3KB5A

Pry-spry domain of human trim72
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite motif-containing protein 72
publication title Crystal structure of PRY-SPRY domain of human TRIM72
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 44
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kb5A00
4N7UA 2E63A 2VOKA 4X8NA 4WVMB 3TOJA 5JIUA 4B3NA 4XW3A 3ZO0B 2YUEA 4X8PA 5JI9A 4V1PA 4N7IA 5F6KA 2FBEA 3UV9A 5C33A 4P9JA 2YYOA 2IWGB 4WVMA 5F6LB 4B8EA 3KB5A 2WL1A 4KG0A 2LM3A 4P9LA 5JIAA 4QT6A 4P9IA 5JI7A
chains in the Genus database with same CATH superfamily
3KS7A 5K0UB 3FHAA 3DKWA 2YBSA 2PHXA 4XYXA 3RPQA 4AQTA 1IOAA 4UAPA 3E6CC 1MVQA 4YW1A 5F39A 1LU2A 5BPXA 3U10A 3ZYHA 1JOJA 1W6OA 4TN7A 4Y33A 4BISA 4RS5A 4EN7B 3T4HB 3UGFA 1QJU3 1BEV2 4B1LA 2DTWA 5JMCA 2IXLA 4ATFA 4INDA 4N53B 2WN3A 1KQRA 4CUGA 2VE1A 1LTEA 3O1TA 5CG9A 1EAH1 3ALQA 1GNZA 1S2BA 1SMVA 2BQPA 1PM7A 1H4HA 2BERA 3AKPA 4CDUA 4ARYA 2VZTA 4MXWB 1OI6A 1R1A3 4AFCA 1FMD1 1UIKA 1UZWA 2J7MA 4DRVA 5I8TA 2BWCA 3H8OA 1DGLA 1SPPA 2CGPA 5FZ0A 3T2PA 4Y20B 1JMUB 4JX0A 1Y3TA 2B42B 2ZGQA 3B7MA 2JDYA 2WWJA 4LHLA 3WDYA 2J42A 4KNCA 4EWEA 2EIGA 2W95A 2C9KA 3KHCA 4K20A 5E16A 1VAKA 3WQBA 4NWVA 4XTPA 3HBKA 2VCCA 2PAMA 2A6YA 1XNBA 3WP6A 2VZSA 2R071 3I2JA 4JGZC 4OUSA 2CDPA 3W58A 4A7ZA 2PLV3 2PYTA 1UOJA 5A7SA 5APAA 4OCTA 3Q8EA 5IJRA 4JVAA 3GZAA 1SACA 3JCIA 4XBLA 1OF4A 2P34A 2WZR3 4S2GA 4EQVA 2ZTNA 3THCA 4QPGC 3MDPA 4A3ZA 3CMGA 1KXGA 3THPA 3VBOB 3IMMA 3EJKA 1CAWA 3A22A 4XUQA 1AYN3 2CV6A 2ZEYA 4GB31 2D98A 5JZGA 4BB3A 3ETQA 2RVAA 4IGPA 4MSVA 4SLIA 1PMHX 3UKVA 3CZUA 1VE0A 2ERFA 2Y6FA 5GLUA 1IGOA 3MW2A 4BQXA 4Q4Y1 2R1DA 2X8KA 4CDQA 1AJOA 1DQ4A 1C8M1 1H6YA 1ND2B 1OOPA 3ACGA 5F3CA 1W9FA 3K2OA 3T0DA 3AP6A 1TNFA 1PHMA 1R1A1 5IW0A 1I5ZA 2DUPA 3LIHA 2VOXA 4IE5A 4DXRA 3PUQA 3IZOA 5A33B 2MPFA 5IT6A 5FDBA 2BYVE 2BTVC 3FX3A 3KQ4B 1PVXA 4B7EA 1LHUA 1TZOA 1W05A 4IE0A 4AI0A 4CE8A 2ZX3A 1PGW1 5HCAA 1IKPA 1W8HA 2AZ5A 3LDRA 1HRI2 3UKNA 5A6QA 4RHV2 4QHZA 3KMHA 1LULA 2VQUA 5C3SA 3WW2A 1MS3A 4GD4A 3CLPA 2GMPA 1UOBA 3N9NA 2HLEA 5FZFA 3OSDA 4X6RB 1WZXA 3USSA 3LPGA 3T30A 3WR0A 4JGZA 3PU3A 1OD5A 1TG7A 1XNDA 3FZ3A 2Z69A 5B4XA 1OVPA 1S0CA 2QJVA 2VNGA 3ASIA 3DXUA 5IVVA 2ZHMA 5JUVA 1JZ5A 3H7YA 1HXS2 1OQEA 2BOIA 2E7AA 1GZWB 1FOD1 3GF6A 4LQRA 3MPPG 2ZGSA 3AZVA 3NVCA 3VDCA 1U0AA 1HDKA 2JX9A 5AFEA 1MZ5A 4YW6A 2QQKA 4QPGA 1W8NA 2YU1A 2DV9A 5DUUA 5FYIA 1W39A 4BLJA 1AYN1 4CCMA 1W90A 4AGVA 2JG9A 1LHNA 5A3TA 4L0PA 3J8F1 4PIXA 1LGNA 5F32A 5KXDA 3GCWA 1YI9A 3RYKA 1C1FA 4OMCA 4NIHA 4AI2A 4EYUA 1MZ6A 1CD3G 4EZHA 5F7UA 1D7PM 3HT1A 3CQOA 1US2A 1RXFA 3N9MA 2AC1A 2Q1FA 3NKTA 3ZKYA 1Y9MA 3I59A 5BY5A 1XYOA 1ZA7A 2GU9A 3URFA 5DG2A 3ZFFC 2IUWA 1CJDA 2VZOA 4ES9A 1NX9A 3WDXA 2WNVB 2NZ9A 1MR5A 3RWKX 1C5HA 4MUVA 4OQ9A 4C1WA 4E8DA 3BTXA 2D97A 1DZQA 5A3WA 2VOVA 1POV3 2KXLA 1LGBA 5EXOA 1AR82 1NXMA 4LK6A 5T5OA 1EPZA 1PGL1 2RMU3 1V6MA 2N7GA 4LT5A 4BE3A 4Q0QA 2JXAA 1CX4A 1G7YA 3RS6A 4OLLA 3WQ0A 5C7GA 3S57A 2K0GA 5IVFA 1SLLA 3WUDA 4IETA 3OGSA 2Q8DA 1JU4A 1SFPA 5JLVA 4PJYA 3ZR5A 5GLZA 4QAWA 2VW0A 3AYEA 5D21A 4WBBA 1CVNA 3ZFGA 4OI1A 3B9CA 4HMZA 1XYPA 1QDCA 2GNTA 3AKTA 1VJ2A 3VD5A 2VNOA 3KT4A 2J22A 4YZ3A 4Q8KA 3LSDA 1CPMA 3I4IA 3ILFA 5FLIA 5JPMB 2ES3A 2EXIA 2J1AA 5FBZA 4A3XA 5FTTC 1PVC2 4PLOA 4CZSA 2CGOA 3MF9A 3IDCB 2WINB 2Y8KA 4M3CE 1ZVFA 2WR9A 1UQXA 2NLRA 3MO4A 4CDXB 5IUQA 5A3NA 3Q8FA 4QPYA 2BJSA 2ARBA 2WL1A 3VDDB 3I2KA 3AYAA 2WNUA 1RUC2 4BQ2A 2DCKA 2W47A 3SCFA 4ZPIA 1S0GA 3UJOA 3K51A 1D2QA 2QQNA 4CEYA 1AR71 2Q1MA 3E5XA 4L92A 4BA6A 1X9PA 1MQTC 4BK5A 3F2ZA 4AHXA 4NIIA 4LTAA 1X50A 2VUAA 4AGGA 3DXTA 5J48A 2OYZA 2ET7A 4QM8A 3DYMA 3LEIA 5IK7A 2YV8A 2RS52 1PO13 1POV1 3J7NA 3RZKA 1W6MA 4YG3A 5FY7A 1N1YA 4FP2A 3MI8A 2PHRA 3VKFC 5JSPA 4MGSA 4FPCA 2DYCA 3VD3A 1UY2A 3VBFA 4KQ7A 4Y1UA 4UFKA 2RDRA 4CDWA 1SLBA 2IXIA 2PHTA 1RJ8A 4NRPA 3RYPA 4G4FA 2XVLA 1HQLA 1W6NA 2BRTA 4Q4V3 2PN5A 1C57A 2VD7A 5LA9A 4META 3OG2A 1WLTA 2HWF3 4LA3A 3PMEA 2E63A 1W6QB 5G05L 4CEWA 1GNHA 2VGDA 4LO6B 2XB6C 4QQPA 5F3GA 3ZN5A 3GBWA 1YYNA 2ZAAA 3JUUA 4LITA 1OC1A 5BV6A 1EPWA 1XU1A 4QX5A 1EUTA 3W9AA 3KV4A 2UY9A 5B4NA 2EICA 3ZPYA 2R063 2WRAA 4KI5M 4GH4C 1KFXL 4JV4A 4KU7A 2ZACA 3OBAA 1H8TC 3D82A 1YFWA 1ULDA 3WINE 5L7OC 2VL4A 5T50A 4O9EA 2A73B 1QJU2 3FLPA 4XABA 4QPIB 1PMJX 1OVSA 4CP9A 2W1UA 5CFCC 2O8OA 5EJ1B 3E5UA 5FMOL 2HWD2 1GV9A 2BOJA 4A41A 1AX0A 1UY4A 1Y43B 5FO7B 2GC2A 2EAKA 5T52A 3VKMA 2V5YA 2WQ8A 4FFGA 4B4PA 3LZZA 4CXYA 5E89A 1Q5OA 2OKXA 5A6ZA 2IXCA 1JZ6A 2UWAA 1ENQA 1PIV3 2ZAHA 2RHPA 5EWSA 3CHXA 3HPNA 4C0BA 3NKGA 1SBDA 2RS33 4HSJA 4GIQA 3CJIB 3GJAA 5A3MA 3CIHA 2UYAA 1JZ4A 2CL2A 3LKJA 5EP9A 4FT8A 5AVPA 4XETA 4JKLA 1NCRC 5FMOS 5LA2A 3SKJE 1Q56A 1UD1A 4BXSV 3J7LA 3PUAA 4UOJA 1YQCA 2G9GA 4XCBA 2G4IA 2HWF1 3I2GA 2PLV2 1BYHA 4XPVA 4TYSA 4DO0A 3AKSA 2Z79A 2YG0A 4FQ4A 1O4ZA 5C4WC 2W08A 3PVOA 4M0HA 4I0BA 5DAXA 4H3WA 4E4DX 2JE7A 1G86A 3AP9A 2JD4A 4K8FA 3CL1A 3NV2A 3TB0A 3D5OA 1TMF1 4H55A 1WW7A 3ES1A 4QGMA 4GAZA 1GYKA 1COV3 2GMEA 4L2NA 5FZOA 5CEHA 4OHZA 2PHUA 1H0BA 4JGYA 4AE2A 2V4VA 2XJQA 5FCCA 