2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
molecule keywords PROTEIN RSC3288
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
2VUDA 1OXCA 5A6QA 2JDUA 1OUSA 5A6XA 5A70A 2JDKA 2JDHA 1W8HA 3DCQA 2JDNA 2BOJA 2JDMA 2BV4A 2WR9A 4UT5A 2BP6A 2JDYA 5HCHA 2VUCA 4AOCA 1UZVA 2VNVA 1OURA 1UQXA 5A6YA 2BOIA 5A3OA 2WRAA 1OVSA 1W8FA 1OVPA 3ZDVA 2JDPA 5A6ZA 1OUXA 5D2AA 4CE8A 2XR4A 1GZTA 2CHHA
chains in the Genus database with same CATH superfamily
1MS1A 2J1VA 4AI3A 1O4ZA 3WNMA 5BNQA 4YYOA 4XMAA 4PQ9A 5DXDA 4O9GA 4E9KA 4XDOA 5DAWA 3DECA 3WR0A 1HB4A 1NLSA 4QD2A 1J1LA 3VKMA 4LO6B 3WQ7A 4LKFA 3H3UA 4N43A 1J3QA 2AC1A 2R071 4OLLA 4FPGA 1PIV3 1UQXA 3KT4A 1LOFC 2XJRA 4CXXA 5FR3A 2BNOA 1NKGA 2ZCWA 4BMBA 1YIPA 1YFYA 2JDPA 4XJUA 2DCKA 4AHZA 5E1RA 2Q4SA 2TEPA 2WNVC 1YO8A 3D82A 2VJXA 4DFSA 1ZRFA 5F5AA 5FZ3A 1WW4A 4GB31 1WW7A 4LBQD 1FT9A 2ZEYA 1AYM1 5T50A 3VBRC 5JMOA 5L19A 2UWCA 3H8OA 1SPPA 1XNAA 4W6WA 1W2UA 3FBMA 4HPKA 1O91A 1V6JA 2XJSA 2K46A 2D6MA 1QEXA 5JZGC 1J83A 1IOAA 2JJ6A 4IEYA 4OMDA 2RS12 2YDEA 4ASKA 1DYOA 5LY1A 5LZ6A 4FSJA 2D6OX 5J37A 5AVPA 2BNNA 2Q1MA 5CU1A 1JODA 5BNNC 1GNYA 2E33A 4H14A 1S1AA 1OF4A 1V6OA 2DYCA 1UWWA 1WMFA 1DQ2A 1OKOA 1SLLA 2XJUA 4MADA 5IVEA 5JDBA 1HXS2 4HPKB 3VBSA 1I5ZA 3MIFA 4AWDA 5ERLA 1LHVA 3NV4A 4FFGA 1UXZA 3TNQA 1VBB3 2CWSA 1ZVFA 2XJPA 4AL9A 2RR12 2QDNA 4KL1A 3Q9OA 2GNBA 1Y7BA 3KT7A 3PMEA 4QPWA 1FI2A 2Y6GA 5LRSA 2EICA 3AP6A 4S2HA 3VD5A 1Q3EA 2ES3A 4B8EA 4AK3A 1VBE3 1VRBA 4COWA 2RM21 4N43B 4MO3M 1ENQA 3RSJA 5AC93 5A1LA 1G8WA 5JIAA 5FOJB 1Z78A 4CUCA 2AEYA 3SH4A 1OXCA 4I30A 1JN2P 5DDJ3 5L7OB 4B1LA 4O7XA 4XUOA 1NCRC 3ZX7A 5A3UA 5A7SA 2ZHNA 1CIYA 2VC9A 2WYFA 4I0AA 5JI9A 1JZ4A 4MGYE 4D8MA 5FDBA 1R1A2 4JGZA 4QPYA 3IAPA 5ABJB 5LBCA 3ZOIA 2FBEA 4BMEA 3DF0A 4E4HA 3WW3A 2JD4A 2ZKLA 5LBFA 1NOVA 4YVWB 1OURA 4EWAA 2VZTA 2AZ5A 5DUWA 4NPMA 1B35A 2JIJA 2ENRA 4LLOA 4QU2A 3VBOB 3H8UA 4BE3A 2FDIA 3FC0A 4AXOA 1D4M3 1BEV1 3VBOC 2FHRA 4C90A 2ZX3A 5A3WA 4OQ9A 5CADA 1GZTA 4E2SA 2ZX4A 5F39A 3TBDA 3AMNA 5FFOC 2ET7A 2VGDA 3RGBA 4LO5B 4TSVA 2YC4A 4FBFA 5CFDC 1L7RA 3TEXA 1L7LA 1R091 2QE3A 4F8AA 1NLRA 4WZFA 2RMU2 5C8WA 1RUF3 3ZKYA 1AF9A 4UAPA 3J8F3 4CCLA 1I3HA 1WWYA 1ZZ6A 1AR83 4XE9A 4XDPA 4Q4V2 1XOYA 5I8TA 3PIGA 2JE9A 2HEYF 2Q1ZB 1PK6B 3L9JT 3UETA 3RJ2X 1QJU3 2XQRA 5FXZA 1UU4A 4W65A 1CAWA 4JQRA 4R4XA 1XE8A 2HWF2 4KU7A 2Y6LA 3V65A 4M4RA 3RPQA 2RJLA 2Q8CA 4YGEA 5FQ0B 3U0ZA 5CB7A 4YG0A 1ZREA 4MX3A 1L7QA 4HKOA 2Z4FA 4WV8A 4LBQB 5C8CA 4QB1A 1VBB2 3AZZA 4UI9L 2NZ9A 2XBO1 2E53A 4GA9A 4LK7A 4RFT0 2NP0A 4H2AA 2QDRA 3MO4A 1I5PA 1RXFA 1X9PA 4XF4A 3QBQA 1LRHA 4W50A 3SEEA 5CNAA 4RR3C 5F3EA 3S6PA 3WF4A 5JPMB 3S7EA 3TN93 5EP9A 3AVSA 1UY3A 2VMEA 2JB8A 1NUKA 1QH7A 2XBO3 3WNXA 4CXWA 5A6YA 1K12A 2DVAA 1JYCA 2OPKA 3USUA 2DCTA 3WY6A 2VVDA 3MFCA 4AGRA 3HAGA 3ZMOA 2X29A 1YWKA 1HW5A 4WVMA 1DYPA 3S7IA 4UFKA 1F2NA 3PVNA 4XDQA 1COV1 3DV8A 3THDA 3WVJA 4QQHA 4IXLA 4NE9A 3BN6A 3ZN6A 5FWJA 5DPNA 1CWPA 2ZA9A 2VMGA 3BPZA 1UZWA 3GZUC 1J1TA 4LOSA 4QKDA 4GULA 4UW3A 2WO7A 3UESA 2Y6KA 1F5FA 2B7YA 4Y24A 3PL0A 3O1TA 1U5IA 2BFUL 5FP9A 1DGRA 3I3EA 1U12A 4CEYB 1X50A 1LGBA 1GP6A 3AL6A 4LBMA 2VR4A 4JZRA 3UKNA 3W5NA 1AR91 4K21A 2HWC1 3MEPA 3CBNA 3I3BA 4D69A 1GNZA 5EZWA 1QJFA 3KCXA 3UKVA 2R0HA 1JYXA 4RSUA 4XJ8A 3ZYPA 4IV1A 2JX9A 1RVF1 3NAPA 1OH3A 5FYHA 5AC92 4GMP3 1N1TA 2FCUA 5CFCA 4YGCA 3HD8B 3ZSLA 3OYWA 3FLRA 4Z82A 1S55A 3VDAA 3W21A 4AVCA 3CF6E 3WDVA 3S30A 5C3PA 1ZRRA 5FY5A 4E2QA 1OLME 3D0JA 4FFIA 1RMU1 4YW5A 2X09A 1DF0A 1DGRN 4QPIC 4QQ2A 1C28A 1WZXA 5FLJA 3HQXA 3RG0A 1PVC3 2WC2A 5HV0A 1M4WA 3FHAA 4PF1A 2YUEA 2XWJB 5I8YA 2F17A 1S0JA 5A3TA 1XRUA 5JR2A 1W2OA 3KF3A 5FYVA 4FFHA 2CDPA 5F5QA 5FYCA 1DQ5A 3ZR6A 1HN0A 3POFA 4Q4W1 1O8SA 3N36A 4A7KA 4KU8A 3CIHA 3HBKA 5L7OC 1DYKA 5FP7A 1BJQA 2ZHMA 5LB6A 3HVDA 4RGGA 2AR6A 1OA4A 4LLFA 3J26N 1J58A 2X5IC 1W6QB 2P3YA 2X10A 3OOXA 5K4LA 3BCWA 3UJOA 4BDVB 4KG0A 2SLIA 5FY4A 1SEFA 1SLTA 5C4WA 1K3IA 4RHV3 1UYXA 2C5DA 5F3IA 5JZGB 4XFHA 5GLUA 2R6QA 1NZCA 2J1UA 4MGSA 5FXVA 5ACA2 1EP0A 3JD72 2OUJA 3ES1A 4QKFA 1EV11 3ZVXA 2DUOA 3M8LA 3I2OA 3FHIB 1REEA 4XTPA 4RL7A 1ND2A 4GAZA 4HZFA 1DDLA 4FOYA 3VZKA 4IGQA 5T3NA 1O3TA 2VMHA 3GZTB 4P9GA 5C4WB 1T2XA 3KGZA 5JSRA 2TBVA 3MGUA 3NNLA 1SBDA 1GUIA 4PI0A 3AKTA 4RFRB 4YVSB 2W68A 1JZ7A 4P9YA 4P00B 4DEVA 4V1PA 4KG8A 2WQZC 3NW4A 2XDVA 2HBUA 1PMHX 1VBC1 2D43A 3BOPA 5FZ9A 4YNIA 1AJKA 3OJBA 4M3CA 1RUJ3 3KWVA 4XTMA 3ILFA 1EUTA 3KF5A 4MGZE 2BRTA 2GALA 3JBG1 4GALA 1MACA 5JVVA 4FFFA 2DCJA 1DCSA 3VHRA 1UYZA 3I54A 1XSRA 2G1MA 1W9SA 2VXJA 4CVUA 3JBG3 2I2SA 3LA2A 2XKPA 2LROA 5A32B 3B01A 4BJ0A 1ZBA3 3SEPA 2ZGNA 1OOPB 4I09A 1CJPA 1JYWA 3KSCA 1F15A 4Q4X1 4E2GA 3MIDA 5JOZA 4Y1VA 1GLHA 1H2KA 2G9FA 3E1F1 2HWC2 4NWWA 5T5PA 4CEWA 1BVVA 3PTRB 2QQPA 4L0PA 2E6VA 5FZEA 1JOBA 4JTNA 2AUYA 2W1WA 2VQTA 1V6IA 1GOHA 3BPSA 3CO2A 5D1IA 4Q4Y1 3RYPA 1TE1B 2XG3A 3OG2A 1RUF1 3NAPB 1FPN1 4PLMA 4BLIA 2ARCA 4IEQA 3OD4A 5L36A 3NNMA 4CDWB 2Y6JA 1NE6A 4UBHA 1CN1A 2NN8A 2WUHA 5D8AC 4YW1A 3VZLA 3SH3A 3HT2A 1UAIA 3H7YA 4HKLA 3TEWA 4K8FA 2VBDA 2XHNA 2Q8OA 5CKNA 5KR7A 1JOPA 1PIV1 2CWMA 4ISQA 3J9SA 4OI0A 3GJBA 1UPIA 3AKRA 4AAXA 2CAVA 4NWVA 2EIBA 4RN5A 5IK7A 3KHBA 5D8AA 2N7GA 4BA6A 5IAVA 2VMCA 3WW2A 2P5BA 3VGIA 3T0DA 1MR5A 3ZN6B 1C8M3 4BXFA 1I6XA 1HRI2 2RS13 2VW2A 3AMQA 2W87A 5A6QA 5FO8B 1X8MA 3L2YA 1VBB1 1RUG3 2OVUA 3M3OA 4WM8B 2DVBA 3FFQA 3I3QA 5FMDA 3SHRA 5LBEA 3BIEA 2BDRA 2G9GA 1RHI3 5C71A 2JE8A 3BKZA 2WO1A 1UPSA 1VALA 4CEWC 2ZACA 1W6MB 2VAUA 1PHMA 3J7HA 3FN9A 3F2ZA 4LBJA 2VBBA 4CYDA 5FK8A 4L11A 1LJ7A 5C9AA 5DUVA 1YJKA 4Z1VA 2A7AA 1UMIA 2RM23 4QX5A 2WS91 4NIAA 4D7SA 4YM0A 2VL4A 5CKQA 5FY9A 5I91A 1RUH2 2ZTNA 2AGSA 4JCKA 4GIQA 1AX2A 5JR7B 3RWNA 2R32A 1FMD2 2CL2A 2PHXA 2Q30A 3CU7A 3I8TA 5FZGA 4TTGA 4AW7A 2RMU1 1V9U3 5EFUA 5K7PA 1DQ1A 1DLLA 4M3CB 4SBVA 2VZQA 4QKNA 3MW2A 1SCSA 5F3CA 2ZGPA 4YG3A 3HWJA 1A3KA 4NMIA 1VP6A 1RINA 1KEXA 3NJXA 3ZYHA 4PI2A 4YW7A 2PAEA 1GV9A 5FJHA 1SHWB 1EYBA 5IT6A 2VZVA 4LBLA 4QX3A 1D0GA 3MUY1 3I2DA 1T6BX 5C7GA 1SFPA 2BZDA 4O9EA 5JSPA 5FIXA 1N3QA 1ZX5A 2D6LX 2LM3A 1FAYA 2B5HA 2XL7A 4CRQA 3RI8A 1GQPA 5DDJ1 2O8OA 1NAEA 1GZCA 5E89A 1NLQA 5SV8A 3MPPG 4EWEA 2FZ2A 1RTVA 1FNZA 5FZ4A 2FD8A 3POGA 4Y4YA 1GICA 2WSVA 4P9JA 1QJZA 2IXLA 4XJ9A 1GQHA 4Y1XA 3LWCA 4HSJA 1XBFA 2EXJA 2ZGTA 5K9YA 2PQSA 4FTSA 4FPYA 1W6QA 1QNYA 4OFGA 1LECA 3AP9A 1H1MA 4FPEA 2X5IA 5FPBA 4UFHA 3P6BA 3R4UA 2RS53 1HB1A 2X53S 1VB4A 5L7OA 3P1IA 1IS3A 1RUD3 1S0FA 2A5ZA 4P9IA 5DG1A 5IWFA 3MLJA 4LQRA 4AEDB 3ZFGC 2R7EB 2RDSA 5JPNB 1HIXA 4Z07A 4OMCA 3LZZA 3T0AA 4BQXA 2OZ6A 2VZPA 4JX0A 3NO8A 4YGBA 3T4VA 4LIUA 4HN1A 5JXIA 1DZQA 1RUD1 3TWIA 4J1WA 3I59A 1MZ6A 1E5IA 1XNDA 3HNMA 4GZ9A 1HKDA 1A6CA 4AQTA 4JGYA 1RYYA 3OPZA 5IVBA 3ITQA 4JHZA 4ZXKA 3ZMNA 4CA9A 4NROA 5H9QA 4FTBA 4FOVA 5F3GA 3ELNA 1GR3A 4R9CA 1O7FA 2DUQA 2QUOA 3HQUA 4P14A 5FZKA 4FQ4A 5LA1A 3WT3A 1UIKA 2KXLA 3HPNA 4IV1B 1RB8G 2C26A 3K75B 1NZIA 3GHMA 2HWD1 4QHBA 4DUXA 2NMNA 3H1YA 2KR2A 2YU2A 3OEAA 1W8ZA 3LA3A 3AMHA 2QQKA 5CBLA 1SQ4A 1LULA 4INDA 5DABA 1QOSA 1FOD1 3N9QA 5FZCA 1H4GA 4Q1RA 3TN91 3WF1A 2BWCA 3EJKA 1SBFA 3ZYGA 4ZS3A 3I2KA 4AVVA 4DMIA 3LD8A 4NPLA 4TLGA 5CVRA 3WD5A 1H6XA 4ITCA 2WZR3 4Y20B 5HCFA 3C8XA 1LHOA 3RYKA 1KJLA 3KVBA 3OTFA 2GH2A 1JYNA 4Q4W2 3SMHA 4BU2A 4YG6A 1ASJ3 2XL9A 3NV1A 5BXXA 4QHZA 1MEC3 3ZIXA 4LBNA 5A3PA 1Q8QA 1GANA 1W8OA 1AYN3 2E51A 2JG9C 2PHFA 4JDMA 4MVTA 5GJ6A 3WV6A 5A1AA 1MPXA 1HX6A 5FY7A 2P3JA 1OHFA 4CTEA 4QDQA 1XNCA 1QF3A 5GZDA 2CAUA 1QKQA 3D3AA 4S2DA 1URXA 3K77A 1C8M2 5GLVA 3IIIA 1LESA 2VY0A 3ZN4A 4H3WA 1RGSA 3EB7A 4KGQA 4IEXA 1XE0A 3VHOA 2AENA 3ZN5A 5C8CB 4Z2WA 3OUJA 4FPOB 5F2WA 5C8CC 4EE2A 2RJKA 1ZM1A 1WD3A 2JIGA 1IHMA 3DGTA 2VW0A 2YC0A 2EALA 5GZCA 3ACHA 2H0BA 4H55A 1Y43B 3IN9A 5CISA 1MEC1 3AJYA 2DU0A 1UY4A 1MZEA 1UOBA 2OXBA 4EN6B 2WABA 3GM8A 4HFSA 4A3ZA 5FUPA 2QZ3A 2ZZQA 2WWSA 4XEZA 2R49A 1ND3A 2GU9A 3ZYFA 2D3SA 4LTAA 2VZUA 4CDWC 3GBFA 2E31A 5FZOB 5DAQA 2Q8DA 5LBBA 1SCRA 5F9TA 1QJU2 1KJRA 1RJ7A 4NRPA 1VAVA 3WNLA 3VBUC 2FDFA 2P17A 4ARXA 4CE8A 2A6VA 4PT6A 5CFDA 2XR4A 2VOVA 5EYYA 2VVFA 4JHTA 4QQPA 2ARAA 3THCA 1GYKA 1AR71 1RUOA 3ZKUA 3VD4A 3WZ1A 4Y22A 2C0ZA 1D2QA 1HN1A 1YUDA 3RRDA 4AG4A 5K0UB 1UO9A 2CNAA 3LIHA 4GB33 3VBOA 1XYPA 3VD3A 2WR9A 3ZXAC 2WA4A 4DXTA 5ABJA 3JZVA 4MG2A 3PU3A 4RQPB 4GH4A 4RHV1 4Y26A 3VN4A 1RUI3 2NMOA 4RS5B 1CAXB 4JGZC 1VB2A 3LEIA 4EN9B 2Q1FA 3N4MA 2KM2A 1G7YA 1SFNA 1OVPA 2ARBA 4XOGA 3WG1A 