2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RSC3288
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
1OUSA 1GZTA 1OVSA 2VNVA 5A6YA 5A70A 2JDYA 2BOIA 1OXCA 2JDNA 2VUCA 1OURA 1W8HA 1OUXA 1OVPA 2BP6A 2XR4A 3ZDVA 5A6QA 5D2AA 3DCQA 2WRAA 2JDMA 2JDHA 1UQXA 2JDPA 4UT5A 5HCHA 2JDUA 1W8FA 2VUDA 2JDKA 2WR9A 2BOJA 5A6XA 4AOCA 2CHHA 5A6ZA 5A3OA 4CE8A 1UZVA 2BV4A
chains in the Genus database with same CATH superfamily
1WD4A 2R6QA 3JQWA 4A7KA 4IGPA 2XUEA 4XBQA 1QOOA 4P9WA 1J1TA 4HVRA 4GQ7A 2X05A 4NIGA 2VBDA 1AR92 3ZYIB 2UYAA 5F6KA 1KS5A 3PU3A 4QKFA 5DZFA 3AJYA 4COWA 4QPWA 1UWWA 5EP9A 5BNOB 2GC0A 4MG2A 3M3EA 1H8TA 3GALA 3OGRA 5ISLA 3AX4A 1VAVA 5FPZA 2DV9A 3IM0A 3M3OA 3S5QA 4BQ5A 1JOJA 4G4FA 3VD7A 2WNUA 2WWJA 1VMFA 4DNYA 2VG9A 1RUOA 1W6NB 3HEIA 1NE4A 1VBE2 3KV6A 1GICA 2R32A 4UBHA 2CGNA 5A3OA 4QX1A 2YDEA 4UYBA 1O3SA 4DFSA 4R52A 4GWMA 4QMAA 1AR63 3K3OA 3DYOA 3WXPA 3FLRA 4CUBA 1LGBA 1OQDA 2HWE1 1VR3A 1PGL1 2VMIA 4LA2A 4WM7A 2RE9A 3PU8A 2VBBA 5FPAA 2JB8A 4WM8C 2CWSA 3MYXA 4L9BA 1JYIA 1N1SA 4XFCA 2MHFA 1DP0A 4LR4A 4P9XA 3EO6A 1OC1A 3VBSA 4XJWA 4JGZB 2VUJA 4LK7A 1APNA 1GP6A 3CO2A 5C4WB 1DU3D 3H50A 4BK4A 2UURA 4IEUA 3ZXDA 5LEJA 4XTMA 4OUSA 1V9U2 5LBBA 3VHRA 4BJ0A 3PJQA 1RUE2 3SCFA 4LNVA 3ZMOA 2BV4A 2XLAA 2WS91 3IIIA 4A7ZA 4CEWB 3RNSA 3G7DA 5FCCA 1HXS2 5FYUA 2I07B 3V0AA 2JWPA 4ET7A 5C3SA 4RN5A 1NA1C 4QX3A 2ZHNA 2R0FA 5IJRA 1ZZ9A 3VLBB 4H7LA 4Y20A 2P17A 2VVFA 1RVF3 4Q4W1 5LEKA 2VTXJ 3JUUA 3DUIA 1FPN2 5JOYA 1L3JA 3JBG3 3OTFA 4OFGA 2HEVF 4QHZA 3HN3A 3B7MA 2ZHKA 4WV8A 2VJXA 3NVCA 5AVAA 4BM8A 1ULOA 2VQUA 5ABJB 2HBUA 4BOWA 3RZJA 3PVBB 3PDQA 1DQ6A 2AC1A 2RS53 4FQ4A 5FYSA 2X5IC 5C33A 2W0XA 2PHRA 3AK0A 5F9TA 4AFDA 1R081 4AVTA 5J3UA 5FPUA 3NNFA 4UW3A 5T5OA 1FXZA 1OI6A 2ZGUA 2RMU1 3IIAA 4XXAA 3ABZA 3HJRA 2DBIA 3LDKA 4LULA 1VIWB 5C3OA 3U0ZA 3W5NA 2BP6A 2R041 3OB8A 2VNRA 3S0MA 1ZBA1 2D5FA 3LSEA 4AGGA 4FSJA 3ME2A 4E2QA 1GOFA 4AI8A 2JECA 3H1MA 2GMEA 1UPSA 2ET1A 1QEXA 1NLSA 3WSOA 1NCQB 3A22A 3HD8B 1WMFA 3TN91 3WNPA 3M7AA 4A6SA 2HKXA 1TVGA 5LRSA 1V6JA 1CAWA 2ENRA 2OIIA 4ZXEA 1G6NA 3MPPG 4NMIA 3LPGA 1OFNA 3ZYHA 1S4CA 3GCXA 5EV7A 3LOIA 4IEYA 1W6PA 4EJRA 2XGXA 2MEV2 3ALQA 3MDPA 3IKWA 4QKDA 2JG8C 3OBAA 3J8F3 1P8JA 1WLDA 1G9FA 1ASJ1 3THPA 2JDHA 3VV1A 4AZZA 4RFRB 5I0TA 1F35A 2X29A 1TZOA 3AVRA 3ILNA 3OPWA 4HBNA 1WWYA 4OI2A 1AX2A 3M3QA 4XFHA 2D6KA 2WR9A 5FXZA 1BK0A 1AR83 3MIDA 3AYCA 3BKZA 1ULCA 5JLVA 4JGYB 3WHTA 4ZS3A 2OS2A 3WW4A 1CZVA 5KXBA 5SV8A 2Z79A 2WO3A 2A6VA 5FXVA 5FUPA 1CX1A 5B4XA 4KWKA 3CDZB 4XHBA 1SHWB 2IFWA 1Z7S3 5JSRA 3TB0A 4CDQB 1F4AA 2XJQA 1FYUA 5FMCA 3SLIA 2VPVA 5GKAC 1W0OA 2JIGA 2O8OA 2WWSA 3ZKYA 4FFFA 4UAPA 1G9BA 2A71A 4BDVB 4DQAA 1URXA 4JDOA 4M3CE 4LT5A 2IXIA 4CDUC 4Q4X3 4CUGA 4F8AA 1IPJA 5L7OA 2DVFA 4KH9A 3ZMNA 2D44A 3AMNA 2WAOA 1N47A 3I2IA 3BB6A 4LHLA 3D5OA 2QQMA 4QGNA 4CPBD 1OT5A 4QQPA 4MGZE 4K21A 1LHWA 1C4RA 2WT1A 2BNOA 1SLBA 1UMZA 3RFRA 3S7EA 1XPWA 4KU7A 3J26N 4CPBA 2B39A 3KCCA 3FL7A 2VZUA 2EIBA 3O1UA 5FV3A 3NV3A 1WMDA 4ASKA 1GNZA 2D6OX 1LB2A 2W1UA 4HANA 2BOJA 3ES1A 3M2MA 4FPOB 1CAVA 1VRH1 2DVBA 2NMOA 4DMIA 1AXZA 2ZZQA 1TG7A 4GB32 3CHXA 1GLHA 2A3WA 1GUIA 1NCRC 1Y9QA 1ZX5A 2D6NA 1QJX3 4QPGB 4UFLA 4XW3A 3T3YA 2QVSB 3ZFGA 4XFGA 1WBLA 3Q8AA 1YUDA 3WW1A 2IFRA 5DUUA 5SV5A 1AJKA 5FYMA 3IBMA 2QQNA 1ULDA 3D4KA 1KD7A 1PO12 4L2NA 2CV6A 2RS32 5D8AA 2F4LA 4HKOA 2RDQA 2ZEXA 3DPRC 4X8NA 3TAYA 2HJIA 5LK5A 3GZTB 5A7QA 4Z82A 4ARXA 5JOZA 1S55A 3V56A 4HPKA 2KM2A 1FOD3 2JE9A 2YBPA 3AMPA 3OF1A 4I30A 4R9BA 5FLJA 3WQ0A 5C4WC 2VMDA 4NAOA 3P1IA 2ZX2A 5FO7B 2R1DA 3FHAA 4L0PA 4QX5A 3EYPA 5C9AC 4BK5A 1C8M1 3VDCA 3POYA 4OUMA 1V6OA 2RHPA 4RGKA 1AX0A 2RS52 4COVA 5KHJA 1BBT2 3T0BA 4DZGA 4BLIA 1WA6X 5LBEA 5JPMB 1POV1 1JZ3A 4YW2A 1H1AA 4IV1A 4QB1A 2JDZA 1PZ9A 1QHDA 3THDA 1ZREA 1XU2A 4GZ9A 4GH4A 1STMA 1U12A 4BB3A 2E33A 2ZGLA 4YW6A 5D1IA 5A6XA 3UL2A 5KHGA 1SDDB 4TN7A 1PVC1 1UZVA 3RJ2X 4M0HA 4FPKA 3QCWA 3T4HB 1GMMA 2PAEA 2JENA 3CBNA 5C8CC 3FJSA 3CLPA 3QH6A 4HXCA 4LO5B 2JG9B 4YZ1A 1FX5A 2WZ8A 2HBTA 4N53C 2GNBA 5J1XA 4QB6A 1KDKA 3DN7A 2HWF2 4LOSA 4ZU5A 1UW8A 4FCAA 4O9EA 1EV11 3OD4A 1Q8QA 4AFBA 3LA2A 4IEZA 3J8F2 4XUQA 1RUG3 1XOYA 3KT7A 3EMRA 2GU9A 2JDKA 3LIGA 1JMUB 2BU9A 4Q0UA 3SEEA 4D7YA 3POSA 2D40A 3PVEA 4DY3A 2ZBJA 2A5ZA 5FRAA 1MZ5A 1ULEA 5KC6A 2B8MA 1K45A 4MXWB 1RHI2 1QJY1 1HRI1 3FUQA 1OFSA 2YUEA 3IPVB 4QDQA 1T6GC 2OPKA 1W6OB 2QQIA 4AFCA 2PHFA 4QQLA 1C57A 2V72A 4GJYA 4EZHA 4DPNA 2TBVA 1XBFA 1R1A2 2A3XA 1SBDA 3U11A 3I2OA 3IN9A 1PK6B 3WT3A 2Q30A 4RHV1 3E5QA 1AL21 1E5IA 1Z7S2 2Y6JA 1ALYA 1AJOA 1IKQA 4NWVA 2I74A 2ZGOA 3HVDA 4MGQA 3WG2A 4GWIA 4P08A 1YO8A 3B02A 4BQ2A 1DGLA 2J1AA 1AYN1 2VY0A 3OBRA 3RZMA 3DKWA 1ZRCA 2ZXQA 4Q4V3 3M4FA 2CSGA 3FX3A 1MACA 2PFWA 1VBD3 2Q5TA 4Y1ZA 5C5TA 3OG2A 3BUCA 5FKCA 2Q8OA 5F7UA 4L99A 3ZVXA 4D3WA 4QXKA 3VKOA 1OPOA 3FN9A 4LBLA 2UWAA 1RXFA 3K77A 1DGRA 4BQ3A 1OKOA 1NY71 3KZ4C 4HLTA 4Q2FA 4YZ2A 3GDBA 4LBMA 1AR72 1O5UA 4F7ZA 4IESA 3MLJA 2K46A 1OQEA 1W6NA 2CDOA 2YPDA 1HIXA 3JCIA 1JUHA 5L7OC 1ACCA 3WCSA 2G9FA 3B5LB 5JWPA 1QMJA 2NPIA 2Y60A 3FMGA 4BU2A 2WA4A 5F3IA 5FR3A 1CX4A 1Z0HA 1UIJA 2V73A 4LIUA 3UETA 2VUCA 4FPYA 2YC4A 1J83A 5CYYA 4DXSA 1W0NA 2XBO2 3EHKA 4R4ZA 3USUB 2GH8A 3D82A 3ZM8A 1HRV2 4PDWB 3S30A 1COV3 3MW2A 2NZ9A 5E6HA 4R4XA 4RQPB 3CEWA 5FPBA 1VAMA 4GD4A 4CEYC 1GYKA 1UU4A 5ACA3 5KXEA 4FPEA 2D93A 2BJSA 4HMZA 3RZGA 4QPIB 2AACA 3RS6A 4G3YC 3VBHA 3BPZA 3EBRA 3TBDA 4IL7A 4XIKA 5BYNA 4LTAA 5T54A 3BU0A 3OPZA 4AK3A 5KR7A 4HK9A 3ZFGC 4NAMA 3JQXA 5IW0A 1KGYA 3AZWA 1QQP3 4I01A 4R9DA 5IVBA 2W1QA 1OH3A 4TYSA 4MSVA 4EN9B 2ZGSA 5A3PA 3N9PA 3S57A 5A7PA 1QGLA 4AI2A 4B4PA 1F5JA 2DU0A 1RUF2 5FO8B 2A70A 4IDZA 5HBAA 1VMHA 5FZ8A 2VMCA 1EP0A 1RUC1 2YG0A 1GNYA 2ETEA 2YPJA 3DF0A 4N53B 3ZSJA 4FOWA 1O4TA 2C0ZA 4Y1YA 2RVAA 2ZJCA 1EYBA 4BXFA 5BNPA 4QD2A 3AJZA 4GIQA 4IQPA 2ZX0A 1UZ0A 2YGLA 3KMHA 1BVVA 3ZFFB 4ARYA 4CSWA 3D0JA 5JZGB 4WVMA 2ADDA 4TXWA 2WZR1 3AL6A 4CP1A 1VJ2A 1XNBA 1GP5A 4LO8A 2HWC2 1UU5A 2O14A 1GU3A 1TMF2 3ILFA 2KR2A 3POEA 4GMP1 2P3YA 1JZ4A 3RZLA 1H1MA 3IDBB 5FY4A 5T52A 4Y3OA 1PX4A 1QJEA 2Y34A 5DDJ2 4FP3A 4BA6A 4JHTA 1JOBA 1IOAA 5AFEA 1YLLA 5I8TA 2QE3A 3O12A 4GH4C 4KG8A 4XZPA 4CCKA 1UYPA 4AFMA 2GC3A 4QKNA 3MF6A 4N7UA 1VBC3 4YG0A 1SFYA 2WLQA 4ZU4A 5FO9B 1QNWA 4Z92B 2ZS6B 4AFAA 1GSLA 2RS11 4FXKB 2WNVB 4FBFA 3H7YA 2YU2A 1X36A 1ND2B 1BCXA 1PO21 4UW5A 5FDBA 2PHUA 1ZBE3 4QXHA 4CU6A 3O0WA 3CJIC 5FJHA 4OHXA 1DGWX 4S2GA 4OMCA 1ZZCA 2DVDA 3EXUA 2EIEA 3J7MA 4LBKA 4CDXB 4Y1VA 4QQHA 4NPRA 4I3PA 1JUIA 4OCTA 1PIV1 4DUWA 4E4SA 5CG9A 1PZ8A 1ZM1A 5A32A 5FP9A 1AYM1 3OY8A 5F2SA 4Q0PA 1RUJ1 4XJAA 5H9QA 5IVVA 2W87A 1DZQA 5JR2A 1W39A 4DXZA 3MUZ1 3MBWA 1NG0A 2UY9A 2ZTNA 4FPLA 1CONA 4LBJA 1TNRA 5FY9A 1SLLA 1SLTA 1XNCA 4JGYA 4L11A 4NHYA 2YZ4A 5FZ4A 1A8DA 2VVEA 5BPXA 3KHCA 1QJFA 3FBYA 1BKZA 2B45X 2AR6A 2WC2A 3LOBA 4LE4A 1YIPA 2VL4A 4P9LA 1ZRFA 4HONA 4K8RB 2OKXA 2DCJA 4Q4V2 2P1BA 1HN0A 4M0NA 3TEYA 4CCOA 2B5HA 3MV11 1IS4A 1QU0A 1RTVA 2XQXA 3U4SA 3V0BB 1HW5A 4YW5A 2ZGKA 3OGSA 1C5IA 2FQPA 3KV4A 1VBE3 3LE0A 1YFUA 3N36A 2JEMA 3RYKA 2A3YA 3H3ZA 5FXXA 3I8TA 2AENA 1RMU1 4YGBA 2HWD2 4A3XA 2YV8A 4YW7A 4E8CA 4CXWA 4Z2WA 2JD9A 3FWEA 4NPLA 4YG3A 1I5PA 3VBOA 4E4DX 2FD8A 1SPPB 4YM0A 2JJ6A 4MOAA 4BWOA 2BVBA 2RDSA 3BGAA 1IPSA 2IUWA 3ZYJB 1S0JA 3T2OA 1JYXA 1GV9A 1OOPB 4M01A 4P00B 3UNPA 3OYWA 3ZPOA 3IDAA 4FTSA 1LEMA 1WLWA 3M3IA 2WRAA 4CP9B 3ZN6B 4D0QA 1PGW2 1SFNA 1RUE3 1G8WA 2A75A 4ISQA 3VDDA 5ACA2 2C9KA 5I0RA 3QLQA 2ZGPA 2ZHLA 3FFZA 3HAGA 1HXS3 4Q4Y2 3U14A 1OVSA 2CL2A 5BY5A 3LAGA 1N1TA 2Y6KA 3INAA 3ZFEA 1F2NA 2BBVA 1EPWA 1RUH2 2JXAA 3H1WA 1BEV2 2VMFA 3JZVA 1JYWA 4URTA 4M3CF 1L7LA 4KBZA 1XRUA 1IZ3A 5L19A 3BOPA 4K6BA 1U0AA 4KWLA 1FPN3 3NAPB 5JXHA 1U5ZA 1K5MB 3CU7A 4KWUA 2VTXA 1QQP2 4XUNA 3HBKA 5FTTC 4K9SA 3ZXFA 3JD71 1RUI3 3VUOA 1BQPA 2VZ3A 1VBB2 3POIA 2UYBA 1RUD3 2VMHA 4Y22B 5FZCA 2AEZA 2J1SA 2YC2A 1C1FA 4N43B 4PIZA 3SNMA 3WF3A 5FJKA 4D7SA 3VBHC 4C1XA 2E63A 5EYXA 2R061 4CDWB 2FZ1A 5FYIA 1V6MA 4LBQA 4NPMA 5JCTA 1ZNPA 2GN7A 2VMEA 4AHXA 1V9U1 2H6CA 4AEJA 3LCPA 5DAVA 5DQ0A 4NJ4A 2IC1A 4UFHA 4CCJA 5GLTA 4XOGA 1IS5A 2C9AA 4AAXA 1VMJA 3J7LA 1W3XA 2WZEA 3HIFA 5IVYA 1S0EA 5IK7A 2ZX1A 4NROA 1QJZA 3GXUA 3GF6A 2DBNA 1KS4A 2LS6A 2SLIA 3D3AA 1QXJA 1PNGA 1UZZA 3POJA 4JKMA 1YXWA 4N90A 3WZ1A 5C3PA 5F37A 1G9DA 3VBUB 1DYPA 1NQJA 2AYHA 2JDAA 1D4M1 2MEV3 4FFHA 5G04L 1JXNA 5EZWA 3AKQA 4QT6A 3MUY1 5LZ6A 2VOKA 5BNPC 5C8WA 