1UWWA 1KEXA 1MS0A 3IAQA 3O1VA 4Q0UA 3RZJA 1J58A 4RA0A 1NE4A 3M1HA 3RVHA 4XDQA 1DLCA 4HKWA 2FDFA 5F5QA 5F8PA 3TEZA 5DAPA 2EIDA 1QF3A 3POJA 5KC6A 3RI9A 1QOSA 5JCTA 4XJAA 3DCQA 3UV9A 4AI8A 3KZ4C 3O14A 5ABJB 5K9YA 4TTGA 4M3CF 4FTBA 4K1ZA 2P6CA 1DQ0A 1YRZA 1F2NA 3BGAA 4IQPA 5FKCA 1ZNPA 3AZXA 1YFXA 2IZWA 5FWEA 3RI8A 1REDA 1JYVA 1E5HA 5A3PA 2Y6JA 3OCPA 3ILRA 5FYCA 5I0SA 1VPHA 4D6SA 1IPKA 3AZZA 3BALA 5FMBA 1FV2A 3NAPB 1KS4A 5F3EA 1ND3A 3A0KA 3WNXA 1PK6B 3CJXA 3S6PA 4FAGA 3WDWA 5C9AB 2HWC2 2PFWA 1EV13 1CR7A 5E6HA 5I8SA 2D6NA 5GZEA 2YDEA 5C33A 5IVBA 1FNZA 1GOGA 1CAVA 2JG8B 3HN1A 4NHYA 4XF9A 5FPBA 2Q8CA 4BQ5A 4MHUA 1RUH2 4QDRA 4FPGA 2DURA 2ZGUA 3LSEA 4MZUA 5ANQA 4IEUA 4A45A 5BNOC 4PQ9A 3O12A 5EYYA 2WQZC 4CCDA 3K75B 5EZWA 3AFGA 1COV1 2R043 2W94A 3FC0A 3DYOA 4DMIA 2W87A 1WWYA 4P5YA 1IPSA 1J1TA 4YGCA 1DU3D 3I3QA 5LB6A 1K5JA 2VO5A 1RUI3 2QE3A 2XBO3 1WCKA 2J1TA 4AHZA 2WNOA 4LBQD 1G9DA 3MFAA 1UNBA 3DGTA 3POFA 3QCWA 4E2QA 2VNRA 3AYCA 2UY8A 1YCIA 1ULCA 4PIYA 3AX4A 5KWRA 3N7KA 3KF3A 3H8RA 5FY8A 3VBUC 3USUA 4LBQB 4W8JA 1ZRCA 1PX3A 2ADEA 4NO4A 3ZYJB 3JD73 2FMDA 2RMU2 4RN5A 2XQRA 1HB1A 3VBSC 3BYWA 1QH6A 4A7KA 5A1AA 2D5HA 5J09A 5I8YA 4GKYA 1E5IA 2VBBA 5JR7B 1QWRA 4COZA 5LBEA 1ZRFA 1FATA 1N1VA 4MH0E 3WV6A 4A6SA 4NOTA 3TOJA 2VU9A 3TEXA 4TWTA 3PJYA 2VMFA 1NT0A 3SH4A 5T3NA 4BQWA 4XURA 3HOBA 4WZCA 3SEEA 1HRV2 3NJZA 4UF0A 3KCYA 4QB1A 3M70A 2MEV1 1N3PA 1X7NA 1NQJA 1YI7A 2ZGKA 3RJRA 2FBEA 1EV11 2NPIA 1D4M2 5GZDA 5T5LA 1X82A 2GC1A 1TVGA 1Z78A 4WV8A 4R9DA 1HIXA 1JUHA 4NUBA 1RTVA 4XZUG 4LOSA 2YZ4A 3ZFEB 4CU8A 1ULPA 3H1YA 3T0AA 3WNKA 3LOIA 4IDZA 3JBG2 4XBNA 2HYKA 5D8AC 5FJKA 2PQQA 1DYOA 2WFF3 4B3NA 1ZBE1 2RJKA 1RMU3 1AR91 4K9SA 4HXCA 1UKRA 2XBO1 1R081 4XHXA 2FHRA 3ZR6A 5IATA 2FMYA 1WLCA 2W1WA 4WVWA 2HJIA 2VQAA 4RR3A 5H9RA 4XAAA 2IXJA 1UX7A 2AACA 4LE4A 4N43A 3IMNA 5FYSA 3HJRA 5FYVA 4ZU7A 4BZ4A 1T6GC 4CP1A 3A21A 3VZKA 1IG0A 2EF6A 3B01A 5IVJA 4IV3B 3OBRA 4Z8BA 1PO12 2DUQA 1TE1B 5SV5A 2CY6A 2B46X 3JD71 4D6QA 3GBGA 3O7OA 1WCUA 4DNYA 2QDNA 1OF3A 1GUIA 4GKXA 2F4LA 2OZ6A 4BDVB 5JOYA 3GDBA 1LOEA 2VCMA 4Q4V2 4YYOA 4ZS3A 3THTA 5C8CA 4IERA 3P5BA 2QQJA 5K0UC 1NY71 2YC2A 1UMIA 4LKDA 3VGIA 2JKBA 1H2LA 3NO8A 4FOYA 3TNQA 4BIOA 4DXTA 3V0BB 1XBFA 2BNMA 4HT1T 4QKNA 1H30A 1XOYA 4N7IA 2R6QA 2ZX0A 3ZMNA 2P5BA 1VBB3 3B94A 5FZGA 1CONA 3RMYA 2P3YA 4XHBA 4AW7A 4DY3A 2R062 4ARXA 1S0BA 1MS4A 4XZPA 2BBAA 3IT8A 4Q27A 2I07B 4CVUA 3AP7A 1OPOA 3KT7A 3MIHA 2FQPA 4I0WB 4AAPA 3BIEA 5JVVA 2RR13 2XLFA 3BN6A 4MADA 2Q8OA 1DYPA 1RUF1 5EPAA 1DQ2A 2AUYA 4HETA 1RUE3 2WFF1 3UESA 1VIWB 2C6SA 5JI9A 1AYM3 1RUG1 2XWJB 4XXPA 3KV6A 2LALA 3S7IA 1UMZA 2W1QA 4P9JA 4YFWA 1UZZA 1VBC1 2LS6A 4D7TA 2GC0A 1YJKA 2EAAA 1W2AX 3NSTA 2XVGA 3WQ7A 5EV7A 2RG4A 1QOOA 1JOBA 1PIV2 2QVSB 4CU9A 5KHIA 1UY3A 5AC93 3VHPA 1F31A 4BIFA 2ORZA 2RS32 2B9UA 4Q4W3 3VDBA 1JYTA 2HEYF 1VR3A 4KWJA 1JZ7A 5FZ6A 1DP0A 1R092 2ARCA 4XF1A 3K77A 5HBAA 3SHRA 4Z92B 4BCUA 1S0JA 1UN1A 3CO2A 5IVCA 3WDTA 4IEQA 1WA6X 4V2VA 5FBJA 2Y0IA 4K6BA 5K0UA 3WG2A 2XQXA 3KF5A 3VHOA 5CZKA 3ACIA 5FO8B 3BPSA 2E26A 3M3QA 2WS91 2QDRA 3AM2A 2ZHLA 2DVBA 5LRRA 3C7HA 3NJYA 4IGOA 4ZS2A 5JSOA 1F9KA 1NXD1 2XMLA 4NHLA 1A8DA 1VBD2 3O1UA 1OPMA 1W9SA 3BIWE 3CU7A 4RGKA 1PO23 2VUDA 4OHVA 4OHWA 4WM7B 4YGBA 5D1IA 1V0AA 1ND2C 1PX4A 5JPNB 1H2KA 2X5IA 4IEVA 3WP4A 1EP0A 1YJLA 3CZJA 2RR11 3VUOA 2HBUA 4HBNA 1HB4A 3BB6A 1F5FA 2O1QA 3M7AA 3B93A 4XW3A 5HPOA 2VCBA 1NZIA 2JDZA 2QQIA 3ZX7A 1QXJA 4O61A 3WW1A 1ZM1A 1LGCA 1YXWA 3NL1A 1ASJ2 4K21A 3PIGA 2ZGOA 4YFZA 4C0HA 2D6PA 3RZHA 3RG0A 3TN91 1YQ8A 4Z2WA 4ORFA 5FZHA 3UKTA 2Y34A 1CAUB 3QACA 4MV2A 2QBXA 3ACHA 3BODA 5FP4A 5C3OA 5E88A 4Q4W1 1XE7A 3K4ZA 4YGDA 3HQXA 4S2HA 2ZGNA 5KR7A 5C6CA 1OH4A 2VUCA 4WM8B 3T1LA 4GWMA 1V9U3 3RGBA 2RM22 5FPVA 2HEVF 1SEFA 2WYSA 2D40A 1AZDA 4AVAA 3VD9A 2VM9A 2R49A 4YVSB 3WF4A 5FZMA 3CDZB 3DPRC 2BU9A 2HBTA 3M8LA 1Q8OA 1J83A 4B8EA 4FP3A 4XACA 4EJRA 2W39A 4EROA 3TEWA 3L9JT 2JIJA 4PQQA 5BNPB 4JQRA 1RUD2 3E5QA 4Y5SA 4P9LA 3NMBA 3POWA 5DAQA 5DPNA 3U75A 5JOWA 1UY0A 1F4HA 3U11A 2EA7A 2TBVA 2Q30A 3ZXKA 1PMIA 1I3HA 5LATA 4MGIE 5DQ0A 3W59A 1NCQA 1PO21 4LEJA 4OI4A 3MYXA 1DGRN 4FPEA 3I3MA 1IHMA 4HKLA 5FY1A 1URXA 4TLFA 1LCLA 2R042 1V6OA 2WNVC 3IB3A 4GB33 1GANA 4UFHA 4FPFA 3TWIA 4YVWB 1VRH2 1UMHA 3U37A 1RUI2 2W0XA 4Q4Y3 5EJ3A 5A33A 1DZTA 3WF3A 1C8M3 1I9RA 3IPVA 5FYMA 4AAXA 4FAHA 1RYYA 3M4FA 2XKPA 2RJ2A 5DZFA 1GR3A 4HK9A 4QX1A 1QQP3 5FAXA 1CAXB 5HCBA 4IEXA 4UW4A 2P17A 1HQWA 2AR6A 2V09A 1OKQA 2Q1ZB 3KGZA 4Z07A 3H8XA 4JRAA 3WY6A 5L9RA 4C91A 1Y9GA 1GLHA 4CSWA 3PUSA 1JUIA 4FPJA 1WMDA 4XQWA 4YW3A 2HWB3 5HCFA 2DCYA 3GZTB 1NA1B 2PHFA 3B3QE 1V9U1 2E6VA 3OBTA 2ZGRA 5A3OA 1UXZA 5IK5A 3WNOA 4P08A 3N9PA 4B29A 2IFWA 3S30A 3C7EA 3SISA 2CNAA 4MGTA 3VN4A 2DU1A 2BVBA 1YQ6A 4LBOA 3DPRA 4YLZA 3SMHA 4AQSA 4CDXC 1UU4A 3BU7A 5BUVA 2XHNA 2EIBA 1AXZA 2BP6A 5J37A 4YNIA 1X9TA 1UOFA 4CCNA 1LOGA 1ALYA 2D3SA 3ZYRA 5A7NA 4C1XA 5FZIA 5FPAA 4YM0A 1FOD3 4OULA 1Q8SA 3VL9A 2PHDA 3AMPA 4DEVA 4AWDA 4CRQA 1QXRA 3ZO0B 1GWKA 3UK9A 2R0FA 3MLJA 1LNSA 1N1TA 2GH2A 2RS11 4XOGA 5FO9B 