2FZ2A

Structure of turnip yellow mosaic virus at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
164
structure length
164
Chain Sequence
PSPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*C)-3'
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Virus/rna
total genus 25
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz2A00
2RMU3 2MEV3 2HWE2 1PGW1 4RR3A 5C8CA 2R073 1PO23 5CFDA 4PDWA 4CEWA 3VBUC 1AYM3 5JZGA 3VBRB 1ZBA1 4WM8B 1FMD1 1R081 5C4WA 1PGW2 4YVWA 4AEDB 1FOD1 5ABJA 1TMF1 1BMV1 1NCRC 1OPOA 3ZFGB 3ZFEC 5A32B 3JB4C 4Q4W2 1ZBA2 5L7OC 1AR83 2Y26A 2RR13 5BNNA 1FMD2 1ASJ1 3J8F3 1R082 2WWSA 3NAPB 1ZBE1 1FOD2 1BMV2 1RUI2 1MEC3 3FBMA 1VBD3 3VBRC 4Q4Y3 4RFT0 1RUE1 4WM8C 4NWVA 1ASJ2 2RS11 1FPN3 1X33A 1R1A1 1ZBE2 1C8M2 4AEDC 1AR91 1SMVA 5AC91 1B35B 4CDQB 3ZFGC 2IZWA 5CFDB 2WS93 3TN91 3CJIB 4PDWB 3VBOC 1RUE2 1NCRA 5JZGB 3ZFEA 1ND3B 3IDEA 1QJY2 2MEV1 1VB2A 4IV1B 5L7OA 1X36A 3NAPC 2WZR2 1EV12 1PO21 5CFCA 1AYM1 3TN92 1PVC2 2XBO3 4CEYB 2RMU2 2MEV2 1VAKA 1VBA2 2RM23 3ZXAC 5BNNB 3VBRA 4CDWB 1B35C 4CDQC 1ND2B 2ZTNA 2R072 4GH4B 1W39A 5ACA3 1MQTB 2R043 4AEDA 3CJIC 4PDWC 1RHI3 1AYN1 3ZFGA 1ND3C 2RR11 5A32A 2HWF3 3J8F1 1RUF3 1COV3 3VBOA 4IV1C 2BFUL 1CD3G 1QJX3 2BUKA 1MEC1 1HRI3 4FTSA 3NAPA 1VBD1 4RS5B 1AR82 1IHMA 2HWE1 4FSJA 4Q4Y1 4CEYC 1PO13 1CJDA 2RR12 3JD72 5BNOC 1RUG2 1RUJ3 1FPN1 5BNPB 5BNNC 3DPRB 4CDWC 5K0UB 1PVC3 1ND2C 1MEC2 4GH4C 1POV0 4WM7A 1MQTC 1RB8G 1VBA3 1VBD2 1B35A 4Q4Y2 4CDQA 5CFCB 1FPN2 5J98B 2HWD3 4RHV3 3CJIA 4Q4W1 1ND3A 1V9U3 4CDXB 1RVF3 4IV1A 1VBE3 2WS92 1NY72 1M06G 4RS5C 1HRV3 1AR63 1VB4A 1EAH3 1RUI1 2RM21 5BNPC 4CEYA 3DPRC 3VBOB 5BNOA 5K0UC 4FTBA 2PLV3 2RS53 1TME3 3JD73 1RUG3 4YVSB 5ACA1 2HWC3 2R041 1POV3 4CDWA 1H8TB 2XBO2 5CFCC 1ND2A 1NCQC 1RHI1 2XPJA 1C8M1 2X5IB 4GH4A 2HWF1 1MQTA 2RM22 5C9AB 1COV1 5GKAC 