1VBA2 1IG3A 4IEPA 2WJSA 4XZUG 2ORXA 2OX0A 2O0OA 2BEOA 3HBZA 4AE2A 4C91A 2RM21 5ERLA 5FP8A 4TWTA 1K42A 1PX3A 1SFPA 5GM0A 2IXLA 2Q1ZB 1GFF2 1GNHA 1XJAA 3NQHA 5CFCA 3RSJA 3U78A 4EWEA 2K9ZA 4AR2A 3CF6E 5IVFA 1E5SA 4F83A 5GZCA 3MHZA 1FV3A 5C6CA 2PLV2 1AX1A 3VBRB 1WMXA 4QQOA 5A7NA 4MXWA 3KQ4B 5CFDB 1JZ7A 4KBBA 5DAXA 1LOAA 3I59B 3GJAA 4YVWB 4B1LA 1CIYA 1AXYA 3FHQA 4RA0A 2W3JA 2EA7A 4ZZ5A 4FAHA 2KXLA 1Q8VA 5LB6A 4XQ4A 1YQ8A 1GZWB 4PLMA 4YZ5A 2HWE3 2AUYA 5FYCA 5LASA 4RR3B 3S6PA 3ZIXA 4AGVA 5APAA 5K0UB 1O6UA 2G4IA 5F5QA 4M3CA 4GKXA 5HCFA 4QX2A 3WDVA 2PA7A 1TME2 3I54A 3LIHA 4PI0A 4QB2A 4W8JA 2IZWA 3GJBA 1YJKA 4ZS2A 3WY6A 4QX8A 2BYVE 1UN1A 2R072 2DWRA 1VALA 4IE0A 1CIWA 2R16A 1OUSA 1YQ5A 3BTAA 5F3GA 5F8PA 2DFCA 5IWFA 4YYOA 1L7QA 1AL0G 3S5AA 3H0OA 4A2UA 4LLFA 3P3NA 4YGDA 1S0CA 5AC92 3CZJA 2N7GA 3X29B 4LO4B 5CISA 3V64A 4KNCA 2IXJA 1V00A 3LDRA 2PHWA 1TNFA 2C6SA 3L9JT 3OD0A 1WMEA 1S0GA 4YWAA 2WQ8A 4XF0A 3N3HA 1UX7A 4HL0A 3G6JB 2XJPA 1GR3A 3MGUA 3ITQA 1ND3C 1UY3A 1W8ZA 2FMDA 2BQPA 2RJLA 4GB33 3KVBA 1UY0A 4P5YA 1LHVA 3VBOC 1CR7A 1JI6A 4UFIA 4XUTA 2B46X 2HEWF 3I2FA 3JXSA 4YFWA 1PO13 5A6YA 5H9RA 2RS33 3DYMA 3UKVA 4S2FA 5T3NA 3W21A 4IE7A 5L9BA 2WT0A 2D97A 1DIWA 3LEMA 4N8MA 4XCAA 4YVSA 2GNDA 4D7TA 4YM1A 5FZ3A 2JB4A 5FYHA 1KDMA 1W8TA 1O8PA 1MVEA 4PDWA 5FP4A 5FZHA 1UXXX 2W94A 3PL0A 2ZMLA 4ISRA 2JICA 1AR61 5DZGA 5FMDA 5A7OA 5IAXA 5KWRA 1UKRA 1JZ2A 3A0KA 5CVRA 2VULA 1CGPA 1UYZA 2HLEA 1NXMA 1OPMA 4X6QB 5FYYA 1I6XA 1DZRA 2VQ0A 1B35B 2W1WA 3M8LA 3POBA 5H9PA 4AEDB 1RUI2 2RR12 4GKYA 2WNEA 4XURA 3HNMA 4IEWA 3LPFA 5C7GA 4OLLA 1UXZA 1RUD2 4Y5SA 3PUSA 3ELNA 1BBT3 3NNMA 3ZFEC 1MEC3 2A6YA 5A3LA 4DOUA 2EAKA 3GZEA 1CVNA 1FMD2 1S0IA 2ZKNA 4L92A 4NIAA 1OLME 4OHWA 3WD5A 5JOXA 4FTEA 3UGGA 5JOWA 4XCBA 4MVTA 4M4PA 4QDSA 4AQSA 3ES4A 4QPYA 2H6BA 4YARA 1KRIA 3I2KA 4CCEA 2GMMA 4CUAA 5C70A 1DYKA 1DYOA 3TYJA 1EAH2 3ACFA 3KSCA 4FT8A 1R092 5FP7A 4NIDA 4A45A 1KFXL 4NHKA 3ZX7A 2JD4A 1MZEA 4SLIA 5CKQA 2VQAA 4I09A 5IK4A 1ULGA 3WNLA 2HWF3 2XMLA 2OPWA 2BWCA 2QKDA 1I9RA 1RVF1 3HWJA 2J1EA 4NHXA 1UL9A 5ANNA 4JHZA 4B3NA 3P6BA 1HJFA 4LHSA 2FCVA 2ZZJA 3VKFC 4AEMA 4CCNA 1GWMA 3A7QA 2C1FA 3FC0A 4LKEA 4QXBA 4WZFA 5JZGA 1KITA 3JBG1 1OH4A 1HB1A 4WVWA 3MO4A 4IV3A 4K20A 2DCYA 4PBPA 4XF4A 4DY5A 1FT9A 4GMP0 4J1XA 1QOSA 3I4IA 4I3GA 4ONUA 2R0HA 1K3IA 4I02A 5FYTA 5A33B 3APBA 5L73A 4KMQA 3IB3A 1NE6A 1JW6A 1GZ9A 1ZA7A 2J1VA 3HQRA 3WG3A 1RHI3 2WAAA 1Q56A 1J58A 5B2GB 4CE8A 2VZOA 5JI7A 5FLIA 2C24A 1UZWA 3A0NA 2AH2A 2BFUL 2XVLA 3DECA 2W2IA 3ZR6A 1AHSA 4D69A 2RG4A 3T2PA 1X7NA 3UT0A 1O7FA 1R1A3 1LOBA 5FZ7A 5IFPA 4AYUA 4C0BA 1OVPA 4DINB 3DCQA 4V2VA 3N9OA 2X10A 3VBFC 4CDXA 3OBTA 3BN6A 4PT6A 3M3CA 4EN6B 1UAIA 5HI0A 4RS5A 5CFCC 4E27A 1W90A 1U5IA 1UU6A 2HWE2 3RDIA 4OHZA 1PGL2 1V6LA 1QJU1 2GDFA 3MFAA 5FWJA 4XBLA 4TZDA 2WYFA 3TEWA 1ZYBA 5LY1A 2FDHA 2ARCA 4OI1A 2P6CA 3WF1A 3ZYRA 1US2A 3KHBA 4Q1PA 4ZXKA 3B00A 5LA9A 5E16A 5A3NA 4WM8B 2FHRA 1VB2A 4J1WA 2ARAA 3VHOA 3WDYA 1YJLA 2EXHA 4JRAA 1AR81 1NKGA 3W59A 2DVGA 4TLGA 3T4VA 2E31A 1JTZX 1UCXA 2DUOA 1ND3B 1H8TC 3V0BA 1AR73 2YFUA 2WS92 3K3NA 3V65A 2DCKA 1BHGA 3FBMA 3N9QA 2VQTA 3AZVA 3POFA 3U75A 4Y24A 1X8MA 3SXWA 1MS1A 2WNUC 3I3DA 5BUVA 3T0DA 2QBXA 1CJPA 1BLZA 2VR4A 4TSVA 2QFEA 5BNNA 5JXIA 5A3MA 3AC0A 5F2WA 3I3BA 1J3PA 1Z7S1 1XE0A 1SPPA 5LBFA 5IAVA 2PQQA 2DUPA 5FWEA 5E1RA 3WV6A 5CKMA 3AP7A 2XBO3 3LA3A 4Q4W2 4CZSA 1HRV3 1NA1B 3GBGA 4XACA 4FFIA 4NR1A 3WF0A 4COUA 4WM7C 3BIEA 1OOPA 1SMVA 1NUKA 2WLPA 1MS9A 1O4YA 2ZEYA 3J9SA 4K3UA 2VW2A 5GLUA 5T55A 2DTYA 4EWAA 3N7LA 4F3JA 1SBFA 4Q4X1 1V6KA 5JSOA 1GQHA 3VBSC 1CAXA 5IVJA 1FNYA 3J7NA 2EALA 1OLRA 1NT0A 4OI4A 1RC6A 1PM7A 5L9RA 1O4ZA 4YGCA 4Q0SA 2Z5WA 5GJ6A 3HMYA 1HB2A 1SLAA 2RMU2 5EQUA 1W03A 2X5IB 1SQ4A 4PCRA 2CGPA 1BJQA 1A6CA 2IXKA 3H8XA 2BNNA 2VCBA 1SCSA 2MNGA 1AUYA 1ZBA2 3FZ3A 4P02B 4L97A 1C5HA 4LBOA 2VZPA 1X33A 4GJZA 2VVDA 1PM4A 4YNIA 1DFQA 1PVC3 2Y6HA 5FPXA 3D0SA 3M70A 4NUBA 3TN92 1MEC2 1Q8OA 4YVSC 2PHDA 1RUF3 2DURA 2W08A 1F9KA 2LALA 1CESA 3AXEA 3GYDA 1UQXA 3J7HA 5JIUA 1H0BA 3NAPA 4N7IA 5FIXA 4YSFA 4MZUA 3R0RA 3OUHA 5IVCA 1QJX1 2ZGMA 3U10A 1YFWA 2DUQA 4MGYE 3ZPYA 5FZEA 5C71A 3AKTA 2NP0A 5J37A 2EF6A 2XDVA 5FREA 1K5JA 4N43A 2XJSA 1F8VA 4UW6A 4AW7A 1JZ6A 3VZOA 4EYUA 1R1ZA 4BQXA 1ASJ2 5E89A 4IEVA 1DQ1A 3AZZA 4WVVA 4DEVA 2XLFA 1GQPA 2HWC3 2JG8B 4NE9A 1GWLA 4BQ4A 1MQTA 1TMF3 1O3RA 3H3LA 1FOD1 3VZLA 4D8MA 3KD4A 4DRRA 1W6QB 2YXSA 4OI0A 5DDJ3 5LA1A 2E7AA 1W06A 1YQ6A 2W91A 3C7OA 4FP2A 1YNAA 5A80A 3RJRA 4A44A 4EQVA 3Q8BA 4CVUA 4ZKTB 1FNZA 1RXGA 4Z1VA 1DDLA 2BWAA 3CKHA 1Q8PA 1OD3A 1NX9A 4AL9A 2QDNA 2V4VA 5FUNA 4AI9A 4YM3A 2WA3A 2PAKA 2RJKA 4AVSA 4EZ4A 2ARXA 3T30A 1YFXA 4LXLA 4D6QA 1Q5OA 4XFBA 4HOOA 3AMMA 4MH0E 4Y5TA 2YU1A 2D3SA 1D2SA 3RI9A 1H6XA 2QQLA 4Y4YA 2PHLA 1X8EA 2HWB3 4ZHNA 4R8HA 1HB3A 4QX7A 4HETA 4CYDA 4JCKA 4IV3C 1UOBA 4EN0A 5I91A 4IEOA 5FLHA 3N9NA 1GKBA 5JXGA 3HT1A 3T1LA 5GLVA 3O1OA 3GZAA 4ZU7A 4CDUB 3NKTA 1W6MA 2P5BA 2VOWA 3K2OA 4GULA 4HZFA 1A34A 2WFF3 4QM9A 2QQVA 3PUIA 3ZYFA 3WDXA 2CY6A 5JDBA 1G7YA 1XE8A 3RPQA 1GOHA 1PGSA 1RUG1 3I59A 3NKGA 4YVWA 2W92A 1ENXA 1XU1A 5F6LB 4AG4A 1D0GA 1W8HA 4AVCA 1DLCA 1W2UA 3K46A 3LD8A 5B4NA 1GZWA 2JDMA 1D2QA 2VZTA 2HWD3 1OA2A 2Y0IA 3LF7A 5BNOA 3PIJA 3BTZA 4RS5C 4W50A 3OBZA 1O3QA 3DL3A 3KV5A 5IATA 4BH9A 3J4UH 3L2HA 3ORJA 4FOYA 1NCRB 2WBKA 4JC1A 3ZKUA 1IPKA 2FBEA 2ORZA 1OLQA 4Q8LA 3WQ1A 5CEHA 1Y3TA 3AKSA 3AZYA 3ZDSA 4UOJA 1MZFA 1UOFA 5FZGA 4JQRA 1XYNA 5FP3A 1WCDJ 3BODA 4XC9A 1UKGA 1XNKA 3UV9A 3DPRB 1H30A 4NO4A 1T2XA 1WCUA 1XQNA 2PELA 2J7MA 4AVAA 4MUVA 1REDA 2JDPA 4UT5A 5A1AA 1AVBA 3QOPA 2XHKA 4BZ4A 1QIQA 3TEZA 4JGZA 1CZTA 1C8M2 2Q1MA 2OZJA 3PTYA 4PLNA 4XVHA 2YMZA 5LA2A 2XL7A 3AB0A 1UY1A 3I3QA 3KF3A 4Q4Y3 4AHYA 5I0SA 2Q0AA 4XE9A 1VBD1 5HCBA 1YQ2A 3GBWA 4AOCA 5BNNC 5C9AB 2FDFA 1GBGA 1UYXA 1RUH3 2Y38A 1BEV3 2F6BA 1SBEA 1LOGA 5FZKA 3NV2A 1H2NA 4HKWA 1FV2A 4BQ1A 1HV0A 4CEWA 3THCA 4YPJA 2ZABA 3GBFA 5FYVA 1S0FA 5J7MA 3EB7A 3M1HA 5D8AC 4Y20B 4BXSV 1UIKA 3CNAA 3BI3A 1PVC2 3DYPA 2VC9A 4URAA 1VBB3 2BNMA 4E2GA 4LITA 4XTPA 4Y26A 4PF5A 3NW4A 2ATFA 2WKKA 2X09A 3GZUC 2FDKA 1VPHA 1ZA4A 4XFAA 4Q29A 4GMP3 2XWJB 2FDIA 5C8CB 4GWJA 1B35A 5ABJA 4OQ9A 4JX0A 4AEDA 1ZRDA 3NO8A 2Y33A 1COV1 1EV12 4CCLA 4BIOA 3K4DA 1G86A 2A6ZA 5CG8A 3WP6A 4B4RA 3PUAA 3USSA 4YG6A 2C26A 4PQQA 2VOVA 3ASIA 4CCMA 4FPJA 3NNGA 4MXVA 4XF9A 1XNTA 4IV1C 3KT1A 5CZKA 1QJY2 1HRI2 2VOTA 1W8FA 3ZLIA 1DQ2A 3C7HA 1ST8A 2DCTA 2PYTA 4XBNA 3UJQA 1SACA 3HN1A 3I2GA 4OZOA 1NCQA 2OT7A 1PVXA 3DV8A 1LOFA 3NJYA 5GLWA 1QQP1 2XVKA 3NV4A 4A7YA 1PIV3 1VBA3 1H4GA 1RGSA 4XF3A 3AKRA 2ZA9A 1W6PB 4SBVA 3VGIA 1ZZBA 3NL1A 3VKNA 3ZYGA 4D94A 2AEYA 4FQZA 4ASLA 3ZYPA 2CWMA 4RHV2 1AL22 1RINA 1MQTC 2J1RA 2XUMA 4FXGB 2YBSA 1H9WA 5A3TA 4BE3A 1QNYA 1OF3A 4XAEA 1BZWA 5FMBA 3ZXGA 3WQ7A 2ET7A 4Y33A 2HWB2 4B7KA 2GP5A 4COYA 1IGOA 1AYN2 1XSQA 5A33A 5A7WB 3BTYA 5JXJA 2P3KA 4P9JA 4YFZA 1VAKA 2PLV3 3VL9A 5HV0A 3QH7A 1MS5A 2X8KA 5JIAA 3RMXA 3KGZA 1SLCA 2OW4A 2GAUA 4ZY9A 2FCTA 2QNKA 2BDRA 3WVJA 3LA7A 1J1LA 2F4PA 2RDRA 4QGLA 4AVBA 2WFF2 3N7MA 2GSYA 1NY72 4W4ZA 5E88A 1H2KA 4P9IA 4PIYA 2PTMA 1W8OA 3KS7A 3ZSKA 5JMOA 2YB7A 1VBC1 1W99A 1TME3 2PN5A 1XYOA 2WQZC 3WW2A 2UWCA 2EXJA 4CDQA 3AKPA 4O65A 3PNAA 5F39A 2R073 4FPFA 5DPNA 1IHMA 2V5DA 2ZACA 3PMEA 4LORA 4EE2A 5JSPA 3H8UA 3LFMA 1LODA 3WP3A 3SC7X 1RL3A 5FZOB 1ZBE1 5L7OB 2DF7A 3VKLA 3PURA 4I2OA 2GP3A 5AC93 3Q8EA 3HPNA 4BISA 1US3A 4AHZA 4A4AA 2E26A 3OGGA 2YC0A 5F5CA 2HYXA 5LRRA 4C1WA 5K7PA 3VDBA 1XSRA 2XLGA 2I2SA 4H7MA 5FOJB 4Q8KA 4WM8A 4BQYA 1OURA 2TNFA 3IDCB 2BERA 4BQWA 4AF9A 2IVIB 1W9TA 4YZ3A 2Z69A 4CEYB 5A6QA 3O1VA 2VD7A 3KT4A 1LEDA 5HXMA 1POQA 2Q4SA 3TWIA 1SEFA 5BNOC 1AR91 1QDCA 1W8NA 3FHIB 1IS6A 4O7XA 1LU2A 4LHNA 1PMIA 2ZPXA 4QU1A 1W05A 3BOWA 1JHJA 5BV6A 5J96B 1BK1A 5AFBA 1EY2A 4LMFA 5FZFA 5T5JA 2VZRA 5JAXA 3KV9A 2W39A 3CMGA 1LHUA 2WSUA 4BLJA 1U5YA 1RJ8A 3Q8CA 3E5XA 3ZFGB 4OHYA 3DEMA 3IAPA 4P5HA 1S1AA 2BBAA 3MZHA 1W2TA 1Z78A 4QPGA 5G05L 5FY0A 5ANQA 1VBE1 2IVJA 5A3UA 2GN3A 3AYEA 1VP6A 1PZ7A 3ZDVA 3RYRA 3WP4A 1W04A 5HXVA 4IE4A 1O59A 1Y43B 4YM2A 4UW4A 1RUC2 1WCKA 1UYYA 2B4KA 2DVAA 4HPKB 1O3TA 5FQ0B 1R64A 1LJ7A 4JGZC 4COZA 3RZKA 1DGWA 4KG0A 4XQWA 3ZSLA 1WCQA 1NOVA 2RR13 1OMIA 2BGCA 4LIVA 5DAPA 4OHVA 4K40A 3PIGA 4LBQD 4XF1A 2E6VA 3SCHA 2WZR2 3K48A 3KM5A 3PUHA 5GZFA 5F3EA 1LGNA 2HYKA 3BYWA 1JS9A 4ITCA 3MLKA 1LULA 1FMD3 1ZZ8A 3NNJA 3OUIA 1E5RA 4LKSA 