2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RSC3288
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
2WR9A 2JDKA 2CHHA 2JDPA 5A70A 3ZDVA 4UT5A 1W8FA 5A6YA 2BV4A 2WRAA 5A6XA 2BOJA 4AOCA 4CE8A 5A3OA 2JDUA 2BP6A 1W8HA 2JDMA 2XR4A 5HCHA 1OXCA 2BOIA 2JDHA 1OUXA 1OVPA 5A6QA 1UQXA 3DCQA 2JDNA 1OURA 1GZTA 2VUCA 1UZVA 2JDYA 5D2AA 1OUSA 2VUDA 5A6ZA 1OVSA 2VNVA
chains in the Genus database with same CATH superfamily
1GICA 1U5XA 4CCCA 5F32A 1PO11 2C9KA 4KG8A 5IAVA 4DOUA 2VBPA 1DFQA 2Z42A 4JHTA 5FY4A 5LBBA 2A6VA 1GKBA 1I1EA 3LIGA 5A7SA 2ZGKA 1GP4A 4YW3A 1OQDA 1M06G 1W6OB 4LQRA 3LQCA 1OOPC 3LDRA 1H2MA 4ITCA 4AVTA 2QJVA 3O0XA 3DL3A 2DBIA 1CIYA 3FUQA 3S57A 3ZYIB 2R32A 4B4RA 4R9AA 5JPNB 1C8NA 4JDOA 1AR93 1RUF1 3NJXA 4IETA 2PAEA 5A6QA 3WOGA 2BNMA 3FHQA 1U5IA 4S2FA 3VV1A 2BGCA 2DDUA 4XILA 3VBHB 3ALQA 4BCUA 1IG0A 5DZEA 4LITA 2GNMA 1PGSA 2ADDA 2YV8A 3FUOA 5APAA 4IGPA 1KS4A 2HJIA 1UZ0A 3DUIA 1AL22 5BNNA 5F5QA 1VBA1 1JOBA 3PUQA 1I5PA 4GD4A 4AQSA 3POGA 2ZEYA 5FPVA 1Y9GA 3I2GA 4UWDA 3K77A 4F3JA 1ZRFA 2QQMA 2AH2A 3B9CA 3INAA 4AFDA 4CXYA 4FPHA 1AR92 2YXSA 2BWAA 3WG1A 3H8RA 4RL7A 4YW6A 4A7YA 1XNBA 2PHUA 1K5MC 2XL9A 3MLJA 3ZDSA 2O8QA 3AVRA 3DYOA 4RD7A 5C9AC 1YWKA 1O3SA 3TN93 1RUNA 3EYPA 3T2TA 3CBNA 3JB4C 5L7OC 1UIKA 4YW2A 1Q3EA 4HVRA 3TEYA 1MS4A 5BNNB 1ONAA 3Q8EA 5D8AB 5A7WB 5KR7A 4C1WA 2EAAA 4Q4X1 2HLEA 2WFPA 3ILRA 4RN5A 3ZXGA 4CCOA 2WWJA 2WFF3 3JZVA 1R082 4ZU4A 3RMYA 1PIV3 2YDEA 5I0UA 5EJZB 1H6YA 3DPRA 1X50A 3SITA 4DS0A 2D6MA 2R1DA 3WCSA 1FOD1 4UFIA 5CKQA 4JKKA 2DTYA 1IPSA 4P08A 1NXMA 3IN9A 3MIBA 5T50A 4BZ4A 1QNWA 2DURA 5IVJA 5KXEA 1U12A 2RMU2 3AYDA 2A5ZA 2IWGB 4GWIA 4E4DX 1PIV2 2D6PA 3UK9A 3U07A 2RM22 1XRUA 2ZMNA 2AGSA 4FPYA 3MUZ1 5LBCA 4QX5A 2P2KA 1WMEA 1CR7A 2J1UA 2XJQA 3SXWA 2GMPA 4FFGA 2XQXA 3FBYA 3M8LA 3DKWA 5EXOA 5T54A 3F95A 5BNOC 2TUNA 3UL2A 4N8MA 4NHMA 3GBFA 5FP4A 5G04L 5ISLA 1WGPA 4OULA 3VBHA 2GMMA 2W95A 1L7RA 5HBAA 1WCUA 1DLCA 1QXJA 4Y3OA 1G8WA 3FHAA 3B7MA 4LLFA 1J3PA 2HWC3 2VECA 1A34A 4FOQA 2KA3A 3UJQA 4KWUA 1OOPA 1HXS3 2Q8OA 3PVBB 5EP9A 2QBXA 2PAKA 4NAMA 3OGRA 5KC6A 4LBMA 4DPNA 3LOBA 2WAOA 2XJTA 2YZ4A 5JPMB 3PJYA 2E6VA 3MBWA 4YFZA 1FX5A 4HZFA 1LCLA 2EICA 2A1XA 3MW3A 2HWC2 4GMP3 1NQJA 2JECA 1N3QA 3NO8A 4IV3A 4GKYA 1VRH3 2WLPA 3GBGA 3I54A 4GXLA 3ZSJA 3VD5A 4Q4Y2 2G9ZA 1KQRA 2VPVA 4BQ2A 4XAEA 4E2SA 1W3VA 1D0HA 5D21A 5GLVA 3RI8A 4XBLA 3WG4A 4FO9A 4ISRA 4CDUC 2J7MA 1ZBE3 3U75A 5FKCA 2LUWA 4GB33 1W9SA 1OKQA 2E7QA 1OOPB 2ENRA 4WVVA 4AG4A 1AXYA 1AJKA 2LM3A 1IS3A 1NLSA 3D82A 2VNOA 4HONA 3JQWA 4IV1C 2BQPA 4IL7A 1DGRN 2GC1A 1W8UA 1IQAA 1UPIA 5C9AA 3I2DA 4QPGA 2ZAHA 1KD7A 3ZMOA 3EB7A 5FMBA 1G6NA 2BYVE 5L7OA 2ARXA 2E33A 1EPZA 1OBNA 1ZBE2 3CHXA 4MSVA 4A45A 1Z7S1 1W6PA 1AR83 2RDSA 3H8UA 5BUVA 2YGMA 1OVSA 1BJQA 3OBAA 4OUMA 4BISA 1DU3D 4BH9A 4JQRA 3LSDA 1ZZ8A 2PELA 4QM9A 2W1SA 2WN2A 3AYAA 2IXHA 2AACA 4JDNA 3WP5A 3WQ7A 3B5LB 2BFUL 3VHRA 4OHYA 1R1A3 5KHKA 1YFWA 3ZXJA 3OUHA 1K42A 3MFAA 5DXDA 3T2OA 3CEWA 1K5MB 4AR2A 4AXOA 4MGIE 3NSTA 2OT7A 2ZGNA 3MIDA 2VZUA 2W47A 4D6SA 4DY5A 1KITA 4IEOA 4E27A 4MXVA 1UX7A 2YFZA 3E5XA 4GMP0 4TN7A 5C9AB 1AR82 3B01A 1JMUB 4IEYA 1Q8QA 1WA4A 5L7OB 2JDHA 3T0AA 5DUWA 3MHZA 1VBD3 3KT7A 2OUHA 4UW5A 2VZOA 3MLLA 5KHGA 1W6PB 3I97A 4RGKA 4S2HA 2JG8C 5HCAA 1GQHA 1R1A2 3WQBA 4AVVA 5IT6A 4XUNA 5FXXA 3MV01 3ZOIA 4YNIA 5FV3A 4H3WA 4GULA 1SDDB 4AF9A 5I93A 3DN7A 2P34A 2SBAA 1VBC2 4M3CE 3WF2A 4BXSV 5J48A 1ZZBA 3I49A 1FV3A 1KXGA 2D40A 3ZFEC 1W6NA 5E88A 4BMEA 3WD5A 4ES8A 4AW7A 1ENSA 1I6XA 2FCVA 4RFRB 5FZEA 1GWLA 3EBRA 5IJRA 3H1WA 3JQXA 3ECQA 3AKSA 2OPWA 1UKGA 5HV0A 5DDJ3 2GN3A 4CXXA 1BVP1 1JUHA 2O1QA 1ZREA 2KM2A 4BB3A 3UETA 3QH7A 1H1AA 1JS9A 4H7LA 4A42A 1CGPA 1QF3A 1W0OA 2X09A 2XKPA 4LKSA 1CQ9A 1XE8A 3J8F2 2WNUC 2A6YA 2D98A 3MF6A 4NAOA 4XDQA 3ABZA 3CF6E 2RS52 1QU0A 2BRTA 2WO1A 2WQ4A 3CZJA 2J1TA 2P3KA 4XZPA 1WW6A 3HNBM 3KWVA 5BNOB 2ILMA 1FXZA 2OZJA 3IDBB 4PDWC 1YC61 1SHWB 4AFMA 2ZX0A 4Z8BA 2JIGA 1S1AA 1HJFA 1S0IA 1XNTA 3PU3A 5A3WA 4CUCA 1IS6A 3GGLA 3GBWA 4Y4RA 3GXUA 1JXNA 3AXDA 1RUOA 3Q8AA 4WM7C 4CDUA 5LBFA 2F17A 5G05L 4AI8A 2EALA 3VL9A 1S0FA 2WZR3 3LCPA 5LA9A 5K0UA 2R0HA 2VQUA 4XFAA 1GU3A 2P6HA 1DYKA 4ZHNA 1U5YA 1LHNA 3HMYA 4D3WA 5FWJA 5E16A 5FYIA 4JVAA 2VG9A 2NMOA 4LHLA 1UY1A 5F6LB 4CUGA 5FLJA 2QZ2A 4CUAA 3AL5A 3W58A 3WG3A 4CDQC 5HCHA 1OKOA 1XYNA 4J1XA 4JRAA 4E8CA 1SACA 2XUMA 3JBG2 3GDBA 4CDUB 5KXBA 4CEYA 1S2BA 1RUH3 4HSLA 5D2AA 4S2DA 4XJZA 3MYXA 5IATA 1RUD3 3I3MA 5M0TA 2XLGA 4Z2AA 1XPWA 4HETA 1YO8A 2VVDA 4UT5A 5CFDC 5T5OA 4HL0A 3V56A 1D4M2 3CO2A 3B02A 4RQPA 1ZM1A 3A22A 1C5IA 5FUIA 3OTFA 3NQHA 4CZSA 4AQTA 3NV2A 3C7OA 1LOAA 3NNJA 4N53A 5LA2A 2ZGSA 3ES4A 2BPA2 4M01A 3V0BA 3J8F1 4NWWA 2WS91 4PHZA 1ZBA2 3PUAA 3POIA 4CEYB 4LBNA 1NCRA 1GZTA 1REEA 1O4YA 2Q0AA 3X29B 4QU1A 4AI0A 2PHXA 4BLIA 5F39A 4H7MA 4ASKA 1BBT2 4O61A 2DCJA 3CL1A 2VJXA 2Z5WA 2D6NA 2FDIA 1VJ2A 2BU9A 4EE2A 4JTNA 1QJX3 3N9MA 2WSVA 3TB0A 3THTA 3MLKA 2WIIB 3I2JA 3I2KA 4AI1A 2WBKA 4MHUA 4BM8A 3IAPA 1RMU2 3ORJA 4XUOA 2JG8B 3VBSC 5GZGA 1RUC2 4UW6A 3V0BB 2JE9A 3MUY1 2HWE1 3AYCA 1OVPA 2JD9A 3L2YA 2XBO3 1LJ7A 3PIGA 4OQ9A 3RMXA 4LK7A 2X05A 3KQ4B 4C90A 5JMCA 2PYTA 1QJX2 2B5HA 1DYPA 1SLTA 2P3YA 3ACGA 3ZFEB 4DQAA 5CAZA 1ND2A 3PVNA 3UESA 1W9TA 1WUVA 2LTNA 1Q8OA 3JXSA 5FP8A 2QUOA 3TEXA 2WZ8A 2VW1A 1ST8A 1AYN2 3OYWA 4PDWA 1YI7A 3VUOA 2BUKA 2X8KA 2CAVA 1CX1A 3O5SA 2NQYA 4LO6B 1KFUL 2CDOA 1YQCA 2XBO2 4Q26A 3UKTA 4WM7A 4CDWA 4XF9A 3NRUA 2HWD3 4F83A 1JUIA 1CAVA 3PURA 2BJSA 3TEWA 2EVXA 4X6RB 3JD72 2RJLA 3OY8A 1XNDA 4NOTA 1AF9A 5KC5A 4LKFA 3QBQA 1RUG2 2ATFA 2WNUB 5FQ0B 2IXIA 1UOJA 5DUUA 3GCXA 4CYDA 2VNGA 2WR9A 5JXJA 4QD2A 1HX6A 3BUCA 2Y6KA 1IZ3A 2OYZA 4B7EA 4JGZC 4NMIA 2KXLA 4ZZ8A 1DZQA 1ULDA 4OUEA 3W9AA 4BMBA 4PDWB 2RHPA 2RE9A 4HLTA 3RZKA 4Q4V1 3VBOC 5GZDA 1UU6A 3R4DB 5JAXA 2AZ5A 4P14A 4GALA 1PZ7A 3HOBA 4L2NA 5DUVA 1UN1A 3T1MA 4HN1A 1YCIA 4WM7B 1OI6A 2OXBA 4CDWB 1SBFA 1UOFA 1W0NA 1CAVB 3ZM8A 2O14A 1PM4A 4HFSA 1NYWA 2DV9A 4W6XA 3F2ZA 1V0AA 2P1BA 2D44A 3VKNA 4XYXA 1GOGA 2Y38A 3E1F1 1IKQA 1SQ4A 3ZYRA 5AFEA 1JZ2A 1AUYA 2Z69A 3B94A 3D5OA 4QX1A 5FDBA 1LB2A 2CHHA 4LKEA 3RZMA 1HIXA 4JKMA 1PGW2 4IE6A 1RMU1 4P00B 1UXXX 1GANA 2RS33 2WZEA 3C3VA 4O65A 4NRPA 5J36A 1Q8SA 1RIRA 3SNMA 4EROA 3ZYPA 2I45A 3M1HA 4CDQB 1XBFA 4B29A 1H2NA 2PLV3 3HNYM 4OZXA 1P8JA 1FPN3 2BP6A 3SLIA 1RHI3 1RINA 4XJ9A 3B00A 3THPA 1TME3 4B3NA 3ES1A 5GLZA 4HMZA 3BVCA 4LHKA 2YHJA 2CU5A 3H7YA 4EV0A 5FBJA 1AYN1 4KU7A 3T2PA 1LULA 1RUI3 4C91A 4N9HA 5FR3A 2ZMKA 2QQUA 3N7LA 5CFDB 3KQRA 1PVC3 1QEXA 2VTXA 4YZ5A 1QH6A 2LW8A 2XMLA 2B8MA 2PLV2 3PDQA 4H2AA 2XKOA 1FPN2 3C2UA 3KCYA 1RHI2 4LO5B 1RUE1 1DQ6A 1ND3A 1YEWA 1IS4A 1GOHA 3I3DA 3KV4A 3P3PA 1TME2 5H9SA 3JD71 3A4UA 2CGNA 3VBSA 3HAGA 4ZZ5A 1GV9A 4MOAA 1ENQA 4A7ZA 3WDUA 2E53A 2ZEWA 4IE7A 3ZKYA 1RUJ3 2Y64A 5CKNA 1DIWA 1V6IA 2RS13 4FAHA 4ASLA 4J6GA 3T09A 1V9U3 4QPIC 5C3OA 2C1FA 4NE9A 3GZEA 1LGBA 4L97A 2OZ6A 4QXKA 1TG7A 2XJUA 3R05A 3BI3A 4X8PA 1BEV3 2YC2A 5BYNA 1GNZA 3E97A 5FZ7A 2H0VA 5B4XA 3ZDVA 1EUUA 5TSWA 1QOOA 4DINB 1TMF1 2Q1ZB 5FYHA 1JYVA 3TAYA 1DGRA 3AXEA 4P5YA 2NP0A 1MS3A 1W6MB 2D6KA 1MEC1 1RUJ2 1YQ6A 3VBSB 4IEPA 4FPFA 3ZXEA 3HQXA 3DKQA 4IEXA 4WVWA 1KJLA 2OX0A 5FRAA 5L9BA 1D7PM 1E5HA 5C6CA 1QOSA 1F15A 4PIYA 5ACA2 2HKXA 4XJWA 2R043 1BCXA 3KF3A 5EQUA 1UQXA 3I2IA 5JR7B 4AVBA 2JDYA 1DQ0A 1W05A 4IEWA 4NIDA 4YG3A 5FYZA 2IXLA 4IERA 4O7XA 4FCAA 1PO21 4IE4A 2GN7A 3I7DA 4BYYA 3VBOA 4KQ7A 5JR2A 2P3IA 4FBFA 5F7UA 1H1MA 4H14A 3VBHC 1O3TA 2WWSA 1HQWA 1LR5A 4EWEA 4P5HA 3GZAA 3H3LA 2QDRA 1FMD3 4RHV2 3I8TA 5I0TA 2YYOA 2XPJA 3BN6A 2IVIB 2P5BA 3ITQA 1SLIA 1T6BX 2VMHA 1AZDA 4UW4A 1XE0A 4KG0A 5IFTA 1VAVA 1UKRA 2VH9A 2W1QA 1IPKA 4BQ3A 3P5BA 4JGZB 5CVRA 3IBMA 3LFMA 4RYDA 4B1LA 1UO9A 4XXPA 4DXZA 5CG9A 3J26N 1MR5A 5CBLA 1N3OA 3VBOB 4CCJA 2JB4A 3T0DA 2JE8A 2R1BA 5KHHA 5DAVA 3M3IA 2HEWF 4M0HA 4ES9A 4RSUA 1XOYA 5F5CA 1A6CA 4GWJA 3OGVA 5L19A 4B4PA 1XJAA 1WLDA 2TEPA 5IW0A 3LSEA 4Q8LA 4D6RA 4FOVA 3WX5A 4QQOA 1CAUA 4LT5A 1OMIA 1VE0A 1C8M2 1TVGA 1V6JA 2GC0A 1SCSA 1FATA 1OH4A 1OD3A 1PO13 2I74A 5FZ4A 2RR13 3ZYGA 4Z2WA 2LRPA 3ST7A 4JGYA 2PHTA 1I9RA 2W46A 1UZVA 4MHRA 2GDFA 1SEFA 3AP9A 5FPAA 1JH5A 4NHXA 2MHFA 1G9AA 4FT8A 1X9PA 5FY1A 4EZ4A 2LALA 4TZDA 2W92A 4WVMA 2BBVA 4D7YA 2BFUS 3JB8A 1JBCA 4TWTA 1MZFA 1DLLA 1RUF3 5H9RA 4RGAA 2JDUA 2RR12 1S0CA 2HEYF 1DGWA 3AC0A 4Q4W1 4QM8A 1CAUB 1HRI2 3GHMA 4LUKA 1OLQA 4QPIA 1DCSA 4X8NA 4XFCA 