4BJ0A 2CGNA 3M3EA 3QBQA 3J8F3 4LO4B 1K5MB 3ETPA 5K4LA 3OYWB 3O1MA 1IQAA 4N9HA 1VAVA 3ACLA 1RGSA 2DDUA 4XUNA 5FZDA 3WG4A 4EE2A 4RQPB 1C5IA 1WBFA 4DUVA 4YM3A 3NV1A 4IE4A 1CIWA 5DUVA 3R6SA 5ACA2 3O1PA 2YROA 3WW4A 1QQP1 1X33A 2KR2A 4XFIA 2QQLA 3I97A 5FQ0A 2QZ2A 4UW6A 4X6QB 1VRBA 3HIFA 4ASMB 1L3JA 5I93A 1N1SA 3I54A 3RZZA 2J1EA 3VBHB 1I1EA 1VLNA 2HWB1 3WP3A 3WG3A 1SDWA 1W3VA 1LEDA 3P3PA 4QXCA 1HN1A 3ZLIA 3ZSMA 4HVOA 1YQ2A 2JB4A 1AHSA 4R4ZA 1RUNA 1W6OB 4O65A 2D93A 2R32A 1F35A 2E7QA 4RS5B 4XDOA 2A70A 1TQ5A 4EWDA 1I5PA 3U4XA 4BQYA 2FCUA 5FY4A 4DXSA 1VBB2 3JXSA 4GWIA 1DDLA 3LEGA 4YM2A 2J1VA 2W91A 3FJSA 4NIGA 1QIQA 2C24A 4QPIC 1UU6A 2DF7A 4Z82A 3QH6A 1RUJ1 2ZJCA 3TYJA 1U12A 3LDBA 1UX6A 2VMCA 4CDUB 4M4PA 3RYRA 3PMSA 1VMFA 2CAUA 1ENSA 3WQ1A 1DQ5A 1MEC1 2D5FA 1BVP1 3POGA 4LO5B 4P9XA 2V5DA 1F8VA 1ZBA3 2BEOA 5FZ7A 1LRHA 1ODNA 1S1AA 2D6MA 1RUE2 4XE9A 2NQYA 2BGOA 1A34A 1AYM2 3NNGA 4JDNA 3SCGA 2BBVA 1W2OA 2IVJA 3ZXDA 4FOQA 2WDBA 2WWSA 1AR73 1O91A 3VDAA 2WAOA 4DIQA 3CJIC 4A7YA 4PBPA 2RJLA 1AL23 1DCSA 2VQTA 3GHNA 2YU2A 3R4DB 1XNCA 4BMEA 2HKXA 2YGLA 4I3PA 1BK1A 3I2DA 3ZXLA 3B02A 4KH9A 4IEZA 1VAMA 2VTXA 3LB9A 5FXXA 2OUJA 4HPKA 3L2HA 3N9OA 1YHFA 3J9SA 1DF0A 3OB8A 3J26N 5GLTA 3O0VA 3ZYBA 5FOBB 2R0HA 4LLFA 1ACCA 4B4QA 4RGAA 5GM0A 1HB2A 2WO7A 5I91A 2Y26A 2CU5A 4LA2A 4W6WA 1RITA 3R05A 4J6GA 2FDGA 4OI0A 2C5DA 3SH5A 1RXGA 3FMGA 5GALA 4I2OA 1CAWB 1QGLA 5DDJ2 4P9YA 1O3TA 1BBT1 1LHVA 4DZGA 3ZXJA 3PNAA 5JZGB 4Y5Z0 5FIXA 3PTYA 3PVEA 5JMOA 3MIBA 4Y22B 5JXHA 2DU0A 5JIUA 2CTVA 4ZKTB 4L9BA 1TNRA 2VCAA 4CDQB 4EZ4A 1OLRA 3IAPA 1OOPB 5CU1A 3GNEA 5FXZA 1JTZX 1FNYA 4COYA 4N9IA 1XB9A 4QX3A 2VH9A 2QUOA 2Z2SB 3JU9A 4CP0A 2DFCA 5JXIA 4OMDA 2ZPXA 4AR2A 4KBZA 3HEIA 3T0BA 1WGPA 2PHLA 1ZBA1 3WF2A 2RE9A 1K3IA 4DXZA 3ZPOA 2A6VA 4NIAA 4FPHA 4OVEA 5E8AA 1GWMA 2LM3A 2OVUA 5ABJC 2DWRA 1YIPA 1LJ7A 1EAH2 1BHGA 1ZZ9A 5F1RA 3RNSA 1KDMA 3AKQA 1LECA 1IG3A 3M3CA 3OPZA 2R16A 2WKKA 5HCHA 1AL21 1FMD2 2GP5A 4I09A 3ZFFA 1DQ1A 1TME1 4KBBA 3HT2A 4LLOA 2H6CA 2GC3A 5FPLA 3WLUA 4GJZA 2JIGA 5IAVA 4FOWA 2ZCWA 5FPXA 4LKSA 1LENA 1MPXA 3POSA 3NAPC 2YGMA 3IN9A 4IW3A 4AVCA 5C9AC 2WA3A 1J1LA 2IXKA 1HV0A 3UGHA 2XG3A 3C8XA 4IGQA 4LULA 3ZN6A 3AXDA 2VMEA 5KBFA 4D6RA 2JG8C 2XGXA 3D8CA 4QPGB 4DRRA 3V0AA 5L73A 4IUGA 4W4ZA 2BZDA 1OFSA 4QT6A 2PAKA 2R072 5C70A 3KGLA 1HJFA 2JG9B 2VVEA 1JYWA 4PDWC 4KGQA 4GMP1 1O6UA 4XJ9A 1IQDC 3FUQA 5FZ4A 2O14A 3AMNA 2Y64A 3PHMA 4P14A 5KHKA 4GULA 1JXNA 2JE8A 2P3IA 2VNVA 5L19A 3I59B 2JWPA 2CSGA 4XILA 1YNAA 1TMF3 4NMIA 1OT5A 1RINA 1NOVA 3V64A 3T1MA 4AGRA 4YWAA 2GP3A 4DY5A 1NAEA 3LIGA 3ZDSA 4XUOA 1MS8A 3LAGA 4URAA 5BNOA 1BMV1 1GOHA 3PL0A 1HJGA 5LK5A 2D6LX 5D2AA 1C8M2 4PBOA 4IEYA 1D4VB 2HWE1 1JZ2A 1G9AA 3LDKA 4E2GA 2Q5TA 5KXCA 3LCPA 1RHI3 1HV1A 4ATEA 2XLGA 3LPFA 4DEQA 1MQTA 1R1A2 3MLKA 4FCAA 4B7KA 2HYXA 4BQ3A 3HD8B 4E2SA 2XUMA 3OPWA 3UNPA 1WMFA 3VBRB 2DCZA 1JHJA 2FDJA 3ZFGB 1FPN1 1PGW2 3POBA 2VW1A 1KITA 1WD4A 2E33A 3LFIA 4XQ4A 5C9AA 4Y1YA 4LMFA 2B39A 3NWKA 2E53A 3HNMA 4Z1VA 4B1MA 2AGSA 4P9WA 1H9WA 2FZ2A 4FVVA 4QD2A 3OY8A 2VOKA 4AEJA 2GNBA 2QQWA 2AH2A 2ZGLA 3MEPA 5A80A 3AZYA 3R0RA 4TLGA 5FRAA 4QQHA 1MACA 2C26A 4DUXA 1MS1A 1O4TA 2WNEA 1KGYA 2WNUB 3ZFEC 5CISA 5IFPA 1SZBA 3ILNA 2VOWA 3N9QA 4M3CA 4PDWA 3TRSB 3Q8AA 4Z2AA 1XXNA 5LK7B 1H8VA 1A8MA 1BKZA 2VY0A 4CEYB 1FOD2 2WZR2 4QHOA 3K3NA 2JKXA 3HN3A 1AVBA 1CESA 1DGRA 1ZZ7A 4IEOA 5L9VA 2VBDA 1RVF1 4QB2A 5LCWL 4GH4A 4KG0A 2V73A 1VMHA 4W6YA 1AYN2 4GMP0 3A23A 1H8TA 1XYNA 3M2MA 4JHTA 1LU1A 1CX1A 2XXZA 5L7OA 3J8F2 3WHTA 3FWEA 5JIAA 5IK8A 1LOBA 4XBQA 1AR61 5BNQA 3OOXA 1W6MB 1DLLA 5F37A 4NJ4A 1CPNA 1UO9A 1NZCA 1QOTA 4LJHA 3NNLA 3LEKA 3VBFB 5CFCA 1NG0A 2VBPA 4CDWB 4FOVA 3HQRA 1RHI1 5A7QA 4AFDA 2ORXA 1S4CA 3TAYA 4XFCA 1PZ9A 4OUMA 1GQHA 2FD8A 1B35B 4LUKA 3WX5A 3WDUA 2WBKA 4P02B 2EALA 2GN3A 3BOPA 4CEWB 2LRPA 3T4VA 1ULOA 1PGL2 2VZUA 1S2EA 3P1IA 4AVVA 4XDPA 2BFUS 5FPZA 1O5UA 1Z7S3 3OF1A 1GBGA 5FYHA 4BK4A 5T55A 1WA4A 3OD4A 1KRIA 3WT3A 2BUKA 1GOFA 1VBE1 2ILMA 4ISQA 4QKDA 1NCRA 5LZ6A 5FZEA 4Q1RA 4QQOA 5LASA 4LKFA 3VV1A 5C3PA 2ET1A 3KSCA 3GGLA 1O7FA 4H14A 3KV9A 3NQHA 4FQZA 2MEV3 3I2IA 3OPTA 1QJY3 2DUOA 4I01A 4CP9B 1VBA1 4DOUA 5CFDC 4HG6B 1HQNA 1SHWB 3C7OA 3K4AA 4KU8A 4CTEA 5C4WA 5LRSA 2YC4A 1O3RA 4D7YA 2JICA 5FP9A 1AX2A 4ZU5A 3DL3A 3ENRA 4W6XA 3E97A 1OLMA 2JDHA 4OZXA 3THDA 5L36A 3OUJA 1GP4A 2YMZA 5CA6A 1J84A 2XDVA 5A6YA 4YPJA 3A0NA 3U78A 1LHOA 4AL9A 4DINB 4N90A 2WUHA 1KJRA 2Y60A 3N3HA 4HN0A 2ZEZA 5DZGA 2QFEA 3ABZA 1WBLA 1ZBE3 3GCXA 5B2GB 1AR93 1AR72 5FP7A 1R083 4JTOA 3MW4A 2JENA 1OA2A 2ZEWA 5H9PA 1FI2A 4HONA 3CBNA 2XJRA 1R64A 1XQNA 1REFA 1STMA 3POIA 3DN7A 3HNYM 5LEJA 1E5SA 1BLZA 3L2YA 4G3YC 5J96B 1UYPA 2IFRA 1E57A 5CKQA 2VULA 3WNLA 3OJBA 4K1YA 3WNMA 2PAEA 4UFIA 2VXRA 3VHNA 2W68A 3ZN4A 5A70A 4FSJA 4XCAA 4JC1A 2DFBA 2K2SA 1Z7S1 5A1FA 1G9FA 4AFAA 2X09A 1QJFA 5L9BA 1C28A 1POQA 2EXHA 4JCKA 5M0TA 1Z0HA 2VZPA 3ELNA 4QDQA 2C0ZA 3I7DA 4QU2A 5JSRA 1WMEA 3MZHA 5FZOB 1UOGA 4UFJA 1ULFA 4R52A 5A7OA 3BVCA 1QJY1 4JGYB 5CFDA 1XU2A 1JYIA 1PM4A 1W8WA 4WVMA 2B7YA 2B8MA 1W2NA 