5FY8A 5FXWA 3WF2A 1OLMA 3PJYA 4CEWC 4WBBA 1UOGA 2ZHMA 1RUE1 5AVPA 4AHWA 4UBGA 4Q27A 2CTVA 4CU9A 3VZJA 4FTBA 2OXBA 3ACLA 5D2AA 3GGLA 1EAH3 1Y9MA 1HXS1 1POV0 1R093 4HKLA 2ZGTA 2W52A 2VNOA 1X9PA 4GH4B 2VZQA 5DN2A 2JKBA 2QQPA 1HV1A 1OD5A 2A73B 2B42B 3E6DA 4M00A 3RI8A 4XPVA 1PO22 5IVEA 1LU1A 4DS0A 2LTNA 3DKQA 2XVGA 2ZAAA 1FATA 5ABJC 2VH9A 3W58A 1FPN1 2QQUA 3ZXKA 5A70A 5KHIA 3I97A 2J42A 4KGGA 4BMEA 4OQ8A 4IW3A 1PIV2 2JG9A 3CJIB 2E7TA 2VO5A 1RUI1 3HT2A 3LKJA 4M4RA 4ZONA 1AYM2 3E5UA 5F32A 1RUJ2 2QQWA 4AQ6A 3W5MA 2OQ7A 1CJDA 4CXXA 1JH5A 1QF3A 4Q26A 2WQ4A 3GHMA 3U4XA 3ACHA 2VNGA 2WIIB 2VUAA 4YW3A 3AMQA 1JOPA 3WNKA 4KGQA 2BUKA 1NCQC 3BU7A 3SQOA 2ERFA 4NRPA 4E8DA 1LOFC 4QQ2A 4QXCA 4B29A 1W9FA 2VCCA 4Y1XA 3PLQA 1H4HA 5FZIA 4PQ9A 3ZSEA 1MR5A 3O0VA 3RWKX 3IPVA 2O1QA 2ZX4A 3VDAA 1RMU2 1YEWA 4CP2A 5IT6A 1WBFA 2GNMA 1W6OA 5EJ1B 4P14A 2IXCA 4V1PA 1H1IA 1XXNA 4NRMA 1Q43A 4G9SB 4EN8B 1W9SA 3UK9A 2V09A 2OZ6A 4JVAA 4META 2Q8DA 5CIRA 4HT1T 2MEV1 3RQ0A 2JDUA 3CJXA 1WW5A 1YCIA 4QDRA 1PK6A 5LWBA 2KA3A 3AYDA 2VZVA 1ZVFA 3WNXA 3OCPA 3ENRA 3SEPA 5F5AA 4UI9L 4W6XA 3C7GA 3KVAA 3VL8A 5CBLA 4JGYC 5EHDA 3H9AA 3ST7A 2XB6C 4PI2A 1Y9GA 2E9QA 1JU3A 3WUDA 4XILA 2XWBB 1LENA 4ORFA 3AM2A 4DO0A 1NYWA 4N9IA 1F4HA 1AXKA 2ZGNA 2VE1A 3KLSA 2WS93 5TSWA 2P4EA 1QXPA 2WSVA 3IDEA 2UU8A 1KQRA 4AGRA 1J3RA 4XABA 2AZ5A 2G9GA 4CDQC 3N4MA 5LK7B 1F5FA 3GNEA 3WHUA 3WOGA 2P34A 5GALA 2QQKA 3MIGA 3NMBA 1O8SA 2I45A 3WNNA 3Q9OA 5T50A 3QACA 3D8CA 1NCRA 4Q4W3 4HG6B 3LQCA 3ON7A 2ZAHA 5DUWA 4A42A 2OQ6A 3RYPA 1SG3A 3PUQA 4P9YA 1LAJA 2H0VA 4OVEA 4L8QA 3O1PA 3JD72 1BVP1 3UGFA 3WDTA 2GNTA 2XL9A 2VECA 2YY1A 2R7EB 5I0UA 3N9LA 3RWNA 1JZ8A 3DPRA 1H8VA 2O8QA 3LSDA 3MPBA 2IXHA 2XJRA 2D6PA 4IE6A 3USUA 1YWKA 2Y0OA 1R083 2R062 3K51A 2RMU3 2DDUA 4RQPA 3LGRA 5KBFA 5KHKA 4AI1A 5D21A 2R49A 2R043 5C4WA 1KFUL 2WNOA 1D4VB 1ZBA3 3VBHB 4C8DA 3O7OA 3VDDC 5FOBB 1UF2C 4JZRA 1GOGA 5C9AA 5FK8A 2BZDA 4BIFA 4QPIA 3WW3A 3RRDA 3UYJA 2CAUA 2YFZA 2VTFA 1YYNA 5E8AA 5EWSA 2JDYA 1J59A 3WNOA 3MIEA 4KU8A 4FFGA 4QPGC 3TN93 3WNMA 3BVCA 3IT8A 3F95A 2D6MA 3W9AA 4GB31 1DF0A 4MADA 1G9AA 2BRTA 4XAAA 2Q1FA 3AFKA 2LW8A 5CU1A 1UO9A 2YYOA 3AFGA 1VE0A 1IKPA 3WF4A 4A6OA 1D4M2 5HCHA 4ZPIA 1N1VA 1KEXA 4ES9A 1PO11 3VZNA 1KXGA 2RS31 2WN2A 3WDUA 3WINE 4DB5A 3PMSA 1HLCA 2EXKA 1REEA 2EICA 1ASJ3 3H3UA 1X50A 4LKDA 2WINB 4XJ9A 5C8CA 2JE7A 5J09A 1HJGA 3LB9A 5HCAA 2RM22 5GLZA 4CCDA 1HQNA 2NYYA 2NM1A 4IE5A 4RGGA 3UKTA 4AAPA 5BNPB 4N53A 5CB7A 3B94A 5FY5A 1BMV2 1ENQA 4WVMB 4NIIA 2YBKA 3BIWE 3FUOA 1LGCA 5J98B 3FFQA 2LUWA 1W0PA 4PHZA 3CZUA 5LW9A 2CGOA 4JDMA 4PIXA 3ZFFA 2PHTA 4LUKA 2NQYA 2WABA 4K8FA 3I3MA 2EIGA 1LNSA 4B8EA 1D7PM 1GP4A 4U36A 4I0AA 5FAXA 1WKYA 1U5XA 2RS51 1QY4A 4UXAA 3ILRA 3RMYA 1BBT1 1MEC1 1ENRA 3B93A 3LZZA 1CAUB 1LKNA 4GALA 4MO3M 3B01A 3OEBA 1DGRN 2CHHA 5FZDA 4XETA 5IUQA 2WO1A 1VRBA 2PHXA 5FY7A 2QCSB 3RZZA 1HDKA 4YW1A 2K0GA 1QJU3 1RUNA 3A23A 3PVOA 5FYBA 5FY1A 2W95A 2WNVA 2JG9C 5L36A 1CZSA 5FBZA 2P2KA 3IMNA 1ND2A 1OUXA 2J1TA 3VKMA 4BHPA 3ACGA 4MGTA 2EAAA 4QM8A 1WLCA 3S7IA 4A3ZA 1NZCA 5A32B 3C7EA 5JPNB 3OY8B 5A7WA 2HWF1 3WQBA 2A6WA 4UFMA 4HFSA 5L9VA 4KWJA 2VGDA 3HQXA 1DBNA 3TOJA 3LEIA 3ZSMA 1HQWA 2ILMA 1PMHX 2NMNA 1YQCA 3J8F1 5GZDA 1W28A 3QBQA 2ZMKA 2A6XA 5FZ1A 3SH4A 2B7YA 1DLLA 1VRH3 4FPHA 3VD5A 1GWKA 3O1MA 5DAWA 4K1ZA 1WD3A 3O1RA 3C8XA 3EQEA 3NJVA 1RHI1 1QH6A 1ZZ6A 2D43A 2K2SA 2QZ3A 3MV01 2QUOA 2BPA2 4HSLA 1O91A 2CYFA 1UZYA 4DXTA 1BXHA 4E9KA 3CL1A 3WG4A 5JI9A 1JU4A 1SLIA 3R4DB 4OYUA 5EXOA 4QGMA 2HH9A 2W5FA 1PK6C 4E2SA 2J22A 1WGPA 3VBOB 4EV0A 2P3JA 2G1MA 1R1A1 1MVQA 2ZGRA 3C7FA 1MS4A 2B9VA 2GC2A 4JQTA 4UF0B 5FZOA 3SCGA 5EFUA 3ZR5A 4B7EA 4CXYA 1TQ5A 1CPMA 1OSGA 2AREA 4NVPA 4U2AA 2R30A 5A1LA 4AEKA 3IAQA 2A1XA 4QHOA 4W6YA 3OYWB 1AR62 3K4AA 4IXLA 4OUEA 2XKOA 3A21A 5DXDA 5DUVA 3EJKA 3ZXJA 1UOJA 1C8M3 2FDGA 4CEYA 4XMIA 3PVNA 2MPFA 5IFTA 2V4AA 4H14A 4CP9A 5M0TA 3ZN6A 4HVQA 3AL5A 4O61A 3VDDB 1H6YA 3AZXA 4AQTA 1W8WA 5FYZA 5CA6A 4MHRA 1XNAA 1R082 4JRLA 5KXCA 3P5BA 4Q5OA 1MS8A 2W9XA 2WZPP 1POV3 4J6GA 3H42B 3ZFEB 1YI7A 4R9CA 5FKBA 2R042 1G9CA 1Y4WA 3B69A 2XH6A 2VXRA 4XDOA 2BFUS 1XC6A 4IGQA 3WLUA 5IK5A 4LBNA 1AR71 3LDBA 1CPNA 2JKXA 1DCSA 4CU8A 2VOXA 2XHNA 2CDPA 3KCYA 2HEYF 3SH5A 2Y6GA 4DEQA 4ES8A 1CWPA 1FI2A 1OHFA 4C90A 3KGLA 4DUVA 4IEXA 3B9CA 3BALA 3QD6A 4N9HA 4PDWC 3D6EA 3ZN4A 1AF9A 2W1SA 1XYPA 1K5MA 4PLOA 4RQPC 3SMHA 3VB9A 5F1RA 2P6HA 5FQ0A 1YI9A 2CNAA 3N7JA 2ZMNA 1RVF2 2XBO1 3R05A 4MYEA 2OA2A 2VCMA 3I2JA 1HRV1 4BPZA 4Z2AA 4IERA 5JMCA 1EV13 3JBG2 3KWVA 4Y22A 4LBQB 3MIFA 4QPIC 5I0DA 4LJHA 3Q8FA 3AVSA 4XJ8A 4BMBA 2GZWA 4QWNA 4CDWA 5CNAA 4EROA 1A8MA 1UX6A 1OQ1A 1WW6A 3CQOA 1REFA 4TLFA 1DQ5A 1DZTA 2EIDA 1W9YA 5LATA 3DXTA 4RGAA 3VD9A 3E97A 3P3PA 3SH3A 1QJY3 1HRI3 4ZZ8A 4IGOA 4LHKA 1Q3EA 2E51A 1GZCA 2ZEZA 4XQDA 4O9GA 1ULFA 3CIHA 3MIBA 3TNPB 3LEKA 1HKDA 1OF4A 5FZLA 1C8NA 3MW4A 4NRQA 1H9PA 3WX5A 4CCCA 1IS3A 3FE5A 1J84A 2SBAA 2VMGA 3AP4A 1RUF1 3JB4C 3NV1A 1AL23 4RHV3 4S2DA 5FBJA 3VBUA 2OUJA 3O0XA 4K7JA 4Z07A 5FZBA 2FZ2A 1XE7A 3GCWA 3AMHA 3POGA 1HX6A 5DZEA 2C4XA 4WVZA 1N3PA 3CJIA 5EYYA 3WP5A 4Y5Z0 2NN8A 5JZGC 1ENSA 1QJU2 1T6BX 2FMYA 3ZFFC 1AYN3 5A7SA 1XB9A 3VBFB 4XHXA 5IYYA 4MX3A 1V0AA 4OULA 4OZXA 4DUXA 5CFCB 4LO7A 3R4SA 1ZZ7A 2VW0A 1DQ0A 2WFPA 4RL7A 4XDPA 1UPIA 2WO2A 4EN7B 2QQOA 2DFBA 3I2HA 2HWC1 3B3QE 4LLOA 1TMF1 4FO9A 2NLRA 1RB8G 3GM8A 1JODA 4CA9A 2WN3A 4QU2A 1C1LA 2BGOA 3T08A 2Q8EA 4CUCA 1AR82 3LEGA 1N3OA 5CAZA 5DDJ1 2JIJA 2DYCA 5IK8A 4QX0A 1WA4A 3VBRA 2IWGB 3SHRA 2QJVA 3OEAA 4GAZA 3HQUA 1UMHA 5GZEA 2XQRA 2WNVC 5CFDA 3RGBA 3C2UA 4CTEA 3ECQA 3H8RA 4ASMB 1ND2C 2Y8KA 3H7JA 4PBOA 3THTA 5T5PA 1H8TB 5DABA 4D6RA 1F31A 2ZX3A 1VRH2 4LOTA 5FZMA 1OA3A 3SISA 4M3CB 5LY2A 3TRSB 4CDXC 2WNUB 4RR3A 3N7KA 2LM3A 4JV4A 4XXPA 2VUDA 5K0UA 4D6SA 3VD3A 3WR0A 1LESA 1ONAA 5CADA 4GXLA 1IQAA 3ZXEA 2HWB1 4J25A 4IUGA 5FZAA 5EPAA 1GZTA 5DG1A 4DRVA 2W47A 3OOXA 4A41A 4Q4X2 4ATFA 4WM7B 5FFOC 5IHRA 1OA4A 3KQRA 4Q1RA 4INDA 1S0BA 2YGMA 2JX9A 1LECA 4W65A 4I0BA 4W6WA 2J1UA 1SDWA 3VBSB 3VZKA 1SCRA 1F15A 2Y6FA 2WFF1 1HN1A 2ZCWA 3I2DA 1E57A 3OGVA 3ATGA 1DG6A 2ZOEB 1W2OA 2WUHA 3ACIA 4IEQA 5EJ3A 1K12A 1QXRA 4JTNA 5F5IA 4Q4V1 4C0HA 1QWRA 3BCWA 2RDNA 2G19A 3E6CC 2XJVA 4BCUA 3VD4A 4XJZA 1ZRIA 1O5LA 2Q8CA 1FAYA 3MEPA 3K4ZA 3PHMA 4YZ4A 1W3VA 2HWD1 1I3HA 1JYTA 4LQRA 1NZIA 1D0HA 3V0AB 3AYAA 4YRDA 5DAQA 4RD7A 1QDOA 1QJX2 1WZXA 1XNDA 4XUPA 4YVSB 2W68A 4NIHA 4HN1A 1RUC3 4LPLA 3WUCA 2AGSA 1MS0A 1OOPC 1YIFA 3K75B 3RVHA 2OVUA 3NSTA 1HQLA 2XG3A 4I0WB 4AQ2A 2D3RA 2PAMA 4EWDA 2Z42A 4XUOA 3C3VA 4Z8BA 5LBCA 3U37A 2WZR3 1YHFA 1GANA 1I5ZA 4K1YA 1FOD2 2PQSA 4XIOA 3SKVA 1PGW1 4UFKA 2YROA 2Z4FA 2TEPA 2VNVA 3OSDA 1LHOA 3OPTA 4YGEA 3RG0A 2D98A 5ACA1 3TEXA 4FAGA 2YHJA 3IMMA 4HSJA 2ID4A 1W8UA 2PXJA 2XKPA 5JR7B 3DGTA 4PJYA 2XR4A 4Q4Y1 4JTOA 2RS13 5CKNA 2G9ZA 4Q0VA 4CRQA 1RITA 2P37A 1WUVA 3UGHA 1RUH1 1BEV1 3WDWA 5HPOA 3NAPC 1NLQA 1PO23 1OKQA 3O5SA 1K5MC 4CP0A 4S2HA 3MICA 2D6LX 1CAWB 1V6IA 3OGJA 3BTXA 1RIRA 4MGKE 3URFA 1VLNA 3HOBA 4RFT0 4N43C 1S2EA 3TNQA 2DU1A 4YLZA 4MGIE 3T2TA 1AYM3 1JHNA 2GMPA 1RUJ3 1VBB1 3MLLA 1Y7BA 2Y26A 4FOQA 3ZYBA 4CDWC 5LA0A 3LWCA 1LTEA 2KD7A 4IV3B 1I1EA 4NWWA 3ZXLA 2E53A 2UWBA 3OUJA 5C3QA 2H0BA 1CD3G 1S2KA 5DG2A 4JDNA 2QQJA 3I3EA 3W20A 1X82A 3JU9A 1ZRRA 2RJ2A 1TE1B 5H9SA 1V70A 2Y6LA 4B4QA 2OUHA 1M06G 1CAUA 4MGSA 3R6SA 1NXD1 1RUG2 1W9WA 1WW7A 1A78A 2FDJA 5BXXA 4AI0A 1Q8SA 3POWA 2F17A 3T0AA 4GWNA 1CQ9A 5F3CA 2CAVA 1MZ6A 1DQ4A 1OBNA 2XXZA 4B1MA 2FCUA 3AXDA 3VBUC 1AZDA 1C3HA 1RMU3 2GH2A 2R1BA 2VW1A 3DXUA 2CU5A 4JKLA 4MHUA 4X6RB 4WZCA 4XDQA 2JDNA 3SITA 3ZOIA 2WO7A 1HB4A 2VXJA 5K9YA 3WG1A 2LRPA 4AXOA 3MFCA 4AI3A 1PHMA 4FI9A 2BVVA 4RS5B 3IZOA 5KXDA 1VBA1 4HN0A 1E5HA 3KCXA 3E1F1 1YRZA 2TUNA 3ZXAC 3NRUA 3VHPA 1RJ7A 4ATEA 3GHNA 4YW4A 3MF9A 4LE3A 4E4HA 3H8OA 1ULPA 2VAUA 1JYNA 1AR93 5JUVA 2QDRA 2WL1A 3NWKA 5C3RA 5HV4A 4HVOA 5DUXA 5FZ9A 5A1FA 3T1MA 2WYSA 3VBRC 2L9LA 2BW8A 2WT2A 4QKBA 4Y4RA 1WLTA 5CFDC 2ARBA 4FPCA 2VZ1A 4LUMA 2PLV1 2ZEWA 3AP9A 4YVWC 3ROUA 3SKJE 1DHKB 2V5YA 1J3QA 1VBD2 4MLOA 4R9AA 5FMOL 5T5LA 2GC1A 2XPJA 4NOTA 3NNLA 2DCZA 1YFYA 4KQ7A 3VZMA 4RR3C 3AP6A 1ND3A 3FLTA 1RYYA 2XJUA 4V2WA 5K0UC 5BNNB 1JN2P 1CAVB 3LFIA 4RSUA 4E4ZA 4XMAA 3RZHA 1NLRA 3L2YA 3VHNA 4UF0A 5DMYA 3ZIWA 1UD1A 2WDBA 1KJLA 5I8YA 3JD73 3MW3A 1TME1 2C5DA 4QAWA 1LOEA 1S2BA 2JE8A 1OXCA 1L7RA 1B09A 2VCAA 4LK6A 4P9GA 2A7AA 2R071 4XFIA 5D8AB 