH1 3SNMA 1OA3A 2I2SA 2LALA 3V0AB 3K4DA 2Y8KA 1W2UA 1GQGA 1W8FA 1BBT2 2LTNA 2E9QA 2WSVA 4GKYA 3WNMA 1YC61 5KXEA 3MZHA 2XKOA 3ZN5A 1A78A 2ZKLA 3VD5A 4V1PA 3GZUC 5FLJA 1REFA 1RVF3 1ODNA 1UQXA 1YFXA 4RQPA 4WVWA 4B4QA 1XNKA 2D6LX 1WW4A 3VBOA 4H2AA 3ECQA 4FOWA 2P37A 1ENSA 1J1TA 2VTXA 1ZYBA 2WNUA 2AR6A 3O1TA 1H8VA 5KR7A 1W03A 3R0RA 1RUOA 2BDRA 4E4DX 1OHFA 5J96B 1ND2A 2AC1A 1Z0HA 3JB8A 2WL1A 4JGYB 3WXPA 4DOUA 1WUVA 1X9PA 4YSFA 4L2NA 5CAZA 2QTWB 1B09A 1HN0A 1G9CA 2HYXA 4EJRA 3D82A 2BBAA 2PHDA 4HKWA 1VIWB 3B5LB 2R16A 2R0FA 3TRSB 1A34A 4IV1A 4BK5A 2BGPA 4MVTA 1RVF2 1SMVA 3TN92 2WSUA 1BKZA 1OF3A 4QU2A 2PHLA 3K77A 3PVEA 4WM7A 3WF0A 1MQTB 2BVBA 2W1QA 1HKDA 2DYCA 1RMU1 4P9XA 5H9SA 4CCMA 4Q8KA 1IPJA 4KGGA 3VKFC 5LA1A 4CP1A 5EWSA 1PZ9A 2A6ZA 3ZXEA 3WP3A 1RUE2 1PO23 3NNJA 2BOIA 4IERA 4IEZA 3V0BA 2G19A 4TTGA 4DNYA 4XZUG 4HXCA 5JSOA 4FPKA 1UMZA 1QQP3 1UY1A 2X5IC 2OA2A 1SLIA 4MX3A 2H0VA 5ACA2 3R05A 1URXA 5K0UA 1PO11 1CAWB 3RZHA 4M3CA 1EAH2 2XUEA 2GNMA 2XVLA 4IDZA 2ID4A 3RSJA 1CR7A 2GC0A 2KXLA 1UPIA 4R9AA 3NNMA 4HKOA 2ZX1A 2HEVF 1S0GA 2VBPA 1QH7A 4P9YA 5C4WA 1PM7A 3WY6A 3NAPB 2RDRA 1LHUA 2J1EA 3SMHA 2Y38A 1RUD1 2JENA 1ZBE1 2VR4A 5T5JA 4LHNA 1KJLA 5E8AA 1TEIA 4XUTA 4CPBA 5EFUA 3ZSEA 1I1EA 1N1YA 4CXXA 2PFWA 2QCSB 3GBWA 2PLV3 2XHNA 3HPNA 2B42B 4Q4W1 1G86A 1GSLA 1XC6A 2R49A 4XVHA 2JG9A 2E7TA 3O12A 4Y1ZA 2ZGOA 4A6SA 2WLQA 4AFMA 3KT4A 1V70A 3I2JA 3WLUA 5L9VA 1W6MA 2ZOEB 3H7JA 2BVVA 2D93A 3AVRA 5JXJA 2WO3A 3Q8BA 2CAVA 3VKNA 1VB4A 4F3JA 3K3OA 1Y43B 2E26A 1MZEA 3LPGA 3VDCA 3WQBA 5I0RA 4GWIA 2HBUA 1QXRA 1VLNA 2DCKA 1KGYA 2C0ZA 3CBNA 3ZKYA 1QWRA 1LOCA 1UY3A 1NCQC 4DFSA 5C5TA 2XPJA 2VVFA 3KSCA 3ES1A 4FFFA 5GKAC 1BLZA 1DGLA 5K0UB 4PQQA 1OXCA 4RS5A 1SLAA 5JOWA 5IVBA 4FFIA 5ABJA 2E51A 1ZVFA 2O1QA 2A7AA 4H7MA 1AYN3 1HV1A 4YW5A 5F5QA 1RJ8A 2PHTA 1HV0A 4N7UA 2CHHA 4CCNA 4YW3A 4LHLA 3CJIB 4IEYA 4NJ4A 4P9GA 4XURA 1NOVA 5EJZB 3T30A 3RWNA 2OKXA 4FFHA 3RI8A 3U37A 1QY4A 4JVAA 3AL6A 3BU0A 1VBA1 1ZRFA 3BIEA 1F35A 1REDA 1VBA3 1VAKA 1KXGA 1R081 3AM2A 4QQLA 1ZZ8A 4DXRA 1ENRA 5FZ8A 1YWKA 2MEV2 5EIYB 2SLIA 4JGYC 3HN3A 3MI8A 2AENA 3AP9A 1TE1B 4OLLA 3LIHA 4QPGB 5A7SA 2R061 3BGAA 3ZO0B 1UKGA 4E4SA 5CFDC 2JG9C 4NRMA 2ATFA 1CJDA 2YBKA 1N1SA 2NQYA 3K46A 5A7WA 5HCHA 2H6BA 2W08A 2A73B 3FE5A 2RMU2 5I0TA 4B3NA 2E31A 1LOFA 2VBBA 1SFYA 4XMAA 4LLFA 5C8WA 3F95A 1TME1 3AP6A 1O4TA 1SQ4A 4L11A 1W2OA 4PCRA 2W2IA 4QDSA 3ZMOA 3MO4A 1FNYA 1RUH1 3MIFA 1FPN3 1D4M1 2OQ7A 5GZCA 1GOFA 2E6VA 1K45A 2XLFA 2GSYA 4XDPA 3AMPA 