2CHHA

Ralstonia solanacearum high-affinity mannose-binding lectin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new Ralstonia solanacearum high-affinity mannose-binding lectin RS-IIL structurally resembling the Pseudomonas aeruginosa fucose-specific lectin PA-IIL.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
molecule keywords PROTEIN RSC3288
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2chhA00
1UZVA 2CHHA 2JDKA 2JDUA 5A6ZA 1OURA 4UT5A 2BP6A 4AOCA 2BOIA 5A70A 1UQXA 1W8FA 3DCQA 2WRAA 1OUSA 5HCHA 5A6QA 5D2AA 1OVPA 2BOJA 2WR9A 2VUDA 5A6XA 1GZTA 3ZDVA 4CE8A 1OXCA 2JDHA 2JDNA 5A6YA 2VUCA 1W8HA 2BV4A 2VNVA 2XR4A 2JDYA 5A3OA 1OVSA 2JDPA 1OUXA 2JDMA
chains in the Genus database with same CATH superfamily
5HPOA 5E89A 4XIOA 2W2IA 3I3MA 2VO5A 1Y9GA 1ZNPA 2BJSA 3N9LA 4Q0SA 2JG9C 1YFYA 2WZ8A 5BNOA 5AFEA 1DQ4A 5FOBB 3H7JA 2TUNA 2W1SA 2WNVB 3CZUA 5FMBA 2IXCA 2X09A 1X8MA 3R05A 4LTAA 4R8HA 4V2WA 4XAEA 1AXYA 1FMD1 1PNGA 1VBD2 2B7YA 2NN8A 2P17A 3LEKA 4LUKA 3OY8B 4EYUA 3HN3A 4E4SA 1OLQA 3FHAA 2ZS6B 3U4XA 1AF9A 4D7SA 1TEIA 2YU1A 2WAAA 1SPPA 4AR2A 3IPVA 1SLLA 2HBUA 3UJOA 1QJU3 4X8NA 5FQ0B 3DF0A 3JZVA 1PO23 3ZYPA 2IFWA 2HJIA 4WZCA 4XFHA 3AXEA 1AHSA 4EZHA 3NV4A 1LRHA 3VLBB 2QQLA 4K7JA 2AEZA 2PAMA 4S2GA 4YM2A 5JLVA 1PMHX 1XRUA 3KGZA 4QB1A 1XE0A 3RJRA 3D82A 3UKTA 1QJEA 4YM0A 5LA1A 4ATFA 4QXBA 2D6PA 4KGQA 4R9DA 4CU9A 5C9AB 3MV11 1VAVA 5L9RA 1F5JA 1H1IA 3VBSA 2C4XA 5LATA 3POSA 1BKZA 3MF9A 4YLZA 1VAMA 3SNMA 5FZIA 1JOPA 5HXMA 4D69A 2P3KA 4FP3A 4MVTA 1RUF1 4UYBA 2YBPA 5ABJB 4OHZA 4AGGA 5K7PA 4DUWA 5F3CA 3O1TA 4EN0A 1J1TA 4WZFA 4UAPA 5FP7A 3H8XA 4YGDA 4RD7A 2ES3A 3GNEA 3CQOA 4XC9A 4DINB 5JSPA 1QHDA 5FK8A 1HRI1 4FQZA 4YW7A 3SH3A 4GQ7A 4LIUA 3IIAA 1BVP1 4LBJA 1XYNA 2WNUA 3RZZA 1B09A 1AR71 1P8JA 5JVVA 2WABA 4D6SA 5JOYA 3ELNA 1MACA 1ND2B 3GHNA 2DU1A 4L8QA 2ZABA 4JZRA 1DHKB 4N43C 2O14A 4AL9A 1GFF2 1UY4A 2ZGQA 5D1IA 5DAWA 5DZFA 3LAGA 3ZDVA 1AR62 2WL1A 1JZ4A 4MGYE 5EP9A 3CJIB 3N9PA 3NMBA 2D6OX 1D4M2 1BLZA 4PIZA 1E5HA 2QQVA 2Y34A 3P3NA 3RGBA 4AVTA 5F9TA 1Q3EA 1NUKA 1UX7A 3MF6A 3AP7A 4GJYA 4NHXA 4DXTA 1QXRA 1IG3A 2TBVA 3T0BA 4E4HA 1BBT2 4AVVA 5KBFA 4AFMA 5JIAA 1UOBA 4UFIA 2UWAA 4MGIE 4TLFA 3V56A 3L2YA 1NQJA 1F15A 3HJRA 4Y1VA 3VZKA 3X29B 4XF4A 1CPMA 2GDFA 1JYNA 2LS6A 2VQTA 4LKDA 4QPIC 1YYNA 1JZ5A 1TMF2 1LAJA 3BPZA 2B45X 4XETA 4AQTA 4YZ3A 4ZZ5A 2WSVA 1S0DA 3ZOIA 1REDA 4MGZE 1DZTA 4XHBA 4P9GA 1VBB2 4AI1A 1VBB3 1TVGA 1VRH2 4IESA 4A45A 1DZQA 2CDPA 3B93A 5EJ3A 1UAIA 1HB1A 4AEDC 1OVSA 3OD4A 1R64A 2EF6A 5FZ0A 4OFGA 1OUXA 3GM8A 2W08A 3K2OA 4LR4A 3T4VA 1KITA 4YVSA 4AHWA 1Y4WA 1JODA 5HV4A 1VIWB 2Y6GA 2IUWA 5FZAA 4QHZA 1EUTA 4A4AA 4XQ4A 4GD4A 3RZHA 2R1BA 1VP6A 4PF5A 4JHTA 3W20A 1RUI3 2HEVF 2XBO1 1OH3A 2ZHKA 4IL7A 2VCCA 1LOGA 4OMCA 1FYUA 2IZWA 4OUSA 4L0PA 4Q4X3 1NAEA 3AKQA 5FZCA 4XQWA 3A23A 1URXA 3ZR5A 3R6SA 1VMHA 2R061 3J4UH 5KHHA 4QD2A 1RUC2 4COUA 1HB3A 1XYPA 3JXSA 1XXNA 3PVBB 2WNUB 1BXHA 1S0GA 4RA0A 4LHLA 1JYVA 3F2ZA 1QJZA 4N43A 4OUEA 1ND2A 1AR81 1WLCA 4PLNA 4HVQA 2XKOA 2BGPA 4FOQA 4NIIA 2E6VA 1ZA7A 2RDQA 4QGLA 4META 3VBFA 5A33B 3MW2A 3Q9OA 2VNGA 5LBFA 4AVBA 4FPLA 4QX1A 1LOCA 2A3WA 3LEIA 4E8CA 1VRH3 4ZKTB 5LZ6A 3MFCA 1AJKA 1O8PA 2BUKA 1CONA 3AP4A 2RS32 5FXVA 5FXWA 5ACA1 4YSFA 4XYXA 4CEYB 4FBFA 1U5XA 2YROA 2WT1A 5BXXA 5F37A 2JG8B 5A80A 3JD73 4NAOA 3SEPA 3E6BA 2XPJA 4Y4YA 5JSRA 3BALA 4NRQA 5ACA3 1W6MB 5C8WA 1REEA 1MQTC 4HXCA 3OUJA 1LOBA 1NCRA 3FLPA 1H2MA 1WMDA 4Y1UA 3O1PA 2DVFA 5F3EA 1ZBE3 1VPHA 3WT3A 5D8AA 1BJQA 1UQXA 3CJXA 2C9KA 3TN91 2KR2A 4ET7A 5A1AA 1PK6B 4QDSA 4RQPC 4QX3A 3UNPA 2ZMNA 3ACHA 5FREA 4M00A 1DQ6A 5LCWL 3WXPA 1O4ZA 1Y7BA 1Z0HA 1YQ2A 4YVSB 3WG1A 3WY6A 4ARYA 3Q8BA 4LO4B 2FCVA 4HONA 5IAVA 3ZR6A 1E5IA 5F39A 3Q8FA 2OPKA 3PL0A 2FZ1A 2ZHNA 5KC5A 1VBE1 3AKRA 4OHVA 3ENRA 3SCFA 1R081 1WD3A 4DIQA 1W8OA 3ZPOA 2G9FA 4LOSA 2YGMA 3LZZA 4B1LA 1YNAA 2A6VA 3I3EA 1DDLA 2PELA 4I2OA 1SBFA 3W5NA 3ZXDA 3HT1A 5FAXA 3FFQA 1WMEA 4L99A 4I02A 4HPKA 3VB9A 2W0XA 2B5HA 3AFKA 3H3LA 4CDQA 2CL2A 2G1MA 3BOPA 2E32A 2N7GA 1N1SA 1G9AA 4FCAA 4WM7A 5E16A 2FDHA 1MS3A 3Q8AA 4YGEA 3MI8A 2ZXQA 4CTEA 3SEEA 5DUXA 3B69A 3CDZB 5JI9A 3A4UA 4DY3A 4ORFA 1UX6A 3O5SA 4MO3M 1XSQA 5L7OB 5IVYA 1N1VA 3RNSA 2BFUL 3UYJA 5LBEA 1K5JA 3HPNA 1VB2A 1K5MB 4HSJA 2EXKA 2YPJA 3P1IA 5JCTA 5DABA 1SBDA 3NNLA 1NCRC 2B4KA 1I5ZA 1FNYA 5EJZB 3JBG1 5GZCA 1HJFA 3V0BB 2CU5A 5AC93 1NCRB 1XNKA 5DZEA 5BNNC 2EICA 1DYPA 1RUG2 3AYEA 1XQNA 5E88A 2JE8A 2J7MA 4FQ4A 3G7DA 4R52A 4UFJA 5CIRA 3DEMA 1ZZCA 5CKMA 4AFBA 2XL9A 3INAA 1H2LA 5FZFA 4JQTA 1BEV3 1ULCA 2A73B 2JIJA 1AR73 2VH9A 5CZKA 3OYWB 2SLIA 4M4PA 1UOFA 2XONA 3TOJA 2R0FA 5FBZA 2IXJA 1X33A 2QDNA 1UYXA 4JGYB 1SLIA 2AH2A 3WDXA 4EWEA 1RYYA 4YZ5A 1WD4A 3T2QA 3DV8A 2W1UA 3HR9A 4LBQB 1IPKA 5CNAA 1UMHA 2X29A 2B42B 1XNAA 2VULA 4W8JA 3ZSMA 1HDKA 1RC6A 1T6GC 1V6MA 2JJ6A 3WNXA 3ZFFC 5D2AA 4RQPB 4AEDA 2VQUA 5CFDA 2FD8A 4FPOB 5JAXA 1FATA 2DFCA 2EXIA 1CX4A 5JXGA 2XJSA 1EPZA 5DDJ1 1DYOA 4A42A 2ZAHA 3J7MA 1W2OA 4M3CA 3W21A 4HOOA 4Y20B 3RZMA 2EVXA 1ZZ7A 2K9ZA 3N9OA 4WVMA 4C91A 1GYKA 3A0NA 3BODA 1LESA 4HKLA 1NY71 3ZMOA 2ET7A 2FDIA 2RR11 5A70A 4D6QA 3ZKYA 1E5SA 3LFIA 4PI0A 3OSDA 3O0XA 1B35A 4MX3A 2OX0A 3GJBA 4MGQA 3M3CA 5GKAC 1LHVA 5KHJA 2DU0A 4R4ZA 3O14A 2P6HA 2X05A 1F2NA 2ZGUA 2Y64A 1YFUA 5JDBA 2Z2SB 1JUHA 4A2UA 3LFMA 1OH4A 3VD3A 3V0BA 1TME3 1NXMA 4QAWA 4XZPA 3VKMA 4AQ6A 5LEJA 1OKQA 3WDTA 5LWBA 1J84A 1YQCA 3MYXA 2JDKA 1UPSA 2HWB3 4DXSA 5CA6A 4EN9B 5BNPB 1DG6A 1ULDA 4D7YA 3LE0A 3WQBA 1QJX1 3PU3A 1HRI2 4XMIA 2LALA 3EMRA 1JTZX 2QQIA 3S6PA 3WZ1A 2NMNA 1ZBE1 3H0OA 4XJZA 2ARXA 1DZRA 2WN2A 3B5LB 3I3BA 4KU8A 2NP0A 2HWE3 5ANQA 1XB9A 3MUY1 1RVF3 5KC6A 4N9IA 4MXWB 2VXJA 3AB0A 1KJRA 3KB5A 1K42A 3ALQA 2YU2A 4UOJA 3J9SA 2PMWB 3VKOA 4JKKA 1VBD1 1RTVA 5HXVA 1J59A 1RUD1 2EIBA 4QPGA 1PGSA 1ND3B 1RL3A 1UYZA 2RMU2 2F4LA 1BQPA 1IKPA 1KDKA 1S0IA 1VBE3 2X53S 3CMGA 3I2KA 3LIHA 4XF0A 4N53B 4AEMA 4DNYA 3TRSB 4BOWA 1CPNA 1RINA 1W06A 4ZXKA 3T2TA 2VD7A 3OEBA 3M8LA 3RI8A 1W6QB 4AFDA 1COV2 2GC2A 2W46A 2PHDA 4L92A 1UL9A 1I5PA 2C6SA 2DWRA 4XUPA 2FDKA 3Q8EA 4LQRA 1RUI2 2QBXA 5HBAA 5FK7A 1SACA 1RHI3 2GH8A 1ULFA 3JD71 1VBC1 2VZVA 2Y6KA 2XR4A 3PVNA 3WP6A 3TEYA 4CCLA 5KXCA 1MEC3 1DGWA 1G8WA 1H1MA 5CYYA 5FZBA 4NIGA 2G9ZA 3NW4A 4BPZA 1A3KA 2JX9A 5J36A 1W2TA 5JWPA 3VD4A 1LCLA 5FKBA 4AQ2A 4SLIA 4CXXA 1OFSA 3TYJA 2QQUA 1IPSA 3W58A 4K3UA 1GR3A 3E5UA 4COWA 1PGL2 1OSGA 4NHYA 4PDWB 4CEWA 1AX1A 3RJ2X 1RUJ1 4ASKA 2VXRA 1COV3 1VBC3 1W03A 3M2MA 2YB7A 4PQQA 2PAEA 1DLCA 1CQ9A 3USUB 1NT0A 3KQRA 4CE8A 1RUG1 1UCXA 3OGVA 1X50A 4FPCA 4LA2A 4MYEA 5FV3A 1AZDA 1DQ5A 2WFF2 3VZNA 5FKCA 1FPN1 1EAH1 3U10A 2WNVA 2VU9A 4FP2A 4CUGA 1UZZA 3JU9A 1R091 2O1QA 4PIXA 5I0UA 3O1UA 5FZ4A 3BU0A 4WM8B 5KXBA 1UYYA 1UD1A 1T2XA 3ZYJB 2WINB 2YZ4A 3VBUB 3AM2A 1UO9A 1W8FA 1YQ5A 1OUSA 3VDDA 1J83A 3POJA 3MFAA 5GLWA 2MEV3 1CAVB 3MEPA 1O5LA 1DU3D 2BDRA 3NNMA 1W2UA 5DUVA 1WA6X 4HVRA 4U36A 3MDPA 1PO13 2FBEA 2GALA 3B3QE 3ST7A 4YVWA 1VRH1 1ZRCA 4MH0E 1UWWA 2OQ6A 3GALA 3V0AB 4P08A 4QDQA 5EJ1B 1AL21 1OC1A 4BIFA 5FP9A 5J3UA 3PMEA 2AYHA 4G4FA 4XXPA 4MUVA 4Y33A 1JYTA 4TWTA 4P02B 1YUDA 2AENA 3IM0A 4LLFA 2QFEA 4XUNA 3UGGA 2AUYA 3I2DA 3VBSB 3UK9A 1SDWA 2OZ6A 4NO4A 5J09A 2DCYA 4MGSA 1GWMA 5F6KA 3IT8A 4XUTA 3KVBA 3U14A 4Q8KA 5F5AA 5A32B 2GZWA 3UL2A 3LEGA 3JD72 5L9VA 5K0UA 5EQUA 4QQ2A 3RPQA 2VJXA 2XLFA 3T2OA 3WQ0A 1AYM3 1GZWB 2MHFA 1IS6A 1L7QA 2YDEA 1AYN3 2WQ8A 4AWDA 2YHJA 3RYKA 3VGIA 1W9SA 2CDOA 4IW3A 2X5IA 4XILA 3SCHA 2CWSA 5HCFA 1IS4A 3FHQA 4R4XA 2C5DA 4AI0A 2JB4A 3ILRA 1W6PA 3RI9A 4A7ZA 3NJYA 3WG4A 5E8AA 2GMPA 5BNNA 2JG8C 1OF4A 4Y1YA 2VMDA 2ZPXA 2OIIA 1PO22 4CPBA 2XWJB 2JDMA 4FPGA 5JUVA 1OA3A 3USUA 3I4IA 5EIYB 5FYZA 2DCKA 3OGSA 4W50A 2BEOA 3ZLIA 4YW5A 4M01A 1JZ3A 4CP2A 4JGYC 1Y9QA 2H0VA 5A7QA 4RS5B 5FZ8A 3GZEA 4K20A 1W8UA 2V09A 1XNBA 1Z7S3 2AZ5A 4JDOA 3M3EA 4FPFA 3VZMA 4XE9A 1EY2A 5GZDA 4MOAA 2JWPA 2BVVA 4RFRB 3IPVB 1YWKA 4XJUA 1N3QA 1PMJX 3E5XA 5CFDC 3AVRA 2C1FA 2EALA 5GLZA 3GXUA 4J1XA 1O7FA 3POIA 4HANA 1DQ2A 4YVWB 3KCXA 5EFUA 1CGPA 1G9BA 3ZFEA 1BEV2 5DG2A 3R0RA 2FDFA 4QKDA 1LJ7A 3NKTA 3VD9A 1L7RA 4I01A 2R6QA 4Q29A 2QQNA 4H55A 5LRRA 3DN7A 1EAH2 5KXEA 4OVEA 3CNAA 3J8F2 4KMQA 4E9KA 4YW6A 3EJKA 3MO4A 5C3QA 5C7GA 1W0OA 4GB32 5JMCA 1UMZA 1ZBA2 5FZDA 3ZYIB 3BTAA 1JXNA 3NV1A 3DYPA 3ZSJA 2K46A 2UYAA 4CA9A 3RS6A 4BQYA 1NXD1 1UY0A 5A32A 2GP5A 2Q1MA 2PLV2 1BBT3 2XVGA 4RL7A 1LGBA 3WF2A 5I91A 4RSUA 1FV3A 2E7AA 4TLGA 4BQ4A 