2DCZA

Thermal stabilization of bacillus subtilis family-11 xylanase by directed evolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ASTDYWHFWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGCSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
publication title Thermal Stabilization of Bacillus subtilis Family-11 Xylanase by Directed Evolution
pubmed doi rcsb
source organism Bacillus subtilis
total genus 48
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dczA00
1QH7A 4S2DA 1UU6A 1REFA 1F5JA 3B7MA 4S2FA 3WP4A 4S2HA 2BWAA 2B46X 2JENA 1XYPA 2D98A 2JEMA 2D97A 2DFBA 3VZMA 1BVVA 3AMMA 5EJ3A 2DCZA 3HD8B 4XQ4A 3WQ0A 2F6BA 3VZJA 4S2GA 2NLRA 3AMQA 2B45X 3EXUA 3AMPA 2DFCA 1HV1A 3WR0A 1XYNA 2VULA 2QZ3A 4XPVA 1OA3A 1H4GA 1KS4A 2DCKA 1H4HA 3M4FA 3VGIA 3RI9A 1IGOA 3MF6A 5K9YA 1XNBA 3AKRA 3WX5A 3AKPA 3VL9A 3MFAA 3VZNA 2DCYA 3WQ1A 3VHPA 3AKTA 3VZLA 3MF9A 5K7PA 1C5HA 1OA2A 1UU5A 2C1FA 2B42B 3WP5A 1HIXA 3VZOA 1H0BA 2Z79A 2BW8A 1XNCA 2DCJA 3WY6A 3RI8A 3O7OA 3AKSA 4IXLA 1OA4A 3ZSEA 3LB9A 3AMHA 1XXNA 3VZKA 1REEA 1XNDA 1UU4A 2NQYA 1PVXA 1HV0A 1H8VA 4XQDA 2QZ2A 1XNKA 1C5IA 3WXPA 2VGDA 4H7MA 3WP6A 1KS5A 3VHOA 1OLQA 1UKRA 3B5LB 3MFCA 3VLBB 1OLRA 1T6GC 2BVVA 3AKQA 1H1AA 3VHNA 3VL8A 2JICA 5HXVA 1AXKA 2BWCA 1M4WA 2VUJA 1YNAA 1W2UA 3LGRA 4XQWA 3WP3A 2VG9A 3WT3A 4NPRA 1TE1B 3WQ7A 4HKOA 4HK8A 1BCXA 1XYOA 4HKLA 3AMNA 1REDA 1ENXA 1BK1A 4HK9A 1NLRA 1QH6A 4HKWA
chains in the Genus database with same CATH superfamily
1DHKB 2YDEA 1PO22 1DU3D 2W47A 3LEKA 3K48A 1G8WA 2BNNA 3NSTA 4QPGB 1ND3C 3B7MA 3MUZ1 4ES9A 3VB9A 3IDEA 4CEYC 5FLHA 3S0MA 3KV6A 2YU2A 4CU6A 1ND2B 3I54A 1QEXA 5FO8B 2ZX1A 3C7HA 2DVDA 3PUQA 3M2MA 2Y6GA 1LOAA 1G86A 4YG6A 3WCSA 2XJQA 1O5LA 2E53A 3H1WA 2ZMKA 1WGPA 1JOBA 4Z92B 3ZXDA 1N1SA 4YW3A 1UPIA 4P9IA 2CNAA 5DUUA 3ZFGC 5DAWA 3KS7A 2B45X 3GBGA 1ZRRA 2DFCA 3M3QA 2W46A 2BP6A 2Q1MA 5I0UA 3V0BA 5DAXA 3JBG3 4NIGA 1UOBA 3CDZB 2Q8OA 1QOOA 4BMBA 2JE7A 5B2GB 4Y4RA 2WDBA 5E8AA 3MV11 2JIGA 2QDRA 1CAVB 4CCEA 2VOTA 3FBYA 1NXD1 1HLCA 4FCAA 2YPDA 1C1LA 3Q8FA 4V1PA 3RI9A 3KMHA 4LBOA 3OBRA 1O4YA 1XC6A 2WNVB 3P3PA 3DN7A 3IIAA 1NZIA 3H8UA 4EZ4A 1N1YA 2EVXA 3RVHA 3POGA 5F6LB 4BA6A 1MQTB 3CEWA 1GWKA 1W6MA 2GNBA 1YIPA 2GP5A 3KCYA 1AR83 2A3XA 3ZFEA 4M3CE 3HR9A 4P08A 1UU5A 1H1IA 2BU9A 4XUQA 2E26A 5IWFA 4BQ5A 1F8VA 1CD3G 1H2NA 1XNAA 2RS32 2WNEA 3E5UA 4QXBA 3D0JA 4JGYC 2VXJA 4CXWA 3W5NA 3I2OA 3P3NA 3A21A 5F37A 3J7LA 4I2OA 1E5IA 1RHI1 2AEZA 5GZEA 2EXKA 3VZKA 1TVGA 4C91A 4BYYA 4AFCA 2K46A 1WMEA 1VBE1 2R30A 2E51A 1RUI3 3MIFA 1B35A 1XNKA 3MW2A 4XFHA 4XQDA 2XBO2 4CTEA 4OMDA 4UF0A 4D7YA 4GJZA 3QBQA 2PA7A 2EIGA 1MZ5A 4QDSA 3H7JA 4LEJA 2IFWA 5BNPC 5CG8A 1NZCA 1KS5A 1WA6X 2NMOA 2O14A 5LCWL 1OFSA 3GZTB 2GAUA 2CAVA 1NCQA 4KWLA 5LBFA 4FPEA 3ZOIA 1ZREA 3QD6A 1FV3A 3B94A 4A6SA 3MW3A 3LPGA 2VMDA 3J9SA 2ZX4A 5L9VA 1CAXB 1X8MA 5FMDA 1SACA 3UESA 5FKBA 2I74A 2VUJA 1W8TA 1SLBA 1W2UA 4B7KA 1CJPA 4DXZA 4YWAA 2ZHNA 3WQ7A 3PU8A 2D6MA 1APNA 4FAHA 3T1LA 1RVF1 5AFBA 2BGCA 4P9WA 3FMGA 2Z5WA 3DYMA 4JDOA 3ASIA 1JI6A 4QX0A 1NA1B 2WC2A 3RS6A 3HJRA 4L9BA 2GDFA 1GNYA 1VBC3 5JUVA 3K4ZA 1UD1A 1XSRA 3M3EA 1GZCA 4FOVA 3E97A 5JOZA 4RD7A 4PLMA 3E5QA 3ZN5A 2Y6LA 4Q27A 4QQPA 3FUQA 4YVWB 1V0AA 1PNFA 3MLJA 1OKQA 1OBNA 1PO12 4A3XA 2XJUA 2W1UA 4TTGA 2GNTA 1X50A 1W3VA 4BIOA 5GM0A 3AP4A 3RJ2X 2HWF2 4RGAA 2FDHA 1D0HA 1K5JA 1LRHA 1ODMA 3I2HA 3EXUA 3BI3A 1Z0HA 1PHMA 4XFAA 5FUIA 1MEC2 1IPJA 1CIWA 2EAKA 2WZR1 1I9RA 4YARA 3U37A 1V6IA 5KHHA 5I93A 2WSUA 2J42A 2R062 1KFXL 1SFYA 3GXUA 3A4UA 1BBT2 2RS51 4PLNA 4ZONA 3V0AA 4RHV3 5BNNC 1R1A2 4L92A 3K4AA 2VCMA 5IATA 3ACGA 1GOFA 2YC2A 1QGLA 5FAXA 1VB4A 2F17A 4Y22A 4WM8B 3NJVA 4NE9A 3VBOC 4AYUA 1IQDC 1R081 1AVBA 1SLTA 1Q3EA 2WN3A 1RUD2 3T0AA 4EN9B 3FHAA 2ETEA 3CMGA 3U75A 5ANQA 1L7QA 1JXNA 4X6RB 3NNFA 5T50A 4BB3A 2WSVA 2AEYA 1YFWA 5A80A 1C4RA 2FZ2A 4HANA 2WWJA 3HPNA 1DF0A 4IE7A 1ULFA 3CKHA 5L9BA 1FX5A 1IS5A 3FZ3A 3Q8AA 3ZYHA 1H2MA 3UT0A 3BYWA 3S7IA 2P5BA 5AC93 2WFF1 3OOXA 4PHZA 5A3LA 4YSFA 2QQLA 3ES4A 4PDWC 4Y3OA 3W20A 3M1HA 2TEPA 3A7QA 1X9TA 3IM0A 4FPGA 1YI9A 1BMV2 1J58A 4K6BA 1ENQA 1GQHA 4M4PA 1Y9QA 4PF1A 2YYOA 3HN1A 1QU0A 4UFKA 4LO5B 4OI0A 4D7TA 4K8RB 2QZ2A 4LT5A 3OPZA 4XYXA 2PHLA 1UZ0A 2Y6FA 3B3QE 4NOTA 3WUCA 4P9XA 4QX3A 5CYYA 4MXVA 1RTVA 2IXJA 1W6QB 4D6RA 3IDBB 3WP6A 3GDBA 3SEEA 2VL4A 4Q4V1 1BK0A 4XW3A 5AVAA 4JGZC 2MEV1 4B4QA 4MG2A 2FCUA 3GF6A 5ABJB 1QJX3 2W92A 4LE3A 4PT6A 1QOTA 5F5IA 3DPRC 3BU7A 2ZGLA 3ETQA 5ACA1 1RITA 1LESA 1FT9A 5FO9B 3ELNA 4GB31 5I91A 2VQ0A 5CISA 3WW1A 1SHWB 1CAWA 5HBAA 5JZGA 4IV3A 1XYOA 3OBTA 1DGWX 1VB2A 2JD4A 4TLGA 4G9SB 1VRH1 4JCKA 3WQBA 1GANA 4LTAA 3ABZA 5FV3A 4XFFA 4AGGA 3IPVA 1XNTA 1PM4A 3GHMA 5GALA 4FOQA 2JDPA 2OYZA 3ZMOA 3RZKA 5A7QA 3LQCA 1O4TA 4DS0A 3WVJA 1GNZA 1O91A 1VJ2A 4NRPA 2ZHKA 2RDQA 2EIEA 1GICA 4B8EA 3BTAA 1E57A 4HXCA 1PM7A 4OCTA 3RYPA 3OJBA 1KGYA 2AACA 3O1MA 5A1FA 3J8F2 1JHJA 4KBBA 3TNPB 3E5XA 1S0BA 3KCCA 3ZSLA 1LOFC 1IS4A 3H3ZA 5T3NA 1H6XA 4LHSA 4W4ZA 3MIDA 3DCQA 2BBAA 1D2SA 2A5ZA 3CIHA 3WR0A 1KJLA 4CVUA 2QZ3A 1DQ4A 5FZ0A 4BLJA 