2FZ2A

Structure of turnip yellow mosaic virus at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
164
structure length
164
Chain Sequence
PSPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Virus/rna
molecule keywords 5'-R(*CP*CP*C)-3'
total genus 25
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz2A00
1RUC1 5BNOB 1ZBE2 4Y4YA 5BNPC 2R071 1RUF3 1C8NA 5C8CA 5BNNB 2TBVA 1HXS3 4YVSC 5BNPB 1ASJ2 4PDWB 1D4M1 3M8LA 4WM7C 2XBO1 4N53B 1RHI2 1BBT1 1H8TC 4CDUB 2HWE3 3VBOA 4GH4B 5C4WC 1AR62 4Q4V1 1RUF1 5CFDB 4Q4X2 2WZR2 1TME1 1AR63 1B35A 1PGW1 4GMP0 3J8F2 3VBFB 1CD3G 2HWC1 1B35B 2R062 1IHMA 1V9U1 5D8AB 5L7OC 2WWSA 1ND3A 1MQTA 5C9AB 1RUJ3 1PGL2 1NY72 2BFUL 4RHV2 1OOPC 1RUI3 1BEV3 4Q4X3 4SBVA 1RVF2 1K5MB 5CFCC 1QJX1 3JBG2 4NWVA 5C8CB 4JGZB 1AUYA 1WCDJ 3VBRB 2WFF2 3VDDA 2R063 1FOD1 3DPRA 5LK7B 1PVC1 1VB2A 1QJU3 1BEV1 1RUG1 1PO23 5DDJ2 5ABJA 5ACA2 4QPIC 2RMU1 1VBA2 1PIV2 3ZFEC 2RM21 4RR3A 5A33A 3ZFFC 3HAGA 5CFCA 2HWF2 4WM8C 1PVC2 5BNOA 4CDQB 1H8TA 5J96B 1QJY1 5CFCB 1QJU1 4GMP3 1K5MC 1M06G 1D4M3 1PO21 2ZZQA 4CDQC 1OHFA 4RR3C 1C8M1 2ZTNA 5A32B 1FPN1 1PO11 1X36A 3CJIA 1BBT3 3JD72 4IV3B 1RUD2 1NA1C 2HWE1 2RR13 4EJRA 3ZFEB 1RUE2 4QPIB 1OPOA 5K0UB 1AR93 1COV2 1K5MA 3VBUA 1MQTB 1PGW2 3NAPC 4FTEA 1FPN3 1ND3B 1Z7S1 4FTSA 4CDUC 1POV3 2IZWA 3JD71 1E57A 3JBG3 1CJDA 2PLV3 1VB4A 5C8CC 4QPIA 1BBT2 1VBB1 4NWWA 3ZFEA 5BNPA 1NOVA 2Y26A 3ZFFB 1ND2A 2HWB1 5D8AC 5L7OB 4YVWA 5JZGC 1POV0 1ZBA1 2HWD3 5ACA1 5AC92 1R1A1 1ZBE1 1AL22 2WZR3 2WFF3 4CEWC 5K0UA 2RM22 5CFDC 1RVF3 1PVC3 4FSJA 4Q4W2 1RB8G 3VBHB 1NCRB 1QJX2 1R093 1NA1B 2DF7A 2X5IA 3FBMA 1EV12 1NCRA 2RS53 4GMP1 5L7OA 2WFF1 2BBVA 1TME3 1RUH3 1QJZA 1TMF1 1PGL1 4IV1B 1Z7S2 3J8F3 1VBD1 1V9U2 1PO12 2R041 1COV1 1C8M2 2QQPA 1F2NA 1HRI3 1VBD2 1VBA3 1RHI3 1HRV1 2HWE2 1QJU2 2RS51 2RS33 4Q4W1 5AC93 1PO13 3VBHC 1FPN2 1FMD2 2FZ2A 1AL23 1EV11 3S6PA 2HWC2 1Z7S3 1W39A 4YVSA 1VBA1 1RUF2 4IV3C 2HWB2 4Q4V2 2RMU2 1F8VA 3VBRA 5C9AA 1ND2B 1RHI1 4WM7B 1RUG2 5DDJ1 1BEV2 2XBO2 1HX6A 3JD73 4PDWA 1EAH3 1VBB2 5BNOC 1AYM3 1PIV1 2WS93 1AR81 5JZGA 4AEDB 2R072 4JGYA 1HXS2 3VBUB 1ZBE3 1ND2C 1RUE3 1NY71 4GB33 4CDXB 3VBFC 3VBFA 4Q4Y3 1ND3C 1AYM1 1R091 4RS5C 1HRV2 4CEWB 4N43C 4LLFA 2X5IC 1RVF1 4IV1A 5A33B 4CDUA 4RHV1 1RUH1 1VBE3 2HWD2 3VBHA 2R042 4N53A 4CEYC 3VBUC 1VBE2 2MEV1 2RS12 3NAPA 2R043 1R083 4AEDC 3LOBA 3VBSA 1VBD3 4Q4Y1 1A6CA 1HRV3 2HWF1 4YVWB 5ABJB 3JB4C 3CJIC 1QJY3 1POV1 1PO22 1RUI2 1HRI1 4CDWA 2PLV2 1ASJ3 1AR61 4CEYB 3ZFGA 1NCRC 2ZAHA 3IDEA 1AL21 1EV13 4CDXA 1R1A2 1D4M2 5AC91 1RMU2 1ZBA2 1MEC1 5K0UC 3DPRB 1AR92 1VAKA 3VDDB 4GH4C 5JZGB 4JGZA 4CDXC 5FMOS 1AYN3 1EAH1 1AR72 1RUC2 3ZFFA 2XPJA 1MEC2 1PIV3 5ABJC 3ZFGB 4YVWC 1SMVA 5GKAC 5BNNA 5BNNC 1DDLA 5A32A 2RS13 3JBG1 2PLV1 1OOPB 4QPGA 2R061 4GH4A 3J8F1 1RUE1 1VRH2 2RMU3 4WM8A 2RM23 1RUD1 1VRH3 2RS11 4N43A 1VBE1 2MEV2 1R1A3 1R082 2FZ1A 4QPGC 1AL0G 2BPA2 1ZBA3 5FMOL 1RUJ1 1H8TB 2HWD1 4IV3A 5ACA3 1NA1A 2X5IB 1BMV2 2BFUS 3TN93 1TME2 2RS32 4JGYC 1NCQA 4RR3B 1QJY2 1QQP3 1RUC3 4JGZC 1AYM2 2HWF3 1AYN2 1RUD3 4FTBA 1AR73 1QQP2 4Y5Z0 1GFF2 4CDQA 1HXS1 1FOD3 1C8M3 3TN91 2RR11 5C4WA 3VBOC 5DDJ3 3ZXAC 5J98B 5C9AC 3ZFGC 1COV3 4WM8B 3TN92 1AR91 4JGYB 4CDWC 3JB8A 1FMD3 1RMU1 4Z92B 1MQTC 1QQP1 1FOD2 1AR71 2WS91 1MEC3 4RS5B 4QPGB 4RQPB 1VBC3 3DPRC 1HQNA 4N43B 2RR12 1X33A 4AEDA 1HRI2 4Q4V3 2RS31 4Q4W3 4GB32 1V9U3 3VBSC 1RUJ2 4N53C 1BMV1 1AYN1 5CFDA 4CEYA 3VBOB 1FMD1 1RMU3 2HWC3 1OOPA 2RS52 4WM7A 3CJIB 4YVSB 1RUI1 4IV1C 2GSYA 1NCQC 1VBC1 4RQPA 5D8AA 2MEV3 1VBC2 4RS5A 1R081 4Q4Y2 2WZR1 1QJX3 2WLPA 3VBSB 4Q4X1 3NAPB 2VQ0A 1AR83 1B35C 1TMF2 1NG0A 1VRH1 4RFT0 5FOJB 3VDDC 4RQPC 2BUKA 2WS92 1RUH2 5C4WB 4GB31 2R073 1ASJ1 1EAH2 1VBB3 2GH8A 4CEWA 4PDWC 1RUG3 1R092 1AR82 1TMF3 4BCUA 2XBO3 3VBRC 4RHV3 2HWB3 4CDWB 1NCQB
chains in the Genus database with same CATH superfamily
1RUC1 5BNOB 3OG2A 3GF6A 5H9RA 5LA2A 4P9GA 1QOOA 2JDYA 4HVQA 1JTZX 4XFGA 4FPYA 1RUF3 5JIUA 3LOIA 3VD7A 5C8CA 4MGTA 5GZCA 1SBDA 3W21A 4XCAA 3NWKA 1CX1A 4KBZA 1N1SA 3T2QA 5E1RA 3M8LA 2PQQA 3C3VA 3CO2A 3H1MA 3MF6A 3PURA 2XBO1 3KT1A 4O61A 1LODA 3GBFA 4GJYA 4O9EA 3POBA 4OHZA 1BBT1 2I45A 2CHHA 5DZEA 3D3AA 5CG9A 4Y1ZA 2HWE3 3ZMNA 4OI4A 2F4LA 4CP0A 1OBNA 4HVRA 1RUF1 2YYOA 4Q4X2 2BOJA 4MUVA 4LK6A 1MVQA 3PVNA 4Q2FA 5FZ8A 1SPPA 3RI9A 1FATA 2EXIA 4JHTA 4ES9A 2JDMA 1PGW1 2BWAA 4XETA 2IFRA 2GMEA 4AVVA 4A44A 1DCSA 1LESA 4QQPA 3O1RA 3WT3A 1O4TA 2YBKA 1L7QA 2HWC1 4KGQA 3IWZA 2VGDA 2EVXA 2VQAA 2NMOA 1W28A 4P9WA 1FNYA 1IKPA 2OIIA 2SBAA 2FCVA 2PHXA 1FT9A 5FY5A 1H8VA 2FDGA 4YM2A 2DCKA 2E31A 3JU9A 4PJYA 4B1LA 4HK8A 4A45A 5C9AB 3LA2A 1RUJ3 3FE5A 3NQHA 4FCAA 4DEQA 3RZLA 3H7YA 3HEIA 4XC9A 1F15A 4XBQA 4XFCA 3VZMA 1UX6A 3EJKA 1Y43B 4PHZA 4RHV2 2ZJCA 1OOPC 4FP2A 2PHRA 4SBVA 4AG4A 3CQOA 4OVEA 1K5MB 4QHBA 2P3KA 4N90A 3LDKA 5CIRA 3MHZA 2QVSB 1A78A 2R0HA 3R4DB 1QJX1 4LO5B 1OC1A 2DVAA 4JGZB 2B45X 2VM9A 5B4NA 3NSTA 3VDDA 3ZYBA 5F5CA 4F83A 1W2UA 2ZHMA 5LBEA 4XDPA 3AMPA 5D1IA 4Q8KA 2W39A 3VD4A 1SACA 1QJU3 1JZ4A 1DLCA 5DDJ2 1PO23 3M3OA 4D3WA 2RDRA 4QQHA 