3KB5A

Pry-spry domain of human trim72
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
b'RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite motif-containing protein 72
publication title Crystal structure of PRY-SPRY domain of human TRIM72
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 44
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kb5A00
4P9IA 3KB5A 4WVMB 2WL1A 4XW3A 2YYOA 3TOJA 4P9JA 5F6LB 2E63A 4X8NA 5JI7A 4V1PA 2FBEA 4QT6A 5JI9A 4B8EA 5C33A 2YUEA 3UV9A 4N7IA 2IWGB 4X8PA 5F6KA 5JIAA 2LM3A 2VOKA 4B3NA 4N7UA 4WVMA 5JIUA 3ZO0B 4KG0A 4P9LA
chains in the Genus database with same CATH superfamily
3GZUC 2RMU2 1JU4A 1LOGA 2D43A 2DWRA 1H0BA 3KVBA 5AC91 4AHZA 2PHWA 2BWAA 1QF3A 2WS92 3DKQA 4LE3A 4PBPA 5FP7A 4HONA 5FXZA 4CDXB 5IVBA 4N43A 1XYNA 1W2TA 1PM4A 2XJSA 2K46A 4CUCA 5FO9B 4ORFA 4Y1YA 5IVFA 1H4GA 3PUHA 4XYXA 1RJ7A 2XOMA 4FPYA 2XJTA 4QT6A 4XUQA 5B4NA 1QJY3 3EB7A 4YW2A 1R092 5FLHA 1W6OA 1UOGA 1YCIA 2CL2A 3RZMA 3PMEA 1AR93 1UCXA 3VD5A 1UZVA 3AKRA 4O61A 4QDRA 4DXSA 1VBE1 3WNKA 2X5IB 4XFCA 4CP9B 3LA3A 3T1LA 4Z2WA 2DVBA 1GUIA 2DTWA 4LO7A 2FDHA 1W2NA 4KGQA 5FUNA 1LAJA 2ZXQA 3QH7A 4B4PA 1ZRFA 2NPIA 5KHGA 1ZREA 1BBT2 1UAIA 4XDOA 4XBNA 2UWBA 1WCDJ 2XH6A 2GC2A 3RJRA 1J83A 5LATA 3ZFFC 1RJ8A 1W6PB 5EZWA 4CP0A 2HWB2 5F8PA 5HXVA 2AGSA 3PJQA 2GN3A 3J9SA 3POWA 1W6MB 1W2OA 1KS5A 2WFF1 3GGLA 3T1MA 5I8TA 1OF3A 3ZO0B 2JDMA 5F3EA 2A1XA 5IVYA 3NNJA 3KT7A 2QQNA 2XKOA 3DYMA 4IEXA 3LE0A 1X33A 2EIGA 3I2KA 2OUJA 3DGTA 4INDA 4N53B 1EYBA 2OA2A 1YEWA 3LA7A 3U37A 4Z92B 1S4CA 5FYMA 1LODA 4WVZA 1N3PA 1W03A 4Y22A 5FMOL 3I54A 3P6BA 3QBQA 1UIKA 4Y24A 4A42A 1BEV1 2LRPA 2R16A 1AR82 5T5LA 4KNCA 1HV0A 2HEYF 3KV4A 4B1LA 1GFF2 3DYOA 4LITA 3VHRA 3ZFFA 1J3PA 1FNZA 3S30A 1KJRA 3NKTA 3I3QA 5F6KA 3UKVA 5A7NA 4BLJA 3VD7A 2E31A 1QHDA 2WYSA 2D93A 5C8CC 3MLKA 3WDXA 4XF3A 1EAH2 1DGRA 2TEPA 5FY7A 3WF0A 5F32A 1K42A 1XNTA 1OD3A 1RUG2 5GLTA 3VGIA 1NOVA 3WP4A 1AJOA 5DDJ1 4ES8A 2PLV3 1URXA 2BOIA 3TYJA 4Q4X1 5J36A 1XOYA 5JXJA 1RMU1 1LESA 4A3ZA 2ETEA 1JYCA 1T6BX 4EN6B 2UYAA 3GBGA 4J1WA 2JE9A 4FOVA 5J09A 1UL9A 1F5JA 5ACA2 3CKHA 1WD3A 4A45A 1HLCA 2CWSA 2FHRA 4FXKB 2V09A 1WD4A 2WSVA 4XF0A 4Q4V3 2GH8A 4HPKA 4BQ3A 4META 1HRI3 4GJZA 4UFLA 3T08A 5A3OA 4CDWC 1S2KA 2F4LA 1JBCA 3B01A 4MGQA 1BVVA 5C8CA 1RVF1 2AEZA 5HXMA 2JDKA 4KWJA 3MI8A 1XU2A 1JI6A 5FWEA 5GKAC 4LBNA 1C5IA 4LKSA 3DCQA 4AFAA 4GB31 5BY5A 3I3DA 1DGLA 3TEXA 3LIGA 2WWJA 1GV9A 4COUA 4D6QA 1ACCA 1JN2P 2IVIB 2WZR2 4M3CE 5EJ3A 3SC7X 3U4SA 4MLOA 5FZ6A 3WHUA 4D0QA 2UWAA 4IEQA 4LHLA 5JMCA 4DRVA 3AK0A 1UY1A 4QMAA 2HEVF 4QB1A 1OFNA 2OPKA 3MPBA 1GSLA 1UY2A 3OCPA 2XL9A 3AP5A 2HWE3 1LKNA 5FIXA 3CEWA 3VZLA 1ENQA 3GZAA 3LEMA 4CDWA 5LA0A 5F2SA 5FQ0B 3QCWA 3H8OA 3IMNA 3KT4A 5EYYA 5A32A 2CYFA 4Q4Y3 2PHDA 4NHYA 1J58A 1MS4A 2E33A 3KV5A 3VBRB 2A6YA 4Q4W1 5FLIA 1IGOA 3L2HA 1C4RA 2EA7A 2KA3A 3H42B 4NO4A 3HIFA 1WBFA 3E5XA 2R7EB 4EN7B 1AXYA 4BU2A 5B4XA 5TSWA 1OH3A 1BYHA 1CZVA 2WO7A 4AWDA 5J96B 3H1MA 3N3HA 1QGLA 1X36A 3NVCA 5LBCA 3VBHB 3ZYFA 1APNA 1EPWA 1W8OA 4O9GA 3LWCA 3WVJA 1REFA 1LNSA 1WW5A 1UX6A 1WCSA 2A5ZA 3EBRA 5G05L 1ND2C 1ZZ9A 5HCHA 1ASJ2 3H1WA 4IV1B 3FLPA 5C9AB 4CU8A 4MO3M 4CCLA 4MGYE 4AFBA 4QGMA 2GALA 4S2DA 3JBG2 1S0FA 4XF1A 2AENA 5FZOB 3ZLIA 3M3QA 1EUUA 1CJPA 5LZ6A 2MEV2 2W0XA 5GZGA 2ZGKA 3DF0A 2ZX3A 3C2UA 4NVPA 1NA1B 4X8PA 1ULDA 3PHMA 4XTMA 5FZLA 1H9PA 3PVEA 1AYN3 2W92A 2GMPA 4J6GA 4H2AA 2VTXJ 5KHJA 3WQ1A 4Q1PA 4V2WA 4M3CA 4RN5A 5CISA 2OZ6A 4LORA 4PDWA 5I0RA 1QWRA 2Q1FA 1RC6A 4UW5A 3WW1A 5FJKA 2HWD3 2B7YA 3KT1A 1MS0A 4K21A 3RDIA 4E4SA 3KHBA 3FE5A 5F6LB 2PHLA 5C3PA 4YM0A 3UGFA 1DQ5A 4AVTA 1Q43A 2W3JA 4ZU4A 2YB7A 1SLCA 4EWDA 3BALA 4F3JA 3I2HA 5FBJA 3USUB 3OEAA 1Q56A 3VL8A 2D44A 1RUC3 1KITA 1MS9A 1K5MB 1S0GA 3BPZA 2EXJA 5C3SA 3ZKUA 1RUJ2 1X9TA 5A33B 1OLRA 1WUVA 3OGVA 4P9WA 4XETA 5E1RA 2CTVA 5DG2A 5E16A 4CDXC 2BNMA 4IE6A 2VR4A 2RS11 3FHIB 5FYVA 3NKGA 4MOAA 2HWC3 1SEFA 2P3KA 4H14A 4RR3C 3UNPA 2DUPA 2LALA 3K4DA 4ARYA 5T52A 3AMPA 4UF0B 3S5AA 5LCWL 2UU8A 2VZPA 4AEDB 2ZMKA 3D8CA 1HRI1 1H30A 1PZ8A 1AYM2 2X5IC 4HVOA 3U75A 5DMYA 4AQ2A 1ENRA 4XUOA 3IAPA 4L99A 2H6CA 1VRH1 2VOWA 1NLSA 2WZ8A 1DGRN 4PIYA 4UWDA 4NOTA 4C0BA 2W1SA 3C3VA 1W8FA 3POGA 3I2OA 1HRV1 2P37A 2ZJCA 3C8XA 3PMSA 2ARBA 4LO4B 1GWKA 3WQ7A 4FTSA 2ZACA 3WR0A 4QM8A 4CE8A 2VY0A 4CDXA 4CCCA 4EN8B 4FBFA 2GP3A 1ZRRA 4KH9A 1D7PM 4M4RA 5EP9A 1OA3A 1EV12 3KF3A 1REEA 3RZKA 2YC0A 4DQAA 1O3TA 2YFZA 3IMMA 1YQ8A 2HWE1 2E9QA 3O0XA 2ZX1A 2G9GA 3CNAA 4I01A 4PBOA 2VXRA 3HVDA 4CCMA 3OBTA 2QJVA 1WBLA 2NQYA 2GDFA 2X5IA 3BCWA 4GMP0 4Q4Y1 4CP9A 3OD4A 3RMYA 5FZKA 1ULGA 1PGSA 1POV0 3NV3A 4EWAA 2Z69A 2LUWA 1UZYA 2Y34A 2VZRA 4FP2A 1CZTA 1STMA 2FMYA 2RDSA 3AXDA 4J25A 3SCGA 2VW1A 1YJLA 4RS5B 5FMBA 3SCFA 3GXUA 1A3KA 4LBMA 2O8QA 2PN5A 4KWKA 5KHKA 1CX1A 1GKBA 4C0HA 3J8F1 2OS2A 1W6PA 4AAPA 2ID4A 2J1SA 3ACFA 1AL23 5IUQA 3TEWA 2FD8A 1KGYA 1O4YA 1MVQA 1OA4A 4CDQB 1H6XA 4LKFA 4DXTA 4E4ZA 1W6MA 1H2NA 4P5HA 4QPYA 1JTZX 3VDDB 2QQIA 3AZXA 1PIV2 1SFNA 5CADA 4PLMA 2TUNA 1IPKA 4LJHA 3ZM8A 2DCJA 3MIGA 3LEKA 4N53A 