3KB5A

Pry-spry domain of human trim72
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Tripartite motif-containing protein 72
publication title Crystal structure of PRY-SPRY domain of human TRIM72
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kb5A00
4N7IA 5F6KA 4KG0A 2E63A 2YYOA 5JIUA 4P9LA 4X8NA 2IWGB 4V1PA 4WVMB 3TOJA 3UV9A 4XW3A 5JI9A 4WVMA 4N7UA 4P9IA 2YUEA 4P9JA 4QT6A 5JIAA 3KB5A 2FBEA 5JI7A 4B8EA 2LM3A 5F6LB 4B3NA 5C33A 2WL1A 4X8PA 3ZO0B 2VOKA
chains in the Genus database with same CATH superfamily
5AC93 5KXCA 3WCSA 4CP9A 3JB4C 1O7FA 3NSTA 3AKSA 1VAVA 1VAKA 1UNBA 2WWSA 4Y3OA 3TWIA 4AEMA 2YPDA 5FP8A 1W8NA 2ORZA 3FJSA 3RZKA 1B09A 1EP0A 1UY3A 5SV5A 3VBUA 5J48A 3ZX7A 1XNAA 3GF6A 3J7LA 2WZ8A 2YMZA 4ONUA 2C26A 5FPUA 1YFYA 5BNQA 2P5BA 3VBFC 4JAAA 2V5DA 1RC6A 5IVEA 1OQEA 3IDEA 1CZTA 2KA3A 1QH6A 4IE7A 3AP4A 2VCAA 3LB9A 3LPGA 4XF0A 5DZGA 4P9GA 2JDYA 2XJQA 3PJYA 4XUPA 3VD5A 1YNAA 2ETEA 2W5FA 3T08A 1H2LA 4N43B 1D2SA 2ZGTA 1VBA1 1PMJX 4HFSA 4RQPB 5F5AA 1I3HA 1JYCA 1PGSA 2HWB1 2XVLA 3LFIA 3THDA 3AMPA 4IESA 4ZHNA 1H2NA 2WDBA 1I5ZA 1LHWA 3M3IA 4NHYA 3LEMA 3WUDA 5CAZA 1KDMA 5GJ6A 2DVAA 1B35A 3KB5A 5FKBA 1LHNA 1WLCA 5A6ZA 1EUUA 1POV1 2VCMA 2R063 3BTZA 1SCSA 1YCIA 3Q9OA 4K21A 4DIQA 1SG3A 1TG7A 4GB32 1ZZBA 3IIAA 3MLKA 3UNPA 5J7MA 4JGYC 1BEV2 1LR5A 1MS8A 5BNOC 1S0BA 1JTZX 1NCQA 1HB2A 3UJQA 4CUGA 3MFCA 1PGW1 4YW4A 2W68A 3VBUB 2VECA 3N9NA 1V6KA 3ZXGA 1SZBA 2A75A 5FKCA 1QQP3 4C1WA 2R7EB 3PIGA 3OBTA 1M06G 4UFHA 4XTPA 3UV9A 3THCA 1UY0A 2XL9A 2ARBA 3UL2A 1R1A1 1CN1A 3NJYA 1UMZA 3ZYRA 4BJ0A 3MUY1 3RZLA 2VCBA 4K9SA 2ZEYA 2D44A 4EN8B 1AX0A 1A34A 1MS0A 1W90A 1G9BA 2PLV2 1OLME 4NIAA 4WM8C 3PVOA 3VDAA 2E9QA 2WSUA 3P5BA 4GWJA 2BZDA 3VBSA 3ELNA 1US2A 1U5IA 1YWKA 4UWDA 4L11A 1JYXA 4NE9A 1NZCA 4FPEA 2LUWA 5DZEA 3UT0A 4BHPA 4CPBA 4OHXA 5HBAA 2C6SA 4AGVA 3MW4A 4FFHA 3POSA 5I0SA 1J84A 3VD9A 5LATA 2E51A 2R042 2JG9A 5EJ3A 2FDJA 1B35B 1HV0A 4DPNA 1RUF3 4P9IA 5HXVA 3HPNA 1ASJ2 2ID4A 1VBD2 1HB4A 1TEIA 2W1UA 3I3EA 2IXIA 3D0JA 1W2NA 4IEYA 5FZHA 3KT1A 2C9KA 2XBO1 4KWKA 1NCQB 2VMGA 2ET7A 4I01A 2N7GA 3ZXFA 3U37A 5GZDA 2BBVA 3O12A 4LBQA 4YWAA 3BPZA 1X8EA 2NMNA 5FZ6A 3WZ1A 5JZGB 3WDXA 4KL1A 4MGIE 2VJXA 2BERA 2ORXA 5BV6A 3E6BA 5E89A 4EN0A 4XC9A 1U5YA 2GN7A 4CP9B 4HSJA 4IEVA 3J26N 2EXKA 3WNXA 3JB8A 4Q4X1 1BXHA 3LDBA 2IUWA 4MVTA 4Z2AA 3KS7A 3KGZA 2B46X 3KT4A 4L97A 1IGOA 4FOQA 3GDBA 1WW7A 2ZBJA 4NHMA 4CU8A 1A3KA 3VBSB 1EPZA 3R4SA 1SLIA 2I07B 2DCZA 3C7EA 4OHYA 1BBT2 3C7OA 4QPGA 3S7IA 3INAA 1FOD3 1ZBA2 4MLOA 5DPNA 4COZA 3RG0A 2H0BA 4XJZA 4CSWA 3ZMNA 3NNFA 4XXPA 4AAPA 1FYUA 1N1SA 4AGGA 1ZBE1 3OBZA 2CGPA 3IN9A 1ZZ9A 4GULA 2JG9B 4PLOA 2JEMA 1BK0A 2VZUA 3R4UA 5E6HA 4JV4A 4GWMA 1RUD3 4MXVA 5BNPA 3OJBA 4FPLA 5E16A 1GUIA 1ODNA 1YIPA 2VVFA 2VULA 3VN4A 3THPA 2RMU1 3ZYIB 4JHZA 5HCHA 2P34A 2WT0A 3I97A 1TNFA 4HMZA 4DINB 1TE1B 3NO8A 3SCHA 1VBE2 3WDWA 1GWKA 5BNNB 1S0CA 3SQOA 5FOJB 3HJRA 4ARYA 2JDZA 2MEV3 4N7IA 3RZZA 2WS93 4RGKA 2QKDA 3GJAA 2JD9A 1JBCA 2HWC3 4N90A 3WF2A 5C5UA 3MIFA 1CD3G 5A3OA 1AR81 4AVTA 2VE1A 1RVF3 1ND3A 1HXS2 3ZKYA 2RS31 1J3QA 1G86A 3U75A 5ACA2 3J8F2 2ADDA 2B45X 3DL3A 4WVWA 5L19A 1NZIA 2EXJA 3OUIA 1BLZA 5FP7A 1O4TA 3N7LA 1DG6A 5FZCA 2WINB 4HVOA 1RXFA 3H3UA 2PYTA 1ZA7A 4PBPA 3S6PA 3WP4A 4D8MA 2D3SA 1UAIA 1W9TA 3AVSA 2J1EA 2NLRA 2WNVA 1WMDA 1SPPA 1FXZA 4HT1T 5FK8A 1BHGA 3SISA 4JHTA 1XNTA 2BGPA 5FZ1A 4BLJA 1K5MA 2Y6GA 4H3WA 4OUEA 4YRDA 1WW4A 1O5LA 2VL4A 4WM7A 2XJRA 3LE0A 4IXLA 1BVVA 1RUI1 3RRDA 5C3RA 5CFCA 4IEPA 4TN7A 3CZUA 4LK7A 3B69A 2PQQA 5FY9A 5GALA 1W8ZA 4PLMA 5DDJ1 2FDGA 4IEWA 4IEQA 2FDHA 1HRI3 5BNPB 1F2NA 2ZGKA 3D5OA 1OMIA 2NZ9A 4QXHA 4QPIC 3WF4A 4YZ5A 4QM8A 2BWAA 2AACA 1C28A 2RS51 2JDNA 2KXLA 4IEZA 5K4LA 3GBFA 2BWCA 2XWJB 4PF1A 1CAUA 2DBIA 1E57A 4JTOA 4Q0SA 1NQDA 2VTXA 1GSLA 1KEXA 5EIYB 1UMIA 1V6NA 1L7LA 5J09A 1TQ5A 1JYVA 1UW8A 1EV11 2X5IA 3J4UH 3F95A 3VB9A 3PURA 1SBDA 2DV9A 1SQ4A 3GZAA 4HSLA 4J6GA 2Q8CA 3LCPA 4L2NA 4AVSA 1Y3TA 5GLUA 5CBLA 5FP3A 3TOJA 1VBC1 1OH4A 4OZXA 3BIWE 2R49A 3WNNA 3BTAA 5KHJA 2WFF1 1TME2 3WF3A 4OYUA 5LZ6A 2AEZA 2ZEXA 2WLQA 2WNVB 5FZAA 2BPA2 2JE8A 1J3RA 1SPPB 5EJZB 4BU2A 1PO21 2QQPA 3V0AB 3NRUA 3IBMA 4K8FA 1UZWA 3VD7A 1K5MB 1JU4A 4UBHA 4LBKA 1Q43A 3BCWA 1DF0A 3CBNA 5CFCB 4JGZA 4D7YA 2J1VA 5DABA 3BIEA 5FAXA 4C90A 3LD8A 1UOFA 3KV9A 2QE3A 1Y9MA 4LXLA 4PJYA 5EYYA 2PHXA 3J7NA 3WSOA 3BGAA 5JOXA 5JPNB 2XR4A 5JDBA 4DUWA 2VQAA 4YM3A 5GLVA 3AVRA 4HANA 4Y33A 5FPLA 4OULA 4N9IA 3AJYA 1GICA 4C1XA 4LBQD 2WFPA 3M7AA 1CAUB 3ZXDA 5L9RA 2FBEA 3RFRA 4FQ4A 4YZ3A 2B4KA 1GP5A 2EAKA 2OX0A 3RNSA 4D7SA 1YEWA 1FMD3 3SCFA 2QQNA 5F6LB 2VMCA 3JD73 4ASKA 3AYCA 2JDAA 1RUE2 2VOWA 2YHJA 2X5IB 2YFUA 5A80A 3IPVA 4LHSA 2HEYF 1CPNA 2G4IA 4F8AA 2IXKA 1A8DA 3DUIA 1AXZA 4UOJA 1R091 5FZ4A 1IHMA 4YW6A 2R0HA 3VHPA 3CF6E 4DXZA 2YC0A 5CZKA 2X8KA 4N43C 4QX1A 2RS12 4H14A 4K6BA 1O8PA 3VV1A 3HN1A 4KGQA 4M4RA 5G04L 1VJ2A 5LK5A 3ZXAC 3CMGA 2QUOA 2YGMA 3WY6A 3WD5A 1AYN2 2JG8B 1VPHA 3ZLIA 4DZGA 5T3NA 1I6XA 2HYKA 5FJHA 2VW2A 2W39A 4JGZB 5JOYA 3I49A 3SH3A 4PI0A 1Q56A 1Y9GA 