5LA0A 1JODA 4DXZA 1AXZA 4YWAA 4AI1A 1S0FA 1SLBA 2RMU1 3CL1A 3O0WA 3RZGA 3ZPOA 4E8DA 3UGHA 1KD7A 5JR7B 4LBQD 2ZEWA 1Q43A 1OQ1A 3LB9A 4LMFA 1RITA 5A33A 3FBYA 4JV4A 1I5ZA 4AK3A 2CAVA 5A70A 4WM8C 1UXZA 1W05A 5A7NA 5JOZA 4QHZA 1HN0A 4CP2A 3I2GA 3HOBA 3IDBB 1OXCA 1H8TA 4XQWA 1LR5A 1TVGA 4NAMA 4V2VA 3U10A 2JDAA 3CHXA 4NR1A 5FPVA 3O1UA 3KF3A 4CDQC 2JDKA 2XVLA 4GKYA 3E6DA 5GLWA 4OQ9A 3SCHA 1J3QA 5FPBA 1UL9A 4LORA 3GDBA 2UY9A 3OGRA 1G9BA 1RJ8A 3NV1A 3ZKYA 5CYYA 1C8M1 1FNZA 1CAVA 2ZTNA 3E6CC 3MPBA 1OH3A 1OMIA 1EP0A 2VZPA 2CWSA 4NHMA 1RUD2 3LIHA 1YQ5A 1IGOA 3ZFEB 1PVXA 3LSEA 4MV2A 2PHDA 3WDXA 4X8PA 3AJZA 1VALA 2W9XA 1QDOA 3OUIA 4QPIB 4F8AA 1GNYA 2DDUA 1QJFA 4OI1A 4NAOA 1XOYA 2MNGA 3KV9A 3B01A 5K0UB 4QU2A 3WDVA 5FZIA 1VMJA 1YUDA 1SCSA 4RYDA 2V5DA 1MQTB 1PGW2 3NAPC 2YHJA 5KC5A 5JR2A 4FTSA 1ULOA 1URXA 4LHKA 4TXWA 3SKJE 2IXLA 4LT5A 3WDYA 4LBQB 2IZWA 2Y64A 3S7EA 1GP5A 2YMZA 3OCPA 4R4XA 5C8CC 3AKRA 4XBNA 1VBB1 1JOBA 1JZ5A 1CAXA 3CIHA 3PVOA 4MHUA 1RUNA 2X10A 5A7QA 2WNUA 4HKLA 5BNPA 1W8UA 3HT1A 4XFAA 2O14A 1EPWA 4H2AA 3D4KA 1ND2A 4FT8A 4TN7A 5KWRA 1LOCA 3FC0A 3SKVA 5A3MA 5F2SA 2H6BA 3CBNA 1D7PM 2EXJA 2HBTA 2GMMA 3U11A 2VXJA 3EHKA 5LK5A 1K5JA 1ACCA 3NJVA 4KWJA 3OY8A 1UKRA 2BTVC 4AEMA 4M4RA 1X9TA 1Y9QA 2WFF3 4IE6A 4I0WB 5FKCA 5GLVA 2VMHA 4CEWC 2RM22 4Q0QA 2ORXA 2DUOA 1RYYA 3IZOA 2ZHLA 5AFBA 1RB8G 5DAPA 4BZ4A 5I0RA 1NCRB 1CWPA 3ZXJA 4ET7A 1QJX2 1SBFA 4BDVB 1G9CA 4G3YC 2DF7A 3WCSA 4B29A 4B8EA 5FZ7A 4OYUA 5FYSA 5EP9A 1NCRA 2WT0A 1GOFA 1IKQA 4K7JA 4CP9B 1J58A 2E33A 1LGBA 3AVRA 5L7OA 1TME3 4ARYA 3DYPA 1W3XA 3DKWA 4IESA 1Z7S2 2G9FA 4W6YA 3PUSA 1C4RA 2A3XA 3NNFA 4MGQA 4MYEA 4DEVA 5FZAA 2CNAA 4LUMA 2R041 3N9PA 4UAPA 1QKQA 4ATFA 5ANQA 2JICA 4FP3A 4IEVA 2YY1A 3M3IA 4ZONA 4CCLA 3QD6A 5I91A 2QQPA 4Y20A 2W47A 5E6HA 4XACA 1VBA3 1RUOA 2XONA 3RJ2X 3GCWA 4UFJA 1VMFA 3BIWE 1V6MA 2RS51 2XR4A 4Q4W1 5AC93 3VBHC 4AHZA 5LY2A 1FMD2 4DXSA 4YNIA 2WL1A 4NIDA 1XYPA 4JZRA 2UWBA 4CCNA 5H9PA 5LCWL 3KMHA 2A71A 1K3IA 1HW5A 2CGPA 1LGCA 1NE4A 1W8FA 3T3YA 5BPXA 1IG0A 1UX7A 1WMEA 1SDDB 2HWB2 3HN3A 3N9LA 5FBJA 3WNKA 4AF9A 2QJVA 1UPSA 1ND2B 3PUIA 3EYPA 5LEKA 4WM7B 1UYYA 5E16A 5FY8A 1RUG2 3N7JA 3GZEA 3NMBA 1BEV2 3MPPG 3WP4A 1ULFA 3JD73 3WQBA 3K46A 1SHWB 1IPJA 4LIUA 5BNOC 4AQSA 1Q56A 4UFIA 3OTFA 3S5AA 4XUQA 2VBPA 3LAGA 2VMEA 5C5TA 1AR81 4CCKA 2EXHA 3POFA 5FV3A 3ZYGA 2ET7A 4H14A 5JZGA 1DU3D 3O7OA 4HBNA 2VULA 1NKGA 3VHOA 4B4PA 1S0EA 5C5UA 2LM3A 4XUOA 3VBUB 1C3HA 3V0BB 2XJQA 1CZTA 3J4UH 5JCTA 3SH3A 4HN0A 5JOWA 1ND2C 2QZ3A 1W9TA 4AHWA 4YFZA 5J1XA 4CDXB 1CN1A 3VBFC 5BY5A 2EXKA 1LAJA 2B7YA 2J1SA 3S7IA 4YGEA 2RJ2A 1OA2A 3WHUA 2DTYA 2X8KA 4HN1A 1HRV2 4JQRA 2FBEA 4XAEA 2GZWA 1IOAA 2VNVA 2X5IC 4F7ZA 3VGIA 1RVF1 5DUUA 1O8SA 1BK0A 5IHRA 2ZS6B 1AX1A 2VW0A 3WW3A 2FCUA 1VBE3 1MS3A 5LA9A 2R042 5F1RA 5F3IA 1OLME 3VBUC 3N7KA 2NP0A 2IFWA 1BXHA 4HLTA 3UKNA 4HMZA 4FAGA 2JKXA 2R043 2ZHKA 5M0TA 2FMDA 2ZGQA 3LOBA 5FPLA 4Q4Y1 1W6OB 4FI9A 1MVEA 1SFPA 3QBQA 4BQXA 4QX1A 2RDQA 4EYUA 4L92A 1HRV3 2ZEXA 2UU8A 4JKLA 3JB4C 1LOEA 1QIQA 2XWBB 3BU7A 4QX3A 5FIXA 3WX5A 1ZRIA 1UNBA 3NNMA 4QB2A 1RUI2 1A3KA 2ETEA 2ORZA 2YB7A 4XAAA 1IPSA 1UOBA 1VRBA 1S0DA 2DVGA 1NCRC 3UGFA 5DZFA 3AYCA 3E1F1 5T5LA 1QHDA 5F32A 3GJAA 5ANNA 1QMJA 2VMDA 1LENA 1PNGA 1D4M2 1W6QA 4I3PA 2LUWA 3M3QA 1QXRA 1X8EA 4XDOA 4AE2A 2P3JA 3FZ3A 1NLRA 2VTFA 2Q1ZB 2XMLA 3O0VA 3OGSA 4JGZA 4CDXC 1XRUA 1NXD1 4QGLA 5CNAA 5FMBA 4BISA 1AYN3 1UOFA 1UWWA 2YFZA 4TYSA 5FYUA 2IXJA 4LBOA 3KB5A 2GC2A 3THTA 5T50A 1J3PA 1MEC2 3MV11 5FY1A 1PIV3 1WUVA 1LRHA 4M00A 2XUEA 4LITA 4QB6A 3POGA 5FJHA 3MUY1 5FUPA 3V56A 2P34A 4LLOA 3U37A 4YGDA 5GKAC 5BNNC 1DDLA 3LA3A 3WG4A 1O4YA 1WMDA 2W95A 4A6OA 1GOHA 4OLLA 3WXPA 2VY0A 4CU7A 5JDBA 4CSWA 2AZ5A 1OOPB 2WR9A 4AVSA 3T0AA 4ARXA 2YC0A 2R061 1YJLA 3P6BA 5CVRA 3D82A 4QM8A 3G6JB 3LEMA 2R32A 2VNOA 3MLKA 4LO8A 1R64A 1AJOA 4UFMA 3ZXGA 4XYXA 2ARBA 4D6QA 5FO7B 1G7YA 2VMCA 3ABZA 3DYOA 2W1QA 3KQRA 4XIKA 1RUD1 4DQAA 3AMQA 1UZWA 3AB0A 4B4QA 2MEV2 2NN8A 5FZOB 3ZYFA 2WFPA 1KQRA 1R082 1AX2A 1EUUA 2PAEA 3DKQA 5F8PA 1ZBA3 5E89A 4C1XA 5L9BA 5ACA3 4Q29A 4XCBA 2BFUS 4IE5A 1FI2A 1TME2 1ULDA 3RMXA 2RS32 3MV01 3ETPA 4IEUA 5IYYA 1W6NB 2ATFA 4R9BA 5FMCA 4D94A 4RR3B 1G8WA 3WNXA 3THCA 3KZ4C 4CA9A 2WZ8A 4CE8A 5EIYB 4QXCA 1ULCA 3PVBB 2D7FA 3PJQA 4MXWB 1BLZA 1YRZA 5HV0A 4LUKA 4E4HA 4WBBA 2A6ZA 4FTBA 1AR73 1QQP2 1KDMA 3F2ZA 3GZTB 4GZ9A 4AHXA 4GWMA 2AC1A 3WSOA 4DZGA 4U2AA 5FY4A 4AI9A 3DECA 5LB6A 4M0HA 5J36A 5FK7A 1DGLA 3I59A 5LRSA 3ZXAC 3VDCA 3FHQA 2WN2A 3POSA 4QX7A 5FUIA 5C7GA 1COV3 3L9JT 3U1XA 1H9WA 4WM8B 4QDQA 1W90A 2OVUA 2H6CA 1NE6A 3WG1A 3JB8A 1FMD3 4S2DA 3AZZA 3T2OA 4CVUA 3IM0A 2ZACA 4A6SA 2OPWA 1S4CA 4PI0A 3C8XA 4NRQA 3N35A 1Y3TA 4ZS2A 4J6GA 1YQ8A 3OGJA 4RQPB 4EN7B 5JPMB 3BUCA 3VD9A 3MW2A 2XQRA 3DPRC 1HQNA 3AJYA 4N43B 4K6BA 4AW7A 4YGCA 2Z4FA 3WW1A 1XNCA 4L99A 4Q4V3 2WZPP 3WP6A 4GB32 2ZX0A 1W9WA 3RSJA 3VBSC 3BU0A 3NNGA 4YG3A 3R6SA 1BMV1 4MGZE 2B5HA 3GZUC 3HIFA 3H7JA 4CEYA 2EIBA 1RMU3 2HWC3 2ZMKA 3NNJA 5EYXA 3VBOB 5FO9B 4XJ9A 4BM8A 5FZ3A 2A3WA 4WM7A 3CJIB 