2FZ2A

Structure of turnip yellow mosaic virus at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
164
structure length
164
Chain Sequence
b'PSPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*C)-3'
molecule tags Virus/rna
source organism Turnip yellow mosaic virus
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
total genus 25
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz2A00
1VBA1 1RUC1 1QJX2 4CDUC 1FMD2 1PO12 2R073 1NCRA 1BBT2 1SMVA 5C4WB 1TMF1 1X36A 1RUI2 1BEV3 4N53B 1RUJ1 1RUD2 5K0UC 2RS31 1COV3 1TME1 2WFF3 1VBE1 3ZFGC 1PGW1 2R042 1AUYA 1RHI1 1EV12 1RUG2 2FZ1A 5BNNC 4WM7A 5CFCB 5LK7B 4YVSB 1MQTA 4FTBA 1RHI2 4QPIA 3VDDC 5DDJ1 4Q4X1 4GB31 1AR73 5C9AB 1ASJ1 1ND2B 4RQPA 2HWB1 4Q4Y1 2WZR3 4RR3B 4BCUA 1EAH3 1K5MA 3VBUA 5JZGB 3JD72 1V9U3 1F2NA 2BFUL 1B35C 4N43A 1AR83 1POV1 4CEWB 2RR13 4CDWB 2Y26A 3DPRA 1ND3C 3ZFEA 4GH4C 1ND3A 1ASJ3 2HWB3 2HWD1 2PLV2 1MEC1 4GMP3 5C8CB 3JD73 2R071 3VBHA 1RB8G 1OPOA 2PLV1 4PDWC 1F8VA 1QQP2 2MEV3 4Q4V2 1H8TA 3NAPA 1PO21 2XBO2 4N43C 1VRH2 1AR92 1ZBE2 1QJZA 1R1A1 3VBSC 4JGZC 5CFDC 2RS11 2WS91 1MEC2 1OOPB 3VDDB 5FMOS 1PO11 3VBOC 1OOPC 3NAPC 1AYN2 3CJIC 1HRV2 1AR72 1B35B 4EJRA 1RUC3 1PO22 4CDXC 2WWSA 3ZXAC 1PGL2 1AYN1 1QJU2 3J8F3 1PIV1 1AL22 4QPGA 1BMV1 2HWC2 1VBC1 1TMF3 5C8CA 1NY71 1VBB3 1AYM1 4IV3A 3TN93 1RUJ3 1HRI3 1VAKA 1VBD3 1PIV2 1QJU1 2RS12 1AL21 5J98B 1EV11 1BMV2 1RUD3 5C8CC 2RR12 1VBE3 3VBRC 5DDJ2 3VBFB 4Q4X2 1RUF1 1HRV1 1RUH2 5GKAC 5AC92 4IV1B 1ASJ2 1VB4A 1EV13 3LOBA 2HWC3 1RMU3 4IV1C 2X5IC 1R081 1RVF2 4AEDC 4JGYA 1NY72 1HRI2 1AYM3 5L7OB 1QJY2 5L7OA 4N53C 1VBA3 4Q4W2 1NG0A 2MEV1 5C9AA 3IDEA 1FOD3 1RUE3 4RQPC 1ND2C 4IV1A 5C9AC 1RMU2 1RUI3 1FPN2 5CFCC 4Y5Z0 1C8M3 4Y4YA 1CJDA 1VBA2 4Q4W3 4IV3B 2HWE1 1D4M1 2XPJA 1OHFA 3FBMA 4Q4Y3 4CDQB 5ABJA 2QQPA 3DPRC 1FOD1 1AR71 1TMF2 5ACA2 1BEV2 5D8AC 1PVC2 1B35A 4FTEA 3JB4C 2TBVA 1R093 3VBFA 3TN91 2FZ2A 1BEV1 5FOJB 1VRH3 5BNPB 1RUD1 1VBE2 2XBO1 1OOPA 2RM21 1HXS2 2GH8A 1MQTB 5AC93 5ABJB 4CDQA 5CFCA 2RR11 4QPGB 4WM8C 4QPIC 4Q4V3 1PVC3 2WS92 2HWC1 1ND3B 2HWF3 3M8LA 4CDWC 3ZFEB 1AYM2 2RS52 4CDWA 3JBG3 1FMD3 1EAH2 1VBB1 4LLFA 3ZFGA 2HWB2 3VDDA 1PGW2 1W39A 2R041 1QJU3 2RS51 1RUE1 1EAH1 2R061 1VBB2 4RS5C 1RUG3 4CDXB 1IHMA 3DPRB 5BNOC 4FSJA 4JGYB 2R062 3NAPB 3ZFEC 4IV3C 1RMU1 4QPIB 4RHV2 3JB8A 1ZBA2 1RUF2 4JGZB 4Q4W1 5CFDB 2HWE3 4YVWC 1NCQC 1PO13 2R072 1MEC3 1PIV3 1ND2A 4RQPB 1H8TB 1NOVA 4RS5A 4SBVA 1HRI1 2BBVA 2BUKA 1RUC2 3VBHB 1PO23 1VBC3 1VRH1 2ZZQA 4RHV3 1AL23 5L7OC 2ZTNA 3VBUB 1AR91 5JZGA 1RUI1 5BNNA 2HWE2 1A6CA 1FPN3 1R1A2 4CEYA 1HRV3 1DDLA 2WFF2 4WM8A 4CEWA 1QQP1 1PVC1 1MQTC 4YVWA 5J96B 1BBT1 1HX6A 3VBFC 1AR62 2X5IA 2RMU2 1QJX1 5A32A 4FTSA 1ZBE1 1VBC2 2DF7A 4WM7B 1D4M2 1R091 1RUJ2 1R083 1AR61 1Z7S1 2RMU1 1RVF3 4NWVA 2XBO3 3VBRA 1R092 5K0UA 1Z7S2 4GH4A 5AC91 1NCRC 3CJIB 5BNOA 1ZBA3 4CDUA 2RM22 1HXS1 4RFT0 2BFUS 1NCRB 1RUH1 4GB33 1C8M1 3JBG1 3VBSB 5BNPA 1COV2 3VBUC 1E57A 4N53A 1RVF1 2RS53 5C4WA 4AEDA 1COV1 1V9U1 2RM23 1AR81 1POV3 5ACA3 4RHV1 1TME3 1ZBA1 4CDUB 1V9U2 1NCQB 5DDJ3 1FPN1 5D8AA 1AL0G 1NA1B 4PDWA 3VBOB 3VBRB 1BBT3 1FOD2 2HWF1 2PLV3 1D4M3 1HQNA 4Q4V1 3ZFFA 1QJY3 1TME2 5A32B 1POV0 3TN92 2HWF2 2WZR1 2R063 1FMD1 4N43B 2R043 2WFF1 2WLPA 4CEYB 2WZR2 1RUG1 1K5MB 2ZAHA 3HAGA 2RS32 4RR3A 4YVSC 1NA1C 1RHI3 4GB32 2BPA2 3VBOA 4JGYC 4GH4B 4Z92B 4Q4X3 1C8NA 4YVSA 1AYN3 3J8F1 4GMP1 4RS5B 1AR63 3VBHC 3S6PA 1PGL1 1RUE2 5FMOL 1VBD1 4NWWA 1R1A3 1H8TC 2RS33 4PDWB 5D8AB 1VBD2 4YVWB 2WS93 4WM8B 4QPGC 3ZFFB 3J8F2 4CDXA 1AR93 1R082 1RUH3 5ABJC 5BNNB 4CEWC 4Q4Y2 1K5MC 3CJIA 5BNOB 2HWD3 4CEYC 3ZFGB 1QQP3 2MEV2 1C8M2 2VQ0A 5A33B 3JBG2 1Z7S3 5JZGC 1QJY1 3JD71 2IZWA 3VBSA 5K0UB 1QJX3 4RR3C 1ZBE3 2GSYA 2RMU3 1GFF2 1M06G 4WM7C 5ACA1 4CDQC 5C4WC 1VB2A 1RUF3 1NA1A 1CD3G 4JGZA 5CFDA 4AEDB 1AR82 2X5IB 2HWD2 5BNPC 5A33A 1NCQA 1X33A 2RS13 3ZFFC 1HXS3 4GMP0 1WCDJ
chains in the Genus database with same CATH superfamily
1Q56A 3ACIA 1YRZA 3WVJA 1HB4A 1OD5A 1QJX2 1FMD2 3HIFA 2C9AA 1BBT2 2PYTA 2J1VA 5GLVA 3RMYA 5JMCA 1JN2P 3BPSA 5ISLA 1TMF1 2D3RA 3FN9A 4QHZA 1X36A 2AENA 1RUI2 4B29A 1GNZA 4OMDA 4E4ZA 2OQ7A 5FZEA 2C24A 1RUD2 4HVQA 1QXRA 2RS31 5CISA 2IWGB 4EZHA 3PNAA 5IUQA 4A7KA 1D2QA 2KM2A 1H2MA 1YWKA 3WG1A 5A6XA 5DUVA 2RDNA 5CKNA 1NT0A 1QOTA 2OUHA 4NRPA 1WCUA 3ZFGC 5C5UA 2OVUA 2R042 3ACHA 4XJZA 1SLAA 2VZOA 2PQSA 5F5CA 5JI9A 2ARAA 1RHI1 2JDAA 1JZ6A 1KS5A 4NIDA 1RUG2 3GCWA 1DQ0A 4WV8A 1DZRA 2X09A 3M1HA 3K48A 4YVSB 5K9YA 1ZRCA 1IZ3A 1LNSA 4OI2A 2ZGNA 5DDJ1 4AI0A 4AVCA 5HPOA 4JKMA 4P5HA 1UPSA 1U5ZA 3H8RA 3AYDA 1IS6A 1IS4A 2HWB1 4Q4Y1 4QMAA 4OLLA 3LDBA 1PK6B 2A3XA 3N4MA 2WNVC 3F95A 4J6GA 4IGOA 4BCUA 1YI9A 1EAH3 4OQ9A 3VBUA 1RC6A 4B1LA 2VNRA 1QHDA 1VMHA 2DVBA 1F2NA 4Y1YA 1WLTA 4JQTA 4R52A 4ZONA 1B35C 2A1XA 3C7HA 3RZZA 4ZY9A 3URFA 1MS0A 4OUMA 3KHBA 1ENRA 4X8PA 2E51A 4YW3A 4BIFA 2I74A 3I3BA 3ST7A 1ND3C 3IPVB 5DUXA 1CAWB 4M3CE 2WNEA 1W2AX 4N7UA 1J3RA 4QKNA 3FHQA 4A3ZA 4NPMA 1MEC1 3ZKYA 3MW2A 3T2OA 4GMP3 3Q8AA 2IFRA 4LIUA 4RGAA 2JDUA 3JD73 3MGUA 5T5PA 4FI9A 5CG9A 4C1WA 1JZ4A 