4UW4A 5J98B 4CYDA 4I3PA 4LBMA 1F4HA 1OUSA 2R072 5FP9A 4COWA 2FCTA 3MICA 4EE2A 1RMU1 1KXGA 4XIOA 1F5JA 2D6LX 3JXSA 3BODA 3QH6A 2OPWA 4J25A 2P17A 4ET7A 2R062 1ST8A 3GGLA 2Y0OA 4NHKA 3VBUC 3VBRA 4LUMA 4LO5B 1DZQA 1O4YA 4Y1ZA 3A0KA 3QLQA 2R16A 1UU6A 5F3EA 1VB2A 2D6NA 2X53S 3O0WA 1PGL2 1ZZ8A 3MPBA 2Y64A 2WT2A 1D4VB 2XG3A 3H3LA 4FOVA 5JUVA 1H2KA 4DRVA 4QD2A 3SEPA 1QQP2 5CKMA 3VD3A 3EYPA 2D97A 5LB6A 2YDEA 2DVBA 1OI6A 5CIRA 1UYPA 4FPCA 5DAPA 4XFGA 1AR63 3KV6A 2NN8A 4FVVA 3VBFB 2IFRA 3TAYA 5I8TA 1P8JA 4AGRA 4U36A 2ZGUA 3HVDA 4CUBA 1DFQA 2C5DA 3M70A 5GKAC 1B35C 2GAUA 4PF5A 1N1VA 1VALA 2R6QA 5G05L 2E26A 3Q8EA 4MHRA 5J37A 5KHGA 5IK5A 1UO9A 4CP2A 4LKFA 3OEBA 4QQPA 4MX3A 3AMHA 3ZFEA 2PAKA 4QXBA 5FMBA 2A6WA 2VMIA 3ZDSA 4Q4W2 1NCQC 1W9SA 2OYZA 1J3PA 3RQ0A 2Q30A 1Q3EA 2VZ3A 2HYXA 2VU9A 4Q4V1 1OH3A 3VBRB 1JU3A 3OTFA 5FY7A 2QQOA 4GB33 4M3CA 4YGCA 2YU1A 3FLTA 3POBA 3PHMA 1BEV3 1COV3 4QGMA 4ZPIA 3S57A 5F5IA 1GZTA 2E7AA 2VZPA 3WCRA 2I45A 4RS5A 4I0WB 3TN91 2DTWA 5IAXA 4AXOA 3U10A 2PELA 1RUH1 3NNJA 3V0BA 2Q1ZB 2VZOA 4I0BA 4KG8A 2X05A 3WQ0A 1IPJA 3C7HA 1VBB3 1V9U2 2H0VA 3HIFA 1YIFA 2Q8OA 3VBSC 2AENA 1URXA 4OVEA 2P3IA 1LGNA 3KWVA 5KHHA 4DEVA 3AMQA 2AEYA 2PLV3 1Y7BA 2VXJA 3I8TA 4JCKA 5FYCA 1RIRA 5GM0A 4MUVA 2QVSB 3JCIA 3WV6A 4E4ZA 2WJSA 4IE5A 3ROUA 3HBKA 4HETA 1UIKA 3ECQA 4M01A 1KRIA 4HN0A 3MI8A 1W28A 2JG9C 1WBFA 1QNYA 3U4SA 1GMMA 5EV7A 3ES4A 5IJRA 2HH9A 1AL21 4OUMA 2Q1FA 1AX2A 4NIIA 1SLLA 3VHNA 3HNMA 4NOTA 4IGPA 3I3QA 2BNMA 1K42A 5E8AA 3ZFEB 2HWD1 3RYPA 4FSJA 5CFDC 4AFBA 5HV4A 4LMFA 1QJU3 2DCJA 3ME2A 4QHBA 3I2FA 4QPWA 2DBNA 1VBD3 3EB7A 2HWE1 1QMJA 1SEFA 3USUA 1K3IA 2ZGRA 2E63A 4M3CB 4XZPA 1EAH2 1I5PA 1NA1A 2XJSA 5BUVA 3TBDA 5DAQA 2WWJA 5JOZA 3ZYFA 1D4M3 2RR13 2ZGMA 2GN3A 5I91A 4RS5B 3WLUA 1NLQA 3DYOA 1GP4A 1SMVA 1AX1A 1YC61 1PVXA 3OUHA 1MEC3 2VG9A 2BGCA 2CDOA 2MEV2 2WWUA 4M4PA 2WS92 5T5JA 5C3OA 1JYNA 1H0BA 3N9OA 1UOJA 4HONA 1NLSA 5A33A 2ZMKA 3PUAA 2GMPA 2PAMA 4JQTA 4OI1A 2YBSA 3VHRA 2VOXA 1S2BA 2WZR3 5FZBA 1AR92 1WW5A 1R64A 4QPGC 4A7ZA 3FHQA 3KD4A 1CJPA 1TMF1 2Z4FA 3AX4A 2F4PA 1X8MA 2JXAA 1UWWA 2VVDA 3EJKA 4Z1VA 4O7XA 5A1AA 1BBT3 4KBBA 1YJKA 4CDXA 2D6KA 3ILRA 4BQ3A 2SLIA 3KCYA 4QX0A 4B7KA 1DQ6A 5I8SA 1OQDA 3MPPG 1U5XA 3TRSB 3DPRC 4C8DA 1SFNA 4RR3A 3ACFA 4XUQA 2DWRA 3HT1A 4BE3A 1VRH1 4LIUA 5FZ3A 5HCAA 4Y24A 5A3WA 3ILNA 3IM0A 1NUKA 5F39A 3USUB 1ULFA 1UQXA 4Y1XA 1NKGA 1O59A 5CU1A 4I0AA 2NPIA 2FD8A 5KC6A 5C3QA 1GP6A 2F17A 2J1RA 2Y26A 2VMHA 1NXD1 1L7QA 1ND3C 2DCKA 2WLPA 1JYWA 1HQWA 4A6SA 3U4XA 4WVMB 2RDRA 2V72A 2WNUA 1ULPA 3OF1A 2G1MA 1IG0A 3N9LA 1O3SA 1IKPA 4CCLA 5FZLA 5IT6A 4QPIA 1FPN3 1QU0A 3LDKA 1CX4A 4K40A 4W6XA 1UXZA 1W03A 4HBNA 1SLCA 2ZXQA 4YVSC 3WG1A 4EV0A 1YLLA 5A33B 1W0NA 4BQ4A 3OGGA 1Y9QA 2ZCWA 1RITA 5FUIA 3MEPA 3FUQA 4AFDA 2WNVC 2ZGLA 4HLTA 2IXHA 1W6OB 1GANA 1DYKA 1K5MC 4AVBA 2Y6HA 3EO6A 4Q0UA 4WM7C 4BIFA 1OF4A 2JDUA 5CFCC 4LT5A 4CDXB 4F83A 1O6UA 4Q4Y1 1LODA 4MHUA 4PI2A 4QB2A 1WLDA 3SC7X 3MZHA 2GNMA 1K45A 1OLQA 1W2TA 1WBLA 1RUG1 4A3ZA 2RHPA 4ATFA 3K51A 2NM1A 2JE7A 2D40A 3E97A 3RMYA 4S2GA 3AYDA 5FYHA 1GQPA 3LOIA 1W6PA 4RR3B 1IQAA 2CDPA 5FXVA 1D0GA 1UPIA 2BFUS 3MIEA 4GKYA 1DU3D 2K0GA 1VMJA 1W2UA 1GZWA 4KWJA 2GP5A 5C70A 4UFJA 4XDQA 1X9TA 5FZKA 4LA3A 1CAXA 3FZ3A 4QPYA 1A6CA 3HNBM 5DAWA 1ENRA 4QDRA 3SKJE 3WNPA 3ZIXA 1XNBA 2W0XA 3HQUA 4A3XA 5A3PA 2JD4A 1XRUA 2X5IC 4CEWC 4LR4A 4IE0A 2WFF3 3JBG2 3KSCA 4E2SA 2WNUB 4ZS3A 4MXWA 2Y6FA 3WHUA 1R081 2VCCA 1F5FA 4QPIB 1FMD2 1HJFA 2D3PA 3KM5A 4W8JA 3JD72 2GNDA 4KMQA 4NWVA 2WBKA 3GHNA 4UFLA 2CYFA 1OA3A 1SACA 2GU9A 1DQ4A 5EYXA 4ATEA 1PM7A 1YJLA 4JRLA 2ZX3A 2AGSA 2BW8A 5LA0A 1AXYA 3SNMA 1EUTA 1S0FA 1HB1A 2DCTA 4EQVA 1VMFA 4E4SA 4S2DA 1HIXA 2PHTA 1RUC1 3O1UA 4IGQA 4FAHA 1JN2P 5IWFA 3RZJA 2CY6A 1DGRN 3KQ4B 5FPBA 1OOPC 1AR71 1AYM2 4Z07A 5FOBB 4XF4A 1HV1A 4M00A 4BA6A 4AF9A 1HN0A 5JOWA 5LCWL 1IG3A 2EIDA 2R30A 3CKHA 3HD8B 5FY1A 1PIV3 2P4EA 4OI4A 4KNCA 4O9EA 5GLWA 1JZ4A 2FDKA 1H8VA 1W2AX 1MZ6A 1D0HA 2Y33A 3AL6A 1GZWB 2ZX2A 4XAAA 5IUQA 3LPFA 5T5PA 4OUSA 4CDQA 1FX5A 2CHHA 3ENRA 1CAXB 2CAUA 1GQHA 4IGOA 4O61A 1HQNA 4YW1A 4LHLA 5FMDA 3WP6A 5FO9B 4XBQA 1YRZA 4INDA 3CQOA 4G4FA 4QWNA 5HCFA 1ENSA 1W9FA 3WQ7A 2VGDA 3OPZA 1BKZA 3H8UA 3PMEA 4MXWB 2JDPA 1DP0A 4XFFA 3AKQA 4XJ8A 3ORJA 3VZKA 1RL3A 2QJVA 2G9GA 3HBZA 5LY2A 1PVC1 4NPLA 1O5UA 4LKDA 1ZZ6A 3RGBA 3S0MA 1RUE3 5CG9A 4KH9A 2ZAAA 3ABZA 3G6JB 1SLAA 4D94A 5JCTA 5FQ0A 1SDDB 1QY4A 2A1XA 4XFCA 1G8WA 2HWB2 4IV3A 4QXKA 1AZDA 5FZ9A 3I3DA 1WCQA 2WKKA 3ZYBA 3BYWA 3IWZA 4RA0A 4UW5A 4FCAA 2RS13 2P2KA 4LE4A 1AR62 3FWEA 5C6CA 4P9XA 1W8WA 4XDOA 4MYEA 3VBHA 1FATA 1PX3A 2OS2A 3ITQA 2NYYA 1XSQA 1HRV1 4TYSA 1AYN3 1UU4A 4EYUA 2DVFA 4FFFA 1J1LA 1UMHA 2KD7A 1DGLA 1HJGA 3VZNA 4D0QA 3ZYHA 2HJIA 2P37A 5FPAA 1W6MA 4A4AA 3UGHA 1WA6X 3AKPA 2FMDA 3VBRC 5F5QA 2XHNA 2R073 1W0PA 1HB3A 1KJRA 3I59A 5FZOA 4CDQB 3MW2A 5BXXA 3WG3A 1QJY1 5IFPA 2A6XA 3K3OA 1N3OA 1BQPA 2OZ6A 3AM2A 1R1A2 4D6SA 3C7FA 1NY72 1OA2A 1LECA 3TB0A 4CDWA 4F3JA 4D6RA 1ZRCA 2GP3A 5T50A 2XLAA 4WZFA 4XFAA 1COV2 5HCBA 4BQ5A 4M0NA 2DU1A 