2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RSC3288
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
2CHHA 2JDHA 5A6YA 1OXCA 2BOJA 2JDPA 1W8FA 4CE8A 2JDKA 5D2AA 1UQXA 4AOCA 2VNVA 4UT5A 2JDUA 3DCQA 1OURA 1OUXA 1GZTA 5A70A 1OVSA 2XR4A 2JDNA 2WRAA 2BOIA 2VUCA 5A6XA 5A6ZA 5HCHA 3ZDVA 1OVPA 1OUSA 2BP6A 2VUDA 2WR9A 5A6QA 2JDYA 1UZVA 2BV4A 2JDMA 1W8HA 5A3OA
chains in the Genus database with same CATH superfamily
1GP6A 2XJTA 4Q4V2 1WMEA 3PTRB 1R64A 2ADEA 4NOTA 4FPFA 3MLLA 5I93A 3D8CA 4GMP1 5FZDA 3VZOA 3ZVXA 4R9BA 3WUDA 3T09A 5C8WA 1LR5A 2PAMA 3I59A 2ZBJA 3LFIA 5CA6A 1DBNA 1W6OB 4GH4A 1XE0A 2TUNA 5JWPA 5HI0A 2VZUA 3M3OA 1BMV1 1WMFA 2VNGA 2C9AA 2HWF3 3GM8A 5EV7A 3VBUC 4CTEA 5GZCA 2QQNA 2FDIA 3MPBA 4B3NA 2PHRA 3O1MA 3T0DA 2VCMA 1KFXL 2DBNA 1ND2A 3N9MA 5FO9B 1KXGA 1V6NA 2P4EA 4S2GA 4MHRA 1YQ8A 2JKBA 1OI6A 2GMMA 5FCCA 4M3CF 1SFNA 3ZXAC 4YGBA 1RUC3 3LA2A 5KXEA 3H0OA 4AVCA 3UKVA 3EJKA 2K46A 1HV1A 2GZWA 4RHV2 2VR4A 1XYOA 1HLCA 3FX3A 4OUEA 2ZHLA 1OURA 1K5MB 2VULA 2Y33A 3BTAA 3FC0A 3MHZA 2XKOA 4QU2A 5BYNA 4FSJA 3FFQA 5DZFA 4OHXA 5F5QA 1PVXA 2I07B 5FY9A 1YFXA 3K3OA 4KWUA 4PQQA 1QJFA 2EA7A 1V6LA 2F17A 1W2TA 2E33A 3OUIA 3PJQA 3PTYA 3WDUA 5LA1A 1Q8QA 5J98B 4A3ZA 2RM22 2CDOA 2Z5WA 2KXLA 2H6CA 4HMZA 1EYBA 2RS11 1WLCA 3U10A 5KC6A 4FCAA 5I91A 1ENXA 2JDAA 4GWMA 1ODMA 2WFPA 1JZ6A 3O1PA 4BHPA 5JI7A 1W6MA 3OUHA 1IS3A 3OYWB 2CWMA 5EZWA 4XACA 5F3IA 1ZBE2 2XXZA 3HAGA 4F8AA 4BLJA 2QQKA 3PUIA 1TMF1 4XJAA 4FPEA 2EVXA 4YVSB 3E1F1 4QX0A 1P8JA 2X5IA 1BZWA 5EJZB 2BJSA 5FPUA 3R0RA 5FLJA 5CADA 1AHSA 4COUA 4TN7A 3A0KA 4I09A 4Q4V3 1UY4A 4AEDB 1AYN2 4Z07A 3KGZA 3WP5A 1MS8A 1MS9A 5DG1A 2ORZA 5JIAA 5FFOC 3K4AA 4UOJA 3WD5A 3WQBA 4GIQA 2RS31 2WL1A 3ZLIA 3M70A 3VKOA 1IS6A 1JZ4A 3QBQA 4YZ2A 3WNOA 2OQ7A 2RR13 1R1A1 1KDMA 1V6IA 2VUJA 4Y1VA 5F5IA 4XYXA 4CPBD 3AFKA 2OXBA 2VM9A 2LUWA 4HVRA 1WMXA 2OPKA 3SCFA 3NVCA 2W5FA 1X8MA 5E88A 3VBFC 2CHHA 4A45A 5J1XA 1YLLA 5JPNB 3ZFFA 4BLIA 4Y5TA 4IW3A 4DOUA 2QKDA 5FXZA 5A6YA 4M3CE 1NCRB 4MLOA 1BMV2 2LALA 4ZONA 4PI0A 5GZDA 2G9GA 3CU7A 1HJGA 3UJQA 4UBHA 5DN2A 5CEHA 1A6CA 4RHV3 4R9CA 3MF9A 1JXNA 3TN91 1DF0A 1S55A 3CL1A 1A78A 2TEPA 4BQ1A 3K51A 1VBC2 4YFWA 1S0CA 1W6OA 5FJKA 3KSCA 1MVEA 4Y1UA 1Q3EA 1TZOA 3ELNA 2WNUC 3SH3A 3S5QA 4AVAA 1XXNA 1MS3A 1UL9A 1ZX5A 1GNYA 2Y6GA 5H9PA 2DVBA 1UOFA 1W04A 2JD9A 2PHLA 2ZGOA 3MDPA 1W9YA 2WQ4A 2RM23 4LOTA 2ZEWA 4XDOA 1AR61 5GZGA 2CNAA 4QDSA 1SLLA 4RR3B 1HQNA 5J09A 4Q5OA 2Y6LA 2R30A 3RMYA 4AF9A 2BBAA 1GANA 1TME3 3AMNA 1LAJA 1NA1C 4BM8A 3D4KA 1K5MA 3JB4C 1OD5A 4OHZA 4Z2WA 5IAXA 5JZGB 2EIDA 2ZZQA 1WGPA 3AZWA 4Q4X1 2GDFA 4TYSA 2E6VA 4FQ4A 4JC1A 4F3JA 4BMEA 4UW3A 4FFGA 2OQ6A 1C5HA 1OQ1A 4XHXA 5FP9A 3RWNA 2UWBA 1RUE1 2JB4A 1RC6A 3WG3A 4CRQA 3C3VA 3GJBA 5JVVA 1R082 5C4WC 1R091 1UU5A 1W8NA 5EJ1B 3X29B 4JZRA 1WCKA 5BNOB 1JOJA 2EXHA 2LROA 4LK7A 1OT5A 5DUWA 2EIGA 1AYN3 2ZA9A 3ZXGA 3FE5A 4FP2A 1VAKA 5CBLA 2O1QA 3K3NA 3PIGA 2GMPA 4QKFA 5TSWA 5JAXA 1DQ4A 2R7EB 4RQPB 1O5UA 3WP3A 3OYWA 1UXXX 1RJ7A 3I3BA 4XFHA 1UZZA 4BISA 1UMZA 1HRV2 3U37A 2Y6FA 4N43B 1UMHA 2PXJA 4CDUC 4OLLA 3BOPA 4PIZA 5ANNA 4YVSA 4FFIA 4LMFA 5EXOA 1PVC1 4P9JA 2QQUA 3UKNA 2A6WA 1VRH3 2AEZA 2IZWA 3EQEA 5K4LA 3POBA 1ZA7A 1QJX2 1AUYA 1R1A2 3OCPA 3JXSA 1RITA 4AEDA 4JRLA 1GWMA 3OOXA 1DZRA 2GALA 1Q8PA 4AHXA 3SQOA 1GQGA 5K8SA 5KXDA 1CIWA 3KM5A 4I02A 2GNDA 2VUCA 1LHUA 1DU3D 1QKQA 5GZEA 1FYUA 1VBC3 1YIPA 1NOVA 1JYCA 2R6QA 4G3YC 5EFUA 2OPWA 1W8HA 2BEOA 3LIGA 1SBDA 3MUY1 5FYSA 3VBUB 4EZHA 2BYVE 4O9EA 2D6KA 4XQDA 5GALA 3TN92 2WBKA 1NE6A 3IZOA 1BEV2 2W91A 1FMD2 3HJRA 1SPPB 4Q8KA 1ZBA1 2G9ZA 3TWIA 2BUKA 4Q4W2 4YW5A 1NCRA 3U07A 4JQTA 3UGFA 3I54A 3NKGA 4Q0UA 3MLJA 3ZYRA 5I0TA 2ARBA 3T2OA 2ZX1A 4QXHA 4AQTA 5IJRA 1ZZ6A 4OI4A 5L9BA 3I2OA 3FBYA 1GZTA 3LEKA 3ZIWA 1MZEA 2K0GA 1PNFA 3LDRA 1O4TA 3USSA 4IEWA 4BYYA 5FZ8A 3V0AB 2WN2A 2CSGA 3J9SA 4YM1A 4LJHA 3S0MA 4PLOA 5JXJA 3RZJA 5HCHA 5HV0A 1MZFA 4Z92B 4FPYA 2BFUS 1W2NA 1AR62 2A1XA 2EXKA 4WM8B 3RZZA 3K75B 3AXEA 4IE0A 2B46X 3N4MA 1VLNA 5BPXA 1FATA 5FY7A 2HWD1 1C8M1 2VMHA 1LHOA 3AX4A 1QNYA 4KNCA 4CCLA 1JU3A 3AJYA 1PM7A 3O1UA 4L9BA 1R083 4QD2A 4KI5M 2D44A 3HWJA 4XJ9A 2ZX2A 2O8OA 1TEIA 1WCSA 2YC4A 1SCSA 2OUHA 4A7KA 2PLV1 5C3PA 2OA2A 3DKWA 1VP6A 4RR3A 1X36A 4H55A 4QKDA 4XETA 4ZHNA 1H1MA 2W94A 2VBDA 4G4FA 5JZGA 1ULDA 2XWBB 5H9RA 2E31A 2JEMA 4K9SA 1AXKA 5F7UA 5DAWA 1CZTA 4N53B 3FHIB 3AL5A 4J1XA 1OBNA 1UY2A 4AL9A 1HRV3 1VAVA 4GH4C 5FYZA 1YNAA 2QNKA 2N7GA 4LORA 4YFZA 1TG7A 4ITCA 3ZO0B 4FAGA 3ZXDA 3POYA 2W47A 4H2AA 4EN0A 4AI2A 1AL22 2RV9A 2ES3A 1AR71 1ND2C 3ZYGA 5I8TA 5JOWA 1C1FA 1Q8OA 1QJX3 2CTVA 4XUPA 1GNZA 2W68A 4MGYE 5A7SA 3PVNA 5BNOA 1DDLA 4JKMA 3ZYFA 1UKGA 2VO5A 3KLSA 5IATA 3JBG3 4HANA 2ZGTA 3VN4A 2DTWA 4IEVA 4RQPA 5FYCA 3WR0A 1VBE1 2Z4FA 3BTXA 2A6VA 1JYIA 3LGRA 1RUOA 2E51A 5KBFA 3AZVA 4RFT0 3WQ1A 2JG9C 3VL9A 4N43A 5J37A 1S0FA 4AI9A 3PUHA 3DUIA 2R49A 2XJRA 3OBZA 5D8AB 1VRBA 3VBFB 5IT6A 4XFGA 1BEV3 2VVDA 1FMD3 2WT0A 5A1FA 1OA2A 2HWC2 4JHTA 4D6RA 3WT3A 4Q4W3 1SG3A 5H9SA 1F5FA 1UKRA 1OUXA 2RE9A 1WW5A 2WNVC 3J8F1 2PHTA 2WSUA 4QHZA 2AZ5A 1LOFC 2GN7A 3WNMA 2ZGRA 3BALA 5F2WA 3ACIA 3ZIXA 3CZJA 1H8TB 3BIWE 1ZBA2 5HXVA 2P6HA 3KT4A 3M8LA 2ZX4A 4DEVA 5T3NA 3D3AA 5B2GB 1JHJA 5FPLA 2VCAA 5K7PA 2I74A 1U5YA 2G1MA 3J4UH 3BCWA 3VBUA 3LDBA 3LQCA 3VZNA 2WNUB 3W5MA 1O3RA 5IK5A 4Y4RA 1D2QA 3NNJA 1OD3A 4UWDA 1ASJ3 4CE8A 5LY1A 1SPPA 4XUOA 1AJOA 1OFSA 2XJSA 1IS4A 1BJQA 5FMOL 4Y26A 1CPMA 3TBDA 1AYM2 2GMEA 3POFA 4MVTA 1IQAA 2UYBA 3ETPA 2XJPA 3PVOA 4CEYA 3MICA 3V0AA 2JECA 1GQHA 2IWGB 2R071 4MX3A 2HWD2 1C8M2 2R16A 3AM2A 2B9VA 5JIUA 4I2OA 3MV01 4AYUA 2FCUA 4YW4A 2ZGQA 3C7OA 1X33A 2ZGSA 1F2NA 4TXWA 3ZMOA 4LPLA 4WM8A 2NMNA 3KVAA 3J7LA 3RWKX 1KS5A 3NV2A 1W05A 5FY5A 2VU9A 1UPSA 3SH4A 3UJOA 2AENA 4DIQA 2JG8B 1RUNA 1F4AA 2RJKA 1BLZA 1AL23 2XHNA 5F6KA 5A33B 4QWNA 3IIAA 3O1VA 1GWKA 5C4WB 2YFZA 4BQ5A 2X53S 1VB4A 2QQVA 4LKFA 3OBRA 2W3JA 4TZDA 3VZJA 1WCUA 2I2SA 5A6ZA 1S2KA 2XVGA 4FI9A 1D4M2 1QU0A 1DQ1A 4N9HA 2XWJB 4YW6A 1K3IA 2GC0A 5FZOB 5A7WB 4KG8A 4YYOA 4AEJA 3CJIC 1AR72 4XOGA 2YC0A 2ZGMA 3N7MA 3ZYIB 4OI0A 2QZ3A 4N53A 1TQ5A 3OEBA 2NP0A 1U5XA 4DXZA 4LA2A 2YU1A 5FMCA 2QJVA 4O7XA 5FP3A 3JD73 1GWLA 2R0FA 1MZ6A 2PMWB 5IWFA 4PT6A 3NJXA 3WZ1A 2FCTA 5GLZA 4BK5A 1XSQA 3PUQA 2HWC3 5FPXA 2BNOA 2VZQA 3J7NA 5SV8A 1HN1A 1OHFA 2TNFA 3CQOA 4DEQA 2WT1A 4AI1A 2O8QA 3WHUA 2WIIB 1LOGA 4FXKB 4F83A 1ZZ9A 5C8CB 2HWF1 4GMP0 3CZUA 4XTPA 2XUMA 5J96B 1QF3A 3J8F2 4URTA 2W1QA 2VJXA 4LK6A 1K5MC 1DG6A 3HNMA 4ZZ8A 1O3TA 4W65A 1CZSA 1JZ5A 4AHZA 4WVVA 1RUC1 1UWWA 2E53A 5D8AA 2HEVF 3VBFA 2XBO3 1QJEA 4COVA 2BNMA 3DPRB 5FXXA 5T5PA 4IUGA 2DVAA 4QXKA 5FZ1A 1AYM3 2G4IA 4JDOA 1XPWA 4QX7A 5FZCA 3WDXA 1MS4A 3SITA 4NPRA 1CZVA 1QOOA 1W8ZA 1H8TA 3S6PA 5LEJA 3IBMA 1QY4A 2VL4A 1LOAA 3K4DA 4NRPA 5ERLA 3VBHB 2PA7A 3VDDC 3SXWA 3ZR5A 1JZ7A 1IQDC 2P3YA 2FDJA 4QGNA 5JUVA 1PZ9A 2P3IA 4NR1A 3KMHA 3H8OA 4MXVA 3V0BB 2F4LA 2I45A 2WNUA 1NG0A 3MGUA 2R072 3ZSJA 4BE3A 2VZ1A 1GYKA 1ZVFA 5J36A 1M4WA 1VBB2 2ZGUA 4YZ5A 3U0ZA 2VNRA 2D93A 2P3JA 4ISRA 5FWEA 1DQ6A 4HKLA 3T30A 3ZSKA 1N1SA 5IHRA 3TAYA 3ES1A 1CD3G 2V4AA 1G9FA 4XF9A 1LCLA 4FTEA 1RTVA 1B35C 2YZ4A 4L92A 1MVQA 4BQ2A 4MXWB 3AB0A 1UCXA 2EF6A 3LA7A 1UZVA 5CZKA 4AEDC 4Z8BA 1D4M3 1RUD3 4YM0A 1OF4A 2GNBA 2CY6A 4D94A 1QH6A 5CKQA 1PO13 5C3RA 1J1LA 2VTXA 1YFYA 4R9AA 5ANQA 2DDUA 1XU2A 1W2UA 3H3UA 4NWVA 1VMHA 4YW2A 3C7EA 1S0GA 3OD0A 4XZPA 4H7LA 2FQPA 2UY8A 4J6GA 1POQA 4Q4V1 3AC0A 3KF5A 4CCKA 1JYVA 2JG8A 1QDCA 2J1TA 3OY8B 5E89A 4D7TA 3LD8A 2ZKNA 1A3KA 4I30A 1YO8A 1T2XA 3NJZA 4LBLA 5FP8A 5FZKA 4URAA 5A33A 4W8JA 1Z78A 1ENSA 5C4WA 2VZOA 3MFCA 4Y1XA 3TRSB 5F3CA 1CESA 1NCRC 3Q8EA 2GNTA 4XJZA 2D6NA 3GALA 4NHYA 3ZKUA 2FDGA 3MW3A 3NRUA 1VJ2A 2RR11 2E7QA 2Z2SB 2ZKLA 4O65A 5A7WA 2BW8A 5FZOA 2YROA 3D0JA 1GUIA 3F2ZA 2WZPP 5FWJA 5L9VA 4P02B 5IK8A 4IE4A 5IVCA 3GZTB 1OXCA 4OMCA 2HWE2 1WLTA 5F3GA 3AYDA 5L36A 1BYHA 1MS1A 3ZYHA 5HCFA 4B7KA 3BUCA 2VBBA 2DCKA 3KHBA 4WV8A 2JG9B 3P1IA 3PLQA 5ABJC 2XJQA 1O91A 3KGLA 2ZMLA 3HQRA 4UW6A 4PIXA 4LBKA 4CP1A 1ZREA 3AKTA 5FZ0A 2QFEA 1H9WA 4L97A 5APAA 4CP2A 5FO7B 4RHV1 4UFMA 2VD7A 5FP4A 5FREA 1H4GA 2WNVB 2YMZA 3IM0A 4E8DA 3WG4A 2BERA 5C71A 4IEUA 1NXD1 1RUC2 2P6CA 2YFUA 4L11A 5AVAA 4KBBA 4OCTA 1X7NA 4NROA 5C8CA 5FYBA 4RR3C 3KHCA 1UOBA 4LKSA 4XCBA 2WLPA 3VD7A 2WWSA 3EHKA 4I3GA 5C3SA 2DVGA 4KH9A 4K20A 1DGWX 1BK0A 1PHMA 3ZPYA 4ASMB 5J7MA 1UQXA 3VHOA 3F95A 1RUH2 