3WNNA 4GJZA 4OI2A 2VOXA 4KQ7A 4AFAA 2RDNA 1WCKA 5IVVA 4EN8B 3AXEA 1H1IA 1W9TA 4BCUA 1R1A3 2GP5A 4XUPA 3GALA 2ZGLA 2OIIA 1ZZ8A 1XYNA 1UMZA 3R6SA 1AR73 1Q8SA 3NSTA 5AC91 2C9KA 4DINB 1AL0G 3B94A 1WBFA 3FWEA 1ZA4A 4XZPA 3N7LA 4XAEA 1CAVB 1I9RA 1R082 3AFGA 4Y1YA 5EPAA 1HB3A 3M70A 3B9CA 5FZDA 2GMPA 5A33A 1S0BA 4ZU5A 1HV0A 2JD9A 1TNRA 4EQVA 5EQUA 3GNEA 2FDGA 4QB2A 4PJYA 1DGWA 1MS4A 3FMGA 3WNKA 4A7ZA 1YJLA 2W1SA 4AGVA 4YW4A 4FPLA 3NWKA 4IGPA 1NCQB 1AR63 2H6CA 3M3EA 2WO2A 4C1XA 4PDWC 1TEIA 3FHQA 3NJVA 1G9AA 1ND2B 2Z79A 4M00A 5GZEA 4TLFA 3B5LB 4HXCA 1UMHA 4FI9A 2JDNA 5BNNA 4CCJA 1WLTA 2RS51 2JDYA 4AQ6A 2W1UA 5HPOA 2GSYA 4W8JA 1UY2A 5KXCA 4EYUA 4MHUA 4A6SA 1QDOA 5JZGA 1AX1A 2LTNA 3U07A 4EV0A 3P5BA 2BQPA 5KHJA 2WZEA 1XYOA 1JZ6A 2JICA 1F9KA 2OT7A 3KV5A 4XYXA 3VBRA 2ZAHA 1UU6A 1ZBE2 4UT5A 1JI6A 1IKQA 2QNKA 2XXZA 3ZPOA 3ENRA 1P8JA 1LEMA 1XJAA 4CCOA 1IS4A 3GJAA 4BQ3A 4CZSA 2XOMA 4XURA 1UZYA 2ZKNA 4GB32 4K1YA 4LEJA 1US3A 3RQ0A 2WIIB 3WINE 2BEOA 2XH6A 2XONA 4XQ4A 2P6HA 1LOFA 1V9U2 2PXJA 1G6NA 3B9IA 5IUQA 2WZ8A 1HRI3 2XJTA 4Y5TA 5J09A 1NE4A 5JIUA 3RZZA 4A42A 4TWTA 3A21A 5JCTA 3H8XA 3ME2A 2EAAA 3MF9A 4OUEA 4QX7A 4C0BA 4BXSV 5JMCA 1Z7S1 3MV11 1W8FA 3WF3A 1LB2A 2V73A 4QU1A 1W0NA 4DQAA 1SLAA 3AP5A 3POSA 4GKYA 4XFCA 4EZHA 3V0AA 1W6MA 4LE4A 3T2QA 4EN0A 4LR4A 1PX3A 2WDBA 2W94A 3C7GA 3BTAA 3LB9A 5IFPA 3VD9A 1CPNA 1OFNA 2CSGA 2VUJA 4M0NA 5J3UA 3OUHA 5FZFA 1R64A 3VHNA 3SKVA 2BGOA 4WM8A 3DL3A 4U2AA 3K3NA 3VL8A 3ZYBA 1J59A 3ZXEA 5IAXA 2RDQA 4IEOA 2WNUC 1LR5A 2CY6A 2O0OA 2ADEA 1O4TA 3AYAA 4FPKA 3PHMA 5FYIA 4CPBD 1R083 3H1WA 2FMYA 4LO7A 2GMMA 1D0HA 2EIEA 2WQ4A 3WDTA 2VZRA 2ZGUA 3N9NA 4XFAA 1UXXX 2BU9A 2R1BA 2D44A 4ORFA 5IW0A 2Y8KA 3PUHA 2NM1A 5EJZB 3VBUB 1WKYA 1US2A 1NA1C 4X6RB 3ZXKA 3UNPA 3H8RA 3MLLA 3U75A 1W99A 3ILRA 5IVJA 2ID4A 4GJYA 1H30A 2DWRA 5AFBA 5FBZA 4D3WA 4XZUG 4DPNA 1RUJ2 2JKBA 3E6DA 2F4LA 4AI2A 2DVGA 4Q0PA 1JBCA 4BH9A 5FRAA 1CD3G 4JDOA 4GWNA 4DS0A 1W8HA 1WCDJ 1REFA 3O0WA 4BISA 1DIWA 4D6QA 1NG0A 4LE3A 4HETA 2GNDA 4URAA 3BUCA 4FPHA 4ES8A 3WQBA 5FUIA 1H9PA 1QMJA 3AKPA 5FP8A 4XF0A 1H2LA 3LA7A 3V0BA 3ZM8A 5FO9B 4YLZA 5FMBA 4ZKTB 3CJIA 1XU2A 3AK0A 2P3KA 1YQ6A 4NJ4A 1AJOA 1YIFA 2A71A 3RWKX 1HV1A 1WCUA 2HWC3 2YXSA 1WCQA 5FAXA 4CUGA 1OOPA 1FXZA 2FDJA 2J1RA 4AVBA 1PGW1 2JE7A 3LFMA 4UWDA 4WVVA 3VB9A 2FMDA 2E32A 1ZRIA 2VU9A 4JTOA 1LCLA 2PLV3 3OY8A 4P02B 1GMMA 4QM8A 3O1VA 1HLCA 1ULOA 4LBQA 5FYYA 2PTMA 2WINB 3ZLIA 2FDKA 4EROA 1LU1A 2BOJA 2OQ6A 2QQVA 3RVHA 4BLJA 5ACA3 2WFF3 4AOCA 3AYEA 3JXSA 2HWB2 3LPFA 5EYXA 3R05A 1W6OB 5F7UA 3VKLA 1GWKA 4XBQA 5T5JA 3FJSA 2DFBA 2PELA 4DUWA 1QJX3 3I2FA 3ECQA 1RMU2 3I49A 4QT6A 5H9SA 1CZTA 2B45X 3LEMA 1H2NA 5I0SA 2IVIB 2J1AA 3H9AA 1AL21 1UCXA 1YLLA 3BI3A 2VCMA 5IVYA 4Q4W3 3THTA 4Y5SA 5C6CA 5JXHA 4KWUA 2XPJA 1VR3A 3KLSA 3C2UA 5CKMA 1FOD3 1ZZ7A 2YV8A 4NHMA 2OYZA 1LOAA 1F35A 4HN0A 4CP9A 2CU5A 5KC5A 4AQSA 3HJRA 4OZXA 4TZDA 2TUNA 1NXD1 3VV1A 1VLNA 1UZVA 2VCAA 1GZWB 2QZ2A 5G05L 1STMA 3OPTA 2JG8C 3WLUA 3NV3A 3OD0A 1H8TA 2OW4A 2JG8B 2E26A 4XF9A 4FTEA 1VE0A 3LOBA 3WX5A 4ET7A 1O6UA 4BYYA 1OFSA 4QPGC 5A7PA 2P1BA 4DXRA 4Q0QA 2GC1A 2MNGA 4N7UA 5GKAC 1EV13 1KFUL 4G3YC 3ZXJA 4GWIA 2VZ1A 4DNYA 4BHPA 5BV6A 3WDXA 2YHJA 1OPMA 5F5CA 4P5HA 4BIOA 4QDSA 3VZNA 1BYHA 3Q8BA 1OI6A 2MEV1 5AVAA 5IK8A 1D2SA 3N7MA 3FZ3A 4QX2A 3T09A 1JYVA 1GBGA 4HMZA 3ZXFA 1DGWX 1OLQA 3MIEA 5LA0A 3N9OA 3WDYA 1NCRB 1POQA 5C3SA 3GYDA 1UZ0A 4YM3A 2HWE3 1KQRA 1LENA 1RUJ1 4YW6A 5DZEA 5LW9A 3VBFC 2ZHLA 1LGNA 2OA2A 3KCYA 3AJZA 1BCXA 3NNGA 1X7NA 3BB6A 4KBBA 2X05A 1CONA 4KNCA 1H8TB 3ABZA 4AYUA 5F37A 1VMFA 2DBIA 2H6BA 4XCAA 5CFCB 4LO8A 4OQ8A 5C70A 3QOPA 4LITA 3CZUA 1DLCA 3L2HA 1GZWA 1UIJA 2B9UA 2IFWA 1OQDA 3H3LA 2GAUA 1H2MA 4Y3OA 1OD3A 4ZPIA 3FFZA 3LAGA 2YY1A 2ZGOA 3LIGA 4YW2A 3JQXA 1WA4A 1XNBA 3FUOA 3I2JA 3OB8A 1NXMA 5IJRA 1QDCA 4CP0A 4RGKA 2RHPA 2D97A 4KWJA 3O1MA 1SFYA 3VBHB 2BWAA 3ZFEC 1AR62 1U5ZA 2QCSB 3FX3A 4KBZA 1CZVA 5LK7B 3P3NA 3UK9A 5A70A 2W47A 3VHPA 2IXCA 2GC0A 2Y6HA 3LDKA 3PVBB 1J3PA 4KWKA 1S4CA 4FQZA 2XVGA 1W39A 3AP4A 1K5MA 4FAGA 4YZ5A 2QQUA 3I2IA 1RUI1 5F1RA 5L9VA 1RC6A 3E6CC 3USUB 2BPA2 3WUCA 2VBPA 4K9SA 2JB4A 1QY4A 1VJ2A 2A6ZA 4GKXA 4CDUB 2LUWA 4YM2A 3OGRA 4B1MA 1W9WA 4CDUC 1UOGA 2ZABA 1OH4A 4EN7B 2C9AA 4XQWA 2WAOA 1ZYBA 4YFZA 2WS93 1FV2A 3S5QA 4WVZA 5FV3A 4I01A 1PMIA 4RR3B 1RIRA 3ZXGA 3E5UA 4DO0A 1YXWA 5BNPB 4I2OA 1EV12 1AYN1 2RG4A 3M3QA 2DUPA 4JQTA 3MZHA 4LBOA 2BYVE 3POEA 3DPRA 3BODA 3MUZ1 1Y4WA 4N53B 4MHRA 4CUBA 3RMXA 5IATA 1BK0A 3M2MA 4N53C 3I2GA 1YNAA 3KV9A 2VMIA 3ST7A 1MVQA 3SKJE 2ORXA 1CIWA 4A45A 1PK6A 1CAUB 4Q2FA 5DMYA 1ZRDA 4IEUA 1PGL1 1ULPA 5CEHA 2X8KA 1OUXA 4D6RA 1W8UA 5KHGA 5K0UA 3HN1A 4LIVA 1A8DA 4IV3C 3J7MA 1ULEA 1IG3A 3OUIA 4LHLA 2IC1A 2P2KA 3NKGA 4Q4Y2 1EAH3 1REDA 4YZ3A 3MIGA 1NA1B 2I45A 3DEMA 5EJ1B 4AF9A 1JXNA 5FBJA 4Y33A 1FATA 5FZOA 1MQTC 2ERFA 1IKPA 2Y0IA 3AMMA 2YU1A 4HKWA 1H8VA 1W0OA 2O8QA 2VW1A 2Y64A 4FO9A 5FYMA 1X8EA 3A0NA 5A80A 4BK4A 2FCTA 1JW6A 1POV3 1W8WA 4HL0A 2LALA 3C7OA 3USSA 4LOTA 4W6YA 4FPFA 3T4HB 2IXIA 1RL3A 1Y9MA 4NAOA 1V6NA 2WT1A 5FYZA 5FY8A 3SLIA 2Y6FA 2BJSA 1UN1A 5D2AA 3WCRA 2QTWB 1WMDA 4PIYA 3TYJA 4SLIA 2GNTA 1WGPA 1UY0A 4CU8A 3DPRC 4MGQA 3JU9A 4AGGA 2V5DA 3THPA 4R9AA 1V6MA 2HBTA 1YCIA 3Q8EA 4GMP1 3KM5A 2YMZA 4QPIB 3W20A 2PQQA 2B46X 3O12A 3FE5A 1ZBA1 3SCFA 3UT0A 5FREA 1JZ2A 5IHRA 4Q4X3 4XETA 2EXIA 2GZWA 2HYKA 1OQ1A 3KQRA 4LULA 3T08A 3WP6A 2ILMA 5HCAA 4XJAA 3C7HA 1G9DA 4OHXA 4QMAA 3GF6A 1RMU3 2A6WA 2VM9A 1RHI2 2YPJA 3LKJA 5FCCA 2YBPA 4D0QA 2MPFA 3ZSKA 1KXGA 4JAAA 3ZO0B 3JD71 1VBE2 4BQ1A 4NRMA 5J36A 1OMIA 1PGW2 3ACGA 4UOJA 2ZGKA 1IS6A 4WM7A 4LUKA 1VBD3 1FPN3 1ULDA 2BTVC 4AFMA 1K5MB 2ZOEB 5B2GB 3WXPA 3RZKA 4XHXA 1QJU1 1YEWA 3VBRB 4YPJA 5FZHA 2D3PA 3DXTA 2BNMA 3ZXDA 4Y4RA 4XJZA 2CYFA 4Y1UA 5DZGA 2GN3A 4HK8A 5HI0A 5J98B 3VBSB 3ZFEA 1ALYA 1IPKA 2ATFA 4IERA 4Y20A 4Y5Z0 1V6LA 2EXHA 2YZ4A 3K4DA 3M3IA 3SNMA 3WQ1A 3ZPYA 3AVRA 4AQ2A 4L2NA 4LNVA 4LJHA 1R093 2B8MA 1DQ0A 5LK5A 3VKFC 5BNNB 4OULA 5FYSA 1QJY2 1AXYA 4DOUA 4ONUA 3I7DA 5FKCA 4Z8BA 5FYUA 4XACA 1LAJA 2ZGMA 5C3OA 3CKHA 5G04L 4L8QA 4OVEA 1A34A 1HQLA 3S5AA 2VUDA 4QGLA 1GFF2 3KV4A 4A7YA 2WO3A 3E6BA 4HVQA 1C1LA 2ZBJA 3B3QE 3ZXLA 1WW5A 3EQEA 4XIKA 4B4PA 1QWRA 4B4QA 5C3QA 2VOKA 2WFPA 3E97A 2VTXA 3CDZB 1V70A 2VOWA 1FNYA 1DQ6A 3K48A 5A33B 4MUVA 4JDNA 1WW6A 4WM7B 2MEV2 2VECA 2PHUA 3WHUA 4JGYB 3KZ4C 4RGAA 3J8F2 1TVGA 5I0TA 4AR2A 3FLPA 4AFCA 3RYRA 3WF2A 3V56A 1V6KA 1QOOA 2W08A 1Y9QA 4AEDC 4XMIA 2DVDA 5HCBA 5FTTC 4AHYA 1O4YA 2FZ1A 2VPVA 5J7MA 2ZEXA 3U1XA 3LPGA 1WBLA 2D40A 2O14A 4Z92B 1O3SA 3HR9A 3T2TA 3WP5A 2HH9A 4AAPA 4JKMA 1UW8A 4S2GA 3TNPB 1LHNA 3K4AA 2A3XA 1BMV2 2OPWA 1PVC2 2ZXQA 4XBNA 3GBGA 3Q8AA 3DCQA 4RS5A 1ZZBA 1MS9A 3PVEA 1Z7S2 3CZJA 5CG9A 1H8TC 3POIA 5JOYA 1SDDB 1V00A 3CLPA 2JG8A 5F2SA 3PU8A 4YRDA 1BKZA 1FOD2 1MS3A 3WQ0A 2UU8A 2P4EA 1LTEA 1W05A 1WLWA 2WKKA 2WZR2 2PHWA 4TN7A 1NYWA 4ZONA 2NLRA 3KS7A 4Q4V3 3X29B 1QXRA 5BPXA 4JKLA 3AXDA 4IE6A 4BWOA 5CFDB 1DZTA 2OQ7A 4IESA 1AYM2 3GGLA 4AZZA 2P3IA 2UURA 2PYTA 1QXPA 3OGVA 4FXGB 4IE4A 3PNAA 2IZWA 1APNA 3HEIA 4UXAA 5FPLA 3K51A 1C3HA 2E7QA 1IQAA 4NN0A 2D98A 1AYN2 2GN7A 2ZMLA 3IT8A 4LA2A 5EXOA 2QFEA 4COUA 3W9AA 4DY3A 3AZVA 1RUD2 3PMSA 5ANNA 1JTZX 2HEWF 3OBZA 3VLBB 5FXWA 3ZIWA 4OI1A 1PNFA 4CDXA 3ETQA 2VO5A 3K4ZA 4QXKA 2VNOA 3ZDVA 5A6ZA 2ZS6B 1AYM3 4LHSA 4FPCA 1W9FA 4C1WA 3D4KA 2VZSA 2PAKA 5LWBA 4I3PA 4JRLA 3WP4A 4LKDA 2LW8A 1RUF2 4ZY9A 3K2OA 3ZDSA 4CCDA 4IL7A 1BXHA 4NAMA 4NR1A 5BNPA 1F4HA 4YFWA 3LF7A 2J42A 4MGIE 4D6SA 3W58A 1RUI2 4AI0A 1HJFA 2PHTA 1WLCA 3QACA 5FPAA 4D94A 2MEV3 5C9AB 5HCHA 1YC61 4WZCA 3B93A 4XJWA 1XPWA 3PUSA 2B42B 2DVFA 4X6QB 1AL23 1RUE2 2VUAA 1RXGA 2VMFA 5LY2A 3E5XA 3URFA 4E27A 1G9CA 2K0GA 4QX0A 3V0BB 1YYNA 3IWZA 4H7MA 5FXXA 2WNVB 1WD4A 1KRIA 5FZIA 1CQ9A 1W8NA 3WNOA 1BVP1 2JDUA 3HQRA 5JI7A 3JBG2 1Q8PA 1V9U1 3MW4A 3FLTA 4IW3A 4V2WA 2VCCA 1PM7A 1POV1 1UOFA 3D5OA 1Z0HA 1EPZA 2Z2SB 4XQDA 5LEJA 3J8F1 4QQOA 2XBO2 5D21A 4IV3B 1GOFA 2V5YA 3U4XA 5FY0A 1VBC2 5F32A 1AR81 3VBHA 1JYIA 1BBT2 1MS5A 2GC2A 2RS31 2ZMKA 3AZYA 3PDQA 5A7WA 3ROUA 3ZYRA 1QNWA 2J1SA 1GSLA 4FAHA 4CEYC 4JVAA 5FPUA 1U5YA 4LBKA 1PGSA 4GD4A 1OSGA 1UF2C 2R30A 1J84A 2D6NA 5L9BA 3RZGA 1HRV2 2RS33 1FMD1 1UYYA 4A3XA 4CP2A 4DEQA 1A8MA 2Y60A 4PIZA 3QLQA 1LOGA 3EHKA 2QQLA 4WM8C 3R4DB 3M7AA 4LA3A 2YB7A 4IE5A 1O5UA 4DZGA 1LOCA 1PMJX 4DUVA 4OHYA 5CA6A 4RQPC 3I3DA 5IK4A 1BQPA 4IEZA 1GU3A 