4PBOA 4YARA 2AYHA 5FQ0B 1QIQA 3T4VA 4CDUA 4RYDA 1JZ8A 3L9JT 4IV3B 3H0OA 1FT9A 4GALA 4LJHA 4MGQA 3U14A 1VBB2 2BVBA 3MYXA 1BVP1 1LHVA 1UZZA 3VBHB 2GNBA 1VLNA 2D98A 2VOVA 2QDRA 2VW0A 3KCCA 5FUPA 2CSGA 4IV1A 4GIQA 4XMAA 5DG2A 4N9HA 3B9IA 3VZOA 5LASA 3ZFEC 5K9YA 1UN1A 1MPXA 5C4WA 5FYYA 4CVUA 2XBO2 5FBZA 3O14A 3LSEA 3POWA 1W6MB 5LBFA 4BWOA 4BZ4A 3OD0A 4AZZA 4PIXA 1DQ0A 4AE2A 3I59B 4PT6A 1WW6A 2TUNA 4P14A 1BZWA 5APAA 4OCTA 5AFBA 1G9DA 4N7UA 4Q4W3 3V56A 1CESA 1JW6A 3PMSA 1QJU2 2YY1A 3I2GA 3IDAA 4LTAA 4QQLA 3NL1A 4RS5C 2QQLA 3LWCA 4BK5A 1GYKA 2IXJA 3VDBA 4BIOA 3MLJA 2R0FA 1JMUB 2PFWA 1D7PM 5CFDA 4YYOA 1MVQA 1QXJA 2LS6A 1X82A 4CP0A 3TEZA 1D4M2 1GQGA 2RR12 2OKXA 1CAWA 1DLCA 2OQ7A 4GJYA 4E9KA 4GZ9A 4LUKA 3CJIA 3OG2A 1MEC2 3WF1A 2XL7A 1SBFA 3QOPA 5DUXA 1LOGA 3CJXA 4M3CE 1V9U3 4CCMA 3WW4A 5BY5A 4BXFA 5CA6A 1JI6A 1GNYA 3W5NA 2ZACA 4JZRA 3OGVA 4LBJA 2WZEA 4PCRA 4YZ2A 3RZGA 2OPKA 2WZR2 3I2KA 5F9TA 3N7MA 4XJ9A 1M4WA 4IV1B 4XABA 4F7ZA 2DYCA 3ETQA 2XQRA 2VY0A 4MGKE 2ZHKA 4YVWA 4IEXA 2VZRA 1L3JA 3H9AA 1APNA 4AI0A 4YZ1A 3MHZA 3ETPA 1NAEA 4QX2A 3W9AA 2CWMA 2UY9A 3AMNA 4BM8A 2R041 1H8TA 4CA9A 1OFNA 1SHWB 4W6YA 4ES9A 2CGOA 3RYRA 1NA1C 5B2GB 2PHUA 4X6RB 3ZFGA 3O0VA 1QXRA 3ZFFA 2B9UA 3JU9A 2GH2A 3WW3A 4MG2A 1BMV1 3PVNA 1LEDA 2G9ZA 5J36A 3RZMA 2A70A 2VVEA 1EAH3 4WBBA 4RHV1 3MGUA 3DPRA 5A7QA 1OLRA 3VKLA 5CFDB 4XBLA 1GWLA 5JSRA 4PIZA 1CAWB 4H2AA 2VZVA 4LBQB 4I2OA 3EBRA 4URAA 1RJ7A 4Y22A 4FPYA 1LJ7A 2TNFA 3CJIB 2J1SA 1E5IA 2VBPA 3ATGA 3LEKA 1WWYA 1LOBA 3NNGA 3SH5A 4BXSV 4QAWA 1FPN2 1QJX3 5JSPA 1UX6A 2W52A 5LRSA 3A21A 4XDPA 1CVNA 1UZYA 2CAVA 3OB8A 4DXTA 2PAEA 1IS6A 1RUI2 2ZZJA 1AR93 1PO11 2WO2A 3H7YA 4CDXC 4Q26A 1QH7A 4OHZA 1F9KA 3T0DA 1Z7S1 5DDJ2 3TEWA 1HDKA 2PHFA 2DCYA 3H1WA 4YVSA 3V65A 1ZBA1 4QGLA 3D3AA 2HWF3 4AL9A 2ZOEB 4RR3C 1YQ6A 5JLVA 2B5HA 1OXCA 4FT8A 4QPGB 1H8TB 3QBQA 1DGWX 5LBCA 1S0EA 3PUHA 2D43A 3ZFGB 4QX3A 4XAEA 1YFUA 2VD7A 2H6CA 2JKBA 4B4PA 3LOBA 3KCXA 2RDQA 1LOAA 4NRQA 5CISA 3UKNA 1W6NA 3UKTA 2WR9A 3PNAA 2XGXA 3ZXEA 3E1F1 4BISA 5T5LA 1FNYA 3O1RA 2WNUC 4KU7A 4Q8KA 4P5YA 1HQLA 3OPWA 3DPRB 3VD4A 2XJPA 3ZSLA 3T2TA 1VBE1 1WMFA 2WNEA 1UIJA 2R1DA 3GJBA 3POEA 3W20A 5EXOA 1V6OA 1KJLA 1QHDA 2XHKA 2WQ4A 1C5IA 1IS3A 1H1IA 4ES8A 2WFF2 4QMAA 4Y22B 3I2IA 3H42B 3BU7A 3VZMA 4CE8A 2JKXA 5KR7A 3BI3A 1HXS1 3HEIA 3T09A 1H2MA 5ACA1 1QKQA 3J8F1 4YGEA 3JQXA 2YC4A 1PHMA 2ZGSA 5JXIA 5A70A 4CEWA 1ND3B 3QH7A 4R9CA 1Q8QA 1QGLA 5FXZA 4B1LA 4QGNA 2RG4A 4V2VA 4XFIA 3PL0A 5C3SA 4J1XA 4OHWA 2XLGA 4LKEA 2C9AA 3UETA 3VKOA 2AR6A 5FO8B 4YVSB 3I2OA 3ZSEA 1W8TA 4NIHA 3AP7A 5JI7A 2O1QA 4CPBD 2IVJA 2HEVF 5FMOS 3OCPA 4XHBA 1OPMA 1AVBA 4WZCA 4NIGA 1SFYA 1F4AA 1KITA 4RL7A 3GYDA 3HR9A 2ET1A 4XURA 4DEQA 2HKXA 4FXKB 2W47A 3T0AA 4WM7B 3APBA 1PIV2 1N47A 1W6NB 1GLHA 4FP2A 3NVCA 1OOPA 1LENA 2XUMA 1GV9A 4HVQA 2A71A 1AJKA 1LESA 4HN1A 2VAUA 3I2JA 4JDOA 4TXWA 3TYJA 2UWBA 4QKNA 1R092 5C7GA 1RHI3 2XONA 2GZWA 1AHSA 3MV01 4NPRA 2YUEA 3BTYA 3MV11 3T2PA 2I2SA 3JBG3 2QDNA 1DCSA 4EJRA 4JC1A 5A6YA 4QXCA 1HN1A 1DYOA 4C0HA 4M0HA 2WAAA 3J9SA 5KWRA 4Q2FA 1LU2A 3C2UA 1BYHA 2XXZA 4GMP0 5D8AA 2ILMA 1UZVA 2ENRA 2VNOA 4YFWA 4CEWB 5E1RA 4EZHA 3KGLA 2RM21 4LIVA 4MZUA 4IEOA 1EPWA 1DQ5A 1KGYA 1H4HA 2VNRA 3PUSA 3Q8BA 4K3UA 3AXDA 4NAMA 1TME1 4R4ZA 5A7SA 1LCLA 1JYIA 1QNWA 3T4HB 3E5XA 2HBUA 4P9LA 4DFSA 1RUNA 4ZY9A 4NMIA 4XW3A 1SDWA 4D7TA 5LEKA 1C8M3 3P3PA 1LTEA 3USSA 3ES1A 4SLIA 4UF0A 2W08A 3B02A 1AYM3 2QQUA 4AOCA 3NAPC 4CDQC 1E5RA 1XU1A 1ZNPA 5L9VA 4JVAA 1DQ2A 2PHRA 1DGWA 4GH4C 4XUNA 4AWDA 4OQ9A 1YYNA 3AZZA 4WV8A 4W6WA 2GNTA 3V0BB 1OOPB 2VTXJ 3BUCA 3K46A 1RUJ1 4K8RB 4IETA 1FNZA 1OQ1A 2VZ1A 5LRRA 2YU2A 4BPZA 1LULA 1Q5OA 5LBEA 2TEPA 3OGJA 3WF0A 1TZOA 2WC2A 1LHUA 4AQSA 3N7KA 1H9WA 2LALA 1EYBA 1XNDA 2FCUA 5AC91 1JOBA 1UX7A 4IUGA 1G9AA 1C1FA 5FTTC 1X7NA 5IATA 2ES3A 1PMHX 2RJKA 4AEKA 3AZWA 4IV3C 1PNGA 2B8MA 3AKRA 4LHNA 4RGAA 5FBJA 2OW4A 4KQ7A 1PZ8A 3ILFA 3KV4A 1DZRA 5D8AB 1W9WA 1K12A 2B42B 4E27A 3IPVB 1VBA3 1F8VA 5A3LA 5FY0A 3VBHC 2GH8A 2HWB3 4AW7A 4GA9A 4QQOA 4UT5A 4ZXEA 1WGPA 4BH9A 4TLGA 2JJ6A 5FYUA 1V00A 2GC1A 1BJQA 3KV5A 3PJQA 1W8OA 1O91A 4QKBA 3W5MA 1FAYA 4JRAA 3BALA 1NT0A 3HQXA 5FO7B 1POV3 1JZ2A 4UF0B 2B9VA 2EALA 2Y38A 3UK9A 3VUOA 1NLRA 2EICA 1C4RA 2BUKA 2UWCA 4QQHA 1OLMA 1NX9A 3ZSJA 5CEHA 4X6QB 1WD4A 1EY2A 4G9SB 3UJOA 5DMYA 2JB4A 4CDWC 5A1FA 1JODA 1AL0G 4CCDA 1W8FA 1GOHA 3PUQA 1RUH2 5FYTA 5B4XA 5L7OA 1MR5A 2PQSA 2R061 4GMP1 2Y6LA 3WQ1A 2OUHA 4PQ9A 4AHZA 2XVKA 3POFA 3R6SA 1R1A3 4S2FA 4KBZA 3CHXA 4ZU5A 2GALA 3I2DA 1O3RA 2J7MA 4NN0A 1PGL1 3EXUA 4CDUC 4CXYA 1Q8OA 1ZRIA 5FDBA 1PX4A 5JI9A 3R05A 5FY5A 2WYSA 3H8RA 1XOYA 1ONAA 1US3A 4N53C 1AJOA 2PHDA 5F3GA 3MIDA 1QQP1 2LW8A 5FLHA 4AAXA 4GD4A 1CONA 3C3VA 2PHLA 1T6BX 1CR7A 4EWAA 5FRAA 1YFWA 2G9FA 4FBFA 1DQ1A 2XMLA 4YG0A 5F2SA 2OT7A 4IV1C 1AL22 2W87A 2QQJA 3DXTA 3DF0A 3WNLA 2MPFA 3B3QE 2HWD2 4R9DA 5C4WC 1NYWA 1VRBA 2RDSA 3DYMA 2FCVA 1ZX5A 4RN5A 5FUNA 3Q8FA 1UD1A 2EIGA 4FPKA 1CWPA 1QOSA 2Y8KA 3H7JA 3NMBA 4FPHA 5TSWA 3O1OA 1OT5A 5GZGA 2HWE2 4V2WA 2A3XA 4PHZA 1YQCA 2HLEA 