3ACGA 1NYWA 4CXXA 4ZU4A 3BKZA 3WLUA 1N3PA 1SG3A 3SLIA 5FZ4A 4CZSA 2JECA 3KS7A 4QAWA 1LOAA 1O6UA 3DCQA 5D8AA 3S30A 4FFFA 4Q4Y2 2W91A 2UURA 3VBSB 2WA4A 4NRMA 1WBLA 2IC1A 1GWKA 4Q4X1 5A3OA 2VZ3A 2D6NA 1IPKA 1GR3A 3KHCA 3BTYA 1H1IA 2WQZC 3I3QA 1B35C 1NG0A 4KU7A 5DQ0A 3A4UA 3VDDC 4B7EA 1NLSA 4ISRA 2Y34A 2WS92 4HL0A 2JG8C 5I8YA 4TLGA 1UZZA 1VPHA 4FXKB 5A3TA 3CJXA 4R8HA 5IFTA 2P2KA 4MZUA 5EQUA 2BNOA 1QU0A 4MHRA 2DVFA 4PDWC 5FO8B 2PELA 1V6OA 3B9CA 1TMF3 2VNRA 2W0XA 2XBO3 3VBRC 4BCUA 4CU6A 2NZ9A 1ENSA 1UYXA 2XJSA 5IK4A 3LCPA 3ZR6A 2Y6KA 3VZKA 4UW5A 1KJRA 2VVDA 5F3GA 2BRTA 3UYJA 4NMIA 1ZBE2 4Y4YA 3T2PA 3GNEA 5B4XA 4IEQA 1GUIA 5FYHA 3WQ0A 3MIEA 4CCMA 1C8NA 1ENXA 2BWCA 4Q26A 1G9AA 1H2LA 1HXS3 2C9AA 3KV6A 1B09A 1W8OA 2BNNA 3B00A 2ZEZA 4Q0SA 4AR2A 4PDWB 4N9IA 4QQ2A 5GALA 5JSPA 5A6XA 2VH9A 2JB4A 3IDAA 2DBNA 3AMNA 5DAXA 1RHI2 4Z07A 3NW4A 1H8TC 5A7SA 5C4WC 2QQIA 1AR62 2LTNA 4Q4V1 2WO1A 2JG8A 3OGVA 3ZSEA 3GCXA 4UW4A 2W1WA 3ZYIB 2ZZJA 2VECA 1AR63 4FPCA 1W6QB 4GMP0 5T5PA 1CIYA 3J8F2 1JZ8A 1YFWA 3VBFB 3IIAA 2J1UA 1B35B 1H30A 4LBQA 2QZ2A 5EPAA 2E63A 4MO3M 5D8AB 2Q4SA 2HEVF 2WWSA 2AENA 2DWRA 1LKNA 2WQ4A 5DN2A 5EYYA 3ZYJB 4A7YA 3CF6E 1XE0A 3AFKA 3J26N 1ZRCA 3ORJA 2V73A 5FP9A 2Y38A 5T5JA 1ZZ9A 2BFUL 1RUI3 3VKFC 1ALYA 2QFEA 4Q4X3 3ZDVA 1AF9A 3D8CA 3KCYA 4LEJA 4RL7A 3SHRA 2PHTA 1NZIA 2VZVA 1W0OA 1J83A 2ZMNA 2OX0A 3AP5A 5JXGA 1WCDJ 2YBSA 1HQWA 2R063 3WQ7A 3LFIA 4KQ7A 4UWDA 2WO7A 3ETQA 4O7XA 3DPRA 3U14A 1HV0A 4OMCA 2YROA 3T09A 1C28A 4JTNA 1BEV1 2V4VA 2VUCA 1RUG1 3O1SA 5IK5A 4P14A 5SV8A 3WQ1A 1LTEA 5GLUA 5T5OA 4A3ZA 2OZ6A 2BOIA 3B69A 3FL7A 3HPNA 2BDRA 1BKZA 1IQDC 2GNBA 5LBFA 3KQ4B 5FQ0B 1WW5A 2WT1A 2RM21 4JHZA 4UW3A 1OF4A 2BGOA 4LBNA 4RR3A 3HAGA 5CFCA 1I3HA 2VZQA 1PVC2 3CNAA 1H4HA 4DNYA 4CDQB 1T6BX 1Z0HA 2A5ZA 1ZZBA 3I4IA 2BYVE 4XF0A 1ZRRA 1C1FA 3SC7X 3VHRA 5CFCB 2VUAA 3H42B 4N9HA 5JLVA 3WDUA 1Q8OA 4MVTA 3VHPA 2D5FA 4NPRA 2ZZQA 4YW4A 3PIGA 4DUVA 2W92A 4RR3C 4RSUA 2P37A 3DL3A 3NJXA 1PZ8A 2ZGSA 5DUWA 5F2WA 3ZXKA 2W2IA 1S0IA 1ZX5A 2PA7A 3FFZA 4PBPA 3M70A 4EN6B 2GN3A 5A32B 4CTEA 5E8AA 1FPN1 3B9IA 3JD72 1BBT3 4IV3B 3RJRA 4BU2A 2G19A 1JZ7A 2HWE1 3WF4A 1XNAA 4EJRA 4CP1A 3H8OA 5LASA 3AM2A 1GZTA 2UYBA 1O5UA 2P1BA 4XJWA 1EY2A 2UYAA 2Y33A 3O14A 2IXHA 5H9QA 3TEWA 2Y6JA 2QE3A 5H9SA 1RJ7A 1SFNA 4KBBA 4W6WA 1K5MA 1US3A 1OUSA 2FDJA 3VBUA 4B3NA 4CU8A 5DUVA 2J1VA 5JMCA 1FPN3 3MW3A 1ND3B 1SLLA 3U4XA 2Z79A 1VMHA 3ZN6A 5F5IA 3K48A 1BHGA 4GQ7A 3JD71 4CUAA 1E57A 1W8HA 3JBG3 3ZDSA 3PUQA 4Q27A 5A3PA 4HKWA 4NWWA 1YQCA 1MS1A 3OOXA 4GA9A 4CXYA 1KITA 2ZHNA 4YW5A 1NOVA 2WA3A 4HPKB 2Q0AA 5L7OB 1SLTA 3OD0A 3Q8AA 2CGNA 4YVWA 5CAZA 3MZHA 1ULPA 5C3OA 2WKKA 5KC6A 1ZBA1 2XJTA 3CMGA 2R1BA 2AEYA 4D6SA 2HWD3 4A41A 5AC92 5L9VA 3MF9A 1O5LA 1W8TA 2DFBA 1HLCA 3ZVXA 4RN5A 1GMMA 1GZCA 4LJHA 1QXJA 4JVAA 4M0NA 2JE7A 3NL1A 5DXDA 1X82A 1RVF3 5IVJA 2AH2A 4LHSA 3VV1A 3N9QA 4FPGA 1AJKA 2Z42A 4Y4RA 3CEWA 1YI9A 3R0RA 3W5NA 4TLFA 2GDFA 2TEPA 1O3TA 1CQ9A 1JYCA 1XPWA 1RL3A 2D40A 5IVYA 5APAA 4LHLA 5CG8A 1OT5A 3MYXA 3VUOA 4PQQA 2PHLA 2ZX3A 1RINA 1BZWA 1EV12 2J22A 1ONAA 3WZ1A 2WIIB 5T3NA 2BBVA 1U12A 4IGOA 3GHNA 1UOJA 4P00B 1QJZA 1TMF1 2DTWA 3FWEA 3F95A 4LKSA 2DU0A 3E5XA 3H3ZA 4PF5A 1KFXL 3J8F3 2KM2A 1UY1A 5LZ6A 3CKHA 2VBDA 3D6EA 3OEBA 2EIEA 4ISQA 4Y1UA 2JG9C 4AI8A 1V9U2 1LEMA 1COV1 1MZ6A 2MPFA 3TEZA 3AX4A 5IVBA 1VP6A 3ZMOA 1YFXA 4MOAA 4BXSV 1YQ2A 3OEAA 3AK0A 5T54A 2E26A 3MDPA 3ES1A 5EWSA 1DYPA 3LWCA 3Q8EA 1SZBA 4LOSA 2FD8A 1HRV1 4FO9A 3CU7A 2XLFA 4KG0A 4FOQA 1LCLA 3RS6A 1FPN2 2FZ2A 1PNFA 2VOWA 3N4MA 4R52A 2HWC2 4L8QA 3S0MA 4LOTA 1GYKA 1OSGA 4I2OA 1DYKA 1KFUL 5A3UA 1W06A 1W39A 2YFUA 5FXVA 4AHYA 5JSOA 2BU9A 4FPFA 4KI5M 4PT6A 3WDTA 4IV3C 2LRPA 4Q4V2 2RMU2 4NPMA 1F8VA 2UWCA 2WO3A 1RHI1 4FFGA 1G9DA 5DDJ1 1BK1A 2JD9A 2WNVA 1X50A 2EF6A 3E5QA 3B93A 5CA6A 1PIV1 3H1WA 3IPVA 4P9IA 4J25A 4YGBA 3VZNA 5GJ6A 1DGWX 2E9QA 2WS93 1POQA 1J3RA 2D6LX 1X9PA 1N47A 1S1AA 2RJKA 3KV4A 2MHFA 4PQ9A 4QD2A 3BOPA 1MPXA 1W6OA 1SDWA 4LXLA 3J7NA 1RUE3 1MZ5A 1GP4A 1XJAA 2VZUA 4I09A 4IDZA 2R6QA 5FYBA 3N3HA 3WV6A 1AYM1 2Z2SB 1R091 4HT1T 1UQXA 4AGRA 5ISLA 4RS5C 4H3WA 1UW8A 4UBHA 3T4VA 2JE8A 4I01A 4CEWB 4N43C 4Y24A 3VDBA 4LLFA 3PJYA 2JG8B 1C5IA 1H0BA 2CL2A 1FAYA 5KXDA 4IEPA 1RGSA 4FOWA 3VBHA 1IS4A 1AXYA 2C26A 3LSDA 4L97A 3NKGA 3PTYA 3W59A 4AXOA 1YFYA 4GULA 1APNA 4YZ1A 2RS12 4NHYA 1DG6A 1R083 1PK6C 2A7AA 1CPNA 2PHUA 2Z5WA 3C7FA 3KD4A 3M3EA 3IKWA 5CZKA 1BVP1 4AEDC 3KVBA 4JCKA 1PHMA 2CY6A 3ZLIA 4BPZA 2GALA 2ADDA 5GZEA 4RGGA 4BK4A 4NUBA 3WP5A 3USUA 3LEKA 3CJIC 1JZ3A 1RXFA 1WGPA 5C33A 1PO22 2PLV2 3THDA 4OHYA 4R4ZA 1AR61 2CV6A 2YV8A 2AUYA 1I9RA 4JQTA 4CEYB 5CB7A 2VVFA 3BTXA 5IFPA 3K3OA 5AFEA 2F4PA 2BVBA 3IDEA 4XJZA 4BMEA 3I49A 2DFCA 1ZZ7A 2LS6A 4FPLA 4K8RB 4YFWA 5L9RA 5KHKA 5JXIA 4V1PA 1MACA 3WG3A 3DPRB 1AR92 1VAKA 1DQ1A 4QB1A 3ILRA 2AEZA 3OBAA 4MXVA 4DIQA 2Q5TA 4ZU7A 3VDDB 1J59A 3I2OA 4M4PA 1WMXA 5JZGB 3VZLA 1YEWA 2KXLA 1H1MA 2BNMA 4HKOA 1N1YA 4K1ZA 3WOGA 1EAH1 4P9XA 1AR72 3ZOIA 1SCRA 1WCQA 3SCFA 1YFUA 3I7DA 2YGLA 5ABJC 3AMHA 3ZFGB 5IK7A 5IAVA 