1WW5A 2YPDA 3KQRA 2VVFA 3NRUA 4QDSA 5GZFA 3RFRA 4BQ4A 2K9ZA 4GALA 1W04A 4NR1A 4D3WA 4HVQA 1GP5A 3WP5A 5CAZA 3SNMA 4P9GA 2OPWA 2OA2A 3GYDA 3KLSA 4AF9A 3N4MA 1AX1A 1QJX1 1OUSA 1ZRIA 2MHFA 2P1BA 1GMMA 1WW6A 1WKYA 4X8NA 3O5SA 3ZSKA 1RUF3 5JWPA 3H50A 3D3AA 5CG8A 2XLAA 4DB5A 4HOOA 2UURA 3LA3A 1UF2C 1MZEA 1S0DA 2RV9A 5A1LA 3BTZA 1RUG3 3M3OA 3AFKA 4M00A 4Q4X1 4RFRB 4V1PA 5BXXA 4MGYE 3LFMA 1O3QA 4AQ6A 4WM8C 1VBC3 1XNKA 1GFF2 3FUOA 2DVDA 3IDEA 4XUPA 2ZX2A 2Q4SA 1UW8A 5F3IA 1ND3B 2CHHA 4CXXA 1W6PA 4J25A 1IS5A 2UYBA 2XH6A 5LEKA 2W2IA 3VBUA 2A5ZA 2VJXA 1S0EA 2XOMA 4YZ5A 5C5TA 1H1IA 1UZYA 1CAVB 1S55A 1QU0A 5BNPC 3T08A 1BEV1 4JKMA 4ONUA 5LBFA 3VBSA 1VRH1 4TXWA 2A6XA 2VR4A 4GZ9A 4Y1XA 5HXMA 3RZMA 1VB4A 1XRUA 3G6JB 2QQVA 4NROA 5JOZA 2PELA 2HWF2 3HQUA 4NN0A 4YW5A 4BMBA 1WLDA 1JH5A 4Q8LA 4PLNA 3AL5A 1SFYA 3ZYPA 2TUNA 2WS93 1RB8G 2V72A 3ME2A 2XUEA 2FZ1A 1FX5A 3FLTA 4YVWC 4XC9A 3AVRA 3J4UH 5FKBA 1AF9A 1TMF2 1KD7A 3JB4C 3FLRA 3GXUA 4L99A 4N53C 2LROA 2BVVA 5T54A 2EIEA 4H7MA 5GLWA 2CDOA 4FBFA 1GSLA 5IAXA 3KT1A 2QNKA 4M01A 1NLRA 3IBMA 3USUB 1EUUA 5FUNA 2B4KA 4GA9A 3FBYA 2PXJA 4NPMA 5H9QA 4EN0A 2YPJA 4XUTA 4OUEA 2QZ3A 3NV3A 5D8AA 3RRDA 5BNNB 5IFTA 4YZ4A 4F8AA 2ZGTA 5LBBA 4GJYA 3LOBA 3T2OA 4V2WA 5FK8A 1NA1C 3PVBB 3WG1A 4WM8A 2VTFA 2P6HA 1JODA 5GZCA 5CVRA 1HXS3 4YW7A 3TN93 3AJYA 1YIFA 4UF0B 1LHWA 1A6CA 4QB6A 4OHYA 1B09A 3PU8A 5C5UA 3ITQA 1J3QA 1SBFA 4ET7A 5J7MA 1E5RA 4N7UA 1IS6A 1GKBA 1U5XA 1RL3A 4R9CA 1N3OA 3EXUA 1LESA 2AEYA 3I49A 5EQUA 2WZEA 2D7FA 3VZMA 3QD6A 1JOPA 1HW5A 1US3A 4Y1VA 4XVHA 3ZXAC 2X05A 4XFFA 3OD0A 2WZ8A 5DXDA 4AEDB 5CKMA 1ULGA 2VZ1A 2EVXA 2WSVA 4LIUA 5ERLA 5F5IA 5FYTA 4OI2A 3WD5A 2WO3A 3VBOC 3Q8CA 5EIYB 3I2FA 3I8TA 5ACA1 3H42B 3BTYA 2XONA 3RSJA 1NUKA 1AUYA 3WNNA 4K40A 3LF7A 3PDQA 4RR3B 1Y7BA 3INAA 4N43B 1AR83 1DGWA 3N7MA 1V6LA 3EBRA 4N53A 1LOFC 4PT6A 4RQPC 3ZIXA 5KXBA 2FDKA 4LHNA 1O5LA 2IXHA 1DFQA 1HRI1 5IK4A 3ZM8A 1COV2 3WOGA 4RHV1 4S2FA 1S0IA 4C8DA 4I02A 2G9FA 1GZTA 2JE9A 4MXWA 3IM0A 3WF0A 4R8HA 4KWUA 3MHZA 3OGJA 1LOAA 4BLIA 3H8UA 4Y20A 1DG6A 3HNBM 2XVKA 4AI9A 3VBHC 2XR4A 2NN8A 1SCSA 2JDKA 1VB2A 5A32B 2VZRA 1O8SA 1SG3A 3OBZA 5C8CB 4Q29A 2JD9A 2BV4A 2DBNA 3P6BA 1HXS1 4KWKA 5FV3A 1T6BX 1CZTA 1GZCA 1Q43A 4RS5C 2Z42A 3OGVA 4J1WA 4UI9L 4M4RA 2ZX1A 5KHGA 2ARAA 3AP5A 3MPBA 2XL9A 3H3ZA 1BXHA 1UIJA 1DHKB 3MUY1 3VZJA 1K42A 1F4AA 3RZLA 2UWCA 2Y38A 1QKQA 2YYOA 3N7LA 1I6XA 5A7WB 1OHFA 4CDUC 5HV0A 2MEV2 2VQ0A 2JDAA 5DABA 3T3YA 5EFUA 1EV12 3VBOA 3OEBA 2TEPA 4WZFA 5FREA 5I0DA 5C3RA 3RJ2X 5FK7A 4KG8A 2K46A 5JXJA 4FPLA 3GHMA 4GXLA 2RS53 4YSFA 1L7QA 4NPLA 5C71A 1AR81 4AHYA 4QKBA 4MO3M 4D94A 5I0RA 2OW4A 3R4SA 1LOFA 2Q8EA 4B4RA 4ES8A 3SKVA 1ND2A 3VD4A 3WF1A 2A3WA 5DN2A 4NWWA 2RS13 3ZSJA 1OQ1A 1LB2A 2E31A 1G9BA 2YFZA 4IE6A 4D8MA 4LO8A 4LBJA 4IEPA 1ZBE2 3KVBA 5AFBA 1AR92 4JDMA 1ZREA 1IS3A 2XBO2 2YB7A 1R082 4KGGA 4UBGA 4E27A 4K7JA 4CPBA 3N35A 4URTA 1PGSA 2OX0A 1XNTA 4ZU4A 4CXWA 4Q1PA 1NYWA 4YG6A 3GZEA 5LA0A 4NRQA 2D43A 4LNVA 5JI7A 5JR2A 4Q0PA 4Q26A 2QQMA 1PVC1 3T09A 1EY2A 2CAVA 5BYNA 1SLCA 3JD72 2RDNA 5JZGC 1ZZCA 2XWBB 2VUJA 3HR9A 1H6XA 1NLQA 4KL1A 2NMOA 4X8PA 4AHWA 1W9YA 1RIRA 2GMMA 2WWUA 1QNWA 4FPYA 4Y3OA 5TSWA 3ZSEA 4COWA 3JZVA 5J1XA 1RUC1 4JDOA 4CDQC 1NY72 3POEA 1OOPC 1ZA4A 2D6OX 2D3RA 2W5FA 2X5IB 2OZJA 3DEMA 2GAUA 3VD7A 1JBCA 1GZWA 4SBVA 1HN0A 4NIDA 2HWD3 1GICA 2WC2A 2WT2A 4F7ZA 1O4YA 4LXLA 2D3PA 4QXBA 4S2DA 4XMAA 1PZ8A 1W8OA 5GLVA 3VDDC 2WO1A 2PA7A 4LPLA 4AYUA 1RUJ3 4F3JA 1SQ4A 2RS51 3MGUA 4JQTA 5DUWA 3SEPA 3WVJA 1MEC3 3SXWA 3W5MA 3AMQA 3AMHA 4XMIA 3KCCA 1XSQA 1RUF2 5CIRA 3S5AA 3ON7A 4ASLA 3EQEA 5FP8A 3ZXGA 2WFF2 1WD3A 2WNVA 4U2AA 1AJKA 1D0GA 1RMU2 1RUG2 3BI3A 4QHBA 2VPVA 3VKOA 4NVPA 4Q0SA 4NAOA 4XF0A 3FL7A 3V65A 5ISLA 4H2AA 4HKOA 4WVVA 3IIIA 4CCKA 1VBC2 2DBIA 2W46A 1OKOA 2ADDA 1BK0A 3AP4A 3I3EA 4G9SB 4K8RB 1GU3A 4AOCA 3B00A 4LBKA 3K3OA 1XJAA 2B9VA 3AJZA 4DQAA 1DZRA 1U5IA 2ATFA 4QGLA 1LAJA 1D2SA 4IV1B 1UAIA 1K12A 3FFQA 3HVDA 4AEKA 3W5NA 3LA7A 3FFZA 4ZONA 2JG9C 1W9WA 1CZVA 5LW9A 2CYFA 3VZOA 2I74A 1A3KA 1QJU1 1LEMA 2UWBA 4YZ1A 3IDAA 1UU5A 2VMIA 3EO6A 4XFAA 4Y22A 4GQ7A 1NCQB 2ZMNA 4HANA 1H4GA 5DZEA 4ASKA 5CYYA 5FLJA 2ETEA 2GALA 4QPWA 5HXVA 4FFFA 2AEZA 3MLLA 3DECA 4CPBD 2Y6LA 2A75A 3PUIA 2HWD1 1BBT3 3APBA 1ST8A 3AXEA 1AL0G 3Q9OA 1MVEA 2WS92 1JU3A 1KS5A 1X8EA 4CDXA 3VHRA 1UYYA 2YHJA 1CGPA 1GQPA 3EB7A 1W0PA 4NHKA 5SV8A 2RDSA 1OUXA 5CNAA 3VDDA 2G9ZA 3IPVB 2WYFA 4ZXKA 4XJWA 4ZXEA 1Y4WA 3PTRB 1X8MA 3C2UA 2QTWB 1W8ZA 1XNAA 3MIDA 2GSYA 2RR12 4YM1A 1OA3A 4ZZ5A 1SPPB 3VZNA 1ULEA 1CZSA 1R1ZA 3PVNA 1V6IA 5F6LB 4QXHA 4LUMA 3WCSA 1UL9A 2OQ7A 3RMXA 1CWPA 1W8FA 2CWMA 3VBRC 2PLV1 3FHIB 3ZFGC 4AVSA 4QWNA 5JDBA 3TBDA 2HWC3 2ZS6B 4Q2FA 3TN92 3V56A 5FMDA 2WZR1 2GNDA 1TME3 3N36A 4HZFA 5FFOC 3O1RA 4FPOB 3EYPA 3SH3A 1RUH3 3DPRB 1W0NA 2O0OA 5AC92 5KHJA 4HK8A 2VECA 2Y0OA 4Q4W2 3ES4A 2ZGMA 5FY5A 4CYDA 3TEYA 1WUVA 2VZQA 1PNGA 4YARA 2P3JA 2WNUC 1W6QA 4MYEA 1IZ3A 1WCDJ 5FMCA 4CEYC 3MUZ1 5FZCA 5FZ8A 4AK3A 2BW8A 2WIIB 5GJ6A 1A78A 4O7XA 2BNOA 4CUBA 3IDBB 3DF0A 4QX7A 3D4KA 2Y33A 