2FZ2A

Structure of turnip yellow mosaic virus at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
164
structure length
164
Chain Sequence
PSPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/rna
molecule keywords 5'-R(*CP*CP*C)-3'
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
total genus 25
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz2A00
3VBRC 1AR82 4BCUA 1QJY3 2RS32 1TME3 4JGZC 4Q4V3 4YVSA 4LLFA 1PIV2 1ZBA2 2Y26A 1AYN3 1F2NA 1VB4A 3VBOC 3JBG3 5C9AB 1R092 1VBB2 1R082 2HWE1 1RUF2 2HWF2 5LK7B 1VAKA 1AYM2 1PO23 5D8AC 4AEDB 1NA1B 5CFCB 1ND2B 4CDWA 2WFF3 1DDLA 1RUC1 3JD71 3LOBA 1RUG2 1EV13 1K5MA 1ZBE3 1HQNA 3TN93 3ZFGB 3HAGA 5BNNA 1BMV2 1OOPA 2MEV2 1ND3A 1RB8G 1NOVA 1A6CA 4CEWB 1H8TA 1FMD3 3DPRA 1BEV2 3VBRA 4JGZA 5J98B 2HWC3 2RR12 5C8CC 3VBHB 4WM7B 1FPN3 1VBD3 3VBOA 2BFUL 1D4M3 1POV1 1RUH1 2R042 2RM22 1CJDA 2R072 2HWB2 2R061 2PLV2 4IV1B 1GFF2 5D8AA 3JB8A 4AEDC 1PO12 1NA1C 1VRH1 4YVSB 1ND2C 5CFCC 4Q4Y3 1MQTC 1AR63 1EAH2 1MEC2 2RMU1 5ABJB 1RHI1 2XBO1 1ASJ3 3J8F3 5ACA1 1RMU1 3ZFGC 2DF7A 1OPOA 4GB32 2WWSA 4CDWB 1R1A2 4NWVA 1CD3G 1RUI3 1X36A 3ZFEB 4CEWC 5DDJ1 4Q4W1 5BNNB 5C8CA 1OOPB 5J96B 1FOD1 1AR71 4NWWA 4WM7C 1QJY2 4Q4V2 1TME2 2QQPA 1IHMA 1Z7S3 1AYN2 3DPRB 3JBG2 4IV1C 1HRI1 4AEDA 1NA1A 5CFCA 1ND2A 1MQTA 1PO22 3VBOB 5ABJC 2HWE3 2WFF2 1QJX1 3ZFGA 5D8AB 3ZFFC 1EV12 1ZBE2 5FMOL 1RUC3 3JD73 3TN92 5JZGC 2RS11 4YVWB 3ZFEC 1X33A 3S6PA 1FMD2 4WM7A 5AC91 2HWC2 1RUD1 4RHV2 1FPN2 1VBD2 1D4M2 4IV1A 1PGW1 3DPRC 1HRV1 1VBC1 1COV1 4N43C 1PVC1 5C8CB 5BNOC 1POV3 1RUH3 5ABJA 4N53A 4Q4Y2 2R063 1AR62 4JGYC 1RUE2 4EJRA 1QJZA 4GMP1 2GSYA 3ZFFA 1ASJ2 3J8F2 1VRH3 1MQTB 2RMU3 3NAPB 5GKAC 1NY72 1RHI3 5JZGA 2XBO3 5L7OC 3ZFEA 2RS51 5ACA3 4YVWC 1RMU3 4RQPB 1RUI2 1V9U1 5BNPB 1SMVA 1HXS1 5DDJ3 2FZ2A 4Q4W3 4QPIC 4N43A 1FOD3 1Z7S2 2FZ1A 5BNOA 1AR73 1C8NA 4Q4X1 4FTEA 4JGYA 1RVF1 1HRI3 4RFT0 1PGL1 1QQP1 2HWE2 2HWD1 2BFUS 5L7OA 1VBE1 3NAPC 1RUC2 3JD72 1QJX3 4YVWA 4N53B 5A33B 4RQPC 4Y5Z0 3ZFFB 1RUJ1 4CEYB 5BNPC 2RS13 5JZGB 1AL0G 4QPIA 3VBUC 4CDUB 2WLPA 1C8M1 1VBA1 1BBT1 5AC93 4CDQB 1RUD3 2WS91 1AL21 3VBSB 4CDXB 4FSJA 1RUH2 1HRV3 1VBC3 1COV3 1PVC3 2R062 4N43B 1AR91 4WM8A 5BNOB 3NAPA 1M06G 1QJU1 2RMU2 4JGYB 1RHI2 4GMP3 2XBO2 4N53C 4RQPA 1TMF1 4QPGC 5FOJB 5ACA2 1RMU2 5BNPA 4RHV1 4CEYC 5L7OB 2GH8A 2WZR1 2RS53 1AR81 3VBUA 2RS31 5A32A 1V9U3 5FMOS 4CDUC 1PIV1 1ZBA1 1POV0 5DDJ2 4Q4W2 1R091 2ZZQA 1VBB1 1R081 3VBFB 4CDQC 1RUE1 1FOD2 1HXS3 1RUF1 1W39A 2HWF1 1F8VA 1AR72 2BPA2 1AYM1 3VBSC 4CDXC 4QPIB 2X5IC 1E57A 1HRI2 4Q4X3 5K0UB 1RUG1 1HX6A 1RVF3 3CJIB 1BMV1 2MEV1 4QPGA 1QQP3 5A33A 2HWD3 4RS5A 1QJX2 1VBE3 4WM8B 4CEYA 1BEV1 2RR11 4CDUA 3M8LA 2RS12 4IV3B 1RUJ3 4RR3B 1AUYA 2R041 4CDQA 2RM21 3VBFC 5C4WC 2R071 2HWB1 2PLV1 5AC92 3VBSA 4CDXA 1RUD2 3VBUB 2X5IA 3VDDB 1C8M3 1PO11 5A32B 1VBA3 3ZXAC 1BBT3 1EAH1 1MEC1 1NCQB 1PGW2 1HRV2 1VBC2 1COV2 2WS93 1PVC2 5K0UC 1AL23 5CFDB 3CJIC 4GB31 1R1A1 1AR93 4Y4YA 4PDWC 4WM8C 1QJU3 1TMF3 1B35B 4QPGB 2RS52 4RS5B 4IV3C 4GH4B 1QJY1 4Q4V1 1TME1 4RHV3 4RR3C 1V9U2 3VBFA 5C4WA 2WZR3 1AYN1 5C9AC 1AR83 1NCRB 3JBG1 2RS33 1Z7S1 1HXS2 1PIV3 1ZBA3 3VDDC 1PO21 1R093 1NCQC 1OHFA 1R083 1VBB3 1RUE3 5K0UA 2WFF1 4FTSA 1RUF3 2HWF3 4GMP0 1AYM3 3CJIA 4Q4X2 5CFDC 1EV11 1ZBE1 2X5IB 4Z92B 1RVF2 3TN91 1PGL2 1QQP2 1RUG3 2HWD2 4PDWA 1VRH2 1VBE2 2MEV3 1K5MB 1FMD1 4IV3A 1B35C 2HWC1 4RR3A 1ND3B 4RS5C 1NG0A 4GH4C 3VBHC 1WCDJ 1RUJ2 1BEV3 5C9AA 1FPN1 1VBD1 1D4M1 1H8TB 2RR13 1NCRC 3JB4C 3VBRB 3VDDA 3IDEA 4JGZB 1NCQA 2R043 1C8M2 4YVSC 3FBMA 2RM23 1VBA2 2R073 1BBT2 2HWB3 1AR61 4Q4Y1 2PLV3 5C4WB 5CFDA 1ASJ1 3J8F1 1PO13 2BUKA 2WS92 1AL22 2IZWA 1EAH3 1MEC3 2VQ0A 1NY71 4CDWC 4FTBA 4SBVA 4CEWA 1AR92 2ZAHA 2TBVA 1RUI1 1K5MC 1B35A 2BBVA 1VB2A 1QJU2 4GB33 1R1A3 5BNNC 1OOPC 1TMF2 4GH4A 3VBHA 1ND3C 4PDWB 2XPJA 1NCRA 2ZTNA 1H8TC 2WZR2
chains in the Genus database with same CATH superfamily
1CZVA 3B9CA 1GICA 3VKFC 5B2GB 4LT5A 4W6XA 2RS32 1TME3 3UGHA 1HW5A 2CU5A 1F2NA 3R4UA 4P9YA 2A3YA 3JBG3 1DZQA 1OA4A 1TEIA 3LDKA 4BQ5A 4MG2A 4BISA 2P17A 2JDYA 1RUF2 2W0XA 2WWUA 3PNAA 4XBLA 2QCSB 3BIWE 5FMBA 4YFZA 2BERA 2K0GA 1O4ZA 3AZYA 1AX2A 3HN3A 1O3QA 5F5CA 2WFF3 3B69A 1J58A 5I0DA 3EBRA 2W1UA 1W8TA 5F3IA 5IVBA 2W92A 5LBFA 4COUA 2HEWF 3MIGA 1PK6C 1RUG2 2VECA 5KHGA 2D3PA 4RYDA 1W6MB 1GYKA 2DTWA 3ZFGB 1Q8SA 2V5YA 2ZHKA 3D5OA 4IE7A 5BNNA 3I2OA 1OOPA 5BPXA 4NHYA 3ZXEA 2WDBA 2ZGUA 4QX2A 4AYUA 2J22A 1MS0A 2J1VA 4BJ0A 3JQWA 4XYXA 4CEWB 1Q3EA 3IIIA 5JXIA 1WBFA 3OTFA 3WNKA 3DXUA 1BEV2 1US2A 3B00A 1IS3A 2ZBJA 4HK8A 2Y6KA 3OGGA 1UZ0A 2A6XA 5FZEA 4HMZA 3TRSB 3VBHB 5A1FA 1NKGA 4WM7B 4WVVA 1FPN3 1VBD3 1RUH1 4LTAA 2R042 5G05L 4YG6A 4JZRA 3M7AA 5FWJA 4UFJA 5TSWA 1JOPA 4E8CA 2P2KA 3CLPA 3NNGA 3ZSEA 4CCNA 4GXLA 4Y20A 2ZPXA 3SISA 4NHMA 5IVCA 5CFCC 4Q4Y3 3H0OA 2UYAA 2Y0OA 3BPZA 4EWDA 5HCHA 4AOCA 1PK6A 1RHI1 2XBO1 3AM2A 2W91A 3PURA 1BHGA 4ZHNA 2GNBA 1MZ6A 3FUOA 3CF6E 1C5IA 4JKLA 1C5HA 3K77A 2WQZC 2VG9A 1RUNA 1Q5OA 4E4SA 2HLEA 1R1A2 1G6NA 2WZEA 4DEQA 3ZOIA 2W52A 4KQ7A 1FI2A 5E6HA 5T55A 1DQ1A 3QCWA 