2R062 1QJX1 4QPGB 3M8LA 4CDXC 5ACA2 1QJY1 2R042 1R093 4WM7B 1RHI2 1GFF2 1PO11 1AR72 2WZR1 2HWF2 1RUF2 1RUJ1 1EV11 4NWWA 5DDJ3 1COV2 4RS5A 1E57A 3ZFFB 1QJX2 1C8NA 4N53B 4Q4X3 3LOBA 1PVC1 1BEV3 2RMU1 1HRI2 3VBHC 5BNPA 1HXS3 1NOVA 4YVSC 1VBB2 1VBA1 3DPRA 5K0UA 1H8TC 1PO12 2X5IC 1AUYA 1RUJ2 2R071 2HWD1 5C9AC 4RHV1 1NCQA 1D4M2 4QPGC 2FZ1A 3VDDB 1NG0A 1RVF1 5BNOB 4JGYB 1F8VA 1QJZA 1VBE1 4WM7C 2R063 1AR61 4CDXA 2HWD2 1EAH1 4RHV2 3ZFFC 4N53C 1AR81 1V9U2 2PLV1 1AR73 1RVF2 2RS51 3JD71 1RUG1 4RQPB 1VBE2 2HWC1 1POV1 1HRV2 1PIV3 1TMF3 1AR62 4IV3B 1AL23 3VBHA 5A33A 1PGL1 4YVSA 1EAH2 5FMOS 4GMP0 1H8TA 4EJRA 2HWB3 2X5IA 1VBB3 2PLV2 2RS52 5C9AA 1AL0G 1TME2 2WFF3 3VDDC 4BCUA 2HWC2 4JGYC 4JGZB 1R091 2ZAHA 4QPGA 1D4M3 5D8AB 4CDUB 1PGL2 1WCDJ 5J96B 5DDJ1 3JBG3 2WS91 1NY71 1NCQB 2RS13 1BEV1 1HXS1 3ZFFA 1BBT3 4RQPC 2GSYA 2TBVA 1R092 4N53A 5AC93 4SBVA 4IV3C 4Z92B 5DDJ2 4GMP3 1RMU3 1RUD3 1VRH3 4Q4X2 2XBO1 1BEV2 1RUC2 1OOPB 1HXS2 1Z7S3 4JGZC 2WLPA 2R061 5D8AC 4CDUC 3VDDA 4Q4V2 4JGYA 1QJU3 1VBC3 3VBHB 5A33B 1QQP3 4QPIC 2RS33 1K5MB 1AR71 1NA1B 1RUF1 1PIV1 1AL21 3JB8A 4RQPA 1HX6A 1HRI1 4GB33 5FOJB 1AYN3 3VBSB 4IV3A 2HWB1 1VBB1 2WFF1 1OOPC 1RUH3 2DF7A 1PIV2 1TMF2 4Y4YA 3VBFB 1D4M1 4Y5Z0 1AL22 4N43B 1RUC3 4JGZA 2HWE3 4CDUA 2HWB2 3JBG1 4LLFA 5D8AA 1K5MC 1A6CA 2WFF2 3VBUA 5LK7B 2VQ0A 4Q4V3 1NA1C 1BBT1 4QPIA 4RR3B 5C8CB 1V9U1 3S6PA 2BBVA 4CEWB 4GMP1 3JBG2 1RMU1 1RUD1 1VRH1 3VBSC 1HRV1 2RS12 1DDLA 2BFUS 1R1A2 1BBT2 1Z7S1 4FTEA 4Q4W3 1AR92 5AC92 5C4WB 4YVWB 1ZBA3 3VBFC 1OOPA 4N43C 5ABJB 2FZ2A 1FMD3 1QJU1 1R083 1VBC1 1TME1 1QQP1 1RMU2 1RUD2 1VRH2 2RS31 2ZZQA 1FOD3 1RUI3 1Z7S2 4WM8A 2QQPA 1K5MA 4RR3C 1F2NA 5C8CC 1PO22 1OHFA 1QJU2 1ASJ3 1NA1A 1VBC2 1AYM2 5CFDC 1QQP2 4CEWC 4GB31 2RS32 1ZBE3 5JZGC 1C8M3 1HQNA 1RUH1 2BPA2 3VBUB 3VBSA 2GH8A 5C4WC 4YVWC 4QPIB 1RUE3 4Q4X1 3HAGA 5ABJC 1QJY3 1RUC1 4GB32 1R1A3 3VBFA 1AYN2 1AR93 2WZR3 4N43A 3J8F2 1NCRB 3ZFEB 1EV13 1RUH2 4Q4V1 3TN93 5L7OB 5FMOL