1BJQA 4OMCA 4CCKA 1DYOA 2XLAA 4WVVA 4RL7A 1LOGA 4W65A 2AYHA 4GZ9A 1PO21 1W04A 1WLDA 1W0PA 4XUNA 2HEVF 3BPZA 4LBQA 4RFRB 4UF0A 3DL3A 2B5HA 3GJBA 1AR92 1ZBE2 4KBBA 3W5MA 1UO9A 3C2UA 1QJZA 2ZGQA 4CCLA 4EN8B 1MEC2 2VO5A 3VDDB 3SH3A 1GWKA 2W87A 1UKGA 2VVDA 2YDEA 4DB5A 4U2AA 3Q8CA 1DCSA 2Z4FA 3HT1A 5LBEA 3ZM8A 1GUIA 2GC1A 3NAPC 3NJVA 1AYN2 4URAA 1CAXA 3JQXA 3LEMA 2TNFA 4EJRA 1RUC3 4XYXA 3S57A 2Q30A 4LA2A 5FZFA 1DGRN 1PO22 5T5LA 2B45X 2JB8A 2JG8B 3AKRA 2WWSA 3I2IA 1ZNPA 3ZPYA 4BPZA 3DF0A 3SH5A 1MS5A 4QPGA 1AL22 5EQUA 5JVVA 4BXSV 2JECA 3VD4A 4GWNA 1BMV1 5KR7A 3R4UA 2IXJA 4M3CB 3TEZA 4CVUA 5HXVA 4EN6B 5IVEA 2YC2A 1WCSA 5J98B 3THPA 4AGGA 4LHLA 4P9GA 2RR12 5FYSA 4BU2A 5JXHA 2IXHA 1HN1A 2XHKA 3RS6A 5DDJ2 3ZN4A 2BGOA 1EPWA 2A75A 3AYAA 1RUF1 2WJSA 3HQRA 2VAUA 4HT1T 4KI5M 4EWDA 1CAVB 4QGLA 1VB4A 3VZMA 3HBZA 4GJYA 1FX5A 1F5JA 4FO9A 4YLZA 4MX3A 4CXYA 4LT5A 3IM0A 4AI3A 3WUCA 5LY2A 1RVF2 2A71A 1NY72 2VJXA 5BNQA 3FJSA 3VDAA 5DN2A 4EQVA 1QJY2 3I2DA 1WA6X 2JWPA 4N53C 4CUBA 4Q4W2 5IVJA 1NG0A 4CSWA 2Q1ZB 2UWBA 4W4ZA 5FBZA 5C9AA 1WZXA 2O0OA 1RUE3 1WLWA 5FUPA 5AVPA 4FPJA 5LEJA 3SKJE 1H30A 3P1IA 4C90A 2XJUA 4IV1A 4XETA 3HMYA 1S0IA 2LM3A 2V09A 1FPN2 3WXPA 1UN1A 1V0AA 1JODA 1X9PA 5EFUA 2LRPA 5FV3A 2UWAA 4ISQA 1VJ2A 2VMDA 3N9QA 4Y4YA 1CJDA 3SITA 3O1UA 3DYMA 3ZSEA 2Q8EA 3KVAA 2ZZJA 2XJRA 3RQ0A 4QXKA 1OHFA 1QJEA 5I0UA 5ABJA 1MR5A 4HPKA 4CP2A 1YQ5A 3DPRC 5A3NA 1AR71 5ANNA 5D8AC 3BU0A 1FXZA 1I9RA 2W1QA 1SLCA 2V73A 1OUXA 4Q2FA 2DCYA 1B35A 1DG6A 4XURA 2OW4A 4L92A 3VZKA 2TBVA 1R093 1UZVA 1PK6A 3VBFA 3RZHA 1ZRFA 3MIBA 4NIAA 4QHBA 1BEV1 3ZKUA 1MS3A 2C6SA 2D6OX 3GZUC 5LA9A 3TB0A 5FOJB 1RL3A 2E7AA 2FQPA 3GZEA 1OOPA 1UNBA 2VMGA 2RM21 4QM9A 4QAWA 2GH8A 2YGLA 2OIIA 3E97A 1DBNA 1OMIA 4P08A 5DAWA 3T2TA 5ABJB 3RZKA 3VZNA 3AZZA 4DINB 2B9UA 2ORXA 3ES4A 5F7UA 3S7EA 2XMLA 5A6YA 1HV1A 3ZIWA 5E6HA 4I30A 1AYM2 2XL9A 2A6ZA 3MIEA 2HKXA 5IYYA 3JZVA 4XJ8A 3UJQA 5IATA 4QB1A 2VVFA 1EAH2 3KT7A 4LLFA 3ZFGA 2WC2A 2R041 5F3IA 2GNTA 3GZAA 2W39A 2RS51 4IEPA 4RYDA 1SBFA 4HN0A 5L9RA 1YIFA 5C8WA 2R061 3T1LA 4CCNA 1S2EA 4RS5C 2V5YA 5K7PA 4IGPA 4CDXB 2VUCA 3UV9A 2E63A 5CYYA 3LKJA 2Y6HA 3CZUA 2G4IA 1BK0A 1YHFA 4K7JA 1QIQA 4R9CA 3B69A 1PM7A 3M70A 4UT5A 4OHVA 3RWNA 4UOJA 3WNXA 2OS2A 3A22A 5B4NA 1RMU1 1W2OA 1W6PB 4LIVA 4QPIB 5FYUA 1E5HA 1ZBA2 3FLTA 5JAXA 3ZXLA 3S5AA 4JGZB 3P5BA 3HNYM 4LXLA 3MPBA 1OURA 1HB2A 1CAVA 4WZFA 3OG2A 4ZU5A 3N35A 3WW1A 5FZAA 2VZTA 1XE8A 5A3PA 1PIV3 4MVTA 4E8CA 4L2NA 2PHFA 1JZ3A 3THDA 4I0AA 3BGAA 1TE1B 4KQ7A 1HRI1 1I5ZA 1DYPA 1X50A 1U5XA 4M3CA 3VBHB 1LAJA 4OFGA 1JYIA 4HSJA 5JOYA 2XWBB 5GLZA 3MF9A 4R8HA 4KWUA 4JC1A 3AYCA 2YPJA 3C8XA 1MACA 2FBEA 4LOTA 1MS1A 4QQPA 5L7OC 2ZCWA 1EUTA 1Q8OA 1H8VA 4KBZA 4MZUA 2P3KA 5HXMA 1XJAA 2JKBA 2WT0A 4FPLA 4DQAA 1FT9A 1FPN3 2XUMA 3OTFA 2BVVA 2ZX1A 4CEYA 1HRV3 4AI8A 2WFF2 2IVJA 1PMIA 2FCUA 1MQTC 2QZ3A 1W2UA 1IQAA 5FJKA 1SLLA 1OH4A 1HX6A 3GXUA 3NW4A 1O3SA 2OZ6A 2VXJA 2ZGLA 1QXJA 4TSVA 1R091 5DUUA 1VE0A 2ZX4A 3IZOA 5FYVA 1RUJ2 4LBQB 1NXD1 2ATFA 1V6LA 3FZ3A 3U78A 2C4XA 2JD9A 4OQ8A 1XYPA 2WZPP 3J7NA 5B2GB 5FZ8A 1Z7S2 1S0BA 1W90A 4GH4A 5FYBA 1W6QB 1ENQA 4QX7A 4PQQA 5KHGA 2BFUS 5I8YA 1UX6A 4QX3A 1NCRB 3ZXJA 1F15A 4DFSA 1GBGA 1RIRA 1S0DA 3USUB 3IPVA 2K9ZA 3PVEA 4GB33 3AL5A 2XKOA 2E7QA 2Q8DA 2PTMA 5BNPA 5FY8A 3RRDA 3WNKA 3GZTB 3VBUC 4JV4A 5CNAA 5LZ6A 1E57A 1UU6A 3K4AA 4QQ2A 1ULGA 3Q8FA 2QQWA 2ZS6B 1JYTA 1QMJA 3MHZA 2CGOA 4LKFA 4Q0UA 4PLNA 3ZO0B 5C4WA 4A4AA 3POBA 4YZ1A 1COV1 4MYEA 3M2MA 4NRQA 4Q0SA 2A7AA 5IJRA 1JBCA 3UETA 2RM23 1N47A 1POV3 1S0CA 3POFA 4NHKA 5SV5A 5E8AA 1ZBA1 3OBRA 3S0MA 1V9U2 3KV9A 4WVMA 4BOWA 3WF2A 1LHUA 2XJTA 1OKOA 4LBMA 2JIGA 3SEPA 3ZOIA 5FZHA 2DTYA 4AHXA 3BTXA 1RITA 2X05A 3BN6A 2Y38A 5HCHA 4LBNA 3LDRA 2WIIB 3MZHA 1MPXA 2D7FA 2YFZA 4QD2A 4N8MA 3M7AA 1SFNA 3EHKA 1QOOA 3POYA 5E16A 2IXKA 4AFMA 4CUGA 3SH4A 2R0FA 4CCOA 4DUXA 1D0GA 4FFIA 2D43A 2D6MA 5IK7A 3A23A 3EJKA 4HOOA 3J7MA 4Y22B 3TEWA 5C5TA 2AREA 2AZ5A 2RDRA 1FMD1 4N43B 3T0DA 4JKKA 1MZ5A 1IKPA 2DVAA 2H0BA 2WFF1 5FJHA 5T3NA 4CEYB 3N7JA 1RUG1 4BYYA 1JZ5A 1UCXA 2XHNA 1GMMA 2BQPA 2ZAHA 4RGKA 4DS0A 3AKTA 3HAGA 3PTRB 4GWJA 3R6SA 3AYEA 1C4RA 3T2QA 1SBDA 5L9VA 1NA1C 4YG6A 1VRBA 3V0AA 2ZGSA 4D0QA 3OPWA 4XQWA 3IAPA 5FYIA 5C3OA 2VZ3A 2ZXQA 4FPHA 5JOWA 3OYWA 2CSGA 5L73A 2OUJA 2XLFA 4D7YA 2W1UA 2O1QA 4INDA 2A6WA 1AR63 4IE5A 3ZIXA 4CP9A 2JDYA 1RUE2 4OVEA 2DURA 1VBD1 1YJLA 1W0OA 4MGIE 5LATA 1R1A3 3N9PA 5FIXA 1W05A 3D6EA 3UJOA 3RI9A 2VZPA 2ZA9A 2WS93 4WM8B 3FFQA 4XBNA 1NZCA 2JXAA 3K77A 3WOGA 5HCBA 3K51A 5GZGA 4TLGA 4CDXA 3BCWA 4XF3A 3SNMA 1R082 1RUH3 3JU9A 1B09A 3GGLA 1LHNA 2OX0A 2WKKA 2ZX0A 3CJIA 4CEYC 3RNSA 1VMJA 2G9GA 2Z42A 3ELNA 3GBWA 4YW5A 3ZFGB 2MEV2 1UYZA 1PZ9A 4AOCA 1O5UA 1OUSA 2JE8A 2VNGA 3JCIA 2QQKA 5DG2A 3ZX7A 4LMFA 4BB3A 3IDCB 5JZGC 4FOYA 2IZWA 4NROA 5HI0A 4O7XA 1DFQA 3N9MA 3IKWA 2ZAAA 3KM5A 4GXLA 4QX8A 4ZPIA 4RR3C 5C33A 4QX2A 4UFJA 4ONUA 2R30A 4JDOA 1GFF2 2EXIA 4MXWA 2AC1A 2XH6A 1WBLA 5FR3A 1NQDA 4AQ2A 3CKHA 4XMAA 4G4FA 4AFDA 2ZGTA 4OUSA 1H1MA 1LOFA 2VXRA 1VPHA 4XIKA 5A7WB 1XSRA 