3T09A 2UU8A 3O1RA 2X05A 4EYUA 1WCKA 3C7EA 1H4GA 3N3HA 2BGPA 2YXSA 3ZKUA 1MVEA 3D4KA 4C0BA 1W9TA 3TEXA 3MF6A 3GCWA 4GD4A 3ZMNA 3V0BB 1J3QA 3IDAA 2RS33 4BDVB 3MLKA 1VPHA 4GH4A 2GP3A 4YRDA 2HEWF 2ZAHA 5EPAA 5A3WA 1WBFA 2Y33A 4NO4A 2P6HA 5FZCA 4CDUA 4N43C 4XF0A 1NYWA 1AL21 1LOCA 2FCTA 2QQMA 4O65A 2R1BA 2YFZA 1W6MB 1V70A 2P17A 4OZXA 2MPFA 4CDXA 5JMOA 2XBO3 2BW8A 2DCJA 1PIV1 1OURA 3POEA 4KWKA 4XUOA 3ZFEB 4AL9A 2VZUA 1R1ZA 4JQTA 3ZPOA 3AKSA 4OHYA 4FTSA 2QTWB 4NHMA 3T0DA 3FHQA 3WD5A 5FY0A 1SG3A 3R4SA 1QDOA 2GN7A 1LGNA 1QKQA 4HMZA 1MR5A 4XFGA 2QE3A 4OI4A 3KB5A 4HSLA 4W6WA 3VBHC 5C4WC 4SBVA 1ONAA 1MS5A 5FMOS 4K40A 1QOSA 5JSRA 3JQWA 2HYKA 2ZX0A 1TMF1 3I8TA 1H8VA 2ZHMA 1YC61 2W68A 3VDBA 4HETA 4AEKA 4RR3A 2OT7A 5F5CA 5EJZB 4CUCA 4HBNA 2RE9A 1DQ6A 4NPMA 4AHZA 5CFCC 4JVAA 1OKOA 5FPXA 2W1SA 1YJKA 5BUVA 1B35B 4HL0A 2WO1A 1VBE2 4UF0B 5K0UA 4XF1A 4YGBA 1BVP1 3E1F1 4IEYA 3SC7X 4XXPA 1SLAA 4LO7A 2K9ZA 5DZFA 1OFNA 1PGW1 2YGLA 5D2AA 1WCDJ 2BERA 4XJUA 5EP9A 5LZ6A 3LOIA 2X8KA 1NCQB 4FPOB 5CFDA 5FPAA 2QQKA 4IEXA 2W1QA 5FCCA 4OHXA 3PIGA 1O5UA 4HKOA 3UGGA 2GMMA 1PO13 2EALA 1QXPA 1W8HA 4AVBA 4HT1T 1RUNA 4B4RA 1MZ6A 5CB7A 4F83A 5HPOA 2OIIA 3ZM8A 4HKWA 4FPYA 4DUXA 1JYXA 1OD3A 2JDZA 2HWE1 2PHUA 4LBMA 2RR11 5FYUA 2HWF3 3ZIWA 5IFTA 5FZ3A 2J7MA 4Y1XA 2FMDA 2ZACA 1RVF2 1H8TC 3O0XA 5CKMA 2ZCWA 5BNOC 3I3MA 1MEC3 5F3GA 1ZRFA 3OGRA 1AZDA 1LNSA 3KGZA 3ZFFA 1G9AA 1LHVA 1PVC2 2YROA 3NMBA 1Q56A 5CZKA 1W8NA 3DXUA 1VBB2 2R063 2XOMA 3WDXA 4C0HA 3OF1A 4A4AA 5GLTA 3JD72 4AW7A 3RZZA 5LEKA 3NQHA 2XHKA 5JIAA 2RVAA 1QQP2 2C5DA 4Y20A 2UYBA 4YG0A 3OEAA 2W08A 1TME3 2RMU1 4FP2A 4EWDA 5H9PA 4META 1A8MA 1HW5A 4BXFA 4K1YA 2DDUA 1RUD3 1LENA 2BUKA 4LHLA 3OPTA 4Q1RA 1Y9MA 4AEMA 3PVBB 2B7YA 1XNBA 2PHRA 1JUIA 3DF0A 5GLZA 2PAMA 3O12A 1AX1A 1KQRA 2FZ1A 3T0BA 1PNGA 1JU4A 3ZPYA 4QPYA 3MW4A 3TEWA 3MZHA 3GCXA 5GJ6A 4NRMA 2H0BA 2WJSA 1TG7A 5FY9A 2NMNA 2PN5A 1WKYA 2MHFA 3V0AB 3T2TA 5BXXA 4P02B 1RUC1 5IAVA 2DUOA 2B42B 3WP5A 4GZ9A 4LULA 3PMEA 2Y6KA 4Y22B 3KV5A 4LHKA 3LEGA 3POBA 4Q4X3 4QQ2A 5J3UA 3ST7A 1SFNA 4FOWA 1G9BA 1ZZCA 5FK8A 3POYA 3CZUA 1SFPA 5G04L 3BVCA 3JQXA 1QNWA 1RUG2 1O3TA 5F3CA 1AYM2 1QDCA 3ZN4A 3KWVA 2NQYA 2ZGSA 1VAVA 1AL0G 3KCXA 3F2ZA 3FJSA 3PLQA 4CUAA 3IMNA 5JOWA 1ND3A 2WFF2 5C8WA 2OUJA 3QH6A 4CEYA 4LOSA 5FZKA 2ADDA 3KZ4C 2VGDA 1NLSA 3PVNA 5KHGA 1CR7A 3IKWA 3H1YA 3GZUC 5F39A 5FZEA 1W6OA 2VOWA 4EJRA 1ZBA1 4FVVA 5FYZA 4COUA 2W87A 1RUF1 2WA3A 1LEMA 2V4VA 1W2NA 2NZ9A 2ZGKA 5I8YA 4P9JA 1E5HA 2CY6A 1VBD2 1S0FA 2MNGA 3P6BA 4GXLA 5HXVA 4K3UA 4C8DA 5F7UA 1WD3A 5E16A 2A7AA 4AI8A 4Y4YA 3OCPA 2HKXA 2MEV2 3HVDA 1FPN1 1UZYA 4HVOA 1CZSA 5FUPA 2RDSA 1C8M1 4FTBA 3KHCA 1WA4A 4HVRA 4ZU7A 1BCXA 2YBKA 1HRI2 1REDA 5F3IA 1BEV1 4E27A 2Y38A 5ACA2 2X29A 2JB8A 1FI2A 4YGCA 4RFT0 4YZ1A 2HEYF 2PLV1 5JR2A 1OQEA 4YW6A 2XR4A 1F5JA 2PYTA 2UURA 1ASJ1 1CAWB 1SCRA 3OD4A 3OTFA 1LECA 4IV3B 2XLGA 5JZGB 3WSOA 3LAGA 3O1VA 1Q8SA 2WNUC 3K51A 5LWBA 2B46X 4I02A 3RMXA 4QAWA 1O4ZA 1RUE1 1POV3 1VRH2 5EJ1B 3WNMA 2EICA 1HRV2 3IPVB 3VUOA 4NIHA 1O59A 3VD9A 4NAOA 1COV2 2WO2A 2VE1A 5DXDA 1EV12 4QHZA 5GZDA 1FNZA 3WW2A 2BPA2 3H9AA 3NNJA 4R9BA 5IVJA 4FO9A 4O9GA 3OPWA 5FZAA 4LUKA 3S6PA 3TWIA 4D6QA 1H30A 1PX3A 2D93A 3USUA 1LGBA 2WYFA 3SH3A 3DGTA 1TNFA 3LPFA 5CU1A 2W0XA 4JGYA 1EP0A 5A32A 1JU3A 1NXMA 2Q30A 4HPKA 1CVNA 1RMU2 3A23A 2C0ZA 3CF6E 4BM8A 2Q5TA 4OHVA 5FZOA 2O1QA 4BWOA 1RC6A 4PJYA 5EXOA 1F2NA 1LGCA 4IV1A 4GWNA 3M4FA 1W9SA 5I0TA 2CHHA 3AKRA 3HT1A 1JTZX 4Z2AA 1WD4A 2GMEA 2DTYA 4Y24A 3ZXEA 1HKDA 2R072 2UY9A 2V5DA 4P5YA 3V65A 5BNPA 2WA4A 4YG3A 5H9RA 4WZCA 3UJOA 1SMVA 1UY0A 3N35A 3OUJA 4EV0A 1UYYA 1VIWB 3POIA 3ZSJA 5B4NA 3KF5A 4GH4B 4BLIA 4AQ2A 4QKBA 3VDCA 4D94A 1YLLA 1FNYA 1OUXA 4N7UA 3PU3A 4CDUB 5I0RA 1WMFA 2AREA 2Z79A 3OUIA 4TXWA 1OOPC 2QQIA 2FDKA 3JUUA 4AG4A 2ARBA 2VTXJ 3U4SA 1SDDB 1AYN2 1QWRA 2YC4A 5DDJ2 3NO8A 3AZYA 4IDZA 1AL22 2ET7A 2JDAA 4WM8A 3HEIA 1KJRA 4XBQA 2A6VA 3ZSEA 1BZWA 1RINA 2DF7A 2BEOA 2WQZC 2Y6JA 3DUIA 3MPPG 3OGJA 4L97A 1AR91 1XU2A 4FT8A 4YFWA 1YI7A 4CDXB 1REEA 1XNDA 3SNMA 1OT5A 2JJ6A 1GQPA 2XKOA 4JX0A 2EIDA 2HWB1 2RV9A 5FZGA 1E5SA 1JZ3A 2VMGA 2O0OA 4YW4A 4CE8A 2VOVA 4UYBA 3RSJA 1I1EA 3LD8A 3WNOA 1AXZA 1AR61 1IS3A 1BJQA 1UYZA 1YFXA 3OY8A 4A44A 1YQ5A 4K7JA 5T5PA 2WZ8A 3UK9A 5A7NA 3ZVXA 5JDBA 3AJYA 1DGWA 1WMXA 2XHNA 2V09A 1PMHX 4IL7A 1PX4A 2D7FA 4LBNA 4AEDC 1A34A 1QJU2 1TMF2 1DBNA 4RR3B 4AF9A 4I3PA 4XDOA 4E4HA 5APAA 4F7ZA 3VHRA 1LHUA 3MBWA 4NAMA 1LULA 2GNMA 2QBXA 3FUOA 4RYDA 3WDYA 3EYPA 3ZDSA 2Y0IA 5IT6A 2CU5A 4TZDA 1QJFA 1V9U1 4BQXA 2QJVA 1X8EA 4XQWA 2H0VA 3N9QA 4Z07A 4AHYA 3HQUA 3M3CA 5C33A 5K0UB 3LE0A 1IKQA 3BCWA 5J7MA 4Q4W2 4J1XA 2P3JA 4W6XA 3L9JT 5JI9A 1DP0A 1DQ5A 5FPBA 2W9XA 1PVC3 5JIUA 2LM3A 2UWCA 1U5IA 4UFJA 5CFDB 4B1LA 1VBB3 5T5LA 5GZCA 4QPGC 3ZXLA 3BGAA 4QX7A 3H8RA 2OS2A 3JD73 2C4XA 3VN4A 2IUWA 4BQYA 1JYTA 5BNNA 1Q8OA 2ZKNA 1QQP3 4XJZA 4CP9A 4QX8A 1ZZ9A 2WS92 2WQ8A 5J98B 5FY7A 1ULGA 5L9RA 1UZWA 3VBOA 4AEJA 1MACA 1UXZA 2PAEA 2W52A 4Q4Y1 4DXRA 3A0KA 1GZTA 3APBA 4KL1A 3J7NA 2XGXA 4ZU4A 1S55A 5FZMA 3RZJA 3EBRA 4NMIA 1EAH1 