2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PROTEIN RSC3288
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
2JDYA 1GZTA 1UQXA 2BP6A 2BOIA 2JDUA 5D2AA 5A6ZA 4AOCA 5A6QA 4CE8A 1W8HA 5A6XA 2JDMA 1OXCA 2BV4A 5A6YA 5A3OA 2VNVA 2JDNA 2XR4A 5A70A 1OVPA 1OURA 2JDKA 5HCHA 2CHHA 1UZVA 2WR9A 1OUXA 2JDPA 2WRAA 2VUCA 2JDHA 4UT5A 1W8FA 1OVSA 1OUSA 2BOJA 3ZDVA 2VUDA 3DCQA
chains in the Genus database with same CATH superfamily
1YUDA 5GJ6A 3IPVA 1WKYA 4G9SB 4MYEA 3O1SA 1Z7S3 1O5LA 2GN7A 2QKDA 3RS6A 4BOWA 2PHDA 4NROA 2PMWB 1L3JA 1W6PB 4LORA 2MEV1 1D4M2 3ABZA 1GBGA 3TN93 4DPNA 3QH6A 4PCRA 1B09A 3VB9A 3VV1A 4Q1PA 1W9TA 3ZX7A 2PAMA 2Q1FA 1CQ9A 2GC2A 3WQBA 3TEYA 5FJKA 5GKAC 5GZCA 4LHKA 2Y6GA 3USSA 3LAGA 5LCWL 2BZDA 4Q4V3 1QF3A 5I0RA 1W0NA 2BGOA 2QQUA 4XF3A 2UY9A 1OVSA 1UL9A 3VUOA 2JKBA 1H1IA 2HWB2 1WMDA 3B01A 3BGAA 1N1TA 1S55A 3NWKA 4PDWC 4YG6A 2VUDA 4LKEA 5FP4A 3U78A 4CP1A 5FYTA 2ID4A 4AFMA 4YM1A 4JDNA 4YVSA 4G3YC 1ULOA 4C90A 4LO5B 1E5IA 4D7YA 4E27A 3IWZA 1H8TB 4LBJA 1SQ4A 1ZA7A 1PVC1 5FUNA 4YFZA 3JBG1 2IXLA 3AL6A 4FTSA 2IXHA 2Q1MA 2QBXA 2QQPA 2FCUA 1RYYA 2BVVA 1YI9A 2WO1A 1DQ6A 5FZIA 4PBOA 3KD4A 1J3PA 5B4XA 2BFUS 4NO4A 3DXUA 5J98B 4N53B 2WAAA 1QH7A 2OX0A 3VHRA 3ZYGA 3O0WA 3O0XA 4LBMA 1BK1A 5CVRA 3RGBA 4Y1ZA 4Y22A 3T2TA 5FZHA 4CDWB 3MIDA 1LR5A 2VNRA 3HMYA 3UETA 3U07A 1QQP3 2I74A 2KA3A 4HONA 4IV3A 4ZKTB 1ZVFA 1IQDC 5GLWA 3ZSMA 3CL1A 5FZBA 2HYKA 4PLOA 4QQPA 5A3NA 4KGQA 4LE3A 2DTYA 3ALQA 4OHWA 4XFFA 4BQ1A 5H9QA 2Q4SA 5CG9A 5L9RA 3E97A 1YQ8A 2B4KA 4B4PA 4EJRA 4QD2A 4M01A 2F17A 1OXCA 2WNVB 3LIGA 5FZEA 3WEZA 1W8ZA 1ZBA3 1HLCA 1UY4A 3FN9A 4LO7A 3CU7A 5C8CB 3PTYA 4RL7A 3TEZA 3W9AA 2YC0A 2G9FA 1RINA 5FKBA 5L19A 1J58A 4M3CE 3ZYBA 4Q4Y3 4QGLA 2YBPA 3IPVB 5KC5A 5M0TA 4JGYC 1QXJA 2ZMNA 3HT1A 3I3MA 5L73A 2ADDA 2C9AA 2GNTA 4Z92B 1OC1A 1RIRA 1SLTA 3GZEA 1SLLA 3FZ3A 2C6SA 4NRPA 5EPAA 5DZGA 3BYWA 1D0GA 1GMMA 1NA1B 4NWVA 2W52A 4N8MA 4FVVA 3T0AA 3BTXA 1RC6A 5BNOC 4UI9L 3T4VA 1BYHA 1CD3G 5FZ7A 2WZPP 3N7LA 1UOFA 3CQOA 3WINE 1Y9GA 2P3IA 4AK3A 5FOBB 5HXVA 3WV6A 5G04L 2Z2SB 2CYFA 3M2MA 4LHLA 4DXRA 1WA4A 1KDKA 3ECQA 5KXBA 4BCUA 2HWF1 1US3A 3OBAA 4AWDA 4PT6A 3IM0A 4CZSA 3ZSEA 2ZGUA 2QQNA 1AYN1 1NOVA 3EXUA 2R16A 3ZKYA 5HV0A 5F37A 3WHUA 2X5IA 1SDWA 1FOD1 4WVZA 1W2TA 3V65A 1ZZCA 5ANQA 5LY2A 2YBKA 2MNGA 3VKMA 4QPWA 1QXRA 1V6NA 2Y6HA 5DAXA 2JXAA 1AR93 4TYSA 3T0DA 2A73B 3B02A 1EV12 1QY4A 3I4IA 1U0AA 2ZX0A 2DU0A 4CCJA 2WZR1 4A45A 3DYMA 4QDRA 3T1MA 1BBT2 4GIQA 3VBHA 3O1VA 2X09A 2EAKA 2R49A 2V09A 1C8M1 2ZABA 5LA0A 4AR2A 3H9AA 2WRAA 4NRQA 4YW5A 3SHRA 4AGGA 4BU2A 5CADA 5KBFA 4CDXB 3LEGA 2DVGA 1IG0A 2FMDA 1JYCA 4BLJA 1W8TA 2C5DA 3I3DA 1ENRA 5T5LA 2DUPA 2RMU2 1OF3A 4FPLA 2ZHLA 1GOGA 4WM8C 3ZIXA 1K12A 2BOIA 5C4WB 1VIWB 5AC92 1JYIA 4CRQA 4Y4RA 2JE9A 2QQJA 4XETA 3VBUC 1LGCA 3ZYFA 3KMHA 4GULA 5FKCA 1VMFA 3VDDA 5BNNA 5C3QA 2WINB 1I9RA 2Y33A 3GNEA 4RN5A 4XIOA 3UGGA 2BDRA 4P02B 1TVGA 2HBTA 4IETA 4MX3A 3ZYPA 2H6BA 1L7QA 3KWVA 3LWCA 3O1UA 2VUCA 5C71A 3ES1A 5FZ1A 3PMEA 1BEV2 2JG9B 2FQPA 2GMPA 1OT5A 4QU1A 1OUSA 1R092 4LBQA 5F2WA 3WNMA 3AKRA 3HQUA 5F5CA 3I8TA 5F39A 3WF1A 3P3PA 4MO3M 1AL0G 2CY6A 5BXXA 1NY71 1V6IA 4D7TA 1MEC3 3LA3A 3KV9A 2WSVA 3KGZA 4UFKA 4XDOA 2AACA 2C9KA 5HCBA 2OPWA 2RM22 4JKMA 4B4QA 3B7MA 1HB3A 4Q1RA 1WBFA 4JKKA 1RUF2 1H9PA 3P5BA 2WYFA 5DG1A 1QJU3 3VBSB 2D44A 4COZA 1ND3B 1BHGA 2LROA 2FZ1A 1F31A 2HWC3 1ZX5A 3CHXA 2WS93 3GJBA 3SKVA 5FP9A 3O1TA 3AP7A 3AZWA 1AR72 1R1A2 4MH0E 3AMHA 1RL3A 2GU9A 4YZ4A 3KM5A 4UFLA 5FMOL 3VZMA 2LS6A 3Q8FA 5FO7B 3N7JA 1HX6A 2XJQA 3J8F2 4XEZA 2NZ9A 2Y0IA 1LHVA 1UOJA 5FZOA 4QX7A 3C7EA 3VBHB 4A3XA 3GGLA 1HRV1 3MLLA 4HPKB 1ST8A 4AHYA 5ISLA 4OHYA 2RDNA 3USUA 4CXWA 2KD7A 4JQRA 4E2GA 5FXWA 2IXKA 3FHAA 1XNBA 3CDZB 3WUCA 3ZXAC 3RRDA 4S2FA 3I2FA 3K48A 1VBA2 3Q8CA 4P08A 3K3OA 4LKDA 3PVNA 1AR83 4KMQA 5FXZA 3BTAA 4FPOB 4LMFA 4MOAA 2BOJA 4JRLA 2AYHA 4OHVA 4XC9A 5K4LA 3ZDVA 4ASMB 1US2A 4META 4TLFA 5IT6A 1IOAA 3VDDB 3OPWA 1UKGA 1VLNA 2W39A 4K1ZA 1NG0A 1LECA 5A7PA 2UU8A 2R073 2ZAAA 3NVCA 1PO12 1VRBA 3POSA 2BWCA 3H3UA 4LOTA 5A80A 4P5HA 1CWPA 1YFXA 2PHRA 2FDJA 1RVF3 1AL21 4CU8A 4WBBA 4YM0A 1ULCA 2A3YA 2CHHA 1GU3A 1VBD3 4RHV2 4WZFA 5D8AA 4EE2A 4CUGA 5A1LA 5C33A 2P6CA 2VBBA 1VBE1 1GR3A 1VJ2A 1NZCA 4WVMB 1AXYA 4ZZ8A 3DPRC 4P9JA 4RFT0 3WW2A 4DZGA 2B45X 5C3OA 3R4DB 2RS11 4ES9A 5DDJ1 1UX6A 3PLQA 1CAVB 5L9VA 4RQPB 4AGVA 3PL0A 5FY8A 1W04A 1XNAA 1AUYA 3HR9A 4YW1A 5GZFA 3HQRA 4QQ2A 4HG6B 2VOKA 1MQTA 4KU8A 1S2KA 2PQSA 3O1MA 1SBDA 4M0HA 5FPAA 2P5BA 2WWJA 2D6PA 2D6NA 3VDCA 5I91A 2ZGRA 1ZBE3 1JYVA 2V4AA 2XONA 4B29A 1GWLA 3CMGA 1OH4A 2HEVF 4M4RA 4ORFA 1AXKA 1X36A 5FZOB 2VTXJ 2V72A 3RYRA 4GJYA 2RHPA 3O1RA 1S2EA 4QM9A 5CISA 1H8VA 2GC1A 5CFDA 1PGW2 1JYWA 3AYDA 4NHMA 2WWUA 2ZMLA 4XJ9A 3FMGA 1HKDA 1AX2A 2Y6KA 5C70A 1Z7S2 2GAUA 3LOIA 1GFF2 4GWIA 5EP9A 4JTNA 4IXLA 3WP6A 2XPJA 3PIGA 2H0VA 5ABJC 3WX5A 4QGNA 2DBNA 4RD7A 3TN92 2E9QA 4OYUA 1RUH3 3OY8A 3N9QA 3LSDA 5KHGA 5D21A 1N1SA 4M3CB 1JOBA 1GANA 1YLLA 4TWTA 1ULDA 1JU3A 3AFGA 3CZJA 5J96B 1W6QA 1RUNA 1H6YA 4QPGC 3THCA 5FZ0A 4LE4A 2VBDA 5GLTA 4LUKA 4BZ4A 2C4XA 3ME2A 4HLTA 4YG0A 2P37A 3D0JA 3P3NA 4XDQA 2HJIA 5FIXA 4PBPA 2VZOA 3GBWA 2J7MA 4JGZA 4QB1A 4A41A 2O14A 3AJZA 3KB5A 1AR63 4EWAA 4FCAA 5IVVA 5A6XA 4D6QA 4CPBA 5GLZA 1W6NB 2Y38A 3IDAA 2TNFA 1EAH1 2VU9A 3NV4A 1UPSA 1CAUA 1XNKA 4BHPA 1I5PA 3THTA 3I3BA 4KWKA 4B1MA 2VNOA 4IV1C 4B1LA 4QPIA 3RZJA 5FJHA 2WWSA 3VZJA 1X9PA 2VO5A 3S0MA 3H1WA 1HXS1 3WDVA 1CAWA 2IXJA 3M8LA 1UD1A 3U4SA 4IEWA 3FLPA 4HOOA 1SPPA 2D6KA 1F35A 3PVEA 2ATFA 4IE5A 5FY9A 1F2NA 3TB0A 2PHFA 4WVVA 4GKYA 5I0TA 1O5UA 3POGA 2XJTA 2XWBB 3KS7A 1RHI3 4AVCA 3OEAA 3OUHA 1TMF1 2DCTA 1RUI3 2KXLA 4I02A 4MHUA 4RA0A 4CEWA 2VZSA 4MXVA 3PJYA 5FPXA 2B7YA 1YQ5A 2ZZJA 2OPKA 4OFGA 4CP9A 1LODA 1LENA 4HK9A 2DVFA 5FY7A 1G6NA 3IZOA 4FPCA 5IJRA 4KNCA 4R4XA 3KT1A 2EXJA 3UGFA 1DYKA 4XCBA 4HFSA 3EYPA 2WLPA 2HWD1 2RS31 5CFDB 1VB4A 3WNOA 1U5IA 2IXCA 2CV6A 1ASJ1 2RS52 2Y6FA 4LK7A 3SXWA 3SNMA 3NV3A 1VAKA 2VR4A 4K40A 3GCWA 1K3IA 1L7LA 3D8CA 4ATEA 4ZY9A 1DGWX 5FK7A 3WP4A 3RI8A 5BY5A 2ZGKA 1SFNA 2EALA 2YG0A 5FYSA 3ZFFA 2XG3A 3ZN6A 3ZYJB 1SFYA 2RDSA 1KJRA 4Q27A 5FZFA 1PZ8A 5F1RA 1AJKA 1VP6A 4LEJA 3WNLA 1LJ7A 1OMIA 5A3TA 3PJQA 5T55A 5CKNA 3I3EA 1Y3TA 4IGPA 4MGQA 4HVOA 2D6MA 3ACHA 3AL5A 4MV2A 1W6QB 5A7NA 4XXAA 5LRRA 4GZ9A 3NJXA 4AAXA 2VM9A 2PHWA 3UESA 1URXA 1PMIA 1IS5A 5JVVA 1W06A 2CWMA 3B69A 3DV8A 5J3UA 3FUOA 1XXNA 3ILFA 1AYM2 1SBFA 2ZTNA 1S4CA 2VNGA 3BIWE 3LIHA 1EYBA 5A3UA 1ND2B 5GLVA 2CAVA 5FZCA 2QQIA 2ZGNA 4YW4A 2HH9A 1IPJA 2W87A 1Z0HA 3VL8A 3FE5A 1W9SA 4IGOA 5FYMA 1RUJ2 4QGMA 4AL9A 5C9AA 1QJY3 3WHTA 4QPIB 5J7MA 4COYA 1ULGA 1YHFA 2LW8A 1FATA 2GALA 1NCRA 2I45A 5CEHA 1CAWB 3F2ZA 5F3EA 5LBFA 2P3KA 3Q8EA 3CZUA 1RUE3 2RG4A 4Q8KA 1C5IA 2CGOA 5AFBA 4FOQA 3C7OA 1VBB3 2WT2A 1WGPA 4HSJA 3OBRA 2JE7A 4QWNA 2YFUA 2WO7A 3RWNA 3W20A 4GH4B 1QU0A 3B00A 1W8FA 2EA7A 2RDRA 3A7QA 3VN4A 3C7FA 4EN9B 1DDLA 2GC3A 5KHHA 3O5SA 1RMU3 5DAPA 2D43A 3B3QE 2JDYA 1GZTA 5E6HA 3R05A 4Q4W3 2VH9A 4X6RB 1HIXA 5K0UA 4CEYC 2R061 3AK0A 2XJRA 2XKOA 2D6OX 5AVPA 2BYVE 4O65A 4A42A 2MEV3 3QACA 1A8DA 4AI9A 5F7UA 1O59A 1IS3A 1PGSA 1S0DA 4BMEA 3ZMOA 1VMHA 1ODMA 2FD8A 1MS1A 4IEUA 4R52A 1FT9A 4NRMA 1TEIA 4WM7C 4Y1XA 1UY0A 4JDOA 1NYWA 4ASLA 5I8SA 2UWBA 1UYXA 4LPLA 4FXGB 3NSTA 2XH6A 3PUHA 4GJZA 1WCUA 4RGGA 5APAA 5I93A 3I2GA 1Q8OA 4XDPA 1W28A 1Y9MA 4OUMA 4CCLA 2XJVA 2DDUA 2E32A 3BPZA 3A23A 5FQ0B 2TEPA 4WVWA 1HJGA 5C3RA 4YZ5A 1PVC3 1ZRFA 1MEC2 4JRAA 3JBG3 5FZDA 3UV9A 2VZRA 4AVAA 3UKTA 4FTBA 4E2QA 5JPMB 3LDRA 2A70A 3ITQA 2Q8DA 4CDUB 1OOPB 4Z1VA 3GF6A 3PMSA 3M4FA 2P2KA 1H8TC 2W94A 3E5QA 5BV6A 1FV3A 3GYDA 3OF1A 5K8SA 2QCSB 2OA2A 3IB3A 4Y5TA 5GZDA 3HNBM 1OI6A 1X9TA 2HWC2 2AREA 1DBNA 2WS92 5C9AB 2CTVA 1WZXA 5ANNA 5BNPB 2N7GA 1HQWA 3M3IA 4CDQA 1XE7A 2JG8A 3KQRA 3ZFGB 4N53C 3ZXGA 4RGAA 3AP9A 2XKPA 5CFCB 3KF3A 4CDWC 4FPKA 4H7MA 3OGVA 4OI1A 3W5MA 3IT8A 2K2SA 4QX3A 3QOPA 3V56A 1BMV1 5A70A 1JZ8A 1D7PM 1GKBA 5T54A 5JXIA 3ZN4A 3K3NA 4C1WA 1W9FA 1V9U1 2VVEA 3PURA 4Y20A 1C8NA 1NLQA 3VBOB 4DY3A 3J7HA 1W6MA 4AFCA 4UFJA 1UZYA 4NIHA 3VBFA 2WNVC 5K0UB 1TNRA 1GOHA 2D93A 3UNPA 1K5MA 3BOWA 5C8CC 2E63A 1AR82 1D4M1 4YW2A 2EIGA 2A6ZA 2G4IA 3TWIA 3D3AA 3UKVA 2YGLA 5A3LA 2XLAA 1UQXA 4Y3OA 4RR3B 4IEZA 4EN8B 2WFF2 5DAQA 1D2SA 4D69A 3P6BA 1PMJX 1GNYA 3JB4C 2JEMA 2R072 5FMOS 4HZFA 4IGQA 3H1YA 2MHFA 3WY6A 2WNUA 4XTMA 2V5DA 4AVBA 2YXSA 