1RL3A 2RM21 1DZTA 4BOWA 1OLME 1HN0A 3MV11 1LHNA 1VBB3 1S1AA 3AP4A 2KA3A 5FKBA 1H6YA 3N3HA 1RJ8A 1YRZA 3DPRA 3VBOB 4E2GA 4R52A 2D7FA 4QHBA 1DFQA 1TME1 1LEDA 3MUZ1 5A3PA 2ZGLA 1JOBA 2IXJA 3JQWA 1KD7A 1EAH3 4HG6B 2CGNA 5FZEA 5CG9A 3N7LA 5BNOC 3KVBA 3VBHA 4MADA 1ONAA 3SHRA 1NE4A 2IVJA 3W59A 5I8SA 3U1XA 3N9NA 5DDJ3 1SBFA 4CDQC 1ULEA 1OFNA 3RZMA 1WD4A 3V0BA 5F8PA 5EJ3A 1CAWB 1Z0HA 4CPBA 4QXCA 1E5IA 1L7LA 2E7AA 1JZ3A 4N43C 1QIQA 2BOIA 2VCCA 4PIYA 1AYN1 1RIRA 4L99A 4E4ZA 1JHNA 2WR9A 4NE9A 3B00A 1UYPA 5CKNA 4PBPA 5DUUA 1ZRIA 5F39A 4MXWA 1SLCA 3A21A 3LPFA 4QKBA 4CDXC 4OHWA 4ZXKA 3TEXA 4O61A 3O1TA 1UU6A 2O0OA 4UAPA 3ROUA 5ACA2 3W20A 1IZ3A 3HNYM 2Q1FA 1FAYA 4M0HA 2JB8A 1SBEA 2IXLA 2K9ZA 3CJIB 1LB2A 1QOSA 5LBEA 2HWE3 3BTZA 1OKOA 2HLEA 4HK9A 2JDUA 3NW4A 2QQWA 1OC1A 1UX7A 2PTMA 2RR12 4NUBA 4XC9A 1G7YA 4WBBA 2WFF3 3IPVB 2XUEA 3OY8A 4LO6B 2Y64A 3ZOIA 2H0BA 3ZDVA 1O3QA 2A71A 3MBWA 4XQ4A 1PM4A 2GSYA 3WW3A 4BJ0A 2DCYA 5E16A 3POWA 5K0UB 3NJVA 1VBC1 2JDHA 5C5UA 3HMYA 1T6GC 4B4RA 2HEYF 2W08A 1Q56A 2VY0A 4Q1RA 2PN5A 1VR3A 1FI2A 1N3QA 3PUAA 5A3WA 2BWCA 2VOXA 3D5OA 3R4UA 4AE2A 4YZ3A 2Y0OA 2XHKA 3QOPA 3R05A 1XNAA 1XNCA 1GQPA 4V2VA 1V9U3 2JG9A 1RGSA 2W9XA 1F4HA 1RUH3 3O12A 5FV3A 1H30A 1XU1A 2ARAA 1DP0A 4WM8C 5F6LB 2Q8CA 4KU7A 1NY72 1Y9QA 1JZ8A 5LBBA 2OUJA 2H0VA 3CKHA 4EQVA 4ASLA 4GB33 3AXDA 1V6OA 2YYOA 2JDMA 3NNLA 3I4IA 3KZ4C 4HKWA 1PMIA 2DF7A 2WNVA 3O5SA 4JGYB 4LLOA 2WN3A 3LPGA 2DYCA 1LOFA 1W2AX 5IK4A 1YCIA 4X8PA 3NNFA 3VDDB 2BGCA 5LY2A 1V70A 1X9TA 3FLTA 1EUTA 1G6NA 4XFCA 4A7YA 4AG4A 1TME2 2A3YA 2D6OX 4X6RB 1GP4A 3OTFA 4IESA 4FPGA 4XHBA 4ZU4A 5A80A 3ST7A 5FK7A 5KXBA 3K46A 4IEQA 2VUAA 1R081 4HBNA 4UYBA 4N53C 2QQIA 1DZQA 2QUOA 3VBOA 2BP6A 3A23A 2PQQA 1VBD2 5FUIA 4AI8A 1BK1A 1ENRA 1PMHX 4CDWB 1G86A 3ZXFA 3AYAA 4AAPA 3SCHA 2NLRA 1CAXB 1ZZCA 4AVBA 1B35B 5JR7B 5EP9A 2ZABA 2E26A 3J26N 2Y6JA 3N7JA 1CWPA 4COWA 2AACA 1VALA 1UU4A 4HKOA 4HL0A 4QPGC 4V1PA 4FBFA 2Q4SA 4BB3A 2BGOA 5JSPA 1HRV1 5ACA3 1I6XA 3MIGA 4AOCA 1NQJA 4PQ9A 2NMOA 4LOSA 3WCRA 2OX0A 3ACFA 2B45X 3BVCA 3IAQA 2WWUA 1CAWA 1FXZA 3MEPA 4XUQA 3WUCA 2IVIB 4P08A 4HVQA 5KR7A 3RRDA 1LRHA 1QQP2 2ZMNA 1QJX1 5HCBA 1XNTA 5LASA 4P5HA 1XNDA 3GCXA 5FBJA 4BU2A 1MR5A 5D8AC 4M4RA 2CU5A 3JBG1 5EPAA 1Z7S3 5DABA 2WA3A 4XDQA 3UKTA 4UFKA 1VRH2 4QX8A 4BH9A 5AFBA 2R042 3A0NA 3ZMNA 4GXLA 1C1LA 3WV6A 3S30A 3V56A 4NIAA 4NHMA 5FPAA 3RZGA 1G9AA 3GBFA 3VD5A 3ZFEC 4NHKA 5FR3A 1H8TC 3CJIA 4CXYA 4XABA 1DGWA 4FFFA 1B09A 1BEV1 1CX4A 1FMD1 3I7DA 2JIGA 1TNRA 1W0PA 2WRAA 2W46A 4CCEA 1HQLA 2LW8A 4Q4W1 4I3PA 5ABJB 2PHFA 1HB1A 2LM3A 3GF6A 3IPVA 2F6BA 1YIFA 2AUYA 3OEAA 1ZNPA 2J1AA 5IVEA 1GSLA 1WCDJ 3KF3A 5FOBB 1O59A 4A6OA 2DUQA 2AEYA 4IEZA 3VD4A 2HJIA 4WM7C 3ZR6A 1YI9A 5C33A 4AGGA 5IUQA 4P9GA 3T1MA 4RD7A 1HXS3 2MPFA 2A5ZA 3DYOA 4ONUA 1Q8VA 1REDA 1FNYA 2YBKA 1ZRCA 2SLIA 1UNBA 3H8UA 3IB3A 1F31A 3HT2A 2VQ0A 3PDQA 3UGHA 4AFDA 4CU8A 4YZ4A 3RI9A 3AMHA 3T2PA 4NHXA 4YARA 1ASJ1 1F5JA 3C7GA 3ME2A 3MYXA 4EWDA 2FZ2A 2D6PA 3APBA 1DLCA 5F1RA 1OQEA 1YQCA 4H7MA 4CU9A 1VB2A 1KFUL 2GH8A 4ISQA 4Z82A 1VBD3 2J7MA 2OKXA 3WF1A 1S2EA 2JG8C 4KGGA 5FIXA 3SEEA 4AHYA 3MFAA 1O8SA 2XJUA 4JGYA 5FP7A 5F37A 4LHKA 4XJWA 1QH7A 4BQWA 4XFBA 4P9WA 3VZLA 3THTA 2FBEA 1OF3A 2UWCA 2VAUA 1VMJA 3VDDA 5FPVA 2CGPA 1PGL1 3UYJA 4ARYA 4ZY9A 2G9FA 2J1SA 1H2NA 2WT2A 1F35A 2XR4A 3FUOA 1PGW2 2CV6A 3AP5A 5F32A 3ZN5A 2WDBA 1ULGA 2IXIA 4CDQB 1E57A 4FPJA 1RVF2 1W0NA 3GHNA 3M3CA 3UT0A 1J1TA 1AL21 2V4VA 5G04L 4K8FA 3AKSA 1QQP3 3AKQA 3AZYA 3B02A 3VD9A 4XQWA 4DRVA 3WF4A 2EXJA 4CDWA 1NZIA 1TE1B 2FD8A 4NRMA 3WP6A 3GHMA 2E9QA 2QQOA 1MZ5A 2PQSA 2Y6KA 5A7OA 1JU4A 2C0ZA 2CAUA 2ZCWA 2VMGA 3CBNA 1CAXA 4CA9A 3IKWA 4RA0A 1B35A 2R043 5C3OA 1AVBA 2W1SA 3W21A 3DEMA 1N3PA 1JBCA 4OZXA 2PELA 5K0UC 2DBIA 4QAWA 2D5FA 3K48A 1GV9A 4XZUG 2GAUA 5GLWA 3H9AA 1YXWA 3THPA 4LUMA 1W0OA 2CL2A 4JQRA 3CLPA 3JBG2 3JD71 4YVWC 5C8CC 2JE7A 2NYYA 5J48A 2RJ2A 1LOBA 2EAAA 5FMDA 3GBWA 4JGZB 4UFIA 2ZPXA 1W8WA 4E2QA 1SEFA 2HWC1 2XLFA 1LGNA 3WF0A 2VZ3A 3N35A 4GAZA 5FKCA 3KQ4B 1HIXA 2WSVA 1QXPA 3M4FA 4PHZA 5IAVA 1RMU3 1BBT2 2J1RA 3WSOA 1REFA 4ZPIA 2MEV2 1S0IA 4OVEA 3DPRC 1Y9GA 1EY2A 4AGVA 5EQUA 4RSUA 4LUKA 3RYPA 3E5QA 4E4SA 4YRDA 5C7GA 1GZ9A 3LAGA 4GZ9A 4UFLA 4IETA 3VBHC 1U5ZA 4CSWA 1C57A 2AYHA 2PAEA 1YYNA 2R1DA 2JJ6A 5FPBA 2XBO1 4AGRA 1AR93 2RS52 1JYXA 1US3A 2WWJA 5ABJA 3C7FA 1FT9A 4BCUA 3VGIA 1AYM1 1ZRFA 2WZ8A 5FXWA 4AVVA 4BK4A 1CVNA 3HIFA 2A3XA 3EMRA 4FOYA 2BBVA 3LEGA 5BY5A 2YGMA 2PHWA 1ASJ2 3PURA 3ALQA 5E8AA 1YQ2A 4QX1A 2X8KA 1RXFA 4QGLA 1SLTA 2VQAA 4YW3A 4ES9A 3PHMA 1OLMA 2X10A 1SCRA 4UFHA 4QX2A 4CEWB 3VBSC 1DYPA 1RUI3 3ATGA 4DO0A 1RHI2 4XUNA 4BXFA 3CIHA 4FXGB 4K40A 5T5OA 2QQPA 1RVF3 4R8HA 3A22A 5LB6A 3AMMA 3ACLA 4FVVA 2Q8DA 3AP6A 2VC9A 1QJU3 3IDBB 1IGOA 1UY0A 4Q26A 4XURA 3WCSA 4D7SA 5I0SA 1NCQB 1OOPC 1SHWB 4CDXB 5BNPC 1PGL2 1QJY3 1ACCA 1NYWA 3CO2A 3S5AA 1IHMA 4JDMA 4B1LA 5FZ7A 2FMYA 1H1AA 1D4M1 1RUD1 3RSJA 4CZSA 1DQ5A 4CCMA 3HQUA 4DXTA 4KWJA 3IMNA 4DY3A 1PO11 1PZ8A 2DU1A 3ILFA 3J7MA 5CFCB 4P9LA 4LLFA 4QPGB 3EO6A 4KMQA 5DXDA 3N36A 2Y8KA 4FPOB 1HB4A 3E5XA 4CDQA 3MIHA 4I0WB 1CX1A 1VIWB 1QMJA 1JOPA 4Q0QA 2HKXA 2QQLA 1JMUB 5SV5A 2GU9A 2XG3A 1HX6A 5L7OB 2GP3A 1STMA 2ILMA 3FHQA 3M3QA 4Y1YA 1BVVA 2ZACA 3ZN6B 1FV2A 4NJ4A 3JD72 2FDFA 3KCCA 1BBT3 1KITA 4J1WA 1VAMA 4Q0SA 5D2AA 2RMU2 1YI7A 2MEV3 4AQ2A 3EYPA 1HQWA 2OIIA 4I01A 4S2HA 5BXXA 5IVFA 2BGPA 4CDXA 5AFEA 1AXZA 1K42A 4EZ4A 2J1VA 2X09A 2NZ9A 3ZFEB 3WG2A 2BTVC 2CGOA 3VL8A 1L7QA 1M06G 2ZOEB 1POV3 1SLBA 1LECA 4JGZA 3I3DA 4XJ8A 4AZZA 1O4YA 5T55A 1W06A 2RS53 5M0TA 5EYYA 1OSGA 5CVRA 2ET1A 3LIHA 3INAA 4QB6A 2IUWA 4XMIA 5I0UA 3WF2A 3ZXKA 2Q30A 3OGGA 4E27A 2HEWF 2HYKA 5L19A 4QQHA 5FBZA 5IFPA 5LZ6A 1GNHA 2OT7A 3VLBB 4Q4Y3 1UZYA 3VBOC 2XBO2 2O14A 3RMXA 1D7PM 1HW5A 1UO9A 4LE3A 1HJFA 1WA4A 4AEMA 3LFMA 4MGSA 4P9IA 4NIDA 4EWEA 2NQYA 3EB7A 4N7IA 4WM7B 4IE6A 1I3HA 1HKDA 4AVTA 1XYNA 4I0AA 4BPZA 4JTOA 2Z69A 5LBCA 2ETEA 3OBAA 1RHI3 2WO3A 1LJ7A 5D21A 3P3PA 4MYEA 3WG1A 1XQNA 1U0AA 1VBB1 5BV6A 3WDVA 4MGKE 1W9TA 5IVYA 5A32B 2CYFA 4A4AA 3WNKA 1W6PB 1F9KA 3ES4A 2WO7A 4K3UA 4NPLA 3ZDSA 2R32A 4HVOA 3ZSMA 4IGPA 3VZMA 1EAH1 2D6MA 3AMPA 1EV12 3ASIA 1X8EA 5BNNB 3BI3A 4HN1A 1QOTA 1S4CA 2YUEA 2DCZA 4ATEA 5CAZA 3B7MA 1RUG3 2HBUA 5DDJ1 5C6CA 2XPJA 1U12A 2ARXA 1GLHA 3M3IA 3CMGA 4DNYA 3MZHA 4GALA 1DGRA 5L9RA 4CEWA 5E6HA 1KGYA 2DVFA 2QDNA 1WLDA 2QQJA 2VUDA 1ZA4A 5IK7A 4CCNA 1PX3A 2XQXA 1RUD2 5T5LA 1ZRDA 4YNIA 1ULCA 3RI8A 1RXGA 3C7HA 1PO12 1KQRA 2C4XA 3BU7A 2FDHA 1GP5A 4V2WA 3BU0A 3WQ7A 4QXBA 1RUF2 5DPNA 1KJRA 5FZHA 1NCQA 1QGLA 2LTNA 3MIBA 2JXAA 5A3TA 1OMIA 3M2MA 1MQTB 4OQ8A 5FQ0B 4Q27A 1PGSA 2W87A 4MGQA 4E4HA 5DUXA 4HFSA 2RMU3 1LEMA 4B4PA 3POEA 2HWE1 3S7EA 1W9SA 1HB2A 2A6XA 2L9LA 2VW2A 2QE3A 1CIYA 2PFWA 3ENRA 3FL7A 4NWWA 4QPGA 4EN6B 4F7ZA 3OG2A 5CFCA 4PDWC 3K4ZA 4RYDA 5FZLA 2BPA2 4QQ2A 2WFF1 4YVWB 5A3OA 1UW8A 4C8DA 3SNMA 1V0AA 3WEZA 4EN7B 1XE8A 2QDRA 4KBZA 2OVUA 2C1FA 1JS9A 5L7OA 4NIHA 2YY1A 4JHZA 1WD3A 5AVPA 2DFBA 4JVAA 3O1SA 3ZN6A 1OA3A 4ZU5A 5CYYA 3PMSA 5A7PA 4JRAA 2ARCA 3JUUA 4ZS3A 5IVBA 2V5DA 1J84A 3NV4A 4GD4A 3LSEA 4AFMA 2DWRA 3VHRA 3J7HA 3D82A 5JOXA 3I2JA 1DGLA 3NAPC 4JGYC 4LHSA 2IXCA 2FZ1A 5FY8A 4KGQA 4LO5B 4MV2A 3U75A 3WHTA 3E6DA 2J1UA 4AQ6A 1E5RA 5JXHA 1V9U1 3ZFEA 3BYWA 4CXWA 1RUH1 4PJYA 3LKJA 4CCOA 3H1WA 3Q8FA 3M3EA 3I2DA 1WBLA 2WYSA 4GULA 2B39A 2XMLA 4IV3B 2XVLA 5FXVA 4GB31 5HV4A 1X9PA 1C8NA 2XOMA 3WX5A 3JCIA 1EV13 1V6KA 1YJLA 4L2NA 1Q8SA 4ORFA 1BQPA 3FUQA 1MACA 4YPJA 4B29A 3BTYA 4CDWC 5C9AC 3OGRA 4WM7A 2WNOA 1MEC2 2ZGPA 3VDAA 3AYCA 3LEIA 4NMIA 1UD1A 1QWRA 4EWAA 1D0GA 1PNGA 4XUTA 4LO8A 5LK5A 1EAH2 2HWB2 3VKLA 4FPKA 3VBSB 5T50A 5KWRA 3PJYA 4IE7A 4JDNA 1LULA 4GWIA 5DAXA 4AI3A 5A32A 4MSVA 3S57A 5DDJ2 5GKAC 1W6PA 3BGAA 3ILNA 4EE2A 5HPOA 2Q1ZB 2AREA 2ZHMA 4HONA 1RUF3 1V6MA 1UYZA 2XGXA 1APNA 5F3EA 4XDPA 1OOPB 4UT5A 1UIKA 4BMBA 5BNPB 1Y9MA 1I5ZA 1YEWA 5A70A 4K21A 5BNNA 3RZHA 1DHKB 1SZBA 2XH6A 3E6CC 3A4UA 2LS6A 1K12A 3OSDA 5ACA1 1S0JA 1AX2A 4NPMA 5EYXA 4K8RB 4DINB 2YV8A 2R0HA 5BNQA 1W39A 4LBQB 4N7UA 1AZDA 2VECA 4QPYA 4RS5B 1KJLA 2WZEA 4MZUA 4TSVA 4COYA 1SFYA 4AQSA 4G9SB 2A7AA 3H3ZA 3O7OA 1OPOA 4N8MA 4XTMA 4P00B 4Y20B 5GLVA 4OI1A 1W90A 1CAVB 4U36A 2FMDA 5A1AA 5DMYA 3H8RA 5KHKA 4P14A 3SCGA 1Z7S1 2AR6A 2YHJA 4LR4A 1PK6B 1BVP1 1IG3A 4M01A 4AR2A 4NO4A 4AEKA 1MQTA 1ZRRA 2WFF2 3POGA 5FQ0A 4GQ7A 3ON7A 4CUGA 4D0QA 2W1UA 4CU6A 