4I3PA 3DYMA 1JHJA 1ULOA 1OOPA 2P3KA 4OHWA 3RJRA 1RUC3 2P6HA 2Q8CA 3USUA 1EV11 4FCAA 3IKWA 1JYXA 5F3CA 1RMU2 1NA1A 1WBFA 1XE8A 4YW1A 5A3WA 1WBLA 4LO6B 1P8JA 2XONA 4XHXA 1BK0A 2KM2A 5C9AC 4E4ZA 3O1UA 3JD72 4Z92B 5BNNB 1W6PA 1ZZ6A 1RXGA 3WF3A 1SPPA 1WW7A 3KS7A 5CG8A 2XR4A 1C8M2 2WQZC 3GDBA 4N9IA 4B7EA 1YQ8A 1DFQA 2QQKA 3BALA 4AHWA 1O5LA 1V9U2 2J1SA 2QQNA 1VALA 3EQEA 3PTRB 4XUNA 4UFKA 1NYWA 3ATGA 4K1ZA 1VMHA 2B45X 5FYTA 3MUZ1 2PQQA 2ZABA 5CB7A 1D4VB 4C0HA 5A70A 3IT8A 5IK8A 2WKKA 3N35A 3ABZA 1I6XA 2ZEWA 3KVBA 4KG0A 5I8YA 2RM22 4L97A 4RFRB 2B5HA 4BMBA 3OGGA 1SBEA 4YWAA 5IATA 2JD9A 1GZ9A 3MICA 2FDGA 4WVZA 1F31A 3ZN6A 2DVDA 1LOBA 3D3AA 4EWDA 3AMHA 2HWD1 2RR11 3RQ0A 5BNPA 1HQLA 3KV6A 1ND2C 4RR3A 1JYTA 4AG4A 2DVAA 1G9AA 1ZBE3 2VAUA 4UW4A 4FQ4A 5DDJ2 2B46X 1W6NA 3KGZA 5BV6A 1ULFA 2D6OX 2Y34A 1GP4A 1VBB3 4ZZ8A 2PAEA 1UOBA 3GM8A 4JV4A 4C91A 3RI9A 4QAWA 2JB4A 4R4ZA 4RL7A 1OI6A 3SCGA 5DABA 3TYJA 2UY8A 1AYM3 1W06A 2JB8A 2VU9A 2YZ4A 1XYOA 5T52A 1BEV2 3BN6A 1CX4A 3JXSA 3WG2A 5FK8A 4I0BA 4DIQA 4ONUA 4AW7A 5ABJC 4QGMA 5JI9A 1NE4A 1OQ1A 1V6IA 5FKBA 3B9IA 2ZHLA 1SFNA 2G4IA 3WW4A 2ZGUA 1GLHA 4JGYA 3X29B 1W9SA 3AYAA 2BW8A 3ZN4A 1L7QA 1QOOA 3FHQA 4CDXC 1DHKB 2W1WA 2ZMNA 4KNCA 4HMZA 2OUHA 5FPZA 5A6ZA 2VOKA 2HWD3 2HWC2 2RR13 2Z5WA 3AL5A 3VN4A 4BA6A 1DG6A 3H3ZA 4C90A 5IAVA 2AYHA 5I8SA 2VW0A 2BFUL 1H2KA 4GULA 3ZFGB 2WBKA 1CQ9A 5B2GB 4OHYA 3CO2A 3HQXA 2WC2A 1L7LA 1HQNA 1WD4A 2DUQA 1FPN1 3G7DA 3K4ZA 5LA2A 5C9AB 4IEWA 1JOPA 1W6MB 2QQWA 5FBZA 2WWJA 4Q8LA 4PF1A 4H3WA 4QX2A 1OVPA 3AFGA 3KMHA 4UW5A 3ZYHA 2PELA 2BNNA 2RS32 4HONA 4MH0E 4LBJA 4QPGC 3NSTA 3UGGA 1PMIA 4XFHA 1V9U1 5FZMA 1EY2A 5A7QA 2GN7A 1ZZ9A 4WZCA 4N8MA 5LB6A 3ZYJB 4CCEA 4ZU5A 3U07A 4JTNA 4ASMB 4LO5B 5FUPA 1X50A 2AEYA 4LEJA 1NY72 1PHMA 2PN5A 4AQ2A 5JOYA 1YFWA 4YZ4A 3RMYA 3VKLA 1XBFA 5KXCA 3H8RA 1ZBA1 2VMCA 5T5LA 5FYYA 3RRDA 4D0QA 5DMYA 1W39A 1OUSA 5JZGA 1DQ2A 3QOPA 1VRH2 5I0UA 3I7DA 1JHNA 1MS1A 4Z2WA 4AVVA 2Q0AA 3CDZB 4UW6A 4XIOA 2Z79A 4QKDA 1FMD3 3I2KA 4QQHA 5APAA 3UKVA 5FXXA 1HXS2 3GALA 5JXHA 1TMF1 3U14A 1W04A 1S0JA 3CKHA 5L9BA 4FSJA 3NAPA 4Q4Y2 2WIIB 5DAPA 3ZFGA 4XBLA 3U4SA 1B35C 2IC1A 1JUHA 4AVSA 4DUXA 2NN8A 1AR83 1H1MA 1OD5A 1S2KA 3ENRA 4BMEA 5LCWL 2JG8B 3DECA 2PHUA 4PIZA 5FZ9A 5LASA 5A1AA 4FP3A 3PMSA 3LFIA 1QJX2 5C9AA 5CISA 3MF9A 3DN7A 1U0AA 2HWF1 3W9AA 5FMBA 2DVGA 4XJZA 1VAMA 2UU8A 4LOSA 1G8WA 5EPAA 1WW5A 4DRVA 3C7HA 1Q5OA 1WLWA 2DTYA 4XETA 3VKOA 5A3LA 2A6XA 2EXJA 1COV1 1RUI2 1O59A 3KF5A 3WINE 1DLLA 1LOAA 2FBEA 