1NLQA 4EE2A 5DDJ1 5HXVA 3GZEA 4K8RB 4XF3A 2OXBA 4EWAA 5FFOC 5FQ0A 5BNNB 3V0AA 1OOPB 3ZPOA 4TZDA 1OLME 2BGCA 5KBFA 1TME2 1AXYA 2DU0A 4ARYA 2QQPA 1DGLA 2XB6C 1FXZA 1IHMA 3NRUA 5KC6A 1ZRFA 1F31A 3WF2A 3WNNA 1T2XA 3AX4A 3JBG2 4AXOA 3J7MA 5CFCA 3FUQA 3OD4A 2KM2A 2R16A 3KZ4C 1LULA 5FZ1A 2G19A 3VZOA 1UOJA 3AKPA 2PHUA 2HWE3 2WFF2 4QM8A 2ZX1A 3DF0A 4BM8A 4LK6A 4CPBA 1DCSA 2PHTA 3VKNA 4NIDA 5JR7B 4F83A 4N7UA 1UN1A 1QF3A 5FPUA 1UU4A 5G04L 4Y20B 4KBZA 2DCKA 2BWCA 4CZSA 2Y6LA 2OX0A 3AJZA 3VD9A 4M3CE 2TUNA 4DZGA 2PTMA 4XILA 2E31A 1J1LA 1WLWA 2BYVE 3WNLA 3ZFEC 4PLMA 2YB7A 2VJXA 5J1XA 3E5UA 1JYCA 4LEJA 5FY8A 4CCJA 3HBKA 2C4XA 3TWIA 3ZKYA 4MOAA 5EFUA 3ZSLA 1DYKA 1QXRA 2ZGPA 4CP9B 2RJLA 1D2SA 4OMDA 3RZGA 3ZR5A 2YGLA 3IPVA 1ZRCA 4XAEA 1FPN2 1VBD2 1V0AA 1YFYA 1W8ZA 4HVOA 3ACFA 2B8MA 4PLOA 1CPNA 1COV1 2EICA 3H8UA 4HN1A 1JYWA 3SH3A 3V0AB 1PVC1 5FZ4A 4BXFA 4HZFA 2ARBA 2ZMKA 4QXCA 3LKJA 5BNOC 1POV3 3CJXA 1JU4A 4BIFA 4LO8A 4NR1A 2VQAA 1CPMA 4Q4Y2 1LOAA 1W9WA 3WQBA 1RUE2 4EJRA 2YBKA 4AVCA 2XVGA 5JDBA 1GU3A 4AI2A 3CL1A 2ADDA 4XJUA 1Z78A 1OMIA 2QQOA 2RMU3 4GD4A 4KH9A 2O0OA 4XDOA 4Y24A 5D21A 1UX7A 3OOXA 2RDSA 4MGSA 3U4SA 5C7GA 5L7OC 3IT8A 4FP3A 1LENA 3OPWA 3ZFEA 3I59B 1AZDA 3BIEA 4AG4A 3ZYBA 5FP4A 5IK8A 4G4FA 1Q43A 3ZN5A 4F7ZA 3WV6A 4ES9A 3PDQA 3RZHA 1P8JA 4IEPA 3RMYA 5FZCA 2ZCWA 3C7HA 4OHVA 2Q8CA 4P5HA 1GZCA 3LFMA 3F2ZA 3O1TA 1UMIA 4FPKA 1WA6X 4CU7A 1ULEA 2EF6A 4Q4W3 3T0BA 1IQDC 2OVUA 3BTAA 4YM3A 5FJKA 1YQ8A 3RS6A 4OQ8A 4CXWA 3BUCA 4JHTA 1FOD3 2VVDA 2VU9A 2FZ1A 5BNOA 1AR73 4Q4X1 3B01A 4CUGA 3A4UA 4E2GA 2DUPA 5LEKA 4LE3A 4KWUA 1ULPA 4AVTA 3I97A 2ZHLA 3IPVB 5FMCA 1UY0A 1HRI3 1CAWA 2E33A 2HWE2 5LA2A 1ENRA 2W1WA 3GXUA 1JTZX 3IN9A 5FZAA 5GM0A 2NQYA 1UY1A 1YJLA 2DFCA 4MSVA 2VZUA 5L7OA 1XU1A 4FOYA 3VV1A 2RJ2A 4DPNA 1RITA 4QU2A 1GQGA 5FZ8A 1QJX3 1ULOA 2VOTA 2G9ZA 2RG4A 3K4ZA 5FBZA 5HV4A 2G9FA 1C1LA 2D6MA 1WW6A 1XYNA 2VNGA 3OBRA 3KVBA 5A1LA 1VLNA 5I8YA 1JYVA 3AMMA 1KGYA 1JS9A 1OKQA 1X82A 2JG9C 2JB4A 2QFEA 3LEGA 4CCKA 4X8PA 4MGTA 1YI9A 2ZX2A 1SQ4A 4ZPIA 4AEKA 4D3WA 5C5UA 3KSCA 1VMHA 2QQWA 5HV0A 3WQ1A 3R4SA 5KHKA 5CG8A 1JXNA 2JWPA 3T2QA 3VD3A 1W90A 5H9SA 3ASIA 4UW6A 4MV2A 5HBAA 1SEFA 5FYZA 3ROUA 3X29B 5FYTA 1VBC3 5FLHA 3EO6A 2R49A 5FPBA 2HBTA 2VC9A 4NIIA 1UU5A 4R9DA 2JIJA 4BWOA 5BNOB 4IGOA 2E7QA 3R4DB 3NWKA 4O7XA 5FYCA 4IQPA 3SCHA 4Z1VA 2RMU2 3U10A 1XSQA 3PU8A 4GMP3 3O1UA 3DL3A 2P4EA 3AKRA 1CAWB 4QX5A 3MYXA 1ZM1A 2HEYF 4DIQA 2FDFA 3PIGA 3L9JT 3LEKA 1DYPA 5IW0A 3IAQA 4UBGA 4OI1A 2JG9A 5IFTA 1PNGA 4CRQA 5L7OB 1AJKA 1S2EA 4QD2A 4BHPA 2WYFA 1AR81 3H50A 4IEQA 4W6YA 5FP3A 3E1F1 4QHOA 3ZXFA 2QQMA 2IWGB 3OYWA 4QDQA 4CDUC 2J1UA 1GQHA 3OD0A 1ZBA1 4Q4W2 4RGGA 3SMHA 4NHLA 1I1EA 2ZHNA 4BQYA 4Q4V1 2VMHA 4UAPA 3ZKUA 4B7KA 1CN1A 2ZZQA 1VBB1 4Q1RA 5CB7A 3VBFB 5LZ6A 1FOD2 1HXS3 1W39A 1Z0HA 1GP6A 4B29A 1F8VA 1AR72 2QQVA 4OQ9A 2BPA2 5L9BA 1APNA 2B39A 4RFRB 2YUEA 2ARXA 2VCMA 1HB4A 4PBPA 5K4LA 3VBSC 2DCZA 2WKKA 4Q8LA 5DUWA 2JECA 5FZBA 1YI7A 4OUSA 3AYDA 3K3NA 3H9AA 5EPAA 1KFUL 2Q0AA 1HRI2 3LSEA 4OZXA 3MUZ1 1IPSA 1WWYA 5FZ9A 3O5SA 3Q8EA 4NAMA 4QX8A 1IS4A 5FZ3A 1S0EA 1JUIA 2H6BA 1A78A 2QQLA 3MV11 2JEMA 2MEV1 2QTWB 3LCPA 4AW7A 4EYUA 5A33A 1JZ5A 4RS5A 1YQ6A 2PFWA 5JSRA 3TEYA 4J1WA 4QQHA 1QJX2 3TEZA 1G9BA 2YYOA 4UFKA 1XNAA 2OT7A 2WSUA 2ZAAA 4KGGA 5T5PA 3WP3A 4RN5A 2WN3A 1UWWA 4XPVA 3O1RA 2LS6A 4CP1A 2RR11 2GNDA 4S2GA 3K46A 1GNHA 4CDUA 1NZCA 1RUJ3 5EXOA 2DV9A 3CHXA 3WEZA 2K2SA 1GZWA 4QPWA 4XURA 2CGOA 1OURA 3ABZA 3LD8A 2A6WA 2PN5A 3T0AA 2A71A 4BDVB 3VBSA 4CCLA 5A80A 2K9ZA 2VGDA 2MPFA 3KGLA 4L8QA 1LECA 5FPVA 5A7PA 1W2OA 1OQDA 1EAH1 1NCQB 3PVOA 1VBC2 3NV2A 3WUDA 4NPMA 4AFBA 3JCIA 2RDQA 4HSJA 1V6IA 3I3QA 5L9RA 3PTRB 4L0PA 2BVVA 3VUOA 1DFQA 3DYOA 1QEXA 2GC1A 4IE5A 3N36A 4EN9B 2DCYA 1AR93 1SPPB 2W5FA 1WKYA 2Y6HA 3OGRA 3H7YA 1WD4A 4CUCA 5FZKA 1AVBA 3AVRA 1HV1A 4L97A 4WM8C 1V6LA 3BPSA 4DUXA 4Q2FA 4LKDA 5AVPA 4BQ3A 2PELA 1DGRN 4K6BA 4BXSV 1B35B 4LULA 3PVEA 2YROA 4JVAA 4R52A 4V1PA 4RS5B 4IV3C 2D93A 4ISQA 5JUVA 2ET1A 1IOAA 1QJY1 3AXDA 1YYNA 2QZ3A 3ILRA 1I3HA 2UWCA 3M1HA 4IESA 4OVEA 5F6LB 2DBIA 5FMDA 3H3ZA 3LPFA 5JVVA 5A3LA 1NCRB 2WT0A 2P6HA 4OI4A 1E5HA 4E2QA 4COZA 1OF4A 4FPYA 4MHUA 1HXS2 3PMEA 3VDDC 2XUMA 1RJ8A 2A7AA 1W0PA 3B7MA 1JOJA 4AGRA 4XF9A 4TN7A 1R093 2AENA 3C2UA 4FTSA 4LKFA 5FZFA 2HWF3 3THTA 3WDXA 2CWMA 5GLWA 4AR2A 1WCKA 2CY6A 3LEIA 1ZX5A 1LHOA 2JDAA 4FOVA 4JDMA 4FPEA 3RRDA 3KVAA 1CZTA 3HQXA 5BY5A 2C26A 1EV11 4P14A 5CFDC 3ZYPA 4LITA 1WW5A 1YO8A 4C1XA 3TN91 5DAXA 3KGZA 2XQRA 3BN6A 1PGL2 3ZXJA 1N1TA 1RXFA 2R7EB 3I3BA 3NJXA 3KV9A 3MLKA 3OPZA 1VRH2 4Q27A 4XF0A 3IB3A 1K5MB 3ACLA 1K5JA 1W6NA 3U1XA 1FNZA 4GA9A 3C7OA 4IV3A 5FYVA 4WVMB 2AREA 2HWC1 3T1MA 1ND3B 5F5AA 2VOVA 5JOXA 2WUHA 1RUJ2 5F3GA 5DZGA 4E8DA 1LODA 3H1MA 2Y6JA 1H8TB 1DGWX 4AVAA 3O0XA 3VDDA 4NHKA 5I0RA 2Q8DA 4JGZB 4GAZA 1MS5A 1JN2P 4FQZA 4QDRA 2DUOA 1LOGA 4AQTA 1IG3A 1SACA 2RM23 2V5DA 2R073 2VW1A 1AR61 2PLV3 2WLQA 4V2VA 1O8PA 2X53S 1G86A 1VJ2A 3HWJA 4YW6A 5CFDA 3EJKA 1T6GC 1W3XA 3H8XA 1O6UA 1OQEA 4Q1PA 5C3SA 5DXDA 5E8AA 4SBVA 