3N9MA 3UJOA 3E6BA 1MS3A 1NA1A 4JKKA 2VZSA 4MV2A 2R063 3HR9A 3NJZA 4XJUA 1GQGA 3UESA 1CAXB 4BYYA 4PF1A 1LR5A 5AC91 5I93A 1V9U3 2ES3A 2UY8A 1UY2A 3N35A 5J36A 1MPXA 1EUUA 1COV2 2E7QA 4XFFA 1LRHA 5FPLA 2ZGQA 1EPZA 3MIHA 5KHHA 1W2NA 3OJBA 3VN4A 5A6ZA 1M4WA 1N3QA 2QZ2A 4QHBA 3WEZA 4UWDA 2P3IA 2B9UA 1LHNA 2X5IA 5FPVA 1VB4A 4RYDA 1BYHA 4HK8A 3JB8A 2RV9A 3B9IA 1KJRA 1H2MA 3ETQA 3A4UA 5I8SA 2EXIA 3UKNA 2XONA 1W2AX 2VU9A 4Q0QA 4FVVA 1SZBA 5FZ6A 3U07A 4JAAA 1H2LA 1D4M3 1TEIA 1WW4A 2X53S 5FZ0A 1PMJX 4IV1B 4AVVA 1ODNA 2W46A 3HNYM 3I49A 5K8SA 1N1YA 1NAEA 3IWZA 2D5HA 2RS12 4LA3A 5GZGA 5KC5A 1UNBA 2OYZA 3O1SA 2PMWB 2VBPA 2RM23 3ETPA 1QH7A 4UFJA 4AWDA 1IQDC 1JBCA 3U1XA 3WCRA 1PNFA 2Y64A 2VM9A 1JYVA 4H3WA 3MI8A 2BTVC 1B35C 4AEDC 3BPSA 4LKFA 3O1TA 3O14A 1C28A 5FK7A 1MQTB 2WWUA 5J48A 1WCSA 4FOVA 5FUIA 3PTRB 2XOMA 2JG8A 2RR11 3NJXA 5EIYB 2D7FA 2ADEA 1UY4A 5C5UA 1RUD1 2GALA 2ZKLA 4DXRA 5FMOS 1W6QA 3ZO0B 3KF5A 4Y1UA 3H1YA 1QKQA 1IG0A 5LCWL 3KB5A 1FMD1 2XJTA 4NHMA 4X8PA 4H2AA 5A3WA 3ZN5A 3FLPA 1S0DA 5BNQA 4GA9A 3I7DA 1UMIA 4XYXA 1JZ5A 1QOTA 1A3KA 1VBC2 1EAH1 2QTWB 3HNBM 1R091 4FPGA 1JYCA 2BOIA 4CU7A 4LO6B 4DIQA 3F2ZA 2Z2SB 4NHLA 1ODMA 1YC61 5EJZB 4H55A 5JVVA 1NQDA 3VBFA 1ZBE2 2BGPA 3AP5A 5K4LA 1BMV1 1V6NA 4NN0A 4OMDA 1X9TA 2D3PA 2DTWA 2EVXA 4XEZA 3R4UA 3T2QA 4KL1A 4TTGA 1LCLA 1W6MB 4KI5M 4IETA 3T09A 1EUTA 2E32A 2LROA 1LOCA 4CDUA 1CN1A 4LEJA
chains in the Genus database with same CATH topology
1OUSA 1GZTA 1OVSA 2VNVA 5A6YA 5A70A 2JDYA 2BOIA 1OXCA 2JDNA 2VUCA 1OURA 1W8HA 1OUXA 1OVPA 2BP6A 2XR4A 3ZDVA 5A6QA 5D2AA 3DCQA 2WRAA 2JDMA 2JDHA 1UQXA 2JDPA 4UT5A 5HCHA 2JDUA 1W8FA 2VUDA 2JDKA 2WR9A 2BOJA 5A6XA 4AOCA 2CHHA 5A6ZA 5A3OA 4CE8A 1UZVA 2BV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUS A;  1GZT A;  1OVS A;  2VNV A;  5A6Y A;  5A70 A;  2JDY A;  2BOI A;  1OXC A;  2JDN A;  2VUC A;  1OUR A;  1W8H A;  1OUX A;  1OVP A;  2BP6 A;  2XR4 A;  3ZDV A;  5A6Q A;  5D2A A;  3DCQ A;  2WRA A;  2JDM A;  2JDH A;  1UQX A;  2JDP A;  4UT5 A;  5HCH A;  2JDU A;  1W8F A;  2VUD A;  2JDK A;  2WR9 A;  2BOJ A;  5A6X A;  4AOC A;  2CHH A;  5A6Z A;  5A3O A;  4CE8 A;  1UZV A;  2BV4 A; 
#chains in the Genus database with same CATH topology
 1WD4 A;  2R6Q A;  3JQW A;  4A7K A;  4IGP A;  2XUE A;  4XBQ A;  1QOO A;  4P9W A;  1J1T A;  4HVR A;  4GQ7 A;  2X05 A;  4NIG A;  2VBD A;  1AR9 2;  3ZYI B;  2UYA A;  5F6K A;  1KS5 A;  3PU3 A;  4QKF A;  5DZF A;  3AJY A;  4COW A;  4QPW A;  1UWW A;  5EP9 A;  5BNO B;  2GC0 A;  4MG2 A;  3M3E A;  1H8T A;  3GAL A;  3OGR A;  5ISL A;  3AX4 A;  1VAV A;  5FPZ A;  2DV9 A;  3IM0 A;  3M3O A;  3S5Q A;  4BQ5 A;  1JOJ A;  4G4F A;  3VD7 A;  2WNU A;  2WWJ A;  1VMF A;  4DNY A;  2VG9 A;  1RUO A;  1W6N B;  3HEI A;  1NE4 A;  1VBE 2;  3KV6 A;  1GIC A;  2R32 A;  4UBH A;  2CGN A;  5A3O A;  4QX1 A;  2YDE A;  4UYB A;  1O3S A;  4DFS A;  4R52 A;  4GWM A;  4QMA A;  1AR6 3;  3K3O A;  3DYO A;  3WXP A;  3FLR A;  4CUB A;  1LGB A;  1OQD A;  2HWE 1;  1VR3 A;  1PGL 1;  2VMI A;  4LA2 A;  4WM7 A;  2RE9 A;  3PU8 A;  2VBB A;  5FPA A;  2JB8 A;  4WM8 C;  2CWS A;  3MYX A;  4L9B A;  1JYI A;  1N1S A;  4XFC A;  2MHF A;  1DP0 A;  4LR4 A;  4P9X A;  3EO6 A;  1OC1 A;  3VBS A;  4XJW A;  4JGZ B;  2VUJ A;  4LK7 A;  1APN A;  1GP6 A;  3CO2 A;  5C4W B;  1DU3 D;  3H50 A;  4BK4 A;  2UUR A;  4IEU A;  3ZXD A;  5LEJ A;  4XTM A;  4OUS A;  1V9U 2;  5LBB A;  3VHR A;  4BJ0 A;  3PJQ A;  1RUE 2;  3SCF A;  4LNV A;  3ZMO A;  2BV4 A;  2XLA A;  2WS9 1;  3III A;  4A7Z A;  4CEW B;  3RNS A;  3G7D A;  5FCC A;  1HXS 2;  5FYU A;  2I07 B;  3V0A A;  2JWP A;  4ET7 A;  5C3S A;  4RN5 A;  1NA1 C;  4QX3 A;  2ZHN A;  2R0F A;  5IJR A;  1ZZ9 A;  3VLB B;  4H7L A;  4Y20 A;  2P17 A;  2VVF A;  1RVF 3;  4Q4W 1;  5LEK A;  2VTX J;  3JUU A;  3DUI A;  1FPN 2;  5JOY A;  1L3J A;  3JBG 3;  3OTF A;  4OFG A;  2HEV F;  4QHZ A;  3HN3 A;  3B7M A;  2ZHK A;  4WV8 A;  2VJX A;  3NVC A;  5AVA A;  4BM8 A;  1ULO A;  2VQU A;  5ABJ B;  2HBU A;  4BOW A;  3RZJ A;  3PVB B;  3PDQ A;  1DQ6 A;  2AC1 A;  2RS5 3;  4FQ4 A;  5FYS A;  2X5I C;  5C33 A;  2W0X A;  2PHR A;  3AK0 A;  5F9T A;  4AFD A;  1R08 1;  4AVT A;  5J3U A;  5FPU A;  3NNF A;  4UW3 A;  5T5O A;  1FXZ A;  1OI6 A;  2ZGU A;  2RMU 1;  3IIA A;  4XXA A;  3ABZ A;  3HJR A;  2DBI A;  3LDK A;  4LUL A;  1VIW B;  5C3O A;  3U0Z A;  3W5N A;  2BP6 A;  2R04 1;  3OB8 A;  2VNR A;  3S0M A;  1ZBA 1;  2D5F A;  3LSE A;  4AGG A;  4FSJ A;  3ME2 A;  4E2Q A;  1GOF A;  4AI8 A;  2JEC A;  3H1M A;  2GME A;  1UPS A;  2ET1 A;  1QEX A;  1NLS A;  3WSO A;  1NCQ B;  3A22 A;  3HD8 B;  1WMF A;  3TN9 1;  3WNP A;  3M7A A;  4A6S A;  2HKX A;  1TVG A;  5LRS A;  1V6J A;  1CAW A;  2ENR A;  2OII A;  4ZXE A;  1G6N A;  3MPP G;  4NMI A;  3LPG A;  1OFN A;  3ZYH A;  1S4C A;  3GCX A;  5EV7 A;  3LOI A;  4IEY A;  1W6P A;  4EJR A;  2XGX A;  2MEV 2;  3ALQ A;  3MDP A;  3IKW A;  4QKD A;  2JG8 C;  3OBA A;  3J8F 3;  1P8J A;  1WLD A;  1G9F A;  1ASJ 1;  3THP A;  2JDH A;  3VV1 A;  4AZZ A;  4RFR B;  5I0T A;  1F35 A;  2X29 A;  1TZO A;  3AVR A;  3ILN A;  3OPW A;  4HBN A;  1WWY A;  4OI2 A;  1AX2 A;  3M3Q A;  4XFH A;  2D6K A;  2WR9 A;  5FXZ A;  1BK0 A;  1AR8 3;  3MID A;  3AYC A;  3BKZ A;  1ULC A;  5JLV A;  4JGY B;  3WHT A;  4ZS3 A;  2OS2 A;  3WW4 A;  1CZV A;  5KXB A;  5SV8 A;  2Z79 A;  2WO3 A;  2A6V A;  5FXV A;  5FUP A;  1CX1 A;  5B4X A;  4KWK A;  3CDZ B;  4XHB A;  1SHW B;  2IFW A;  1Z7S 3;  5JSR A;  3TB0 A;  4CDQ B;  1F4A A;  2XJQ A;  1FYU A;  5FMC A;  3SLI A;  2VPV A;  5GKA C;  1W0O A;  2JIG A;  2O8O A;  2WWS A;  3ZKY A;  4FFF A;  4UAP A;  1G9B A;  2A71 A;  4BDV B;  4DQA A;  1URX A;  4JDO A;  4M3C E;  4LT5 A;  2IXI A;  4CDU C;  4Q4X 3;  4CUG A;  4F8A A;  1IPJ A;  5L7O A;  2DVF A;  4KH9 A;  3ZMN A;  2D44 A;  3AMN A;  2WAO A;  1N47 A;  3I2I A;  3BB6 A;  4LHL A;  3D5O A;  2QQM A;  4QGN A;  4CPB D;  1OT5 A;  4QQP A;  4MGZ E;  4K21 A;  1LHW A;  1C4R A;  2WT1 A;  2BNO A;  1SLB A;  1UMZ A;  3RFR A;  3S7E A;  1XPW A;  4KU7 A;  3J26 N;  4CPB A;  2B39 A;  3KCC A;  3FL7 A;  2VZU A;  2EIB A;  3O1U A;  5FV3 A;  3NV3 A;  1WMD A;  4ASK A;  1GNZ A;  2D6O X;  1LB2 A;  2W1U A;  4HAN A;  2BOJ A;  3ES1 A;  3M2M A;  4FPO B;  1CAV A;  1VRH 1;  2DVB A;  2NMO A;  4DMI A;  1AXZ A;  2ZZQ A;  1TG7 A;  4GB3 2;  3CHX A;  1GLH A;  2A3W A;  1GUI A;  1NCR C;  1Y9Q A;  1ZX5 A;  2D6N A;  1QJX 3;  4QPG B;  4UFL A;  4XW3 A;  3T3Y A;  2QVS B;  3ZFG A;  4XFG A;  1WBL A;  3Q8A A;  1YUD A;  3WW1 A;  2IFR A;  5DUU A;  5SV5 A;  1AJK A;  5FYM A;  3IBM A;  2QQN A;  1ULD A;  3D4K A;  1KD7 A;  1PO1 2;  4L2N A;  2CV6 A;  2RS3 2;  5D8A A;  2F4L A;  4HKO A;  2RDQ A;  2ZEX A;  3DPR C;  4X8N A;  3TAY A;  2HJI A;  5LK5 A;  3GZT B;  5A7Q A;  4Z82 A;  4ARX A;  5JOZ A;  1S55 A;  3V56 A;  4HPK A;  2KM2 A;  1FOD 3;  2JE9 A;  2YBP A;  3AMP A;  3OF1 A;  4I30 A;  4R9B A;  5FLJ A;  3WQ0 A;  5C4W C;  2VMD A;  4NAO A;  3P1I A;  2ZX2 A;  5FO7 B;  2R1D A;  3FHA A;  4L0P A;  4QX5 A;  3EYP A;  5C9A C;  4BK5 A;  1C8M 1;  3VDC A;  3POY A;  4OUM A;  1V6O A;  2RHP A;  4RGK A;  1AX0 A;  2RS5 2;  4COV A;  5KHJ A;  1BBT 2;  3T0B A;  4DZG A;  4BLI A;  1WA6 X;  5LBE A;  5JPM B;  1POV 1;  1JZ3 A;  4YW2 A;  1H1A A;  4IV1 A;  4QB1 A;  2JDZ A;  1PZ9 A;  1QHD A;  3THD A;  1ZRE A;  1XU2 A;  4GZ9 A;  4GH4 A;  1STM A;  1U12 A;  4BB3 A;  2E33 A;  2ZGL A;  4YW6 A;  5D1I A;  5A6X A;  3UL2 A;  5KHG A;  1SDD B;  4TN7 A;  1PVC 1;  1UZV A;  3RJ2 X;  4M0H A;  4FPK A;  3QCW A;  3T4H B;  1GMM A;  2PAE A;  2JEN A;  3CBN A;  5C8C C;  3FJS A;  3CLP A;  3QH6 A;  4HXC A;  4LO5 B;  2JG9 B;  4YZ1 A;  1FX5 A;  2WZ8 A;  2HBT A;  4N53 C;  2GNB A;  5J1X A;  4QB6 A;  1KDK A;  3DN7 A;  2HWF 2;  4LOS A;  4ZU5 A;  1UW8 A;  4FCA A;  4O9E A;  1EV1 1;  3OD4 A;  1Q8Q A;  4AFB A;  3LA2 A;  4IEZ A;  3J8F 2;  4XUQ A;  1RUG 3;  1XOY A;  3KT7 A;  3EMR A;  2GU9 A;  2JDK A;  3LIG A;  1JMU B;  2BU9 A;  4Q0U A;  3SEE A;  4D7Y A;  3POS A;  2D40 A;  3PVE A;  4DY3 A;  2ZBJ A;  2A5Z A;  5FRA A;  1MZ5 A;  1ULE A;  5KC6 A;  2B8M A;  1K45 A;  4MXW B;  1RHI 2;  1QJY 1;  1HRI 1;  3FUQ A;  1OFS A;  2YUE A;  3IPV B;  4QDQ A;  1T6G C;  2OPK A;  1W6O B;  2QQI A;  4AFC A;  2PHF A;  4QQL A;  1C57 A;  2V72 A;  4GJY A;  4EZH A;  4DPN A;  2TBV A;  1XBF A;  1R1A 2;  2A3X A;  1SBD A;  3U11 A;  3I2O A;  3IN9 A;  1PK6 B;  3WT3 A;  2Q30 A;  4RHV 1;  3E5Q A;  1AL2 1;  1E5I A;  1Z7S 2;  2Y6J A;  1ALY