1ZZCA 2D3SA 4A7YA 4AVAA 2YFUA 1C4RA 4FPCA 5FAXA 4JHTA 1OA2A 3MDPA 5A3MA 4FPYA 1PVC3 2X8KA 4QGNA 2HJIA 3DEMA 5FFOC 3HIFA 4RS5B 3RFRA 4K6BA 2EAAA 5CBLA 1Y9QA 3T0AA 4YVSB 4LNVA 1MS4A 2DCJA 5BY5A 1IS4A 1QJZA 1JZ8A 4WM8A 2EIBA 4PI2A 4BYYA 4BQ4A 3I97A 1D7PM 1QIQA 2VCBA 2XGXA 1U5XA 4I2OA 2VOTA 4HFSA 2MEV1 2UYBA 1HQWA 3UGHA 5KXDA 1A3KA 5BNNA 4XJ9A 4XW3A 3ZPYA 2D6KA 4B7KA 4GMP1 5JWPA 2HWB3 5DUUA 2VGDA 4XFAA 2OYZA 3RWKX 2HWF2 5JPNB 4RSUA 5A7WB 5IVCA 1QJX3 4HG6B 4JKMA 1A6CA 3U78A 3WEZA 3AC0A 4QX0A 2CDOA 3WHUA 3LCPA 3LA7A 3N7LA 5DAQA 1XU2A 4EN9B 1NXMA 3AYCA 1KDKA 5JUVA 5I0DA 4OQ9A 4N43C 1AR82 3AZVA 3NJZA 1GZWB 5F6KA 5D1IA 1HJFA 3GCXA 4NPMA 1JOBA 1YYNA 3LD8A 3OBZA 4OZXA 1HXS3 3D4KA 1QDCA 1JYVA 4RS5C 3ZIWA 5GLVA 3WQ1A 4QU1A 1V6OA 1NQDA 3HOBA 1OPOA 5JMCA 5CKMA 3RG0A 1SLTA 3APBA 3I3BA 4FFGA 3WDUA 2IVJA 3K2OA 4BPZA 3LQCA 3MLJA 4LBMA 1F9KA 1JODA 2WT0A 5E89A 2KA3A 2XJPA 2RS12 3PTYA 2WNOA 2ORZA 4O7XA 2ZPXA 4LMFA 4YGDA 1W8UA 3N7KA 4KWKA 5E88A 5JOXA 1AJOA 4XQ4A 1HB3A 2X29A 4LBQA 2P3IA 1OVSA 2D3PA 4JHZA 2AGSA 3VBUB 1Q8SA 1QJEA 4MXVA 2EXHA 5C3OA 3U75A 5JPMB 1UAIA 4GJYA 4DB5A 1KS5A 2ZKNA 4IQPA 5HI0A 5LEJA 1OQEA 1R1A1 4JAAA 4BE3A 5F8PA 3IAPA 3O0VA 4NOTA 4XUPA 2VOXA 5FY0A 1H2MA 4KMQA 5A3UA 2QQPA 1O3SA 3TB0A 4W8JA 3POBA 5EV7A 1PZ8A 2YHJA 4OHZA 1F4HA 3L2HA 1QJY2 4RA0A 3G6JB 1O4YA 1RVF1 4LIUA 4MHUA 1JYCA 2LROA 4CP0A 2QZ2A 2IXHA 5F5CA 1OQDA 2GC3A 3WUDA 3BI3A 3POIA 4PT6A 2HWD2 2RR12 3THPA 5F9TA 4Q4X3 5HCAA 2MHFA 4ZU7A 2BZDA 2XG3A 2ZS6B 1D2QA 3IPVA 3BPSA 1J83A 1W3VA 3SLIA 1EYBA 2CGOA 2R042 3H42B 5CZKA 1MZ6A 3DUIA 1DCSA 2XOMA 4XCAA 1ASJ2 1BK1A 1G6NA 3EMRA 4JRLA 4OHVA 5F2SA 4XFFA 1E57A 2FDHA 1GFF2 3LZZA 2RJ2A 1VE0A 4Y26A 2GH8A 2JX9A 4MZUA 3MHZA 1WKYA 1AR93 4AHXA 3VL9A 2VMHA 4RGGA 4S2FA 1QNYA 3RPQA 1WWYA 3Q8CA 5BXXA 4RQPB 4COUA 2QQOA 3IMNA 2BEOA 2VW2A 4B4RA 4QX7A 4YM0A 1XQNA 3F2ZA 3OUHA 3RGBA 1YEWA 1HRI3 4LE4A 4Q4V1 4NHLA 2Q1MA 5FP8A 1Z7S2 1OLQA 5GZDA 2ZX3A 1QNWA 3ZR6A 3KT7A 5ANQA 4YW4A 4YVSC 3WDYA 1PVC1 2JJ6A 5FZEA 3D0JA 4Q29A 1UU4A 4BQYA 1X33A 1W99A 3ITQA 3HT2A 4CDWA 1RUE1 2QE3A 2W39A 4E9KA 5C3RA 2BGOA 1DDLA 1RXFA 2VUCA 2VNRA
chains in the Genus database with same CATH topology