3VUOA 4OULA 3PUQA 3VBSC 3H42B 3R4DB 4ZPIA 1CAXA 4Q0PA 1W8TA 1W6PB 1AL22 1GZ9A 1AR63 1JU4A 3PDQA 3PUIA 2D6MA 4JDMA 2Y60A 2DURA 4YG3A 1QGLA 4O9GA 1K5MC 4FFFA 3PURA 4MGTA 1LHOA 1PZ9A 2JD4A 3ASIA 4AAPA 4CUBA 1X9TA 1ZM1A 3H1WA 3AJZA 4BZ4A 3ZDSA 3T30A 1C8M1 1PIV3 3OF1A 4AK3A 4B29A 1V6KA 3HVDA 1Z7S2 5C71A 5IK7A 2ZKLA 1ZRRA 2UU8A 3B01A 3JCIA 1WLWA 1XJAA 4RGAA 3FN9A 3POYA 5H9PA 1WZXA 1YJLA 3LQCA 3RWKX 4XW3A 2WS91 3BN6A 2KD7A 1H6XA 1LKNA 3KGLA 2PHTA 1JS9A 2VCBA 5J1XA 3U37A 1ZRDA 4FI9A 2XJVA 1POQA 1QEXA 5FMOS 5A7WB 2CGPA 4N53C 4FAHA 2PXJA 2HWD2 1MS1A 1REFA 4NE9A 4RFT0 5KHGA 2ZEYA 3M7AA 3NL1A 4UW3A 5APAA 3WP3A 4AF9A 4IEZA 2WZPP 1FPN3 3WW1A 1OF3A 2YPDA 2ZEZA 4A41A 1H8TB 2RG4A 5C9AC 1SLCA 4QPIB 4QM9A 5FLIA 5FZKA 4A6OA 3A7QA 1KFXL 2PHXA 3J7HA 1UN1A 2XOMA 1J3QA 1C28A 1T6BX 1ULOA 4FPYA 2CSGA 3M4FA 4KWLA 1Y3TA 3U78A 3HNMA 4LK7A 5FYSA 3FBYA 3SISA 4AHYA 4Q27A 2XLGA 4MV2A 1JHJA 5T5OA 4BB3A 3OGGA 2BVBA 3KWVA 4LBOA 4XCBA 5CVRA 3CF6E 5ANNA 1ASJ1 2VUAA 4QQOA 5FTTC 3BIWE 4PDWC 4CDUB 1QU0A 2AACA 2Y38A 4Y24A 3IAPA 4N43B 4LHSA 3RFRA 4CDUC 3K51A 5T3NA 1JZ6A 3N3HA 1AX2A 1HN0A 4K21A 1RUJ2 3ETPA 3ABZA 5LB6A 1ENXA 4ZS2A 1S2BA 1WUVA 4KBBA 2JIGA 1A34A 5IVFA 2GP3A 4AI9A 2DVAA 4LHKA 3SLIA 4GH4B 4AEJA 1RMU1 2E53A 4QM8A 4XBLA 1RUF2 2C9AA 2DUOA 5EYYA 4CDXB 1I1EA 1H6YA 4HVOA 4XDQA 5KHKA 2SBAA 4XF9A 5FLHA 3MPBA 5BUVA 2GC3A 2A71A 4HETA 2ADEA 4BK4A 3AVSA 4XBQA 1CAVA 3PMSA 3ZN6B 1ASJ2 5AVAA 4CP1A 1W28A 1US3A 2YFZA 2LUWA 3TAYA 4ES8A 2PFWA 4K8FA 4BYYA 2JDUA 5JI7A 2ERFA 5EPAA 4NN0A 1C1FA 4BQ1A 2VBPA 1SG3A 3SHRA 1OA2A 3I7DA 1ZA4A 3HWJA 2HWC1 5T54A 4B3NA 2W47A 3ECQA 1GNYA 1Q8OA 4BQWA 1H8TA 4E2GA 3ES1A 3UKNA 2CTVA 3WV6A 3T0DA 1UYPA 4COZA 2W95A 2RS53 3J26N 3NAPC 4S2FA 4BA6A 4JRLA 2GN3A 2ZX2A 2VNRA 2QQOA 3ZFGC 5KXDA 4Z92B 1F35A 2WFF3 3NAPB 4IDZA 1CJPA 4KWUA 1PX4A 4J25A 5F5IA 3VDAA 2HWE1 4NJ4A 5C8CB 1IOAA 2HYKA 2ARCA 2W91A 3SITA 2XVKA 1DYKA 2EAAA 1CZVA 4DZGA 5GZEA 1APNA 5DPNA 2LROA 1W6NA 4IEOA 4LBMA 3AP5A 3B94A 3ZFFB 1DIWA 4PLMA 2D93A 5HCAA 3IN9A 2HWD1 2WC2A 3AKPA 2VZTA 1VBB1 1LOEA 1LOFA 2JEMA 2VQ0A 3AKTA 5FZOB 4ZXEA 4DRVA 2FMYA 1RUI1 4W65A 2W39A 5FR3A 3ACIA 3I54A 2RS33 1VRBA 4QXHA 5AVPA 5CBLA 3BUCA 3NV2A 1LODA 4H3WA 4Q1PA 5F6LB 2ZHMA 4KG8A 1RVF2 4GH4A 5FYBA 3KQ4B 4JQRA 1NE4A 3POGA 3RQ0A 1RUD3 4NPRA 5I0RA 3LB9A 1O3TA 4IV3C 2QQKA 4AYUA 5IK4A 3JQXA 1MZFA 1LGNA 3H8OA 1PM7A 2VPVA 4XF3A 3WNKA 2QZ3A 2R30A 1HXS1 3JB8A 5A1FA 2QQJA 4MLOA 1DCSA 3E1F1 3T3YA 3NJVA 3NQHA 3J7LA 2PA7A 3O1SA 1S1AA 2L9LA 2PHWA 5CKQA 5T5JA 1RUH3 1IQAA 1OI6A 2W1WA 2DV9A 2ZGKA 4XIKA 4HL0A 1UIJA 3OUIA 4F7ZA 4C0HA 2ZGRA 1SBEA 1U5YA 4FTEA 5DAVA 3D5OA 1DLLA 2XKPA 1U0AA 3V65A 2WO1A 2DBIA 3AZXA 1UKRA 3IB3A 5I8TA 4OZXA 2XJTA 4JGYA 5FBJA 1CVNA 5T5PA 5L19A 3M70A 3B9CA 4OHYA 2I2SA 4S2HA 1YQ6A 1MEC2 2VVFA 2BRTA 1BBT1 4LBQA 1RUH1 3B7MA 5FY7A 3HNYM 1W8WA 3I2IA 3IWZA 5FDBA 3LA3A 2VW1A 3IMNA 4EV0A 3QLQA 2KA3A 1X7NA 3HBKA 1QJU1 2VC9A 3J7NA 1X8EA 1HQLA 3FUQA 3Q8CA 1QKQA 3BCWA 4ASLA 1RB8G 1Q56A 3GJAA 1DP0A 2GMEA 1BCXA 1CZSA 1V6OA 2LW8A 4UXAA 3C3VA 2JDHA 2WNUC 4XUQA 1VLNA 1V9U3 5C4WA 2A6XA 3PIGA 4QKFA 3WNMA 2E51A 5FYMA 3ZXEA 4NWVA 3O1OA 5I0TA 1W3XA 4CPBD 2YY1A 4XJWA 3WF3A 2UURA 3D0SA 1O8SA 4A3XA 2Y6LA 5A6ZA 1SZBA 4WM7C 4BLIA 2WO2A 3KV4A 4Y1XA 2DBNA 2DF7A 1US2A 3MICA 2G4IA 2Q5TA 4GWJA 1KRIA 5FY8A 3CLPA 2D40A 5DAPA 4ES9A 2HWE2 4FTSA 1SLTA 3PLQA 4BQ5A 1KD7A 1UY1A 1KEXA 1GLHA 1O91A 1SLAA 1W2AX 1IHMA 3VZOA 5GALA 5C3SA 2BFUS 4GALA 5A7PA 3EYPA 2P37A 1RJ8A 1I3HA 4R9AA 2P3IA 3KHCA 2VOKA 4YM3A 3HN1A 3PUSA 4ZU5A 3RRDA 3GBGA 4C8DA 2XHNA 4WBBA 5JIUA 4CEYC 2ZHLA 3QH6A 3VZJA 4LBNA 4DXRA 5A33A 1XPWA 2WA4A 4P14A 4AAXA 4EWAA 5C9AA 2RS11 1BZWA 3TN93 1RUNA 3SKVA 1LGCA 5FFOC 4YVSC 4QT6A 1W99A 3TBDA 2YC4A 1W8NA 1ULGA 4KI5M 4MGKE 4NRPA 4WM8A 4BXFA 1JOBA 4CP9B 3USSA 4UFMA 1CAUB 2AC1A 3PNAA 2GSYA 4QX5A 1W9YA 1Q8SA 3ZYBA 1ODMA 4BCUA 4PT6A 2Q8CA 1HQWA 1POV1 3KT4A 1QJU2 1RUE3 2CHHA 5AC92 4OI4A 1H2NA 1QDOA 4RR3A 2E63A 4IE4A 3RMXA 3IDAA 1GQHA 3VBHA 5FOJB 1QOSA 1GU3A 1U5IA 5FO7B 3BU7A 5I0SA 1V70A 4NPMA 3H50A 5F2SA 2HWB2 3I59A 1F9KA 5FZHA 5HCHA 1Q5OA 3H3UA 2WAOA 5FXZA 5FPXA 3B02A 5LK7B 1UU5A 3N4MA 3B00A 5JZGA 4XFGA 1CZTA 1VALA 1J3RA 2RDNA 4IGOA 1QNYA 3PJYA 4XFFA 4QKNA 1CAWB 1B35C 2FDGA 4CSWA 1J58A 2G9GA 2LTNA 2Y33A 4NWWA 1L3JA 4Q0UA 3ZXGA 2EIGA 2W94A 4UF0B 1QXJA 1LECA 1LOFC 3GYDA 3OD0A 1BYHA 4UFHA 5A7SA 3AMHA 5JZGC 3GBFA 2C24A 2WFF1 2D5HA 2Q1ZB 3LD8A 4LUMA 1F31A 2X10A 3MIHA 3BTYA 1W2NA 2XBO3 4CZSA 1D7PM 2WRAA 4LBKA 2GH2A 4E27A 2YBKA 3C2UA 2UWCA 5IWFA 5BNNB 2R49A 3WHUA 3IAQA 3L9JT 5JOWA 2JD9A 2VQAA 4P9IA 2VW2A 5D8AB 3WOGA 1JBCA 1U5ZA 4MZUA 4DEVA 2PHLA 4M4RA 2IXIA 4QGNA 5L7OC 4HPKB 2OQ7A 4HLTA 4JX0A 5FZEA 4WV8A 1ZBA3 4I3GA 4V2VA 3AZZA 4NRMA 4COVA 5CADA 3PVOA 1V6LA 1VBA2 4RS5A 1UIKA 4FSJA 2RS12 3NAPA 1IS5A 5BPXA 4N90A 3ILFA 4YFWA 2J1EA 1KQRA 4MADA 1JYWA 4LITA 1MEC1 2CYFA 3AX4A 1VJ2A 2ZX1A 4QX0A 2ZX0A 3P5BA 2BWCA 5HCBA 1BVVA 4FFHA 4RGKA 2PHRA 4YW3A 1UXXX 5BY5A 4XFAA 3KCYA 2HWF3 1Y43B 4JTOA 1VB4A 4UFKA 1AX0A 5FYIA 3THDA 3KV6A 1SQ4A 2R041 4MG2A 2YC0A 3DKWA 4C1XA 5JXHA 3W5MA 3ZMNA 1MS9A 1HRV3 4XMAA 1OD3A 2ZX4A 2VOXA 3FLRA 2P3JA 3K48A 4DY5A 1SFPA 2VY0A 3FJSA 3WW2A 3O1MA 4GB31 3HD8B 1WGPA 4YARA 1VR3A 3OYWA 3SCGA 3UESA 5FY4A 4DUVA 2ZGMA 3OGJA 1O3SA 2Q8OA 4HMZA 4O65A 1Q8VA 2JG8A 1GV9A 1QF3A 2FDJA 2A6ZA 1ALYA 2YGLA 3HQRA 3CHXA 3T4HB 3WLUA 4LO6B 4QU1A 3AMNA 4IEWA 4QHBA 4QXCA 1QQP2 2R072 3VDBA 2GC1A 3EB7A 1PGL1 1W6MA 1NCQB 4EQVA 5IAXA 1XOYA 2X5IB 2Y0OA 1G9CA 3RZKA 1ULEA 4Q4Y3 4DFSA 2WWUA 4GIQA 1DQ1A 3LEMA 3DPRA 4ISRA 4PBOA 4BMBA 3D6EA 1QOOA 3DUIA 5A7NA 4GXLA 2ARBA 4AI3A 3ON7A 2BTVC 3RVHA 4EZ4A 1W39A 1M4WA 1LENA 1UF2C 2P1BA 2CY6A 4ZONA 3CIHA 4LEJA 4FTBA 1HN1A 1AR72 2O8QA 2VGDA 1MR5A 2JG9B 2ETEA 1QH7A 2VZ1A 4GAZA 3PTRB 4XJ8A 2UWBA 3S57A 1QY4A 4CCCA 3IDCB 4Y4RA 1KS4A 2V4VA 2VMIA 4X6QB 1TE1B 5D8AC 4CU6A 1FNZA 4LBQD 4W6XA 3ZSKA 3OEAA 2HBTA 4EROA 4XFCA 3JQWA 4Q4Y2 1ACCA 4RQPA 4KH9A 1CR7A 3QACA 1SDDB 2BGOA 2Q0AA 5IVJA 5A3OA 5BNOC 2Y26A 1MVQA 1PO12 1SPPB 4A7YA 1HIXA 5FYYA 3TB0A 4LPLA 5FIXA 2NYYA 1OOPA 1NG0A 3VBRA 3I2FA 4DO0A 3R4UA 3EO6A 1ZZ9A 3LA7A 4QB6A 4FVVA 4Y20A 2VBDA 3MIFA 1ZZBA 1RUC3 3EHKA 2E7QA 3CO2A 3K4AA 3N36A 4N8MA 4Q26A 3MLKA 2XJPA 3I3DA 1WCDJ 2Z4FA 1XNTA 4WM7B 5C5UA 2B9UA 1CX1A 2Z69A 4JVAA 1GOHA 2WO3A 1GZTA 2WDBA 3D0JA 1WCUA 1S0BA 5FPLA 3JB4C 3KZ4C 2EAKA 1D4M3 4GMP3 4KWJA 1JMUB 1K12A 4IGQA 4ASMB 5ABJC 4NHMA 3WP5A 1HB2A 3U1XA 4ZU4A 3ZSEA 2R7EB 4CDWA 4WVZA 3U11A 1C3HA 1K5MA 1O4YA 3V64A 5L36A 3PJQA 1AYN1 1UZVA 3IIIA 1NCQA 3SQOA 2VECA 2YBSA 3DPRC 4EN8B 2GNBA 4BH9A 2JDAA 4F8AA 4JKMA 1QXPA 2CGNA 3VN4A 5EWSA 5BNPA 1WCQA 5LW9A 2LRPA 3OTFA 1ND2C 5FYUA 2Q8EA 3S0MA 1R1A3 1Z7S1 3OPZA 4IV1B 4QX8A 4RGGA 1JZ7A 1FMD2 3ZVXA 2OT7A 1NCQC 2JXAA 2RE9A 2V5YA 2YXSA 3CEWA 5FMDA 4AGVA 1RHI2 2WBKA 3JBG3 2PYTA 4IETA 3ZKUA 1MS8A 4RHV2 2R16A 1V00A 2OYZA 4CP9A 1GMMA 5FUIA 4ONUA 4E4ZA 2PQQA 2JE9A 2F4PA 1QH6A 4UBHA 4YG0A 2P3YA 1BEV1 2ZEWA 4EN6B 4XBNA 4N9HA 5F2WA 1MS4A 3QBQA 5ACA2 1YFXA 2V72A 1FV2A 2J42A 2WYSA 3AXDA 4AG4A 1ZVFA 5L73A 1JI6A 5CFDB 3MW3A 2YMZA 1SLBA 3AL5A 4O7XA 2HEYF 4Q0QA 5LBBA 3DKQA 2D3PA 5GM0A 3VBHB 4N7UA 1N3PA 1NYWA 4Q5OA 5FLJA 1J3PA 4I09A 3O0WA 1OOPB 3VBRB 1NLQA 3B9IA 1JYIA 3VHRA 2OXBA 4XAAA 4K1ZA 4EWDA 2JDZA 4OQ9A 1E57A 5LRSA 1NZIA 2MPFA 5C3PA 3WCRA 2XUMA 4H7MA 4DEQA 2CAUA 1ZBA1 4LORA 5T52A 4TXWA 3VBUC 1O3RA 4CU8A 3A0KA 1YXWA 2XG3A 1CAWA 5C33A 5FMCA 1COV1 1OMIA 1Y9MA 1RGSA 2Q1FA 3WUCA 5F32A 3WR0A 1EPWA 2FCTA 3ZXAC 3E97A 3ZFGB 3MLJA 4FT8A 5A1LA 2Z5WA 2KXLA 1OLME 3GCWA 5JXJA 1RUE2 4GA9A 4NIHA 3BVCA 1FOD3 2VW0A 3VBUA 5FYHA 2RS51 4PI2A 4BK5A 4CU7A 3LPFA 3AYDA 4CUCA 1QIQA 3UGHA 2XGXA 4RR3C 4DQAA 3C7OA 1NX9A 2ZKNA 3ATGA 2BBAA 3AZVA 4GWMA 4CVUA 2RMU3 2ZGLA 4DXZA 1R1A2 3V0AA 2F6BA 2ZGTA 5ERLA 5K0UC 5HV0A 4IV1A 3VBFB 2DDUA 4G9SB 4XVHA 1N3OA 1EV12 2OVUA 3ZXJA 5D21A 3SC7X 1IS3A 4HSLA 4L97A 5FMOL 1N1YA 3D3AA 4Y1ZA 4O9EA 3WDYA 1AJOA 1TQ5A 3WP4A 2JKBA 1PIV2 4FXKB 4BXSV 1IZ3A 2CNAA 3AYAA 4IV1C 5DN2A 3GZUC 3NJXA 1OA4A 1H30A 2ZGNA 3VV1A 2WA3A 4QPGB 2WNOA 2VUCA 2ZTNA 3ZN6A 1OPMA 2VUJA 4KWKA 2ZAAA 5FZ7A 4Y3OA 1FOD1 1MQTB 4N53A 4UT5A 2WFPA 4WM8C 4YVWC 4GULA 1UNBA 2W3JA 4H14A 4JHZA 3KMHA 3KSCA 2OS2A 2HLEA 2XBO2 2PHFA 3LCPA 4Q4W3 1C5IA 1VAKA 3N7KA 2A3XA 3MZHA 3FMGA 1QJX3 1S0CA 2MNGA 1RHI1 1RUJ3 2ZGPA 3KV9A 1AXZA 2ORZA 3VL9A 4UW5A 1ENSA 4BQXA 2VCMA 2QCSB 4OLLA 2VTXJ 4FOWA 4TSVA 3HT2A 4LO8A 2J1TA 4P9LA 1TME1 3WCSA 1LEMA 1C8M3 1I6XA 1PIV1 