4CCKA 1RVF2 2JDZA 4DEVA 1NA1C 4CCDA 4DQAA 2JDPA 2AZ5A 1REDA 2Z79A 2WQ8A 1VBD2 4R9BA 3VGIA 2IWGB 5GLUA 1AZDA 3PUQA 2HWF3 4PQQA 4XPVA 4YGBA 5FK8A 2OW4A 5LW9A 1BLZA 1WCDJ 1WLDA 2K0GA 1CAXA 3KGLA 1AYN3 2C24A 1GQGA 5F3IA 4S2GA 1LB2A 3AMMA 4PI2A 3IAQA 5E89A 3WF0A 1R64A 5IK4A 1FOD3 4AF9A 4BH9A 4ZONA 4YVSC 3ZDSA 2QVSB 1S0JA 1G9BA 3NAPA 4YFWA 2XUEA 2DCZA 1STMA 3HQXA 1F5JA 4MGYE 5CNAA 3ILRA 3WUDA 3PUAA 2WZR3 4KG8A 4FAGA 2WKKA 3ZVXA 3DUIA 3AX4A 3S7EA 1UMHA 1HB1A 2A7AA 1C8M3 1ZBE2 5JXJA 2ZX1A 4AEMA 5FY1A 2Y26A 4C1XA 2GNDA 1K42A 1O7FA 1JZ5A 4B4RA 4Q4X1 5LRSA 3T1LA 4DUWA 5H9SA 3U11A 4GMP0 4JX0A 2QE3A 2RV9A 3I2JA 3ZR6A 2AR6A 1NUKA 5A6QA 4X6QB 5LBBA 1PGL1 4Y26A 4CDXC 3A21A 1COV2 3OGJA 4W65A 4YM3A 2PAEA 1WLCA 1KFXL 3MW4A 4DXZA 4XILA 5K7PA 3H7JA 4ZU5A 5L7OA 3ZXKA 2JE8A 4AHZA 5IK7A 4YVWA 5C4WC 3ZFEB 4OI0A 2OZJA 5A32A 2VL4A 4XQDA 3RZHA 4FPFA 3KV6A 5E88A 4UOJA 1OHFA 3V0BA 4H2AA 4LBNA 4PIZA 2D40A 4Q0QA 1LOGA 2W1QA 1VAVA 1H0BA 1G86A 4YM2A 1IS6A 2PHUA 2V73A 2DF7A 2QDRA 2YBSA 2XWJB 3I2OA 2CGPA 1SBEA 3AKQA 1RUG1 2WNUB 4XAAA 1XB9A 2LALA 3DYPA 4BXFA 1OPMA 1J59A 3UJQA 1KQRA 1PMHX 2JG9C 4JC1A 4N43A 1FNZA 4C91A 1AR62 3BTZA 4DO0A 4D6RA 4L99A 3TAYA 3WG4A 4IERA 1GYKA 1DYPA 1BVVA 3KLSA 3RZLA 4AI2A 4QHOA 4YZ3A 4QHZA 3GALA 5A3WA 4I3GA 2H0BA 1KDMA 1BXHA 3PTRB 1ZNPA 3TYJA 2W3JA 3VHOA 3ZMNA 1XE8A 1TG7A 2BBAA 4MGSA 1EY2A 3ZN5A 4BK4A 1YCIA 3NNMA 3IDEA 4XURA 2ZAHA 1DFQA 2A75A 3VBSC 1MVQA 1ND3C 3O0VA 4CU9A 3MW3A 3NO8A 3GZAA 5GM0A 4H55A 4MUVA 3NKGA 3WP5A 1HRV3 5FBZA 3PUIA 1WBLA 5B4NA 2VW2A 3N9NA 4YNIA 3RDIA 3MUZ1 1DGLA 1W99A 2J1TA 2E31A 2BGCA 2XBO2 2XVGA 2CDPA 3OD4A 4UXAA 3ZXFA 1YO8A 2X05A 3MFCA 1SHWB 3VBHC 3GXUA 4W50A 2RMU1 3MV01 3MHZA 1AF9A 2AH2A 3FC0A 2AENA 3AFKA 2ZCWA 4OMDA 2ZHNA 5AC91 4SLIA 1W2NA 4W4ZA 3OBZA 2BWAA 2YFZA 1LOFC 5GALA 5JUVA 4DEQA 1LRHA 2DUQA 1MACA 2WO3A 2ZEXA 3AJYA 1U12A 1UXXX 4NN0A 4AEJA 1LAJA 4YVWB 4DUXA 2EIDA 3OGRA 4O9GA 5CKQA 3UJOA 4DFSA 5T5JA 2A3XA 5FBJA 4NVPA 2NPIA 1XNTA 2HKXA 4E2SA 1XE0A 1W90A 5CBLA 1W9WA 4LIVA 3VDDC 1R091 2ZS6B 5BNNC 1AL23 2G9GA 4AVSA 5HV4A 4GB32 5CG8A 3Q8BA 1CZVA 4XFIA 4DOUA 4JZRA 1PX4A 3IDBB 4INDA 4N9IA 4UBGA 1CPNA 3RVHA 1PM4A 1VAMA 1VBE3 2B8MA 3AZZA 5JCTA 3MZHA 3S7IA 3H8OA 1OLQA 1EUUA 1WLWA 3W21A 1PVXA 3APBA 1J1LA 3M3CA 1CZSA 2RM21 4N43B 2C0ZA 2RS13 3H3LA 3JCIA 3P1IA 3SISA 4AYUA 4C8DA 4CP2A 5FYZA 5IWFA 1G9AA 5DDJ3 4TSVA 4HETA 4XUQA 2YMZA 3I2IA 2W95A 1SZBA 3ZXLA 2AEZA 2QQKA 4AHXA 2P1BA 2Q8CA 4PLNA 3OUJA 1ZZBA 2QQLA 4DXSA 1QMJA 4FOVA 4FOYA 3E1F1 2OZ6A 2VTFA 4H7LA 4Q0UA 3WOGA 1EPWA 1AR71 1IZ3A 1R1A1 2WN3A 3OYWA 1RUE2 4I0AA 4RQPC 3DGTA 4UF0A 1R082 4Y33A 5L7OB 2IVIB 3VL9A 3CJXA 4Y5SA 1VBB2 2TBVA 4YVSB 5LK5A 2PLV2 3J8F1 4NIAA 3MIGA 5F32A 3OJBA 3V64A 2RJ2A 1DLLA 4BE3A 4AFAA 5FLIA 5TSWA 3QCWA 5FZGA 3MUY1 2ARAA 2R1DA 2CL2A 1T2XA 5FYBA 2PN5A 2PHLA 1WCSA 1ULFA 2FDGA 3MICA 2LRPA 3T3YA 4Q4W2 4F83A 1J3RA 1W9YA 4LITA 2HEWF 1NLRA 3MYXA 1VBA1 2SLIA 1UMIA 4Y22B 2J1AA 3H8RA 1ZRRA 4IV3B 2A6YA 2BRTA 3HOBA 5FYYA 4E9KA 4LULA 1FV2A 4PDWA 2Q1ZB 5FREA 2FDHA 2VQTA 1JYNA 3KVBA 2CDOA 3SH5A 1SG3A 3RMYA 4MGTA 2QQOA 5A33A 2DBIA 2OT7A 1N3OA 1PO11 1QOSA 2XVLA 3ETQA 2ILMA 3WF3A 2VCCA 4QQHA 1APNA 2VMEA 1RUC1 4FFGA 1JW6A 5T3NA 3BOPA 1W6OA 3AMQA 2A6VA 4IEQA 1YJKA 1JMUB 1NT0A 2WNEA 3VZOA 4RHV1 3MF9A 2VUAA 2VZ1A 1FI2A 3CF6E 1PVC2 5A7OA 4D94A 1EAH3 3HIFA 3SEPA 3JBG2 4YG3A 1O3QA 4UBHA 3VDBA 2E7AA 3WG1A 3WQ1A 5FO9B 4K6BA 4XYXA 1K5JA 3ZYHA 2RJLA 2WR9A 1I1EA 1HXS3 5F5QA 4XFGA 5JXGA 3RJRA 3ROUA 2W47A 4XZUG 1V6LA 4XF0A 5FP3A 4LJHA 3GHNA 5DQ0A 1QJEA 4AGRA 1WWYA 2F6BA 3I97A 2YB7A 1QNYA 3PHMA 2ZXQA 5IFPA 1H6XA 2ZGSA 2ZZQA 3PU8A 3KCCA 5EJ3A 2YGMA 1V00A 1TMF3 1VRH2 2A3WA 2A5ZA 1F15A 1JN2P 4IEPA 3RNSA 4I01A 2GN3A 1NCQA 1RUD2 4UW6A 4YW6A 2JECA 1AX1A 2CSGA 4QKBA 4BQ4A 1DZRA 2XB6C 1WW7A 4JGYA 1W0PA 4M3CF 1XNDA 2VMIA 2ET7A 2ZKNA 5LA9A 3VHNA 1FMD2 1REEA 2VG9A 1UY2A 3ATGA 1OH3A 1WMEA 4KWUA 4QDQA 1O3TA 1GV9A 2X5IB 4MHRA 3WQ0A 1FPN3 1VALA 2B9UA 3AZXA 2HWD3 3EQEA 2RS33 2WUHA 3FBYA 5D1IA 4ZXEA 1XRUA 1CX1A 5FMCA 1ASJ3 1DG6A 2Y6JA 3B5LB 2ZEYA 3O14A 4BQ5A 1NQDA 4EZ4A 3PUSA 1JZ6A 3AXDA 4EYUA 1GQPA 3D6EA 3MLKA 5CFDC 4CE8A 4J1WA 1JOPA 3NRUA 4L92A 3IAPA 2VECA 1UU5A 4KI5M 5E16A 5HPOA 1JZ7A 1LU1A 4XJUA 5AVAA 2O0OA 2XR4A 2AUYA 4YRDA 2XXZA 3NV1A 4Y5Z0 5JLVA 1W05A 4JV4A 5LASA 1XYPA 5A33B 3I49A 3DL3A 1R1ZA 2RR11 1ACCA 4BQYA 2ORZA 2WQZC 5JOZA 1DQ4A 2ENRA 3KVAA 3DN7A 1BJQA 1W6OB 1JYTA 1XSQA 2HWF2 2PYTA 5FPUA 4J6GA 4GWJA 4PF5A 1WMXA 5IK8A 1MZ6A 1AYN2 5BNNB 2FCTA 2BERA 1CPMA 4B7KA 4OZOA 4MADA 4AVTA 1FOD2 2JIJA 3VHPA 3S57A 1ND2C 5LB6A 2Y0OA 2ZGOA 1H4HA 1UY1A 1QJX2 2VMFA 3DYOA 3F95A 1I5ZA 4QB2A 4XBNA 3SLIA 2NM1A 5FFOC 3JXSA 5C8WA 4NHLA 2QFEA 4LBOA 1VBC3 2E53A 4LBQB 2WZR2 3LSEA 4RS5A 5EJ1B 3BKZA 4FO9A 4QPIC 2VMHA 2Y34A 5IATA 5C5TA 1QKQA 3BPSA 2EIBA 4N7IA 3RSJA 2IVJA 3NNGA 2DVDA 1QHDA 2A1XA 4UAPA 2ZGMA 1NCQB 1RTVA 1AXZA 3NQHA 4OVEA 3VBUA 5JIUA 5JXHA 4PJYA 2JDUA 1N1YA 4O61A 4XUOA 4BQ2A 3BVCA 3LCPA 2XMLA 4COVA 1UZ0A 2R063 4GH4C 4EN7B 1HN1A 3N9LA 4D0QA 5DPNA 3LA7A 5B2GB 2RS51 4S2HA 3FHQA 5GZGA 4OUEA 4G4FA 2WZEA 3N3HA 3I54A 5C3SA 5LBCA 1M4WA 4JKLA 4OCTA 3SH3A 2PHXA 2QZ2A 4GALA 4HL0A 3E6CC 4AFBA 3V0AA 5LBEA 2R042 1C1LA 3HBKA 5JDBA 2NN8A 1HRI2 2J1VA 3LEIA 3K77A 1J1TA 1KXGA 3K75B 3HBZA 2VW0A 3AP6A 3PVOA 1LHNA 2YDEA 3USUB 4E4DX 5C6CA 1KS5A 4AI8A 2ZGPA 4QDSA 4YZ1A 4XF9A 2VD7A 3DKWA 1PO23 4HMZA 5E1RA 1X7NA 3R4UA 1AYM1 3G6JB 4Z2AA 1IG3A 1JZ2A 4KQ7A 1PIV1 2UY8A 4HKLA 4MXWA 3FHIB 5T5OA 3AP5A 1OFNA 1ULEA 4K9SA 4CUAA 4MSVA 3K4ZA 1Q8SA 1KRIA 1UN1A 5FY4A 3WXPA 1RUJ1 1OSGA 4PIYA 2Z5WA 4YW7A 2A71A 3O1OA 4AVVA 4AFDA 4XJWA 2WABA 3QBQA 4Q4V2 4YLZA 4HKOA 4MGZE 1FAYA 4UFIA 4CDUC 1OOPC 1YNAA 1YI7A 4P9YA 2WFPA 1GWMA 4JCKA 4BDVB 4ZXKA 1D2QA 2XOMA 1TME1 2RE9A 3FLTA 4NPLA 5EJZB 3AVSA 1MS4A 1XBFA 4QX1A 2VXJA 3BU0A 3NJZA 2PA7A 2JDMA 2E6VA 1S0IA 2XJUA 2W0XA 4XHBA 5D8AB 3IBMA 4RS5B 4AEDA 5C9AC 5HCAA 5BNPC 1MVEA 4QXHA 5FYIA 3JD71 5I0UA 1OVPA 4QQLA 5FZ8A 3S5QA 4XBLA 5FPLA 4Z8BA 3OOXA 3MPBA 2HWE1 3ZFGC 2PAKA 4OHXA 1TNFA 1NLSA 1V9U3 5CFCC 4R9AA 2J1EA 2QUOA 1RITA 1EP0A 2VQ0A 5FOJB 4IEVA 3QD6A 4IL7A 1SLBA 1Q43A 4DINB 3T08A 1CN1A 1QQP2 2B5HA 2BFUL 4JVAA 1D4M3 1MQTB 4SBVA 3RPQA 5ACA1 4YGDA 1A6CA 4M0NA 3BODA 1PM7A 3VBOC 3D4KA 4W6YA 2DVAA 5ERLA 4BJ0A 5K0UC 4B7EA 1LESA 4Y1UA 3BUCA 1ZZ7A 4XFHA 3SMHA 4CPBD 1ZBA2 4RR3C 5A6YA 3H50A 4JTOA 4YGCA 4MGIE 4W6XA 5KXEA 1E5SA 4NHKA 3E5XA 1OLMA 4Q4Y2 1D0HA 4FFIA 3MF6A 3MGUA 4LNVA 1RXFA 4OMCA 5FZ4A 4NIIA 2ZX4A 5IVFA 4HVQA 4TLGA 3NNFA 2V5YA 4OQ8A 1CGPA 2OS2A 3OEBA 3FFZA 3LEMA 5SV8A 1N47A 3Q9OA 1PZ7A 1NZIA 1TZOA 3OY8B 4EN0A 1B35A 2PTMA 2P4EA 5A1AA 3IMNA 3BN6A 5K9YA 4MZUA 2DFBA 4CCOA 4AZZA 1Y43B 4UW4A 2ZJCA 4A6OA 4CTEA 5IUQA 1MZFA 1OURA 1WCKA 5DMYA 4FBFA 4H3WA 4OUSA 3OGGA 4ES8A 2FMYA 2ZHMA 1H2KA 2W1WA 5E8AA 1PNGA 1SLCA 4JGZB 1H9WA 1S0EA 4K20A 5FCCA 3ZOIA 2JKXA 2ZEWA 1GP5A 2UYAA 4AEDB 4Q4X3 5T50A 1EPZA 2VZQA 4GA9A 5JOWA 1KD7A 3AP4A 1CAUB 5ABJA 4XUNA 4QXCA 2P17A 3HEIA 4C0HA 2P3YA 1HW5A 1IPSA 1JYXA 1WW6A 1ODNA 1YC61 3ZSJA 3AZVA 5J09A 4XUPA 2QTWB 5HBAA 1DHKB 4DY5A 1AR92 5LATA 1OD3A 1SPPB 4XTPA 3WG3A 3A0NA 2ZGLA 3POJA 3W59A 2EXHA 3HPNA 2ETEA 3N4MA 3GBFA 2VC9A 3AXEA 4PLMA 2VMGA 1MS8A 1G9FA 2CU5A 5LEKA 2XVKA 4K8RB 4D7SA 4DB5A 2WFF1 3POEA 5F6KA 4AQTA 5KHJA 2ARCA 2VY0A 4F8AA 3SCHA 4CEWB 3WQ7A 4NJ4A 4Q26A 3RG0A 4FPGA 2XJPA 4NIGA 3ZFEC 1CX4A 4CP9B 4LO4B 3ORJA 5A7SA 3WDXA 2YZ4A 3POIA 4NHYA 2FHRA 1W8HA 2G19A 4ZPIA 5EYYA 5I8YA 4H14A 3SKJE 1RUG3 4IV1A 2PELA 3E6DA 4QX5A 3MPPG 2X8KA 3S6PA 3ZXJA 3OTFA 1YQ6A 1MS0A 1BKZA 1OPOA 2VMCA 1O3RA 3JQWA 3WF4A 1EAH2 1JODA 1PHMA 3I3QA 1KITA 4PI0A 2WNUC 1GP4A 3IIAA 4Z82A 3ZFFB 3ZN6B 4BQWA 1KGYA 1QOOA 1C3HA 4PQ9A 2W08A 3ILNA 4FPYA 1B35B 5DUVA 3NNJA 2BPA2 2HEYF 2XHKA 5T52A 3AVRA 4K3UA 4L11A 1UIJA 4X8NA 4LHSA 2VOVA 4OQ9A 3WW4A 5JMOA 4LHNA 5EFUA 3VZLA 2IFWA 4KU7A 1FYUA 1X50A 2NYYA 3VD4A 4QX8A 1S1AA 1OFSA 1D4VB 5LA1A 2VZVA 1S0BA 1UPIA 2VCBA 2BGPA 3BB6A 3KCYA 5F5AA 5CYYA 5HCHA 2J1UA 4FQ4A 1H30A 3RFRA 3T2QA 4DMIA 3AKPA 4L2NA 2H6CA 4LLFA 2YU1A 3I59A 3L2HA 4P9XA 4CXXA 1QJU2 1U5ZA 3OBTA 2RMU3 2YU2A 4HK8A 1DIWA 2QJVA 1FPN2 2RS32 1CJDA 4KL1A 2VZTA 5AC93 1COV1 1NCRB 2LTNA 5DUUA 2ZX2A 2E33A 3M70A 4B3NA 4OI2A 4LQRA 4UFHA 1M06G 5KHIA 1ZZ9A 1UCXA 4BYYA 3SITA 4YZ2A 1PK6A 3AYEA 2B46X 4V2VA 3PIJA 4UW3A 3I2DA 3C7HA 3VKNA 2WA3A 4LKFA 4P9LA 5J1XA 3FFQA 3VKLA 4NHXA 4NWWA 2NP0A 3T0BA 1V6MA 2EICA 4YVWC 1ZRIA 