2YV8A 1RGSA 2VC9A 4QDQA 1ACCA 1ULGA 2OZJA 4Q0PA 3FLRA 3VDDA 3ZMOA 3BVCA 2XBO3 5GLTA 1CX1A 3NV4A 1WMEA 3B00A 2FMYA 5IK4A 3D8CA 2Z5WA 2EXIA 4HXCA 3KHCA 4DUXA 2IVIB 1RUF1 3MIBA 4TSVA 5L9BA 4FPOB 2K46A 2GC3A 5EP9A 4OI2A 4ZXKA 1CAVA 4Z82A 3S7EA 1JYTA 1ZRRA 3M4FA 4Q4X3 2P3YA 1XB9A 1ULCA 1STMA 4MGZE 1XBFA 2ERFA 3ASIA 3CJIC 3P3NA 4LO4B 4R4XA 3IAPA 5F7UA 2HBTA 4P08A 1TMF2 3FFZA 4XZUG 3WQBA 2ZEWA 3I4IA 1UYXA 1POQA 4QX7A 5JR2A 3MDPA 3U0ZA 5IW0A 3E6DA 1OF3A 5FYZA 4NAOA 1QDOA 4K20A 1QJX2 1UKRA 1XNCA 1ZBE3 1G7YA 4YVWC 3K4ZA 4N8MA 2W94A 5H9RA 3BTXA 3SLIA 3VKNA 3IIIA 4COVA 1VRH2 4XJAA 3HN3A 1H8TC 2QFEA 3CO2A 3M3EA 3ZM8A 1R1ZA 4WVZA 3CDZB 1W3XA 3ZFGC 4L92A 5IK7A 4JX0A 4CCNA 3KT7A 1FOD1 4QKFA 3ZFFC 2JDMA 2HWF2 4XVHA 1CIWA 2RMU3 4DRRA 5KC5A 1QOTA 5CYYA 4DXSA 2BDRA 3KZ4C 1J1TA 1LB2A 3O7OA 5IHRA 2V09A 3RYKA 1XYNA 2JICA 3K48A 1H6YA 4LK6A 3AYAA 4XJUA 4XF1A 1QWRA 4XIKA 1RUD1 1AR83 2Z42A 3OYWA 3ZR6A 1PZ7A 4X8PA 4CUAA 3LEGA 5ISLA 2RS33 2GC0A 3ZO0B 2XPJA 1LOFA 3ZPYA 3HT2A 1PK6A 4LLFA 1NA1B 4XPVA 3IDBB 4URTA 1S2KA 2BJSA 5B4NA 4A44A 1ENQA 2BEOA 4AQTA 3IAQA 2BYVE 3AL5A 2QBXA 2ARAA 4DQAA 1GU3A 3GHMA 4IEUA 2MEV1 2E32A 4UFMA 1ULOA 2R32A 1OURA 2H6BA 2WS91 3HWJA 4GAZA 2HWC1 3T1MA 1T2XA 2ZHNA 1IPSA 4Z92B 4MGSA 4GXLA 2LROA 1RVF1 3T2QA 1NE4A 2FDIA 4Q29A 4DY3A 2WT1A 1RUG2 2VM9A 3AJZA 3GBGA 4NHXA 2BTVC 1OVSA 4DMIA 4EWEA 4CCKA 4XQ4A 1RUI3 5IVVA 1HKDA 3DGTA 4AK3A 4LE3A 4MV2A 3SH4A 4MGTA 3ACIA 1N3QA 5DDJ3 3C7GA 2QTWB 4A42A 1Z78A 2JDKA 3CLPA 5I0RA 1XNKA 2JIJA 4ZKTB 1DDLA 1IOAA 2LRPA 4E4HA 4DY5A 2RS53 2X29A 4KU8A 3N36A 4AHXA 5HXMA 4L8QA 3O1SA 1H1AA 4LBOA 1S55A 2BGOA 2P6HA 3NNMA 1RJ8A 4FFIA 2DFBA 3VZLA 4AI2A 5C9AA 1UF2C 2WQZC 3M2MA 4XBNA 1T6GC 1IZ3A 5CADA 5DUWA 4CCOA 3J7MA 3FL7A 4OMCA 4QQ2A 3VLBB 4E2GA 3RZHA 1JOPA 1W0OA 4YSFA 1HRI1 3OYWB 1EV13 1OD5A 2DUOA 2XJUA 1DBNA 5T55A 4FP3A 4CU7A 2QQVA 4OZOA 1PK6B 5CNAA 5IVFA 2ZHLA 5C3PA 3B94A 3VL9A 4B4RA 3AP9A 4XF9A 3D82A 1YQ5A 3B93A 1RHI2 3I3MA 1MS4A 3POJA 1VBC3 1JXNA 5AVPA 1G9CA 3ON7A 4BQ2A 2VUJA 1Q8SA 2BBAA 4HKOA 4QB1A 2YFZA 4R9BA 5FZ7A 3OUJA 5GZEA 1AR72 3OOXA 1PO23 3ZSMA 4JQRA 3LEIA 2UY8A 3D6EA 5GZCA 1ND2A 4QM9A 5FZMA 3A0NA 2DUQA 1UOGA 1GZ9A 5LA9A 4LBNA 3O1MA 2Q8DA 5D2AA 1OKQA 3LIHA 3UYJA 1CJDA 1F31A 2BFUL 1OHFA 5JPMB 5DN2A 4EN9B 5FYSA 2UYBA 2V73A 4NRPA 1NCRA 3KLSA 4HVRA 3HQRA 3KHBA 3QD6A 3ZN6A 4D6QA 1ALYA 4KG0A 1C8M2 2G19A 1KQRA 1VP6A 3LAGA 4UW6A 1ZA4A 3B7MA 1UCXA 2P6CA 3AB0A 5EWSA 5A3UA 3SITA 1OC1A 1W6PB 1PVC2 1OPOA 1WCDJ 3OY8A 1NG0A 1PZ9A 3K77A 5C71A 4LQRA 3VBOA 1A78A 2ARCA 4LORA 4CCCA 3NAPA 3A4UA 2YC2A 4FOYA 3FMGA 5LW9A 4B1MA 3BU0A 3N9PA 1JS9A 4AG4A 3GZUC 1R093 3MIGA 3H1MA 4FOWA 4GH4A 4YM0A 5A3MA 2XJVA 3H3ZA 5LK7B 5D8AC 2VOKA 1FMD1 1V6JA 1W9YA 5C8WA 3JD71 5F8PA 4DO0A 1E5SA 2CGNA 3EQEA 4RGGA 1S2EA 4AQ2A 4H7LA 3W21A 3WP3A 1HRV2 3LSDA 2IWGB 2P3KA 1ND2B 3NV2A 3IB3A 2RJ2A 4S2HA 4AI3A 1MQTC 1VBA2 4LBLA 3K75B 1ZVFA 5LA2A 3T3YA 4BMEA 5GLZA 5F1RA 2VUCA 2F6BA 4P9JA 2OXBA 4IDZA 4QT6A 5BNNC 4P9YA 1V0AA 1XE8A 1C1LA 3DN7A 2QQIA 3NQHA 4YFZA 4CUCA 1NCRB 2QQWA 2P1BA 4B3NA 2VBDA 3S5AA 4LO6B 1QJY2 3ZN6B 1RMU3 3OPTA 3GBWA 5CVRA 1KDKA 2GC2A 4WVVA 2J42A 4O9GA 1XXNA 1LGCA 3TNQA 3UGGA 2JE9A 2D7FA 5T54A 4A41A 3OY8B 4XQWA 1CQ9A 2UU8A 1O8SA 1PGW2 2I74A 2FQPA 1OVPA 3VBOB 5LEJA 5FPZA 3S5QA 3NAPB 2YZ4A 3HAGA 1G6NA 3WINE 2YROA 4HL0A 3K3NA 4GH4B 3RPQA 3POIA 2W92A 1QJFA 1VIWB 4MSVA 4LKSA 1OUXA 5I8YA 5ABJC 4GJZA 4ISRA 2JIGA 2EXHA 3VKFC 4AEDA 1V6IA 3A22A 4COUA 1OFSA 4QX5A 3G7DA 5EQUA 2OQ6A 5FYBA 2WZPP 4RFRB 3AP6A 4ARXA 1MZFA 2VMDA 4C0BA 1PNFA 2EA7A 4Y5SA 3A7QA 3ZXJA 3VDCA 4HPKA 2RE9A 3WDUA 2VZTA 5JIUA 1PM4A 2AUYA 4RSUA 1Q8VA 4NHLA 4V1PA 4O65A 1JHJA 3MF6A 3N7JA 2Y60A 1HX6A 1UYYA 4XFBA 5DQ0A 1UZ0A 1AR61 1YI7A 4M3CF 2D6OX 4N53A 2WAOA 4GMP3 3AMMA 4FXGB 5FV3A 4COYA 4XCAA 3VKMA 2YXSA 4DS0A 1JZ7A 4CRQA 1H30A 5F2WA 3PUIA 4QKDA 4Q4V3 2QNKA 1ULDA 5F32A 1X50A 4Q1RA 2WNOA 4BOWA 5L7OC 1JUIA 5CKQA 1I1EA 3WR0A 3KVBA 1MZEA 3MFAA 1H4GA 2WN2A 4Q0VA 1V6LA 3ZYGA 5JZGA 4YW5A 3TN93 4JKKA 4YW7A 4QDSA 1LU1A 1S4CA 4ISQA 5KXEA 1UY4A 3PU3A 3QACA 4LHKA 3ZOIA 1RUH3 5FZOB 5LA1A 2VMFA 1NY71 1XJAA 2BP6A 2WRAA 2EIBA 5K0UA 2AH2A 2Z79A 3CU7A 4GB31 2FDFA 3ZKUA 4I30A 4XETA 3KVAA 1BEV1 1LGBA 1COV1 1YQ2A 2V4AA 4Q4X2 3W59A 4CDWB 5A7PA 4OLLA 4AEDB 2ARXA 3M8LA 3WNOA 5FZIA 2W2IA 1UXXX 4IQPA 3ST7A 4W65A 3PTRB 3U78A 5KBFA 1GR3A 1UYZA 4I02A 3THTA 4HKWA 1WCUA 4HPKB 3BOPA 4NVPA 3T30A 5FR3A 1VBB1 1VE0A 3WX5A 2AZ5A 4CDUB 4Q8LA 1AL23 4AFMA 3SKVA 4LPLA 2PXJA 1ENXA 4N53B 5E88A 4IW3A 4DNYA 1ZBE2 2PLV1 2HWD3 4KI5M 2O8QA 4H55A 2RV9A 2GDFA 3VDDC 5IFTA 5FPVA 2A5ZA 1BMV2 2UURA 2JENA 2IFWA 3PDQA 4Y26A 5C8CA 3OD4A 2A3WA 2HWE3 1YUDA 3ACHA 4SBVA 1REFA 1ZREA 3GXUA 3L2HA 3DXUA 4Q0QA 4RHV2 5C4WB 3AKTA 5DUUA 2RMU2 3SCGA 5IAVA 5IVYA 5EPAA 2ZAHA 1HLCA 4L99A 3JUUA 4XYXA 2WO1A 4OI0A 1IS5A 1QJU1 1ASJ1 2RVAA 4XEZA 1VBD1 2BVVA 1W2OA 5K0UB 2XVGA 1NOVA 4PDWC 2A6YA 1AR82 3I2HA 2RS32 2ADEA 1D4M1 1UL9A 2J1TA 1PO12 2RR11 3B01A 5KHIA 2CL2A 2Y34A 1TMF3 1Z7S2 4HK8A 1LKNA 5F3IA 1MEC1 5H9PA 5FY4A 2DF7A 1RTVA 1OD3A 2XKOA 2ZMNA 