4CYDA 5IK8A 1W0NA 1GZWA 3SH4A 5JR2A 2ZGOA 3FE5A 4INDA 1L7LA 2YYOA 4W6YA 1C8NA 2JB8A 3SKJE 1WCSA 5DG1A 5FUNA 3RZJA 5IVVA 1YEWA 1S0JA 2WN3A 5C3OA 5IYYA 1ASJ3 3TEXA 1LEDA 5JPMB 4IE5A 2Y0IA 5FZGA 3IDBB 4S2DA 3AMQA 1YFWA 3QOPA 4XQDA 3DCQA 2D6LX 1OLRA 3C7HA 2H6CA 5C4WC 5JPNB 5FY1A 1ZZ6A 2CGOA 1JUIA 1CWPA 4IERA 3E5QA 1RVF1 3POBA 4JGZA 3ZFEB 3FC0A 5LASA 1PVXA 4YG6A 2WSUA 4URTA 3MBWA 5A3TA 2P6CA 3GBWA 2YUEA 5DAQA 1A6CA 5FO9B 5I8YA 2VVEA 4KL1A 3O1RA 1HXS2 4AE2A 2QZ2A 5IHRA 4U2AA 2B9VA 2VBBA 3S5QA 2JDPA 3QH7A 1PZ8A 3MIEA 2VR4A 2AREA 3WVJA 3VBOC 1XU2A 2RM22 4L11A 4LK6A 2WZR1 2VVDA 4JDNA 1GNZA 2HH9A 3VZLA 3LGRA 1NY72 3FUOA 1QOTA 3L2HA 3LOBA 3RDIA 2JENA 3BKZA 3TEWA 3AZWA 1QNWA 5M0TA 2K2SA 1GZCA 3IKWA 1HB4A 1AR82 3O0VA 5H9RA 1R1A1 3BTXA 1NA1C 1AR93 1SFNA 4YZ1A 4PJYA 1NA1B 1C1LA 1EV13 1H4GA 2GMMA 1XE8A 4OZOA 5BNOB 2WLQA 2A7AA 4H2AA 3UETA 1QJX2 2W52A 3H3ZA 3NV3A 1EP0A 1UMIA 2VZPA 4L9BA 4CDWB 4BWOA 1H8VA 4NVPA 1PO21 1NE6A 1R092 4B4QA 5F7UA 2EIDA 2VZ3A 4Q4X2 2Y8KA 3DL3A 4QMAA 4BE3A 1PX3A 1FOD2 2O0OA 1CAXB 3MHZA 3S5AA 1FAYA 3GZTB 4ZS3A 2EIEA 3PTYA 4QXKA 1V9U2 2XB6C 3BIEA 4M3CB 1YJKA 4JC1A 4XABA 3ZN4A 3ZYGA 3I59B 5DZGA 1H2KA 3ZSLA 4WVMB 2YG0A 2A6WA 5AC91 4CCDA 1NLRA 3LF7A 4BMEA 3DXTA 4B4PA 5FY0A 5G05L 1JZ8A 3VD7A 3ACFA 1GOGA 4XEZA 4Y22A 1HXS3 1POV0 5EV7A 1EV11 1F4AA 3VD5A 5C70A 4IUGA 3THTA 1GP6A 3FWEA 2ZX3A 3RSJA 4TZDA 2HWF2 3HBZA 4UW4A 2JKXA 4YGCA 1OXCA 1MPXA 1YIFA 3AZYA 5IW0A 3WG2A 4AI8A 5FQ0A 2WZR2 5A3NA 1HRV1 4D3WA 2BNMA 1FXZA 3S30A 1HW5A 2WO7A 4AXOA 4TYSA 1UZ0A 3BTZA 1UY3A 2V4AA 1WW5A 3WF4A 1RUH2 1O4TA 1YRZA 3OJBA 5BNPC 1LHNA 2AR6A 3ZXKA 4XOGA 2PHUA 1S55A 1E5RA 4HBNA 5LA9A 2JECA 2D97A 1GUIA 2WJSA 4NUBA 1FMD3 4DOUA 1JW6A 3CJIA 4GB33 3TWIA 5FZ9A 3EQEA 5A6XA 4PF1A 2Q4SA 2XJUA 4B7EA 4A6SA 1R093 4CEYA 1MS0A 4ZY9A 4PCRA 2VZUA 2ZZJA 5EXOA 5FZ3A 1RIRA 1W3VA 3WG3A 4LA3A 3O1VA 4RR3B 3WSOA 5BNQA 2VZOA 1UXZA 4Y5TA 4YGBA 1ND3C 3H1YA 2BPA2 4Q4Y1 4K9SA 4NMIA 5FWEA 2ZGSA 2W5FA 4HG6B 1S4CA 2BWAA 4YRDA 1GWKA 5LBCA 2BZDA 3MUZ1 4COYA 5FZMA 1W6QA 3G6JB 4NOTA 2DVGA 1VBC2 4E4DX 4C1WA 2R043 4KBZA 3LDKA 2GNMA 4H7LA 3IDEA 4ATEA 4RHV3 3TNQA 3WW3A 2D44A 3KF3A 3DXUA 3I2JA 3KT7A 4KNCA 4QPWA 5DQ0A 2J1UA 2HWC3 2WYFA 2R071 4RN5A 5IJRA 2I07B 1Z78A 1G9FA 3K46A 4B4RA 1OQDA 1QQP3 1H4HA 3PUHA 5F8PA 3T09A 1GQGA 4JV4A 2A6YA 1PNFA 3RMYA 3JUUA 2NZ9A 1QDCA 2FCUA 3BPSA 5A3LA 1MZEA 3FLTA 1ST8A 5FCCA 1UU4A 1O6UA 1PVC1 4PDWA 4CEWB 4JCKA 3H8UA 1YI7A 1QQP1 3WNLA 1AYN2 2G19A 3CL1A 1HV0A 1YO8A 4AGRA 3I2OA 2JE7A 5L9BA 4ITCA 3M3QA 2B8MA 4DRRA 3BOWA 2R063 3HAGA 3KVAA 2QQMA 3MLLA 1H9PA 4HK8A 4CDQB 1WCKA 1HKDA 1PVC3 3LWCA 1DBNA 3WINE 2JG9A 3CJIC 5JOXA 4ZHNA 4Z8BA 2RS52 1FI2A 2Z42A 4AFCA 3ZX7A 2VTXA 3NSTA 3P6BA 5LA0A 1SHWB 1HV1A 1TNFA 1W9FA 4Q4V3 3I97A 5E1RA 4NIAA 2FZ2A 3D4KA 2IVJA 5C3RA 2B46X 3AP6A 4E8DA 2HEWF 1GOFA 3GCXA 3WHTA 2IVIB 3KCCA 5C5TA 2RMU1 1C8M2 2GNTA 5L7OA 4YZ4A 1RXGA 3BI3A 1OT5A 4DB5A 4Z2AA 2A70A 3AP9A 3N7MA 2YV8A 4NHLA 1JOJA 1SCSA 1WA4A 4QQHA 4D7TA 1PK6C 5KHIA 3CZJA 1S0FA 4KGGA 4CXYA 4LKSA 2ZMKA 4YW1A 1TMF3 3OBZA 5T5LA 3VBHC 1F8VA 2WWSA 3I8TA 2XMLA 3ZXLA 1I9RA 3ETQA 2PN5A 3MIGA 2IXHA 1QJY1 1JYXA 1W6OA 1XNDA 5FZOA 2QDRA 4JGZB 1ONAA 2VG9A 1NQDA 3C8XA 5F3IA 2NLRA 1WKYA 4UW6A 2OUHA 2XVLA 1AVBA 2ENRA 2GN7A 2X8KA 4LLOA 3DECA 1Q43A 1WW7A 1G9DA 3AL6A 5CFCB 2WT0A 2C0ZA 5IK5A 4QX7A 1LB2A 2DUPA 3S7EA 5CFCC 2ZJCA 3POEA 2UYBA 1KFUL 2J1RA 2VMEA 2P2KA 4NROA 5J98B 1D4VB 1LHUA 5LA2A 1JHNA 1CN1A 4HFSA 3ME2A 3WUDA 2E9QA 2VZRA 4IV3A 4K40A 1CJDA 3VBFC 2YC2A 4AEKA 3I49A 1RJ7A 2VOTA 4OQ8A 2B39A 2VOVA 1ZX5A 3RG0A 4Z2WA 3NNGA 1GQPA 1U12A 1V6JA 3IZOA 1C5HA 3MW4A 3IBMA 5FPAA 4NPLA 3NO8A 4LBLA 3QD6A 5F1RA 4P9JA 2FQPA 5IVCA 2UY9A 3POWA 1WBLA 2VMFA 2V5DA 3BGAA 5DDJ3 5F5CA 3WF1A 2HWB1 2QUOA 5EYXA 5F3GA 4BIOA 2A5ZA 5KWRA 1G86A 1GANA 3VBOB 1HRI3 2D7FA 4AHZA 1W05A 2X5IC 1EYBA 4W6WA 2OPWA 4LJHA 2I45A 2VTFA 2WKKA 3AMMA 4IE6A 1WLDA 4RS5C 4CCJA 4YWAA 2DCTA 3NNFA 3ZIXA 2WQZC 3POFA 2Q30A 1RUF3 1XYOA 1G6NA 1NOVA 4URAA 1YHFA 4OHWA 4I0AA 4AVSA 1CIYA 5BYNA 3AYCA 4IE7A 2JDNA 2OUJA 1WMXA 1W9TA 3NNJA 4Q2FA 4YNIA 3WDWA 2ILMA 1LNSA 3O12A 5GJ6A 4BHPA 4FPEA 1DFQA 1FX5A 4JKLA 2WS92 2E31A 2RDRA 1LULA 4ISQA 3OBRA 4BLJA 4GZ9A 2RM21 4C90A 1XSRA 3LDRA 3U75A 3TEZA 2QQPA 1WWYA 4XFIA 4CDWC 3VL8A 4LNVA 2LM3A 4LT5A 5A6QA 1GICA 2IXLA 2QJVA 3KV5A 3CBNA 4Y22B 4XDPA 1A78A 3S7IA 2VUDA 1VBA3 1VBA1 3ITQA 4OCTA 4QWNA 3UGFA 5CFCA 1DQ0A 2DTWA 3GF6A 1XBFA 3MGUA 4FFIA 4PIYA 1WW4A 2XHKA 3ORJA 4FPJA 2ZEXA 2RM23 3FL7A 4XF1A 4MXWA 2XQRA 5GLUA 1OPOA 2MEV2 1OD5A 2CAVA 5FUPA 2BW8A 2K0GA 5LY2A 1IQDC 5I93A 3E6CC 5FYTA 5T55A 4AQSA 4XTMA 1NZCA 2WZR3 5J96B 2Q8DA 1YI9A 2WZEA 3C7GA 4JRAA 3OB8A 4LKFA 1N1TA 2BU9A 1YLLA 5FWJA 2PTMA 2WR9A 3KLSA 2VAUA 1RUC1 2QE3A 1ZZ8A 4C0BA 1R1ZA 1UY2A 1HLCA 4GKXA 4KU7A 4CP0A 1FT9A 1OLMA 5JZGB 4CCEA 2DCZA 3LA2A 5FY9A 2BERA 2V73A 4RYDA 2BGCA 3AMPA 4HN0A 1TZOA 2DTYA 1F5FA 4FFGA 1CAUA 1C57A 3OY8A 5J7MA 3HQUA 4GWIA 5CG9A 1AR91 1RMU2 1UZYA 4W4ZA 3VHOA 2AEYA 4A44A 4AEDB 1ENRA 1SFYA 1W8ZA 5FJHA 5CAZA 5B4NA 1GP5A 3FHIB 1YIPA 4I3PA 1CIWA 4V1PA 4Y5SA 4BM8A 1AL23 3DYMA 1BMV1 3WQ7A 4MHRA 5C6CA 1TMF1 2HWD3 1ZBE2 1QJY2 3PU8A 2RJ2A 1UW8A 2QQWA 2W68A 3VDDC 3W9AA 4AW7A 1HX6A 5SV8A 4QPYA 3LSDA 2TEPA 2CWMA 2PLV3 4IEUA 2TNFA 1R083 4Q1RA 4Z07A 5FP3A 5H9SA 3TN92 3WW4A 1W90A 1VMJA 2D98A 4D94A 5FPVA 4AOCA 3LIGA 1RMU3 3R4SA 1D0GA 4UF0A 1VMFA 1YQ8A 1BMV2 5I8SA 4UWDA 1IPJA 4GJZA 3NKGA 4CUAA 4P00B 1WMFA 2BQPA 4M0HA 1JU3A 3U07A 3FX3A 4FAGA 4IEXA 3T1LA 4XXAA 4E2SA 3HOBA 2E33A 3NRUA 1CD3G 1ND3A 3MV01 4QB2A 2WWJA 5EHDA 3F95A 1S0EA 1TG7A 4I0WB 1IG0A 1GNHA 4BJ0A 4IEQA 3OG2A 3MIBA 3T1MA 4DPNA 2D43A 4GMP0 4QDRA 1V6IA 4FOVA 4A7KA 1OQ1A 2RR12 3DYOA 1KDMA 3ZXFA 3GGLA 2A75A 1QJY3 1CESA 1DGRN 4Q4W2 2NMOA 3VKLA 1RUOA 1UZWA 2WNVC 2ARAA 1AXKA 3THCA 5CEHA 3NWKA 1O5UA 2PAKA 2GC0A 4GH4C 2HWF1 5KR7A 3OBAA 2W92A 3WX5A 5LEKA 2R073 1LTEA 2PLV1 1UKGA 4K6BA 4WVWA 4PQ9A 5IT6A 3ACLA 3PVEA 5K0UB 5GLVA 3AJYA 3N9NA 1SEFA 4LE4A 4P9YA 1K3IA 5A6YA 4AVAA 4Q4V1 1OHFA 1XU1A 3MIDA 3AKSA 3N9MA 3BB6A 3QCWA 1PM4A 4N7IA 2VMGA 4UI9L 3RYPA 1JH5A 1W6OB 1XC6A 2DYCA 4CCMA 1GSLA 4BISA 2BP6A 2VE1A 3SMHA 5ISLA 1A8MA 3CU7A 3GZAA 4LKEA 4YW2A 1D2QA 4YFZA 4IQPA 1QMJA 2JICA 1OQEA 1KXGA 5CISA 1AL0G 4RHV1 4Q4V2 2NQYA 4JAAA 1XE7A 2XJRA 2HWC2 2W1QA 2NM1A 4L2NA 4LIVA 5IUQA 2ZOEB 3ZN5A 5FYCA 4Y5Z0 3ZFEC 2Y6FA 4JGZC 4YYOA 5JXIA 1KJLA 4HK9A 3VDDB 1W6NB 3UT0A 3ZFFA 3DPRB 4PBPA 2J1AA 4FPHA 4Z1VA 3OBTA 4CRQA 2FHRA 3D8CA 5EZWA 1VBE2 3NVCA 2J1VA 4J1WA 5FXXA 3ZYFA 1LHWA 2IWGB 2VZSA 4F83A 2VL4A 3N9QA 2ADDA 3OGRA 3VBOA 5DDJ2 4R9CA 4NAMA 4MXVA 3OUHA 3A22A 1Q8QA 4Y26A 3VKNA 3WNPA 1ODNA 2ET1A 1XNCA 2XJQA 2XWBB 1MS5A 3EXUA 3KM5A 2DVBA 2Z79A 3ILNA 2UY8A 2WNEA 5GLTA 3WNOA 4IEPA 2P4EA 1VBD3 1X36A 2EXJA 5I0DA 2BYVE 3LOIA 4Z82A 4CDQC 1H1AA 3H7YA 4B7KA 4IEVA 4AHXA 1AUYA 5FZ6A 4HT1T 4XPVA 1UOJA 5K9YA 1M06G 1C4RA 5FPZA 4IEYA 1ZRIA 3ES4A 2XL7A 4EE2A 3GDBA 4XURA 2EA7A 5JR7B 1OOPC 2E7TA 2RHPA 3VBRC 4YPJA 5FZ1A 2PQSA 1TME2 4UFLA 4P9WA 3OPTA 2H6BA 3APBA 3I2HA 3PUAA 3JBG2 4QX2A 1DGWX 4YZ2A 5J37A 2ID4A 1UPIA 4OI1A 2W9XA 2D6KA 3HEIA 4QU2A 4MHUA 3RWNA 2RR13 2QTWB 5G04L 3TNPB 1KGYA 4BDVB 4X8PA 2XH6A 2R32A 4TTGA 1V0AA 3K3NA 2EXHA 4OMDA 3C7FA 3M3OA 3DGTA 4D0QA 2OKXA 4NR1A 5FPBA 4EJRA 3ZYRA 2ORXA 1V9U1 4OYUA 1D4M1 2WQ4A 4GMP1 1W9WA 2H0BA 1JZ2A 3UKVA 2GU9A 3P3PA 4I30A 1DF0A 1HJGA 4AVCA 5FP4A 3ZO0B 3VHPA 3HQXA 1YCIA 5A7WA 3ROUA 1JN2P 3WNNA 4E2QA 3A21A 4O61A 4J6GA 4IXLA 4XACA 2JDYA 3H1MA 2VMHA 3ZIWA 3NJZA 4F3JA 5C8CC 2RS31 2WT2A 1GP4A 1K45A 4AZZA 2XUEA 4LO7A 4BU2A 1WW6A 1W0PA 5FPUA 1RUD2 2CV6A 4DUXA 2QKDA 5A3PA 1OURA 2ZCWA 1FPN2 2RJKA 4FOYA 3HIFA 2F17A 3KT1A 4DS0A 1WLTA 5JSOA 2GNDA 1H9WA 2WUHA 1S2KA 1PMIA 2XDVA 2W87A 4HKOA 5IATA 2C26A 2A3YA 1SCRA 4AFAA 1QJFA 3WD5A 5K8SA 2O8OA 3OCPA 4HKWA 3VDCA 1OBNA 1AR92 2KM2A 1IGOA 4XJ9A 4IE0A 5DXDA 3U0ZA 3M1HA 4K1YA 3K77A 1RITA 4CEWC 1S2EA 2Y6JA 2VMCA 4OI2A 4SBVA 3T0AA 3VHNA 4LE3A 5FY5A 1J1LA 2VM9A 2VCAA 1PVC2 1LOAA 3THPA 1BHGA 4K8RB 3PHMA 4QHOA 2R062 1PGW1 4BQ3A 4QPGC 1ZREA 2WLPA 3T2PA 4FPKA 4X6RB 4QQLA 2P34A 1LU1A 5JOZA 2R0HA 5DUUA 3WF0A 1OFNA 5HI0A 4NIDA 3T08A 3GHMA 4LMFA 2IFRA 5B4XA 5T50A 4CXWA 2ZBJA 4LXLA 2IC1A 3KD4A 2E26A 5FO8B 4XFBA 3H8RA 4WVVA 4R9BA 1W8HA 2BV4A 1GKBA 3FBMA 4TN7A 4LO5B 1WBFA 3M3IA 1PGW2 1RUG3 2D3SA 2YFUA 1H8TC 4Q0VA 4BQ2A 5CB7A 4B8EA 1NLSA 5BV6A 3E6DA 5FYVA 4Q4W1 2D3RA 3C7EA 5FJKA 1PZ7A 4ZZ8A 4FO9A 4LULA 1H0BA 1GBGA 3RYRA 1MZ5A 