2GH2A 2QQWA 2F4PA 1C5HA 1E5HA 3ZYRA 3UK9A 4R9CA 4CVUA 2RM23 3OPTA 2OUHA 4HN0A 4I30A 2ET1A 2W1UA 3HN3A 2BNMA 1V6JA 2K9ZA 4N43C 2WLQA 3EBRA 3K4DA 2HWB1 2JENA 2B9VA 1IKQA 1VBC2 3CJIA 5CA6A 4Z2WA 3B9IA 2BVBA 4GWMA 4J25A 1W2UA 5IHRA 4V2WA 3J8F3 4Q29A 1BCXA 4CEYA 4FI9A 2R30A 4XUTA 1BK0A 2GSYA 5L7OC 2XBO1 4QX0A 5A7WA 1GZCA 3GZTB 3QH7A 4DRRA 1H1MA 2J22A 4WM7A 1UYZA 4OLLA 5FY0A 1LCLA 3MIFA 4HSLA 3I59B 2NMOA 4I0BA 4IDZA 2JDAA 5DUXA 3DF0A 5JI9A 1W6PA 4IE0A 3HN1A 1V0AA 4LOSA 3VBRA 4HANA 5IAXA 1VBA3 3JB8A 5BNQA 2XQRA 4FFFA 1WMFA 3LD8A 1DZQA 1VMJA 5CAZA 1RGSA 1KEXA 4DIQA 1LNSA 4PIXA 5F5IA 2JG8B 4CDQB 2ZACA 3TEWA 2ZGTA 2WT0A 3GJAA 3VD9A 2D5FA 2DYCA 1GZWA 4P9IA 3INAA 1TE1B 5FZLA 1PK6B 3LKJA 4IV3C 1UMZA 2BJSA 1PO13 1GNHA 1O8PA 2RJKA 5A6ZA 3C8XA 5DZEA 5FXVA 1RUC3 3ST7A 1IPKA 3PU3A 4EZHA 4YPJA 4BWOA 5FWJA 3FBMA 4FTEA 3MIBA 4FPHA 4GB31 4Y20B 1AHSA 4IEYA 4RHV3 2I07B 3ZSLA 1PO22 1W6MB 2ZOEB 4FP3A 3KCXA 3LPFA 3VBFB 4ZZ5A 3AYAA 3PVBB 1K5MB 4Q0VA 3IDCB 1Q8PA 1UZVA 3ACFA 3M1HA 4LXLA 1RUH2 3CNAA 5BYNA 1UOBA 5LWBA 1Q8VA 3CEWA 4DS0A 5EXOA 2VCMA 4N53A 1NKGA 3BI3A 2VZUA 1GQHA 3VD7A 1H2NA 3WVJA 1J83A 2ARXA 3DCQA 4CDWA 3ON7A 4XMAA 1CVNA 4KBZA 3HWJA 3MLJA 5FPVA 2QNKA 4AEKA 3N7KA 3AM2A 1LTEA 4LIUA 4CYDA 1JUIA 2ERFA 1R081 4XJAA 2Y6LA 3CJIB 3U0ZA 1POV1 1YXWA 3J7LA 2WIIB 1JZ3A 1CJPA 1LOBA 2PLV1 4XZPA 1F8VA 1PX3A 1BMV2 1DQ5A 1F4AA 1CAXB 2WSUA 1BQPA 1DGRA 2LUWA 4A7ZA 1ZM1A 5FR3A 3AZYA 2GP3A 2B42B 4NAOA 4AI3A 4AQ6A 1DU3D 4A3ZA 3RZGA 3B9CA 5F3GA 1W3VA 2J42A 4NPMA 4E4HA 5LY1A 4YARA 1F4HA 3NAPB 1RJ8A 4MGKE 1HB4A 2VVFA 1EV11 3RYPA 3TOJA 3VBRB 3RJ2X 4LBLA 3ZKUA 1RHI2 1ZZ8A 1BBT1 1CZTA 2X5IC 4E8DA 3PDQA 5A3PA 3WCRA 3WDWA 3OG2A 3HD8B 1S2BA 3T09A 4AQ2A 1RUI2 1RB8G 1NA1A 2C1FA 1LHUA 4UFMA 4Q0SA 1JS9A 3BCWA 2WA4A 1GZWB 3LGRA 4TXWA 3URFA 2JD4A 1ENXA 3N9PA 2AGSA 1OA4A 5JZGA 4LKSA 4A2UA 2WQ4A 3OGSA 2HYXA 1A3KA 3O1PA 5L9BA 2JDHA 2RR13 3NKTA 1LU2A 4HT1T 3NMBA 2PQQA 4FXKB 3J9SA 1OQ1A 1ULPA 2UYBA 5FWEA 5JIAA 4BXSV 4D6SA 3OD0A 2JICA 3POYA 4GD4A 4I0WB 5BPXA 1W39A 4EV0A 1IKPA 2XLGA 1F5FA 4A7KA 1OA3A 2ORXA 5J48A 3KV4A 1O8SA 2BBVA 2Z4FA 2YV8A 3WDUA 3T30A 5A32B 2VQUA 4JHTA 4CUBA 5J37A 1WA6X 4QXKA 2DU1A 1BEV1 3V0BB 3KT4A 4QB6A 4K7JA 4FOWA 4F7ZA 2R1BA 5KXDA 4I09A 2D6LX 2NQYA 3MO4A 3TNPB 4ATFA 2Q30A 4Y1YA 4EROA 1IQAA 1YJLA 2ZKLA 3WNNA 3GHMA 1VRH1 2D3RA 2D7FA 4CDXA 2D3SA 1RUD1 4LA3A 1ALYA 1MPXA 4Q4X2 5G05L 1RUF1 4BA6A 2IFRA 1FMD1 5JPNB 2VTXA 2GMMA 3VKFC 1XC6A 1QJY2 1C28A 4N90A 5C4WA 2WBKA 1PGL2 2FDKA 2DV9A 1NCQC 4FT8A 4KH9A 5GZEA 2RS53 1LGBA 4CUCA 2W68A 2JJ6A 5KXCA 3OSDA 5DG2A 3TBDA 1LHOA 4JQTA 4P5YA 1S0FA 3H1MA 4XCAA 2JWPA 5LA2A 5CU1A 4CCMA 2VPVA 1O4ZA 2E7TA 2GDFA 2CWSA 5LK7B 4MVTA 1CONA 2JG9A 2OXBA 1AVBA 1RMU2 2A6XA 4LT5A 5I0SA 5A1FA 5HCFA 4AHWA 1W8OA 4IE7A 3ZIWA 2O8OA 5JZGB 3KHBA 1W03A 1HQNA 4L8QA 3IN9A 1UU4A 4A7YA 1RUG2 2Q8OA 1AYM3 2MEV2 1XYOA 1SLIA 4PHZA 1PIV3 4IE6A 1HV1A 4N7UA 4XIKA 5CZKA 1XNCA 1IS4A 5FLJA 3LDBA 4GMP1 3VBSA 1NXMA 2UWAA 3K46A 1ND3A 4COWA 3S5AA 1RUJ3 1XQNA 3N7MA 1W8NA 4L97A 5FRAA 1QJX1 3WNXA 1UZZA 2JB8A 3WF2A 5JI7A 1OA2A 3EB7A 4QPYA 4URTA 4BMBA 1QGLA 1TME3 3LA2A 2Y60A 4Q8LA 4DRVA 3KHCA 4LBKA 1XPWA 3A0KA 3OPZA 2ZA9A 1MS9A 2XJSA 1DZTA 3DECA 3JD73 3LZZA 5FTTC 2B39A 4HPKA 4I2OA 1LEMA 2W5FA 3R4SA 2VBPA 2GC0A 4LUMA 1A34A 2EXIA 5FPZA 1F9KA 2HWE3 3JQXA 3MFAA 4XQ4A 4NPRA 1DYOA 1SCRA 1CESA 5FMBA 1LOFA 1CIWA 4P9GA 2DCJA 3POFA 4RS5C 5D8AC 4TZDA 2OKXA 1W8UA 4FFHA 1C4RA 3SC7X 5KR7A 4ZHNA 3OCPA 1GSLA 1MZ5A 4CCNA 5FY5A 5IFTA 3BTYA 4Z07A 1ZRDA 4KBBA 5ACA3 3ZLIA 2OUJA 3MEPA 3MIEA 4NE9A 5FP8A 3NV2A 3OYWB 1TQ5A 4UF0B 1T6GC 3E5UA 5FLHA 1JI6A 2ZPXA 1HQLA 4O9EA 5F3CA 1E5RA 1WCQA 3U1XA 3U14A 3SCFA 1MQTC 2R041 1GUIA 1GLHA 2XQXA 3AB0A 3JZVA 1HRI1 2VCAA 1SEFA 2ZX3A 3RZZA 3U37A 4DNYA 4IQPA 4OHZA 1PGW1 3SCGA 5SV5A 3K51A 4BISA 1AX0A 3B93A 3RWKX 1Z7S1 2FCVA 4WVMA 3Q8AA 5BNOA 2VXRA 3KQ4B 4KG0A 4LBQD 2Z69A 4CU6A 1J84A 3TN91 4XJ8A 3J7MA 2VUJA 1UNBA 1Y7BA 1QNWA 4K8FA 4MG2A 1CAVA 4RQPA 2QQMA 1O4TA 4PDWB 4OI4A 2FBEA 4LA2A 4XW3A 1N3QA 5EQUA 4YSFA 3AKTA 4AAPA 3UGHA 1UF2C 2RVAA 1BZWA 4Q4V1 2NMNA 3HVDA 5FV3A 2XL7A 1JXNA 1OLME 4KWLA 3ZM8A 1Y9QA 3C3VA 5EZWA 2VAUA 1LEDA 4RFRB 1NX9A 3K2OA 4Y24A 3WW3A 1IHMA 2VE1A 3M3EA 2L9LA 4EWDA 2I2SA 1J3QA 1C57A 2Q8EA 2R6QA 1WLTA 2YUEA 2IC1A 1YQCA 1KS4A 1DP0A 3ES4A 3VZNA 3W5NA 4GWNA 2BV4A 4JGZC 4IEOA 5FDBA 3LDKA 5DABA 5A7QA 1XU1A 2JDNA 1H4GA 3J26N 4AEDC 1VPHA 1UW8A 2DFCA 3RI9A 4A44A 2PXJA 1Q56A 2E26A 1V6KA 4QHBA 1X82A 3AYCA 1UZWA 3OUIA 2EIEA 1QQP1 3LF7A 3WDTA 1I6XA 4ARXA 2BNNA 1SFPA 2G9ZA 4BLIA 4TN7A 2WN2A 4R4ZA 1C8M2 1LGNA 4E4ZA 4M3CA 4CCCA 4WM8A 2W9XA 5CB7A 1G9CA 2VW1A 2ZMKA 2CAUA 3M3QA 2WFF3 2JX9A 2UURA 1QIQA 1XYNA 2ARBA 4ZS3A 5FZ6A 3KSCA 3WCSA 3WDYA 2FZ2A 4EWEA 2Z42A 4IEXA 4W8JA 4JGYB 2YC2A 1ZBA1 2F4LA 5EYXA 1JUHA 4ONUA 1DQ2A 1RUC2 5A3OA 5IW0A 1JHNA 1W3XA 3H42B 2ZGQA 4CEWC 2YC4A 4QKFA 1DQ1A 3LPGA 3M7AA 1W6NA 4R8HA 3H0OA 2ADEA 4Q4Y1 5DZFA 2OYZA 4QKDA 4WV8A 2DWRA 2ZEZA 5BNOB 5F9TA 5JSPA 4L0PA 4OZXA 4XFBA 1QDOA 3HJRA 1SCSA 1JZ4A 2YPJA 3KT7A 4J1XA 1O91A 3TRSB 2BQPA 4ARYA 5JMCA 3FUQA 3LFMA 4Q0PA 4DXTA 3H8XA 3C7GA 1KFUL 5KC6A 1UO9A 2QDNA 1VE0A 2X53S 4LO6B 1GWKA 1S0CA 2W91A 1E57A 3E6BA 4M00A 1SDDB 3ZFFC 3MI8A 3VD5A 1QDCA 2W46A 3ACLA 5JOXA 1YEWA 3TNQA 1NY72 4ISQA 1B35C 4NOTA 4YWAA 2W1SA 4IW3A 1Q3EA 2VZ3A 4Q5OA 4FPJA 1S0GA 4HVRA 2WYSA 4U36A 2YY1A 5FZ3A 2J1RA 1JU4A 1OBNA 3ACIA 5EIYB 2EVXA 3FX3A 4HBNA 1RXGA 5DAVA 3U4XA 4AXOA 4AG4A 1COV3 1HN0A 3EMRA 4GQ7A 4RSUA 3WNPA 1AR91 4E4SA 1U5YA 1DGRN 3HAGA 4Q2FA 2OQ6A 1NQJA 3GBGA 2Q5TA 3GCXA 4X8PA 3T4HB 5A3MA 5JR2A 4V1PA 1OLRA 3O12A 4RGKA 5FYHA 2HLEA 1QJZA 4WZCA 2OVUA 1HRV2 1UYYA 5DAWA 1NCRC 1UXZA 5FYUA 4WM8B 1X33A 3D0SA 4EQVA 1GP6A 3VKOA 4BM8A 2J1SA 4I3PA 3VBUB 1OKOA 3X29B 1LULA 1XJAA 2JIGA 4FQZA 2JD9A 2RR12 2O8QA 3IMMA 5FP7A 1YQ2A 3LE0A 4XF1A 1BVP1 3H3ZA 4ASKA 3H7YA 1ND2A 1P8JA 3U10A 5D2AA 2VMDA 1W2AX 3J4UH 4BQXA 2IXIA 4NMIA 3POWA 4GKXA 2MPFA 4LK6A 5IVBA 1AJOA 3L9JT 2WNOA 5FZKA 5C7GA 1LOEA 3NL1A 2VNVA 2VOTA 3CO2A 4U2AA 3ELNA 1V6OA 4AI1A 1XOYA 3CKHA 4LR4A 3ZXEA 3V0AB 1JH5A 1XSRA 2X29A 1DGWA 4DUVA 5DXDA 1T6BX 3DPRA 3WNKA 1OUXA 5DUWA 1NXD1 1KJLA 2HWB3 2YHJA 1AL22 2Y8KA 1QXPA 2ZBJA 3AC0A 5IVYA 2NLRA 2Y64A 1POQA 1IGOA 1HDKA 1VBE2 2GMEA 2WT1A 2WDBA 4ITCA 3NJVA 3RYKA 5I0DA 4XACA 2JB4A 1MEC1 4GH4A 3SQOA 2ZHKA 3AMPA 4PF1A 3VLBB 3KZ4C 3THDA 4KGGA 1XU2A 2RS12 5JOYA 5KHKA 4MXWB 2W92A 1H2MA 2XBO3 5DDJ2 5JAXA 2SBAA 1QOTA 2FDFA 4BB3A 1ZRCA 1QJU1 1O6UA 5BUVA 4XHXA 1VR3A 2HWC1 3SH4A 1FXZA 1FPN1 2WS91 3SEEA 3ZR5A 3DEMA 5F2SA 2R0HA 4CA9A 1Q8QA 4UT5A 3J7NA 4QXBA 4CP0A 5FMDA 1OF4A 2VVDA 5FZAA 2OQ7A 5FAXA 1H1AA 1VB2A 3CBNA 2AC1A 2YPDA 2BU9A 1WD3A 3BU7A 2QQVA 1SMVA 2V4VA 4XMIA 1GNZA 4XJZA 3R6SA 2RDQA 5LEJA 3TEXA 4L9BA 4BK5A 4CDQC 2JG8C 3D82A 4QKNA 2XUMA 2WL1A 3WT3A 5FQ0A 3H8UA 4GB33 1ENQA 3MBWA 2VZPA 1PK6C 4HKWA 1G7YA 4QPGA 3RMXA 4E8CA 3RZMA 1PIV2 4K21A 1LOCA 1AR81 3KF5A 4Y1VA 3FL7A 4BPZA 3GZUC 4ZU4A 4CDUA 1OOPA 4QU2A 1MS3A 1ZREA 1ZYBA 1MR5A 4GAZA 4TTGA 3OB8A 3FJSA 4O7XA 4FP2A 1NAEA 3VBFC 3UT0A 4COUA 4EN6B 2R7EB 1K5MC 2DUOA 1JTZX 2R071 4C0BA 5BNPA 4A4AA 3HNYM 4ET7A 2D98A 3MIHA 4XFCA 4QQOA 3DPRB 5FUIA 5CIRA 1RVF1 3I7DA 3ZFGA 1VBC1 1TME2 1OQEA 1FX5A 1DQ0A 1R083 3UL2A 1VBD1 5CFCA 1POV3 1FNYA 1OD5A 2CGNA 2PLV3 4CU7A 2YYOA 2TUNA 3AKSA 3JD72 4ISRA 3FLRA 5EHDA 2EXKA 2HWE2 4RYDA 2P6HA 3CJIC 4UYBA 2FDIA 1W8WA 3ENRA 1HXS2 3VBOA 1PNFA 4AQSA 5FXXA 3EHKA 5F6LB 3WW1A 3RZKA 5FZ9A 1UAIA 3O7OA 1WW5A 2D97A 1EV13 2BUKA 3MV11 1DF0A 5ACA2 1JBCA 2D5HA 1BBT3 1YYNA 3THPA 1LKNA 2DCYA 4MLOA 4RR3A 5IVEA 1A8MA 1TMF2 1ZBE1 3IKWA 3PNAA 3NW4A 2VJXA 5IYYA 3L2YA 3NAPC 1POV0 3B94A 3G7DA 4NIDA 5I8TA 2EF6A 2LM3A 1W0OA 1PZ9A 3VBRC 2E51A 5FZMA 3WD5A 4YGEA 3A22A 1UWWA 1ZZ6A 1YFUA 4LTAA 4CCEA 5ABJB 5FUPA 3D5OA 4QX2A 1ONAA 4A6SA 2HWD2 2UWCA 1UOGA 2K46A 2KR2A 3A4UA 1ASJ2 1LHWA 4D3WA 1SLAA 4B8EA 1ZA4A 4URAA 3QLQA 5IK5A 1PO21 3WZ1A 4JAAA 4AOCA 2HBUA 4XABA 1YFYA 4QPGB 1H2LA 1N3PA 2WJSA 3T2PA 3ZPOA 2XHNA 1RUH1 3M3OA 4QMAA 3ZO0B 1GOFA 5F8PA 4XE9A 5FPBA 2VOWA 1YIFA 1DCSA 1HV0A 1RJ7A 2GP5A 1YIPA 3LQCA 3W58A 1BEV3 3WSOA 5T5PA 2XL9A 4LLOA 4BQ3A 3DKQA 1R093 2DURA 2GNMA 2P34A 2YROA 4GXLA 5JSOA 4LO8A 3BALA 1JOJA 4IE4A 4CSWA 2WAOA 4XF4A 3I2KA 2ES3A 2XGXA 4FSJA 3GDBA 2XLFA 4IV1B 1VRH3 1AR61 4OULA 4Y4YA 1A78A 4JHZA 4N9HA 5HXMA 1RUD3 1N1VA 3AMNA 1YWKA 4P14A 4XAEA 1UU6A 1Y4WA 1RUF3 3R0RA 2VULA 3ETPA 3IIIA 1FMD3 1GZ9A 