4QXKA 4WV8A 4Q29A 2HWC2 2QQOA 2AYHA 1ENRA 1F4AA 3TN93 4XXAA 3ZFFB 1XE7A 2XB6C 1Z78A 3WZ1A 2Q0AA 2QQWA 4NR1A 4YZ5A 2G4IA 3FN9A 1NX9A 1S0CA 3NV3A 3VD4A 4PDWA 5LASA 1OPMA 1S0JA 4QXHA 5FZ7A 1MZEA 5FZDA 5A6QA 4Y20B 4EN8B 2NPIA 5LK7B 2A3YA 5IW0A 1Z7S2 2VZRA 2WNVC 1UN1A 1W0PA 4E2QA 2LALA 1S2BA 1MPXA 2E7TA 4FOYA 3FFQA 1Q5OA 2XH6A 2GN3A 2DCYA 2RM22 4LXLA 3TNQA 1US2A 1IZ3A 2IXIA 3AJZA 3AKTA 1RJ7A 4M01A 4A7KA 4MLOA 4JGZA 4R9CA 5FP8A 1RUG3 4BMEA 2VUCA 4AAPA 1Q8PA 4LBJA 1AYM3 3NJZA 4UFHA 5JPMB 1NQDA 3MO4A 2IVIB 3WW3A 1AXYA 1LR5A 4ZXKA 1GV9A 3DPRA 3OD0A 2JX9A 5GKAC 4BQ1A 2VCCA 5F2WA 1O7FA 2AENA 2GC1A 4MUVA 3FWEA 5J09A 2JKBA 5KHKA 3H8OA 1SBFA 1UL9A 3HN3A 3JB8A 3H42B 2Y60A 3NRUA 4E4SA 2C24A 3POWA 5AVPA 3SKVA 4ZZ5A 3GBFA 3P1IA 2LS6A 3ACFA 2SBAA 5EYXA 3AMHA 1QJY3 1MZFA 1A78A 3T30A 1URXA 4QB1A 2WZPP 3M8LA 1VBD3 2BVBA 1W9FA 1QF3A 2ZJCA 3SLIA 3HNYM 2XJPA 4I0AA 5IVBA 3ENRA 3OYWA 3NV2A 1UOFA 3CL1A 5JVVA 5C71A 2VBPA 5M0TA 1FAYA 2OW4A 1W0OA 2VNGA 4LOTA 4UOJA 3WOGA 1TZOA 1ZZ7A 5A3NA 4BU2A 3AXDA 3AYDA 3KV9A 1HRI3 4XF9A 4UW6A 1ND3B 4H14A 1FMD1 2QNKA 1XSQA 4GWIA 4CEYB 1ZRDA 5JXGA 4E2GA 3G6JB 1OXCA 4B1MA 2W2IA 1W6OB 2ZHLA 1YNAA 2ZEZA 3B01A 4YM2A 2QQNA 3NAPC 5FFOC 5KWRA 5DAVA 1ZBA2 4URAA 3VBRC 4PLOA 5F8PA 4IUGA 1HRV3 1OLME 2DUQA 4FPKA 1UY3A 4HK8A 2K2SA 4LBQD 4DMIA 4OI2A 5JAXA 1ZBE1 1FYUA 2GMPA 3AZVA 1IPKA 1EV13 4GJYA 5FWEA 1NLRA 3LWCA 4AI9A 2XKPA 4NIDA 4KH9A 4SLIA 3N9LA 1IHMA 3DYOA 3ILNA 1FPN2 5JWPA 2DVGA 3SCHA 1KRIA 4XBNA 2ZGPA 3WP4A 1CJDA 2R49A 4CEWC 1F31A 5IK8A 1N3PA 1RMU3 4IGQA 1PK6A 4LIUA 4A7ZA 2V73A 3LIGA 1L7LA 3MLLA 1MS9A 3VDDC 2D97A 2PLV2 3CJIA 4GMP3 4N43A 2IXHA 1HXS2 2R042 3C7GA 3FFZA 3TEZA 2JB4A 2FD8A 1W6NA 3OGGA 2KR2A 2ZAAA 4LBQA 1JYCA 1V00A 2JDUA 1KEXA 3MDPA 2DBIA 3MHZA 1R091 2XJTA 1RUJ1 5EIYB 3AMPA 2R073 2ZKLA 2E9QA 4AGVA 4JKMA 4ET7A 1J1TA 1RUH2 3ILFA 5LBEA 3UGHA 2WAOA 1ULDA 1GP4A 3D5OA 3H1MA 3VBHA 5KR7A 1GFF2 3AXEA 3N36A 1KD7A 3USUB 5C4WA 3WDVA 4D7SA 4JGYB 5A32B 1IKPA 5L7OA 4HPKB 1NT0A 2YUEA 2QVSB 4L11A 5FZOB 1UZVA 3PTRB 3LIHA 3VL9A 2WABA 2YU1A 4IGOA 1AYN3 2ORXA 5DDJ3 5DN2A 4IV1B 2RJLA 5CFCA 1JZ5A 1GZ9A 4FPHA 5FZ9A 2JDNA 3C7OA 1VBA2 4MO3M 1OQDA 4CCCA 2UY8A 4AWDA 2AH2A 1AJKA 1S2EA 3Q8EA 5E88A 2FDIA 4XETA 5BNPB 4MOAA 1N47A 2UWBA 4XMAA 3VKNA 1WMDA 4M3CF 4Y5SA 4LA2A 4FBFA 4HZFA 4YM0A 4OUSA 5FPVA 1H9PA 1Q8VA 1JN2P 3T4VA 5D8AC 4GWMA 2E63A 1CESA 4OQ8A 1FOD3 3IAQA 3NV1A 4IXLA 3J7HA 4XURA 3OBAA 5DPNA 4AOCA 4CCLA 4CCJA 3BOPA 1A3KA 4IETA 4UBGA 1QJU3 2VVFA 2JXAA 5TSWA 1MS4A 1O8PA 2XDVA 4AI0A 4CCMA 2OPWA 1K5MC 4QB6A 4A45A 3NNGA 5BNQA 4N9IA 1OF3A 5FOBB 1SPPA 4Y1UA 3THTA 5CG9A 1M06G 5BNOA 2E32A 4Q4W3 4YM3A 4GALA 1P8JA 4FPLA 1D4M2 2IXLA 3I49A 3HBKA 4AVCA 1QJEA 4C1WA 3MFCA 4Q26A 2BYVE 1QJZA 2AR6A 4OYUA 3IDCB 3OY8B 4E8CA 2R0FA 1AR72 2TBVA 3R4UA 5F6KA 2NM1A 4OUEA 2HWD2 2WAAA 3LSEA 4UXAA 3ZYGA 3C3VA 3RYRA 2YY1A 3M3IA 4NPRA 1U5ZA 2WS93 2XG3A 3LFMA 5C3SA 4COYA 5FPZA 2B5HA 4JKKA 5LW9A 1IG0A 3LF7A 3TBDA 4N53C 3T2QA 3ZYFA 3N7KA 4N7IA 3UL2A 2RS12 4HK9A 4CCKA 5C8CC 2HWC3 1W03A 4S2DA 2VXRA 4MYEA 5FK7A 3I2GA 4NROA 2ATFA 1JMUB 1PZ9A 2RDNA 3O1UA 2OZ6A 4JZRA 3JBG1 2BWAA 2JENA 4QKFA 3WINE 1PO23 5FZHA 2J1AA 1LB2A 4UI9L 5JXJA 3K4DA 5BNNB 2G9FA 1BVVA 1QIQA 1LU1A 1IG3A 4CP9B 4XHXA 2GC3A 1Z7S3 3BIWE 2D5HA 3NV4A 3TYJA 2B4KA 4R4XA 3VZJA 1FXZA 3VBOB 4XIOA 4C1XA 2OX0A 3R0RA 3AFGA 3UKTA 4CDQA 5FJKA 3U4XA 4BOWA 2R32A 4OFGA 4XOGA 2VCBA 5LRRA 1GR3A 2HJIA 1TQ5A 2RM23 4B29A 1AR81 2R6QA 3IN9A 3KVAA 5D21A 3VKLA 2W95A 2VMIA 2VQAA 4DY3A 2VNRA 1RGSA 4XPVA 1SDWA 2HBUA 4Y33A 2ENRA 5FLJA 2QDNA 4LQRA 4NVPA 3RQ0A 5KXCA 1XJAA 2VVDA 4KG0A 4U36A 2DURA 3WF1A 4PDWB 5HCHA 1RL3A 1SCSA 4UFIA 4K8FA 3ZSKA 4YW7A 1X7NA 4OHWA 4M00A 1V6LA 2BQPA 4NIIA 2QFEA 5FP3A 4ATEA 1JYNA 2XWBB 1C1FA 2VZVA 5FZ1A 4Z8BA 3AZXA 1KDKA 1AX2A 3DL3A 4W65A 1OSGA 3ZX7A 2EAAA 3FHIB 4A3ZA 1BXHA 2YB7A 4PBOA 4GULA 4XC9A 5T5OA 2PFWA 1OA2A 2D43A 1RUI1 5A7OA 3INAA 5IVFA 4RQPC 4QMAA 1PGL1 4AI1A 4JGZB 1POV0 2PAKA 3CU7A 1W99A 3KV4A 3HQRA 3RI8A 2RHPA 2BJSA 1DYOA 1DYKA 2OXBA 5FYHA 2QCSB 3I3EA 4RGGA 2VO5A 3DPRB 1OPOA 1IOAA 4FPJA 2BGOA 2IFRA 3BN6A 1S4CA 4P9YA 5BV6A 4IE5A 2OZJA 3WDUA 3WDWA 1VAKA 2FBEA 2G19A 2CV6A 2HEVF 5EFUA 1J3RA 3I97A 1N1TA 2XJVA 3RZMA 4G3YC 4MGKE 2VMEA 4L2NA 4COVA 1VLNA 2Z4FA 3V64A 2WNUA 4FAGA 3HNBM 2WR9A 3UV9A 4ATFA 2KXLA 1GP6A 4M0NA 3AP5A 3VHOA 4NHYA 1B35C 2QUOA 1UKRA 3O14A 2ZMLA 3U11A 3N7MA 1K45A 1UOJA 3OYWB 3IBMA 1VBC1 1XE0A 2OKXA 3CJXA 5A7WA 3U10A 4XUTA 1GQGA 1YFUA 3S30A 1SLIA 1S0DA 1POQA 4D6SA 4LO8A 5EHDA 5FWJA 5FOJB 5FZLA 5H9QA 4E9KA 4NWVA 2PHFA 2IZWA 2WWSA 1BQPA 5FRAA 4Q0PA 2ZX3A 2QKDA 1VR3A 4W6YA 5KXBA 2QQUA 1W05A 4HKLA 4IEZA 1JZ8A 3POJA 1CONA 2D3PA 1HXS3 1I3HA 4XHBA 5CBLA 5HV4A 2PQQA 1DGLA 1FV2A 1VRBA 1RHI2 3FLRA 4URTA 3LDKA 5CNAA 4LKFA 1UZZA 4DO0A 3K75B 1ALYA 2N7GA 1W2TA 3FL7A 2A6WA 4S2FA 4D3WA 5KHIA 3DKWA 5C3QA 5DAQA 5IAXA 3VBUA 4CYDA 2WO7A 4QX2A 1RUH3 1DG6A 3A22A 3AK0A 1V6NA 1HQNA 4GWJA 4Z82A 1HQWA 3TRSB 2CGNA 4CUBA 5L36A 1I5PA 1OHFA 3SH5A 3T3YA 2Y8KA 4RHV1 5GLWA 3PMSA 2BTVC 1YQ8A 1PK6B 3MICA 4WVWA 3A0NA 5FQ0A 2VZOA 