4PHZA 1AYM1 3K75B 1UOGA 1D0HA 2A1XA 4HN1A 4NHKA 1SMVA 4HZFA 1ZYBA 2R042 2DCJA 3LPGA 3WDVA 1EAH3 3K3OA 5CKNA 3VKFC 3K4DA 4P5YA 1HRV2 4Q8LA 2RJLA 1D2SA 1MZ6A 5CG8A 1LU2A 4I0BA 1V6NA 2J1SA 5A3MA 3HMYA 2IXKA 1B35B 4XHXA 2ATFA 1AYM2 1X9PA 2BNNA 2ZZQA 2R1DA 3KF5A 4M3CF 1ENQA 4YM1A 4M0NA 5A3WA 4XUOA 5LK5A 3W59A 2D5FA 4D8MA 4CCKA 1ZRFA 4OUMA 2FMDA 1MQTA 4UBGA 1X82A 1NKGA 1PO11 5IVEA 4JTNA 4G3YC 4XDOA 3H9AA 5GZGA 3AFGA 2MEV1 4P5HA 5SV5A 4XTPA 1OVPA 1IKQA 4GWNA 4CDUA 2VNOA 3SXWA 3IMMA 1POV3 1KS5A 1VE0A 2QNKA 4YW4A 4AI2A 2OA2A 2D6NA 3CKHA 1LR5A 4CCOA 1TNRA 5K4LA 4ARXA 2P5BA 4QPIA 3HNBM 3MPPG 4XZUG 3PIJA 3UJQA 5DMYA 1MVEA 1EUUA 1JYCA 2OW4A 1R082 2VZQA 4A3ZA 3J8F3 3J8F1 1Q8PA 5TSWA 3OOXA 4EN7B 2HYXA 4LOTA 2J22A 3ZFGA 3WEZA 1YC61 5JMOA 1A8DA 3N7JA 2XXZA 4D6RA 3LSEA 3EBRA 2BNOA 5DUWA 2BBVA 1BK1A 4KG0A 2RVAA 4FXGB 4XJAA 1HQNA 3WQ1A 4CCNA 4ZU7A 2AGSA 3ZM8A 2RDSA 2ZACA 3LKJA 3SH5A 2HKXA 4OHXA 4PLOA 3ZPYA 3ZYHA 1BK0A 3RZLA 5IFPA 4Q4X1 2Y6HA 4MSVA 4GKYA 3N7LA 3WDUA 3OPWA 5A7OA 3BYWA 1OKOA 3K4ZA 2ZA9A 5LY1A 5A3UA 5IFTA 3N35A 1QWRA 2VNVA 4OI0A 3AC0A 4IGPA 3I2GA 1AR83 1G7YA 1W04A 1N47A 1DGLA 5CU1A 3O7OA 4KQ7A 1PK6A 2XLAA 5F5QA 2RS13 1RXFA 4B1MA 4LHNA 3URFA 5J48A 1UU6A 1PHMA 4QGMA 2ZMLA 3ACGA 3RZGA 2BOIA 2GAUA 1ULPA 5E6HA 4QQPA 2DVDA 3I3QA 5AFBA 4IV3B 1O59A 3U4SA 2QVSB 5ABJA 2NPIA 5FRAA 3FZ3A 4M3CE 2WIIB 2DUQA 5H9QA 2BOJA 4DMIA 4QKBA 5FZLA 5C8CA 3LDBA 2RV9A 5DAXA 2I74A 3AK0A 1DGRA 5FP8A 5B2GB 3KHBA 3KS7A 1O3QA 2DFBA 5GZFA 3UV9A 1GWLA 1F4HA 1RUE1 2OZJA 4XCAA 4P9XA 2XQXA 4CDXC 1STMA 4CDXA 3FFZA 5IVBA 1AR61 2WS93 5C4WB 2VOWA 1NA1A
chains in the Genus database with same CATH topology
1UZVA 2CHHA 2JDKA 2JDUA 5A6ZA 1OURA 4UT5A 2BP6A 4AOCA 2BOIA 5A70A 1UQXA 1W8FA 3DCQA 2WRAA 1OUSA 5HCHA 5A6QA 5D2AA 1OVPA 2BOJA 2WR9A 2VUDA 5A6XA 1GZTA 3ZDVA 4CE8A 1OXCA 2JDHA 2JDNA 5A6YA 2VUCA 1W8HA 2BV4A 2VNVA 2XR4A 2JDYA 5A3OA 1OVSA 2JDPA 1OUXA 2JDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZV A;  2CHH A;  2JDK A;  2JDU A;  5A6Z A;  1OUR A;  4UT5 A;  2BP6 A;  4AOC A;  2BOI A;  5A70 A;  1UQX A;  1W8F A;  3DCQ A;  2WRA A;  1OUS A;  5HCH A;  5A6Q A;  5D2A A;  1OVP A;  2BOJ A;  2WR9 A;  2VUD A;  5A6X A;  1GZT A;  3ZDV A;  4CE8 A;  1OXC A;  2JDH A;  2JDN A;  5A6Y A;  2VUC A;  1W8H A;  2BV4 A;  2VNV A;  2XR4 A;  2JDY A;  5A3O A;  1OVS A;  2JDP A;  1OUX A;  2JDM A; 
#chains in the Genus database with same CATH topology
 5HPO A;  5E89 A;  4XIO A;  2W2I A;  3I3M A;  2VO5 A;  1Y9G A;  1ZNP A;  2BJS A;  3N9L A;  4Q0S A;  2JG9 C;  1YFY A;  2WZ8 A;  5BNO A;  5AFE A;  1DQ4 A;  5FOB B;  3H7J A;  2TUN A;  2W1S A;  2WNV B;  3CZU A;  5FMB A;  2IXC A;  2X09 A;  1X8M A;  3R05 A;  4LTA A;  4R8H A;  4V2W A;  4XAE A;  1AXY A;  1FMD 1;  1PNG A;  1VBD 2;  2B7Y A;  2NN8 A;  2P17 A;  3LEK A;  4LUK A;  3OY8 B;  4EYU A;  3HN3 A;  4E4S A;  1OLQ A;  3FHA A;  2ZS6 B;  3U4X A;  1AF9 A;  4D7S A;  1TEI A;  2YU1 A;  2WAA A;  1SPP A;  4AR2 A;  3IPV A;  1SLL A;  2HBU A;  3UJO A;  1QJU 3;  4X8N A;  5FQ0 B;  3DF0 A;  3JZV A;  1PO2 3;  3ZYP A;  2IFW A;  2HJI A;  4WZC A;  4XFH A;  3AXE A;  1AHS A;  4EZH A;  3NV4 A;  1LRH A;  3VLB B;  2QQL A;  4K7J A;  2AEZ A;  2PAM A;  4S2G A;  4YM2 A;  5JLV A;  1PMH X;  1XRU A;  3KGZ A;  4QB1 A;  1XE0 A;  3RJR A;  3D82 A;  3UKT A;  1QJE A;  4YM0 A;  5LA1 A;  4ATF A;  4QXB A;  2D6P A;  4KGQ A;  4R9D A;  4CU9 A;  5C9A B;  3MV1 1;  1VAV A;  5L9R A;  1F5J A;  1H1I A;  3VBS A;  2C4X A;  5LAT A;  3POS A;  1BKZ A;  3MF9 A;  4YLZ A;  1VAM A;  3SNM A;  5FZI A;  1JOP A;  5HXM A;  4D69 A;  2P3K A;  4FP3 A;  4MVT A;  1RUF 1;  4UYB A;  2YBP A;  5ABJ B;  4OHZ A;  4AGG A;  5K7P A;  4DUW A;  5F3C A;  3O1T A;  4EN0 A;  1J1T A;  4WZF A;  4UAP A;  5FP7 A;  3H8X A;  4YGD A;  4RD7 A;  2ES3 A;  3GNE A;  3CQO A;  4XC9 A;  4DIN B;  5JSP A;  1QHD A;  5FK8 A;  1HRI 1;  4FQZ A;  4YW7 A;  3SH3 A;  4GQ7 A;  4LIU A;  3IIA A;  1BVP 1;  4LBJ A;  1XYN A;  2WNU A;  3RZZ A;  1B09 A;  1AR7 1;  1P8J A;  5JVV A;  2WAB A;  4D6S A;  5JOY A;  3ELN A;  1MAC A;  1ND2 B;  3GHN A;  2DU1 A;  4L8Q A;  2ZAB A;  4JZR A;  1DHK B;  4N43 C;  2O14 A;  4AL9 A;  1GFF 2;  1UY4 A;  2ZGQ A;  5D1I A;  5DAW A;  5DZF A;  3LAG A;  3ZDV A;  1AR6 2;  2WL1 A;  1JZ4 A;  4MGY E;  5EP9 A;  3CJI B;  3N9P A;  3NMB A;  2D6O X;  1D4M 2;  1BLZ A;  4PIZ A;  1E5H A;  2QQV A;  2Y34 A;  3P3N A;  3RGB A;  4AVT A;  5F9T A;  1Q3E A;  1NUK A;  1UX7 A;  3MF6 A;  3AP7 A;  4GJY A;  4NHX A;  4DXT A;  1QXR A;  1IG3 A;  2TBV A;  3T0B A;  4E4H A;  1BBT 2;  4AVV A;  5KBF A;  4AFM A;  5JIA A;  1UOB A;  4UFI A;  2UWA A;  4MGI E;  4TLF A;  3V56 A;  3L2Y A;  1NQJ A;  1F15 A;  3HJR A;  4Y1V A;  3VZK A;  3X29 B;  4XF4 A;  1CPM A;  2GDF A;  1JYN A;  2LS6 A;  2VQT A;  4LKD A;  4QPI C;  1YYN A;  1JZ5 A;  1TMF 2;  1LAJ A;  3BPZ A;  2B45 X;  4XET A;  4AQT A;  4YZ3 A;  4ZZ5 A;  2WSV A;  1S0D A;  3ZOI A;  1RED A;  4MGZ E;  1DZT A;  4XHB A;  4P9G A;  1VBB 2;  4AI1 A;  1VBB 3;  1TVG A;  1VRH 2;  4IES A;  4A45 A;  1DZQ A;  2CDP A;  3B93 A;  5EJ3 A;  1UAI A;  1HB1 A;  4AED C;  1OVS A;  3OD4 A;  1R64 A;  2EF6 A;  5FZ0 A;  4OFG A;  1OUX A;  3GM8 A;  2W08 A;  3K2O A;  4LR4 A;  3T4V A;  1KIT A;  4YVS A;  4AHW A;  1Y4W A;  1JOD A;  5HV4 A;  1VIW B;  2Y6G A;  2IUW A;  5FZA A;  4QHZ A;  1EUT A;  4A4A A;  4XQ4 A;  4GD4 A;  3RZH A;  2R1B A;  1VP6 A;  4PF5 A;  4JHT A;  3W20 A;  1RUI 3;  2HEV F;  2XBO 1;  1OH3 A;  2ZHK A;  4IL7 A;  2VCC A;  1LOG A;  4OMC A;  1FYU A;  2IZW A;  4OUS A;  4L0P A;  4Q4X 3;  1NAE A;  3AKQ A;  5FZC A;  4XQW A;  3A23 A;  1URX A;  3ZR5 A;  3R6S A;  1VMH A;  2R06 1;  3J4U H;  5KHH A;  4QD2 A;  1RUC 2;  4COU A;  1HB3 A;  1XYP A;  3JXS A;  1XXN A;  3PVB B;  2WNU B;  1BXH A;  1S0G A;  4RA0 A;  4LHL A;  1JYV A;  3F2Z A;  1QJZ A;  4N43 A;  4OUE A;  1ND2 A;  1AR8 1;  1WLC A;  4PLN A;  4HVQ A;  2XKO A;  2BGP A;  4FOQ A;  4NII A;  2E6V A;  1ZA7 A;  2RDQ A;  4QGL A;  4MET A;  3VBF A;  5A33 B;  3MW2 A;  3Q9O A;  2VNG A;  5LBF A;  4AVB A;  4FPL A;  4QX1 A;  1LOC A;  2A3W A;  3LEI A;  4E8C A;  1VRH 3;  4ZKT B;  5LZ6 A;  3MFC A;  1AJK A;  1O8P A;  2BUK A;  1CON A;  3AP4 A;  2RS3 2;  5FXV A;  5FXW A;  5ACA 1;  4YSF A;  4XYX A;  4CEY B;  4FBF A;  1U5X A;  2YRO A;  2WT1 A;  5BXX A;  5F37 A;  2JG8 B;  5A80 A;  3JD7 3;  4NAO A;  3SEP A;  3E6B A;  2XPJ A;  4Y4Y A;  5JSR A;  3BAL A;  4NRQ A;  5ACA 3;  1W6M B;  5C8W A;  1REE A;  1MQT C;  4HXC A;  3OUJ A;  1LOB A;  1NCR A;  3FLP A;  1H2M A;  1WMD A;  4Y1U A;  3O1P A;  2DVF A;  5F3E A;  1ZBE 3;  1VPH A;  3WT3 A;  5D8A A;  1BJQ A;  1UQX A;  3CJX A;  2C9K A;  3TN9 1;  2KR2 A;  4ET7 A;  5A1A A;  1PK6 B;  4QDS A;  4RQP C;  4QX3 A;  3UNP A;  2ZMN A;  3ACH A;  5FRE A;  4M00 A;  1DQ6 A;  5LCW L;  3WXP A;  1O4Z A;  1Y7B A;  1Z0H A;  1YQ2 A;  4YVS B;  3WG1 A;  3WY6 A;  4ARY A;  3Q8B A;  4LO4 B;  2FCV A;  4HON A;  5IAV A;  3ZR6 A;  1E5I A;  5F39 A;  3Q8F A;  2OPK A;  3PL0 A;  2FZ1 A;  2ZHN A;  5KC5 A;  1VBE 1;  3AKR A;  4OHV A;  3ENR A;  3SCF A;  1R08 1;  1WD3 A;  4DIQ A;  1W8O A;  3ZPO A;  2G9F A;  4LOS A;  2YGM A;  3LZZ A;  4B1L A;  1YNA A;  2A6V A;  3I3E A;  1DDL A;  2PEL A;  4I2O A;  1SBF A;  3W5N A;  3ZXD A;  3HT1 A;  5FAX A;  3FFQ A;  1WME A;  4L99 A;  4I02 A;  4HPK A;  3VB9 A;  2W0X A;  2B5H A;  3AFK A;  3H3L A;  4CDQ A;  2CL2 A;  2G1M A;  3BOP A;  2E32 A;  2N7G A;  1N1S A;  1G9A A;  4FCA A;  4WM7 A;  5E16 A;  2FDH A;  1MS3 A;  3Q8A A;  4YGE A;  3MI8 A;  2ZXQ A;  4CTE A;  3SEE A;  5DUX A;  3B69 A;  3CDZ B;  5JI9 A;  3A4U A;  4DY3 A;  4ORF A;  1UX6 A;  3O5S A;  4MO3 M;  1XSQ A;  5L7O B;  5IVY A;  1N1V A;  3RNS A;  2BFU L;  3UYJ A;  5LBE A;  1K5J A;  3HPN A;  1VB2 A;  1K5M B;  4HSJ A;  2EXK A;  2YPJ A;  3P1I A;  5JCT A;  5DAB A;  1SBD A;  3NNL A;  1NCR C;  2B4K A;  1I5Z A;  1FNY A;  5EJZ B;  3JBG 1;  5GZC A;  1HJF A;  3V0B B;  2CU5 A;  5AC9 3;  1NCR B;  1XNK A;  5DZE A;  5BNN C;  2EIC A;  1DYP A;  1RUG 2;  3AYE A;  1XQN A;  5E88 A;  2JE8 A;  2J7M A;  4FQ4 A;  3G7D A;  4R52 A;  4UFJ A;  5CIR A;  3DEM A;  1ZZC A;  5CKM A;  4AFB A;  2XL9 A;  3INA A;  1H2L A;  5FZF A;  4JQT A;  1BEV 3;  1ULC A;  2A73 B;  2JIJ A;  1AR7 3;  2VH9 A;  5CZK A;  3OYW B;  2SLI A;  4M4P A;  1UOF A;  2XON A;  3TOJ A;  2R0F A;  5FBZ A;  2IXJ A;  1X33 A;  2QDN A;  1UYX A;  4JGY B;  1SLI A;  2AH2 A;  3WDX A;  4EWE A;  1RYY A;  4YZ5 A;  1WD4 A;  3T2Q A;  3DV8 A;  2W1U A;  3HR9 A;  4LBQ B;  1IPK A;  