A;  1AJO A;  1IKQ A;  4NWV A;  2I74 A;  2ZGO A;  3HVD A;  4MGQ A;  3WG2 A;  4GWI A;  4P08 A;  1YO8 A;  3B02 A;  4BQ2 A;  1DGL A;  2J1A A;  1AYN 1;  2VY0 A;  3OBR A;  3RZM A;  3DKW A;  1ZRC A;  2ZXQ A;  4Q4V 3;  3M4F A;  2CSG A;  3FX3 A;  1MAC A;  2PFW A;  1VBD 3;  2Q5T A;  4Y1Z A;  5C5T A;  3OG2 A;  3BUC A;  5FKC A;  2Q8O A;  5F7U A;  4L99 A;  3ZVX A;  4D3W A;  4QXK A;  3VKO A;  1OPO A;  3FN9 A;  4LBL A;  2UWA A;  1RXF A;  3K77 A;  1DGR A;  4BQ3 A;  1OKO A;  1NY7 1;  3KZ4 C;  4HLT A;  4Q2F A;  4YZ2 A;  3GDB A;  4LBM A;  1AR7 2;  1O5U A;  4F7Z A;  4IES A;  3MLJ A;  2K46 A;  1OQE A;  1W6N A;  2CDO A;  2YPD A;  1HIX A;  3JCI A;  1JUH A;  5L7O C;  1ACC A;  3WCS A;  2G9F A;  3B5L B;  5JWP A;  1QMJ A;  2NPI A;  2Y60 A;  3FMG A;  4BU2 A;  2WA4 A;  5F3I A;  5FR3 A;  1CX4 A;  1Z0H A;  1UIJ A;  2V73 A;  4LIU A;  3UET A;  2VUC A;  4FPY A;  2YC4 A;  1J83 A;  5CYY A;  4DXS A;  1W0N A;  2XBO 2;  3EHK A;  4R4Z A;  3USU B;  2GH8 A;  3D82 A;  3ZM8 A;  1HRV 2;  4PDW B;  3S30 A;  1COV 3;  3MW2 A;  2NZ9 A;  5E6H A;  4R4X A;  4RQP B;  3CEW A;  5FPB A;  1VAM A;  4GD4 A;  4CEY C;  1GYK A;  1UU4 A;  5ACA 3;  5KXE A;  4FPE A;  2D93 A;  2BJS A;  4HMZ A;  3RZG A;  4QPI B;  2AAC A;  3RS6 A;  4G3Y C;  3VBH A;  3BPZ A;  3EBR A;  3TBD A;  4IL7 A;  4XIK A;  5BYN A;  4LTA A;  5T54 A;  3BU0 A;  3OPZ A;  4AK3 A;  5KR7 A;  4HK9 A;  3ZFG C;  4NAM A;  3JQX A;  5IW0 A;  1KGY A;  3AZW A;  1QQP 3;  4I01 A;  4R9D A;  5IVB A;  2W1Q A;  1OH3 A;  4TYS A;  4MSV A;  4EN9 B;  2ZGS A;  5A3P A;  3N9P A;  3S57 A;  5A7P A;  1QGL A;  4AI2 A;  4B4P A;  1F5J A;  2DU0 A;  1RUF 2;  5FO8 B;  2A70 A;  4IDZ A;  5HBA A;  1VMH A;  5FZ8 A;  2VMC A;  1EP0 A;  1RUC 1;  2YG0 A;  1GNY A;  2ETE A;  2YPJ A;  3DF0 A;  4N53 B;  3ZSJ A;  4FOW A;  1O4T A;  2C0Z A;  4Y1Y A;  2RVA A;  2ZJC A;  1EYB A;  4BXF A;  5BNP A;  4QD2 A;  3AJZ A;  4GIQ A;  4IQP A;  2ZX0 A;  1UZ0 A;  2YGL A;  3KMH A;  1BVV A;  3ZFF B;  4ARY A;  4CSW A;  3D0J A;  5JZG B;  4WVM A;  2ADD A;  4TXW A;  2WZR 1;  3AL6 A;  4CP1 A;  1VJ2 A;  1XNB A;  1GP5 A;  4LO8 A;  2HWC 2;  1UU5 A;  2O14 A;  1GU3 A;  1TMF 2;  3ILF A;  2KR2 A;  3POE A;  4GMP 1;  2P3Y A;  1JZ4 A;  3RZL A;  1H1M A;  3IDB B;  5FY4 A;  5T52 A;  4Y3O A;  1PX4 A;  1QJE A;  2Y34 A;  5DDJ 2;  4FP3 A;  4BA6 A;  4JHT A;  1JOB A;  1IOA A;  5AFE A;  1YLL A;  5I8T A;  2QE3 A;  3O12 A;  4GH4 C;  4KG8 A;  4XZP A;  4CCK A;  1UYP A;  4AFM A;  2GC3 A;  4QKN A;  3MF6 A;  4N7U A;  1VBC 3;  4YG0 A;  1SFY A;  2WLQ A;  4ZU4 A;  5FO9 B;  1QNW A;  4Z92 B;  2ZS6 B;  4AFA A;  1GSL A;  2RS1 1;  4FXK B;  2WNV B;  4FBF A;  3H7Y A;  2YU2 A;  1X36 A;  1ND2 B;  1BCX A;  1PO2 1;  4UW5 A;  5FDB A;  2PHU A;  1ZBE 3;  4QXH A;  4CU6 A;  3O0W A;  3CJI C;  5FJH A;  4OHX A;  1DGW X;  4S2G A;  4OMC A;  1ZZC A;  2DVD A;  3EXU A;  2EIE A;  3J7M A;  4LBK A;  4CDX B;  4Y1V A;  4QQH A;  4NPR A;  4I3P A;  1JUI A;  4OCT A;  1PIV 1;  4DUW A;  4E4S A;  5CG9 A;  1PZ8 A;  1ZM1 A;  5A32 A;  5FP9 A;  1AYM 1;  3OY8 A;  5F2S A;  4Q0P A;  1RUJ 1;  4XJA A;  5H9Q A;  5IVV A;  2W87 A;  1DZQ A;  5JR2 A;  1W39 A;  4DXZ A;  3MUZ 1;  3MBW A;  1NG0 A;  2UY9 A;  2ZTN A;  4FPL A;  1CON A;  4LBJ A;  1TNR A;  5FY9 A;  1SLL A;  1SLT A;  1XNC A;  4JGY A;  4L11 A;  4NHY A;  2YZ4 A;  5FZ4 A;  1A8D A;  2VVE A;  5BPX A;  3KHC A;  1QJF A;  3FBY A;  1BKZ A;  2B45 X;  2AR6 A;  2WC2 A;  3LOB A;  4LE4 A;  1YIP A;  2VL4 A;  4P9L A;  1ZRF A;  4HON A;  4K8R B;  2OKX A;  2DCJ A;  4Q4V 2;  2P1B A;  1HN0 A;  4M0N A;  3TEY A;  4CCO A;  2B5H A;  3MV1 1;  1IS4 A;  1QU0 A;  1RTV A;  2XQX A;  3U4S A;  3V0B B;  1HW5 A;  4YW5 A;  2ZGK A;  3OGS A;  1C5I A;  2FQP A;  3KV4 A;  1VBE 3;  3LE0 A;  1YFU A;  3N36 A;  2JEM A;  3RYK A;  2A3Y A;  3H3Z A;  5FXX A;  3I8T A;  2AEN A;  1RMU 1;  4YGB A;  2HWD 2;  4A3X A;  2YV8 A;  4YW7 A;  4E8C A;  4CXW A;  4Z2W A;  2JD9 A;  3FWE A;  4NPL A;  4YG3 A;  1I5P A;  3VBO A;  4E4D X;  2FD8 A;  1SPP B;  4YM0 A;  2JJ6 A;  4MOA A;  4BWO A;  2BVB A;  2RDS A;  3BGA A;  1IPS A;  2IUW A;  3ZYJ B;  1S0J A;  3T2O A;  1JYX A;  1GV9 A;  1OOP B;  4M01 A;  4P00 B;  3UNP A;  3OYW A;  3ZPO A;  3IDA A;  4FTS A;  1LEM A;  1WLW A;  3M3I A;  2WRA A;  4CP9 B;  3ZN6 B;  4D0Q A;  1PGW 2;  1SFN A;  1RUE 3;  1G8W A;  2A75 A;  4ISQ A;  3VDD A;  5ACA 2;  2C9K A;  5I0R A;  3QLQ A;  2ZGP A;  2ZHL A;  3FFZ A;  3HAG A;  1HXS 3;  4Q4Y 2;  3U14 A;  1OVS A;  2CL2 A;  5BY5 A;  3LAG A;  1N1T A;  2Y6K A;  3INA A;  3ZFE A;  1F2N A;  2BBV A;  1EPW A;  1RUH 2;  2JXA A;  3H1W A;  1BEV 2;  2VMF A;  3JZV A;  1JYW A;  4URT A;  4M3C F;  1L7L A;  4KBZ A;  1XRU A;  1IZ3 A;  5L19 A;  3BOP A;  4K6B A;  1U0A A;  4KWL A;  1FPN 3;  3NAP B;  5JXH A;  1U5Z A;  1K5M B;  3CU7 A;  4KWU A;  2VTX A;  1QQP 2;  4XUN A;  3HBK A;  5FTT C;  4K9S A;  3ZXF A;  3JD7 1;  1RUI 3;  3VUO A;  1BQP A;  2VZ3 A;  1VBB 2;  3POI A;  2UYB A;  1RUD 3;  2VMH A;  4Y22 B;  5FZC A;  2AEZ A;  2J1S A;  2YC2 A;  1C1F A;  4N43 B;  4PIZ A;  3SNM A;  3WF3 A;  5FJK A;  4D7S A;  3VBH C;  4C1X A;  2E63 A;  5EYX A;  2R06 1;  4CDW B;  2FZ1 A;  5FYI A;  1V6M A;  4LBQ A;  4NPM A;  5JCT A;  1ZNP A;  2GN7 A;  2VME A;  4AHX A;  1V9U 1;  2H6C A;  4AEJ A;  3LCP A;  5DAV A;  5DQ0 A;  4NJ4 A;  2IC1 A;  4UFH A;  4CCJ A;  5GLT A;  4XOG A;  1IS5 A;  2C9A A;  4AAX A;  1VMJ A;  3J7L A;  1W3X A;  2WZE A;  3HIF A;  5IVY A;  1S0E A;  5IK7 A;  2ZX1 A;  4NRO A;  1QJZ A;  3GXU A;  3GF6 A;  2DBN A;  1KS4 A;  2LS6 A;  2SLI A;  3D3A A;  1QXJ A;  1PNG A;  1UZZ A;  3POJ A;  4JKM A;  1YXW A;  4N90 A;  3WZ1 A;  5C3P A;  5F37 A;  1G9D A;  3VBU B;  1DYP A;  1NQJ A;  2AYH A;  2JDA A;  1D4M 1;  2MEV 3;  4FFH A;  5G04 L;  1JXN A;  5EZW A;  3AKQ A;  4QT6 A;  3MUY 1;  5LZ6 A;  2VOK A;  5BNP C;  5C8W A;  1VBA 2;  1IG3 A;  4IEP A;  2WJS A;  4XZU G;  2ORX A;  2OX0 A;  2O0O A;  2BEO A;  3HBZ A;  4AE2 A;  4C91 A;  2RM2 1;  5ERL A;  5FP8 A;  4TWT A;  1K42 A;  1PX3 A;  1SFP A;  5GM0 A;  2IXL A;  2Q1Z B;  1GFF 2;  1GNH A;  1XJA A;  3NQH A;  5CFC A;  3RSJ A;  3U78 A;  4EWE A;  2K9Z A;  4AR2 A;  3CF6 E;  5IVF A;  1E5S A;  4F83 A;  5GZC A;  3MHZ A;  1FV3 A;  5C6C A;  2PLV 2;  1AX1 A;  3VBR B;  1WMX A;  4QQO A;  5A7N A;  4MXW A;  3KQ4 B;  5CFD B;  1JZ7 A;  4KBB A;  5DAX A;  1LOA A;  3I59 B;  3GJA A;  4YVW B;  4B1L A;  1CIY A;  1AXY A;  3FHQ A;  4RA0 A;  2W3J A;  2EA7 A;  4ZZ5 A;  4FAH A;  2KXL A;  1Q8V A;  5LB6 A;  4XQ4 A;  1YQ8 A;  1GZW B;  4PLM A;  4YZ5 A;  2HWE 3;  2AUY A;  5FYC A;  5LAS A;  4RR3 B;  3S6P A;  3ZIX A;  4AGV A;  5APA A;  5K0U B;  1O6U A;  2G4I A;  5F5Q A;  4M3C A;  4GKX A;  5HCF A;  4QX2 A;  3WDV A;  2PA7 A;  1TME 2;  3I54 A;  3LIH A;  4PI0 A;  4QB2 A;  4W8J A;  2IZW A;  3GJB A;  1YJK A;  4ZS2 A;  3WY6 A;  4QX8 A;  2BYV E;  1UN1 A;  2R07 2;  2DWR A;  1VAL A;  4IE0 A;  1CIW A;  2R16 A;  1OUS A;  1YQ5 A;  3BTA A;  5F3G A;  5F8P A;  2DFC A;  5IWF A;  4YYO A;  1L7Q A;  1AL0 G;  3S5A A;  3H0O A;  4A2U A;  4LLF A;  3P3N A;  4YGD A;  1S0C A;  5AC9 2;  3CZJ A;  2N7G A;  3X29 B;  4LO4 B;  5CIS A;  3V64 A;  4KNC A;  2IXJ A;  1V00 A;  3LDR A;  2PHW A;  1TNF A;  2C6S A;  3L9J T;  3OD0 A;  1WME A;  1S0G A;  4YWA A;  2WQ8 A;  4XF0 A;  3N3H A;  1UX7 A;  4HL0 A;  3G6J B;  2XJP A;  1GR3 A;  3MGU A;  3ITQ A;  1ND3 C;  1UY3 A;  1W8Z A;  2FMD A;  2BQP A;  2RJL A;  4GB3 3;  3KVB A;  1UY0 A;  4P5Y A;  1LHV A;  3VBO C;  1CR7 A;  1JI6 A;  4UFI A;  4XUT A;  2B46 X;  2HEW F;  3I2F A;  3JXS A;  4YFW A;  1PO1 3;  5A6Y A;  5H9R A;  2RS3 3;  3DYM A;  3UKV A;  4S2F A;  5T3N A;  3W21 A;  4IE7 A;  5L9B A;  2WT0 A;  2D97 A;  1DIW A;  3LEM A;  4N8M A;  4XCA A;  4YVS A;  2GND A;  4D7T A;  4YM1 A;  5FZ3 A;  2JB4 A;  5FYH A;  1KDM A;  1W8T A;  1O8P A;  1MVE A;  4PDW A;  5FP4 A;  5FZH A;  1UXX X;  2W94 A;  3PL0 A;  2ZML A;  4ISR A;  2JIC A;  1AR6 1;  5DZG A;  5FMD A;  5A7O A;  5IAX A;  5KWR A;  1UKR A;  1JZ2 A;  3A0K A;  5CVR A;  2VUL A;  1CGP A;  1UYZ A;  2HLE A;  1NXM A;  1OPM A;  4X6Q B;  5FYY A;  1I6X A;  1DZR A;  2VQ0 A;  1B35 B;  2W1W A;  3M8L A;  3POB A;  5H9P A;  4AED B;  1RUI 2;  2RR1 2;  4GKY A;  2WNE A;  4XUR A;  3HNM A;  4IEW A;  3LPF A;  5C7G A;  4OLL A;  1UXZ A;  1RUD 2;  4Y5S A;  3PUS A;  3ELN A;  1BBT 3;  3NNM A;  3ZFE C;  1MEC 3;  2A6Y A;  5A3L A;  4DOU A;  2EAK A;  3GZE A;  1CVN A;  1FMD 2;  1S0I A;  2ZKN A;  4L92 A;  4NIA A;  1OLM E;  4OHW A;  3WD5 A;  5JOX