3O1OA 5AFEA 2WRAA 4YZ2A 1LOGA 4YVSC 4N43B 2OQ7A 1OOPA 3CJIB 5FYIA 3ROUA 1WLTA 4ZZ8A 1HJGA 1OD5A 2XQRA 1W6NB 4FXKB 4AE2A 2F4PA 2JG9C 1MS8A 1VBA3 4LBQB 3I2DA 5FYYA 4Q2FA 4ASLA 2JDKA 1JZ7A 1CAUA 5SV5A 5J96B 1KS4A 4AZZA 2AZ5A 4COWA 2PTMA 3NW4A 4QGLA 2Q8DA 3KT4A 1R092 4OUMA 4UT5A 5FTTC 5K9YA 4CXYA 2JG8C 2Q1FA 3AYAA 1I6XA 1ZX5A 2W3JA 3E6BA 1AUYA 3AX4A 3VBHB 4ARXA 5AC91 5C4WB 2DCTA 4NN0A 2KM2A 3AZZA 4YW1A 3VHPA 4AVTA 2FCVA 2VOKA 3I2IA 5L7OB 3CQOA 1H2LA 1BBT3 1YO8A 4HSJA 4AEDA 1R1A3 1W2AX 3M3OA 1PMIA 2A73B 5LB6A 3N9MA 4NIAA 3VV1A 4BPZA 1YQ2A 3GZAA 5F32A 4D0QA 4E4DX 3OSDA 3PHMA 5CFCB 4MADA 4CUGA 1NCRC 1TNRA 4A2UA 4Z2WA 2ILMA 1OH4A 2VMHA 2W91A 5CVRA 2VPVA 1W8OA 5JI7A 4N8MA 4OI1A 1ZA4A 1D4M3 1HX6A 1QJX1 4CSWA 1LKNA 3IMMA 2VJXA 3LCPA 3E6DA 3RDIA 4DUWA 4ASMB 5I0SA 3U78A 2ZGRA 2WLPA 2WZR2 4I0BA 4QPIC 1NUKA 1RB8G 1AR73 3ES1A 1UMIA 4TN7A 1LCLA 3AP9A 3CLPA 2VOXA 1XB9A 2HWD3 4FQ4A 3MIBA 1WW5A 4LK6A 4ORFA 4DY5A 4QQLA 3RPQA 3L2HA 5LEJA 5A6XA 2RS52 5DZGA 2ZMNA 2EXIA 1CZTA 1V6KA 4Z1VA 1OI6A 4RS5C 5IVEA 1SZBA 2J1SA 4LJHA 4HN0A 2JDYA 3B5LB 4XF3A 2ID4A 5FO7B 3VLBB 2RS13 1SPPB 1T6GC 5C9AC 4AFBA 1H8TB 1R082 4KWUA 2JIJA 1AXKA 1JH5A 1GLHA 4B7EA 2A6ZA 5BNOB 5FZIA 3SH4A 5IK5A 4I0WB 1NQJA 2VZQA 4MXWA 2YV8A 3LGRA 4JQRA 3I2KA 2VG9A 3HT2A 4CZSA 1MS3A 2BRTA 4Q0VA 4W50A 5DUWA 2ZZJA 4P5HA 1O3RA 5I8TA 2BOIA 2WT2A 3ETPA 2J1TA 3JB4C 4XTPA 4XEZA 4ASKA 3NJYA 2EA7A 1OH3A 4ZY9A 3UKVA 1G9DA 1Y7BA 3D82A 4AHXA 5DQ0A 1XRUA 2CTVA 2A75A 1H6YA 2ADEA 1REFA 3AVRA 4IV3C 3FBMA 4MX3A 3T4HB 5FPUA 3H7YA 2CGPA 4S2HA 2NP0A 2P6CA 4ISRA 2Y64A 3LDRA 1WLWA 4LE4A 3NNLA 3QOPA 4XFCA 5LA0A 4O7XA 3ZFGA 3IIIA 4CU7A 4LPLA 3AMMA 2P3IA 4Q8LA 4Q4V2 2IWGB 3VBFC 5F5QA 2RS31 1NKGA 1YEWA 4WM7C 5FYSA 2F6BA 5IYYA 5JXHA 3JBG2 2HLEA 1X82A 4S2GA 2NLRA 4BQ4A 4FTEA 4IESA 4CRQA 1YHFA 3D3AA 5JSPA 3J8F3 4D69A 5FR3A 1HV1A 4AGRA 4EWAA 1SEFA 2ZGMA 2DYCA 4Y1YA 1V6JA 5IJRA 4JHZA 4CDQB 4GB32 4OLLA 4E8DA 2VMFA 4KMQA 3UYJA 2DCKA 2ERFA 5SV8A 2QQPA 1DZQA 2XBO1 2XUEA 3AP6A 2XLAA 4LNVA 1K42A 1GOHA 2WZEA 3WX5A 3U1XA 1XU1A 2BOJA 2OA2A 1GUIA 3ECQA 4QGNA 5GZFA 3MFAA 1RIRA 2W39A 1JUHA 2IC1A 2XL9A 2W94A 2LW8A 2VZPA 2BNMA 4A42A 1DQ2A 4LO4B 5IUQA 1KDMA 4GH4C 5EZWA 5A33A 4RN5A 4FFFA 4QDQA 4UFMA 4PI2A 2C1FA 3X29B 5FREA 1U5YA 1ZVFA 3D8CA 3WG1A 4OMCA 3NAPA 3WW4A 3LFIA 4DNYA 3OG2A 4DZGA 3VBRA 3B69A 4GMP0 1HN0A 1GKBA 4H2AA 3WF2A 4YPJA 4NHLA 3BODA 3VBSC 3ZXFA 3K77A 5KXDA 1W04A 3Q8CA 5IK4A 2ZABA 3WDTA 1W8UA 5GLVA 1LTEA 2YC0A 1DQ0A 1AJOA 1JOPA 1U0AA 4YW2A 2D5FA 4AQTA 5IHRA 1ZRCA 3I3BA 4CCOA 5F3EA 4A41A 5K8SA 5IK7A 2X5IC 4ES8A 2WQ4A 4CEWA 1CIYA 1PO11 1CX4A 1KFUL 1O6UA 4E2SA 3AVSA 3VDDA 3NKGA 5A70A 3MGUA 4XAEA 4MH0E 5FP7A 4BXSV 2WNUB 3GM8A 3HNMA 1UKGA 2HWF1 1RHI3 3K3OA 3SITA 1XE8A 4HONA 1PMJX 3NNMA 3SKJE 4Y5Z0 1MEC1 1W28A 2J1UA 5K0UC 4XE9A 4XCBA 1VBE3 4MGIE 4M3CA 3LDBA 5A7WB 2WLQA 5EWSA 4NWWA 1PIV2 3ZN6A 2HYXA 2R061 3U14A 3BOWA 2L9LA 5L73A 2FHRA 2GSYA 1ENXA 1UX7A 1XQNA 4CDWC 4ZHNA 1JW6A 3LEMA 1QH7A 5A1AA 2VNOA 3ZLIA 1YWKA 1TME1 3POFA 3ZDVA 2ZTNA 3WF0A 2YGMA 3R6SA 1RUD1 5FZ6A 3RWNA 1UY2A 3M70A 4EWEA 2A71A 5F5AA 2ZBJA 5IVVA 2OQ6A 3VZMA 4J1WA 3LA2A 1ZYBA 5EJ3A 1I5ZA 1RVF3 2D6OX 4JTNA 1HB4A 1YCIA 4M0HA 3VBUB 3J4UH 5DZEA 5FXVA 5FXXA 3SEPA 3DYPA 2WYSA 3VKOA 5BYNA 1PGW2 5KBFA 4AK3A 5D8AA 4DXSA 5JOYA 4KU8A 3NJXA 5FQ0B 2PHWA 1K12A 5C6CA 1ZNPA 2FDGA 1HB1A 1JYVA 3RZHA 3BKZA 3AP7A 1OOPB 1WW6A 2Z2SB 4Q4X1 5JXIA 1ND2C 4PI0A 4Q0SA 1JYIA 1K5MA 1O8SA 3RZLA 3C2UA 2J1EA 1IS6A 1L7RA 1CAUB 1UPSA 2AUYA 2HWE2 3PL0A 4IERA 1LOBA 2E7QA 2RR12 4TLFA 3WNLA 2JD9A 2C9AA 2WWUA 1X36A 1NAEA 1EPWA 3FE5A 2VBBA 4JTOA 3LOBA 4LR4A 2BFUL 3EQEA 1EY2A 2VD7A 2WZR3 2VZ3A 4ZPIA 2K0GA 4R4ZA 3FC0A 4NHXA 3MIHA 4DEVA 3I59A 5LBCA 4M4RA 4DEQA 1F5FA 4XJAA 4Q0QA 4AEDB 1XPWA 2WKKA 1WCQA 1CPMA 1FATA 2RS53 1QXRA 2CWSA 3POSA 4XFBA 1HB3A 5DMYA 3HWJA 5FBZA 1G6NA 1OA4A 2RMU2 3AB0A 4N53A 2ET1A 5FY5A 5FYBA 5C8CA 1R083 2IXKA 3OB8A 5C5UA 3BPZA 1E5RA 1MQTC 5C3PA 5F9TA 4CU9A 3RNSA 2G9ZA 4JV4A 4XIKA 1QJX2 2CWMA 3KHBA 4EQVA 3LA7A 2ZPXA 3R4DB 4XMIA 3J8F1 4Y1ZA 3ZYIB 3NWKA 4J25A 1UY1A 4PQQA 4XJ9A 1OLQA 5CADA 5J1XA 1RXFA 5I8SA 2WFF3 5I0DA 1R64A 1IQAA 4JHTA 2X53S 1OVPA 4DRVA 4QU2A 1EPZA 2TNFA 3EHKA 2VBDA 3WF3A 4MZUA 1RUC2 3KSCA 4DOUA 3WT3A 1POV1 3GZEA 4LITA 4YGEA 2VM9A 1ULPA 5D1IA 3VD5A 3KQRA 5H9SA 2JDHA 3GALA 4LHNA 4DQAA 3O0WA 3AMNA 3I2FA 4MXWB 1HQLA 4XILA 4Q4V3 3LKJA 1UAIA 4TWTA 2MEV3 4JC1A 2D3SA 4UFLA 3HMYA 1DLCA 1UU6A 2C9KA 4A6OA 1LEDA 5F2SA 3GJAA 2ARAA 3OEBA 5ACA3 5DUVA 3WNXA 1CGPA 2RDRA 1LOFA 2D98A 5HCAA 1Y9GA 1A8DA 2D6LX 4LA3A 1GZWA 4PF5A 4L0PA 4GB33 3SMHA 4BE3A 2CGOA 4Y26A 2YFUA 4IEUA 4RQPA 4XQ4A 3WQ0A 2Z42A 5FLIA 2GH8A 1RUF2 1VRH3 1XBFA 2JECA 4MGZE 4EN0A 4EZHA 5A6YA 5EYYA 3BTYA 2BBVA 2KD7A 3ZFGB 4UWDA 1COV3 1NA1C 3RFRA 1VP6A 4QHOA 2PHXA 3SHRA 3TAYA 4XJWA 4FXGB 5A7PA 5CIRA 1XYNA 3WEZA 4CP1A 2LROA 2VZ1A 3J26N 5CAZA 4LLOA 2WINB 1IPSA 2GH2A 1C8M2 1MS1A 3WHTA 3EB7A 2Y6HA 2ZGNA 2FQPA 2JDMA 2VVEA 2H6BA 3PUAA 2DVBA 4KGQA 4YVWC 1BEV2 3H50A 4FI9A 3ZXGA 3C7FA 1CX1A 3N9NA 2XONA 1X33A 3QCWA 4JKLA 4QD2A 4BQ2A 4PCRA 4HVQA 