5CNA A;  1UMH A;  2X29 A;  2B42 B;  1XNA A;  2VUL A;  4W8J A;  3ZSM A;  1HDK A;  1RC6 A;  1T6G C;  1V6M A;  2JJ6 A;  3WNX A;  3ZFF C;  5D2A A;  4RQP B;  4AED A;  2VQU A;  5CFD A;  2FD8 A;  4FPO B;  5JAX A;  1FAT A;  2DFC A;  2EXI A;  1CX4 A;  5JXG A;  2XJS A;  1EPZ A;  5DDJ 1;  1DYO A;  4A42 A;  2ZAH A;  3J7M A;  1W2O A;  4M3C A;  3W21 A;  4HOO A;  4Y20 B;  3RZM A;  2EVX A;  1ZZ7 A;  2K9Z A;  3N9O A;  4WVM A;  4C91 A;  1GYK A;  3A0N A;  3BOD A;  1LES A;  4HKL A;  1NY7 1;  3ZMO A;  2ET7 A;  2FDI A;  2RR1 1;  5A70 A;  4D6Q A;  3ZKY A;  1E5S A;  3LFI A;  4PI0 A;  3OSD A;  3O0X A;  1B35 A;  4MX3 A;  2OX0 A;  3GJB A;  4MGQ A;  3M3C A;  5GKA C;  1LHV A;  5KHJ A;  2DU0 A;  4R4Z A;  3O14 A;  2P6H A;  2X05 A;  1F2N A;  2ZGU A;  2Y64 A;  1YFU A;  5JDB A;  2Z2S B;  1JUH A;  4A2U A;  3LFM A;  1OH4 A;  3VD3 A;  3V0B A;  1TME 3;  1NXM A;  4QAW A;  4XZP A;  3VKM A;  4AQ6 A;  5LEJ A;  1OKQ A;  3WDT A;  5LWB A;  1J84 A;  1YQC A;  3MYX A;  2JDK A;  1UPS A;  2HWB 3;  4DXS A;  5CA6 A;  4EN9 B;  5BNP B;  1DG6 A;  1ULD A;  4D7Y A;  3LE0 A;  3WQB A;  1QJX 1;  3PU3 A;  1HRI 2;  4XMI A;  2LAL A;  3EMR A;  1JTZ X;  2QQI A;  3S6P A;  3WZ1 A;  2NMN A;  1ZBE 1;  3H0O A;  4XJZ A;  2ARX A;  1DZR A;  2WN2 A;  3B5L B;  3I3B A;  4KU8 A;  2NP0 A;  2HWE 3;  5ANQ A;  1XB9 A;  3MUY 1;  1RVF 3;  5KC6 A;  4N9I A;  4MXW B;  2VXJ A;  3AB0 A;  1KJR A;  3KB5 A;  1K42 A;  3ALQ A;  2YU2 A;  4UOJ A;  3J9S A;  2PMW B;  3VKO A;  4JKK A;  1VBD 1;  1RTV A;  5HXV A;  1J59 A;  1RUD 1;  2EIB A;  4QPG A;  1PGS A;  1ND3 B;  1RL3 A;  1UYZ A;  2RMU 2;  2F4L A;  1BQP A;  1IKP A;  1KDK A;  1S0I A;  1VBE 3;  2X53 S;  3CMG A;  3I2K A;  3LIH A;  4XF0 A;  4N53 B;  4AEM A;  4DNY A;  3TRS B;  4BOW A;  1CPN A;  1RIN A;  1W06 A;  4ZXK A;  3T2T A;  2VD7 A;  3OEB A;  3M8L A;  3RI8 A;  1W6Q B;  4AFD A;  1COV 2;  2GC2 A;  2W46 A;  2PHD A;  4L92 A;  1UL9 A;  1I5P A;  2C6S A;  2DWR A;  4XUP A;  2FDK A;  3Q8E A;  4LQR A;  1RUI 2;  2QBX A;  5HBA A;  5FK7 A;  1SAC A;  1RHI 3;  2GH8 A;  1ULF A;  3JD7 1;  1VBC 1;  2VZV A;  2Y6K A;  2XR4 A;  3PVN A;  3WP6 A;  3TEY A;  4CCL A;  5KXC A;  1MEC 3;  1DGW A;  1G8W A;  1H1M A;  5CYY A;  5FZB A;  4NIG A;  2G9Z A;  3NW4 A;  4BPZ A;  1A3K A;  2JX9 A;  5J36 A;  1W2T A;  5JWP A;  3VD4 A;  1LCL A;  5FKB A;  4AQ2 A;  4SLI A;  4CXX A;  1OFS A;  3TYJ A;  2QQU A;  1IPS A;  3W58 A;  4K3U A;  1GR3 A;  3E5U A;  4COW A;  1PGL 2;  1OSG A;  4NHY A;  4PDW B;  4CEW A;  1AX1 A;  3RJ2 X;  1RUJ 1;  4ASK A;  2VXR A;  1COV 3;  1VBC 3;  1W03 A;  3M2M A;  2YB7 A;  4PQQ A;  2PAE A;  1DLC A;  1CQ9 A;  3USU B;  1NT0 A;  3KQR A;  4CE8 A;  1RUG 1;  1UCX A;  3OGV A;  1X50 A;  4FPC A;  4LA2 A;  4MYE A;  5FV3 A;  1AZD A;  1DQ5 A;  2WFF 2;  3VZN A;  5FKC A;  1FPN 1;  1EAH 1;  3U10 A;  2WNV A;  2VU9 A;  4FP2 A;  4CUG A;  1UZZ A;  3JU9 A;  1R09 1;  2O1Q A;  4PIX A;  5I0U A;  3O1U A;  5FZ4 A;  3BU0 A;  4WM8 B;  5KXB A;  1UYY A;  1UD1 A;  1T2X A;  3ZYJ B;  2WIN B;  2YZ4 A;  3VBU B;  3AM2 A;  1UO9 A;  1W8F A;  1YQ5 A;  1OUS A;  3VDD A;  1J83 A;  3POJ A;  3MFA A;  5GLW A;  2MEV 3;  1CAV B;  3MEP A;  1O5L A;  1DU3 D;  2BDR A;  3NNM A;  1W2U A;  5DUV A;  1WA6 X;  4HVR A;  4U36 A;  3MDP A;  1PO1 3;  2FBE A;  2GAL A;  3B3Q E;  3ST7 A;  4YVW A;  1VRH 1;  1ZRC A;  4MH0 E;  1UWW A;  2OQ6 A;  3GAL A;  3V0A B;  4P08 A;  4QDQ A;  5EJ1 B;  1AL2 1;  1OC1 A;  4BIF A;  5FP9 A;  5J3U A;  3PME A;  2AYH A;  4G4F A;  4XXP A;  4MUV A;  4Y33 A;  1JYT A;  4TWT A;  4P02 B;  1YUD A;  2AEN A;  3IM0 A;  4LLF A;  2QFE A;  4XUN A;  3UGG A;  2AUY A;  3I2D A;  3VBS B;  3UK9 A;  1SDW A;  2OZ6 A;  4NO4 A;  5J09 A;  2DCY A;  4MGS A;  1GWM A;  5F6K A;  3IT8 A;  4XUT A;  3KVB A;  3U14 A;  4Q8K A;  5F5A A;  5A32 B;  2GZW A;  3UL2 A;  3LEG A;  3JD7 2;  5L9V A;  5K0U A;  5EQU A;  4QQ2 A;  3RPQ A;  2VJX A;  2XLF A;  3T2O A;  3WQ0 A;  1AYM 3;  1GZW B;  2MHF A;  1IS6 A;  1L7Q A;  2YDE A;  1AYN 3;  2WQ8 A;  4AWD A;  2YHJ A;  3RYK A;  3VGI A;  1W9S A;  2CDO A;  4IW3 A;  2X5I A;  4XIL A;  3SCH A;  2CWS A;  5HCF A;  1IS4 A;  3FHQ A;  4R4X A;  2C5D A;  4AI0 A;  2JB4 A;  3ILR A;  1W6P A;  3RI9 A;  4A7Z A;  3NJY A;  3WG4 A;  5E8A A;  2GMP A;  5BNN A;  2JG8 C;  1OF4 A;  4Y1Y A;  2VMD A;  2ZPX A;  2OII A;  1PO2 2;  4CPB A;  2XWJ B;  2JDM A;  4FPG A;  5JUV A;  1OA3 A;  3USU A;  3I4I A;  5EIY B;  5FYZ A;  2DCK A;  3OGS A;  4W50 A;  2BEO A;  3ZLI A;  4YW5 A;  4M01 A;  1JZ3 A;  4CP2 A;  4JGY C;  1Y9Q A;  2H0V A;  5A7Q A;  4RS5 B;  5FZ8 A;  3GZE A;  4K20 A;  1W8U A;  2V09 A;  1XNB A;  1Z7S 3;  2AZ5 A;  4JDO A;  3M3E A;  4FPF A;  3VZM A;  4XE9 A;  1EY2 A;  5GZD A;  4MOA A;  2JWP A;  2BVV A;  4RFR B;  3IPV B;  1YWK A;  4XJU A;  1N3Q A;  1PMJ X;  3E5X A;  5CFD C;  3AVR A;  2C1F A;  2EAL A;  5GLZ A;  3GXU A;  4J1X A;  1O7F A;  3POI A;  4HAN A;  1DQ2 A;  4YVW B;  3KCX A;  5EFU A;  1CGP A;  1G9B A;  3ZFE A;  1BEV 2;  5DG2 A;  3R0R A;  2FDF A;  4QKD A;  1LJ7 A;  3NKT A;  3VD9 A;  1L7R A;  4I01 A;  2R6Q A;  4Q29 A;  2QQN A;  4H55 A;  5LRR A;  3DN7 A;  1EAH 2;  5KXE A;  4OVE A;  3CNA A;  3J8F 2;  4KMQ A;  4E9K A;  4YW6 A;  3EJK A;  3MO4 A;  5C3Q A;  5C7G A;  1W0O A;  4GB3 2;  5JMC A;  1UMZ A;  1ZBA 2;  5FZD A;  3ZYI B;  3BTA A;  1JXN A;  3NV1 A;  3DYP A;  3ZSJ A;  2K46 A;  2UYA A;  4CA9 A;  3RS6 A;  4BQY A;  1NXD 1;  1UY0 A;  5A32 A;  2GP5 A;  2Q1M A;  2PLV 2;  1BBT 3;  2XVG A;  4RL7 A;  1LGB A;  3WF2 A;  5I91 A;  4RSU A;  1FV3 A;  2E7A A;  4TLG A;  4BQ4 A;  3VUO A;  4OUL A;  3PUQ A;  3VBS C;  3H42 B;  3R4D B;  4ZPI A;  1CAX A;  4Q0P A;  1W8T A;  1W6P B;  1AL2 2;  1GZ9 A;  1AR6 3;  1JU4 A;  3PDQ A;  3PUI A;  2D6M A;  4JDM A;  2Y60 A;  2DUR A;  4YG3 A;  1QGL A;  4O9G A;  1K5M C;  4FFF A;  3PUR A;  4MGT A;  1LHO A;  1PZ9 A;  2JD4 A;  3ASI A;  4AAP A;  4CUB A;  1X9T A;  1ZM1 A;  3H1W A;  3AJZ A;  4BZ4 A;  3ZDS A;  3T30 A;  1C8M 1;  1PIV 3;  3OF1 A;  4AK3 A;  4B29 A;  1V6K A;  3HVD A;  1Z7S 2;  5C71 A;  5IK7 A;  2ZKL A;  1ZRR A;  2UU8 A;  3B01 A;  3JCI A;  1WLW A;  1XJA A;  4RGA A;  3FN9 A;  3POY A;  5H9P A;  1WZX A;  1YJL A;  3LQC A;  3RWK X;  4XW3 A;  2WS9 1;  3BN6 A;  2KD7 A;  1H6X A;  1LKN A;  3KGL A;  2PHT A;  1JS9 A;  2VCB A;  5J1X A;  3U37 A;  1ZRD A;  4FI9 A;  2XJV A;  1POQ A;  1QEX A;  5FMO S;  5A7W B;  2CGP A;  4N53 C;  4FAH A;  2PXJ A;  2HWD 2;  1MS1 A;  1REF A;  4NE9 A;  4RFT 0;  5KHG A;  2ZEY A;  3M7A A;  3NL1 A;  4UW3 A;  5APA A;  3WP3 A;  4AF9 A;  4IEZ A;  2WZP P;  1FPN 3;  3WW1 A;  1OF3 A;  2YPD A;  2ZEZ A;  4A41 A;  1H8T B;  2RG4 A;  5C9A C;  1SLC A;  4QPI B;  4QM9 A;  5FLI A;  5FZK A;  4A6O A;  3A7Q A;  1KFX L;  2PHX A;  3J7H A;  1UN1 A;  2XOM A;  1J3Q A;  1C28 A;  1T6B X;  1ULO A;  4FPY A;  2CSG A;  3M4F A;  4KWL A;  1Y3T A;  3U78 A;  3HNM A;  4LK7 A;  5FYS A;  3FBY A;  3SIS A;  4AHY A;  4Q27 A;  2XLG A;  4MV2 A;  1JHJ A;  5T5O A;  4BB3 A;  3OGG A;  2BVB A;  3KWV A;  4LBO A;  4XCB A;  5CVR A;  3CF6 E;  5ANN A;  1ASJ 1;  2VUA A;  4QQO A;  5FTT C;  3BIW E;  4PDW C;  4CDU B;  1QU0 A;  2AAC A;  2Y38 A;  4Y24 A;  3IAP A;  4N43 B;  4LHS A;  3RFR A;  4CDU C;  3K51 A;  5T3N A;  1JZ6 A;  3N3H A;  1AX2 A;  1HN0 A;  4K21 A;  1RUJ 2;  3ETP A;  3ABZ A;  5LB6 A;  1ENX A;  4ZS2 A;  1S2B A;  1WUV A;  4KBB A;  2JIG A;  1A34 A;  5IVF A;  2GP3 A;  4AI9 A;  2DVA A;  4LHK A;  3SLI A;  4GH4 B;  4AEJ A;  1RMU 1;  2E53 A;  4QM8 A;  4XBL A;  1RUF 2;  2C9A A;  2DUO A;  5EYY A;  4CDX B;  1I1E A;  1H6Y A;  4HVO A;  4XDQ A;  5KHK A;  2SBA A;  4XF9 A;  5FLH A;  3MPB A;  5BUV A;  2GC3 A;  2A71 A;  4HET A;  2ADE A;  4BK4 A;  3AVS A;  4XBQ A;  1CAV A;  3PMS A;  3ZN6 B;  1ASJ 2;  5AVA A;  4CP1 A;  1W28 A;  1US3 A;  2YFZ A;  2LUW A;  3TAY A;  4ES8 A;  2PFW A;  4K8F A;  4BYY A;  2JDU A;  5JI7 A;  2ERF A;  5EPA A;  4NN0 A;  1C1F A;  4BQ1 A;  2VBP A;  1SG3 A;  3SHR A;  1OA2 A;  3I7D A;  1ZA4 A;  3HWJ A;  2HWC 1;  5T54 A;  4B3N A;  2W47 A;  3ECQ A;  1GNY A;  1Q8O A;  4BQW A;  1H8T A;  4E2G A;  3ES1 A;  3UKN A;  2CTV A;  3WV6 A;  3T0D A;  1UYP A;  4COZ A;  2W95 A;  2RS5 3;  3J26 N;  3NAP C;  4S2F A;  4BA6 A;  4JRL A;  2GN3 A;  2ZX2 A;  2VNR A;  2QQO A;  3ZFG C;  5KXD A;  4Z92 B;  1F35 A;  2WFF 3;  3NAP B;  4IDZ A;  1CJP A;  4KWU A;  1PX4 A;  4J25 A;  5F5I A;  3VDA A;  2HWE 1;  4NJ4 A;  5C8C B;  1IOA A;  2HYK A;  2ARC A;  2W91 A;  3SIT A;  2XVK A;  1DYK A;  2EAA A;  1CZV A;  4DZG A;  5GZE A;  1APN A;  5DPN A;  