2BW8A 1WUVA 3N9MA 3RQ0A 4JDMA 2JDKA 1EUTA 2X10A 2R0FA 1CR7A 4FPEA 1MZEA 4M4PA 5FYCA 5H9PA 1G8WA 3NJYA 1QH6A 2DCKA 2PFWA 3DXTA 4IESA 2DTWA 1AR73 2GZWA 1R1A3 2QZ3A 5IVJA 1CIYA 3LFIA 2WC2A 2A6WA 2CNAA 3EO6A 2WZ8A 2IUWA 2GNBA 2VOXA 1DLCA 3ZFEA 5FO8B 3N35A 1RHI1 2O1QA 4XVHA 4BIOA 4HXCA 5J36A 1RUI1 1G9DA 3MW2A 3BIEA 1MS5A 1V70A 4QAWA 3UKNA 4AI0A 1X8MA 4XFAA 4ZU7A 4F3JA 5C5UA 3VZKA 2EAAA 5EWSA 1UX7A 1K45A 1JHJA 4AE2A 1X8EA 5IVCA 2R062 1QEXA 3C2UA 4XQWA 2G1MA 1LOAA 3LB9A 1NE6A 2R32A 4W6WA 4XXPA 2GH8A 1OQDA 1O4YA 2KM2A 3HNMA 5LZ6A 5JZGC 1O3SA 1RUOA 1REFA 3LEKA 4P9WA 3CIHA 1QJFA 5C3PA 4K1YA 4GMP3 3VD3A 3ZYIB 2VQAA 3CLPA 1WD4A 1U5XA 3N36A 1Q5OA 3ZXDA 4FAHA 1SACA 2DVBA 2D3PA 1QJX3 2Q0AA 4NAMA 4KWJA 2BNOA 3MDPA 3EJKA 1L7RA 2PHTA 3ASIA 4P00B 4XBQA 5EV7A 5JSRA 1NE4A 5KWRA 4UWDA 5JR7B 5HI0A 4S2DA 2E7QA 4NUBA 1H8TA 3T2OA 2WO2A 2BTVC 4BIFA 3ACGA 2P3JA 3WR0A 1WW4A 1HB2A 4NR1A 1GICA 3ZPYA 1YFWA 1C1FA 5CKMA 4CXYA 2C26A 5L36A 3KV5A 2XDVA 1I3HA 4QT6A 4YW3A 3K4AA 1UIKA 2AEYA 4YYOA 3N9OA 1QJY1 3HT2A 2BP6A 1ENSA 1QWRA 3I2HA 1YRZA 3WP3A 3JUUA 2OIIA 3POBA 3WG2A 5DN2A 4QM8A 2VGDA 4IUGA 1RUE1 4R9DA 4XOGA 3GM8A 2IZWA 5IAVA 4AW7A 3S30A 3LOBA 1HJFA 1UY3A 1VBB1 3FWEA 5JWPA 4UW5A 2BEOA 3UYJA 3JU9A 1OKQA 3NNLA 1Z78A 1W2OA 2WNVA 1UYPA 2R043 4CEYB 3ZSKA 1HRI3 5C8CA 3U75A 3WLUA 1RMU1 4HN1A 4ZS2A 2W2IA 5AFEA 1V9U2 5H9RA 5A7WB 1UKRA 5FYVA 4D8MA 3VDAA 4WM7B 4Q4W1
chains in the Genus database with same CATH topology
2JDYA 1GZTA 1UQXA 2BP6A 2BOIA 2JDUA 5D2AA 5A6ZA 4AOCA 5A6QA 4CE8A 1W8HA 5A6XA 2JDMA 1OXCA 2BV4A 5A6YA 5A3OA 2VNVA 2JDNA 2XR4A 5A70A 1OVPA 1OURA 2JDKA 5HCHA 2CHHA 1UZVA 2WR9A 1OUXA 2JDPA 2WRAA 2VUCA 2JDHA 4UT5A 1W8FA 1OVSA 1OUSA 2BOJA 3ZDVA 2VUDA 3DCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDY A;  1GZT A;  1UQX A;  2BP6 A;  2BOI A;  2JDU A;  5D2A A;  5A6Z A;  4AOC A;  5A6Q A;  4CE8 A;  1W8H A;  5A6X A;  2JDM A;  1OXC A;  2BV4 A;  5A6Y A;  5A3O A;  2VNV A;  2JDN A;  2XR4 A;  5A70 A;  1OVP A;  1OUR A;  2JDK A;  5HCH A;  2CHH A;  1UZV A;  2WR9 A;  1OUX A;  2JDP A;  2WRA A;  2VUC A;  2JDH A;  4UT5 A;  1W8F A;  1OVS A;  1OUS A;  2BOJ A;  3ZDV A;  2VUD A;  3DCQ A; 
#chains in the Genus database with same CATH topology
 1YUD A;  5GJ6 A;  3IPV A;  1WKY A;  4G9S B;  4MYE A;  3O1S A;  1Z7S 3;  1O5L A;  2GN7 A;  2QKD A;  3RS6 A;  4BOW A;  2PHD A;  4NRO A;  2PMW B;  1L3J A;  1W6P B;  4LOR A;  2MEV 1;  1D4M 2;  3ABZ A;  1GBG A;  3TN9 3;  4DPN A;  3QH6 A;  4PCR A;  1B09 A;  3VB9 A;  3VV1 A;  4Q1P A;  1W9T A;  3ZX7 A;  2PAM A;  2Q1F A;  1CQ9 A;  2GC2 A;  3WQB A;  3TEY A;  5FJK A;  5GKA C;  5GZC A;  4LHK A;  2Y6G A;  3USS A;  3LAG A;  5LCW L;  2BZD A;  4Q4V 3;  1QF3 A;  5I0R A;  1W0N A;  2BGO A;  2QQU A;  4XF3 A;  2UY9 A;  1OVS A;  1UL9 A;  3VUO A;  2JKB A;  1H1I A;  2HWB 2;  1WMD A;  3B01 A;  3BGA A;  1N1T A;  1S55 A;  3NWK A;  4PDW C;  4YG6 A;  2VUD A;  4LKE A;  5FP4 A;  3U78 A;  4CP1 A;  5FYT A;  2ID4 A;  4AFM A;  4YM1 A;  4JDN A;  4YVS A;  4G3Y C;  1ULO A;  4C90 A;  4LO5 B;  1E5I A;  4D7Y A;  4E27 A;  3IWZ A;  1H8T B;  4LBJ A;  1SQ4 A;  1ZA7 A;  1PVC 1;  5FUN A;  4YFZ A;  3JBG 1;  2IXL A;  3AL6 A;  4FTS A;  2IXH A;  2Q1M A;  2QBX A;  2QQP A;  2FCU A;  1RYY A;  2BVV A;  1YI9 A;  2WO1 A;  1DQ6 A;  5FZI A;  4PBO A;  3KD4 A;  1J3P A;  5B4X A;  2BFU S;  4NO4 A;  3DXU A;  5J98 B;  4N53 B;  2WAA A;  1QH7 A;  2OX0 A;  3VHR A;  3ZYG A;  3O0W A;  3O0X A;  4LBM A;  1BK1 A;  5CVR A;  3RGB A;  4Y1Z A;  4Y22 A;  3T2T A;  5FZH A;  4CDW B;  3MID A;  1LR5 A;  2VNR A;  3HMY A;  3UET A;  3U07 A;  1QQP 3;  2I74 A;  2KA3 A;  4HON A;  4IV3 A;  4ZKT B;  1ZVF A;  1IQD C;  5GLW A;  3ZSM A;  3CL1 A;  5FZB A;  2HYK A;  4PLO A;  4QQP A;  5A3N A;  4KGQ A;  4LE3 A;  2DTY A;  3ALQ A;  4OHW A;  4XFF A;  4BQ1 A;  5H9Q A;  2Q4S A;  5CG9 A;  5L9R A;  3E97 A;  1YQ8 A;  2B4K A;  4B4P A;  4EJR A;  4QD2 A;  4M01 A;  2F17 A;  1OXC A;  2WNV B;  3LIG A;  5FZE A;  3WEZ A;  1W8Z A;  1ZBA 3;  1HLC A;  1UY4 A;  3FN9 A;  4LO7 A;  3CU7 A;  5C8C B;  3PTY A;  4RL7 A;  3TEZ A;  3W9A A;  2YC0 A;  2G9F A;  1RIN A;  5FKB A;  5L19 A;  1J58 A;  4M3C E;  3ZYB A;  4Q4Y 3;  4QGL A;  2YBP A;  3IPV B;  5KC5 A;  5M0T A;  4JGY C;  1QXJ A;  2ZMN A;  3HT1 A;  3I3M A;  5L73 A;  2ADD A;  2C9A A;  2GNT A;  4Z92 B;  1OC1 A;  1RIR A;  1SLT A;  3GZE A;  1SLL A;  3FZ3 A;  2C6S A;  4NRP A;  5EPA A;  5DZG A;  3BYW A;  1D0G A;  1GMM A;  1NA1 B;  4NWV A;  2W52 A;  4N8M A;  4FVV A;  3T0A A;  3BTX A;  1RC6 A;  5BNO C;  4UI9 L;  3T4V A;  1BYH A;  1CD3 G;  5FZ7 A;  2WZP P;  3N7L A;  1UOF A;  3CQO A;  3WIN E;  1Y9G A;  2P3I A;  4AK3 A;  5FOB B;  5HXV A;  3WV6 A;  5G04 L;  2Z2S B;  2CYF A;  3M2M A;  4LHL A;  4DXR A;  1WA4 A;  1KDK A;  3ECQ A;  5KXB A;  4BCU A;  2HWF 1;  1US3 A;  3OBA A;  4AWD A;  4PT6 A;  3IM0 A;  4CZS A;  3ZSE A;  2ZGU A;  2QQN A;  1AYN 1;  1NOV A;  3EXU A;  2R16 A;  3ZKY A;  5HV0 A;  5F37 A;  3WHU A;  2X5I A;  1SDW A;  1FOD 1;  4WVZ A;  1W2T A;  3V65 A;  1ZZC A;  5ANQ A;  5LY2 A;  2YBK A;  2MNG A;  3VKM A;  4QPW A;  1QXR A;  1V6N A;  2Y6H A;  5DAX A;  2JXA A;  1AR9 3;  4TYS A;  3T0D A;  2A73 B;  3B02 A;  1EV1 2;  1QY4 A;  3I4I A;  1U0A A;  2ZX0 A;  2DU0 A;  4CCJ A;  2WZR 1;  4A45 A;  3DYM A;  4QDR A;  3T1M A;  1BBT 2;  4GIQ A;  3VBH A;  3O1V A;  2X09 A;  2EAK A;  2R49 A;  2V09 A;  1C8M 1;  2ZAB A;  5LA0 A;  4AR2 A;  3H9A A;  2WRA A;  4NRQ A;  4YW5 A;  3SHR A;  4AGG A;  4BU2 A;  5CAD A;  5KBF A;  4CDX B;  3LEG A;  2DVG A;  1IG0 A;  2FMD A;  1JYC A;  4BLJ A;  1W8T A;  2C5D A;  3I3D A;  1ENR A;  5T5L A;  2DUP A;  2RMU 2;  1OF3 A;  4FPL A;  2ZHL A;  1GOG A;  4WM8 C;  3ZIX A;  1K12 A;  2BOI A;  5C4W B;  1VIW B;  5AC9 2;  1JYI A;  4CRQ A;  4Y4R A;  2JE9 A;  2QQJ A;  4XET A;  3VBU C;  1LGC A;  3ZYF A;  3KMH A;  4GUL A;  5FKC A;  1VMF A;  3VDD A;  5BNN A;  5C3Q A;  2WIN B;  1I9R A;  2Y33 A;  3GNE A;  4RN5 A;  4XIO A;  3UGG A;  2BDR A;  4P02 B;  1TVG A;  2HBT A;  4IET A;  4MX3 A;  3ZYP A;  2H6B A;  1L7Q A;  3KWV A;  3LWC A;  3O1U A;  2VUC A;  5C71 A;  3ES1 A;  5FZ1 A;  3PME A;  1BEV 2;  2JG9 B;  2FQP A;  2GMP A;  1OT5 A;  4QU1 A;  1OUS A;  1R09 2;  4LBQ A;  5F2W A;  3WNM A;  3AKR A;  3HQU A;  5F5C A;  3I8T A;  5F39 A;  3WF1 A;  3P3P A;  4MO3 M;  1AL0 G;  2CY6 A;  5BXX A;  1NY7 1;  1V6I A;  4D7T A;  1MEC 3;  3LA3 A;  3KV9 A;  2WSV A;  3KGZ A;  4UFK A;  4XDO A;  2AAC A;  2C9K A;  5HCB A;  2OPW A;  2RM2 2;  4JKM A;  4B4Q A;  3B7M A;  1HB3 A;  4Q1R A;  1WBF A;  4JKK A;  1RUF 2;  1H9P A;  3P5B A;  2WYF A;  5DG1 A;  1QJU 3;  3VBS B;  2D44 A;  4COZ A;  1ND3 B;  1BHG A;  2LRO A;  2FZ1 A;  1F31 A;  2HWC 3;  1ZX5 A;  3CHX A;  2WS9 3;  3GJB A;  3SKV A;  5FP9 A;  3O1T A;  3AP7 A;  3AZW A;  1AR7 2;  1R1A 2;  4MH0 E;  3AMH A;  1RL3 A;  2GU9 A;  4YZ4 A;  3KM5 A;  4UFL A;  5FMO L;  3VZM A;  2LS6 A;  3Q8F A;  5FO7 B;  3N7J A;  1HX6 A;  2XJQ A;  3J8F 2;  4XEZ A;  2NZ9 A;  2Y0I A;  1LHV A;  1UOJ A;  5FZO A;  4QX7 A;  3C7E A;  3VBH B;  4A3X A;  3GGL A;  1HRV 1;  3MLL A;  4HPK B;  1ST8 A;  4AHY A;  5ISL A;  4OHY A;  2RDN A;  3USU A;  4CXW A;  2KD7 A;  4JQR A;  4E2G A;  5FXW A;  2IXK A;  3FHA A;  1XNB A;  3CDZ B;  3WUC A;  3ZXA C;  3RRD A;  4S2F A;  3I2F A;  3K48 A;  1VBA 2;  3Q8C A;  4P08 A;  3K3O A;  4LKD A;  3PVN A;  1AR8 3;  4KMQ A;  5FXZ A;  3BTA A;  4FPO B;  4LMF A;  4MOA A;  2BOJ A;  4JRL A;  2AYH A;  4OHV A;  4XC9 A;  5K4L A;  3ZDV A;  4ASM B;  1US2 A;  4MET A;  4TLF A;  5IT6 A;  1IOA A;  3VDD B;  3OPW A;  1UKG A;  1VLN A;  2W39 A;  4K1Z A;  1NG0 A;  1LEC A;  5A7P A;  2UU8 A;  2R07 3;  2ZAA A;  3NVC A;  1PO1 2;  1VRB A;  3POS A;  2BWC A;  3H3U A;  4LOT A;  5A80 A;  4P5H A;  1CWP A;  1YFX A;  2PHR A;  2FDJ A;  1RVF 3;  1AL2 1;  4CU8 A;  4WBB A;  4YM0 A;  1ULC A;  2A3Y A;  2CHH A;  1GU3 A;  1VBD 3;  4RHV 2;  4WZF A;  5D8A A;  4EE2 A;  4CUG A;  5A1L A;  5C33 A;  2P6C A;  2VBB A;  1VBE 1;  1GR3 A;  1VJ2 A;  1NZC A;  4WVM B;  1AXY A;  4ZZ8 A;  3DPR C;  4P9J A;  4RFT 0;  3WW2 A;  4DZG A;  2B45 X;  5C3O A;  3R4D B;  2RS1 1;  4ES9 A;  5DDJ 1;  1UX6 A;  3PLQ A;  1CAV B;  5L9V A;  4RQP B;  4AGV A;  3PL0 A;  5FY8 A;  1W04 A;  1XNA A;  1AUY A;  3HR9 A;  4YW1 A;  5GZF A;  3HQR A;  4QQ2 A;  4HG6 B;  2VOK A;  1MQT A;  4KU8 A;  1S2K A;  2PQS A;  3O1M A;  1SBD A;  4M0H A;  5FPA A;  2P5B A;  2WWJ A;  2D6P A;  2D6N A;  3VDC A;  5I91 A;  2ZGR A;  1ZBE 