2WABA 1U5YA 4GMP3 1FAYA 3H3UA 4UW5A 4LHSA 4QPIA 3VZLA 3ZIWA 5F2WA 4AI3A 1PO22 2H6BA 5G04L 5JXGA 1RJ7A 3ATGA 4XXAA 3I3DA 3VBFC 4CDWC 4AEMA 4CU6A 4AFMA 2H0BA 3OGRA 4FI9A 5FQ0B 3ZYIB 3N7JA 1GP6A 2VZVA 1GQGA 1SCRA 3HAGA 1B35C 3ZDVA 3H9AA 4HFSA 1DGWX 4PF5A 1V70A 2V4AA 3WDVA 4CEWC 3AZWA 1HRV3 2P3KA 1W03A 1IKQA 3VBRA 2HWE3 4ZZ8A 3CNAA 4IESA 4TZDA 5J3UA 2HWC1 1D4M3 3DV8A 4XQDA 3CJIA 1LKNA 5EYXA 1FT9A 1CQ9A 3GM8A 4BWOA 1W2UA 1RUH1 2XKOA 4DS0A 3RDIA 4PI2A 5FP3A 4JGZB 3OUIA 1CJPA 1JYNA 1XC6A 2WJSA 1OD3A 1FPN3 1PK6C 1AXYA 1XE8A 2YC0A 3KCXA 2JEMA 1V9U2 1V6JA 2EXKA 4WVZA 1JYXA 2VAUA 3BKZA 3JBG3 2ZA9A 1OLQA 2ARXA 4HN1A 4LORA 2WT1A 4JKKA 4YW2A 1T2XA 1VMJA 4CUAA 1F5JA 4AZZA 1W28A 2F17A 3B9IA 3PUHA 5ANNA 4ZHNA 2R7EB 4D7SA 3VB9A 1OXCA 1UYZA 2X10A 4K3UA 1W3XA 2XJUA 4QM9A 1WCQA 5DAVA 5F5AA 5IWFA 3GJBA 5LBCA 1UZVA 1L7RA 3RZGA 4ISRA 2W52A 1OA4A 3GALA 4BPZA 3KV5A 4MVTA 5E1RA 2W92A 3O0XA 2RMU1 1RVF3 1ZZBA 1ODMA 3UYJA 1BQPA 4W50A 1FV3A 4DPNA 2RS12 5FUIA 2GH8A 3HWJA 4GB32 3TNPB 3SCHA 2ZXQA 4LK7A 2FDHA 4HPKB 4YG0A 5EJZB 2LUWA 1AR63 1B35A 1QMJA 1W8UA 2QQOA 4Q4Y2 3K46A 1HRV1 3H1WA 4YZ2A 2B5HA 4CCJA 5ABJA 1JZ8A 5FZ3A 4A6OA 2I2SA 1OH3A 4PI0A 3AKRA 1S0FA 2ZBJA 1BCXA 3IKWA 2QQPA 1D4M1 2ENRA 1QQP2 4FTEA 4YW4A 1C3HA 1NE6A 4UT5A 4Y4RA 4MX3A 3S5QA 4CCCA 4EN8B 1C4RA 4UXAA 5EHDA 5FXVA 5FZ1A 3T2QA 3JQXA 4OFGA 2FDIA 2HWB2 2VZ3A 3KB5A 3NAPA 1HX6A 2D6KA 2DCTA 1PK6A 1REEA 2LW8A 4JGYC 2SLIA 1QNYA 3JBG1 4COVA 4E8CA 1QHDA 5FZ9A 4W65A 1OLME 5A3UA 5HV4A 1VBE3 4Y24A 2WLQA 2J1SA 3OTFA 4Y4YA 2BPA2 2JG8A 2PMWB 3MBWA 3FE5A 4XF4A 1AXKA 2BDRA 4CCOA 5CBLA 1WMXA 4NHXA 2ZMKA 1ZRDA 1VBA3 4I3GA 1QEXA 4LKEA 5F9TA 1QXPA 2W9XA 2C4XA 2H0VA 1YC61 1BZWA 2YXSA 1RUJ2 3MIGA 1PO11 3C3VA 4L97A 1OSGA 3T2TA 3U07A 1UZ0A 4D0QA 1MEC2 1WW4A 3ZFFB 2P4EA 1R093 4MGZE 4OZOA 4BXFA 1UCXA 1SDDB 1XE0A 1POV0 2QCSB 1ZYBA 2VMGA 2E7TA 3CF6E 4NAMA 4Q4V1 4IL7A 3ZXFA 4A44A 1W2TA 5FLHA 1ND3C 1QJEA 2ZZQA 1U5ZA 4I0AA 3PJQA 3E6DA 4IV3C 1J3PA 2BFUL 1O59A 4XIOA 4LBQA 2X53S 4UBHA 5A7PA 3ZN6B 1PZ7A 4RFT0 1Y9QA 2OS2A 3QOPA 1SLIA 2E32A 1BJQA 4XTMA 3QH7A 3WNPA 3V0AB 1W6NB 4EV0A 4MOAA 1MS5A 3DUIA 1OBNA 1N3QA 1FXZA 2R061 3I3BA 4RGGA 1VBD3 4MG2A 1DYKA 1IS4A 2DVAA 2VTXJ 4HVRA 2FCTA 2AENA 3G7DA 4DUWA 3D6EA 5I0UA 2AREA 5FZAA 1S2KA 4XFGA 5DG1A 3SQOA 1OFNA 3K48A 4TSVA 4XFBA 3SC7X 2ZHNA 1DIWA 4Q0VA 4R9BA 2XHKA 3GZUC 3WCRA 1WLWA 3ZVXA 3U4SA 3BUCA 5DUXA 4GWJA 2P2KA 1BBT2 2XL7A 3LD8A 5BNOB 1ASJ3 3BPZA 1W8TA 3O0WA 1YFYA 4FXKB 1YWKA 1FYUA 1V00A 2BWAA 4Y26A 3MF6A 1YFUA 3ZFEA 4PIZA 5FZLA 1PIV1 1ONAA 5JOXA 1CN1A 1M4WA 4UYBA 4YRDA 5DAWA 5FZBA 2KA3A 4Y5TA 2RS31 4FXGB 4CUCA 5BNNC 1J3RA 3WXPA 1MQTB 2KD7A 5K7PA 1XSRA 2WN2A 1NKGA 2RM23 2GNMA 1R091 1ZBA2 2ID4A 1QDOA 1TEIA 4P00B 4UW3A 1QJX3 3C7FA 3VKLA 4C90A 2OT7A 2VMHA 2DTYA 4YGEA 3O1OA 2B45X 2Y6KA 2Z5WA 3OGGA 5CKNA 1W99A 2YBPA 1XPWA 3FHQA 5KHHA 2PTMA 4AI1A 3OEAA 5A6XA 4IV3A 2OXBA 3O1SA 4Q4X3 3CKHA 5FY9A 3CEWA 3ACFA 3KD4A 2ZGPA 1AL22 1RUD3 3H0OA 1TME2 2HEWF 2A7AA 3OY8B 4OYUA 3S0MA 4FFHA 1VALA 1MZFA 1PNFA 2Q0AA 3S7EA 3FN9A 1VBD1 1JYCA 2A1XA 3N9LA 4AEDC 4FO9A 4Q5OA 3AMMA 1H1AA 3D0JA 1UY1A 4M3CB 4PDWB 4RSUA 5C8WA 1RC6A 5KXEA 3V0BA 4QMAA 1C8NA 2ZKNA 4CCEA 4ITCA 2PHWA 2QQUA 2W1SA 3AK0A 4UWDA 1YLLA 4CU7A 5A3LA 3I2OA 1BEV3 1VRH3 2GZWA 2WFPA 3MV01 3X29B 3ZMOA 1IPJA 4GH4B 2E51A 4RR3C 5JAXA 5LA1A 4NE9A 3F95A 4QX2A 3UJQA 4N43C 1H8TB 1UKGA 1V6NA 2WAAA 4WM7C 1ASJ1 3ZXEA 1UPSA 2J1RA 5L7OB 3BU0A 5FPUA 4BYYA 4UFMA 4Y1ZA 5F2SA 2XJVA 1LOCA 3MFCA 5CADA 3LGRA 1D0HA 5CFCB 4FFIA 2BGPA 2WA4A 2I45A 2OQ6A 4HLTA 4PF1A 5K8SA 3DYPA 5BNNA 2YBKA 3VL8A 3NV4A 2F4PA 3WZ1A 2RM21 5C8CC 1JZ3A 1SFNA 3LA2A 3M3IA 1BMV2 1JS9A 1JHNA 4O9GA 1ZRRA 5FJHA 1QH7A 1DQ6A 4PHZA 4CA9A 3PIJA 4JHZA 2HWE2 4RYDA 4XEZA 4UFLA 3SLIA 3ST7A 4XAEA 2RDQA 2ZABA 2JDMA 1Q8QA 4BH9A 1YO8A 1UXXX 3A7QA 4LO7A 1RUD1 5I0TA 1F15A 1NCRB 4A42A 2IWGB 5IYYA 2NM1A 2YFUA 3ECQA 3D0SA 4F83A 4FTSA 2JDUA 2NP0A 3AB0A 3W21A 3H1MA 1HLCA 4HL0A 4AVBA 2JDNA 2GN7A 2WZPP 4BM8A 4YVSC 4AEDA 1FPN2 3ZYGA 4QQLA 3RQ0A 1O8PA 2BGCA 1GWLA 3DKQA 4BOWA 3EMRA 4PLMA 2R041 5FYUA 3ZSLA 4BU2A 3ORJA 5C4WB 1JN2P 1DBNA 3OUHA 2ZEXA 1J59A 1O3SA 1OURA 2Y6HA 4DFSA 4U36A 5F5CA 4OQ8A 1RUI1 1OMIA 1ZZ6A 5FYBA 2LTNA 4J1XA 3C7GA 1KDKA 2F6BA 5T5PA 4WM7A 4CP2A 1MS9A 3VLBB 4AQ2A 5ACA3 1LR5A 3H3LA 2IC1A 4MGQA 2AYHA 1CIYA 1ZX5A 4LOTA 3Q8BA 4AG4A 2YY1A 4BHPA 3LWCA 1H9PA 4IXLA 1RVF2 3UGGA 1APNA 3MV11 2X29A 2VOTA 3KHBA 2A6WA 3LE0A 4L8QA 1KJLA 2OIIA 4XJZA 4MLOA 4EWAA 1W9TA 2C1FA 2J1UA 5FUPA 1HRI3 5AVAA 4RHV3 5A32A 1JI6A 2DVGA 4N8MA 4ZY9A 4LIVA 4BQ1A 1AR62 2A6ZA 1Q8PA 2MNGA 2JECA 3PURA 1VP6A 1QY4A 2KM2A 3ROUA 4RL7A 3UT0A 4AXOA 1CAUA 2A3YA 3EHKA 3ZYFA 3KWVA 4NPRA 2ZX4A 5FZKA 1RHI2 1SLTA 2P37A 2ZMLA 1G9CA 3B5LB 2ZOEB 3BCWA 2SBAA 2QKDA 2O8QA 4MGKE 3A4UA 2JDPA 3POYA 3JB8A 3JQWA 2VG9A 2X5IC 4XIKA 3WUCA 1L7LA 5CFDB 4HSLA 5A7WA 4YVSA 2CWSA 2OPKA 2IVIB 2GDFA 3NW4A 4WVMB 3BOWA 3E6BA 3GBFA 4A4AA 2TNFA 3ZKUA 2ZKLA 4A2UA 5IVEA 5LY2A 2EXJA 5BNPA 1VBE2 1RMU1 3IWZA 2WO2A 5FR3A 5F6KA 3NJXA 1Q8VA 3I2HA 1OQDA 3MW3A 4KWLA 4GWNA 4XF3A 1GZ9A 