chains in the Genus database with same CATH superfamily
1N1VA 1NXMA 4EE2A 1H4GA 2XLFA 5E6HA 5FP8A 1RJ8A 4COWA 1NLRA 3POJA 3H0OA 2EIDA 2HWE2 5C8CA 1W0OA 3I49A 2ZMKA 2WUHA 3RSJA 5IVYA 3U4SA 1PO23 4RD7A 5FDBA 1GP6A 3PVEA 1LRHA 3VBUC 3SQOA 5A1FA 1C1LA 1DGWX 5EFUA 3H8OA 4AWDA 3RZHA 4WV8A 2TUNA 3DV8A 2W95A 1R081 2VMIA 2W08A 1PGW2 1TE1B 5C4WA 5A3MA 1SBEA 2JB4A 5FZOB 1F31A 4QGNA 4EN0A 1FOD1 3L2HA 4XFCA 1J3RA 5JAXA 1BMV1 1TMF1 1NCRC 5FZ0A 4AQTA 1A8MA 3OPWA 3JB4C 4CCJA 4TXWA 4HBNA 4LK7A 3KSCA 3LCPA 4FI9A 4NRQA 1SACA 4JRAA 5D21A 3LA2A 2QUOA 4NIAA 2RR13 3C7GA 5C3SA 1S1AA 1QKQA 5IFTA 3DYMA 2WWSA 5LRRA 3NAPB 2ZKLA 3FHQA 2R1BA 2E26A 4Y1ZA 5EXOA 5LA2A 3WVJA 1JYNA 3D3AA 1RUI2 1MEC3 1NLQA 3O5SA 1HN0A 4CCOA 4MLOA 1ZRCA 3IDCB 5A7WB 2CDPA 3ZXKA 1HJGA 1XU1A 2VMGA 2XQRA 2X29A 3WF3A 3AB0A 4K3UA 3IAQA 4WM8C 2RE9A 3M3IA 4IEZA 1VRBA 4OVEA 5FZCA 3UGHA 2VPVA 1ASJ2 2A6XA 2OUHA 2XKPA 2KXLA 4IETA 5E88A 4EN8B 4RA0A 2WN3A 2UURA 5FLHA 1C8M2 1SG3A 2E31A 1W2TA 5AC91 4IL7A 2QQLA 4M3CE 4ASKA 3BI3A 5HI0A 4XUTA 3ZFGC 4XUQA 2GDFA 2JG9B 2W87A 4P08A 3TBDA 2AUYA 4BMEA 3CL1A 3WW1A 4PCRA 4NRMA 1E5HA 1NCRA 2VQTA 3MPPG 3WP3A 1JYVA 2EIBA 4IW3A 3VL8A 1KS4A 1OLMA 2YZ4A 1DP0A 1PHMA 1SFNA 4IV1B 4XUPA 5FLJA 5IAVA 1MVEA 1JMUB 3ZDVA 2BW8A 3MIFA 4Y1YA 2B45X 2TEPA 1DZRA 2PMWB 3N7JA 3PTRB 4Z1VA 3I3BA 2FDIA 3KB5A 5JOZA 3WG4A 2VECA 4XBQA 1UXZA 4P9WA 2DVAA 1CAWA 4CEYB 5EJ1B 4TTGA 1W6QB 3AYAA 4CVUA 2MEV2 1LU1A 4N7UA 3IT8A 4O7XA 3OYWA 1W9TA 2C9AA 4LBMA 1JZ6A 3HQRA 5BNNB 5HCFA 3ZYJB 2FDHA 2NM1A 4IE7A 3HQUA 2VCBA 3AL6A 2AEZA 3RS6A 4CDQC 4GAZA 4H2AA 2R072 4GIQA 4EN6B 1C3HA 3M3EA 1REEA 3OPZA 3ATGA 3O1RA 5B4XA 4JHZA 3LIGA 1PK6C 4AGRA 2F4PA 2L9LA 1ODNA 1RHI3 4WVMB 1QJEA 1XSRA 