4YRDA 4EYUA 4YZ2A 1W03A 3C8XA 2IXCA 3AJYA 5FYCA 5GZCA 2Y6LA 1CVNA 2BERA 4QXCA 4CEWA 1CAXB 1VBA3 2GALA 2WWUA 2JKBA 4QU2A 3KD4A 4B7KA 1W8OA 1UY0A 4Y1VA 3DPRC 3WNXA 5A6ZA 5JSRA 3KT1A 1DGLA 3S5QA 3ASIA 2V4AA 1COV1 2ZPXA 4MUVA 3O1TA 3VGIA 3S0MA 3CDZB 3G6JB 5FO9B 4WVMB 5FZ6A 4Q0QA 3CU7A 5FZ9A 3AMHA 2FD8A 2WRAA 1WA6X 3OCPA 1VBB1 3FBMA 3PL0A 4XE9A 5FZOA 3VN4A 3FC0A 2WL1A 2RVAA 5LASA 3D8CA 2FDFA 2W91A 1SBDA 4QPIB 1E5SA 4LNVA 2RG4A 1QQP3 2KR2A 1VIWB 4AFAA 3N9NA 3PIJA 2JB8A 2ZGQA 4CCMA 4D94A 1F4HA 2BGOA 2JX9A 4OI1A 4A4AA 4JC1A 1V6NA 3RDIA 2RJ2A 2WO7A 1DF0A 4PCRA 3CMGA 4Q4X3 2AEYA 3FWEA 4NIIA 4URAA 4AI2A 4XF0A 1O3RA 2UYAA 3J7NA 3AVSA 4CCEA 1ZX5A 1NY71 2GP3A 1LHVA 1W8NA 2I2SA 2HWB1 1C8M1 1QQP2 2GNBA 2VE1A 3N9PA 4YLZA 5FJHA 5FZOB 4BQXA 2QCSB 1EAH1 5C3SA 5LZ6A 2VGDA 1OQEA 1YJKA 2B42B 4E4SA 1LOGA 1FT9A 3ZYFA 1LU2A 2R061 3POSA 5B2GB 2ZGMA 4ATEA 1QHDA 4RR3A 4KMQA 4K7JA 3H50A 3T2QA 1OLME 2YB7A 2VUCA 1EV13 4LOSA 1R093 4XQ4A 2DBNA 3WT3A 1F31A 2VZVA 2WT2A 3H8OA 2DVGA 3ME2A 3MO4A 1UU5A 2R7EB 4Q0PA 5IWFA 4IV3C 4K6BA 2ES3A 4XTMA 5FZ3A 3U37A 5J37A 3LAGA 4CDXC 1W9WA 4FAGA 4UXAA 3SH4A 1LEDA 3TEZA 4LOTA 3PUHA 2NZ9A 2WO3A 5LEJA 1PZ9A 3U4SA 5I0SA 1HRV1 3I3EA 2WNEA 1UOBA 5FZKA 5C8CA 1RL3A 3RWNA 4Y5TA 2J1VA 1W2UA 2VC9A 4OZOA 1EV12 4LIUA 1R092 4Z1VA 5I8YA 2WQZC 2JJ6A 5LWBA 3H8XA 4RR3B 3BALA 2WINB 1RC6A 2JG9C 3TOJA 4QPGC 1LTEA 4YZ1A 4JRLA 4KWKA 3KHCA 3KCXA 1YIPA 2XLAA 4XXAA 4C1XA 4HK9A 1AYM1 1AX1A 2EIBA 1Q43A 4RGGA 1VRBA 1HB2A 2GMEA 5DUXA 5HXMA 1UY4A 4L92A 3CJIA 1PK6A 1WW4A 1O4ZA 2YBSA 3FZ3A 1BYHA 5FYYA 3RZHA 2W94A 2IFWA 2AENA 5FKBA 4FSJA 1JZ3A 2HWF3 1VALA 3GZTB 1A3KA 1OF3A 5E6HA 4BDVB 1OA3A 1XE7A 1XYOA 3TN92 3NNLA 5GJ6A 3HJRA 4AGGA 1KJRA 2Q30A 2XJVA 3WG2A 3IM0A 1RJ8A 4OYUA 2OVUA 2E7AA 4GZ9A 4Y1YA 1JI6A 2QE3A 4CVUA 3ILNA 1KDKA 2VQTA 1Y9MA 4ZONA 4R9BA 2HWF2 3O0WA 3J7MA 4N7IA 5L73A 2WFF2 2A3YA 4E9KA 2XH6A 2XOMA 2FQPA 3VHNA 1EY2A 3B3QE 1ENXA 1HV0A 1LOFA 2X10A 1MS1A 4KGQA 2QFEA 4QX0A 1H2LA 2DTWA 3RS6A 5C7GA 5I91A 3BU7A 2UY8A 4K8FA 4L0PA 3NVCA 2OS2A 3DPRB 1V6LA 5EHDA 3TBDA 1AL21 1H30A 3KV9A 1URXA 2XGXA 4FPEA 4OHVA 2G9GA 2J1RA 2P6CA 4UFJA 4XEZA 4URTA 4ZKTB 4U36A 1CJDA 4ORFA 4ZXEA 1OQ1A 4BA6A 3HD8B 1ZYBA 5IVYA 1AR91 5BV6A 1R64A 2BVVA 1MZ6A 4FTBA 1QNYA 5CB7A 3H3ZA 1H9PA 1LODA 4QPWA 2JDZA 2XVLA 4XF4A 1PX4A 3N7MA 4XUTA 1OFSA 1X82A 4SBVA 5HCFA 3WQ0A 2PN5A 1LESA 3OD0A 4UBGA 4BWOA 3H7JA 3ZXAC 4AEJA 1L7LA 2PFWA 2ZACA 1QXPA 4JAAA 1GFF2 4IDZA 1ZZ6A 4XURA 1XNCA 1NE6A 4W65A 3O1VA 3SHRA 1ZA7A 5LEKA 5DMYA 1RGSA 4DB5A 3RG0A 1LENA 2F6BA 4A2UA 4BHPA 4CDXA 3WW4A 1HXS2 5FTTC 4HKOA 1R081 1MACA 1VAMA 3TN91 4XMIA 3BU0A 2W3JA 3ZFGA 2J1AA 5FXVA 5F3EA 1LNSA 4QKNA 1UF2C 3R0RA 4XETA 1DQ1A 1K3IA 1AX0A 5K0UC 1WW5A 3N7KA 3FLPA 3ZMNA 2XLFA 2JG9A 1VRH2 2VVFA 3ETQA 3UYJA 4LK6A 4FPCA 2CAUA 4YW7A 3BKZA 1W2NA 3EJKA 4B8EA 4LO4B 2RMU1 5FP3A 4IV3B 3NV1A 5C5UA 1PIV1 5IVBA 1F4AA 4KNCA 2RM21 3NW4A 2VO5A 2XHKA 3LEMA 4GB32 2EXIA 4CDXB 4GJZA 3KVAA 4M4PA 4EN6B 1D0GA 3H9AA 2WT1A 4KWLA 3VDDA 4CEYC 4S2GA 1UU4A 2CNAA 2CSGA 2ZGTA 3BPSA 2AUYA 2B45X 1YQ5A 4FXGB 2ZHLA 2XUEA 1MS8A 1NZIA 3OUIA 3BIWE 3PU8A 3OOXA 1C4RA 2JG9B 1HLCA 2YPDA 4DMIA 3J9SA 1BVVA 4QPGB 4RQPC 5ERLA 1FAYA 3U1XA 4KBBA 3ZN4A 4DUWA 2P4EA 4QT6A 2WA3A 1OURA 4QXBA 4QXHA 1RITA 5FPXA 5IVFA 3M3EA 4N53C 4UFLA 5ANQA 3UV9A 4A3XA 1U0AA 1XU2A 3VDDB 4CRQA 3LZZA 3VDBA 1NCRC 2VW2A 2VOTA 4HVOA 4N43C 1QJU3 1AXKA 3LGRA 4RS5C 2ZOEB 5FLIA 2E31A 3I59A 2R6QA 3O12A 4OHZA 2HWC1 5AC93 4N90A 3VB9A 1ASJ3 4KU8A 4CTEA 1AR73 2CGPA 1VBD2 4Q4Y1 4DO0A 3BTXA 1HXS1 5T55A 2DU1A 5FYVA 4YGEA 4W4ZA 1ULGA 3OEBA 2GU9A 3LKJA 1XYPA 3WVJA 5C8WA 1GWKA 1CJPA 4K8RB 4IEQA 5FZAA 5GM0A 4BQ5A 1GMMA 1JYCA 1QJU2 1QWRA 1JYXA 1DYOA 4R52A 1XB9A 1N47A 5FAXA 3WY6A 2Y6JA 1CIWA 2ZHNA 3WLUA 5AC92 3HVDA 4Y1UA 1F5FA 1ASJ2 1JOJA 1VRH1 5KXDA 3M3OA 4PI0A 2OKXA 1QJFA 5I8TA 5EPAA 3PTYA 4FVVA 1UMIA 1YUDA 2YBPA 4HOOA 4EWAA 5K8SA 1W6NB 1ND2C 1O59A 2WS93 4XF1A 3WF0A 4YW1A 4CE8A 4K1YA 3WDXA 4PLOA 1ZBE1 4HANA 4PF5A 4GB31 4WM8C 1WD3A 3VZMA 5D1IA 4IEZA 5DDJ2 3VKMA 2XXZA 3CNAA 2DFBA 1UXZA 1SPPA 5T3NA 4PQQA 3UT0A 1PMJX 4JHZA 2W0XA 4CDWC 4U2AA 1HQLA 1JZ8A 3NKTA 2WYSA 2UY9A 2VZ3A 2E7TA 3W20A 3VDCA 1NA1A 2VZPA 3POFA 2Y26A 4DEQA 2JENA 2OQ6A 4P9YA 1H0BA 2WA4A 1J3QA 1AR81 4QGLA 2ZXQA 1ULCA 2AEZA 3AMQA 4MYEA 1CX4A 5CG8A 3WUCA 3K51A 3VZLA 1SG3A 4HKLA 3WHUA 1O3QA 3ENRA 2HYKA 1Q56A 3EHKA 3PVEA 5J96B 1G7YA 4R8HA 4ISQA 3AZYA 1R1A1 1GOFA 4Q5OA 3HN3A 1SPPB 4NWVA 2W52A 3IIIA 1VBC1 2WZR2 3PTRB 1S4CA 2EXHA 2YMZA 4TTGA 1HJGA 2VOXA 4MGSA 1NA1B 2GC3A 1DQ5A 5FFOC 3FHIB 4XHBA 4KH9A 1VBD1 5K0UB 1CONA 1GR3A 4BIOA 4YG0A 4MLOA 2PHFA 2MPFA 5C3RA 2XJRA 3BOPA 4ZS3A 2KD7A 2YC4A 1PZ8A 1UNBA 2NN8A 1POV3 4Z07A 3HT2A 1KGYA 4OMCA 5FPBA 2CV6A 3A0KA 3N36A 2IXJA 1CZTA 5HV4A 1RUH2 4LBOA 3FFZA 2ZX3A 1YQ8A 5FZCA 3WF1A 3TNPB 4TSVA 5JSOA 5FOJB 4I2OA 1FNZA 1EP0A 1RUD2 5A3NA 4YSFA 4Q4V3 2VULA 2RS51 4Y20A 1OPMA 4GQ7A 1NCQA 1X36A 4N43A 3P6BA 5FY9A 4HVQA 1TZOA 3ZR5A 4FOYA 4RS5A 3LPGA 3KMHA 1O5LA 3NL1A 4HN0A 2Y0OA 3DXTA 3POBA 2RDRA 4I0BA 3U10A 3KV5A 4EZHA 3E5QA 3Q8BA 3OB8A 2V4VA 4ASMB 1WMFA 1VMJA 3EMRA 3KZ4C 4RQPB 3T4HB 2JDAA 3VZKA 4CCNA 4E2QA 4K3UA 5C3QA 5LRSA 1FNYA 1ND3C 1I5ZA 4PLMA 4JKLA 3P3NA 3V0AA 2JKXA 4N53B 3U4XA 2DU0A 2R30A 1YRZA 3MW4A 2NM1A 2PAMA 4IXLA 5FUNA 5JWPA 1PNFA 3KB5A 3ZSKA 3SH5A 4DNYA 2F4PA 1AR63 3AYEA 1NCRB 5A1LA 3LIHA 1IKPA 1NLQA 1SBEA 4N43B 1T2XA 4Y20B 4XAAA 1ZRCA 3OD4A 3MPPG 2QQWA 2MEV3 4RS5B 5FZ8A 2XWBB 1IOAA 2W2IA 5GZEA 3KM5A 4M3CF 4WM8A 4XTPA 4AHXA 4QKFA 1POV0 2Q4SA 2A6WA 2G19A 3ZXFA 4I0AA 4K1ZA 3JBG1 4AAPA 2K0GA 1DP0A 2QQNA 3AKRA 1XNKA 1AR62 3POWA 4HSJA 5FPUA 4AHZA 3S7EA 1MS0A 2GH8A 3OF1A 4MO3M 2EA7A 1OSGA 2MEV2 4C0BA 2XL7A 3DECA 2DUPA 1UWWA 4AHWA 2HBUA 2ZA9A 4UFMA 5AVAA 1D4M1 2JD4A 2PHDA 3UGFA 1GSLA 3OGGA 3SCHA 4SLIA 1KRIA 3B69A 1UZWA 4HBNA 2XJSA 1ND2B 4MX3A 4P02B 3H1MA 1L7QA 1TEIA 2Y34A 2ZGUA 3FL7A 2FCTA 4M4RA 4WM8B 5AVPA 1RUH1 5GLTA 5A7PA 3HQUA 4CCKA 4MVTA 1YFYA 5DABA 3OYWB 2WNVA 4AQ2A 4CXWA 4AEDA 1S0BA 2HWD2 2R49A 1YIFA 1ZBA1 5DPNA 1QMJA 3K3OA 3ROUA 4DXSA 4GKXA 3ON7A 3IKWA 4LMFA 3USUA 3NJZA 2BVBA 1YNAA 2ZMLA 4FFHA 3VHOA 3VKFC 1BBT1 1W2AX 3FX3A 3T1LA 4XQDA 2D6LX 3OY8B 3VD3A 2VBBA 2VY0A 2B9VA 3Q8CA 1MEC3 3FLRA 4AVAA 5T5PA 1NT0A 2Z2SB 4XIOA 3BODA 3O14A 1BKZA 1LHWA 4ZU7A 5A70A 5JCTA 2WNVB 1RUC1 5B4NA 4AEDB 5JI7A 3D3AA 3BPZA 3LFIA 3NNGA 5JZGA 1PGL2 1ULOA 5FP7A 1D2SA 4QHOA 4A6SA 1SZBA 3IAQA 1HV1A 3USUB 3A7QA 4AEMA 1XNAA 1BMV2 4FOWA 1QJX1 1JZ4A 4I01A 1PO23 4OLLA 1HB3A 1GNYA 4CU9A 1KDMA 5A32A 4L8QA 3AL6A 4NHLA 4V1PA 4Y22A 1W04A 2B39A 1QJY3 4W50A 2RS32 3WNLA 5FK7A 1Y9QA 3ZVXA 4K21A 5F8PA 5GALA 1DBNA 4JGYC 2XVGA 5A3PA 3E6DA 2XBO1 5FIXA 3RGBA 1QJZA 1W8FA 3CIHA 4J1WA 4AI9A 4CPBA 4DEVA 4XUPA 1DZRA 5I8SA 5JZGB 1C1LA 1JHJA 1YYNA 4JQTA 1OT5A 2R073 5JOWA 4Q2FA 1I3HA 1RUG1 2PHLA 1QJY2 3RI9A 3WDTA 5IK7A 2WJSA 2VNRA 3I3BA 1RUI2 1SLCA 2AREA 3MIHA 4I3PA 4NHKA 3WW3A 1XSQA 4PLNA 1PVC2 5IK5A 2ZX4A 1NUKA 4Y22B 3UGGA 1JHNA 1NOVA 3OBZA 3IDCB 4IUGA 3ZX7A 2A6XA 2VW0A 4XFBA 3ACFA 5SV8A 4CEWC 2DF7A 3VBUC 3ZO0B 2W5FA 1SCRA 2Y0IA 3MICA 2W39A 2R072 2Z4FA 4YM1A 1VBE3 3OSDA 5FZBA 1ND3B 1QH7A 3WQ1A 3BTYA 1N1TA 1SFPA 3VBFA 4BXFA 1OD5A 3JCIA 5GKAC 4AEKA 2RS12 5LA0A 1S55A 1RVF3 1V9U2 4XCBA 1JU4A 4YGBA 3N3HA 5FZLA 1NXD1 1Y43B 2XVKA 4XBNA 5LBEA 3IIAA 1BEV2 4MGQA 1PGW1 3WDVA 1LAJA 2BGPA 3HBZA 5CFCA 2NLRA 1BLZA 4Q0UA 4XFHA 1JZ7A 2FHRA 4QGMA 3POYA 5KHIA 1GLHA 1PMHX 2ZX2A 4PJYA 4AHYA 4OMDA 1V6MA 3IMNA 2B46X 1SLBA 2GSYA 2BW8A 1PX3A 4Q8KA 2Q5TA 3GYDA 4X6QB 4HPKA 1REDA 1RVF2 5FZ0A 3RZLA 3MZHA 4C8DA 1BK1A 4P9JA 4BQYA 1UPSA 4FTSA 2DVBA 2QZ3A 4ZY9A 1RTVA 2IUWA 4B4QA 3CLPA 3MGUA 2R042 4NIAA 2V73A 4LBKA 5JIAA 2ZGOA 2Q8CA 4F7ZA 4XJ8A 1T6GC 4FI9A 3T08A 1COV3 1G9DA 2BBAA 3D0JA 4YVSC 2W1UA 2PLV1 2VCMA 2ZS6B 3MW2A 4LBQA 4LLOA 1FPN1 1RHI1 4CP0A 2WC2A 2VCBA 4H55A 3OGJA 1VBB3 4QQLA 4W6WA 1VLNA 1TME1 4R4XA 1YJLA 3PLQA 4RR3C 1WCQA 1W90A 1X8EA 4I02A 4AVSA 2V5DA 1EYBA 1W06A 3R4SA 4E4HA 5LB6A 3RSJA 1BZWA 3POJA 1RUI1 1FMD2 3HN1A 1YQ2A 2OW4A 4P9IA 2FZ2A 3I2OA 2R0FA 3ELNA 3OUJA 4HG6B 2ORXA 4MG2A 3WDWA 1QGLA 3LEGA 4A6OA 1UOGA 4Q0VA 1AHSA 2Y6HA 4LIVA 2B9UA 2XR4A 3IMMA 4RA0A 1MQTA 5EWSA 5FYMA 5C8CC 1ODMA 4LBQB 4E8DA 5F3CA 1QY4A 2FCUA 3PMEA 3WW1A 4AK3A 5ABJC 5KHJA 2VMIA 3WEZA 1ZVFA 1ULPA 5JXGA 4IGQA 3WP4A 2VCCA 1EAH3 1RUJ1 3T0BA 2DCKA 4DRVA 4FP2A 4CCLA 3NV3A 1GZWA 1V9U1 1BQPA 4I3GA 2HYXA 4QHZA 4NIGA 2DVAA 