1BK0A 1V6MA 4OHYA 2QQJA 2WRAA 4LBJA 1AR92 4QWNA 5GLZA 4S2DA 2TBVA 1RUI1 1BVP1 3I3DA 3MW4A 5CU1A 4XETA 1OD3A 3MGUA 2EAKA 5CISA 4GB33 4A6SA 2Z79A 1HJGA 1GKBA 3O7OA 4K3UA 4MADA 1LHNA 1W0NA 3AXEA 5LA1A 4HOOA 1QKQA 3HN1A 4ISRA 3ZM8A 1NT0A 1ALYA 4L2NA 5JWPA 1FT9A 4FPOB 4NRPA 4GULA 4DS0A 2DURA 2FDGA 4QQPA 3T0DA 4Y26A 4XJZA 1VMFA 2ERFA 3J7HA 2YGMA 4S2FA 3W5MA 4QKNA 4XBNA 4V2WA 3KV5A 3OBZA 1N3OA 5JMOA 4LLFA 2X29A 1UO9A 2CYFA 2Y34A 2Y26A 2SLIA 5FZHA 4D6RA 4K8FA 1R092 2NN8A 1GP4A 5FXZA 4PJYA 2HWF2 4X8NA 2DVBA 4ZXKA 1JYTA 1SFNA 1U5XA 4K20A 2BP6A 3RJ2X 5D8AC 4AEDB 1NA1B 3ETPA 3OEAA 1ND2B 1PZ8A 1OI6A 5DG2A 3K75B 1RUC1 3JD71 2TNFA 1DZTA 2ZA9A 4NMIA 5ERLA 3VZMA 3LOBA 4QT6A 3GBWA 1UKRA 4AAPA 4XZPA 2B45X 3UV9A 4A3ZA 3CNAA 3UYJA 3DN7A 2VZOA 3W59A 4WVZA 2D98A 1UXXX 5F39A 4C0BA 1BMV2 2E6VA 5JI7A 4H55A 1W9YA 1RB8G 4UF0A 4XMIA 4Z8BA 1FV2A 1AXZA 2GP5A 3AL6A 3N9LA 3Q8FA 1NOVA 3H3UA 5LY2A 3UT0A 5LBEA 1FMD3 4FXKB 3NNFA 3NW4A 5JMCA 4RL7A 2B9VA 1F4HA 3POFA 3R0RA 3SKJE 3CKHA 4M0NA 3NV4A 2JICA 4XABA 3MI8A 4YFWA 4XCBA 4SLIA 1TG7A 5EWSA 1AF9A 2Y64A 1LU2A 1V70A 1TVGA 3U75A 3FZ3A 5F2WA 2RM22 2MHFA 2VZRA 2R072 2R061 2PLV2 5D8AA 3SHRA 4QQLA 4AGGA 4XEZA 5IJRA 5A3UA 1ZNPA 1WGPA 2PHXA 2XHKA 2ZGTA 4LUKA 3S7IA 4FQ4A 4MUVA 2KR2A 4Y22B 2VQUA 2JKXA 3I2FA 3ZO0B 5ABJB 5CBLA 4ITCA 4IUGA 1ASJ3 2JB8A 3J8F3 4TLGA 2BU9A 4GWNA 4YG0A 4FVVA 4XFGA 5ACA1 1QNWA 3ZFGC 2DF7A 2VTXJ 5C3QA 4LBLA 1LEMA 3RSJA 4ES8A 1O91A 4GB32 1WMEA 1BK1A 4UXAA 3PJQA 1CAXA 4AGVA 1CD3G 4I3GA 3FFZA 2BNMA 2ID4A 4CEWC 1QMJA 3VHNA 2IXKA 3WG3A 1POQA 2ETEA 4QQOA 4R9CA 1H1IA 3LWCA 4X6QB 4J6GA 3ITQA 2WFPA 1W8UA 3MF6A 1YNAA 3VZNA 4UF0B 4WM7C 4E9KA 5FY4A 4YYOA 2AACA 4GJZA 2FCVA 1GOGA 3CZUA 4IW3A 1S55A 1PZ9A 4NVPA 5FLJA 2Y6FA 2YV8A 1L7RA 1UX6A 2XXZA 2DVGA 3PHMA 1ENQA 1XQNA 4GJYA 4JQTA 1CGPA 4R9BA 2NPIA 2D5HA 2P6CA 4YPJA 3U0ZA 2DVFA 3H42B 2BDRA 2B9UA 3WXPA 3WDYA 1JZ8A 3UNPA 3ZVXA 1UYPA 2GU9A 4DXSA 2F4LA 1NLRA 1QDOA 4A7YA 4JAAA 4IEUA 1UNBA 1BYHA 2OIIA 3ZFGA 5FZGA 1HV0A 4QM9A 5D8AB 5SV8A 1UIKA 4MGKE 4OULA 4DB5A 1PMIA 5F5QA 5FMOL 2DFBA 2VBBA 1JZ2A 2OKXA 4LBMA 3OGSA 5AVAA 3SCFA 1RXGA 2B46X 4XIOA 4CSWA 5JXJA 4DFSA 2EXHA 5DZEA 3JUUA 3WNPA 2XOMA 5GZEA 5GZCA 1G9CA 1W03A 3S6PA 5EZWA 1XPWA 1FMD2 2FMDA 5CKQA 3USSA 1ZZ8A 4WM7A 4ZU7A 4BQXA 5J7MA 1RUD1 2XQXA 2QQNA 4RHV2 2VUCA 5KXDA 1LU1A 4YNIA 5JLVA 1OLQA 1BVVA 1PGW1 3DCQA 3URFA 5ISLA 2R0FA 4N43C 5B4XA 4FP2A 1BCXA 2NM1A 2JDUA 2EIEA 2QDRA 1RUH3 4FFGA 4Q0SA 5FTTC 1UF2C 1J59A 2R0HA 5FY1A 3AFGA 4FOQA 4LMFA 4N53A 5LATA 3WW1A 2Q5TA 2JX9A 4LBOA 1QJZA 4NIGA 1W3VA 2D3RA 4CCCA 4DQAA 1ASJ2 1T6BX 3AYAA 3J8F2 4Z2WA 5I0SA 3UKNA 4OUMA 1JZ4A 1CX4A 2QE3A 2XKOA 1ZA7A 1RHI3 4XQ4A 2XBO3 3E5XA 4S2HA 4C1WA 1TNRA 1S0CA 4JRAA 2SBAA 4HK9A 5LA0A 2VMDA 3N7KA 1LCLA 1QXPA 1YWKA 1OFSA 2BVBA 4RQPB 4LO4B 1JZ6A 4QDSA 5FZ6A 4D7TA 1ZZBA 4MGIE 4YW5A 3D4KA 4CA9A 2JDZA 3ZIXA 1SMVA 1XBFA 3AB0A 1A3KA 3M70A 4AQ6A 4B4PA 2CSGA 3LDRA 5EIYB 1OPMA 3LIHA 4XF4A 1W8HA 5CKMA 5DDJ3 2FZ2A 3ZSJA 3IWZA 1QOOA 4ZU4A 5L19A 2HBUA 2XMLA 4N43A 4Q0QA 5GJ6A 3Q8BA 2WINB 3G7DA 3CEWA 1R64A 2DWRA 3ZSMA 5IVFA 1VR3A 3NO8A 1H9WA 1PX3A 1RVF1 3SH4A 4RFT0 3N7LA 1S0FA 4IL7A 3O1SA 2HWD1 4EV0A 3ZYRA 1H30A 1ZZ7A 5HPOA 2PAMA 2W08A 1V6NA 2BFUS 1MVQA 3VL9A 1GR3A 2VZ3A 3WHTA 4K21A 2ARCA 2BW8A 2Z69A 3K48A 1VBE1 2VW0A 2YPJA 2ZX3A 2VQTA 4XTPA 5EJ3A 4YZ5A 1UD1A 2XVLA 2CL2A 3CIHA 4N53B 3BGAA 3POYA 2VL4A 1J3RA 5A3TA 4HT1T 2W46A 1FX5A 3I2DA 1XNBA 4CP9A 2R1BA 1SLIA 5F37A 3NV1A 3RFRA 2B5HA 1UW8A 5I8TA 3U14A 1IS5A 3VKLA 4ZZ5A 1AL0G 2FQPA 4JX0A 5A3PA 1EPZA 4XAAA 1QJEA 3VBUC 1LHWA 2WLPA 2VCAA 5FY0A 3NKTA 4FPLA 4ZXEA 4NOTA 3JZVA 4UYBA 1HDKA 3VD7A 3OCPA 1O3RA 3C7FA 4FO9A 3BYWA 4CDQB 2ZS6B 3VKOA 3KQ4B 2WS91 3BALA 3KM5A 4EROA 4CDXB 4UFMA 5C3OA 1RC6A 1RUH2 5FP7A 3RI8A 3V65A 3AP9A 1E5SA 2V4VA 2VMFA 1COV3 4OFGA 3UKVA 4QX7A 1SLBA 1PVC3 2VNRA 3N9MA 1BKZA 3PUSA 2W3JA 4N43B 4P9JA 2PMWB 1LRHA 5JXHA 1CONA 2VULA 2CGNA 2XONA 2DBNA 3WQ7A 4A41A 1AXKA 1M06G 3RWKX 4RGKA 4QGMA 2EIGA 3I59A 1RHI2 4MYEA 3R6SA 5FYYA 2XBO2 4ZY9A 4AVVA 4MHRA 3OGVA 1O59A 5GZFA 3FLTA 1Y43B 3VB9A 2DDUA 2E7AA 2IC1A 3LSDA 5KR7A 1WZXA 3HD8B 4Z82A 5CKNA 1Q8VA 2ADEA 2UYBA 1UZWA 3KCCA 3K4AA 1LKNA 3ATGA 3VBUA 3GBFA 1O5LA 4URAA 2X05A 2B42B 5A32A 3NNJA 2V73A 4P9GA 4RA0A 1PIV1 2DYCA 3AZXA 5DDJ2 5FUPA 4CU8A 1CVNA 1SDWA 5KHIA 3DYMA 4LIUA 1R081 2W39A 1RUE1 2FCUA 2XGXA 2UY8A 1AYM1 1H6XA 4D6QA 3WT3A 2X5IC 4MVTA 3PIJA 2E9QA 4C0HA 5HI0A 4YGBA 3KV4A 3EHKA 4LHNA 1ENXA 3ZSKA 1H1MA 1DLLA 4XUOA 5L9VA 4Q4X3 2Z42A 4FPGA 3E97A 3VHPA 1H2MA 5FZOA 3VKMA 4IE4A 4BU2A 1BJQA 1HX6A 1KXGA 2E51A 1VE0A 5BNQA 5JXGA 1DGWA 3S0MA 1SBDA 4N9IA 3PUQA 3WP6A 3L2HA 1BLZA 3MF9A 4NAOA 3KHCA 4XFIA 4MGQA 3UK9A 3H1WA 4AI3A 2DVDA 3POWA 4HN0A 4YZ2A 1OF3A 5CIRA 3VD4A 4NIHA 2NP0A 4FXGB 1W6PA 5JR2A 3N4MA 2VNVA 4BH9A 4A7ZA 1DIWA 3K4DA 5AFEA 5JCTA 2I74A 3NKGA 1AUYA 5A7WA 1EY2A 4FFIA 1JHJA 2B7YA 5IT6A 1JI6A 3RQ0A 3VBFC 5C4WC 2HWB1 3WG2A 4BMEA 4XFAA 4CCEA 1NE6A 3VBUB 1C1FA 2X5IA 3ZDVA 1PO11 1K12A 1N3QA 5A32B 4HG6B 5FZIA 4BQWA 1C4RA 2IXCA 1OA3A 1DG6A 1MEC1 4H14A 