3ZFGA 5FRAA 1QXJA 4MH0E 5CG8A 1UX7A 1V6JA 2HWF3 3GCWA 5FWJA 2J1EA 1UOJA 2SBAA 4QWNA 1V6NA 4BOWA 2WNUB 3VKFC 5GLWA 4XEZA 3RZGA 1QJX3 1GWKA 3Q9OA 3LPFA 4AVBA 1MS9A 2J1UA 3T4VA 3LOIA 4ES9A 4LUMA 5AVAA 4LNVA 4CCKA 5LRSA 4ARXA 5FY7A 4FTSA 4W4ZA 1AZDA 1SCRA 3CLPA 2GH2A 4OHVA 4Y33A 2W1WA 1VBD1 3LQCA 2DTYA 2HWE1 2VR4A 3IBMA 1CJDA 5LCWL 1RUG2 4OQ8A 4PT6A 3ZXFA 5A6QA 4GJYA 4LBQA 2JB8A 5A7QA 3Q8AA 3S7EA 5LZ6A 2ZGRA 3VB9A 3ZSEA 1H2NA 3Q8EA 4HMZA 4LA3A 4FPLA 5K0UB 3K46A 1LHWA 3G7DA 3BVCA 4NPLA 4GH4C 3D4KA 4LHNA 2DFBA 1GOGA 4WM7A 5CEHA 1GZWB 5FCCA 5FYIA 3MIEA 5CZKA 4CDQA 5CFCB 5IK8A 4FAGA 1NZIA 4JVAA 3AYDA 3GF6A 2VBBA 2HWD3 1WCQA 1PK6A 3N9QA 4B7EA 1CX1A 4LO7A 3PVOA 5FBZA 3FLRA 4Q5OA 1XYNA 1IGOA 1W3VA 4OMCA 1MR5A 4IE6A 5FTTC 5K8SA 4XJ8A 2Q8OA 1DQ5A 2ZABA 3AJYA 3USSA 2J42A 5JOXA 2IXIA 3THDA 1A8DA 2VU9A 3BALA 3IB3A 1EAH3 1QHDA 1RUI1 2RM21 2Q30A 4BQ5A 3I2JA 5A7PA 4Y22B 5BNPC 1H2KA 1L7LA 4H7LA 4GKXA 1F35A 4HVQA 3W21A 1JZ7A 3KWVA 5DPNA 4ZU5A 3U11A 2E7TA 1W8WA 3Q8BA 1POV3 1STMA 4Q2FA 2PHWA 3SKJE 3WCRA 5BNQA 5KXDA 4CUAA 4PF5A 1C8M1 1OMIA 1Y7BA 4CXXA 4GH4A 5FZ4A 3TAYA 5IK4A 3D5OA 2JE7A 3C2UA 4HANA 2WQZC 5T54A 3MFAA 2X8KA 2D3PA 5I91A 2JJ6A 3IPVA 1GP4A 4LXLA 1ZA7A 2R062 5DXDA 2Z79A 3EJKA 1YUDA 4UW5A 2FMYA 1ENQA 3U1XA 3MIGA 2WYSA 4AG4A 1RL3A 3QH6A 4OHWA 1VLNA 1RUOA 3MDPA 1AJOA 1O5UA 1AR72 2WLQA 2VTFA 4XAAA 4Q0VA 1COV2 4XURA 1W6NA 3CMGA 2F4LA 4E27A 1F5JA 5JLVA 3MGUA 4HFSA 4R4XA 1NT0A 3LZZA 4HN1A 4MGQA 3LOBA 2IFWA 2OS2A 3O0WA 4KG0A 4P5YA 1HRI2 2WIIB 3VBHC 2QQUA 2Y6KA 5BNPA 3A0NA 2BGCA 2QTWB 2ARBA 1BK1A 3K3OA 4ISRA 1WUVA 2VQAA 3P3NA 2X5IC 3RG0A 1AUYA 2EXIA 1RUJ2 4PIXA 2R071 2WAOA 5C8WA 1GNZA 2P3IA 1APNA 1OH3A 3SEPA 4XUOA 3OD0A 5FY9A 1NG0A 2DCJA 2V73A 5L9RA 3RYKA 5HCHA 1F8VA 5JR2A 4YW3A 5DUUA 2VTXJ 1GZTA 4XYXA 2MPFA 1LAJA 1Q8VA 3QLQA 2JDNA 1L3JA 1W2AX 