3R4UA 3H7JA 1ENXA 2G19A 1UPIA 1VBA2 4NHMA 1HB3A 4P5HA 1NLSA 1H2NA 1UYXA 2NYYA 1N47A 2XJTA 5KC5A 3P3NA 1K5MC 4XFHA 4QKFA 1K45A 1ZZ8A 1Q3EA 4YVWA 1HKDA 3U1XA 5LY1A 2WSUA 1H2MA 1ENRA 3QLQA 1YUDA 5FOJB 3HMYA 4JAAA 4QXKA 4XJUA 2VC9A 2WQ4A 2E9QA 3AC0A 3VKNA 1W6PB 3ZOIA 2R30A 2VXJA 2WT0A 4M0NA 4R4XA 3SITA 3VBUB 1LODA 4PCRA 4COUA 1BVVA 2Y6GA 5DDJ3 5FYZA 3WSOA 4AFBA 1CAXA 4R9AA 5HI0A 2Z4FA 2DVFA 4IV1C 4QU1A 4L11A 4IE7A 3MIEA 4I30A 1KFUL 2XJSA 4JZRA 4QX8A 2ZHKA 1QJZA 5T5JA 3VBSB 1VBB1 4EN6B 2W3JA 4CCLA 4NRMA 3J7MA 3KM5A 2VMDA 1NA1A 4FPKA 5LWBA 5DMYA 1NCQC 1WCSA 4KMQA 3NNFA 4LBNA 4MHRA 3BTAA 2UU8A 3W20A 4D69A 4MXVA 2BNNA 4OHXA 5H9SA 1PVC3 5CB7A 3WHUA 2HH9A 4JTNA 3UL2A 5FXWA 3J7HA 1Z7S2 3PLQA 5J36A 5GKAC 4LE3A 1RUE1 3E1F1 1EYBA 3U14A 4E4ZA 1RUC3 4E4HA 1AYM1 2D44A 1EAH3 4QGNA 2DCJA 3NJVA 4H7LA 5C3QA 2L9LA 3RWNA 1YEWA 5FWJA 1G8WA 1QJY2 2FCVA 2XJPA 1V6KA 2ZZJA 2OUHA 1FMD3 1W06A 2PQSA 3LQCA 3MIFA 4JRLA 3IIAA 4RD7A 5D8AB 4IEWA 4P9IA 5IVYA 3WEZA 5AC91 3B69A 4EN9B 2WLPA 2A3XA 3U0ZA 2C9AA 5FY0A 1K5MA 2A71A 3K4DA 2VW2A 3AYDA 3KVAA 3OYWA 4XJ8A 2JJ6A 5FYYA 2G1MA 1QJX2 4E9KA 4RQPA 1H1MA 2YUEA 1JW6A 2JB8A 2XPJA 1SBEA 3UETA 3NNMA 4AVTA 1X36A 4LBLA 3NNJA 1GNYA 4QQ2A 1M06G 1P8JA 2R1BA 4LHKA 5DDJ1 2R073 3MICA 1C1LA 3HBZA 4Q4X2 4E4SA 4IV1A 1RUOA 3FBMA 1W0OA 1G6NA 1NQDA 5J98B 3WW3A 3AVSA 2VVDA 5IHRA 4QX0A 1YQ5A 4LR4A 3VBHA 3LEMA 1SLAA 2NMNA 4LBMA 5GZGA 3AL6A
chains in the Genus database with same CATH topology
3KS7A 5K0UB 4XYXA 3DKWA 3RPQA 2PHXA 4AQTA 1IOAA 3E6CC 1MVQA 4YW1A 1LU2A 5BPXA 3U10A 1JOJA 1W6OA 4RS5A 4EN7B 1QJU3 1BEV2 2DTWA 5JMCA 2IXLA 4ATFA 4INDA 4N53B 1KQRA 1LTEA 5CG9A 1EAH1 3ALQA 1GNZA 1S2BA 1SMVA 2BQPA 1PM7A 1H4HA 4CDUA 3AKPA 4MXWB 1OI6A 1R1A3 4AFCA 1FMD1 1UIKA 4DRVA 5I8TA 2BWCA 1DGLA 2CGPA 4Y20B 1Y3TA 2B42B 2ZGQA 3B7MA 4LHLA 3WDYA 4KNCA 4EWEA 2EIGA 4K20A 5E16A 1VAKA 4NWVA 4XTPA 2PAMA 2A6YA 1XNBA 3WP6A 2R071 4JGZC 4OUSA 3W58A 4A7ZA 2PLV3 2PYTA 4JVAA 3GZAA 1SACA 3JCIA 4XBLA 2P34A 2WZR3 4S2GA 2ZTNA 4QPGC 3MDPA 1KXGA 3THPA 3VBOB 3EJKA 1CAWA 1AYN3 2CV6A 4GB31 2D98A 5JZGA 3ETQA 4MSVA 4SLIA 3UKVA 5GLUA 2ERFA 1IGOA 3MW2A 4Q4Y1 2R1DA 2X8KA 4CDQA 1AJOA 1DQ4A 1C8M1 1ND2B 1OOPA 3AP6A 1TNFA 1PHMA 1R1A1 1I5ZA 2DUPA 2VOXA 5IT6A 5A33B 2MPFA 5FDBA 2BYVE 2BTVC 3FX3A 4B7EA 1PVXA 1LHUA 4AI0A 2ZX3A 1PGW1 5HCAA 1IKPA 2AZ5A 1HRI2 3UKNA 4RHV2 3KMHA 1LULA 3WW2A 1MS3A 3CLPA 2GMPA 4X6RB 3USSA 3WR0A 4JGZA 1OD5A 1XNDA 3FZ3A 2Z69A 1S0CA 2QJVA 2VNGA 3ASIA 2ZHMA 3H7YA 1HXS2 1OQEA 2E7AA 1GZWB 1FOD1 3GF6A 3MPPG 2ZGSA 3AZVA 3NVCA 1U0AA 1HDKA 2JX9A 5AFEA 1MZ5A 4QPGA 2DV9A 5DUUA 1W39A 1AYN1 4AGVA 2JG9A 1LHNA 3J8F1 4PIXA 1LGNA 5KXDA 1YI9A 3RYKA 1C1FA 4AI2A 1MZ6A 1CD3G 3HT1A 3NKTA 5BY5A 3I59A 1XYOA 2GU9A 3URFA 3ZFFC 5DG2A 1CJDA 4ES9A 3WDXA 2WNVB 2NZ9A 1MR5A 1C5HA 4MUVA 4C1WA 2D97A 1DZQA 2VOVA 1POV3 2KXLA 1LGBA 5EXOA 1AR82 1NXMA 5T5OA 1EPZA 1PGL1 2RMU3 1V6MA 2N7GA 4LT5A 4BE3A 4Q0QA 2JXAA 1CX4A 1G7YA 3RS6A 4OLLA 3WQ0A 2K0GA 1SLLA 3WUDA 4IETA 5JLVA 4PJYA 5GLZA 2VW0A 3AYEA 4WBBA 1CVNA 3ZFGA 4OI1A 3B9CA 4HMZA 1XYPA 1QDCA 2GNTA 3AKTA 1VJ2A 2VNOA 3KT4A 4YZ3A 4Q8KA 3LSDA 1CPMA 3I4IA 3ILFA 5FLIA 5JPMB 2ES3A 2EXIA 5FBZA 4A3XA 5FTTC 1PVC2 4PLOA 4CZSA 2CGOA 3MF9A 3IDCB 2WINB 4M3CE 4CDXB 1ZVFA 5BNOC 5KBFA 2NLRA 5IUQA 4QPYA 2ARBA 2WL1A 3VDDB 3AYAA 2WNUA 1RUC2 2DCKA 3SCFA 1S0GA 3UJOA 3K51A 1D2QA 4CEYA 1AR71 2Q1MA 3E5XA 4L92A 4BA6A 1MQTC 4AHXA 4LTAA 1X50A 2VUAA 4AGGA 5J48A 2OYZA 2ET7A 4QM8A 5IK7A 2YV8A 2RS52 1PO13 1POV1 1W6MA 4YG3A 1N1YA 4FP2A 3MI8A 2PHRA 3VKFC 5JSPA 4FPCA 2DYCA 3VBFA 4KQ7A 4Y1UA 4CDWA 1SLBA 2IXIA 2PHTA 1RJ8A 3RYPA 4G4FA 2XVLA 1HQLA 1W6NA 4Q4V3 2PN5A 1C57A 4META 1WLTA 2HWF3 4LA3A 3PMEA 2E63A 1W6QB 4CEWA 1GNHA 2VGDA 4LO6B 2XB6C 4QQPA 3ZN5A 3GBWA 1YYNA 2ZAAA 3JUUA 5BV6A 1EPWA 1XU1A 4QX5A 3W9AA 2UY9A 3ZPYA 2R063 4GH4C 1KFXL 4JV4A 4KU7A 2ZACA 1H8TC 3D82A 1YFWA 1ULDA 3WINE 5L7OC 5T50A 4O9EA 2A73B 1QJU2 3FLPA 4QPIB 5CFCC 2O8OA 3E5UA 5FMOL 2HWD2 1GV9A 1AX0A 1Y43B 5FO7B 2GC2A 2EAKA 5T52A 3VKMA 2V5YA 4B4PA 3LZZA 5E89A 1Q5OA 2IXCA 2UWAA 1ENQA 1PIV3 2ZAHA 2RHPA 5EWSA 4C0BA 3NKGA 1SBDA 2RS33 4HSJA 4GIQA 3CJIB 5A3MA 2UYAA 2CL2A 3LKJA 5AVPA 4FT8A 4XETA 1NCRC 5FMOS 1Q56A 1UD1A 2G9GA 2G4IA 2HWF1 4XPVA 2PLV2 1BYHA 4TYSA 3AKSA 2Z79A 4FQ4A 1O4ZA 5C4WC 2W08A 3PVOA 4M0HA 4I0BA 4E4DX 4H3WA 2JE7A 1G86A 3AP9A 2JD4A 4K8FA 3CL1A 3NV2A 3TB0A 3D5OA 1TMF1 4H55A 1WW7A 3ES1A 4QGMA 1GYKA 1COV3 2GMEA 4L2NA 4OHZA 2PHUA 1H0BA 4JGYA 4AE2A 2XJQA 5FCCA 1MS0A 4Q0UA 1J58A 4RA0A 1NE4A 3M1HA 4XDQA 4HKWA 5F5QA 5KC6A 1QF3A 3RI9A 1QOSA 5JCTA 4XJAA 3UV9A 4AI8A 3KZ4C 3O14A 5ABJB 5K9YA 4M3CF 4FTBA 4K1ZA 1DQ0A 1YRZA 1F2NA 4IQPA 1ZNPA 3AZXA 1YFXA 2IZWA 3RI8A 1REDA 3OCPA 3ILRA 5I0SA 1IPKA 3AZZA 3BALA 1FV2A 3NAPB 1KS4A 1ND3A 3A0KA 3WNXA 1PK6B 3CJXA 3S6PA 4FAGA 3WDWA 5C9AB 2HWC2 2PFWA 1EV13 1CR7A 5I8SA 2D6NA 5GZEA 2YDEA 5C33A 1FNZA 1CAVA 2JG8B 3HN1A 4XF9A 1RUH2 4FPGA 2DURA 2ZGUA 3LSEA 4MZUA 4IEUA 4PQ9A 3O12A 5EYYA 2WQZC 5EZWA 3AFGA 1COV1 2R043 3FC0A 4DMIA 1J1TA 4YGCA 1DU3D 1RUI3 2QE3A 2XBO3 1WCKA 4AHZA 4LBQD 1G9DA 3MFAA 