3N9PA 2JKBA 3ORJA 5DUXA 5FIXA 4D94A 1KRIA 1COV2 2R32A 4KWJA 5A3MA 4I2OA 1PVC2 2WBKA 1UY3A 2YY1A 1G9FA 5EYYA 1HB2A 1HQWA 2VZQA 3TNPB 1STMA 1ZVFA 2ZGKA 4R8HA 4CCMA 4LQRA 3MO4A 1GZ9A 3MW2A 4CXXA 2GALA 3OY8B 3MW3A 4LHSA 3FHQA 4PDWC 4H7LA 5FZOB 4DUVA 1D0HA 2XWBB 4GIQA 4QXHA 3A0KA 3GDBA 1GQPA 1NZIA 3RYKA 3I2JA 4AVSA 2GH2A 3WOGA 4TSVA 1D4VB 5LB6A 2WQ8A 3FFQA 3P3NA 1GV9A 3HVDA 3I7DA 4G3YC 2IUWA 3VBFA 5C4WA 1MR5A 4QGNA 4R9AA 1AYN1 3EMRA 5C9AC 1X7NA 1AR83 3FLRA 5C3RA 3SEPA 3U4XA 1OVPA 3U78A 3WF0A 2BNOA 1ZBA3 4FAHA 1LJ7A 1W6PB 2EIBA 3N9QA 2W2IA 1PO21 1TQ5A 4PF1A 4R4ZA 4XFBA 5BV6A 1NCQC 1VBB3 1JZ3A 2PHLA 4NUBA 4N7IA 5A7WB 1CJPA 1HB3A 2ZGOA 2EALA 2Q1MA 3N3HA 3NMBA 1W06A 2H0BA 1SZBA 3I2IA 4Q4X2 5CYYA 1JYNA 3S5AA 4XUTA 4BOWA 1NYWA 2BJSA 3T30A 3BU7A 3LA3A 1ZBE1 2X5IB 3ZXDA 1RIRA 3GHMA 4GWMA 4F8AA 4JDOA 4LBNA 4COYA 4XHBA 1WBLA 4PDWA 1S4CA 2VMCA 3J4UH 1JMUB 3ZMNA 5C6CA 2MEV3 2DCTA 4XTMA 3W21A 3RMXA 4M4PA 2LROA 3D0SA 4QXBA 3ZXKA 1B35C 3MBWA 3OG2A 3ZPYA 4YM0A 1V6JA 4D7SA 4RS5C 1W6OB 2CAUA 2BGOA 1US3A 2J1TA 3QOPA 3MEPA 2DTYA 1WCDJ 5FWEA 1VPHA 2W94A 5C9AA 2FHRA 2PQQA 2VH9A 3SQOA 1D4M1 1UAIA 2RR13 1NCRC 2WN2A 3JB4C 3SH5A 3VBRB 4K1YA 2Q30A 1WW4A 2R1DA 3IDEA 4NROA 1ACCA 1S1AA 4D7YA 3IZOA 2HYKA 2C5DA 2W1QA 3LIGA 3OUJA 3POEA 2R6QA 1NCQA 1U5YA 1MACA 2JDKA 2P1BA 5FLIA 1W9TA 3KF3A 1ZZ6A 2RDRA 3H7JA 5C4WB 3CMGA 4MGZE 1U5ZA 3N7MA 3H8RA 1O5UA 1LHVA 4MGYE 2WAAA 2QJVA 3GJAA 4B1LA 4W50A 2BUKA 3QH7A 4FFHA 1CAUB 2IZWA 1EAH3 3VN4A 4AI0A 1NY71 4KU8A 3TEWA 1SPPA 2J42A 1YLLA 3NQHA 3ZN6A 4JQRA 5BUVA 5GLUA 1YJKA 2VXJA 2X8KA 2ZAHA 3POBA 3S57A 2YC4A 1ULGA 1HJFA 3ENRA 1H8VA 4D0QA 1K5MC 4LLOA 1B35A 4FAGA 1VB2A 2BBVA 5KXEA 2ZX0A 5E89A 3M3EA 3DEMA 2C1FA 4BK4A 2P3IA 4FI9A 1ND3C 3D0JA 4Q29A 4L99A 2ZGNA 4PDWB 4A6OA 1W8NA 2ES3A 3HNYM 1NCRA 4D69A 1XNTA 2WNEA 4P08A 4OYUA 1H8TC 1Z7S1 2P5BA 2QQIA 2ZABA 4JC1A 3BTXA 1AR82 1KD7A 1QJY3 2W87A 2YBSA 4JGZC 4Q4V3 2UY9A 3A23A 1VAMA 5HCFA 1ZBA2 4EQVA 2OW4A 5AFBA 3BI3A 1HLCA 2D6LX 4NRMA 3V56A 1DQ5A 3VBOC 5C9AB 2HEVF 1VBB2 3GJBA 1J84A 3Q8AA 4Y5SA 4B3NA 5LK7B 1W28A 2WC2A 4B4RA 3I4IA 3EYPA 3HNMA 4M3CB 3IMNA 2ZHMA 5T5JA 1K3IA 1DF0A 1ULCA 1DDLA 1SDDB 3K2OA 3WP5A 5CAZA 3WINE 1EV13 1K5MA 1N1SA 2VPVA 3NJVA 3WW4A 1HQNA 1E5IA 3TN93 1WCQA 2ZACA 3HAGA 4K1ZA 4WVMA 2VMIA 2MEV2 2WIIB 4XQDA 1ND3A 4YGCA 4M0HA 1PGSA 2YMZA 2AUYA 3P3PA 2RVAA 5FY7A 3ZIWA 4C91A 2IVIB 3UESA 1GLHA 1V6KA 3ZN6B 1A6CA 4LPLA 1H8TA 1Q8QA 3DPRA 4DO0A 3M3QA 4EN8B 2OUJA 1CQ9A 2WWJA 2ZKNA 4JGZA 2HWC3 2OS2A 1XE8A 4YWAA 2RR12 4AZZA 1VRBA 5FKBA 1GWLA 4FPHA 4PIYA 3VBOA 2GZWA 4QKFA 1O8SA 1GWMA 2NLRA 1H4GA 4YM2A 1CJDA 3Q9OA 3ZYJB 1SCRA 2RE9A 4IV1B 4YZ1A 5FXVA 3HT2A 3RYRA 5F32A 4AEDC 3GCWA 1NA1C 1VRH1 4IEVA 3RVHA 1ND2C 3WDVA 4EZHA 1SG3A 1AR63 5LBBA 1ZZ9A 1EAH2 3OBAA 4N8MA 3USUB 1DYOA 1KS5A 2VCCA 2XVKA 3O1VA 5CG9A 2LM3A 4LBQD 4LOSA 4NPLA 2C9KA 1J3PA 1RMU1 2G1MA 3I2GA 3U11A 4QX0A 4QGLA 3LQCA 1HN0A 2WNUB 3WHUA 1LOFC 4BIOA 2VD7A 1F4AA 3LF7A 2HH9A 3GNEA 4MX3A 3BTYA 1NAEA 1RUI3 1X36A 4A3XA 4CUBA 1AX0A 2OQ6A 3RWNA 1URXA 2Z5WA 3MPBA 3FN9A 4DMIA 5J96B 2DVAA 3V0BB 2VM9A 1YFUA 4DXZA 1IG0A 2BWAA 4DRVA 1QJFA 3ZR6A 1QJY2 2CTVA 4FOWA 4Q4V2 1HKDA 2VR4A 2XH6A 4AI1A 4CTEA 4KMQA 3WR0A 4AEMA 1Q8PA 2ORZA 4JTOA 3BKZA 1ZRRA 1YEWA 3DPRB 4Q26A 4XF1A 3N7JA 3DKWA 2XJUA 4GKYA 4AEDA 1WLDA 2JE9A 5EHDA 1NA1A 2NZ9A 1ND2A 2YC2A 1SLCA 1H2LA 1LOEA 4HANA 4TYSA 2GC2A 3VBOB 3H1YA 3VLBB 1MPXA 1NE4A 1Q8OA 5FUIA 4MXWB 5FZ7A 3AZVA 5ABJC 2O14A 5LRSA 5A70A 5LW9A 1W2NA 4UI9L 4EN6B 4XVHA 5I93A 2YZ4A 1EV12 1LOFA 1GOFA 1XYPA 1RUC3 2XHNA 3JD73 3TN92 1A34A 3KCXA 2PA7A 3VDCA 2IXIA 3HPNA 4O9GA 4PIZA 2YU1A 4CXYA 2RS11 2AZ5A 5JIAA 4YVWB 3SCGA 4KNCA 2VCBA 2WZ8A 5C70A 2CGPA 1X33A 4CUAA 1UY2A 4LBQB 5A3NA 2LALA 1JHNA 2QDNA 3B5LB 1B09A 1NXD1 3O14A 1LAJA 1QNYA 4WVWA 5FPXA 1X9PA 2JE7A 2W95A 5E1RA 5AC91 2HWC2 1CESA 5GZGA 2XLAA 2D3SA 1SLLA 1XE0A 1XSRA 1YIFA 2IXHA 3MICA 1LOCA 5T5OA 3NL1A 4E27A 3ZLIA 1IPKA 1HRV1 1LGNA 1XJAA 2H0VA 3GYDA 5T5LA 1UYYA 5H9RA 4YG3A 1RTVA 5FPZA 4PF5A 1QH6A 4Y22A 2JDMA 5ABJA 1JU3A 2UURA 2WABA 4Q5OA 2ZGRA 2R063 2XL7A 4JGYC 1AR62 5FR3A 2FDHA 5FAXA 2PAEA 3WF4A 4IEXA 1JYIA 2GDFA 4UW3A 1LGBA 4LA2A 1IGOA 3NAPB 1DZRA 4A44A 2ET7A 2OZJA 2C24A 1CIYA 1QY4A 2RS51 2WQ4A 5ACA3 1H4HA 1CIWA 4B7EA 1RUI2 1X9TA 4DOUA 5DUVA 4L92A 1V9U1 5T3NA 4RD7A 1FV3A 5BNPB 3MIBA 4UWDA 4TTGA 1QXJA 2D40A 1Y9GA 3AKSA 1S0BA 3SC7X 4M00A 2X10A 3WNMA 1UPSA 4XACA 4AHXA 1KJRA 1C57A 4XUQA 1CX1A 3AJYA 3AMQA 4C90A 4AHYA 3AP6A 1OUSA 2W1SA 4E4ZA 3ILNA 3JU9A 1JH5A 4N9HA 1C8NA 3QLQA 2YXSA 3V64A 3B93A 1DQ6A 5IVJA 5C71A 1D2QA 1OLRA 2E32A 1UZYA 3FMGA 3NJZA 1SFPA 4JGYA 4Y1YA 4ATEA 1YQ5A 1ENSA 4YW3A 1WCUA 3TNQA 4HKLA 2O1QA 1X8MA 1QQP1 1OQ1A 2VTFA 4HONA 3SKVA 3VZKA 4Q0VA 4QB6A 4Q0PA 2IVJA 3P5BA 1BXHA 2YFZA 5FO9B 1RUOA 1IS6A 1RUC2 3GALA 3JD72 4XC9A 3THPA 2CDOA 4B8EA 3POJA 4CVUA 3BB6A 5KXCA 4RQPC 3LPGA 2K46A 1W8OA 3KF5A 2D6OX 4AFCA 5IFPA 2JD9A 2VNOA 2C0ZA 1W2AX 2VUAA 2ZGLA 3VDAA 1XNDA 4CEYB 4YW4A 2OUHA 1TZOA 2BQPA 3KB5A 3WDWA 1GNYA 5B4NA 3A22A 4A7KA 2CV6A 4Y3OA 3PUIA 1C8M1 2ZGQA 