1D2QA 2R063 1SFYA 1E5IA 1W8WA 4P9GA 1US2A 5ACA1 1HKDA 4ONUA 3C7GA 4LORA 5EYXA 1VMHA 4AOCA 1Q5OA 3CJIC 3PMSA 1D4VB 1PK6C 4LUMA 4Y24A 1PO12 4L11A 1M4WA 4XPVA 5KXCA 3D6EA 3R6SA 3UNPA 2Y6FA 2ZGRA 5F37A 4QX7A 2BDRA 4GH4A 2RDNA 5L9VA 1GZCA 1FI2A 3UGHA 4COUA 5A1FA 3MI8A 1QDOA 4JGYB 3VBUA 4DXRA 2ET1A 4A3ZA 4LE4A 2AR6A 1HRV3 3FN9A 4MGYE 1UMHA 4BPZA 4UF0A 1GZWB 1C3HA 1TQ5A 3LE0A 1RUF2 4RHV1 4XBQA 1FYUA 2QQPA 1UY3A 2EIEA 3IZOA 4M3CA 4YW4A 3ACLA 3ZYHA 5FPLA 1MS9A 2BNNA 2BV4A 1J1TA 4FQZA 3N35A 2J1SA 2A73B 3SKVA 3G7DA 5K4LA 4P9WA 5HCBA 5DZGA 3A0NA 1VBA2 4IE0A 5LA1A 4LA3A 4NHYA 2ZTNA 3ZN5A 1Y3TA 1LOFC 2TBVA 1GQPA 3LWCA 2OPKA 4NPLA 1OUXA 1U5ZA 1UX6A 3IB3A 3QCWA 3MIFA 4CEWB 3VBUB 2JDNA 4KWJA 4IE5A 4TLGA 2DVDA 4XOGA 2VMEA 1UD1A 1ZRRA 3K46A 4UF0B 3DV8A 3Q9OA 5FY5A 4A44A 2Q1MA 4Y26A 4I0WB 2E32A 1JZ6A 1Y7BA 1SLLA 4M3CB 4YGCA 1QOTA 2QVSB 4LEJA 5GLUA 3AFGA 3I2FA 4AVCA 2K9ZA 4OI4A 2VMFA 4GIQA 1H8TA 3M3QA 5FUPA 2BZDA 4WZFA 4L99A 4ARXA 1UYPA 2N7GA 3RYRA 2WQ8A 3IWZA 2F4LA 4YVSA 1FOD3 2ZZQA 5JMOA 1HB1A 2EXKA 4XJAA 3U0ZA 3NKGA 1KEXA 4Q4X2 5KWRA 3ACIA 4HT1T 2RJKA 4ATFA 1WLCA 3TRSB 5KBFA 3V65A 4COZA 4I30A 4Q27A 2ARCA 4XFIA 3W59A 3LDBA 4QWNA 5JOXA 3AB0A 3AMMA 2X5IA 2RR11 5DAXA 5I0RA 4ARYA 3OBRA 1HRI1 4NR1A 1HQNA 1NG0A 1FOD2 3K2OA 4FPGA 4NPRA 2CWMA 3C7EA 3L2HA 5GZFA 1YFUA 5A6YA 5IFPA 1H8TB 1K45A 2UWBA 5EYYA 1H9WA 3AZXA 2BOJA 5SV5A 5J7MA 2ARBA 1AL23 1JYIA 1VPHA 3AMPA 3AX4A 4YVSB 3PNAA 1AVBA 4XJUA 5DAPA 3ZFGC 4MXWA 4HK8A 5ABJA 3FFQA 2C5DA 4MH0E 1LGCA 3HT1A 2D5FA 4DUXA 3WNPA 1WCDJ 5HPOA 2OIIA 1AL0G 1QDCA 2X29A 1OPOA 4YM0A 3NNMA 2VR4A 2K46A 3WNMA 2J22A 4CSWA 2VU9A 4LBJA 2X5IB 5F5AA 2JDKA 4LKDA 2QNKA 3NWKA 3GHNA 2JIJA 5JSPA 1O6UA 2Q1FA 5D8AA 2Q8DA 1YI9A 5A7OA 5A7WA 3RZZA 2D93A 4QX8A 3JUUA 4LE3A 2QKDA 5IHRA 1WD4A 2IVJA 4NN0A 3DGTA 3RNSA 1LHUA 3VDDC 1RJ7A 4YM2A 5LY1A 5C8CB 4JDMA 1GP5A 4MXWB 2PXJA 1UYYA 4MZUA 5ABJB 3ZR6A 2VZTA 4I09A 4OI2A 1R083 1W39A 1NLRA 3T30A 3J7LA 1LOBA 1X33A 1QQP1 1WKYA 3RJ2X 5K9YA 1WBFA 3NMBA 3WNOA 2UWCA 5LRRA 2W87A 2P37A 4LPLA 2Y8KA 1YLLA 3CJIB 5F5IA 1PK6B 3CQOA 3HQRA 3DF0A 3WINE 1ZZ7A 2JXAA 2A3WA 5JLVA 1S0EA 1ZZ9A 2V09A 2QQVA 3EXUA 4COYA 2EF6A 2RMU3 3OJBA 5FO7B 5T52A 5FYBA 5LK7B 3AM2A 1MZEA 2RM23 1Z7S3 1EPWA 4L9BA 4MV2A 4J25A 4BLJA 1GYKA 1XSRA 3RYKA 2D3RA 1ULEA 3DXUA 2D3SA 1E57A 3ZYBA 3ZXLA 3DCQA 2A75A 3QACA 4LJHA 2DUQA 3D4KA 4UFKA 2QQOA 4PI2A 3OG2A 1OUSA 1XXNA 3IDAA 3NAPC 4EN7B 4AQ6A 4TYSA 1V6OA 4OHWA 3WCRA 5J09A 2VXRA 3AK0A 4W8JA 1WWYA 1SLAA 2FMDA 1EV11 3EO6A 1R091 4CP1A 1CPMA 1W6QA 1Z7S2 2R16A 2NYYA 5BXXA 2QQKA 3K4AA 2ZGLA 1EUTA 2XJPA 3W21A 1REFA 3K48A 4B1MA 2ETEA 1HB4A 2UWAA 2VTFA 2X53S 5FREA 3J4UH 1Q8PA 5IAXA 1LU1A 3E5UA 2VTXJ 2CTVA 5J3UA 2VBDA 1JN2P 3WP6A 2O8OA 3VL8A 3LEIA 4BE3A 4Z92B 2NMNA 1GZ9A 4CP9A 5IVVA 3FJSA 5A3TA 4YGDA 3C7HA 3THCA 1UMZA 1W9YA 3KVBA 3BB6A 4Q4Y3 3WP3A 2ZZJA 1W6QB 1NX9A 2ID4A 4OCTA 5FMOS 3ZKUA 3AZVA 1NA1C 2HH9A 5LATA 5EJ1B 5A6XA 2LS6A 1HN0A 3RYPA 1POQA 1BXHA 2JDMA 4QGNA 2VL4A 3FE5A 1CESA 1N1SA 5FYTA 4GAZA 5F2SA 3BTZA 1DDLA 4DXTA 3ACHA 1OC1A 4PBOA 1OXCA 1Y4WA 4IQPA 4ZU5A 3E6CC 2XG3A 2HWF1 1IQDC 1W2TA 2WFF1 5LK5A 3ZYJB 4CP9B 4NIHA 3ZFFC 2ZBJA 5C70A 5FXZA 3WSOA 3AMNA 4IEUA 4V2WA 2DWRA 4BU2A 3H3UA 1OA2A 2XB6C 2BWCA 2DCYA 3H1YA 5DQ0A 2VXJA 5BPXA 4LO7A 3RVHA 3ZFGB 4XW3A 4UOJA 4YW5A 3VKLA 2PMWB 1K5MA 5DG1A 4YPJA 1ULFA 1MVQA 2A7AA 4QQHA 1LOCA 5C4WC 2ERFA 4META 5FY8A 1AXZA 5FZFA 2XDVA 4QMAA 2QDNA 4IEVA 4XDOA 4YM3A 2BOIA 4E2GA 2JICA 2ZJCA 3O1PA 2WYFA 3LOIA 1WCSA 5FY7A 5K7PA 1XU1A 4KGGA 5EIYB 5L36A 3TWIA 3SMHA 4RFT0 4UBHA 3ILFA 5FP9A 2DFCA 2HBTA 3VBRC 1ALYA 1CZSA 1W0PA 1Z0HA 2QQLA 3SISA 2MNGA 1WW7A 1W3XA 1NCQC 2PHRA 4QB6A 3R4UA 3HNMA 4Y1XA 1XQNA 5C5TA 3ZSLA 5IUQA 2C9AA 2V5YA 4QX3A 1VBC3 2ORZA 4D8MA 2NPIA 3M3CA 2G1MA 4JX0A 3PUSA 4JZRA 3AP7A 1A8DA 1A8MA 1J84A 3QOPA 4QB2A 4K20A 1TNFA 5AFBA 2WT0A 3S6PA 3VZOA 5A7NA 1WLTA 1UZZA 3NAPA 4GJYA 3OEAA 1IG3A 3NV4A 3ZXDA 3JU9A 3LF7A 5FY0A 1H6XA 3GNEA 2J1EA 2YY1A 2DVFA 1NQDA 4QKBA 3RQ0A 4A7KA 5I0DA 4GMP1 3APBA 3KGZA 4UW3A 2D3PA 5DAQA 2EXJA 1AR72 1XC6A 1FV2A 2DYCA 2GNDA 1ZRIA 4EN0A 1SDWA 1C57A 3I59B 1L3JA 4DIQA 3MV11 3EQEA 3J8F3 3O1OA 5BNOA 3I3QA 2XWJB 5FYSA 1RXFA 3RFRA 2YU1A 3UKVA 2RS53 1G9CA 5H9PA 3HBKA 1X7NA 5JOZA 4MGKE 2PA7A 3WF4A 3NAPB 2Y6GA 4Y33A 5DZFA 2EAKA 4XABA 3CJXA 3M4FA 3U14A 4FPLA 1F5JA 4JCKA 4PBPA 3ZSMA 1Q8VA 2VUDA 3K75B 1DGWX 1LHOA 5BNPC 4N7UA 3AP5A 3SCGA 2ZHMA 2WS92 3N4MA 4WBBA 2E51A 2VUJA 2G4IA 2VUAA 3O1MA 4XZUG 4BQ1A 2VQ0A 5JXIA 5FZMA 2D7FA 2V72A 3BTAA 3LDKA 2ZAAA 1X8MA 1ZNPA 2HWE3 1A78A 5J1XA 3RPQA 3VZJA 1IHMA 3D0SA 4DFSA 4MADA 2WNVC 4AEDC 3ZFFA 4AWDA 4BOWA 5C71A 2QQIA 2PQSA 5FOBB 1JOPA 3GALA 1GBGA 3RZGA 4KBZA 2DCTA 2Z79A 3B9IA 3M2MA 1GNHA 1DQ2A 5HXVA 4N9IA 3JBG3 3FLTA 1VP6A 4YZ4A 3UKNA 4CCDA 2JDPA 3GJAA 3GF6A 2HWE2 2FMYA 4COVA 3KGLA 4IV1A 3NNFA 4WVZA 3POEA 2ET7A 5C4WA 5LCWL 2WSUA 4FXKB 5FK8A 4DY3A 1PM7A 4W6YA 2YGLA 1JTZX 2D6OX 4FPJA 4CU7A 2ZKLA 2B4KA 4LHSA 4DZGA 3MDPA 1JYNA 3O0VA 5A1AA 3RZJA 1UW8A 5IYYA 1D4M3 1QJU1 1US3A 1VR3A 2YPJA 1DZTA 1ENRA 3AP4A 4PQ9A 5FZHA 3ZFFB 1WZXA 4LHNA 2AYHA 1YXWA 3B93A 5AC91 5JZGC 4QX2A 3ZIXA 4AI3A 3SC7X 2QTWB 3LA2A 2CY6A 1GWMA 1ASJ1 2GP5A 3WNKA 4QDSA 4Q29A 1AR71 2OQ7A 2HEVF 2P17A 4LXLA 4M0NA 3VBRA 1WLWA 3OPTA 2VAUA 4LR4A 4BK4A 4OHXA 1ZBA3 2W1WA 1PVXA 5A3MA 3I4IA 4XACA 5F3GA 4IV1B 5DDJ1 4OFGA 4UYBA 5EJ3A 4BJ0A 3NJYA 5FZGA 5C4WB 3ZN6A 1JYWA 1UL9A 1BBT3 5CISA 1SFNA 1C1FA 1O91A 3N9LA 3N9OA 2A71A 4UI9L 4FFIA 3MPBA 4CA9A 5JI9A 1ACCA 2YG0A 4OUSA 1W8HA 3VHPA 5E89A 2BEOA 2JG8A 2PQQA 1F8VA 3HWJA 5CKMA 2FZ1A 3PJQA 5FZ1A 4Q4V2 1QXRA 2D97A 2G9FA 2ZX1A 2FDHA 1JZ5A 2GZWA 1LRHA 4MGZE 5IK4A 3LA3A 5LW9A 2GC2A 2UU8A 1C28A 1RMU3 3VBRB 5JVVA 4AGRA 1JU3A 1RUC3 3HIFA 1DHKB 3KLSA 4BK5A 1R1ZA 4YZ3A 4GWNA 3SH3A 1NCQB 3O1RA 3ZFEA 1H4GA 4FPKA 4XDPA 4PIZA 5IVCA 5JIUA 1YHFA 2JWPA 4OVEA 1UAIA 5A80A 4XHXA 1WMXA 5T5LA 3ZLIA 5CIRA 3KV6A 4YYOA 3ZN6B 3OBTA 5A33A 3BYWA 5FO8B 4D7TA 2WZR1 1WBLA 3KHBA 3KSCA 2YUEA 1QIQA 1AYN3 2JEMA 4AYUA 1IS5A 1OFNA 4INDA 3VBFC 5FBZA 3V0AB 3AP6A 5EFUA 3AKPA 3LPFA 4IGOA 3VD9A 4PT6A 3T4VA 2DCZA 1N1VA 4AGVA 4AZZA 4NUBA 5FYUA 5L9RA 5BNPA 1RUE3 2WNUA 5FQ0A 4YG6A 4FQ4A 2SLIA 1H2KA 1MVEA 4QDRA 3JD73 2L9LA 4YVWC 2H6BA 1AJOA 4YFWA 3V64A 1RUG3 5CFCC 2XHNA 3AZZA 5FMOL 5GLWA 2VQAA 3GM8A 5A33B 4D6QA 2DUOA 3RRDA 1O8PA 2D5HA 4NO4A 3QLQA 2VOWA 3SEEA 1RUD1 1S0GA 1O4TA 2OUJA 2GH2A 4G3YC 1C5HA 4TXWA 3PUIA 4AFBA 5FZDA 4QHBA 1RUE2 1GQGA 1QKQA 3IDEA 5DG2A 2ZHKA 3KS7A 1B35C 2FDGA 1WMDA 2BNOA 5BNPB 1POV1 3VLBB 3OPZA 1TMF3 4IW3A 1OLMA 4HKWA 1OH3A 4GA9A 3UJOA 2C0ZA 4E4ZA 1O8SA 2ZGPA 3THDA 2UURA 2VD7A 2VZSA 1W8TA 3AZWA 1HDKA 2W08A 4KI5M 2WLQA 2Q8EA 1ZA4A 2RDQA 4CDQA 1NZCA 5CA6A 3N7JA 1VMFA 4V2VA 1H8VA 3U78A 2W9XA 4XVHA 4F8AA 4IESA 4CPBD 4QB1A 3SQOA 5BY5A 1TMF2 3WR0A 2VMDA 2YFUA 1MEC2 4LA2A 4ET7A 3M7AA 4EJRA 4NJ4A 4UAPA 2I07B 2YROA 4NVPA 3OGSA 5JUVA 1PMIA 4LO8A 1OHFA 4ZXKA 1J3RA 1ODNA 5CFDA 4FTEA 1MQTC 3TYJA 3BCWA 4QPYA 5BNQA 1UIJA 3DYMA 2LROA 3LEKA 4G9SB 3KT4A 1AR61 3HEIA 4WV8A 4XUQA 2A3XA 1WCKA 3S5AA 1K5JA 2MEV1 3URFA 4COWA 4Q0SA 1GP6A 1PO22 1PNGA 2H6CA 5A3OA 1LGNA 4BIFA 1W9FA 4C0HA 3P1IA 3FMGA 4AE2A 5EV7A 1MPXA 2WUHA 3DYPA 2IFRA 5DN2A 4EWDA 3ZSEA 4BQ4A 5A32B 4QDQA 3MIGA 5IVEA 5FWEA 4GH4C 2WAAA 3IT8A 3RWKX 4Z82A 3GZUC 2HWD1 1ZZCA 5T5JA 4TLFA 1K12A 3RJRA 1RXGA 3AKQA 1S0JA 3ZPOA 2D43A 5CEHA 1N1YA 4XQWA 5FLHA 1JW6A 5CYYA 1TE1B 3MFCA 1W6MA 3DEMA 4XMAA 4NRQA 1H4HA 4DRRA 4EQVA 5C33A 1G9BA 2P3JA 2JE7A 4ZPIA 4CUBA 1OF4A 2ZKNA 1CAWA 3BGAA 2BTVC 1GUIA 4CP2A 3Q8FA 2PHWA 3AKTA 3WNNA 2VZRA 2WKKA 3OPWA 1UCXA 2W68A 4YARA 2ZABA 1CD3G 1LEMA 1JODA 2XONA 4Y1ZA 1OLRA 4YVWA 1X9TA 3IPVA 3SEPA 1IGOA 4D0QA 1BK0A 4O9GA 3L9JT 5ANNA 5CU1A 5ACA3 5JOYA 4K40A 5F1RA 1S0DA 4LBQD 1VBE2 4R9DA 5F9TA 1PGL1 4WZCA 1CWPA 5F2WA 3W5NA 4Q4W3 3VD4A 4PF1A 5A3LA 1W8ZA 2Y60A 3QH6A 4XF3A 1MS5A 1BMV1 3KF5A 4YWAA 3VBFB 3WF3A 2ADEA 2VZ1A 4Q1RA 1UY2A 1B35A 4M00A 2VOVA 2WABA 3WV6A 1CAWB 3GJBA 2RS31 1NAEA 3CKHA 1W28A 1H8TC 2VMGA 1S2EA 3O1UA 4YVWB 3AFKA 4RHV3 3IPVB 4XC9A 4Q4W2 4O9EA 2YU2A 4JGZA 3USSA 5CFCB 4MGTA 5FPZA 2OA2A 1NE4A 1BHGA 5CADA 2VM9A 3SCFA 2VMCA 2Y33A 2UYBA 4Y5Z0 5A7QA 5CZKA 1QJY1 1F2NA 2WO2A 2CYFA 2WNOA 4HPKB 4EN9B 3LD8A 4JV4A 2GAUA 3GCWA 1VB2A 2X5IC 2B7YA 4LBLA 1E5RA 3MIEA 2FBEA 4LULA 5FXWA 2AC1A 5EZWA 1OA4A 1PVC1 3HPNA 1J59A 1B35B 1COV2 5JDBA 2IXKA 2K2SA 1LOEA 4NROA 4CU8A 3O7OA 3U11A 1VBB2 1V6KA 1MZ5A 