2LRO A;  1W6N A;  4IEO A;  4LBM A;  3AP5 A;  3B94 A;  3ZFF B;  1DIW A;  4PLM A;  2D93 A;  5HCA A;  3IN9 A;  2HWD 1;  2WC2 A;  3AKP A;  2VZT A;  1VBB 1;  1LOE A;  1LOF A;  2JEM A;  2VQ0 A;  3AKT A;  5FZO B;  4ZXE A;  4DRV A;  2FMY A;  1RUI 1;  4W65 A;  2W39 A;  5FR3 A;  3ACI A;  3I54 A;  2RS3 3;  1VRB A;  4QXH A;  5AVP A;  5CBL A;  3BUC A;  3NV2 A;  1LOD A;  4H3W A;  4Q1P A;  5F6L B;  2ZHM A;  4KG8 A;  1RVF 2;  4GH4 A;  5FYB A;  3KQ4 B;  4JQR A;  1NE4 A;  3POG A;  3RQ0 A;  1RUD 3;  4NPR A;  5I0R A;  3LB9 A;  1O3T A;  4IV3 C;  2QQK A;  4AYU A;  5IK4 A;  3JQX A;  1MZF A;  1LGN A;  3H8O A;  1PM7 A;  2VPV A;  4XF3 A;  3WNK A;  2QZ3 A;  2R30 A;  1HXS 1;  3JB8 A;  5A1F A;  2QQJ A;  4MLO A;  1DCS A;  3E1F 1;  3T3Y A;  3NJV A;  3NQH A;  3J7L A;  2PA7 A;  3O1S A;  1S1A A;  2L9L A;  2PHW A;  5CKQ A;  5T5J A;  1RUH 3;  1IQA A;  1OI6 A;  2W1W A;  2DV9 A;  2ZGK A;  4XIK A;  4HL0 A;  1UIJ A;  3OUI A;  4F7Z A;  4C0H A;  2ZGR A;  1SBE A;  1U5Y A;  4FTE A;  5DAV A;  3D5O A;  1DLL A;  2XKP A;  1U0A A;  3V65 A;  2WO1 A;  2DBI A;  3AZX A;  1UKR A;  3IB3 A;  5I8T A;  4OZX A;  2XJT A;  4JGY A;  5FBJ A;  1CVN A;  5T5P A;  5L19 A;  3M70 A;  3B9C A;  4OHY A;  2I2S A;  4S2H A;  1YQ6 A;  1MEC 2;  2VVF A;  2BRT A;  1BBT 1;  4LBQ A;  1RUH 1;  3B7M A;  5FY7 A;  3HNY M;  1W8W A;  3I2I A;  3IWZ A;  5FDB A;  3LA3 A;  2VW1 A;  3IMN A;  4EV0 A;  3QLQ A;  2KA3 A;  1X7N A;  3HBK A;  1QJU 1;  2VC9 A;  3J7N A;  1X8E A;  1HQL A;  3FUQ A;  3Q8C A;  1QKQ A;  3BCW A;  4ASL A;  1RB8 G;  1Q56 A;  3GJA A;  1DP0 A;  2GME A;  1BCX A;  1CZS A;  1V6O A;  2LW8 A;  4UXA A;  3C3V A;  2JDH A;  2WNU C;  4XUQ A;  1VLN A;  1V9U 3;  5C4W A;  2A6X A;  3PIG A;  4QKF A;  3WNM A;  2E51 A;  5FYM A;  3ZXE A;  4NWV A;  3O1O A;  5I0T A;  1W3X A;  4CPB D;  2YY1 A;  4XJW A;  3WF3 A;  2UUR A;  3D0S A;  1O8S A;  4A3X A;  2Y6L A;  5A6Z A;  1SZB A;  4WM7 C;  4BLI A;  2WO2 A;  3KV4 A;  4Y1X A;  2DBN A;  2DF7 A;  1US2 A;  3MIC A;  2G4I A;  2Q5T A;  4GWJ A;  1KRI A;  5FY8 A;  3CLP A;  2D40 A;  5DAP A;  4ES9 A;  2HWE 2;  4FTS A;  1SLT A;  3PLQ A;  4BQ5 A;  1KD7 A;  1UY1 A;  1KEX A;  1GLH A;  1O91 A;  1SLA A;  1W2A X;  1IHM A;  3VZO A;  5GAL A;  5C3S A;  2BFU S;  4GAL A;  5A7P A;  3EYP A;  2P37 A;  1RJ8 A;  1I3H A;  4R9A A;  2P3I A;  3KHC A;  2VOK A;  4YM3 A;  3HN1 A;  3PUS A;  4ZU5 A;  3RRD A;  3GBG A;  4C8D A;  2XHN A;  4WBB A;  5JIU A;  4CEY C;  2ZHL A;  3QH6 A;  3VZJ A;  4LBN A;  4DXR A;  5A33 A;  1XPW A;  2WA4 A;  4P14 A;  4AAX A;  4EWA A;  5C9A A;  2RS1 1;  1BZW A;  3TN9 3;  1RUN A;  3SKV A;  1LGC A;  5FFO C;  4YVS C;  4QT6 A;  1W99 A;  3TBD A;  2YC4 A;  1W8N A;  1ULG A;  4KI5 M;  4MGK E;  4NRP A;  4WM8 A;  4BXF A;  1JOB A;  4CP9 B;  3USS A;  4UFM A;  1CAU B;  2AC1 A;  3PNA A;  2GSY A;  4QX5 A;  1W9Y A;  1Q8S A;  3ZYB A;  1ODM A;  4BCU A;  4PT6 A;  2Q8C A;  1HQW A;  1POV 1;  3KT4 A;  1QJU 2;  1RUE 3;  2CHH A;  5AC9 2;  4OI4 A;  1H2N A;  1QDO A;  4RR3 A;  2E63 A;  4IE4 A;  3RMX A;  3IDA A;  1GQH A;  3VBH A;  5FOJ B;  1QOS A;  1GU3 A;  1U5I A;  5FO7 B;  3BU7 A;  5I0S A;  1V70 A;  4NPM A;  3H50 A;  5F2S A;  2HWB 2;  3I59 A;  1F9K A;  5FZH A;  5HCH A;  1Q5O A;  3H3U A;  2WAO A;  5FXZ A;  5FPX A;  3B02 A;  5LK7 B;  1UU5 A;  3N4M A;  3B00 A;  5JZG A;  4XFG A;  1CZT A;  1VAL A;  1J3R A;  2RDN A;  4IGO A;  1QNY A;  3PJY A;  4XFF A;  4QKN A;  1CAW B;  1B35 C;  2FDG A;  4CSW A;  1J58 A;  2G9G A;  2LTN A;  2Y33 A;  4NWW A;  1L3J A;  4Q0U A;  3ZXG A;  2EIG A;  2W94 A;  4UF0 B;  1QXJ A;  1LEC A;  1LOF C;  3GYD A;  3OD0 A;  1BYH A;  4UFH A;  5A7S A;  3AMH A;  5JZG C;  3GBF A;  2C24 A;  2WFF 1;  2D5H A;  2Q1Z B;  3LD8 A;  4LUM A;  1F31 A;  2X10 A;  3MIH A;  3BTY A;  1W2N A;  2XBO 3;  4CZS A;  1D7P M;  2WRA A;  4LBK A;  2GH2 A;  4E27 A;  2YBK A;  3C2U A;  2UWC A;  5IWF A;  5BNN B;  2R49 A;  3WHU A;  3IAQ A;  3L9J T;  5JOW A;  2JD9 A;  2VQA A;  4P9I A;  2VW2 A;  5D8A B;  3WOG A;  1JBC A;  1U5Z A;  4MZU A;  4DEV A;  2PHL A;  4M4R A;  2IXI A;  4QGN A;  5L7O C;  4HPK B;  2OQ7 A;  4HLT A;  4JX0 A;  5FZE A;  4WV8 A;  1ZBA 3;  4I3G A;  4V2V A;  3AZZ A;  4NRM A;  4COV A;  5CAD A;  3PVO A;  1V6L A;  1VBA 2;  4RS5 A;  1UIK A;  4FSJ A;  2RS1 2;  3NAP A;  1IS5 A;  5BPX A;  4N90 A;  3ILF A;  4YFW A;  2J1E A;  1KQR A;  4MAD A;  1JYW A;  4LIT A;  1MEC 1;  2CYF A;  3AX4 A;  1VJ2 A;  2ZX1 A;  4QX0 A;  2ZX0 A;  3P5B A;  2BWC A;  5HCB A;  1BVV A;  4FFH A;  4RGK A;  2PHR A;  4YW3 A;  1UXX X;  5BY5 A;  4XFA A;  3KCY A;  2HWF 3;  1Y43 B;  4JTO A;  1VB4 A;  4UFK A;  1AX0 A;  5FYI A;  3THD A;  3KV6 A;  1SQ4 A;  2R04 1;  4MG2 A;  2YC0 A;  3DKW A;  4C1X A;  5JXH A;  3W5M A;  3ZMN A;  1MS9 A;  1HRV 3;  4XMA A;  1OD3 A;  2ZX4 A;  2VOX A;  3FLR A;  2P3J A;  3K48 A;  4DY5 A;  1SFP A;  2VY0 A;  3FJS A;  3WW2 A;  3O1M A;  4GB3 1;  3HD8 B;  1WGP A;  4YAR A;  1VR3 A;  3OYW A;  3SCG A;  3UES A;  5FY4 A;  4DUV A;  2ZGM A;  3OGJ A;  1O3S A;  2Q8O A;  4HMZ A;  4O65 A;  1Q8V A;  2JG8 A;  1GV9 A;  1QF3 A;  2FDJ A;  2A6Z A;  1ALY A;  2YGL A;  3HQR A;  3CHX A;  3T4H B;  3WLU A;  4LO6 B;  4QU1 A;  3AMN A;  4IEW A;  4QHB A;  4QXC A;  1QQP 2;  2R07 2;  3VDB A;  2GC1 A;  3EB7 A;  1PGL 1;  1W6M A;  1NCQ B;  4EQV A;  5IAX A;  1XOY A;  2X5I B;  2Y0O A;  1G9C A;  3RZK A;  1ULE A;  4Q4Y 3;  4DFS A;  2WWU A;  4GIQ A;  1DQ1 A;  3LEM A;  3DPR A;  4ISR A;  4PBO A;  4BMB A;  3D6E A;  1QOO A;  3DUI A;  5A7N A;  4GXL A;  2ARB A;  4AI3 A;  3ON7 A;  2BTV C;  3RVH A;  4EZ4 A;  1W39 A;  1M4W A;  1LEN A;  1UF2 C;  2P1B A;  2CY6 A;  4ZON A;  3CIH A;  4LEJ A;  4FTB A;  1HN1 A;  1AR7 2;  2O8Q A;  2VGD A;  1MR5 A;  2JG9 B;  2ETE A;  1QH7 A;  2VZ1 A;  4GAZ A;  3PTR B;  4XJ8 A;  2UWB A;  3S57 A;  1QY4 A;  4CCC A;  3IDC B;  4Y4R A;  1KS4 A;  2V4V A;  2VMI A;  4X6Q B;  1TE1 B;  5D8A C;  4CU6 A;  1FNZ A;  4LBQ D;  4W6X A;  3ZSK A;  3OEA A;  2HBT A;  4ERO A;  4XFC A;  3JQW A;  4Q4Y 2;  1ACC A;  4RQP A;  4KH9 A;  1CR7 A;  3QAC A;  1SDD B;  2BGO A;  2Q0A A;  5IVJ A;  5A3O A;  5BNO C;  2Y26 A;  1MVQ A;  1PO1 2;  1SPP B;  4A7Y A;  1HIX A;  5FYY A;  3TB0 A;  4LPL A;  5FIX A;  2NYY A;  1OOP A;  1NG0 A;  3VBR A;  3I2F A;  4DO0 A;  3R4U A;  3EO6 A;  1ZZ9 A;  3LA7 A;  4QB6 A;  4FVV A;  4Y20 A;  2VBD A;  3MIF A;  1ZZB A;  1RUC 3;  3EHK A;  2E7Q A;  3CO2 A;  3K4A A;  3N36 A;  4N8M A;  4Q26 A;  3MLK A;  2XJP A;  3I3D A;  1WCD J;  2Z4F A;  1XNT A;  4WM7 B;  5C5U A;  2B9U A;  1CX1 A;  2Z69 A;  4JVA A;  1GOH A;  2WO3 A;  1GZT A;  2WDB A;  3D0J A;  1WCU A;  1S0B A;  5FPL A;  3JB4 C;  3KZ4 C;  2EAK A;  1D4M 3;  4GMP 3;  4KWJ A;  1JMU B;  1K12 A;  4IGQ A;  4ASM B;  5ABJ C;  4NHM A;  3WP5 A;  1HB2 A;  3U1X A;  4ZU4 A;  3ZSE A;  2R7E B;  4CDW A;  4WVZ A;  3U11 A;  1C3H A;  1K5M A;  1O4Y A;  3V64 A;  5L36 A;  3PJQ A;  1AYN 1;  1UZV A;  3III A;  1NCQ A;  3SQO A;  2VEC A;  2YBS A;  3DPR C;  4EN8 B;  2GNB A;  4BH9 A;  2JDA A;  4F8A A;  4JKM A;  1QXP A;  2CGN A;  3VN4 A;  5EWS A;  5BNP A;  1WCQ A;  5LW9 A;  2LRP A;  3OTF A;  1ND2 C;  5FYU A;  2Q8E A;  3S0M A;  1R1A 3;  1Z7S 1;  3OPZ A;  4IV1 B;  4QX8 A;  4RGG A;  1JZ7 A;  1FMD 2;  3ZVX A;  2OT7 A;  1NCQ C;  2JXA A;  2RE9 A;  2V5Y A;  2YXS A;  3CEW A;  5FMD A;  4AGV A;  1RHI 2;  2WBK A;  3JBG 3;  2PYT A;  4IET A;  3ZKU A;  1MS8 A;  4RHV 2;  2R16 A;  1V00 A;  2OYZ A;  4CP9 A;  1GMM A;  5FUI A;  4ONU A;  4E4Z A;  2PQQ A;  2JE9 A;  2F4P A;  1QH6 A;  4UBH A;  4YG0 A;  2P3Y A;  1BEV 1;  2ZEW A;  4EN6 B;  4XBN A;  4N9H A;  5F2W A;  1MS4 A;  3QBQ A;  5ACA 2;  1YFX A;  2V72 A;  1FV2 A;  2J42 A;  2WYS A;  3AXD A;  4AG4 A;  1ZVF A;  5L73 A;  1JI6 A;  5CFD B;  3MW3 A;  2YMZ A;  1SLB A;  3AL5 A;  4O7X A;  2HEY F;  4Q0Q A;  5LBB A;  3DKQ A;  2D3P A;  5GM0 A;  3VBH B;  4N7U A;  1N3P A;  1NYW A;  4Q5O A;  5FLJ A;  1J3P A;  4I09 A;  3O0W A;  1OOP B;  3VBR B;  1NLQ A;  3B9I A;  1JYI A;  3VHR A;  2OXB A;  4XAA A;  4K1Z A;  4EWD A;  2JDZ A;  4OQ9 A;  1E57 A;  5LRS A;  1NZI A;  2MPF A;  5C3P A;  3WCR A;  2XUM A;  4H7M A;  4DEQ A;  2CAU A;  1ZBA 1;  4LOR A;  5T52 A;  4TXW A;  3VBU C;  1O3R A;  4CU8 A;  3A0K A;  1YXW A;  2XG3 A;  1CAW A;  5C33 A;  5FMC A;  1COV 1;  1OMI A;  1Y9M A;  1RGS A;  2Q1F A;  3WUC A;  5F32 A;  3WR0 A;  1EPW A;  2FCT A;  3ZXA C;  3E97 A;  3ZFG B;  3MLJ A;  4FT8 A;  5A1L A;  2Z5W A;  2KXL A;  1OLM E;  3GCW A;  5JXJ A;  1RUE 2;  4GA9 A;  4NIH A;  3BVC A;  1FOD 3;  2VW0 A;  3VBU A;  