3BB6A 2IXLA 4FTEA 5LBBA 1A8MA 5L36A 3POGA 5K7PA 5IVJA 1O4ZA 2WZR1 3FLPA 5C5TA 2W46A 2TBVA 5FCCA 2NP0A 4FTBA 1LAJA 1Y4WA 3B9CA 1VRH3 5C8CB 4XE9A 3IZOA 1S0GA 2BQPA 2XH6A 4P00B 4QU2A 4R52A 1BBT1 1WUVA 4YVWB 2Z2SB 5FYMA 4B8EA 4ASMB 1C8NA 1XC6A 4KWUA 1O3QA 3WG4A 2RS52 1DIWA 4TWTA 3LGRA 5M0TA 3Q8AA 1RYYA 4XF3A 2FZ2A 2O8OA 3GZTB 4UYBA 4K1YA 3LFMA 1LOFC 3ZYJB 1PK6C 2E7TA 1SCRA 2RDNA 4MOAA 3ZFFB 3EHKA 3DYPA 1Q8PA 3RMXA 1WMXA 4EZ4A 4IL7A 2VQTA 1DHKB 3RI8A 3P6BA 4E8DA 1VB4A 4Y5TA 1EV12 2ZZQA 3JQWA 3KMHA 1C5HA 1JHNA 1SBEA 4ZONA 5I0TA 4AEJA 1KS4A 2X10A 3C8XA 4E8CA 1IPKA 2W1QA 5FP4A 4BDVB 4HOOA 4XOGA 5A1LA 3CIHA 4YPJA 1VBC2 4LOSA 5HPOA 3CEWA 1N1TA 1W8UA 2VUDA 1FPN1 2KM2A 3V0AA 2ATFA 2ZX4A 4Q4Y3 4BMBA 1XE0A 2P3JA 4FFGA 4AYUA 4JTNA 2DVDA 4Q1PA 5FZGA 1W3VA 4XHXA 5L73A 1JH5A 2CU5A 1PO22 4OFGA 3RWKX 1RUG3 3AXEA 3CZJA 1G9FA 2RJLA 4D69A 4XTMA 5A7NA 5JMCA 1AUYA 2VR4A 2W9XA 2WUHA 2DDUA 5DAVA 5ANQA 1C3HA 1OA4A 4ORFA 4LULA 2E6VA 5IVCA 2PHWA 1MZ5A 1WCKA 2ZEZA 2PTMA 3K2OA 1KFXL 3NNLA 4QHOA 5C9AC 3CL1A 1BK1A 1ULEA 2O14A 3NKTA 1MACA 3E5QA 4CXXA 2XUEA 3L2YA 4META 5JIAA 4CEYA 5EFUA 4NJ4A 4AFCA 4FPGA 3RVHA 4R9AA 3OGSA 1C57A 3FHAA 1YI9A 4YNIA 4A2UA 2B7YA 1RINA 2ZMLA 4FI9A 4OHVA 3URFA 3DKWA 1WA4A 3LF7A 4XACA 5H9SA 2VMEA 1R083 3DEMA 4J1WA 2Q8EA 4Z2WA 3R4DB 4QB6A 2K2SA 1DZTA 4JKLA 2ZJCA 2YBPA 1UPSA 2XB6C 4HKLA 2OVUA 1GWMA 4FO9A 2YPJA 5CKNA 3AP5A 4YW3A 2RM22 2WQ8A 4AI9A 3WDYA 4NWWA 3LZZA 3ZXKA 5J3UA 2A7AA 2W1SA 2D93A 3WT3A 5JWPA 1ND2C 1QDCA 1W05A 1RUC3 3D4KA 1X36A 4NIDA 4JDNA 3O1TA 2EVXA 2JG8A 5IYYA 5FMOL 1CZSA 1GOFA 1AR73 5FZ8A 4K7JA 4DXRA 4CU6A 1L7RA 3WVJA 1CGPA 1QJEA 2VZQA 3WEZA 1NCRC 3I3BA 3ZDVA 4UFKA 3LA7A 5IVBA 3NJXA 4Y5Z0 5A7OA 4A7YA 1MS3A 5FZDA 4BQXA 5F37A 1OKOA 3VHOA 3NJVA 1NXMA 4B4QA 1RUJ2 2FHRA 4BYYA 1VMHA 2BNNA 3OGRA 4A6OA 2A3YA 1BCXA 4CEYB 5HV0A 2EIEA 1MQTA 2A6VA 2ZGQA 1UY1A 4L0PA 2GMMA 1RMU2 3T2OA 3WDVA 3H8OA 4E4DX 2ZABA 4CXWA 1DLLA 2YBKA 2LTNA 3WNMA 5AC92 5BNNA 4Y1UA 3VBOC 1MS9A 2BU9A 4RFT0 1PIV1 4EN6B 2PA7A 4L9BA 2BNOA 2WL1A 3X29B 4BB3A 3PU8A 3LIGA 4YG6A 1PVC3 1ZYBA 2J1AA 3OSDA 4LITA 3AYEA 4ASLA 2ZKLA 3U11A 1Z0HA 3MUZ1 2Y6JA 2ZTNA 3N3HA 4CU9A 4QHZA 1S0JA 4AHYA 3PLQA 3GALA 4EN7B 1QJZA 3UKVA 4AVVA 4CP1A 4AVCA 4RQPC 3FN9A 4MGYE 3NKGA 4RD7A 4Y1VA 2MNGA 3AZVA 2K9ZA 1QOOA 3VBFA 1LRHA 3O5SA 1S0IA 2YG0A 2ZS6B 3ZYPA 1RUE1 1TVGA 2BOIA 2QCSB 3D0SA 1S0DA 3HMYA 3E6CC 1MS1A 2E7QA 2VXRA 3ZN4A 1HRV3 1VR3A 3PVBB 3ZSKA 4NO4A 4NUBA 2ZA9A 2JWPA 3DECA 5ABJA 4D3WA 2VW1A 1GBGA 4QX8A 4TZDA 4I09A 1GNHA 1YFXA 2A6ZA 4PQQA 2RS11 4XQDA 5I0UA 2C4XA 2PMWB 1ZZCA 3EMRA 4K1ZA 3BN6A 2YYOA 1S1AA 2MHFA 3J7HA 1QJY3 4GKXA 2ZGPA 1MQTB 1KD7A 3WUCA 1XE7A 1W04A 1AYN1 2XQXA 2XJTA 2E53A 1UKGA 2QQKA 2Z69A 3PTYA 4Q4V2 4XUTA 4MH0E 2PN5A 4Y4YA 4EROA 2E31A 3AC0A 5HI0A 3UESA 3NW4A 1IS4A 4DB5A 5DXDA 2R071 1FV3A 1U0AA 4XUOA 1FV2A 4YM1A 5FXWA 1AF9A 1GKBA 3WG2A 3TN92 3FC0A 4JGYA 5BNOA 3RJRA 5ERLA 4AEDC 4YG3A 5K8SA 4UAPA 3OBRA 2GSYA 5GZFA 4XCBA 4BQYA 3AZYA 1RB8G 1QEXA 3RSJA 1H1MA 1VAMA 3FE5A 4X8NA 5FWEA 2IC1A 5D1IA 5A6XA 4UFIA 2QQMA 3T1LA 5KXBA 3B5LB 1XSRA 2QZ2A 4H7MA 2D6PA 4UXAA 5ABJB 4WM8A 4Y20A 2D5HA 4JKMA 1GZCA 3WW2A 3V64A 2JB8A 2JDHA 2JX9A 5J96B 5FWJA 5IK8A 2DVGA 3ACGA 5A6QA 2VH9A 3I7DA 1XYPA 3IMMA 3AK0A 3IMNA 4P9WA 1RUF2 4NRMA 5EHDA 3M3CA 4BCUA 3KQRA 2XDVA 3JZVA 5FZEA 3WNKA 2YB7A 3ZPOA 4ZZ5A 4KWLA 1K5JA 2VBBA 4CCJA 3O0XA 1W8HA 4XXAA 5JZGC 4FPFA 4FQZA 2X09A 4G3YC 4B29A 5LY1A 1RUOA 4UW3A 5CG8A 2DTYA 2BOJA 5SV8A 2BRTA 2VZSA 5K0UC 3VGIA 3PIJA 4BK4A 4JDMA 3K4AA 2NMOA 2LM3A 4LLOA 4XMIA 4JGYB 3ZVXA 2D5FA 4Q4W1 5BNOB 1XYOA 4AFAA 5L7OB 4YW2A 2V5YA 3H50A 4U2AA 3S30A 4W50A 2FZ1A 3DV8A 5A3NA 2JECA 2C1FA 1CZVA 2W95A 3LDRA 4P5HA 1YXWA 3RJ2X 1OSGA 2ZX0A 5D21A 2XLFA 1LNSA 3LA3A 2HEWF 3NV3A 5BPXA 3WDTA 5A32A 1XU2A 2CWSA 3UGFA 3NJZA 1WCSA 4PDWA 3HOBA 3ZR5A 4AI1A 1RXGA 2VNGA 2GMEA 4WM8B 4Y20B 5DG1A 2O0OA 1FOD2 1WKYA 3SHRA 3SMHA 4AVAA 5JXGA 1GNZA 1V9U1 3ACLA 5EJ1B 5C8CC 1E5HA 4TTGA 1JOJA 4P02B 2R043 3AZXA 2OA2A 3HNYM 5FZFA 1CIYA 1ASJ3 3WXPA 1IKQA 4ITCA 4YLZA 4XFHA 3NWKA 1ZZ7A 1O3TA 1RUD2 3WP5A 2V4VA 3O1PA 1JUHA 3WHTA 2VQ0A 3P1IA 2IXCA 2WSVA 4RHV3 4GWNA 3MIHA 3VDDB 1AXKA 3GNEA 3VZJA 4BLIA 5T5OA 3BOWA 4LA2A 2DFCA 1GFF2 4WVMA 2D6MA 1SFPA 4MO3M 5KXDA 3VL8A 3AFGA 2UYAA 1WD3A 1WLWA 4AI8A 1YO8A 2F4LA 4YZ4A 5FREA 2HWC2 4Q27A 4QU1A 1TNRA 5DZFA 4LO7A 3WOGA 4DUVA 1RVF2 5AVAA 2WN3A 1CAVB 1EAH1 2EAAA 4UBGA 1REDA 1PMIA 3MBWA 3BPSA 5FYVA 1U12A 5JAXA 4NR1A 3IT8A 1FI2A 1ODMA 4Y1YA 5JXJA 1PO13 3I54A 4FAGA 1W6OA 5A32B 2WIIB 2VQUA 3MW3A 4OQ8A 1OBNA 4R8HA 1Z7S3 1ZM1A 4PDWB 3CNAA 2VOTA 4FPJA 5EZWA 2E33A 1ZBA3 2XKPA 1UY2A 4UI9L 3O1VA 1N1YA 1Y43B 3FUOA 1QJX1 4LOTA 3SXWA 2VNVA 4NROA 4Q4Y2 3NV1A 5BNPC 3IDCB 1LOEA 3OBAA 1JZ3A 3FFQA 1WLTA 1AR91 1X33A 3TNPB 2ZHMA 1QF3A 1LOCA 1SLTA 2VPVA 3DKQA 4CCEA 2R1BA 4I3GA 2B39A 2OIIA 3GCWA 2J22A 1KS5A 1HRI2 1UOBA 2Q4SA 2HWF1 5A3TA 4DOUA 3GZEA 5FMCA 4PLNA 5JVVA 3F2ZA 3N9QA 1VBE3 3ZN5A 5JMOA 1ZRFA 1X9PA 2Q1MA 5JR7B 5DUVA 3M1HA 1F35A 2EF6A 3R0RA 3QCWA 1V70A 4IE6A 1NQJA 2CTVA 3U1XA 4AR2A 4GQ7A 