1DLCA 1W2TA 4K9SA 1GUIA 1VBA1 1XE7A 1S0DA 1BBT1 2WNOA 4YZ4A 5KXBA 3WSOA 5EJ1B 4FFFA 4HL0A 1JBCA 1RUD3 1WW7A 3I3EA 1IKPA 2XJSA 4O9EA 1AL21 1WLCA 2O8OA 4FSJA 3WVJA 5JPNB 1KQRA 1BQPA 1UU6A 2FD8A 4X6RB 2R062 4QPYA 5A3OA 5FZLA 1DQ2A 1W9SA 1Y9QA 3OEBA 1S2KA 1UY4A 4QMAA 5GLTA 1JOBA 2XR4A 4LOTA 4MH0E 4QX1A 2C6SA 5IYYA 2AEZA 1QJU1 2GMEA 1Y3TA 4JGYB 1SFYA 2W47A 4E2SA 4RQPA 4N53C 4XXPA 5J09A 1TMF1 4QPGC 5GZDA 4W8JA 3MIHA 1M4WA 4Q8KA 1QH7A 3PMSA 5ACA2 2VW2A 1OVSA 2RDNA 2UWBA 1ST8A 4RHV1 1N1YA 2JE8A 5FREA 3E6BA 5DQ0A 3W58A 2PHFA 1UOBA 5JSPA 1EUUA 2WZR1 2A3WA 5LBCA 2WJSA 1ZRIA 2RS31 2GC3A 5IUQA 4PLNA 5L73A 5FZMA 3WNXA 1POV0 2BOIA 2NMNA 3B9IA 3GGLA 3PVNA 3POSA 3U07A 4CDQC 2D5FA 5C3PA 1RUF1 3N35A 3N9OA 2D7FA 1FNYA 3SEEA 4CDXC 4F3JA 5DMYA 4DNYA 1K45A 1SCSA 4Y1ZA 1W04A 1WMXA 2ENRA 1H0BA 3VDBA 3POGA 4W6WA 5K0UB 1RL3A 4GWIA 5A7NA 1RUG1 2A70A 5HCBA 2AH2A 4PHZA 1RVF3 4HETA 3CJIB 1YC61 3J7LA 4QPGA 4LA3A 4BMBA 4EN0A 2HWD3 2EXIA 4AF9A 2AYHA 2JIGA 2VUDA 2Z4FA 4Z07A 1NXMA 4JKKA 1VBE3 3JQXA 3APBA 3MLLA 1MS4A 3S5QA 4DINB 3OB8A 5LASA 4OCTA 5LEJA 3DGTA 1IPJA 1BEV1 3DECA 3NV3A 4Y4RA 2VOWA 4H2AA 1LB2A 4GQ7A 3WDUA 3H8OA 3D82A 3LGRA 1ONAA 1DBNA 2KA3A 3M8LA 1U12A 5FUNA 2XJRA 1IQAA 1GNZA 2Q1ZB 4XUPA 3O1MA 2F4PA 1W99A 3B94A 4RR3B 2KXLA 2Z2SB 1QHDA 2R041 4OUEA 4ZS2A 4CDQA 5JOWA 1PMHX 1PM7A 3T2TA 1LR5A 4CCOA 1FYUA 3A7QA 4CDXA 3CDZB 4IEWA 1RUD2 4JCKA 4ASKA 3AYCA 5FBJA 2ZGMA 4AVBA 4P9XA 3ZXAC 4ORFA 5IVVA 3PU3A 2PQSA 1PGW2 1UOFA 2A3XA 5A7OA 4NRQA 2WS93 4PI2A 4D6SA 4XZUG 5J3UA 1OH4A 1JODA 2FCTA 2ZEYA 1OD5A 3WF3A 5I0UA 2ARAA 2GNTA 2J7MA 4TXWA 3OSDA 1HIXA 1R1A1 2L9LA 5BXXA 4Y4YA 3NNLA 4HBNA 1N47A 1YQ2A 4IGPA 4XW3A 1Y7BA 4XJWA 1MS8A 4YW7A 4WV8A 2GC0A 2NMOA 4AFDA 3ACHA 1F15A 3FX3A 4KBBA 1O4TA 4QPGB 4XIKA 2FMYA 1H6YA 1VALA 1O3SA 1LTEA 4GH4B 1SBEA 1TME1 4K40A 3E5QA 4AFMA 1JYXA 1OH3A 3PUAA 4XBQA 5F3CA 3WD5A 2LW8A 1UZZA 5F8PA 3IDBB 4BYYA 3JBG1 1MZEA 5CNAA 2QNKA 4IEYA 4KWKA 2ZGSA 3VBHC 1KDMA 1PIV3 3OF1A 2A6ZA 2XJQA 4P9WA 3CZJA 4HVRA 5C5TA 5FRAA 1GBGA 3M2MA 1H1AA 1DU3D 3NVCA 1R083 1RUE3 2WFF1 2ZZJA 2ZKLA 5JAXA 4I30A 4UW4A 1I9RA 3VL8A 4DUWA 1ULFA 3CU7A 3HMYA 4GMP0 3AYEA 1AYM3 4LO6B 4Y5TA 5A7QA 1OXCA 2EIDA 3ZXLA 3AKTA 3TAYA 5FOBB 2D43A 4Z92B 1RVF2 1ZRDA 3MPPG 3SNMA 1WUVA 3HBZA 5K8SA 2ZX4A 4JHZA 2HWD2 2WA3A 3FBYA 3LOIA 3QH6A 3NJYA 4P9IA 4LO5B 2Y8KA 3A0NA 3B02A 1VBE2 1LGCA 4A42A 5IVEA 2VUJA 2Q8OA 1L7LA 4FPFA 3O1PA 3ETQA 4AHZA 2P3JA 1UKGA 2I45A 3AZWA 4IETA 1X8EA 4AL9A 2OPWA 1UPIA 2RV9A 2BEOA 1FPN1 1VBD1 2VZVA 4IGQA 4OHXA 1A8DA 2G4IA 3NNMA 5DZFA 3UL2A 4ET7A 4DXRA 2Y38A 1G8WA 1XXNA 3W5NA 1AHSA 1LEDA 4NO4A 1UIJA 1ULDA 2PYTA 4YVSC 5DAVA 5CADA 1KS4A 2HWB3 4Q4Y1 2VMEA 5I8SA 4FT8A 2JG8C 3T3YA 3THCA 4CPBD 1PNFA 1PO13 2JDPA 2WS92 5FXXA 3RJRA 3SITA 1X50A 1W05A 4YW2A 1MEC3 3OBTA 4KI5M 4PCRA 4B4QA 3LZZA 3AZZA 4CDWC 3OY8A 4QHBA 4CE8A 5K7PA 2FBEA 2OZ6A 1PK6B 5DG1A 4MO3M 3OUIA 5E16A 2W9XA 3IIAA 5FCCA 3WCSA 3IKWA 2F17A 2XDVA 3RZJA 1WMDA 4LBKA 4M4RA 3RPQA 3BTZA 5A7SA 2VE1A 4JKMA 1NX9A 4BA6A 1FAYA 5KWRA 2BBAA 2ILMA 2JENA 2MNGA 3O0VA 4UT5A 5FJHA 3ZXGA 2H6CA 4UW5A 2QKDA 2E63A 1NLSA 1YHFA 4BK5A 4XDPA 2IFWA 3IDAA 2EXJA 2OPKA 2P3KA 3WP4A 2P34A 2BNNA 2ZTNA 3ST7A 1MS9A 3C8XA 2JDHA 3KT1A 1ODNA 3ZMOA 4NE9A 4AEJA 1RINA 4YM1A 3VBRC 1CR7A 5EJZB 4KU7A 4QAWA 2E53A 5FQ0B 3KT7A 4BCUA 5KHJA 4YVSA 1PIV2 2VZPA 1AYN3 1REEA 1VB4A 2VO5A 2JG8A 3VHOA 1H2KA 2XKPA 3DUIA 3LA2A 5FZ0A 3TEXA 2FDKA 1R082 1MS1A 1YRZA 3D6EA 1YQCA 2HWE1 5I91A 2A6VA 1VAKA 3J26N 3NSTA 4LORA 1AYM2 1PO23 1Q56A 2VZ1A 5LCWL 2AC1A 4OZOA 4PQQA 5CFCB 4CDWA 3MIDA 1ODMA 4XDQA 3EXUA 3AVSA 4IDZA 4E4HA 1IKQA 4P5YA 3ECQA 1EYBA 1W6QA 2R30A 3HNBM 4XOGA 1S0IA 4LE4A 3RG0A 1ZBE3 4JTNA 1XRUA 4HXCA 4XFHA 4LUMA 2OQ7A 4R4XA 5IVYA 4OHWA 5IATA 1GSLA 1YFWA 5DUUA 4AQ2A 3GZAA 1W6OA 3HQRA 1XOYA 1O7FA 2Q1FA 4M01A 3K51A 1VAVA 3IBMA 3QBQA 1UOGA 1MVEA 1SLAA 2J1SA 4YW1A 4I01A 5A1AA 5A6ZA 2KD7A 3VBRA 4I0WB 3FHIB 5IK7A 3KHBA 5J98B 4EN7B 3MHZA 1UYZA 2D97A 1F5FA 4OLLA 1SBFA 5C8CC 5FDBA 2Y6GA 4P02B 2ZJCA 2BFUL 5F1RA 1D4M3 1OC1A 1MZ5A 1POV1 5DPNA 3T4VA 1ZA4A 2HWB2 3HIFA 4L9BA 4LXLA 1GFF2 4Y1UA 4COVA 1CAUA 3JB8A 2ZXQA 4IE6A 3ZYFA 1G9DA 1OKOA 1PO12 2OA2A 4YVSB 1MQTC 1OSGA 4MLOA 1MEC2 2RMU1 1LESA 4BZ4A 3A21A 4AQSA 2JG8B 3O12A 2WZPP 1REDA 4XCAA 4J25A 3L2YA 2JXAA 2YHJA 1OLMA 5EQUA 4BLIA 1W9FA 3LEMA 5FK7A 3LFIA 3MFAA 4YGEA 5T52A 5JSOA 1OPOA 2WWSA 4MXVA 2Q8EA 4JV4A 3WLUA 5F3EA 4CDWB 1OT5A 4NWVA 5FP9A 3BU0A 5FKCA 4IERA 1W6QB 3LAGA 1PVXA 3EQEA 4LKSA 3ZFEB 4K7JA 4Q4W1 4QQ2A 3FLPA 1NUKA 3IMMA 1J1TA 1JUHA 5FPAA 4AI9A 5C8CA 1FOD1 3AL5A 2VOXA 2EVXA 1AR71 1J83A 4NWWA 3DKQA 3ES1A 5M0TA 5LRRA 1UCXA 1PZ7A 1JW6A 4LO7A 2TEPA 3W9AA 1Z7S3 1AYN2 2PXJA 3GZUC 4HSLA 2EA7A 2OYZA 3AMNA 4Y1VA 4IV1C 1HRI1 4OI2A 2A75A 1QU0A 2IFRA 2C9AA 3PUHA 4M3CA 4BE3A 2A1XA 3MIEA 1MQTA 5FYMA 4UFLA 1PO22 2YC0A 2ZEXA 4QU1A 1DP0A 2HKXA 1H9PA 5K9YA 3BOPA 3ACIA 3CQOA 3KT4A 4ZZ8A 1UYXA 2DCJA 4GKXA 3WY6A 1QJX1 3U37A 5A6XA 1FATA 3UKTA 3ZFFC 2I2SA 1ZBE2 5D1IA 2WNUC 2A5ZA 1XB9A 4RSUA 3I2KA 1XC6A 1S0GA 5JZGC 4KG0A 5FYIA 1L7QA 1D7PM 5LK5A 