4X6QB 4EWEA 1WBLA 2LRPA 5A1AA 1SBDA 3ZFFC 4DS0A 5DMYA 4KU7A 4FFHA 2ZEZA 4N53C 3PU3A 4S2FA 4YARA 2PLV1 2RS51 1RVF2 2EXKA 3UJOA 1RUG1 3TWIA 1NZCA 3MW4A 3POYA 1PIV3 1TMF3 4IV3B 4Y1VA 3I97A 1AL23 3VBHA 4AHZA 3O1UA 5LY2A 1XNTA 3OF1A 2A3WA 1GWMA 2ZGKA 3PUIA 1DGRN 4EJRA 4RL7A 2X5IA 3FMGA 3WHUA 2QQKA 4IEPA 4LOTA 4Y1XA 3HNYM 5JOYA 3PUQA 1TME2 3CHXA 1YWKA 5FP9A 5FY1A 3CKHA 4OYUA 3VDDC 3HJRA 4MGKE 4QU1A 5TSWA 3CZUA 1D0GA 4Q26A 1D4M3 2AR6A 2Z5WA 3L9JT 1V70A 5F3EA 5GM0A 5J96B 1REFA 3BTZA 4M4PA 3BIEA 3VZNA 3I59A 4NIHA 1Q8QA 5DDJ1 3VD7A 3UK9A 2WAAA 3KQRA 2HLEA 1BQPA 1AHSA 3BN6A 4QX1A 3BOPA 2LUWA 4IE4A 1DZTA 5HV0A 1I5PA 3P1IA 1O8PA 3POIA 3ZFFA 5FAXA 3ZSJA 1SFYA 2XJUA 1R092 4N53A 5AC93 3NV3A 3AKRA 3OGJA 3NL1A 2JEMA 4DXSA 1YJLA 3V0AA 1UPSA 1RITA 1B09A 2Y0OA 5F32A 2XVLA 2NN8A 2DVBA 1WCUA 2HEVF 5F2SA 4Q0SA 1RMU3 2WZEA 2OZ6A 2YU2A 2HBTA 4Q4X2 3LEGA 3ME2A 4NOTA 4DY5A 2GNBA 1ZZ9A 1ACCA 2WT2A 4Y4RA 1IPJA 4LLOA 5A3WA 1WD3A 2E9QA 3FFQA 1URXA 1XXNA 4A3ZA 3B00A 2ZS6B 3RPQA 5I93A 4M0HA 2R061 5D8AC 4UFIA 3VDDA 2XL9A 3SMHA 1VBC3 5A33B 2D6NA 2EA7A 1DGRA 3UL2A 1W03A 1QQP3 3FJSA 5EJ3A 4UBHA 1WW4A 1IKQA 3BPZA 1K5MB 3PVBB 4R9CA 2ERFA 4RFRB 1TNFA 1AR71 4B8EA 3HVDA 1OFSA 4UFHA 2DVDA 3B93A 5IVJA 4KU8A 5FYCA 1O4YA 3RMYA 3SCFA 1H0BA 5IATA 4GWJA 4JKKA 3NRUA 5T5LA 4QX0A 2V5YA 1G9DA 3WNNA 2VQUA 4AQ2A 1HRI1 1QOOA 2YBSA 2JDUA 3E5UA 5FOJB 3VBSB 3GJAA 1OQ1A 4PF1A 5FYVA 4A45A 3JUUA 2ZX2A 3ILRA 1XYPA 3AXEA 4AFAA 2DF7A 2ADDA 3KLSA 5FO9B 1JW6A 3VBFB 5FPXA 4Y5Z0 2W2IA 1OI6A 1WLDA 2D5HA 1GZCA 3OY8A 2HJIA 2R32A 3NSTA 1H8VA 2NYYA 4AVTA 4NE9A 2HWE3 2HWB2 2LALA 4LLFA 5D8AA 1CX4A 1FNZA 2YB7A 3ILNA 4DXTA 3W5MA 3BUCA 2JD4A 4D6SA 1PM4A 4V2WA 5DABA 2VZ1A 3DXTA 5B2GB 2JE8A 2R0FA 3KT7A 1UN1A 4S2HA 3ZOIA 2XJSA 4XILA 2XJVA 2W94A 2XUMA 2R0HA 1UIKA 2XWJB 1E5IA 2P4EA 3BB6A 3OBTA 3M3OA 2VNRA 