3B7MA 5DUXA 4A2UA 4N90A 3RNSA 3CNAA 1C5HA 2DF7A 3U10A 1ENSA 1O8PA 1PO11 5GZGA 4YGDA 5FZ8A 1NT0A 1BK1A 2A3YA 2UYAA 3JB4C 2EIGA 4TYSA 3VUOA 5IVCA 1S0DA 1BEV2 4C0HA 3BTZA 4CPBA 3CHXA 4NRQA 1QIQA 1HRI1 1R1ZA 2HWB3 2GNMA 1B09A 1KS4A 3HN3A 1XNKA 3GCWA 1K5JA 1ODNA 2P37A 3PLQA 4XFIA 2YGMA 3ZSJA 5JXGA 1NQJA 5A7OA 3PJYA 5IK5A 4PIXA 4PLOA 2WNEA 1PZ8A 1CX1A 1N47A 1S2EA 4XBLA 1PNGA 2E63A 1TME2 2P6CA 3N3HA 5FPZA 4DXSA 1J3RA 2X5IB 3VBFB 4Q4Y3 3EO6A 1YQ5A 5ISLA 2RS11 2W5FA 5FLHA 5EV7A 3U11A 2ARXA 2D93A 2BVBA 3C7EA 5C33A 2XGXA 5FYTA 3OGJA 1UKRA 4QM9A 2J1TA 2YG0A 4YVSA 1ZBA2 3AB0A 4CXYA 3O1UA 3A23A 2VNGA 3RZJA 4UF0B 4YVWC 4IGOA 1NCQC 1VIWB 1W03A 2R062 4HONA 3NNJA 1OF3A 4I3GA 1N1YA 1S0CA 1IQDC 1XC6A 4K40A 4CP9B 5IFTA 1Q5OA 5A1FA 2W91A 2W46A 4EJRA 3K46A 3QCWA 4BQYA 4AHWA 2WWJA 4ZHNA 4XUQA 4FCAA 4PQQA 1KS5A 1VBA3 2R072 4PDWA 1Q56A 5C3RA 4QAWA 3VL9A 4UFMA 4E4SA 5LRRA 4NOTA 3WEZA 4XFGA 4Z2AA 3RZHA 4LPLA 3H7JA 5KXDA 2EIDA 2JWPA 1SG3A 3MI8A 3AYCA 4B29A 1LODA 5L9RA 1R081 2V4AA 4J1XA 3A22A 1RVF3 2BOIA 1LEDA 1GWMA 2RJ2A 1OPOA 5FJKA 1F5JA 1A78A 5JOWA 5JWPA 3ZFFC 3O0VA 4OI4A 1CX4A 1Q8VA 1W6PA 2CGOA 4HVOA 1VAMA 5JSOA 2AYHA 5FZLA 4Q8LA 3BU0A 1G86A 4TXWA 1O5LA 1F31A 4NIIA 1PGL2 2C24A 3RZLA 3SH5A 4NIHA 4XW3A 2JKXA 3NMBA 3DN7A 4FT8A 2HLEA 1ENXA 2K2SA 4CCNA 5DG2A 1YQCA 1OBNA 4BQ4A 3H0OA 3AKSA 2RS52 4G4FA 2Y34A 1OLMA 1QQP3 2OX0A 1OVSA 5HXMA 1KDKA 1VMHA 3MLKA 4GH4C 2V09A 1VBD1 3PUIA 5A3NA 2E7TA 5ABJC 2FCVA 4QQLA 1S2BA 2P34A 3POJA 5CZKA 1X36A 1YQ8A 4I0WB 4LORA 3BYWA 4GWJA 4ASMB 1QQP1 2D6PA 3APBA 4JC1A 5FMOS 1KGYA 2RMU3 1QXJA 3OGSA 4F7ZA 4K1ZA 3WNPA 2LRPA 5DAPA 3KB5A 4CDQA 2FQPA 2UWBA 2J7MA 5GM0A 1OC1A 2XUEA 5F6KA 4AI8A 1KDMA 1LHUA 3DYPA 3OBTA 1EPWA 3VBUA 2DCZA 5I93A 3KCCA 5BUVA 1C57A 3WP3A 4AEKA 1UY1A 4L92A 5JXJA 4CDQC 4I0BA 5E8AA 4CDWA 1YHFA 4IEPA 1ND3C 4F83A 4UYBA 4B4RA 4R8HA 1D4VB 1ND3B 4NIGA 3O1OA 2D5FA 2C4XA 4MXVA 3S0MA 2WSUA 4MZUA 1H6YA 3PVOA 1DQ4A 2C1FA 2VD7A 2VMDA 4FOQA 4RD7A 3T0BA 2YBSA 4PLNA 2A70A 3LGRA 5FZMA 3RZMA 2AACA 3O1PA 1AR82 1W2NA 4L9BA 4DB5A 4DRVA 4DIQA 3U14A 3HBZA 4M01A 3LE0A 1DG6A 2R0FA 5LA2A 5FYBA 3I4IA 5A3OA 4Q0UA 4XUNA 2ET1A 2VE1A 2ORZA 1RUG2 3DKQA 2OS2A 1AX0A 2AREA 5KC6A 1I1EA 2XLFA 5M0TA 5FQ0A 2KD7A 3M3CA 1ZRCA 2GDFA 1SLIA 2JG9A 3UKTA 2BVVA 2A6YA 3ZFFA 4AVTA 4HANA 1CAWB 3ACLA 1TG7A 1C1FA 1W8TA 1JOJA 3CJXA 2ZGQA 2I07B 4CCEA 4CDXB 5JAXA 4BOWA 2WS92 2VVEA 5I0RA 2VQUA 3IMNA 1CGPA 3ILNA 4JKKA 1AR93 1G9FA 4OHVA 2UYBA 4X8PA 3AL5A 1W3VA 1UNBA 1VRH2 2W92A 4K6BA 3HNYM 5GLWA 3W59A 1AZDA 2WLQA 3ATGA 2QVSB 5CYYA 2XQXA 4KH9A 3FUQA 1OUSA 3VKNA 2SBAA 1O59A 1ZBE1 1BMV1 1QJX2 1OLRA 4META 4P08A 2MHFA 1PO13 1YFXA 2F6BA 4QGNA 4HLTA 3H42B 4WBBA 5T52A 2DTYA 4E8DA 4E4ZA 1NCQA 2Z42A 1IS5A 3M1HA 1COV3 3CL1A 4IETA 4YVWA 4AEMA 3O1SA 4AE2A 1N1VA 4MGTA 4D7YA 3OF1A 4YVSC 3Q8CA 1C8M1 4XFBA 4I02A 1QHDA 4BQWA 1XU1A 3GBWA 3UGGA 2PAMA 2VH9A 2DTWA 2WZR1 3OSDA 4JGYC 1RUG1 4WVWA 4CU9A 1YRZA 3MDPA 2R042 1CAVA 2FDHA 3KVAA 4OCTA 1M06G 2Q0AA 2G4IA 4R52A 3PIJA 1Q8OA 3N7KA 3O0XA 1DP0A 3D8CA 4ZU4A 3I59B 1JZ5A 1HQNA 3IM0A 3HMYA 2BW8A 1EUUA 2VQ0A 3ZFGB 4QXBA 2OKXA 3MF6A 3ZFGA 2VZOA 2WT0A 2IXKA 2XJQA 1PM4A 3O14A 4LUMA 2PA7A 4ISRA 4KMQA 5CG8A 3IZOA 2BERA 1HDKA 3FL7A 2OZJA 2R043 2WN2A 3POWA 3Q8FA 1HXS1 3KQ4B 2VNVA 4GXLA 4MXWB 5DQ0A 4UBGA 1AR72 1EAH2 4RQPA 4AEJA 4NVPA 3LSDA 4YSFA 2NPIA 1Q43A 2ZEZA 4UW4A 1HXS3 1V0AA 4CCMA 3R4SA 1TMF2 4BB3A 2WWUA 1SMVA 4Y22B 1QJEA 1DU3D 3BTXA 3NKTA 2G19A 5E16A 5HXVA 1JU4A 2HJIA 3UL2A 3RDIA 4FPJA 3TEZA 2PFWA 2IXHA 2VNRA 4CEYA 4U36A 4N7IA 3N7JA 3KGLA 3WF0A 1VBE1 1W0PA 1WCSA 3VKOA 1X9TA 4AVAA 4CU6A 4A41A 3HT1A 3VBHC 1CESA 5F6LB 3CMGA 3NJZA 3V64A 2BBVA 2BGPA 4NHKA 3U78A 5FWEA 3VDCA 5BY5A 3AZWA 4XFFA 4BK5A 1OA3A 4WVMB 4N9HA 5FP4A 5H9PA 5AFEA 4ARYA 2UWAA 2J22A 5KBFA 1KFXL 1UL9A 5ACA1 4QWNA 1RUH3 3ZFFB 3DKWA 2O1QA 3AZXA 2WA3A 1ODMA 4M0HA 3SISA 1YFWA 1JU3A 3RJRA 3G6JB 2JDMA 5FMCA 3WW1A 5K8SA 1ONAA 3LQCA 3NVCA 3CEWA 4YZ4A 4HBNA 4PCRA 4ZU7A 4L97A 3A7QA 2PMWB 4FP3A 4LHKA 3LDBA 3IDEA 3N9PA 2YGLA 3AX4A 2XJVA 4JV4A 3U37A 1D4M1 4IE0A 5C9AC 5C5TA 4BQ2A 3POYA 1AXKA 3GHNA 5DN2A 5BNPC 1NX9A 4QX8A 4BIFA 4MV2A 5FMOL 3ZSMA 4D7TA 2YC2A 1VBC3 4OYUA 4COYA 4V2VA 3B69A 4YW3A 4LMFA 2ZZJA 5T5OA 4JRAA 1WLDA 3UGHA 1GP5A 3O7OA 3TN92 4CDXC 5JLVA 1W28A 1GZ9A 4MH0E 4UFIA 4Q5OA 1VMJA 1LOBA 1AVBA 1FMD3 2W1QA 5SV5A 4NO4A 3EMRA 2H0VA 4GWMA 5T54A 2ZPXA 3J4UH 2WFF1 3MV01 4FP2A 4LT5A 3PURA 2AH2A 1S2KA 2QQJA 1RVF2 4HVRA 4XILA 4H7LA 5IYYA 1TNFA 3OPWA 1C4RA 1BZWA 2V4VA 2WT2A 3WHTA 2Y0OA 4FXKB 1DBNA 3TEYA 3FBYA 2HWF3 4GMP0 3G7DA 1NY72 1UU5A 1B35B 1S0EA 4LO4B 1XNTA 3IKWA 1W3XA 1CAUA 1TME1 5I0DA 3VDDB 2BP6A 1OD5A 2DURA 2XKOA 3E5QA 3LEGA 2XB6C 3H1MA 4Q4X2 5FK7A 5FZ7A 3O1RA 2PHLA 4ZS2A 3LSEA 3PJQA 2ZAAA 3ACFA 4MXWA 4CU7A 1MS0A 3DXUA 4RS5C 4CEWB 4OUSA 1N3PA 4BPZA 3AMPA 1GNHA 2B39A 2AEZA 3QH6A 2A73B 1YQ2A 3P3PA 5A7QA 1LGCA 2HWD2 4QHOA 5DUUA 1IZ3A 2HWE2 1Z7S3 1COV2 2NYYA 5A32A 1BLZA 2J1EA 4YWAA 3IBMA 3RFRA 3RS6A 2QQIA 4XUTA 3J7NA 2W39A 4AEDA 1TMF3 3HOBA 1C5IA 5TSWA 4FOWA 1RUC3 1ST8A 2GH8A 3UJQA 1BBT3 1HRV1 2XHKA 4Q1PA 1W90A 1E5SA 1JS9A 2VTXJ 1ASJ1 4XF1A 4IEWA 2QKDA 2KA3A 1MS8A 2EA7A 4K20A 1QJY3 5HV4A 5DDJ2 2PLV2 1VBA1 4PF5A 1GOGA 2R041 2ZGRA 1UD1A 2ZMNA 4A6OA 3N9MA 2QJVA 3VDBA 2RVAA 5FZAA 5APAA 2EVXA 1YI9A 4YZ2A 1RUC2 1IPSA 1ND2C 2WNOA 4ATEA 3MHZA 4AFBA 4PDWB 3LEKA 3BU7A 2Q5TA 4DRRA 2VOTA 4P9LA 1ZNPA 1F8VA 2A3WA 3JQWA 1YFUA 4LK6A 1O3QA 2CV6A 1FYUA 1W6NA 1PVC1 3ZYJB 1D4M2 3ZFEB 4QKBA 1HQWA 1OKQA 2E7AA 5C4WC 2TNFA 1UYPA 3SQOA 2I74A 2JECA 1PO21 3EYPA 2VG9A 4QB6A 1RUE1 5A3LA 1MVEA 1R092 3OGGA 4LKEA 5DAVA 5FUNA 1QGLA 4UW5A 3AFKA 5KHHA 2R1DA 2B4KA 3ASIA 4RYDA 3BIWE 4BQ5A 5EHDA 4QPGB 5ANQA 3NV2A 5A6XA 3WDUA 3U4SA 4HOOA 4FVVA 2EAKA 1PO23 2IXJA 2JG9B 4WM7C 4B7EA 5FZBA 2JDHA 5FPXA 1HJGA 3GDBA 3GZEA 3I2HA 3UYJA 1KITA 1X33A 3LDRA 4X8NA 4B3NA 4KWLA 2W95A 4AHXA 3OBAA 4EWDA 5EIYB 1JH5A 2XLGA 2OUHA 2K9ZA 1PZ9A 1R1A1 4QPIA 3SC7X 4NHXA 4EZ4A 1DHKB 2BUKA 2QQMA 4M3CE 4S2FA 3B02A 3PUAA 2HWD3 4IEVA 1K45A 1OT5A 3SXWA 1XXNA 4F3JA 4W4ZA 5BNOB 5JOXA 3OEBA 2HEVF 5I0UA 5BNOC 2VULA 5CFCC 2W0XA 1ZZCA 1UOJA 2XWBB 2ZHKA 3KT1A 3OYWB 2WNUB 1JZ3A 3NAPC 4MSVA 1PIV2 1D7PM 4C91A 4IV1C 3SCGA 4OHZA 3IDAA 1MZFA 5A7NA 3D0SA 1LKNA 2RR11 1UX7A 3JUUA 3NNFA 3WOGA 5D8AB 2CTVA 5IVFA 1JZ8A 4DY5A 2QQOA 1MQTA 4Q26A 1IG0A 5FZ0A 4B7KA 2A1XA 3AP7A 4IDZA 3IIAA 5HBAA 4Q27A 4XF3A 1SACA 3PUQA 2GC3A 5CIRA 2BGCA 5T5LA 4CDQB 1UZZA 1UX6A 3BALA 4ASLA 5FPVA 3EBRA 4IV3A 3NJYA 2CDOA 3N9LA 5K0UC 2ZX1A 4CUAA 1VRH3 4MLOA 3NRUA 4PBOA 1ULFA 4R9DA 4AI9A 1MZ5A 4HK9A 3MYXA 1OA2A 4PHZA 5BYNA 2YROA 1PK6C 2B9VA 3KV6A 3JD73 2IFRA 1U5XA 5EWSA 5E6HA 3MBWA 5FKBA 4P9WA 1K42A 4N53A 1PZ7A 3DPRB 5FY1A 2JENA 1Y3TA 1QQP2 1TME3 3H50A 2DV9A 4RR3A 1PX4A 3PTYA 1U0AA 2R061 3B00A 4N8MA 2DDUA 4QXHA 3WG4A 4KI5M 2CHHA 2ZJCA 4UW6A 1ZBE3 1FPN2 3LOIA 5FLIA 2YFUA 5H9RA 5B4NA 3VZMA 1WMEA 3DYOA 3IAQA 3MFAA 5GALA 4CDUA 5KWRA 3INAA 5KHIA 4K7JA 2XVKA 1QH6A 3IDBB 1XB9A 4RA0A 2VCBA 4XAAA 4XXAA 2JEMA 1W6PB 1BHGA 1IGOA 2L9LA 2LS6A 4R9BA 1AUYA 2ZX2A 1CZSA 3RMYA 2W52A 2D7FA 1WUVA 1JYTA 2WLPA 3ES4A 3T1MA 2XVLA 3WSOA 3NQHA 1K5MC 1N3OA 1JUIA 1W2TA 2Z5WA 3EXUA 4J25A 1RITA 1SLBA 4P5YA 2YYOA 3BGAA 4NPRA 2G9ZA 2QQNA 2Y33A 3ON7A 3CQOA 1WA6X 3SCHA 1WMXA 2HWE1 4O61A 3MIHA 2VQAA 5T55A 5KXEA 1ZZ9A 4R4ZA 2ZEWA 3KHCA 3IPVB 4A4AA 3D6EA 3BOWA 3ACIA 4LXLA 5LA9A 1N1SA 4MGKE 5F8PA 1MQTB 1LHWA 1MEC2 3AM2A 3N35A 4W6XA 1JHNA 2E9QA 2Y26A 2WZPP 2QBXA 3DYMA 1W04A 2JDAA 1L3JA 1B35C 4J6GA 5FP3A 1TZOA 1RUNA 2YPDA 1IPJA 1O3RA 2W3JA 3LFIA 2GP3A 4UF0A 4M3CF 4NUBA 5J96B 5GZFA 1CPMA 3C7FA 3ZYIB 1T6GC 2CGPA 1ULGA 1FV3A 2IWGB 1OQEA 4QXCA 1JHJA 1RHI1 2QQWA 4XABA 4JGZB 4E4DX 3MPBA 1RUC1 5BNOA 4O65A 1E5RA 3VBFA 2R16A 1NCRA 2PHRA 3LCPA 1BBT1 1HRV3 2RS32 4P9XA 3V0AB 2DCYA 3S57A 3QD6A 3T30A 3T1LA 1VBA2 1AL22 1RUE3 1SDWA 1W2AX 2R073 3AKQA 2WYSA 3OBRA 4L99A 5GLTA 1QOTA 3MICA 3VZOA 4M4PA 4OUMA 1LU2A 2C6SA 2PHDA 2WFF2 4UFJA 5A3MA 1FX5A 1G9BA 1H0BA 1SBEA 1ASJ2 4HSLA 3TAYA 4AFDA 3J7LA 4Q4V1 1EAH1 4A44A 4YZ1A 2DFCA 4ZZ8A 4NIDA 1GKBA 2NQYA 3JB8A 3HIFA 1PO22 4XHBA 4QDRA 1AR92 1AR61 5FZ1A 1DFQA 2YFZA 4CSWA 4QPGA 4XC9A 3WW4A 2HYXA 2VZ3A 2UY8A 2ZGSA 1GQGA 1RUH1 1PVXA 1VPHA 4QX1A 2Z69A 2PN5A 1PO12 5EJ3A 1F4AA 4Q29A 3VBSC 5C5UA 5KHKA 2W9XA 4AVSA 4CCKA 1XE7A 3DUIA 2Y38A 3WUDA 5FOBB 5J1XA 4IE7A 1VBD2 3O5SA 1CR7A 1W6NB 3W5MA 5LASA 1DGLA 3POBA 4URTA 1HB2A 2V72A 5I8SA 