4TZDA 5BNNA 1XU2A 4XHXA 2E32A 2PFWA 4QGMA 4CYDA 4KMQA 2A70A 1GQHA 1WLTA 5HCFA 4TTGA 4FXGB 3JBG1 2BZDA 2DUPA 2IVJA 4DY3A 2F6BA 2PLV1 3POIA 5K7PA 1S2KA 1ZZ6A 4LA3A 1HB1A 5FOBB 1V6KA 4YW2A 2A73B 1H2KA 4XF1A 3MIFA 1W2AX 3N36A 4GH4A 5IW0A 1W0PA 4Z2AA 3VD5A 3J8F1 1RUE1 1DQ2A 2I2SA 4AVAA 1W8WA 5A1LA 1MZEA 1NXMA 1ULEA 2RMU3 2KR2A 2XJRA 3NJZA 5FAXA 5FK8A 5FY9A 5FYMA 5IUQA 5KXCA 2D44A 1OH4A 4CUGA 1PMIA 2ID4A 3GYDA 4AWDA 2B39A 3T0BA 2RS11 2XWJB 3DXUA 4N43A 1R1A3 3IMMA 2OQ6A 2FDHA 1AL0G 4OHVA 2XJPA 2WT2A 5FMOL 1R1ZA 3MO4A 1H8TB 4HSJA 1BMV2 4JX0A 5HPOA 2YXSA 4DRVA 5CADA 2Z69A 1UCXA 2A6WA 4TWTA 3ZYPA 4P5YA 3M3CA 3L2HA 3BTZA 1QJY2 3K51A 2EA7A 1UU5A 1WLDA 2ARXA 4HSLA 4LPLA 4ZPIA 1AYM2 4M3CA 4YZ2A 1V0AA 1UU6A 3EQEA 3POEA 4LKDA 4JDMA 1GFF2 4UF0B 4CDQA 4XQ4A 3SEPA 4B1MA 1HXS1 2W1UA 1FOD3 2LROA 1D0GA 1UPIA 1GOGA 4NROA 4QX5A 1GANA 3WF1A 3VBOC 1EYBA 2WAAA 3E97A 4HPKA 4YRDA 5J98B 4BA6A 3ZFGC 2VMGA 4Y3OA 5FYVA 4NIHA 4JGYB 3Q8FA 1ZZ8A 2OW4A 3TRSB 1GZWA 1ZM1A 1QQP1 3DXTA 3MGUA 1PX3A 3I3DA 2O8QA 4GALA 2VTXJ 1E5IA 4D8MA 4AFDA 2Q8DA 4N7UA 3K4ZA 3KLSA 3WUCA 4JC1A 3RI8A 1HB4A 4LO7A 2ZKLA 2OXBA 1JHJA 2GP5A 4G4FA 1X33A 1HRI2 3LEIA 4D6RA 2DU1A 1U5IA 1BCXA 2PTMA 2RS31 3H1YA 5T52A 1OLMA 1VAVA 1UD1A 1JOPA 4OZOA 3WINE 3HJRA 1REDA 2ZGMA 4K3UA 4PIYA 4N53C 4D7TA 4DXRA 1SLAA 3IAPA 5CFDA 5FZEA 4GWNA 1Z78A 1S55A 1OOPA 3LD8A 4V2WA 3IMNA 5JUVA 4XBLA 4YPJA 2CAUA 1RUI1 1D4VB 4YLZA 3WF0A 4CCOA 2CDPA 3BALA 4EROA 5HXMA 1C57A 1PK6B 1DF0A 2ILMA 3I2JA 2VCBA 1VBC1 4XFFA 2JG9B 3SNMA 5BV6A 1VBC2 4RS5A 1SLIA 5HV4A 3VKLA 1DGRN 4GAZA 5KHGA 3RWNA 4KH9A 1HB3A 5JXJA 4EN9B 1CGPA 2J1AA 1UY0A 4UXAA 1XYOA 5FOJB 3MFAA 5FR3A 1XSRA 2H0BA 3BPZA 2XGXA 4RQPC 4ASKA 3MIGA 4XDQA 1CAUA 3N9NA 2GC1A 4PI2A 5KHHA 4MX3A 1YO8A 3ON7A 4DXTA 1WW6A 4X6QB 5FPAA 4CEWA 1WKYA 4AL9A 3MLLA 3ZSJA 1XQNA 1W03A 1RUG3 3ZN5A 2P3YA 3K2OA 2UY8A 3TYJA 3WNOA 5F5QA 5FZBA 4RFRB 3I2DA 4FVVA 3H3LA 2AGSA 2XJVA 2HWB3 3OPZA 2CYFA 3H0OA 1NT0A 3GBGA 2GH2A 4EN0A 4EQVA 3IN9A 2QKDA 4QX0A 1YYNA 4WZCA 2RVAA 5C3SA 3R4SA 2BP6A 2XXZA 1RXGA 3A7QA 2Q1FA 2TBVA 2W52A 4YVSC 1J84A 1GNZA 5BNPB 4COVA 4C0BA 5KHIA 1ASJ2 3OYWB 2VJXA 2BERA 3PHMA 2G9GA 5JOYA 5FXZA 1D4M1 5IVCA 4WM7C 2RV9A 1XYNA 2WN3A 1G9FA 4FOYA 4N53B 3MEPA 1YXWA 4CUBA 4Z1VA 5CBLA 4LBMA 4YZ5A 1W3VA 3HBKA 1MS5A 4Q5OA 1CZVA 3WW4A 4CDUB 3VBOA 4BQ4A 5C70A 5CFDB 1D0HA 4S2FA 3BYWA 1W6PA 1S2BA 4HONA 2JXAA 1B35A 5DG1A 2ZPXA 4ASLA 4RGAA 3UESA 3HD8B 1KJLA 3MI8A 1OKOA 1QNYA 2C0ZA 1CD3G 3PVEA 3WDWA 3M7AA 5LRRA 3ZYRA 3MUZ1 2R30A 5BYNA 2R062 5GZDA 5J3UA 1FYUA 4HZFA 4LBJA 3IT8A 2DVDA 1ND3A 3VZOA 3ZR5A 2WNUC 3GXUA 4E4ZA 5HI0A 1PGL2 2XVKA 5FZ1A 1LHOA 2ZX1A 3U07A 3TEYA 4IEZA 1CPMA 2WINB 2ZGOA 1BEV3 4I3GA 4AVTA 2B8MA 1RVF2 2VXRA 4XIOA 1US2A 2RG4A 3VL8A 4IETA 3BOWA 4WVWA 3KSCA 1OQDA 3I2FA 4HVOA 4E4DX 4DO0A 1VJ2A 2VD7A 1AUYA 2XLGA 1CJPA 4E2GA 1WMFA 1NZCA 2WFF2 1QY4A 1W9SA 2QQWA 2VO5A 3P3NA 5FZDA 2VAUA 2WSVA 4R9DA 1PVC1 2W94A 3U4SA 3O1MA 1FV3A 3LPFA 3JUUA 3H3UA 4QHOA 4KL1A 2JIJA 5FLIA 1C5HA 1YIFA 1VBA2 3AKPA 1PIV2 5HBAA 2IXCA 2VCCA 4WZFA 3EO6A 4QQOA 4XFBA 2VOKA 4AI3A 3ZFFC 2ZGKA 4P9LA 2LW8A 5IVEA 1CVNA 4QKNA 4QX2A 4COUA 3RMYA 2JDNA 2QNKA 5FTTC 5JVVA 4QM9A 3WF2A 1QJU1 3J7LA 3R05A 1D4M3 2QDNA 1PO21 3USSA 4NHLA 1OHFA 2WDBA 4QKFA 1TEIA 1Q8QA 2IWGB 1S0GA 2WNUB 3OPTA 5J7MA 4JDNA 4LE3A 4D7SA 4LULA 1OA4A 3O1VA 3RFRA 3OY8B 1PO11 1WW4A 4LBLA 3A0NA 2AYHA 3AYAA 1TQ5A 3V0BA 2RR13 1A8MA 1UXXX 2DYCA 3E5UA 4EWEA 2R0FA 5FY0A 1JMUB 5A3NA 2WNOA 4BIOA 2R16A 4I0AA 2WNVB 3LE0A 4XPVA 3ASIA 3I54A 1AR93 3TAYA 3IPVB 4LIVA 4E9KA 5F9TA 1COV2 1JBCA 2FCTA 4CCCA 4UW6A 2ZAAA 2GN7A 4PLMA 4I0BA 4LK7A 3RWKX 3RZZA 3VL9A 4CDUC 1D2QA 1GBGA 1POV3 2WO2A 2YDEA 4FQZA 2XDVA 3O1PA 4FPOB 2PLV3 1VB4A 5GLTA 1GQPA 1VR3A 4QPIA 5IAXA 1DGWA 2OQ7A 3LDRA 3P5BA 2B4KA 5FYYA 2ENRA 2JIGA 2NPIA 2YC2A 1YNAA 3B02A 3ZFEA 3W58A 4M3CE 1AVBA 2CU5A 2DUQA 2Y26A 3A22A 1NLQA 2JDHA 3ZFFB 4R9AA 2ZA9A 2D6PA 2Q8EA 2HWB1 4LTAA 3Q8CA 1W9YA 3OJBA 3LQCA 2CDOA 1GV9A 1POV0 2R7EB 5FZ6A 3RZMA 5ACA1 4XTMA 1R1A1 1ZBE1 3I2HA 3WUDA 4AYUA 1AL22 1LHVA 5FRAA 2WZR3 2VU9A 3QACA 4BXFA 4IE0A 5DUXA 2OS2A 1BYHA 5K0UA 3TNQA 3UT0A 3ACLA 4M01A 3TWIA 3VB9A 4OI0A 4I30A 3GZAA 1PVC3 3SMHA 4Q4W2 5CKNA 5KR7A 1WD3A 5CKQA 1KS5A 4XUPA 3ZKUA 3VBHB 5F7UA 5FLHA 3AMMA 3VKOA 2ZOEB 5IVFA 1CAUB 1R093 4COWA 5JMOA 5FP8A 4YW6A 1UU4A 3FBMA 2D6KA 1QF3A 3WW2A 2WYSA 3WNLA 3AZYA 3HNYM 1STMA 2D6MA 2RS53 3DF0A 4GMP1 3RGBA 5FMDA 2XLAA 3RYPA 1RUH3 3KWVA 4Y33A 3O1OA 1LECA 1KS4A 1JZ2A 2X09A 1PGL1 4AI0A 1EUTA 5KXBA 4META 1VBD1 4BE3A 3AKQA 2PHFA 3FLPA 4RGKA 1HB2A 2ZGPA 4ZU5A 4AFMA 4FPKA 1C8M2 4CCJA 4XEZA 5I93A 5EJZB 1DZRA 3NV3A 1DQ4A 3ZXFA 2OKXA 1HRI3 3PU8A 1VBD2 5G04L 3AL6A 1RHI3 4HG6B 3KT7A 5I0DA 1LOFC 4F3JA 4Z2WA 2HWE2 2TNFA 4BK5A 2RS33 3ACFA 4ITCA 1PO13 3GBWA 2GC3A 4QGNA 4HXCA 2XKOA 1AL23 1EV11 3IB3A 4R9CA 4Y5TA 1CZSA 5FP3A 3S6PA 4PF1A 3BVCA 3OSDA 3C7GA 3J9SA 1Z7S3 4X6RB 1LOBA 2GU9A 5BXXA 4AFAA 2Q30A 1W6PB 4KWKA 4IE4A 4Q0VA 1QEXA 3HWJA 4Y1YA 1RUF2 4URTA 3LPGA 4C8DA 5A80A 3HR9A 4ASMB 1QNWA 1Y9MA 2V09A 4Q1RA 2Y6HA 