3ZFGC 2JDNA 4QPIB 4QDRA 5DUVA 4IE5A 2IXHA 3VBRC 2VMDA 2P37A 4D3WA 4QB2A 3ZXJA 1W28A 4XIKA 3VKFC 2EICA 2VMIA 2GNMA 2AGSA 5K0UA 3KD4A 1S2BA 4QM8A 3C2UA 5K9YA 3O1OA 1J3RA 3EXUA 1BXHA 4YVWA 2VBPA 2BVVA 2BDRA 2UYAA 4U2AA 4YGDA 3IMMA 1JZ2A 4DMIA 2W95A 1NY71 4BQXA 3LOIA 1CONA 1W6NB 3L2HA 1VBA2 2D43A 3ZYBA 1C4RA 2JDKA 4BQYA 5FZ6A 4D6SA 2HYXA 3Q8BA 5IVVA 4BQ4A 1V9U2 2ZJCA 2W39A 1W3VA 1LNSA 2IFWA 2VMFA 3GGLA 4GKYA 1HXS1 3DKQA 1GU3A 4NAMA 5FMOS 2WLQA 4LO7A 3SKJE 3UV9A 4NIGA 3MO4A 4GB32 2KR2A 2R063 1NLSA 1MEC3 1NLQA 3RGBA 1QJZA 4Q0PA 2JX9A 1OH4A 5FY1A 3VV1A 4HK8A 5F5AA 3HT1A 2HWB3 4META 4P5YA 4CCCA 1ZZ7A 4P9YA 3ETQA 4IEXA 2TBVA 3B5LB 4OZOA 1I9RA 1SDWA 4R9DA 3NJYA 1ST8A 1XJAA 4WZFA 1VBD1 3T4HB 5A3LA 4IV3A 3I2HA 3WW1A 2JDZA 1H2LA 5FO8B 2XL9A 4IV1B 1AR82 2BQPA 3POIA 4LXLA 2QBXA 4LTAA 1L3JA 1MS5A 5EHDA 5FMBA 5GJ6A 3GXUA 1MS0A 2WS93 3KT1A 4HT1T 1OH3A 5KHGA 3BIEA 2JIJA 3AL6A 3TOJA 5A6XA 1JH5A 2JD4A 4RFRB 1ND3C 1E5SA 4RGAA 1ULOA 5AC92 3BPZA 3FN9A 4C1XA 4N90A 4XF4A 1DGRN 3DXTA 4K7JA 2A6YA 4SBVA 1AX1A 1NXMA 3VBSA 3N9OA 1QQP1 3NWKA 2XB6C 1D0HA 4EV0A 4LIUA 2X05A 2UU8A 3NNGA 3ZM8A 1IG0A 1ULPA 4JGZC 1HRI2 1Y43B 1JYTA 3QCWA 4TTGA 1N3OA 5DG2A 1VRH1 1OOPA 1UYXA 2R041 3GNEA 3HOBA 3AK0A 5KHHA 5BNPA 3NQHA 3MIFA 2NM1A 3I3EA 1OVPA 2P34A 2UY9A 2Q8OA 3H3LA 5T5JA 3B93A 3OF1A 4PLNA 3N9LA 1IPSA 4IQPA 1IPKA 4K1YA 5H9QA 1Z7S2 3SC7X 5CFDC 4O9GA 1W3XA 4XCAA 2WZR2 3AP9A 4CUBA 4AXOA 4LBQA 4W6WA 4Y1ZA 2HH9A 4RS5A 1PO23 3SKVA 3RZLA 2XONA 2OW4A 2P17A 4PDWB 4XPVA 3T2TA 4Z2AA 2W52A 4D7YA 2B42B 2ZXQA 4MH0E 4Y20A 1CAVA 1RMU1 1JN2P 1U5IA 1VBA3 4NVPA 2Z42A 3C8XA 5FZMA 4ZZ5A 1H0BA 5IW0A 1PK6A 4LBMA 4MO3M 5DAPA 4W4ZA 5A1LA 3ZSEA 3B3QE 1BHGA 3SH5A 5BUVA 2EAKA 2BVBA 1FOD2 4QPIA 3U14A 3I49A 3AJZA 4XEZA 1KS4A 1C5IA 1CR7A 1JUIA 3RS6A 3RG0A 1DQ0A 4XXAA 3NAPB 4UI9L 2J42A 2VVFA 2VTFA 1AR91 2D3PA 2GP5A 5FZBA 1NZCA 2DU0A 2VOWA 3TEZA 3S7IA 3ECQA 1ULFA 1HXS2 1JYWA 1H1IA 5KHIA 1RUJ2 4CEWC 3FHAA 5FRAA 1H4HA 4UF0B 5LK7B 1W6NA 2GC2A 2DV9A 2JE9A 2NPIA 2JKXA 5FK8A 4AW7A 2BFUL 1AR83 2DCTA 1WKYA 2WKKA 2Y38A 3HNBM 4HSJA 4WZCA 4S2FA 5LEKA 2EIBA 3WXPA 5DZEA 1NLRA 1QDOA 5CNAA 2MNGA 1NCQC 4XILA 1UF2C 4B7EA 5LCWL 1O4ZA 1FPN2 3RQ0A 2J1EA 4LQRA 4E4DX 2XVKA 5C9AB 5AC93 1RUI1 1LGBA 5FYUA 3SMHA 3CDZB 4RGGA 1SACA 3MLKA 3POSA 1PGW1 3BODA 3FWEA 1FNZA 1REEA 3GBGA 4OMDA 1RVF1 3KS7A 4EN9B 2VW0A 4DPNA 1X50A 2PHUA 2AC1A 3D6EA 1QJU1 3ZXEA 1COV2 5CFCC 5IYYA 4MG2A 1S0EA 1QJY1 4QGMA 4FPLA 4YM2A 3UGGA 3RFRA 4Z1VA 2LRPA 4IV1A 3T0BA 1WMDA 1HRI3 4RGKA 4CEYB 1PIV3 2MHFA 5GM0A 3B01A 1EP0A 4Y5Z0 3USUB 5HCAA 2Y60A 5L7OC 1O3SA 1RYYA 3H42B 3R6SA 3ZKYA 5A6QA 2V09A 4KWLA 5E1RA 3MW4A 4AVSA 2YG0A 1CN1A 2ZEXA 1WUVA 4IDZA 5JSRA 1DLLA 3P6BA 1QXRA 3VDCA 3WP4A 3D0SA 4MGZE 1LKNA 4Q0VA 2WZR3 1OPMA 2YXSA 1A8DA 1Y3TA 4SLIA 2B5HA 3P3NA 4WVMB 5A7QA 2OS2A 5FZAA 3ITQA 3OBTA 1O6UA 5I0DA 5DQ0A 1FX5A 3NNMA 3NMBA 4BIOA 4ZKTB 1ALYA 5L73A 1BBT1 3HBKA 4FFHA 2GN3A 2MEV1 4LITA 3JB8A 2Q5TA 2VOKA 4DUXA 2QVSB 4JV4A 1OLQA 2V5YA 1G8WA 1OUSA 3DV8A 5GZFA 2GH2A 2PYTA 3OGJA 1FOD3 3PNAA 5EWSA 3ZFGB 1H2KA 1RMU2 1W6QB 3LZZA 4A7ZA 3VBRB 3MIEA 1CAUB 1NKGA 2P5BA 4GKXA 4BDVB 2ZS6B 3ACHA 5JOZA 5T52A 1POV1 2ID4A 5B4NA 1XNKA 3GZEA 2RS51 1LU1A 2WAOA 4LO4B 5FZ4A 4PDWA 1K5JA 1GOHA 3PIJA 4LBQD 4CUCA 4PBOA 1RUJ3 4PI2A 3NSTA 4XFIA 4W6YA 5FYVA 3V65A 4A3XA 2ZX3A 2VCBA 4Q4Y1 5LA2A 2V73A 3B94A 3ZYJB 1JI6A 5JMOA 1AR92 2ZZJA 1F15A 4LHNA 4BA6A 2NN8A 3MF6A 5CB7A 5KC5A 5FYHA 5C70A 4HXCA 1NUKA 3H1YA 1FPN3 5BNNC 4XAAA 5HXMA 4TLFA 3CF6E 1RHI1 4W6XA 5G05L 3HD8B 3NAPA 4FQZA 1O5LA 5FYIA 2D3SA 2YDEA 3T1LA 3WF3A 2R1BA 3QH6A 1UY3A 5A7NA 1YFUA 3IDCB 2WAAA 3DCQA 4HSLA 4DFSA 1JYNA 1COV3 4BIFA 4UF0A 1RUI2 5J3UA 1CPNA 1UN1A 2EALA 2H6BA 1DIWA 4S2DA 5FYYA 5JCTA 2Y0IA 3IIIA 2ZEYA 5LWBA 2JE8A 2RS12 1H8VA 4CCDA 1UAIA 3BPSA 1ZBE3 5FZIA 1K45A 1RUG1 1Q5OA 1QJU2 5B4XA 3T4VA 3WNPA 1GOFA 3NV3A 1QJY2 4Y24A 3IWZA 1MQTC 5C9AA 4JAAA 1ND3B 2V72A 1DQ2A 3I8TA 1UIJA 2JDPA 1ZYBA 3AVRA 5I0RA 3AFGA 1US2A 2PAKA 2RJLA 1LGCA 1TMF2 1UX6A 3LCPA 4IEOA 3AKPA 4KG0A 4GJZA 1YWKA 4TLGA 2XLAA 1GR3A 4XBNA 4I0BA 4XFAA 3WDTA 2WYFA 1WA6X 4NIIA 1EUUA 1EPWA 3FMGA 4XIOA 3BN6A 3GJAA 3B9IA 4GMP3 1LENA 2RMU1 4GWJA 4HLTA 5CU1A 5D1IA 1HV0A 1T6BX 3USUA 4QMAA 4P9XA 3JQXA 1CJDA 3GZAA 2RS32 3E97A 1WBFA 2VOTA 3KV5A 1W03A 3NV1A 3VKNA 1FV3A 2WA4A 3RJ2X 3ZPOA 5F9TA 2A75A 3LDKA 4DXRA 2BWAA 4ARXA 2A3WA 4ASKA 2Y34A 5CFDB 2CWSA 4WVMA 2VNVA 3VHPA 3JZVA 2FDKA 1WW6A 1XB9A 3R4SA 3VHNA 2QQMA 4OHYA 4AAXA 2XKPA 3PVEA 2HBTA 4JKKA 5CKMA 4MHUA 1CQ9A 2IFRA 3RVHA 4LBNA 1WLWA 4IV3C 1BCXA 4FO9A 4Q2FA 3RNSA 2Y6HA 3LEMA 1J58A 1QXJA 1YJKA 2XQRA 4XW3A 4LNVA 3WLUA 4YLZA 3ZFGA 1E5HA 3KQRA 4FTBA 3I3MA 1W6QA 4IXLA 3OGSA 2C9KA 3G6JB 3VBRA 1CAUA 2WUHA 3HVDA 3KT7A 4Q4Y2 5CIRA 5I8YA 1XOYA 2YBSA 3WW2A 2D5HA 2C26A 1G9CA 1W8TA 4C0HA 2WC2A 5FY0A 4AFBA 2B8MA 2F4PA 2RDSA 4QQOA 4DB5A 5FOJB 1N1VA 3DL3A 1D2SA 4R4ZA 1H2MA 1YC61 2RHPA 4A41A 1SDDB 1EV11 1UPIA 4Y3OA 5LA0A 2P3KA 4XF3A 5JXIA 2RS13 1W9FA 3IN9A 2W2IA 4QPWA 2ZGKA 4JCKA 4QM9A 1S0BA 5JMCA 2D97A 1PMJX 1PX4A 2RDNA 4LEJA 4DS0A 3LB9A 4UXAA 4X8NA 4Q4X2 3HBZA 1IS5A 3U11A 3KCXA 1OA4A 2BU9A 3H8XA 3N9PA 1RUG2 3TB0A 4MUVA 1KDKA 3FLPA 1A34A 1RUE2 1TMF3 3GCWA 3WVJA 3M1HA 5FZFA 3WINE 4RS5C 1GKBA 1RUF1 3FJSA 3UK9A 2E7TA 5CG8A 1R092 4QX3A 4UW4A 3H7JA 3NL1A 2VMCA 3PUSA 3OJBA 3WDWA 1UY1A 4Q29A 2ADDA 4X6QB 3TNQA 1SQ4A 2KD7A 1N1YA 3R4DB 4IEYA 2J22A 1PK6C 1UMIA 3UL2A 4R4XA 2RS33 1GMMA 2ATFA 1W8FA 1ND3A 2FCVA 3DN7A 3K2OA 3DF0A 4HETA 3O0VA 4QPIC 2VZSA 1WW7A 1ENQA 1R1A3 5FLHA 3TNPB 1UOJA 4DRRA 5C5TA 1W99A 4INDA 2XLGA 2VZVA 4QB1A 2VPVA 4CXXA 2C6SA 2Q0AA 3ABZA 1PVC2 4BWOA 1A8MA 1QNWA 2WINB 1KEXA 2VVEA 3PU8A 4AK3A 4LT5A 3FFZA 3CHXA 3SEPA 2BRTA 3THCA 2XJVA 4ATFA 1DYOA 4M3CB 1SMVA 2YC2A 4AI0A 4FTSA 1HDKA 4Q8LA 2CAVA 2E63A 2VH9A 4QKNA 3AZXA 5FYTA 4H14A 3LA3A 2WQ8A 1IOAA 3H50A 4XXPA 2DURA 2ZHNA 2VXRA 1WCQA 1OKQA 3TN93 4D8MA 4AHWA 1KRIA 3HQXA 4LKDA 4Y22B 5JR2A 3OPWA 1G9DA 3SLIA 1WZXA 4QQLA 5HBAA 2C24A 2VGDA 5CFDA 4XBLA 5JSOA 3TEWA 3WQ0A 3GYDA 3MIDA 4CYDA 3AVSA 2VZRA 2ZX0A 4UW5A 1OLRA 4XF1A 1HB3A 5KXCA 3RZKA 2A70A 4CU7A 3MI8A 2IC1A 3I2GA 2PHXA 4CP0A 3W5NA 3Q9OA 5FYMA 3HN1A 1AR63 1LHWA 1C28A 1W8OA 2DUOA 4OI2A 3VB9A 3DECA 4IV1C 2R061 1AJKA 5JI9A 1MEC1 3VDBA 4B4QA 4OHVA 2RDRA 2ZTNA 3HEIA 4COZA 1UYYA 4KL1A 1IKQA 3KV9A 1J3PA 4XFFA 3IAPA 1YFWA 4A42A 2HWB1 4C90A 2D3RA 4Q4X3 2UWAA 3QD6A 1NT0A 2KM2A 4RN5A 3RPQA 3T08A 4IL7A 2X5IC 2JWPA 3B9CA 4NAOA 1XRUA 4PF5A 3ILRA 4XF0A 5EIYB 3PMEA 2W92A 4IGOA 3WY6A 5FY4A 1RUE3 4B1MA 4FOQA 4DUVA 1GOGA 1ZZ8A 2X29A 4KQ7A 5KHJA 2WNEA 4QT6A 1H6XA 5DAQA 1NA1B 3TYJA 2W1WA 2WS91 1R093 3O0XA 4C1WA 2OYZA 2OZ6A 2QTWB 4JX0A 1D4VB 3PU3A 2PLV2 3AYEA 4UFJA 4CP9B 5JDBA 1Y7BA 1QEXA 4FOVA 5GLTA 1LODA 2Q1MA 3ORJA 3U4XA 5FZ9A 5FZ3A 5C3QA 3ZN4A 5JLVA 3GZUC 2YPDA 2VNOA 4WVZA 4LBJA 2B9UA 1J3QA 2JENA 3DXUA 2WJSA 3KWVA 1L7RA 4ZXEA 3ZFFC 1OVSA 4M00A 3O0WA 3ZX7A 1NX9A 3AP7A 2YGLA 3I97A 3BKZA 4C91A 1QHDA 4KWKA 4YSFA 1ZZBA 1UZ0A 2P1BA 1PVC3 2P2KA 3TEYA 3VD3A 2JDYA 1J59A 1UZWA 1XYPA 2OZJA 4LULA 4QHOA 2WQZC 4CCJA 3FZ3A 2YU2A 4AFAA 5LW9A 1JODA 3KB5A 3N9QA 2RVAA 1WW4A 2E32A 1Q43A 5LATA 1SLAA 4OQ9A 3H1MA 2ZAHA 3CNAA 4CDUB 2C5DA 3PVBB 4Y33A 4M4PA 1VE0A 2ZHKA 1I5PA 2ET7A 1VBE2 1PO21 2FHRA 4QQPA 4QU1A 4FAHA 1XNBA 4QDQA 2ZGNA 2YB7A 3HR9A 2ZAAA 3SISA 3T2QA 2QZ2A 1X82A 3DGTA 3WNLA 1V00A 4W50A 4DZGA 3WDYA 2YBPA 1VBA1 4N9IA 1PZ7A 2VW1A 3PL0A 2D40A 4LKEA 4YWAA 3W9AA 2G19A 1RB8G 5LBFA 5JPMB 1ZBA3 4PLMA 1YHFA 4PCRA 3I2KA 5FAXA 4C0BA 5LRSA 3T3YA 1SLIA 4M3CA 4HPKB 1UXZA 3KCYA 2DCJA 4LE4A 5FLIA 4KU8A 2RG4A 4DY5A 5T54A 2D98A 3HN3A 1CJPA 5CISA 3ZYPA 5FUPA 1W9WA 4Y22A 4CUAA 1JUHA 1MPXA 4MOAA 3FLRA 1LESA 2DVDA 3U4SA 4YG6A 3NO8A 1JTZX 4LA3A 1VMFA 2R062 4BZ4A 1YQ6A 4Y5SA 1O8PA 5FTTC 4A44A 1AR81 3Q8CA 3N7KA 3RYRA 2ERFA 1C8M3 2HWD3 2W0XA 4H3WA 4A2UA 4E2SA 3VUOA 3LE0A 1GZWB 1XBFA 4OUSA 4AWDA 3EBRA 1WWYA 1AF9A 3E6BA 3O1RA 3THDA 3I2IA 4NN0A 2PLV3 1GICA 5AC91 3T0AA 3I2FA 5ISLA 4M0NA 1LOCA 1IPJA 4CVUA 1XSRA 5A3NA 4CEYC 1XE7A 4FOWA 2VXJA 2D6LX 5FPZA 5LA9A 1H9PA 5GLUA 1CGPA 3UETA 3WW4A 3Q8AA 2WS92 3BB6A 4XJUA 4YVSC 2ENRA 3AMQA 3IDAA 4FPHA 4XVHA 3A7QA 4XAEA 3AKRA 4EN8B 1I1EA 4FPCA 2UURA 4UBGA 1JW6A 2DUPA 2BZDA 2XDVA 4GA9A 3V64A 4PF1A 3AZZA 2BV4A 1RINA 1HRI1 4YZ1A 1PIV1 1GZCA 1NA1A 4YGEA 1BKZA 3RDIA 3W58A 3JU9A 1AR73 5A3UA 3RYKA 4MGIE 4RL7A 4CP9A 2BOJA 2ORXA 3I59B 4ZS2A 1GFF2 1AXYA 3OUJA 3B69A 4GH4B 