1QOTA 1AL21 3KM5A 3OY8B 1BEV1 1UL9A 5HCBA 4AI2A 3KT1A 4FTEA 4I3GA 3B3QE 4HLTA 1EP0A 3IWZA 3M8LA 2DUOA 3CEWA 5EJ3A 2FZ1A 4AEJA 2RE9A 4EV0A 3OF1A 1AR91 1RINA 2WZR1 3TAYA 2D3RA 1V9U3 4CEYC 1PIV2 3R4DB 4ISQA 3MLLA 3E6CC 2VG9A 3MFAA 5C33A 4GH4B 3JD73 1OFSA 3LWCA 4IEUA 3E97A 1WW6A 2JD4A 2RS51 3CL1A 3T1MA 2TEPA 3SCFA 2VNGA 3VBFC 2IFRA 4I0AA 4QXKA 3TBDA 1YJKA 3M3OA 1CIWA 1RUC2 1JTZX 1MZFA 2JKBA 4Q27A 2UY9A 1NCRC 4XFGA 5JZGB 4LBQD 2EAKA 4KH9A 4QPIC 1AXZA 3M2MA 5LRRA 4PIYA 5AC91 3PHMA 4D69A 1MEC2 1OMIA 3QH7A 4QX5A 4CDUC 1R1A3 4LO4B 3B9CA 3AP4A 2XJVA 3WP4A 2VOVA 3J26N 1YI9A 3WDWA 4Y1XA 5GLUA 4JTOA 4Q4X1 4Z1VA 3KLSA 2ZMKA 2DFBA 2JECA 3V0BB 1RUJ1 1ZZ7A 3ZMNA 1O3RA 1GICA 1VBA2 2YC0A 3MIHA 1RUI1 3VDDA 2WFPA 3WVJA 1HRI1 2UYAA 3EJKA 4GA9A 4N53C 4UBGA 1G9DA 1JH5A 4E2GA 1VBD3 2C5DA 4YGBA 1YJLA 1AR71 2NP0A 4XQWA 4U2AA 4YVSA 5FTTC 1GBGA 3NKTA 2PTMA 1QJU3 4XMIA 4FPFA 5FQ0B 1CVNA 2F4PA 2YMZA 4LBQB 2BUKA 2ZGQA 3WQ7A 1KS4A 2HWB1 3FX3A 4Q4X2 3ZYRA 1UZZA 3LKJA 4DQAA 2XH6A 4LHKA 1LHNA 1RHI2 3JQXA 4AGGA 1XNCA 2G9FA 1QJY3 4A3XA 3AXDA 4NR1A 1DZTA 1RC6A 3WUCA 2P17A 4AHYA 1SEFA 4Q4W2 1S0BA 4Q1RA 5KHKA 4XHBA 3VBFB 1DF0A 1Q3EA 2ZGSA 5E1RA 1M06G 4MXWB 3ZYPA 5ABJB 3CU7A 3O7OA 1B35A 4LO7A 4DY3A 1N3QA 5A32A 1TQ5A 4CEWC 4YLZA 3GBFA 3NO8A 4GH4C 3WG4A 1AR73 2O0OA 3AKPA 4FOYA 5ACA3 2HWE1 2WA4A 2VUJA 2ARBA 4HVOA 3HWJA 2ZZJA 1Z78A 1Y3TA 4LUKA 4I01A 4LA3A 1VBE3 1PVXA 3VBOB 3B01A 4AI0A 4CDQA 2FQPA 3AB0A 2MPFA 4MGIE 3WDTA 5T50A 1V6MA 1IS5A 4COVA 5CNAA 3LSEA 4LUMA 5SV8A 3TN93 3QH6A 1V6JA 1G9BA 4RHV3 5FRAA 2CNAA 1N47A 4K21A 1D0HA 1S2BA 2FMDA 5T54A 3JB4C 4Q0VA 4W65A 3VZLA 1CGPA 2HWF3 2BQPA 4FPOB 1AYN1 2XL9A 4PLOA 4QPIA 1IOAA 1UD1A 1NLRA 2XKPA 2ZBJA 2YV8A 4WM7B 1YCIA 1WCSA 2XL7A 3M3CA 2H6CA 1W6NB 1SBFA 4CRQA 2HWC1 5D8AA 1LESA 1C3HA 5GZEA 2ET7A 2DUPA 5DUWA 4DZGA 2XUMA 1PVC2 1ND3A 1HX6A 3NWKA 3D6EA 2FZ2A 4FXKB 3VHNA 1MQTC 3VKMA 1JBCA 4BIFA 2Q1ZB 3EHKA 1COV3 2XJSA 4M0NA 2ZHNA 2A3XA 4NVPA 3OGJA 2PLV1 3VGIA 3AKSA 5LK7B 4OVEA 1SCSA 4EN0A 1Q43A 3CLPA 1RUNA 4E2QA 4FQZA 1ASJ1 4PIXA 4E27A 1JUIA 3M70A 1J1LA 4LBNA 4N90A 1HRV3 1LHOA 2W68A 1PGW1 3ME2A 3OY8A 1U12A 5KBFA 1DQ6A 5I93A 3O0XA 5L73A 3LB9A 1GQHA 1IS6A 2NMOA 1WCKA 1GZCA 2PHWA 3VHRA 1LRHA 2ZGLA 1AF9A 1ULEA 4HT1T 3ZSLA 4BWOA 4PBPA 4NWWA 2EALA 3JCIA 2WA3A 5JDBA 5EZWA 5CFDB 2QUOA 2E7QA 1ZBA3 4LO8A 1RUD3 3VDDB 1XNBA 1O4ZA 2VW1A 3NAPC 1F2NA 3K51A 3WW3A 1BCXA 3B93A 1U5YA 3AMQA 4XXAA 4EN6B 3MFCA 4HKLA 1O7FA 4GWMA 1RUG1 2WS91 1FX5A 1PO13 1YIFA 3AMMA 5IUQA 3NVCA 1CPMA 1CJPA 1CAVB 1WMEA 1H4HA 2PHXA 1LOFC 1QQP1 1SACA 3M4FA 4HN1A 1OA4A 1VP6A 4LA2A 4Y1YA 1OOPC 2N7GA 2X53S 2D6NA 4W6WA 4I0WB 4QPGA 5AFEA 2P34A 2WNUC 3JUUA 1HIXA 5DZFA 2ILMA 2PHRA 3KZ4C 1X82A 1ZA4A 2ZAHA 3OCPA 4NHMA 4B29A 3LAGA 3D8CA 5FOJB 4PBOA 3B7MA 2BPA2 2R1BA 2DWRA 5I0SA 1CAUB 1R092 1WD3A 4B8EA 