5FP9A 1Y3TA 3LA3A 2OUHA 3F95A 4I30A 4IV1C 1KITA 1ASJ2 1STMA 2PHDA 4WVZA 1GYKA 5K4LA 5CKNA 4FSJA 4BQ3A 4BQWA 3MF9A 3DEMA 1C5HA 3HQXA 3JU9A 1WUVA 2Q4SA 5JPNB 5HCFA 1RUE2 5FXWA 4AFDA 2V5YA 3KT7A 3GNEA 2Y26A 5C5TA 1HIXA 4YLZA 2QQVA 5KXEA 1JZ6A 4BH9A 2A70A 4JDMA 5A33B 4QX5A 4HLTA 2GC0A 1GU3A 1WLCA 4IEOA 1DQ1A 2VY0A 3B02A 4WVMA 5LA2A 3ZYJB 3PUHA 4AR2A 3EJKA 3NAPB 5A7SA 5HI0A 5HV0A 2YBSA 4MGQA 1WW7A 2Z69A 4N90A 4IE0A 1B09A 3VBRB 4WM8C 5J48A 2WL1A 2XUMA 1AL23 2GU9A 1JS9A 2TUNA 3B93A 5EV7A 1D4VB 1LHWA 4UW3A 3WXPA 4IGPA 4I09A 2VQTA 5J37A 4H7MA 3CBNA 3BU0A 2VTXA 1PVC1 1W8FA 1PIV3 3PJQA 1GSLA 1VBB1 2X09A 2YZ4A 1ULCA 3ATGA 4F3JA 3O1PA 2D6NA 2WO3A 3JD71 3GHNA 4CEWB 3N9PA 2JICA 4OVEA 2OVUA 3W21A 5A6ZA 1QQP1 5C70A 4FFHA 2B9VA 4HFSA 1NY71 1DLLA 3VDDB 3CNAA 4YVSA 2A6XA 3URFA 1TMF3 1UMZA 1RJ8A 4PBPA 2HH9A 3J7MA 2B39A 2VW1A 2JG9A 4PIZA 3KF3A 4QQHA 2BZDA 4ZKTB 4BISA 2CL2A 3JZVA 4FP3A 5FYCA 4AVSA 3HAGA 1S1AA 1U12A 1QH6A 3WF4A 1H8TA 2ZXQA 3TN91 2P4EA 1YYNA 4UBHA 4M3CB 4BK4A 1AR92 1D7PM 1BKZA 5BPXA 1LJ7A 2JG8A 2P34A 3ZN6B 3RGBA 1GWMA 1J59A 5ABJC 5FY1A 5FYVA 5A3MA 4OQ9A 5KHJA 2HWB2 3WHUA 1CPNA 2G9GA 4KU7A 5CKQA 3MI8A 1XYPA 1OQ1A 4KGGA 5DG2A 4AI3A 4OZOA 1AR62 3I7DA 4HG6B 1LOEA 2XVLA 4PQ9A 2JKXA 2WNOA 3E6CC 5GLUA 1TME2 2DU0A 3BUCA 2J1VA 3OGVA 3UKNA 1W6PA 4IQPA 1NCRA 5FZ8A 1LAJA 4Q0UA 4AQSA 4BK5A 1D0GA 2HWE3 2DVFA 2RR13 1RUG1 1V9U2 4AI2A 1PZ7A 1WW4A 2C6SA 3LZZA 4AVVA 1AYM1 3BTXA 2VULA 1J1LA 2WIIB 4EN6B 2QQJA 3S5QA 1C57A 3ZR5A 1UYPA 4QPIA 4YZ3A 5D8AB 1J83A 2J1RA 1DZTA 2VW0A 3W58A 4FPFA 3ACLA 2ZZQA 3BALA 1OVSA 2DVAA 2VUDA 2YMZA 3T08A 2ZOEB 3BPSA 4LK7A 2V4AA 2P2KA 1KXGA 4XUPA 4RS5A 1QJY1 1K5MB 4Q4X2 2O8OA 3W59A 5LY1A 1W3XA 2RMU3 1VBD1 4NRQA 2D40A 5C9AA 2VUAA 4LBKA 4Q4Y2 2EIBA 3USSA 1YRZA 4ZS2A 5FBJA 3H3UA 1EAH2 3NL1A 3NVCA 4NUBA 2FMYA 2ZEWA 3OBZA 1HRI1 3VKMA 2ZGQA 3M7AA 4FQZA 1UX6A 2XLFA 3I59B 3ZXAC 1J3PA 4DFSA 4P14A 1ULOA 3KGLA 1N3QA 2E31A 3K3NA 1W9WA 2GALA 4QPWA 5FMCA 1VALA 3IT8A 2F4LA 2VCAA 1JZ4A 1RUC3 3LSDA 3AL6A 4QU1A 4YGDA 3CO2A 4JRAA 4WZFA 1BYHA 4K21A 4N53B 1HRV1 2UYAA 4XUNA 2R1DA 3DV8A 4KI5M 5C8CB 4GIQA 1PZ8A 3ILRA 1COV1 1RXGA 3C8XA 1EV11 3T1MA 3N4MA 3ZYRA 3WCRA 3ZFEC 3VBFA 4ZU5A 1LHOA 1H1AA 5FY8A 5CA6A 4WM7A 3HBZA 3WG2A 3S57A 2I07B 4R8HA 4W8JA 1HDKA 5E6HA 1RMU1 2E6VA 3HIFA 1F15A 1UW8A 5DG1A 1TE1B 4PIXA 3FLTA 4GMP1 1UYXA 4OHZA 5CEHA 4XABA 2UWAA 2ZGTA 3AC0A 4JAAA 4WVVA 3O1SA 3SISA 2ZX2A 3THCA 5JOXA 5HCBA 3PUIA 2P1BA 5JLVA 1ZBA3 4CPBD 4QXCA 2BV4A 4DB5A 2E7AA 4BJ0A 1RUF3 4DRRA 2NN8A 2R071 4FFIA 3U0ZA 2A6YA 2VH9A 3VD7A 4QT6A 5JMCA 2VZSA 1ENSA 2BNOA 4XZPA 1UMHA 1W8ZA 1XOYA 2Q8CA 1FPN3 1NCQC 4K1ZA 5FKCA 3WG3A 2DFBA 1C8M3 4ONUA 5LA1A 1CWPA 1H1MA 3ZKYA 1PK6C 3HD8B 3T2PA 1BEV3 1FMD2 4KQ7A 1AYN1 3CJIC 5DDJ1 5E1RA 4JRLA 1GZWB 3AFKA 2PLV3 4AFAA 4CPBA 3D0SA 3PVOA 4RL7A 4XBLA 4ZS3A 3SQOA 3WNPA 2R043 1ASJ3 2E33A 3DKQA 5KC5A 4RQPB 3VBSA 1G9FA 2X10A 4NPLA 1RUE3 4B4PA 1OA3A 4AAXA 4KNCA 4LBLA 4QDRA 1Q8QA 5T55A 1ZBE2 1F9KA 3VGIA 2VR4A 2YHJA 4QWNA 4X8NA 2OPKA 5C3RA 1FOD1 3TEYA 1HJFA 2ZEXA 4O9EA 2RJ2A 1UXXX 2X5IA 1ACCA 2Y34A 4N9HA 4QX1A 1H9WA 5L7OC 1OUSA 1QJU1 4H55A 1GNHA 3HOBA 4QKDA 5FUNA 1WBLA 4E4ZA 1D2QA 3ITQA 5DABA 3V56A 1UY4A 1JHNA 3ORJA 1QHDA 2DU1A 2VAUA 4ISQA 2R16A 2R7EB 1V6OA 3AL5A 4UW5A 1O3QA 2XPJA 3R05A 2P3KA 3VZOA 1H0BA 4X8PA 5ISLA 4Q4W1 1EUUA 1XNCA 2YPJA 2YG0A 4TSVA 1YQCA 2XL7A 4MGSA 5A3OA 2WT1A 4K20A 3VKFC 4DXTA 4GKYA 4QM8A 1UQXA 3H3LA 1RUJ2 2ORZA 1ZZBA 5E89A 2VTFA 4AFMA 4CDWA 4XAAA 3TB0A 2XXZA 1XXNA 3P5BA 4EROA 2EF6A 2WFPA 3CZJA 2I45A 2PHTA 1UF2C 1VMJA 2D6PA 2WN2A 4WVMB 3JXSA 1UIJA 2RJKA 2WS91 5FDBA 3PIJA 3W9AA 2CSGA 2I2SA 2CAUA 1DIWA 4NJ4A 3GYDA 1OMIA 3IWZA 3QH7A 4MSVA 1NLQA 1ULEA 5FMOL 5ANNA 5JR7B 1PGSA 2HWC1 4IE6A 1NE6A 3MIEA 1ZZ8A 2XWJB 3EMRA 3PVEA 5FIXA 3T2OA 1VMHA 3UNPA 3VL8A 4BZ4A 2R0HA 2VNVA 3FX3A 1EYBA 4LMFA 1AR93 1M4WA 3RMYA 3WUDA 5ERLA 1W0NA 4UW4A 2JE9A 5EQUA 4COZA 2D3RA 3I2JA 1PO21 2HWB3 2O8QA 2DTWA 3WG4A 5T54A 5FJHA 5A3UA 3THDA 4QPGA 1AR63 1WLDA 1N1VA 1SBDA 3S7EA 4C90A 1Z7S1 2B9UA 4YVSB 3QLQA 1BK1A 1NY72 5A3TA 1ND2A 1UO9A 4B3NA 4L8QA 3GGLA 4Q1PA 5FPLA 2WBKA 3AZWA 1YJLA 4R9AA 2JG9B 2RM21 4FPCA 2YBPA 2VZTA 1US3A 1X9PA 4KWJA 2W5FA 1DFQA 1V9U3 1OF4A 2LRPA 3KD4A 3ON7A 3FLPA 1LU2A 3AM2A 4XCAA 5FY4A 3TN92 2JG8B 3PNAA 5LK5A 1S2KA 4U2AA 3VDAA 1DCSA 4A7YA 4LKSA 5LRSA 2PMWB 4QB2A 2AGSA 4GQ7A 1W90A 2A3WA 3IAPA 1DGRN 1QNYA 2EXJA 1F35A 4LKEA 4NHKA 1DDLA 2AC1A 1CAVA 1DYPA 1AX0A 2BDRA 2LUWA 3K2OA 4QKNA 5JSOA 3ALQA 3I4IA 5T52A 2GC2A 4BCUA 1GBGA 4CDQC 1W6PB 2WNVA 5JZGC 1JODA 4HOOA 1NCRB 1ST8A 1WCSA 1WCUA 5HXMA 3TOJA 1SLCA 4Q4Y3 5C3OA 1MQTA 4YFZA 4GA9A 1IGOA 3Q9OA 3RWKX 1EAH3 4KG8A 3CHXA 4O61A 1DGRA 3BB6A 2JE8A 3Q8BA 3THPA 4LO6B 3WV6A 3OUHA 3JCIA 5F1RA 4XF4A 4XZUG 5FP4A 4IEVA 3VZNA 3WQ1A 3DECA 4QPIB 2A1XA 3DXTA 2B8MA 2Q1ZB 2LTNA 3O5SA 3ACIA 2FDJA 5K7PA 4BHPA 4P00B 3GJBA 1W2OA 2WUHA 2D44A 3OGSA 1CN1A 1HN1A 4H3WA 5FYMA 3WLUA 4BIFA 3MV01 4CP0A 4RS5B 1BHGA 4IEQA 4ARYA 2DBNA 2ZGUA 4RGKA 1QJY2 3UJQA 3H8XA 2CDOA 4LORA 4XVHA 4FFGA 5A1LA 5C9AB 2ARXA 1AF9A 1S0IA 3O7OA 