3;  1JYV A;  2V4A A;  2XON A;  4B29 A;  1GWL A;  3CMG A;  1OH4 A;  2HEV F;  4M4R A;  4ORF A;  1AXK A;  1X36 A;  5FZO B;  2VTX J;  2V72 A;  3RYR A;  4GJY A;  2RHP A;  3O1R A;  1S2E A;  4QM9 A;  5CIS A;  1H8V A;  2GC1 A;  5CFD A;  1PGW 2;  1JYW A;  3AYD A;  4NHM A;  2WWU A;  2ZML A;  4XJ9 A;  3FMG A;  1HKD A;  1AX2 A;  2Y6K A;  5C70 A;  1Z7S 2;  2GAU A;  3LOI A;  1GFF 2;  4GWI A;  5EP9 A;  4JTN A;  4IXL A;  3WP6 A;  2XPJ A;  3PIG A;  2H0V A;  5ABJ C;  3WX5 A;  4QGN A;  2DBN A;  4RD7 A;  3TN9 2;  2E9Q A;  4OYU A;  1RUH 3;  3OY8 A;  3N9Q A;  3LSD A;  5KHG A;  5D21 A;  1N1S A;  4M3C B;  1JOB A;  1GAN A;  1YLL A;  4TWT A;  1ULD A;  1JU3 A;  3AFG A;  3CZJ A;  5J96 B;  1W6Q A;  1RUN A;  1H6Y A;  4QPG C;  3THC A;  5FZ0 A;  4LE4 A;  2VBD A;  5GLT A;  4LUK A;  4BZ4 A;  2C4X A;  3ME2 A;  4HLT A;  4YG0 A;  2P37 A;  3D0J A;  3P3N A;  4XDQ A;  2HJI A;  5FIX A;  4PBP A;  2VZO A;  3GBW A;  2J7M A;  4JGZ A;  4QB1 A;  4A41 A;  2O14 A;  3AJZ A;  3KB5 A;  1AR6 3;  4EWA A;  4FCA A;  5IVV A;  5A6X A;  4D6Q A;  4CPB A;  5GLZ A;  1W6N B;  2Y38 A;  3IDA A;  2TNF A;  1EAH 1;  2VU9 A;  3NV4 A;  1UPS A;  1CAU A;  1XNK A;  4BHP A;  1I5P A;  3THT A;  3I3B A;  4KWK A;  4B1M A;  2VNO A;  4IV1 C;  4B1L A;  4QPI A;  3RZJ A;  5FJH A;  2WWS A;  3VZJ A;  1X9P A;  2VO5 A;  3S0M A;  3H1W A;  1HXS 1;  3WDV A;  1CAW A;  2IXJ A;  3M8L A;  1UD1 A;  3U4S A;  4IEW A;  3FLP A;  4HOO A;  1SPP A;  2D6K A;  1F35 A;  3PVE A;  2ATF A;  4IE5 A;  5FY9 A;  1F2N A;  3TB0 A;  2PHF A;  4WVV A;  4GKY A;  5I0T A;  1O5U A;  3POG A;  2XJT A;  2XWB B;  3KS7 A;  1RHI 3;  4AVC A;  3OEA A;  3OUH A;  1TMF 1;  2DCT A;  1RUI 3;  2KXL A;  4I02 A;  4MHU A;  4RA0 A;  4CEW A;  2VZS A;  4MXV A;  3PJY A;  5FPX A;  2B7Y A;  1YQ5 A;  2ZZJ A;  2OPK A;  4OFG A;  4CP9 A;  1LOD A;  1LEN A;  4HK9 A;  2DVF A;  5FY7 A;  1G6N A;  3IZO A;  4FPC A;  5IJR A;  4KNC A;  4R4X A;  3KT1 A;  2EXJ A;  3UGF A;  1DYK A;  4XCB A;  4HFS A;  3EYP A;  2WLP A;  2HWD 1;  2RS3 1;  5CFD B;  1VB4 A;  3WNO A;  1U5I A;  2IXC A;  2CV6 A;  1ASJ 1;  2RS5 2;  2Y6F A;  4LK7 A;  3SXW A;  3SNM A;  3NV3 A;  1VAK A;  2VR4 A;  4K40 A;  3GCW A;  1K3I A;  1L7L A;  3D8C A;  4ATE A;  4ZY9 A;  1DGW X;  5FK7 A;  3WP4 A;  3RI8 A;  5BY5 A;  2ZGK A;  1SFN A;  2EAL A;  2YG0 A;  5FYS A;  3ZFF A;  2XG3 A;  3ZN6 A;  3ZYJ B;  1SFY A;  2RDS A;  1KJR A;  4Q27 A;  5FZF A;  1PZ8 A;  5F1R A;  1AJK A;  1VP6 A;  4LEJ A;  3WNL A;  1LJ7 A;  1OMI A;  5A3T A;  3PJQ A;  5T55 A;  5CKN A;  3I3E A;  1Y3T A;  4IGP A;  4MGQ A;  4HVO A;  2D6M A;  3ACH A;  3AL5 A;  4MV2 A;  1W6Q B;  5A7N A;  4XXA A;  5LRR A;  4GZ9 A;  3NJX A;  4AAX A;  2VM9 A;  2PHW A;  3UES A;  1URX A;  1PMI A;  1IS5 A;  5JVV A;  1W06 A;  2CWM A;  3B69 A;  3DV8 A;  5J3U A;  3FUO A;  1XXN A;  3ILF A;  1AYM 2;  1SBF A;  2ZTN A;  1S4C A;  2VNG A;  3BIW E;  3LIH A;  1EYB A;  5A3U A;  1ND2 B;  5GLV A;  2CAV A;  5FZC A;  2QQI A;  2ZGN A;  4YW4 A;  2HH9 A;  1IPJ A;  2W87 A;  1Z0H A;  3VL8 A;  3FE5 A;  1W9S A;  4IGO A;  5FYM A;  1RUJ 2;  4QGM A;  4AL9 A;  5C9A A;  1QJY 3;  3WHT A;  4QPI B;  5J7M A;  4COY A;  1ULG A;  1YHF A;  2LW8 A;  1FAT A;  2GAL A;  1NCR A;  2I45 A;  5CEH A;  1CAW B;  3F2Z A;  5F3E A;  5LBF A;  2P3K A;  3Q8E A;  3CZU A;  1RUE 3;  2RG4 A;  4Q8K A;  1C5I A;  2CGO A;  5AFB A;  4FOQ A;  3C7O A;  1VBB 3;  2WT2 A;  1WGP A;  4HSJ A;  3OBR A;  2JE7 A;  4QWN A;  2YFU A;  2WO7 A;  3RWN A;  3W20 A;  4GH4 B;  1QU0 A;  3B00 A;  1W8F A;  2EA7 A;  2RDR A;  3A7Q A;  3VN4 A;  3C7F A;  4EN9 B;  1DDL A;  2GC3 A;  5KHH A;  3O5S A;  1RMU 3;  5DAP A;  2D43 A;  3B3Q E;  2JDY A;  1GZT A;  5E6H A;  3R05 A;  4Q4W 3;  2VH9 A;  4X6R B;  1HIX A;  5K0U A;  4CEY C;  2R06 1;  3AK0 A;  2XJR A;  2XKO A;  2D6O X;  5AVP A;  2BYV E;  4O65 A;  4A42 A;  2MEV 3;  3QAC A;  1A8D A;  4AI9 A;  5F7U A;  1O59 A;  1IS3 A;  1PGS A;  1S0D A;  4BME A;  3ZMO A;  1VMH A;  1ODM A;  2FD8 A;  1MS1 A;  4IEU A;  4R52 A;  1FT9 A;  4NRM A;  1TEI A;  4WM7 C;  4Y1X A;  1UY0 A;  4JDO A;  1NYW A;  4ASL A;  5I8S A;  2UWB A;  1UYX A;  4LPL A;  4FXG B;  3NST A;  2XH6 A;  3PUH A;  4GJZ A;  1WCU A;  4RGG A;  5APA A;  5I93 A;  3I2G A;  1Q8O A;  4XDP A;  1W28 A;  1Y9M A;  4OUM A;  4CCL A;  2XJV A;  2DDU A;  2E32 A;  3BPZ A;  3A23 A;  5FQ0 B;  2TEP A;  4WVW A;  1HJG A;  5C3R A;  4YZ5 A;  1PVC 3;  1ZRF A;  1MEC 2;  4JRA A;  3JBG 3;  5FZD A;  3UV9 A;  2VZR A;  4AVA A;  3UKT A;  4FTB A;  4E2Q A;  5JPM B;  3LDR A;  2A70 A;  3ITQ A;  2Q8D A;  4CDU B;  1OOP B;  4Z1V A;  3GF6 A;  3PMS A;  3M4F A;  2P2K A;  1H8T C;  2W94 A;  3E5Q A;  5BV6 A;  1FV3 A;  3GYD A;  3OF1 A;  5K8S A;  2QCS B;  2OA2 A;  3IB3 A;  4Y5T A;  5GZD A;  3HNB M;  1OI6 A;  1X9T A;  2HWC 2;  2ARE A;  1DBN A;  2WS9 2;  5C9A B;  2CTV A;  1WZX A;  5ANN A;  5BNP B;  2N7G A;  1HQW A;  3M3I A;  4CDQ A;  1XE7 A;  2JG8 A;  3KQR A;  3ZFG B;  4N53 C;  3ZXG A;  4RGA A;  3AP9 A;  2XKP A;  5CFC B;  3KF3 A;  4CDW C;  4FPK A;  4H7M A;  3OGV A;  4OI1 A;  3W5M A;  3IT8 A;  2K2S A;  4QX3 A;  3QOP A;  3V56 A;  1BMV 1;  5A70 A;  1JZ8 A;  1D7P M;  1GKB A;  5T54 A;  5JXI A;  3ZN4 A;  3K3N A;  4C1W A;  1W9F A;  1V9U 1;  2VVE A;  3PUR A;  4Y20 A;  1C8N A;  1NLQ A;  3VBO B;  4DY3 A;  3J7H A;  1W6M A;  4AFC A;  4UFJ A;  1UZY A;  4NIH A;  3VBF A;  2WNV C;  5K0U B;  1TNR A;  1GOH A;  2D93 A;  3UNP A;  1K5M A;  3BOW A;  5C8C C;  2E63 A;  1AR8 2;  1D4M 1;  4YW2 A;  2EIG A;  2A6Z A;  2G4I A;  3TWI A;  3D3A A;  3UKV A;  2YGL A;  5A3L A;  2XLA A;  1UQX A;  4Y3O A;  4RR3 B;  4IEZ A;  4EN8 B;  2WFF 2;  5DAQ A;  1D2S A;  4D69 A;  3P6B A;  1PMJ X;  1GNY A;  3JB4 C;  2JEM A;  2R07 2;  5FMO S;  4HZF A;  4IGQ A;  3H1Y A;  2MHF A;  3WY6 A;  2WNU A;  4XTM A;  2V5D A;  4AVB A;  2YXS A;  4CCK A;  1RVF 2;  2JDZ A;  4DEV A;  1NA1 C;  4CCD A;  4DQA A;  2JDP A;  2AZ5 A;  1RED A;  2Z79 A;  2WQ8 A;  1VBD 2;  4R9B A;  3VGI A;  2IWG B;  5GLU A;  1AZD A;  3PUQ A;  2HWF 3;  4PQQ A;  4XPV A;  4YGB A;  5FK8 A;  2OW4 A;  5LW9 A;  1BLZ A;  1WCD J;  1WLD A;  2K0G A;  1CAX A;  3KGL A;  1AYN 3;  2C24 A;  1GQG A;  5F3I A;  4S2G A;  1LB2 A;  3AMM A;  4PI2 A;  3IAQ A;  5E89 A;  3WF0 A;  1R64 A;  5IK4 A;  1FOD 3;  4AF9 A;  4BH9 A;  4ZON A;  4YVS C;  3ZDS A;  2QVS B;  1S0J A;  1G9B A;  3NAP A;  4YFW A;  2XUE A;  2DCZ A;  1STM A;  3HQX A;  1F5J A;  4MGY E;  5CNA A;  3ILR A;  3WUD A;  3PUA A;  2WZR 3;  4KG8 A;  4FAG A;  2WKK A;  3ZVX A;  3DUI A;  3AX4 A;  3S7E A;  1UMH A;  1HB1 A;  2A7A A;  1C8M 3;  1ZBE 2;  5JXJ A;  2ZX1 A;  4AEM A;  5FY1 A;  2Y26 A;  4C1X A;  2GND A;  1K42 A;  1O7F A;  1JZ5 A;  4B4R A;  4Q4X 1;  5LRS A;  3T1L A;  4DUW A;  5H9S A;  3U11 A;  4GMP 0;  4JX0 A;  2QE3 A;  2RV9 A;  3I2J A;  3ZR6 A;  2AR6 A;  1NUK A;  5A6Q A;  4X6Q B;  5LBB A;  1PGL 1;  4Y26 A;  4CDX C;  3A21 A;  1COV 2;  3OGJ A;  4W65 A;  4YM3 A;  2PAE A;  1WLC A;  1KFX L;  3MW4 A;  4DXZ A;  4XIL A;  5K7P A;  3H7J A;  4ZU5 A;  5L7O A;  3ZXK A;  2JE8 A;  4AHZ A;  5IK7 A;  4YVW A;  5C4W C;  3ZFE B;  4OI0 A;  2OZJ A;  5A32 A;  2VL4 A;  4XQD A;  3RZH A;  4FPF A;  3KV6 A;  5E88 A;  4UOJ A;  1OHF A;  3V0B A;  4H2A A;  4LBN A;  4PIZ A;  2D40 A;  4Q0Q A;  1LOG A;  2W1Q A;  1VAV A;  1H0B A;  1G86 A;  4YM2 A;  1IS6 A;  2PHU A;  2V73 A;  2DF7 A;  2QDR A;  2YBS A;  2XWJ B;  3I2O A;  2CGP A;  1SBE A;  3AKQ A;  1RUG 1;  2WNU B;  4XAA A;  1XB9 A;  2LAL A;  3DYP A;  4BXF A;  1OPM A;  1J59 A;  3UJQ A;  1KQR A;  1PMH X;  2JG9 C;  4JC1 A;  4N43 A;  1FNZ A;  4C91 A;  1AR6 2;  3BTZ A;  4DO0 A;  4D6R A;  4L99 A;  3TAY A;  3WG4 A;  4IER A;  1GYK A;  1DYP A;  1BVV A;  3KLS A;  3RZL A;  4AI2 A;  4QHO A;  4YZ3 A;  4QHZ A;  3GAL A;  5A3W A;  4I3G A;  2H0B A;  1KDM A;  1BXH A;  3PTR B;  1ZNP A;  3TYJ A;  2W3J A;  3VHO A;  3ZMN A;  1XE8 A;  1TG7 A;  2BBA A;  4MGS A;  1EY2 A;  3ZN5 A;  4BK4 A;  1YCI A;  3NNM A;  3IDE A;  4XUR A;  2ZAH A;  1DFQ A;  2A75 A;  3VBS C;  1MVQ A;  1ND3 C;  3O0V A;  4CU9 A;  3MW3 A;  3NO8 A;  3GZA A;  5GM0 A;  4H55 A;  4MUV A;  3NKG A;  3WP5 A;  1HRV 3;  5FBZ A;  3PUI A;  1WBL A;  5B4N A;  2VW2 A;  3N9N A;  4YNI A;  3RDI A;  3MUZ 1;  1DGL A;  1W99 A;  2J1T A;  2E31 A;  2BGC A;  2XBO 2;  2XVG A;  2CDP A;  3OD4 A;  4UXA A;  3ZXF A;  1YO8 A;  2X05 A;  3MFC A;  1SHW B;  3VBH C;  3GXU A;  4W50 A;  2RMU 1;  3MV0 1;  3MHZ A;  1AF9 A;  2AH2 A;  3FC0 A;  2AEN A;  3AFK A;  2ZCW A;  4OMD A;  2ZHN