2CL2A 5H9QA 1QJEA 1G9FA 2R071 3O1SA 4XFGA 2EIDA 1J1LA 2HWB3 3N9QA 1C8M3 1V70A 4Y4YA 5J98B 3ZPYA 1UZYA 2CWSA 1G86A 4ZS2A 5FJKA 5FZIA 3VZNA 4GWMA 2VNVA 4QKDA 5A3UA 4OI0A 2E63A 2RS11 3ATGA 4DUVA 1F35A 2IC1A 4BQWA 1UYZA 4CU6A 3BIEA 1VAKA 2C6SA 3WUDA 3SKJE 1KS5A 2VZQA 1BEV1 1Z78A 5BNNC 5FMCA 3W5MA 1HN1A 5CNAA 5D8AC 2E26A 1NY72 4P9XA 1SMVA 1CN1A 2HWB2 1F9KA 1VBE1 4OQ8A 1UYXA 4JTOA 3BOWA 5E8AA 2ZEZA 5F6KA 1MQTB 1EAH2 1HRI3 1CAXA 3A21A 3H0OA 2C26A 2H0BA 1RVF1 3K4ZA 5IK8A 3PHMA 1APNA 5FMDA 3S7IA 3MF9A 4AAXA 2GNTA 3E6BA 2R062 4R9CA 4D69A 3H42B 3M70A 2RV9A 3ZIWA 4Q1PA 2J42A 1J58A 3T3YA 2R041 4AL9A 5F3IA 2ARAA 4FP3A 4G4FA 4QQ2A 3VKOA 2FDKA 4XCAA 3LA7A 2WDBA 1AX2A 1CPNA 4PIXA 2VVEA 4LTAA 4P9LA 3C7FA 1LECA 3TNQA 3VDAA 3NJVA 3LB9A 5HI0A 2QQJA 3WHTA 4GH4B 2VOKA 1AYM3 1NKGA 4FPOB 1HRV2 4D7SA 5DAWA 3J7HA 1KFXL 1TNRA 3KCCA 1S2KA 1FMD1 3PVOA 5FCCA 2XQRA 1J83A 3I2HA 2C24A 2ZEXA 1W99A 4AFCA 4HXCA 4Y5SA 4EN8B 3HR9A 1HW5A 1IPJA 5C3PA 2WN3A 2YC0A 2WZPP 2IZWA 3MEPA 3WW2A 3K3NA 4NPMA 3WDYA 1RB8G 1B09A 1V00A 1YFXA 2A6ZA 3AJZA 1LKNA 3ETPA 5LY2A 3ZXKA 3K4DA 3S30A 4A41A 2TNFA 1AYM2 2EIGA 5E1RA 4QAWA 2CGOA 4UFHA 2ZCWA 1DQ4A 4NRMA 1W6OA 4QQPA 3VD7A 2VCAA 2PTMA 2C4XA 1STMA 2CDPA 2O0OA 2A70A 2YBKA 1JYTA 1DG6A 4R4ZA 5JXHA 1O5UA 1VB4A 1H1IA 3QD6A 4K9SA 1O7FA 1PHMA 1N3PA 1ZRDA 4KL1A 3A23A 1CZVA 3WZ1A 2FDJA 4FFFA 3WXPA 4XFFA 3CZUA 2E9QA 1RYYA 4XIKA 1W2OA
chains in the Genus database with same CATH topology
2WR9A 2JDKA 2CHHA 2JDPA 5A70A 3ZDVA 4UT5A 1W8FA 5A6YA 2BV4A 2WRAA 5A6XA 2BOJA 4AOCA 4CE8A 5A3OA 2JDUA 2BP6A 1W8HA 2JDMA 2XR4A 5HCHA 1OXCA 2BOIA 2JDHA 1OUXA 1OVPA 5A6QA 1UQXA 3DCQA 2JDNA 1OURA 1GZTA 2VUCA 1UZVA 2JDYA 5D2AA 1OUSA 2VUDA 5A6ZA 1OVSA 2VNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WR9 A;  2JDK A;  2CHH A;  2JDP A;  5A70 A;  3ZDV A;  4UT5 A;  1W8F A;  5A6Y A;  2BV4 A;  2WRA A;  5A6X A;  2BOJ A;  4AOC A;  4CE8 A;  5A3O A;  2JDU A;  2BP6 A;  1W8H A;  2JDM A;  2XR4 A;  5HCH A;  1OXC A;  2BOI A;  2JDH A;  1OUX A;  1OVP A;  5A6Q A;  1UQX A;  3DCQ A;  2JDN A;  1OUR A;  1GZT A;  2VUC A;  1UZV A;  2JDY A;  5D2A A;  1OUS A;  2VUD A;  5A6Z A;  1OVS A;  2VNV A; 
#chains in the Genus database with same CATH topology
 1GIC A;  1U5X A;  4CCC A;  5F32 A;  1PO1 1;  2C9K A;  4KG8 A;  5IAV A;  4DOU A;  2VBP A;  1DFQ A;  2Z42 A;  4JHT A;  5FY4 A;  5LBB A;  2A6V A;  1GKB A;  1I1E A;  3LIG A;  5A7S A;  2ZGK A;  1GP4 A;  4YW3 A;  1OQD A;  1M06 G;  1W6O B;  4LQR A;  3LQC A;  1OOP C;  3LDR A;  1H2M A;  4ITC A;  4AVT A;  2QJV A;  3O0X A;  3DL3 A;  2DBI A;  1CIY A;  3FUQ A;  3S57 A;  3ZYI B;  2R32 A;  4B4R A;  4R9A A;  5JPN B;  1C8N A;  4JDO A;  1AR9 3;  1RUF 1;  3NJX A;  4IET A;  2PAE A;  5A6Q A;  3WOG A;  2BNM A;  3FHQ A;  1U5I A;  4S2F A;  3VV1 A;  2BGC A;  2DDU A;  4XIL A;  3VBH B;  3ALQ A;  4BCU A;  1IG0 A;  5DZE A;  4LIT A;  2GNM A;  1PGS A;  2ADD A;  2YV8 A;  3FUO A;  5APA A;  4IGP A;  1KS4 A;  2HJI A;  1UZ0 A;  3DUI A;  1AL2 2;  5BNN A;  5F5Q A;  1VBA 1;  1JOB A;  3PUQ A;  1I5P A;  4GD4 A;  4AQS A;  3POG A;  2ZEY A;  5FPV A;  1Y9G A;  3I2G A;  4UWD A;  3K77 A;  4F3J A;  1ZRF A;  2QQM A;  2AH2 A;  3B9C A;  3INA A;  4AFD A;  4CXY A;  4FPH A;  1AR9 2;  2YXS A;  2BWA A;  3WG1 A;  3H8R A;  4RL7 A;  4YW6 A;  4A7Y A;  1XNB A;  2PHU A;  1K5M C;  2XL9 A;  3MLJ A;  3ZDS A;  2O8Q A;  3AVR A;  3DYO A;  4RD7 A;  5C9A C;  1YWK A;  1O3S A;  3TN9 3;  1RUN A;  3EYP A;  3T2T A;  3CBN A;  3JB4 C;  5L7O C;  1UIK A;  4YW2 A;  1Q3E A;  4HVR A;  3TEY A;  1MS4 A;  5BNN B;  1ONA A;  3Q8E A;  5D8A B;  5A7W B;  5KR7 A;  4C1W A;  2EAA A;  4Q4X 1;  2HLE A;  2WFP A;  3ILR A;  4RN5 A;  3ZXG A;  4CCO A;  2WWJ A;  2WFF 3;  3JZV A;  1R08 2;  4ZU4 A;  3RMY A;  1PIV 3;  2YDE A;  5I0U A;  5EJZ B;  1H6Y A;  3DPR A;  1X50 A;  3SIT A;  4DS0 A;  2D6M A;  2R1D A;  3WCS A;  1FOD 1;  4UFI A;  5CKQ A;  4JKK A;  2DTY A;  1IPS A;  4P08 A;  1NXM A;  3IN9 A;  3MIB A;  5T50 A;  4BZ4 A;  1QNW A;  2DUR A;  5IVJ A;  5KXE A;  1U12 A;  2RMU 2;  3AYD A;  2A5Z A;  2IWG B;  4GWI A;  4E4D X;  1PIV 2;  2D6P A;  3UK9 A;  3U07 A;  2RM2 2;  1XRU A;  2ZMN A;  2AGS A;  4FPY A;  3MUZ 1;  5LBC A;  4QX5 A;  2P2K A;  1WME A;  1CR7 A;  2J1U A;  2XJQ A;  3SXW A;  2GMP A;  4FFG A;  2XQX A;  3FBY A;  3M8L A;  3DKW A;  5EXO A;  5T54 A;  3F95 A;  5BNO C;  2TUN A;  3UL2 A;  4N8M A;  4NHM A;  3GBF A;  5FP4 A;  5G04 L;  5ISL A;  1WGP A;  4OUL A;  3VBH A;  2GMM A;  2W95 A;  1L7R A;  5HBA A;  1WCU A;  1DLC A;  1QXJ A;  4Y3O A;  1G8W A;  3FHA A;  3B7M A;  4LLF A;  1J3P A;  2HWC 3;  2VEC A;  1A34 A;  4FOQ A;  2KA3 A;  3UJQ A;  4KWU A;  1OOP A;  1HXS 3;  2Q8O A;  3PVB B;  5EP9 A;  2QBX A;  2PAK A;  4NAM A;  3OGR A;  5KC6 A;  4LBM A;  4DPN A;  3LOB A;  2WAO A;  2XJT A;  2YZ4 A;  5JPM B;  3PJY A;  2E6V A;  3MBW A;  4YFZ A;  1FX5 A;  4HZF A;  1LCL A;  2EIC A;  2A1X A;  3MW3 A;  2HWC 2;  4GMP 3;  1NQJ A;  2JEC A;  1N3Q A;  3NO8 A;  4IV3 A;  4GKY A;  1VRH 3;  2WLP A;  3GBG A;  3I54 A;  4GXL A;  3ZSJ A;  3VD5 A;  4Q4Y 2;  2G9Z A;  1KQR A;  2VPV A;  4BQ2 A;  4XAE A;  4E2S A;  1W3V A;  1D0H A;  5D21 A;  5GLV A;  3RI8 A;  4XBL A;  3WG4 A;  4FO9 A;  4ISR A;  4CDU C;  2J7M A;  1ZBE 3;  3U75 A;  5FKC A;  2LUW A;  4GB3 3;  1W9S A;  1OKQ A;  2E7Q A;  1OOP B;  2ENR A;  4WVV A;  4AG4 A;  1AXY A;  1AJK A;  2LM3 A;  1IS3 A;  1NLS A;  3D82 A;  2VNO A;  4HON A;  3JQW A;  4IV1 C;  2BQP A;  4IL7 A;  1DGR N;  2GC1 A;  1W8U A;  1IQA A;  1UPI A;  5C9A A;  3I2D A;  4QPG A;  2ZAH A;  1KD7 A;  3ZMO A;  3EB7 A;  5FMB A;  1G6N A;  2BYV E;  5L7O A;  2ARX A;  2E33 A;  1EPZ A;  1OBN A;  1ZBE 2;  3CHX A;  4MSV A;  4A45 A;  1Z7S 1;  1W6P A;  1AR8 3;  2RDS A;  3H8U A;  5BUV A;  2YGM A;  1OVS A;  1BJQ A;  3OBA A;  4OUM A;  4BIS A;  1DU3 D;  4BH9 A;  4JQR A;  3LSD A;  1ZZ8 A;  2PEL A;  4QM9 A;  2W1S A;  2WN2 A;  3AYA A;  2IXH A;  2AAC A;  4JDN A;  3WP5 A;  3WQ7 A;  3B5L B;  2BFU L;  3VHR A;  4OHY A;  1R1A 3;  5KHK A;  1YFW A;  3ZXJ A;  3OUH A;  1K42 A;  3MFA A;  5DXD A;  3T2O A;  3CEW A;  1K5M B;  4AR2 A;  4AXO A;  4MGI E;  3NST A;  2OT7 A;  2ZGN A;  3MID A;  2VZU A;  2W47 A;  4D6S A;  4DY5 A;  1KIT A;  4IEO A;  4E27 A;  4MXV A;  1UX7 A;  2YFZ A;  3E5X A;  4GMP 0;  4TN7 A;  5C9A B;  1AR8 2;  3B01 A;  1JMU B;  4IEY A;  1Q8Q A;  1WA4 A;  5L7O B;  2JDH A;  3T0A A;  5DUW A;  3MHZ A;  1VBD 3;  3KT7 A;  2OUH A;  4UW5 A;  2VZO A;  3MLL A;  5KHG A;  1W6P B;  3I97 A;  4RGK A;  4S2H A;  2JG8 C;  5HCA A;  1GQH A;  1R1A 2;  3WQB A;  4AVV A;  5IT6 A;  4XUN A;  5FXX A;  3MV0 1;  3ZOI A;  4YNI A;  5FV3 A;  4H3W A;  4GUL A;  1SDD B;  4AF9 A;  5I93 A;  3DN7 A;  2P34 A;  2SBA A;  1VBC 2;  4M3C E;  3WF2 A;  4BXS V;  5J48 A;  1ZZB A;  3I49 A;  1FV3 A;  1KXG A;  2D40 A;  3ZFE C;  1W6N A;  5E88 A;  4BME A;  3WD5 A;  4ES8 A;  4AW7 A;  1ENS A;  1I6X A;  2FCV A;  4RFR B;  5FZE A;  1GWL A;  3EBR A;  5IJR A;  3H1W A;  3JQX A;  3ECQ A;  3AKS A;  2OPW A;  1UKG A;  5HV0 A;  5DDJ 3;  2GN3 A;  4CXX A;  1BVP 1;  1JUH A;  2O1Q A;  1ZRE A;  2KM2 A;  4BB3 A;  3UET A;  3QH7 A;  1H1A A;  1JS9 A;  4H7L A;  4A42 A;  1CGP A;  1QF3 A;  1W0O A;  2X09 A;  2XKP A;  4LKS A;  1CQ9 A;  1XE8 A;  3J8F 2;  2WNU C;  2A6Y A;  2D98 A;  3MF6 A;  4NAO A;  4XDQ A;  3ABZ A;  3CF6 E;  2RS5 2;  1QU0 A;  2BRT A;  2WO1 A;  2WQ4 A;  3CZJ A;  2J1T A;  2P3K A;  4XZP A;  1WW6 A;  3HNB M;  3KWV A;  5BNO B;  2ILM A;  1FXZ A;  2OZJ A;  3IDB B;  4PDW C;  1YC6 1;  1SHW B;  4AFM A;  2ZX0 A;  4Z8B A;  2JIG A;  1S1A A;  1HJF A;  1S0I A;  1XNT A;  3PU3 A;  5A3W A;  4CUC A;  1IS6 A;  3GGL A;  3GBW A;  4Y4R A;  3GXU A;  1JXN A;  3AXD A;  1RUO A;  3Q8A A;  4WM7 C;  4CDU A;  5LBF A;  2F17 A;  5G05 L;  4AI8 A;  2EAL A;  3VL9 A;  1S0F A;  2WZR 3;  3LCP A;  5LA9 A;  5K0U A;  2R0H A;  2VQU A;  4XFA A;  1GU3 A;  2P6H A;  1DYK A;  4ZHN A;  1U5Y A;  1LHN A;  3HMY A;  4D3W A;  5FWJ A;  5E16 A;  5FYI A;  4JVA A;  2VG9 A;  2NMO A;  4LHL A;  1UY1 A;  5F6L B;  4CUG A;  5FLJ A;  2QZ2 A;  4CUA A;  3AL5 A;  3W58 A;  3WG3 A;  4CDQ C;  5HCH A;  1OKO A;  1XYN A;  4J1X A;  4JRA A;  4E8C A;  1SAC A;  2XUM A;  3JBG 2;  3GDB A;  4CDU B;  5KXB A;  4CEY A;  1S2B A;  1RUH 3;  4HSL A;  5D2A A;  4S2D A;  4XJZ A;  3MYX A;  5IAT A;  1RUD 3;  3I3M A;  5M0T A;  2XLG A;  4Z2A A;  1XPW A;  4HET A;  1YO8 A;  2VVD A;  4UT5 A;  5CFD C;  5T5O A;  4HL0 A;  3V56 A;  1D4M 2;  3CO2 