3DGTA 3QCWA 4E2QA 2VNRA 3AYCA 2UY8A 1YCIA 1ULCA 4PIYA 3AX4A 5KWRA 3N7KA 3VBUC 3USUA 4LBQB 1ZRCA 4NO4A 3ZYJB 3JD73 2FMDA 2RMU2 3VBSC 4A7KA 1QH6A 5J09A 2D5HA 5I8YA 4GKYA 5JR7B 1QWRA 4COZA 1ZRFA 1FATA 1N1VA 4MH0E 3WV6A 4NOTA 3TOJA 2VU9A 4TWTA 3PJYA 3SH4A 5T3NA 4WZCA 1HRV2 3NJZA 3KCYA 3M70A 2MEV1 1N3PA 1X7NA 1NQJA 1YI7A 2ZGKA 3RJRA 2FBEA 1EV11 2NPIA 1D4M2 5GZDA 5T5LA 1X82A 2GC1A 1Z78A 4WV8A 4R9DA 1HIXA 1JUHA 1RTVA 2YZ4A 3ZFEB 3H1YA 3LOIA 3JBG2 4XBNA 2HYKA 5D8AC 2PQQA 2WFF3 4B3NA 1ZBE1 2RJKA 1RMU3 1AR91 4K9SA 1UKRA 2XBO1 1R081 4XHXA 2FHRA 2FMYA 1WLCA 4WVWA 2HJIA 2VQAA 4RR3A 5H9RA 2IXJA 4N43A 4LE4A 4ZU7A 3IMNA 4BZ4A 1T6GC 4CP1A 3VZKA 2EF6A 3B01A 4IV3B 3OBRA 4Z8BA 1PO12 2DUQA 1TE1B 5SV5A 2CY6A 2B46X 3JD71 3GBGA 3O7OA 4DNYA 2QDNA 4GKXA 2OZ6A 5JOYA 1LOEA 4Q4V2 4YYOA 3THTA 5C8CA 4IERA 5K0UC 1NY71 3VGIA 2JKBA 1H2LA 3NO8A 4FOYA 3TNQA 4BIOA 3V0BB 2BNMA 4HT1T 1H30A 4N7IA 2R6QA 2ZX0A 3ZMNA 1VBB3 3B94A 1CONA 3RMYA 4XHBA 4DY3A 2R062 1S0BA 1MS4A 4XZPA 3IT8A 4Q27A 2I07B 3AP7A 1OPOA 3KT7A 3MIHA 2FQPA 4I0WB 5JVVA 2RR13 2XLFA 2Q8OA 1DYPA 1RUF1 1DQ2A 2AUYA 4HETA 1RUE3 2WFF1 1VIWB 5JI9A 1AYM3 1RUG1 2XWJB 4XXPA 2LALA 3S7IA 1UMZA 4P9JA 4YFWA 1UZZA 1VBC1 4D7TA 2GC0A 1YJKA 2EAAA 3NSTA 2XVGA 3WQ7A 5EV7A 1QOOA 1PIV2 2QVSB 5KHIA 5AC93 3VHPA 1F31A 4BIFA 2RS32 2B9UA 4Q4W3 2HEYF 1VR3A 4KWJA 1R092 4XF1A 5HBAA 3SHRA 4Z92B 4BCUA 1S0JA 1UN1A 3CO2A 3WDTA 4IEQA 2Y0IA 4K6BA 5K0UA 3WG2A 3VHOA 5FO8B 3M3QA 2WS91 2QDRA 3AM2A 2ZHLA 2DVBA 5LRRA 5JSOA 1F9KA 1NXD1 4NHLA 1A8DA 1VBD2 1OPMA 3BIWE 3CU7A 1PO23 4OHVA 4OHWA 4WM7B 4YGBA 5D1IA 1ND2C 5JPNB 1H2KA 2X5IA 4IEVA 3WP4A 1EP0A 1YJLA 2RR11 3VUOA 4HBNA 3BB6A 3M7AA 1F5FA 2O1QA 4XW3A 3B93A 2JDZA 3ZX7A 1QXJA 3WW1A 1ZM1A 1LGCA 1YXWA 3NL1A 1ASJ2 4K21A 2ZGOA 4YFZA 4C0HA 2D6PA 3RG0A 3TN91 4Z2WA 4ORFA 3UKTA 1CAUB 3QACA 4MV2A 3BODA 5E88A 4Q4W1 1XE7A 4YGDA 3HQXA 4S2HA 2ZGNA 5C6CA 4WM8B 3T1LA 4GWMA 1V9U3 2RM22 2HEVF 1SEFA 2D40A 1AZDA 4AVAA 2R49A 4YVSB 3DPRC 3M8LA 1Q8OA 4B8EA 4FP3A 4EJRA 2W39A 4EROA 3L9JT 5BNPB 4JQRA 1RUD2 3E5QA 4P9LA 3POWA 5JOWA 3U11A 2EA7A 2TBVA 2Q30A 3ZXKA 1PMIA 1I3HA 4MGIE 3W59A 1NCQA 1PO21 4LEJA 4OI4A 3MYXA 1DGRN 4FPEA 1IHMA 4HKLA 1URXA 4TLFA 1LCLA 2R042 1V6OA 2WNVC 4GB33 3TWIA 1GANA 4FPFA 4YVWB 1VRH2 1RUI2 2W0XA 4Q4Y3 5EJ3A 5A33A 1DZTA 1C8M3 1I9RA 3IPVA 4FAHA 3M4FA 2XKPA 5DZFA 1GR3A 4HK9A 1QQP3 5FAXA 1CAXB 5HCBA 4IEXA 4UW4A 2P17A 1HQWA 2AR6A 2V09A 1OKQA 2Q1ZB 3KGZA 4Z07A 4JRAA 3WY6A 4C91A 1GLHA 1JUIA 4FPJA 1WMDA 4XQWA 4YW3A 2HWB3 5HCFA 2DCYA 3GZTB 1NA1B 2PHFA 3B3QE 1V9U1 2E6VA 3OBTA 2ZGRA 5IK5A 4B29A 2IFWA 3S30A 3SISA 2CNAA 3VN4A 2DU1A 2BVBA 4LBOA 3DPRA 4YLZA 3SMHA 4AQSA 4CDXC 1UU4A 3BU7A 5BUVA 1AXZA 5J37A 4YNIA 1LOGA 1ALYA 2D3SA 3ZYRA 4C1XA 4YM0A 1FOD3 4OULA 1Q8SA 3VL9A 2PHDA 3AMPA 4AWDA 4CRQA 1QXRA 3ZO0B 3UK9A 2R0FA 3MLJA 2GH2A 1N1TA 2RS11 5FO9B 4XOGA 2CGNA 3M3EA 3QBQA 3J8F3 4LO4B 1K5MB 3OYWB 1IQAA 4N9HA 1VAVA 3ACLA 1RGSA 3WG4A 4RQPB 1C5IA 1WBFA 4YM3A 3NV1A 1CIWA 5DUVA 3R6SA 5ACA2 2YROA 3WW4A 1QQP1 1X33A 4XFIA 5FQ0A 2QZ2A 4UW6A 4X6QB 3HIFA 4ASMB 1L3JA 5I93A 1N1SA 3I54A 3RZZA 3VBHB 1I1EA 1VLNA 2HWB1 3WP3A 3WG3A 1SDWA 1LEDA 3P3PA 3ZSMA 4HVOA 4R4ZA 1AHSA 1RUNA 1W6OB 2D93A 2R32A 4RS5B 2E7QA 2A70A 1TQ5A 4EWDA 3U4XA 1VBB2 1DDLA 4YM2A 3FJSA 4QPIC 1UU6A 2DF7A 4Z82A 3QH6A 1RUJ1 2ZJCA 3TYJA 1U12A 1UX6A 4CDUB 3RYRA 3PMSA 2CAUA 1ENSA 3WQ1A 1DQ5A 1MEC1 2D5FA 1BVP1 4P9XA 4LO5B 1F8VA 1ZBA3 2BEOA 1LRHA 1S1AA 2D6MA 1RUE2 4XE9A 2NQYA 1AYM2 4JDNA 3SCGA 2BBVA 3ZXDA 4FOQA 2WWSA 1AR73 1O91A 3CJIC 4A7YA 4PBPA 2RJLA 1AL23 3GHNA 3R4DB 1XNCA 4BMEA 2HKXA 2YGLA 4I3PA 1BK1A 3I2DA 3ZXLA 3B02A 4KH9A 4IEZA 1VAMA 3LB9A 2OUJA 4HPKA 3L2HA 1YHFA 3J9SA 1DF0A 5GLTA 3J26N 5FOBB 3O0VA 2R0HA 4LLFA 4B4QA 4RGAA 5GM0A 5I91A 2Y26A 4LA2A 4W6WA 1RITA 3R05A 4J6GA 4OI0A 2C5DA 3SH5A 3FMGA 5GALA 4I2OA 1CAWB 1QGLA 5DDJ2 4P9YA 1O3TA 1BBT1 1LHVA 4DZGA 3ZXJA 3PNAA 5JZGB 4Y5Z0 3PTYA 3PVEA 3MIBA 4Y22B 2DU0A 5JIUA 2CTVA 4ZKTB 4L9BA 1TNRA 4CDQB 1OLRA 1OOPB 5CU1A 3GNEA 4COYA 1JTZX 1FNYA 4N9IA 2VH9A 2QUOA 2Z2SB 3JU9A 4CP0A 2DFCA 2ZPXA 1WGPA 2PHLA 1ZBA1 2RE9A 4DXZA 2A6VA 4FPHA 4OVEA 5E8AA 2LM3A 2OVUA 5ABJC 2DWRA 1YIPA 1LJ7A 1EAH2 1ZZ9A 5F1RA 3RNSA 1KDMA 3AKQA 1LECA 3M3CA 3OPZA 2R16A 2WKKA 1AL21 1FMD2 4I09A 3ZFFA 1DQ1A 1TME1 4KBBA 3HT2A 4LLOA 2H6CA 2GC3A 3WLUA 4FOWA 2ZCWA 5FPXA 1LENA 3POSA 3NAPC 2YGMA 3IN9A 4AVCA 5C9AC 2WA3A 1J1LA 2IXKA 1HV0A 2XG3A 4LULA 3ZN6A 3AXDA 2JG8C 2XGXA 3D8CA 4QPGB 4DRRA 3V0AA 5L73A 1OFSA 4QT6A 2PAKA 2R072 3KGLA 2VVEA 2JG9B 4PDWC 4KGQA 4GMP1 4XJ9A 3FUQA 3AMNA 3PHMA 4P14A 5KHKA 4GULA 1JXNA 2P3IA 5L19A 3I59B 4XILA 1YNAA 1TMF3 1RINA 1NOVA 3V64A 3T1MA 4AGRA 4DY5A 5BNOA 3ZDSA 1MS8A 3LAGA 1BMV1 5LK5A 2D6LX 1C8M2 4PBOA 4IEYA 1D4VB 2HWE1 1G9AA 4E2GA 2Q5TA 5KXCA 3LCPA 1RHI3 1HV1A 4ATEA 2XLGA 1MQTA 1R1A2 3MLKA 4FCAA 4B7KA 3HD8B 4E2SA 2XUMA 1WMFA 3VBRB 2DCZA 3ZFGB 1FPN1 1PGW2 2VW1A 1KITA 1WD4A 5C9AA 4XQ4A 4Y1YA 2B39A 3NWKA 2E53A 4Z1VA 2AGSA 4P9WA 1H9WA 2FZ2A 4FVVA 4QD2A 3OY8A 2VOKA 4AEJA 2GNBA 2AH2A 2ZGLA 3MEPA 3AZYA 3R0RA 5FRAA 4QQHA 1MACA 1MS1A 1O4TA 