A;  4FTE A;  3UGG A;  5JOW A;  4XCB A;  4MVT A;  4M4P A;  4QDS A;  4AQS A;  3ES4 A;  4QPY A;  2H6B A;  4YAR A;  1KRI A;  3I2K A;  4CCE A;  2GMM A;  4CUA A;  5C70 A;  1DYK A;  1DYO A;  3TYJ A;  1EAH 2;  3ACF A;  3KSC A;  4FT8 A;  1R09 2;  5FP7 A;  4NID A;  4A45 A;  1KFX L;  4NHK A;  3ZX7 A;  2JD4 A;  1MZE A;  4SLI A;  5CKQ A;  2VQA A;  4I09 A;  5IK4 A;  1ULG A;  3WNL A;  2HWF 3;  2XML A;  2OPW A;  2BWC A;  2QKD A;  1I9R A;  1RVF 1;  3HWJ A;  2J1E A;  4NHX A;  1UL9 A;  5ANN A;  4JHZ A;  4B3N A;  3P6B A;  1HJF A;  4LHS A;  2FCV A;  2ZZJ A;  3VKF C;  4AEM A;  4CCN A;  1GWM A;  3A7Q A;  2C1F A;  3FC0 A;  4LKE A;  4QXB A;  4WZF A;  5JZG A;  1KIT A;  3JBG 1;  1OH4 A;  1HB1 A;  4WVW A;  3MO4 A;  4IV3 A;  4K20 A;  2DCY A;  4PBP A;  4XF4 A;  4DY5 A;  1FT9 A;  4GMP 0;  4J1X A;  1QOS A;  3I4I A;  4I3G A;  4ONU A;  2R0H A;  1K3I A;  4I02 A;  5FYT A;  5A33 B;  3APB A;  5L73 A;  4KMQ A;  3IB3 A;  1NE6 A;  1JW6 A;  1GZ9 A;  1ZA7 A;  2J1V A;  3HQR A;  3WG3 A;  1RHI 3;  2WAA A;  1Q56 A;  1J58 A;  5B2G B;  4CE8 A;  2VZO A;  5JI7 A;  5FLI A;  2C24 A;  1UZW A;  3A0N A;  2AH2 A;  2BFU L;  2XVL A;  3DEC A;  2W2I A;  3ZR6 A;  1AHS A;  4D69 A;  2RG4 A;  3T2P A;  1X7N A;  3UT0 A;  1O7F A;  1R1A 3;  1LOB A;  5FZ7 A;  5IFP A;  4AYU A;  4C0B A;  1OVP A;  4DIN B;  3DCQ A;  4V2V A;  3N9O A;  2X10 A;  3VBF C;  4CDX A;  3OBT A;  3BN6 A;  4PT6 A;  3M3C A;  4EN6 B;  1UAI A;  5HI0 A;  4RS5 A;  5CFC C;  4E27 A;  1W90 A;  1U5I A;  1UU6 A;  2HWE 2;  3RDI A;  4OHZ A;  1PGL 2;  1V6L A;  1QJU 1;  2GDF A;  3MFA A;  5FWJ A;  4XBL A;  4TZD A;  2WYF A;  3TEW A;  1ZYB A;  5LY1 A;  2FDH A;  2ARC A;  4OI1 A;  2P6C A;  3WF1 A;  3ZYR A;  1US2 A;  3KHB A;  4Q1P A;  4ZXK A;  3B00 A;  5LA9 A;  5E16 A;  5A3N A;  4WM8 B;  2FHR A;  1VB2 A;  4J1W A;  2ARA A;  3VHO A;  3WDY A;  1YJL A;  2EXH A;  4JRA A;  1AR8 1;  1NKG A;  3W59 A;  2DVG A;  4TLG A;  3T4V A;  2E31 A;  1JTZ X;  1UCX A;  2DUO A;  1ND3 B;  1H8T C;  3V0B A;  1AR7 3;  2YFU A;  2WS9 2;  3K3N A;  3V65 A;  2DCK A;  1BHG A;  3FBM A;  3N9Q A;  2VQT A;  3AZV A;  3POF A;  3U75 A;  4Y24 A;  1X8M A;  3SXW A;  1MS1 A;  2WNU C;  3I3D A;  5BUV A;  3T0D A;  2QBX A;  1CJP A;  1BLZ A;  2VR4 A;  4TSV A;  2QFE A;  5BNN A;  5JXI A;  5A3M A;  3AC0 A;  5F2W A;  3I3B A;  1J3P A;  1Z7S 1;  1XE0 A;  1SPP A;  5LBF A;  5IAV A;  2PQQ A;  2DUP A;  5FWE A;  5E1R A;  3WV6 A;  5CKM A;  3AP7 A;  2XBO 3;  3LA3 A;  4Q4W 2;  4CZS A;  1HRV 3;  1NA1 B;  3GBG A;  4XAC A;  4FFI A;  4NR1 A;  3WF0 A;  4COU A;  4WM7 C;  3BIE A;  1OOP A;  1SMV A;  1NUK A;  2WLP A;  1MS9 A;  1O4Y A;  2ZEY A;  3J9S A;  4K3U A;  2VW2 A;  5GLU A;  5T55 A;  2DTY A;  4EWA A;  3N7L A;  4F3J A;  1SBF A;  4Q4X 1;  1V6K A;  5JSO A;  1GQH A;  3VBS C;  1CAX A;  5IVJ A;  1FNY A;  3J7N A;  2EAL A;  1OLR A;  1NT0 A;  4OI4 A;  1RC6 A;  1PM7 A;  5L9R A;  1O4Z A;  4YGC A;  4Q0S A;  2Z5W A;  5GJ6 A;  3HMY A;  1HB2 A;  1SLA A;  2RMU 2;  5EQU A;  1W03 A;  2X5I B;  1SQ4 A;  4PCR A;  2CGP A;  1BJQ A;  1A6C A;  2IXK A;  3H8X A;  2BNN A;  2VCB A;  1SCS A;  2MNG A;  1AUY A;  1ZBA 2;  3FZ3 A;  4P02 B;  4L97 A;  1C5H A;  4LBO A;  2VZP A;  1X33 A;  4GJZ A;  2VVD A;  1PM4 A;  4YNI A;  1DFQ A;  1PVC 3;  2Y6H A;  5FPX A;  3D0S A;  3M70 A;  4NUB A;  3TN9 2;  1MEC 2;  1Q8O A;  4YVS C;  2PHD A;  1RUF 3;  2DUR A;  2W08 A;  1F9K A;  2LAL A;  1CES A;  3AXE A;  3GYD A;  1UQX A;  3J7H A;  5JIU A;  1H0B A;  3NAP A;  4N7I A;  5FIX A;  4YSF A;  4MZU A;  3R0R A;  3OUH A;  5IVC A;  1QJX 1;  2ZGM A;  3U10 A;  1YFW A;  2DUQ A;  4MGY E;  3ZPY A;  5FZE A;  5C71 A;  3AKT A;  2NP0 A;  5J37 A;  2EF6 A;  2XDV A;  5FRE A;  1K5J A;  4N43 A;  2XJS A;  1F8V A;  4UW6 A;  4AW7 A;  1JZ6 A;  3VZO A;  4EYU A;  1R1Z A;  4BQX A;  1ASJ 2;  5E89 A;  4IEV A;  1DQ1 A;  3AZZ A;  4WVV A;  4DEV A;  2XLF A;  1GQP A;  2HWC 3;  2JG8 B;  4NE9 A;  1GWL A;  4BQ4 A;  1MQT A;  1TMF 3;  1O3R A;  3H3L A;  1FOD 1;  3VZL A;  4D8M A;  3KD4 A;  4DRR A;  1W6Q B;  2YXS A;  4OI0 A;  5DDJ 3;  5LA1 A;  2E7A A;  1W06 A;  1YQ6 A;  2W91 A;  3C7O A;  4FP2 A;  1YNA A;  5A80 A;  3RJR A;  4A44 A;  4EQV A;  3Q8B A;  4CVU A;  4ZKT B;  1FNZ A;  1RXG A;  4Z1V A;  1DDL A;  2BWA A;  3CKH A;  1Q8P A;  1OD3 A;  1NX9 A;  4AL9 A;  2QDN A;  2V4V A;  5FUN A;  4AI9 A;  4YM3 A;  2WA3 A;  2PAK A;  2RJK A;  4AVS A;  4EZ4 A;  2ARX A;  3T30 A;  1YFX A;  4LXL A;  4D6Q A;  1Q5O A;  4XFB A;  4HOO A;  3AMM A;  4MH0 E;  4Y5T A;  2YU1 A;  2D3S A;  1D2S A;  3RI9 A;  1H6X A;  2QQL A;  4Y4Y A;  2PHL A;  1X8E A;  2HWB 3;  4ZHN A;  4R8H A;  1HB3 A;  4QX7 A;  4HET A;  4CYD A;  4JCK A;  4IV3 C;  1UOB A;  4EN0 A;  5I91 A;  4IEO A;  5FLH A;  3N9N A;  1GKB A;  5JXG A;  3HT1 A;  3T1L A;  5GLV A;  3O1O A;  3GZA A;  4ZU7 A;  4CDU B;  3NKT A;  1W6M A;  2P5B A;  2VOW A;  3K2O A;  4GUL A;  4HZF A;  1A34 A;  2WFF 3;  4QM9 A;  2QQV A;  3PUI A;  3ZYF A;  3WDX A;  2CY6 A;  5JDB A;  1G7Y A;  1XE8 A;  3RPQ A;  1GOH A;  1PGS A;  1RUG 1;  3I59 A;  3NKG A;  4YVW A;  2W92 A;  1ENX A;  1XU1 A;  5F6L B;  4AG4 A;  1D0G A;  1W8H A;  4AVC A;  1DLC A;  1W2U A;  3K46 A;  3LD8 A;  5B4N A;  1GZW A;  2JDM A;  1D2Q A;  2VZT A;  2HWD 3;  1OA2 A;  2Y0I A;  3LF7 A;  5BNO A;  3PIJ A;  3BTZ A;  4RS5 C;  4W50 A;  3OBZ A;  1O3Q A;  3DL3 A;  3KV5 A;  5IAT A;  4BH9 A;  3J4U H;  3L2H A;  3ORJ A;  4FOY A;  1NCR B;  2WBK A;  4JC1 A;  3ZKU A;  1IPK A;  2FBE A;  2ORZ A;  1OLQ A;  4Q8L A;  3WQ1 A;  5CEH A;  1Y3T A;  3AKS A;  3AZY A;  3ZDS A;  4UOJ A;  1MZF A;  1UOF A;  5FZG A;  4JQR A;  1XYN A;  5FP3 A;  1WCD J;  3BOD A;  4XC9 A;  1UKG A;  1XNK A;  3UV9 A;  3DPR B;  1H30 A;  4NO4 A;  1T2X A;  1WCU A;  1XQN A;  2PEL A;  2J7M A;  4AVA A;  4MUV A;  1RED A;  2JDP A;  4UT5 A;  5A1A A;  1AVB A;  3QOP A;  2XHK A;  4BZ4 A;  1QIQ A;  3TEZ A;  4JGZ A;  1CZT A;  1C8M 2;  2Q1M A;  2OZJ A;  3PTY A;  4PLN A;  4XVH A;  2YMZ A;  5LA2 A;  2XL7 A;  3AB0 A;  1UY1 A;  3I3Q A;  3KF3 A;  4Q4Y 3;  4AHY A;  5I0S A;  2Q0A A;  4XE9 A;  1VBD 1;  5HCB A;  1YQ2 A;  3GBW A;  4AOC A;  5BNN C;  5C9A B;  2FDF A;  1GBG A;  1UYX A;  1RUH 3;  2Y38 A;  1BEV 3;  2F6B A;  1SBE A;  1LOG A;  5FZK A;  3NV2 A;  1H2N A;  4HKW A;  1FV2 A;  4BQ1 A;  1HV0 A;  4CEW A;  3THC A;  4YPJ A;  2ZAB A;  3GBF A;  5FYV A;  1S0F A;  5J7M A;  3EB7 A;  3M1H A;  5D8A C;  4Y20 B;  4BXS V;  1UIK A;  3CNA A;  3BI3 A;  1PVC 2;  3DYP A;  2VC9 A;  4URA A;  1VBB 3;  2BNM A;  4E2G A;  4LIT A;  4XTP A;  4Y26 A;  4PF5 A;  3NW4 A;  2ATF A;  2WKK A;  2X09 A;  3GZU C;  2FDK A;  1VPH A;  1ZA4 A;  4XFA A;  4Q29 A;  4GMP 3;  2XWJ B;  2FDI A;  5C8C B;  4GWJ A;  1B35 A;  5ABJ A;  4OQ9 A;  4JX0 A;  4AED A;  1ZRD A;  3NO8 A;  2Y33 A;  1COV 1;  1EV1 2;  4CCL A;  4BIO A;  3K4D A;  1G86 A;  2A6Z A;  5CG8 A;  3WP6 A;  4B4R A;  3PUA A;  3USS A;  4YG6 A;  2C26 A;  4PQQ A;  2VOV A;  3ASI A;  4CCM A;  4FPJ A;  3NNG A;  4MXV A;  4XF9 A;  1XNT A;  4IV1 C;  3KT1 A;  5CZK A;  1QJY 2;  1HRI 2;  2VOT A;  1W8F A;  3ZLI A;  1DQ2 A;  3C7H A;  1ST8 A;  2DCT A;  2PYT A;  4XBN A;  3UJQ A;  1SAC A;  3HN1 A;  3I2G A;  4OZO A;  1NCQ A;  2OT7 A;  1PVX A;  3DV8 A;  1LOF A;  3NJY A;  5GLW A;  1QQP 1;  2XVK A;  3NV4 A;  4A7Y A;  1PIV 3;  1VBA 3;  1H4G A;  1RGS A;  4XF3 A;  3AKR A;  2ZA9 A;  1W6P B;  4SBV A;  3VGI A;  1ZZB A;  3NL1 A;  3VKN A;  3ZYG A;  4D94 A;  2AEY A;  4FQZ A;  4ASL A;  3ZYP A;  2CWM A;  4RHV 2;  1AL2 2;  1RIN A;  1MQT C;  2J1R A;  2XUM A;  4FXG B;  2YBS A;  1H9W A;  5A3T A;  4BE3 A;  1QNY A;  1OF3 A;  4XAE A;  1BZW A;  5FMB A;  3ZXG A;  3WQ7 A;  2ET7 A;  4Y33 A;  2HWB 2;  4B7K A;  2GP5 A;  4COY A;  1IGO A;  1AYN 2;  1XSQ A;  5A33 A;  5A7W B;  3BTY A;  5JXJ A;  2P3K A;  4P9J A;  4YFZ A;  1VAK A;  2PLV 3;  3VL9 A;  5HV0 A;  3QH7 A;  1MS5 A;  2X8K A;  5JIA A;  3RMX A;  3KGZ A;  1SLC A;  2OW4 A;  2GAU A;  4ZY9 A;  2FCT A;  2QNK A;  2BDR A;  3WVJ A;  3LA7 A;  1J1L A;  2F4P A;  2RDR A;  4QGL A;  4AVB A;  2WFF 2;  3N7M A;  2GSY A;  1NY7 2;  4W4Z A;  5E88 A;  1H2K A;  4P9I A;  4PIY A;  2PTM A;  1W8O A;  3KS7 A;  3ZSK A;  5JMO A;  2YB7 A;  1VBC 1;  1W99 A;  1TME 3;  2PN5 A;  1XYO A;  2WQZ C;  3WW2 A;  2UWC A;  2EXJ A;  4CDQ A;  3AKP A;  4O65 A;  3PNA A;  5F39 A;  2R07 3;  4FPF A;  5DPN A;  1IHM A;  2V5D A;  2ZAC A;  3PME A;  4LOR A;  4EE2 A;  5JSP A;  3H8U A;  3LFM A;  1LOD A;  3WP3 A;  3SC7 X;  1RL3 A;  5FZO B;  1ZBE 1;  5L7O B;  2DF7 