1IG3A 4BLJA 3DV8A 4GJZA 4LA2A 1NQJA 1HX6A 2BJSA 2XBO2 3K75B 4ZXKA 2JX9A 1LGNA 2W3JA 4FFIA 1EAH3 3WNMA 1AYM3 1W6MB 2WZEA 4IEWA 2XH6A 2W87A 1LEDA 4QKDA 4Y1XA 1L7LA 3JZVA 4J1WA 4YW1A 2BGPA 3DEMA 4AEDB 2NYYA 2R072 4OUMA 3VKNA 4EE2A 5C3PA 5AVAA 1OF3A 4XUNA 2VZTA 2Y0OA 1M4WA 1HXS2 3AKSA 4G9SB 3H9AA 4M3CB 4NIIA 3UV9A 5FJKA 2QTWB 2QDRA 3C7HA 4JKMA 2XKPA 2C1FA 1NY71 1F5JA 2PAKA 2J1TA 1DZTA 3AL5A 4Q4Y3 1MS4A 3INAA 2DCJA 2E7TA 5FCCA 5CEHA 1PMHX 2DCYA 4Q0UA 2JB8A 2WWJA 3RVHA 3W5MA 4JTOA 2D3SA 2BQPA 5D21A 3ECQA 1Q3EA 4IL7A 4C0HA 2Q1MA 2VW2A 3PU3A 1OKQA 2X29A 3ZSKA 1RUH1 3VHNA 2I74A 4BB3A 2GNDA 4M3CF 5EJ1B 4N53A 1W2NA 2I07B 2E53A 4NIAA 4LR4A 2YPDA 3O1TA 1FV2A 2MEV1 3IDCB 2JDZA 2D5HA 4BIFA 1QH6A 4KNCA 3VBSA 1NX9A 1VBD3 5LEJA 1CAWB 1XE8A 2WYFA 1W8ZA 1XNKA 4S2GA 5FXXA 3C7OA 3KM5A 5J48A 1A6CA 1QXPA 2BV4A 1G86A 4ZZ5A 3DN7A 2Y0IA 2WC2A 5ABJB 1FX5A 1V00A 1KDKA 5B2GB 1V6IA 4EWAA 4CDWA 4KGGA 2VOXA 2ZMLA 5KXEA 2GC0A 3AXEA 1ASJ3 2VQTA 4IUGA 5I8TA 3UKVA 2PXJA 1WW7A 4KG8A 2P5BA 2VZSA 1LU1A 2H0VA 1U5XA 3HVDA 3S5QA 3SQOA 4CDXA 1SLCA 4E2SA 3AC0A 2CWMA 4HFSA 1RMU2 1YQ6A 3I3EA 1MEC1 1XB9A 4U36A 2ET1A 1RTVA 3TEXA 3HQUA 4FQ4A 4YG0A 5SV5A 3PL0A 2C5DA 2EICA 2L9LA 2QQKA 4MGSA 2CTVA 1LU2A 3HQRA 1Q5OA 3O12A 3V0AB 2W08A 5JI9A 4Y22A 3NJYA 3ZFFA 4IERA 2QQMA 5EHDA 2QCSB 2V4AA 2VNGA 1X7NA 4DINB 1AZDA 3LEGA 1LB2A 1SMVA 2PAMA 2OZJA 4UFHA 3PTRB 5EJ3A 1CIWA 2C4XA 2YZ4A 5J09A 3AYDA 3PUAA 4K8FA 4RA0A 3QH6A 3K3NA 3T30A 2RS13 4QT6A 3V64A 4IEXA 5EV7A 1AHSA 4K40A 4QPGA 5LW9A 4Z8BA 4N7IA 1DQ6A 3ZN4A 2ZEYA 4QDRA 4W65A 3JXSA 5A3LA 5FZ9A 3RNSA 1UF2C 4MXWA 1U0AA 4FPHA 4DMIA 2JD4A 5FPUA 3I3MA 1F5FA 3QOPA 1OPMA 1DHKB 4GWJA 4AFCA 4WM8A 2RM23 3FX3A 4IQPA 1VRH3 3PMEA 2W68A 1SBEA 2W46A 1HJGA 3O0XA 4NRPA 4QPGC 1CR7A 1C1LA 4NJ4A 5FYIA 5IWFA 5A7OA 2VE1A 4IV3A 3WEZA 2DVBA 3LFMA 2K0GA 3ZXEA 2ZGLA 1JW6A 2OA2A 1VAMA 2K9ZA 1K45A 2WNEA 1SEFA 3AXDA 2OUHA 1QH7A 2UWAA 4XZPA 1PM4A 4AGVA 1JS9A 1J1TA 1QOSA 1T2XA 1QQP3 2XOMA 3V65A 2XJUA 4A7ZA 4QXBA 4GKXA 1AYN2 3JQWA 3POWA 5F39A 4D69A 5IATA 2YU2A 4NIGA 4ZKTB 2C6SA 4Y5Z0 1LOFA 4FFHA 4A42A 2VPVA 1JYTA 2HBUA 2ZGRA 5I0SA 4YYOA 4NOTA 3SITA 3VDAA 2R1DA 4FBFA 4BH9A 3ACIA 5A1FA 4NVPA 2LALA 4EWDA 5C4WA 5LA1A 2DCZA 4ONUA 5DDJ3 2JKBA 4ATEA 2J1EA 5EZWA 4XFIA 3TN92 5C71A 1DIWA 3RZHA 1AR91 4UYBA 4CDWC 3FFQA 2QUOA 1RMU1 4Z92B 2EAKA 2XHNA 1WLCA 3HMYA 2D43A 1FOD2 1OVPA 2WS91 4ORFA 1W0NA 5F6KA 4UBGA 3S57A 4RS5B 3TOJA 4COZA 4IGPA 1HQLA 4D7YA 5FPZA 3ILNA 2XG3A 2D6OX 2W5FA 3MW4A 2K2SA 4HANA 3HN1A 4AEDA 4AAXA 3ZSLA 3LZZA 4EZ4A 4A7KA 2BVVA 1S0CA 1NUKA 2RHPA 2XB6C 3EB7A 1RUJ2 3N9OA 3VLBB 2BW8A 4S2HA 5A7WB 4FPJA 4QQLA 1X8MA 3WP3A 3H8RA 3IBMA 1ZRDA 5L73A 5LBCA 5C3RA 4A4AA 2FMYA 2O8OA 1FMD1 2B9UA 2Q8OA 3RZKA 4Y20B 2RS52 4E2QA 1GKBA 1UY3A 3PLQA 2IUWA 4YVSB 4ZXEA 5A7PA 3UETA 3WF3A 4D0QA 5JPNB 3NV2A 4JRAA 1NCQC 1JOJA 2VW1A 1TZOA 1P8JA 4RQPA 3FN9A 1AX0A 4W4ZA 4PBOA 1R081 1JI6A 1JYIA 1WCSA 4XE9A 5IVVA 4QPWA 2WZR1 4MLOA 3AP6A 4EZHA 1HN1A 4YZ4A 2DBIA 4LO4B 1ST8A 2P3IA 1ZVFA 5FLJA 3NVCA 3TB0A 3USUB 1GWMA 4LO6B 4UFLA 5F3CA 1ZREA 1OLRA 2ADEA 2O0OA 2VQ0A 3HT2A 1TMF2 1DGRA 2A75A 4RFT0 4E8CA 3FHIB 5FP7A 1WA4A 1A8DA 3D0JA 2BUKA 4TSVA 1L3JA 1O91A 1OLQA 4MH0E 3VD3A 4GB31 1MS8A 2ERFA 1ASJ1 3AFGA 4PIZA 1YCIA 2HJIA 1VBB3 5GZFA 2GH8A 2GNTA 5FWEA 4XTPA 4YM1A 4BQ1A 3RG0A 3ILFA 4PIXA 2QQVA 5FYTA 3KVAA 2ARAA 3U75A 1DYOA 4XF4A 2JJ6A 2FDKA 4LHNA 1GU3A 3FUQA 4Y5SA 3QH7A 3I2KA 3I97A 4RHV3 4CDWB 1NCQB 4FOVA 5BNQA 1YLLA 4RD7A 2WAOA 4Y1VA 5BNPC 2RDNA 2RDSA 4LKFA 2XHKA 5CKMA 2R071 5A6ZA 3A23A 5K8SA 2Y6FA 1UZVA 4AQ2A 1DFQA 5BNNB 2A3YA 3KF5A 1CONA 1LHUA 4YM0A 2EIDA 3ZO0B 1UZYA 5CU1A 2DV9A 4B4RA 3H8UA 4Y22B 3HNMA 5F5AA 2HLEA 1S0JA 2KD7A 2X05A 3OGGA 4IXLA 4MGIE 1TE1B 1W2OA 3HNBM 4QPYA 4GH4B 3ZIXA 4SLIA 4OZXA 4Q0PA 5T55A 2QQOA 3Q9OA 2D97A 4K21A 2WZR2 3UJOA 1TME1 1YJKA 1W2TA 4HK9A 3T08A 3ITQA 4OQ8A 3UJQA 1H2NA 4L11A 2J1RA 4BYYA 3EBRA 4IE7A 5FXWA 3V0AA 4H55A 2W1SA 1IHMA 1REFA 5FZFA 3VKMA 3WVJA 2WWUA 1V9U1 5L7OC 4AFBA 3B94A 4ZS3A 4FPEA 5JI7A 5KBFA 4XOGA 2Y8KA 1MQTA 4P02B 5DABA 4L2NA 4XILA 4QU1A 2K46A 3DUIA 3LIGA 2DCTA 5A1AA 5DZGA 4AEJA 1NY72 2ZGTA 1LJ7A 3OBTA 1D2SA 2G9ZA 2VOTA 4NHXA 4O9GA 5FZGA 4ZZ8A 2R49A 2JWPA 2P4EA 2WJSA 3FLTA 2NLRA 2VZ1A 4Y26A 5JWPA 3I59B 5CFCC 1UY4A 3JBG2 4NWVA 5C8CB 1HDKA 4LNVA 4YZ3A 2ZXQA 3D0SA 2ZABA 3IAQA 1H1AA 1JUIA 1QWRA 4NO4A 3VBRB 4DOUA 2E7AA 4YM3A 4AAPA 1Y4WA 3MFCA 4KWUA 2IXIA 4LQRA 2ZX4A 4COYA 4BQWA 1FOD1 1OFNA 1ZNPA 3J7HA 1W99A 4WVVA 1GICA 3URFA 3GALA 5LK7B 4LKEA 1W8NA 1VB2A 1Y7BA 4QX8A 1G6NA 2VUJA 3T2TA 2JENA 5ABJA 5ACA2 1GZWB 3D5OA 2WSUA 2PQSA 4QPIC 3ES4A 2O1QA 1F31A 1EPZA 2B46X 2HYXA 2P17A 2ZGNA 4BQ5A 4XFHA 3ZFEC 1L7RA 1XBFA 3WCRA 3PUHA 4OUSA 1RIRA 4J1XA 5AVPA 2HWF2 3OPWA 3PNAA 1WCKA 1Q8SA 5BNOA 2HEWF 3X29B 3BIEA 1BQPA 2VVEA 4AOCA 4DRRA 2WBKA 3B7MA 5GLZA 2A6YA 1OUXA 3IIIA 4BQYA 1QJY1 2G4IA 5J96B 1MS9A 2VC9A 5C3QA 5D2AA 1JYNA 4P5HA 1Q8VA 4GMP3 2YPJA 1K5MC 3FLRA 4XURA 1M06G 1F35A 4CUCA 1KGYA 5IJRA 4XUTA 3GJBA 2OUJA 3M1HA 1VIWB 1PM7A 3GGLA 4GXLA 4K9SA 2Y60A 4BJ0A 2HKXA 