4O9EA 3S6PA 3H1MA 4IEOA 4ET7A 5T5OA 1PGSA 1LR5A 3JBG2 2OA2A 3NNFA 2V5DA 4NUBA 4HKLA 2BTVC 2UU8A 4FFIA 2D6OX 2GMMA 3N7MA 1DDLA 2YROA 5FREA 1ZRDA 2YYOA 2J1SA 1BBT2 4YG6A 4F3JA 2ID4A 2PAMA 1AR92 4I0BA 4D6QA 5HCAA 3FFZA 3AK0A 1W2OA 4YZ1A 2WYFA 3MF6A 4A44A 5JPMB 3MV01 3BU7A 4MGSA 4UWDA 2Q0AA 1DHKB 1TME1 2YPDA 2ZZQA 2UWBA 1VRH2 2W92A 3ZXDA 2Z2SB 5ISLA 3AMHA 1RUI3 3ACHA 1LGCA 4LKFA 1LEDA 3AYCA 1KD7A 1Z7S2 4OI1A 1GNYA 4XJUA 2QQWA 3BTYA 1HB1A 1D0HA 5FMCA 1ZZBA 1F2NA 4LBOA 3VN4A 5L36A 4LMFA 5AFEA 4UI9L 1H9PA 1ASJ3 3KV4A 3VKLA 2VOVA 5FOBB 5FZOA 3U75A 5FBJA 1XYOA 3MO4A 3ZSKA 1Z78A 4LO8A 1C8M3 4XW3A 2G1MA 2Y6GA 1HQNA 3HPNA 1MVQA 1X9TA 2VOKA 3B69A 3M1HA 4PQ9A 3DF0A 4XHBA 5F6KA 1AVBA 1FT9A 1LNSA 5EYYA 5J37A 5CKMA 2XGXA 5IK5A 4YLZA 1FATA 4WZCA 3A21A 4YVWC 2OKXA 4DQAA 4Q4X1 2BZDA 5FZ7A 1X82A 2AZ5A 2ORZA 1UKRA 3NV1A 1LOGA 1N47A 1R1A3 4QU2A 4XF1A 4CUGA 2Y64A 1HV0A 2RDNA 4HVRA 5FYYA 2F17A 3AMQA 2O8QA 5DUVA 3ZPOA 4YGCA 2GZWA 1Y9GA 3AC0A 3ZMOA 2AYHA 4FP3A 1U5ZA 4PBOA 1JYWA 1JUIA 2MEV3 4JDMA 5A6ZA 3DXUA 3GBWA 1IPSA 3ZO0B 4NAOA 2YGLA 4BQ4A 4HN0A 4HPKA 4CU7A 4N9IA 2Q1MA 1WGPA 4RN5A 2R073 3D82A 2ZA9A 1AYM3 2BGPA 4ORFA 3VBRB 1ZBA1 1QIQA 1YEWA 1OD5A 3ENRA 2IXCA 1FMD1 4E4SA 4CPBA 1CPMA 4YVWA 4IGOA 3AKSA 4LR4A 4YM2A 1CAVB 2XONA 3LFMA 4HL0A 2Y38A 1OA2A 1ZM1A 4XFFA 1YQ8A 2JG8B 4AEDB 1UIJA 3VD9A 4QGLA 3ZFEC 4FCAA 4K40A 2BGOA 3WQBA 4ATFA 3WXPA 1MPXA 5L7OC 3AXDA 5FY4A 4BK5A 1CAXB 2WRAA 3R4DB 4GWNA 4K8RB 3J8F3 4EROA 1I5ZA 3IMMA 1R082 5BNNA 5FQ0A 1H2LA 4HK9A 4AZZA 1FOD2 4HT1T 4DRRA 1BMV2 1Q3EA 5FY5A 3AP4A 4EWAA 2DCTA 3MICA 4C0HA 4ZZ5A 2QCSB 4O61A 1UKGA 3BGAA 3CBNA 1H1MA 4DEQA 2AACA 1UZYA 3JCIA 1LEMA 2J1AA 2CY6A 1U5YA 3PJQA 4TLFA 2Q8DA 4AE2A 2YU1A 1S2BA 3LDKA 3PUAA 4QX3A 4MXWB 1AR91 3WLUA 2FBEA 4KMQA 1YNAA 4YW4A 2IZWA 5KHIA 3OUHA 2IFRA 4LK6A 1OPMA 1PNFA 1W9WA 1S0BA 