2GNMA 1AZDA 2ZABA 4YPJA 1W9YA 2JB8A 1UXXX 3WUCA 4AFDA 3NNMA 2R073 2K0GA 3MW4A 5EV7A 2D40A 3HMYA 4K6BA 1NE6A 1VLNA 3NNGA 1R1A3 3G7DA 3R6SA 1AYN1 1DFQA 1UF2C 2BDRA 2HKXA 2RM22 2ZBJA 2PAMA 1DGWX 4UAPA 5C5UA 4I2OA 3OTFA 4KMQA 4AEKA 1DF0A 1D0GA 1CPMA 1Z0HA 1N47A 5DG1A 1G9BA 2WNVB 1ALYA 1LHOA 3O0WA 3PUQA 2HWD1 5JZGB 3RZJA 1U5XA 1XBFA 3I4IA 1SLAA 4ITCA 3R4UA 1OSGA 1V6NA 4XACA 3OY8B 4BWOA 2OZJA 2GNTA 4RGKA 1UYXA 4UYBA 5BV6A 5JDBA 3EQEA 3WOGA 2CGPA 4KQ7A 3DKWA 4E8DA 4I02A 1K45A 4GKXA 2CWMA 4YZ3A 5JPNB 2GU9A 2E7QA 3D82A 4X8NA 4AI2A 3T2TA 3SKJE 3IDEA 3TWIA 1Z7S3 5A7WB 4FTBA 2ARCA 4LPLA 4FFFA 2HWC1 2VQAA 2VMFA 5JOWA 3I2JA 5T5PA 1W3XA 4LIVA 4FP3A 4LBJA 1F9KA 2ZOEB 4AGVA 1JXNA 5A3PA 1DIWA 4W50A 3LDRA 4TSVA 1JYNA 1G86A 1K3IA 3H3ZA 3VBRC 1RUD3 2WKKA 3H3LA 2B9UA 4BYYA 1FT9A 1RUNA 1C57A 1W9WA 3D6EA 3E6BA 2Y64A 4P9GA 1AR62 3A23A 5SV8A 5FYIA 1Y7BA 1HQNA 2QUOA 3LGRA 3O1PA 1ZBA3 2GC1A 3ZYRA 3MF6A 4M00A 3VBHC 3WNLA 5FCCA 2GNDA 2VE1A 2FZ2A 1VBA3 2IXIA 2YPJA 5F7UA 3BOWA 3WCRA 1VALA 3ZXJA 2Y6LA 4NRPA 4IGOA 4IV1C 2W1WA 2C6SA 5JIUA 4AFMA 2IXJA 2K9ZA 5C9AC 5FQ0A 1QXRA 1FMD1 4UFJA 4QX7A 4GWMA 3VBRA 1UQXA 5FK8A 2WUHA 4HL0A 1R1ZA 4IE0A 3ZIXA 4NRMA 1D4M1 1X7NA 3LSEA 4OHYA 3N35A 2WFPA 5JXHA 2CU5A 2MNGA 1VBD2 3O0VA 2WR9A 1NA1C 5FOJB 2VM9A 3WNOA 3PIGA 5C3RA 3VBHA 3ZSJA 3IIIA 5HPOA 5KXBA 1QJU3 1SBEA 5FPLA 3VKNA 1QNYA 5T50A 4DNYA 4FVVA 2ZAHA 4FPJA 4W4ZA 1UY3A 5CIRA 5A7SA 4CUAA 1AL21 2W2IA 3RZHA 2JENA 3WNXA 5AVAA 3TBDA 1AUYA 4P9IA 4IV1A 4TN7A 5FP9A 2KR2A 1OLQA 2AZ5A 1RUF1 4E4DX 5C9AA 2VXJA 5JOXA 1RUG3 2P3IA 3BIWE 2JIJA 4ZXEA 1VMJA 1QOTA 1QXPA 2G9FA 3MIFA 2ZHNA 1K5MC 1PVC2 1QMJA 1PM7A 1RUH2 5FZOA 3JD72 1NQJA 4LHNA 2Q8CA 3POJA 1NA1A 1SDWA 4WV8A 4A7KA 2R071 1NT0A 4EROA 1QJX3 5FYBA 3ACIA 3SMHA 1R1A1 1DQ4A 3POIA 4MHRA 1H4HA 5I0TA 4N8MA 4RQPB 4URTA 5C6CA 1JW6A 1OF4A 3WF3A 3OBRA 4AEDC 2SLIA 5F3CA 5HCAA 3GALA 1CPNA 3IIAA 2JG8B 3K4ZA 2R1DA 4JGZB 5IVJA 4LOTA 5IAXA 1WCKA 3RYKA 2A75A 2HBTA 5DUXA 3WP3A 3A21A 3HQXA 3AP7A 4HG6B 1UU6A 3O7OA 3USUA 2FBEA 1FV2A 1K5MA 2RMU1 4OI4A 1H2LA 2D3SA 3OGSA 4H3WA 2DBNA 5A33A 1LGBA 5FY4A 2A6ZA 1TNRA 3K75B 3THDA 1QH7A 4N7IA 1UY0A 1AR72 2WS91 4YW6A 1TME2 3NV2A 1NKGA 1O7FA 2BU9A 3MUY1 4IEYA 2C5DA 4JDOA 4ZS2A 4XMIA 4AI9A 4KG0A 5FMCA 5CB7A 4FAHA 2LROA 2A6VA 4MX3A 4UF0A 3WXPA 4D3WA 4AEDA 5A6YA 4DEVA 4UW6A 1GNZA 1TNFA 4NR1A 5FXWA 3VKMA 1F8VA 4A4AA 4CU9A 5I91A 3KVAA 4DRRA 4P5YA 5BXXA 1E57A 1VBE3 1W06A 3FN9A 4CXYA 1VB4A 3IDAA 3QOPA 3N9NA 1JUIA 2YFUA 3PTYA 3VD3A 3NL1A 4Q0QA 4QDQA 2QTWB 1VBB2 2RJ2A 2KM2A 1BK0A 2B8MA 3AYDA 5A80A 3VUOA 1BBT1 3CJIB 2R32A 3JQXA 2RR12 4XTPA 4BQ2A 4IGPA 2X53S 4RS5C 1JUHA 5E89A 2WC2A 4R4ZA 3Q8CA 3EMRA 3K3OA 3SEPA 4I0AA 2XJUA 1Q3EA 4H7LA 4LLOA 5LASA 1XPWA 2ADDA 3THCA 1QDCA 5DZFA 4Y3OA 4CSWA 3WDWA 3WZ1A 4NN0A 4LK6A 1QJEA 4BJ0A 3PU8A 3BIEA 2PHUA 4CDQC 3OG2A 4XOGA 4NMIA 3DPRB 2VZOA 4YW7A 4BHPA 5FP8A 5BNQA 2WAAA 3VDDC 3Q8FA 4JRLA 2VUCA 2YBPA 3CLPA 4MXVA 3WUDA 3P5BA 4P9XA 1OPMA 1NXMA 3I7DA 5C33A 4DZGA 4WVWA 4BIFA 4FPEA 5FZDA 4AAXA 3THPA 4CZSA 4D7SA 1ZZBA 4AGGA 4LOSA 1G6NA 1ND3C 1I6XA 3ZFGB 5JSOA 3FX3A 4MUVA 2JDPA 3ILRA 5L9VA 2W52A 1GMMA 2JDUA 1B35B 1AR81 4RS5A 1CAVB 1HXS3 2NP0A 4R9CA 1U0AA 4AHWA 1OBNA 3PDQA 1D0HA 4JZRA 2B42B 1PO22 2Y6FA 4YW4A 3ME2A 1SCSA 5CG8A 3H0OA 3W5NA 1BMV2 4W8JA 5KR7A 1RUE2 3KLSA 1W0NA 3FLRA 1KJLA 4YVWB 4CDQA 4CCKA 5FRAA 1RYYA 5CA6A 2WWSA 2R042 5JZGC 5FY9A 2ZCWA 1RINA 1EAH1 3KQ4B 3VDDA 5JSPA 4NUBA 3IM0A 3WINE 2VNVA 1RUG1 4JRAA 1WWYA 1CONA 2FDGA 3HNYM 2O1QA 2PAKA 5DUWA 2YMZA 3ZR5A 4NHMA 1HW5A 4QX5A 2JD4A 4IV3B 4GWIA 3H8XA 4GWNA 1OPOA 2VBPA 4Q4X3 3WQBA 4YRDA 3RSJA 2QCSB 3RPQA 4JX0A 1G8WA 1K12A 3AYEA 3L9JT 3T2QA 1H2MA 1WLDA 2DVDA 5ACA1 1JS9A 2P3YA 3OJBA 4JGYB 3WW4A 5FY5A 1LEMA 3SH3A 4MXWB 3POFA 1W28A 1RB8G 3LD8A 2GMMA 1HJGA 2D6OX 4QQPA 2ZPXA 2PFWA 1CVNA 4DEQA 5A1AA 2WNVA 5JZGA 3FUOA 2PHFA 1JH5A 2WO2A 4QPIB 5CYYA 2FDIA 1DQ0A 4BA6A 4PF1A 1N1YA 3EO6A 3JU9A 1RVF3 3OY8A 1W6QB 4H55A 4DUWA 3Q9OA 3ASIA 2DV9A 1XU1A 4Z07A 4JV4A 3POYA 1SCRA 4NWVA 1IG3A 3HT2A 3M3OA 2B5HA 2D3PA 2JDAA 3ECQA 2EICA 4AG4A 4GB33 3MO4A 2A6WA 2VMEA 5CVRA 4HKWA 2E7TA 2WZR1 4HSJA 1Y3TA 1FATA 4GIQA 3VHOA 3J7MA 3LCPA 1TEIA 3PJYA 4AE2A 4ZU5A 1GICA 5A7WA 3N9PA 5CAZA 5J1XA 1OURA 3BTZA 3M1HA 1BVP1 3JCIA 3JZVA 3LPGA 1FPN2 4G4FA 1PK6B 3OPZA 4EN9B 2SBAA 4CEWB 2WZPP 1HQWA 1CX4A 2PQSA 4HK8A 1LB2A 1CIYA 4HK9A 4O7XA 3K77A 3OUIA 4M0HA 4XDPA 4Q4W3 2P1BA 5FPVA 1GWMA 2VQUA 2Y33A 1GP4A 1R083 2D5HA 5DAVA 1JZ3A 1ZZCA 1YNAA 5FKCA 3T30A 1RUOA 2MPFA 1SQ4A 4MVTA 2YYOA 4M3CF 1GP5A 2ET1A 2RS52 2VPVA 3LOBA 2DCKA 1S0DA 3A0KA 3HBKA 3I2GA 2CDPA 4P08A 3V0BB 2YGLA 1RHI3 2QE3A 3R05A 5F5QA 3N4MA 3T3YA 4QXKA 1JHNA 2VQ0A 5EJZB 5FZ9A 4F8AA 1QKQA 4CXWA 2ZZJA 2W5FA 4OI1A 4NPMA 4QX2A 4HVRA 3DEMA 1E5HA 5D21A 5F39A 5A6XA 5HI0A 4NIGA 1XQNA 3L2YA 1UU5A 4FPGA 2YY1A 4Q8LA 4EJRA 5IK4A 1CR7A 4LA3A 3JBG1 4P9LA 3LDBA 1H6YA 3R0RA 2BYVE 4R9BA 2KXLA 1JOPA 5K8SA 2ZKLA 3W59A 1S0JA 2MEV1 2PHTA 3GYDA 2ZX4A 2JDNA 4MGIE 5FV3A 1YFWA 2AYHA 3QACA 1TMF2 4KI5M 4QD2A 4DY3A 4TTGA 4XZPA 1L7QA 1W0OA 3FMGA 1HXS1 1IZ3A 1X50A 