3U37A 1CONA 1R1ZA 4AEDB 3FHAA 3MUY1 4AQTA 2YFUA 5BNPC 4QWNA 2RS13 3PHMA 4LE4A 3UK9A 3TOJA 1W6OB 3ACFA 5ANQA 4DXZA 3ZFFC 4KL1A 1HXS3 2W3JA 5JOXA 1OLRA 2LALA 1KS4A 1EV11 1KJRA 3HR9A 5JCTA 4XDQA 1STMA 3O1RA 1RUC1 3EB7A 4AHYA 1UX7A 3UESA 2ZJCA 4F3JA 4E9KA 4XC9A 2R073 3LZZA 3WCRA 1UQXA 3QACA 1SMVA 3H3LA 1CAUA 2YBKA 1JW6A 3IIIA 2Y6JA 4O9GA 5FWEA 5C4WB 1C57A 1G9DA 3ZSLA 3IB3A 1RJ7A 5DUWA 4I01A 5FZOB 1BEV3 2YUEA 4UW5A 4RSUA 1LHOA 3T4VA 4DXTA 3H9AA 4PHZA 4V2VA 4ASKA 4BE3A 3MW3A 1DGWA 1VR3A 2JG8C 2CDPA 4XFHA 4AVVA 1CR7A 3ZN6B 2EAAA 3IDAA 4GWMA 5H9RA 1EV12 1A78A 4XJWA 5D2AA 1I6XA 5FCCA 1UU5A 4QB6A 4WM7A 5GZDA 5BNNC 1OA4A 1J1TA 1H2LA 3GBFA 1MQTA 4FTBA 4AFBA 2XDVA 1NKGA 4L11A 5HCFA 4AFCA 4M3CF 1BVP1 2DCTA 2JENA 4IESA 5FUNA 5A7PA 4D3WA 5C9AB 2J1TA 4RQPA 4FOQA 1QY4A 2P3JA 3VL8A 2CYFA 1NE4A 4P14A 2WZR3 1SFPA 4RR3B 2HBUA 4S2GA 3H7JA 3WNNA 3V64A 3B94A 1GQPA 1O5LA 3TAYA 1K5MA 1KJLA 4FFFA 1UWWA 2YG0A 4TYSA 3I2JA 1V9U3 1XNBA 2J1EA 1VALA 4IEVA 4BM8A 4CYDA 1WD3A 4EWAA 2F6BA 5DZFA 5T5JA 3W59A 4DOUA 1AR83 4W8JA 1IKQA 2D40A 5FRAA 4CDWB 1A34A 5FZ9A 2Y26A 3DPRA 2DTWA 3CL1A 1G7YA 3DEMA 3ZFEA 2DU1A 2ZHMA 2ZX2A 3PMSA 1ULCA 4LNVA 4YW1A 1ASJ3 4NVPA 1U5IA 4AQSA 2HWB3 2OZJA 4BMBA 1D2SA 4TXWA 2CDOA 1UIJA 4AR2A 3BODA 2CNAA 4C8DA 4FBFA 3WZ1A 3RJ2X 2Z69A 4K40A 4MXVA 1PMJX 5FP9A 3VBHA 4QXCA 1C1FA 3KCXA 1RB8G 2VMEA 2YPDA 3ZSMA 1F8VA 4XJAA 4GQ7A 2MEV3 1OH3A 3H0OA 3MEPA 4NR1A 4Q4V2 4Z82A 1I1EA 1DZQA 2XBO2 3VDCA 2C26A 1JS9A 1VRH2 2ZPXA 3I2KA 3U4SA 5C3QA 1SLTA 2WWJA 4DZGA 2R0HA 5FPUA 1YEWA 2CHHA 5J09A 4AI2A 5A7NA 4AZZA 2GNBA 4ZXEA 3PL0A 3VBSC 4JGZC 4D7TA 2RS11 2BGPA 3M3OA 2WS91 5B4XA 2WO2A 3OUHA 3UYJA 4OULA 1CX1A 2HBTA 3NNLA 5EJZB 3VBOC 4YFWA 3WV6A 1BVVA 1F31A 2CGNA 1LEMA 3HOBA 4UF0B 3SQOA 1S55A 5T55A 4ASMB 5JPMB 3BKZA 4IW3A 5I0RA 4FT8A 5A3UA 3OY8A 2EA7A 3T3YA 3LGRA 1ZZ6A 2XJSA 5FZ1A 2VTXJ 4A6OA 1L7QA 1YQCA 3CQOA 1QJU2 1EYBA 2XWJB 4YGEA 2HEWF 1JYCA 2HWC2 1J1LA 4XHBA 1W28A 2D5HA 1AYM1 1X9TA 1JOJA 2K0GA 4IV3A 1XE7A 1C28A 3QH7A 2J1UA 3AP7A 5F8PA 1H2KA 1SACA 1VAKA 3MBWA 4LK7A 2FCVA 1AL21 5FPZA 5IWFA 1BMV2 2ENRA 3I59A 3POIA 4CCEA 3PTYA 5F9TA 4PI0A 4YARA 3VD9A 2RDQA 4CXXA 3DXUA 5BYNA 4JTNA 5KHKA 4XF9A 3ZR6A 1V6OA 2D93A 5GKAC 1PHMA 5DMYA 3W21A 4DEQA 1FAYA 2NZ9A 2WA3A 4YGDA 2RJLA 3NNFA 4PIXA 1LOFC 1L7LA 3HQUA 4D6RA 2D6NA 3N3HA 4I3GA 3FHIB 1SZBA 1WMDA 3CLPA 4JGYA 2UY8A 4MGSA 1HRI2 3OSDA 4PBOA 4UW6A 4LHNA 3A7QA 4IE0A 2DFBA 4E4HA 5L7OB 4LUKA 2JX9A 4P02B 5L7OA 1FATA 1UMZA 1XXNA 4LLOA 4UBGA 1W9SA 2VUJA 3HEIA 2VECA 1ZX5A 5FPAA 3HT2A 1L3JA 2GC2A 4HPKB 1LOEA 3WF1A 4LO6B 2BRTA 3PU8A 2A73B 1LESA 2NP0A 2G19A 4LKEA 5T50A 2WWUA 3LFMA 3WCSA 3JUUA 3JXSA 5EV7A 4JVAA 1QH6A 5CFCC 2EXHA 1AXKA 4F7ZA 1UW8A 4LO7A 5I8SA 3MICA 4YW2A 2WAAA 1LOBA 1C8M3 4Y5Z0 3WR0A 4YZ5A 1LTEA 4IV3B 5J3UA 2HWE1 3ZYHA 1UZWA 1QU0A 1ULDA 2ZEXA 2ZHKA 5FP3A 2RJ2A 2XKPA 5BPXA 2QQPA 1TMF2 5EZWA 1REFA 4CE8A 4XE9A 1XSQA 3RZLA 3C3VA 3ROUA 4X8NA 1WMXA 2E9QA 5J36A 3OY8B 3I7DA 3WNPA 3JB4C 3RVHA 3A0KA 2EIDA 3MIGA 4NJ4A 4JDMA 4XAAA 1FYUA 4QU1A 1OXCA 1RUD1 3WNMA 5T5OA 5G05L 5HV0A 4XFBA 2VQAA 4LBOA 1T6GC 1GWLA 4FQZA 2PAMA 1P8JA 4LA3A 2RR11 1UOFA 1RXGA 1IG3A 3NKGA 3VD3A 4H14A 3O5SA 4DXRA 2HWC1 4UFLA 1ND3B 4NO4A 4IE6A 5FY1A 2X8KA 2B4KA 2VE1A 1ONAA 2P37A 1ZVFA 2GC3A 3O14A 3PJYA 4ZZ5A 4D6SA 1V6IA 3JBG3 1FMD3 4S2HA 2W92A 3AMNA 4QPYA 2FCTA 2MNGA 3KB5A 3WP6A 1HIXA 3WNLA 1W39A 5F2WA 4UYBA 1QJU3 3RDIA 3AMQA 3SXWA 2VL4A 5LRRA 1CQ9A 4FAHA 4F8AA 1VBB2 2WO3A 2IXLA 3WW3A 4RD7A 1RUG3 4EN9B 1W8HA 3LPGA 3PUIA 5F5IA 3DPRB 5BNOC 2PHDA 4GD4A 2CY6A 2XQRA 4JRAA 2CGPA 2EXJA 5FMDA 2D3SA 4AAPA 1EY2A 1BZWA 3JQWA 4P9YA 5FYYA 1U12A 3JB8A 1OLQA 4QXBA 5FK8A 3RYPA 2DBNA 1AJKA 3POJA 2HJIA 2LW8A 3RMXA 2DVDA 1W0NA 2YYOA 5KBFA 4ZHNA 5FYHA 3G7DA 1ODMA 3KGLA 4HKOA 4NHYA 3UKVA 2CAVA 3GALA 1JXNA 4RQPB 3W20A 3UT0A 4RS5A 3CHXA 2ARCA 1YIPA 1OSGA 1QXPA 3CDZB 3H8UA 5H9QA 4NE9A 3V0BA 1VBC3 4IQPA 4IXLA 1HB1A 1GKBA 2DYCA 4XUQA 4QKFA 3EXUA 2DUPA 4BMEA 1R64A 3HVDA 1AR91 1Q8SA 3NO8A 3E5XA 4Q8LA 2AUYA 2HWE2 2XJQA 2XL7A 5GM0A 3T08A 1R1A2 1XC6A 3HQXA 1C5HA 3NRUA 1DDLA 4FOWA 2D97A 5A7OA 2JDZA 3ZYBA 1OLME 4R9BA 3QD6A 4YVWA 3KMHA 3ATGA 3KF5A 5I91A 3MW4A 1F9KA 2X5IA 2RMU2 1WW4A 5EYYA 1OF4A 4I0BA 1ZBE1 2X53S 3BVCA 3KV6A 1D4M2 4WM7B 3NNJA 5KXCA 3SCGA 1W6NB 2Q8OA 5KHJA 2PA7A 1UU4A 1XNDA 4MO3M 5K4LA 3AP9A 3G6JB 3VKMA 1RVF3 1PK6C 3WD5A 1NX9A 4FPKA 2WO7A 2W08A 5FUIA 5F6KA 5F5AA 1REDA 2XLGA 2P6CA 1AJOA 4NUBA 5CB7A 3CU7A 3WDYA 4QDSA 1IPKA 3AX4A 4CXWA 1MS9A 5LA1A 4K8RB 1ACCA 2VGDA 4OHZA 2VNOA 2G9ZA 3B00A 1HXS1 2WFPA 4FP3A 1XOYA 3O0WA 1RUH1 2MHFA 3KV5A 3N7LA 2H0VA 3J7LA 4IEYA 5A3LA 1C8M1 3E6DA 4AW7A 1ZA7A 5JMOA 1H9WA 3OD4A 4W6XA 2VOKA 3FBYA 5A7QA 1GR3A 2VZSA 1GZCA 3W58A 1YLLA 4BQ2A 2IUWA 2NPIA 1SEFA 1RVF1 4JZRA 5JLVA 4I0WB 4AHWA 2RS53 1FV3A 2WNUC 4LTAA 1UOJA 2XONA 2IVIB 2QVSB 2PN5A 4LOSA 2VQTA 3THCA 2E7TA 4AEDA 1N1SA 4BISA 4EE2A 1KQRA 1DIWA 5FAXA 4NHXA 2GMEA 3RYRA 4EV0A 2IFWA 1ULOA 2ET7A 4CCCA 1UMHA 2JE9A 1AR81 4KNCA 5ACA3 2PAEA 3NQHA 1TME3 2DFCA 2WN3A 3HN1A 4MSVA 4X6RB 1V6JA 3SC7X 3T30A 2LTNA 