5CFDB 1EYBA 4FOQA 4MUVA 4PDWB 1G7YA 5JOWA 3ZFEA 4CCCA 3NKGA 1ND3B 3IDEA 2UYAA 3AP5A 4OMDA 1TNRA 1DYOA 4Y20A 5F6LB 5DAQA 3NW4A 5L7OA 3H8RA 2QJVA 4AI9A 5K7PA 1S0IA 1X8MA 2Q8CA 3VDAA 3WDTA 2AC1A 3O14A 5SV8A 5CFCA 1K12A 5LA1A 3WV6A 1SFPA 1PVC2 1PX4A 1DIWA 2K46A 2WL1A 3VDBA 3I4IA 4LE3A 2LROA 2RMU2 4I2OA 4OHZA 1VAKA 5F2WA 3UETA 1VBA2 2BWCA 2VJXA 2WT1A 3ACLA 3A23A 1BXHA 1UZ0A 3I8TA 4NIIA 1SBFA 4IE0A 1EPWA 3SH3A 5IVBA 3BU0A 1B35C 4JZRA 1ND2B 4I0AA 3S7IA 1MS1A 2XLGA 4BDVB 3T2PA 1W39A 3I2DA 3I2HA 3AP6A 1NUKA 2BJSA 3UGFA 4AEJA 4OZXA 3CJIC 1CZTA 5I0DA 3N35A 3ACGA 3TOJA 5A32A 5GLUA 2J1VA 2VUJA 4RGKA 4LBNA 4PLMA 5E16A 1BK0A 1COV3 4PIYA 4BH9A 2PTMA 4C1XA 2BFUL 2Z69A 1CD3G 5IYYA 3OBAA 3O1TA 4ES8A 1Q56A 1LENA 1GV9A 2RV9A 2I2SA 1YFYA 3HQXA 1HRI3 5KHHA 1W8OA 3JXSA 1EPZA 4MZUA 1CAUA 4M00A 4B4RA 1J3QA 2VCMA 3ZYRA 3H8UA 1AR82 1IHMA 2X09A 4GZ9A 2D6PA 3LAGA 4Q4Y1 4C0BA 3KQ4B 4QGMA 1VP6A 3K3NA 4XVHA 3ZYFA 2BYVE 4M3CB 4OLLA 5JPNB 1RUJ3 3I2FA 1FPN1 4XABA 1SLLA 1PNGA 4K20A 4B29A 1Y4WA 2I45A 3U4XA 4CDWC 3R6SA 2Y6FA 4BPZA 3POWA 1FNYA 2GC1A 2VMDA 4AVVA 4AHWA 2QQVA 5KBFA 1XC6A 3B01A 2ORXA 3VHOA 1MQTC 4D3WA 1AXZA 1VBD2 3WSOA 5FJHA 2JDAA 1B35A 4LOSA 3O1VA 1SLTA 3C8XA 4Q0UA 5DQ0A 1BLZA 3CJIA 3OJBA 2P34A 1V6KA 1SPPB 4BQXA 2ET7A 2ZGNA 2ZGUA 4I01A 5J7MA 4AYUA 3ZMNA 2YC4A 1RVF3 1JXNA 3DN7A 3O12A 3ZSMA 4KWJA 3HNBM 4E2SA 1LU2A 1VMFA 2A6WA 3WY6A 4RS5C 1JZ4A 3M2MA 4FQZA 2XUEA 4BXFA 1QWRA 1KRIA 1DGWA 1VB4A 3HNMA 4BQWA 3MUY1 4MV2A 3MYXA 2NQYA 1XNBA 4DNYA 2A6ZA 1W9SA 3DPRC 3OOXA 4KQ7A 1EY2A 2H6CA 4DY3A 5JDBA 1CESA 2VNVA 1ULFA 1TME3 2BEOA 1HV1A 2VY0A 3JD73 5ACA1 2R041 5FZ3A 2CGOA 4UW3A 3CQOA 4L99A 4CDWA 5HXMA 2XBO2 2PQQA 4MVTA 3U07A 2XPJA 2JD9A 3CZJA 4DO0A 3QACA 4UT5A 1Q43A 1YYNA 4L92A 1MQTA 1OURA 2RM22 2WNOA 4HKOA 1XPWA 2ZX1A 5LBBA 5B4NA 2WN2A 4IGPA 4EN9B 2ZOEB 3VZKA 