A;  3B02 A;  4RQP A;  1ZM1 A;  3A22 A;  1C5I A;  5FUI A;  3OTF A;  3NQH A;  4CZS A;  4AQT A;  3NV2 A;  3C7O A;  1LOA A;  3NNJ A;  4N53 A;  5LA2 A;  2ZGS A;  3ES4 A;  2BPA 2;  4M01 A;  3V0B A;  3J8F 1;  4NWW A;  2WS9 1;  4PHZ A;  1ZBA 2;  3PUA A;  3POI A;  4CEY B;  4LBN A;  1NCR A;  1GZT A;  1REE A;  1O4Y A;  2Q0A A;  3X29 B;  4QU1 A;  4AI0 A;  2PHX A;  4BLI A;  5F39 A;  4H7M A;  4ASK A;  1BBT 2;  4O61 A;  2DCJ A;  3CL1 A;  2VJX A;  2Z5W A;  2D6N A;  2FDI A;  1VJ2 A;  2BU9 A;  4EE2 A;  4JTN A;  1QJX 3;  3N9M A;  2WSV A;  3TB0 A;  3THT A;  3MLK A;  2WII B;  3I2J A;  3I2K A;  4AI1 A;  2WBK A;  4MHU A;  4BM8 A;  3IAP A;  1RMU 2;  3ORJ A;  4XUO A;  2JG8 B;  3VBS C;  5GZG A;  1RUC 2;  4UW6 A;  3V0B B;  2JE9 A;  3MUY 1;  2HWE 1;  3AYC A;  1OVP A;  2JD9 A;  3L2Y A;  2XBO 3;  1LJ7 A;  3PIG A;  4OQ9 A;  3RMX A;  4LK7 A;  2X05 A;  3KQ4 B;  4C90 A;  5JMC A;  2PYT A;  1QJX 2;  2B5H A;  1DYP A;  1SLT A;  2P3Y A;  3ACG A;  3ZFE B;  4DQA A;  5CAZ A;  1ND2 A;  3PVN A;  3UES A;  1W9T A;  1WUV A;  2LTN A;  1Q8O A;  3JXS A;  5FP8 A;  2QUO A;  3TEX A;  2WZ8 A;  2VW1 A;  1ST8 A;  1AYN 2;  3OYW A;  4PDW A;  1YI7 A;  3VUO A;  2BUK A;  2X8K A;  2CAV A;  1CX1 A;  3O5S A;  2NQY A;  4LO6 B;  1KFU L;  2CDO A;  1YQC A;  2XBO 2;  4Q26 A;  3UKT A;  4WM7 A;  4CDW A;  4XF9 A;  3NRU A;  2HWD 3;  4F83 A;  1JUI A;  1CAV A;  3PUR A;  2BJS A;  3TEW A;  2EVX A;  4X6R B;  3JD7 2;  2RJL A;  3OY8 A;  1XND A;  4NOT A;  1AF9 A;  5KC5 A;  4LKF A;  3QBQ A;  1RUG 2;  2ATF A;  2WNU B;  5FQ0 B;  2IXI A;  1UOJ A;  5DUU A;  3GCX A;  4CYD A;  2VNG A;  2WR9 A;  5JXJ A;  4QD2 A;  1HX6 A;  3BUC A;  2Y6K A;  1IZ3 A;  2OYZ A;  4B7E A;  4JGZ C;  4NMI A;  2KXL A;  4ZZ8 A;  1DZQ A;  1ULD A;  4OUE A;  3W9A A;  4BMB A;  4PDW B;  2RHP A;  2RE9 A;  4HLT A;  3RZK A;  4Q4V 1;  3VBO C;  5GZD A;  1UU6 A;  3R4D B;  5JAX A;  2AZ5 A;  4P14 A;  4GAL A;  1PZ7 A;  3HOB A;  4L2N A;  5DUV A;  1UN1 A;  3T1M A;  4HN1 A;  1YCI A;  4WM7 B;  1OI6 A;  2OXB A;  4CDW B;  1SBF A;  1UOF A;  1W0N A;  1CAV B;  3ZM8 A;  2O14 A;  1PM4 A;  4HFS A;  1NYW A;  2DV9 A;  4W6X A;  3F2Z A;  1V0A A;  2P1B A;  2D44 A;  3VKN A;  4XYX A;  1GOG A;  2Y38 A;  3E1F 1;  1IKQ A;  1SQ4 A;  3ZYR A;  5AFE A;  1JZ2 A;  1AUY A;  2Z69 A;  3B94 A;  3D5O A;  4QX1 A;  5FDB A;  1LB2 A;  2CHH A;  4LKE A;  3RZM A;  1HIX A;  4JKM A;  1PGW 2;  4IE6 A;  1RMU 1;  4P00 B;  1UXX X;  1GAN A;  2RS3 3;  2WZE A;  3C3V A;  4O65 A;  4NRP A;  5J36 A;  1Q8S A;  1RIR A;  3SNM A;  4ERO A;  3ZYP A;  2I45 A;  3M1H A;  4CDQ B;  1XBF A;  4B29 A;  1H2N A;  2PLV 3;  3HNY M;  4OZX A;  1P8J A;  1FPN 3;  2BP6 A;  3SLI A;  1RHI 3;  1RIN A;  4XJ9 A;  3B00 A;  3THP A;  1TME 3;  4B3N A;  3ES1 A;  5GLZ A;  4HMZ A;  3BVC A;  4LHK A;  2YHJ A;  2CU5 A;  3H7Y A;  4EV0 A;  5FBJ A;  1AYN 1;  4KU7 A;  3T2P A;  1LUL A;  1RUI 3;  4C91 A;  4N9H A;  5FR3 A;  2ZMK A;  2QQU A;  3N7L A;  5CFD B;  3KQR A;  1PVC 3;  1QEX A;  2VTX A;  4YZ5 A;  1QH6 A;  2LW8 A;  2XML A;  2B8M A;  2PLV 2;  3PDQ A;  4H2A A;  2XKO A;  1FPN 2;  3C2U A;  3KCY A;  1RHI 2;  4LO5 B;  1RUE 1;  1DQ6 A;  1ND3 A;  1YEW A;  1IS4 A;  1GOH A;  3I3D A;  3KV4 A;  3P3P A;  1TME 2;  5H9S A;  3JD7 1;  3A4U A;  2CGN A;  3VBS A;  3HAG A;  4ZZ5 A;  1GV9 A;  4MOA A;  1ENQ A;  4A7Z A;  3WDU A;  2E53 A;  2ZEW A;  4IE7 A;  3ZKY A;  1RUJ 3;  2Y64 A;  5CKN A;  1DIW A;  1V6I A;  2RS1 3;  4FAH A;  4ASL A;  4J6G A;  3T09 A;  1V9U 3;  4QPI C;  5C3O A;  2C1F A;  4NE9 A;  3GZE A;  1LGB A;  4L97 A;  2OZ6 A;  4QXK A;  1TG7 A;  2XJU A;  3R05 A;  3BI3 A;  4X8P A;  1BEV 3;  2YC2 A;  5BYN A;  1GNZ A;  3E97 A;  5FZ7 A;  2H0V A;  5B4X A;  3ZDV A;  1EUU A;  5TSW A;  1QOO A;  4DIN B;  1TMF 1;  2Q1Z B;  5FYH A;  1JYV A;  3TAY A;  1DGR A;  3AXE A;  4P5Y A;  2NP0 A;  1MS3 A;  1W6M B;  2D6K A;  1MEC 1;  1RUJ 2;  1YQ6 A;  3VBS B;  4IEP A;  4FPF A;  3ZXE A;  3HQX A;  3DKQ A;  4IEX A;  4WVW A;  1KJL A;  2OX0 A;  5FRA A;  5L9B A;  1D7P M;  1E5H A;  5C6C A;  1QOS A;  1F15 A;  4PIY A;  5ACA 2;  2HKX A;  4XJW A;  2R04 3;  1BCX A;  3KF3 A;  5EQU A;  1UQX A;  3I2I A;  5JR7 B;  4AVB A;  2JDY A;  1DQ0 A;  1W05 A;  4IEW A;  4NID A;  4YG3 A;  5FYZ A;  2IXL A;  4IER A;  4O7X A;  4FCA A;  1PO2 1;  4IE4 A;  2GN7 A;  3I7D A;  4BYY A;  3VBO A;  4KQ7 A;  5JR2 A;  2P3I A;  4FBF A;  5F7U A;  1H1M A;  4H14 A;  3VBH C;  1O3T A;  2WWS A;  1HQW A;  1LR5 A;  4EWE A;  4P5H A;  3GZA A;  3H3L A;  2QDR A;  1FMD 3;  4RHV 2;  3I8T A;  5I0T A;  2YYO A;  2XPJ A;  3BN6 A;  2IVI B;  2P5B A;  3ITQ A;  1SLI A;  1T6B X;  2VMH A;  1AZD A;  4UW4 A;  1XE0 A;  4KG0 A;  5IFT A;  1VAV A;  1UKR A;  2VH9 A;  2W1Q A;  1IPK A;  4BQ3 A;  3P5B A;  4JGZ B;  5CVR A;  3IBM A;  3LFM A;  4RYD A;  4B1L A;  1UO9 A;  4XXP A;  4DXZ A;  5CG9 A;  3J26 N;  1MR5 A;  5CBL A;  1N3O A;  3VBO B;  4CCJ A;  2JB4 A;  3T0D A;  2JE8 A;  2R1B A;  5KHH A;  5DAV A;  3M3I A;  2HEW F;  4M0H A;  4ES9 A;  4RSU A;  1XOY A;  5F5C A;  1A6C A;  4GWJ A;  3OGV A;  5L19 A;  4B4P A;  1XJA A;  1WLD A;  2TEP A;  5IW0 A;  3LSE A;  4Q8L A;  4D6R A;  4FOV A;  3WX5 A;  4QQO A;  1CAU A;  4LT5 A;  1OMI A;  1VE0 A;  1C8M 2;  1TVG A;  1V6J A;  2GC0 A;  1SCS A;  1FAT A;  1OH4 A;  1OD3 A;  1PO1 3;  2I74 A;  5FZ4 A;  2RR1 3;  3ZYG A;  4Z2W A;  2LRP A;  3ST7 A;  4JGY A;  2PHT A;  1I9R A;  2W46 A;  1UZV A;  4MHR A;  2GDF A;  1SEF A;  3AP9 A;  5FPA A;  1JH5 A;  4NHX A;  2MHF A;  1G9A A;  4FT8 A;  1X9P A;  5FY1 A;  4EZ4 A;  2LAL A;  4TZD A;  2W92 A;  4WVM A;  2BBV A;  4D7Y A;  2BFU S;  3JB8 A;  1JBC A;  4TWT A;  1MZF A;  1DLL A;  1RUF 3;  5H9R A;  4RGA A;  2JDU A;  2RR1 2;  1S0C A;  2HEY F;  1DGW A;  3AC0 A;  4Q4W 1;  4QM8 A;  1CAU B;  1HRI 2;  3GHM A;  4LUK A;  1OLQ A;  4QPI A;  1DCS A;  4X8N A;  4XFC A;  4YRD A;  4EYU A;  4YZ2 A;  1W03 A;  3C8X A;  2IXC A;  3AJY A;  5FYC A;  5GZC A;  2Y6L A;  1CVN A;  2BER A;  4QXC A;  4CEW A;  1CAX B;  1VBA 3;  2GAL A;  2WWU A;  2JKB A;  4QU2 A;  3KD4 A;  4B7K A;  1W8O A;  1UY0 A;  4Y1V A;  3DPR C;  3WNX A;  5A6Z A;  5JSR A;  3KT1 A;  1DGL A;  3S5Q A;  3ASI A;  2V4A A;  1COV 1;  2ZPX A;  4MUV A;  3O1T A;  3VGI A;  3S0M A;  3CDZ B;  3G6J B;  5FO9 B;  4WVM B;  5FZ6 A;  4Q0Q A;  3CU7 A;  5FZ9 A;  3AMH A;  2FD8 A;  2WRA A;  1WA6 X;  3OCP A;  1VBB 1;  3FBM A;  3PL0 A;  4XE9 A;  5FZO A;  3VN4 A;  3FC0 A;  2WL1 A;  2RVA A;  5LAS A;  3D8C A;  2FDF A;  2W91 A;  1SBD A;  4QPI B;  1E5S A;  4LNV A;  2RG4 A;  1QQP 3;  2KR2 A;  1VIW B;  4AFA A;  3N9N A;  3PIJ A;  2JB8 A;  2ZGQ A;  4CCM A;  4D94 A;  1F4H A;  2BGO A;  2JX9 A;  4OI1 A;  4A4A A;  4JC1 A;  1V6N A;  3RDI A;  2RJ2 A;  2WO7 A;  1DF0 A;  4PCR A;  3CMG A;  4Q4X 3;  2AEY A;  3FWE A;  4NII A;  4URA A;  4AI2 A;  4XF0 A;  1O3R A;  2UYA A;  3J7N A;  3AVS A;  4CCE A;  1ZX5 A;  1NY7 1;  2GP3 A;  1LHV A;  1W8N A;  2I2S A;  2HWB 1;  1C8M 1;  1QQP 2;  2GNB A;  2VE1 A;  3N9P A;  4YLZ A;  5FJH A;  5FZO B;  4BQX A;  2QCS B;  1EAH 1;  5C3S A;  5LZ6 A;  2VGD A;  1OQE A;  1YJK A;  2B42 B;  4E4S A;  1LOG A;  1FT9 A;  3ZYF A;  1LU2 A;  2R06 1;  3POS A;  5B2G B;  2ZGM A;  4ATE A;  1QHD A;  4RR3 A;  4KMQ A;  4K7J A;  3H50 A;  3T2Q A;  1OLM E;  2YB7 A;  2VUC A;  1EV1 3;  4LOS A;  1R09 3;  4XQ4 A;  2DBN A;  3WT3 A;  1F31 A;  2VZV A;  2WT2 A;  3H8O A;  2DVG A;  3ME2 A;  3MO4 A;  1UU5 A;  2R7E B;  4Q0P A;  5IWF A;  4IV3 C;  4K6B A;  2ES3 A;  4XTM A;  5FZ3 A;  3U37 A;  5J37 A;  3LAG A;  4CDX C;  1W9W A;  4FAG A;  4UXA A;  3SH4 A;  1LED A;  3TEZ A;  4LOT A;  3PUH A;  2NZ9 A;  2WO3 A;  5LEJ A;  1PZ9 A;  3U4S A;  5I0S A;  1HRV 1;  3I3E A;  2WNE A;  1UOB A;  5FZK A;  5C8C A;  1RL3 A;  3RWN A;  4Y5T A;  2J1V A;  1W2U A;  2VC9 A;  4OZO A;  1EV1 2;  4LIU A;  1R09 2;  4Z1V A;  5I8Y A;  2WQZ C;  2JJ6 A;  5LWB A;  3H8X A;  4RR3 B;  3BAL A;  2WIN B;  1RC6 A;  2JG9 C;  3TOJ A;  4QPG C;  1LTE A;  4YZ1 A;  4JRL A;  4KWK A;  3KHC A;  3KCX A;  1YIP A;  2XLA A;  4XXA A;  4C1X A;  4HK9 A;  1AYM 1;  1AX1 A;  2EIB A;  1Q43 A;  4RGG A;  1VRB A;  1HB2 A;  2GME A;  5DUX A;  5HXM A;  1UY4 A;  4L92 A;  3CJI A;  1PK6 A;  1WW4 A;  1O4Z A;  2YBS A;  3FZ3 A;  1BYH A;  5FYY A;  3RZH A;  2W94 A;  2IFW A;  2AEN A;  5FKB A;  4FSJ A;  1JZ3 A;  2HWF 3;  1VAL A;  3GZT B;  1A3K A;  1OF3 A;  5E6H A;  4BDV B;  1OA3 A;  1XE7 A;  1XYO A;  3TN9 2;  3NNL A;  5GJ6 A;  3HJR A;  4AGG A;  1KJR A;  2Q30 A;  2XJV A;  3WG2 A;  3IM0 A;  1RJ8 