1NG0A 5A33B 2AREA 5AC92 1GNHA 2DU0A 3MYXA 4COWA 2VXRA 1DGWA 1XE7A 3ZX7A 1SLBA 1D4M3 3DPRB 4K40A 2NYYA 1DQ0A 1FNZA 3E5QA 1N1VA 1OLRA 2F6BA 2BTVC 5A32B 1V00A 4GB32 1BJQA 1NA1B 3KCYA 1RB8G 2CWSA 2FHRA 4PDWB 4HSLA 1VBB2 4AFCA 3VBHB 1HDKA 1K5MB 1SDWA 2ZGTA 2TUNA 1YO8A 4AQSA 1W6PB 4FBFA 2Q4SA 1COV2 4DRRA 4META 1CD3G 4BHPA 3LA2A 2PAMA 5GLZA 1LB2A 2VVEA 5BNQA 1RUJ2 1RHI1 3RDIA 3ILFA 3OTFA 3B02A 2RM23 4XBNA 5T3NA 1PZ7A 4AEKA 3OBRA 2QNKA 1YRZA 4PLMA 1BVVA 4TLFA 1IKPA 5A33A 1LU1A 4AEMA 5K8SA 2XJQA 2XLAA 4FPGA 3KB5A 3FLPA 4LBLA 5EXOA 3H1MA 2YUEA 4N53B 1J3RA 4GQ7A 1SBDA 1GANA 4P9JA 4YFZA 4WM8B 3VV1A 4AI8A 3DV8A 4JDMA 4GXLA 3FBYA 5DG1A 1W6QB 1ZZBA 2DURA 4P9LA 4G4FA 2QDRA 3N4MA 5J36A 2DU1A 5JSPA 3V64A 5KC5A 4JDNA 1PK6C 5J3UA 4QD2A 4BCUA 1VBE2 3DKWA 4Q4V3 2R073 1FOD3 4AWDA 4DY5A 1CN1A 1O91A 2D98A 3WW1A 5L7OB 4AFAA 3UV9A 1SCRA 2HEYF 4COZA 4XFBA 3FHIB 1MVQA 4L99A 2UWBA 4E2SA 3KQRA 1MS5A 1PGW2 4XFCA 3ZFGC 4R9CA 1YHFA 3M3QA 3WZ1A 4Q26A 3SISA 1LECA 1FV3A 3ZYGA 1RL3A 3EO6A 1MR5A 4K20A 2VVDA 1V6LA 1ZRCA 4D7TA 4Q4W3 3NV2A 3ZXDA 5CG9A 1BMV1 4MGZE 2XWJB 4C1XA 4OI1A 5I91A 1W6QA 5KWRA 1RUF2 2RS52 3VBHC 3D5OA 4KU8A 5D8AB 5CFDA 4OFGA 3H1YA 1L3JA 4J1XA 2IXKA 2DVFA 3UJOA 3U11A 4ATFA 2O8QA 2W52A 3S30A 1QKQA 4YVWA 3VBOC 5ACA1 5JOZA 4RFT0 4MV2A 3WX5A 4G3YC 4IXLA 4HANA 2PYTA 3FWEA 1ZM1A 4XF3A 2GN3A 5GLTA 4FTBA 2JG8C 3AXEA 3AJZA 4LR4A 2NZ9A 1LOGA 3J8F1 2XBO3 3ZYIB 4HSJA 4MUVA 4O9GA 4Y4YA 4QQOA 1LJ7A 4IEVA 4HVQA 4SBVA 1EV12 3MEPA 3IN9A 2UURA 2TNFA 2ZAAA 2A6VA 4YG3A 4OI2A 5HBAA 3VZKA 3FUQA 1PNGA 3OYWB 5E16A 1NCRA 1QXPA 1EAH3 2ZX4A 4Y20A 4P14A 5J48A 2ZX0A 5FOBB 1BVP1 1LGCA 4AK3A 4I02A 2H0BA 4YW2A 1RUG3 2WS93 4YVWB 4XF0A 2GH2A 1YIPA 4AEDB 1R1A2 1ZRDA 2K2SA 2Q30A 5DXDA 2EF6A 4HK8A 1FOD2 1MACA 3TWIA 3BODA 2JXAA 4AGRA 1BQPA 2GNBA 3WDVA 2YROA 5F6LB 5LK5A 5C4WB 3W59A 3MGUA 3MW2A 3I4IA 2MNGA 3VBHA 3GZTB 4AF9A 4YZ5A 4LE3A 2XLGA 4WM8C 3H50A 3CJXA 4IEQA 4K1YA 4AI1A 3B00A 1H1AA 4MGYE 1QMJA 1J3PA 3ZXAC 3SH4A 5FO7B 5DDJ1 3RYPA 3ILNA 3BU7A 1DYPA 5LEKA 1DGWX 5JI7A 2YGMA 1A8DA 2TBVA 1LCLA 3VBRC 2ZGKA 1XU1A 3ZXFA 4EROA 1PIV3 1QH6A 2WFF1 3QCWA 4GH4A 4RD7A 4XF4A 4XIKA 3GNEA 4CEWA 3CF6E 4AYUA 3LOIA 1NXD1 3UL2A 1DGRN 4CZSA 3IDCB 1KITA 4BLJA 2IXCA 4AE2A 1WLCA 4FP2A 2DF7A 5L19A 3PVOA 1D0GA 4GB31 2NLRA 5IK4A 2QKDA 2C1FA 4Y22A 4F8AA 1RUJ3 2FMYA 3ES4A 4Q0QA 1RUC1 3R4SA 2WLPA 2YGLA 3CJIA 1NY71 3NW4A 4R9DA 4YZ2A 3GHMA 1Z7S3 5FMOL 1YFYA 1HRI2 1H0BA 2IXLA 3VZJA 4NN0A 2Q5TA 1VRH1 1IZ3A 4GB33 1LU2A 3HBZA 4INDA 4M01A 