1O3SA 1UCXA 4ZXEA 3KT1A 3ZYPA 5KC6A 5IVCA 1QXJA 3LB9A 5B4XA 1AR82 1ZM1A 4V2WA 3IB3A 1Q43A 1UU4A 5FZBA 5L19A 1PVXA 1T2XA 4XJ8A 1TEIA 2J22A 1WZXA 1HV0A 2VW2A 4P9LA 3KQ4B 1G7YA 3ZXKA 5T5JA 4LUMA 1MVQA 3D6EA 4G4FA 5JCTA 1JOJA 3O1TA 2FDFA 4IW3A 3WNKA 4YW5A 1T6BX 2XVGA 4EN7B 2ARCA 3PUSA 1CAXA 4ITCA 3H0OA 2ZGOA 4OULA 4CDUC 1HXS1 2R041 5LATA 3BTZA 1W8WA 5IVYA 3SCGA 4R9DA 1CZVA 3EO6A 3SXWA 3RRDA 1RYYA 4IEWA 2BWCA 1OC1A 1BLZA 1RUI2 4CDXC 1RUH1 2ZA9A 4QQOA 1NA1A 1PGL2 3BIEA 3VBFB 2GZWA 2W1WA 3GBWA 5FZFA 4H7LA 4WM7B 1GMMA 3AYCA 3UETA 3ME2A 1V6MA 2CDPA 1W9YA 3ZXJA 3RJRA 4MVTA 2G1MA 4KBZA 4QHBA 4RSUA 4YVWA 3AYEA 1FMD3 3PTYA 4XACA 3G7DA 3ZYBA 5LA9A 1F4HA 4RR3C 1UNBA 2P3YA 4GKXA 1VBA1 1W06A 5FXZA 4L99A 2P37A 4CA9A 5GZGA 2D6KA 1JYWA 4QM9A 1YXWA 2JEMA 2GNDA 3B9IA 2JWPA 4AXOA 1VMFA 4Q8KA 1S0EA 3I3QA 3VBUC 4AVAA 2DCZA 1ZA7A 3N9OA 1ZBE3 2V72A 3W5MA 5DAPA 1VE0A 1VBC2 3NKTA 3KLSA 1K3IA 3AMQA 4Q5OA 4QGMA 4YM1A 4DINB 2Q8EA 5CFDC 5C7GA 1Y4WA 1BBT1 1QMJA 1S0GA 3MUY1 1W39A 1YFYA 4I01A 4P9GA 4XDQA 4TYSA 4CCDA 1R1A1 4AHWA 1SBEA 4MGTA 2XVKA 3QACA 1WWYA 1L3JA 1Y43B 2VMCA 3RYKA 2WT0A 2ZEYA 4AQ6A 4IE4A 4INDA 2VQUA 3WNNA 2XJSA 1C8NA 1YQ6A 1H4HA 2PELA 3MPBA 4IEPA 1GWLA 4XDPA 2VC9A 1ZZ6A 1YUDA 2BFUS 1GOGA 3PDQA 4V2VA 5LY2A 5FMBA 3VBSB 4DPNA 1OLMA 4F8AA 3AKPA 1D4M1 3ZO0B 3RZGA 1NE4A 2XQXA 3IZOA 4MV2A 4MGYE 4CXXA 1LHNA 3VZLA 5FYTA 4K9SA 4CCNA 4D8MA 1R093 1CQ9A 3S5AA 4MHUA 1RUJ3 3ZFFC 4DUVA 1H2KA 2Y0OA 1AR71 4CU8A 2ZS6B 1G9CA 3PJYA 3KVBA 1SLLA 2X5IB 2HWD1 4R52A 1DZRA 1FOD2 4RA0A 1AHSA 1C3HA 2IVJA 3PURA 3MIGA 3N7JA 1JBCA 3KM5A 2CYFA 1BMV1 4YYOA 1JZ2A 4RHV2 3B9CA 1MS0A 1ODNA 4YNIA 3WY6A 4I3GA 3ZIXA 3LEIA 2H6CA 1UWWA 2RS11 5LBBA 2IXCA 3MYXA 4XTMA 1LODA 1HB2A 1C28A 4RFRB 1A6CA 4JDNA 1W6QA 3VD3A 1EUTA 4LKDA 5DUXA 4PIYA 4XFIA 5FZ4A 3U07A 1RUOA 3UGFA 1VAMA 3RG0A 4Y5TA 3ZSMA 2C26A 1J84A 2HBTA 4EE2A 5ABJA 1C5IA 4LIVA 4J6GA 2DV9A 4CDWB 5J36A 3I3DA 2KA3A 1U5XA 1N3OA 3N7LA 4WBBA 5AC92 4YZ4A 5BY5A 2SLIA 2XMLA 3K46A 1OLRA 2BVVA 3AKQA 2VECA 3VHNA 3ACHA 5A3PA 1QY4A 3SCFA 4DIQA 1GP5A 4CP2A 1YIFA 4MHRA 3ZR6A 1UOGA 1UIKA 2DWRA 2DUPA 2PQSA 2NYYA 4GAZA 3O0VA 4Y1VA 5G05L 3WP3A 1ZRIA 4LLFA 2RG4A 1SQ4A 2XJRA 1NOVA 2ES3A 3B00A 2PXJA 2EXHA 4X6QB 3L2YA 4HN1A 4UAPA 5IFPA 2VU9A 3MEPA 1NG0A
chains in the Genus database with same CATH topology
1DHKB 2YDEA 1PO22 1DU3D 4QPGB 3NSTA 3K48A 1G8WA 2BNNA 1ND3C 3B7MA 4ES9A 3IDEA 4CEYC 5FLHA 3S0MA 1ND2B 3I54A 5FO8B 2ZX1A 2DVDA 3M2MA 1LOAA 1G86A 4YG6A 3WCSA 2XJQA 1O5LA 2E53A 3H1WA 2ZMKA 1WGPA 4Z92B 3ZXDA 1N1SA 4YW3A 1UPIA 4P9IA 2CNAA 5DUUA 3ZFGC 3KS7A 2B45X 3GBGA 1ZRRA 2DFCA 3M3QA 2Q1MA 5I0UA 3V0BA 3JBG3 2Q8OA 4BMBA 1QOOA 2JE7A 5B2GB 5E8AA 2QDRA 1CAVB 3FBYA 1NXD1 1HLCA 4FCAA 1C1LA 4V1PA 3RI9A 3KMHA 4LBOA 3OBRA 1O4YA 3P3PA 2WNVB 3DN7A 3IIAA 3H8UA 1N1YA 2EVXA 4BA6A 5F6LB 1MQTB 3CEWA 1W6MA 2GNBA 1YIPA 3KCYA 1AR83 2A3XA 3ZFEA 4M3CE 3HR9A 1UU5A 1H1IA 1F8VA 1CD3G 1H2NA 2WNEA 2RS32 3E5UA 3D0JA 4JGYC 3P3NA 4I2OA 1RHI1 5GZEA 2EXKA 3VZKA 4C91A 4BYYA 4AFCA 1WMEA 1VBE1 2R30A 2E51A 1RUI3 3MIFA 1B35A 1XNKA 3MW2A 4XFHA 4XQDA 2XBO2 4CTEA 4D7YA 3QBQA 2PA7A 2EIGA 1MZ5A 3H7JA 4LEJA 2IFWA 5BNPC 5CG8A 1NZCA 1KS5A 2NMOA 1OFSA 3GZTB 2GAUA 2CAVA 1NCQA 4KWLA 1ZREA 4FPEA 3QD6A 1FV3A 3B94A 3MW3A 3J9SA 2ZX4A 1CAXB 1X8MA 1SACA 2I74A 2VUJA 1SLBA 1W2UA 4B7KA 1CJPA 4DXZA 2ZHNA 3WQ7A 2D6MA 1APNA 4FAHA 3T1LA 1RVF1 5AFBA 2BGCA 4P9WA 3FMGA 2Z5WA 4JDOA 3ASIA 1NA1B 2WC2A 3RS6A 4L9BA 2GDFA 1VBC3 1UD1A 3M3EA 1GZCA 4FOVA 3E97A 5JOZA 4RD7A 4PLMA 3E5QA 3ZN5A 4Q27A 4QQPA 3FUQA 4YVWB 1PNFA 3MLJA 1OKQA 1PO12 4A3XA 2XJUA 2GNTA 1X50A 4BIOA 5GM0A 3AP4A 3RJ2X 2HWF2 4RGAA 1D0HA 1LRHA 3EXUA 1Z0HA 1PHMA 4XFAA 1MEC2 1IPJA 1CIWA 2EAKA 2WZR1 1I9RA 4YARA 1V6IA 5KHHA 5I93A 2WSUA 2R062 1KFXL 1SFYA 3A4UA 1BBT2 2RS51 4PLNA 3V0AA 4RHV3 5BNNC 1R1A2 4L92A 5FAXA 1QGLA 1VB4A 4Y22A 4WM8B 3VBOC 4AYUA 1R081 1AVBA 1SLTA 1Q3EA 1RUD2 4EN9B 2ETEA 5T50A 1JXNA 4X6RB 2WSVA 1YFWA 1C4RA 2FZ2A 4HANA 1DF0A 1ULFA 1FX5A 1IS5A 3FZ3A 1H2MA 3S7IA 5AC93 2WFF1 5A3LA 4YSFA 4PDWC 3ES4A 3M1HA 2TEPA 3IM0A 4FPGA 1YI9A 1BMV2 1J58A 4K6BA 1ENQA 1GQHA 1Y9QA 2YYOA 3HN1A 1QU0A 4OI0A 4LO5B 4D7TA 4LT5A 2QZ2A 3OPZA 4XYXA 2PHLA 3B3QE 4NOTA 3WUCA 4P9XA 4MXVA 1RTVA 2IXJA 1W6QB 3IDBB 3WP6A 4Q4V1 4XW3A 5AVAA 4JGZC 2MEV1 4B4QA 3GF6A 5ABJB 1QJX3 4LE3A 1QOTA 3DPRC 3BU7A 2ZGLA 3ETQA 5ACA1 1RITA 1LESA 1FT9A 5FO9B 3ELNA 4GB31 5I91A 2VQ0A 3WW1A 1CAWA 5HBAA 5JZGA 4IV3A 1XYOA 3OBTA 2JD4A 1DGWX 1VB2A 4G9SB 1VRH1 4JCKA 1GANA 4LTAA 4XFFA 4AGGA 3IPVA 3GHMA 5GALA 2OYZA 4FOQA 3ZMOA 4DS0A 1O4TA 3WVJA 1GNZA 1O91A 1VJ2A 2ZHKA 1GICA 4B8EA 3BTAA 1E57A 1PM7A 3RYPA 3OJBA 3J8F2 4KBBA 3TNPB 3E5XA 1S0BA 3KCCA 3ZSLA 1LOFC 1IS4A 3H3ZA 5T3NA 3MIDA 1D2SA 2A5ZA 3WR0A 1KJLA 2QZ3A 1DQ4A 4BLJA 2UU8A 1WCKA 1H4GA 3N3HA 2YXSA 1MVEA 3D4KA 4C0BA 3MF6A 3ZMNA 3V0BB 1J3QA 2RS33 3MLKA 4GH4A 4YRDA 2HEWF 2ZAHA 1WBFA 4NO4A 4CDUA 4N43C 4XF0A 1NYWA 1AL21 1LOCA 2R1BA 1W6MB 1V70A 2P17A 4OZXA 2MPFA 4CDXA 2XBO3 2BW8A 2DCJA 1PIV1 4KWKA 3ZFEB 1R1ZA 3AKSA 4OHYA 4FTSA 4NHMA 3WD5A 3R4SA 1QDOA 2GN7A 1LGNA 1QKQA 4HMZA 