A;  4OYU A;  2OVU A;  2E7A A;  4GZ9 A;  4Y1Y A;  1JI6 A;  2QE3 A;  4CVU A;  3ILN A;  1KDK A;  2VQT A;  1Y9M A;  4ZON A;  4R9B A;  2HWF 2;  3O0W A;  3J7M A;  4N7I A;  5L73 A;  2WFF 2;  2A3Y A;  4E9K A;  2XH6 A;  2XOM A;  2FQP A;  3VHN A;  1EY2 A;  3B3Q E;  1ENX A;  1HV0 A;  1LOF A;  2X10 A;  1MS1 A;  4KGQ A;  2QFE A;  4QX0 A;  1H2L A;  2DTW A;  3RS6 A;  5C7G A;  5I91 A;  3BU7 A;  2UY8 A;  4K8F A;  4L0P A;  3NVC A;  2OS2 A;  3DPR B;  1V6L A;  5EHD A;  3TBD A;  1AL2 1;  1H30 A;  3KV9 A;  1URX A;  2XGX A;  4FPE A;  4OHV A;  2G9G A;  2J1R A;  2P6C A;  4UFJ A;  4XEZ A;  4URT A;  4ZKT B;  4U36 A;  1CJD A;  4ORF A;  4ZXE A;  1OQ1 A;  4BA6 A;  3HD8 B;  1ZYB A;  5IVY A;  1AR9 1;  5BV6 A;  1R64 A;  2BVV A;  1MZ6 A;  4FTB A;  1QNY A;  5CB7 A;  3H3Z A;  1H9P A;  1LOD A;  4QPW A;  2JDZ A;  2XVL A;  4XF4 A;  1PX4 A;  3N7M A;  4XUT A;  1OFS A;  1X82 A;  4SBV A;  5HCF A;  3WQ0 A;  2PN5 A;  1LES A;  3OD0 A;  4UBG A;  4BWO A;  3H7J A;  3ZXA C;  4AEJ A;  1L7L A;  2PFW A;  2ZAC A;  1QXP A;  4JAA A;  1GFF 2;  4IDZ A;  1ZZ6 A;  4XUR A;  1XNC A;  1NE6 A;  4W65 A;  3O1V A;  3SHR A;  1ZA7 A;  5LEK A;  5DMY A;  1RGS A;  4DB5 A;  3RG0 A;  1LEN A;  2F6B A;  4A2U A;  4BHP A;  4CDX A;  3WW4 A;  1HXS 2;  5FTT C;  4HKO A;  1R08 1;  1MAC A;  1VAM A;  3TN9 1;  4XMI A;  3BU0 A;  2W3J A;  3ZFG A;  2J1A A;  5FXV A;  5F3E A;  1LNS A;  4QKN A;  1UF2 C;  3R0R A;  4XET A;  1DQ1 A;  1K3I A;  1AX0 A;  5K0U C;  1WW5 A;  3N7K A;  3FLP A;  3ZMN A;  2XLF A;  2JG9 A;  1VRH 2;  2VVF A;  3ETQ A;  3UYJ A;  4LK6 A;  4FPC A;  2CAU A;  4YW7 A;  3BKZ A;  1W2N A;  3EJK A;  4B8E A;  4LO4 B;  2RMU 1;  5FP3 A;  4IV3 B;  3NV1 A;  5C5U A;  1PIV 1;  5IVB A;  1F4A A;  4KNC A;  2RM2 1;  3NW4 A;  2VO5 A;  2XHK A;  3LEM A;  4GB3 2;  2EXI A;  4CDX B;  4GJZ A;  3KVA A;  4M4P A;  4EN6 B;  1D0G A;  3H9A A;  2WT1 A;  4KWL A;  3VDD A;  4CEY C;  4S2G A;  1UU4 A;  2CNA A;  2CSG A;  2ZGT A;  3BPS A;  2AUY A;  2B45 X;  1YQ5 A;  4FXG B;  2ZHL A;  2XUE A;  1MS8 A;  1NZI A;  3OUI A;  3BIW E;  3PU8 A;  3OOX A;  1C4R A;  2JG9 B;  1HLC A;  2YPD A;  4DMI A;  3J9S A;  1BVV A;  4QPG B;  4RQP C;  5ERL A;  1FAY A;  3U1X A;  4KBB A;  3ZN4 A;  4DUW A;  2P4E A;  4QT6 A;  2WA3 A;  1OUR A;  4QXB A;  4QXH A;  1RIT A;  5FPX A;  5IVF A;  3M3E A;  4N53 C;  4UFL A;  5ANQ A;  3UV9 A;  4A3X A;  1U0A A;  1XU2 A;  3VDD B;  4CRQ A;  3LZZ A;  3VDB A;  1NCR C;  2VW2 A;  2VOT A;  4HVO A;  4N43 C;  1QJU 3;  1AXK A;  3LGR A;  4RS5 C;  2ZOE B;  5FLI A;  2E31 A;  3I59 A;  2R6Q A;  3O12 A;  4OHZ A;  2HWC 1;  5AC9 3;  4N90 A;  3VB9 A;  1ASJ 3;  4KU8 A;  4CTE A;  1AR7 3;  2CGP A;  1VBD 2;  4Q4Y 1;  4DO0 A;  3BTX A;  1HXS 1;  5T55 A;  2DU1 A;  5FYV A;  4YGE A;  4W4Z A;  1ULG A;  3OEB A;  2GU9 A;  3LKJ A;  1XYP A;  3WVJ A;  5C8W A;  1GWK A;  1CJP A;  4K8R B;  4IEQ A;  5FZA A;  5GM0 A;  4BQ5 A;  1GMM A;  1JYC A;  1QJU 2;  1QWR A;  1JYX A;  1DYO A;  4R52 A;  1XB9 A;  1N47 A;  5FAX A;  3WY6 A;  2Y6J A;  1CIW A;  2ZHN A;  3WLU A;  5AC9 2;  3HVD A;  4Y1U A;  1F5F A;  1ASJ 2;  1JOJ A;  1VRH 1;  5KXD A;  3M3O A;  4PI0 A;  2OKX A;  1QJF A;  5I8T A;  5EPA A;  3PTY A;  4FVV A;  1UMI A;  1YUD A;  2YBP A;  4HOO A;  4EWA A;  5K8S A;  1W6N B;  1ND2 C;  1O59 A;  2WS9 3;  4XF1 A;  3WF0 A;  4YW1 A;  4CE8 A;  4K1Y A;  3WDX A;  4PLO A;  1ZBE 1;  4HAN A;  4PF5 A;  4GB3 1;  4WM8 C;  1WD3 A;  3VZM A;  5D1I A;  4IEZ A;  5DDJ 2;  3VKM A;  2XXZ A;  3CNA A;  2DFB A;  1UXZ A;  1SPP A;  5T3N A;  4PQQ A;  3UT0 A;  1PMJ X;  4JHZ A;  2W0X A;  4CDW C;  4U2A A;  1HQL A;  1JZ8 A;  3NKT A;  2WYS A;  2UY9 A;  2VZ3 A;  2E7T A;  3W20 A;  3VDC A;  1NA1 A;  2VZP A;  3POF A;  2Y26 A;  4DEQ A;  2JEN A;  2OQ6 A;  4P9Y A;  1H0B A;  2WA4 A;  1J3Q A;  1AR8 1;  4QGL A;  2ZXQ A;  1ULC A;  2AEZ A;  3AMQ A;  4MYE A;  1CX4 A;  5CG8 A;  3WUC A;  3K51 A;  3VZL A;  1SG3 A;  4HKL A;  3WHU A;  1O3Q A;  3ENR A;  2HYK A;  1Q56 A;  3EHK A;  3PVE A;  5J96 B;  1G7Y A;  4R8H A;  4ISQ A;  3AZY A;  1R1A 1;  1GOF A;  4Q5O A;  3HN3 A;  1SPP B;  4NWV A;  2W52 A;  3III A;  1VBC 1;  2WZR 2;  3PTR B;  1S4C A;  2EXH A;  2YMZ A;  4TTG A;  1HJG A;  2VOX A;  4MGS A;  1NA1 B;  2GC3 A;  1DQ5 A;  5FFO C;  3FHI B;  4XHB A;  4KH9 A;  1VBD 1;  5K0U B;  1CON A;  1GR3 A;  4BIO A;  4YG0 A;  4MLO A;  2PHF A;  2MPF A;  5C3R A;  2XJR A;  3BOP A;  4ZS3 A;  2KD7 A;  2YC4 A;  1PZ8 A;  1UNB A;  2NN8 A;  1POV 3;  4Z07 A;  3HT2 A;  1KGY A;  4OMC A;  5FPB A;  2CV6 A;  3A0K A;  3N36 A;  2IXJ A;  1CZT A;  5HV4 A;  1RUH 2;  4LBO A;  3FFZ A;  2ZX3 A;  1YQ8 A;  5FZC A;  3WF1 A;  3TNP B;  4TSV A;  5JSO A;  5FOJ B;  4I2O A;  1FNZ A;  1EP0 A;  1RUD 2;  5A3N A;  4YSF A;  4Q4V 3;  2VUL A;  2RS5 1;  4Y20 A;  1OPM A;  4GQ7 A;  1NCQ A;  1X36 A;  4N43 A;  3P6B A;  5FY9 A;  4HVQ A;  1TZO A;  3ZR5 A;  4FOY A;  4RS5 A;  3LPG A;  3KMH A;  1O5L A;  3NL1 A;  4HN0 A;  2Y0O A;  3DXT A;  3POB A;  2RDR A;  4I0B A;  3U10 A;  3KV5 A;  4EZH A;  3E5Q A;  3Q8B A;  3OB8 A;  2V4V A;  4ASM B;  1WMF A;  1VMJ A;  3EMR A;  3KZ4 C;  4RQP B;  3T4H B;  2JDA A;  3VZK A;  4CCN A;  4E2Q A;  4K3U A;  5C3Q A;  5LRS A;  1FNY A;  1ND3 C;  1I5Z A;  4PLM A;  4JKL A;  3P3N A;  3V0A A;  2JKX A;  4N53 B;  3U4X A;  2DU0 A;  2R30 A;  1YRZ A;  3MW4 A;  2NM1 A;  2PAM A;  4IXL A;  5FUN A;  5JWP A;  1PNF A;  3KB5 A;  3ZSK A;  3SH5 A;  4DNY A;  2F4P A;  1AR6 3;  3AYE A;  1NCR B;  5A1L A;  3LIH A;  1IKP A;  1NLQ A;  1SBE A;  4N43 B;  1T2X A;  4Y20 B;  4XAA A;  1ZRC A;  3OD4 A;  3MPP G;  2QQW A;  2MEV 3;  4RS5 B;  5FZ8 A;  2XWB B;  1IOA A;  2W2I A;  5GZE A;  3KM5 A;  4M3C F;  4WM8 A;  4XTP A;  4AHX A;  4QKF A;  1POV 0;  2Q4S A;  2A6W A;  2G19 A;  3ZXF A;  4I0A A;  4K1Z A;  3JBG 1;  4AAP A;  2K0G A;  1DP0 A;  2QQN A;  3AKR A;  1XNK A;  1AR6 2;  3POW A;  4HSJ A;  5FPU A;  4AHZ A;  3S7E A;  1MS0 A;  2GH8 A;  3OF1 A;  4MO3 M;  2EA7 A;  1OSG A;  2MEV 2;  4C0B A;  2XL7 A;  3DEC A;  2DUP A;  1UWW A;  4AHW A;  2HBU A;  2ZA9 A;  4UFM A;  5AVA A;  1D4M 1;  2JD4 A;  2PHD A;  3UGF A;  1GSL A;  3OGG A;  3SCH A;  4SLI A;  1KRI A;  3B69 A;  1UZW A;  4HBN A;  2XJS A;  1ND2 B;  4MX3 A;  4P02 B;  3H1M A;  1L7Q A;  1TEI A;  2Y34 A;  2ZGU A;  3FL7 A;  2FCT A;  4M4R A;  4WM8 B;  5AVP A;  1RUH 1;  5GLT A;  5A7P A;  3HQU A;  4CCK A;  4MVT A;  1YFY A;  5DAB A;  3OYW B;  2WNV A;  4AQ2 A;  4CXW A;  4AED A;  1S0B A;  2HWD 2;  2R49 A;  1YIF A;  1ZBA 1;  5DPN A;  1QMJ A;  3K3O A;  3ROU A;  4DXS A;  4GKX A;  3ON7 A;  3IKW A;  4LMF A;  3USU A;  3NJZ A;  2BVB A;  1YNA A;  2ZML A;  4FFH A;  3VHO A;  3VKF C;  1BBT 1;  1W2A X;  3FX3 A;  3T1L A;  4XQD A;  2D6L X;  3OY8 B;  3VD3 A;  2VBB A;  2VY0 A;  2B9V A;  3Q8C A;  1MEC 3;  3FLR A;  4AVA A;  5T5P A;  1NT0 A;  2Z2S B;  4XIO A;  3BOD A;  3O14 A;  1BKZ A;  1LHW A;  4ZU7 A;  5A70 A;  5JCT A;  2WNV B;  1RUC 1;  5B4N A;  4AED B;  5JI7 A;  3D3A A;  3BPZ A;  3LFI A;  3NNG A;  5JZG A;  1PGL 2;  1ULO A;  5FP7 A;  1D2S A;  4QHO A;  4A6S A;  1SZB A;  3IAQ A;  1HV1 A;  3USU B;  3A7Q A;  4AEM A;  1XNA A;  1BMV 2;  4FOW A;  1QJX 1;  1JZ4 A;  4I01 A;  1PO2 3;  4OLL A;  1HB3 A;  1GNY A;  4CU9 A;  1KDM A;  5A32 A;  4L8Q A;  3AL6 A;  4NHL A;  4V1P A;  4Y22 A;  1W04 A;  2B39 A;  1QJY 3;  4W50 A;  2RS3 2;  3WNL A;  5FK7 A;  1Y9Q A;  3ZVX A;  4K21 A;  5F8P A;  5GAL A;  1DBN A;  4JGY C;  2XVG A;  5A3P A;  3E6D A;  2XBO 1;  5FIX A;  3RGB A;  1QJZ A;  1W8F A;  3CIH A;  4J1W A;  4AI9 A;  4CPB A;  4DEV A;  4XUP A;  1DZR A;  5I8S A;  5JZG B;  1C1L A;  1JHJ A;  1YYN A;  4JQT A;  1OT5 A;  2R07 3;  5JOW A;  4Q2F A;  1I3H A;  1RUG 1;  2PHL A;  1QJY 2;  3RI9 A;  3WDT A;  5IK7 A;  2WJS A;  2VNR A;  3I3B A;  1RUI 2;  1SLC A;  2ARE A;  3MIH A;  4I3P A;  4NHK A;  3WW3 A;  1XSQ A;  4PLN A;  1PVC 2;  5IK5 A;  2ZX4 A;  1NUK A;  4Y22 B;  3UGG A;  1JHN A;  1NOV A;  3OBZ A;  3IDC B;  4IUG A;  3ZX7 A;  2A6X A;  2VW0 A;  4XFB A;  3ACF A;  5SV8 A;  4CEW C;  2DF7 A;  3VBU C;  3ZO0 B;  2W5F A;  1SCR A;  2Y0I A;  3MIC A;  2W39 A;  2R07 2;  2Z4F A;  4YM1 A;  1VBE 3;  3OSD A;  5FZB A;  1ND3 B;  1QH7 A;  3WQ1 A;  3BTY A;  1N1T A;  1SFP A;  3VBF A;  4BXF A;  1OD5 A;  3JCI A;  5GKA C;  4AEK A;  2RS1 2;  5LA0 A;  1S55 A;  1RVF 3;  1V9U 2;  4XCB A;  1JU4 A;  4YGB A;  3N3H A;  5FZL A;  1NXD 1;  1Y43 B;  2XVK A;  4XBN A;  5LBE A;  3IIA A;  1BEV 2;  4MGQ A;  1PGW 1;  3WDV A;  1LAJ A;  2BGP A;  3HBZ A;  5CFC A;  2NLR