4XBQA 4DUWA 3QH7A 2WO2A 2WZR1 4OYUA 1VBE3 4OFGA 3BOWA 2Q8EA 1N47A 2Y26A 4J25A 4YGCA 1ND2B 1IKPA 2ZEZA 3CJXA 1N1TA 4DQAA 5FDBA 3GDBA 4FP3A 4Q1PA 3UNPA 4YG0A 1W2OA 5F5CA 4B8EA 1SFPA 1PO22 3LF7A 4K6BA 3UESA 3VZKA 1DCSA 2SBAA 4K1ZA 2JICA 4QX5A 2IXKA 2PHDA 2RDQA 1J83A 2XL7A 3QLQA 4HN0A 1OQDA 1YUDA 1FOD1 3J8F3 3QACA 1F8VA 5FUNA 5A3MA 5IFTA 5LRRA 2QCSB 3L9JT 4HZFA 4JTNA 4CDUA 3LOBA 2VQTA 4ES8A 2HWF2 4A6SA 4ZU7A 4L0PA 2VQUA 4D6QA 4Y4YA 5IVJA 2ZMKA 4IGQA 5FJHA 3K77A 1UOGA 5JOYA 1RUJ1 3POJA 4L8QA 4OUMA 3VKMA 2AH2A 3KV4A 2VG9A 3G7DA 3WOGA 2VMEA 4GJYA 3WNNA 4E9KA 1R1ZA 3NKTA 3OB8A 4LBOA 3I3QA 4YM3A 1POV0 2EXIA 4MGTA 1URXA 1YQ5A 2GC3A 3ZSLA 2BNNA 3IT8A 2VE1A 1Y4WA 4HPKA 3DYPA 4D69A 1EPZA 5JXGA 3OPTA 1LTEA 1LU2A 5JZGC 3IDEA 4JKLA 1W6MB 1C3HA 1FPN1 3OPZA 4YW7A 3U78A 3KV6A 5DAVA 2R073 1G9BA 2VZTA 3L2YA 5DZGA 3FBMA 3M7AA 4YW1A 4BXSV 3URFA 5FZGA 1TVGA 4XMAA 1ODNA 3P5BA 2VOVA 2VZPA 4EJRA 1LHVA 2Z79A 4WVWA 4GWNA 1VPHA 4NRQA 1COV1 1TNFA 1DYKA 2K2SA 2X5IB 3DYMA 4OULA 3CEWA 2WO1A 4E8CA 3RJRA 1XC6A 3O14A 4NHLA 2WABA 4FT8A 2GC1A 4DXSA 1S0DA 1ZBE1 1V6JA 2A6ZA 3ACGA 1GZWA 2VTXJ 2B4KA 1NAEA 1W8UA 2YPJA 3LSDA 3OD4A 4XE9A 2EIEA 5F2SA 4BQ3A 4IEPA 2B7YA 4HOOA 4RQPC 4LIVA 2CDPA 3HPNA 1AL0G 4EYUA 2DFCA 4EROA 1ZM1A 1PIV2 4ET7A 3WNXA 4YG3A 1GBGA 1AX0A 2DTYA 3MW2A 1NQDA 4TWTA 3H7YA 3MPPG 4AFCA 1LOEA 3E5UA 4IERA 4LHLA 3ZXLA 3LWCA 3ZFFB 2A73B 3OGVA 1O7FA
chains in the Genus database with same CATH topology
2CHHA 2JDHA 5A6YA 1OXCA 2BOJA 2JDPA 1W8FA 4CE8A 2JDKA 5D2AA 1UQXA 4AOCA 2VNVA 4UT5A 2JDUA 3DCQA 1OURA 1OUXA 1GZTA 5A70A 1OVSA 2XR4A 2JDNA 2WRAA 2BOIA 2VUCA 5A6XA 5A6ZA 5HCHA 3ZDVA 1OVPA 1OUSA 2BP6A 2VUDA 2WR9A 5A6QA 2JDYA 1UZVA 2BV4A 2JDMA 1W8HA 5A3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHH A;  2JDH A;  5A6Y A;  1OXC A;  2BOJ A;  2JDP A;  1W8F A;  4CE8 A;  2JDK A;  5D2A A;  1UQX A;  4AOC A;  2VNV A;  4UT5 A;  2JDU A;  3DCQ A;  1OUR A;  1OUX A;  1GZT A;  5A70 A;  1OVS A;  2XR4 A;  2JDN A;  2WRA A;  2BOI A;  2VUC A;  5A6X A;  5A6Z A;  5HCH A;  3ZDV A;  1OVP A;  1OUS A;  2BP6 A;  2VUD A;  2WR9 A;  5A6Q A;  2JDY A;  1UZV A;  2BV4 A;  2JDM A;  1W8H A;  5A3O A; 
#chains in the Genus database with same CATH topology
 1GP6 A;  2XJT A;  4Q4V 2;  1WME A;  3PTR B;  1R64 A;  2ADE A;  4NOT A;  4FPF A;  3MLL A;  5I93 A;  3D8C A;  4GMP 1;  5FZD A;  3VZO A;  3ZVX A;  4R9B A;  3WUD A;  3T09 A;  5C8W A;  1LR5 A;  2PAM A;  3I59 A;  2ZBJ A;  3LFI A;  5CA6 A;  1DBN A;  1W6O B;  4GH4 A;  1XE0 A;  2TUN A;  5JWP A;  5HI0 A;  2VZU A;  3M3O A;  1BMV 1;  1WMF A;  2VNG A;  2C9A A;  2HWF 3;  3GM8 A;  5EV7 A;  3VBU C;  4CTE A;  5GZC A;  2QQN A;  2FDI A;  3MPB A;  4B3N A;  2PHR A;  3O1M A;  3T0D A;  2VCM A;  1KFX L;  2DBN A;  1ND2 A;  3N9M A;  5FO9 B;  1KXG A;  1V6N A;  2P4E A;  4S2G A;  4MHR A;  1YQ8 A;  2JKB A;  1OI6 A;  2GMM A;  5FCC A;  4M3C F;  1SFN A;  3ZXA C;  4YGB A;  1RUC 3;  3LA2 A;  5KXE A;  3H0O A;  4AVC A;  3UKV A;  3EJK A;  2K46 A;  1HV1 A;  2GZW A;  4RHV 2;  2VR4 A;  1XYO A;  1HLC A;  3FX3 A;  4OUE A;  2ZHL A;  1OUR A;  1K5M B;  2VUL A;  2Y33 A;  3BTA A;  3FC0 A;  3MHZ A;  2XKO A;  4QU2 A;  5BYN A;  4FSJ A;  3FFQ A;  5DZF A;  4OHX A;  5F5Q A;  1PVX A;  2I07 B;  5FY9 A;  1YFX A;  3K3O A;  4KWU A;  4PQQ A;  1QJF A;  2EA7 A;  1V6L A;  2F17 A;  1W2T A;  2E33 A;  3OUI A;  3PJQ A;  3PTY A;  3WDU A;  5LA1 A;  1Q8Q A;  5J98 B;  4A3Z A;  2RM2 2;  2CDO A;  2Z5W A;  2KXL A;  2H6C A;  4HMZ A;  1EYB A;  2RS1 1;  1WLC A;  3U10 A;  5KC6 A;  4FCA A;  5I91 A;  1ENX A;  2JDA A;  4GWM A;  1ODM A;  2WFP A;  1JZ6 A;  3O1P A;  4BHP A;  5JI7 A;  1W6M A;  3OUH A;  1IS3 A;  3OYW B;  2CWM A;  5EZW A;  4XAC A;  5F3I A;  1ZBE 2;  2XXZ A;  3HAG A;  4F8A A;  4BLJ A;  2QQK A;  3PUI A;  1TMF 1;  4XJA A;  4FPE A;  2EVX A;  4YVS B;  3E1F 1;  4QX0 A;  1P8J A;  2X5I A;  1BZW A;  5EJZ B;  2BJS A;  5FPU A;  3R0R A;  5FLJ A;  5CAD A;  1AHS A;  4COU A;  4TN7 A;  3A0K A;  4I09 A;  4Q4V 3;  1UY4 A;  4AED B;  1AYN 2;  4Z07 A;  3KGZ A;  3WP5 A;  1MS8 A;  1MS9 A;  5DG1 A;  2ORZ A;  5JIA A;  5FFO C;  3K4A A;  4UOJ A;  3WD5 A;  3WQB A;  4GIQ A;  2RS3 1;  2WL1 A;  3ZLI A;  3M70 A;  3VKO A;  1IS6 A;  1JZ4 A;  3QBQ A;  4YZ2 A;  3WNO A;  2OQ7 A;  2RR1 3;  1R1A 1;  1KDM A;  1V6I A;  2VUJ A;  4Y1V A;  5F5I A;  4XYX A;  4CPB D;  3AFK A;  2OXB A;  2VM9 A;  2LUW A;  4HVR A;  1WMX A;  2OPK A;  3SCF A;  3NVC A;  2W5F A;  1X8M A;  5E88 A;  3VBF C;  2CHH A;  4A45 A;  5J1X A;  1YLL A;  5JPN B;  3ZFF A;  4BLI A;  4Y5T A;  4IW3 A;  4DOU A;  2QKD A;  5FXZ A;  5A6Y A;  4M3C E;  1NCR B;  4MLO A;  1BMV 2;  2LAL A;  4ZON A;  4PI0 A;  5GZD A;  2G9G A;  3CU7 A;  1HJG A;  3UJQ A;  4UBH A;  5DN2 A;  5CEH A;  1A6C A;  4RHV 3;  4R9C A;  3MF9 A;  1JXN A;  3TN9 1;  1DF0 A;  1S55 A;  3CL1 A;  1A78 A;  2TEP A;  4BQ1 A;  3K51 A;  1VBC 2;  4YFW A;  1S0C A;  1W6O A;  5FJK A;  3KSC A;  1MVE A;  4Y1U A;  1Q3E A;  1TZO A;  3ELN A;  2WNU C;  3SH3 A;  3S5Q A;  4AVA A;  1XXN A;  1MS3 A;  1UL9 A;  1ZX5 A;  1GNY A;  2Y6G A;  5H9P A;  2DVB A;  1UOF A;  1W04 A;  2JD9 A;  2PHL A;  2ZGO A;  3MDP A;  1W9Y A;  2WQ4 A;  2RM2 3;  4LOT A;  2ZEW A;  4XDO A;  1AR6 1;  5GZG A;  2CNA A;  4QDS A;  1SLL A;  4RR3 B;  1HQN A;  5J09 A;  4Q5O A;  2Y6L A;  2R30 A;  3RMY A;  4AF9 A;  2BBA A;  1GAN A;  1TME 3;  3AMN A;  1LAJ A;  1NA1 C;  4BM8 A;  3D4K A;  1K5M A;  3JB4 C;  1OD5 A;  4OHZ A;  4Z2W A;  5IAX A;  5JZG B;  2EID A;  2ZZQ A;  1WGP A;  3AZW A;  4Q4X 1;  2GDF A;  4TYS A;  2E6V A;  4FQ4 A;  4JC1 A;  4F3J A;  4BME A;  4UW3 A;  4FFG A;  2OQ6 A;  1C5H A;  1OQ1 A;  4XHX A;  5FP9 A;  3RWN A;  2UWB A;  1RUE 1;  2JB4 A;  1RC6 A;  3WG3 A;  4CRQ A;  3C3V A;  3GJB A;  5JVV A;  1R08 2;  5C4W C;  1R09 1;  1UU5 A;  1W8N A;  5EJ1 B;  3X29 B;  4JZR A;  1WCK A;  5BNO B;  1JOJ A;  2EXH A;  2LRO A;  4LK7 A;  1OT5 A;  5DUW A;  2EIG A;  1AYN 3;  2ZA9 A;  3ZXG A;  3FE5 A;  4FP2 A;  1VAK A;  5CBL A;  2O1Q A;  3K3N A;  3PIG A;  2GMP A;  4QKF A;  5TSW A;  5JAX A;  1DQ4 A;  2R7E B;  4RQP B;  1O5U A;  3WP3 A;  3OYW A;  1UXX X;  1RJ7 A;  3I3B A;  4XFH A;  1UZZ A;  4BIS A;  1UMZ A;  1HRV 2;  3U37 A;  2Y6F A;  4N43 B;  1UMH A;  2PXJ A;  4CDU C;  4OLL A;  3BOP A;  4PIZ A;  5ANN A;  4YVS A;  4FFI A;  4LMF A;  5EXO A;  1PVC 1;  4P9J A;  2QQU A;  3UKN A;  2A6W A;  1VRH 3;  2AEZ A;  2IZW A;  3EQE A;  5K4L A;  3POB A;  1ZA7 A;  1QJX 2;  1AUY A;  1R1A 2;  3OCP A;  3JXS A;  1RIT A;  4AED A;  4JRL A;  1GWM A;  3OOX A;  1DZR A;  2GAL A;  1Q8P A;  4AHX A;  3SQO A;  1GQG A;  5K8S A;  5KXD A;  1CIW A;  3KM5 A;  4I02 A;  2GND A;  2VUC A;  1LHU A;  1DU3 D;  1QKQ A;  5GZE A;  1FYU A;  1VBC 3;  1YIP A;  1NOV A;  1JYC A;  2R6Q A;  4G3Y C;  5EFU A;  2OPW A;  1W8H A;  2BEO A;  3LIG A;  1SBD A;  3MUY 1;  5FYS A;  3VBU B;  4EZH A;  2BYV E;  4O9E A;  2D6K A;  4XQD A;  5GAL A;  3TN9 2;  2WBK A;  1NE6 A;  3IZO A;  1BEV 2;  2W91 A;  1FMD 2;  3HJR A;  1SPP B;  4Q8K A;  1ZBA 1;  2G9Z A;  3TWI A;  2BUK A;  4Q4W 2;  4YW5 A;  1NCR A;  3U07 A;  4JQT A;  3UGF A;  3I54 A;  3NKG A;  4Q0U A;  3MLJ A;  3ZYR A;  5I0T A;  2ARB A;  3T2O A;  2ZX1 A;  4QXH A;  4AQT A;  5IJR A;  1ZZ6 A;  4OI4 A;  5L9B A;  3I2O A;  3FBY A;  1GZT A;  3LEK A;  3ZIW A;  1MZE A;  2K0G A;  1PNF A;  3LDR A;  1O4T A;  3USS A;  4IEW A;  4BYY A;  5FZ8 A;  3V0A B;  2WN2 A;  2CSG A;  3J9S A;  4YM1 A;  4LJH A;  3S0M A;  4PLO A;  5JXJ A;  3RZJ A;  5HCH A;  5HV0 A;  1MZF A;  4Z92 B;  4FPY A;  2BFU S;  1W2N A;  1AR6 2;  2A1X A;  2EXK A;  4WM8 B;  3RZZ A;  3K75 B;  3AXE A;  4IE0 A;  2B46 X;  3N4M A;  1VLN A;  5BPX A;  1FAT A;  5FY7 A;  2HWD 1;  1C8M 1;  2VMH A;  1LHO A;  3AX4 A;  1QNY A;  4KNC A;  4CCL A;  1JU3 A;  3AJY A;  1PM7 A;  3O1U A;  4L9B A;  1R08 3;  4QD2 A;  4KI5 M;  2D44 A;  3HWJ A;  4XJ9 A;  2ZX2 A;  2O8O A;  1TEI A;  1WCS A;  2YC4 A;  1SCS A;  2OUH A;  4A7K A;  2PLV 1;  5C3P A;  2OA2 A;  3DKW A;  1VP6 A;  4RR3 A;  1X36 A;  4H55 A;  4QKD A;  4XET A;  4ZHN A;  1H1M A;  2W94 A;  2VBD A;  4G4F A;  5JZG A;  1ULD A;  2XWB B;  5H9R A;  2E31 A;  2JEM A;  4K9S A;  1AXK A;  5F7U A;  5DAW A;  1CZT A;  4N53 B;  3FHI B;  3AL5 A;  4J1X A;  1OBN A;  1UY2 A;  4AL9 A;  1HRV 3;  1VAV A;  4GH4 C;  5FYZ A;  1YNA A;  2QNK A;  2N7G A;  4LOR A;  4YFZ A;  1TG7 A;  4ITC A;  3ZO0 B;  4FAG A;  3ZXD A;  3POY A;  2W47 A;  4H2A A;  4EN0 A;  4AI2 A;  1AL2 2;  2RV9 A;  2ES3 