4AI8A 3P3NA 1PGW2 1OUXA 4RQPC 1Q8OA 4KWLA 4PT6A 1YHFA 2P6HA 4XE9A 2DDUA 1E5SA 3B9CA 5FPXA 1JZ5A 2JG8C 5FZ7A 1OHFA 3RS6A 4AHXA 1COV3 3AP4A 4UFIA 3WSOA 1NYWA 2R063 3LIHA 2ILMA 4XXAA 5C70A 1QOOA 2ENRA 3BPSA 3CO2A 3RQ0A 4DMIA 1UYPA 1OA2A 1VMFA 4EQVA 1RUJ1 4W6YA 1FAYA 2W1QA 2WT0A 5IFPA 4H7MA 1OKOA 2VTFA 5LBBA 1V6LA 4LXLA 5CBLA 4UBGA 4YSFA 1XJAA 3M7AA 3M8LA 4FOYA 4QXCA 4RGGA 3WG3A 5IYYA 2EIBA 1BK1A 2BERA 2RS13 2ZHMA 1H1IA 1MEC2 5FYZA 2VBBA 3VBFB 3ZYPA 2QQVA 3AMQA 1HN0A 2VZUA 4RQPA 1QQP2 1YC61 3CZUA 4AZZA 3PUIA 2K2SA 2Q4SA 1JZ2A 3ALQA 1FOD2 2JG8A 2OX0A 1CAWB 1V6IA 1CESA 2OQ7A 3AJYA 5FYHA 1W3VA 1AYM1 1PO12 3K48A 3AVRA 4AQSA 1FYUA 2GC3A 1WLWA 4QAWA 4LBQB 5FMOS 4XDQA 2QQUA 2WZEA 4FPFA 1AR63 3KCCA 2AREA 3C7EA 1TVGA 1RITA 4Z8BA 3GBWA 4FT8A 1HDKA 1VRH3 3ZN5A 4A41A 1XE7A 1LULA 2EXIA 1XE8A 1C5HA 2XL7A 3CJIC 3TN93 1YQ5A 1HRV3 4PIXA 2IVJA 4LLFA 4JQRA 1Q8QA 1ZBE3 1X82A 1DYPA 5CZKA 4CRQA 5J98B 2UY8A 1EV11 3AC0A 2LM3A 1LHNA 3GCWA 4AEMA 2JWPA 4JKKA 4CPBD 3NV4A 5GALA 4COWA 3BOPA 4ISQA 2XQXA 3BYWA 5J3UA 4BB3A 1XNDA 1DU3D 2C24A 4NIIA 3KWVA 3D0JA 3KM5A 1W8ZA 2WQ8A 1LGCA 4QQ2A 4EYUA 2G1MA 5GZEA 3KSCA 4JQTA 3FJSA 4MZUA 4OHXA 3WNPA 2P17A 3V64A 1GZCA 3AMNA 1NCRB 1R081 3ACHA 4AGRA 3ZFGC 5LEJA 5H9QA 3DXTA 5A3LA 5AC92 2PMWB 3G6JB 3CJIA 1B35C 2VMHA 2XBO2 4RFT0 3UV9A 4BOWA 3MHZA 3T4VA 3CBNA 5JIAA 2VVEA 4AHYA 1RHI1 3AFGA 1ZZ6A 4OUEA 2XONA 4N7UA 1PMHX 3J8F3 4RHV3 4XFHA 4Y1ZA 2WRAA 4OHVA 4PDWC 2YDEA 2V73A 1WLCA 3GZTB 4TLGA 4YVWC 3I2DA 3MFCA 3DPRA 2X05A 3ZN6B 3LPFA 2R0HA 3ZOIA 1DYOA 3SEEA 1G9CA 1YI9A 1OKQA 4IXLA 1PIV1 3B5LB 3HJRA 2IZWA 1JZ4A 1AXZA 1US2A 3S57A 5FYUA 4CCNA 5A1FA 1J3QA 3NSTA 1BHGA 2J42A 1UW8A 1W90A 1XYPA 4JDMA 4YZ4A 3W20A 3AKSA 4HKOA 2RS32 3LEIA 1UMZA 2XLAA 4RD7A 3VBSB 1ZA4A 1F35A 3ELNA 4CVUA 3ZFGA 2TNFA 5F5CA 2VUJA 1WGPA 2XLFA 3AB0A 1ZRIA 4A6OA 1B35A 4WBBA 1SACA 4JTOA 1NLRA 5GM0A 1CAVA 2RM21 1PMIA 3GF6A 2JEMA 2VZTA 4YM3A 2ZHKA 2VL4A 3ZYIB 2BVBA 3IBMA 1S2BA 5BYNA 3RYRA 4YVWA 3I97A 1COV1 1K5JA 2E63A 4QPIC 3BUCA 4HXCA 2GZWA 2VZVA 2JDHA 1LOFC 3ZXEA 5JCTA 1W8UA 1C8M2 3SXWA 1ZX5A 2R061 4IE4A 1W05A 2E6VA 4QGNA 1HB2A 5KHHA 3KS7A 3AP9A 1AXKA 5A3TA 4IEWA 4LTAA 4CCDA 3H50A 1LTEA 4IE7A 3FBMA 4IV3A 1MS3A 4XF4A 3MIEA 3WF1A 1HB4A 1TME3 1BEV2 1SBFA 5IK8A 1U5YA 1OH4A 2VW0A 2XDVA 2ZAAA 4XHXA 4JGYA 3S7IA 2J1EA 2Y6HA 4MXWA 4QU2A 4R52A 5A70A 5JSRA 1HN1A 1NX9A 2EAKA 1QEXA 5ERLA 2WQZC 1S0CA 1LECA 2Z79A 3EXUA 5EFUA 2NMOA 5C5TA 2Y38A 4LBQD 4EZ4A 3ETQA 3K51A 3PL0A 3ZXAC 2P5BA 1G9DA 4R9AA 3QH6A 4QPIA 4Y5SA 4NIAA 4HZFA 4CXXA 3KV9A 1RIRA 3NMBA 1LOFA 4MGZE 4C90A 1J84A 2ZTNA 4OQ9A 1W6QA 1SHWB 3IN9A 5DDJ2 1AR61 3ABZA 2ZGOA 4CP2A 1C1LA 1VAMA 2O8OA 4OMDA 4Q27A 4Q5OA 4I0WB 4Z82A 5FO7B 5FYCA 1RMU2 2BBAA 3D0SA 1QDOA 3ZSMA 1GQGA 4B7EA 5HV4A 1MZ5A 3TN91 2HWF2 3JUUA 1GOFA 1PMJX 2NN8A 5FY1A 2Y6GA 1OVPA 1JODA 3S5QA 3V56A 5DQ0A 1ZBE1 4NHLA 5AFBA 3CIHA 2G4IA 2B9VA 1RGSA 5IW0A 3P1IA 4RFRB 1SFYA 4FTEA 2ZKNA 3I49A 1PK6A 4TLFA 3U11A 4CEWA 1MVEA 1W8TA 3PIJA 3MV01 3OEBA 2HEWF 5LB6A 3DL3A 1FMD3 1YO8A 3O14A 1CAUB 4NE9A 1SFPA 2EXHA 3USSA 4EV0A 2QQMA 1YI7A 2YZ4A 2ZHLA 4BQXA 5CEHA 1D4M3 5LEKA 5IHRA 4N53C 4F83A 4BMEA 2WA3A 4K8FA 1NY72 4NROA 1CIWA 5DABA 1V6KA 3V0BA 5BPXA 1RUI3 1NZCA 3IAQA 3LEGA 1W04A 1HB1A 5BNPB 3A7QA 1EPZA 3H8UA 4XEZA 2GC0A 2IXHA 3N9MA 2WWUA 4RHV1 5F37A 2E7AA 2YU1A 4IW3A 3VV1A 1QJY2 1W8HA 2GNBA 4P9YA 3BTYA 1A6CA 1ODNA 2AACA 2NZ9A 1AR92 3B93A 2DBIA 1RUF3 4BK4A 1G9AA 4OUSA 4XVHA 5JMOA 2CNAA 1PVC1 1RUH1 1XXNA 2IC1A 4B1MA 5C3QA 4QX1A 3JD71 5FY0A 4MADA 1XNKA 3TEYA 1POV3 2D6PA 4NRQA 4D6RA 4QGLA 3FL7A 5D2AA 3PVNA 1ULFA 5CG9A 5FMDA 5JVVA 3WD5A 1PZ7A 4G9SB 1S0EA 4AFCA 1XC6A 1MPXA 5CKMA 3CJXA 3VBFC 1JOJA 4OULA 2YV8A 2BW8A 5GZFA 5FP3A 4E4HA 4NHKA 4DXRA 3PURA 4OI0A 5F2WA 4QWNA 3EYPA 2ZGQA 3H7JA 5BNOB 4WVVA 1QJFA 2VU9A 2YBSA 2N7GA 4B7KA 5IK5A 3DN7A 1BZWA 2C1FA 3E6CC 2PAEA 4FAGA 3ZSEA 4AXOA 3BKZA 2WYFA 4AQ6A 1ENSA 1W8WA 4O65A 4R9DA 3WQ0A 4CA9A 1UYZA 5CFDB 1V9U3 5EPAA 3MW3A 3WEZA 2ORXA 2RMU3 3JB4C 1OD5A 4XCAA 3ACLA 3N7KA 1QIQA 3ZFEB 5JR7B 3CMGA 1TME1 2XKPA 2C0ZA 2WS93 1GZTA 2ZMNA 4GD4A 4PI0A 4DO0A 2BGCA 4GA9A 4GULA 3I3BA 4L0PA 1CJDA 1KEXA 5EXOA 2BRTA 3SLIA 2R0FA 3U14A 1GOHA 3VBFA 1M06G 1GLHA 3ILFA 5F5IA 5K0UB 1EP0A 2RJKA 4FPLA 4IEPA 1R093 3F95A 4Q2FA 1CAWA 1VMHA 2Q8DA 1LEDA 2W39A 1VAVA 4K7JA 4LO5B 1I3HA 1LENA 1W0PA 4AI1A 3C7GA 3UL2A 3NJZA 4ASKA 1UZZA 2AUYA 2EALA 2WQ4A 3FFQA 4LBQA 2CDOA 1ONAA 1QJZA 1N1VA 5T3NA 5DAWA 1NCRC 1Y9MA 2PLV2 2OPWA 3ZDVA 4Q0SA 1VPHA 1MR5A 2PQQA 2W1UA 3TNPB 2RR11 2WSUA 1SG3A 1BBT3 3ITQA 3HPNA 1UWWA 3SQOA 4UI9L 4JHZA 2VOVA 1VJ2A 2W46A 4DPNA 4S2GA 3U78A 5LK7B 4ARXA 1J1LA 1BCXA 5A6ZA 1OOPB 4LQRA 4OZXA 5L9RA 2RVAA 1C1FA 2HWB3 3OB8A 1O6UA 2VMCA 1ULCA 2YC2A 3KCXA 3RI9A 5KXEA 4Q4V2 4YW5A 5L9BA 2BBVA 4K40A 1HV1A 3S7EA 1WW7A 3NW4A 1E5IA 5D1IA 5E88A 4X6RB 2VZ1A 1D2QA 1P8JA 2XR4A 2J1TA 4P02B 5LA9A 4QDSA 3TOJA 2HLEA 3VBSC 5DAQA 4XFIA 3ZDSA 4EWEA 3CF6E 1L3JA 1NCRA 3KQRA 2J7MA 4XBQA 1IHMA 2WDBA 4FFGA 3R4DB 5F9TA 3JB8A 1AR83 4UW4A 2LS6A 3MEPA 3J7NA 1O3SA 1ZRCA 1RUI1 1PO21 5T5OA 2G19A 2ZGUA 