1O6UA 4OI0A 5C3SA 1DZTA 1NQJA 5A3TA 1V6KA 2PFWA 2X10A 1AF9A 3LSDA 1QWRA 4JQRA 5E89A 3IWZA 4MV2A 3O1SA 3SLIA 2WT1A 3VBOB 4XXAA 3VBRB 1W8OA 2L9LA 5CG8A 1W6MA 4CCJA 4NIHA 4KWLA 2MPFA 1YC61 2LROA 1HQNA 1US2A 3OCPA 1PM4A 5CAZA 1QJY3 1DQ5A 1WD4A 5A32B 5CA6A 4Y1ZA 3E5UA 3U10A 2ZMLA 3WDVA 1FI2A 4EN0A 5IK5A 1GV9A 3PIJA 3UGGA 2WNVB 3V0AB 2QUOA 1GSLA 2YB7A 4GALA 4Z1VA 2ZOEB 3SCHA 3I3MA 4A45A 3ZXFA 2JIJA 4YRDA 1Q8VA 3O1TA 1QJFA 4GAZA 1K12A 3I2GA 4YVSC 1IPSA 5JPNB 1IOAA 3TNQA 2BPA2 4XMIA 3VBOA 1XPWA 4QGMA 4E4DX 2EIBA 2ORZA 5EWSA 2D6KA 5FTTC 5IVFA 4M00A 1PVXA 3E5QA 4PLOA 2A6YA 3S5QA 5FP7A 1AYN3 3J8F1 1Q43A 2V4VA 3GJAA 5F5QA 3S6PA 1WW6A 3FUQA 3P3NA 4YZ2A 1PGL1 4R9DA 3K75B 5FMOL 5KXBA 4OHYA 5IFPA 1ZZ7A 4B8EA 4LO8A 3OGVA 4NWWA 2RS33 2CWMA 3Q8BA 2O8QA 1SCSA 4YGBA 1BYHA 4OYUA 4LPLA 1J3QA 1VBD2 4ATFA 2ADEA 4A41A 3KVBA 5FP4A 2W95A 1H1AA 5ERLA 3DXTA 2YBPA 4V1PA 1LOAA 3MLJA 1J59A 4E4SA 3H8XA 1RTVA 4Q1RA 2HYXA 2Y34A 1NUKA 2ET1A 1QH7A 3U14A 2BV4A 5ABJC 5BNNB 1E5SA 4GKYA 2R16A 4PLMA 4A3XA 2PHWA 4TWTA 5F39A 4CEWC 4B7EA 4GKXA 4AK3A 2HH9A 2BTVC 1XRUA 2NMOA 5DPNA 4ZS2A 2UURA 3VKLA 1JHNA 3THTA 2J42A 4J1XA 4OHWA 1T6BX 1Z7S3 1SDDB 3JD71 2EALA 3LEGA 5IVBA 2VCMA 3HPNA 1OLMA 4C91A 1Q3EA 2G1MA 1QJX3 4CP0A 2QCSB 4HL0A 5FFOC 5LBBA 3AMHA 5EJ3A 2WINB 3OBZA 1IGOA 1H1IA 2BU9A 4S2DA 1LODA 3R4SA 4PF5A 1WA4A 5KHHA 4CCDA 4WM7C 1W8NA 4CDQC 5ACA1 5C4WC 2FDFA 1BCXA 1W6QA 4AXOA 5F3EA 4O61A 3VLBB 5JXIA 5CFDA 4CCMA 2X5IB 4RA0A 2WRAA 3GNEA 1NCQA 5IVYA 3E1F1 2VZUA 2DCZA 2A6XA 4AL9A 5IHRA 3UKNA 1WCDJ 2QQMA 1ULEA 4M4PA 5BNPB 1VBA1 3AK0A 3NJZA 1MVEA 4QX5A 3L9JT 2AEZA 4AE2A 2G9FA 1PO12 1NCRA 4S2FA 4UI9L 2EAKA 4KWKA 3ZXEA 4Q8KA 1RXFA 1IS5A 1DF0A 4H55A 5FYMA 1JUIA 4GIQA 4JTOA 3V0BB 4UW4A 4N53B 1G9FA 1RUJ1 3GYDA 1TME1 1J84A 2D6LX 4UFMA 2XB6C 2Z5WA 3DCQA 1G6NA 3LA2A 2WFF3 5BV6A 3V56A 1VBE1 1K5JA 3LF7A 2VZQA 1PZ8A 4C1XA 4LKDA 1GZWB 3OPTA 4NMIA 3GF6A 2JB4A 4H7LA 2WT2A 3F2ZA 2FZ1A 3E6CC 2EICA 1YYNA 4NOTA 2Y6LA 3KCCA 5FY0A 2OPWA 3M3IA 4COWA 3IBMA 5CFCB 2ARXA 3KSCA 5LK7B 2H6BA 1RHI2 4GA9A 2GC0A 4Q4X1 2NN8A 1QDCA 4LHSA 1AR73 1ASJ1 4KG8A 4M0HA 4ORFA 1W9YA 4CU8A 1UIKA 2BYVE 3IAQA 3RZMA 1DQ4A 2DBIA 3DKWA 5LY1A 2D98A 4L8QA 3RGBA 1GZTA 3WQBA 5JR2A 4HG6B 2YBSA 3ETPA 3J7HA 4I3PA 4PQ9A 4XDPA 4A6SA 3AFKA 4M0NA 2JDPA 3MIDA 3JD72 1LKNA 5C6CA 3WDWA 3GBGA 1W6PA 1MS4A 2QQIA 3LQCA 3TNPB 1RINA 2BFUL 5GLTA 2F4LA 4Y20B 4GWIA 2BBAA 2V72A 3POEA 5C7GA 3IN9A 1POV1 4NAMA 5F6LB 3N9NA 1QOSA 4CEWB 1JYVA 3WLUA 2JEMA 3PURA 1SLBA 4HKLA 4URTA 1ENSA 2WYFA 1Y7BA 2Q8CA 3WHUA 1ND3A 4DUWA 4SLIA 1QF3A 4YM1A 3GHMA 2VG9A 3CEWA 5FXZA 5FZBA 2PLV2 4E27A 2ETEA 5C71A 2VC9A 4J1WA 1Z0HA 1YQ2A 2B42B 1WCQA 3AP4A 1PX4A 2Q5TA 2YXSA 3K3NA 3MYXA 2DVGA 3RWKX 1OPOA 4PDWC 5LK5A 4CU7A 2WQ8A 4AGVA 2XUEA 1QQP2 2BZDA 1OVSA 2BJSA 2VOTA 3N9LA 4FFGA 2QKDA 1H8TA 3U1XA 3CIHA 5DAPA 4AEJA 4N43C 4A2UA 1JUHA 1KFUL 4UFKA 5F1RA 2WNUB 4BXFA 2P17A 2PELA 2WN2A 3OEAA 3OUIA 1G9AA 1UY1A 1UAIA 4IGQA 4JKLA 5CU1A 3D5OA 4Y5SA 4AHZA 4BLIA 1Y9MA 1OOPB 2ZACA 5FMOS 3H1WA 4LBJA 3RSJA 1PO11 3AKSA 5IVCA 4YW4A 1H4GA 2VY0A 4ITCA 1TVGA 4YNIA 3O7OA 1HRV2 5AFEA 3H7YA 3ECQA 3NWKA 4K8FA 4K20A 4MGYE 3WDUA 1B35B 1GP6A 2Y6KA 2BERA 2JG9A 4Z2WA 3AZVA 4XBQA 4FQ4A 3BUCA 3OOXA 4NHLA 1PGL2 1AYN1 1PIV1 3J8F3 1ULFA 1YI7A 4XFAA 1VBC1 1N1TA 1TMF3 3DUIA 5C8CA 1UYXA 4KMQA 4LUMA 4QQOA 1G86A 5GLWA 4AVTA 3MIFA 1RUJ3 3POWA 4OI1A 1GNHA 1VBD3 1QJU1 2ADDA 2C0ZA 2RS12 5FO8B 4B3NA 1RUD3 2CV6A 3LSEA 5C8CC 1O8SA 4AQ6A 1JZ2A 4B4PA 2I07B 1LGCA 5FK7A 4A7YA 1E5IA 2VH9A 4NPLA 5FP8A 1ZRRA 2E32A 3VBRC 4Q4X2 5CKQA 3VBFB 3AVRA 1W8UA 3WF3A 2RHPA 2TUNA 5FBJA 5AC92 4IV1B 1ASJ2 1MVQA 3MO4A 2XJPA 2Y60A 1N3OA 2B7YA 3BIWE 4MGQA 4IEXA 4BZ4A 1U0AA 4CRQA 4CU6A 4EN7B 5A6QA 5FZGA 3KF3A 1NYWA 3I4IA 4AEDC 3MV01 4LEJA 5JIAA 2WNUA 1WMEA 3AJYA 4XTMA 4UWDA 5A3WA 2Y33A 1KGYA 1HKDA 2XOMA 3FWEA 3I3EA 3HNMA 1F4HA 1CJPA 3IDEA 5A1AA 1Y3TA 1FOD3 2B9VA 2C1FA 4Y33A 5FQ0B 5F3GA 4A7ZA 1NLSA 3ZYRA 1OT5A 2UU8A 4CZSA 3VD7A 4RQPC 3NV4A 4LKSA 5DG1A 1ND2C 3DYOA 3BOWA 3H3UA 5BUVA 3DECA 5C9AC 3B93A 3ITQA 4YWAA 3WNOA 2OA2A 3ORJA 2FZ2A 4XJ9A 3TEYA 1QGLA 1KEXA 1X7NA 3AM2A 2FDHA 1URXA 1OQDA 3CBNA 4P9LA 3TWIA 1DYKA 1TG7A 3PLQA 1S2KA 2VU9A 4ZXKA 4Q4W3 3QCWA 4JCKA 4XF4A 3CNAA 1D4M1 1Z78A 3MFCA 4O65A 4Q4Y3 2J1SA 2QQJA 4CDQB 2P4EA 4YM3A 5JUVA 3WEZA 1X8EA 3KT4A 5ACA2 1LR5A 4YM2A 4XXPA 4E2SA 2QZ2A 2GP3A 5AFBA 1JYNA 3T2PA 3BOPA 4LORA 4FTEA 4B7KA 1J58A 5FYTA 2GNDA 4COZA 1HW5A 3MFAA 3VZJA 1Q5OA 5C70A 1F4AA 2ZHLA 2W0XA 3RYKA 4FAGA 3CZJA 4QM8A 1QKQA 3CMGA 1VBE2 3OD0A 5IT6A 4LBLA 4XDOA 5L19A 2XVGA 2H6CA 4KU8A 2UYAA 4IE7A 4DRRA 1HXS2 1OBNA 5DXDA 1US3A 4JHZA 3OJBA 4CDQA 4Z8BA 3OGRA 5CFCA 2ZKNA 4PCRA 2ZABA 4Y3OA 2UWCA 3AC0A 4QPGB 2VBDA 1JYXA 1H6XA 4DPNA 5A70A 4QPIC 2DDUA 4Q4V3 3USSA 2HWF3 2VR4A 2QQLA 3M8LA 4CDWC 1ZZCA 2BW8A 1OVPA 3AZYA 3ZDVA 3ZFEB 3ZYPA 1RUNA 4CDWA 2GALA 4FPYA 2F17A 4LE3A 1ZZ9A 4MOAA 4Q26A 5DQ0A 4ZU4A 3INAA 1PGSA 3ASIA 3NJXA 4CUCA 2HWB2 3VDDA 4C0BA 3B01A 2B8MA 1UL9A 3LB9A 1BLZA 2YY1A 4LR4A 5FQ0A 1DGWX 2A70A 1X8MA 1EAH1 2O8OA 3T4HB 4D8MA 3AB0A 1W8WA 