1MR5A 4XFGA 2QE3A 4OI4A 3KB5A 4HSLA 4W6WA 3VBHC 5C4WC 4SBVA 1ONAA 1MS5A 5FMOS 4K40A 1QOSA 5JSRA 3JQWA 2HYKA 2ZX0A 1TMF1 3I8TA 1H8VA 2ZHMA 2W68A 4HETA 4AEKA 4RR3A 4HBNA 2RE9A 1DQ6A 4AHZA 5CFCC 4JVAA 5FPXA 1YJKA 5BUVA 1B35B 4HL0A 1VBE2 5K0UA 4XF1A 4YGBA 1BVP1 4IEYA 4XXPA 1SLAA 4LO7A 2K9ZA 5DZFA 1OFNA 1PGW1 2YGLA 1WCDJ 4XJUA 3LOIA 2X8KA 1NCQB 4FPOB 5CFDA 4IEXA 5FCCA 4OHXA 1O5UA 4HKOA 2GMMA 1PO13 2EALA 1QXPA 1RUNA 4AVBA 4HT1T 4B4RA 1MZ6A 5CB7A 4F83A 2OIIA 4HKWA 4FPYA 2JDZA 2HWE1 2PHUA 4LBMA 2RR11 2HWF3 3ZIWA 4Y1XA 2FMDA 2ZACA 1RVF2 1H8TC 3O0XA 2ZCWA 5BNOC 1MEC3 1ZRFA 3ZFFA 1AZDA 3KGZA 1LHVA 1PVC2 2YROA 1Q56A 3WDXA 1VBB2 2R063 4C0HA 3OF1A 5GLTA 3JD72 4AW7A 3RZZA 5LEKA 2XHKA 5JIAA 1QQP2 2C5DA 4Y20A 2UYBA 4YG0A 2W08A 1TME3 2RMU1 4FP2A 4EWDA 5H9PA 4META 1A8MA 1HW5A 4K1YA 1RUD3 1LENA 2BUKA 4LHLA 4Q1RA 4AEMA 3PVBB 2B7YA 1XNBA 2PHRA 1JUIA 3DF0A 5GLZA 2PAMA 3O12A 1AX1A 1KQRA 2FZ1A 1PNGA 3ZPYA 4QPYA 3MW4A 3MZHA 5GJ6A 2H0BA 2WJSA 2NMNA 2PN5A 2MHFA 3V0AB 3T2TA 5BXXA 1RUC1 2DUOA 2B42B 3WP5A 4LULA 3PMEA 4Y22B 5J3UA 4LHKA 4Q4X3 4QQ2A 3ST7A 1SFNA 4FOWA 1G9BA 1ZZCA 3POYA 3JQXA 1QNWA 1RUG2 1O3TA 1AYM2 1QDCA 3ZN4A 2NQYA 2ZGSA 1VAVA 1AL0G 3KCXA 3PLQA 3FJSA 5JOWA 3IMNA 1ND3A 2WFF2 5C8WA 2OUJA 3QH6A 4CEYA 3KZ4C 2VGDA 1NLSA 3PVNA 5KHGA 1CR7A 3IKWA 3H1YA 3GZUC 1W6OA 2VOWA 4EJRA 1ZBA1 4FVVA 4COUA 1RUF1 2WA3A 1LEMA 5I8YA 2NZ9A 2ZGKA 4P9JA 2MNGA 2CY6A 1VBD2 1S0FA 5HXVA 3UK9A 4GXLA 4K3UA 1WD3A 5E16A 2A7AA 4AI8A 4Y4YA 3OCPA 2HKXA 2MEV2 1FPN1 1UZYA 4HVOA 4FTBA 1C8M1 1WA4A 4HVRA 4ZU7A 1BCXA 1HRI2 1REDA 1BEV1 4E27A 2Y38A 5ACA2 2X29A 1FI2A 4YGCA 4RFT0 4YZ1A 2HEYF 2PLV1 1OQEA 3OD4A 1F5JA 2PYTA 2UURA 1ASJ1 1CAWB 1SCRA 3OTFA 4AK3A 1LECA 4IV3B 2XLGA 5JZGB 3LAGA 1Q8SA 2WNUC 3K51A 2B46X 4I02A 3RMXA 1O4ZA 1RUE1 1POV3 1VRH2 1HRV2 3IPVB 3VUOA 1COV2 5DXDA 1EV12 5GZDA 3WW2A 1FNZA 2BPA2 3H9AA 4R9BA 4FO9A 4O9GA 4LUKA 3S6PA 3TWIA 1H30A 2D93A 3USUA 1LGBA 3SH3A 3DGTA 1TNFA 5CU1A 2W0XA 4JGYA 1EP0A 5A32A 1NXMA 2Q30A 4HPKA 1CVNA 1RMU2 2C0ZA 3CF6E 4BM8A 2Q5TA 4OHVA 2O1QA 4BWOA 1RC6A 4PJYA 5EXOA 1F2NA 1LGCA 4IV1A 4GWNA 3M4FA 5I0TA 3AKRA 3HT1A 1JTZX 1WD4A 2GMEA 2DTYA 4Y24A 3ZXEA 1HKDA 2R072 2UY9A 3V65A 5BNPA 2WA4A 4YG3A 5H9RA 4WZCA 3UJOA 1SMVA 3N35A 4EV0A 1VIWB 3ZSJA 4GH4B 4BLIA 4AQ2A 4D94A 1YLLA 1FNYA 4N7UA 5I0RA 4CDUB 1WMFA 2AREA 2Z79A 1OOPC 3JUUA 4AG4A 2ARBA 1AYN2 1QWRA 5DDJ2 3NO8A 3AZYA 1AL22 2ET7A 4WM8A 1KJRA 4XBQA 2A6VA 3ZSEA 1BZWA 1RINA 2DF7A 2BEOA 2WQZC 3DUIA 3MPPG 4L97A 3OGJA 4CDXB 1AR91 1XU2A 4FT8A 4YFWA 1YI7A 1REEA 1XNDA 3SNMA 2JJ6A 2XKOA 2HWB1 1I1EA 2VMGA 2O0OA 4YW4A 2VOVA 3RSJA 1AXZA 1AR61 1IS3A 1BJQA 1YFXA 3OY8A 4K7JA 5T5PA 3ZVXA 5JDBA 3AJYA 1DGWA 2V09A 4IL7A 4LBNA 2D7FA 4AEDC 1QJU2 1TMF2 1DBNA 4RR3B 4AF9A 4I3PA 4F7ZA 3VHRA 1LHUA 1LULA 2GNMA 3FUOA 3WDYA 3ZDSA 5IT6A 2Y0IA 4TZDA 1V9U1 2QJVA 1X8EA 4XQWA 2H0VA 4Z07A 4AHYA 5C33A 3M3CA 5K0UB 5J7MA 1IKQA 3BCWA 4Q4W2 4J1XA 2P3JA 4W6XA 3L9JT 5JI9A 1DQ5A 1PVC3 5JIUA 2LM3A 2UWCA 1U5IA 5CFDB 1VBB3 5T5LA 5GZCA 4QPGC 3ZXLA 3JD73 3VN4A 5BNNA 1Q8OA 2ZKNA 1QQP3 4XJZA 1ZZ9A 2WS92 5J98B 1ULGA 3VBOA 4AEJA 1MACA 2PAEA 2W52A 4Q4Y1 3A0KA 3APBA 4KL1A 4ZU4A 2XGXA 1S55A 3EBRA 4WV8A 1EAH1 4QXKA 4Q29A 2HWC2 2AYHA 1ENRA 3TN93 4XXAA 3ZFFB 1XE7A 2XB6C 1Z78A 3WZ1A 2Q0AA 4NR1A 4YZ5A 2G4IA 3NV3A 1S0CA 4PDWA 1OPMA 1S0JA 1MZEA 4Y20B 4EN8B 2NPIA 5LK7B 2A3YA 1Z7S2 2WNVC 1UN1A 1W0PA 4E2QA 2LALA 1S2BA 2E7TA 4FOYA 3FFQA 1Q5OA 2XH6A 2GN3A 2DCYA 2RM22 3TNQA 1IZ3A 2IXIA 3AJZA 3AKTA 1RJ7A 4M01A 4A7KA 4MLOA 4JGZA 4R9CA 4BMEA 1RUG3 1Q8PA 4LBJA 1AYM3 3NJZA 5JPMB 1NQDA 3WW3A 1AXYA 1LR5A 4ZXKA 1GV9A 3DPRA 3OD0A 2JX9A 5GKAC 4BQ1A 1O7FA 2AENA 2GC1A 4MUVA 3FWEA 5J09A 2JKBA 5KHKA 1SBFA 1UL9A 3JB8A 4E4SA 3POWA 5AVPA 3GBFA 2SBAA 5EYXA 3AMHA 1QJY3 1MZFA 1A78A 1URXA 2WZPP 3M8LA 1VBD3 2BVBA 2ZJCA 1QF3A 3SLIA 2XJPA 4I0AA 3ENRA 3OYWA 3NV2A 3CL1A 5JVVA 1FAYA 2OW4A 1W0OA 2VNGA 3WOGA 1ZZ7A 3AXDA 3AYDA 1HRI3 4XF9A 4UW6A 1ND3B 4H14A 1FMD1 2QNKA 4CEYB 1ZRDA 4E2GA 3G6JB 1W6OB 2ZHLA 1YNAA 3B01A 4YM2A 5FFOC 3NAPC 5KWRA 1ZBA2 3VBRC 4PLOA 1HRV3 4FPKA 2DUQA 4HK8A 2K2SA 4LBQD 4DMIA 4OI2A 5JAXA 1ZBE1 1FYUA 2GMPA 3AZVA 1IPKA 1EV13 1NLRA 3LWCA 2XKPA 4KH9A 4SLIA 1IHMA 3ILNA 1FPN2 5JWPA 2DVGA 3SCHA 1KRIA 4XBNA 2ZGPA 3WP4A 1CJDA 2R49A 4CEWC 1F31A 5IK8A 1N3PA 1RMU3 1PK6A 4A7ZA 2V73A 3MLLA 1MS9A 3VDDC 2D97A 2PLV2 3CJIA 4GMP3 4N43A 2IXHA 1HXS2 2R042 3FFZA 1W6NA 3OGGA 2ZAAA 4LBQA 1JYCA 1V00A 3MDPA 1R091 2XJTA 1RUJ1 3AMPA 2R073 2ZKLA 2E9QA 4AGVA 1J1TA 1RUH2 3ILFA 1ULDA 3D5OA 3H1MA 3VBHA 1GFF2 3AXEA 3N36A 1KD7A 3USUB 5C4WA 3WDVA 4D7SA 4JGYB 5A32B 1IKPA 5L7OA 4HPKB 2YUEA 2QVSB 4L11A 3VL9A 1AYN3 5DDJ3 4IV1B 2RJLA 5CFCA 1GZ9A 4FPHA 1VBA2 1OQDA 2UY8A 4AWDA 2AH2A 1AJKA 5E88A 4XETA 5BNPB 1N47A 2UWBA 4XMAA 3VKNA 1WMDA 4M3CF 4FBFA 4LA2A 4HZFA 4YM0A 4OUSA 1H9PA 1Q8VA 1JN2P 5D8AC 4GWMA 2E63A 1CESA 1FOD3 3NV1A 4IXLA 3BOPA 1A3KA 4IETA 4UBGA 1QJU3 2VVFA 2JXAA 5TSWA 1MS4A 4AI0A 1K5MC 5BNQA 4N9IA 5FOBB 4Y1UA 3THTA 5CG9A 1M06G 5BNOA 4Q4W3 4YM3A 4GALA 4FPLA 1D4M2 2IXLA 4AVCA 4C1WA 3MFCA 4Q26A 2BYVE 1QJZA 2AR6A 3IDCB 