1GQHA 3EJKA 4HBNA 4HN0A 1X9PA 4CDUB 3TEZA 1BMV1 2PYTA 1RUE1 1SLIA 2HWE2 2VUAA 1AJKA 2BPA2 3ZN6A 2YXSA 1G7YA 5I93A 1N1SA 1MACA 2DCYA 2PXJA 2VCMA 5A7QA 1EAH3 2C4XA 4Q4Y2 1OVSA 3IPVB 1A8MA 4PJYA 3MZHA 2CV6A 5FYSA 4LA2A 2XWJB 3VD9A 3UT0A 1XE0A 4GMP1 5FOBB 3AL5A 3VBSA 3UGHA 5K4LA 3RWKX 3LFMA 3HD8B 1SLLA 1POV1 4IUGA 4YFZA 2ZEXA 1V70A 4LO8A 4Q29A 4R8HA 5EWSA 1L7LA 4IERA 4RYDA 2W94A 4JVAA 4WM8B 3LDKA 3O1MA 4V2VA 5ACA3 2ET7A 3MFAA 2ZX0A 4AW7A 3RVHA 4G3YC 5H9RA 4CCEA 4ZPIA 3BODA 4BPZA 4COYA 2FDJA 5JPMB 3NJXA 3W21A 1MS8A 3VDCA 5C71A 2B45X 5DAPA 3WY6A 1WZXA 3E1F1 4N9IA 2QQJA 4YW1A 2B39A 3HNBM 1KS4A 1UY4A 1VP6A 3MIDA 1UMHA 3QLQA 4MV2A 2VJXA 1ENXA 2PA7A 2V72A 3CDZB 3PUAA 2A7AA 4XUNA 2UY9A 3RGBA 1V9U1 4L97A 4YGBA 3T09A 4CEYB 4XJAA 5A3WA 5LRSA 1XSQA 4QU1A 1QOSA 5D8AB 2WNEA 2XJQA 3T0AA 4TYSA 2V4VA 2WZR3 3ILNA 1VAKA 2I45A 4OHWA 1AYN2 5IVEA 3VHPA 3OPWA 5LBEA 3NAPB 4XURA 4QHZA 2WO3A 4Y20B 4BIOA 3SH5A 1WMFA 2GP5A 1BKZA 2WBKA 3KMHA 2OIIA 2DU0A 3GJBA 5T5JA 3VL9A 4AVAA 4E27A 4K8RB 4LEJA 2JDYA 3NO8A 2JD9A 4FPKA 4K9SA 2Q8OA 3WHTA 1R091 1VB2A 2HWD2 3IKWA 4MYEA 5FZ0A 4DINB 3WG4A 2ZS6B 4KU8A 1DGWA 4P9JA 2A70A 2YBKA 4YVSB 1O91A 1A34A 4YWAA 1N3QA 1WA4A 4A44A 2QVSB 2Y26A 2A3XA 1PHMA 3T0BA 2V5DA 1NE4A 1J1TA 1RUC2 1PGL2 1OT5A 4LKEA 4I09A 4FFIA 2Q0AA 4LE4A 4L8QA 3N7JA 4ATEA 2RS51 2BGOA 5L7OB 2BJSA 1DZTA 2XVKA 5FXVA 4HVQA 3HWJA 4JKLA 3BN6A 4UBHA 4BLIA 3POBA 2HWC2 1KFUL 4MSVA 4NPLA 2NMNA 3GHMA 3VBUB 3OGRA 2HWB1 3UYJA 1I5PA 1O5UA 3VKLA 3ZXDA 4OFGA 1YWKA 1ASJ3 1TE1B 3WNMA 1NXD1 1OLME 1YXWA 1XNBA 2LW8A 3ETPA 2XVLA 4FPHA 4V1PA 2F17A 3KCYA 5L36A 1CAUA 1ZZ7A 2ZEYA 4JAAA 3V0AB 3NJYA 3JBG3 1PNFA 1DP0A 1WMXA 4QX3A 2A3YA 4I30A 1IPSA 4Y1VA 2MEV3 1MZFA 1H2KA 5H9SA 5HV0A 1TMF1 2ZGRA 3IWZA 4TWTA 2BQPA 2JKBA 2ARXA 2UWCA 3O12A 1UXZA 4LR4A 4D6SA 4CU6A 3VKFC 4Z1VA 5HCBA 1PGW1 4C8DA 5BNPA 4XIOA 5JUVA 3AYAA 4A3XA 1DDLA 5C3OA 2NLRA 5HCFA 3FUQA 4DXZA 4JHTA 1YYNA 4BQWA 1DLLA 3MF9A 3ZSKA 3I3MA 3CQOA 4XZUG 2WNVC 4OZOA 1V0AA 4J1XA 5ANQA 1B09A 2VOTA 4S2FA 2VULA 3FHQA 2GN7A 1QY4A 1JYXA 3M2MA 5A3UA 3O1UA 2IXLA 2QFEA 1XYOA 5CFDC 1V6MA 4IEZA 4FO9A 1RXFA 1WA6X 1RUJ3 2BFUS 4KBZA 1FXZA 5A3MA 1WW4A 4BH9A 1WCQA 1S1AA 1SBDA 4PLOA 3ZFEC 2E32A 4RA0A 2F6BA 5C4WB 3BU0A 1QNWA 4CCOA 4XXPA 2A6XA 3ZVXA 4DS0A 1MEC1 3VD4A 5APAA 2VOXA 2RJLA 5F3GA 5KC6A 3W5MA 1ZRDA 5K0UC 2X09A 3MIBA 4WM7B 2VQTA 3PLQA 1N1TA 4LUKA 1ND2B 1Q5OA 5CNAA 4YYOA 1AL22 3GZEA 2ERFA 2JG9B 3H3UA 3M3IA 1UNBA 1XSRA 2Q30A 4NAOA 3UGGA 1PO11 1UX7A 4A7YA 5BNOA 2C26A 1NG0A 2PHRA 1AYM3 3IZOA 1VR3A 4JKMA 2V5YA 4URAA 5ABJB 3A0NA 5FBZA 3PVOA 1DZRA 1OLMA 1N3OA 1W6NB 3T4HB 4AR2A 4ZZ8A 1WCUA 3HQUA 5CFDA 4YG3A 4IL7A 2OKXA 1I1EA 4PQQA 2VMIA 3GCXA 5L73A 3K3NA 1QU0A 3WNNA 4BQ4A 2R072 2VZQA 3ZFEA 3H9AA 2D98A 3UETA 3WP5A 3SHRA 1NAEA 1OOPC 5DUUA 1EV13 3URFA 5IVVA 5K0UA 1DQ6A 4S2HA 1CD3G 2EAAA 3AX4A 4JDNA 2DUQA 3LAGA 1E5RA 2EVXA 1GYKA 4ZHNA 4RGAA 4QPGB 3AZZA 1JHJA 5FYYA 1F31A 3D4KA 3POSA 4AL9A 5FZCA 1BJQA 5FZAA 3UJQA 3VN4A 5FYTA 4I3GA 3B7MA 1F4AA 2WNUB 4SBVA 2ZEWA 4LBLA 1F5FA 2XBO1 1LGNA 4XUTA 4BM8A 2GAUA 1KXGA 4RR3B 2AEYA 2AH2A 1Z7S2 3GM8A 3ON7A 3V65A 2WA4A 4CDUC 1OOPA 4E2GA 2I2SA 4FCAA 4BE3A 4BXSV 4Q26A 3AP6A 4P14A 1UO9A 1AF9A 2HJIA 1ASJ1 5EQUA 3FBYA 5FWJA 2HYXA 4FOQA 4LHSA 1LJ7A 2D7FA 4Y33A 4DFSA 4MGTA 1PIV3 1RUD2 1YLLA 1SZBA 4D7TA 1CN1A 4ZZ5A 2MHFA 4IGQA 1VBC2 4LULA 2RS31 2WAOA 3KB5A 2ZA9A 3AZYA 2J1VA 3A4UA 5FZFA 5FUIA 1CZSA 3RI8A 1DQ1A 5EYXA 1JZ6A 3LB9A 1ZBA2 2EIEA 2I07B 3ZPYA 4DOUA 4WM8C 1HQLA 1GWLA 1H1AA 3T2PA 2RM23 4HSLA 5F3IA 1VBA2 4HKLA 3OF1A 1QH6A 5JI9A 2CAVA 1IKPA 1JOBA 4CDUA 1U12A 3WW2A 4QX8A 2WLQA 2ZZQA 4QKFA 3AKTA 3WF4A 1W2UA 1H9WA 1KDMA 1O3QA 4CUGA 5FZ3A 1C8M1 4JGZC 3R4SA 1ZZ8A 4OCTA 4YARA 5JLVA 3IPVA 2HH9A 3NQHA 3UKNA 1WKYA 4XW3A 4CEYC 2VAUA 3B02A 2PTMA 5D8AC 1FI2A 3OYWB 4QKBA 4PHZA 4XHBA 2D3RA 5JI7A 2XPJA 3K4AA 5CKNA 1SDDB 1IPJA 3NAPC 4WM8A 3NNLA 4PQ9A 1PNGA 1QJU2 5KWRA 3O1TA 1XRUA 2JICA 4YG0A 4M01A 1GU3A 4OI2A 1L7RA 2FZ1A 4Y26A 4MGKE 2OW4A 2VCCA 4RSUA 1IS6A 3J4UH 2JECA 1YIPA 1UIJA 1U5ZA 2D6KA 2VGDA 4XAAA 1WW6A 4CP1A 3OPTA 4QQLA 4YVSC 4XBLA 4JGZA 4WVMB 3W9AA 4CYDA 1JZ8A 1MZ6A 3FWEA 3AFKA 3FLTA 4CEYA 4C1XA 4W6WA 4A6SA 5JXIA 5D8AA 1GBGA 2HWF1 1GZWB 5L7OC 4Q0PA 5FZEA 1Y9QA 2Y6JA 1ULOA 3SISA 4YGDA 1OMIA 1QJX2 1PX3A 5LA1A 4YGEA 4BQ5A 3BTAA 1OQDA 3NAPA 1XB9A 4Y20A 3VKOA 3VBUC 2P34A 1O4ZA 4L2NA 2WT2A 1OQ1A 5I0UA 2YU2A 2XXZA 3I3EA 4KWUA 1YJKA 2X29A 3DPRC 2VG9A 4WZCA 5L19A 1IS4A 1G9FA 1GNYA 2XUEA 3DXUA 4YVSA 5FKBA 2A71A 2R49A 1Y4WA 1AX0A 3CHXA 5F1RA 5B2GB 2QNKA 5FZBA 4GXLA 1XNCA 1W39A 2DVFA 2E51A 1SLTA 2H6BA 3PTRB 3RZLA 1VBD3 3ZYHA 4YGCA 1HX6A 1NY71 1UPSA 5C7GA 2Q1MA 2R1BA 5L7OA 1MQTB 3H8RA 1YFUA 3RZGA 1MS5A 1DLCA 3WF2A 3KF5A 5LW9A 3MICA 4ASLA 4OLLA 2QZ3A 1S2EA 2CGNA 3ES4A 1I5ZA 1H1MA 1KFXL 4X6QB 5K9YA 4PIZA 4PLNA 4Y5TA 4FXGB 3VBUA 4P00B 1QJY1 1LHVA 1O8SA 4E2SA 5GLZA 4XCBA 1AR91 3VHNA 2QQKA 5JOYA 2W9XA 5FTTC 2VVFA 2DYCA 3BVCA 1NUKA 4IDZA 3I2IA 3ZMOA 1VBE2 4B4QA 1MS1A 4Q8KA 2HYKA 4NIHA 3V0AA 3ACGA 5LA2A 2UURA 2WIIB 4AK3A 1PVC3 1RUH3 3WG2A 4CTEA 3BI3A 