3MDPA 1IHMA 3AMMA 3S30A 2JDKA 1D7PM 1DQ1A 1XNKA 2WABA 4F83A 1PMHX 2ERFA 1LOCA 2W91A 3KV4A 4FSJA 5I93A 2R062 5FZ4A 3ZFEC 4IV3C 5C3PA 1I5PA 2ILMA 2YMZA 3OBAA 5G04L 4XFCA 1XQNA 3BTAA 5A3MA 2RVAA 3ZSJA 5CFDB 2JDHA 5FZKA 4B4QA 2VCCA 4YVWC 1SDWA 1PO13 3T09A 1O3TA 4P9XA 1NZIA 5DAXA 1G9CA 2BNMA 4NIGA 1UOBA 2SBAA 1MS8A 1V6NA 4PBPA 5IAVA 4XACA 3BIEA 3CF6E 1UOGA 3ZDSA 3NJYA 1HV0A 2XQXA 2WUHA 4Y1XA 2ZGRA 1DLCA 4LO5B 5JXGA 4AFAA 5A7SA 2YV8A 1VMFA 5FMCA 3HWJA 4JDNA 5FY9A 2UYBA 4MADA 3X29B 1GP5A 1VRH1 1JZ7A 3O0XA 5KXDA 2A5ZA 4ES9A 1YQ6A 3VZOA 4CP1A 3VBUB 1X82A 5BNNA 1UZ0A 4IEQA 2JG9B 2VMCA 1A6CA 3VKFC 4XUPA 1UY3A 1KRIA 5JR7B 3ZYGA 3K3OA 3LEIA 4O9EA 1JH5A 4FOVA 3CO2A 2GU9A 3WSOA 4B4RA 1S0EA 5J96B 2FDIA 1BBT1 2DWRA 1APNA 2NYYA 2D3PA 2GNMA 1AR62 1BK1A 4ARXA 1QJX1 3MIHA 4Q5OA 4FTSA 5FMBA 2DUOA 1A8DA 2DF7A 3LA3A 2ZGKA 1YFXA 1LHVA 2ID4A 3A21A 2A3WA 3U07A 1WW5A 5EIYB 1UXXX 2C5DA 4XQ4A 1UY2A 3FC0A 4KG0A 2Y6GA 4QX0A 5F32A 4UW3A 4W50A 4XW3A 3SCFA 1OKQA 4NWVA 2XBO3 3I59B 1O7FA 1R092 2PHUA 5FLIA 2VD7A 4YYOA 1AX1A 1CVNA 1WMFA 1SG3A 3VHOA 4IEUA 4XVHA 5AC91 4XFIA 1TZOA 2VMHA 3CJIB 3K2OA 3KD4A 3ZYIB 4CDUA 2RM22 3ME2A 4RFT0 1W3VA 2P6HA 3OPZA 1JU3A 2RE9A 2W47A 4FVVA 4AAXA 4BQXA 1WKYA 2P5BA 4BQ3A 2P3YA 2BP6A 2DVFA 1I3HA 1XYNA 4IL7A 4Q0VA 4XZUG 5EXOA 5AVAA 1W03A 2JG9C 4XBLA 3T0AA 3VBSB 4LBKA 2VNVA 2XGXA 4K9SA 1GWMA 1AHSA 4AEMA 3EQEA 4BK5A 1YFUA 3VZLA 2QQOA 3H1YA 4NIIA 4ASLA 1OFSA 1LULA 1A3KA 4ISRA 4P9WA 4DY3A 4R9AA 2UY9A 5FXVA 1ZM1A 4AVBA 3UL2A 2ZGPA 3MLKA 2Q4SA 4BQ5A 3LIHA 4IEWA 5LWBA 4M4RA 5FDBA 3OGSA 4HVRA 5JSPA 2EVXA 4IETA 4DUVA 5FO9B 1CZVA 4RHV1 4DIQA 4OUEA 4CDUB 4CP9B 1CWPA 2B39A 4LULA 4PF1A 2XJVA 1WBFA 3ZN5A 5D1IA 3ZXGA 4YPJA 1LGNA 4YZ3A 4E2GA 2R1DA 4NAOA 2Y0OA 1FPN1 1XBFA 2IC1A 1JU4A 1AL0G 2NMNA 4DY5A 5CEHA 5FO7B 3A0NA 4KGGA 1NA1B 5C3RA 4PDWA 2K46A 4FCAA 3E6BA 4HANA 1EUUA 3KCYA 2HWF1 2O14A 1D4M3 1HJGA 2VBPA 5I0SA 1UKRA 2FDGA 1WWYA 4Q4V1 3L2HA 1T2XA 3NV3A 3WF0A 2SLIA 1EP0A 4MUVA 2DU0A 3NSTA 1JI6A 2QNKA 3RG0A 3U0ZA 5GZEA 2VVEA 2WZR1 5KHIA 1SPPB 5GALA 3J26N 1FV2A 4B1MA 3AZXA 4GJZA 3PDQA 1V00A 4Y22A 2YU2A 2WLPA 3LAGA 4X6QB 2JICA 4MHRA 4OZXA 1K5MB 1V70A 5A1LA 5KC6A 2YU1A 1XYOA 1L7RA 2KXLA 4QDRA 2PAKA 4RR3A 5FYZA 1OQ1A 4Z2AA 1RUOA 1UXZA 4N90A 3WDTA 3BI3A 3LOIA 4JGYC 3OBTA 2EIEA 4BH9A 3RI8A 1VP6A 3PIGA 1VIWB 4Q4X3 1C8NA 4Z92B 1XNCA 1C5IA 1A8MA 4HXCA 4XQDA 4AVSA 4K1YA 4WVMB 1XB9A 2GMPA 1XU2A 3VBHC 1YCIA 4QHOA 1W2TA 3O1VA 5KWRA 3QBQA 2K2SA 3W5NA 1Y43B 5FY7A 3D0JA 3BB6A 4L0PA 1UF2C 1UPIA 2KA3A 5D8AB 4HZFA 4KU7A 3AFGA 4YVWB 4ZS3A 1K3IA 4N9IA 1LGBA 5FZOA 2I45A 2W2IA 3EBRA 2Q1FA 1DQ2A 3FFZA 3GDBA 4MH0E 4HVOA 4YFZA 5CADA 3WQ0A 3ZFFB 3OUJA 3J8F2 1MZ6A 5FPXA 1AR93 3AVSA 3B7MA 4XUOA 2ARBA 5FZCA 1GYKA 4AVAA 1OI6A 4Q4Y2 3WW2A 1K5MC 2QE3A 5FZLA 5DZGA 2HWD3 3I3QA 1H6YA 4WZCA 1AZDA 2R49A 1W6OA 1ZRDA 4XIOA 2C9KA 3JBG2 4JX0A 3HNBM 3Q8EA 4W6WA 3TEXA 2VZVA 2AEYA 3NKTA 3VDBA 5J37A 2VBBA 3KQ4B 1BXHA 3UKTA 4AEKA 4LITA 2W68A 3MI8A 2GSYA 3ILRA 1YO8A 2RMU3 3LPFA 2BWCA 4IDZA 2FHRA 4MGZE 5L9BA 1NE6A 5CKMA 5J48A 4XHXA 5A1FA 2XXZA 3IDBB 1VB2A 1W9WA 3IMNA 4Y5TA 1RUF3 1KXGA 1NA1A 1W06A 1CD3G 3APBA 4HONA 4N7IA 4UFIA 1E5RA 5LRSA 5DAVA 3WHTA 3WP4A 2HWD2 1QDOA 3O0VA 3H42B 1CZTA 1W2NA 1O8PA 1QEXA 2J7MA 3WX5A 3SKVA 3WY6A 2GMMA 3GM8A 2YC0A 2E26A 5FZDA 3D82A 3DGTA 5I8TA 1S4CA 2E33A 4AI9A 3H3ZA 4MG2A 4CDUC 3RFRA 2AGSA 1D4VB 3C7EA 1TNRA 2WDBA 3BYWA 2VZRA 4FPCA 4BLJA 2KD7A 2OT7A 3WP3A 4H3WA 5HV4A 5K8SA 3VV1A 2VW0A 2GZWA 3NVCA 4OI4A 1CIYA 3D8CA 4UBHA 4XCBA 5K0UC 5FZIA 5E88A 4BIOA 1COV3 4IUGA 1YQ8A 3SEEA 3DV8A 1MZFA 1OA3A 4BK4A 2WR9A 2GAUA 5CVRA 2D44A 5LEKA 4G3YC 1O91A 2IXCA 1F5FA 1PGW1 4E8DA 1AUYA 2TEPA 4QKBA 1Y4WA 2J1AA 4FP2A 1W6MB 4XJUA 1N3PA 3PMEA 2RG4A 4YW6A 5T54A 2Y8KA 3B9IA 1IQDC 2QBXA 1H0BA 3WUDA 3VGIA 3A4UA 4YZ4A 4QPIA 3ILFA 3VDDC 2VMFA 3FUOA 5FKBA 4COYA 5FLHA 5J1XA 1LECA 3WINE 1GOGA 4GB31 2AH2A 2QDRA 3I8TA 4EYUA 1ND2B 2AACA 1FNYA 3ZXDA 1GLHA 1O59A 5HCAA 4DRVA 4DNYA 2Y6FA 3KLSA 4NN0A 4MGKE 4D69A 2V5DA 2WSUA 4QXHA 3T1MA 5JZGB 1CZSA 4YG3A 4NRMA 5FWJA 1AVBA 3WF4A 4ES8A 2DV9A 4LQRA 1H2NA 2YGMA 4N43A 4OZOA 1K42A 4FXGB 1J83A 4IERA 4DXSA 1WCKA 2LS6A 1W8ZA 2RR13 1SLIA 3H1MA 4CPBD 1LHWA 5JSRA 2PMWB 1OPMA 2Y64A 4GH4C 4BQYA 3EYPA 4G9SB 4XF0A 5FPLA 3O1MA 2A3YA 1O4YA 2HWD1 3M3CA 4IEOA 4KWJA 4OHXA 4QPWA 2PXJA 5FZMA 3KT1A 3RZGA 4MHUA 1TEIA 5E1RA 5C8CB 4CUAA 3I97A 4LJHA 1IPJA 2P3IA 1ZYBA 2R071 3Q9OA 1OQEA 4A44A 1O3QA 2PLV1 3LE0A 3AP5A 1KFXL 2QTWB 5H9PA 3ZLIA 3D3AA 4HMZA 3NAPA 1WUVA 2IXIA 4YSFA 1DQ6A 4JAAA 4P5YA 3VD5A 3SMHA 2GN7A 1SCRA 1AXZA 5EP9A 4UAPA 1HN0A 1W6NA 5A80A 3WDXA 1DGRA 2VTFA 2OXBA 4QQLA 5JSOA 4YG0A 1OFNA 1R1A1 2JDMA 5CFDC 2QJVA 2ZEWA 2F4PA 3S7IA 5LCWL 1C3HA 2KR2A 2NQYA 5IFTA 5FOBB 1LB2A 5F37A 1OOPC 4XUTA 3HJRA 4XZPA 3CJIC 4HN1A 1AR72 1YUDA 2WYSA 3N36A 2ZGOA 4ZZ8A 2NLRA 2QQNA 2WO1A 2ZEYA 2ZMNA 3USUA 2Y0IA 3WQ7A 2J1RA 4Q0QA 3KHCA 1LJ7A 5CBLA 4CDXC 3R0RA 4UXAA 3BTYA 3SISA 3ZXAC 3AXEA 4CPBA 3UNPA 1IS3A 3MF6A 4HSLA 2VZ1A 1VLNA 4A42A 1ZA4A 4L97A 4WBBA 3K4DA 4LO4B 3TYJA 1NY71 1VBB3 3CJXA 5IK4A 