3VZJA 2PLV1 2ETEA 1EY2A 3IPVA 4Q0VA 5A7WB 1X82A 1GP4A 5LCWL 4NHYA 4IQPA 3SITA 1ENRA 3OCPA 2W2IA 2WAAA 3C3VA 1KD7A 4CP1A 4MYEA 1POV0 1RJ8A 3M4FA 1SPPB 5F5IA 1C8NA 2JDKA 1BEV3 3I97A 3QH7A 3WCSA 4GQ7A 1AXZA 2IVJA 1W06A 1W6OA 3WG2A 1GWLA 1JUHA 1UKGA 2A6XA 2BV4A 2JDZA 2ZX0A 3KD4A 1H4HA 2WNVA 3ZR5A 3ORJA 2RE9A 1QJX1 2RV9A 4BZ4A 2BFUS 5JUVA 1S0IA 2ADDA 5J48A 1DZRA 1VRH1 2VUCA 3UGFA 4AI1A 3ZSEA 1SLCA 4XCBA 3WDWA 1ULCA 1ZA7A 2HWB1 4ZXEA 5LATA 1H1AA 4N43C 3AC0A 1TQ5A 3T2OA 2VXRA 3OY8B 2XLAA 1Y9GA 3BVCA 2VTFA 4OZOA 1QU0A 2HWF1 4XXPA 3F95A 5E88A 1VAKA 5KXBA 2RR13 4XPVA 4PBPA 4CCCA 2YBKA 2XMLA 1OOPC 4OHWA 3A0KA 2R063 1XSQA 4LHNA 3CJIB 2F4PA 1SZBA 2EXKA 2WL1A 4K8RB 4C8DA 4Y1ZA 3CJIC 3IDCB 2WN3A 3IB3A 1NY71 1CJDA 1CAXA 2DU1A 2HKXA 4G9SB 4BM8A 2CGNA 4K3UA 4GH4B 1S0GA 3MW3A 2UY9A 4XVHA 3TB0A 3R0RA 3WG3A 4ZZ5A 1H9WA 4ES9A 3VDDA 1LNSA 3TRSB 2RDRA 1E5HA 3ETPA 1CVNA 2GMEA 4Q0SA 3UV9A 3NL1A 1NQDA 2A75A 3AYDA 3ALQA 4QGMA 5FO7B 2D5HA 4ATFA 5LEKA 3BTYA 1LOEA 3IMMA 5L73A 2XUMA 3JCIA 2WJSA 3GXUA 3A4UA 4COVA 2Q8EA 1YI7A 4YM1A 2EF6A 2JXAA 3H3ZA 5GLZA 1XQNA 1AHSA 4YARA 2WBKA 1JMUB 3MIBA 1NA1A 4NHLA 3KMHA 2IUWA 1E57A 2WQ8A 1ACCA 4RHV2 4XIOA 2D6KA 5B4XA 3T2PA 4E8CA 2DBNA 3K3OA 3GCXA 2BBAA 4LKSA 4MOAA 5DAXA 3VD7A 5CAZA 5DZFA 3HNBM 4N9IA 1QJY1 1W9YA 2D3RA 2WNUA 4HT1T 3VDDC 4IUGA 3T3YA 3GZAA 5FZ6A 2RM22 3RI9A 4KGGA 4UFLA 3I3MA 4COZA 4Q8KA 4HG6B 3TOJA 2WRAA 4DXZA 1TMF1
chains in the Genus database with same CATH topology
2VUDA 1OXCA 5A6QA 2JDUA 1OUSA 5A6XA 5A70A 2JDKA 2JDHA 1W8HA 3DCQA 2JDNA 2BOJA 2JDMA 2BV4A 2WR9A 4UT5A 2BP6A 2JDYA 5HCHA 2VUCA 4AOCA 1UZVA 2VNVA 1OURA 1UQXA 5A6YA 2BOIA 5A3OA 2WRAA 1OVSA 1W8FA 1OVPA 3ZDVA 2JDPA 5A6ZA 1OUXA 5D2AA 4CE8A 2XR4A 1GZTA 2CHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  1OXC A;  5A6Q A;  2JDU A;  1OUS A;  5A6X A;  5A70 A;  2JDK A;  2JDH A;  1W8H A;  3DCQ A;  2JDN A;  2BOJ A;  2JDM A;  2BV4 A;  2WR9 A;  4UT5 A;  2BP6 A;  2JDY A;  5HCH A;  2VUC A;  4AOC A;  1UZV A;  2VNV A;  1OUR A;  1UQX A;  5A6Y A;  2BOI A;  5A3O A;  2WRA A;  1OVS A;  1W8F A;  1OVP A;  3ZDV A;  2JDP A;  5A6Z A;  1OUX A;  5D2A A;  4CE8 A;  2XR4 A;  1GZT A;  2CHH A; 
#chains in the Genus database with same CATH topology
 1MS1 A;  2J1V A;  4AI3 A;  1O4Z A;  3WNM A;  5BNQ A;  4YYO A;  4XMA A;  4PQ9 A;  5DXD A;  4O9G A;  4E9K A;  4XDO A;  5DAW A;  3DEC A;  3WR0 A;  1HB4 A;  1NLS A;  4QD2 A;  1J1L A;  3VKM A;  4LO6 B;  3WQ7 A;  4LKF A;  3H3U A;  4N43 A;  1J3Q A;  2AC1 A;  2R07 1;  4OLL A;  4FPG A;  1PIV 3;  1UQX A;  3KT4 A;  1LOF C;  2XJR A;  4CXX A;  5FR3 A;  2BNO A;  1NKG A;  2ZCW A;  4BMB A;  1YIP A;  1YFY A;  2JDP A;  4XJU A;  2DCK A;  4AHZ A;  5E1R A;  2Q4S A;  2TEP A;  2WNV C;  1YO8 A;  3D82 A;  2VJX A;  4DFS A;  1ZRF A;  5F5A A;  5FZ3 A;  1WW4 A;  4GB3 1;  1WW7 A;  4LBQ D;  1FT9 A;  2ZEY A;  1AYM 1;  5T50 A;  3VBR C;  5JMO A;  5L19 A;  2UWC A;  3H8O A;  1SPP A;  1XNA A;  4W6W A;  1W2U A;  3FBM A;  4HPK A;  1O91 A;  1V6J A;  2XJS A;  2K46 A;  2D6M A;  1QEX A;  5JZG C;  1J83 A;  1IOA A;  2JJ6 A;  4IEY A;  4OMD A;  2RS1 2;  2YDE A;  4ASK A;  1DYO A;  5LY1 A;  5LZ6 A;  4FSJ A;  2D6O X;  5J37 A;  5AVP A;  2BNN A;  2Q1M A;  5CU1 A;  1JOD A;  5BNN C;  1GNY A;  2E33 A;  4H14 A;  1S1A A;  1OF4 A;  1V6O A;  2DYC A;  1UWW A;  1WMF A;  1DQ2 A;  1OKO A;  1SLL A;  2XJU A;  4MAD A;  5IVE A;  5JDB A;  1HXS 2;  4HPK B;  3VBS A;  1I5Z A;  3MIF A;  4AWD A;  5ERL A;  1LHV A;  3NV4 A;  4FFG A;  1UXZ A;  3TNQ A;  1VBB 3;  2CWS A;  1ZVF A;  2XJP A;  4AL9 A;  2RR1 2;  2QDN A;  4KL1 A;  3Q9O A;  2GNB A;  1Y7B A;  3KT7 A;  3PME A;  4QPW A;  1FI2 A;  2Y6G A;  5LRS A;  2EIC A;  3AP6 A;  4S2H A;  3VD5 A;  1Q3E A;  2ES3 A;  4B8E A;  4AK3 A;  1VBE 3;  1VRB A;  4COW A;  2RM2 1;  4N43 B;  4MO3 M;  1ENQ A;  3RSJ A;  5AC9 3;  5A1L A;  1G8W A;  5JIA A;  5FOJ B;  1Z78 A;  4CUC A;  2AEY A;  3SH4 A;  1OXC A;  4I30 A;  1JN2 P;  5DDJ 3;  5L7O B;  4B1L A;  4O7X A;  4XUO A;  1NCR C;  3ZX7 A;  5A3U A;  5A7S A;  2ZHN A;  1CIY A;  2VC9 A;  2WYF A;  4I0A A;  5JI9 A;  1JZ4 A;  4MGY E;  4D8M A;  5FDB A;  1R1A 2;  4JGZ A;  4QPY A;  3IAP A;  5ABJ B;  5LBC A;  3ZOI A;  2FBE A;  4BME A;  3DF0 A;  4E4H A;  3WW3 A;  2JD4 A;  2ZKL A;  5LBF A;  1NOV A;  4YVW B;  1OUR A;  4EWA A;  2VZT A;  2AZ5 A;  5DUW A;  4NPM A;  1B35 A;  2JIJ A;  2ENR A;  4LLO A;  4QU2 A;  3VBO B;  3H8U A;  4BE3 A;  2FDI A;  3FC0 A;  4AXO A;  1D4M 3;  1BEV 1;  3VBO C;  2FHR A;  4C90 A;  2ZX3 A;  5A3W A;  4OQ9 A;  5CAD A;  1GZT A;  4E2S A;  2ZX4 A;  5F39 A;  3TBD A;  3AMN A;  5FFO C;  2ET7 A;  2VGD A;  3RGB A;  4LO5 B;  4TSV A;  2YC4 A;  4FBF A;  5CFD C;  1L7R A;  3TEX A;  1L7L A;  1R09 1;  2QE3 A;  4F8A A;  1NLR A;  4WZF A;  2RMU 2;  5C8W A;  1RUF 3;  3ZKY A;  1AF9 A;  4UAP A;  3J8F 3;  4CCL A;  1I3H A;  1WWY A;  1ZZ6 A;  1AR8 3;  4XE9 A;  4XDP A;  4Q4V 2;  1XOY A;  5I8T A;  3PIG A;  2JE9 A;  2HEY F;  2Q1Z B;  1PK6 B;  3L9J T;  3UET A;  3RJ2 X;  1QJU 3;  2XQR A;  5FXZ A;  1UU4 A;  4W65 A;  1CAW A;  4JQR A;  4R4X A;  1XE8 A;  2HWF 2;  4KU7 A;  2Y6L A;  3V65 A;  4M4R A;  3RPQ A;  2RJL A;  2Q8C A;  4YGE A;  5FQ0 B;  3U0Z A;  5CB7 A;  4YG0 A;  1ZRE A;  4MX3 A;  1L7Q A;  4HKO A;  2Z4F A;  4WV8 A;  4LBQ B;  5C8C A;  4QB1 A;  1VBB 2;  3AZZ A;  4UI9 L;  2NZ9 A;  2XBO 1;  2E53 A;  4GA9 A;  4LK7 A;  4RFT 0;  2NP0 A;  4H2A A;  2QDR A;  3MO4 A;  1I5P A;  1RXF A;  1X9P A;  4XF4 A;  3QBQ A;  1LRH A;  4W50 A;  3SEE A;  5CNA A;  4RR3 C;  5F3E A;  3S6P A;  3WF4 A;  5JPM B;  3S7E A;  3TN9 3;  5EP9 A;  3AVS A;  1UY3 A;  2VME A;  2JB8 A;  1NUK A;  1QH7 A;  2XBO 3;  3WNX A;  4CXW A;  5A6Y A;  1K12 A;  2DVA A;  1JYC A;  2OPK A;  3USU A;  2DCT A;  3WY6 A;  2VVD A;  3MFC A;  4AGR A;  3HAG A;  3ZMO A;  2X29 A;  1YWK A;  1HW5 A;  4WVM A;  1DYP A;  3S7I A;  4UFK A;  1F2N A;  3PVN A;  4XDQ A;  1COV 1;  3DV8 A;  3THD A;  3WVJ A;  4QQH A;  4IXL A;  4NE9 A;  3BN6 A;  3ZN6 A;  5FWJ A;  5DPN A;  1CWP A;  2ZA9 A;  2VMG A;  3BPZ A;  1UZW A;  3GZU C;  1J1T A;  4LOS A;  4QKD A;  4GUL A;  4UW3 A;  2WO7 A;  3UES A;  2Y6K A;  1F5F A;  2B7Y A;  4Y24 A;  3PL0 A;  3O1T A;  1U5I A;  2BFU L;  5FP9 A;  1DGR A;  3I3E A;  1U12 A;  4CEY B;  1X50 A;  1LGB A;  1GP6 A;  3AL6 A;  4LBM A;  2VR4 A;  4JZR A;  3UKN A;  3W5N A;  1AR9 1;  4K21 A;  2HWC 1;  3MEP A;  3CBN A;  3I3B A;  4D69 A;  1GNZ A;  5EZW A;  1QJF A;  3KCX A;  3UKV A;  2R0H A;  1JYX A;  4RSU A;  4XJ8 A;  3ZYP A;  4IV1 A;  2JX9 A;  1RVF 1;  3NAP A;  1OH3 A;  5FYH A;  5AC9 2;  4GMP 3;  1N1T A;  2FCU A;  5CFC A;  4YGC A;  3HD8 B;  3ZSL A;  3OYW A;  3FLR A;  4Z82 A;  1S55 A;  3VDA A;  3W21 A;  4AVC A;  3CF6 E;  3WDV A;  3S30 A;  5C3P A;  1ZRR A;  5FY5 A;  4E2Q A;  1OLM E;  3D0J A;  4FFI A;  1RMU 1;  4YW5 A;  2X09 A;  1DF0 A;  1DGR N;  4QPI C;  4QQ2 A;  1C28 A;  1WZX A;  5FLJ A;  3HQX A;  3RG0 A;  1PVC 3;  2WC2 A;  5HV0 A;  1M4W A;  3FHA A;  4PF1 A;  2YUE A;  2XWJ B;  5I8Y A;  2F17 A;  1S0J A;  5A3T A;  1XRU A;  5JR2 A;  1W2O A;  3KF3 A;  5FYV A;  4FFH A;  2CDP A;  5F5Q A;  5FYC A;  1DQ5 A;  3ZR6 A;  1HN0 A;  3POF A;  4Q4W 1;  1O8S A;  3N36 A;  4A7K A;  4KU8 A;  3CIH A;  3HBK A;  5L7O C;  1DYK A;  5FP7 A;  1BJQ A;  2ZHM A;  5LB6 A;  3HVD A;  4RGG A;  2AR6 A;  1OA4 A;  4LLF A;  3J26 N;  1J58 A;  2X5I C;  1W6Q B;  2P3Y A;  2X10 A;  3OOX A;  5K4L A;  3BCW A;  3UJO A;  4BDV B;  4KG0 A;  2SLI A;  5FY4 A;  1SEF A;  1SLT A;  5C4W A;  1K3I A;  4RHV 3;  1UYX A;  2C5D A;  5F3I A;  5JZG B;  4XFH A;  5GLU A;  2R6Q A;  1NZC A;  2J1U A;  4MGS A;  5FXV A;  5ACA 2;  1EP0 A;  3JD7 2;  2OUJ A;  3ES1 A;  4QKF A;  1EV1 1;  3ZVX A;  2DUO A;  3M8L A;  3I2O A;  3FHI B;  1REE A;  4XTP A;  4RL7 A;  1ND2 A;  4GAZ A;  4HZF A;  1DDL A;  4FOY A;  3VZK A;  4IGQ A;  5T3N A;  1O3T A;  2VMH A;  3GZT B;  4P9G A;  5C4W B;  1T2X A;  3KGZ A;  5JSR A;  2TBV A;  3MGU A;  3NNL A;  1SBD A;  1GUI A;  4PI0 A;  3AKT A;  4RFR B;  4YVS B;  2W68 A;  1JZ7 A;  4P9Y A;  4P00 B;  4DEV A;  4V1P A;  4KG8 A;  2WQZ C;  3NW4 A;  2XDV A;  2HBU A;  1PMH X;  1VBC 1;  2D43 A;  3BOP A;  5FZ9 A;  4YNI A;  1AJK A;  3OJB A;  4M3C A;  1RUJ 3;  3KWV A;  4XTM A;  3ILF A;  1EUT A;  3KF5 A;  4MGZ E;  2BRT A;  2GAL A;  3JBG 1;  4GAL A;  1MAC A;  5JVV A;  4FFF A;  2DCJ A;  1DCS A;  3VHR A;  1UYZ A;  3I54 A;  1XSR A;  2G1M A;  1W9S A;  2VXJ A;  4CVU A;  3JBG 3;  2I2S A;  3LA2 A;  2XKP