4GQ7A 4IESA 5F5AA 3JD73 4LIUA 4XJ9A 1OQEA 2EF6A 4IV3C 4D8MA 1LOEA 5SV5A 1LU1A 5C4WC 2VUDA 3I59B 4K1ZA 4L11A 3ZXFA 5JXGA 1UU4A 4C1WA 2Y0OA 2DVGA 2GSYA 4YW3A 4BMBA 4HT1T 2IXKA 1W99A 3BB6A 5T54A 3WDYA 4JGYC 5FZGA 3PNAA 2ZGMA 4WM7C 5HBAA 2VW2A 5FP4A 4YG6A 1YIFA 3U0ZA 3HEIA 1CQ9A 2X10A 2JG9C 2WL1A 1UZWA 3ZIWA 4LKDA 1OFSA 4UOJA 5FZ8A 3ZPOA 2FDKA 2DURA 2WFF2 5ABJC 1ZNPA 3O5SA 2Q8EA 3DECA 1UOFA 3WX5A 4DUXA 2VVDA 1NCQB 1KQRA 1YFXA 2OT7A 4FQZA 1M4WA 1EUTA 3LA2A 4GZ9A 4IETA 5K7PA 2VMGA 1POQA 3MYXA 2WN2A 1S55A 2L9LA 3KGZA 4YZ2A 4PF5A 2QQLA 4RL7A 1NQDA 3IT8A 2Q1ZB 5JR2A 4ONUA 4Y1XA 2IFRA 1AR73 4BQ1A 5C4WA 4OHZA 2ZGSA 4IE5A 1LU2A 1HXS2 2D6LX 1H8TB 3GBFA 2W68A 5KXDA 3FFZA 4NWWA 3CL1A 5FZ4A 3POEA 5KXCA 4N90A 4ZS3A 2XVGA 4WM7A 3AZVA 3EHKA 1ND2A 3HAGA 2ZGTA 3ZN4A 2JG9A 3AJZA 2CSGA 1PK6C 4XC9A 4K3UA 2JIGA 4ZKTB 4CEWC 3Q8BA 5IVCA 3APBA 3HN3A 2Q5TA 4QPGC 5ABJA 4LNVA 2ZGNA 4FQ4A 2O0OA 3M4FA 3U07A 1W6NA 3WDUA 3HR9A 3LFIA 4Y4YA 1ZM1A 2RDRA 3RRDA 4BZ4A 3U4XA 1VBB3 3RWNA 2PLV1 2AC1A 4XQ4A 2WNUC 4I3PA 4Q4X2 4NPRA 3UKTA 2RR13 3A22A 2A73B 4BXFA 3MW2A 1D2SA 3TNQA 2D6NA 2HBUA 4LHKA 1O4TA 5LRRA 2C9KA 1O8PA 2O14A 1W9FA 2W91A 3HNMA 4IEOA 4M4PA 5FUPA 1U5IA 4GJYA 2ADEA 4QPWA 4UFMA 5BNNB 2FCUA 2Z5WA 4HFSA 4Q4V1 2QDRA 3OGGA 4KL1A 4MH0E 2KD7A 2WN3A 4GH4B 3VZJA 1BQPA 3VDBA 2XGXA 4CPBA 4QPGA 3J26N 1OC1A 1WMEA 1NZIA 1RVF2 2H0VA 4CU7A 1V6OA 3AKPA 2WABA 2XMLA 2QZ2A 4HOOA 2RG4A 5CFCB 2RDNA 2J1AA 1F2NA 2ZMLA 4U2AA 2WNUA 4XIKA 2CHHA 3AKQA 1PVXA 5GJ6A 1VBD1 3AMHA 4GB32 2YGMA 4FI9A 4GKYA 2BOJA 3W58A 3VDAA 3FC0A 4Z2AA 2UYBA 5G04L 2D5FA 4QXBA 4RR3A 2NYYA 2BNNA 3N9QA 4XJWA 4ES9A 1JYWA 1PO23 2WJSA 4GAZA 4Q1RA 4D7YA 3WDVA 2WLPA 1X8EA 2FCVA 2DVAA 2DU1A 2R6QA 1YRZA 1RUE3 1IS5A 1V6JA 2EIDA 1V00A 1CAXB 2R043 1WLTA 5CU1A 2FMDA 3ZMNA 5FJHA 3SH4A 2PELA 3K46A 3IDBB 5DXDA 5E6HA 5IK7A 4Q4W2 2A3WA 2VZ3A 3VZOA 1DYKA 4HN1A 5CKQA 2JDZA 4QKDA 1R082 1A8DA 2P2KA 4GMP3 5JOZA 2VMDA 3H1YA 4MG2A 5IWFA 2ORZA 3B69A 4U36A 1Z78A 3SNMA 3U1XA 3JXSA 4WZFA 4F7ZA 1ZA7A 5A3NA 2ZGPA 3AM2A 1EY2A 1RHI2 4AVSA 3C7FA 3ENRA 4XFFA 4COVA 3OGJA 4ZONA 1DZQA 3PU3A 1GOGA 2DCZA 2VECA 3OOXA 4XQWA 2G9ZA 3ZYGA 4FFHA 1SPPB 2OXBA 4TZDA 1RXGA 2D6MA 3AMMA 3N36A 5T55A 4FSJA 4XMAA 1OUSA 1IG0A 1W9SA 1DQ2A 3ATGA 5H9PA 3N7MA 4XPVA 3N9LA 2D97A 1JU3A 1UYYA 3SKVA 2XQRA 1C8NA 4HLTA 1ND3B 3MV11 5EIYB 2VNGA 2WO1A 3Q8EA 4ZY9A 4AEJA 3OYWA 2FCTA 2QDNA 3MIHA 4YFWA 3E5QA 4E8CA 3GHNA 5FAXA 3M3CA 4XUPA 4YZ5A 3P3PA 1AR71 5DUVA 2XHNA 3O1RA 2XHKA 3IB3A 1S0IA 2VNRA 2YHJA 4IEUA 3LSDA 4LT5A 1W8NA 3BGAA 4UFHA 3KV6A 2XJPA 1FPN3 2CAUA 3M70A 3ZYBA 2B46X 3C7OA 3KGLA 2RDQA 4O9EA 1COV2 1S0BA 1FNYA 4SLIA 1D4VB 5GZDA 3VBOB 2R062 2ZX2A 4WVMA 1A78A 4W65A 1KD7A 4LK7A 2J1UA 1RUC1 2WINB 3VZNA 2JB4A 4MGSA 1PGL1 2XUMA 4LBKA 1VBB1 2VH9A 2YG0A 1YQCA 1UN1A 5FK7A 4MHUA 4OYUA 4AI3A 5A1LA 4OVEA 2ATFA 3D5OA 3HN1A 4NAMA 1GZWA 1MQTC 2JX9A 1HJFA 2RS53 3OSDA 1OXCA 4K20A 4OUMA 4XILA 2W95A 3GDBA 1VE0A 2E53A 4N43B 2BWCA 2RS12 2Y60A 3E6DA 2BV4A 5A6QA 4NIDA 4A2UA 5FPAA 3UK9A 1CWPA 4XJ8A 4XJZA 4D69A 4Q0VA 4IQPA 2E26A 5GLUA 4QHBA 1W6OB 4LMFA 3I8TA 4Y5Z0 4YLZA 3SCHA 5FZHA 3T0DA 5IAVA 2AR6A 1GANA 2I74A 4XQDA 5IJRA 1HRI2 4CUBA 3D3AA 3O1VA 1VBC3 4DB5A 2EXKA 2VC9A 1NLQA 3LOIA 5AFEA 3U10A 4OQ8A 3TRSB 2B4KA 1GNHA 1VRH2 3BU7A 2XJVA 2X8KA 3TN92 1TMF3 1UKRA 1HRV2 1IQDC 1MQTA 3B00A 1LOAA 1ZBE2 3MPPG 3N7LA 5GZCA 5KBFA 1JYTA 1W2AX 2BZDA 2F4PA 5FPZA 4W6XA 3DV8A 5M0TA 1PX4A 3K2OA 3UJOA 3WLUA 4AOCA 1DG6A 2Y6KA 3WT3A 4AF9A 2OUHA 2XB6C 3LF7A 5DAXA 4QXHA 5LBFA 3UESA 5LY1A 2R041 3RYPA 1DBNA 3M3EA 3KD4A 3RZZA 2QQPA 1O3RA 5GLWA 5FR3A 4TXWA 1NCQC 1PZ9A 4LBOA 3FZ3A 2ZGLA 2W87A 1TZOA 3LZZA 1AVBA 3DYPA 4XFGA 2JE7A 2VBDA 1IOAA 5DPNA 4Y4RA 3AL6A 5A7PA 5IFTA 1IQAA 4CCJA 5LK5A 4UW3A 2FQPA 3X29B 1SMVA 4Y22B 1AX2A 1H8VA 4UT5A 4B8EA 3I59A 1IS3A 3ZX7A 1O5LA 1H8TC 2RV9A 4L9BA 3TAYA 1MEC3 5FLJA 4AQTA 5ANNA 3ZFFB 3B3QE 3J8F2 4RHV2 2P4EA 1KDKA 1QQP3 2Y8KA 4ET7A 4GWJA 1GZ9A 1VRBA 3MLLA 3OBAA 2R30A 4ASMB 2DFCA 1FOD3 2XWBB 5A7OA 1GR3A 3WW3A 5JWPA 4HMZA 1C28A 5EJ1B 3T2OA 1PO13 1RTVA 2BP6A 3RJ2X 4DY5A 3N9OA 3O1SA 3SITA 3VZMA 4HANA 2ES3A 4NHXA 4ATFA 5BUVA 1NCQA 2JJ6A 4OMCA 2GH2A 5J48A 4KU7A 2BNOA 3I2FA 4PCRA 1Y43B 4QQOA 3MUZ1 3PUSA 3KZ4C 4XJUA 4FPCA 1FX5A 2DTYA 5DZGA 5KHIA 4DIQA 5FPUA 2VD7A 5I8YA 5IT6A 4QKNA 3E5UA 1WMDA 3OUHA 4LUMA 5J37A 2VOKA 3ZR6A 1JZ7A 1H8TA 3NWKA 4UFKA 4B3NA 3WG1A 3Q8AA 4GALA 2Z42A 5BNNC 2VTXA 2VCBA 5LY2A 3PVBB 3ZXLA 4GH4C 1FPN1 4HPKB 2CGOA 2W47A 3NV1A 4FOWA 1VIWB 4BCUA 3MLJA 1R64A 1JYIA 4JTNA 1BXHA 4BQYA 5C8CB 4COZA 3OUJA 3THTA 3NNFA 4BDVB 4LO6B 3QD6A 5CFCC 1T2XA 2YC4A 2VCAA 5ISLA 4AI0A 1KRIA 2JKXA 3RMXA 3ORJA 2QBXA 3JQWA 1DCSA 3J7HA 1BLZA 1Q8SA 5AC93 3CZJA 1IKQA 2XBO3 5EHDA 1LHWA 4ZU7A 4EE2A 3AYCA 5FREA 1Z7S1 3ZXGA 4ISRA 1UOJA 4XAEA 1OI6A 1ZYBA 2C9AA 3J7LA 4Q0UA 5BNPC 1UPIA 4I0BA 4KGGA 1I9RA 5DN2A 1LOCA 5BNNA 2IFWA 4UXAA 4K1YA 2XJRA 5C8WA 4GH4A 1LRHA 5FO8B 3CU7A 4QB6A 4CDWB 1HIXA 3MBWA 5A32B 1GP6A 1RUD1 3B9IA 4Y1UA 4C91A 5FXXA 3GJAA 1VBC1 2BUKA 5DZEA 4E9KA 2OQ6A 2DCTA 1UMIA 5CFCA 1YUDA 3OBZA 2RS33 1ULPA 