4KL1A 4I02A 1F9KA 3BODA 3J7NA 2YG0A 2FDIA 3AKQA 3EB7A 1V00A 3WCRA 3T4HB 2ORXA 1UXZA 2Y60A 4QX3A 5FO8B 1NQDA 2YBPA 3MZHA 3VHRA 3DYPA 5FP8A 5D2AA 1ZREA 1D4M2 2WO1A 4IV1A 2VBPA 2ZMNA 3BOWA 3JXSA 3DPRC 3UGFA 4BQ1A 3VZJA 1VBC1 4AK3A 2QQUA 3GZTB 4ZU5A 1YFXA 5C8CB 4OI0A 3ME2A 4BB3A 2D44A 4I0AA 2V4AA 1F35A 2IXLA 4XJAA 5LA9A 3MLJA 3USUA 4AFAA 5CA6A 3C7EA 3PTYA 2JD4A 4P00B 4QHZA 5FK8A 5FV3A 2VMGA 2XJPA 3VD5A 4AHWA 4PI0A 1WCSA 4I3PA 2PHRA 2VZTA 1GWKA 2GSYA 2JDNA 4GMP1 4NPRA 3ZFFA 1EP0A 3AMHA 4B1MA 1VRH3 2WNUA 5KC5A 2VBDA 3PVBB 5T54A 1MQTB 5GKAC 2LTNA 1NY72 2GNMA 4XXAA 1OUXA 5JZGA 2P37A 3GHNA 4W65A 2WT1A 3M4FA 1W2UA 1DQ0A 2NYYA 4YVWC 1RMU3 1W8WA 3BCWA 4E4DX 2XL9A 3ALQA 4U2AA 1YCIA 3IM0A 3V0BA 2ZOEB 1RJ7A 1GANA 2JJ6A 5IAVA 3D3AA 2YDEA 1BZWA 2JG9B 4CP2A 3GCXA 5J36A 1NQJA 1U0AA 3QACA 1HXS1 4KGQA 2CWSA 4QPIC 5IK4A 2BOJA 2P3YA 3OYWB 4Y33A 4DRRA 1KITA 3RNSA 3INAA 3KV6A 1Z7S2 3WUCA 1WLTA 4CU9A 3HOBA 4UFIA 4ZONA 5H9QA 2BGPA 4FPCA 4ONUA 4INDA 4FTEA 1E5RA 2GMPA 3HQUA 4MXWA 2WO2A 4AE2A 5J48A 1MZFA 1PGL1 2E26A 2ZEZA 3KQRA 2W68A 3WG4A 1C28A 1W8FA 2ATFA 4LJHA 3P1IA 4PIXA 4QKDA 3NAPC 5E88A 5J37A 3MUY1 5LY1A 3AP7A 4OMCA 2XJVA 4YVWA 2VZSA 1H2NA 3VZLA 4CU6A 3ZN4A 3O1OA 1OA2A 5A33B 3ELNA 5FY5A 1D0GA 2A73B 5JOZA 4LBQA 4G9SB 4XFCA 4Y5Z0 3ZFFB 4WZCA 1RUJ1 1VP6A 5EYXA 3PLQA 2O8QA 1O3TA 3LA7A 5BNPC 1PMJX 5DAPA 1CAVA 5APAA 2RS13 5JZGB 1PM4A 5IK5A 4QPIA 3PJYA 1RGSA 3IAPA 4QB1A 4CDUB 2WT2A 2VY0A 2B4KA 5FXWA 2PHDA 3UGGA 3H3LA 3ZX7A 1GZWB 2IXJA 2XLFA 3I54A 4NN0A 3KS7A 5AC93 5C8WA 2WNVC 1S2BA 2BV4A 3FJSA 4GWJA 2XJTA 5CEHA 5CZKA 3VBSB 4HVQA 4KG8A 3FL7A 3ILFA 4MZUA 3QD6A 4HFSA 1HRV3 3B3QE 5FPLA 5FYSA 3WDTA 4L11A 4NIAA 2Q4SA 2GN3A 1EUTA 4I09A 3W20A 1AR91 1LNSA 4WM8A 3NAPA 3KWVA 5FYHA 2V72A 4URTA 4EZ4A 1S0JA 2XG3A 4CP0A 5FY9A 3CBNA 1OFNA 1LHUA 1SHWB 3HEIA 1UMZA 5FOJB 2VXRA 1RMU2 2QQKA 5BNPA 4A4AA 3RGBA 1CZSA 4HPKA 4CCDA 4CEYC 3WW2A 3OGJA 2GH8A 4P9LA 4YGDA 2RS53 4W4ZA 5I0TA 4EWEA 4UOJA 1K42A 2AR6A 5H9PA 3UJQA 4TWTA 3I3MA 2FDJA 1V9U3 5FMOS 4QB2A 3WW3A 2VTXA 3GM8A 1R1ZA 4BLJA 2WNVA 4FPJA 5F5IA 1R091 3ACGA 3G6JB 4H3WA 3RZMA 3VGIA 1CAVB 2HWF1 2LRPA 4KWLA 4RGAA 3UJOA 1QIQA 3CO2A 1HN1A 5KHHA 3M3IA 1DQ4A 3RZZA 4QPIB 3TOJA 4DY5A 3F95A 1E57A 1HB1A 1N3PA 4NHXA 3I49A 2VOKA 2ZMLA 4BQ4A 4JRLA 2E7TA 1YIPA 5DN2A 1W0OA 2DU1A 3OJBA 1KDKA 3KCYA 1RYYA 3K3OA 2WSVA 4AAXA 1BMV1 1KFXL 1QQP3 2CAVA 5A6YA 1Y4WA 1REFA 2J1EA 1AJOA 4AWDA 2HJIA 4YRDA 4IXLA 4DY3A 4WM8B 5GLVA 4CEYA 5IHRA 4I0BA 4ZKTB 1UQXA 3SLIA 1G9AA 4BPZA 3AP5A 4Q0UA 1W6NB 2WO7A 3WZ1A 2RS12 4IE0A 4IV3B 4YZ3A 2QVSB 5DAWA 1OBNA 2BZDA 1QDCA 2J1RA 3POIA 2HYXA 2VVEA 4FCAA 3RZLA 1GP5A 2RM21 3RZKA 2R071 3MFCA 4HPKB 5F2SA 1ZYBA 2PLV1 2X09A 3KD4A 5AC92 3ES4A 3KMHA 2QBXA 2DUQA 3VDDB 1C8M3 1MS3A 4YLZA 1WMFA 1VBA3 1BBT3 1U5IA 2CHHA 3LDBA 2J1AA 2ZEWA 2XLGA 4IEOA 2UU8A 1HRV2 1QWRA 3IDCB 3T2OA 2WNVB 5K0UC 1AL23 5GALA 4GALA 1N1VA 4QXKA 5CFDB 4BQ2A 3CJIC 1DGRA 5FYUA 4ARXA 4HKWA 4XUNA 3ZYIB 4GB31 5HXMA 3ZYGA 3FC0A 4YARA 1XYOA 4H7MA 2D6KA 4OHZA 1DHKB 3R05A 4XFFA 3S30A 3RDIA 3WX5A 1QJU3 5IWFA 1QOSA 5L36A 2A6YA 4N90A 1TMF3 5JOYA 2CDPA 1KEXA 1TE1B 1F5JA 1HQLA 3WNOA 2RS52 3P6BA 4O65A 4ASLA 4RHV3 2EXKA 4PBOA 4RR3C 1V9U2 3I2HA 3I8TA 4IEZA 2PHWA 2WZR3 1L3JA 1V6OA 5C33A 4O61A 1KJLA 1WA4A 2RS33 4HLTA 2QZ2A 1C3HA 5FZDA 1I5PA 4JDNA 5T50A 1G7YA 5HCAA 3THDA 1I5ZA 1LOBA 4A2UA 4LNVA 3D8CA 1OHFA 4ATFA 4A45A 5K0UA 2WL1A 3WG1A 2YPDA 4XJ8A 1RUF3 5F9TA 4YSFA 4WBBA 4LR4A 3RI9A 1JZ7A 4CYDA 3CJIA 3FHAA 4XMAA 3PL0A 3HR9A 4META 4UBHA 4FBFA 5JPMB 3E6DA 4TLFA 3MV01 3OUHA 5FO7B 3Q8CA 5CVRA 5IAXA 1J3QA 2G9GA 4GZ9A 3LE0A 1PHMA 1QQP2 1RUG3 2XWJB 4LKEA 4AI8A 1GOHA 3WF1A 1UZVA 2WAOA 1YXWA 1O4YA 1SLTA 1WD3A 4LK7A 3E6CC 3AK0A 2N7GA 3TBDA 3T2PA 4LHLA 3M3OA 2BRTA 1FMD1 3AC0A 5A6QA 5EV7A 3BVCA 1YUDA 1QOTA 4LIVA 5F7UA 2VVFA 4RR3A 2WO3A 3MDPA 5BYNA 1EPWA 4M3CF 1NG0A 2GAUA 1UMHA 2PAKA 2RJKA 2GMMA 4GH4C 4QKBA 3C3VA 3S7EA 2XUEA 1BEV3 2QUOA 3T08A 1Y9MA 3ON7A 2AGSA 5A3WA 4PT6A 2WR9A 1XNKA 2AEYA 3OPTA 3AP4A 3TB0A 4UFHA 2EAAA 3FWEA 3LB9A 3N9NA 4J1XA 3GF6A 5FYBA 4COWA 2WA4A 5SV5A 3WQ0A 2GP3A 2I07B 2CNAA 5LWBA 2R043 3HT1A 1C8M2 3FBMA 1VBA2 3HJRA 2LUWA 1BBT2 3AMPA 3ZYHA 4XJ9A 2V09A 1VMJA 3ZDSA 4U36A 1PX4A 2D6PA 3FE5A 1W6MA 1ASJ1 2D6NA 3J8F1 5DABA 1TNFA 1AL22 4C8DA 1GMMA 2F6BA 2Y33A 1XNCA 4LHKA 2VQ0A 2YU2A 5DAQA 5F6KA 1CWPA 4NJ4A 3GBGA 2YFUA 4XE9A 3T1LA 1QGLA 3UETA 4FTBA 2VAUA 5EP9A 4CEWA 2GN7A 4ZS3A 2UWAA 4XHXA 1I6XA 1ZZCA 4XQWA 4Z2AA 5JI9A 3RYPA 3AFKA 4Y1XA 4DXTA 3TYJA 3O0WA 4HKOA 1QJU2 5JIUA 4PQ9A 1XU2A 1UL9A 1R1A3 4WZFA 1VIWB 5ANNA 4D8MA 3DXTA 5BNNC 1OOPC 1TMF2 3C7GA 4GH4A 3VBHA 1A8MA 3KLSA 5ANQA 4ASMB 1IZ3A 3DV8A 1CAXB 3MIFA 2Y0IA 3SXWA 4DEVA 2XPJA 3T09A 2BTVC 3J9SA 2RHPA 1GZTA 3M3CA 2WYSA 1AX1A 2WZR2
chains in the Genus database with same CATH topology