A;  1AR7 1;  1ND2 C;  3ZYG A;  5I8T A;  5JOW A;  1C1F A;  1Q8O A;  1QJX 3;  2CTV A;  4XUP A;  1GNZ A;  2W68 A;  4MGY E;  5A7S A;  3PVN A;  5BNO A;  1DDL A;  4JKM A;  3ZYF A;  1UKG A;  2VO5 A;  3KLS A;  5IAT A;  3JBG 3;  4HAN A;  2ZGT A;  3VN4 A;  2DTW A;  4IEV A;  4RQP A;  5FYC A;  3WR0 A;  1VBE 1;  2Z4F A;  3BTX A;  2A6V A;  1JYI A;  3LGR A;  1RUO A;  2E51 A;  5KBF A;  3AZV A;  4RFT 0;  3WQ1 A;  2JG9 C;  3VL9 A;  4N43 A;  5J37 A;  1S0F A;  4AI9 A;  3PUH A;  3DUI A;  2R49 A;  2XJR A;  3OBZ A;  5D8A B;  1VRB A;  3VBF B;  5IT6 A;  4XFG A;  1BEV 3;  2VVD A;  1FMD 3;  2WT0 A;  5A1F A;  1OA2 A;  2HWC 2;  4JHT A;  4D6R A;  3WT3 A;  4Q4W 3;  1SG3 A;  5H9S A;  1F5F A;  1UKR A;  1OUX A;  2RE9 A;  1WW5 A;  2WNV C;  3J8F 1;  2PHT A;  2WSU A;  4QHZ A;  2AZ5 A;  1LOF C;  2GN7 A;  3WNM A;  2ZGR A;  3BAL A;  5F2W A;  3ACI A;  3ZIX A;  3CZJ A;  1H8T B;  3BIW E;  1ZBA 2;  5HXV A;  2P6H A;  3KT4 A;  3M8L A;  2ZX4 A;  4DEV A;  5T3N A;  3D3A A;  5B2G B;  1JHJ A;  5FPL A;  2VCA A;  5K7P A;  2I74 A;  1U5Y A;  2G1M A;  3J4U H;  3BCW A;  3VBU A;  3LDB A;  3LQC A;  3VZN A;  2WNU B;  3W5M A;  1O3R A;  5IK5 A;  4Y4R A;  1D2Q A;  3NNJ A;  1OD3 A;  4UWD A;  1ASJ 3;  4CE8 A;  5LY1 A;  1SPP A;  4XUO A;  1AJO A;  1OFS A;  2XJS A;  1IS4 A;  1BJQ A;  5FMO L;  4Y26 A;  1CPM A;  3TBD A;  1AYM 2;  2GME A;  3POF A;  4MVT A;  1IQA A;  2UYB A;  3ETP A;  2XJP A;  3PVO A;  4CEY A;  3MIC A;  3V0A A;  2JEC A;  1GQH A;  2IWG B;  2R07 1;  4MX3 A;  2HWD 2;  1C8M 2;  2R16 A;  3AM2 A;  2B9V A;  5JIU A;  4I2O A;  3MV0 1;  4AYU A;  2FCU A;  4YW4 A;  2ZGQ A;  3C7O A;  1X33 A;  2ZGS A;  1F2N A;  4TXW A;  3ZMO A;  4LPL A;  4WM8 A;  2NMN A;  3KVA A;  3J7L A;  3RWK X;  1KS5 A;  3NV2 A;  1W05 A;  5FY5 A;  2VU9 A;  1UPS A;  3SH4 A;  3UJO A;  2AEN A;  4DIQ A;  2JG8 B;  1RUN A;  1F4A A;  2RJK A;  1BLZ A;  1AL2 3;  2XHN A;  5F6K A;  5A33 B;  4QWN A;  3IIA A;  3O1V A;  1GWK A;  5C4W B;  2YFZ A;  4BQ5 A;  2X53 S;  1VB4 A;  2QQV A;  4LKF A;  3OBR A;  2W3J A;  4TZD A;  3VZJ A;  1WCU A;  2I2S A;  5A6Z A;  1S2K A;  2XVG A;  4FI9 A;  1D4M 2;  1QU0 A;  1DQ1 A;  4N9H A;  2XWJ B;  4YW6 A;  1K3I A;  2GC0 A;  5FZO B;  5A7W B;  4KG8 A;  4YYO A;  4AEJ A;  3CJI C;  1AR7 2;  4XOG A;  2YC0 A;  2ZGM A;  3N7M A;  3ZYI B;  4OI0 A;  2QZ3 A;  4N53 A;  1TQ5 A;  3OEB A;  2NP0 A;  1U5X A;  4DXZ A;  4LA2 A;  2YU1 A;  5FMC A;  2QJV A;  4O7X A;  5FP3 A;  3JD7 3;  1GWL A;  2R0F A;  1MZ6 A;  2PMW B;  5IWF A;  4PT6 A;  3NJX A;  3WZ1 A;  2FCT A;  5GLZ A;  4BK5 A;  1XSQ A;  3PUQ A;  2HWC 3;  5FPX A;  2BNO A;  2VZQ A;  3J7N A;  5SV8 A;  1HN1 A;  1OHF A;  2TNF A;  3CQO A;  4DEQ A;  2WT1 A;  4AI1 A;  2O8Q A;  3WHU A;  2WII B;  1LOG A;  4FXK B;  4F83 A;  1ZZ9 A;  5C8C B;  2HWF 1;  4GMP 0;  3CZU A;  4XTP A;  2XUM A;  5J96 B;  1QF3 A;  3J8F 2;  4URT A;  2W1Q A;  2VJX A;  4LK6 A;  1K5M C;  1DG6 A;  3HNM A;  4ZZ8 A;  1O3T A;  4W65 A;  1CZS A;  1JZ5 A;  4AHZ A;  4WVV A;  1RUC 1;  1UWW A;  2E53 A;  5D8A A;  2HEV F;  3VBF A;  2XBO 3;  1QJE A;  4COV A;  2BNM A;  3DPR B;  5FXX A;  5T5P A;  4IUG A;  2DVA A;  4QXK A;  5FZ1 A;  1AYM 3;  2G4I A;  4JDO A;  1XPW A;  4QX7 A;  5FZC A;  3WDX A;  1MS4 A;  3SIT A;  4NPR A;  1CZV A;  1QOO A;  1W8Z A;  1H8T A;  3S6P A;  5LEJ A;  3IBM A;  1QY4 A;  2VL4 A;  1LOA A;  3K4D A;  4NRP A;  5ERL A;  3VBH B;  2PA7 A;  3VDD C;  3SXW A;  3ZR5 A;  1JZ7 A;  1IQD C;  2P3Y A;  2FDJ A;  4QGN A;  5JUV A;  1PZ9 A;  2P3I A;  4NR1 A;  3KMH A;  3H8O A;  4MXV A;  3V0B B;  2F4L A;  2I45 A;  2WNU A;  1NG0 A;  3MGU A;  2R07 2;  3ZSJ A;  4BE3 A;  2VZ1 A;  1GYK A;  1ZVF A;  5J36 A;  1M4W A;  1VBB 2;  2ZGU A;  4YZ5 A;  3U0Z A;  2VNR A;  2D93 A;  2P3J A;  4ISR A;  5FWE A;  1DQ6 A;  4HKL A;  3T30 A;  3ZSK A;  1N1S A;  5IHR A;  3TAY A;  3ES1 A;  1CD3 G;  2V4A A;  1G9F A;  4XF9 A;  1LCL A;  4FTE A;  1RTV A;  1B35 C;  2YZ4 A;  4L92 A;  1MVQ A;  4BQ2 A;  4MXW B;  3AB0 A;  1UCX A;  2EF6 A;  3LA7 A;  1UZV A;  5CZK A;  4AED C;  4Z8B A;  1D4M 3;  1RUD 3;  4YM0 A;  1OF4 A;  2GNB A;  2CY6 A;  4D94 A;  1QH6 A;  5CKQ A;  1PO1 3;  5C3R A;  1J1L A;  2VTX A;  1YFY A;  4R9A A;  5ANQ A;  2DDU A;  1XU2 A;  1W2U A;  3H3U A;  4NWV A;  1VMH A;  4YW2 A;  3C7E A;  1S0G A;  3OD0 A;  4XZP A;  4H7L A;  2FQP A;  2UY8 A;  4J6G A;  1POQ A;  4Q4V 1;  3AC0 A;  3KF5 A;  4CCK A;  1JYV A;  2JG8 A;  1QDC A;  2J1T A;  3OY8 B;  5E89 A;  4D7T A;  3LD8 A;  2ZKN A;  1A3K A;  4I30 A;  1YO8 A;  1T2X A;  3NJZ A;  4LBL A;  5FP8 A;  5FZK A;  4URA A;  5A33 A;  4W8J A;  1Z78 A;  1ENS A;  5C4W A;  2VZO A;  3MFC A;  4Y1X A;  3TRS B;  5F3C A;  1CES A;  1NCR C;  3Q8E A;  2GNT A;  4XJZ A;  2D6N A;  3GAL A;  4NHY A;  3ZKU A;  2FDG A;  3MW3 A;  3NRU A;  1VJ2 A;  2RR1 1;  2E7Q A;  2Z2S B;  2ZKL A;  4O65 A;  5A7W A;  2BW8 A;  5FZO A;  2YRO A;  3D0J A;  1GUI A;  3F2Z A;  2WZP P;  5FWJ A;  5L9V A;  4P02 B;  5IK8 A;  4IE4 A;  5IVC A;  3GZT B;  1OXC A;  4OMC A;  2HWE 2;  1WLT A;  5F3G A;  3AYD A;  5L36 A;  1BYH A;  1MS1 A;  3ZYH A;  5HCF A;  4B7K A;  3BUC A;  2VBB A;  2DCK A;  3KHB A;  4WV8 A;  2JG9 B;  3P1I A;  3PLQ A;  5ABJ C;  2XJQ A;  1O91 A;  3KGL A;  2ZML A;  3HQR A;  4UW6 A;  4PIX A;  4LBK A;  4CP1 A;  1ZRE A;  3AKT A;  5FZ0 A;  2QFE A;  1H9W A;  4L97 A;  5APA A;  4CP2 A;  5FO7 B;  4RHV 1;  4UFM A;  2VD7 A;  5FP4 A;  5FRE A;  1H4G A;  2WNV B;  2YMZ A;  3IM0 A;  4E8D A;  3WG4 A;  2BER A;  5C71 A;  4IEU A;  1NXD 1;  1RUC 2;  2P6C A;  2YFU A;  4L11 A;  5AVA A;  4KBB A;  4OCT A;  1X7N A;  4NRO A;  5C8C A;  5FYB A;  4RR3 C;  3KHC A;  1UOB A;  4LKS A;  4XCB A;  2WLP A;  3VD7 A;  2WWS A;  3EHK A;  4I3G A;  5C3S A;  2DVG A;  4KH9 A;  4K20 A;  1DGW X;  1BK0 A;  1PHM A;  3ZPY A;  4ASM B;  5J7M A;  1UQX A;  3VHO A;  3F95 A;  1RUH 2;  1RL3 A;  2RM2 1;  1DZT A;  4BOW A;  1OLM E;  1HN0 A;  3MV1 1;  1LHN A;  1VBB 3;  1S1A A;  3AP4 A;  2KA3 A;  5FKB A;  1H6Y A;  3N3H A;  1RJ8 A;  1YRZ A;  3DPR A;  3VBO B;  4E2G A;  4R52 A;  2D7F A;  4QHB A;  1DFQ A;  1TME 1;  1LED A;  3MUZ 1;  5A3P A;  2ZGL A;  1JOB A;  2IXJ A;  3JQW A;  1KD7 A;  1EAH 3;  4HG6 B;  2CGN A;  5FZE A;  5CG9 A;  3N7L A;  5BNO C;  3KVB A;  3VBH A;  4MAD A;  1ONA A;  3SHR A;  1NE4 A;  2IVJ A;  3W59 A;  5I8S A;  3U1X A;  3N9N A;  5DDJ 3;  1SBF A;  4CDQ C;  1ULE A;  1OFN A;  3RZM A;  1WD4 A;  3V0B A;  5F8P A;  5EJ3 A;  1CAW B;  1Z0H A;  4CPB A;  4QXC A;  1E5I A;  1L7L A;  2E7A A;  1JZ3 A;  4N43 C;  1QIQ A;  2BOI A;  2VCC A;  4PIY A;  1AYN 1;  1RIR A;  4L99 A;  4E4Z A;  1JHN A;  2WR9 A;  4NE9 A;  3B00 A;  1UYP A;  5CKN A;  4PBP A;  5DUU A;  1ZRI A;  5F39 A;  4MXW A;  1SLC A;  3A21 A;  3LPF A;  4QKB A;  4CDX C;  4OHW A;  4ZXK A;  3TEX A;  4O61 A;  3O1T A;  1UU6 A;  2O0O A;  4UAP A;  3ROU A;  5ACA 2;  3W20 A;  1IZ3 A;  3HNY M;  2Q1F A;  1FAY A;  4M0H A;  2JB8 A;  1SBE A;  2IXL A;  2K9Z A;  3CJI B;  1LB2 A;  1QOS A;  5LBE A;  2HWE 3;  3BTZ A;  1OKO A;  2HLE A;  4HK9 A;  2JDU A;  3NW4 A;  2QQW A;  1OC1 A;  1UX7 A;  2PTM A;  2RR1 2;  4NUB A;  4XC9 A;  1G7Y A;  4WBB A;  2WFF 3;  3IPV B;  2XUE A;  3OY8 A;  4LO6 B;  2Y64 A;  3ZOI A;  2H0B A;  3ZDV A;  1O3Q A;  2A71 A;  3MBW A;  4XQ4 A;  1PM4 A;  2GSY A;  3WW3 A;  4BJ0 A;  2DCY A;  5E16 A;  3POW A;  5K0U B;  3NJV A;  1VBC 1;  2JDH A;  5C5U A;  3HMY A;  1T6G C;  4B4R A;  2HEY F;  2W08 A;  1Q56 A;  2VY0 A;  4Q1R A;  2PN5 A;  1VR3 A;  1FI2 A;  1N3Q A;  3PUA A;  5A3W A;  2BWC A;  2VOX A;  3D5O A;  3R4U A;  4AE2 A;  4YZ3 A;  2Y0O A;  2XHK A;  3QOP A;  3R05 A;  1XNA A;  1XNC A;  1GQP A;  4V2V A;  1V9U 3;  2JG9 A;  1RGS A;  2W9X A;  1F4H A;  1RUH 3;  3O12 A;  5FV3 A;  1H30 A;  1XU1 A;  2ARA A;  1DP0 A;  4WM8 C;  5F6L B;  2Q8C A;  4KU7 A;  1NY7 2;  1Y9Q A;  1JZ8 A;  5LBB A;  2OUJ A;  2H0V A;  3CKH A;  4EQV A;  4ASL A;  4GB3 3;  3AXD A;  1V6O A;  2YYO A;  2JDM A;  3NNL A;  3I4I A;  3KZ4 C;  4HKW A;  1PMI A;  2DF7 A;  2WNV A;  3O5S A;  4JGY B;  4LLO A;  2WN3 A;  3LPG A;  2DYC A;  1LOF A;  1W2A X;  5IK4 A;  1YCI A;  4X8P A;  3NNF A;  3VDD B;  2BGC A;  5LY2 A;  1V70 A;  1X9T A;  3FLT A;  1EUT A;  1G6N A;  4XFC A;  4A7Y A;  4AG4 A;  1TME 2;  2A3Y A;  2D6O X;  4X6R B;  1GP4 A;  3OTF A;  4IES A;  4FPG A;  4XHB A;  4ZU4 A;  5A80 A;  3ST7 A;  5FK7 A;  5KXB A;  3K46 A;  4IEQ A;  2VUA A;  1R08 1;  4HBN A;  4UYB A;  4N53 C;  2QQI A;  1DZQ A;  2QUO A;  3VBO A;  2BP6 A;  3A23 A;  2PQQ A;  1VBD 2;  5FUI