A;  1BLZ A;  4Q0U A;  4XFH A;  1JZ7 A;  2FHR A;  4QGM A;  3POY A;  5KHI A;  1GLH A;  1PMH X;  2ZX2 A;  4PJY A;  4AHY A;  4OMD A;  1V6M A;  3IMN A;  2B46 X;  1SLB A;  2GSY A;  2BW8 A;  1PX3 A;  4Q8K A;  2Q5T A;  3GYD A;  4X6Q B;  4HPK A;  1RED A;  1RVF 2;  5FZ0 A;  3RZL A;  3MZH A;  4C8D A;  1BK1 A;  4P9J A;  4BQY A;  1UPS A;  4FTS A;  2DVB A;  2QZ3 A;  4ZY9 A;  1RTV A;  2IUW A;  4B4Q A;  3CLP A;  3MGU A;  2R04 2;  4NIA A;  2V73 A;  4LBK A;  5JIA A;  2ZGO A;  2Q8C A;  4F7Z A;  4XJ8 A;  1T6G C;  4FI9 A;  3T08 A;  1COV 3;  1G9D A;  2BBA A;  3D0J A;  4YVS C;  2W1U A;  2PLV 1;  2VCM A;  2ZS6 B;  3MW2 A;  4LBQ A;  4LLO A;  1FPN 1;  1RHI 1;  4CP0 A;  2WC2 A;  2VCB A;  4H55 A;  3OGJ A;  1VBB 3;  4QQL A;  4W6W A;  1VLN A;  1TME 1;  4R4X A;  1YJL A;  3PLQ A;  4RR3 C;  1WCQ A;  1W90 A;  1X8E A;  4I02 A;  4AVS A;  2V5D A;  1EYB A;  1W06 A;  3R4S A;  4E4H A;  5LB6 A;  3RSJ A;  1BZW A;  3POJ A;  1RUI 1;  1FMD 2;  3HN1 A;  1YQ2 A;  2OW4 A;  4P9I A;  2FZ2 A;  3I2O A;  2R0F A;  3ELN A;  3OUJ A;  4HG6 B;  2ORX A;  4MG2 A;  3WDW A;  1QGL A;  3LEG A;  4A6O A;  1UOG A;  4Q0V A;  1AHS A;  2Y6H A;  4LIV A;  2B9U A;  2XR4 A;  3IMM A;  4RA0 A;  1MQT A;  5EWS A;  5FYM A;  5C8C C;  1ODM A;  4LBQ B;  4E8D A;  5F3C A;  1QY4 A;  2FCU A;  3PME A;  3WW1 A;  4AK3 A;  5ABJ C;  5KHJ A;  2VMI A;  3WEZ A;  1ZVF A;  1ULP A;  5JXG A;  4IGQ A;  3WP4 A;  2VCC A;  1EAH 3;  1RUJ 1;  3T0B A;  2DCK A;  4DRV A;  4FP2 A;  4CCL A;  3NV3 A;  1GZW A;  1V9U 1;  1BQP A;  4I3G A;  2HYX A;  4QHZ A;  4NIG A;  2DVA A;  1D2Q A;  2R06 3;  1SFY A;  1E5I A;  1W8W A;  4P9G A;  1US2 A;  5ACA 1;  1HKD A;  4ONU A;  3C7G A;  4LOR A;  5EYX A;  1VMH A;  4AOC A;  1Q5O A;  3CJI C;  3PMS A;  1D4V B;  1PK6 C;  4LUM A;  4Y24 A;  1PO1 2;  4L11 A;  1M4W A;  4XPV A;  5KXC A;  3D6E A;  3R6S A;  3UNP A;  2Y6F A;  2ZGR A;  5F37 A;  4QX7 A;  2BDR A;  4GH4 A;  2RDN A;  5L9V A;  1GZC A;  1FI2 A;  3UGH A;  4COU A;  5A1F A;  3MI8 A;  1QDO A;  4JGY B;  3VBU A;  4DXR A;  2ET1 A;  4A3Z A;  4LE4 A;  2AR6 A;  1HRV 3;  3FN9 A;  4MGY E;  1UMH A;  4BPZ A;  4UF0 A;  1GZW B;  1C3H A;  1TQ5 A;  3LE0 A;  1RUF 2;  4RHV 1;  4XBQ A;  1FYU A;  2QQP A;  1UY3 A;  2EIE A;  3IZO A;  4M3C A;  4YW4 A;  3ACL A;  3ZYH A;  5FPL A;  1MS9 A;  2BNN A;  2BV4 A;  1J1T A;  4FQZ A;  3N35 A;  2J1S A;  2A73 B;  3SKV A;  3G7D A;  5K4L A;  4P9W A;  5HCB A;  5DZG A;  3A0N A;  1VBA 2;  4IE0 A;  5LA1 A;  4LA3 A;  4NHY A;  2ZTN A;  3ZN5 A;  1Y3T A;  1LOF C;  2TBV A;  1GQP A;  3LWC A;  2OPK A;  4NPL A;  1OUX A;  1U5Z A;  1UX6 A;  3IB3 A;  3QCW A;  3MIF A;  4CEW B;  3VBU B;  2JDN A;  4KWJ A;  4IE5 A;  4TLG A;  2DVD A;  4XOG A;  2VME A;  1UD1 A;  1ZRR A;  3K46 A;  4UF0 B;  3DV8 A;  3Q9O A;  5FY5 A;  4A44 A;  2Q1M A;  4Y26 A;  4I0W B;  2E32 A;  1JZ6 A;  1Y7B A;  1SLL A;  4M3C B;  4YGC A;  1QOT A;  2QVS B;  4LEJ A;  5GLU A;  3AFG A;  3I2F A;  4AVC A;  2K9Z A;  4OI4 A;  2VMF A;  4GIQ A;  1H8T A;  3M3Q A;  5FUP A;  2BZD A;  4WZF A;  4L99 A;  4ARX A;  1UYP A;  2N7G A;  3RYR A;  2WQ8 A;  3IWZ A;  2F4L A;  4YVS A;  1FOD 3;  2ZZQ A;  5JMO A;  1HB1 A;  2EXK A;  4XJA A;  3U0Z A;  3NKG A;  1KEX A;  4Q4X 2;  5KWR A;  3ACI A;  4HT1 T;  2RJK A;  4ATF A;  1WLC A;  3TRS B;  5KBF A;  3V65 A;  4COZ A;  4I30 A;  4Q27 A;  2ARC A;  4XFI A;  3W59 A;  3LDB A;  4QWN A;  5JOX A;  3AB0 A;  3AMM A;  2X5I A;  2RR1 1;  5DAX A;  5I0R A;  4ARY A;  3OBR A;  1HRI 1;  4NR1 A;  1HQN A;  1NG0 A;  1FOD 2;  3K2O A;  4FPG A;  4NPR A;  2CWM A;  3C7E A;  3L2H A;  5GZF A;  1YFU A;  5A6Y A;  5IFP A;  1H8T B;  1K45 A;  2UWB A;  5EYY A;  1H9W A;  3AZX A;  2BOJ A;  5SV5 A;  5J7M A;  2ARB A;  1AL2 3;  1JYI A;  1VPH A;  3AMP A;  3AX4 A;  4YVS B;  3PNA A;  1AVB A;  4XJU A;  5DAP A;  3ZFG C;  4MXW A;  4HK8 A;  5ABJ A;  3FFQ A;  2C5D A;  4MH0 E;  1LGC A;  3HT1 A;  2D5F A;  4DUX A;  3WNP A;  1WCD J;  5HPO A;  2OII A;  1AL0 G;  1QDC A;  2X29 A;  1OPO A;  4YM0 A;  3NNM A;  2VR4 A;  2K46 A;  3WNM A;  2J22 A;  4CSW A;  2VU9 A;  4LBJ A;  2X5I B;  5F5A A;  2JDK A;  4LKD A;  2QNK A;  3NWK A;  3GHN A;  2JIJ A;  5JSP A;  1O6U A;  2Q1F A;  5D8A A;  2Q8D A;  1YI9 A;  5A7O A;  5A7W A;  3RZZ A;  2D93 A;  4QX8 A;  3JUU A;  4LE3 A;  2QKD A;  5IHR A;  1WD4 A;  2IVJ A;  4NN0 A;  3DGT A;  3RNS A;  1LHU A;  3VDD C;  1RJ7 A;  4YM2 A;  5LY1 A;  5C8C B;  4JDM A;  1GP5 A;  4MXW B;  2PXJ A;  1UYY A;  4MZU A;  5ABJ B;  3ZR6 A;  2VZT A;  4I09 A;  4OI2 A;  1R08 3;  1W39 A;  1NLR A;  3T30 A;  3J7L A;  1LOB A;  1X33 A;  1QQP 1;  1WKY A;  3RJ2 X;  5K9Y A;  1WBF A;  3NMB A;  3WNO A;  2UWC A;  5LRR A;  2W87 A;  2P37 A;  4LPL A;  2Y8K A;  1YLL A;  3CJI B;  5F5I A;  1PK6 B;  3CQO A;  3HQR A;  3DF0 A;  3WIN E;  1ZZ7 A;  2JXA A;  2A3W A;  5JLV A;  1S0E A;  1ZZ9 A;  2V09 A;  2QQV A;  3EXU A;  4COY A;  2EF6 A;  2RMU 3;  3OJB A;  5FO7 B;  5T52 A;  5FYB A;  5LK7 B;  3AM2 A;  1MZE A;  2RM2 3;  1Z7S 3;  1EPW A;  4L9B A;  4MV2 A;  4J25 A;  4BLJ A;  1GYK A;  1XSR A;  3RYK A;  2D3R A;  1ULE A;  3DXU A;  2D3S A;  1E57 A;  3ZYB A;  3ZXL A;  3DCQ A;  2A75 A;  3QAC A;  4LJH A;  2DUQ A;  3D4K A;  4UFK A;  2QQO A;  4PI2 A;  3OG2 A;  1OUS A;  1XXN A;  3IDA A;  3NAP C;  4EN7 B;  4AQ6 A;  4TYS A;  1V6O A;  4OHW A;  3WCR A;  5J09 A;  2VXR A;  3AK0 A;  4W8J A;  1WWY A;  1SLA A;  2FMD A;  1EV1 1;  3EO6 A;  1R09 1;  4CP1 A;  1CPM A;  1W6Q A;  1Z7S 2;  2R16 A;  2NYY A;  5BXX A;  2QQK A;  3K4A A;  2ZGL A;  1EUT A;  2XJP A;  3W21 A;  1REF A;  3K48 A;  4B1M A;  2ETE A;  1HB4 A;  2UWA A;  2VTF A;  2X53 S;  5FRE A;  3J4U H;  1Q8P A;  5IAX A;  1LU1 A;  3E5U A;  2VTX J;  2CTV A;  5J3U A;  2VBD A;  1JN2 P;  3WP6 A;  2O8O A;  3VL8 A;  3LEI A;  4BE3 A;  4Z92 B;  2NMN A;  1GZ9 A;  4CP9 A;  5IVV A;  3FJS A;  5A3T A;  4YGD A;  3C7H A;  3THC A;  1UMZ A;  1W9Y A;  3KVB A;  3BB6 A;  4Q4Y 3;  3WP3 A;  2ZZJ A;  1W6Q B;  1NX9 A;  2ID4 A;  4OCT A;  5FMO S;  3ZKU A;  3AZV A;  1NA1 C;  2HH9 A;  5LAT A;  5EJ1 B;  5A6X A;  2LS6 A;  1HN0 A;  3RYP A;  1POQ A;  1BXH A;  2JDM A;  4QGN A;  2VL4 A;  3FE5 A;  1CES A;  1N1S A;  5FYT A;  4GAZ A;  5F2S A;  3BTZ A;  1DDL A;  4DXT A;  3ACH A;  1OC1 A;  4PBO A;  1OXC A;  1Y4W A;  4IQP A;  4ZU5 A;  3E6C C;  2XG3 A;  2HWF 1;  1IQD C;  1W2T A;  2WFF 1;  5LK5 A;  3ZYJ B;  4CP9 B;  4NIH A;  3ZFF C;  2ZBJ A;  5C70 A;  5FXZ A;  3WSO A;  3AMN A;  4IEU A;  4V2W A;  2DWR A;  4BU2 A;  3H3U A;  1OA2 A;  2XB6 C;  2BWC A;  2DCY A;  3H1Y A;  5DQ0 A;  2VXJ A;  5BPX A;  4LO7 A;  3RVH A;  3ZFG B;  4XW3 A;  4UOJ A;  4YW5 A;  3VKL A;  2PMW B;  1K5M A;  5DG1 A;  4YPJ A;  1ULF A;  1MVQ A;  2A7A A;  4QQH A;  1LOC A;  5C4W C;  2ERF A;  4MET A;  5FY8 A;  1AXZ A;  5FZF A;  2XDV A;  4QMA A;  2QDN A;  4IEV A;  4XDO A;  4YM3 A;  2BOI A;  4E2G A;  2JIC A;  2ZJC A;  3O1P A;  2WYF A;  3LOI A;  1WCS A;  5FY7 A;  5K7P A;  1XU1 A;  4KGG A;  5EIY B;  5L36 A;  3TWI A;  3SMH A;  4RFT 0;  4UBH A;  3ILF A;  5FP9 A;  2DFC A;  2HBT A;  3VBR C;  1ALY A;  1CZS A;  1W0P A;  1Z0H A;  2QQL A;  3SIS A;  2MNG A;  1WW7 A;  1W3X A;  1NCQ C;  2PHR A;  4QB6 A;  3R4U A;  3HNM A;  4Y1X A;  1XQN A;  5C5T A;  3ZSL A;  5IUQ A;  2C9A A;  2V5Y A;  4QX3 A;  1VBC 3;  2ORZ A;  4D8M A;  2NPI A;  3M3C A;  2G1M A;  4JX0 A;  3PUS A;  4JZR A;  3AP7 A;  1A8D A;  1A8M A;  1J84 A;  3QOP A;  4QB2 A;  4K20 A;  1TNF A;  5AFB A;  2WT0 A;  3S6P A;  3VZO A;  5A7N A;  1WLT A;  1UZZ A;  3NAP A;  4GJY A;  3OEA A;  1IG3 A;  3NV4 A;  3ZXD A;  3JU9 A;  3LF7 A;  5FY0 A;  1H6X A;  3GNE A;  2J1E A;  2YY1 A;  2DVF A;  1NQD A;  4QKB A;  3RQ0 A;  4A7K A;  5I0D A;  4GMP 1;  3APB A;  3KGZ A;  4UW3 A;  2D3P A;  5DAQ A;  2EXJ A;  1AR7 2;  1XC6 A;  1FV2 A;  2DYC A;  2GND A;  1ZRI A;  4EN0 A;  1SDW A;  1C57 A;  3I59 B;  1L3J A;  4DIQ A;  3MV1 1;  3EQE A;  3J8F 3;  3O1O A;  5BNO A;  3I3Q A;  2XWJ B;  5FYS A;  1RXF A;  3RFR A;  2YU1 A;  3UKV A;  2RS5 3;  1G9C A;  5H9P A;  3HBK A;  1X7N A;  5JOZ A;  4MGK E;  2PA7 A;  3WF4 A;  3NAP B;  2Y6G A;  4Y33 A;  5DZF A;  2EAK A;  4XAB A;  3CJX A;  3M4F A;  3U14 A;  4FPL A;  1F5J A;  4JCK A;  4PBP A;  3ZSM A;  1Q8V A;  2VUD A;  3K75 B;  1DGW X;  1LHO A;  5BNP C;  4N7U A;  3AP5 A;  3SCG A;  2ZHM A;  2WS9 2;  3N4M A;  4WBB A;  2E51 A;  2VUJ A;  2G4I A;  2VUA A;  3O1M A;  4XZU G;  4BQ1 A;  2VQ0 A;  5JXI A;  5FZM A;  2D7F A;  2V72 A;  3BTA A;  3LDK A;  2ZAA A;  1X8M A;  1ZNP A;  2HWE 3;  1A78 