3B9CA 1GICA 3VKFC 5B2GB 4LT5A 4W6XA 2RS32 1TME3 1HW5A 1F2NA 3R4UA 4P9YA 2A3YA 3JBG3 1DZQA 1OA4A 1TEIA 2P17A 1RUF2 2W0XA 3PNAA 4XBLA 2QCSB 3BIWE 4YFZA 2K0GA 1O4ZA 3AZYA 1AX2A 1O3QA 2WFF3 3B69A 1J58A 3EBRA 4COUA 2HEWF 3MIGA 1PK6C 1RUG2 2VECA 5KHGA 2D3PA 1W6MB 1GYKA 2DTWA 3ZFGB 1Q8SA 2V5YA 2ZHKA 3D5OA 5BNNA 1OOPA 5BPXA 3ZXEA 2ZGUA 4AYUA 1MS0A 3JQWA 4XYXA 4CEWB 1Q3EA 1WBFA 3OTFA 1BEV2 3B00A 1IS3A 2ZBJA 4HK8A 3OGGA 2A6XA 4HMZA 3TRSB 3VBHB 4WM7B 4WVVA 1FPN3 1VBD3 1RUH1 4LTAA 2R042 4YG6A 3M7AA 5TSWA 2P2KA 3CLPA 3ZSEA 4GXLA 4Y20A 2ZPXA 3SISA 4NHMA 5CFCC 4Q4Y3 3H0OA 2UYAA 2Y0OA 3BPZA 4EWDA 1PK6A 1RHI1 2XBO1 3AM2A 2GNBA 1MZ6A 3FUOA 3CF6E 1C5IA 1C5HA 2WQZC 2VG9A 1RUNA 1Q5OA 4E4SA 1R1A2 1G6NA 2W52A 4KQ7A 1FI2A 5T55A 1DQ1A 3QCWA 5DDJ1 5HXVA 4XF3A 4EWAA 5FFOC 5FQ0A 5BNNB 3V0AA 1OOPB 4TZDA 2BGCA 5KBFA 1TME2 1AXYA 2DU0A 2QQPA 1DGLA 2XB6C 1FXZA 1IHMA 5KC6A 1ZRFA 1F31A 3AX4A 4AXOA 3JBG2 5CFCA 3FUQA 3OD4A 2KM2A 2R16A 3KZ4C 1LULA 3VZOA 3AKPA 2PHUA 2HWE3 2WFF2 4QM8A 2ZX1A 3DF0A 4BM8A 2PHTA 3VKNA 5JR7B 4F83A 4N7UA 1UN1A 1QF3A 1UU4A 4Y20B 2DCKA 2BWCA 4CZSA 3AJZA 4M3CE 2TUNA 4DZGA 2PTMA 4XILA 1J1LA 1WLWA 2BYVE 3ZFEC 4PLMA 3E5UA 1JYCA 4LEJA 3TWIA 3ZSLA 5EFUA 1DYKA 1QXRA 2ZGPA 2RJLA 1D2SA 2YGLA 3IPVA 1ZRCA 1FPN2 1VBD2 1YFYA 4HVOA 2B8MA 4PLOA 1CPNA 1COV1 3H8UA 4HN1A 3SH3A 3V0AB 1PVC1 4HZFA 2ARBA 2ZMKA 5BNOC 3LKJA 1POV3 3CJXA 4BIFA 4LO8A 4NR1A 2VQAA 1CPMA 4Q4Y2 1LOAA 1RUE2 4EJRA 4AVCA 2XVGA 5JDBA 4AI2A 3CL1A 4XJUA 1Z78A 1OMIA 2RMU3 4KH9A 4Y24A 3SCHA 2O0OA 5J7MA 5L7OC 3IT8A 4FP3A 1LENA 3ZFEA 3I59B 1AZDA 4AG4A 5IK8A 4G4FA 1Q43A 3ZN5A 4F7ZA 3WV6A 4ES9A 4IEPA 3RMYA 2ZCWA 4OHVA 4P5HA 1GZCA 4FPKA 1ULEA 2EF6A 4Q4W3 2OVUA 3BTAA 4YM3A 3RS6A 1FOD3 2VVDA 2VU9A 2FZ1A 5BNOA 1AR73 4Q4X1 3B01A 4E2GA 3A4UA 2DUPA 5LEKA 4LE3A 4AVTA 2ZHLA 3IPVB 1HRI3 1CAWA 2HWE2 1ENRA 1JTZX 3IN9A 5GM0A 2NQYA 1YJLA 2DFCA 4MSVA 5L7OA 1XU1A 4FOYA 3VV1A 4DPNA 1RITA 4QU2A 1GQGA 1QJX3 5FBZA 2G9FA 1C1LA 2D6MA 1WW6A 1XYNA 2VNGA 3OBRA 1VLNA 5I8YA 3AMMA 2JG9C 1OKQA 1X82A 2QFEA 4X8PA 1YI9A 2ZX2A 1SQ4A 4AEKA 4D3WA 3KSCA 3WQ1A 3R4SA 5KHKA 5CG8A 1JXNA 5H9SA 3ASIA 4UW6A 4MV2A 5HBAA 1SEFA 3ROUA 3X29B 1VBC3 5FLHA 3EO6A 2R49A 1UU5A 4R9DA 4BWOA 5BNOB 2E7QA 3R4DB 3NWKA 4IQPA 4Z1VA 2RMU2 3U10A 4GMP3 3DL3A 3AKRA 1CAWB 4QX5A 3MYXA 1ZM1A 2HEYF 3L9JT 1DYPA 4UBGA 4OI1A 2JG9A 1PNGA 4CRQA 5L7OB 1AJKA 4QD2A 4BHPA 4IEQA 1AR81 3H50A 4W6YA 3ZXFA 2IWGB 3OYWA 4CDUC 1GQHA 3OD0A 1ZBA1 4Q4W2 4RGGA 3SMHA 4NHLA 1I1EA 2ZHNA 4Q4V1 2VMHA 4B7KA 1CN1A 2ZZQA 1VBB1 4Q1RA 5CB7A 3VBFB 1FOD2 1HXS3 1W39A 1Z0HA 4B29A 1F8VA 1AR72 2BPA2 1APNA 2B39A 3VBSC 2YUEA 2ARXA 4PBPA 2DCZA 2WKKA 4Q8LA 5DUWA 2JECA 1YI7A 4OUSA 3AYDA 3H9AA 1KFUL 2Q0AA 1HRI2 3LSEA 4OZXA 3O5SA 1IS4A 1S0EA 1JUIA 2H6BA 1A78A 2JEMA 2MEV1 3LCPA 4AW7A 5A33A 4RS5A 2PFWA 5JSRA 4J1WA 4QQHA 1QJX2 1G9BA 2YYOA 2WSUA 2ZAAA 4KGGA 5T5PA 3WP3A 4XPVA 4CP1A 2RR11 2GNDA 4S2GA 4CDUA 1GNHA 1NZCA 1RUJ3 5EXOA 2DV9A 2K2SA 1GZWA 2CGOA 2A6WA 2PN5A 2A71A 3VBSA 2K9ZA 2VGDA 2MPFA 3KGLA 4L8QA 1LECA 1OQDA 1EAH1 1NCQB 3PVOA 1VBC2 3NV2A 3WUDA 4AFBA 3JCIA 4HSJA 1V6IA 2BVVA 3VUOA 1DFQA 2GC1A 4EN9B 3N36A 2DCYA 1AR93 3H7YA 1WD4A 1AVBA 1HV1A 4L97A 4WM8C 1V6LA 4Q2FA 5AVPA 2PELA 1DGRN 4K6BA 1B35B 4LULA 3PVEA 2YROA 4JVAA 4R52A 4V1PA 4RS5B 4IV3C 2D93A 4ISQA 2ET1A 1IOAA 1QJY1 3AXDA 1YYNA 2QZ3A 3ILRA 1I3HA 2UWCA 3M1HA 4IESA 4OVEA 5F6LB 3H3ZA 5JVVA 5A3LA 1NCRB 2WT0A 4OI4A 4E2QA 4COZA 4FPYA 1HXS2 3PMEA 3VDDC 2XUMA 1RJ8A 2A7AA 1W0PA 3B7MA 1JOJA 4AGRA 4XF9A 1R093 2AENA 3C2UA 4FTSA 2HWF3 3THTA 3WDXA 2CWMA 5GLWA 1WCKA 2CY6A 1ZX5A 1LHOA 4FOVA 4JDMA 3RRDA 4FPEA 3ZXLA 3HQXA 5BY5A 5CFDC 4P14A 1EV11 3ZYPA 1WW5A 1YO8A 4C1XA 3TN91 3KGZA 1PGL2 3ZXJA 1N1TA 3MLKA 3OPZA 1VRH2 4Q27A 4XF0A 1K5MB 3ACLA 1W6NA 1FNZA 4GA9A 4IV3A 4WVMB 2AREA 2HWC1 3T1MA 1ND3B 2VOVA 5JOXA 1RUJ2 5DZGA 1LODA 3H1MA 1H8TB 1DGWX 4AVAA 3O0XA 3VDDA 4NHKA 5I0RA 4JGZB 1MS5A 1JN2P 4FQZA 2DUOA 1LOGA 4AQTA 2RM23 1SACA 2R073 2VW1A 1AR61 2PLV3 2WLQA 2X53S 1G86A 1VJ2A 3HWJA 5CFDA 3EJKA 1T6GC 1OQEA 4Q1PA 5DXDA 5E8AA 4SBVA 4OHYA 1V6MA 4LBJA 1AR92 5GLZA 4S2DA 2TBVA 1RUI1 1BVP1 3MW4A 5CU1A 4XETA 3MGUA 2EAKA 4GB33 2Z79A 4K3UA 1GKBA 3O7OA 1LHNA 3AXEA 4ISRA 1QKQA 3HN1A 5JWPA 4L2NA 1ALYA 1FT9A 4FPOB 4DS0A 4GULA 2DURA 4QQPA 4Y26A 4XJZA 2ERFA 2YGMA 4S2FA 4XBNA 1N3OA 4LLFA 2X29A 2CYFA 2Y26A 2SLIA 4K8FA 1R092 2NN8A 4PJYA 2HWF2 4X8NA 2DVBA 4ZXKA 1SFNA 1U5XA 4K20A 3RJ2X 5D8AC 4AEDB 1NA1B 1ND2B 1PZ8A 1OI6A 5DG2A 1RUC1 3JD71 2TNFA 1DZTA 2ZA9A 3VZMA 3LOBA 4QT6A 3GBWA 1UKRA 4XZPA 2B45X 3UV9A 3CNAA 3DN7A 3W59A 4WVZA 2D98A 4C0BA 1BMV2 2E6VA 5JI7A 4H55A 1RB8G 4XMIA 4Z8BA 1FV2A 1AXZA 1NOVA 3H3UA 1FMD3 4FXKB 3NW4A 5JMCA 4RL7A 3R0RA 4M0NA 3NV4A 2JICA 3MI8A 4YFWA 5EWSA 4SLIA 1AF9A 1LU2A 1V70A 3FZ3A 2RM22 2MHFA 2R072 2R061 2PLV2 5D8AA 3SHRA 4QQLA 4AGGA 4XEZA 1ZNPA 1WGPA 2PHXA 2XHKA 2ZGTA 4LUKA 3S7IA 4FQ4A 4MUVA 4Y22B 5ABJB 3ZO0B 5CBLA 4ITCA 1ASJ3 3J8F3 4GWNA 4YG0A 4FVVA 4XFGA 5ACA1 1QNWA 3ZFGC 2DF7A 4LBLA 1LEMA 3RSJA 4ES8A 1O91A 4GB32 1WMEA 1BK1A 4UXAA 3PJQA 1CAXA 4AGVA 1CD3G 4I3GA 3FFZA 2BNMA 4CEWC 1QMJA 3VHNA 2IXKA 3WG3A 2ETEA 4QQOA 4R9CA 1H1IA 3LWCA 4X6QB 4J6GA 2WFPA 3MF6A 1YNAA 3VZNA 4WM7C 4E9KA 4YYOA 1S55A 1PZ9A 4NVPA 5FLJA 2YV8A 1UX6A 3PHMA 2DVGA 1ENQA 1XQNA 1CGPA 4R9BA 2NPIA 2D5HA 3U0ZA 2DVFA 2B9UA 3WXPA 3WDYA 