2WNEA 3ZFEC 2WNUB 3ILNA 4M3CA 2VOWA 5LK7B 4PDWA 3TRSB 1XXNA 1H8VA 1A8MA 1BKZA 2VY0A 4CEYB 1FOD2 2WZR2 1AVBA 1CESA 1DGRA 1ZZ7A 4IEOA 1RVF1 4GH4A 4KG0A 2V73A 4W6YA 1AYN2 4GMP0 1H8TA 1XYNA 3M2MA 1LU1A 5L7OA 3J8F2 3WHTA 3FWEA 5JIAA 5IK8A 1LOBA 4XBQA 1AR61 5BNQA 1W6MB 1DLLA 1CPNA 1NZCA 1QOTA 3VBFB 5CFCA 1NG0A 4CDWB 4FOVA 1RHI1 4AFDA 3TAYA 4XFCA 1PZ9A 4OUMA 1GQHA 1B35B 4LUKA 3WX5A 3WDUA 2EALA 2GN3A 3BOPA 4CEWB 1PGL2 4AVVA 2BFUS 5FPZA 1O5UA 1Z7S3 3OF1A 1GBGA 5T55A 1WA4A 3OD4A 1KRIA 3WT3A 2BUKA 1VBE1 4ISQA 2ILMA 1NCRA 4Q1RA 4QQOA 3VV1A 2ET1A 3KSCA 4H14A 1O7FA 4FQZA 2MEV3 5CFDC 1QJY3 2DUOA 4I01A 4DOUA 1VBA1 1HQNA 4KU8A 4CTEA 5C4WA 5LRSA 1O3RA 4D7YA 2JICA 1AX2A 4ZU5A 3DL3A 3ENRA 4W6XA 3E97A 5L36A 4OZXA 2YMZA 5CA6A 3A0NA 1LHOA 4DINB 4N90A 4HN0A 1KJRA 3N3HA 5DZGA 2QFEA 1WBLA 1ZBE3 5B2GB 1AR93 1AR72 1R083 4JTOA 3MW4A 2JENA 1OA2A 5H9PA 1FI2A 2XJRA 1XQNA 1REFA 3DN7A 5LEJA 3L2YA 4G3YC 5J96B 2IFRA 1E57A 2VULA 3OJBA 4K1YA 2PAEA 2VXRA 3VHNA 2W68A 3ZN4A 4FSJA 4JC1A 2DFBA 2K2SA 1Z7S1 1G9FA 4AFAA 1C28A 2EXHA 4JCKA 1Z0HA 3ELNA 2C0ZA 3I7DA 4QU2A 5JSRA 1WMEA 3MZHA 1ULFA 4R52A 1QJY1 4JGYB 5CFDA 1XU2A 1JYIA 4WVMA 2B7YA 2B8MA 5GZFA 1WW5A 3KQRA 2VVFA 2K9ZA 4GALA 4NR1A 4D3WA 4HVQA 3WP5A 5CAZA 3SNMA 4P9GA 2OA2A 3GYDA 3KLSA 4AF9A 3N4MA 1AX1A 1QJX1 2MHFA 1WW6A 3ZSKA 4X8NA 3O5SA 1RUF3 5JWPA 3H50A 5CG8A 2XLAA 4DB5A 2UURA 3LA3A 1UF2C 1MZEA 1S0DA 1RUG3 3M3OA 3AFKA 4M00A 4Q4X1 4V1PA 5BXXA 4MGYE 1O3QA 4AQ6A 4WM8C 1VBC3 1XNKA 1GFF2 3FUOA 2DVDA 3IDEA 2ZX2A 2Q4SA 1UW8A 1ND3B 1W6PA 1IS5A 2UYBA 2XH6A 5LEKA 3VBUA 2A5ZA 1S0EA 4YZ5A 1H1IA 1UZYA 1CAVB 1S55A 1QU0A 5BNPC 1BEV1 4ONUA 3VBSA 1VRH1 2A6XA 4Y1XA 1VB4A 1XRUA 3G6JB 5JOZA 2PELA 2HWF2 4NN0A 4YW5A 4BMBA 1WLDA 1JH5A 4Q8LA 4PLNA 1SFYA 3ZYPA 2TUNA 2WS93 1RB8G 3ME2A 2FZ1A 1FX5A 3FLTA 4YVWC 3J4UH 1AF9A 1TMF2 1KD7A 3JB4C 3FLRA 4L99A 4N53C 2BVVA 5T54A 4H7MA 5GLWA 4FBFA 1GSLA 3KT1A 2QNKA 4M01A 1NLRA 3IBMA 3USUB 4GA9A 3FBYA 5H9QA 4EN0A 2YPJA 5D8AA 2QZ3A 3NV3A 3RRDA 5BNNB 4YZ4A 4F8AA 2ZGTA 3LOBA 1NA1C 3PVBB 3WG1A 4WM8A 5GZCA 5CVRA 1HXS3 3TN93 3AJYA 1YIFA 1LHWA 1A6CA 4OHYA 1B09A 1J3QA 1SBFA 5J7MA 4N7UA 1IS6A 1GKBA 1U5XA 1RL3A 4R9CA 1N3OA 3EXUA 1LESA 2D7FA 3VZMA 3QD6A 1HW5A 4Y1VA 3ZXAC 4XFFA 3OD0A 5DXDA 4AEDB 1ULGA 2EVXA 2WSVA 4OI2A 3WD5A 3VBOC 3I8TA 5ACA1 3RSJA 1AUYA 4K40A 4RR3B 1Y7BA 3INAA 4N43B 1AR83 1DGWA 3N7MA 1V6LA 3EBRA 4N53A 1LOFC 4RQPC 3ZIXA 5KXBA 4LHNA 1O5LA 2IXHA 1DFQA 1HRI1 5IK4A 1COV2 3WOGA 4RHV1 4S2FA 1S0IA 4I02A 2G9FA 2JE9A 4MXWA 3IM0A 4R8HA 3OGJA 1LOAA 4BLIA 3H8UA 4Y20A 1DG6A 2XVKA 3VBHC 2NN8A 1SCSA 5A32B 1VB2A 5C8CB 4Q29A 1HXS1 4KWKA 1GZCA 1Q43A 4RS5C 2Z42A 4J1WA 2ZX1A 5KHGA 3AP5A 3MPBA 2XL9A 3H3ZA 1BXHA 1UIJA 1DHKB 3VZJA 2UWCA 2Y38A 1QKQA 2YYOA 3N7LA 1I6XA 4CDUC 1OHFA 2MEV2 2VQ0A 5EFUA 1EV12 3VBOA 2TEPA 4WZFA 5FREA 3RJ2X 4KG8A 4FPLA 3GHMA 4GXLA 2RS53 4YSFA 1AR81 4AHYA 4D94A 5I0RA 2OW4A 3R4SA 1LOFA 4ES8A 4B4RA 1ND2A 2A3WA 4NWWA 2RS13 3ZSJA 1OQ1A 1LB2A 1G9BA 4LO8A 4LBJA 4IEPA 1ZBE2 5AFBA 1ZREA 1AR92 4JDMA 1IS3A 2XBO2 4KGGA 1R082 4E27A 4UBGA 4K7JA 3N35A 4URTA 1PGSA 4ZU4A 4Q1PA 1NYWA 4YG6A 2D43A 4LNVA 5JI7A 4Q0PA 4Q26A 1PVC1 1EY2A 2CAVA 5BYNA 1SLCA 3JD72 5JZGC 1ZZCA 2XWBB 2VUJA 3HR9A 4KL1A 2NMOA 4X8PA 4AHWA 1RIRA 2GMMA 4FPYA 1QNWA 5TSWA 3ZSEA 4COWA 3JZVA 1RUC1 4JDOA 4CDQC 1NY72 1OOPC 1ZA4A 2D6OX 2D3RA 2X5IB 2OZJA 2GAUA 1JBCA 1GZWA 4SBVA 2HWD3 1GICA 2WC2A 2WT2A 4F7ZA 1O4YA 2D3PA 4S2DA 4XMAA 1PZ8A 5GLVA 3VDDC 2PA7A 4AYUA 1RUJ3 4F3JA 1SQ4A 2RS51 3MGUA 5DUWA 3WVJA 1MEC3 3SXWA 3AMQA 3AMHA 4XMIA 3KCCA 1RUF2 5CIRA 4ASLA 3EQEA 3ZXGA 2WFF2 1WD3A 2WNVA 4U2AA 1AJKA 1D0GA 1RMU2 1RUG2 4QHBA 2VPVA 3VKOA 4NVPA 4Q0SA 4XF0A 3V65A 4HKOA 4WVVA 1VBC2 4G9SB 3AP4A 3B00A 4LBKA 3AJZA 4DQAA 1DZRA 1U5IA 2ATFA 4QGLA 1D2SA 4IV1B 1UAIA 3FFQA 4AEKA 3LA7A 3FFZA 2JG9C 2CYFA 3VZOA 2I74A 1A3KA 1QJU1 1LEMA 2UWBA 4YZ1A 1UU5A 2VMIA 3EO6A 4XFAA 4Y22A 4GQ7A 1NCQB 2ZMNA 4HANA 1H4GA 5DZEA 5FLJA 2ETEA 2GALA 5HXVA 3MLLA 2A75A 2HWD1 1BBT3 3APBA 3AXEA 1AL0G 3Q9OA 1MVEA 2WS92 1KS5A 1X8EA 4CDXA 3VHRA 2YHJA 1CGPA 1W0PA 4NHKA 5SV8A 5CNAA 3VDDA 3IPVB 4ZXKA 4XJWA 1X8MA 3C2UA 3MIDA 2GSYA 2RR12 4YM1A 1OA3A 3VZNA 1ULEA 1R1ZA 3PVNA 1V6IA 5F6LB 4LUMA 3WCSA 1UL9A 3RMXA 2CWMA 3VBRC 2PLV1 3FHIB 3ZFGC 4AVSA 5JDBA 3TBDA 2HWC3 2ZS6B 4Q2FA 3TN92 3V56A 2WZR1 2GNDA 1TME3 3N36A 4HZFA 5FFOC 4FPOB 3SH3A 1RUH3 3DPRB 2O0OA 5AC92 5KHJA 4HK8A 2VECA 2Y0OA 4Q4W2 3ES4A 2ZGMA 4CYDA 1WUVA 1PNGA 4YARA 2P3JA 2WNUC 1W6QA 4MYEA 1IZ3A 1WCDJ 4CEYC 4AK3A 2BW8A 2WIIB 5GJ6A 1A78A 2BNOA 3IDBB 3DF0A 3D4KA 1U5YA 4GMP3 1FAYA 3H3UA 4UW5A 4QPIA 3VZLA 3ZIWA 4AI3A 1PO22 2H6BA 1RJ7A 3ATGA 4XXAA 3VBFC 4CDWC 4AEMA 4AFMA 2H0BA 5FQ0B 3ZYIB 3N7JA 1GQGA 1SCRA 3HAGA 1B35C 3H9AA 4HFSA 1DGWX 4PF5A 1V70A 3WDVA 4CEWC 3AZWA 1HRV3 2P3KA 1IKQA 3VBRA 2HWE3 3CNAA 4IESA 4TZDA 5J3UA 2HWC1 1D4M3 3DV8A 4XQDA 3CJIA 1LKNA 5EYXA 1FT9A 1CQ9A 4BWOA 1W2UA 1RUH1 2XKOA 4DS0A 3RDIA 4JGZB 1CJPA 2WJSA 1FPN3 1PK6C 1AXYA 1XE8A 2YC0A 3KCXA 2JEMA 1V9U2 1V6JA 2EXKA 4WVZA 3JBG3 2ZA9A 1OLQA 2ARXA 4HN1A 2WT1A 4YW2A 1F5JA 3B9IA 4D7SA 4K3UA