4YG6A 1QOSA 1J58A 1R091 1AR92 2OUJA 3PNAA 4MLOA 1D4M2 1J3QA 4NPRA 2QZ3A 3FUOA 3WG1A 3AKTA 1F8VA 5L7OA 4S2HA 4X8PA 1PGSA 1FYUA 2IFWA 1NZCA 1UCXA 1Q8VA 1NE6A 4JRAA 4N53A 4PQ9A 3E6DA 1UZYA 4XTMA 4M3CF 3USUB 3NL1A 3RMXA 3SITA 4Y24A 5C8CB 5AVPA 2ZMLA 3R4UA 1H8TC 3SH5A 3GBGA 3M7AA 4ZKTB 1OOPB 3H1WA 2A75A 4XILA 4ITCA 4X6QB 1ULDA 3ZXJA 1R082 1NQJA 3ZIXA 1VBC2 4HL0A 4Q4Y1 1XNDA 5FREA 3C3VA 4D3WA 4DMIA 3PJYA 1BXHA 5BNOB 5IK7A 1IHMA 4ZU4A 4DPNA 2CAUA 1PO12 1LEDA 1PIV1 2D7FA 2WNVA 1D2SA 4Q2FA 1JN2P 4FOVA 2R0HA 3ETQA 3PLQA 5J37A 4CDWB 1RUD2 4D7YA 1AYM1 3L9JT 1S0IA 4RR3B 3NV4A 4XE9A 4AEDC 4MXWA 2D5FA 1GR3A 3M1HA 5GLWA 1WLTA 3J9SA 3ZN6B 1FT9A 5C8CA 1DQ5A 1C5IA 2OZ6A 3MIGA 5BUVA 5J09A 3FLRA 2GC2A 4AGVA 4YGCA 5JR7B 3CJIC 2G9GA 1QF3A 4M0HA 2PAKA 1U5IA 3N36A 3ST7A 1AXYA 4JGZB 4AVCA 5J7MA 5CADA 3PMEA 1UX6A 2GAUA 3WNXA 3N7JA 4H7LA 3OYWA 3USSA 4XTPA 4QGLA 2ZHMA 4DS0A 4XJ8A 3PVNA 5T5OA 4U36A 2QFEA 1DBNA 4FOQA 1BYHA 3IM0A 5L36A 4A7KA 4MYEA 4BQ1A 4XF9A 3AKQA 3I54A 4CDWC 5GALA 5KC6A 2WT2A 5F1RA 1W6OA 3HAGA 2WZPP 2YDEA 3DL3A 3S6PA 1LTEA 3H0OA 4YZ3A 2XBO1 3MIDA 2WQ4A 1RUF1 3FBMA 4YM3A 3V0AA 2VH9A 1PGL2 3JU9A 4ATEA 4FTSA 3UKTA 3AP7A 5BPXA 1ZREA 4HK9A 4LLOA 3I59A 4RGAA 3VUOA 4YG0A 5C8CC 4AI3A 3KD4A 1AVBA 1AX0A 2IXJA 1NCRB 4RHV2 1N3OA 4PJYA 2XJRA 3VDDC 1VAVA 1SLLA 1AR81 2BGCA 1QDOA 3ACLA 2WNEA 4R9BA 3J4UH 4N43B 4IETA 1WCDJ 4IV1B 1C8NA 5CVRA 2Z69A 1OKQA 3ZFFC 4N7IA 2EVXA 2P2KA 3RYRA 2WZR3 1XYNA 2R041 2HWE2 2GZWA 1AR72 1CONA 1RJ7A 4BLIA 2JG8A 1LHWA 1POV3 1UW8A 3N7MA 4Z8BA 2BNMA 4XOGA 4TWTA 2RS33 3FFQA 3INAA 4JGZC 1FAYA 1APNA 4L92A 1I3HA 2WFF3 3ZXKA 2ZZQA 1TME2 4YVWC 3ALQA 1ONAA 4AXOA 4CEWB 1UKRA 2CL2A 3JBG3 3OD0A 4YZ1A 5JLVA 1CAUA 2VY0A 3ZFEC 4FPEA 4Y22B 3WP5A 4AQ6A 3GYDA 3WP6A 1POV0 1RHI3 4Y1VA 1UIJA 5JAXA 1NLSA 2W0XA 4N43A 4AQTA 4XPVA 3JBG2 2R062 1C57A 4R4XA 3WR0A 3A4UA 4WVMA 3KCCA 3QD6A 5AVAA 4PDWA 2WFF2 3THTA 1QJU2 3HN1A 1NCQB 4X8NA 1GV9A 3P3NA 1V6NA 1MS9A 1KQRA 3QACA 4A2UA 5BNPC 4LBOA 2WZR2 4OHXA 1VBD2 4M00A 4OUMA 3UK9A 5GZFA 1LHVA 3R6SA 5I8TA 3H7YA 1JXNA 1IKQA 4LBKA 1RITA 2WINB 1FI2A 2R6QA 2E7AA 4D7SA 1G9FA 1VBB1 3WG3A 2GC1A 1YUDA 1A8MA 4XQDA 1UF2C 5GZGA 1YNAA 4OULA 1ZBE2 1AZDA 1Q56A 3VHPA 1VJ2A 1WGPA 1TNFA 2NMNA 2GDFA 1IS3A 4ZXKA 3OJBA 4IV1C 3VBUA 2JDZA 4YM2A 2D44A 1MEC3 3GZAA 3BCWA 4AVTA 2CV6A 2GNTA 3KCXA 3BOPA 2IWGB 5BNOA 2EXKA 2RHPA 1UU6A 3AZXA 5T5PA 1LEMA 5DUXA 3LSDA 3SHRA 1C8M3 5JIAA 3CNAA 3MIBA 2JE7A 3EBRA 3LOBA 1BBT1 2RJLA 2WNVB 4QMAA 1UPSA 1C5HA 2V73A 5JZGC 1AXKA 