3TN93 1S0JA 2ZMKA 3ZXKA 3POGA 2A6VA 4HFSA 1HRI3 1ZREA 4XFGA 1PIV2 2FDJA 4EROA 1M4WA 3WG2A 2VOXA 1N1YA 2X29A 1O4ZA 1XU1A 5JOZA 1VBE3 4PIZA 2VOWA 4XFFA 1HRV1 1RUH2 2W9XA 2PQQA 1W8TA 2PHLA 2R7EB 4Y20A 2EF6A 5LBFA 1EV13 3LOBA 2VUDA 3PUSA 2E31A 3UGHA 2HWC3 1RMU3 1NXMA 3B9CA 4IV1C 5GJ6A 3P3PA 4C0HA 1CGPA 3FX3A 2X5IC 1W99A 1R081 4YM0A 1GP4A 3ALQA 3BU7A 5EJ1B 1LU1A 1YFWA 4LHKA 1BQPA 3ACGA 1KDMA 4AYUA 1AYM3 1HDKA 1PZ7A 3N7MA 4IE4A 1UY0A 4QB2A 1S2BA 1Y9QA 2HEYF 2WNOA 1VBA3 4NPRA 2MEV1 1GQHA 3AZWA 3OB8A 1SHWB 3KGZA 4HBNA 5DABA 3I3DA 5JI7A 3AP6A 1AX0A 2BEOA 2QDNA 5CZKA 1AX2A 1GANA 3ON7A 1TQ5A 3I54A 4XEZA 3MPPG 2D6PA 4CTEA 1RMU2 1GZWA 1RUI3 3NV2A 2JG8A 1JMUB 2VQUA 1GOHA 3FMGA 3O12A 3MLLA 3OEBA 1CESA 5EHDA 2WQ4A 3PVOA 3ABZA 4HK9A 3VHNA 4EWEA 1VBA2 2GH2A 1CPNA 3K46A 3I2OA 3B3QE 5APAA 2XPJA 4Q0PA 1XNTA 3FBMA 4COUA 4QGNA 3C7FA 4YGCA 1FOD1 1OF3A 2WZEA 1BEV2 1DLLA 2LUWA 2PHTA 4QQHA 5J7MA 1PVC2 3LD8A 1UZZA 1SFYA 2QQVA 2WQZC 2RJKA 1WW7A 4FPOB 3TN91 2B46X 2DUQA 1IG0A 3SHRA 4AG4A 4PJYA 4H7MA 4DEVA 1VRH3 3FLPA 3ILNA 3O1PA 1VAVA 1CIWA 2XBO1 2OKXA 1BHGA 1HJFA 1GQGA 1CN1A 2V4AA 1UZYA 1MQTB 5AC93 1ST8A 1GU3A 3NNGA 2EXKA 1JYWA 3ZMOA 1HB3A 2ZKLA 3ZMNA 4DO0A 2N7GA 4E2QA 3AXDA 2XVLA 4WM8C 5IVVA 4RN5A 5JIUA 3WW4A 1PVC3 2WS92 2VM9A 3ZN6A 2DCKA 2FD8A 3ZYJB 2VULA 1C1LA 2GN3A 2RV9A 2YHJA 3PUHA 2JD4A 3ENRA 2RS52 2ZX3A 4EZ4A 1ZRIA 4FPEA 4WVZA 4XCAA 1VBB1 3ES1A 3VHRA 4AI1A 4BHPA 1PGW2 5LBCA 1DP0A 1LU2A 1PNGA 4XAEA 1RUE1 1POQA 3J4UH 1YJKA 1ULPA 1CAUB 3POSA 3V65A 1G9BA 1Y9GA 4TTGA 1PX3A 3ZSKA 1W8FA 4FXKB 1NLRA 2ZGUA 5LB6A 3AKPA 3LFIA 1PNFA 1WLCA 1U5YA 1JHJA 4AF9A 4IEZA 2P1BA 4JGYB 1REEA 3NAPB 4QT6A 5FPBA 5D21A 4BWOA 2Z79A 4CA9A 1KDKA 5EPAA 5IAXA 2VOVA 4RHV2 5GLUA 1FNZA 1RUF2 4Q4W1 5A7WA 1W9TA 4U36A 1N3QA 2GP5A 2HWE3 4ET7A 1NCQC 2R072 1MEC3 4KH9A 1UD1A 1DGLA 3LEKA 2FMDA 3RJRA 4K6BA 2WZ8A 3GCXA 1ND2A 2VUAA 1H8TB 2W94A 4K3UA 4XPVA 1NOVA 5FPVA 3NV1A 4DMIA 1HLCA 5FZ3A 4SBVA 2BBVA 4PI2A 2BUKA 2XVKA 1KD7A 4LK6A 1RUC2 2CU5A 1PO23 3BTZA 4XABA 4QKDA 2HYKA 2W46A 2ZZQA 5FZ0A 5L36A 4RHV3 1AL23 2ZTNA 3B5LB 2VTXA 4Y26A 1JOPA 2QFEA 3TBDA 5JZGA 1D0HA 1RUI1 3HD8B 3WG3A 1RYYA 3OF1A 1GZ9A 5FXXA 2QQUA 1W3XA 3PUAA 1SQ4A 3WG4A 4MGTA 4TZDA 1EPZA 4WM8A 4D6QA 4CEWA 1QQP1 1PVC1 3HN3A 3MV11 1LRHA 5M0TA 1AXYA 3PVNA 3IT8A 4XTPA 5I0TA 3H8OA 3VBFC 2WSVA 1ZZ8A 4N9HA 3AJZA 3HBKA 4H2AA 5TSWA 3VN4A 3WT3A 5A32A 1O3RA 1VBC2 5BXXA 3VKNA 1GOFA 3FL7A 3ETQA 3QOPA 5FZ7A 3QLQA 3MUZ1 5BY5A 3VL9A 3IIAA 1R083 5H9SA 2BOIA 4R4ZA 5GZCA 1AR61 1Z7S1 2P2KA 2RMU1 3K4ZA 4Q29A 1UY4A 2JKXA 5FLJA 4ZU7A 3EO6A 3FLRA 4BJ0A 1S0GA 3VBRA 5DAQA 1H4HA 2JE7A 5K0UA 4ARYA 2Q0AA 2OPKA 4GULA 4BA6A 2RDSA 3FE5A 3WP5A 1GICA 3OYWB 1DU3D 2GDFA 2JJ6A 1NCRC 3J9SA 2CAUA 4PT6A 5BNOA 1ZBA3 4Y1VA 2OQ6A 2PHXA 1UYYA 5LA0A 1LEDA 1J3PA 2VCBA 3JBG1 1CAXB 1O4TA 4FPGA 3I2FA 3VUOA 5FKCA 4BQ4A 5FXWA 1QNYA 1COV2 2BGCA 1ALYA 2VW1A 4QX1A 1OC1A 4N53A 4COVA 2EIGA 3L2YA 3M4FA 3B02A 3LWCA 5HBAA 1V9U1 1QNWA 1S1AA 3R4DB 2WBKA 4P9JA 4L99A 1CX4A 2FDKA 5LASA 2R32A 1YXWA 2BWAA 3I49A 2AR6A 4Z07A 5F3CA 4P9IA 1JOBA 2ZHNA 4W6YA 2XR4A 3KWVA 1NCQB 5IW0A 1LENA 4BQWA 4I2OA 5DDJ3 5FZ6A 1WGPA 4HLTA 5FY4A 5D8AA 3ZPOA 3U11A 5LA2A 5I0DA 3LCPA 1G8WA 4ATEA 1UMIA 4AWDA 2BNOA 2WAOA 4Y24A 3NL1A 3UGFA 2WL1A 3ZR5A 5KC5A 1BBT3 1XNAA 3KQRA 2W1WA 1FOD2 1RGSA 4YW7A 2PLV3 3KS7A 1CAWA 4PIYA 3U4XA 3OGGA 1YFYA 2CL2A 4HKWA 4I09A 4Y1UA 1LCLA 1JZ8A 2HLEA 3ZFFA 3R05A 4ZKTB 1TME2 4V2WA 2DCJA 1MZEA 1POV0 3TN92 5T52A 2HWF2 2R063 3TRSB 4TN7A 3GHNA 3U75A 3RZJA 2NM1A 3T0BA 3AKQA 2R043 2OYZA 4BQ1A 3O1OA 2WZR2 4MLOA 1ENXA 5A6ZA 1UYPA 3N9OA 1W9FA 2W5FA 3WQ1A 4K21A 1HQLA 4XILA 4UFHA 2RS32 2YC4A 4TLFA 4D7SA 1RHI3 2PHRA 4GB32 2BOJA 3M3EA 3BALA 4JHTA 5FYCA 3LA7A 4GH4B 1GNYA 3AL6A 1SPPA 1OA2A 5CIRA 4CU9A 2E53A 5JDBA 4I02A 2ZEZA 2VW2A 3N7KA 3IMMA 4YVSA 4L9BA 3PJQA 1NAEA 4GMP1 2E6VA 3M3QA 4FPFA 4RS5B 2W52A 5FY5A 2WLQA 3OGJA 4AGRA 1F35A 1H9PA 2VPVA 4QDQA 2CWSA 5GZFA 1JTZX 4MXWB 5DZEA 3RPQA 2Z2SB 1SBEA 5IK8A 4Q27A 2R1BA 4M01A 5FREA 3VB9A 2ZBJA 3QH6A 1ZZBA 4PDWB 1H8TC 5JXJA 2I2SA 3AMPA 2W1SA 4R4XA 3ACLA 1S0FA 4J25A 1DHKB 1K45A 3EMRA 1XE0A 5LW9A 1KITA 4HETA 2P34A 2BDRA 3PUQA 4QPGC 4K1ZA 2BNNA 3W9AA 4WVWA 2J22A 4D94A 3D4KA 1CPMA 4FFHA 4RGGA 4XOGA 3ZVXA 4P00B 1Q8QA 2YROA 2CTVA 3C7GA 4KGQA 5EYXA 2VCAA 2YZ4A 2BVBA 1OD3A 3P6BA 3LDKA 5A3OA 5BNOB 2JDNA 2WNVA 2WA4A 1QQP3 1HQWA 1C8M2 2FMYA 2VQ0A 5A33B 1N1VA 4Q1PA 2Q1MA 1QJY1 3VKOA 3VBSA 2R6QA 1ODNA 2D5FA 3I2HA 1RJ8A 3KZ4C 5JWPA 5F2SA 5K0UB 1V6MA 3ZYFA 3NMBA 4JRLA 4Y4RA 1ZBE3 3H50A 4QU2A 4NHMA 2ES3A 3NNMA 1BKZA 4XF1A 1M06G 2XG3A 1VAMA 5KXEA 3DKQA 2VMIA 1NLQA 5SV8A 4JGZA 3D0SA 1AR82 3C7OA 3PU3A 3DN7A 3DYPA 2ZGMA 4BDVB 5A33A 1Q8PA 1X33A 3LIGA 3PVBB 4META 1YNAA 4LBQD 1TNFA 4GMP0 4OCTA 3VHPA 4HK8A
chains in the Genus database with same CATH topology