3ZVXA 2GU9A 1NLRA 1QDOA 4A7YA 4JAAA 4IEUA 2OIIA 1BYHA 3ZFGA 1HV0A 4QM9A 5D8AB 5SV8A 1UIKA 4MGKE 4OULA 4DB5A 1PMIA 5F5QA 5FMOL 2DFBA 4LBMA 5AVAA 3SCFA 2B46X 4XIOA 4DFSA 2EXHA 5DZEA 3JUUA 5GZEA 5GZCA 1G9CA 3S6PA 5EZWA 1FMD2 2FMDA 3USSA 1ZZ8A 4WM7A 4ZU7A 1RUD1 4RHV2 5KXDA 1LU1A 4YNIA 5JLVA 1OLQA 1BVVA 1PGW1 3URFA 2R0FA 4N43C 4FP2A 1BCXA 2NM1A 2QDRA 4Q0SA 1RUH3 5FTTC 1UF2C 1J59A 2R0HA 3AFGA 4FOQA 4N53A 3WW1A 2Q5TA 2JX9A 4LBOA 1QJZA 2D3RA 4DQAA 1ASJ2 3AYAA 3J8F2 4Z2WA 5I0SA 3UKNA 4OUMA 1CX4A 2QE3A 2XKOA 1RHI3 4XQ4A 2XBO3 3E5XA 4S2HA 4C1WA 1TNRA 1S0CA 4JRAA 2SBAA 4HK9A 3N7KA 1LCLA 1QXPA 1YWKA 1OFSA 2BVBA 4RQPB 4LO4B 4D7TA 1ZZBA 4MGIE 4YW5A 3D4KA 2JDZA 3ZIXA 1SMVA 3AB0A 1A3KA 3M70A 4AQ6A 4B4PA 1OPMA 4XF4A 5DDJ3 2FZ2A 3ZSJA 3IWZA 1QOOA 4ZU4A 5L19A 4Q0QA 4N43A 5GJ6A 2WINB 3G7DA 3CEWA 2DWRA 3ZSMA 1VR3A 3NO8A 1H9WA 1RVF1 3SH4A 4RFT0 3N7LA 1S0FA 4IL7A 2HWD1 4EV0A 3ZYRA 1H30A 1ZZ7A 2PAMA 2W08A 1V6NA 2BFUS 1MVQA 3VL9A 1GR3A 3WHTA 4K21A 2Z69A 2BW8A 3K48A 4XTPA 1VBE1 2VW0A 2YPJA 2ZX3A 5EJ3A 4YZ5A 1UD1A 2XVLA 2CL2A 4N53B 3POYA 1J3RA 4HT1T 1FX5A 3I2DA 1XNBA 2R1BA 1SLIA 3NV1A 2B5HA 1UW8A 5I8TA 1IS5A 3VKLA 1AL0G 2FQPA 1EPZA 3VBUC 1LHWA 2WLPA 3NKTA 4FPLA 4NOTA 3JZVA 1O3RA 1HDKA 3OCPA 4FO9A 4CDQB 2ZS6B 3VKOA 2WS91 3BALA 3KM5A 4EROA 4CDXB 1RC6A 1RUH2 3RI8A 3V65A 3AP9A 1COV3 4OFGA 3UKVA 1SLBA 1PVC3 2VNRA 4P9JA 1BKZA 4N43B 1LRHA 1CONA 2VULA 2CGNA 3WQ7A 1AXKA 1M06G 4QGMA 2EIGA 3I59A 1RHI2 4MYEA 3R6SA 4AVVA 2XBO2 5GZFA 3FLTA 1Y43B 2E7AA 2IC1A 3LSDA 3HD8B 4Z82A 1Q8VA 2UYBA 3KCCA 1LKNA 3ATGA 3VBUA 3GBFA 1O5LA 2B42B 5A32A 4P9GA 2V73A 4RA0A 1PIV1 2DYCA 3AZXA 5DDJ2 1CVNA 1SDWA 5KHIA 1R081 2W39A 1RUE1 2XGXA 2UY8A 1AYM1 3WT3A 2X5IC 4MVTA 2E9QA 4C0HA 5HI0A 4YGBA 3EHKA 4LHNA 1ENXA 3ZSKA 1H1MA 1DLLA 4Q4X3 2Z42A 4FPGA 3E97A 3VHPA 1H2MA 3VKMA 1BJQA 1HX6A 1KXGA 2E51A 5BNQA 1DGWA 3S0MA 1SBDA 4N9IA 3WP6A 3L2HA 3MF9A 4XFIA 3UK9A 3H1WA 4AI3A 2DVDA 3POWA 4HN0A 4YZ2A 5CIRA 2NP0A 4FXGB 1W6PA 3N4MA 4BH9A 4A7ZA 1DIWA 5AFEA 5JCTA 2I74A 3NKGA 1AUYA 1EY2A 2B7YA 5IT6A 3VBFC 3RQ0A 5C4WC 2HWB1 3WG2A 4BMEA 4XFAA 1NE6A 3VBUB 1C1FA 2X5IA 1PO11 1N3QA 5A32B 1C4RA 2IXCA 1OA3A 1DG6A 1MEC1 4H14A 4D94A 2JKBA 5DUXA 1KRIA 1COV2 2R32A 4KWJA 5A3MA 4I2OA 1PVC2 2YY1A 1G9FA 5EYYA 1HQWA 3TNPB 1ZVFA 2ZGKA 4R8HA 1GZ9A 3MW2A 2GALA 3OY8B 3MW3A 4PDWC 4H7LA 1D0HA 2XWBB 4GIQA 3A0KA 3RYKA 4AVSA 2GH2A 3WOGA 4TSVA 1D4VB 3FFQA 3P3NA 1GV9A 3I7DA 4G3YC 3VBFA 5C4WA 1MR5A 4QGNA 4R9AA 1AYN1 5C9AC 1X7NA 1AR83 3FLRA 3U4XA 2BNOA 1ZBA3 4FAHA 1LJ7A 1W6PB 1PO21 1TQ5A 4R4ZA 4XFBA 5BV6A 1NCQC 1VBB3 2PHLA 4N7IA 1CJPA 2ZGOA 2EALA 2Q1MA 3N3HA 2H0BA 4Q4X2 4BOWA 1NYWA 3BU7A 3LA3A 1ZBE1 2X5IB 3ZXDA 1RIRA 3GHMA 4GWMA 4F8AA 4JDOA 4LBNA 4COYA 4XHBA 1WBLA 4PDWA 3J4UH 3ZMNA 5C6CA 2MEV3 2DCTA 4XTMA 3RMXA 3D0SA 3ZXKA 1B35C 3ZPYA 4YM0A 1V6JA 4D7SA 4RS5C 1W6OB 2CAUA 3QOPA 3MEPA 2DTYA 1WCDJ 5C9AA 2FHRA 2PQQA 2VH9A 1D4M1 1UAIA 2RR13 1NCRC 3JB4C 3SH5A 3VBRB 4K1YA 2Q30A 1WW4A 2R1DA 3IDEA 1S1AA 4D7YA 2HYKA 2C5DA 2R6QA 1NCQA 1U5YA 1MACA 5FLIA 1ZZ6A 3H7JA 5C4WB 4MGZE 1U5ZA 3N7MA 1O5UA 1LHVA 4MGYE 2QJVA 2BUKA 3QH7A 1CAUB 2IZWA 1EAH3 3VN4A 4AI0A 1NY71 4KU8A 1YLLA 3ZN6A 4JQRA 5BUVA 5GLUA 1YJKA 2X8KA 2ZAHA 1ULGA 3ENRA 1H8VA 1K5MC 4LLOA 1B35A 4FAGA 1VB2A 2BBVA 5KXEA 2ZX0A 5E89A 3M3EA 2C1FA 2P3IA 1ND3C 3D0JA 4Q29A 4L99A 2ZGNA 4PDWB 2ES3A 1NCRA 4D69A 2WNEA 1H8TC 1Z7S1 2ZABA 4JC1A 1AR82 1KD7A 1QJY3 4JGZC 4Q4V3 2UY9A 1VAMA 5HCFA 1ZBA2 2OW4A 5AFBA 1HLCA 2D6LX 3V56A 1DQ5A 3VBOC 5C9AB 2HEVF 1VBB2 4B3NA 5LK7B 2WC2A 4B4RA 3I4IA 4M3CB 3IMNA 2ZHMA 5T5JA 1DF0A 1ULCA 1DDLA 3WP5A 5CAZA 3WINE 1EV13 1K5MA 1N1SA 2VPVA 3WW4A 1HQNA 3TN93 2ZACA 3HAGA 4K1ZA 4WVMA 2VMIA 2MEV2 2WIIB 4XQDA 1ND3A 4YGCA 4M0HA 1PGSA 2YMZA 2AUYA 3P3PA 3ZIWA 4C91A 1GLHA 1V6KA 3ZN6B 1A6CA 1H8TA 1Q8QA 3DPRA 3M3QA 4EN8B 2OUJA 1CQ9A 2ZKNA 4JGZA 2HWC3 1XE8A 2RR12 4FPHA 4PIYA 3VBOA 2GZWA 2NLRA 4YM2A 1H4GA 1CJDA 3Q9OA 3ZYJB 1SCRA 2RE9A 4IV1B 4YZ1A 3HT2A 3RYRA 4AEDC 1NA1C 1VRH1 4IEVA 3WDVA 1ND2C 1AR63 1ZZ9A 1EAH2 3USUB 2XVKA 1KS5A 5CG9A 2LM3A 4LBQD 1J3PA 1RMU1 3U11A 4QGLA 3WHUA 2WNUB 1LOFC 4BIOA 3GNEA 4MX3A 1RUI3 1X36A 4A3XA 1AX0A 3RWNA 1URXA 2Z5WA 3MPBA 4DMIA 5J96B 2DVAA 3V0BB 1YFUA 4DXZA 2BWAA 4DRVA 1QJY2 2CTVA 4FOWA 4Q4V2 1HKDA 2XH6A 4AI1A 4CTEA 3WR0A 4AEMA 1Q8PA 4JTOA 1ZRRA 4Q26A 3DPRB 4XF1A 3N7JA 3DKWA 2XJUA 4GKYA 4AEDA 1WLDA 2JE9A 1NA1A 2NZ9A 1ND2A 1SLCA 1H2LA 1LOEA 4HANA 4TYSA 2GC2A 3VBOB 3H1YA 3VLBB 5LRSA 1NE4A 1Q8OA 5ABJC 4MXWB 3AZVA 4EN6B 5I93A 2YZ4A 1EV12 1LOFA 1XYPA 1RUC3 3JD73 3TN92 3KCXA 2PA7A 2IXIA 4O9GA 4PIZA 2RS11 2AZ5A 5JIAA 4YVWB 3SCGA 4KNCA 2CGPA 1X33A 4LBQB 2LALA 1JHNA 2QDNA 3B5LB 1B09A 1NXD1 3O14A 1QNYA 4WVWA 5FPXA 2JE7A 5E1RA 5AC91 2HWC2 1CESA 5GZGA 2XLAA 2D3SA 1SLLA 1YIFA 3MICA 2IXHA 1LOCA 5T5OA 3NL1A 4E27A 1IPKA 1HRV1 1LGNA 5T5LA 2H0VA 3GYDA 5H9RA 4YG3A 1RTVA 5FPZA 4PF5A 1QH6A 4Y22A 5ABJA 2UURA 2ZGRA 2R063 2XL7A 4JGYC 1AR62 5FAXA 2PAEA 4IEXA 1JYIA 2GDFA 4UW3A 1LGBA 4LA2A 1IGOA 3NAPB 1DZRA 2ET7A 2OZJA 1QY4A 2WQ4A 2RS51 5ACA3 1H4HA 1CIWA 4B7EA 1RUI2 4DOUA 5DUVA