4CXWA 4OUEA 1N1TA 1LNSA 1WA6X 4L9BA 1PX4A 4P9YA 3OBZA 1X36A 3CJIA 5FP4A 4NN0A 1W04A 2HYKA 1U5YA 1XXNA 1NA1C 3ZN6B 1CESA 1W6MA 1RUE2 2RJLA 4UOJA 3AYEA 4NHKA 3TNPB 4AEKA 1NAEA 1LULA 5HXVA 3PMSA 3ROUA 1OPOA 5I0UA 4BLIA 1LHNA 3T4HB 5HCHA 5FREA 1T6GC 4OI2A 4FTEA 3AP7A 4XJAA 2D93A 4ZY9A 1YWKA 1Z7S1 4CPBD 2VCMA 3MIDA 3LDBA 2E6VA 3PIJA 2FDFA 1QJEA 1QOTA 3WY6A 1CJDA 1CAVB 1BBT2 3ATGA 1IS3A 4OMDA 2CGOA 2FHRA 4H7LA 3HBZA 4Q1PA 1GLHA 1DZQA 3ALQA 5JSRA 5GM0A 3NO8A 1ODNA 2IVIB 4WVZA 4BMBA 4DB5A 3UL2A 5D8AC 5FZ0A 1QDCA 1JU3A 4GIQA 5FFOC 1UO9A 3DGTA 4MSVA 4QXKA 2C9KA 5JZGC 1JYWA 4UF0A 4LBKA 2EIGA 1CAWA 1GQGA 3K4DA 3T0DA 4ZHNA 1MS0A 3N7LA 1O3QA 2V5YA 3BODA 2WABA 1UMZA 1KEXA 5CFDC 3JCIA 1ENRA 2J7MA 5TSWA 1XNTA 4C91A 3UKTA 5J37A 4FSJA 3UGGA 1WZXA 4PLOA 4XF9A 2VUDA 4A3XA 3M2MA 4QDSA 1NA1B 2X5IA 1OI6A 3WG2A 5FZMA 4PLNA 3ZYHA 3OBRA 5FY7A 3NV4A 4BQ3A 2E51A 3BN6A 2YU1A 3ST7A 4IEYA 4K1YA 3LGRA 1ULGA 4FAHA 2WFF1 5LATA 2JEMA 4IEOA 2OYZA 1JUHA 1UIKA 1I6XA 4IV1B 4XJUA 3AP9A 1ZYBA 3RZJA 1Q8PA 1V6LA 4MG2A 5JXHA 5FWJA 2VZOA 1S2EA 2QQJA 1PO12 3BTAA 4XF3A 2RE9A 5CISA 5LY1A 5IK8A 1HJFA 1NQDA 2ZGUA 4OULA 3SXWA 4WVMA 1JYXA 4AI2A 4AVBA 5FUNA 1F2NA 5EFUA 1JN2P 3K77A 2PYTA 1MR5A 5LBBA 4NE9A 1V6NA 4X8NA 5FZOA 3RPQA 3GHMA 1QJU2 3OD4A 2HEYF 3KCXA 2JG9A 1VLNA 1YC61 2AREA 3BB6A 3FMGA 3G7DA 4Q8LA 5FZCA 4INDA 5A6QA 1UOGA 5GZGA 1IZ3A 4YVSA 1K12A 3AP4A 3MIBA 1N1VA 5FZKA 2YGMA 2X53S 3RQ0A 5KHJA 4OCTA 4CPBA 3FHAA 1VBA1 1E5RA 2YG0A 1PMJX 1WLWA 1VE0A 3Q8BA 3AVSA 3POYA 3VBRA 1UAIA 4XJ8A 5C9AA 3SH4A 3WNPA 1REEA 1SQ4A 1UYZA 4IGQA 1H9PA 1JYVA 1WBFA 3T1MA 4PDWA 2YC4A 1VBB2 1ZRFA 4WV8A 1ODMA 4BOWA 4Z82A 5E88A 3KGLA 1H2MA 4CCDA 3SISA 3FUOA 1SPPB 4K20A 2HH9A 1O4ZA 3E6BA 3W9AA 1O7FA 4JGYA 3TBDA 3ZSMA 3BI3A 4E27A 2GNMA 2FQPA 1ZBE3 5DMYA 1OVSA 3DYMA 4GB33 1O8PA 2P6HA 3VBFA 5FKBA 4ES8A 1O3RA 1ND3C 1LHWA 2ZKNA 3AZXA 4XMIA 3MIHA 3ZM8A 3OYWA 4MGKE 3RYKA 1K42A 2B9VA 2JDPA 3C7EA 2EAAA 1F4AA 4UFKA 4DPNA 3P1IA 1V70A 3AZVA 2QBXA 4C1WA 4IV1A 5FPXA 3EMRA 2WQ8A 1A34A 5JAXA 5A33B 2NQYA 1CX4A 1JU4A 4RHV1 4CDUA 2F17A 4BWOA 2HWD2 4XVHA 1BVVA 1S0BA 3CLPA 3SCGA 4CEYC 4UT5A 5G05L 4WVMB 3B5LB 2BBAA 1VBE2 3NAPA 5K9YA 3OB8A 2Y6GA 2XVGA 2WLQA 3CZJA 2ZBJA 1ZA7A 1PZ9A 3QLQA 2D3RA 2PMWB 5FBZA 2VZRA 3W20A 5FQ0A 2XQXA 3MBWA 2VR4A 2HWF1 1AXKA 3P3PA 4YVWB 2ZX2A 4GD4A 4AVCA 1GWLA 1QJY3 1GNHA 1POV1 1V6JA 1XSQA 1ZA4A 3BPSA 3O5SA 4MGYE 1HRI1 2YUEA 3LKJA 1YI7A 3ZX7A 1HIXA 4KWLA 3N9MA 3UK9A 3ZFGA 2ZAHA 4OHXA 1BJQA 1N3OA 5F37A 1O59A 2NMNA 5C8WA 3KCCA 1AL21 1EV13 1E5SA 4CU9A 2B42B 2NM1A 1R1A2 2VBBA 5AC91 2WUHA 1U5ZA 4XMAA 1ZBA2 1Y9GA 5K0UC 5FZHA 4QKBA 3BCWA 3U78A 4E4SA 4GH4C 1TNRA 4XXPA 5JOXA 2SLIA 5I0TA 5FMOS 3ZXDA 3ME2A 2FDIA 1F9KA 2VMIA 4DS0A 1RUC2 2ARCA 1F4HA 3EXUA 4YW7A 2VCAA 2XPJA 2VQUA 1OD5A 3LA7A 5A7WA 3SEEA 3OUJA 4YVWC 2GP3A 1QGLA 4XABA 4H7MA 2BGCA 1DP0A 4XXAA 4AGGA 5L36A 3ACHA 5A32A 2WRAA 2EALA 1H4GA 2VL4A 2CSGA 3RRDA 2V72A 2VOVA 1WCUA 4O65A 1GSLA 3WNNA 1H6XA 3H50A 4EV0A 1XU1A 1GP6A 1YIPA 1SFYA 2ES3A 3MICA 4HOOA 3FJSA 1VRH2 4YG6A 3VZJA 3NNLA 1H6YA 3CDZB 2WNVC 4JRLA 5K4LA 2D3PA 3SH5A 4BHPA 4GWIA 1LOGA 1VBE1 4W6XA 5FYCA 2FZ1A 5L19A 1YHFA 5DG2A 2BPA2 1HKDA 1RUJ1 1JH5A 2HWD1 1DBNA 1NA1A 2X5IB 1XC6A 2XL9A 2JE9A 2PHWA 3WHTA 1DQ0A 3TN93 1OQEA 1PGSA 3OUHA 2VG9A 5F3EA 1E5HA 4JGYC 3ELNA 3R4UA 1UN1A 5I8SA 1NCQA 2AR6A 2OPKA 4W50A 4JGZC 1RUC3 1WD4A 3I8TA 2HWF3 2GAUA 3A21A 5DAWA 3KT4A 1HV1A 3M4FA 4PCRA 1RUD3 1OFSA 1UZ0A 3KV5A 1PK6A 3LF7A 2QQLA 4DUXA 1OA3A 1OD3A 4KU8A 4DFSA 5FZLA 3QCWA 5DAVA 1C8M3 3BGAA 4XQDA 4XW3A 3TN91 4DY5A 2RR11 3B3QE 5F6LB 2TUNA 5IT6A 4N8MA 3C2UA 4P9JA 3ENRA 4UI9L 2D98A 1UMHA 4CCEA 5C9AC 2BEOA 4IW3A 1IS5A 1XNDA 2JDUA 2DURA 1KRIA 3AKTA 2P6CA 1MQTC 1AR71 4YARA 1UYPA 4URAA 3A0KA 2XL7A 1MEC3 4C90A 4A2UA 4OHWA 4QPGB 3AZWA 3NRUA 5A6YA 2QQUA 3MLJA 4AZZA 1PZ7A 1VBC3 2A6VA 4JKKA 4LE4A 5DAQA 2C24A 1MZFA 2Y6LA 2RR12 4MADA 4NPLA 2QQNA 3RYRA 4JDOA 4Q4W3 2XUMA 2IXKA 1V9U3 1UIJA 3I3BA 3WR0A 2KA3A 4L0PA 3UNPA 3WD5A 1AYN1 4EN8B 4P08A 5FDBA 2OT7A 1CAXB 5LWBA 1UMIA 3NKTA 1JHNA 2N7GA 2ZCWA 2YBPA 3VN4A 3THPA 4W8JA 4XZUG 1JXNA 3U0ZA 3J7MA 4IV1C 4DUWA 2GSYA 4I02A 2AACA 5JIAA 1IQAA 1DQ5A 1O3SA 1RC6A 4QXHA 2MEV3 1DLLA 1TG7A 1W9FA 3HQXA 5HCBA 3KGZA 4OFGA 3RDIA 1QJX3 2PN5A 2WLPA 5HCAA 1WWYA 1N3QA 1ENQA 3NAPB 1TNFA 1JZ6A 2J42A 1ZZCA 2GMPA 1UY2A 5ERLA 1I1EA 1AR83 1VRH1 2A1XA 2E7QA 4YW3A 5C6CA 2A6XA 4XHBA 5FYZA 3H8XA 3N7MA 1XNBA 5DPNA 1RUH2 3POJA 5C4WB 4JAAA 1J1LA 3T1LA 4BQ2A 5EXOA 2VTXA 3KHBA 1IS6A 2R073 3PDQA 3ZPYA 1UKGA 3I2IA 1GZ9A 2G1MA 4B7KA 1EAH2 1I5PA 4QMAA 4AQTA 4YSFA 5BUVA 3K4AA 3L2YA 4AQ6A 3GM8A 4QWNA 4CP9A 1R092 1AR82 1OURA 2VMFA 1FXZA 3JQXA 5A3WA 3ZIWA 4CRQA 1KXGA 3APBA 4HETA 3ZXLA 1W6NA 3OF1A 2Q8CA 1XE7A 3CZUA
chains in the Genus database with same CATH topology