1Q56A 1YRZA 3WVJA 1OD5A 1QJX2 1FMD2 3HIFA 2C9AA 1BBT2 2PYTA 3RMYA 5GLVA 5JMCA 1JN2P 1TMF1 2D3RA 1X36A 2AENA 1RUI2 4B29A 1GNZA 4E4ZA 1RUD2 4HVQA 1QXRA 2RS31 2IWGB 3PNAA 5IUQA 4A7KA 1D2QA 2KM2A 1H2MA 1YWKA 3WG1A 5DUVA 1QOTA 2OUHA 3ZFGC 2OVUA 2R042 4XJZA 1SLAA 5JI9A 1RHI1 1KS5A 1RUG2 1DQ0A 4WV8A 1DZRA 3M1HA 3K48A 4YVSB 5K9YA 1ZRCA 1IZ3A 4OI2A 2ZGNA 5DDJ1 4AI0A 4AVCA 4P5HA 1UPSA 1U5ZA 3AYDA 1IS6A 1IS4A 2HWB1 4Q4Y1 4QMAA 4OLLA 1PK6B 2A3XA 3N4MA 2WNVC 4J6GA 4BCUA 1YI9A 1EAH3 3VBUA 1RC6A 2VNRA 1QHDA 2DVBA 1F2NA 4Y1YA 1WLTA 4R52A 3RZZA 3URFA 1B35C 1MS0A 4OUMA 1ENRA 4X8PA 2E51A 4YW3A 4BIFA 2I74A 3ST7A 1ND3C 3IPVB 5DUXA 1CAWB 4M3CE 2WNEA 4N7UA 1J3RA 1MEC1 3MW2A 4GMP3 2IFRA 4RGAA 5T5PA 3JD73 3MGUA 5CG9A 4C1WA 1BJQA 2XLAA 4WVVA 4RL7A 1LOGA 4W65A 2AYHA 1PO21 1WLDA 1W0PA 2HEVF 3BPZA 4LBQA 3DL3A 2B5HA 1AR92 1ZBE2 4KBBA 3C2UA 1QJZA 2ZGQA 4EN8B 1MEC2 3VDDB 3SH3A 1UKGA 2VVDA 2YDEA 4DB5A 4U2AA 3HT1A 2GC1A 3NAPC 1AYN2 1CAXA 3JQXA 2TNFA 4EJRA 1RUC3 4XYXA 2Q30A 4LA2A 1DGRN 1PO22 5T5LA 2B45X 2JG8B 3AKRA 2WWSA 3ZPYA 1ZNPA 4BPZA 3DF0A 3SH5A 1MS5A 4QPGA 1AL22 5JVVA 1BMV1 2JECA 4GWNA 3R4UA 2IXJA 4M3CB 5HXVA 4EN6B 1WCSA 5J98B 3THPA 4AGGA 4LHLA 4P9GA 2RR12 2IXHA 2XHKA 3RS6A 5DDJ2 3ZN4A 1EPWA 2A75A 3AYAA 1RUF1 2WJSA 4HT1T 4EWDA 1CAVB 4QGLA 1VB4A 3VZMA 3HBZA 1FX5A 1F5JA 4FO9A 4YLZA 4MX3A 4LT5A 3IM0A 4AI3A 3WUCA 1RVF2 2A71A 1NY72 5BNQA 3FJSA 1QJY2 3I2DA 4N53C 4Q4W2 1NG0A 2Q1ZB 2UWBA 5FBZA 5C9AA 2O0OA 1RUE3 1WLWA 5AVPA 4FPJA 5LEJA 1H30A 4C90A 2XJUA 4IV1A 4XETA 3HMYA 1S0IA 2LM3A 2V09A 1FPN2 3WXPA 1UN1A 5EFUA 2UWAA 4ISQA 1VJ2A 4Y4YA 1CJDA 3SITA 3ZSEA 2ZZJA 2XJRA 3RQ0A 4QXKA 1OHFA 5I0UA 5ABJA 1MR5A 4HPKA 4CP2A 3DPRC 1AR71 5D8AC 1FXZA 1I9RA 1SLCA 2V73A 4Q2FA 2DCYA 1B35A 1DG6A 3VZKA 2OW4A 4L92A 2TBVA 1R093 3VBFA 1PK6A 1ZRFA 3MIBA 4QHBA 1BEV1 2FZ2A 1MS3A 2D6OX 3GZUC 3TB0A 5FOJB 1RL3A 2E7AA 2FQPA 1OOPA 4QM9A 2VMGA 2RM21 2GH8A 2YGLA 2OIIA 3E97A 1DBNA 1OMIA 5ABJB 3T2TA 3VZNA 3AZZA 4DINB 2B9UA 3ES4A 3S7EA 1HV1A 3ZIWA 4I30A 1AYM2 2XL9A 2A6ZA 3MIEA 2HKXA 3JZVA 4XJ8A 3UJQA 2VVFA 1EAH2 3KT7A 4LLFA 3ZFGA 2WC2A 2R041 2GNTA 3GZAA 2W39A 2RS51 4IEPA 1SBFA 4HN0A 1YIFA 5C8WA 2R061 3T1LA 5K7PA 4RS5C 2V5YA 4CDXB 3UV9A 2E63A 3LKJA 2G4IA 1YHFA 4K7JA 4R9CA 3B69A 1PM7A 3M70A 3RWNA 4OHVA 3WNXA 1RMU1 1W6PB 4QPIB 1ZBA2 3FLTA 5JAXA 3ZXLA 4JGZB 3MPBA 3WW1A 4WZFA 1CAVA 4ZU5A 3N35A 1XE8A 1PIV3 4MVTA 4L2NA 2PHFA 4I0AA 1TE1B 4KQ7A 1HRI1 1I5ZA 1DYPA 1X50A 1U5XA 4M3CA 3VBHB 4OFGA 1JYIA 4HSJA 5JOYA 2XWBB 5GLZA 3MF9A 4R8HA 4JC1A 3AYCA 2YPJA 5L7OC 1MACA 2FBEA 4QQPA 1MS1A 2ZCWA 1Q8OA 1H8VA 4MZUA 2P3KA 2JKBA 2WT0A 4FPLA 4DQAA 1FT9A 1FPN3 2XUMA 3OTFA 2BVVA 2ZX1A 4CEYA 1HRV3 4AI8A 2WFF2 1PMIA 1MQTC 2QZ3A 1W2UA 1IQAA 1SLLA 3NW4A 1HX6A 1O3SA 2OZ6A 2ZGLA 1QXJA 4TSVA 1R091 5DUUA 2ZX4A 1RUJ2 4LBQB 1NXD1 2ATFA 1V6LA 3FZ3A 1XYPA 2WZPP 5B2GB 1Z7S2 1S0BA 4GH4A 1W6QB 1ENQA 5KHGA 2BFUS 5I8YA 1UX6A 1NCRB 3ZXJA 4DFSA 1GBGA 1RIRA 1S0DA 3USUB 3IPVA 2K9ZA 3PVEA 4GB33 2XKOA 2E7QA 2PTMA 5BNPA 3RRDA 3GZTB 3VBUC 4JV4A 5CNAA 1E57A 1UU6A 4QQ2A 1ULGA 2ZS6B 1QMJA 2CGOA 4Q0UA 4PLNA 3ZO0B 5C4WA 4YZ1A 1COV1 4MYEA 3M2MA 4Q0SA 2A7AA 1JBCA 2RM23 1N47A 1POV3 1S0CA 4NHKA 5SV5A 5E8AA 1ZBA1 3OBRA 3S0MA 1V9U2 4WVMA 4BOWA 1LHUA 2XJTA 4LBMA 4AHXA 2DTYA 1RITA 2Y38A 4LBNA 2WIIB 3MZHA 2D7FA 4QD2A 3M7AA 1SFNA 3EHKA 1QOOA 3POYA 5E16A 2IXKA 4AFMA 3SH4A 2R0FA 1D0GA 2D43A 2D6MA 5IK7A 3EJKA 4Y22B 2AREA 2AZ5A 1FMD1 4N43B 1MZ5A 1IKPA 2DVAA 2H0BA 2WFF1 5T3NA 4CEYB 3N7JA 1RUG1 4BYYA 1UCXA 2BQPA 2ZAHA 4DS0A 3AKTA 3HAGA 3R6SA 3AYEA 1C4RA 1SBDA 1NA1C 4YG6A 3V0AA 2ZGSA 4XQWA 4FPHA 5JOWA 3OYWA 5L73A 2OUJA 2XLFA 4D7YA 2O1QA 4INDA 2A6WA 1AR63 3ZIXA 1RUE2 4OVEA 2DURA 1VBD1 1YJLA 1W0OA 4MGIE 1R1A3 3D6EA 3UJOA 3RI9A 2ZA9A 2WS93 4WM8B 3FFQA 4XBNA 1NZCA 2JXAA 3WOGA 5HCBA 3K51A 5GZGA 4CDXA 3BCWA 4XF3A 3SNMA 1R082 1RUH3 3JU9A 1B09A 1LHNA 2WKKA 2ZX0A 3CJIA 4CEYC 3RNSA 2G9GA 2Z42A 3ELNA 3GBWA 4YW5A 3ZFGB 2MEV2 1PZ9A 1O5UA 2VNGA 3JCIA 3ZX7A 5DG2A 5JZGC 3IDCB 4FOYA 2IZWA 5HI0A 1DFQA 3IKWA 2ZAAA 3KM5A 4GXLA 4RR3C 5C33A 4ONUA 2R30A 4JDOA 1GFF2 2EXIA 4MXWA 2XH6A 1WBLA 1NQDA 4AQ2A 4XMAA 4G4FA 4AFDA 2ZGTA 4OUSA 1H1MA 1LOFA 2VXRA 4XIKA 4AEDB 4AQTA 1O3TA 1CONA 1R1ZA 5BNPC 2RS13 3PHMA 4LE4A 3UK9A 3TOJA 1W6OB 4DXZA 3ZFFC 4KL1A 1HXS3 5JOXA 1OLRA 2LALA 1EV11 1KS4A 1KJRA 3HR9A 5JCTA 4XDQA 1RUC1 4AHYA 2ZJCA 4F3JA 4E9KA 2R073 3LZZA 3WCRA 3QACA 1SMVA 1CAUA 1JW6A 4O9GA 5C4WB 1C57A 1G9DA 3ZSLA 1RJ7A 5DUWA 4I01A 1BEV3 2YUEA 4UW5A 4RSUA 1LHOA 3H9AA 4BE3A 3MW3A 1DGWA 1VR3A 2JG8C 4XFHA 4AVVA 1CR7A 3ZN6B 2EAAA 4GWMA 5H9RA 1EV12 1A78A 4XJWA 1I6XA 5FCCA 1UU5A 5BNNC 4WM7A 5GZDA 1OA4A 1J1TA 1H2LA 3GBFA 1MQTA 4FTBA 4AFBA 5HCFA 4L11A 4AFCA 4M3CF 1BVP1 2DCTA 2JENA 4IESA 4D3WA 5C9AB 4RQPA 4FOQA 1QY4A 2P3JA 3VL8A 2CYFA 1NE4A 4P14A 2WZR3 4RR3B 4S2GA 3H7JA 3V64A 3B94A 1O5LA 3TAYA 1K5MA 1KJLA 4TYSA 1V9U3 1XNBA 1VALA 4IEVA 4BM8A 4CYDA 1WD3A 4EWAA 2F6BA 5DZFA 5T5JA 3W59A 4DOUA 1AR83 1IKQA 2D40A 5FRAA 4CDWB 2Y26A 3DPRA 2DTWA 3CL1A 1G7YA 3ZFEA 2DU1A 2ZHMA 2ZX2A 3PMSA 1ULCA 4LNVA 4YW1A 1ASJ3 4NVPA 1U5IA 4AQSA 2HWB3 2OZJA 4BMBA 1D2SA 1UIJA 3BODA 2CNAA 4FBFA 3WZ1A 3RJ2X 2Z69A 4K40A 4MXVA 3VBHA 1C1FA 3KCXA 1RB8G 1F8VA 3ZSMA 4XJAA 4GQ7A 2MEV3 3H0OA 3MEPA 4NR1A 4Q4V2 4Z82A 1I1EA 1DZQA 2XBO2 1VRH2 2ZPXA 1SLTA 4DZGA 2R0HA 5J09A 4AI2A 