3C7HA 1Y9GA 2J22A 1QXJA 2IWGB 4IEVA 4AYUA 1ZBA1 2LTNA 1J59A 1Q8VA 2TBVA 1GQPA 2JE8A 4HETA 2BFUL 4BISA 1VBA1 4EZHA 2CY6A 2BGPA 1J3RA 3WV6A 1ST8A 2P3JA 3WP6A 4ZXKA 1AL0G 2FDFA 1SLBA 2Z2SB 1US3A 4KBBA 1HKDA 3WCSA 1MZEA 1JMUB 3H7YA 5FFOC 2JXAA 3ZKYA 1UD1A 4D94A 5FDBA 2WFF3 4XABA 5AVPA 1CAXA 4XFAA 4BK5A 2PHXA 2BVVA 1YFYA 4XF9A 5BNOC 1O59A 3ES1A 3VZKA 3ROUA 4YNIA 1C8M3 4QB2A 3ZYJB 1HB3A 2XG3A 5FY8A 1FMD2 1TG7A 1JYVA 2ZEZA 5FZMA 3BTXA 3WDTA 1ULEA 3AXEA 3GNEA 1Q8PA 1D4M2 2QKDA 4B4RA 5J7MA 2WT1A 1LCLA 2RE9A 4L92A 4PI2A 4N9HA 1BEV3 1YQ2A 2BEOA 1YQ6A 2RHPA 3FHAA 4XFBA 3O1OA 1F15A 5IATA 1QJU1 1RUI2 1AX1A 5I0SA 3F2ZA 3MDPA 4M3CB 1DHKB 1C3HA 2VO5A 2J1RA 2DFBA 2VZSA 4AVBA 2V4AA 4PDWB 1LOBA 1QQP1 2P6CA 2W08A 2YPDA 2QQWA 3HT1A 5E8AA 5FZIA 2GMEA 2YROA 3S6PA 4YM1A 5I8SA 4YZ1A 1FOD1 3OD0A 1SPPA 3AVSA 1X8MA 3VB9A 2NM1A 3VBOC 1ZVFA 1RUF2 2BTVC 2YUEA 5GLVA 3LKJA 1UKGA 1ODMA 4R4XA 5DDJ3 3S0MA 4AVVA 4E2QA 1CGPA 4AVCA 1FV3A 2Z4FA 1F4HA 1XNAA 1ND3A 1RMU3 1TQ5A 3NRUA 4KG8A 2H0BA 2OYZA 1AHSA 2HWF3 3RG0A 2VNOA 4A7ZA 4QHOA 3KHCA 1QJX1 3NJVA 4JCKA 3TB0A 4N43C 2IXCA 3B94A 3AZWA 2DF7A 2WNOA 3ST7A 1LR5A 1R1A2 4QM9A 4YM2A 5LWBA 4M0NA 4JC1A 1REDA 2QQOA 4FPOB 3RNSA 1T6GC 5FPBA 5FZ1A 1UZ0A 4QQHA 3HQRA 3MGUA 5KC5A 3LQCA 4EN0A 3DUIA 3RFRA 1UOBA 1W9TA 5JAXA 1RL3A 3IDCB 3VLBB 2Y0IA 3VBOA 3E97A 3INAA 3ZSLA 3HBZA 2ARAA 2DUOA 5I0DA 4NJ4A 1LHUA 4B29A 1V9U2 2IUWA 2XLGA 2OVUA 3HOBA 4QX0A 4DUVA 3ZXKA
chains in the Genus database with same CATH topology
3GZUC 2RMU2 1LOGA 2D43A 2DWRA 1H0BA 5AC91 4AHZA 2PHWA 2BWAA 1QF3A 2WS92 4LE3A 4CDXB 4PBPA 4N43A 1XYNA 5FO9B 2XJSA 4ORFA 4Y1YA 1H4GA 4XYXA 1RJ7A 4FPYA 2XJTA 4QT6A 1QJY3 4YW2A 1R092 5FLHA 1W6OA 1YCIA 2CL2A 3PMEA 1AR93 1UCXA 3AKRA 1VBE1 2X5IB 4XFCA 3LA3A 3T1LA 4Z2WA 2DVBA 2DTWA 4LO7A 4KGQA 3QH7A 4B4PA 2NPIA 5KHGA 1ZREA 1BBT2 1UAIA 4XBNA 2UWBA 1WCDJ 2XH6A 2GC2A 3RJRA 3ZFFC 1RJ8A 1W6PB 5EZWA 4CP0A 2HWB2 5HXVA 2AGSA 3PJQA 2GN3A 3J9SA 3POWA 1W6MB 1KS5A 2WFF1 3T1MA 5I8TA 3ZO0B 3KT7A 2XKOA 4IEXA 1X33A 2EIGA 2OUJA 3DGTA 4INDA 4N53B 1EYBA 2OA2A 3LA7A 4Z92B 1LODA 4WVZA 1N3PA 4Y22A 5FMOL 3I54A 3QBQA 1UIKA 4Y24A 1BEV1 2R16A 1AR82 5T5LA 4KNCA 1HV0A 2HEYF 1GFF2 3VHRA 3ZFFA 1J3PA 1FNZA 3S30A 1KJRA 3NKTA 5F6KA 3UKVA 4BLJA 1QHDA 2D93A 5C8CC 3MLKA 3WDXA 4XF3A 1EAH2 1DGRA 2TEPA 1RUG2 5GLTA 3VGIA 1NOVA 3WP4A 1AJOA 5DDJ1 4ES8A 2PLV3 1URXA 3TYJA 4Q4X1 5J36A 1RMU1 1LESA 2ETEA 1JYCA 4EN6B 2UYAA 3GBGA 4J1WA 2JE9A 4FOVA 5J09A 1UL9A 1F5JA 5ACA2 1WD3A 1HLCA 2CWSA 2FHRA 4FXKB 2V09A 1WD4A 2WSVA 4XF0A 4Q4V3 2GH8A 4HPKA 4META 1HRI3 4CDWC 1S2KA 1JBCA 3B01A 1BVVA 5C8CA 1RVF1 4KWJA 3MI8A 1XU2A 5GKAC 4LBNA 1C5IA 4AFAA 4GB31 5BY5A 1DGLA 4COUA 1GV9A 1JN2P 2WZR2 4M3CE 5EJ3A 3WHUA 4MLOA 2UWAA 4IEQA 4LHLA 5JMCA 4DRVA 3AK0A 4QMAA 2HEVF 1OFNA 2OPKA 3MPBA 1GSLA 3OCPA 2XL9A 3AP5A 2HWE3 1LKNA 3CEWA 3VZLA 1ENQA 3GZAA 4CDWA 5FQ0B 3QCWA 3IMNA 3KT4A 5EYYA 5A32A 2CYFA 4Q4Y3 2PHDA 1J58A 1MS4A 3VBRB 2A6YA 4Q4W1 5FLIA 1IGOA 3L2HA 1C4RA 2EA7A 2KA3A 4NO4A 3HIFA 1WBFA 3E5XA 4EN7B 1AXYA 5TSWA 1BYHA 4AWDA 5J96B 3H1MA 3N3HA 1QGLA 1X36A 3NVCA 3VBHB 1APNA 1EPWA 4O9GA 3LWCA 3WVJA 1REFA 1WW5A 1UX6A 1WCSA 2A5ZA 3EBRA 1ND2C 1ZZ9A 1ASJ2 3H1WA 4IV1B 3FLPA 5C9AB 4MGYE 4AFBA 4QGMA 2GALA 4S2DA 3JBG2 1S0FA 4XF1A 2AENA 3M3QA 1CJPA 2MEV2 2W0XA 5GZGA 2ZGKA 3DF0A 2ZX3A 3C2UA 4NVPA 1NA1B 4X8PA 1ULDA 3PHMA 4XTMA 1H9PA 3PVEA 1AYN3 2GMPA 4J6GA 5KHJA 3WQ1A 4Q1PA 4M3CA 2OZ6A 5I0RA 4PDWA 1QWRA 1RC6A 4UW5A 3WW1A 2HWD3 2B7YA 3KT1A 1MS0A 4K21A 3RDIA 4E4SA 3FE5A 5F6LB 2PHLA 4YM0A 1DQ5A 4AVTA 1Q43A 4ZU4A 1SLCA 4EWDA 3BALA 4F3JA 3USUB 3VL8A 1Q56A 1RUC3 1S0GA 1KITA 1MS9A 1K5MB 2D44A 3BPZA 2EXJA 1RUJ2 5A33B 1OLRA 1WUVA 5E1RA 4P9WA 4XETA 2CTVA 5DG2A 5E16A 4CDXC 2BNMA 2RS11 3FHIB 3NKGA 2HWC3 1SEFA 2P3KA 4H14A 4RR3C 2DUPA 2LALA 5T52A 3AMPA 2UU8A 4AEDB 2ZMKA 3D8CA 1HRI1 1H30A 1PZ8A 1AYM2 2X5IC 4HVOA 4AQ2A 1ENRA 4L99A 2H6CA 1VRH1 2VOWA 1NLSA 4PIYA 1DGRN 4NOTA 4C0BA 3C3VA 1HRV1 2P37A 2ZJCA 3PMSA 3WQ7A 2ARBA 4LO4B 4FTSA 2ZACA 3WR0A 4QM8A 2VY0A 4CDXA 4EN8B 4FBFA 1ZRRA 4KH9A 1OA3A 1EV12 1REEA 2YC0A 4DQAA 1O3TA 2HWE1 2E9QA 3O0XA 2ZX1A 2G9GA 3CNAA 4I01A 4PBOA 2VXRA 3OBTA 2QJVA 1WBLA 2NQYA 2GDFA 2X5IA 3BCWA 4GMP0 4Q4Y1 3OD4A 3RMYA 1ULGA 1PGSA 1POV0 3NV3A 4EWAA 2Z69A 2LUWA 1UZYA 4FP2A 3AXDA 2FMYA 3SCGA 2VW1A 1YJLA 4RS5B 3SCFA 1A3KA 4LBMA 2O8QA 2PN5A 4KWKA 5KHKA 1GKBA 4C0HA 3J8F1 1W6PA 1AL23 5IUQA 1O4YA 1MVQA 1OA4A 4CDQB 4E4ZA 1W6MA 1H2NA 4P5HA 4QPYA 1JTZX 3VDDB 3AZXA 1PIV2 1SFNA 5CADA 4PLMA 2TUNA 1IPKA 2DCJA 3MIGA 4N53A 2GNMA 1AZDA 2ZABA 4AFDA 3WUCA 2R073 2K0GA 3MW4A 5EV7A 2D40A 3HMYA 4K6BA 1NE6A 1VLNA 1R1A3 3G7DA 3R6SA 1AYN1 1DFQA 1UF2C 2HKXA 2RM22 2ZBJA 2PAMA 1DGWX 4I2OA 3OTFA 4AEKA 1DF0A 1D0GA 1CPMA 1Z0HA 1N47A 5DG1A 1G9BA 2WNVB 1ALYA 1LHOA 3O0WA 2HWD1 5JZGB 1U5XA 3I4IA 1SLAA 4ITCA 3R4UA 1OSGA 1V6NA 3OY8B 4BWOA 2OZJA 2GNTA 5BV6A 5JDBA 3EQEA 3WOGA 2CGPA 4KQ7A 3DKWA 4I02A 4GKXA 2CWMA 4YZ3A 5JPNB 2GU9A 2E7QA 3D82A 4X8NA 4AI2A 3T2TA 3IDEA 3TWIA 1Z7S3 4FTBA 2HWC1 2VQAA 5JOWA 5T5PA 4FP3A 4LBJA 1F9KA 2ZOEB 4AGVA 1JXNA 1DIWA 4TSVA 