A;  3VKL A;  3PUR A;  4I2O A;  2GP3 A;  5AC9 3;  3Q8E A;  3HPN A;  4BIS A;  1US3 A;  4AHZ A;  4A4A A;  2E26 A;  3OGG A;  2YC0 A;  5F5C A;  2HYX A;  5LRR A;  4C1W A;  5K7P A;  3VDB A;  1XSR A;  2XLG A;  2I2S A;  4H7M A;  5FOJ B;  4Q8K A;  4WM8 A;  4BQY A;  1OUR A;  2TNF A;  3IDC B;  2BER A;  4BQW A;  4AF9 A;  2IVI B;  1W9T A;  4YZ3 A;  2Z69 A;  4CEY B;  5A6Q A;  3O1V A;  2VD7 A;  3KT4 A;  1LED A;  5HXM A;  1POQ A;  2Q4S A;  3TWI A;  1SEF A;  5BNO C;  1AR9 1;  1QDC A;  1W8N A;  3FHI B;  1IS6 A;  4O7X A;  1LU2 A;  4LHN A;  1PMI A;  2ZPX A;  4QU1 A;  1W05 A;  3BOW A;  1JHJ A;  5BV6 A;  5J96 B;  1BK1 A;  5AFB A;  1EY2 A;  4LMF A;  5FZF A;  5T5J A;  2VZR A;  5JAX A;  3KV9 A;  2W39 A;  3CMG A;  1LHU A;  2WSU A;  4BLJ A;  1U5Y A;  1RJ8 A;  3Q8C A;  3E5X A;  3ZFG B;  4OHY A;  3DEM A;  3IAP A;  4P5H A;  1S1A A;  2BBA A;  3MZH A;  1W2T A;  1Z78 A;  4QPG A;  5G05 L;  5FY0 A;  5ANQ A;  1VBE 1;  2IVJ A;  5A3U A;  2GN3 A;  3AYE A;  1VP6 A;  1PZ7 A;  3ZDV A;  3RYR A;  3WP4 A;  1W04 A;  5HXV A;  4IE4 A;  1O59 A;  1Y43 B;  4YM2 A;  4UW4 A;  1RUC 2;  1WCK A;  1UYY A;  2B4K A;  2DVA A;  4HPK B;  1O3T A;  5FQ0 B;  1R64 A;  1LJ7 A;  4JGZ C;  4COZ A;  3RZK A;  1DGW A;  4KG0 A;  4XQW A;  3ZSL A;  1WCQ A;  1NOV A;  2RR1 3;  1OMI A;  2BGC A;  4LIV A;  5DAP A;  4OHV A;  4K40 A;  3PIG A;  4LBQ D;  4XF1 A;  2E6V A;  3SCH A;  2WZR 2;  3K48 A;  3KM5 A;  3PUH A;  5GZF A;  5F3E A;  1LGN A;  2HYK A;  3BYW A;  1JS9 A;  4ITC A;  3MLK A;  1LUL A;  1FMD 3;  1ZZ8 A;  3NNJ A;  3OUI A;  1E5R A;  4LKS A;  5FY8 A;  5FXW A;  3WF2 A;  1OLM A;  3PJY A;  4CEW C;  4WBB A;  1UOG A;  2ZHM A;  1RUE 1;  5AVP A;  4AHW A;  4UBG A;  4Q27 A;  2CTV A;  4CU9 A;  3VZJ A;  4FTB A;  2OXB A;  3ACL A;  5D2A A;  3GGL A;  1EAH 3;  1Y9M A;  1HXS 1;  1POV 0;  1R09 3;  4HKL A;  2ZGT A;  2W52 A;  2VNO A;  1X9P A;  4GH4 B;  2VZQ A;  5DN2 A;  2JKB A;  2QQP A;  1HV1 A;  1OD5 A;  2A73 B;  2B42 B;  3E6D A;  4M00 A;  3RI8 A;  4XPV A;  1PO2 2;  5IVE A;  1LU1 A;  4DS0 A;  2LTN A;  3DKQ A;  2XVG A;  2ZAA A;  1FAT A;  5ABJ C;  2VH9 A;  3W58 A;  1FPN 1;  2QQU A;  3ZXK A;  5A70 A;  5KHI A;  3I97 A;  2J42 A;  4KGG A;  4BME A;  4OQ8 A;  4IW3 A;  1PIV 2;  2JG9 A;  3CJI B;  2E7T A;  2VO5 A;  1RUI 1;  3HT2 A;  3LKJ A;  4M4R A;  4ZON A;  1AYM 2;  3E5U A;  5F32 A;  1RUJ 2;  2QQW A;  4AQ6 A;  3W5M A;  2OQ7 A;  1CJD A;  4CXX A;  1JH5 A;  1QF3 A;  4Q26 A;  2WQ4 A;  3GHM A;  3U4X A;  3ACH A;  2VNG A;  2WII B;  2VUA A;  4YW3 A;  3AMQ A;  1JOP A;  3WNK A;  4KGQ A;  2BUK A;  1NCQ C;  3BU7 A;  3SQO A;  2ERF A;  4NRP A;  4E8D A;  1LOF C;  4QQ2 A;  4QXC A;  4B29 A;  1W9F A;  2VCC A;  4Y1X A;  3PLQ A;  1H4H A;  5FZI A;  4PQ9 A;  3ZSE A;  1MR5 A;  3O0V A;  3RWK X;  3IPV A;  2O1Q A;  2ZX4 A;  3VDA A;  1RMU 2;  1YEW A;  4CP2 A;  5IT6 A;  1WBF A;  2GNM A;  1W6O A;  5EJ1 B;  4P14 A;  2IXC A;  4V1P A;  1H1I A;  1XXN A;  4NRM A;  1Q43 A;  4G9S B;  4EN8 B;  1W9S A;  3UK9 A;  2V09 A;  2OZ6 A;  4JVA A;  4MET A;  2Q8D A;  5CIR A;  4HT1 T;  2MEV 1;  3RQ0 A;  2JDU A;  3CJX A;  1WW5 A;  1YCI A;  4QDR A;  1PK6 A;  5LWB A;  2KA3 A;  3AYD A;  2VZV A;  1ZVF A;  3WNX A;  3OCP A;  3ENR A;  3SEP A;  5F5A A;  4UI9 L;  4W6X A;  3C7G A;  3KVA A;  3VL8 A;  5CBL A;  4JGY C;  5EHD A;  3H9A A;  3ST7 A;  2XB6 C;  4PI2 A;  1Y9G A;  2E9Q A;  1JU3 A;  3WUD A;  4XIL A;  2XWB B;  1LEN A;  4ORF A;  3AM2 A;  4DO0 A;  1NYW A;  4N9I A;  1F4H A;  1AXK A;  2ZGN A;  2VE1 A;  3KLS A;  2WS9 3;  5TSW A;  2P4E A;  1QXP A;  2WSV A;  3IDE A;  2UU8 A;  1KQR A;  4AGR A;  1J3R A;  4XAB A;  2AZ5 A;  2G9G A;  4CDQ C;  3N4M A;  5LK7 B;  1F5F A;  3GNE A;  3WHU A;  3WOG A;  2P34 A;  5GAL A;  2QQK A;  3MIG A;  3NMB A;  1O8S A;  2I45 A;  3WNN A;  3Q9O A;  5T50 A;  3QAC A;  3D8C A;  1NCR A;  4Q4W 3;  4HG6 B;  3LQC A;  3ON7 A;  2ZAH A;  5DUW A;  4A42 A;  2OQ6 A;  3RYP A;  1SG3 A;  3PUQ A;  4P9Y A;  1LAJ A;  2H0V A;  4OVE A;  4L8Q A;  3O1P A;  3JD7 2;  1BVP 1;  3UGF A;  3WDT A;  2GNT A;  2XL9 A;  2VEC A;  2YY1 A;  2R7E B;  5I0U A;  3N9L A;  3RWN A;  1JZ8 A;  3DPR A;  1H8V A;  2O8Q A;  3LSD A;  3MPB A;  2IXH A;  2XJR A;  2D6P A;  4IE6 A;  3USU A;  1YWK A;  2Y0O A;  1R08 3;  2R06 2;  3K51 A;  2RMU 3;  2DDU A;  4RQP A;  3LGR A;  5KBF A;  5KHK A;  4AI1 A;  5D21 A;  2R49 A;  2R04 3;  5C4W A;  1KFU L;  2WNO A;  1D4V B;  1ZBA 3;  3VBH B;  4C8D A;  3O7O A;  3VDD C;  5FOB B;  1UF2 C;  4JZR A;  1GOG A;  5C9A A;  5FK8 A;  2BZD A;  4BIF A;  4QPI A;  3WW3 A;  3RRD A;  3UYJ A;  2CAU A;  2YFZ A;  2VTF A;  1YYN A;  5E8A A;  5EWS A;  2JDY A;  1J59 A;  3WNO A;  3MIE A;  4KU8 A;  4FFG A;  4QPG C;  3TN9 3;  3WNM A;  3BVC A;  3IT8 A;  3F95 A;  2D6M A;  3W9A A;  4GB3 1;  1DF0 A;  4MAD A;  1G9A A;  2BRT A;  4XAA A;  2Q1F A;  3AFK A;  2LW8 A;  5CU1 A;  1UO9 A;  2YYO A;  3AFG A;  1VE0 A;  1IKP A;  3WF4 A;  4A6O A;  1D4M 2;  5HCH A;  4ZPI A;  1N1V A;  1KEX A;  4ES9 A;  1PO1 1;  3VZN A;  1KXG A;  2RS3 1;  2WN2 A;  3WDU A;  3WIN E;  4DB5 A;  3PMS A;  1HLC A;  2EXK A;  1REE A;  2EIC A;  1ASJ 3;  3H3U A;  1X50 A;  4LKD A;  2WIN B;  4XJ9 A;  5C8C A;  2JE7 A;  5J09 A;  1HJG A;  3LB9 A;  5HCA A;  2RM2 2;  5GLZ A;  4CCD A;  1HQN A;  2NYY A;  2NM1 A;  4IE5 A;  4RGG A;  3UKT A;  4AAP A;  5BNP B;  4N53 A;  5CB7 A;  3B94 A;  5FY5 A;  1BMV 2;  1ENQ A;  4WVM B;  4NII A;  2YBK A;  3BIW E;  3FUO A;  1LGC A;  5J98 B;  3FFQ A;  2LUW A;  1W0P A;  4PHZ A;  3CZU A;  5LW9 A;  2CGO A;  4JDM A;  4PIX A;  3ZFF A;  2PHT A;  4LUK A;  2NQY A;  2WAB A;  4K8F A;  3I3M A;  2EIG A;  1LNS A;  4B8E A;  1D7P M;  1GP4 A;  4U36 A;  4I0A A;  5FAX A;  1WKY A;  1U5X A;  2RS5 1;  1QY4 A;  4UXA A;  3ILR A;  3RMY A;  1BBT 1;  1MEC 1;  1ENR A;  3B93 A;  3LZZ A;  1CAU B;  1LKN A;  4GAL A;  4MO3 M;  3B01 A;  3OEB A;  1DGR N;  2CHH A;  5FZD A;  4XET A;  5IUQ A;  2WO1 A;  1VRB A;  2PHX A;  5FY7 A;  2QCS B;  3RZZ A;  1HDK A;  4YW1 A;  2K0G A;  1QJU 3;  1RUN A;  3A23 A;  3PVO A;  5FYB A;  5FY1 A;  2W95 A;  2WNV A;  2JG9 C;  5L36 A;  1CZS A;  5FBZ A;  2P2K A;  3IMN A;  1ND2 A;  1OUX A;  2J1T A;  3VKM A;  4BHP A;  3ACG A;  4MGT A;  2EAA A;  4QM8 A;  1WLC A;  3S7I A;  4A3Z A;  1NZC A;  5A32 B;  3C7E A;  5JPN B;  3OY8 B;  5A7W A;  2HWF 1;  3WQB A;  2A6W A;  4UFM A;  4HFS A;  5L9V A;  4KWJ A;  2VGD A;  3HQX A;  1DBN A;  3TOJ A;  3LEI A;  3ZSM A;  1HQW A;  2ILM A;  1PMH X;  2NMN A;  1YQC A;  3J8F 1;  5GZD A;  1W28 A;  3QBQ A;  2ZMK A;  2A6X A;  5FZ1 A;  3SH4 A;  2B7Y A;  1DLL A;  1VRH 3;  4FPH A;  3VD5 A;  1GWK A;  3O1M A;  5DAW A;  4K1Z A;  1WD3 A;  3O1R A;  3C8X A;  3EQE A;  3NJV A;  1RHI 1;  1QH6 A;  1ZZ6 A;  2D43 A;  2K2S A;  2QZ3 A;  3MV0 1;  2QUO A;  2BPA 2;  4HSL A;  1O91 A;  2CYF A;  1UZY A;  4DXT A;  1BXH A;  4E9K A;  3CL1 A;  3WG4 A;  5JI9 A;  1JU4 A;  1SLI A;  3R4D B;  4OYU A;  5EXO A;  4QGM A;  2HH9 A;  2W5F A;  1PK6 C;  4E2S A;  2J22 A;  1WGP A;  3VBO B;  4EV0 A;  2P3J A;  2G1M A;  1R1A 1;  1MVQ A;  2ZGR A;  3C7F A;  1MS4 A;  2B9V A;  2GC2 A;  4JQT A;  4UF0 B;  5FZO A;  3SCG A;  5EFU A;  3ZR5 A;  4B7E A;  4CXY A;  1TQ5 A;  1CPM A;  1OSG A;  2ARE A;  4NVP A;  4U2A A;  2R30 A;  5A1L A;  4AEK A;  3IAQ A;  2A1X A;  4QHO A;  4W6Y A;  3OYW B;  1AR6 2;  3K4A A;  4IXL A;  4OUE A;  2XKO A;  3A21 A;  5DXD A;  5DUV A;  3EJK A;  3ZXJ A;  1UOJ A;  1C8M 3;  2FDG A;  4CEY A;  4XMI A;  3PVN A;  2MPF A;  5IFT A;  2V4A A;  4H14 A;  4CP9 A;  5M0T A;  3ZN6 A;  4HVQ A;  3AL5 A;  4O61 A;  3VDD B;  1H6Y A;  3AZX A;  4AQT A;  1W8W A;  5FYZ A;  5CA6 A;  4MHR A;  1XNA A;  1R08 2;  4JRL A;  5KXC A;  3P5B A;  4Q5O A;  1MS8 A;  2W9X A;  2WZP P;  1POV 3;  4J6G A;  3H42 B;  3ZFE B;  1YI7 A;  4R9C A;  5FKB A;  2R04 2;  1G9C A;  1Y4W A;  3B69 A;  2XH6 A;  2VXR A;  4XDO A;  2BFU S;  1XC6 A;  4IGQ A;  3WLU A;  5IK5 A;  4LBN A;  1AR7 1;  3LDB A;  1CPN A;  2JKX A;  1DCS A;  4CU8 A;  2VOX A;  2XHN A;  2CDP A;  3KCY A;  2HEY F;  3SH5 A;  2Y6G A;  4DEQ A;  4ES8 A;  1CWP A;  1FI2 A;  1OHF A;  4C90 A;  3KGL A;  4DUV A;  4IEX A;  3B9C A;  3BAL A;  3QD6 A;  4N9H A;  4PDW C;  3D6E A;  3ZN4 A;  1AF9 A;  2W1S A;  1XYP A;  1K5M A;  4PLO A;  4RQP C;  3SMH A;  3VB9 A;  5F1R A;  2P6H A;  5FQ0 A;  1YI9 A;  2CNA A;  3N7J A;  2ZMN A;  1RVF 2;  2XBO 1;  3R05 A;  4MYE A;  2OA2 A;  2VCM A;  3I2J A;  1HRV 1;  4BPZ A;  4Z2A A;  4IER A;  5JMC A;  1EV1 3;  3JBG 2;  3KWV A;  4Y22 A;  4LBQ B;  3MIF