A;  2LRO A;  5A32 B;  3B01 A;  4BJ0 A;  1ZBA 3;  3SEP A;  2ZGN A;  1OOP B;  4I09 A;  1CJP A;  1JYW A;  3KSC A;  1F15 A;  4Q4X 1;  4E2G A;  3MID A;  5JOZ A;  4Y1V A;  1GLH A;  1H2K A;  2G9F A;  3E1F 1;  2HWC 2;  4NWW A;  5T5P A;  4CEW A;  1BVV A;  3PTR B;  2QQP A;  4L0P A;  2E6V A;  5FZE A;  1JOB A;  4JTN A;  2AUY A;  2W1W A;  2VQT A;  1V6I A;  1GOH A;  3BPS A;  3CO2 A;  5D1I A;  4Q4Y 1;  3RYP A;  1TE1 B;  2XG3 A;  3OG2 A;  1RUF 1;  3NAP B;  1FPN 1;  4PLM A;  4BLI A;  2ARC A;  4IEQ A;  3OD4 A;  5L36 A;  3NNM A;  4CDW B;  2Y6J A;  1NE6 A;  4UBH A;  1CN1 A;  2NN8 A;  2WUH A;  5D8A C;  4YW1 A;  3VZL A;  3SH3 A;  3HT2 A;  1UAI A;  3H7Y A;  4HKL A;  3TEW A;  4K8F A;  2VBD A;  2XHN A;  2Q8O A;  5CKN A;  5KR7 A;  1JOP A;  1PIV 1;  2CWM A;  4ISQ A;  3J9S A;  4OI0 A;  3GJB A;  1UPI A;  3AKR A;  4AAX A;  2CAV A;  4NWV A;  2EIB A;  4RN5 A;  5IK7 A;  3KHB A;  5D8A A;  2N7G A;  4BA6 A;  5IAV A;  2VMC A;  3WW2 A;  2P5B A;  3VGI A;  3T0D A;  1MR5 A;  3ZN6 B;  1C8M 3;  4BXF A;  1I6X A;  1HRI 2;  2RS1 3;  2VW2 A;  3AMQ A;  2W87 A;  5A6Q A;  5FO8 B;  1X8M A;  3L2Y A;  1VBB 1;  1RUG 3;  2OVU A;  3M3O A;  4WM8 B;  2DVB A;  3FFQ A;  3I3Q A;  5FMD A;  3SHR A;  5LBE A;  3BIE A;  2BDR A;  2G9G A;  1RHI 3;  5C71 A;  2JE8 A;  3BKZ A;  2WO1 A;  1UPS A;  1VAL A;  4CEW C;  2ZAC A;  1W6M B;  2VAU A;  1PHM A;  3J7H A;  3FN9 A;  3F2Z A;  4LBJ A;  2VBB A;  4CYD A;  5FK8 A;  4L11 A;  1LJ7 A;  5C9A A;  5DUV A;  1YJK A;  4Z1V A;  2A7A A;  1UMI A;  2RM2 3;  4QX5 A;  2WS9 1;  4NIA A;  4D7S A;  4YM0 A;  2VL4 A;  5CKQ A;  5FY9 A;  5I91 A;  1RUH 2;  2ZTN A;  2AGS A;  4JCK A;  4GIQ A;  1AX2 A;  5JR7 B;  3RWN A;  2R32 A;  1FMD 2;  2CL2 A;  2PHX A;  2Q30 A;  3CU7 A;  3I8T A;  5FZG A;  4TTG A;  4AW7 A;  2RMU 1;  1V9U 3;  5EFU A;  5K7P A;  1DQ1 A;  1DLL A;  4M3C B;  4SBV A;  2VZQ A;  4QKN A;  3MW2 A;  1SCS A;  5F3C A;  2ZGP A;  4YG3 A;  3HWJ A;  1A3K A;  4NMI A;  1VP6 A;  1RIN A;  1KEX A;  3NJX A;  3ZYH A;  4PI2 A;  4YW7 A;  2PAE A;  1GV9 A;  5FJH A;  1SHW B;  1EYB A;  5IT6 A;  2VZV A;  4LBL A;  4QX3 A;  1D0G A;  3MUY 1;  3I2D A;  1T6B X;  5C7G A;  1SFP A;  2BZD A;  4O9E A;  5JSP A;  5FIX A;  1N3Q A;  1ZX5 A;  2D6L X;  2LM3 A;  1FAY A;  2B5H A;  2XL7 A;  4CRQ A;  3RI8 A;  1GQP A;  5DDJ 1;  2O8O A;  1NAE A;  1GZC A;  5E89 A;  1NLQ A;  5SV8 A;  3MPP G;  4EWE A;  2FZ2 A;  1RTV A;  1FNZ A;  5FZ4 A;  2FD8 A;  3POG A;  4Y4Y A;  1GIC A;  2WSV A;  4P9J A;  1QJZ A;  2IXL A;  4XJ9 A;  1GQH A;  4Y1X A;  3LWC A;  4HSJ A;  1XBF A;  2EXJ A;  2ZGT A;  5K9Y A;  2PQS A;  4FTS A;  4FPY A;  1W6Q A;  1QNY A;  4OFG A;  1LEC A;  3AP9 A;  1H1M A;  4FPE A;  2X5I A;  5FPB A;  4UFH A;  3P6B A;  3R4U A;  2RS5 3;  1HB1 A;  2X53 S;  1VB4 A;  5L7O A;  3P1I A;  1IS3 A;  1RUD 3;  1S0F A;  2A5Z A;  4P9I A;  5DG1 A;  5IWF A;  3MLJ A;  4LQR A;  4AED B;  3ZFG C;  2R7E B;  2RDS A;  5JPN B;  1HIX A;  4Z07 A;  4OMC A;  3LZZ A;  3T0A A;  4BQX A;  2OZ6 A;  2VZP A;  4JX0 A;  3NO8 A;  4YGB A;  3T4V A;  4LIU A;  4HN1 A;  5JXI A;  1DZQ A;  1RUD 1;  3TWI A;  4J1W A;  3I59 A;  1MZ6 A;  1E5I A;  1XND A;  3HNM A;  4GZ9 A;  1HKD A;  1A6C A;  4AQT A;  4JGY A;  1RYY A;  3OPZ A;  5IVB A;  3ITQ A;  4JHZ A;  4ZXK A;  3ZMN A;  4CA9 A;  4NRO A;  5H9Q A;  4FTB A;  4FOV A;  5F3G A;  3ELN A;  1GR3 A;  4R9C A;  1O7F A;  2DUQ A;  2QUO A;  3HQU A;  4P14 A;  5FZK A;  4FQ4 A;  5LA1 A;  3WT3 A;  1UIK A;  2KXL A;  3HPN A;  4IV1 B;  1RB8 G;  2C26 A;  3K75 B;  1NZI A;  3GHM A;  2HWD 1;  4QHB A;  4DUX A;  2NMN A;  3H1Y A;  2KR2 A;  2YU2 A;  3OEA A;  1W8Z A;  3LA3 A;  3AMH A;  2QQK A;  5CBL A;  1SQ4 A;  1LUL A;  4IND A;  5DAB A;  1QOS A;  1FOD 1;  3N9Q A;  5FZC A;  1H4G A;  4Q1R A;  3TN9 1;  3WF1 A;  2BWC A;  3EJK A;  1SBF A;  3ZYG A;  4ZS3 A;  3I2K A;  4AVV A;  4DMI A;  3LD8 A;  4NPL A;  4TLG A;  5CVR A;  3WD5 A;  1H6X A;  4ITC A;  2WZR 3;  4Y20 B;  5HCF A;  3C8X A;  1LHO A;  3RYK A;  1KJL A;  3KVB A;  3OTF A;  2GH2 A;  1JYN A;  4Q4W 2;  3SMH A;  4BU2 A;  4YG6 A;  1ASJ 3;  2XL9 A;  3NV1 A;  5BXX A;  4QHZ A;  1MEC 3;  3ZIX A;  4LBN A;  5A3P A;  1Q8Q A;  1GAN A;  1W8O A;  1AYN 3;  2E51 A;  2JG9 C;  2PHF A;  4JDM A;  4MVT A;  5GJ6 A;  3WV6 A;  5A1A A;  1MPX A;  1HX6 A;  5FY7 A;  2P3J A;  1OHF A;  4CTE A;  4QDQ A;  1XNC A;  1QF3 A;  5GZD A;  2CAU A;  1QKQ A;  3D3A A;  4S2D A;  1URX A;  3K77 A;  1C8M 2;  5GLV A;  3III A;  1LES A;  2VY0 A;  3ZN4 A;  4H3W A;  1RGS A;  3EB7 A;  4KGQ A;  4IEX A;  1XE0 A;  3VHO A;  2AEN A;  3ZN5 A;  5C8C B;  4Z2W A;  3OUJ A;  4FPO B;  5F2W A;  5C8C C;  4EE2 A;  2RJK A;  1ZM1 A;  1WD3 A;  2JIG A;  1IHM A;  3DGT A;  2VW0 A;  2YC0 A;  2EAL A;  5GZC A;  3ACH A;  2H0B A;  4H55 A;  1Y43 B;  3IN9 A;  5CIS A;  1MEC 1;  3AJY A;  2DU0 A;  1UY4 A;  1MZE A;  1UOB A;  2OXB A;  4EN6 B;  2WAB A;  3GM8 A;  4HFS A;  4A3Z A;  5FUP A;  2QZ3 A;  2ZZQ A;  2WWS A;  4XEZ A;  2R49 A;  1ND3 A;  2GU9 A;  3ZYF A;  2D3S A;  4LTA A;  2VZU A;  4CDW C;  3GBF A;  2E31 A;  5FZO B;  5DAQ A;  2Q8D A;  5LBB A;  1SCR A;  5F9T A;  1QJU 2;  1KJR A;  1RJ7 A;  4NRP A;  1VAV A;  3WNL A;  3VBU C;  2FDF A;  2P17 A;  4ARX A;  4CE8 A;  2A6V A;  4PT6 A;  5CFD A;  2XR4 A;  2VOV A;  5EYY A;  2VVF A;  4JHT A;  4QQP A;  2ARA A;  3THC A;  1GYK A;  1AR7 1;  1RUO A;  3ZKU A;  3VD4 A;  3WZ1 A;  4Y22 A;  2C0Z A;  1D2Q A;  1HN1 A;  1YUD A;  3RRD A;  4AG4 A;  5K0U B;  1UO9 A;  2CNA A;  3LIH A;  4GB3 3;  3VBO A;  1XYP A;  3VD3 A;  2WR9 A;  3ZXA C;  2WA4 A;  4DXT A;  5ABJ A;  3JZV A;  4MG2 A;  3PU3 A;  4RQP B;  4GH4 A;  4RHV 1;  4Y26 A;  3VN4 A;  1RUI 3;  2NMO A;  4RS5 B;  1CAX B;  4JGZ C;  1VB2 A;  3LEI A;  4EN9 B;  2Q1F A;  3N4M A;  2KM2 A;  1G7Y A;  1SFN A;  1OVP A;  2ARB A;  4XOG A;  3WG1 A;  3WNN A;  4GJZ A;  4OI2 A;  2VOX A;  4KQ7 A;  4AFA A;  2RDN A;  1WCK A;  5IVV A;  4EN8 B;  3AXE A;  1H1I A;  1W9T A;  4BCU A;  1R1A 3;  2GP5 A;  4XUP A;  3GAL A;  2ZGL A;  2OII A;  1ZZ8 A;  1XYN A;  1UMZ A;  3R6S A;  1AR7 3;  1Q8S A;  3NST A;  5AC9 1;  2C9K A;  4DIN B;  1AL0 G;  3B94 A;  1WBF A;  3FWE A;  1ZA4 A;  4XZP A;  3N7L A;  4XAE A;  1CAV B;  1I9R A;  1R08 2;  3AFG A;  4Y1Y A;  5EPA A;  1HB3 A;  3M70 A;  3B9C A;  5FZD A;  2GMP A;  5A33 A;  1S0B A;  4ZU5 A;  1HV0 A;  2JD9 A;  1TNR A;  4EQV A;  5EQU A;  3GNE A;  2FDG A;  4QB2 A;  4PJY A;  1DGW A;  1MS4 A;  3FMG A;  3WNK A;  4A7Z A;  1YJL A;  2W1S A;  4AGV A;  4YW4 A;  4FPL A;  3NWK A;  4IGP A;  1NCQ B;  1AR6 3;  2H6C A;  3M3E A;  2WO2 A;  4C1X A;  4PDW C;  1TEI A;  3FHQ A;  3NJV A;  1G9A A;  1ND2 B;  2Z79 A;  4M00 A;  5GZE A;  4TLF A;  3B5L B;  4HXC A;  1UMH A;  4FI9 A;  2JDN A;  5BNN A;  4CCJ A;  1WLT A;  2RS5 1;  2JDY A;  4AQ6 A;  2W1U A;  5HPO A;  2GSY A;  4W8J A;  1UY2 A;  5KXC A;  4EYU A;  4MHU A;  4A6S A;  1QDO A;  5JZG A;  1AX1 A;  2LTN A;  3U07 A;  4EV0 A;  3P5B A;  2BQP A;  5KHJ A;  2WZE A;  1XYO A;  1JZ6 A;  2JIC A;  1F9K A;  2OT7 A;  3KV5 A;  4XYX A;  3VBR A;  2ZAH A;  1UU6 A;  1ZBE 2;  4UT5 A;  1JI6 A;  1IKQ A;  2QNK A;  2XXZ A;  3ZPO A;  3ENR A;  1P8J A;  1LEM A;  1XJA A;  4CCO A;  1IS4 A;  3GJA A;  4BQ3 A;  4CZS A;  2XOM A;  4XUR A;  1UZY A;  2ZKN A;  4GB3 2;  4K1Y A;  4LEJ A;  1US3 A;  3RQ0 A;  2WII B;  3WIN E;  2BEO A;  2XH6 A;  2XON A;  4XQ4 A;  2P6H A;  1LOF A;  1V9U 2;  2PXJ A;  1G6N A;  3B9I A;  5IUQ A;  2WZ8 A;  1HRI 3;  2XJT A;  4Y5T A;  5J09 A;  1NE4 A;  5JIU A;  3RZZ A;  4A42 A;  4TWT A;  3A21 A;  5JCT A;  3H8X A;  3ME2 A;  2EAA A;  3MF9 A;  4OUE A;  4QX7 A;  4C0B A;  4BXS V;  5JMC A;  1Z7S 1;  3MV1 1;  1W8F A;  3WF3 A;  1LB2 A;  2V73 A;  4QU1 A;  1W0N A;  4DQA A;  1SLA A;  3AP5 A;  3POS A;  4GKY A;  4XFC A;  4EZH A;  3V0A A;  1W6M A;  4LE4 A;  3T2Q A;  4EN0 A;  4LR4 A;  1PX3 A;  2WDB A;  2W94 A;  3C7G A;  3BTA A;  3LB9 A;  5IFP A;  3VD9 A;  1CPN A;  1OFN A;  2CSG A;  2VUJ A;  4M0N A;  5J3U A;  3OUH A;  5FZF A;  1R64 A;  3VHN A;  3SKV A;  2BGO A;  4WM8 A;  3DL3 A;  4U2A A;  3K3N A;  3VL8 A;  3ZYB A;  1J59 A;  3ZXE A;  5IAX A;  2RDQ A;  4IEO A;  2WNU C;  1LR5 A;  2CY6 A;  2O0O A;  2ADE A;  1O4T A;  3AYA A;  4FPK A;  3PHM A;  5FYI A;  4CPB D;  1R08 3;  3H1W A;  2FMY A;  4LO7 A;  2GMM A;  1D0H A;  2EIE A;  2WQ4 A;  3WDT A;  2VZR A;  2ZGU A;  3N9N A;  4XFA A;  1UXX X;  2BU9 A;  2R1B A;  2D44 A;  4ORF A;  5IW0 A;  2Y8K A;  3PUH A;  2NM1 A;  5EJZ B;  3VBU B;  1WKY A;  1US2 A;  1NA1 C;  4X6R B;  3ZXK A;  