1G86A 3H3ZA 3VBRC 1RUD3 2WKKA 2B9UA 4BYYA 1FT9A 1RUNA 1C57A 3D6EA 3E6BA 4P9GA 1AR62 5SV8A 1Y7BA 1HQNA 2QUOA 3LGRA 1ZBA3 2GC1A 3ZYRA 3MF6A 4M00A 3VBHC 5FCCA 2GNDA 2FZ2A 1VBA3 2IXIA 2YPJA 3BOWA 3WCRA 1VALA 3ZXJA 4IV1C 5JIUA 4AFMA 2IXJA 2K9ZA 5C9AC 5FQ0A 1QXRA 1FMD1 3VBRA 4GWMA 4HL0A 1R1ZA 3ZIXA 4OHYA 1D4M1 1X7NA 3LSEA 3N35A 2WFPA 2MNGA 1VBD2 3O0VA 1NA1C 5FOJB 3VBHA 3ZSJA 5KXBA 1QJU3 1SBEA 3VKNA 1QNYA 5T50A 4DNYA 4FVVA 2ZAHA 4FPJA 5CIRA 1AL21 2JENA 3WNXA 5AVAA 3TBDA 1AUYA 4P9IA 4IV1A 1OLQA 2AZ5A 1RUF1 4E4DX 5C9AA 5JOXA 1RUG3 2P3IA 3BIWE 1QOTA 1QXPA 2G9FA 3MIFA 2ZHNA 1K5MC 1PVC2 1QMJA 1PM7A 1RUH2 3JD72 1NQJA 4LHNA 4EROA 1NA1A 1SDWA 4WV8A 4A7KA 2R071 1QJX3 3SMHA 1R1A1 1DQ4A 1H4HA 5I0TA 4URTA 4RQPB 5C6CA 1JW6A 5HCAA 3OBRA 4AEDC 2SLIA 3GALA 1CPNA 3IIAA 2JG8B 2R1DA 4JGZB 1WCKA 3RYKA 2A75A 5DUXA 3WP3A 3HQXA 3AP7A 1UU6A 3O7OA 3USUA 2FBEA 1FV2A 1K5MA 2RMU1 4OI4A 1H2LA 2D3SA 4H3WA 5A33A 1LGBA 2A6ZA 1TNRA 1QH7A 4N7IA 1AR72 2WS91 1TME2 3NV2A 4JDOA 1O7FA 4IEYA 2C5DA 4XMIA 4KG0A 5CB7A 4FAHA 2A6VA 4MX3A 3WXPA 4D3WA 4AEDA 4UW6A 1GNZA 1TNFA 4NR1A 3VKMA 5I91A 4DRRA 5BXXA 1E57A 1VBE3 1VB4A 3QOPA 1JUIA 3PTYA 3NL1A 4Q0QA 1VBB2 2KM2A 2B8MA 3AYDA 3VUOA 1BBT1 3CJIB 2R32A 3JQXA 2RR12 4XTPA 4RS5C 2X53S 5E89A 1JUHA 2WC2A 4R4ZA 4I0AA 2XJUA 1Q3EA 4H7LA 4LLOA 1QDCA 5DZFA 3WDWA 3WZ1A 4NN0A 2PHUA 4CDQC 4XOGA 3DPRB 4BHPA 5BNQA 3VDDC 4JRLA 3CLPA 4MXVA 3WUDA 4P9XA 1OPMA 1NXMA 3I7DA 5C33A 4DZGA 4WVWA 4BIFA 4FPEA 3THPA 4CZSA 4D7SA 1ZZBA 4AGGA 1G6NA 1ND3C 1I6XA 3ZFGB 5JSOA 3FX3A 4MUVA 3ILRA 2W52A 1B35B 1AR81 4RS5A 1CAVB 1HXS3 2NP0A 4R9CA 1U0AA 4AHWA 1D0HA 2B42B 1PO22 4YW4A 3ME2A 1SCSA 5CG8A 3H0OA 1BMV2 1RUE2 3KLSA 3FLRA 1KJLA 4YVWB 4CDQA 5CA6A 5FRAA 5JZGC 2WWSA 2R042 2ZCWA 1RINA 1EAH1 3VDDA 5JSPA 3IM0A 3WINE 1RUG1 4JRAA 1CONA 2O1QA 2PAKA 5DUWA 2YMZA 4NHMA 1HW5A 4QX5A 2JD4A 4IV3B 4GWNA 1OPOA 4Q4X3 4YRDA 3RSJA 2QCSB 3RPQA 1G8WA 3AYEA 3L9JT 1H2MA 1WLDA 2DVDA 5ACA1 3OJBA 4JGYB 3WW4A 3SH3A 1LEMA 4MXWB 1RB8G 2GMMA 2D6OX 4QQPA 2ZPXA 2PFWA 1CVNA 2WNVA 5JZGA 3FUOA 2PHFA 1JH5A 4QPIB 1DQ0A 4BA6A 1N1YA 3EO6A 3JU9A 1RVF3 3OY8A 1W6QB 4H55A 3Q9OA 3ASIA 2DV9A 1XU1A 4Z07A 4JV4A 3POYA 1SCRA 4NWVA 3HT2A 3M3OA 2B5HA 2D3PA 3ECQA 4AG4A 4GB33 2A6WA 5CVRA 4HKWA 2E7TA 2WZR1 4HSJA 1Y3TA 1FATA 4GIQA 3VHOA 3PJYA 3LCPA 1TEIA 4AE2A 4ZU5A 1GICA 5CAZA 3M1HA 1BVP1 3JCIA 3JZVA 4G4FA 1FPN2 1PK6B 3OPZA 4EN9B 2SBAA 4CEWB 2WZPP 1HQWA 1CX4A 4HK8A 1LB2A 4HK9A 4M0HA 4Q4W3 1R083 2D5HA 1ZZCA 1YNAA 1RUOA 2MPFA 1SQ4A 4MVTA 2YYOA 4M3CF 2ET1A 2RS52 2VPVA 3LOBA 2DCKA 1S0DA 3A0KA 3V0BB 2YGLA 1RHI3 2QE3A 3R05A 5F5QA 3N4MA 4QXKA 1JHNA 2VQ0A 4F8AA 1QKQA 2ZZJA 4OI1A 4HVRA 5HI0A 1XQNA 3L2YA 1UU5A 4FPGA 2YY1A 4Q8LA 4EJRA 5IK4A 1CR7A 4LA3A 3JBG1 4P9LA 3R0RA 2BYVE 4R9BA 2KXLA 5K8SA 2ZKLA 3W59A 1S0JA 2MEV1 2PHTA 3GYDA 2ZX4A 4MGIE 1YFWA 2AYHA 3QACA 1TMF2 4QD2A 4DY3A 4XZPA 1W0OA 3FMGA 1HXS1 1IZ3A 1X50A 4AI8A 3P3NA 1PGW2 4RQPC 1Q8OA 4KWLA 1YHFA 4XE9A 5FPXA 3B9CA 2JG8C 1OHFA 3RS6A 4AHXA 1COV3 3AP4A 1NYWA 2R063 2ILMA 4XXAA 1QOOA 2ENRA 3CO2A 3RQ0A 4DMIA 1OA2A 1RUJ1 4W6YA 1FAYA 2WT0A 4H7MA 1V6LA 5CBLA 4UBGA 4YSFA 3M7AA 3M8LA 4FOYA 4RGGA 3WG3A 1BK1A 2RS13 2ZHMA 1H1IA 1MEC2 3VBFB 3ZYPA 3AMQA 4RQPA 1QQP2 2K2SA 2Q4SA 3ALQA 1FOD2 2JG8A 1CAWB 1V6IA 1CESA 3AJYA 1AYM1 1PO12 3K48A 4AQSA 1FYUA 2GC3A 1WLWA 4LBQB 5FMOS 4XDQA 4FPFA 1AR63 3KCCA 2AREA 1RITA 4Z8BA 3GBWA 4FT8A 1HDKA 1VRH3 3ZN5A 1XE7A 1LULA 2EXIA 1XE8A 2XL7A 1C5HA 3CJIC 3TN93 1HRV3 4PIXA 4LLFA 4JQRA 1Q8QA 1ZBE3 1X82A 1DYPA 4CRQA 5J98B 2UY8A 1EV11 2LM3A 1LHNA 4AEMA 3NV4A 5GALA 4COWA 3BOPA 4ISQA 5J3UA 1XNDA 1DU3D 3D0JA 3KM5A 1LGCA 4QQ2A 5GZEA 3KSCA 3FJSA 4MZUA 4OHXA 2P17A 3V64A 1GZCA 3AMNA 1NCRB 1R081 4AGRA 3ZFGC 5LEJA 5H9QA 5A3LA 5AC92 3G6JB 3CJIA 1B35C 2VMHA 2XBO2 4RFT0 3UV9A 4BOWA 5JIAA 2VVEA 4AHYA 1RHI1 3AFGA 1ZZ6A 4N7UA 3J8F3 4RHV3 4XFHA 4Y1ZA 4PDWC 4OHVA 2YDEA 2V73A 1WLCA 3GZTB 4YVWC 3ZN6B 3I2DA 3MFCA 3DPRA 2R0HA 1G9CA 1YI9A 1OKQA 4IXLA 1PIV1 3B5LB 2IZWA 1AXZA 1J3QA 3NSTA 1UW8A 4JDMA 1XYPA 4YZ4A 3AKSA 4HKOA 2RS32 4RD7A 1UMZA 2XLAA 3VBSB 1ZA4A 3ELNA 3ZFGA 2TNFA 2VUJA 1WGPA 2XLFA 3AB0A 1B35A 4WBBA 1SACA 4JTOA 1NLRA 5GM0A 1CAVA 2RM21 1PMIA 3GF6A 2JEMA 4YM3A 2ZHKA 3ZYIB 2BVBA 3IBMA 1S2BA 5BYNA 3RYRA 4YVWA 1COV1 4QPIC 2E63A 2GZWA 3ZXEA 1LOFC 5JCTA 1C8M2 3SXWA 1ZX5A 2R061 2E6VA 4QGNA 5KHHA 3KS7A 3AP9A 1AXKA 4IEWA 4LTAA 3H50A 1LTEA 3FBMA 4IV3A 1MS3A 4XF4A 3MIEA 1TME3 1BEV2 1SBFA 5IK8A 1U5YA 2VW0A 2ZAAA 4XHXA 4JGYA 3S7IA 4MXWA 4R52A 4QU2A 5JSRA 2EAKA 2WQZC 1S0CA 1LECA 2Z79A 3EXUA 5EFUA 2NMOA 2Y38A 4LBQD 3ETQA 3K51A 3ZXAC 1G9DA 4R9AA 3QH6A 4QPIA 4HZFA 1RIRA 1LOFA 4MGZE 4C90A 2ZTNA 1W6QA 3IN9A 5DDJ2 1AR61 4CP2A 2ZGOA 1ZRFA 1C1LA 1VAMA 2O8OA 1F8VA 4Q27A 4I0WB 4Z82A 5FO7B 1RMU2 4B7EA 3D0SA 1QDOA 3ZSMA 1GQGA 1MZ5A 3TN91 2HWF2 3JUUA 2NN8A 3V56A 1ZBE1 4NHLA 5AFBA 2G4IA 1RGSA 1SFYA 4FTEA 2ZKNA 1PK6A 4TLFA 3U11A 4CEWA 1MVEA 2HEWF 3DL3A 1FMD3 1YO8A 3O14A 1CAUB 3USSA 2EXHA 4EV0A 1YI7A 2YZ4A 2ZHLA 1D4M3 5LEKA 4N53C 4F83A 4BMEA 2WA3A 4K8FA 1NY72 1CIWA 1V6KA 3V0BA 5BPXA 1RUI3 1NZCA 5BNPB 1EPZA 3H8UA 