A;  4QPI C;  5I0D A;  4LJH A;  3Q8F A;  3AVS A;  4XJ8 A;  4BMB A;  2GZW A;  4QWN A;  4CDW A;  5CNA A;  4ERO A;  1A8M A;  1UX6 A;  1OQ1 A;  1WW6 A;  3CQO A;  1REF A;  4TLF A;  1DQ5 A;  1DZT A;  2EID A;  1W9Y A;  5LAT A;  3DXT A;  4RGA A;  3VD9 A;  3E97 A;  3P3P A;  3SH3 A;  1QJY 3;  1HRI 3;  4ZZ8 A;  4IGO A;  4LHK A;  1Q3E A;  2E51 A;  1GZC A;  2ZEZ A;  4XQD A;  4O9G A;  1ULF A;  3CIH A;  3MIB A;  3TNP B;  3LEK A;  1HKD A;  1OF4 A;  5FZL A;  1C8N A;  3MW4 A;  4NRQ A;  1H9P A;  3WX5 A;  4CCC A;  1IS3 A;  3FE5 A;  1J84 A;  2SBA A;  2VMG A;  3AP4 A;  1RUF 1;  3JB4 C;  3NV1 A;  1AL2 3;  4RHV 3;  4S2D A;  5FBJ A;  3VBU A;  2OUJ A;  3O0X A;  4K7J A;  4Z07 A;  5FZB A;  2FZ2 A;  1XE7 A;  3GCW A;  3AMH A;  3POG A;  1HX6 A;  5DZE A;  2C4X A;  4WVZ A;  1N3P A;  3CJI A;  5EYY A;  3WP5 A;  4Y5Z 0;  2NN8 A;  5JZG C;  1ENS A;  1QJU 2;  1T6B X;  2FMY A;  3ZFF C;  1AYN 3;  5A7S A;  1XB9 A;  3VBF B;  4XHX A;  5IYY A;  4MX3 A;  1V0A A;  4OUL A;  4OZX A;  4DUX A;  5CFC B;  4LO7 A;  3R4S A;  1ZZ7 A;  2VW0 A;  1DQ0 A;  2WFP A;  4RL7 A;  4XDP A;  1UPI A;  2WO2 A;  4EN7 B;  2QQO A;  2DFB A;  3I2H A;  2HWC 1;  3B3Q E;  4LLO A;  1TMF 1;  4FO9 A;  2NLR A;  1RB8 G;  3GM8 A;  1JOD A;  4CA9 A;  2WN3 A;  4QU2 A;  1C1L A;  2BGO A;  3T08 A;  2Q8E A;  4CUC A;  1AR8 2;  3LEG A;  1N3O A;  5CAZ A;  5DDJ 1;  2JIJ A;  2DYC A;  5IK8 A;  4QX0 A;  1WA4 A;  3VBR A;  2IWG B;  3SHR A;  2QJV A;  3OEA A;  4GAZ A;  3HQU A;  1UMH A;  5GZE A;  2XQR A;  2WNV C;  5CFD A;  3RGB A;  3C2U A;  4CTE A;  3ECQ A;  3H8R A;  4ASM B;  1ND2 C;  2Y8K A;  3H7J A;  4PBO A;  3THT A;  5T5P A;  1H8T B;  5DAB A;  4D6R A;  1F31 A;  2ZX3 A;  1VRH 2;  4LOT A;  5FZM A;  1OA3 A;  3SIS A;  4M3C B;  5LY2 A;  3TRS B;  4CDX C;  2WNU B;  4RR3 A;  3N7K A;  2LM3 A;  4JV4 A;  4XXP A;  2VUD A;  5K0U A;  4D6S A;  3VD3 A;  3WR0 A;  1LES A;  1ONA A;  5CAD A;  4GXL A;  1IQA A;  3ZXE A;  2HWB 1;  4J25 A;  4IUG A;  5FZA A;  5EPA A;  1GZT A;  5DG1 A;  4DRV A;  2W47 A;  3OOX A;  4A41 A;  4Q4X 2;  4ATF A;  4WM7 B;  5FFO C;  5IHR A;  1OA4 A;  3KQR A;  4Q1R A;  4IND A;  1S0B A;  2YGM A;  2JX9 A;  1LEC A;  4W65 A;  4I0B A;  4W6W A;  2J1U A;  1SDW A;  3VBS B;  3VZK A;  1SCR A;  1F15 A;  2Y6F A;  2WFF 1;  1HN1 A;  2ZCW A;  3I2D A;  1E57 A;  3OGV A;  3ATG A;  1DG6 A;  2ZOE B;  1W2O A;  2WUH A;  3ACI A;  4IEQ A;  5EJ3 A;  1K12 A;  1QXR A;  4JTN A;  5F5I A;  4Q4V 1;  4C0H A;  1QWR A;  3BCW A;  2RDN A;  2G19 A;  3E6C C;  2XJV A;  4BCU A;  3VD4 A;  4XJZ A;  1ZRI A;  1O5L A;  2Q8C A;  1FAY A;  3MEP A;  3K4Z A;  3PHM A;  4YZ4 A;  1W3V A;  2HWD 1;  1I3H A;  1JYT A;  4LQR A;  1NZI A;  1D0H A;  3V0A B;  3AYA A;  4YRD A;  5DAQ A;  4RD7 A;  1QDO A;  1QJX 2;  1WZX A;  1XND A;  4XUP A;  4YVS B;  2W68 A;  4NIH A;  4HN1 A;  1RUC 3;  4LPL A;  3WUC A;  2AGS A;  1MS0 A;  1OOP C;  1YIF A;  3K75 B;  3RVH A;  2OVU A;  3NST A;  1HQL A;  2XG3 A;  4I0W B;  4AQ2 A;  2D3R A;  2PAM A;  4EWD A;  2Z42 A;  4XUO A;  3C3V A;  4Z8B A;  5LBC A;  3U37 A;  2WZR 3;  1YHF A;  1GAN A;  1I5Z A;  4K1Y A;  1FOD 2;  2PQS A;  4XIO A;  3SKV A;  1PGW 1;  4UFK A;  2YRO A;  2Z4F A;  2TEP A;  2VNV A;  3OSD A;  1LHO A;  3OPT A;  4YGE A;  3RG0 A;  2D98 A;  5ACA 1;  3TEX A;  4FAG A;  2YHJ A;  3IMM A;  4HSJ A;  2ID4 A;  1W8U A;  2PXJ A;  2XKP A;  5JR7 B;  3DGT A;  4PJY A;  2XR4 A;  4Q4Y 1;  4JTO A;  2RS1 3;  5CKN A;  2G9Z A;  4Q0V A;  4CRQ A;  1RIT A;  2P37 A;  1WUV A;  3UGH A;  1RUH 1;  1BEV 1;  3WDW A;  5HPO A;  3NAP C;  1NLQ A;  1PO2 3;  1OKQ A;  3O5S A;  1K5M C;  4CP0 A;  4S2H A;  3MIC A;  2D6L X;  1CAW B;  1V6I A;  3OGJ A;  3BTX A;  1RIR A;  4MGK E;  3URF A;  1VLN A;  3HOB A;  4RFT 0;  4N43 C;  1S2E A;  3TNQ A;  2DU1 A;  4YLZ A;  4MGI E;  3T2T A;  1AYM 3;  1JHN A;  2GMP A;  1RUJ 3;  1VBB 1;  3MLL A;  1Y7B A;  2Y26 A;  4FOQ A;  3ZYB A;  4CDW C;  5LA0 A;  3LWC A;  1LTE A;  2KD7 A;  4IV3 B;  1I1E A;  4NWW A;  3ZXL A;  2E53 A;  2UWB A;  3OUJ A;  5C3Q A;  2H0B A;  1CD3 G;  1S2K A;  5DG2 A;  4JDN A;  2QQJ A;  3I3E A;  3W20 A;  1X82 A;  3JU9 A;  1ZRR A;  2RJ2 A;  1TE1 B;  5H9S A;  1V70 A;  2Y6L A;  4B4Q A;  2OUH A;  1M06 G;  1CAU A;  4MGS A;  3R6S A;  1NXD 1;  1RUG 2;  1W9W A;  1WW7 A;  1A78 A;  2FDJ A;  5BXX A;  4AI0 A;  1Q8S A;  3POW A;  2F17 A;  3T0A A;  4GWN A;  1CQ9 A;  5F3C A;  2CAV A;  1MZ6 A;  1DQ4 A;  1OBN A;  2XXZ A;  4B1M A;  2FCU A;  3AXD A;  3VBU C;  1AZD A;  1C3H A;  1RMU 3;  2GH2 A;  2R1B A;  2VW1 A;  3DXU A;  2CU5 A;  4JKL A;  4MHU A;  4X6R B;  4WZC A;  4XDQ A;  2JDN A;  3SIT A;  3ZOI A;  2WO7 A;  1HB4 A;  2VXJ A;  5K9Y A;  3WG1 A;  2LRP A;  4AXO A;  3MFC A;  4AI3 A;  1PHM A;  4FI9 A;  2BVV A;  4RS5 B;  3IZO A;  5KXD A;  1VBA 1;  4HN0 A;  1E5H A;  3KCX A;  3E1F 1;  1YRZ A;  2TUN A;  3ZXA C;  3NRU A;  3VHP A;  1RJ7 A;  4ATE A;  3GHN A;  4YW4 A;  3MF9 A;  4LE3 A;  4E4H A;  3H8O A;  1ULP A;  2VAU A;  1JYN A;  1AR9 3;  5JUV A;  2QDR A;  2WL1 A;  3NWK A;  5C3R A;  5HV4 A;  4HVO A;  5DUX A;  5FZ9 A;  5A1F A;  3T1M A;  2WYS A;  3VBR C;  2L9L A;  2BW8 A;  2WT2 A;  4QKB A;  4Y4R A;  1WLT A;  5CFD C;  2ARB A;  4FPC A;  2VZ1 A;  4LUM A;  2PLV 1;  2ZEW A;  3AP9 A;  4YVW C;  3ROU A;  3SKJ E;  1DHK B;  2V5Y A;  1J3Q A;  1VBD 2;  4MLO A;  4R9A A;  5FMO L;  5T5L A;  2GC1 A;  2XPJ A;  4NOT A;  3NNL A;  2DCZ A;  1YFY A;  4KQ7 A;  3VZM A;  4RR3 C;  3AP6 A;  1ND3 A;  3FLT A;  1RYY A;  2XJU A;  4V2W A;  5K0U C;  5BNN B;  1JN2 P;  1CAV B;  3LFI A;  4RSU A;  4E4Z A;  4XMA A;  3RZH A;  1NLR A;  3L2Y A;  3VHN A;  4UF0 A;  5DMY A;  3ZIW A;  1UD1 A;  2WDB A;  1KJL A;  5I8Y A;  3JD7 3;  3MW3 A;  1TME 1;  2C5D A;  4QAW A;  1LOE A;  1S2B A;  2JE8 A;  1OXC A;  1L7R A;  1B09 A;  2VCA A;  4LK6 A;  4P9G A;  2A7A A;  2R07 1;  4XFI A;  5D8A B;  3N9M A;  3UJO A;  3E6B A;  1MS3 A;  1NA1 A;  4JKK A;  2VZS A;  4MV2 A;  2R06 3;  3HR9 A;  3NJZ A;  4XJU A;  1GQG A;  3UES A;  1CAX B;  4BYY A;  4PF1 A;  1LR5 A;  5AC9 1;  5I93 A;  1V9U 3;  2ES3 A;  2UY8 A;  1UY2 A;  3N35 A;  5J36 A;  1MPX A;  1EUU A;  1COV 2;  2E7Q A;  4XFF A;  1LRH A;  5FPL A;  2ZGQ A;  1EPZ A;  3MIH A;  5KHH A;  1W2N A;  3OJB A;  3VN4 A;  5A6Z A;  1M4W A;  1N3Q A;  2QZ2 A;  4QHB A;  3WEZ A;  4UWD A;  2P3I A;  2B9U A;  1LHN A;  2X5I A;  5FPV A;  1VB4 A;  4RYD A;  1BYH A;  4HK8 A;  3JB8 A;  2RV9 A;  3B9I A;  1KJR A;  1H2M A;  3ETQ A;  3A4U A;  5I8S A;  2EXI A;  3UKN A;  2XON A;  1W2A X;  2VU9 A;  4Q0Q A;  4FVV A;  1SZB A;  5FZ6 A;  3U07 A;  4JAA A;  1H2L A;  1D4M 3;  1TEI A;  1WW4 A;  2X53 S;  5FZ0 A;  1PMJ X;  4IV1 B;  4AVV A;  1ODN A;  2W46 A;  3HNY M;  3I49 A;  5K8S A;  1N1Y A;  1NAE A;  3IWZ A;  2D5H A;  2RS1 2;  4LA3 A;  5GZG A;  5KC5 A;  1UNB A;  2OYZ A;  3O1S A;  2PMW B;  2VBP A;  2RM2 3;  3ETP A;  1QH7 A;  4UFJ A;  4AWD A;  1IQD C;  1JBC A;  3U1X A;  3WCR A;  1PNF A;  2Y64 A;  2VM9 A;  1JYV A;  4H3W A;  3MI8 A;  2BTV C;  1B35 C;  4AED C;  3BPS A;  4LKF A;  3O1T A;  3O14 A;  1C28 A;  5FK7 A;  1MQT B;  2WWU A;  5J48 A;  1WCS A;  4FOV A;  5FUI A;  3PTR B;  2XOM A;  2JG8 A;  2RR1 1;  3NJX A;  5EIY B;  2D7F A;  2ADE A;  1UY4 A;  5C5U A;  1RUD 1;  2GAL A;  2ZKL A;  4DXR A;  5FMO S;  1W6Q A;  3ZO0 B;  3KF5 A;  4Y1U A;  3H1Y A;  1QKQ A;  1IG0 A;  5LCW L;  3KB5 A;  1FMD 1;  2XJT A;  4NHM A;  4X8P A;  4H2A A;  5A3W A;  3ZN5 A;  3FLP A;  1S0D A;  5BNQ A;  4GA9 A;  3I7D A;  1UMI A;  4XYX A;  1JZ5 A;  1QOT A;  1A3K A;  1VBC 2;  1EAH 1;  2QTW B;  3HNB M;  1R09 1;  4FPG A;  1JYC A;  2BOI A;  4CU7 A;  4LO6 B;  4DIQ A;  3F2Z A;  2Z2S B;  4NHL A;  1ODM A;  1YC6 1;  5EJZ B;  4H55 A;  5JVV A;  1NQD A;  3VBF A;  1ZBE 2;  2BGP A;  3AP5 A;  5K4L A;  1BMV 1;  1V6N A;  4NN0 A;  4OMD A;  1X9T A;  2D3P A;  2DTW A;  2EVX A;  4XEZ A;  3R4U A;  3T2Q A;  4KL1 A;  4TTG A;  1LCL A;  1W6M B;  4KI5 M;  4IET A;  3T09 A;  1EUT A;  2E32 A;  2LRO A;  1LOC A;  4CDU A;  1CN1 A;  4LEJ A; 
#chains in the Genus database with same CATH homology
 1OUS A;  1GZT A;  1OVS A;  2VNV A;  5A6Y A;  5A70 A;  2JDY A;  2BOI A;  1OXC A;  2JDN A;  2VUC A;  1OUR A;  1W8H A;  1OUX A;  1OVP A;  2BP6 A;  2XR4 A;  3ZDV A;  5A6Q A;  5D2A A;  3DCQ A;  2WRA A;  2JDM A;  2JDH A;  1UQX A;  2JDP A;  4UT5 A;  5HCH A;  2JDU A;  1W8F A;  2VUD A;  2JDK A;  2WR9 A;  2BOJ A;  5A6X A;  4AOC A;  2CHH A;  5A6Z A;  5A3O A;  4CE8 A;  1UZV A;  2BV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...