1RUC1 5BNOB 3GF6A 5H9RA 4P9GA 1QOOA 4HVQA 1JTZX 4XFGA 4FPYA 1RUF3 5JIUA 3LOIA 5C8CA 5GZCA 1SBDA 3NWKA 1N1SA 5E1RA 3M8LA 2PQQA 3C3VA 3CO2A 3H1MA 3MF6A 2XBO1 3KT1A 1LODA 3GBFA 4O9EA 4OHZA 1BBT1 2I45A 5DZEA 5CG9A 4Y1ZA 2HWE3 3ZMNA 4OI4A 4CP0A 4HVRA 1RUF1 2YYOA 4Q4X2 4MUVA 1MVQA 3PVNA 4Q2FA 4ES9A 3RI9A 1FATA 2EXIA 1PGW1 2BWAA 4XETA 2IFRA 2GMEA 4AVVA 1LESA 4QQPA 3WT3A 1O4TA 2HWC1 4KGQA 3IWZA 2VGDA 2EVXA 2VQAA 2NMOA 4P9WA 1FNYA 1IKPA 2OIIA 2SBAA 2PHXA 1FT9A 1H8VA 4YM2A 2DCKA 4PJYA 3JU9A 4HK8A 5C9AB 3LA2A 1RUJ3 3FE5A 4FCAA 3H7YA 4XBQA 3VZMA 4XFCA 1UX6A 3EJKA 1Y43B 4RHV2 2ZJCA 1OOPC 4FP2A 2PHRA 4SBVA 4AG4A 4OVEA 1K5MB 4QHBA 2P3KA 4N90A 5CIRA 3R4DB 2QVSB 1A78A 2R0HA 1QJX1 4LO5B 2DVAA 4JGZB 2B45X 3NSTA 3VDDA 4F83A 1W2UA 2ZHMA 3AMPA 5D1IA 4Q8KA 2W39A 1SACA 1QJU3 5DDJ2 1PO23 3M3OA 4D3WA 4QQHA 4DXZA 1AXZA 4AI1A 1S0FA 1SLBA 2RMU1 3CL1A 3O0WA 1KD7A 5JR7B 4LBQD 1Q43A 1OQ1A 3LB9A 5A33A 1RITA 4AK3A 3FBYA 4JV4A 1I5ZA 2CAVA 4WM8C 5JOZA 4CP2A 3IDBB 1H8TA 4XQWA 1LR5A 3U10A 4NR1A 4CDQC 2XVLA 4GKYA 3E6DA 5GLWA 3SCHA 1J3QA 1UL9A 2UY9A 1G9BA 1RJ8A 3NV1A 1C8M1 1FNZA 1CAVA 2ZTNA 3E6CC 3MPBA 1OMIA 1EP0A 2CWSA 4NHMA 1RUD2 1IGOA 3ZFEB 1PVXA 3LSEA 4MV2A 2PHDA 3WDXA 4X8PA 3AJZA 1VALA 4QPIB 1QDOA 4F8AA 4OI1A 2MNGA 3B01A 5K0UB 4QU2A 3WDVA 1YUDA 1SCSA 1MQTB 1PGW2 3NAPC 2YHJA 5KC5A 4FTSA 1URXA 4LHKA 4LT5A 2IXLA 3WDYA 4LBQB 2IZWA 3S7EA 2YMZA 3OCPA 4R4XA 5C8CC 3AKRA 4XBNA 1VBB1 1CAXA 3PVOA 1RUNA 2WNUA 4HKLA 5BNPA 3HT1A 4XFAA 1EPWA 3D4KA 1ND2A 4FT8A 5KWRA 1LOCA 3FC0A 5A3MA 2H6BA 2EXJA 2GMMA 3U11A 3EHKA 5LK5A 4KWJA 3OY8A 1UKRA 2BTVC 4AEMA 1Y9QA 2WFF3 5GLVA 4I0WB 4CEWC 2VMHA 2RM22 4Q0QA 2DUOA 2ZHLA 5AFBA 1RB8G 4BZ4A 5I0RA 1NCRB 3ZXJA 1QJX2 1SBFA 1G9CA 4G3YC 2DF7A 3WCSA 4B29A 4B8EA 1NCRA 2WT0A 1IKQA 4K7JA 1J58A 5L7OA 1LGBA 1TME3 3DKWA 4IESA 1Z7S2 2G9FA 4W6YA 1C4RA 2A3XA 4MYEA 2CNAA 4LUMA 2R041 1QKQA 4ATFA 2JICA 4FP3A 4IEVA 2YY1A 3M3IA 5I91A 2QQPA 3QD6A 4Y20A 1VBA3 1RUOA 3RJ2X 3BIWE 1V6MA 2RS51 4Q4W1 5AC93 3VBHC 4AHZA 1FMD2 4YNIA 2WL1A 1XYPA 2UWBA 5H9PA 3KMHA 2A71A 1HW5A 2CGPA 1LGCA 1NE4A 5BPXA 1WMEA 2HWB2 4AF9A 2QJVA 1UPSA 1ND2B 5LEKA 4WM7B 5E16A 1RUG2 3N7JA 3WP4A 1BEV2 3MPPG 1ULFA 3JD73 1IPJA 5BNOC 4AQSA 1Q56A 3OTFA 3LAGA 1AR81 2EXHA 3ZYGA 2ET7A 4H14A 5JZGA 1DU3D 3O7OA 4HBNA 2VULA 3VHOA 4B4PA 1S0EA 2LM3A 3VBUB 1C3HA 3V0BB 2XJQA 3J4UH 5JCTA 3SH3A 4HN0A 5JOWA 1ND2C 2QZ3A 4AHWA 4YFZA 4CDXB 1CN1A 3VBFC 5BY5A 2EXKA 2B7YA 3S7IA 4YGEA 3WHUA 1OA2A 2DTYA 2X8KA 4HN1A 1HRV2 4JQRA 2FBEA 2GZWA 1IOAA 2X5IC 4F7ZA 3VGIA 1RVF1 5DUUA 2ZS6B 1AX1A 2VW0A 3WW3A 1VBE3 1MS3A 2R042 5F1RA 3VBUC 3N7KA 2NP0A 2IFWA 1BXHA 4HLTA 3UKNA 4HMZA 4FAGA 2R043 2ZHKA 2FMDA 2ZGQA 3LOBA 4Q4Y1 1W6OB 1MVEA 3QBQA 4L92A 1HRV3 2UU8A 3JB4C 3BU7A 1LOEA 2XWBB 3WX5A 1RUI2 1A3KA 2ETEA 1S0DA 2DVGA 1NCRC 5DZFA 3AYCA 5T5LA 1QHDA 1QMJA 1LENA 1PNGA 1D4M2 1W6QA 4I3PA 2LUWA 3M3QA 1QXRA 1X8EA 4AE2A 2P3JA 3FZ3A 1NLRA 2Q1ZB 3O0VA 4JGZA 4CDXC 1XRUA 1NXD1 4QGLA 5CNAA 1AYN3 4TYSA 2IXJA 4LBOA 3KB5A 2GC2A 3THTA 5T50A 1J3PA 1MEC2 1PIV3 1WUVA 1LRHA 4M00A 3V56A 2P34A 4LLOA 4YGDA 5GKAC 5BNNC 1DDLA 3LA3A 3WG4A 1O4YA 1WMDA 4OLLA 3WXPA 2VY0A 5JDBA 2AZ5A 1OOPB 4AVSA 2YC0A 2R061 1YJLA 5CVRA 3D82A 4QM8A 3G6JB 2R32A 2VNOA 3MLKA 4LO8A 3ZXGA 1AJOA 4XYXA 2ARBA 5FO7B 1G7YA 3KQRA 4XIKA 1RUD1 4DQAA 3AMQA 3AB0A 4B4QA 2MEV2 2NN8A 2WFPA 1KQRA 1R082 1AX2A 2PAEA 1ZBA3 5E89A 4C1XA 5ACA3 4Q29A 2BFUS 1FI2A 1TME2 1ULDA 3RMXA 2RS32 4IEUA 1W6NB 2ATFA 4R9BA 4D94A 4RR3B 1G8WA 3WNXA 3KZ4C 1ULCA 3PVBB 2D7FA 3PJQA 4MXWB 1YRZA 4LUKA 4WBBA 2A6ZA 4FTBA 1AR73 1QQP2 1KDMA 3GZTB 4AHXA 4GWMA 4DZGA 4U2AA 5J36A 4M0HA 5LRSA 1DGLA 3I59A 3ZXAC 3POSA 1COV3 3L9JT 1H9WA 4WM8B 2OVUA 2H6CA 1NE6A 3WG1A 3JB8A 1FMD3 4S2DA 3AZZA 3IM0A 2ZACA 3N35A 1Y3TA 4J6GA 4RQPB 3OGJA 4EN7B 5JPMB 3MW2A 3DPRC 1HQNA 3AJYA 4N43B 4K6BA 4AW7A 4YGCA 3WW1A 1XNCA 4L99A 4Q4V3 2WZPP 3WP6A 4GB32 2ZX0A 3RSJA 3VBSC 4YG3A 3R6SA 1BMV1 4MGZE 2B5HA 3GZUC 3HIFA 3H7JA 4CEYA 2ZMKA 1RMU3 2HWC3 5EYXA 3VBOB 5FO9B 4XJ9A 4BM8A 2A3WA 4WM7A 3CJIB 1NYWA 4ZU4A 3WLUA 1N3PA 3SLIA 4CZSA 2JECA 3KS7A 5D8AA 1LOAA 3S30A 4Q4Y2 2UURA 3VBSB 2WA4A 1WBLA 2IC1A 4Q4X1 2D6NA 1IPKA 1GR3A 1H1IA 2WQZC 1B35C 1NG0A 4KU7A 3A4UA 3VDDC 4B7EA 1NLSA 4ISRA 2WS92 4HL0A 2JG8C 5I8YA 1UZZA 4FXKB 3CJXA 4R8HA 2P2KA 4MZUA 2BNOA 1QU0A 2DVFA 4PDWC 5FO8B 3B9CA 1V6OA 2PELA 1TMF3 2VNRA 2W0XA 2XBO3 3VBRC 4BCUA 2NZ9A 1ENSA 5IK4A 2XJSA 3LCPA 3VZKA 4UW5A 2VVDA 1KJRA 1ZBE2 4Y4YA 3GNEA 4IEQA 3WQ0A 3MIEA 1C8NA 1ENXA 2BWCA 4Q26A 1G9AA 1H2LA 1HXS3 2C9AA 1B09A 2BNNA 3B00A 4Q0SA 4PDWB 4N9IA 4QQ2A 5GALA 5JSPA 2VH9A 3AMNA 1RHI2 4Z07A 3NW4A 1H8TC 5C4WC 1AR62 2LTNA 4Q4V1 3ZSEA 2JG8A 4UW4A 3ZYIB 2ZZJA 2VECA 1AR63 4FPCA 1W6QB 4GMP0 5T5PA 3J8F2 1YFWA 3VBFB 3IIAA 1B35B 1H30A 4LBQA 2QZ2A 2E63A 5D8AB 2Q4SA 2HEVF 2WWSA 2AENA 2DWRA 1LKNA 2WQ4A 5EYYA 3ZYJB 4A7YA 3CF6E 3AFKA 3J26N 1ZRCA 2V73A 2Y38A 5T5JA 1ZZ9A 2BFUL 1RUI3 3VKFC 1ALYA 2QFEA 4Q4X3 1AF9A 3D8CA 3KCYA 4LEJA 4RL7A 3SHRA 2PHTA 1W0OA 2ZMNA 3AP5A 1WCDJ 1HQWA 2R063 3WQ7A 4KQ7A 3ETQA 3DPRA 1HV0A 2YROA 1C28A 4JTNA 1BEV1 1RUG1 5IK5A 4P14A 5SV8A 3WQ1A 1LTEA 5GLUA 5T5OA 2OZ6A 3B69A 1BKZA 2GNBA 5FQ0B 1WW5A 2WT1A 2RM21 4UW3A 4LBNA 4RR3A 3HAGA 5CFCA 1I3HA 1PVC2 3CNAA 1H4HA 4DNYA 4CDQB 2A5ZA 1Z0HA 1ZZBA 3I4IA 2BYVE 4XF0A 1ZRRA 1C1FA 3VHRA 5CFCB 2VUAA 4N9HA 5JLVA 3WDUA 