4XEZA 2GC0A 2IXHA 4RHV1 2E7AA 3VV1A 1QJY2 4P9YA 2GNBA 1A6CA 2NZ9A 1AR92 3B93A 1RUF3 1G9AA 4OUSA 2CNAA 1PVC1 1RUH1 1XXNA 2IC1A 3JD71 1XNKA 1POV3 2D6PA 4QGLA 3PVNA 1ULFA 5CG9A 5JVVA 3WD5A 1PZ7A 4G9SB 1S0EA 4AFCA 3CJXA 3VBFC 1JOJA 4OULA 2YV8A 2BW8A 5GZFA 5IT6A 4OI0A 4NHKA 2ZGQA 3H7JA 5BNOB 4WVVA 2VU9A 2N7GA 4B7KA 5IK5A 3DN7A 1BZWA 2C1FA 3E6CC 2PAEA 4FAGA 3ZSEA 4AXOA 4AQ6A 1ENSA 4R9DA 3WQ0A 5CFDB 1V9U3 3MW3A 2RMU3 3JB4C 1OD5A 3ACLA 3N7KA 3ZFEB 5JR7B 1TME1 2XKPA 2C0ZA 2WS93 2ZMNA 2BGCA 4GA9A 4GULA 3SLIA 5EXOA 1CJDA 3VBFA 2R0FA 1M06G 1GLHA 3ILFA 5K0UB 1EP0A 2RJKA 4FPLA 4IEPA 1R093 4Q2FA 1CAWA 1LEDA 2W39A 1VAVA 4K7JA 4LO5B 1I3HA 1LENA 1W0PA 4AI1A 3UL2A 3NJZA 1UZZA 2AUYA 2EALA 2WQ4A 3FFQA 4LBQA 1ONAA 1QJZA 1N1VA 5T3NA 1NCRC 2PLV2 4Q0SA 2PQQA 1MR5A 3TNPB 2RR11 2WSUA 1BBT3 2VOVA 1VJ2A 4DPNA 4S2GA 5LK7B 1J1LA 1BCXA 1OOPB 4OZXA 1C1FA 2HWB3 1ULCA 3KCXA 3RI9A 5KXEA 4Q4V2 4YW5A 2BBVA 4K40A 1HV1A 3S7EA 1WW7A 3NW4A 5D1IA 5E88A 4X6RB 1D2QA 3TOJA 3ZDSA 3VBSC 4XFIA 4EWEA 3CF6E 1L3JA 1NCRA 3KQRA 4XBQA 1IHMA 3R4DB 5F9TA 3JB8A 1AR83 4UW4A 3MEPA 1O3SA 1ZRCA 1RUI1 1PO21 5T5OA 2ZGUA 3EJKA 1GQHA 4HBNA 4HN0A 4CDUB 1BMV1 2PYTA 1RUE1 1SLIA 2HWE2 2VUAA 1AJKA 2BPA2 3ZN6A 2YXSA 1G7YA 5I93A 1N1SA 1MACA 2DCYA 1EAH3 4Q4Y2 3IPVB 1A8MA 4PJYA 3MZHA 2CV6A 4LA2A 2XWJB 4GMP1 5FOBB 3VBSA 3HD8B 1SLLA 1POV1 4YFZA 4LO8A 1V70A 4Q29A 4R8HA 5EWSA 4IERA 4JVAA 4WM8B 5ACA3 2ET7A 3MFAA 2ZX0A 4AW7A 4G3YC 5H9RA 3BODA 4BPZA 4COYA 5JPMB 1MS8A 2B45X 3WY6A 4N9IA 4YW1A 2B39A 1KS4A 1VP6A 3MIDA 3QLQA 4MV2A 1ENXA 2PA7A 2A7AA 2UY9A 4CEYB 1V9U1 4L97A 4YGBA 4XJAA 5LRSA 1QOSA 5D8AB 2WNEA 2XJQA 4TYSA 2WZR3 3ILNA 1VAKA 2I45A 4OHWA 1AYN2 3VHPA 3NAPB 4Y20B 4BIOA 3SH5A 1WMFA 1BKZA 3KMHA 2OIIA 2DU0A 4E27A 5T5JA 3VL9A 4AVAA 4LEJA 4FPKA 3NO8A 4K9SA 2Q8OA 3WHTA 1R091 1VB2A 2HWD2 3IKWA 4MYEA 4DINB 3WG4A 2ZS6B 4KU8A 1DGWA 4P9JA 2A70A 4YVSB 1O91A 1N3QA 1WA4A 2QVSB 2Y26A 2A3XA 1PHMA 1NE4A 1J1TA 1RUC2 1PGL2 4I09A 2Q0AA 4LE4A 4L8QA 3N7JA 4ATEA 2RS51 5L7OB 1DZTA 2XVKA 4HVQA 3HWJA 4UBHA 4BLIA 2HWC2 1KFUL 4MSVA 2NMNA 3GHMA 3VBUB 2HWB1 1O5UA 3VKLA 3ZXDA 4OFGA 1YWKA 1ASJ3 1TE1B 1NXD1 1YXWA 1XNBA 2XVLA 4FPHA 4V1PA 3KCYA 5L36A 1CAUA 1ZZ7A 4JAAA 3V0AB 3JBG3 1PNFA 2A3YA 4I30A 4Y1VA 2MEV3 1MZFA 1H2KA 5H9SA 1TMF1 2ZGRA 3IWZA 4TWTA 2BQPA 2JKBA 2ARXA 2UWCA 3O12A 4LR4A 3VKFC 4Z1VA 5HCBA 1PGW1 5BNPA 4XIOA 3AYAA 4A3XA 1DDLA 2NLRA 5HCFA 3FUQA 4DXZA 1YYNA 1DLLA 3MF9A 3ZSKA 2WNVC 4J1XA 1B09A 4S2FA 2VULA 2GN7A 1QY4A 3M2MA 2IXLA 2QFEA 1XYOA 5CFDC 1V6MA 4IEZA 4FO9A 1RUJ3 2BFUS 1FXZA 5A3MA 1WW4A 4BH9A 1S1AA 1SBDA 4PLOA 3ZFEC 4RA0A 2F6BA 5C4WB 1QNWA 4XXPA 2A6XA 3ZVXA 4DS0A 1MEC1 2VOXA 2RJLA 5KC6A 1ZRDA 5K0UC 3MIBA 4WM7B 3PLQA 1N1TA 4LUKA 1ND2B 1Q5OA 5CNAA 4YYOA 1AL22 3H3UA 2JG9B 2ERFA 3M3IA 4A7YA 2Q30A 5BNOA 1PO11 1NG0A 2PHRA 1AYM3 1VR3A 2V5YA 5ABJB 3A0NA 5FBZA 3PVOA 1DZRA 1N3OA 1W6NB 5CFDA 4YG3A 4IL7A 1I1EA 2VMIA 5L73A 1QU0A 2R072 3ZFEA 3H9AA 2D98A 3WP5A 3SHRA 1OOPC 5DUUA 1EV13 3URFA 5K0UA 1DQ6A 4S2HA 1CD3G 2EAAA 3AX4A 4JDNA 2DUQA 3LAGA 2EVXA 1GYKA 4RGAA 4QPGB 3AZZA 1F31A 3D4KA 3POSA 1BJQA 3UJQA 3VN4A 4I3GA 3B7MA 2WNUB 4SBVA 4LBLA 1F5FA 2XBO1 1LGNA 4BM8A 2GAUA 1KXGA 4RR3B 2AH2A 3V65A 1Z7S2 2WA4A 4CDUC 1OOPA 4E2GA 2I2SA 4FCAA 4BE3A 4Q26A 3AP6A 4P14A 1AF9A 2HJIA 1ASJ1 3FBYA 4FOQA 1LJ7A 2D7FA 4DFSA 1PIV3 1RUD2 1YLLA 4D7TA 1CN1A 2MHFA 4LULA 1VBC2 2RS31 3KB5A 2ZA9A 3AZYA 3A4UA 3RI8A 1DQ1A 5EYXA 3LB9A 1ZBA2 2I07B 3ZPYA 4DOUA 4WM8C 1HQLA 1H1AA 2RM23 4HSLA 1VBA2 4HKLA 3OF1A 1QH6A 5JI9A 2CAVA 1IKPA 4CDUA 1U12A 3WW2A 2WLQA 2ZZQA 3AKTA 1W2UA 1H9WA 1KDMA 1O3QA 1C8M1 4JGZC 3R4SA 1ZZ8A 5JLVA 4YARA 3IPVA 3UKNA 4XW3A 4CEYC 3B02A 2PTMA 5D8AC 1FI2A 3OYWB 4XHBA 2D3RA 5JI7A 2XPJA 1IPJA 3NAPC 4WM8A 4PQ9A 1PNGA 1QJU2 5KWRA 1XRUA 2JICA 4YG0A 4M01A 4OI2A 2FZ1A 4Y26A 4MGKE 2OW4A 4RSUA 1IS6A 3J4UH 2JECA 1YIPA 1UIJA 1U5ZA 2D6KA 2VGDA 1WW6A 4CP1A 4YVSC 4QQLA 4XBLA 4JGZA 4WVMB 3W9AA 4CYDA 1MZ6A 3FWEA 3AFKA 3FLTA 4CEYA 4C1XA 4W6WA 5D8AA 1GBGA 2HWF1 1GZWB 5L7OC 4Q0PA 1Y9QA 3SISA 4YGDA 1OMIA 1QJX2 4YGEA 3BTAA 1OQDA 3NAPA 4Y20A 3VKOA 3VBUC 2P34A 1O4ZA 4L2NA 2WT2A 1OQ1A 5I0UA 1YJKA 2X29A 3DPRC 2VG9A 4WZCA 5L19A 1IS4A 1G9FA 4YVSA 2A71A 2R49A 1AX0A 5F1RA 5B2GB 2QNKA 4GXLA 1XNCA 1W39A 2DVFA 2E51A 1SLTA 2H6BA 1VBD3 4YGCA 1HX6A 1NY71 1UPSA 2Q1MA 2R1BA 5L7OA 1MQTB 1YFUA 1MS5A 3MICA 4ASLA 4OLLA 2QZ3A 2CGNA 3ES4A 1I5ZA 1H1MA 1KFXL 4X6QB 5K9YA 4PIZA 4PLNA 4FXGB 3VBUA 1QJY1 1LHVA 4E2SA 5GLZA 1AR91 5JOYA 5FTTC 2VVFA 2DYCA 4B4QA 4Q8KA 3ZMOA 1VBE2 1MS1A 2HYKA 3V0AA 2UURA 2WIIB 4AK3A 1PVC3 1RUH3 3WG2A 4CTEA 4GQ7A 4IESA 3JD73 4XJ9A 1OQEA 2EF6A 4IV3C 1LOEA 5SV5A 1LU1A 5C4WC 3I59B 4K1ZA 4L11A 3ZXFA 1UU4A 4C1WA 2Y0OA 2DVGA 2GSYA 4YW3A 4BMBA 4HT1T 2IXKA 3BB6A 5T54A 3WDYA 4JGYC 3PNAA 2ZGMA 4WM7C 5HBAA 2VW2A 4YG6A 1YIFA 3U0ZA 1CQ9A 2JG9C 2WL1A 3ZIWA 1OFSA 2DURA 2WFF2 5ABJC 1ZNPA 3O5SA 3WX5A 2VVDA 1NCQB 1KQRA 1YFXA 4FQZA 1M4WA 5K7PA 3LA2A 4IETA 2VMGA 3MYXA 3KGZA 1S55A 4YZ2A 4PF5A 4RL7A 1NQDA 3IT8A 2Q1ZB 4ONUA 4Y1XA 2IFRA 1AR73 4BQ1A 5C4WA 4OHZA 2ZGSA 1LU2A 1HXS2 2D6LX 1H8TB 3GBFA