1R082 3ALQA 1HXS3 1W99A 1LEMA 5ANNA 5ACA3 3FBYA 2ZGNA 4YGBA 5A7WA 2W3JA 3J8F3 2VUAA 4HZFA 1GOGA 1QXPA 4PIYA 5AFEA 2VTFA 2J1UA 4HK9A 3M3OA 3N4MA 5DAXA 3WW1A 1W39A 5C33A 1MVEA 5I93A 5F3CA 5JSOA 2YGLA 3GM8A 2NQYA 5LWBA 3AFKA 1XPWA 2Y6KA 3E5UA 3U07A 3MF9A 2CV6A 4Q5OA 1RUC2 2BV4A 5FIXA 3DCQA 5BYNA 3MLLA 1D2QA 2AREA 4ZU7A 3H1YA 3OEAA 3FX3A 4IE4A 4MADA 1JZ5A 4ZU4A 1J59A 4YGDA 4LNVA 5H9QA 4LEJA 3PVEA 1IQDC 1WZXA 2WA3A 2W1WA 4NPMA 1W06A 4KGGA 3FBMA 3RDIA 2QZ3A 4CEYC 2WA4A 4CZSA 1W6QA 2AC1A 2WABA 3RWNA 4AHWA 1J58A 2L9LA 2ZKNA 4A7KA 2ZGOA 4XILA 4C91A 2CNAA 3W58A 1JZ6A 3GCXA 3K4DA 5FY8A 3POYA 3H8XA 4YM2A 3KF5A 5JXHA 2XOMA 3TEXA 4EWDA 1J83A 1YQ8A 1I9RA 1UU5A 2Q0AA 5F6KA 5FLIA 3IKWA 3FHIB 4LO8A 3Q8CA 1NE6A 2SBAA 5FK7A 2Q5TA 5C9AB 2A73B 1V6MA 3SEEA 5KHKA 1CPMA 1N3PA 4W4ZA 5J1XA 5FZ0A 5I0DA 3RI9A 3KF3A 3LQCA 4CTEA 3LKJA 5FYIA 1REEA 5A7WB 3A23A 5FLJA 2ZPXA 1SLBA 1POV0 1ZRDA 4ZZ8A 2W91A 2WO7A 2RM23 1RHI1 2D3RA 5FJKA 4FTSA 2JG8C 3MO4A 1YHFA 1TME3 3JBG1 4JGZC 4XJWA 5CB7A 4E2QA 4Z8BA 1LHOA 3BKZA 5FXXA 2WO3A 3ZXLA 4BQWA 5F5CA 2VO5A 2Y0IA 2DURA 4B7EA 1F15A 3TEYA 4IERA 1U5ZA 4HG6B 1H6XA 1DGRA 4ZS2A 2UWAA 5FFOC 1MS5A 4N43A 4BQ1A 3N9MA 3N35A 5T52A 4RQPA 3LA2A 4A45A 2IZWA 2OUJA 1W6QB 4OMDA 2DU0A 3M3QA 2ZX1A 4TLFA 4AQ6A 4Y4RA 1HW5A 2KR2A 2WYFA 4GWIA 1RUJ3 3RS6A 2XWBB 1C8M1 1KFUL 1DYPA 2C24A 1XQNA 2C0ZA 2DUPA 3T0BA 5FPXA 1AYM1 1H9PA 3ZIWA
chains in the Genus database with same CATH topology
5AC93 5KXCA 3WCSA 3JB4C 1O7FA 3NSTA 3AKSA 1VAVA 1VAKA 2WWSA 3TWIA 4AEMA 3FJSA 1B09A 1EP0A 5SV5A 5J48A 3VBUA 3ZX7A 3GF6A 2YMZA 4ONUA 1YFYA 5BNQA 3VBFC 4JAAA 1RC6A 1OQEA 3IDEA 2KA3A 1QH6A 3AP4A 3LB9A 4XF0A 5DZGA 4P9GA 2XJQA 3PJYA 1YNAA 2ETEA 1H2LA 4N43B 1D2SA 2ZGTA 1VBA1 4HFSA 4RQPB 1I3HA 1JYCA 1PGSA 2HWB1 2XVLA 3AMPA 4IESA 1H2NA 1I5ZA 1LHWA 3M3IA 5CAZA 3WUDA 1KDMA 5GJ6A 2DVAA 1B35A 3KB5A 1LHNA 1WLCA 1POV1 2R063 1SCSA 1YCIA 3Q9OA 4K21A 4GB32 1ZZBA 3IIAA 3MLKA 5J7MA 4JGYC 1BEV2 1LR5A 1MS8A 5BNOC 1S0BA 1JTZX 1NCQA 3UJQA 3MFCA 1PGW1 4YW4A 2W68A 3VBUB 2VECA 1V6KA 3ZXGA 2A75A 1QQP3 4C1WA 3OBTA 1M06G 4XTPA 3UV9A 2XL9A 3UL2A 2ARBA 3ZYRA 1R1A1 1CN1A 1UMZA 4K9SA 2D44A 4EN8B 1AX0A 1MS0A 1G9BA 2PLV2 4WM8C 3PVOA 2E9QA 2WSUA 3VBSA 3ELNA 1YWKA 1U5IA 4L11A 1NZCA 4FPEA 2LUWA 5DZEA 4BHPA 4OHXA 5HBAA 4AGVA 3MW4A 3POSA 5I0SA 2E51A 2R042 2JG9A 5EJ3A 1B35B 1HV0A 4DPNA 1RUF3 4P9IA 5HXVA 1ASJ2 1VBD2 1TEIA 2IXIA 3D0JA 4IEYA 3KT1A 2XBO1 4KWKA 1NCQB 2VMGA 2ET7A 4I01A 2N7GA 3ZXFA 2BBVA 5GZDA 3O12A 4LBQA 3WZ1A 3BPZA 1X8EA 2NMNA 5JZGB 3WDXA 4KL1A 4MGIE 5BV6A 3E6BA 5E89A 4EN0A 1U5YA 2GN7A 4HSJA 4IEVA 3J26N 2EXKA 3WNXA 3JB8A 4Q4X1 1BXHA 4MVTA 3KS7A 3KGZA 2B46X 3KT4A 4L97A 1IGOA 4FOQA 1WW7A 2ZBJA 4NHMA 1A3KA 3VBSB 1EPZA 3R4SA 1SLIA 2I07B 2DCZA 4OHYA 1BBT2 4QPGA 3S7IA 3INAA 1FOD3 1ZBA2 4MLOA 4COZA 3RG0A 2H0BA 4XJZA 4D94A 3ZMNA 4AGGA 4XXPA 2CGPA 1FYUA 1N1SA 1ZBE1 3IN9A 1ZZ9A 4GULA 2JG9B 4PLOA 2JEMA 3R4UA 4JV4A 4GWMA 1RUD3 4MXVA 5BNPA 3OJBA 4FPLA 5E16A 1YIPA 3VN4A 2VVFA 2VULA 3THPA 2RMU1 3ZYIB 2P34A 2WT0A 4HMZA 1TNFA 4DINB 1TE1B 3NO8A 3SCHA 1VBE2 3WDWA 5FOJB 1S0CA 2JDZA 2MEV3 4N7IA 3RZZA 2WS93 2QKDA 1JBCA 2HWC3 4N90A 3MIFA 1CD3G 1AR81 4AVTA 1RVF3 1ND3A 1HXS2 2RS31 1J3QA 1G86A 5ACA2 3J8F2 2B45X 3DL3A 4WVWA 5L19A 2EXJA 1O4TA 3N7LA 1DG6A 2WINB 4HVOA 3H3UA 2PYTA 4PBPA 3S6PA 3WP4A 2D3SA 1UAIA 2NLRA 2WNVA 1WMDA 1FXZA 4HT1T 3SISA 4BLJA 1K5MA 4H3WA 4YRDA 1WW4A 1O5LA 4WM7A 2XJRA 4IXLA 5CFCA 1BVVA 1RUI1 3RRDA 4IEPA 5GALA 3B69A 2PQQA 5DDJ1 4PLMA 4IEWA 4IEQA 1HRI3 5BNPB 1F2NA 2ZGKA 3D5OA 1OMIA 2NZ9A 4QPIC 4YZ5A 4QM8A 2BWAA 1C28A 2RS51 2KXLA 4IEZA 3GBFA 2BWCA 2XWJB 1CAUA 4JTOA 1E57A 4Q0SA 1NQDA 1GSLA 1V6NA 5J09A 1TQ5A 1UW8A 1EV11 2X5IA 3J4UH 1SBDA 2DV9A 1SQ4A 3GZAA 4HSLA 4J6GA 3LCPA 4L2NA 4AVSA 1Y3TA 5GLUA 5CBLA 3TOJA 1VBC1 4OZXA 3BIWE 2R49A 3BTAA 5KHJA 2WFF1 1TME2 2WLQA 2WNVB 2BPA2 1J3RA 2QQPA 1PO21 3V0AB 3IBMA 4K8FA 1K5MB 4UBHA 4LBKA 1Q43A 3BCWA 1DF0A 5CFCB 4JGZA 4D7YA 5FAXA 4C90A 4PJYA 2QE3A 3V0BA 5EYYA 2PHXA 5JOXA 5JPNB 5JDBA 2VQAA 4YM3A 5GLVA 4HANA 4C1XA 4OULA 4N9IA 3AJYA 1GICA 4LBQD 2WFPA 3M7AA 1CAUB 3ZXDA 2FBEA 4FQ4A 4YZ3A 2EAKA 4D7SA 3RNSA 1FMD3 3SCFA 5F6LB 3JD73 3AYCA 1RUE2 2VOWA 2YHJA 2X5IB 3IPVA 2HEYF 1CPNA 2G4IA 4F8AA 2IXKA 1A8DA 3DUIA 1AXZA 1R091 1IHMA 3VHPA 2R0HA 3CF6E 4DXZA 2YC0A 2X8KA 4N43C 2RS12 4H14A 4K6BA 3VV1A 3HN1A 4KGQA 1VJ2A 5LK5A 3ZXAC 2QUOA 2YGMA 3WY6A 3WD5A 1AYN2 2JG8B 4DZGA 5T3NA 1I6XA 2HYKA 2VW2A 2W39A 4JGZB 5JOYA 3SH3A 4CYDA 1Q56A 4UW4A 5J98B 4I3PA 4LBMA 2R072 4COWA 3MICA 1RMU1 1KXGA 4XIOA 1F5JA 2D6LX 3BODA 3QH6A 2P17A 2R062 2Y0OA 4NHKA 3VBUC 3VBRA 4LUMA 4LO5B 1DZQA 1O4YA 4Y1ZA 3A0KA 3QLQA 2R16A 1UU6A 1VB2A 2D6NA 2X53S 3O0WA 1PGL2 1ZZ8A 3MPBA 2WT2A 1D4VB 2XG3A 4FOVA 1H2KA 4DRVA 4QD2A 1QQP2 2D97A 2YDEA 2DVBA 1OI6A 5CIRA 4FPCA 4XFGA 1AR63 2NN8A 4FVVA 3VBFB 2IFRA 3TAYA 5I8TA 4AGRA 4U36A 2ZGUA 1DFQA 2C5DA 3M70A 5GKAC 1B35C 2GAUA 4PF5A 1N1VA 1VALA 2R6QA 5J37A 5KHGA 5IK5A 4CP2A 4QQPA 4MX3A 3AMHA 3ZFEA 2PAKA 2A6WA 2VMIA 3ZDSA 4Q4W2 1NCQC 2OYZA 1J3PA 3RQ0A 2Q30A 1Q3EA 4Q4V1 2VU9A 