5FYH A;  2RS5 1;  4PI2 A;  4BK5 A;  4CU7 A;  3LPF A;  3AYD A;  4CUC A;  1QIQ A;  3UGH A;  2XGX A;  4RR3 C;  4DQA A;  3C7O A;  1NX9 A;  2ZKN A;  3ATG A;  2BBA A;  3AZV A;  4GWM A;  4CVU A;  2RMU 3;  2ZGL A;  4DXZ A;  1R1A 2;  3V0A A;  2F6B A;  2ZGT A;  5ERL A;  5K0U C;  5HV0 A;  4IV1 A;  3VBF B;  2DDU A;  4G9S B;  4XVH A;  1N3O A;  1EV1 2;  2OVU A;  3ZXJ A;  5D21 A;  3SC7 X;  1IS3 A;  4HSL A;  4L97 A;  5FMO L;  1N1Y A;  3D3A A;  4Y1Z A;  4O9E A;  3WDY A;  1AJO A;  1TQ5 A;  3WP4 A;  2JKB A;  1PIV 2;  4FXK B;  4BXS V;  1IZ3 A;  2CNA A;  3AYA A;  4IV1 C;  5DN2 A;  3GZU C;  3NJX A;  1OA4 A;  1H30 A;  2ZGN A;  3VV1 A;  2WA3 A;  4QPG B;  2WNO A;  2VUC A;  2ZTN A;  3ZN6 A;  1OPM A;  2VUJ A;  4KWK A;  2ZAA A;  5FZ7 A;  4Y3O A;  1FOD 1;  1MQT B;  4N53 A;  4UT5 A;  2WFP A;  4WM8 C;  4YVW C;  4GUL A;  1UNB A;  2W3J A;  4H14 A;  4JHZ A;  3KMH A;  3KSC A;  2OS2 A;  2HLE A;  2XBO 2;  2PHF A;  3LCP A;  4Q4W 3;  1C5I A;  1VAK A;  3N7K A;  2A3X A;  3MZH A;  3FMG A;  1QJX 3;  1S0C A;  2MNG A;  1RHI 1;  1RUJ 3;  2ZGP A;  3KV9 A;  1AXZ A;  2ORZ A;  3VL9 A;  4UW5 A;  1ENS A;  4BQX A;  2VCM A;  2QCS B;  4OLL A;  2VTX J;  4FOW A;  4TSV A;  3HT2 A;  4LO8 A;  2J1T A;  4P9L A;  1TME 1;  3WCS A;  1LEM A;  1C8M 3;  1I6X A;  1PIV 1;  4CYD A;  5IK8 A;  1W0N A;  1GZW A;  3SH4 A;  5JR2 A;  2ZGO A;  3FE5 A;  4IND A;  1L7L A;  2YYO A;  4W6Y A;  1C8N A;  2JB8 A;  3SKJ E;  1WCS A;  5DG1 A;  5FUN A;  3RZJ A;  5IVV A;  1YEW A;  1S0J A;  2WN3 A;  5C3O A;  5IYY A;  1ASJ 3;  3TEX A;  1LED A;  5JPM B;  4IE5 A;  2Y0I A;  5FZG A;  3IDB B;  4S2D A;  3AMQ A;  1YFW A;  3QOP A;  4XQD A;  3DCQ A;  2D6L X;  1OLR A;  3C7H A;  2H6C A;  5C4W C;  5JPN B;  5FY1 A;  1ZZ6 A;  2CGO A;  1JUI A;  1CWP A;  4IER A;  3E5Q A;  1RVF 1;  3POB A;  4JGZ A;  3ZFE B;  3FC0 A;  5LAS A;  1PVX A;  4YG6 A;  2WSU A;  4URT A;  3MBW A;  5A3T A;  2P6C A;  3GBW A;  2YUE A;  5DAQ A;  1A6C A;  5FO9 B;  5I8Y A;  2VVE A;  4KL1 A;  3O1R A;  1HXS 2;  4AE2 A;  2QZ2 A;  5IHR A;  4U2A A;  2B9V A;  2VBB A;  3S5Q A;  2JDP A;  3QH7 A;  1PZ8 A;  3MIE A;  2VR4 A;  2ARE A;  3WVJ A;  3VBO C;  1XU2 A;  2RM2 2;  4L11 A;  4LK6 A;  2WZR 1;  2VVD A;  4JDN A;  1GNZ A;  2HH9 A;  3VZL A;  3LGR A;  1NY7 2;  3FUO A;  1QOT A;  3L2H A;  3LOB A;  3RDI A;  2JEN A;  3BKZ A;  3TEW A;  3AZW A;  1QNW A;  5M0T A;  2K2S A;  1GZC A;  3IKW A;  1HB4 A;  1AR8 2;  3O0V A;  5H9R A;  1R1A 1;  3BTX A;  1NA1 C;  1AR9 3;  1SFN A;  4YZ1 A;  4PJY A;  1NA1 B;  1C1L A;  1EV1 3;  1H4G A;  2GMM A;  1XE8 A;  4OZO A;  5BNO B;  2WLQ A;  2A7A A;  4H2A A;  3UET A;  1QJX 2;  2W52 A;  3H3Z A;  3NV3 A;  1EP0 A;  1UMI A;  2VZP A;  4L9B A;  4CDW B;  4BWO A;  1H8V A;  4NVP A;  1PO2 1;  1NE6 A;  1R09 2;  4B4Q A;  5F7U A;  2EID A;  2VZ3 A;  4Q4X 2;  2Y8K A;  3DL3 A;  4QMA A;  4BE3 A;  1PX3 A;  1FOD 2;  2O0O A;  1CAX B;  3MHZ A;  3S5A A;  1FAY A;  3GZT B;  4ZS3 A;  2EIE A;  3PTY A;  4QXK A;  1V9U 2;  2XB6 C;  3BIE A;  4M3C B;  1YJK A;  4JC1 A;  4XAB A;  3ZN4 A;  3ZYG A;  3I59 B;  5DZG A;  1H2K A;  3ZSL A;  4WVM B;  2YG0 A;  2A6W A;  5AC9 1;  4CCD A;  1NLR A;  3LF7 A;  4BME A;  3DXT A;  4B4P A;  5FY0 A;  5G05 L;  1JZ8 A;  3VD7 A;  3ACF A;  1GOG A;  4XEZ A;  4Y22 A;  1HXS 3;  1POV 0;  5EV7 A;  1EV1 1;  1F4A A;  3VD5 A;  5C70 A;  4IUG A;  3THT A;  1GP6 A;  3FWE A;  2ZX3 A;  3RSJ A;  4TZD A;  2HWF 2;  3HBZ A;  4UW4 A;  2JKX A;  4YGC A;  1OXC A;  1MPX A;  1YIF A;  3AZY A;  5IW0 A;  3WG2 A;  4AI8 A;  5FQ0 A;  2WZR 2;  5A3N A;  1HRV 1;  4D3W A;  2BNM A;  1FXZ A;  3S30 A;  1HW5 A;  2WO7 A;  4AXO A;  4TYS A;  1UZ0 A;  3BTZ A;  1UY3 A;  2V4A A;  1WW5 A;  3WF4 A;  1RUH 2;  1O4T A;  1YRZ A;  3OJB A;  5BNP C;  1LHN A;  2AR6 A;  3ZXK A;  4XOG A;  2PHU A;  1S55 A;  1E5R A;  4HBN A;  5LA9 A;  2JEC A;  2D97 A;  1GUI A;  2WJS A;  4NUB A;  1FMD 3;  4DOU A;  1JW6 A;  3CJI A;  4GB3 3;  3TWI A;  5FZ9 A;  3EQE A;  5A6X A;  4PF1 A;  2Q4S A;  2XJU A;  4B7E A;  4A6S A;  1R09 3;  4CEY A;  1MS0 A;  4ZY9 A;  4PCR A;  2VZU A;  2ZZJ A;  5EXO A;  5FZ3 A;  1RIR A;  1W3V A;  3WG3 A;  4LA3 A;  3O1V A;  4RR3 B;  3WSO A;  5BNQ A;  2VZO A;  1UXZ A;  4Y5T A;  4YGB A;  1ND3 C;  3H1Y A;  2BPA 2;  4Q4Y 1;  4K9S A;  4NMI A;  5FWE A;  2ZGS A;  2W5F A;  4HG6 B;  1S4C A;  2BWA A;  4YRD A;  1GWK A;  5LBC A;  2BZD A;  3MUZ 1;  4COY A;  5FZM A;  1W6Q A;  3G6J B;  4NOT A;  2DVG A;  1VBC 2;  4E4D X;  4C1W A;  2R04 3;  4KBZ A;  3LDK A;  2GNM A;  4H7L A;  3IDE A;  4ATE A;  4RHV 3;  3TNQ A;  3WW3 A;  2D44 A;  3KF3 A;  3DXU A;  3I2J A;  3KT7 A;  4KNC A;  4QPW A;  5DQ0 A;  2J1U A;  2HWC 3;  2WYF A;  2R07 1;  4RN5 A;  5IJR A;  2I07 B;  1Z78 A;  1G9F A;  3K46 A;  4B4R A;  1OQD A;  1QQP 3;  1H4H A;  3PUH A;  5F8P A;  3T09 A;  1GQG A;  4JV4 A;  2A6Y A;  1PNF A;  3RMY A;  3JUU A;  2NZ9 A;  1QDC A;  2FCU A;  3BPS A;  5A3L A;  1MZE A;  3FLT A;  1ST8 A;  5FCC A;  1UU4 A;  1O6U A;  1PVC 1;  4PDW A;  4CEW B;  4JCK A;  3H8U A;  1YI7 A;  1QQP 1;  3WNL A;  1AYN 2;  2G19 A;  3CL1 A;  1HV0 A;  1YO8 A;  4AGR A;  3I2O A;  2JE7 A;  5L9B A;  4ITC A;  3M3Q A;  2B8M A;  4DRR A;  3BOW A;  2R06 3;  3HAG A;  3KVA A;  2QQM A;  3MLL A;  1H9P A;  4HK8 A;  4CDQ B;  1WCK A;  1HKD A;  1PVC 3;  3LWC A;  1DBN A;  3WIN E;  2JG9 A;  3CJI C;  5JOX A;  4ZHN A;  4Z8B A;  2RS5 2;  1FI2 A;  2Z42 A;  4AFC A;  3ZX7 A;  2VTX A;  3NST A;  3P6B A;  5LA0 A;  1SHW B;  1HV1 A;  1TNF A;  1W9F A;  4Q4V 3;  3I97 A;  5E1R A;  4NIA A;  2FZ2 A;  3D4K A;  2IVJ A;  5C3R A;  2B46 X;  3AP6 A;  4E8D A;  2HEW F;  1GOF A;  3GCX A;  3WHT A;  2IVI B;  3KCC A;  5C5T A;  2RMU 1;  1C8M 2;  2GNT A;  5L7O A;  4YZ4 A;  1RXG A;  3BI3 A;  1OT5 A;  4DB5 A;  4Z2A A;  2A70 A;  3AP9 A;  3N7M A;  2YV8 A;  4NHL A;  1JOJ A;  1SCS A;  1WA4 A;  4QQH A;  4D7T A;  1PK6 C;  5KHI A;  3CZJ A;  1S0F A;  4KGG A;  4CXY A;  4LKS A;  2ZMK A;  4YW1 A;  1TMF 3;  3OBZ A;  5T5L A;  3VBH C;  1F8V A;  2WWS A;  3I8T A;  2XML A;  3ZXL A;  1I9R A;  3ETQ A;  2PN5 A;  3MIG A;  2IXH A;  1QJY 1;  1JYX A;  1W6O A;  1XND A;  5FZO A;  2QDR A;  4JGZ B;  1ONA A;  2VG9 A;  1NQD A;  3C8X A;  5F3I A;  2NLR A;  1WKY A;  4UW6 A;  2OUH A;  2XVL A;  1AVB A;  2ENR A;  2GN7 A;  2X8K A;  4LLO A;  3DEC A;  1Q43 A;  1WW7 A;  1G9D A;  3AL6 A;  5CFC B;  2WT0 A;  2C0Z A;  5IK5 A;  4QX7 A;  1LB2 A;  2DUP A;  3S7E A;  5CFC C;  2ZJC A;  3POE A;  2UYB A;  1KFU L;  2J1R A;  2VME A;  2P2K A;  4NRO A;  5J98 B;  1D4V B;  1LHU A;  5LA2 A;  1JHN A;  1CN1 A;  4HFS A;  3ME2 A;  3WUD A;  2E9Q A;  2VZR A;  4IV3 A;  4K40 A;  1CJD A;  3VBF C;  2YC2 A;  4AEK A;  3I49 A;  1RJ7 A;  2VOT A;  4OQ8 A;  2B39 A;  2VOV A;  1ZX5 A;  3RG0 A;  4Z2W A;  3NNG A;  1GQP A;  1U12 A;  1V6J A;  3IZO A;  1C5H A;  3MW4 A;  3IBM A;  5FPA A;  4NPL A;  3NO8 A;  4LBL A;  3QD6 A;  5F1R A;  4P9J A;  2FQP A;  5IVC A;  2UY9 A;  3POW A;  1WBL A;  2VMF A;  2V5D A;  3BGA A;  5DDJ 3;  5F5C A;  3WF1 A;  2HWB 1;  2QUO A;  5EYX A;  5F3G A;  4BIO A;  2A5Z A;  5KWR A;  1G86 A;  1GAN A;  3VBO B;  1HRI 3;  2D7F A;  4AHZ A;  1W05 A;  2X5I C;  1EYB A;  4W6W A;  2OPW A;  4LJH A;  2I45 A;  2VTF A;  2WKK A;  3AMM A;  4IE6 A;  1WLD A;  4RS5 C;  4CCJ A;  4YWA A;  2DCT A;  3NNF A;  3ZIX A;  2WQZ C;  3POF A;  2Q30 A;  1RUF 3;  1XYO A;  1G6N A;  1NOV A;  4URA A;  1YHF A;  4OHW A;  4I0A A;  4AVS A;  1CIY A;  5BYN A;  3AYC A;  4IE7 A;  2JDN A;  2OUJ A;  1WMX A;  1W9T A;  3NNJ A;  4Q2F A;  4YNI A;  3WDW A;  2ILM A;  1LNS A;  3O12 A;  5GJ6 A;  4BHP A;  4FPE A;  1DFQ A;  1FX5 A;  4JKL A;  2WS9 2;  2E31 A;  2RDR A;  1LUL A;  4ISQ A;  3OBR A;  4BLJ A;  4GZ9 A;  2RM2 1;  4C90 A;  1XSR A;  3LDR A;  3U75 A;  3TEZ A;  2QQP A;  1WWY A;  4XFI A;  4CDW C;  3VL8 A;  4LNV A;  2LM3 A;  4LT5 A;  5A6Q A;  1GIC A;  2IXL A;  2QJV A;  3KV5 A;  3CBN A;  4Y22 B;  4XDP A;  1A78 A;  3S7I A;  2VUD A;  1VBA 3;  1VBA 1;  3ITQ A;  4OCT A;  4QWN A;  3UGF A;  5CFC A;  1DQ0 A;  2DTW A;  3GF6 A;  1XBF A;  3MGU A;  4FFI A;  4PIY A;  1WW4 A;  2XHK A;  3ORJ A;  4FPJ A;  2ZEX A;  2RM2 3;  3FL7 A;  4XF1 A;  4MXW A;  2XQR A;  5GLU A;  1OPO A;  2MEV 2;  1OD5 A;  2CAV A;  5FUP A;  2BW8 A;  2K0G A;  5LY2 A;  1IQD C;  5I93 A;  3E6C C;  5FYT A;  5T55 A;  4AQS A;  4XTM A;  1NZC A;  2WZR 3;  5J96 B;  2Q8D A;  1YI9 A;  2WZE A;  3C7G A;  4JRA A;  3OB8 A;  4LKF A;  1N1T A;  2BU9 A;  1YLL A;  5FWJ A;  2PTM A;  2WR9 A;  3KLS A;  2VAU A;  1RUC 1;  2QE3 A;  1ZZ8 A;  4C0B A;  1R1Z A;  1UY2 