1Q8OA 4MVTA 3VHPA 2D5FA 4NPRA 2ZZQA 4YW4A 4RR3C 4RSUA 2P37A 3DL3A 1PZ8A 2ZGSA 5DUWA 3ZXKA 1S0IA 1ZX5A 2PA7A 3FFZA 4PBPA 3M70A 4EN6B 2GN3A 5A32B 4CTEA 5E8AA 1FPN1 3B9IA 3JD72 1BBT3 4IV3B 3RJRA 2HWE1 4EJRA 4CP1A 3AM2A 2UYBA 1O5UA 4XJWA 1EY2A 2UYAA 3O14A 2IXHA 5H9QA 2QE3A 5H9SA 1RJ7A 1SFNA 4KBBA 4W6WA 1K5MA 3VBUA 4B3NA 5DUVA 5JMCA 1FPN3 3MW3A 1ND3B 1SLLA 3U4XA 2Z79A 3ZN6A 3K48A 4GQ7A 3JD71 1E57A 3JBG3 3ZDSA 4Q27A 4HKWA 4NWWA 1MS1A 4GA9A 1KITA 2ZHNA 4YW5A 1NOVA 2WA3A 4HPKB 2Q0AA 5L7OB 1SLTA 3OD0A 5CAZA 2CGNA 4YVWA 3MZHA 2WKKA 5KC6A 1ZBA1 2XJTA 2R1BA 2HWD3 5AC92 3MF9A 1O5LA 2DFBA 1HLCA 3ZVXA 1GZCA 1QXJA 4JVAA 4M0NA 2JE7A 3NL1A 5DXDA 1X82A 1RVF3 2AH2A 3VV1A 4FPGA 1AJKA 2Z42A 3CEWA 1YI9A 3R0RA 4TLFA 2GDFA 2TEPA 1O3TA 1CQ9A 1JYCA 1RL3A 2D40A 5CG8A 4LHLA 3MYXA 3VUOA 2ZX3A 2PHLA 1RINA 1BZWA 1EV12 1ONAA 3WZ1A 2WIIB 5T3NA 2BBVA 1U12A 3GHNA 1QJZA 1TMF1 2DTWA 3FWEA 4PF5A 2DU0A 3E5XA 3H3ZA 1KFXL 3J8F3 2KM2A 3D6EA 4ISQA 4Y1UA 2JG9C 4AI8A 1V9U2 1LEMA 1COV1 1MZ6A 2MPFA 3AX4A 1VP6A 3ZMOA 1YFXA 3AK0A 5T54A 3MDPA 3ES1A 5EWSA 1DYPA 3LWCA 1HRV1 4FO9A 3CU7A 2XLFA 4KG0A 4FOQA 1LCLA 3RS6A 1FPN2 2FZ2A 1PNFA 2VOWA 3N4MA 4R52A 2HWC2 4L8QA 3S0MA 1GYKA 1OSGA 4I2OA 1DYKA 1KFUL 1W39A 4AHYA 5JSOA 4FPFA 3WDTA 4IV3C 4Q4V2 2RMU2 1F8VA 2UWCA 1RHI1 1G9DA 5DDJ1 1BK1A 2WNVA 1X50A 2EF6A 3E5QA 3B93A 5CA6A 1PIV1 3H1WA 3IPVA 4P9IA 4YGBA 3VZNA 5GJ6A 1DGWX 2E9QA 2WS93 1J3RA 2D6LX 1N47A 1S1AA 2RJKA 2MHFA 4PQ9A 4QD2A 3BOPA 1W6OA 1SDWA 1RUE3 1MZ5A 4I09A 2R6QA 3N3HA 3WV6A 1AYM1 2Z2SB 1R091 4HT1T 4AGRA 4RS5C 4H3WA 1UW8A 4UBHA 4I01A 4CEWB 4N43C 4Y24A 4LLFA 3PJYA 2JG8B 1C5IA 1H0BA 2CL2A 1FAYA 5KXDA 4IEPA 1RGSA 4FOWA 3VBHA 1IS4A 1AXYA 4L97A 3LSDA 3W59A 3NKGA 3PTYA 4AXOA 1YFYA 4GULA 1APNA 4YZ1A 2RS12 1DG6A 1R083 1PK6C 2A7AA 1CPNA 2PHUA 2Z5WA 3KD4A 3M3EA 4AEDC 3IKWA 1BVP1 4JCKA 1PHMA 2CY6A 4BPZA 2GALA 5GZEA 4RGGA 3WP5A 3USUA 3CJIC 1WGPA 5C33A 1PO22 2PLV2 4OHYA 4R4ZA 2YV8A 1AR61 2CV6A 2AUYA 1I9RA 4CEYB 5CB7A 2VVFA 5AFEA 2F4PA 2BVBA 3IDEA 4XJZA 4BMEA 2DFCA 1ZZ7A 4FPLA 4YFWA 5KHKA 4V1PA 1MACA 3WG3A 3DPRB 1AR92 1VAKA 1DQ1A 3ILRA 4ZU7A 4MXVA 2Q5TA 3VDDB 1J59A 5JZGB 3VZLA 2KXLA 1H1MA 2BNMA 4HKOA 1N1YA 4K1ZA 3WOGA 1EAH1 4P9XA 1AR72 1SCRA 3SCFA 1YFUA 3I7DA 2YGLA 5ABJC 3AMHA 3ZFGB 5IK7A 4TZDA 5BNNA 1XU2A 4XHXA 4QGMA 2PFWA 4CYDA 2A70A 1GQHA 1WLTA 5HCFA 4FXGB 3JBG1 2DUPA 4DY3A 2F6BA 2PLV1 5K7PA 1S2KA 1ZZ6A 4LA3A 5FOBB 1V6KA 4YW2A 2A73B 1H2KA 4XF1A 3MIFA 3N36A 4GH4A 1W0PA 3J8F1 1RUE1 1DQ2A 2I2SA 4AVAA 1MZEA 1NXMA 1ULEA 2RMU3 3NJZA 2XJRA 5FAXA 5KXCA 5IUQA 2D44A 1PMIA 4AWDA 3GYDA 2B39A 2RS11 2XWJB 4N43A 1R1A3 1AL0G 4OHVA 2XJPA 2WT2A 5FMOL 1R1ZA 1BMV2 1H8TB 4HSJA 2YXSA 4DRVA 5CADA 2Z69A 1UCXA 2A6WA 4TWTA 3ZYPA 3M3CA 3L2HA 1QJY2 3K51A 2EA7A 1UU5A 1WLDA 2ARXA 4HSLA 1AYM2 4M3CA 4YZ2A 1UU6A 3EQEA 4JDMA 1GFF2 4CDQA 4XQ4A 1HXS1 1FOD3 1D0GA 1UPIA 4QX5A 1GANA 3VBOC 1EYBA 3E97A 4HPKA 5J98B 4YRDA 4BA6A 3ZFGC 2VMGA 4JGYB 1ZZ8A 2OW4A 3TRSB 1GZWA 1ZM1A 1QQP1 3MGUA 2O8QA 4GALA 4AFDA 4N7UA 3KLSA 3WUCA 4JC1A 3RI8A 4LO7A 2ZKLA 4G4FA 1X33A 1HRI2 2DU1A 1U5IA 1BCXA 2PTMA 2RS31 3H1YA 5T52A 1VAVA 1UD1A 3WINE 1REDA 2ZGMA 4K3UA 4PIYA 4N53C 4D7TA 1SLAA 5CFDA 4GWNA 1Z78A 1S55A 1OOPA 3IMNA 4XBLA 2CAUA 1RUI1 1D4VB 4YLZA 4EROA 3BALA 1C57A 1PK6B 1DF0A 2ILMA 1VBC1 4XFFA 2JG9B 3SNMA 5BV6A 1VBC2 4RS5A 1SLIA 3VKLA 1DGRN 5KHGA 3RWNA 4KH9A 1CGPA 4EN9B 4UXAA 1XYOA 5FOJB 3MFAA 2H0BA 4RQPC 3BPZA 2XGXA 3MIGA 4XDQA 1CAUA 2GC1A 5KHHA 4MX3A 1YO8A 1WW6A 4X6QB 4CEWA 3MLLA 3ZSJA 1XQNA 3ZN5A 1RUG3 2UY8A 3TYJA 5F5QA 3I2DA 4FVVA 2AGSA 2XJVA 2HWB3 3OPZA 2CYFA 3H0OA 3GBGA 2GH2A 4EN0A 3IN9A 2QKDA 1YYNA 4WZCA 3R4SA 2TBVA 2W52A 4YVSC 5BNPB 1GNZA 4COVA 4C0BA 5KHIA 1ASJ2 3OYWB 3PHMA 2G9GA 5JOYA 1D4M1 4WM7C 1XYNA 4FOYA 1G9FA 4N53B 3MEPA 1YXWA 4Z1VA 5CBLA 4LBMA 4YZ5A 1MS5A 3WW4A 4CDUB 3VBOA 5CFDB 1D0HA 4S2FA 1W6PA 1S2BA 2JXAA 1B35A 5DG1A 2ZPXA 4ASLA 4RGAA 3HD8B 1KJLA 3MI8A 1QNYA 2C0ZA 1CD3G 3PVEA 3WDWA 3M7AA 5LRRA 3ZYRA 2R30A 5BYNA 2R062 5GZDA 5J3UA 1FYUA 4HZFA 4LBJA 3IT8A 2DVDA 1ND3A 3VZOA 2WNUC 4E4ZA 5HI0A 1PGL2 2XVKA 1LHOA 2ZX1A 3U07A 4IEZA 1CPMA 2WINB 2ZGOA 1BEV3 4I3GA 4AVTA 2B8MA 1RVF2 2VXRA 4XIOA 3VL8A 4IETA 3BOWA 4WVWA 3KSCA 1OQDA 4HVOA 4E4DX 1VJ2A 2XLGA 1AUYA 4E2GA 1CJPA 1WMFA 1NZCA 2WFF2 1QY4A 3P3NA 2WSVA 4R9DA 1PVC1 1FV3A 3JUUA 3H3UA 4KL1A 5FLIA 1C5HA 1YIFA 1VBA2 3AKPA 1PIV2 5HBAA 2IXCA 4WZFA 3EO6A 4QQOA 4XFBA 2VOKA 4AI3A 3ZFFC 2ZGKA 4P9LA 1CVNA 4COUA 3RMYA 5FTTC 2QNKA 5JVVA 4QM9A 1QJU1 3R05A 1D4M3 2QDNA 1PO21 3USSA 4NHLA 1OHFA 1TEIA 1Q8QA 2IWGB 1S0GA 2WNUB 5J7MA 4JDNA 4LE3A 4D7SA 4LULA 1OA4A 3OY8B 1PO11 1WW4A 4LBLA 3A0NA 2AYHA 3AYAA 1TQ5A 3V0BA 2RR13 1A8MA 3E5UA 2DYCA 4EWEA 2R0FA 4BIOA 2R16A 4I0AA 2WNVB 4XPVA 3ASIA 3I54A 1AR93 3TAYA 3IPVB 4E9KA 5F9TA 1COV2 1JBCA 4UW6A 2ZAAA 2GN7A 4PLMA 4I0BA 3RZZA 3VL9A 4CDUC 1D2QA 1GBGA 1POV3 2YDEA 4FQZA 4FPOB 2PLV3 1VB4A 5GLTA 1VR3A 4QPIA 1DGWA 2ENRA 2NPIA 3B02A 3ZFEA 1YNAA 3W58A 4M3CE 1AVBA 2DUQA 2Y26A 3ZFFB 4R9AA 2ZA9A 2D6PA 2HWB1 4LTAA 3OJBA 1GV9A 1POV0 5ACA1 4XTMA 1R1A1 1ZBE1 3WUDA 4AYUA