3UNP A;  3H8R A;  3MLL A;  3U75 A;  1W99 A;  3ILR A;  5IVJ A;  2ID4 A;  4GJY A;  1H30 A;  2DWR A;  5AFB A;  5FBZ A;  4D3W A;  4XZU G;  4DPN A;  1RUJ 2;  2JKB A;  3E6D A;  2F4L A;  4AI2 A;  2DVG A;  4Q0P A;  1JBC A;  4BH9 A;  5FRA A;  1CD3 G;  4JDO A;  4GWN A;  4DS0 A;  1W8H A;  1WCD J;  1REF A;  3O0W A;  4BIS A;  1DIW A;  4D6Q A;  1NG0 A;  4LE3 A;  4HET A;  2GND A;  4URA A;  3BUC A;  4FPH A;  4ES8 A;  3WQB A;  5FUI A;  1H9P A;  1QMJ A;  3AKP A;  5FP8 A;  4XF0 A;  1H2L A;  3LA7 A;  3V0B A;  3ZM8 A;  5FO9 B;  4YLZ A;  5FMB A;  4ZKT B;  3CJI A;  1XU2 A;  3AK0 A;  2P3K A;  1YQ6 A;  4NJ4 A;  1AJO A;  1YIF A;  2A71 A;  3RWK X;  1HV1 A;  1WCU A;  2HWC 3;  2YXS A;  1WCQ A;  5FAX A;  4CUG A;  1OOP A;  1FXZ A;  2FDJ A;  2J1R A;  4AVB A;  1PGW 1;  2JE7 A;  3LFM A;  4UWD A;  4WVV A;  3VB9 A;  2FMD A;  2E32 A;  1ZRI A;  2VU9 A;  4JTO A;  1LCL A;  2PLV 3;  3OY8 A;  4P02 B;  1GMM A;  4QM8 A;  3O1V A;  1HLC A;  1ULO A;  4LBQ A;  5FYY A;  2PTM A;  2WIN B;  3ZLI A;  2FDK A;  4ERO A;  1LU1 A;  2BOJ A;  2OQ6 A;  2QQV A;  3RVH A;  4BLJ A;  5ACA 3;  2WFF 3;  4AOC A;  3AYE A;  3JXS A;  2HWB 2;  3LPF A;  5EYX A;  3R05 A;  1W6O B;  5F7U A;  3VKL A;  1GWK A;  4XBQ A;  5T5J A;  3FJS A;  2DFB A;  2PEL A;  4DUW A;  1QJX 3;  3I2F A;  3ECQ A;  1RMU 2;  3I49 A;  4QT6 A;  5H9S A;  1CZT A;  2B45 X;  3LEM A;  1H2N A;  5I0S A;  2IVI B;  2J1A A;  3H9A A;  1AL2 1;  1UCX A;  1YLL A;  3BI3 A;  2VCM A;  5IVY A;  4Q4W 3;  3THT A;  4Y5S A;  5C6C A;  5JXH A;  4KWU A;  2XPJ A;  1VR3 A;  3KLS A;  3C2U A;  5CKM A;  1FOD 3;  1ZZ7 A;  2YV8 A;  4NHM A;  2OYZ A;  1LOA A;  1F35 A;  4HN0 A;  4CP9 A;  2CU5 A;  5KC5 A;  4AQS A;  3HJR A;  4OZX A;  4TZD A;  2TUN A;  1NXD 1;  3VV1 A;  1VLN A;  1UZV A;  2VCA A;  1GZW B;  2QZ2 A;  5G05 L;  1STM A;  3OPT A;  2JG8 C;  3WLU A;  3NV3 A;  3OD0 A;  1H8T A;  2OW4 A;  2JG8 B;  2E26 A;  4XF9 A;  4FTE A;  1VE0 A;  3LOB A;  3WX5 A;  4ET7 A;  1O6U A;  4BYY A;  1OFS A;  4QPG C;  5A7P A;  2P1B A;  4DXR A;  4Q0Q A;  2GC1 A;  2MNG A;  4N7U A;  5GKA C;  1EV1 3;  1KFU L;  4G3Y C;  3ZXJ A;  4GWI A;  2VZ1 A;  4DNY A;  4BHP A;  5BV6 A;  3WDX A;  2YHJ A;  1OPM A;  5F5C A;  4P5H A;  4BIO A;  4QDS A;  3VZN A;  1BYH A;  3Q8B A;  1OI6 A;  2MEV 1;  5AVA A;  5IK8 A;  1D2S A;  3N7M A;  3FZ3 A;  4QX2 A;  3T09 A;  1JYV A;  1GBG A;  4HMZ A;  3ZXF A;  1DGW X;  1OLQ A;  3MIE A;  5LA0 A;  3N9O A;  3WDY A;  1NCR B;  1POQ A;  5C3S A;  3GYD A;  1UZ0 A;  4YM3 A;  2HWE 3;  1KQR A;  1LEN A;  1RUJ 1;  4YW6 A;  5DZE A;  5LW9 A;  3VBF C;  2ZHL A;  1LGN A;  2OA2 A;  3KCY A;  3AJZ A;  1BCX A;  3NNG A;  1X7N A;  3BB6 A;  4KBB A;  2X05 A;  1CON A;  4KNC A;  1H8T B;  3ABZ A;  4AYU A;  5F37 A;  1VMF A;  2DBI A;  2H6B A;  4XCA A;  5CFC B;  4LO8 A;  4OQ8 A;  5C70 A;  3QOP A;  4LIT A;  3CZU A;  1DLC A;  3L2H A;  1GZW A;  1UIJ A;  2B9U A;  2IFW A;  1OQD A;  3H3L A;  2GAU A;  1H2M A;  4Y3O A;  1OD3 A;  4ZPI A;  3FFZ A;  3LAG A;  2YY1 A;  2ZGO A;  3LIG A;  4YW2 A;  3JQX A;  1WA4 A;  1XNB A;  3FUO A;  3I2J A;  3OB8 A;  1NXM A;  5IJR A;  1QDC A;  4CP0 A;  4RGK A;  2RHP A;  2D97 A;  4KWJ A;  3O1M A;  1SFY A;  3VBH B;  2BWA A;  3ZFE C;  1AR6 2;  1U5Z A;  2QCS B;  3FX3 A;  4KBZ A;  1CZV A;  5LK7 B;  3P3N A;  3UK9 A;  5A70 A;  2W47 A;  3VHP A;  2IXC A;  2GC0 A;  2Y6H A;  3LDK A;  3PVB B;  1J3P A;  4KWK A;  1S4C A;  4FQZ A;  2XVG A;  1W39 A;  3AP4 A;  1K5M A;  4FAG A;  4YZ5 A;  2QQU A;  3I2I A;  1RUI 1;  5F1R A;  5L9V A;  1RC6 A;  3E6C C;  3USU B;  2BPA 2;  3WUC A;  2VBP A;  4K9S A;  2JB4 A;  1QY4 A;  1VJ2 A;  2A6Z A;  4GKX A;  4CDU B;  2LUW A;  4YM2 A;  3OGR A;  4B1M A;  1W9W A;  4CDU C;  1UOG A;  2ZAB A;  1OH4 A;  4EN7 B;  2C9A A;  4XQW A;  2WAO A;  1ZYB A;  4YFZ A;  2WS9 3;  1FV2 A;  3S5Q A;  4WVZ A;  5FV3 A;  4I01 A;  1PMI A;  4RR3 B;  1RIR A;  3ZXG A;  3E5U A;  4DO0 A;  1YXW A;  5BNP B;  4I2O A;  1EV1 2;  1AYN 1;  2RG4 A;  3M3Q A;  2DUP A;  4JQT A;  3MZH A;  4LBO A;  2BYV E;  3POE A;  3DPR A;  3BOD A;  3MUZ 1;  1Y4W A;  4N53 B;  4MHR A;  4CUB A;  3RMX A;  5IAT A;  1BK0 A;  3M2M A;  4N53 C;  3I2G A;  1YNA A;  3KV9 A;  2VMI A;  3ST7 A;  1MVQ A;  3SKJ E;  2ORX A;  1CIW A;  4A45 A;  1PK6 A;  1CAU B;  4Q2F A;  5DMY A;  1ZRD A;  4IEU A;  1PGL 1;  1ULP A;  5CEH A;  2X8K A;  1OUX A;  4D6R A;  1W8U A;  5KHG A;  5K0U A;  3HN1 A;  4LIV A;  1A8D A;  4IV3 C;  3J7M A;  1ULE A;  1IG3 A;  3OUI A;  4LHL A;  2IC1 A;  2P2K A;  3NKG A;  4Q4Y 2;  1EAH 3;  1RED A;  4YZ3 A;  3MIG A;  1NA1 B;  2I45 A;  3DEM A;  5EJ1 B;  4AF9 A;  1JXN A;  5FBJ A;  4Y33 A;  1FAT A;  5FZO A;  1MQT C;  2ERF A;  1IKP A;  2Y0I A;  3AMM A;  2YU1 A;  4HKW A;  1H8V A;  1W0O A;  2O8Q A;  2VW1 A;  2Y64 A;  4FO9 A;  5FYM A;  1X8E A;  3A0N A;  5A80 A;  4BK4 A;  2FCT A;  1JW6 A;  1POV 3;  1W8W A;  4HL0 A;  2LAL A;  3C7O A;  3USS A;  4LOT A;  4W6Y A;  4FPF A;  3T4H B;  2IXI A;  1RL3 A;  1Y9M A;  4NAO A;  1V6N A;  2WT1 A;  5FYZ A;  5FY8 A;  3SLI A;  2Y6F A;  2BJS A;  1UN1 A;  5D2A A;  3WCR A;  2QTW B;  1WMD A;  4PIY A;  3TYJ A;  4SLI A;  2GNT A;  1WGP A;  1UY0 A;  4CU8 A;  3DPR C;  4MGQ A;  3JU9 A;  4AGG A;  2V5D A;  3THP A;  4R9A A;  1V6M A;  2HBT A;  1YCI A;  3Q8E A;  4GMP 1;  3KM5 A;  2YMZ A;  4QPI B;  3W20 A;  2PQQ A;  2B46 X;  3O12 A;  3FE5 A;  1ZBA 1;  3SCF A;  3UT0 A;  5FRE A;  1JZ2 A;  5IHR A;  4Q4X 3;  4XET A;  2EXI A;  2GZW A;  2HYK A;  1OQ1 A;  3KQR A;  4LUL A;  3T08 A;  3WP6 A;  2ILM A;  5HCA A;  4XJA A;  3C7H A;  1G9D A;  4OHX A;  4QMA A;  3GF6 A;  1RMU 3;  2A6W A;  2VM9 A;  1RHI 2;  2YPJ A;  3LKJ A;  5FCC A;  2YBP A;  4D0Q A;  2MPF A;  3ZSK A;  1KXG A;  4JAA A;  3ZO0 B;  3JD7 1;  1VBE 2;  4BQ1 A;  4NRM A;  5J36 A;  1OMI A;  1PGW 2;  3ACG A;  4UOJ A;  2ZGK A;  1IS6 A;  4WM7 A;  4LUK A;  1VBD 3;  1FPN 3;  1ULD A;  2BTV C;  4AFM A;  1K5M B;  2ZOE B;  5B2G B;  3WXP A;  3RZK A;  4XHX A;  1QJU 1;  1YEW A;  3VBR B;  4YPJ A;  5FZH A;  2D3P A;  3DXT A;  2BNM A;  3ZXD A;  4Y4R A;  4XJZ A;  2CYF A;  4Y1U A;  5DZG A;  2GN3 A;  4HK8 A;  5HI0 A;  5J98 B;  3VBS B;  3ZFE A;  1ALY A;  1IPK A;  2ATF A;  4IER A;  4Y20 A;  4Y5Z 0;  1V6L A;  2EXH A;  2YZ4 A;  3K4D A;  3M3I A;  3SNM A;  3WQ1 A;  3ZPY A;  3AVR A;  4AQ2 A;  4L2N A;  4LNV A;  4LJH A;  1R09 3;  2B8M A;  1DQ0 A;  5LK5 A;  3VKF C;  5BNN B;  4OUL A;  5FYS A;  1QJY 2;  1AXY A;  4DOU A;  4ONU A;  3I7D A;  5FKC A;  4Z8B A;  5FYU A;  4XAC A;  1LAJ A;  2ZGM A;  5C3O A;  3CKH A;  5G04 L;  4L8Q A;  4OVE A;  1A34 A;  1HQL A;  3S5A A;  2VUD A;  4QGL A;  1GFF 2;  3KV4 A;  4A7Y A;  2WO3 A;  3E6B A;  4HVQ A;  1C1L A;  2ZBJ A;  3B3Q E;  3ZXL A;  1WW5 A;  3EQE A;  4XIK A;  4B4P A;  1QWR A;  4B4Q A;  5C3Q A;  2VOK A;  2WFP A;  3E97 A;  2VTX A;  3CDZ B;  1V70 A;  2VOW A;  1FNY A;  1DQ6 A;  3K48 A;  5A33 B;  4MUV A;  4JDN A;  1WW6 A;  4WM7 B;  2MEV 2;  2VEC A;  2PHU A;  3WHU A;  4JGY B;  3KZ4 C;  4RGA A;  3J8F 2;  1TVG A;  5I0T A;  4AR2 A;  3FLP A;  4AFC A;  3RYR A;  3WF2 A;  3V56 A;  1V6K A;  1QOO A;  2W08 A;  1Y9Q A;  4AED C;  4XMI A;  2DVD A;  5HCB A;  5FTT C;  4AHY A;  1O4Y A;  2FZ1 A;  2VPV A;  5J7M A;  2ZEX A;  3U1X A;  3LPG A;  1WBL A;  2D40 A;  2O14 A;  4Z92 B;  1O3S A;  3HR9 A;  3T2T A;  3WP5 A;  2HH9 A;  4AAP A;  4JKM A;  1UW8 A;  4S2G A;  3TNP B;  1LHN A;  3K4A A;  2A3X A;  1BMV 2;  2OPW A;  1PVC 2;  2ZXQ A;  4XBN A;  3GBG A;  3Q8A A;  3DCQ A;  4RS5 A;  1ZZB A;  1MS9 A;  3PVE A;  1Z7S 2;  3CZJ A;  5CG9 A;  1H8T C;  3POI A;  5JOY A;  1SDD B;  1V00 A;  3CLP A;  2JG8 A;  5F2S A;  3PU8 A;  4YRD A;  1BKZ A;  1FOD 2;  1MS3 A;  3WQ0 A;  2UU8 A;  2P4E A;  1LTE A;  1W05 A;  1WLW A;  2WKK A;  2WZR 2;  2PHW A;  4TN7 A;  1NYW A;  4ZON A;  2NLR A;  3KS7 A;  4Q4V 3;  3X29 B;  1QXR A;  5BPX A;  4JKL A;  3AXD A;  4IE6 A;  4BWO A;  5CFD B;  1DZT A;  2OQ7 A;  4IES A;  1AYM 2;  3GGL A;  4AZZ A;  2P3I A;  2UUR A;  2PYT A;  1QXP A;  3OGV A;  4FXG B;  4IE4 A;  3PNA A;  2IZW A;  1APN A;  3HEI A;  4UXA A;  5FPL A;  3K51 A;  1C3H A;  2E7Q A;  1IQA A;  4NN0 A;  2D98 A;  1AYN 2;  2GN7 A;  2ZML A;  3IT8 A;  4LA2 A;  5EXO A;  2QFE A;  4COU A;  3W9A A;  4DY3 A;  3AZV A;  1RUD 2;  3PMS A;  5ANN A;  1JTZ X;  2HEW F;  3OBZ A;  3VLB B;  5FXW A;  3ZIW A;  4OI1 A;  1PNF A;  4CDX A;  3ETQ A;  2VO5 A;  3K4Z A;  4QXK A;  2VNO A;  3ZDV A;  5A6Z A;  2ZS6 B;  1AYM 3;  4LHS A;  4FPC A;  1W9F A;  4C1W A;  3D4K A;  2VZS A;  2PAK A;  