A;  5AC9 1;  4SLI A;  1W2N A;  4W4Z A;  3OBZ A;  2BWA A;  2YFZ A;  1LOF C;  5GAL A;  5JUV A;  4DEQ A;  1LRH A;  2DUQ A;  1MAC A;  2WO3 A;  2ZEX A;  3AJY A;  1U12 A;  1UXX X;  4NN0 A;  4AEJ A;  1LAJ A;  4YVW B;  4DUX A;  2EID A;  3OGR A;  4O9G A;  5CKQ A;  3UJO A;  4DFS A;  5T5J A;  2A3X A;  5FBJ A;  4NVP A;  2NPI A;  1XNT A;  2HKX A;  4E2S A;  1XE0 A;  1W90 A;  5CBL A;  1W9W A;  4LIV A;  3VDD C;  1R09 1;  2ZS6 B;  5BNN C;  1AL2 3;  2G9G A;  4AVS A;  5HV4 A;  4GB3 2;  5CG8 A;  3Q8B A;  1CZV A;  4XFI A;  4DOU A;  4JZR A;  1PX4 A;  3IDB B;  4IND A;  4N9I A;  4UBG A;  1CPN A;  3RVH A;  1PM4 A;  1VAM A;  1VBE 3;  2B8M A;  3AZZ A;  5JCT A;  3MZH A;  3S7I A;  3H8O A;  1OLQ A;  1EUU A;  1WLW A;  3W21 A;  1PVX A;  3APB A;  1J1L A;  3M3C A;  1CZS A;  2RM2 1;  4N43 B;  2C0Z A;  2RS1 3;  3H3L A;  3JCI A;  3P1I A;  3SIS A;  4AYU A;  4C8D A;  4CP2 A;  5FYZ A;  5IWF A;  1G9A A;  5DDJ 3;  4TSV A;  4HET A;  4XUQ A;  2YMZ A;  3I2I A;  2W95 A;  1SZB A;  3ZXL A;  2AEZ A;  2QQK A;  4AHX A;  2P1B A;  2Q8C A;  4PLN A;  3OUJ A;  1ZZB A;  2QQL A;  4DXS A;  1QMJ A;  4FOV A;  4FOY A;  3E1F 1;  2OZ6 A;  2VTF A;  4H7L A;  4Q0U A;  3WOG A;  1EPW A;  1AR7 1;  1IZ3 A;  1R1A 1;  2WN3 A;  3OYW A;  1RUE 2;  4I0A A;  4RQP C;  3DGT A;  4UF0 A;  1R08 2;  4Y33 A;  5L7O B;  2IVI B;  3VL9 A;  3CJX A;  4Y5S A;  1VBB 2;  2TBV A;  4YVS B;  5LK5 A;  2PLV 2;  3J8F 1;  4NIA A;  3MIG A;  5F32 A;  3OJB A;  3V64 A;  2RJ2 A;  1DLL A;  4BE3 A;  4AFA A;  5FLI A;  5TSW A;  3QCW A;  5FZG A;  3MUY 1;  2ARA A;  2R1D A;  2CL2 A;  1T2X A;  5FYB A;  2PN5 A;  2PHL A;  1WCS A;  1ULF A;  2FDG A;  3MIC A;  2LRP A;  3T3Y A;  4Q4W 2;  4F83 A;  1J3R A;  1W9Y A;  4LIT A;  2HEW F;  1NLR A;  3MYX A;  1VBA 1;  2SLI A;  1UMI A;  4Y22 B;  2J1A A;  3H8R A;  1ZRR A;  4IV3 B;  2A6Y A;  2BRT A;  3HOB A;  5FYY A;  4E9K A;  4LUL A;  1FV2 A;  4PDW A;  2Q1Z B;  5FRE A;  2FDH A;  2VQT A;  1JYN A;  3KVB A;  2CDO A;  3SH5 A;  1SG3 A;  3RMY A;  4MGT A;  2QQO A;  5A33 A;  2DBI A;  2OT7 A;  1N3O A;  1PO1 1;  1QOS A;  2XVL A;  3ETQ A;  2ILM A;  3WF3 A;  2VCC A;  4QQH A;  1APN A;  2VME A;  1RUC 1;  4FFG A;  1JW6 A;  5T3N A;  3BOP A;  1W6O A;  3AMQ A;  2A6V A;  4IEQ A;  1YJK A;  1JMU B;  1NT0 A;  2WNE A;  3VZO A;  4RHV 1;  3MF9 A;  2VUA A;  2VZ1 A;  1FI2 A;  3CF6 E;  1PVC 2;  5A7O A;  4D94 A;  1EAH 3;  3HIF A;  3SEP A;  3JBG 2;  4YG3 A;  1O3Q A;  4UBH A;  3VDB A;  2E7A A;  3WG1 A;  3WQ1 A;  5FO9 B;  4K6B A;  4XYX A;  1K5J A;  3ZYH A;  2RJL A;  2WR9 A;  1I1E A;  1HXS 3;  5F5Q A;  4XFG A;  5JXG A;  3RJR A;  3ROU A;  2W47 A;  4XZU G;  1V6L A;  4XF0 A;  5FP3 A;  4LJH A;  3GHN A;  5DQ0 A;  1QJE A;  4AGR A;  1WWY A;  2F6B A;  3I97 A;  2YB7 A;  1QNY A;  3PHM A;  2ZXQ A;  5IFP A;  1H6X A;  2ZGS A;  2ZZQ A;  3PU8 A;  3KCC A;  5EJ3 A;  2YGM A;  1V00 A;  1TMF 3;  1VRH 2;  2A3W A;  2A5Z A;  1F15 A;  1JN2 P;  4IEP A;  3RNS A;  4I01 A;  2GN3 A;  1NCQ A;  1RUD 2;  4UW6 A;  4YW6 A;  2JEC A;  1AX1 A;  2CSG A;  4QKB A;  4BQ4 A;  1DZR A;  2XB6 C;  1WW7 A;  4JGY A;  1W0P A;  4M3C F;  1XND A;  2VMI A;  2ET7 A;  2ZKN A;  5LA9 A;  3VHN A;  1FMD 2;  1REE A;  2VG9 A;  1UY2 A;  3ATG A;  1OH3 A;  1WME A;  4KWU A;  4QDQ A;  1O3T A;  1GV9 A;  2X5I B;  4MHR A;  3WQ0 A;  1FPN 3;  1VAL A;  2B9U A;  3AZX A;  2HWD 3;  3EQE A;  2RS3 3;  2WUH A;  3FBY A;  5D1I A;  4ZXE A;  1XRU A;  1CX1 A;  5FMC A;  1ASJ 3;  1DG6 A;  2Y6J A;  3B5L B;  2ZEY A;  3O14 A;  4BQ5 A;  1NQD A;  4EZ4 A;  3PUS A;  1JZ6 A;  3AXD A;  4EYU A;  1GQP A;  3D6E A;  3MLK A;  5CFD C;  4CE8 A;  4J1W A;  1JOP A;  3NRU A;  4L92 A;  3IAP A;  2VEC A;  1UU5 A;  4KI5 M;  5E16 A;  5HPO A;  1JZ7 A;  1LU1 A;  4XJU A;  5AVA A;  2O0O A;  2XR4 A;  2AUY A;  4YRD A;  2XXZ A;  3NV1 A;  4Y5Z 0;  5JLV A;  1W05 A;  4JV4 A;  5LAS A;  1XYP A;  5A33 B;  3I49 A;  3DL3 A;  1R1Z A;  2RR1 1;  1ACC A;  4BQY A;  2ORZ A;  2WQZ C;  5JOZ A;  1DQ4 A;  2ENR A;  3KVA A;  3DN7 A;  1BJQ A;  1W6O B;  1JYT A;  1XSQ A;  2HWF 2;  2PYT A;  5FPU A;  4J6G A;  4GWJ A;  4PF5 A;  1WMX A;  5IK8 A;  1MZ6 A;  1AYN 2;  5BNN B;  2FCT A;  2BER A;  1CPM A;  4B7K A;  4OZO A;  4MAD A;  4AVT A;  1FOD 2;  2JIJ A;  3VHP A;  3S57 A;  1ND2 C;  5LB6 A;  2Y0O A;  2ZGO A;  1H4H A;  1UY1 A;  1QJX 2;  2VMF A;  3DYO A;  3F95 A;  1I5Z A;  4QB2 A;  4XBN A;  3SLI A;  2NM1 A;  5FFO C;  3JXS A;  5C8W A;  4NHL A;  2QFE A;  4LBO A;  1VBC 3;  2E53 A;  4LBQ B;  2WZR 2;  3LSE A;  4RS5 A;  5EJ1 B;  3BKZ A;  4FO9 A;  4QPI C;  2VMH A;  2Y34 A;  5IAT A;  5C5T A;  1QKQ A;  3BPS A;  2EIB A;  4N7I A;  3RSJ A;  2IVJ A;  3NNG A;  2DVD A;  1QHD A;  2A1X A;  4UAP A;  2ZGM A;  1NCQ B;  1RTV A;  1AXZ A;  3NQH A;  4OVE A;  3VBU A;  5JIU A;  5JXH A;  4PJY A;  2JDU A;  1N1Y A;  4O61 A;  4XUO A;  4BQ2 A;  3BVC A;  3LCP A;  2XML A;  4COV A;  1UZ0 A;  2R06 3;  4GH4 C;  4EN7 B;  1HN1 A;  3N9L A;  4D0Q A;  5DPN A;  3LA7 A;  5B2G B;  2RS5 1;  4S2H A;  3FHQ A;  5GZG A;  4OUE A;  4G4F A;  2WZE A;  3N3H A;  3I54 A;  5C3S A;  5LBC A;  1M4W A;  4JKL A;  4OCT A;  3SH3 A;  2PHX A;  2QZ2 A;  4GAL A;  4HL0 A;  3E6C C;  4AFB A;  3V0A A;  5LBE A;  2R04 2;  1C1L A;  3HBK A;  5JDB A;  2NN8 A;  1HRI 2;  2J1V A;  3LEI A;  3K77 A;  1J1T A;  1KXG A;  3K75 B;  3HBZ A;  2VW0 A;  3AP6 A;  3PVO A;  1LHN A;  2YDE A;  3USU B;  4E4D X;  5C6C A;  1KS5 A;  4AI8 A;  2ZGP A;  4QDS A;  4YZ1 A;  4XF9 A;  2VD7 A;  3DKW A;  1PO2 3;  4HMZ A;  5E1R A;  1X7N A;  3R4U A;  1AYM 1;  3G6J B;  4Z2A A;  1IG3 A;  1JZ2 A;  4KQ7 A;  1PIV 1;  2UY8 A;  4HKL A;  4MXW A;  3FHI B;  5T5O A;  3AP5 A;  1OFN A;  1ULE A;  4K9S A;  4CUA A;  4MSV A;  3K4Z A;  1Q8S A;  1KRI A;  1UN1 A;  5FY4 A;  3WXP A;  1RUJ 1;  1OSG A;  4PIY A;  2Z5W A;  4YW7 A;  2A71 A;  3O1O A;  4AVV A;  4AFD A;  4XJW A;  2WAB A;  3QBQ A;  4Q4V 2;  4YLZ A;  4HKO A;  4MGZ E;  1FAY A;  4UFI A;  4CDU C;  1OOP C;  1YNA A;  1YI7 A;  4P9Y A;  2WFP A;  1GWM A;  4JCK A;  4BDV B;  4ZXK A;  1D2Q A;  2XOM A;  1TME 1;  2RE9 A;  3FLT A;  4NPL A;  5EJZ B;  3AVS A;  1MS4 A;  1XBF A;  4QX1 A;  2VXJ A;  3BU0 A;  3NJZ A;  2PA7 A;  2JDM A;  2E6V A;  1S0I A;  2XJU A;  2W0X A;  4XHB A;  5D8A B;  3IBM A;  4RS5 B;  4AED A;  5C9A C;  5HCA A;  5BNP C;  1MVE A;  4QXH A;  5FYI A;  3JD7 1;  5I0U A;  1OVP A;  4QQL A;  5FZ8 A;  3S5Q A;  4XBL A;  5FPL A;  4Z8B A;  3OOX A;  3MPB A;  2HWE 1;  3ZFG C;  2PAK A;  4OHX A;  1TNF A;  1NLS A;  1V9U 3;  5CFC C;  4R9A A;  2J1E A;  2QUO A;  1RIT A;  1EP0 A;  2VQ0 A;  5FOJ B;  4IEV A;  3QD6 A;  4IL7 A;  1SLB A;  1Q43 A;  4DIN B;  3T08 A;  1CN1 A;  1QQP 2;  2B5H A;  2BFU L;  4JVA A;  1D4M 3;  1MQT B;  4SBV A;  3RPQ A;  5ACA 1;  4YGD A;  1A6C A;  4M0N A;  3BOD A;  1PM7 A;  3VBO C;  3D4K A;  4W6Y A;  2DVA A;  5ERL A;  4BJ0 A;  5K0U C;  4B7E A;  1LES A;  4Y1U A;  3BUC A;  1ZZ7 A;  4XFH A;  3SMH A;  4CPB D;  1ZBA 2;  4RR3 C;  5A6Y A;  3H50 A;  4JTO A;  4YGC A;  4MGI E;  4W6X A;  5KXE A;  1E5S A;  4NHK A;  3E5X A;  1OLM A;  4Q4Y 2;  1D0H A;  4FFI A;  3MF6 A;  3MGU A;  4LNV A;  1RXF A;  4OMC A;  5FZ4 A;  4NII A;  2ZX4 A;  5IVF A;  4HVQ A;  4TLG A;  3NNF A;  2V5Y A;  4OQ8 A;  1CGP A;  2OS2 A;  3OEB A;  3FFZ A;  3LEM A;  5SV8 A;  1N47 A;  3Q9O A;  1PZ7 A;  1NZI A;  1TZO A;  3OY8 B;  4EN0 A;  1B35 A;  2PTM A;  2P4E A;  5A1A A;  3IMN A;  3BN6 A;  5K9Y A;  4MZU A;  2DFB A;  4CCO A;  4AZZ A;  1Y43 B;  4UW4 A;  2ZJC A;  4A6O A;  4CTE A;  5IUQ A;  1MZF A;  1OUR A;  1WCK A;  5DMY A;  4FBF A;  4H3W A;  4OUS A;  3OGG A;  4ES8 A;  2FMY A;  2ZHM A;  1H2K A;  2W1W A;  5E8A A;  1PNG A;  1SLC A;  4JGZ B;  1H9W A;  1S0E A;  4K20 A;  5FCC A;  3ZOI A;  2JKX A;  2ZEW A;  1GP5 A;  2UYA A;  4AED B;  4Q4X 3;  5T50 A;  1EPZ A;  2VZQ A;  4GA9 A;  5JOW A;  1KD7 A;  3AP4 A;  1CAU B;  5ABJ A;  4XUN A;  4QXC A;  2P17 A;  3HEI A;  4C0H A;  2P3Y A;  1HW5 A;  1IPS A;  1JYX A;  1WW6 A;  1ODN A;  1YC6 1;  3ZSJ A;  3AZV A;  5J09 A;  4XUP A;  2QTW B;  5HBA A;  1DHK B;  4DY5 A;  1AR9 2;  5LAT A;  1OD3 A;  1SPP B;  4XTP A;  3WG3 A;  3A0N A;  2ZGL A;  3POJ A;  3W59 A;  2EXH A;  3HPN A;  2ETE A;  3N4M A;  3GBF A;  2VC9 A;  3AXE A;  4PLM A;  2VMG A;  1MS8 A;  1G9F A;  2CU5 A;  5LEK A;  2XVK A;  4K8R B;  4D7S A;  4DB5 A;  2WFF 1;  3POE A;  5F6K A;  4AQT A;  5KHJ A;  2ARC A;  2VY0 A;  4F8A A;  3SCH A;  4CEW B;  3WQ7 A;  4NJ4 A;  4Q26 A;  3RG0 A;  4FPG A;  2XJP A;  4NIG A;  3ZFE C;  1CX4 A;  4CP9 