3OY8B 2R0FA 1AR72 2TBVA 3R4UA 5F6KA 2NM1A 2HWD2 4UXAA 3LSEA 3ZYGA 3C3VA 3RYRA 2YY1A 3M3IA 4NPRA 1U5ZA 2WS93 2XG3A 4COYA 5FPZA 2B5HA 3TBDA 4N53C 3N7KA 4N7IA 3UL2A 2RS12 4HK9A 5C8CC 2HWC3 4S2DA 2VXRA 4MYEA 2ATFA 1PZ9A 2OZ6A 3JBG1 2BWAA 2JENA 3WINE 1PO23 1LB2A 5BNNB 2G9FA 1BVVA 1LU1A 4XHXA 2GC3A 1Z7S3 3BIWE 2D5HA 3NV4A 3TYJA 4R4XA 3VZJA 1FXZA 3VBOB 4XIOA 4C1XA 3R0RA 3UKTA 3AFGA 4CDQA 3U4XA 4BOWA 2R32A 4OFGA 4XOGA 5LRRA 2RM23 1GR3A 1TQ5A 2HJIA 4B29A 1AR81 2R6QA 3IN9A 3VKLA 2VMIA 2VQAA 4DY3A 2VNRA 1RGSA 4XPVA 1SDWA 5FLJA 2ENRA 2QDNA 4NVPA 3RQ0A 5KXCA 2VVDA 4KG0A 4U36A 2DURA 4PDWB 1RL3A 1SCSA 4K8FA 3ZSKA 1X7NA 4OHWA 4M00A 1V6LA 2BQPA 4ATEA 2QFEA 2XWBB 1C1FA 4Z8BA 3AZXA 1KDKA 1AX2A 3DL3A 4W65A 1OSGA 3ZX7A 2EAAA 3FHIB 1BXHA 4PBOA 4GULA 5T5OA 2PFWA 1OA2A 2D43A 1RUI1 3INAA 4RQPC 4QMAA 1PGL1 4AI1A 4JGZB 1POV0 2PAKA 3CU7A 3RI8A 2RHPA 1DYKA 2QCSB 4RGGA 3DPRB 1OPOA 1IOAA 4FPJA 2IFRA 4P9YA 5BV6A 2OZJA 3WDUA 3WDWA 1VAKA 2FBEA 2CV6A 2HEVF 5EFUA 1J3RA 1N1TA 2XJVA 4G3YC 4MGKE 4L2NA 4COVA 1VLNA 3V64A 4FAGA 2WNUA 3UV9A 4ATFA 2KXLA 4M0NA 3AP5A 3VHOA 1B35C 2QUOA 1UKRA 3O14A 2ZMLA 3U11A 3N7MA 3OYWB 3IBMA 1VBC1 3CJXA 3U10A 1GQGA 1YFUA 3S30A 1SLIA 1S0DA 4LO8A 5FOJB 5H9QA 4E9KA 4NWVA 2PHFA 2IZWA 2WWSA 1BQPA 5FRAA 4Q0PA 2ZX3A 2QKDA 1VR3A 4W6YA 5KXBA 4HKLA 4IEZA 1CONA 2D3PA 1HXS3 1I3HA 4XHBA 5CBLA 2PQQA 1DGLA 1FV2A 1RHI2 3FLRA 4URTA 5CNAA 1UZZA 1ALYA 2N7GA 2A6WA 4S2FA 4D3WA 5KHIA 3DKWA 3VBUA 4CYDA 1RUH3 1DG6A 3AK0A 1V6NA 1HQNA 4Z82A 1HQWA 3TRSB 2CGNA 5L36A 1OHFA 3SH5A 4RHV1 5GLWA 3PMSA 2BTVC 3MICA 1PK6B 5FQ0A 4WVWA 3A0NA 5AFEA 4YZ2A 1LOGA 4YVSC 4N43B 3CJIB 1OOPA 3ROUA 1WLTA 1OD5A 1W6NB 4FXKB 4AE2A 2F4PA 2JG9C 1MS8A 1VBA3 4LBQB 3I2DA 4ASLA 4Q2FA 1CAUA 5SV5A 5J96B 1KS4A 2AZ5A 4COWA 2PTMA 3NW4A 4QGLA 3KT4A 1R092 4OUMA 5FTTC 5K9YA 2JG8C 3AYAA 1I6XA 1ZX5A 3E6BA 3VBHB 1AUYA 3AX4A 5AC91 5C4WB 2DCTA 4NN0A 2KM2A 3AZZA 4YW1A 3VHPA 4AVTA 2VOKA 5L7OB 1H2LA 1BBT3 1YO8A 4HSJA 4AEDA 1R1A3 3M3OA 4BPZA 1PMIA 2A73B 3VV1A 3GZAA 4E4DX 3PHMA 5CFCB 1NCRC 1TNRA 4A2UA 4Z2WA 2ILMA 2VMHA 5CVRA 2VPVA 5JI7A 4OI1A 1ZA4A 1D4M3 1HX6A 1QJX1 1LKNA 3LCPA 3E6DA 3RDIA 4ASMB 5I0SA 2ZGRA 2WLPA 2WZR2 4I0BA 4QPIC 1RB8G 1AR73 3ES1A 1LCLA 3AP9A 3CLPA 2VOXA 2HWD3 4ORFA 4FQ4A 3MIBA 1WW5A 4DY5A 4QQLA 3RPQA 3L2HA 5LEJA 2RS52 5DZGA 2ZMNA 2EXIA 1V6KA 4Z1VA 1OI6A 4RS5C 4HN0A 3B5LB 4XF3A 5FO7B 3VLBB 2RS13 1T6GC 5C9AC 4AFBA 1H8TB 1R082 5BNOB 1AXKA 1JH5A 1GLHA 4B7EA 2A6ZA 5IK5A 3SH4A 4I0WB 1NQJA 4MXWA 2YV8A 3LGRA 4JQRA 2VG9A 3HT2A 4CZSA 1MS3A 4Q0VA 5DUWA 2ZZJA 4P5HA 1O3RA 5I8TA 2WT2A 4XTPA 3JB4C 4XEZA 2EA7A 3UKVA 1G9DA 1Y7BA 3D82A 4AHXA 1XRUA 2CTVA 2A75A 4IV3C 1REFA 4MX3A 3FBMA 3H7YA 2CGPA 4S2HA 2NP0A 4ISRA 1WLWA 4LE4A 4XFCA 3QOPA 3ZFGA 3AMMA 2P3IA 4Q8LA 4Q4V2 2IWGB 3VBFC 5F5QA 2RS31 4WM7C 2F6BA 3JBG2 1X82A 4S2GA 2NLRA 4FTEA 4IESA 4CRQA 1YHFA 5JSPA 3J8F3 4D69A 1HV1A 4AGRA 4EWAA 1SEFA 2ZGMA 2DYCA 4Y1YA 1V6JA 4CDQB 4GB32 4OLLA 2QQPA 2DCKA 2ERFA 5SV8A 1DZQA 2XBO1 3AP6A 2XLAA 4LNVA 3WX5A 1XU1A 2OA2A 3ECQA 4QGNA 5GZFA 3MFAA 1RIRA 2W39A 1JUHA 2IC1A 2XL9A 2BNMA 1DQ2A 4LO4B 5IUQA 1KDMA 4GH4C 5EZWA 5A33A 2C1FA 3X29B 5FREA 1U5YA 1ZVFA 3D8CA 3WG1A 3NAPA 3WW4A 4DNYA 4DZGA 3VBRA 3B69A 4GMP0 1GKBA 4NHLA 3BODA 3VBSC 3ZXFA 5KXDA 5IK4A 2ZABA 3WDTA 5GLVA 1LTEA 2YC0A 1DQ0A 1AJOA 1U0AA 4YW2A 4AQTA 2D5FA 1ZRCA 5K8SA 5IK7A 2X5IC 4ES8A 2WQ4A 4CEWA 1PO11 1CX4A 1KFUL 4E2SA 3VDDA 3NKGA 3MGUA 4MH0E 2WNUB 1UKGA 2HWF1 1RHI3 3SITA 1XE8A 4Y5Z0 1MEC1 5K0UC 4XE9A 1VBE3 4MGIE 4M3CA 2WLQA 5EWSA 4NWWA 1PIV2 3ZN6A 2R061 3BOWA 5L73A 2FHRA 2GSYA 1ENXA 4CDWC 1XQNA 1JW6A 1QH7A 2VNOA 1YWKA 1TME1 2ZTNA 2YGMA 3R6SA 1RUD1 3RWNA 3M70A 4EWEA 2A71A 2ZBJA 3VZMA 4J1WA 3LA2A 1ZYBA 5EJ3A 1I5ZA 1RVF3 2D6OX 4JTNA 1YCIA 4M0HA 3VBUB 3J4UH 5DZEA 3VKOA 5BYNA 1PGW2 5KBFA 5D8AA 5JOYA 4KU8A 5FQ0B 2PHWA 5C6CA 1ZNPA 3AP7A 1OOPB 1WW6A 2Z2SB 4Q4X1 1ND2C 4Q0SA 1JYIA 1K5MA 3C2UA 1IS6A 1UPSA 1CAUB 2AUYA 2HWE2 4IERA 4TLFA 1LOBA 2E7QA 2RR12 2C9AA 1X36A 1EPWA 3FE5A 4JTOA 3LOBA 4LR4A 2BFUL 3EQEA 1EY2A 2WZR3 2K0GA 4R4ZA 3FC0A 3MIHA 3I59A 1F5FA 4XJAA 4Q0QA 4AEDB 2WKKA 2RS53 1CPMA 1FATA 4XFBA 1QXRA 2CWSA 3POSA 3HWJA 5FBZA 1G6NA 1OA4A 2RMU2 3AB0A 4N53A 2ET1A 5C8CA 1R083 2IXKA 3BPZA 1MQTC 5F9TA 3RNSA 4JV4A 4XIKA 1QJX2 2CWMA 3LA7A 2ZPXA 3R4DB 4XMIA 3J8F1 4Y1ZA 3ZYIB 3NWKA 4XJ9A 5CADA 1OLQA 5I8SA 2WFF3 1IQAA 2X53S 4DRVA 4QU2A 1EPZA 2TNFA 3EHKA 4MZUA 1RUC2 3KSCA 4DOUA 3WT3A 1POV1 4YGEA 5D1IA 3KQRA 5H9SA 3GALA 4LHNA 4DQAA 3O0WA 3AMNA 4MXWB 1HQLA 4XILA 4Q4V3 3LKJA 1UAIA 4TWTA 2MEV3 4JC1A 2D3SA 3HMYA 1UU6A 1LEDA 5ACA3 5DUVA 3WNXA 1CGPA 1LOFA 2D98A 5HCAA 1A8DA 2D6LX 4LA3A 1GZWA 4PF5A 4GB33 3SMHA 4BE3A 2CGOA 4Y26A 4IEUA 4RQPA 4XQ4A 3WQ0A 2Z42A 5FLIA 2GH8A 1RUF2 1VRH3 2JECA 4MGZE 4EN0A 5EYYA 2BBVA 3ZFGB 1COV3 1NA1C 1VP6A 2PHXA 3SHRA 3TAYA 4XJWA 4FXGB 5CIRA 1XYNA 4CP1A 3J26N 5CAZA 4LLOA 2WINB 2GH2A 1C8M2 1MS1A 3WHTA 2ZGNA 2FQPA 2VVEA 4KGQA 2H6BA 4YVWC 2DVBA 1BEV2 3H50A 3ZXGA 1X33A 3QCWA 4QD2A 4HVQA 4PCRA 1Y3TA 3LA3A 2OUHA 4I30A 4IV1C 1KITA 1ASJ2 2PHDA 4WVZA 1GYKA 4FSJA 3MF9A 3JU9A 1C5HA 3HQXA