A;  5J1X A;  3RPQ A;  3VZJ A;  1IHM A;  3D0S A;  4DFS A;  4MAD A;  2WNV C;  4AED C;  3ZFF A;  4AWD A;  4BOW A;  5C71 A;  2QQI A;  2PQS A;  5FOB B;  1JOP A;  3GAL A;  1GBG A;  3RZG A;  4KBZ A;  2DCT A;  2Z79 A;  3B9I A;  3M2M A;  1GNH A;  1DQ2 A;  5HXV A;  4N9I A;  3JBG 3;  3FLT A;  1VP6 A;  4YZ4 A;  3UKN A;  4CCD A;  2JDP A;  3GJA A;  3GF6 A;  2HWE 2;  2FMY A;  4COV A;  3KGL A;  4IV1 A;  3NNF A;  4WVZ A;  3POE A;  2ET7 A;  5C4W A;  5LCW L;  2WSU A;  4FXK B;  5FK8 A;  4DY3 A;  1PM7 A;  4W6Y A;  2YGL A;  1JTZ X;  2D6O X;  4FPJ A;  4CU7 A;  2ZKL A;  2B4K A;  4LHS A;  4DZG A;  3MDP A;  1JYN A;  3O0V A;  5A1A A;  3RZJ A;  1UW8 A;  5IYY A;  1D4M 3;  1QJU 1;  1US3 A;  1VR3 A;  2YPJ A;  1DZT A;  1ENR A;  3AP4 A;  4PQ9 A;  5FZH A;  3ZFF B;  1WZX A;  4LHN A;  2AYH A;  1YXW A;  3B93 A;  5AC9 1;  5JZG C;  4QX2 A;  3ZIX A;  4AI3 A;  3SC7 X;  2QTW B;  3LA2 A;  2CY6 A;  1GWM A;  1ASJ 1;  2GP5 A;  3WNK A;  4QDS A;  4Q29 A;  1AR7 1;  2OQ7 A;  2HEV F;  2P17 A;  4LXL A;  4M0N A;  3VBR A;  1WLW A;  3OPT A;  2VAU A;  4LR4 A;  4BK4 A;  4OHX A;  1ZBA 3;  2W1W A;  1PVX A;  5A3M A;  3I4I A;  4XAC A;  5F3G A;  4IV1 B;  5DDJ 1;  4OFG A;  4UYB A;  5EJ3 A;  4BJ0 A;  3NJY A;  5FZG A;  5C4W B;  3ZN6 A;  1JYW A;  1UL9 A;  1BBT 3;  5CIS A;  1SFN A;  1C1F A;  1O91 A;  3N9L A;  3N9O A;  2A71 A;  4UI9 L;  4FFI A;  3MPB A;  4CA9 A;  5JI9 A;  1ACC A;  2YG0 A;  4OUS A;  1W8H A;  3VHP A;  5E89 A;  2BEO A;  2JG8 A;  2PQQ A;  1F8V A;  3HWJ A;  5CKM A;  2FZ1 A;  3PJQ A;  5FZ1 A;  4Q4V 2;  1QXR A;  2D97 A;  2G9F A;  2ZX1 A;  2FDH A;  1JZ5 A;  2GZW A;  1LRH A;  4MGZ E;  5IK4 A;  3LA3 A;  5LW9 A;  2GC2 A;  2UU8 A;  1C28 A;  1RMU 3;  3VBR B;  5JVV A;  4AGR A;  1JU3 A;  1RUC 3;  3HIF A;  1DHK B;  3KLS A;  4BK5 A;  1R1Z A;  4YZ3 A;  4GWN A;  3SH3 A;  1NCQ B;  3O1R A;  3ZFE A;  1H4G A;  4FPK A;  4XDP A;  4PIZ A;  5IVC A;  5JIU A;  1YHF A;  2JWP A;  4OVE A;  1UAI A;  5A80 A;  4XHX A;  1WMX A;  5T5L A;  3ZLI A;  5CIR A;  3KV6 A;  4YYO A;  3ZN6 B;  3OBT A;  5A33 A;  3BYW A;  5FO8 B;  4D7T A;  2WZR 1;  1WBL A;  3KHB A;  3KSC A;  2YUE A;  1QIQ A;  1AYN 3;  2JEM A;  4AYU A;  1IS5 A;  1OFN A;  4IND A;  3VBF C;  5FBZ A;  3V0A B;  3AP6 A;  5EFU A;  3AKP A;  3LPF A;  4IGO A;  3VD9 A;  4PT6 A;  3T4V A;  2DCZ A;  1N1V A;  4AGV A;  4AZZ A;  4NUB A;  5FYU A;  5L9R A;  5BNP A;  1RUE 3;  2WNU A;  5FQ0 A;  4YG6 A;  4FQ4 A;  2SLI A;  1H2K A;  1MVE A;  4QDR A;  3JD7 3;  2L9L A;  4YVW C;  2H6B A;  1AJO A;  4YFW A;  3V64 A;  1RUG 3;  5CFC C;  2XHN A;  3AZZ A;  5FMO L;  5GLW A;  2VQA A;  3GM8 A;  5A33 B;  4D6Q A;  2DUO A;  3RRD A;  1O8P A;  2D5H A;  4NO4 A;  3QLQ A;  2VOW A;  3SEE A;  1RUD 1;  1S0G A;  1O4T A;  2OUJ A;  2GH2 A;  4G3Y C;  1C5H A;  4TXW A;  3PUI A;  4AFB A;  5FZD A;  4QHB A;  1RUE 2;  1GQG A;  1QKQ A;  3IDE A;  5DG2 A;  2ZHK A;  3KS7 A;  1B35 C;  2FDG A;  1WMD A;  2BNO A;  5BNP B;  1POV 1;  3VLB B;  3OPZ A;  1TMF 3;  4IW3 A;  1OLM A;  4HKW A;  1OH3 A;  4GA9 A;  3UJO A;  2C0Z A;  4E4Z A;  1O8S A;  2ZGP A;  3THD A;  2UUR A;  2VD7 A;  2VZS A;  1W8T A;  3AZW A;  1HDK A;  2W08 A;  4KI5 M;  2WLQ A;  2Q8E A;  1ZA4 A;  2RDQ A;  4CDQ A;  1NZC A;  5CA6 A;  3N7J A;  1VMF A;  4V2V A;  1H8V A;  3U78 A;  2W9X A;  4XVH A;  4F8A A;  4IES A;  4CPB D;  4QB1 A;  3SQO A;  5BY5 A;  1TMF 2;  3WR0 A;  2VMD A;  2YFU A;  1MEC 2;  4LA2 A;  4ET7 A;  3M7A A;  4EJR A;  4NJ4 A;  4UAP A;  2I07 B;  2YRO A;  4NVP A;  3OGS A;  5JUV A;  1PMI A;  4LO8 A;  1OHF A;  4ZXK A;  1J3R A;  1ODN A;  5CFD A;  4FTE A;  1MQT C;  3TYJ A;  3BCW A;  4QPY A;  5BNQ A;  1UIJ A;  3DYM A;  2LRO A;  3LEK A;  4G9S B;  3KT4 A;  1AR6 1;  3HEI A;  4WV8 A;  4XUQ A;  2A3X A;  1WCK A;  3S5A A;  1K5J A;  2MEV 1;  3URF A;  4COW A;  4Q0S A;  1GP6 A;  1PO2 2;  1PNG A;  2H6C A;  5A3O A;  1LGN A;  4BIF A;  1W9F A;  4C0H A;  3P1I A;  3FMG A;  4AE2 A;  5EV7 A;  1MPX A;  2WUH A;  3DYP A;  2IFR A;  5DN2 A;  4EWD A;  3ZSE A;  4BQ4 A;  5A32 B;  4QDQ A;  3MIG A;  5IVE A;  5FWE A;  4GH4 C;  2WAA A;  3IT8 A;  3RWK X;  4Z82 A;  3GZU C;  2HWD 1;  1ZZC A;  5T5J A;  4TLF A;  1K12 A;  3RJR A;  1RXG A;  3AKQ A;  1S0J A;  3ZPO A;  2D43 A;  5CEH A;  1N1Y A;  4XQW A;  5FLH A;  1JW6 A;  5CYY A;  1TE1 B;  3MFC A;  1W6M A;  3DEM A;  4XMA A;  4NRQ A;  1H4H A;  4DRR A;  4EQV A;  5C33 A;  1G9B A;  2P3J A;  2JE7 A;  4ZPI A;  4CUB A;  1OF4 A;  2ZKN A;  1CAW A;  3BGA A;  2BTV C;  1GUI A;  4CP2 A;  3Q8F A;  2PHW A;  3AKT A;  3WNN A;  2VZR A;  2WKK A;  3OPW A;  1UCX A;  2W68 A;  4YAR A;  2ZAB A;  1CD3 G;  1LEM A;  1JOD A;  2XON A;  4Y1Z A;  1OLR A;  4YVW A;  1X9T A;  3IPV A;  3SEP A;  1IGO A;  4D0Q A;  1BK0 A;  4O9G A;  3L9J T;  5ANN A;  5CU1 A;  5ACA 3;  5JOY A;  4K40 A;  5F1R A;  1S0D A;  4LBQ D;  1VBE 2;  4R9D A;  5F9T A;  1PGL 1;  4WZC A;  1CWP A;  5F2W A;  3W5N A;  4Q4W 3;  3VD4 A;  4PF1 A;  5A3L A;  1W8Z A;  2Y60 A;  3QH6 A;  4XF3 A;  1MS5 A;  1BMV 1;  3KF5 A;  4YWA A;  3VBF B;  3WF3 A;  2ADE A;  2VZ1 A;  4Q1R A;  1UY2 A;  1B35 A;  4M00 A;  2VOV A;  2WAB A;  3WV6 A;  1CAW B;  3GJB A;  2RS3 1;  1NAE A;  3CKH A;  1W28 A;  1H8T C;  2VMG A;  1S2E A;  3O1U A;  4YVW B;  3AFK A;  4RHV 3;  3IPV B;  4XC9 A;  4Q4W 2;  4O9E A;  2YU2 A;  4JGZ A;  3USS A;  5CFC B;  4MGT A;  5FPZ A;  2OA2 A;  1NE4 A;  1BHG A;  5CAD A;  2VM9 A;  3SCF A;  2VMC A;  2Y33 A;  2UYB A;  4Y5Z 0;  5A7Q A;  5CZK A;  1QJY 1;  1F2N A;  2WO2 A;  2CYF A;  2WNO A;  4HPK B;  4EN9 B;  3LD8 A;  4JV4 A;  2GAU A;  3GCW A;  1VB2 A;  2X5I C;  2B7Y A;  4LBL A;  1E5R A;  3MIE A;  2FBE A;  4LUL A;  5FXW A;  2AC1 A;  5EZW A;  1OA4 A;  1PVC 1;  3HPN A;  1J59 A;  1B35 B;  1COV 2;  5JDB A;  2IXK A;  2K2S A;  1LOE A;  4NRO A;  4CU8 A;  3O7O A;  3U11 A;  1VBB 2;  1V6K A;  1MZ5 A;  2CL2 A;  5H9Q A;  1QJE A;  1G9F A;  2R07 1;  3O1S A;  4XFG A;  2EID A;  1J1L A;  2HWB 3;  3N9Q A;  1C8M 3;  1V70 A;  4Y4Y A;  5J98 B;  3ZPY A;  1UZY A;  2CWS A;  1G86 A;  4ZS2 A;  5FJK A;  5FZI A;  3VZN A;  4GWM A;  2VNV A;  4QKD A;  5A3U A;  4OI0 A;  2E63 A;  2RS1 1;  3ATG A;  4DUV A;  1F35 A;  2IC1 A;  4BQW A;  1UYZ A;  4CU6 A;  3BIE A;  1VAK A;  2C6S A;  3WUD A;  3SKJ E;  1KS5 A;  2VZQ A;  1BEV 1;  1Z78 A;  5BNN C;  5FMC A;  3W5M A;  1HN1 A;  5CNA A;  5D8A C;  2E26 A;  1NY7 2;  4P9X A;  1SMV A;  1CN1 A;  2HWB 2;  1F9K A;  1VBE 1;  4OQ8 A;  1UYX A;  4JTO A;  3BOW A;  5E8A A;  2ZEZ A;  5F6K A;  1MQT B;  1EAH 2;  1HRI 3;  1CAX A;  3A21 A;  3H0O A;  2C26 A;  2H0B A;  1RVF 1;  3K4Z A;  5IK8 A;  3PHM A;  1APN A;  5FMD A;  3S7I A;  3MF9 A;  4AAX A;  2GNT A;  3E6B A;  2R06 2;  4R9C A;  4D69 A;  3H42 B;  3M70 A;  2RV9 A;  3ZIW A;  4Q1P A;  2J42 A;  1J58 A;  3T3Y A;  2R04 1;  4AL9 A;  5F3I A;  2ARA A;  4FP3 A;  4G4F A;  4QQ2 A;  3VKO A;  2FDK A;  4XCA A;  3LA7 A;  2WDB A;  1AX2 A;  1CPN A;  4PIX A;  2VVE A;  4LTA A;  4P9L A;  3C7F A;  1LEC A;  3TNQ A;  3VDA A;  3NJV A;  3LB9 A;  5HI0 A;  2QQJ A;  3WHT A;  4GH4 B;  2VOK A;  1AYM 3;  1NKG A;  4FPO B;  1HRV 2;  4D7S A;  5DAW A;  3J7H A;  1KFX L;  1TNR A;  3KCC A;  1S2K A;  1FMD 1;  3PVO A;  5FCC A;  2XQR A;  1J83 A;  3I2H A;  2C24 A;  2ZEX A;  1W99 A;  4AFC A;  4HXC A;  4Y5S A;  4EN8 B;  3HR9 A;  1HW5 A;  1IPJ A;  5C3P A;  2WN3 A;  2YC0 A;  2WZP P;  2IZW A;  3MEP A;  3WW2 A;  3K3N A;  4NPM A;  3WDY A;  1RB8 G;  1B09 A;  1V00 A;  1YFX A;  2A6Z A;  3AJZ A;  1LKN A;  3ETP A;  5LY2 A;  3ZXK A;  3K4D A;  3S30 A;  4A41 A;  2TNF A;  1AYM 2;  2EIG A;  5E1R A;  4QAW A;  2CGO A;  4UFH A;  2ZCW A;  1DQ4 A;  4NRM A;  1W6O A;  4QQP A;  3VD7 A;  2VCA A;  2PTM A;  2C4X A;  1STM A;  2CDP A;  2O0O A;  2A70 A;  2YBK A;  1JYT A;  1DG6 A;  4R4Z A;  5JXH A;  1O5U A;  1VB4 A;  1H1I A;  3QD6 A;  4K9S A;  1O7F A;  1PHM A;  1N3P A;  1ZRD A;  4KL1 A;  3A23 A;  1CZV A;  3WZ1 A;  2FDJ A;  4FFF A;  3WXP A;  4XFF A;  3CZU A;  2E9Q A;  1RYY A;  4XIK A;  1W2O A; 
#chains in the Genus database with same CATH homology
 2WR9 A;  2JDK A;  2CHH A;  2JDP A;  5A70 A;  3ZDV A;  4UT5 A;  1W8F A;  5A6Y A;  2BV4 A;  2WRA A;  5A6X A;  2BOJ A;  4AOC A;  4CE8 A;  5A3O A;  2JDU A;  2BP6 A;  1W8H A;  2JDM A;  2XR4 A;  5HCH A;  1OXC A;  2BOI A;  2JDH A;  1OUX A;  1OVP A;  5A6Q A;  1UQX A;  3DCQ A;  2JDN A;  1OUR A;  1GZT A;  2VUC A;  1UZV A;  2JDY A;  5D2A A;  1OUS A;  2VUD A;  5A6Z A;  1OVS A;  2VNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...