B;  4LO4 B;  3ORJ A;  5A7S A;  3WDX A;  2YZ4 A;  3POI A;  4NHY A;  2FHR A;  1W8H A;  2G19 A;  4ZPI A;  5EYY A;  5I8Y A;  4H14 A;  3SKJ E;  1RUG 3;  4IV1 A;  2PEL A;  3E6D A;  4QX5 A;  3MPP G;  2X8K A;  3S6P A;  3ZXJ A;  3OTF A;  1YQ6 A;  1MS0 A;  1BKZ A;  1OPO A;  2VMC A;  1O3R A;  3JQW A;  3WF4 A;  1EAH 2;  1JOD A;  1PHM A;  3I3Q A;  1KIT A;  4PI0 A;  2WNU C;  1GP4 A;  3IIA A;  4Z82 A;  3ZFF B;  3ZN6 B;  4BQW A;  1KGY A;  1QOO A;  1C3H A;  4PQ9 A;  2W08 A;  3ILN A;  4FPY A;  1B35 B;  5DUV A;  3NNJ A;  2BPA 2;  2HEY F;  2XHK A;  5T52 A;  3AVR A;  4K3U A;  4L11 A;  1UIJ A;  4X8N A;  4LHS A;  2VOV A;  4OQ9 A;  3WW4 A;  5JMO A;  4LHN A;  5EFU A;  3VZL A;  2IFW A;  4KU7 A;  1FYU A;  1X50 A;  2NYY A;  3VD4 A;  4QX8 A;  1S1A A;  1OFS A;  1D4V B;  5LA1 A;  2VZV A;  1S0B A;  1UPI A;  2VCB A;  2BGP A;  3BB6 A;  3KCY A;  5F5A A;  5CYY A;  5HCH A;  2J1U A;  4FQ4 A;  1H30 A;  3RFR A;  3T2Q A;  4DMI A;  3AKP A;  4L2N A;  2H6C A;  4LLF A;  2YU1 A;  3I59 A;  3L2H A;  4P9X A;  4CXX A;  1QJU 2;  1U5Z A;  3OBT A;  2RMU 3;  2YU2 A;  4HK8 A;  1DIW A;  2QJV A;  1FPN 2;  2RS3 2;  1CJD A;  4KL1 A;  2VZT A;  5AC9 3;  1COV 1;  1NCR B;  2LTN A;  5DUU A;  2ZX2 A;  2E33 A;  3M70 A;  4B3N A;  4OI2 A;  4LQR A;  4UFH A;  1M06 G;  5KHI A;  1ZZ9 A;  1UCX A;  4BYY A;  3SIT A;  4YZ2 A;  1PK6 A;  3AYE A;  2B46 X;  4V2V A;  3PIJ A;  4UW3 A;  3I2D A;  3C7H A;  3VKN A;  2WA3 A;  4LKF A;  4P9L A;  5J1X A;  3FFQ A;  3VKL A;  4NHX A;  4NWW A;  2NP0 A;  3T0B A;  1V6M A;  2EIC A;  4YVW C;  1ZRI A;  2GH2 A;  2QQW A;  2F4P A;  1C5H A;  1E5H A;  3ZYR A;  3UK9 A;  4R9C A;  4CVU A;  2RM2 3;  3OPT A;  2OUH A;  4HN0 A;  4I30 A;  2ET1 A;  2W1U A;  3HN3 A;  2BNM A;  1V6J A;  2K9Z A;  4N43 C;  2WLQ A;  3EBR A;  3K4D A;  2HWB 1;  2JEN A;  2B9V A;  1IKQ A;  1VBC 2;  3CJI A;  5CA6 A;  4Z2W A;  3B9I A;  2BVB A;  4GWM A;  4J25 A;  1W2U A;  5IHR A;  4V2W A;  3J8F 3;  4Q29 A;  1BCX A;  4CEY A;  4FI9 A;  2R30 A;  4XUT A;  1BK0 A;  2GSY A;  5L7O C;  2XBO 1;  4QX0 A;  5A7W A;  1GZC A;  3GZT B;  3QH7 A;  4DRR A;  1H1M A;  2J22 A;  4WM7 A;  1UYZ A;  4OLL A;  5FY0 A;  1LCL A;  3MIF A;  4HSL A;  3I59 B;  2NMO A;  4I0B A;  4IDZ A;  2JDA A;  5DUX A;  3DF0 A;  5JI9 A;  1W6P A;  4IE0 A;  3HN1 A;  1V0A A;  4LOS A;  3VBR A;  4HAN A;  5IAX A;  1VBA 3;  3JB8 A;  5BNQ A;  2XQR A;  4FFF A;  1WMF A;  3LD8 A;  1DZQ A;  1VMJ A;  5CAZ A;  1RGS A;  1KEX A;  4DIQ A;  1LNS A;  4PIX A;  5F5I A;  2JG8 B;  4CDQ B;  2ZAC A;  3TEW A;  2ZGT A;  2WT0 A;  3GJA A;  3VD9 A;  2D5F A;  2DYC A;  1GZW A;  4P9I A;  3INA A;  1TE1 B;  5FZL A;  1PK6 B;  3LKJ A;  4IV3 C;  1UMZ A;  2BJS A;  1PO1 3;  1GNH A;  1O8P A;  2RJK A;  5A6Z A;  3C8X A;  5DZE A;  5FXV A;  1RUC 3;  3ST7 A;  1IPK A;  3PU3 A;  4EZH A;  4YPJ A;  4BWO A;  5FWJ A;  3FBM A;  4FTE A;  3MIB A;  4FPH A;  4GB3 1;  4Y20 B;  1AHS A;  4IEY A;  4RHV 3;  2I07 B;  3ZSL A;  1PO2 2;  1W6M B;  2ZOE B;  4FP3 A;  3KCX A;  3LPF A;  3VBF B;  4ZZ5 A;  3AYA A;  3PVB B;  1K5M B;  4Q0V A;  3IDC B;  1Q8P A;  1UZV A;  3ACF A;  3M1H A;  4LXL A;  1RUH 2;  3CNA A;  5BYN A;  1UOB A;  5LWB A;  1Q8V A;  3CEW A;  4DS0 A;  5EXO A;  2VCM A;  4N53 A;  1NKG A;  3BI3 A;  2VZU A;  1GQH A;  3VD7 A;  1H2N A;  3WVJ A;  1J83 A;  2ARX A;  3DCQ A;  4CDW A;  3ON7 A;  4XMA A;  1CVN A;  4KBZ A;  3HWJ A;  3MLJ A;  5FPV A;  2QNK A;  4AEK A;  3N7K A;  3AM2 A;  1LTE A;  4LIU A;  4CYD A;  1JUI A;  2ERF A;  1R08 1;  4XJA A;  2Y6L A;  3CJI B;  3U0Z A;  1POV 1;  1YXW A;  3J7L A;  2WII B;  1JZ3 A;  1CJP A;  1LOB A;  2PLV 1;  4XZP A;  1F8V A;  1PX3 A;  1BMV 2;  1DQ5 A;  1F4A A;  1CAX B;  2WSU A;  1BQP A;  1DGR A;  2LUW A;  4A7Z A;  1ZM1 A;  5FR3 A;  3AZY A;  2GP3 A;  2B42 B;  4NAO A;  4AI3 A;  4AQ6 A;  1DU3 D;  4A3Z A;  3RZG A;  3B9C A;  5F3G A;  1W3V A;  2J42 A;  4NPM A;  4E4H A;  5LY1 A;  4YAR A;  1F4H A;  3NAP B;  1RJ8 A;  4MGK E;  1HB4 A;  2VVF A;  1EV1 1;  3RYP A;  3TOJ A;  3VBR B;  3RJ2 X;  4LBL A;  3ZKU A;  1RHI 2;  1ZZ8 A;  1BBT 1;  1CZT A;  2X5I C;  4E8D A;  3PDQ A;  5A3P A;  3WCR A;  3WDW A;  3OG2 A;  3HD8 B;  1S2B A;  3T09 A;  4AQ2 A;  1RUI 2;  1RB8 G;  1NA1 A;  2C1F A;  1LHU A;  4UFM A;  4Q0S A;  1JS9 A;  3BCW A;  2WA4 A;  1GZW B;  3LGR A;  4TXW A;  3URF A;  2JD4 A;  1ENX A;  3N9P A;  2AGS A;  1OA4 A;  5JZG A;  4LKS A;  4A2U A;  2WQ4 A;  3OGS A;  2HYX A;  1A3K A;  3O1P A;  5L9B A;  2JDH A;  2RR1 3;  3NKT A;  1LU2 A;  4HT1 T;  3NMB A;  2PQQ A;  4FXK B;  3J9S A;  1OQ1 A;  1ULP A;  2UYB A;  5FWE A;  5JIA A;  4BXS V;  4D6S A;  3OD0 A;  2JIC A;  3POY A;  4GD4 A;  4I0W B;  5BPX A;  1W39 A;  4EV0 A;  1IKP A;  2XLG A;  1F5F A;  4A7K A;  1OA3 A;  2ORX A;  5J48 A;  3KV4 A;  1O8S A;  2BBV A;  2Z4F A;  2YV8 A;  3WDU A;  3T30 A;  5A32 B;  2VQU A;  4JHT A;  4CUB A;  5J37 A;  1WA6 X;  4QXK A;  2DU1 A;  1BEV 1;  3V0B B;  3KT4 A;  4QB6 A;  4K7J A;  4FOW A;  4F7Z A;  2R1B A;  5KXD A;  4I09 A;  2D6L X;  2NQY A;  3MO4 A;  3TNP B;  4ATF A;  2Q30 A;  4Y1Y A;  4ERO A;  1IQA A;  1YJL A;  2ZKL A;  3WNN A;  3GHM A;  1VRH 1;  2D3R A;  2D7F A;  4CDX A;  2D3S A;  1RUD 1;  4LA3 A;  1ALY A;  1MPX A;  4Q4X 2;  5G05 L;  1RUF 1;  4BA6 A;  2IFR A;  1FMD 1;  5JPN B;  2VTX A;  2GMM A;  3VKF C;  1XC6 A;  1QJY 2;  1C28 A;  4N90 A;  5C4W A;  2WBK A;  1PGL 2;  2FDK A;  2DV9 A;  1NCQ C;  4FT8 A;  4KH9 A;  5GZE A;  2RS5 3;  1LGB A;  4CUC A;  2W68 A;  2JJ6 A;  5KXC A;  3OSD A;  5DG2 A;  3TBD A;  1LHO A;  4JQT A;  4P5Y A;  1S0F A;  3H1M A;  4XCA A;  2JWP A;  5LA2 A;  5CU1 A;  4CCM A;  2VPV A;  1O4Z A;  2E7T A;  2GDF A;  2CWS A;  5LK7 B;  4MVT A;  1CON A;  2JG9 A;  2OXB A;  1AVB A;  1RMU 2;  2A6X A;  4LT5 A;  5I0S A;  5A1F A;  5HCF A;  4AHW A;  1W8O A;  4IE7 A;  3ZIW A;  2O8O A;  5JZG B;  3KHB A;  1W03 A;  1HQN A;  4L8Q A;  3IN9 A;  1UU4 A;  4A7Y A;  1RUG 2;  2Q8O A;  1AYM 3;  2MEV 2;  1XYO A;  1SLI A;  4PHZ A;  1PIV 3;  4IE6 A;  1HV1 A;  4N7U A;  4XIK A;  5CZK A;  1XNC A;  1IS4 A;  5FLJ A;  3LDB A;  4GMP 1;  3VBS A;  1NXM A;  2UWA A;  3K46 A;  1ND3 A;  4COW A;  3S5A A;  1RUJ 3;  1XQN A;  3N7M A;  1W8N A;  4L97 A;  5FRA A;  1QJX 1;  3WNX A;  1UZZ A;  2JB8 A;  3WF2 A;  5JI7 A;  1OA2 A;  3EB7 A;  4QPY A;  4URT A;  4BMB A;  1QGL A;  1TME 3;  3LA2 A;  2Y60 A;  4Q8L A;  4DRV A;  3KHC A;  4LBK A;  1XPW A;  3A0K A;  3OPZ A;  2ZA9 A;  1MS9 A;  2XJS A;  1DZT A;  3DEC A;  3JD7 3;  3LZZ A;  5FTT C;  2B39 A;  4HPK A;  4I2O A;  1LEM A;  2W5F A;  3R4S A;  2VBP A;  2GC0 A;  4LUM A;  1A34 A;  2EXI A;  5FPZ A;  1F9K A;  2HWE 3;  3JQX A;  3MFA A;  4XQ4 A;  4NPR A;  1DYO A;  1SCR A;  1CES A;  5FMB A;  1LOF A;  1CIW A;  4P9G A;  2DCJ A;  3POF A;  4RS5 C;  5D8A C;  4TZD A;  2OKX A;  1W8U A;  4FFH A;  1C4R A;  3SC7 X;  5KR7 A;  4ZHN A;  3OCP A;  1GSL A;  1MZ5 A;  4CCN A;  5FY5 A;  5IFT A;  3BTY A;  4Z07 A;  1ZRD A;  4KBB A;  5ACA 3;  3ZLI A;  2OUJ A;  3MEP A;  3MIE A;  4NE9 A;  5FP8 A;  3NV2 A;  3OYW B;  1TQ5 A;  4UF0 B;  1T6G C;  3E5U A;  5FLH A;  1JI6 A;  2ZPX A;  1HQL A;  4O9E A;  5F3C A;  1E5R A;  1WCQ A;  3U1X A;  3U14 A;  3SCF A;  1MQT C;  2R04 1;  1GUI A;  1GLH A;  2XQX A;  3AB0 A;  3JZV A;  1HRI 1;  2VCA A;  1SEF A;  2ZX3 A;  3RZZ A;  3U37 A;  4DNY A;  4IQP A;  4OHZ A;  1PGW 1;  3SCG A;  5SV5 A;  3K51 A;  4BIS A;  1AX0 A;  3B93 A;  3RWK X;  1Z7S 1;  2FCV A;  4WVM A;  3Q8A A;  5BNO A;  2VXR A;  3KQ4 B;  4KG0 A;  4LBQ D;  2Z69 A;  4CU6 A;  1J84 A;  3TN9 1;  4XJ8 A;  3J7M A;  2VUJ A;  1UNB A;  1Y7B A;  1QNW A;  4K8F A;  4MG2 A;  1CAV A;  4RQP A;  2QQM A;  1O4T A;  4PDW B;  4OI4 A;  2FBE A;  4LA2 A;  4XW3 A;  1N3Q A;  5EQU A;  4YSF A;  3AKT A;  4AAP A;  3UGH A;  1UF2 C;  2RVA A;  1BZW A;  4Q4V 1;  2NMN A;  3HVD A;  5FV3 A;  2XL7 A;  1JXN A;  1OLM E;  4KWL A;  3ZM8 A;  1Y9Q A;  3C3V A;  5EZW A;  2VAU A;  1LED A;  4RFR B;  1NX9 A;  3K2O A;  4Y24 A;  3WW3 A;  1IHM A;  2VE1 A;  3M3E A;  2L9L A;  4EWD A;  2I2S A;  1J3Q A;  1C57 A;  2Q8E A;  2R6Q A;  1WLT A;  2YUE A;  2IC1 A;  1YQC A;  1KS4 A;  1DP0 A;  3ES4 A;  3VZN A;  3W5N A;  4GWN A;  2BV4 A;  4JGZ C;  4IEO A;  5FDB A;  3LDK A;  5DAB A;  5A7Q A;  1XU1 A;  2JDN A;  1H4G A;  3J26 N;  4AED C;  1VPH A;  1UW8 A;  2DFC A;  3RI9 A;  4A44 A;  2PXJ A;  1Q56 A;  2E26 A;  1V6K A;  4QHB A;  1X82 A;  3AYC A;  1UZW A;  3OUI A;  2EIE A;  1QQP 1;  3LF7 A;  3WDT A;  1I6X A;  4ARX A;  2BNN A;  1SFP A;  2G9Z A;  4BLI A;  4TN7 