5LWB A;  4I3P A;  4JRL A;  3WP4 A;  4LKD A;  2LW8 A;  1RUF 2;  4ZY9 A;  3K2O A;  3ZDS A;  4CCD A;  4IL7 A;  1BXH A;  4NAM A;  4NR1 A;  5BNP A;  1F4H A;  4YFW A;  3LF7 A;  2J42 A;  4MGI E;  4D6S A;  3W58 A;  1RUI 2;  4AI0 A;  1HJF A;  2PHT A;  1WLC A;  3QAC A;  5FPA A;  4D94 A;  2MEV 3;  5C9A B;  5HCH A;  1YC6 1;  4WZC A;  3B93 A;  4XJW A;  1XPW A;  3PUS A;  2B42 B;  2DVF A;  4X6Q B;  1AL2 3;  1RUE 2;  2VUA A;  1RXG A;  2VMF A;  5LY2 A;  3E5X A;  3URF A;  4E27 A;  1G9C A;  2K0G A;  4QX0 A;  3V0B B;  1YYN A;  3IWZ A;  4H7M A;  5FXX A;  2WNV B;  1WD4 A;  1KRI A;  5FZI A;  1CQ9 A;  1W8N A;  3WNO A;  1BVP 1;  2JDU A;  3HQR A;  5JI7 A;  3JBG 2;  1Q8P A;  1V9U 1;  3MW4 A;  3FLT A;  4IW3 A;  4V2W A;  2VCC A;  1PM7 A;  1POV 1;  1UOF A;  3D5O A;  1Z0H A;  1EPZ A;  2Z2S B;  4XQD A;  5LEJ A;  3J8F 1;  4QQO A;  2XBO 2;  5D21 A;  4IV3 B;  1GOF A;  2V5Y A;  3U4X A;  5FY0 A;  1VBC 2;  5F32 A;  1AR8 1;  3VBH A;  1JYI A;  1BBT 2;  1MS5 A;  2GC2 A;  2RS3 1;  2ZMK A;  3AZY A;  3PDQ A;  5A7W A;  3ROU A;  3ZYR A;  1QNW A;  2J1S A;  1GSL A;  4FAH A;  4CEY C;  4JVA A;  5FPU A;  1U5Y A;  4LBK A;  1PGS A;  4GD4 A;  1OSG A;  1UF2 C;  2R30 A;  1J84 A;  2D6N A;  5L9B A;  3RZG A;  1HRV 2;  2RS3 3;  1FMD 1;  1UYY A;  4A3X A;  4CP2 A;  4DEQ A;  1A8M A;  2Y60 A;  4PIZ A;  3QLQ A;  1LOG A;  3EHK A;  2QQL A;  4WM8 C;  3R4D B;  3M7A A;  4LA3 A;  2YB7 A;  4IE5 A;  1O5U A;  4DZG A;  1LOC A;  1PMJ X;  4DUV A;  4OHY A;  5CA6 A;  4RQP C;  3I3D A;  5IK4 A;  1BQP A;  4IEZ A;  1GU3 A;  3B7M A;  5DUX A;  4A2U A;  4N90 A;  3RNS A;  3CNA A;  1C5H A;  2DF7 A;  3U10 A;  1ENS A;  1O8P A;  1PO1 1;  5GZG A;  4YGD A;  5FZ8 A;  1NT0 A;  1BK1 A;  2A3Y A;  2UYA A;  3JB4 C;  2EIG A;  4TYS A;  3VUO A;  5IVC A;  1S0D A;  1BEV 2;  4C0H A;  3BTZ A;  4CPB A;  3CHX A;  4NRQ A;  1QIQ A;  1HRI 1;  1R1Z A;  2HWB 3;  2GNM A;  1B09 A;  1KS4 A;  3HN3 A;  1XNK A;  3GCW A;  1K5J A;  1ODN A;  2P37 A;  3PLQ A;  4XFI A;  2YGM A;  3ZSJ A;  5JXG A;  1NQJ A;  5A7O A;  3PJY A;  5IK5 A;  4PIX A;  4PLO A;  2WNE A;  1PZ8 A;  1CX1 A;  1N47 A;  1S2E A;  4XBL A;  1PNG A;  2E63 A;  1TME 2;  2P6C A;  3N3H A;  5FPZ A;  4DXS A;  1J3R A;  2X5I B;  3VBF B;  4Q4Y 3;  3EO6 A;  1YQ5 A;  5ISL A;  2RS1 1;  2W5F A;  5FLH A;  5EV7 A;  3U11 A;  2ARX A;  2D93 A;  2BVB A;  3C7E A;  5C33 A;  2XGX A;  5FYT A;  3OGJ A;  1UKR A;  4QM9 A;  2J1T A;  2YG0 A;  4YVS A;  1ZBA 2;  3AB0 A;  4CXY A;  3O1U A;  3A23 A;  2VNG A;  3RZJ A;  4UF0 B;  4YVW C;  4IGO A;  1NCQ C;  1VIW B;  1W03 A;  2R06 2;  4HON A;  3NNJ A;  1OF3 A;  4I3G A;  1N1Y A;  1S0C A;  1IQD C;  1XC6 A;  4K40 A;  4CP9 B;  5IFT A;  1Q5O A;  5A1F A;  2W91 A;  2W46 A;  4EJR A;  3K46 A;  3QCW A;  4BQY A;  4AHW A;  2WWJ A;  4ZHN A;  4XUQ A;  4FCA A;  4PQQ A;  1KS5 A;  1VBA 3;  2R07 2;  4PDW A;  1Q56 A;  5C3R A;  4QAW A;  3VL9 A;  4UFM A;  4E4S A;  5LRR A;  4NOT A;  3WEZ A;  4XFG A;  4Z2A A;  3RZH A;  4LPL A;  3H7J A;  5KXD A;  2EID A;  2JWP A;  1SG3 A;  3MI8 A;  3AYC A;  4B29 A;  1LOD A;  5L9R A;  1R08 1;  2V4A A;  4J1X A;  3A22 A;  1RVF 3;  2BOI A;  1LED A;  1GWM A;  2RJ2 A;  1OPO A;  5FJK A;  1F5J A;  1A78 A;  5JOW A;  5JWP A;  3ZFF C;  3O0V A;  4OI4 A;  1CX4 A;  1Q8V A;  1W6P A;  2CGO A;  4HVO A;  1VAM A;  5JSO A;  2AYH A;  5FZL A;  4Q8L A;  3BU0 A;  1G86 A;  4TXW A;  1O5L A;  1F31 A;  4NII A;  1PGL 2;  2C24 A;  3RZL A;  3SH5 A;  4NIH A;  4XW3 A;  2JKX A;  3NMB A;  3DN7 A;  4FT8 A;  2HLE A;  1ENX A;  2K2S A;  4CCN A;  5DG2 A;  1YQC A;  1OBN A;  4BQ4 A;  3H0O A;  3AKS A;  2RS5 2;  4G4F A;  2Y34 A;  1OLM A;  1QQP 3;  2OX0 A;  1OVS A;  5HXM A;  1KDK A;  1VMH A;  3MLK A;  4GH4 C;  2V09 A;  1VBD 1;  3PUI A;  5A3N A;  2E7T A;  5ABJ C;  2FCV A;  4QQL A;  1S2B A;  2P34 A;  3POJ A;  5CZK A;  1X36 A;  1YQ8 A;  4I0W B;  4LOR A;  3BYW A;  4GWJ A;  4ASM B;  1QQP 1;  2D6P A;  3APB A;  4JC1 A;  5FMO S;  1KGY A;  2RMU 3;  1QXJ A;  3OGS A;  4F7Z A;  4K1Z A;  3WNP A;  2LRP A;  5DAP A;  3KB5 A;  4CDQ A;  2FQP A;  2UWB A;  2J7M A;  5GM0 A;  1OC1 A;  2XUE A;  5F6K A;  4AI8 A;  1KDM A;  1LHU A;  3DYP A;  3OBT A;  1EPW A;  3VBU A;  2DCZ A;  5I93 A;  3KCC A;  5BUV A;  1C57 A;  3WP3 A;  4AEK A;  1UY1 A;  4L92 A;  5JXJ A;  4CDQ C;  4I0B A;  5E8A A;  4CDW A;  1YHF A;  4IEP A;  1ND3 C;  4F83 A;  4UYB A;  4B4R A;  4R8H A;  1D4V B;  1ND3 B;  4NIG A;  3O1O A;  2D5F A;  2C4X A;  4MXV A;  3S0M A;  2WSU A;  4MZU A;  1H6Y A;  3PVO A;  1DQ4 A;  2C1F A;  2VD7 A;  2VMD A;  4FOQ A;  4RD7 A;  3T0B A;  2YBS A;  4PLN A;  2A70 A;  3LGR A;  5FZM A;  3RZM A;  2AAC A;  3O1P A;  1AR8 2;  1W2N A;  4L9B A;  4DB5 A;  4DRV A;  4DIQ A;  3U14 A;  3HBZ A;  4M01 A;  3LE0 A;  1DG6 A;  2R0F A;  5LA2 A;  5FYB A;  3I4I A;  5A3O A;  4Q0U A;  4XUN A;  2ET1 A;  2VE1 A;  2ORZ A;  1RUG 2;  3DKQ A;  2OS2 A;  1AX0 A;  2ARE A;  5KC6 A;  1I1E A;  2XLF A;  5M0T A;  5FQ0 A;  2KD7 A;  3M3C A;  1ZRC A;  2GDF A;  1SLI A;  2JG9 A;  3UKT A;  2BVV A;  2A6Y A;  3ZFF A;  4AVT A;  4HAN A;  1CAW B;  3ACL A;  1TG7 A;  1C1F A;  1W8T A;  1JOJ A;  3CJX A;  2ZGQ A;  2I07 B;  4CCE A;  4CDX B;  5JAX A;  4BOW A;  2WS9 2;  2VVE A;  5I0R A;  2VQU A;  3IMN A;  1CGP A;  3ILN A;  4JKK A;  1AR9 3;  1G9F A;  4OHV A;  2UYB A;  4X8P A;  3AL5 A;  1W3V A;  1UNB A;  1VRH 2;  2W92 A;  4K6B A;  3HNY M;  5GLW A;  3W59 A;  1AZD A;  2WLQ A;  3ATG A;  2QVS B;  5CYY A;  2XQX A;  4KH9 A;  3FUQ A;  1OUS A;  3VKN A;  2SBA A;  1O59 A;  1ZBE 1;  1BMV 1;  1QJX 2;  1OLR A;  4MET A;  4P08 A;  2MHF A;  1PO1 3;  1YFX A;  2F6B A;  4QGN A;  4HLT A;  3H42 B;  4WBB A;  5T52 A;  2DTY A;  4E8D A;  4E4Z A;  1NCQ A;  2Z42 A;  1IS5 A;  3M1H A;  1COV 3;  3CL1 A;  4IET A;  4YVW A;  4AEM A;  3O1S A;  4AE2 A;  1N1V A;  4MGT A;  4D7Y A;  3OF1 A;  4YVS C;  3Q8C A;  1C8M 1;  4XFB A;  4I02 A;  1QHD A;  4BQW A;  1XU1 A;  3GBW A;  3UGG A;  2PAM A;  2VH9 A;  2DTW A;  2WZR 1;  3OSD A;  4JGY C;  1RUG 1;  4WVW A;  4CU9 A;  1YRZ A;  3MDP A;  2R04 2;  1CAV A;  2FDH A;  3KVA A;  4OCT A;  1M06 G;  2Q0A A;  2G4I A;  4R52 A;  3PIJ A;  1Q8O A;  3N7K A;  3O0X A;  1DP0 A;  3D8C A;  4ZU4 A;  3I59 B;  1JZ5 A;  1HQN A;  3IM0 A;  3HMY A;  2BW8 A;  1EUU A;  2VQ0 A;  3ZFG B;  4QXB A;  2OKX A;  3MF6 A;  3ZFG A;  2VZO A;  2WT0 A;  2IXK A;  2XJQ A;  1PM4 A;  3O14 A;  4LUM A;  2PA7 A;  4ISR A;  4KMQ A;  5CG8 A;  3IZO A;  2BER A;  1HDK A;  3FL7 A;  2OZJ A;  2R04 3;  2WN2 A;  3POW A;  3Q8F A;  1HXS 1;  3KQ4 B;  2VNV A;  4GXL A;  4MXW B;  5DQ0 A;  4UBG A;  1AR7 2;  1EAH 2;  4RQP A;  4AEJ A;  4NVP A;  3LSD A;  4YSF A;  2NPI A;  1Q43 A;  2ZEZ A;  4UW4 A;  1HXS 3;  1V0A A;  4CCM A;  3R4S A;  1TMF 2;  4BB3 A;  2WWU A;  1SMV A;  4Y22 B;  1QJE A;  1DU3 D;  3BTX A;  3NKT A;  2G19 A;  5E16 A;  5HXV A;  1JU4 A;  2HJI A;  3UL2 A;  3RDI A;  4FPJ A;  3TEZ A;  2PFW A;  2IXH A;  2VNR A;  4CEY A;  4U36 A;  4N7I A;  3N7J A;  3KGL A;  3WF0 A;  1VBE 1;  1W0P A;  1WCS A;  3VKO A;  1X9T A;  4AVA A;  4CU6 A;  4A41 A;  3HT1 A;  3VBH C;  1CES A;  5F6L B;  3CMG A;  3NJZ A;  3V64 A;  2BBV A;  2BGP A;  4NHK A;  3U78 A;  5FWE A;  3VDC A;  5BY5 A;  3AZW A;  4XFF A;  4BK5 A;  1OA3 A;  4WVM B;  4N9H A;  5FP4 A;  5H9P A;  5AFE A;  4ARY A;  2UWA A;  2J22 A;  5KBF A;  1KFX L;  1UL9 A;  5ACA 1;  4QWN A;  1RUH 3;  3ZFF B;  3DKW A;  2O1Q A;  3AZX A;  2WA3 A;  1ODM A;  4M0H A;  3SIS A;  1YFW A;  1JU3 A;  3RJR A;  3G6J B;  2JDM A;  5FMC A;  3WW1 A;  5K8S A;  1ONA A;  3LQC A;  3NVC A;  3CEW A;  4YZ4 A;  4HBN A;  4PCR A;  4ZU7 A;  4L97 A;  3A7Q A;  2PMW B;  4FP3 A;  4LHK A;  3LDB A;  3IDE A;  3N9P A;  2YGL A;  3AX4 A;  2XJV A;  4JV4 A;  3U37 A;  1D4M 1;  4IE0 A;  5C9A C;  5C5T A;  4BQ2 A;  3POY A;  1AXK A;  3GHN A;  5DN2 A;  5BNP C;  1NX9 A;  4QX8 A;  4BIF A;  4MV2 A;  5FMO L;  3ZSM A;  4D7T A;  2YC2 A;  1VBC 3;  4OYU A;  4COY A;  4V2V A;  3B69 A;  4YW3 A;  4LMF A;  2ZZJ A;  5T5O A;  4JRA A;  1WLD A;  3UGH A;  1GP5 A;  3O7O A;  3TN9 2;  4CDX C;  5JLV A;  1W28 A;  1GZ9 A;  4MH0 E;  4UFI A;  4Q5O A;  1VMJ A;  1LOB A;  1AVB A;  1FMD 3;  2W1Q A;  5SV5 A;  4NO4 A;  3EMR A;  2H0V A;  4GWM A;  5T54 A;  2ZPX A;  3J4U H;  2WFF 1;  3MV0 1;  4FP2 A;  4LT5 A;  3PUR A;  2AH2 A;  1S2K A;  2QQJ A;  1RVF 2;  4HVR A;  4XIL A;  4H7L A;  5IYY A;  1TNF A;  3OPW A;  1C4R A;  1BZW A;  2V4V A;  2WT2 A;  3WHT A;  2Y0O A;  4FXK B;  1DBN A;  3TEY A;  3FBY A;  2HWF 3;  4GMP 0;  3G7D A;  1NY7 