2GNBA 4D7TA 3VBSC 4JGZC 2RS11 3M3OA 2WS91 4OULA 3VBOC 4YFWA 3WV6A 1BVVA 1F31A 2CGNA 1LEMA 1S55A 5T55A 4ASMB 5JPMB 5I0RA 4FT8A 3OY8A 2EA7A 3LGRA 1ZZ6A 2XJSA 4YGEA 1QJU2 2XWJB 1EYBA 2HEWF 1JYCA 2HWC2 1J1LA 4XHBA 2D5HA 1AYM1 2K0GA 1JOJA 4IV3A 1XE7A 1C28A 3QH7A 3AP7A 1H2KA 1SACA 1VAKA 1AL21 5FPZA 1BMV2 2ENRA 3I59A 5F9TA 3PTYA 4YARA 5BYNA 4JTNA 5KHKA 4XF9A 1V6OA 2D93A 5GKAC 1PHMA 1FAYA 2NZ9A 2WA3A 4YGDA 2RJLA 4PIXA 1LOFC 2D6NA 3N3HA 4I3GA 3FHIB 4JGYA 1WMDA 3CLPA 4PBOA 2UY8A 1HRI2 4UW6A 4LHNA 5L7OB 2DFBA 4LUKA 2JX9A 5L7OA 1FATA 1UMZA 1XXNA 4LLOA 4UBGA 2VUJA 2VECA 1ZX5A 3HT2A 1L3JA 2GC2A 4HPKB 1LOEA 4LO6B 2A73B 1LESA 2NP0A 5T50A 3WCSA 3JUUA 5EV7A 4JVAA 1QH6A 5CFCC 2EXHA 1AXKA 4F7ZA 1UW8A 4LO7A 5I8SA 3MICA 4YW2A 1LOBA 1C8M3 4Y5Z0 3WR0A 4YZ5A 1LTEA 4IV3B 5J3UA 2HWE1 1QU0A 1ULDA 2ZHKA 2XKPA 5BPXA 2QQPA 1TMF2 5EZWA 1REFA 4XE9A 3C3VA 3ROUA 4X8NA 2E9QA 5J36A 3OY8B 3I7DA 3JB4C 3A0KA 3MIGA 4JDMA 1FYUA 1RUD1 5T5OA 4XFBA 2VQAA 4LBOA 1T6GC 4FQZA 2PAMA 4LA3A 2RR11 3NKGA 4H14A 3O5SA 2HWC1 1ND3B 4NO4A 2X8KA 1ONAA 2P37A 1ZVFA 2GC3A 3O14A 3PJYA 1V6IA 3JBG3 1FMD3 4S2HA 3AMNA 4QPYA 2MNGA 3KB5A 3WP6A 1HIXA 1W39A 1QJU3 3RDIA 3AMQA 3SXWA 5LRRA 1CQ9A 4FAHA 4F8AA 1VBB2 2IXLA 3WW3A 4RD7A 1RUG3 4EN9B 3DPRB 5BNOC 2PHDA 2CY6A 4JRAA 2CGPA 2EXJA 2D3SA 1EY2A 1BZWA 3JQWA 4P9YA 1U12A 3JB8A 1OLQA 3RYPA 1AJKA 2HJIA 3RMXA 2DVDA 2YYOA 5KBFA 3G7DA 3KGLA 4HKOA 3UKVA 2CAVA 3GALA 1JXNA 4RQPB 4RS5A 1YIPA 1OSGA 1QXPA 3H8UA 5H9QA 3V0BA 1VBC3 4IQPA 4IXLA 1GKBA 2DYCA 4BMEA 3EXUA 2DUPA 3NO8A 1AR91 1Q8SA 3E5XA 4Q8LA 2AUYA 2HWE2 2XJQA 2XL7A 5GM0A 1R1A2 3HQXA 1C5HA 1DDLA 4FOWA 2D97A 2JDZA 4R9BA 3QD6A 4YVWA 3KMHA 3ATGA 5I91A 3MW4A 1F9KA 2X5IA 2RMU2 1WW4A 5EYYA 4I0BA 1ZBE1 2X53S 4WM7B 1D4M2 5KXCA 3SCGA 1W6NB 2Q8OA 5KHJA 2PA7A 1UU4A 1XNDA 3AP9A 3G6JB 3VKMA 1RVF3 1PK6C 3WD5A 4FPKA 2W08A 5F6KA 1REDA 2XLGA 1AJOA 5CB7A 3CU7A 3WDYA 1IPKA 3AX4A 1MS9A 2VGDA 4OHZA 2VNOA 3B00A 1HXS1 2WFPA 4FP3A 3O0WA 1RUH1 2MHFA 4IEYA 3N7LA 2H0VA 5A3LA 1C8M1 3E6DA 4AW7A 1H9WA 3OD4A 4W6XA 2VOKA 3FBYA 1GR3A 1GZCA 3W58A 1YLLA 2NPIA 1SEFA 1RVF1 5JLVA 4I0WB 4AHWA 2RS53 1FV3A 2WNUC 4LTAA 2QVSB 2PN5A 2E7TA 4AEDA 1N1SA 1KQRA 1DIWA 5FAXA 4EV0A 2GMEA 3RYRA 2IFWA 2ET7A 2JE9A 1AR81 4KNCA 5ACA3 2PAEA 4MSVA 1TME3 2DFCA 3HN1A 4X6RB 1V6JA 2LTNA 4OI0A 1DZTA 1NQJA 1V6KA 2PFWA 1AF9A 3LSDA 1QWRA 4JQRA 5E89A 3IWZA 4MV2A 3SLIA 2WT1A 3VBOB 4XXAA 3VBRB 5CG8A 1W6MA 4KWLA 2MPFA 3OCPA 1HQNA 5CAZA 1QJY3 1DQ5A 1WD4A 5A32B 5CA6A 4Y1ZA 3E5UA 3U10A 2ZMLA 3WDVA 1FI2A 4EN0A 5IK5A 1GV9A 2WNVB 3V0AB 2QUOA 1GSLA 4GALA 4Z1VA 2ZOEB 3SCHA 3ZXFA 4YRDA 1Q8VA 4YVSC 5JPNB 1IOAA 3TNQA 2BPA2 4XMIA 3VBOA 4QGMA 4E4DX 5EWSA 2D6KA 5FTTC 4M00A 1PVXA 3E5QA 4PLOA 2A6YA 1AYN3 3J8F1 1Q43A 5F5QA 3S6PA 1WW6A 3FUQA 3P3NA 4YZ2A 1PGL1 4R9DA 5FMOL 4OHYA 5KXBA 1ZZ7A 4B8EA 4LO8A 4NWWA 2RS33 2CWMA 2O8QA 1SCSA 4YGBA 1BYHA 1J3QA 1VBD2 4ATFA 1H1AA 4V1PA 1LOAA 3MLJA 1J59A 4E4SA 1RTVA 4Q1RA 2ET1A 1QH7A 5ABJC 5BNNB 4GKYA 2R16A 4PLMA 4A3XA 2PHWA 4TWTA 4CEWC 4B7EA 4GKXA 4AK3A 2BTVC 1XRUA 2NMOA 2UURA 3VKLA 1JHNA 3THTA 4J1XA 4OHWA 1Z7S3 3JD71 2EALA 4C91A 1Q3EA 1QJX3 4CP0A 2QCSB 4HL0A 5FFOC 3AMHA 5EJ3A 2WINB 1IGOA 1H1IA 4S2DA 1LODA 3R4SA 4PF5A 1WA4A 5KHHA 4WM7C 5ACA1 4CDQC 5C4WC 1BCXA 1W6QA 4AXOA 3VLBB 5CFDA 2X5IB 4RA0A 3GNEA 1NCQA 2DCZA 2A6XA 3UKNA 1WCDJ 5BNPB 1ULEA 1VBA1 3AK0A 3NJZA 1MVEA 4QX5A 3L9JT 4AE2A 2G9FA 1PO12 1NCRA 4S2FA 2EAKA 4KWKA 3ZXEA 4Q8KA 1IS5A 1DF0A 4H55A 1JUIA 4GIQA 4JTOA 3V0BB 4UW4A 4N53B 1G9FA 1RUJ1 3GYDA 1TME1 2D6LX 2XB6C 2Z5WA 1G6NA 3LA2A 2WFF3 5BV6A 3V56A 1VBE1 1PZ8A 4C1XA 1GZWB 3GF6A 4H7LA 2WT2A 2FZ1A 3E6CC 4NOTA 1YYNA 3KCCA 5CFCB 3M3IA 3IBMA 5LK7B 2ARXA 3KSCA 2H6BA 1RHI2 4GA9A 2GC0A 4Q4X1 2NN8A 1QDCA 1AR73 1ASJ1 4KG8A 4M0HA 4ORFA 1UIKA 2BYVE 1DQ4A 3DKWA 2D98A 4L8QA 4I3PA 4PQ9A 3AFKA 4M0NA 3MIDA 3JD72 1LKNA 5C6CA 3WDWA 3GBGA 1W6PA 1MS4A 3TNPB 1RINA 2BFUL 5GLTA 4Y20B 3IN9A 1POV1 5F6LB 1QOSA 4CEWB 3WLUA 2JEMA 1SLBA 4HKLA 4URTA 1ENSA 1Y7BA 3WHUA 1ND3A 4SLIA 1QF3A 4YM1A 3GHMA 2VG9A 3CEWA 2PLV2 4E27A 2ETEA 4J1WA 1Z0HA 2B42B 3AP4A 2Q5TA 2YXSA 3MYXA 2DVGA 1OPOA 4PDWC 5LK5A 4AGVA 1QQP2 4COWA 2QKDA 1H8TA 4AEJA 4N43C 4A2UA 1JUHA 1KFUL 5F1RA 2WNUB 2P17A 2PELA 1G9AA 1UAIA 5CU1A 3D5OA 4AHZA 4BLIA 1OOPB 2ZACA 5FMOS 3H1WA 4LBJA 3RSJA 1PO11 3AKSA 4YW4A 1H4GA 2VY0A 4ITCA 4YNIA 3O7OA 1HRV2 5AFEA 3H7YA 3ECQA 3NWKA 4K8FA 4K20A 4MGYE 3WDUA 1B35B 2JG9A 4Z2WA 3AZVA 4XBQA 4FQ4A 4NHLA 1PGL2 1AYN1 1PIV1 3J8F3 1ULFA 1YI7A 4XFAA 1VBC1 1N1TA 1TMF3 3DUIA 5C8CA 4LUMA 4QQOA 1G86A 5GLWA 4AVTA 3MIFA 1RUJ3 3POWA 4OI1A 1GNHA 1VBD3 1QJU1 2C0ZA 2RS12 5FO8B 4B3NA 1RUD3 2CV6A 3LSEA 5C8CC 4AQ6A 4B4PA 2I07B 1LGCA 4A7YA 2VH9A 3VBRC 1ZRRA 3VBFB 4Q4X2 2RHPA 2TUNA 5AC92 4IV1B 1ASJ2 1MVQA 2XJPA 1N3OA 2B7YA 3BIWE 4BZ4A 4IEXA 4CRQA 1U0AA 4EN7B 1NYWA 3I4IA 4AEDC 4LEJA 5JIAA 2WNUA 1WMEA 3AJYA 4XTMA 1HKDA 3FWEA 1CJPA 3IDEA 1Y3TA 1FOD3 2C1FA 5FQ0B 4A7ZA 1NLSA 3ZYRA 2UU8A 4CZSA 4RQPC 3NV4A 5DG1A 1ND2C 3H3UA 3BOWA 5BUVA 5C9AC 3B93A 2OA2A 4XJ9A 1QGLA 1X7NA 3AM2A 1URXA 1OQDA 4P9LA 3TWIA 1DYKA 3PLQA 1S2K