A;  4AI8 A;  1BK1 A;  1ENR A;  1PMH X;  4CDW B;  1G86 A;  3ZXF A;  3AYA A;  4AAP A;  3SCH A;  2NLR A;  1CAX B;  1ZZC A;  4AVB A;  1B35 B;  5JR7 B;  5EP9 A;  2ZAB A;  2E26 A;  3J26 N;  2Y6J A;  3N7J A;  1CWP A;  4COW A;  2AAC A;  1VAL A;  1UU4 A;  4HKO A;  4HL0 A;  4QPG C;  4V1P A;  4FBF A;  2Q4S A;  4BB3 A;  2BGO A;  5JSP A;  1HRV 1;  5ACA 3;  1I6X A;  3MIG A;  4AOC A;  1NQJ A;  4PQ9 A;  2NMO A;  4LOS A;  3WCR A;  2OX0 A;  3ACF A;  2B45 X;  3BVC A;  3IAQ A;  2WWU A;  1CAW A;  1FXZ A;  3MEP A;  4XUQ A;  3WUC A;  2IVI B;  4P08 A;  4HVQ A;  5KR7 A;  3RRD A;  1LRH A;  1QQP 2;  2ZMN A;  1QJX 1;  5HCB A;  1XNT A;  5LAS A;  4P5H A;  1XND A;  3GCX A;  5FBJ A;  4BU2 A;  1MR5 A;  5D8A C;  4M4R A;  2CU5 A;  3JBG 1;  5EPA A;  1Z7S 3;  5DAB A;  2WA3 A;  4XDQ A;  3UKT A;  4UFK A;  1VRH 2;  4QX8 A;  4BH9 A;  5AFB A;  2R04 2;  3A0N A;  3ZMN A;  4GXL A;  1C1L A;  3WV6 A;  3S30 A;  3V56 A;  4NIA A;  4NHM A;  5FPA A;  3RZG A;  1G9A A;  3GBF A;  3VD5 A;  3ZFE C;  4NHK A;  5FR3 A;  1H8T C;  3CJI A;  4CXY A;  4XAB A;  1DGW A;  4FFF A;  1B09 A;  1BEV 1;  1CX4 A;  1FMD 1;  3I7D A;  2JIG A;  1TNR A;  1W0P A;  2WRA A;  2W46 A;  4CCE A;  1HQL A;  2LW8 A;  4Q4W 1;  4I3P A;  5ABJ B;  2PHF A;  1HB1 A;  2LM3 A;  3GF6 A;  3IPV A;  2F6B A;  1YIF A;  2AUY A;  3OEA A;  1ZNP A;  2J1A A;  5IVE A;  1GSL A;  1WCD J;  3KF3 A;  5FOB B;  1O59 A;  4A6O A;  2DUQ A;  2AEY A;  4IEZ A;  3VD4 A;  2HJI A;  4WM7 C;  3ZR6 A;  1YI9 A;  5C33 A;  4AGG A;  5IUQ A;  4P9G A;  3T1M A;  4RD7 A;  1HXS 3;  2MPF A;  2A5Z A;  3DYO A;  4ONU A;  1Q8V A;  1RED A;  1FNY A;  2YBK A;  1ZRC A;  2SLI A;  1UNB A;  3H8U A;  3IB3 A;  1F31 A;  3HT2 A;  2VQ0 A;  3PDQ A;  3UGH A;  4AFD A;  4CU8 A;  4YZ4 A;  3RI9 A;  3AMH A;  3T2P A;  4NHX A;  4YAR A;  1ASJ 1;  1F5J A;  3C7G A;  3ME2 A;  3MYX A;  4EWD A;  2FZ2 A;  2D6P A;  3APB A;  1DLC A;  5F1R A;  1OQE A;  1YQC A;  4H7M A;  4CU9 A;  1VB2 A;  1KFU L;  2GH8 A;  4ISQ A;  4Z82 A;  1VBD 3;  2J7M A;  2OKX A;  3WF1 A;  1S2E A;  2JG8 C;  4KGG A;  5FIX A;  3SEE A;  4AHY A;  3MFA A;  1O8S A;  2XJU A;  4JGY A;  5FP7 A;  5F37 A;  4LHK A;  4XJW A;  1QH7 A;  4BQW A;  4XFB A;  4P9W A;  3VZL A;  3THT A;  2FBE A;  1OF3 A;  2UWC A;  2VAU A;  1VMJ A;  3VDD A;  5FPV A;  2CGP A;  1PGL 1;  3UYJ A;  4ARY A;  4ZY9 A;  2G9F A;  2J1S A;  1H2N A;  2WT2 A;  1F35 A;  2XR4 A;  3FUO A;  1PGW 2;  2CV6 A;  3AP5 A;  5F32 A;  3ZN5 A;  2WDB A;  1ULG A;  2IXI A;  4CDQ B;  1E57 A;  4FPJ A;  1RVF 2;  1W0N A;  3GHN A;  3M3C A;  3UT0 A;  1J1T A;  1AL2 1;  2V4V A;  5G04 L;  4K8F A;  3AKS A;  1QQP 3;  3AKQ A;  3AZY A;  3B02 A;  3VD9 A;  4XQW A;  4DRV A;  3WF4 A;  2EXJ A;  4CDW A;  1NZI A;  1TE1 B;  2FD8 A;  4NRM A;  3WP6 A;  3GHM A;  2E9Q A;  2QQO A;  1MZ5 A;  2PQS A;  2Y6K A;  5A7O A;  1JU4 A;  2C0Z A;  2CAU A;  2ZCW A;  2VMG A;  3CBN A;  1CAX A;  4CA9 A;  3IKW A;  4RA0 A;  1B35 A;  2R04 3;  5C3O A;  1AVB A;  2W1S A;  3W21 A;  3DEM A;  1N3P A;  1JBC A;  4OZX A;  2PEL A;  5K0U C;  2DBI A;  4QAW A;  2D5F A;  3K48 A;  1GV9 A;  4XZU G;  2GAU A;  5GLW A;  3H9A A;  1YXW A;  3THP A;  4LUM A;  1W0O A;  2CL2 A;  4JQR A;  3CLP A;  3JBG 2;  3JD7 1;  4YVW C;  5C8C C;  2JE7 A;  2NYY A;  5J48 A;  2RJ2 A;  1LOB A;  2EAA A;  5FMD A;  3GBW A;  4JGZ B;  4UFI A;  2ZPX A;  1W8W A;  4E2Q A;  1SEF A;  2HWC 1;  2XLF A;  1LGN A;  3WF0 A;  2VZ3 A;  3N35 A;  4GAZ A;  5FKC A;  3KQ4 B;  1HIX A;  2WSV A;  1QXP A;  3M4F A;  4PHZ A;  5IAV A;  1RMU 3;  1BBT 2;  2J1R A;  3WSO A;  1REF A;  4ZPI A;  2MEV 2;  1S0I A;  4OVE A;  3DPR C;  1Y9G A;  1EY2 A;  4AGV A;  5EQU A;  4RSU A;  4LUK A;  3RYP A;  3E5Q A;  4E4S A;  4YRD A;  5C7G A;  1GZ9 A;  3LAG A;  4GZ9 A;  4UFL A;  4IET A;  3VBH C;  1U5Z A;  4CSW A;  1C57 A;  2AYH A;  2PAE A;  1YYN A;  2R1D A;  2JJ6 A;  5FPB A;  2XBO 1;  4AGR A;  1AR9 3;  2RS5 2;  1JYX A;  1US3 A;  2WWJ A;  5ABJ A;  3C7F A;  1FT9 A;  4BCU A;  3VGI A;  1AYM 1;  1ZRF A;  2WZ8 A;  5FXW A;  4AVV A;  4BK4 A;  1CVN A;  3HIF A;  2A3X A;  3EMR A;  4FOY A;  2BBV A;  3LEG A;  5BY5 A;  2YGM A;  2PHW A;  1ASJ 2;  3PUR A;  3ALQ A;  5E8A A;  1YQ2 A;  4QX1 A;  2X8K A;  1RXF A;  4QGL A;  1SLT A;  2VQA A;  4YW3 A;  4ES9 A;  3PHM A;  1OLM A;  2X10 A;  1SCR A;  4UFH A;  4QX2 A;  4CEW B;  3VBS C;  1DYP A;  1RUI 3;  3ATG A;  4DO0 A;  1RHI 2;  4XUN A;  4BXF A;  3CIH A;  4FXG B;  4K40 A;  5T5O A;  2QQP A;  1RVF 3;  4R8H A;  3A22 A;  5LB6 A;  3AMM A;  3ACL A;  4FVV A;  2Q8D A;  3AP6 A;  2VC9 A;  1QJU 3;  3IDB B;  1IGO A;  1UY0 A;  4Q26 A;  4XUR A;  3WCS A;  4D7S A;  5I0S A;  1NCQ B;  1OOP C;  1SHW B;  4CDX B;  5BNP C;  1PGL 2;  1QJY 3;  1ACC A;  1NYW A;  3CO2 A;  3S5A A;  1IHM A;  4JDM A;  4B1L A;  5FZ7 A;  2FMY A;  1H1A A;  1D4M 1;  1RUD 1;  3RSJ A;  4CZS A;  1DQ5 A;  4CCM A;  3HQU A;  4DXT A;  4KWJ A;  3IMN A;  4DY3 A;  1PO1 1;  1PZ8 A;  2DU1 A;  3ILF A;  3J7M A;  5CFC B;  4P9L A;  4LLF A;  4QPG B;  3EO6 A;  4KMQ A;  5DXD A;  3N36 A;  2Y8K A;  4FPO B;  1HB4 A;  3E5X A;  4CDQ A;  3MIH A;  4I0W B;  1CX1 A;  1VIW B;  1QMJ A;  1JOP A;  4Q0Q A;  2HKX A;  2QQL A;  1JMU B;  5SV5 A;  2GU9 A;  2XG3 A;  1HX6 A;  5L7O B;  2GP3 A;  1STM A;  2ILM A;  3FHQ A;  3M3Q A;  4Y1Y A;  1BVV A;  2ZAC A;  3ZN6 B;  1FV2 A;  4NJ4 A;  3JD7 2;  2FDF A;  3KCC A;  1BBT 3;  1KIT A;  4J1W A;  1VAM A;  4Q0S A;  5D2A A;  2RMU 2;  1YI7 A;  2MEV 3;  4AQ2 A;  3EYP A;  1HQW A;  2OII A;  4I01 A;  4S2H A;  5BXX A;  5IVF A;  2BGP A;  4CDX A;  5AFE A;  1AXZ A;  1K42 A;  4EZ4 A;  2J1V A;  2X09 A;  2NZ9 A;  3ZFE B;  3WG2 A;  2BTV C;  2CGO A;  3VL8 A;  1L7Q A;  1M06 G;  2ZOE B;  1POV 3;  1SLB A;  1LEC A;  4JGZ A;  3I3D A;  4XJ8 A;  4AZZ A;  1O4Y A;  5T55 A;  1W06 A;  2RS5 3;  5M0T A;  5EYY A;  1OSG A;  5CVR A;  2ET1 A;  3LIH A;  3INA A;  4QB6 A;  2IUW A;  4XMI A;  5I0U A;  3WF2 A;  3ZXK A;  2Q30 A;  3OGG A;  4E27 A;  2HEW F;  2HYK A;  5L19 A;  4QQH A;  5FBZ A;  5IFP A;  5LZ6 A;  1GNH A;  2OT7 A;  3VLB B;  4Q4Y 3;  1UZY A;  3VBO C;  2XBO 2;  2O14 A;  3RMX A;  1D7P M;  1HW5 A;  1UO9 A;  4LE3 A;  1HJF A;  1WA4 A;  4AEM A;  3LFM A;  4MGS A;  4P9I A;  4NID A;  4EWE A;  2NQY A;  3EB7 A;  4N7I A;  4WM7 B;  4IE6 A;  1I3H A;  1HKD A;  4AVT A;  1XYN A;  4I0A A;  4BPZ A;  4JTO A;  2Z69 A;  5LBC A;  2ETE A;  3OBA A;  1RHI 3;  2WO3 A;  1LJ7 A;  5D21 A;  3P3P A;  4MYE A;  3WG1 A;  1XQN A;  1U0A A;  1VBB 1;  5BV6 A;  3WDV A;  4MGK E;  1W9T A;  5IVY A;  5A32 B;  2CYF A;  4A4A A;  3WNK A;  1W6P B;  1F9K A;  3ES4 A;  2WO7 A;  4K3U A;  4NPL A;  3ZDS A;  2R32 A;  4HVO A;  3ZSM A;  4IGP A;  3VZM A;  1EAH 1;  2D6M A;  3AMP A;  1EV1 2;  3ASI A;  1X8E A;  5BNN B;  3BI3 A;  4HN1 A;  1QOT A;  1S4C A;  2YUE A;  2DCZ A;  4ATE A;  5CAZ A;  3B7M A;  1RUG 3;  2HBU A;  5DDJ 1;  5C6C A;  2XPJ A;  1U12 A;  2ARX A;  1GLH A;  3M3I A;  3CMG A;  4DNY A;  3MZH A;  4GAL A;  1DGR A;  5L9R A;  4CEW A;  5E6H A;  1KGY A;  2DVF A;  2QDN A;  1WLD A;  2QQJ A;  2VUD A;  1ZA4 A;  5IK7 A;  4CCN A;  1PX3 A;  2XQX A;  1RUD 2;  5T5L A;  1ZRD A;  4YNI A;  1ULC A;  3RI8 A;  1RXG A;  3C7H A;  1PO1 2;  1KQR A;  2C4X A;  3BU7 A;  2FDH A;  1GP5 A;  4V2W A;  3BU0 A;  3WQ7 A;  4QXB A;  1RUF 2;  5DPN A;  1KJR A;  5FZH A;  1NCQ A;  1QGL A;  2LTN A;  3MIB A;  2JXA A;  5A3T A;  1OMI A;  3M2M A;  1MQT B;  4OQ8 A;  5FQ0 B;  4Q27 A;  1PGS A;  2W87 A;  4MGQ A;  4E4H A;  5DUX A;  4HFS A;  2RMU 3;  1LEM A;  4B4P A;  3POE A;  2HWE 1;  3S7E A;  1W9S A;  1HB2 A;  2A6X A;  2L9L A;  2VW2 A;  2QE3 A;  1CIY A;  2PFW A;  3ENR A;  3FL7 A;  4NWW A;  4QPG A;  4EN6 B;  4F7Z A;  3OG2 A;  5CFC A;  4PDW C;  3K4Z A;  4RYD A;  5FZL A;  2BPA 2;  4QQ2 A;  2WFF 1;  4YVW B;  5A3O A;  1UW8 A;  4C8D A;  3SNM A;  1V0A A;  3WEZ A;  4EN7 B;  1XE8 A;  2QDR A;  4KBZ A;  2OVU A;  2C1F A;  1JS9 A;  5L7O A;  4NIH A;  2YY1 A;  4JHZ A;  1WD3 A;  5AVP A;  2DFB A;  4JVA A;  3O1S A;  3ZN6 A;  1OA3 A;  4ZU5 A;  5CYY A;  3PMS A;  5A7P A;  4JRA A;  2ARC A;  3JUU A;  4ZS3 A;  5IVB A;  2V5D A;  1J84 A;  3NV4 A;  4GD4 A;  3LSE A;  4AFM A;  2DWR A;  3VHR A;  3J7H A;  3D82 A;  5JOX A;  3I2J A;  1DGL A;  3NAP C;  4JGY C;  4LHS A;  2IXC A;  2FZ1 A;  5FY8 A;  4KGQ A;  4LO5 B;  4MV2 A;  3U75 A;  3WHT A;  3E6D A;  2J1U A;  4AQ6 A;  1E5R A;  5JXH A;  1V9U 1;  3ZFE A;  3BYW A;  4CXW A;  1RUH 1;  4PJY A;  3LKJ A;  4CCO A;  3H1W A;  3Q8F A;  3M3E A;  3I2D A;  1WBL A;  2WYS A;  4GUL