2;  1UU5 A;  1B35 B;  1S0E A;  4LO4 B;  1XNT A;  3IKW A;  1W3X A;  1CAU A;  1TME 1;  5I0D A;  3VDD B;  2BP6 A;  1OD5 A;  2DUR A;  2XKO A;  3E5Q A;  3LEG A;  2XB6 C;  3H1M A;  4Q4X 2;  5FK7 A;  5FZ7 A;  3O1R A;  2PHL A;  4ZS2 A;  3LSE A;  3PJQ A;  2ZAA A;  3ACF A;  4MXW A;  4CU7 A;  1MS0 A;  3DXU A;  4RS5 C;  4CEW B;  4OUS A;  1N3P A;  4BPZ A;  3AMP A;  1GNH A;  2B39 A;  2AEZ A;  3QH6 A;  2A73 B;  1YQ2 A;  3P3P A;  5A7Q A;  1LGC A;  2HWD 2;  4QHO A;  5DUU A;  1IZ3 A;  2HWE 2;  1Z7S 3;  1COV 2;  2NYY A;  5A32 A;  1BLZ A;  2J1E A;  4YWA A;  3IBM A;  3RFR A;  3RS6 A;  2QQI A;  4XUT A;  3J7N A;  2W39 A;  4AED A;  1TMF 3;  3HOB A;  1C5I A;  5TSW A;  4FOW A;  1RUC 3;  1ST8 A;  2GH8 A;  3UJQ A;  1BBT 3;  1HRV 1;  2XHK A;  4Q1P A;  1W90 A;  1E5S A;  1JS9 A;  2VTX J;  1ASJ 1;  4XF1 A;  4IEW A;  2QKD A;  2KA3 A;  1MS8 A;  2EA7 A;  4K20 A;  1QJY 3;  5HV4 A;  5DDJ 2;  2PLV 2;  1VBA 1;  4PF5 A;  1GOG A;  2R04 1;  2ZGR A;  1UD1 A;  2ZMN A;  4A6O A;  3N9M A;  2QJV A;  3VDB A;  2RVA A;  5FZA A;  5APA A;  2EVX A;  1YI9 A;  4YZ2 A;  1RUC 2;  1IPS A;  1ND2 C;  2WNO A;  4ATE A;  3MHZ A;  4AFB A;  4PDW B;  3LEK A;  3BU7 A;  2Q5T A;  4DRR A;  2VOT A;  4P9L A;  1ZNP A;  1F8V A;  2A3W A;  3JQW A;  1YFU A;  4LK6 A;  1O3Q A;  2CV6 A;  1FYU A;  1W6N A;  1PVC 1;  3ZYJ B;  1D4M 2;  3ZFE B;  4QKB A;  1HQW A;  1OKQ A;  2E7A A;  5C4W C;  2TNF A;  1UYP A;  3SQO A;  2I74 A;  2JEC A;  1PO2 1;  3EYP A;  2VG9 A;  4QB6 A;  1RUE 1;  5A3L A;  1MVE A;  1R09 2;  3OGG A;  4LKE A;  5DAV A;  5FUN A;  1QGL A;  4UW5 A;  3AFK A;  5KHH A;  2R1D A;  2B4K A;  3ASI A;  4RYD A;  3BIW E;  4BQ5 A;  5EHD A;  4QPG B;  5ANQ A;  3NV2 A;  5A6X A;  3WDU A;  3U4S A;  4HOO A;  4FVV A;  2EAK A;  1PO2 3;  2IXJ A;  2JG9 B;  4WM7 C;  4B7E A;  5FZB A;  2JDH A;  5FPX A;  1HJG A;  3GDB A;  3GZE A;  3I2H A;  3UYJ A;  1KIT A;  1X33 A;  3LDR A;  4X8N A;  4B3N A;  4KWL A;  2W95 A;  4AHX A;  3OBA A;  4EWD A;  5EIY B;  1JH5 A;  2XLG A;  2OUH A;  2K9Z A;  1PZ9 A;  1R1A 1;  4QPI A;  3SC7 X;  4NHX A;  4EZ4 A;  1DHK B;  2BUK A;  2QQM A;  4M3C E;  4S2F A;  3B02 A;  3PUA A;  2HWD 3;  4IEV A;  1K45 A;  1OT5 A;  3SXW A;  1XXN A;  4F3J A;  4W4Z A;  5BNO B;  5JOX A;  3OEB A;  2HEV F;  5I0U A;  5BNO C;  2VUL A;  5CFC C;  2W0X A;  1ZZC A;  1UOJ A;  2XWB B;  2ZHK A;  3KT1 A;  3OYW B;  2WNU B;  1JZ3 A;  3NAP C;  4MSV A;  1PIV 2;  1D7P M;  4C91 A;  4IV1 C;  3SCG A;  4OHZ A;  3IDA A;  1MZF A;  5A7N A;  3D0S A;  1LKN A;  2RR1 1;  1UX7 A;  3JUU A;  3NNF A;  3WOG A;  5D8A B;  2CTV A;  5IVF A;  1JZ8 A;  4DY5 A;  2QQO A;  1MQT A;  4Q26 A;  1IG0 A;  5FZ0 A;  4B7K A;  2A1X A;  3AP7 A;  4IDZ A;  3IIA A;  5HBA A;  4Q27 A;  4XF3 A;  1SAC A;  3PUQ A;  2GC3 A;  5CIR A;  2BGC A;  5T5L A;  4CDQ B;  1UZZ A;  1UX6 A;  3BAL A;  4ASL A;  5FPV A;  3EBR A;  4IV3 A;  3NJY A;  2CDO A;  3N9L A;  5K0U C;  2ZX1 A;  4CUA A;  1VRH 3;  4MLO A;  3NRU A;  4PBO A;  1ULF A;  4R9D A;  4AI9 A;  1MZ5 A;  4HK9 A;  3MYX A;  1OA2 A;  4PHZ A;  5BYN A;  2YRO A;  1PK6 C;  2B9V A;  3KV6 A;  3JD7 3;  2IFR A;  1U5X A;  5EWS A;  5E6H A;  3MBW A;  5FKB A;  4P9W A;  1K42 A;  4N53 A;  1PZ7 A;  3DPR B;  5FY1 A;  2JEN A;  1Y3T A;  1QQP 2;  1TME 3;  3H50 A;  2DV9 A;  4RR3 A;  1PX4 A;  3PTY A;  1U0A A;  2R06 1;  3B00 A;  4N8M A;  2DDU A;  4QXH A;  3WG4 A;  4KI5 M;  2CHH A;  2ZJC A;  4UW6 A;  1ZBE 3;  1FPN 2;  3LOI A;  5FLI A;  2YFU A;  5H9R A;  5B4N A;  3VZM A;  1WME A;  3DYO A;  3IAQ A;  3MFA A;  5GAL A;  4CDU A;  5KWR A;  3INA A;  5KHI A;  4K7J A;  2XVK A;  1QH6 A;  3IDB B;  1XB9 A;  4RA0 A;  2VCB A;  4XAA A;  4XXA A;  2JEM A;  1W6P B;  1BHG A;  1IGO A;  2L9L A;  2LS6 A;  4R9B A;  1AUY A;  2ZX2 A;  1CZS A;  3RMY A;  2W52 A;  2D7F A;  1WUV A;  1JYT A;  2WLP A;  3ES4 A;  3T1M A;  2XVL A;  3WSO A;  3NQH A;  1K5M C;  1N3O A;  1JUI A;  1W2T A;  2Z5W A;  3EXU A;  4J25 A;  1RIT A;  1SLB A;  4P5Y A;  2YYO A;  3BGA A;  4NPR A;  2G9Z A;  2QQN A;  2Y33 A;  3ON7 A;  3CQO A;  1WA6 X;  3SCH A;  1WMX A;  2HWE 1;  4O61 A;  3MIH A;  2VQA A;  5T55 A;  5KXE A;  1ZZ9 A;  4R4Z A;  2ZEW A;  3KHC A;  3IPV B;  4A4A A;  3D6E A;  3BOW A;  3ACI A;  4LXL A;  5LA9 A;  1N1S A;  4MGK E;  5F8P A;  1MQT B;  1LHW A;  1MEC 2;  3AM2 A;  3N35 A;  4W6X A;  1JHN A;  2E9Q A;  2Y26 A;  2WZP P;  2QBX A;  3DYM A;  1W04 A;  2JDA A;  1L3J A;  1B35 C;  4J6G A;  5FP3 A;  1TZO A;  1RUN A;  2YPD A;  1IPJ A;  1O3R A;  2W3J A;  3LFI A;  2GP3 A;  4UF0 A;  4M3C F;  4NUB A;  5J96 B;  5GZF A;  1CPM A;  3C7F A;  3ZYI B;  1T6G C;  2CGP A;  1ULG A;  1FV3 A;  2IWG B;  1OQE A;  4QXC A;  1JHJ A;  1RHI 1;  2QQW A;  4XAB A;  4JGZ B;  4E4D X;  3MPB A;  1RUC 1;  5BNO A;  4O65 A;  1E5R A;  3VBF A;  2R16 A;  1NCR A;  2PHR A;  3LCP A;  1BBT 1;  1HRV 3;  2RS3 2;  4P9X A;  3V0A B;  2DCY A;  3S57 A;  3QD6 A;  3T30 A;  3T1L A;  1VBA 2;  1AL2 2;  1RUE 3;  1SDW A;  1W2A X;  2R07 3;  3AKQ A;  2WYS A;  3OBR A;  4L99 A;  5GLT A;  1QOT A;  3MIC A;  3VZO A;  4M4P A;  4OUM A;  1LU2 A;  2C6S A;  2PHD A;  2WFF 2;  4UFJ A;  5A3M A;  1FX5 A;  1G9B A;  1H0B A;  1SBE A;  1ASJ 2;  4HSL A;  3TAY A;  4AFD A;  3J7L A;  4Q4V 1;  1EAH 1;  4A44 A;  4YZ1 A;  2DFC A;  4ZZ8 A;  4NID A;  1GKB A;  2NQY A;  3JB8 A;  3HIF A;  1PO2 2;  4XHB A;  4QDR A;  1AR9 2;  1AR6 1;  5FZ1 A;  1DFQ A;  2YFZ A;  4CSW A;  4QPG A;  4XC9 A;  3WW4 A;  2HYX A;  2VZ3 A;  2UY8 A;  2ZGS A;  1GQG A;  1RUH 1;  1PVX A;  1VPH A;  4QX1 A;  2Z69 A;  2PN5 A;  1PO1 2;  5EJ3 A;  1F4A A;  4Q29 A;  3VBS C;  5C5U A;  5KHK A;  2W9X A;  4AVS A;  4CCK A;  1XE7 A;  3DUI A;  2Y38 A;  3WUD A;  5FOB B;  5J1X A;  4IE7 A;  1VBD 2;  3O5S A;  1CR7 A;  1W6N B;  3W5M A;  5LAS A;  1DGL A;  3POB A;  4URT A;  1HB2 A;  2V72 A;  5I8S A;  3VZJ A;  2PLV 1;  2ETE A;  1EY2 A;  3IPV A;  4Q0V A;  5A7W B;  1X82 A;  1GP4 A;  5LCW L;  4NHY A;  4IQP A;  3SIT A;  1ENR A;  3OCP A;  2W2I A;  2WAA A;  3C3V A;  1KD7 A;  4CP1 A;  4MYE A;  1POV 0;  1RJ8 A;  3M4F A;  1SPP B;  5F5I A;  1C8N A;  2JDK A;  1BEV 3;  3I97 A;  3QH7 A;  3WCS A;  4GQ7 A;  1AXZ A;  2IVJ A;  1W06 A;  1W6O A;  3WG2 A;  1GWL A;  1JUH A;  1UKG A;  2A6X A;  2BV4 A;  2JDZ A;  2ZX0 A;  3KD4 A;  1H4H A;  2WNV A;  3ZR5 A;  3ORJ A;  2RE9 A;  1QJX 1;  2RV9 A;  4BZ4 A;  2BFU S;  5JUV A;  1S0I A;  2ADD A;  5J48 A;  1DZR A;  1VRH 1;  2VUC A;  3UGF A;  4AI1 A;  3ZSE A;  1SLC A;  4XCB A;  3WDW A;  1ULC A;  1ZA7 A;  2HWB 1;  4ZXE A;  5LAT A;  1H1A A;  4N43 C;  3AC0 A;  1TQ5 A;  3T2O A;  2VXR A;  3OY8 B;  2XLA A;  1Y9G A;  3BVC A;  2VTF A;  4OZO A;  1QU0 A;  2HWF 1;  4XXP A;  3F95 A;  5E88 A;  1VAK A;  5KXB A;  2RR1 3;  4XPV A;  4PBP A;  4CCC A;  2YBK A;  2XML A;  1OOP C;  4OHW A;  3A0K A;  2R06 3;  1XSQ A;  4LHN A;  3CJI B;  2F4P A;  1SZB A;  2EXK A;  2WL1 A;  4K8R B;  4C8D A;  4Y1Z A;  3CJI C;  3IDC B;  2WN3 A;  3IB3 A;  1NY7 1;  1CJD A;  1CAX A;  2DU1 A;  2HKX A;  4G9S B;  4BM8 A;  2CGN A;  4K3U A;  4GH4 B;  1S0G A;  3MW3 A;  2UY9 A;  4XVH A;  3TB0 A;  3R0R A;  3WG3 A;  4ZZ5 A;  1H9W A;  4ES9 A;  3VDD A;  1LNS A;  3TRS B;  2RDR A;  1E5H A;  3ETP A;  1CVN A;  2GME A;  4Q0S A;  3UV9 A;  3NL1 A;  1NQD A;  2A75 A;  3AYD A;  3ALQ A;  4QGM A;  5FO7 B;  2D5H A;  4ATF A;  5LEK A;  3BTY A;  1LOE A;  3IMM A;  5L73 A;  2XUM A;  3JCI A;  2WJS A;  3GXU A;  3A4U A;  4COV A;  2Q8E A;  1YI7 A;  4YM1 A;  2EF6 A;  2JXA A;  3H3Z A;  5GLZ A;  1XQN A;  1AHS A;  4YAR A;  2WBK A;  1JMU B;  3MIB A;  1NA1 A;  4NHL A;  3KMH A;  2IUW A;  1E57 A;  2WQ8 A;  1ACC A;  4RHV 2;  4XIO A;  2D6K A;  5B4X A;  3T2P A;  4E8C A;  2DBN A;  3K3O A;  3GCX A;  2BBA A;  4LKS A;  4MOA A;  5DAX A;  3VD7 A;  5CAZ A;  5DZF A;  3HNB M;  4N9I A;  1QJY 1;  1W9Y A;  2D3R A;  2WNU A;  4HT1 T;  3VDD C;  4IUG A;  3T3Y A;  3GZA A;  5FZ6 A;  2RM2 2;  3RI9 A;  4KGG A;  4UFL A;  3I3M A;  4COZ A;  4Q8K A;  4HG6 B;  3TOJ A;  2WRA A;  4DXZ A;  1TMF 1; 
#chains in the Genus database with same CATH homology
 2VUD A;  1OXC A;  5A6Q A;  2JDU A;  1OUS A;  5A6X A;  5A70 A;  2JDK A;  2JDH A;  1W8H A;  3DCQ A;  2JDN A;  2BOJ A;  2JDM A;  2BV4 A;  2WR9 A;  4UT5 A;  2BP6 A;  2JDY A;  5HCH A;  2VUC A;  4AOC A;  1UZV A;  2VNV A;  1OUR A;  1UQX A;  5A6Y A;  2BOI A;  5A3O A;  2WRA A;  1OVS A;  1W8F A;  1OVP A;  3ZDV A;  2JDP A;  5A6Z A;  1OUX A;  5D2A A;  4CE8 A;  2XR4 A;  1GZT A;  2CHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...