3VBRB 3OTFA 4YGCA 4GB33 4M3CA 3FLTA 3PHMA 1BEV3 1COV3 4QGMA 2E7AA 3WCRA 2I45A 4RS5A 4I0WB 3TN91 2DTWA 4AXOA 3U10A 2PELA 1RUH1 2Q1ZB 4I0BA 4KG8A 3WQ0A 1IPJA 1VBB3 1V9U2 2H0VA 3HIFA 1YIFA 2Q8OA 3VBSC 2AENA 1URXA 4OVEA 2P3IA 1LGNA 5KHHA 3AMQA 2PLV3 1Y7BA 3I8TA 4JCKA 1RIRA 5GM0A 4MUVA 2QVSB 3JCIA 3WV6A 4E4ZA 2WJSA 3ROUA 4HETA 1UIKA 3ECQA 4M01A 1KRIA 4HN0A 3MI8A 2JG9C 1WBFA 1QNYA 5EV7A 3ES4A 1AL21 4OUMA 1AX2A 3VHNA 1SLLA 4NOTA 2BNMA 5E8AA 3ZFEB 2HWD1 3RYPA 4FSJA 5CFDC 4AFBA 1QJU3 2DCJA 3ME2A 4QHBA 1VBD3 2HWE1 1QMJA 1SEFA 3USUA 2ZGRA 4XZPA 2E63A 4M3CB 1EAH2 1NA1A 2XJSA 5BUVA 3TBDA 5JOZA 1D4M3 2RR13 2ZGMA 2GN3A 5I91A 4RS5B 3WLUA 1SMVA 1AX1A 1PVXA 1MEC3 2VG9A 2BGCA 2MEV2 5T5JA 2WS92 1H0BA 1NLSA 5A33A 2ZMKA 4AG4A 2GMPA 2PAMA 4OI1A 3VHRA 2VOXA 2WZR3 1S2BA 1AR92 1WW5A 4QPGC 4A7ZA 3KD4A 1CJPA 1TMF1 3AX4A 2F4PA 1X8MA 2JXAA 2VVDA 3EJKA 4Z1VA 1BBT3 4KBBA 1YJKA 4CDXA 2D6KA 3ILRA 2SLIA 3KCYA 4B7KA 1DQ6A 5I8SA 1OQDA 3MPPG 1U5XA 3TRSB 3DPRC 1SFNA 4RR3A 2DWRA 3HT1A 4BE3A 1VRH1 5HCAA 4Y24A 3ILNA 3IM0A 3USUB 1ULFA 4Y1XA 5CU1A 4I0AA 2NPIA 5KC6A 2Y26A 2VMHA 1NXD1 1ND3C 2DCKA 2WLPA 3U4XA 1HQWA 4WVMB 2WNUA 3OF1A 1O3SA 1IKPA 5IT6A 4QPIA 1FPN3 1QU0A 4K40A 1CX4A 4W6XA 4EV0A 4HBNA 1SLCA 4YVSC 3WG1A 1YLLA 5A33B 3OGGA 1Y9QA 2ZCWA 1RITA 3MEPA 3FUQA 4AFDA 2WNVC 2ZGLA 4HLTA 2IXHA 1W6OB 1GANA 1DYKA 1K5MC 4AVBA 3EO6A 4Q0UA 4WM7C 4BIFA 5CFCC 4CDXB 4F83A 4Q4Y1 1LODA 3MZHA 1WLDA 2GNMA 1OLQA 1WBLA 4ATFA 1RUG1 2RHPA 3K51A 2NM1A 2JE7A 2D40A 3E97A 3RMYA 4S2GA 3AYDA 3LOIA 1W6PA 4RR3B 1IQAA 1D0GA 1UPIA 2BFUS 3MIEA 4GKYA 1DU3D 2K0GA 1W2UA 1GZWA 4KWJA 4XDQA 4LA3A 1CAXA 3FZ3A 4QPYA 1A6CA 1ENRA 3ZIXA 1XNBA 2W0XA 4A3XA 2JD4A 1XRUA 2X5IC 4CEWC 4LR4A 2WFF3 3JBG2 3KSCA 4E2SA 2WNUB 4MXWA 3WHUA 1R081 1F5FA 4QPIB 1FMD2 2D3PA 3KM5A 3JD72 2GNDA 4NWVA 3GHNA 2CYFA 1OA3A 1SACA 1DQ4A 2GU9A 5EYXA 4ATEA 1PM7A 1YJLA 4JRLA 2ZX3A 2AGSA 2BW8A 1AXYA 3SNMA 1S0FA 2DCTA 4E4SA 4S2DA 1HIXA 2PHTA 1RUC1 4FAHA 1JN2P 2CY6A 1DGRN 1OOPC 1AR71 1AYM2 4Z07A 5FOBB 4XF4A 1HV1A 4M00A 4BA6A 4AF9A 5JOWA 2R30A 3HD8B 1PIV3 4OI4A 4KNCA 4O9EA 5GLWA 1H8VA 5IUQA 1MZ6A 1D0HA 1GZWB 2ZX2A 5T5PA 4OUSA 4CDQA 1FX5A 3ENRA 1CAXB 2CAUA 1GQHA 4YW1A 3WP6A 1HQNA 5FO9B 4LHLA 4LT5A 4XBQA 1YRZA 4INDA 4G4FA 5HCFA 1ENSA 3WQ7A 2VGDA 3OPZA 1BKZA 3H8UA 3PMEA 4MXWB 4XFFA 3AKQA 4XJ8A 3VZKA 1RL3A 2QJVA 2G9GA 3HBZA 1PVC1 1O5UA 1ZZ6A 3S0MA 1RUE3 5CG9A 4KH9A 2ZAAA 3G6JB 1SLAA 5JCTA 5FQ0A 1QY4A 4XFCA 1G8WA 2HWB2 4IV3A 4QXKA 1AZDA 2WKKA 3IWZA 4RA0A 4UW5A 4FCAA 2RS13 2P2KA 4LE4A 1AR62 3FWEA 5C6CA 4P9XA 3VBHA 4MYEA 1FATA 2NYYA 1HRV1 4TYSA 1AYN3 1UU4A 2DVFA 1J1LA 1DGLA 3VZNA 2HJIA 2P37A 1W6MA 3AKPA 2FMDA 3VBRC 5F5QA 2R073 1W0PA 3I59A 1KJRA 4CDQB 3MW2A 5BXXA 3WG3A 1QJY1 2A6XA 1N3OA 1BQPA 2OZ6A 3AM2A 1R1A2 1NY72 1OA2A 1LECA 3TB0A 4CDWA 4F3JA 1ZRCA 5T50A 2XLAA 4WZFA 4XFAA 1COV2 5HCBA 4M0NA 2DU1A 4PBOA 4YARA 2AYHA 5FQ0B 4CDUA 3L9JT 4IV3B 3H0OA 1FT9A 4GALA 1VBB2 2BVBA 3MYXA 1BVP1 1LHVA 1UZZA 3VBHB 2GNBA 1VLNA 2D98A 2VOVA 2VW0A 2QDRA 3KCCA 4IV1A 4GIQA 4XMAA 5DG2A 4N9HA 3B9IA 3VZOA 3ZFEC 5K9YA 1UN1A 5C4WA 2XBO2 5FBZA 3O14A 3LSEA 3POWA 1W6MB 4BWOA 4BZ4A 3OD0A 4PIXA 1DQ0A 4AE2A 3I59B 1WW6A 2TUNA 4P14A 1BZWA 5AFBA 1G9DA 4N7UA 4Q4W3 3V56A 1CESA 1JW6A 3PMSA 1QJU2 2YY1A 4LTAA 4QQLA 3NL1A 4RS5C 3LWCA 1GYKA 2IXJA 4BIOA 3MLJA 2R0FA 2PFWA 5CFDA 4YYOA 1MVQA 1QXJA 1X82A 4CP0A 1D4M2 1GQGA 2RR12 1CAWA 4E9KA 4LUKA 3CJIA 1MEC2 2XL7A 1SBFA 3QOPA 5DUXA 1LOGA 3CJXA 4M3CE 1V9U3 3WW4A 5BY5A 5CA6A 2ZACA 4LBJA 4PCRA 4YZ2A 2OPKA 2WZR2 5F9TA 3N7MA 4XJ9A 1M4WA 4IV1B 4F7ZA 2DYCA 3ETQA 4MGKE 2VY0A 2ZHKA 4YVWA 4IEXA 1L3JA 3H9AA 1APNA 4AI0A 4YZ1A 3W9AA 2CWMA 2UY9A 3AMNA 4BM8A 2R041 1H8TA 1OFNA 4ES9A 4W6YA 2CGOA 3RYRA 1NA1C 5B2GB 2PHUA 4X6RB 3ZFGA 3O0VA 1QXRA 3ZFFA 2B9UA 3JU9A 2GH2A 3WW3A 1BMV1 3PVNA 1LEDA 5J36A 2A70A 2VVEA 1EAH3 4WBBA 4RHV1 3MGUA 3DPRA 1OLRA 3VKLA 5CFDB 4XBLA 5JSRA 4PIZA 1CAWB 4I2OA 4LBQB 3EBRA 1RJ7A 4Y22A 4FPYA 1LJ7A 2TNFA 3CJIB 3SH5A 3ATGA 1LOBA 1FPN2 1QJX3 5JSPA 1UX6A 2W52A 5LRSA 1CVNA 1UZYA 2CAVA 2PAEA 1IS6A 1RUI2 2ZZJA 1AR93 1PO11 4CDXC 3H7YA 4Q26A 1QH7A 4OHZA 1F9KA 1Z7S1 5DDJ2 1HDKA 2PHFA 2DCYA 3H1WA 4YVSA 3V65A 1ZBA1 4QGLA 2HWF3 2ZOEB 4RR3C 5JLVA 2B5HA 4FT8A 4QPGB 1H8TB 3QBQA 1DGWX 1S0EA 2D43A 3ZFGB 1YFUA 2H6CA 2JKBA 4B4PA 3LOBA 3KCXA 1LOAA 3UKNA 1W6NA 3UKTA 3ZXEA 3PNAA 2XGXA 5T5LA 1FNYA 2WNUC 4KU7A 4Q8KA 1HQLA 3DPRB 2XJPA 3ZSLA 3T2TA 2WNEA 1VBE1 1WMFA 1UIJA 2R1DA 5EXOA 1V6OA 1KJLA 1QHDA 2XHKA 2WQ4A 1C5IA 1IS3A 1H1IA 4ES8A 2WFF2 4QMAA 4Y22B 3VZMA 3BU7A 1HXS1 1H2MA 5ACA1 1QKQA 3J8F1 4YGEA 3JQXA 1PHMA 2ZGSA 4CEWA 1ND3B 3QH7A 4R9CA 1Q8QA 1QGLA 4QGNA 4XFIA 4J1XA 4OHWA 2XLGA 2C9AA 3VKOA 2AR6A 5FO8B 4YVSB 3ZSEA 3AP7A 5JI7A 2O1QA 2HEVF 5FMOS 3OCPA 4XHBA 1OPMA 1AVBA 4WZCA 1SFYA 4RL7A 1KITA 3GYDA 3HR9A 2ET1A 2HKXA 4FXKB 4WM7B 3APBA 1PIV2 1N47A 1W6NB 1GLHA 4FP2A 3NVCA 1OOPA 1LENA 2XUMA 1GV9A 4HVQA 2A71A 1AJKA 1LESA 4HN1A 4JDOA 3TYJA 2UWBA 1R092 1RHI3 2GZWA 1AHSA 4NPRA 2YUEA 2I2SA 3JBG3 2QDNA 4EJRA 4JC1A 4C0HA 4M0HA 3J9SA 5KWRA 4Q2FA 1LU2A 3C2UA 1BYHA 4GMP0 