A;  2B39 A;  2XML A;  4IV3 B;  2XVL A;  5FXV A;  4GB3 1;  5HV4 A;  1X9P A;  1C8N A;  2XOM A;  3WX5 A;  3JCI A;  1EV1 3;  1V6K A;  1YJL A;  4L2N A;  1Q8S A;  4ORF A;  1BQP A;  3FUQ A;  1MAC A;  4YPJ A;  4B29 A;  3BTY A;  4CDW C;  5C9A C;  3OGR A;  4WM7 A;  2WNO A;  1MEC 2;  2ZGP A;  3VDA A;  3AYC A;  3LEI A;  4NMI A;  1UD1 A;  1QWR A;  4EWA A;  1D0G A;  1PNG A;  4XUT A;  4LO8 A;  5LK5 A;  1EAH 2;  2HWB 2;  3VKL A;  4FPK A;  3VBS B;  5T50 A;  5KWR A;  3PJY A;  4IE7 A;  4JDN A;  1LUL A;  4GWI A;  5DAX A;  4AI3 A;  5A32 A;  4MSV A;  3S57 A;  5DDJ 2;  5GKA C;  1W6P A;  3BGA A;  3ILN A;  4EE2 A;  5HPO A;  2Q1Z B;  2ARE A;  2ZHM A;  4HON A;  1RUF 3;  1V6M A;  1UYZ A;  2XGX A;  1APN A;  5F3E A;  4XDP A;  1OOP B;  4UT5 A;  1UIK A;  4BMB A;  5BNP B;  1Y9M A;  1I5Z A;  1YEW A;  5A70 A;  4K21 A;  5BNN A;  3RZH A;  1DHK B;  1SZB A;  2XH6 A;  3E6C C;  3A4U A;  2LS6 A;  1K12 A;  3OSD A;  5ACA 1;  1S0J A;  1AX2 A;  4NPM A;  5EYX A;  4K8R B;  4DIN B;  2YV8 A;  2R0H A;  5BNQ A;  1W39 A;  4LBQ B;  4N7U A;  1AZD A;  2VEC A;  4QPY A;  4RS5 B;  1KJL A;  2WZE A;  4MZU A;  4TSV A;  4COY A;  1SFY A;  4AQS A;  4G9S B;  2A7A A;  3H3Z A;  3O7O A;  1OPO A;  4N8M A;  4XTM A;  4P00 B;  4Y20 B;  5GLV A;  4OI1 A;  1W90 A;  1CAV B;  4U36 A;  2FMD A;  5A1A A;  5DMY A;  3H8R A;  5KHK A;  4P14 A;  3SCG A;  1Z7S 1;  2AR6 A;  2YHJ A;  4LR4 A;  1PK6 B;  1BVP 1;  1IG3 A;  4M01 A;  4AR2 A;  4NO4 A;  4AEK A;  1MQT A;  1ZRR A;  2WFF 2;  3POG A;  5FQ0 A;  4GQ7 A;  3ON7 A;  4CUG A;  4D0Q A;  2W1U A;  4CU6 A;  3ZFG C;  2JDN A;  4QPI B;  4QDR A;  5DUV A;  4IE5 A;  2IXH A;  3VBR C;  2VMD A;  2P37 A;  4D3W A;  4QB2 A;  3ZXJ A;  1W28 A;  4XIK A;  3VKF C;  2EIC A;  2VMI A;  2GNM A;  2AGS A;  5K0U A;  3KD4 A;  1S2B A;  4QM8 A;  3C2U A;  5K9Y A;  3O1O A;  1J3R A;  3EXU A;  1BXH A;  4YVW A;  2VBP A;  2BVV A;  2BDR A;  2UYA A;  4U2A A;  4YGD A;  3IMM A;  1JZ2 A;  4DMI A;  2W95 A;  1NY7 1;  4BQX A;  3LOI A;  1CON A;  1W6N B;  3L2H A;  1VBA 2;  2D43 A;  3ZYB A;  1C4R A;  2JDK A;  4BQY A;  5FZ6 A;  4D6S A;  2HYX A;  3Q8B A;  5IVV A;  4BQ4 A;  1V9U 2;  2ZJC A;  2W39 A;  1W3V A;  1LNS A;  2IFW A;  2VMF A;  3GGL A;  4GKY A;  1HXS 1;  3DKQ A;  1GU3 A;  4NAM A;  5FMO S;  2WLQ A;  4LO7 A;  3SKJ E;  3UV9 A;  4NIG A;  3MO4 A;  4GB3 2;  2KR2 A;  2R06 3;  1NLS A;  1MEC 3;  1NLQ A;  3RGB A;  1QJZ A;  4Q0P A;  2JX9 A;  1OH4 A;  5FY1 A;  3VV1 A;  4HK8 A;  5F5A A;  3HT1 A;  2HWB 3;  4MET A;  4P5Y A;  4CCC A;  1ZZ7 A;  4P9Y A;  3ETQ A;  4IEX A;  2TBV A;  3B5L B;  4OZO A;  1I9R A;  1SDW A;  4R9D A;  3NJY A;  1ST8 A;  1XJA A;  4WZF A;  1VBD 1;  3T4H B;  5A3L A;  4IV3 A;  3I2H A;  3WW1 A;  2JDZ A;  1H2L A;  5FO8 B;  2XL9 A;  4IV1 B;  1AR8 2;  2BQP A;  3POI A;  4LXL A;  2QBX A;  4LTA A;  1L3J A;  1MS5 A;  5EHD A;  5FMB A;  5GJ6 A;  3GXU A;  1MS0 A;  2WS9 3;  3KT1 A;  4HT1 T;  1OH3 A;  5KHG A;  3BIE A;  2JIJ A;  3AL6 A;  3TOJ A;  5A6X A;  1JH5 A;  2JD4 A;  4RFR B;  1ND3 C;  1E5S A;  4RGA A;  1ULO A;  5AC9 2;  3BPZ A;  3FN9 A;  4C1X A;  4N90 A;  4XF4 A;  1DGR N;  3DXT A;  4K7J A;  2A6Y A;  4SBV A;  1AX1 A;  1NXM A;  3VBS A;  3N9O A;  1QQP 1;  3NWK A;  2XB6 C;  1D0H A;  4EV0 A;  4LIU A;  2X05 A;  2UU8 A;  3NNG A;  3ZM8 A;  1IG0 A;  1ULP A;  4JGZ C;  1HRI 2;  1Y43 B;  1JYT A;  3QCW A;  4TTG A;  1N3O A;  5DG2 A;  1VRH 1;  1OOP A;  1UYX A;  2R04 1;  3GNE A;  3HOB A;  3AK0 A;  5KHH A;  5BNP A;  3NQH A;  3MIF A;  2NM1 A;  3I3E A;  1OVP A;  2P34 A;  2UY9 A;  2Q8O A;  3H3L A;  5T5J A;  3B93 A;  3OF1 A;  4PLN A;  3N9L A;  1IPS A;  4IQP A;  1IPK A;  4K1Y A;  5H9Q A;  1Z7S 2;  3SC7 X;  5CFD C;  4O9G A;  1W3X A;  4XCA A;  2WZR 2;  3AP9 A;  4CUB A;  4AXO A;  4LBQ A;  4W6W A;  4Y1Z A;  2HH9 A;  4RS5 A;  1PO2 3;  3SKV A;  3RZL A;  2XON A;  2OW4 A;  2P17 A;  4PDW B;  4XPV A;  3T2T A;  4Z2A A;  2W52 A;  4D7Y A;  2B42 B;  2ZXQ A;  4MH0 E;  4Y20 A;  1CAV A;  1RMU 1;  1JN2 P;  1U5I A;  1VBA 3;  4NVP A;  2Z42 A;  3C8X A;  5FZM A;  4ZZ5 A;  1H0B A;  5IW0 A;  1PK6 A;  4LBM A;  4MO3 M;  5DAP A;  4W4Z A;  5A1L A;  3ZSE A;  3B3Q E;  1BHG A;  3SH5 A;  5BUV A;  2EAK A;  2BVB A;  1FOD 2;  4QPI A;  3U14 A;  3I49 A;  3AJZ A;  4XEZ A;  1KS4 A;  1C5I A;  1CR7 A;  1JUI A;  3RS6 A;  3RG0 A;  1DQ0 A;  4XXA A;  3NAP B;  4UI9 L;  2J42 A;  2VVF A;  2VTF A;  1AR9 1;  2D3P A;  2GP5 A;  5FZB A;  1NZC A;  2DU0 A;  2VOW A;  3TEZ A;  3S7I A;  3ECQ A;  1ULF A;  1HXS 2;  1JYW A;  1H1I A;  5KHI A;  1RUJ 2;  4CEW C;  3FHA A;  5FRA A;  1H4H A;  4UF0 B;  5LK7 B;  1W6N A;  2GC2 A;  2DV9 A;  2JE9 A;  2NPI A;  2JKX A;  5FK8 A;  4AW7 A;  2BFU L;  1AR8 3;  2DCT A;  1WKY A;  2WKK A;  2Y38 A;  3HNB M;  4HSJ A;  4WZC A;  4S2F A;  5LEK A;  2EIB A;  3WXP A;  5DZE A;  1NLR A;  1QDO A;  5CNA A;  2MNG A;  1NCQ C;  4XIL A;  1UF2 C;  4B7E A;  5LCW L;  1O4Z A;  1FPN 2;  3RQ0 A;  2J1E A;  4LQR A;  4E4D X;  2XVK A;  5C9A B;  5AC9 3;  1RUI 1;  1LGB A;  5FYU A;  3SMH A;  3CDZ B;  4RGG A;  1SAC A;  3MLK A;  3POS A;  1PGW 1;  3BOD A;  3FWE A;  1FNZ A;  1REE A;  3GBG A;  4OMD A;  1RVF 1;  3KS7 A;  4EN9 B;  2VW0 A;  4DPN A;  1X50 A;  2PHU A;  2AC1 A;  3D6E A;  1QJU 1;  3ZXE A;  1COV 2;  5CFC C;  5IYY A;  4MG2 A;  1S0E A;  1QJY 1;  4QGM A;  4FPL A;  4YM2 A;  3UGG A;  3RFR A;  4Z1V A;  2LRP A;  4IV1 A;  3T0B A;  1WMD A;  1HRI 3;  4RGK A;  4CEY B;  1PIV 3;  2MHF A;  5GM0 A;  3B01 A;  1EP0 A;  4Y5Z 0;  3USU B;  5HCA A;  2Y60 A;  5L7O C;  1O3S A;  1RYY A;  3H42 B;  3R6S A;  3ZKY A;  5A6Q A;  2V09 A;  4KWL A;  5E1R A;  3MW4 A;  4AVS A;  2YG0 A;  1CN1 A;  2ZEX A;  1WUV A;  4IDZ A;  5JSR A;  1DLL A;  3P6B A;  1QXR A;  3VDC A;  3WP4 A;  3D0S A;  4MGZ E;  1LKN A;  4Q0V A;  2WZR 3;  1OPM A;  2YXS A;  1A8D A;  1Y3T A;  4SLI A;  2B5H A;  3P3N A;  4WVM B;  5A7Q A;  2OS2 A;  5FZA A;  3ITQ A;  3OBT A;  1O6U A;  5I0D A;  5DQ0 A;  1FX5 A;  3NNM A;  3NMB A;  4BIO A;  4ZKT B;  1ALY A;  5L73 A;  1BBT 1;  3HBK A;  4FFH A;  2GN3 A;  2MEV 1;  4LIT A;  3JB8 A;  2Q5T A;  2VOK A;  4DUX A;  2QVS B;  4JV4 A;  1OLQ A;  2V5Y A;  1G8W A;  1OUS A;  3DV8 A;  5GZF A;  2GH2 A;  2PYT A;  3OGJ A;  1FOD 3;  3PNA A;  5EWS A;  3ZFG B;  1H2K A;  1RMU 2;  1W6Q B;  3LZZ A;  4A7Z A;  3VBR B;  3MIE A;  1CAU B;  1NKG A;  2P5B A;  4GKX A;  4BDV B;  2ZS6 B;  3ACH A;  5JOZ A;  5T52 A;  1POV 1;  2ID4 A;  5B4N A;  1XNK A;  3GZE A;  2RS5 1;  1LU1 A;  2WAO A;  4LO4 B;  5FZ4 A;  4PDW A;  1K5J A;  1GOH A;  3PIJ A;  4LBQ D;  4CUC A;  4PBO A;  1RUJ 3;  4PI2 A;  3NST A;  4XFI A;  4W6Y A;  5FYV A;  3V65 A;  4A3X A;  2ZX3 A;  2VCB A;  4Q4Y 1;  5LA2 A;  2V73 A;  3B94 A;  3ZYJ B;  1JI6 A;  5JMO A;  1AR9 2;  2ZZJ A;  1F15 A;  4LHN A;  4BA6 A;  2NN8 A;  3MF6 A;  5CB7 A;  5KC5 A;  5FYH A;  5C70 A;  4HXC A;  1NUK A;  3H1Y A;  1FPN 3;  5BNN C;  4XAA A;  5HXM A;  4TLF A;  3CF6 E;  1RHI 1;  4W6X A;  5G05 L;  3HD8 B;  3NAP A;  4FQZ A;  1O5L A;  5FYI A;  2D3S A;  2YDE A;  3T1L A;  3WF3 A;  2R1B A;  3QH6 A;  1UY3 A;  5A7N A;  1YFU A;  3IDC B;  2WAA A;  3DCQ A;  4HSL A;  4DFS A;  1JYN A;  1COV 3;  4BIF A;  4UF0 A;  1RUI 2;  5J3U A;  1CPN A;  1UN1 A;  2EAL A;  2H6B A;  1DIW A;  4S2D A;  5FYY A;  5JCT A;  2Y0I A;  3III A;  2ZEY A;  5LWB A;  2JE8 A;  2RS1 2;  1H8V A;  4CCD A;  1UAI A;  3BPS A;  1ZBE 3;  5FZI A;  1K45 A;  1RUG 1;  1Q5O A;  1QJU 2;  5B4X A;  3T4V A;  3WNP A;  1GOF A;  3NV3 A;  1QJY 2;  4Y24 A;  3IWZ A;  1MQT C;  5C9A A;  4JAA A;  1ND3 B;  2V72 A;  1DQ2 A;  3I8T A;  1UIJ A;  2JDP A;  1ZYB A;  3AVR A;  5I0R A;  3AFG A;  1US2 A;  2PAK A;  2RJL A;  1LGC A;  1TMF 2;  1UX6 A;  3LCP A;  4IEO A;  3AKP A;  4KG0 A;  4GJZ A;  1YWK A;  4TLG A;  2XLA A;  1GR3 A;  4XBN A;  4I0B A;  4XFA A;  3WDT A;  2WYF A;  1WA6 X;  4NII A;  1EUU A;  1EPW A;  3FMG A;  4XIO A;  3BN6 A;  3GJA A;  3B9I A;  4GMP 3;  1LEN A;  2RMU 1;  4GWJ A;  4HLT A;  5CU1 A;  5D1I A;  1HV0 A;  1T6B X;  3USU A;  4QMA A;  4P9X A;  3JQX A;  1CJD A;  3GZA A;  2RS3 2;  3E97 A;  1WBF A;  2VOT A;  3KV5 A;  1W03 A;  3NV1 A;  3VKN A;  1FV3 A;  2WA4 A;  3RJ2 X;  3ZPO A;  5F9T A;  2A75 A;  3LDK A;  4DXR A;  2BWA A;  4ARX A;  2A3W A;  4ASK A;  2Y34 A;  5CFD B;  2CWS A;  4WVM A;  2VNV A;  3VHP A;  3JZV A;  2FDK A;  1WW6 A;  1XB9 A;  3R4S A;  3VHN A;  2QQM A;  4OHY A;  4AAX A;  2XKP A;  3PVE A;  2HBT A;  4JKK A;  5CKM A;  4MHU A;  1CQ9 A;  2IFR A;  3RVH A;  4LBN A;  1WLW A;  4IV3 C;  1BCX