A;  1HLC A;  4GKX A;  4KU7 A;  4CP0 A;  1FT9 A;  1OLM A;  5JZG B;  4CCE A;  2DCZ A;  3LA2 A;  5FY9 A;  2BER A;  2V73 A;  4RYD A;  2BGC A;  3AMP A;  4HN0 A;  1TZO A;  2DTY A;  1F5F A;  4FFG A;  1CAU A;  1C57 A;  3OY8 A;  5J7M A;  3HQU A;  4GWI A;  5CG9 A;  1AR9 1;  1RMU 2;  1UZY A;  4W4Z A;  3VHO A;  2AEY A;  4A44 A;  4AED B;  1ENR A;  1SFY A;  1W8Z A;  5FJH A;  5CAZ A;  5B4N A;  1GP5 A;  3FHI B;  1YIP A;  4I3P A;  1CIW A;  4V1P A;  4Y5S A;  4BM8 A;  1AL2 3;  3DYM A;  1BMV 1;  3WQ7 A;  4MHR A;  5C6C A;  1TMF 1;  2HWD 3;  1ZBE 2;  1QJY 2;  3PU8 A;  2RJ2 A;  1UW8 A;  2QQW A;  2W68 A;  3VDD C;  3W9A A;  4AW7 A;  1HX6 A;  5SV8 A;  4QPY A;  3LSD A;  2TEP A;  2CWM A;  2PLV 3;  4IEU A;  2TNF A;  1R08 3;  4Q1R A;  4Z07 A;  5FP3 A;  5H9S A;  3TN9 2;  3WW4 A;  1W90 A;  1VMJ A;  2D98 A;  4D94 A;  5FPV A;  4AOC A;  3LIG A;  1RMU 3;  3R4S A;  1D0G A;  4UF0 A;  1VMF A;  1YQ8 A;  1BMV 2;  5I8S A;  4UWD A;  1IPJ A;  4GJZ A;  3NKG A;  4CUA A;  4P00 B;  1WMF A;  2BQP A;  4M0H A;  1JU3 A;  3U07 A;  3FX3 A;  4FAG A;  4IEX A;  3T1L A;  4XXA A;  4E2S A;  3HOB A;  2E33 A;  3NRU A;  1CD3 G;  1ND3 A;  3MV0 1;  4QB2 A;  2WWJ A;  5EHD A;  3F95 A;  1S0E A;  1TG7 A;  4I0W B;  1IG0 A;  1GNH A;  4BJ0 A;  4IEQ A;  3OG2 A;  3MIB A;  3T1M A;  4DPN A;  2D43 A;  4GMP 0;  4QDR A;  1V6I A;  4FOV A;  4A7K A;  1OQ1 A;  2RR1 2;  3DYO A;  1KDM A;  3ZXF A;  3GGL A;  2A75 A;  1QJY 3;  1CES A;  1DGR N;  4Q4W 2;  2NMO A;  3VKL A;  1RUO A;  1UZW A;  2WNV C;  2ARA A;  1AXK A;  3THC A;  5CEH A;  3NWK A;  1O5U A;  2PAK A;  2GC0 A;  4GH4 C;  2HWF 1;  5KR7 A;  3OBA A;  2W92 A;  3WX5 A;  5LEK A;  2R07 3;  1LTE A;  2PLV 1;  1UKG A;  4K6B A;  4WVW A;  4PQ9 A;  5IT6 A;  3ACL A;  3PVE A;  5K0U B;  5GLV A;  3AJY A;  3N9N A;  1SEF A;  4LE4 A;  4P9Y A;  1K3I A;  5A6Y A;  4AVA A;  4Q4V 1;  1OHF A;  1XU1 A;  3MID A;  3AKS A;  3N9M A;  3BB6 A;  3QCW A;  1PM4 A;  4N7I A;  2VMG A;  4UI9 L;  3RYP A;  1JH5 A;  1W6O B;  1XC6 A;  2DYC A;  4CCM A;  1GSL A;  4BIS A;  2BP6 A;  2VE1 A;  3SMH A;  5ISL A;  1A8M A;  3CU7 A;  3GZA A;  4LKE A;  4YW2 A;  1D2Q A;  4YFZ A;  4IQP A;  1QMJ A;  2JIC A;  1OQE A;  1KXG A;  5CIS A;  1AL0 G;  4RHV 1;  4Q4V 2;  2NQY A;  4JAA A;  1XE7 A;  2XJR A;  2HWC 2;  2W1Q A;  2NM1 A;  4L2N A;  4LIV A;  5IUQ A;  2ZOE B;  3ZN5 A;  5FYC A;  4Y5Z 0;  3ZFE C;  2Y6F A;  4JGZ C;  4YYO A;  5JXI A;  1KJL A;  4HK9 A;  3VDD B;  1W6N B;  3UT0 A;  3ZFF A;  3DPR B;  4PBP A;  2J1A A;  4FPH A;  4Z1V A;  3OBT A;  4CRQ A;  2FHR A;  3D8C A;  5EZW A;  1VBE 2;  3NVC A;  2J1V A;  4J1W A;  5FXX A;  3ZYF A;  1LHW A;  2IWG B;  2VZS A;  4F83 A;  2VL4 A;  3N9Q A;  2ADD A;  3OGR A;  3VBO A;  5DDJ 2;  4R9C A;  4NAM A;  4MXV A;  3OUH A;  3A22 A;  1Q8Q A;  4Y26 A;  3VKN A;  3WNP A;  1ODN A;  2ET1 A;  1XNC A;  2XJQ A;  2XWB B;  1MS5 A;  3EXU A;  3KM5 A;  2DVB A;  2Z79 A;  3ILN A;  2UY8 A;  2WNE A;  5GLT A;  3WNO A;  4IEP A;  2P4E A;  1VBD 3;  1X36 A;  2EXJ A;  5I0D A;  2BYV E;  3LOI A;  4Z82 A;  4CDQ C;  1H1A A;  3H7Y A;  4B7K A;  4IEV A;  4AHX A;  1AUY A;  5FZ6 A;  4HT1 T;  4XPV A;  1UOJ A;  5K9Y A;  1M06 G;  1C4R A;  5FPZ A;  4IEY A;  1ZRI A;  3ES4 A;  2XL7 A;  4EE2 A;  3GDB A;  4XUR A;  2EA7 A;  5JR7 B;  1OOP C;  2E7T A;  2RHP A;  3VBR C;  4YPJ A;  5FZ1 A;  2PQS A;  1TME 2;  4UFL A;  4P9W A;  3OPT A;  2H6B A;  3APB A;  3I2H A;  3PUA A;  3JBG 2;  4QX2 A;  1DGW X;  4YZ2 A;  5J37 A;  2ID4 A;  1UPI A;  4OI1 A;  2W9X A;  2D6K A;  3HEI A;  4QU2 A;  4MHU A;  3RWN A;  2RR1 3;  2QTW B;  5G04 L;  3TNP B;  1KGY A;  4BDV B;  4X8P A;  2XH6 A;  2R32 A;  4TTG A;  1V0A A;  3K3N A;  2EXH A;  4OMD A;  3C7F A;  3M3O A;  3DGT A;  4D0Q A;  2OKX A;  4NR1 A;  5FPB A;  4EJR A;  3ZYR A;  2ORX A;  1V9U 1;  4OYU A;  1D4M 1;  2WQ4 A;  4GMP 1;  1W9W A;  2H0B A;  1JZ2 A;  3UKV A;  2GU9 A;  3P3P A;  4I30 A;  1DF0 A;  1HJG A;  4AVC A;  5FP4 A;  3ZO0 B;  3VHP A;  3HQX A;  1YCI A;  5A7W A;  3ROU A;  1JN2 P;  3WNN A;  4E2Q A;  3A21 A;  4O61 A;  4J6G A;  4IXL A;  4XAC A;  2JDY A;  3H1M A;  2VMH A;  3ZIW A;  3NJZ A;  4F3J A;  5C8C C;  2RS3 1;  2WT2 A;  1GP4 A;  1K45 A;  4AZZ A;  2XUE A;  4LO7 A;  4BU2 A;  1WW6 A;  1W0P A;  5FPU A;  1RUD 2;  2CV6 A;  4DUX A;  2QKD A;  5A3P A;  1OUR A;  2ZCW A;  1FPN 2;  2RJK A;  4FOY A;  3HIF A;  2F17 A;  3KT1 A;  4DS0 A;  1WLT A;  5JSO A;  2GND A;  1H9W A;  2WUH A;  1S2K A;  1PMI A;  2XDV A;  2W87 A;  4HKO A;  5IAT A;  2C26 A;  2A3Y A;  1SCR A;  4AFA A;  1QJF A;  3WD5 A;  5K8S A;  2O8O A;  3OCP A;  4HKW A;  3VDC A;  1OBN A;  1AR9 2;  2KM2 A;  1IGO A;  4XJ9 A;  4IE0 A;  5DXD A;  3U0Z A;  3M1H A;  4K1Y A;  3K77 A;  1RIT A;  4CEW C;  1S2E A;  2Y6J A;  2VMC A;  4OI2 A;  4SBV A;  3T0A A;  3VHN A;  4LE3 A;  5FY5 A;  1J1L A;  2VM9 A;  2VCA A;  1PVC 2;  1LOA A;  3THP A;  1BHG A;  4K8R B;  3PHM A;  4QHO A;  2R06 2;  1PGW 1;  4BQ3 A;  4QPG C;  1ZRE A;  2WLP A;  3T2P A;  4FPK A;  4X6R B;  4QQL A;  2P34 A;  1LU1 A;  5JOZ A;  2R0H A;  5DUU A;  3WF0 A;  1OFN A;  5HI0 A;  4NID A;  3T08 A;  3GHM A;  4LMF A;  2IFR A;  5B4X A;  5T50 A;  4CXW A;  2ZBJ A;  4LXL A;  2IC1 A;  3KD4 A;  2E26 A;  5FO8 B;  4XFB A;  3H8R A;  4WVV A;  4R9B A;  1W8H A;  2BV4 A;  1GKB A;  3FBM A;  4TN7 A;  4LO5 B;  1WBF A;  3M3I A;  1PGW 2;  1RUG 3;  2D3S A;  2YFU A;  1H8T C;  4Q0V A;  4BQ2 A;  5CB7 A;  4B8E A;  1NLS A;  5BV6 A;  3E6D A;  5FYV A;  4Q4W 1;  2D3R A;  3C7E A;  5FJK A;  1PZ7 A;  4ZZ8 A;  4FO9 A;  4LUL A;  1H0B A;  1GBG A;  3RYR A;  1MZ5 A;  4PHZ A;  1AYM 1;  3K75 B;  1UOG A;  1D0H A;  2A1X A;  4HN1 A;  4NHK A;  1SMV A;  4HZF A;  1ZYB A;  2R04 2;  2DCJ A;  3LPG A;  3WDV A;  1EAH 3;  3K3O A;  5CKN A;  3VKF C;  3K4D A;  4P5Y A;  1HRV 2;  4Q8L A;  2RJL A;  1D2S A;  1MZ6 A;  5CG8 A;  1LU2 A;  4I0B A;  1V6N A;  2J1S A;  5A3M A;  3HMY A;  2IXK A;  1B35 B;  4XHX A;  2ATF A;  1AYM 2;  1X9P A;  2BNN A;  2ZZQ A;  2R1D A;  3KF5 A;  4M3C F;  1ENQ A;  4YM1 A;  4M0N A;  5A3W A;  4XUO A;  5LK5 A;  3W59 A;  2D5F A;  4D8M A;  4CCK A;  1ZRF A;  4OUM A;  2FMD A;  1MQT A;  4UBG A;  1X82 A;  1NKG A;  1PO1 1;  5IVE A;  4JTN A;  4G3Y C;  4XDO A;  3H9A A;  5GZG A;  3AFG A;  2MEV 1;  4P5H A;  5SV5 A;  4XTP A;  1OVP A;  1IKQ A;  4GWN A;  4CDU A;  2VNO A;  3SXW A;  3IMM A;  1POV 3;  1KS5 A;  1VE0 A;  2QNK A;  4YW4 A;  4AI2 A;  2OA2 A;  2D6N A;  3CKH A;  1LR5 A;  4CCO A;  1TNR A;  5K4L A;  4ARX A;  2P5B A;  4QPI A;  3HNB M;  3MPP G;  4XZU G;  3PIJ A;  3UJQ A;  5DMY A;  1MVE A;  1EUU A;  1JYC A;  2OW4 A;  1R08 2;  2VZQ A;  4A3Z A;  3J8F 3;  3J8F 1;  1Q8P A;  5TSW A;  3OOX A;  4EN7 B;  2HYX A;  4LOT A;  2J22 A;  3ZFG A;  3WEZ A;  1YC6 1;  5JMO A;  1A8D A;  3N7J A;  2XXZ A;  4D6R A;  3LSE A;  3EBR A;  2BNO A;  5DUW A;  2BBV A;  1BK1 A;  4KG0 A;  2RVA A;  4FXG B;  4XJA A;  1HQN A;  3WQ1 A;  4CCN A;  4ZU7 A;  2AGS A;  3ZM8 A;  2RDS A;  2ZAC A;  3LKJ A;  3SH5 A;  2HKX A;  4OHX A;  4PLO A;  3ZPY A;  3ZYH A;  1BK0 A;  3RZL A;  5IFP A;  4Q4X 1;  2Y6H A;  4MSV A;  4GKY A;  3N7L A;  3WDU A;  3OPW A;  5A7O A;  3BYW A;  1OKO A;  3K4Z A;  2ZA9 A;  5LY1 A;  5A3U A;  5IFT A;  3N35 A;  1QWR A;  2VNV A;  4OI0 A;  3AC0 A;  4IGP A;  3I2G A;  1AR8 3;  1G7Y A;  1W04 A;  1N47 A;  1DGL A;  5CU1 A;  3O7O A;  4KQ7 A;  1PK6 A;  2XLA A;  5F5Q A;  2RS1 3;  1RXF A;  4B1M A;  4LHN A;  3URF A;  5J48 A;  1UU6 A;  1PHM A;  4QGM A;  2ZML A;  3ACG A;  3RZG A;  2BOI A;  2GAU A;  1ULP A;  5E6H A;  4QQP A;  2DVD A;  3I3Q A;  5AFB A;  4IV3 B;  1O59 A;  3U4S A;  2QVS B;  5ABJ A;  2NPI A;  5FRA A;  3FZ3 A;  4M3C E;  2WII B;  2DUQ A;  5H9Q A;  2BOJ A;  4DMI A;  4QKB A;  5FZL A;  5C8C A;  3LDB A;  2RV9 A;  5DAX A;  2I74 A;  3AK0 A;  1DGR A;  5FP8 A;  5B2G B;  3KHB A;  3KS7 A;  1O3Q A;  2DFB A;  5GZF A;  3UV9 A;  1GWL A;  1F4H A;  1RUE 1;  2OZJ A;  4XCA A;  4P9X A;  2XQX A;  4CDX C;  1STM A;  4CDX A;  3FFZ A;  5IVB A;  1AR6 1;  2WS9 3;  5C4W B;  2VOW A;  1NA1 A; 
#chains in the Genus database with same CATH homology
 1UZV A;  2CHH A;  2JDK A;  2JDU A;  5A6Z A;  1OUR A;  4UT5 A;  2BP6 A;  4AOC A;  2BOI A;  5A70 A;  1UQX A;  1W8F A;  3DCQ A;  2WRA A;  1OUS A;  5HCH A;  5A6Q A;  5D2A A;  1OVP A;  2BOJ A;  2WR9 A;  2VUD A;  5A6X A;  1GZT A;  3ZDV A;  4CE8 A;  1OXC A;  2JDH A;  2JDN A;  5A6Y A;  2VUC A;  1W8H A;  2BV4 A;  2VNV A;  2XR4 A;  2JDY A;  5A3O A;  1OVS A;  2JDP A;  1OUX A;  2JDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...