5D8AA 2ILMA 4YFWA 2ENRA 2VNOA 4CEWB 5E1RA 3KGLA 2RM21 4MZUA 4IEOA 1EPWA 1DQ5A 2VNRA 1H4HA 4K3UA 1JYIA 3AXDA 1TME1 4R4ZA 1LCLA 1QNWA 3E5XA 4P9LA 4DFSA 1RUNA 4XW3A 1SDWA 4D7TA 5LEKA 1C8M3 3P3PA 1LTEA 3USSA 3ES1A 4SLIA 2W08A 3B02A 1AYM3 3NAPC 4CDQC 1ZNPA 1XU1A 4JVAA 1DQ2A 2PHRA 1DGWA 4GH4C 4AWDA 1YYNA 3AZZA 4WV8A 4W6WA 2GNTA 3V0BB 1OOPB 1RUJ1 4IETA 1FNZA 1OQ1A 5LRRA 4BPZA 1LULA 1Q5OA 2TEPA 3OGJA 2WC2A 1LHUA 4AQSA 3N7KA 1H9WA 2LALA 1EYBA 1XNDA 5AC91 1G9AA 1C1FA 5FTTC 1X7NA 2ES3A 2RJKA 4AEKA 3AZWA 4IV3C 1PNGA 2B8MA 3AKRA 4LHNA 4RGAA 2OW4A 4KQ7A 1PZ8A 3ILFA 1DZRA 5D8AB 2B42B 4E27A 3IPVB 1VBA3 1F8VA 5A3LA 3VBHC 2GH8A 2HWB3 4AW7A 4GA9A 4QQOA 4BH9A 1WGPA 2JJ6A 1V00A 2GC1A 1BJQA 3PJQA 1O91A 1FAYA 4JRAA 3BALA 3HQXA 5FO7B 1POV3 2EALA 2Y38A 3UK9A 3VUOA 1NLRA 1C4RA 2BUKA 2UWCA 4QQHA 3ZSJA 4X6QB 1WD4A 1EY2A 4G9SB 3UJOA 4CDWC 1AL0G 1RUH2 5L7OA 1MR5A 2R061 4GMP1 3WQ1A 4AHZA 2OUHA 4PQ9A 2XVKA 3R6SA 1R1A3 4S2FA 4ZU5A 2GALA 3I2DA 1O3RA 4NN0A 1PGL1 3EXUA 4CDUC 1Q8OA 5FDBA 5JI9A 3R05A 1ONAA 4N53C 1AJOA 2PHDA 5FLHA 3MIDA 1QQP1 1CONA 3C3VA 2PHLA 1CR7A 4EWAA 5FRAA 1YFWA 2G9FA 4FBFA 1DQ1A 4YG0A 4IV1C 1AL22 3DF0A 2MPFA 3B3QE 2HWD2 4R9DA 5C4WC 1NYWA 1ZX5A 1UD1A 2EIGA 4FPKA 1QOSA 3H7JA 4FPHA 5TSWA 5GZGA 2HWE2 2A3XA 2YV8A 1RGSA 1ULGA 2OZJA 4Q0PA 3FLRA 3VDDA 3ZMOA 2XBO3 5GLTA 3NV4A 1WMEA 3B00A 2FMYA 5IK4A 3D8CA 2Z5WA 2EXIA 1RUF1 3MIBA 4TSVA 4FPOB 2GC3A 4OI2A 4ZXKA 1CAVA 4Z82A 3S7EA 1ZRRA 3M4FA 4Q4X3 1ULCA 4MGZE 2ERFA 3ASIA 3CJIC 3P3NA 4LO4B 4R4XA 1TMF2 3FFZA 3I4IA 3MDPA 3U0ZA 3E6DA 1QDOA 4K20A 1QJX2 1UKRA 1XNCA 1ZBE3 1G7YA 4YVWC 5H9RA 3SLIA 3VKNA 4COVA 1VRH2 4XJAA 1H8TC 2QFEA 3CO2A 3M3EA 1R1ZA 4WVZA 3ZFGC 4L92A 5IK7A 3KT7A 1FOD1 3ZFFC 2HWF2 5KC5A 1CIWA 2RMU3 4DRRA 1QOTA 3KZ4C 1J1TA 1LB2A 3O7OA 2V09A 3RYKA 1XYNA 2JICA 3K48A 3AYAA 4XJUA 4XF1A 1QWRA 4XIKA 1RUD1 1AR83 2Z42A 3OYWA 1PZ7A 4X8PA 2RS33 2GC0A 3ZO0B 2XPJA 1LOFA 3ZPYA 3HT2A 1PK6A 4LLFA 1NA1B 4XPVA 3IDBB 4URTA 1S2KA 1ENQA 2BEOA 4AQTA 2BYVE 4DQAA 3GHMA 4IEUA 2MEV1 2WS91 2R32A 3HWJA 2H6BA 2HWC1 3T1MA 2ZHNA 4Z92B 4GXLA 1RVF1 1NE4A 4Q29A 4DY3A 2WT1A 1RUG2 3AJZA 3GBGA 2BTVC 4DMIA 4EWEA 4XQ4A 1RUI3 1HKDA 3DGTA 4AK3A 4LE3A 4MV2A 3SH4A 1N3QA 5DDJ3 1Z78A 3CLPA 5I0RA 1XNKA 4ZKTB 1DDLA 1IOAA 4DY5A 2RS53 2X29A 4KU8A 3N36A 4AHXA 4L8QA 1H1AA 4LBOA 1S55A 1RJ8A 3VZLA 2DFBA 4AI2A 5C9AA 1UF2C 2WQZC 3M2MA 4XBNA 1T6GC 1IZ3A 5CADA 5DUWA 4QQ2A 3VLBB 4E2GA 1W0OA 4YSFA 1HRI1 3OYWB 2XJUA 1EV13 1OD5A 2DUOA 1DBNA 5T55A 4FP3A 1PK6B 5CNAA 2ZHLA 3B94A 3VL9A 4B4RA 3AP9A 4XF9A 3D82A 3B93A 1RHI2 1MS4A 1VBC3 1JXNA 5AVPA 1G9CA 2VUJA 1Q8SA 4HKOA 4R9BA 5GZEA 1AR72 3ZSMA 1PO23 4JQRA 2UY8A 3D6EA 5GZCA 1ND2A 4QM9A 3A0NA 2DUQA 1GZ9A 4LBNA 1OKQA 1CJDA 1F31A 2BFUL 1OHFA 5JPMB 4EN9B 2UYBA 2V73A 1NCRA 3KLSA 4HVRA 3QD6A 3ZN6A 1ALYA 4KG0A 1C8M2 1KQRA 1VP6A 3LAGA 4UW6A 1ZA4A 3B7MA 1UCXA 3AB0A 5EWSA 3SITA 1W6PB 1PVC2 1OPOA 1WCDJ 3OY8A 1NG0A 1PZ9A 3VBOA 1A78A 3NAPA 3A4UA 4FOYA 3FMGA 3GZUC 1R093 3MIGA 3H1MA 4FOWA 4GH4A 4YM0A 5A3MA 2XJVA 3H3ZA 5LK7B 5D8AC 2VOKA 1FMD1 1V6JA 5C8WA 3JD71 4RGGA 2CGNA 3EQEA 4AQ2A 4H7LA 3WP3A 1HRV2 3LSDA 2IWGB 2P3KA 1ND2B 3NV2A 4S2HA 4AI3A 1MQTC 1VBA2 4LBLA 1ZVFA 4BMEA 5GLZA 5F1RA 4P9JA 2F6BA 4QT6A 5BNNC 4P9YA 1XE8A 1C1LA 3DN7A 4YFZA 1NCRB 4B3NA 4LO6B 1QJY2 3ZN6B 1RMU3 3GBWA 5CVRA 1KDKA 2GC2A 4WVVA 4O9GA 1XXNA 1LGCA 3TNQA 2JE9A 2D7FA 5T54A 3OY8B 4XQWA 1CQ9A 2UU8A 1PGW2 2I74A 2FQPA 3VBOB 5LEJA 5FPZA 3NAPB 2YZ4A 3HAGA 1G6NA 3WINE 2YROA 4HL0A 3RPQA 4GH4B 1VIWB 4MSVA 5I8YA 5ABJC 4ISRA 2EXHA 3VKFC 4AEDA 1V6IA 4COUA 1OFSA 4QX5A 3G7DA 2WZPP 3AP6A 1MZFA 4C0BA 1PNFA 2EA7A 3ZXJA 4HPKA 2RE9A 3WDUA 5JIUA 2AUYA 4RSUA 1Q8VA 4NHLA 4V1PA 3N7JA 3MF6A 4XFBA 1HX6A 1AR61 1YI7A 4M3CF 2D6OX 4N53A 4GMP3 3AMMA 4FXGB 4COYA 3VKMA 2YXSA 4DS0A 4CRQA 1H30A 4Q4V3 2QNKA 1ULDA 1X50A 4Q1RA 4BOWA 5L7OC 1JUIA 1I1EA 3WR0A 1MZEA 3MFAA 1H4GA 4Q0VA 1V6LA 3ZYGA 5JZGA 4YW5A 3TN93 1LU1A 5KXEA 4ISQA 3QACA 4LHKA 1RUH3 1NY71 5K0UA 2AH2A 2Z79A 3CU7A 4GB31 4I30A 4XETA 4Q4X2 1BEV1 1LGBA 1COV1 3W59A 4CDWB 4OLLA 4AEDB 2ARXA 3M8LA 4IQPA 3ST7A 4W65A 5KBFA 1GR3A 4I02A 3THTA 4HKWA 4HPKB 3BOPA 4NVPA 1VBB1 3WX5A 4CDUB 2AZ5A 4Q8LA 1AL23 4AFMA 1ENXA 4N53B 5E88A 4DNYA 1ZBE2 2PLV1 2HWD3 2O8QA 4H55A 3VDDC 2GDFA 2A5ZA 1BMV2 2UURA 2JENA 2IFWA 4Y26A 5C8CA 3OD4A 2A3WA 2HWE3 1YUDA 4SBVA 1REFA 1ZREA 3L2HA 4Q0QA 4RHV2 5C4WB 3AKTA 5DUUA 2RMU2 3SCGA 2ZAHA 1HLCA 4L99A 3JUUA 4XYXA 4OI0A 1IS5A 1QJU1 1ASJ1 4XEZA 1VBD1 2BVVA 5K0UB 2XVGA 1NOVA 4PDWC 2A6YA 1AR82 2RS32 1D4M1 1UL9A 5KHIA 1PO12 2RR11 3B01A 2CL2A 1TMF3 1Z7S2 4HK8A 1LKNA 1MEC1 5H9PA 2DF7A 1RTVA 2XKOA 2ZMNA 3BB6A 2IXLA 4FTEA 1A8MA 5L36A 5K7PA 1O4ZA 2WZR1 3FLPA 2TBVA 5FCCA 2NP0A 4FTBA 3B9CA 1VRH3 5C8CB 4XE9A 1S0GA 2BQPA 2XH6A 4QU2A 4R52A 1BBT1 1WUVA 4YVWB 2Z2SB 4B8EA 4ASMB 1C8NA 1O3QA 3WG4A 2RS52 1DIWA 4TWTA 3LGRA 4XF3A 2FZ2A 2O8OA 3GZTB 4K1YA 1LOFC 3ZYJB 1PK6C 2E7TA 1SCRA 3ZFFB 3EHKA 1Q8PA 3RMXA 4IL7A 3RI8A 1DHKB 1VB4A 1EV12 2ZZQA 3JQWA 3KMHA 1C5HA 1JHNA 1SBEA 5I0TA 4AEJA 1KS4A 1IPKA 4XOGA 1VBC2 3CEWA 1N1TA 1FPN1 2KM2A 3V0AA