A;  4FO9 A;  4Q2F A;  3RNS A;  2Y6H A;  3LEM A;  1J58 A;  1QXJ A;  1YJK A;  2XQR A;  4XW3 A;  4LNV A;  3WLU A;  4YLZ A;  3ZFG A;  1E5H A;  3KQR A;  4FTB A;  3I3M A;  1W6Q A;  4IXL A;  3OGS A;  2C9K A;  3G6J B;  3VBR A;  1CAU A;  2WUH A;  3HVD A;  3KT7 A;  4Q4Y 2;  5CIR A;  5I8Y A;  1XOY A;  2YBS A;  3WW2 A;  2D5H A;  2C26 A;  1G9C A;  1W8T A;  4C0H A;  2WC2 A;  5FY0 A;  4AFB A;  2B8M A;  2F4P A;  2RDS A;  4QQO A;  4DB5 A;  5FOJ B;  1N1V A;  3DL3 A;  1D2S A;  4R4Z A;  1H2M A;  1YC6 1;  2RHP A;  4A41 A;  1SDD B;  1EV1 1;  1UPI A;  4Y3O A;  5LA0 A;  2P3K A;  4XF3 A;  5JXI A;  2RS1 3;  1W9F A;  3IN9 A;  2W2I A;  4QPW A;  2ZGK A;  4JCK A;  4QM9 A;  1S0B A;  5JMC A;  2D97 A;  1PMJ X;  1PX4 A;  2RDN A;  4LEJ A;  4DS0 A;  3LB9 A;  4UXA A;  4X8N A;  4Q4X 2;  3HBZ A;  1IS5 A;  3U11 A;  3KCX A;  1OA4 A;  2BU9 A;  3H8X A;  3N9P A;  1RUG 2;  3TB0 A;  4MUV A;  1KDK A;  3FLP A;  1A34 A;  1RUE 2;  1TMF 3;  3GCW A;  3WVJ A;  3M1H A;  5FZF A;  3WIN E;  4RS5 C;  1GKB A;  1RUF 1;  3FJS A;  3UK9 A;  2E7T A;  5CG8 A;  1R09 2;  4QX3 A;  4UW4 A;  3H7J A;  3NL1 A;  2VMC A;  3PUS A;  3OJB A;  3WDW A;  1UY1 A;  4Q29 A;  2ADD A;  4X6Q B;  3TNQ A;  1SQ4 A;  2KD7 A;  1N1Y A;  3R4D B;  4IEY A;  2J22 A;  1PK6 C;  1UMI A;  3UL2 A;  4R4X A;  2RS3 3;  1GMM A;  2ATF A;  1W8F A;  1ND3 A;  2FCV A;  3DN7 A;  3K2O A;  3DF0 A;  4HET A;  3O0V A;  4QPI C;  2VZS A;  1WW7 A;  1ENQ A;  1R1A 3;  5FLH A;  3TNP B;  1UOJ A;  4DRR A;  5C5T A;  1W99 A;  4IND A;  2XLG A;  2VZV A;  4QB1 A;  2VPV A;  4CXX A;  2C6S A;  2Q0A A;  3ABZ A;  1PVC 2;  4BWO A;  1A8M A;  1QNW A;  2WIN B;  1KEX A;  2VVE A;  3PU8 A;  4AK3 A;  4LT5 A;  3FFZ A;  3CHX A;  3SEP A;  2BRT A;  3THC A;  2XJV A;  4ATF A;  1DYO A;  4M3C B;  1SMV A;  2YC2 A;  4AI0 A;  4FTS A;  1HDK A;  4Q8L A;  2CAV A;  2E63 A;  2VH9 A;  4QKN A;  3AZX A;  5FYT A;  4H14 A;  3LA3 A;  2WQ8 A;  1IOA A;  3H50 A;  4XXP A;  2DUR A;  2ZHN A;  2VXR A;  1WCQ A;  1OKQ A;  3TN9 3;  4D8M A;  4AHW A;  1KRI A;  3HQX A;  4LKD A;  4Y22 B;  5JR2 A;  3OPW A;  1G9D A;  3SLI A;  1WZX A;  4QQL A;  5HBA A;  2C24 A;  2VGD A;  5CFD A;  4XBL A;  5JSO A;  3TEW A;  3WQ0 A;  3GYD A;  3MID A;  4CYD A;  3AVS A;  2VZR A;  2ZX0 A;  4UW5 A;  1OLR A;  4XF1 A;  1HB3 A;  5KXC A;  3RZK A;  2A70 A;  4CU7 A;  3MI8 A;  2IC1 A;  3I2G A;  2PHX A;  4CP0 A;  3W5N A;  3Q9O A;  5FYM A;  3HN1 A;  1AR6 3;  1LHW A;  1C28 A;  1W8O A;  2DUO A;  4OI2 A;  3VB9 A;  3DEC A;  4IV1 C;  2R06 1;  1AJK A;  5JI9 A;  1MEC 1;  3VDB A;  4B4Q A;  4OHV A;  2RDR A;  2ZTN A;  3HEI A;  4COZ A;  1UYY A;  4KL1 A;  1IKQ A;  3KV9 A;  1J3P A;  4XFF A;  3IAP A;  1YFW A;  4A42 A;  2HWB 1;  4C90 A;  2D3R A;  4Q4X 3;  2UWA A;  3QD6 A;  1NT0 A;  2KM2 A;  4RN5 A;  3RPQ A;  3T08 A;  4IL7 A;  2X5I C;  2JWP A;  3B9C A;  4NAO A;  1XRU A;  4PF5 A;  3ILR A;  4XF0 A;  5EIY B;  3PME A;  2W92 A;  4IGO A;  3WY6 A;  5FY4 A;  1RUE 3;  4B1M A;  4FOQ A;  4DUV A;  1GOG A;  1ZZ8 A;  2X29 A;  4KQ7 A;  5KHJ A;  2WNE A;  4QT6 A;  1H6X A;  5DAQ A;  1NA1 B;  3TYJ A;  2W1W A;  2WS9 1;  1R09 3;  3O0X A;  4C1W A;  2OYZ A;  2OZ6 A;  2QTW B;  4JX0 A;  1D4V B;  3PU3 A;  2PLV 2;  3AYE A;  4UFJ A;  4CP9 B;  5JDB A;  1Y7B A;  1QEX A;  4FOV A;  5GLT A;  1LOD A;  2Q1M A;  3ORJ A;  3U4X A;  5FZ9 A;  5FZ3 A;  5C3Q A;  3ZN4 A;  5JLV A;  3GZU C;  2YPD A;  2VNO A;  4WVZ A;  4LBJ A;  2B9U A;  1J3Q A;  2JEN A;  3DXU A;  2WJS A;  3KWV A;  1L7R A;  4ZXE A;  3ZFF C;  1OVS A;  4M00 A;  3O0W A;  3ZX7 A;  1NX9 A;  3AP7 A;  2YGL A;  3I97 A;  3BKZ A;  4C91 A;  1QHD A;  4KWK A;  4YSF A;  1ZZB A;  1UZ0 A;  2P1B A;  1PVC 3;  2P2K A;  3TEY A;  3VD3 A;  2JDY A;  1J59 A;  1UZW A;  1XYP A;  2OZJ A;  4LUL A;  4QHO A;  2WQZ C;  4CCJ A;  3FZ3 A;  2YU2 A;  4AFA A;  5LW9 A;  1JOD A;  3KB5 A;  3N9Q A;  2RVA A;  1WW4 A;  2E32 A;  1Q43 A;  5LAT A;  1SLA A;  4OQ9 A;  3H1M A;  2ZAH A;  3CNA A;  4CDU B;  2C5D A;  3PVB B;  4Y33 A;  4M4P A;  1VE0 A;  2ZHK A;  1I5P A;  2ET7 A;  1VBE 2;  1PO2 1;  2FHR A;  4QQP A;  4QU1 A;  4FAH A;  1XNB A;  4QDQ A;  2ZGN A;  2YB7 A;  3HR9 A;  2ZAA A;  3SIS A;  3T2Q A;  2QZ2 A;  1X82 A;  3DGT A;  3WNL A;  1V00 A;  4W50 A;  4DZG A;  3WDY A;  2YBP A;  1VBA 1;  4N9I A;  1PZ7 A;  2VW1 A;  3PL0 A;  2D40 A;  4LKE A;  4YWA A;  3W9A A;  2G19 A;  1RB8 G;  5LBF A;  5JPM B;  1ZBA 3;  4PLM A;  1YHF A;  4PCR A;  3I2K A;  5FAX A;  4C0B A;  5LRS A;  3T3Y A;  1SLI A;  4M3C A;  4HPK B;  1UXZ A;  3KCY A;  2DCJ A;  4LE4 A;  5FLI A;  4KU8 A;  2RG4 A;  4DY5 A;  5T54 A;  2D98 A;  3HN3 A;  1CJP A;  5CIS A;  3ZYP A;  5FUP A;  1W9W A;  4Y22 A;  4CUA A;  1JUH A;  1MPX A;  4MOA A;  3FLR A;  1LES A;  2DVD A;  3U4S A;  4YG6 A;  3NO8 A;  1JTZ X;  4LA3 A;  1VMF A;  2R06 2;  4BZ4 A;  1YQ6 A;  4Y5S A;  1O8P A;  5FTT C;  4A44 A;  1AR8 1;  3Q8C A;  3N7K A;  3RYR A;  2ERF A;  1C8M 3;  2HWD 3;  2W0X A;  4H3W A;  4A2U A;  4E2S A;  3VUO A;  3LE0 A;  1GZW B;  1XBF A;  4OUS A;  4AWD A;  3EBR A;  1WWY A;  1AF9 A;  3E6B A;  3O1R A;  3THD A;  3I2I A;  4NN0 A;  2PLV 3;  1GIC A;  5AC9 1;  3T0A A;  3I2F A;  5ISL A;  4M0N A;  1LOC A;  1IPJ A;  4CVU A;  1XSR A;  5A3N A;  4CEY C;  1XE7 A;  4FOW A;  2VXJ A;  2D6L X;  5FPZ A;  5LA9 A;  1H9P A;  5GLU A;  1CGP A;  3UET A;  3WW4 A;  3Q8A A;  2WS9 2;  3BB6 A;  4XJU A;  4YVS C;  2ENR A;  3AMQ A;  3IDA A;  4FPH A;  4XVH A;  3A7Q A;  4XAE A;  3AKR A;  4EN8 B;  1I1E A;  4FPC A;  2UUR A;  4UBG A;  1JW6 A;  2DUP A;  2BZD A;  2XDV A;  4GA9 A;  3V64 A;  4PF1 A;  3AZZ A;  2BV4 A;  1RIN A;  1HRI 1;  4YZ1 A;  1PIV 1;  1GZC A;  1NA1 A;  4YGE A;  1BKZ A;  3RDI A;  3W58 A;  3JU9 A;  1AR7 3;  5A3U A;  3RYK A;  4MGI E;  4RL7 A;  4CP9 A;  2BOJ A;  2ORX A;  3I59 B;  4ZS2 A;  1GFF 2;  1AXY A;  3OUJ A;  3B69 A;  4GH4 B;  4XBQ A;  4DUW A;  3QH7 A;  2WO2 A;  2WZR 1;  4OYU A;  1VBE 3;  4OFG A;  3BOW A;  2Q8E A;  1N47 A;  2Y26 A;  4J25 A;  4YGC A;  1ND2 B;  1IKP A;  2ZEZ A;  3CJX A;  1N1T A;  4DQA A;  5FDB A;  3GDB A;  4FP3 A;  4Q1P A;  3UNP A;  4YG0 A;  1W2O A;  5F5C A;  4B8E A;  1SFP A;  1PO2 2;  3LF7 A;  4K6B A;  3UES A;  3VZK A;  1DCS A;  2SBA A;  4K1Z A;  2JIC A;  4QX5 A;  2IXK A;  2PHD A;  2RDQ A;  1J83 A;  2XL7 A;  3QLQ A;  4HN0 A;  1OQD A;  1YUD A;  1FOD 1;  3J8F 3;  3QAC A;  1F8V A;  5FUN A;  5A3M A;  5IFT A;  5LRR A;  2QCS B;  3L9J T;  4HZF A;  4JTN A;  4CDU A;  3LOB A;  2VQT A;  4ES8 A;  2HWF 2;  4A6S A;  4ZU7 A;  4L0P A;  2VQU A;  4D6Q A;  4Y4Y A;  5IVJ A;  2ZMK A;  4IGQ A;  5FJH A;  3K77 A;  1UOG A;  5JOY A;  1RUJ 1;  3POJ A;  4L8Q A;  4OUM A;  3VKM A;  2AH2 A;  3KV4 A;  2VG9 A;  3G7D A;  3WOG A;  2VME A;  4GJY A;  3WNN A;  4E9K A;  1R1Z A;  3NKT A;  3OB8 A;  4LBO A;  3I3Q A;  4YM3 A;  1POV 0;  2EXI A;  4MGT A;  1URX A;  1YQ5 A;  2GC3 A;  3ZSL A;  2BNN A;  3IT8 A;  2VE1 A;  1Y4W A;  4HPK A;  3DYP A;  4D69 A;  1EPZ A;  5JXG A;  3OPT A;  1LTE A;  1LU2 A;  5JZG C;  3IDE A;  4JKL A;  1W6M B;  1C3H A;  1FPN 1;  3OPZ A;  4YW7 A;  3U78 A;  3KV6 A;  5DAV A;  2R07 3;  1G9B A;  2VZT A;  3L2Y A;  5DZG A;  3FBM A;  3M7A A;  4YW1 A;  4BXS V;  3URF A;  5FZG A;  1TVG A;  4XMA A;  1ODN A;  3P5B A;  2VOV A;  2VZP A;  4EJR A;  1LHV A;  2Z79 A;  4WVW A;  4GWN A;  1VPH A;  4NRQ A;  1COV 1;  1TNF A;  1DYK A;  2K2S A;  2X5I B;  3DYM A;  4OUL A;  3CEW A;  2WO1 A;  4E8C A;  3RJR A;  1XC6 A;  3O14 A;  4NHL A;  2WAB A;  4FT8 A;  2GC1 A;  4DXS A;  1S0D A;  1ZBE 1;  1V6J A;  2A6Z A;  3ACG A;  1GZW A;  2VTX J;  2B4K A;  1NAE A;  1W8U A;  2YPJ A;  3LSD A;  3OD4 A;  4XE9 A;  2EIE A;  5F2S A;  4BQ3 A;  4IEP A;  2B7Y A;  4HOO A;  4RQP C;  4LIV A;  2CDP A;  3HPN A;  1AL0 G;  4EYU A;  2DFC A;  4ERO A;  1ZM1 A;  1PIV 2;  4ET7 A;  3WNX A;  4YG3 A;  1GBG A;  1AX0 A;  2DTY A;  3MW2 A;  1NQD A;  4TWT A;  3H7Y A;  3MPP G;  4AFC A;  1LOE A;  3E5U A;  4IER A;  4LHL A;  3ZXL A;  3LWC A;  3ZFF B;  2A73 B;  3OGV A;  1O7F A; 
#chains in the Genus database with same CATH homology
 2CHH A;  2JDH A;  5A6Y A;  1OXC A;  2BOJ A;  2JDP A;  1W8F A;  4CE8 A;  2JDK A;  5D2A A;  1UQX A;  4AOC A;  2VNV A;  4UT5 A;  2JDU A;  3DCQ A;  1OUR A;  1OUX A;  1GZT A;  5A70 A;  1OVS A;  2XR4 A;  2JDN A;  2WRA A;  2BOI A;  2VUC A;  5A6X A;  5A6Z A;  5HCH A;  3ZDV A;  1OVP A;  1OUS A;  2BP6 A;  2VUD A;  2WR9 A;  5A6Q A;  2JDY A;  1UZV A;  2BV4 A;  2JDM A;  1W8H A;  5A3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...