2D43A 1HXS1 1F5FA 5EYXA 2CGNA 4CP2A 1F5JA 2AH2A 3PJQA 3T1LA 1PGL1 1ENXA 4KU7A 4IL7A 3VZMA 2ES3A 1FPN2 1MQTA 5HCFA 1RUH3 2YXSA 3E5UA 2GU9A 2CY6A 2SBAA 1MS3A 2XVKA 4H55A 2HYKA 5KHGA 1XXNA 4HZFA 3RS6A 4JC1A 4QT6A 2K9ZA 2E53A 1FV2A 4FVVA 2EXIA 4JGZA 1YLLA 2RS31 4ISRA 4MGKE 2EA7A 3MW3A 2WNUB 5FDBA 1O5UA 1POV1 1FOD1 4XZPA 1ND2B 4K8FA 3SCHA 4XEZA 2LM3A 3U0ZA 1ZNPA 4YNIA 1JOJA 1W6OB 1H8TA 1N3PA 2D6MA 4XXPA 5GM0A 1IQAA 3ZXLA 1MVEA 2DCYA 2CYFA 2ZGRA 3M3EA 2XJUA 4HPKA 3O14A 3RNSA 4XYXA 3UKNA 4CYDA 3AJYA 1AYN2 3QLQA 1HRV1 2DV9A 5FCCA 1PK6B 1Y7BA 2D6PA 4B4PA 5FO8B 3M3IA 4RR3C 3ZSJA 4CEYA 4AFDA 4K7JA 1C1LA 1YI7A 4TSVA 2GMPA 5EYYA 2WJSA 1ASJ3 2DTWA 5TSWA 4Q0PA 2QJVA 2R043 4QM9A 3AZYA 4QQ2A 4COYA 3WOGA 3MPPG 4JCKA 4M3CE 1YFUA 1DZRA 5C4WC 2YYOA 3AX4A 4FPJA 1H4GA 5DZEA 3I59B 3FMGA 2QDNA 1U5ZA 1FMD1 1KD7A 3MPBA 2ET1A 3SXWA 1R083 4P5HA 4FT8A 1ENQA 4Y20B 5JCTA 5J98B 2IXIA 4PLNA 2PLV2 4CTEA 2A70A 4HN0A 2ZACA 3S0MA 1H2LA 3AP5A 1DQ1A 1Q8QA 5CU1A 1DIWA 1ALYA 4GMP0 3A0NA 4XDQA 1JW6A 3POSA 4UBHA 3VBUC 2OPKA 3PVBB 2JICA 3ZXGA 2VMGA 2Z2SB 2VOWA 2VQ0A 1C8M1 1PK6A 3H3UA 3H8UA 3POYA 4XJUA 1R1ZA 3O5SA 2A3WA 3B69A 2BWCA 2JE9A 5FLIA 1I9RA 2RMU1 4WM7C 3AK0A 4R52A 2WWSA 2RS13 3HT1A 2E63A 4EN7B 3AZWA 1C1FA 3P3PA 2CTVA 1MZ5A 1PO21 5K9YA 1G7YA 1LULA 3VLBB 5KHJA 2ERFA 3V65A 4J6GA 2ZCWA 4MSVA 5JVVA 4YRDA 4C0BA 2C9AA 3S7EA 2VUAA 2VECA 2DCTA 3JQWA 1ND3C 2XHKA 3AMNA 4KG8A 1CESA 1H30A 1S0EA 2GNDA 3LA3A 4S2DA 3SH3A 3OBTA 4RQPC 2PHFA 3VBSB 1QGLA 2HWB2 3IDBB 5FQ0A 1RUH2 4DINB 1QJU1 1MS0A 3BOWA 4K9SA 1H1IA 2YPJA 5DG2A 4K3UA 3TOJA 1QHDA 3ZFEA 3O0WA 2A3YA 1NCQA 2V5YA 2I07B 4HBNA 4QHBA 4CDXA 3UJQA 2D97A 2DVBA 3N3HA 3WT3A 5D8AC 3JZVA 1DZQA 1WLDA 3ILRA 3IDEA 3ZSKA 2PA7A 1M4WA 3KGLA 3RYKA 1BBT3 4BOWA 4Q0UA 4XFIA 1RUI3 1UU5A 1OFNA 5CFCB 2I45A 4FXGB 2ZA9A 4YYOA 4S2GA 3NV1A 1RGSA 1TMF2 4PF5A 1V6KA 2OVUA 5JSRA 4IV3A 3ASIA 4BIOA 3HR9A 1AR63 2ZJCA 1B35B 3VZOA 4UXAA 1RUG2 2WS92 1C28A 3FLTA 3EXUA 3POWA 5BNNC 1DU3D 1XYPA 1WA4A 2A6YA 4Q4Y3 4XJAA 1H9WA 5L7OC 5BNOC 2NM1A 5K0UC 2D5HA 3VL8A 1OSGA 1FMD2 3WHTA 5DZGA 3URFA 3ZDSA 2X5IA 4HVRA 1VRH3 4FAHA 1EV13 1S0CA 4CDQB 4WVVA 4OI0A 1CPNA 1LKNA 3WCSA 3DGTA 4GIQA 3VBRA 1H8TB 3ZVXA 2NPIA 4F83A 5CFCC 1HW5A 4L9BA 2XBO2 1AL22 4KWJA 4W6YA 1LGNA 3WW2A 3OPZA 3TNQA 3IBMA 5DUVA 3DF0A 4P9WA 1CAXB 1QU0A 1UN1A 2V09A 3BB6A 4QPIB 2LUWA 3HMYA 4I30A 1KRIA 1NA1C 2BNOA 4W6XA 2R063 4KQ7A 4YM1A 2K0GA 3H9AA 3NKGA 3QBQA 4RHV1 1LGBA 4GALA 1K5MC 3AYEA 1MS8A 4AHZA 4KGQA 3TN91 1ND3B 1FXZA 