A;  2WN2 A;  4R4Z A;  1C8M 2;  1LGN A;  4E4Z A;  4M3C A;  4CCC A;  4WM8 A;  2W9X A;  5CB7 A;  1G9C A;  2VW1 A;  2ZMK A;  2CAU A;  3M3Q A;  2WFF 3;  2JX9 A;  2UUR A;  1QIQ A;  1XYN A;  2ARB A;  4ZS3 A;  5FZ6 A;  3KSC A;  3WCS A;  3WDY A;  2FZ2 A;  4EWE A;  2Z42 A;  4IEX A;  4W8J A;  4JGY B;  2YC2 A;  1ZBA 1;  2F4L A;  5EYX A;  1JUH A;  4ONU A;  1DQ2 A;  1RUC 2;  5A3O A;  5IW0 A;  1JHN A;  1W3X A;  3H42 B;  2ZGQ A;  4CEW C;  2YC4 A;  4QKF A;  1DQ1 A;  3LPG A;  3M7A A;  1W6N A;  4R8H A;  3H0O A;  2ADE A;  4Q4Y 1;  5DZF A;  2OYZ A;  4QKD A;  4WV8 A;  2DWR A;  2ZEZ A;  5BNO B;  5F9T A;  5JSP A;  4L0P A;  4OZX A;  4XFB A;  1QDO A;  3HJR A;  1SCS A;  1JZ4 A;  2YPJ A;  3KT7 A;  4J1X A;  1O91 A;  3TRS B;  2BQP A;  4ARY A;  5JMC A;  3FUQ A;  3LFM A;  4Q0P A;  4DXT A;  3H8X A;  3C7G A;  1KFU L;  5KC6 A;  1UO9 A;  2QDN A;  1VE0 A;  2X53 S;  4LO6 B;  1GWK A;  1S0C A;  2W91 A;  1E57 A;  3E6B A;  4M00 A;  1SDD B;  3ZFF C;  3MI8 A;  3VD5 A;  1QDC A;  2W46 A;  3ACL A;  5JOX A;  1YEW A;  3TNQ A;  1NY7 2;  4ISQ A;  1B35 C;  4NOT A;  4YWA A;  2W1S A;  4IW3 A;  1Q3E A;  2VZ3 A;  4Q5O A;  4FPJ A;  1S0G A;  4HVR A;  2WYS A;  4U36 A;  2YY1 A;  5FZ3 A;  2J1R A;  1JU4 A;  1OBN A;  3ACI A;  5EIY B;  2EVX A;  3FX3 A;  4HBN A;  1RXG A;  5DAV A;  3U4X A;  4AXO A;  4AG4 A;  1COV 3;  1HN0 A;  3EMR A;  4GQ7 A;  4RSU A;  3WNP A;  1AR9 1;  4E4S A;  1U5Y A;  1DGR N;  3HAG A;  4Q2F A;  2OQ6 A;  1NQJ A;  3GBG A;  2Q5T A;  3GCX A;  4X8P A;  3T4H B;  5A3M A;  5JR2 A;  4V1P A;  1OLR A;  3O12 A;  4RGK A;  5FYH A;  2HLE A;  1QJZ A;  4WZC A;  2OVU A;  1HRV 2;  1UYY A;  5DAW A;  1NCR C;  1UXZ A;  5FYU A;  4WM8 B;  1X33 A;  3D0S A;  4EQV A;  1GP6 A;  3VKO A;  4BM8 A;  2J1S A;  4I3P A;  3VBU B;  1OKO A;  3X29 B;  1LUL A;  1XJA A;  2JIG A;  4FQZ A;  2JD9 A;  2RR1 2;  2O8Q A;  3IMM A;  5FP7 A;  1YQ2 A;  3LE0 A;  4XF1 A;  1BVP 1;  3H3Z A;  4ASK A;  3H7Y A;  1ND2 A;  1P8J A;  3U10 A;  5D2A A;  2VMD A;  1W2A X;  3J4U H;  4BQX A;  2IXI A;  4NMI A;  3POW A;  4GKX A;  2MPF A;  4LK6 A;  5IVB A;  1AJO A;  3L9J T;  2WNO A;  5FZK A;  5C7G A;  1LOE A;  3NL1 A;  2VNV A;  2VOT A;  3CO2 A;  4U2A A;  3ELN A;  1V6O A;  4AI1 A;  1XOY A;  3CKH A;  4LR4 A;  3ZXE A;  3V0A B;  1JH5 A;  1XSR A;  2X29 A;  1DGW A;  4DUV A;  5DXD A;  1T6B X;  3DPR A;  3WNK A;  1OUX A;  5DUW A;  1NXD 1;  1KJL A;  2HWB 3;  2YHJ A;  1AL2 2;  2Y8K A;  1QXP A;  2ZBJ A;  3AC0 A;  5IVY A;  2NLR A;  2Y64 A;  1POQ A;  1IGO A;  1HDK A;  1VBE 2;  2GME A;  2WT1 A;  2WDB A;  4ITC A;  3NJV A;  3RYK A;  5I0D A;  4XAC A;  2JB4 A;  1MEC 1;  4GH4 A;  3SQO A;  2ZHK A;  3AMP A;  4PF1 A;  3VLB B;  3KZ4 C;  3THD A;  4KGG A;  1XU2 A;  2RS1 2;  5JOY A;  5KHK A;  4MXW B;  2W92 A;  1H2M A;  2XBO 3;  5DDJ 2;  5JAX A;  2SBA A;  1QOT A;  2FDF A;  4BB3 A;  1ZRC A;  1QJU 1;  1O6U A;  5BUV A;  4XHX A;  1VR3 A;  2HWC 1;  3SH4 A;  1FXZ A;  1FPN 1;  2WS9 1;  3SEE A;  3ZR5 A;  3DEM A;  5F2S A;  2R0H A;  4CA9 A;  1Q8Q A;  4UT5 A;  3J7N A;  4QXB A;  4CP0 A;  5FMD A;  1OF4 A;  2VVD A;  5FZA A;  2OQ7 A;  5FAX A;  1H1A A;  1VB2 A;  3CBN A;  2AC1 A;  2YPD A;  2BU9 A;  1WD3 A;  3BU7 A;  2QQV A;  1SMV A;  2V4V A;  4XMI A;  1GNZ A;  4XJZ A;  3R6S A;  2RDQ A;  5LEJ A;  3TEX A;  4L9B A;  4BK5 A;  4CDQ C;  2JG8 C;  3D82 A;  4QKN A;  2XUM A;  2WL1 A;  3WT3 A;  5FQ0 A;  3H8U A;  4GB3 3;  1ENQ A;  3MBW A;  2VZP A;  1PK6 C;  4HKW A;  1G7Y A;  4QPG A;  3RMX A;  4E8C A;  3RZM A;  1PIV 2;  4K21 A;  1LOC A;  1AR8 1;  3KF5 A;  4Y1V A;  3FL7 A;  4BPZ A;  3GZU C;  4ZU4 A;  4CDU A;  1OOP A;  4QU2 A;  1MS3 A;  1ZRE A;  1ZYB A;  1MR5 A;  4GAZ A;  4TTG A;  3OB8 A;  3FJS A;  4O7X A;  4FP2 A;  1NAE A;  3VBF C;  3UT0 A;  4COU A;  4EN6 B;  2R7E B;  1K5M C;  2DUO A;  1JTZ X;  2R07 1;  4C0B A;  5BNP A;  4A4A A;  3HNY M;  4ET7 A;  2D98 A;  3MIH A;  4XFC A;  4QQO A;  3DPR B;  5FUI A;  5CIR A;  1RVF 1;  3I7D A;  3ZFG A;  1VBC 1;  1TME 2;  1OQE A;  1FX5 A;  1DQ0 A;  1R08 3;  3UL2 A;  1VBD 1;  5CFC A;  1POV 3;  1FNY A;  1OD5 A;  2CGN A;  2PLV 3;  4CU7 A;  2YYO A;  2TUN A;  3AKS A;  3JD7 2;  4ISR A;  3FLR A;  5EHD A;  2EXK A;  2HWE 2;  4RYD A;  2P6H A;  3CJI C;  4UYB A;  2FDI A;  1W8W A;  3ENR A;  1HXS 2;  3VBO A;  1PNF A;  4AQS A;  5FXX A;  3EHK A;  5F6L B;  3WW1 A;  3RZK A;  5FZ9 A;  1UAI A;  3O7O A;  1WW5 A;  2D97 A;  1EV1 3;  2BUK A;  3MV1 1;  1DF0 A;  5ACA 2;  1JBC A;  2D5H A;  1BBT 3;  1YYN A;  3THP A;  1LKN A;  2DCY A;  4MLO A;  4RR3 A;  5IVE A;  1A8M A;  1TMF 2;  1ZBE 1;  3IKW A;  3PNA A;  3NW4 A;  2VJX A;  5IYY A;  3L2Y A;  3NAP C;  1POV 0;  3B94 A;  3G7D A;  4NID A;  5I8T A;  2EF6 A;  2LM3 A;  1W0O A;  1PZ9 A;  3VBR C;  2E51 A;  5FZM A;  3WD5 A;  4YGE A;  3A22 A;  1UWW A;  1ZZ6 A;  1YFU A;  4LTA A;  4CCE A;  5ABJ B;  5FUP A;  3D5O A;  4QX2 A;  1ONA A;  4A6S A;  2HWD 2;  2UWC A;  1UOG A;  2K46 A;  2KR2 A;  3A4U A;  1ASJ 2;  1LHW A;  4D3W A;  1SLA A;  4B8E A;  1ZA4 A;  4URA A;  3QLQ A;  5IK5 A;  1PO2 1;  3WZ1 A;  4JAA A;  4AOC A;  2HBU A;  4XAB A;  1YFY A;  4QPG B;  1H2L A;  1N3P A;  2WJS A;  3T2P A;  3ZPO A;  2XHN A;  1RUH 1;  3M3O A;  4QMA A;  3ZO0 B;  1GOF A;  5F8P A;  4XE9 A;  5FPB A;  2VOW A;  1YIF A;  1DCS A;  1HV0 A;  1RJ7 A;  2GP5 A;  1YIP A;  3LQC A;  3W58 A;  1BEV 3;  3WSO A;  5T5P A;  2XL9 A;  4LLO A;  4BQ3 A;  3DKQ A;  1R09 3;  2DUR A;  2GNM A;  2P34 A;  2YRO A;  4GXL A;  5JSO A;  4LO8 A;  3BAL A;  1JOJ A;  4IE4 A;  4CSW A;  2WAO A;  4XF4 A;  3I2K A;  2ES3 A;  2XGX A;  4FSJ A;  3GDB A;  2XLF A;  4IV1 B;  1VRH 3;  1AR6 1;  4OUL A;  4Y4Y A;  1A78 A;  4JHZ A;  4N9H A;  5HXM A;  1RUD 3;  1N1V A;  3AMN A;  1YWK A;  4P14 A;  4XAE A;  1UU6 A;  1Y4W A;  1RUF 3;  3R0R A;  2VUL A;  3ETP A;  3III A;  1FMD 3;  1GZ9 A;  2BW8 A;  1WUV A;  3N9M A;  3RQ0 A;  4JDM A;  2JDK A;  1EUT A;  2X10 A;  2R0F A;  1CR7 A;  4FPE A;  1MZE A;  4M4P A;  5FYC A;  5H9P A;  1G8W A;  3NJY A;  1QH6 A;  2DCK A;  2PFW A;  3DXT A;  4IES A;  2DTW A;  1AR7 3;  2GZW A;  1R1A 3;  2QZ3 A;  5IVJ A;  1CIY A;  3LFI A;  2WC2 A;  2A6W A;  2CNA A;  3EO6 A;  2WZ8 A;  2IUW A;  2GNB A;  2VOX A;  1DLC A;  3ZFE A;  5FO8 B;  3N35 A;  1RHI 1;  2O1Q A;  4XVH A;  4BIO A;  4HXC A;  5J36 A;  1RUI 1;  1G9D A;  3MW2 A;  3BIE A;  1MS5 A;  1V70 A;  4QAW A;  3UKN A;  4AI0 A;  1X8M A;  4XFA A;  4ZU7 A;  4F3J A;  5C5U A;  3VZK A;  2EAA A;  5EWS A;  1UX7 A;  1K45 A;  1JHJ A;  4AE2 A;  1X8E A;  5IVC A;  2R06 2;  1QEX A;  3C2U A;  4XQW A;  2G1M A;  1LOA A;  3LB9 A;  1NE6 A;  2R32 A;  4W6W A;  4XXP A;  2GH8 A;  1OQD A;  1O4Y A;  2KM2 A;  3HNM A;  5LZ6 A;  5JZG C;  1O3S A;  1RUO A;  1REF A;  3LEK A;  4P9W A;  3CIH A;  1QJF A;  5C3P A;  4K1Y A;  4GMP 3;  3VD3 A;  3ZYI B;  2VQA A;  3CLP A;  1WD4 A;  1U5X A;  3N36 A;  1Q5O A;  3ZXD A;  4FAH A;  1SAC A;  2DVB A;  2D3P A;  1QJX 3;  2Q0A A;  4NAM A;  4KWJ A;  2BNO A;  3MDP A;  3EJK A;  1L7R A;  2PHT A;  3ASI A;  4P00 B;  4XBQ A;  5EV7 A;  5JSR A;  1NE4 A;  5KWR A;  4UWD A;  5JR7 B;  5HI0 A;  4S2D A;  2E7Q A;  4NUB A;  1H8T A;  3T2O A;  2WO2 A;  2BTV C;  4BIF A;  3ACG A;  2P3J A;  3WR0 A;  1WW4 A;  1HB2 A;  4NR1 A;  1GIC A;  3ZPY A;  1YFW A;  1C1F A;  5CKM A;  4CXY A;  2C26 A;  5L36 A;  3KV5 A;  2XDV A;  1I3H A;  4QT6 A;  4YW3 A;  3K4A A;  1UIK A;  2AEY A;  4YYO A;  3N9O A;  1QJY 1;  3HT2 A;  2BP6 A;  1ENS A;  1QWR A;  3I2H A;  1YRZ A;  3WP3 A;  3JUU A;  2OII A;  3POB A;  3WG2 A;  5DN2 A;  4QM8 A;  2VGD A;  4IUG A;  1RUE 1;  4R9D A;  4XOG A;  3GM8 A;  2IZW A;  5IAV A;  4AW7 A;  3S30 A;  3LOB A;  1HJF A;  1UY3 A;  1VBB 1;  3FWE A;  5JWP A;  4UW5 A;  2BEO A;  3UYJ A;  3JU9 A;  1OKQ A;  3NNL A;  1Z78 A;  1W2O A;  2WNV A;  1UYP A;  2R04 3;  4CEY B;  3ZSK A;  1HRI 3;  5C8C A;  3U75 A;  3WLU A;  1RMU 1;  4HN1 A;  4ZS2 A;  2W2I A;  5AFE A;  1V9U 2;  5H9R A;  5A7W B;  1UKR A;  5FYV A;  4D8M A;  3VDA A;  4WM7 B;  4Q4W 1; 
#chains in the Genus database with same CATH homology
 2JDY A;  1GZT A;  1UQX A;  2BP6 A;  2BOI A;  2JDU A;  5D2A A;  5A6Z A;  4AOC A;  5A6Q A;  4CE8 A;  1W8H A;  5A6X A;  2JDM A;  1OXC A;  2BV4 A;  5A6Y A;  5A3O A;  2VNV A;  2JDN A;  2XR4 A;  5A70 A;  1OVP A;  1OUR A;  2JDK A;  5HCH A;  2CHH A;  1UZV A;  2WR9 A;  1OUX A;  2JDP A;  2WRA A;  2VUC A;  2JDH A;  4UT5 A;  1W8F A;  1OVS A;  1OUS A;  2BOJ A;  3ZDV A;  2VUD A;  3DCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...