2OZJA 2VULA 1S55A 1RUF3 2GMEA 2HWC3 2O8OA 2RS53 3FZ3A 3GHNA 4OI4A 4P9IA 4AVBA 3JD71 3LGRA 4PDWC 5CIRA 1KDMA 1Q8PA 2YY1A 3DPRC 1TME3 2D40A 4QQPA 4UW3A 4AEDA 1W0OA 3AYDA 4LTAA 2GALA 3U10A 1DGRA 2WNVC 5H9PA 4J1WA 2XWBB 4KL1A 2A5ZA 4KWLA 1BZWA 1ZX5A 2DCZA 4H14A 1S0DA 2HWE3 4Z82A 4HPKB 3AFKA 4CEYB 1RTVA 2OW4A 1BEV3 3AZZA 4NWVA 1CAXA 4SLIA 5FO9B 3Q9OA 5KXBA 1AR61 1AYM2 1O3TA 2ZX2A 2AZ5A 3I2DA 4XF1A 2DFCA 1GKBA 1LENA 4I09A 4R8HA 5IK5A 2R072 4JQRA 2EIGA 4Q4V2 4XBQA 2B39A 1VR3A 3J8F2 5DDJ3 2VPVA 1VB2A 3IIAA 4IEOA 2Y26A 2JEMA 2A71A 4N9HA 1DYKA 1VBE1 4X6RB 1VBC1 2CGPA 1QJY1 1H2NA 5H9QA 4HETA 4Q0SA 1IPKA 4IESA 3FJSA 1LR5A 5KHIA 4GWNA 3S7IA 1BMV2 1LODA 4KBBA 3FFZA 1REEA 3D0SA 4AFBA 4Z07A 3VZNA 1KJRA 3T2TA 1CAWA 5FMOS 4EWEA 1ULCA 4YFWA 1CAVA 2GMMA 5JIUA 2R1DA 1EPWA 4BZ4A 2I74A 1X36A 2Y0IA 4QPYA 1T6GC 1RIRA 5C6CA 3MF6A 5K7PA 4CDQC 1I5ZA 1HLCA 3L2YA 3ZSMA 3WCRA 3MW4A 1TNRA 2BFUS 4Y5Z0 1X8EA 4WBBA 3RZZA 2JG9B 1ULGA 1VBD1 2R32A 3B94A 1Q8OA 4FO9A 4YARA 1RMU3 1AUYA 1X8MA 2ETEA 3MLKA 4C1WA 2B7YA 4CDXB 3BPZA 4BM8A 2ZHKA 3BTAA 4EN8B 4GKXA 2ZGMA 1GZWA 2VMIA 3J8F3 4TYSA 3W58A 2IZWA 4XJWA 3MIEA 5CA6A 1W0PA 1MEC1 3E5XA 3DPRA 1X7NA 1KFUL 2AUYA 1GNZA 4M3CB 2ARXA 2RS11 4ES9A 1LOEA 4ASLA 3U4XA 1PNFA 2Y0OA 4QM8A 3ROUA 4IV3B 2RMU3 1S1AA 2R30A 1QJX1 1FATA 1IGOA 2WT1A 3VBSA 4G9SB 1YXWA 3OD4A 2RJKA 3WV6A 5AC93 4URTA 1K5MA 4ORFA 1R093 1WMFA 5HXVA 2XJTA 2B9UA 2MEV3 2Q8OA 1QXJA 4WVMB 1WMDA 1SLCA 5LRSA 5KHHA 4ES8A 4CDUB 3ELNA 4Q1PA 3C2UA 3I8TA 2BYVE 3NV3A 3ZFEB 3GF6A 3VHOA 1EPZA 4LT5A 4WV8A 1XRUA 5SV5A 2A6WA 3VBSC 4EWAA 2ENRA 5CFCA 4FPLA 5AFBA 4F7ZA 3FC0A 4NO4A 2BBVA 3ZFFB 2QVSB 4GMP3 2VQAA 2BWAA 4IEXA 5T55A 2ZGNA 4A7ZA 4WZFA 1S0FA 4YGEA 3E6BA 4FAGA 1DQ4A 2HEWF 2HKXA 3WD5A 1VBC3 2R071 2ZTNA 4TZDA 4NHKA 1AL23 5IT6A 1Z7S1 5GJ6A 3WQ0A 1ZBA2 1ZRRA 3HD8B 4OUSA 1H9PA 2UWCA 1AJKA 4D94A 1AHSA 3JBG1 3AKRA 4JDOA 5FLHA 1OPMA 4CDUA 1AX2A 1AX1A 2X5IB 2UWAA 5BYNA 4IEPA 1AL0G 3A0KA 4IV3C 1J59A 1O3QA 1UIKA 1N1TA 2ZGPA 4BH9A 3BIWE 5FPXA 4LULA 5H9RA 1HRV2 2OIIA 3K48A 2B8MA 3V56A 2Z42A 1KFXL 3ZFFA 1QQP2 1AR62 1JYIA 3VBFA 4L8QA 3IPVB 3VBRB 2P3JA 3TNPB 1PO22 1RUE3 2VNOA 4DXZA 2XB6C 2XVGA 1TMF3 4FPHA 4Y1UA 5BNPB 4O9EA 3RJ2X 2RM21 1GYKA 2CWMA 3WDXA 1EAH1 3SNMA 1OA3A 2I2SA 2LALA 3V0AB 1W2UA 1GQGA 1BBT2 2LTNA 2E9QA 2WSVA 4GKYA 5KXEA 3MZHA 2XKOA 3ZN5A 1A78A 2ZKLA 4V1PA 3GZUC 5FLJA 1REFA 1RVF3 1YFXA 4RQPA 4WVWA 4B4QA 1XNKA 2D6LX 1WW4A 3VBOA 3ECQA 4FOWA 2P37A 1ENSA 1J1TA 1ZYBA 2WNUA 2AR6A 1H8VA 3R0RA 1RUOA 4E4DX