4CDXC 1D7PM 2RJ2A 4QXHA 4E8CA 4FXKB 2OPWA 4I3PA 1TG7A 3NMBA 2G4IA 1R093 2R7EB 2WT0A 4W6WA 1GFF2 1PO11 3D8CA 4CCLA 4AFDA 2B9UA 4QQLA 1J58A 4R9AA 1UY2A 3CF6E 4RS5A 2WWUA 4QKFA 1E57A 1C8NA 1US2A 3CEWA 4Q4X3 4TWTA 1PVC1 3S5AA 2RMU1 3TB0A 1JYIA 2BOJA 4YVSC 2VW2A 2W39A 2W47A 1VBB2 1VBA1 3DPRA 5ERLA 1H8TC 3M3CA 4ZU7A 1F4AA 2Q4SA 4FPOB 4P9LA 1DQ4A 4CU8A 1O3SA 5A7OA 3USUA 5C9AC 1ZZCA 4RHV1 5DUXA 1QEXA 2YXSA 1E5SA 1UU5A 3GALA 4Q1RA 3KMHA 1XSQA 1JZ3A 2WJSA 5DAXA 5FY0A 4PHZA 3SHRA 1W6OB 4QPGC 1LCLA 2VM9A 3H9AA 5FXVA 4JGYB 1S4CA 4CP1A 1VBE1 3N7LA 4WM7C 4XJWA 1AR61 3IDAA 3B9CA 4CDXA 4Q1PA 1Q8PA 2PYTA 1RTVA 4UFMA 2RHPA 4EZ4A 5T52A 1ZNPA 3MPBA 5F5CA 3W59A 4DPNA 3ORJA 4BIOA 4CP2A 2LS6A 1AR81 1V9U2 3IKWA 3IMNA 3AJZA 3K2OA 4RQPB 2HWC1 3NJZA 1JYCA 1H6XA 3M7AA 1ZYBA 4KBBA 3HMYA 1HRV2 1XE0A 1O3RA 4O9GA 3LDBA 5A33A 4XDQA 4YVSA 4CA9A 1UY4A 5FMOS 3X29B 3CU7A 1O7FA 2UY8A 4GMP0 1H8TA 5CKQA 2VMCA 2HWB3 3LA7A 3JQWA 1CIWA 2PLV2 5LBEA 2RS52 3GZAA 4AQ6A 4COYA 5C9AA 2R49A 1HB2A 3FHIB 2GNDA 3T1MA 2VZRA 4D8MA 1YJKA 3LIHA 5APAA 5FZ9A 3K48A 4R9BA 2ZPXA 3B5LB 4IEVA 1UF2C 4QPGA 4CDUB 4EQVA 4ATEA 2JENA 4JAAA 1LOEA 5H9PA 4KI5M 5J48A 3OGVA 4XFHA 1FV3A 3JBG3 1GYKA 4WVZA 5C3RA 4D7SA 1W0PA 3C7HA 1BEV1 2VXRA 1O91A 2BRTA 2QQOA 2ILMA 2VO5A 1HXS1 2OT7A 3B7MA 1BBT3 4L97A 1GWLA 5GALA 2TBVA 1GR3A 2ARXA 4M3CF 3AP7A 3M70A 3QOPA 1WMFA 2WINB 2YDEA 1XQNA 1MZ5A 3LFIA 1FXZA 1K3IA 1W6PB 2BNMA 4PQQA 2WQ8A 5DDJ2 5I8SA 5HV4A 2EVXA 3FC0A 4QDQA 5A3NA 1VRH3 3C7EA 5L9VA 2QQMA 2BOIA 2XBO1 5KHGA 2R16A 4WZFA 1RUC2 3GNEA 4AI8A 4NR1A 4CP9A 1Z7S3 5EYXA 2KD7A 1N3QA 3HR9A 4BMBA 4JGZC 1O3TA 3OPTA 4XFAA 5J09A 5KC5A 3V0BB 3O1PA 3H3ZA 2D40A 3DGTA 5GLTA 2XR4A 1W90A 2ZX4A 4Q4V2 2ZGQA 1W2NA 3ZN6B 2JKXA 3HOBA 3BODA 4YYOA 2YGMA 3WF1A 4JRLA 1DBNA 1I6XA 4J1XA 4ZKTB 4QQPA 4ONUA 1IS3A 1YO8A 2J1RA 1U5IA 3AL5A 4P9JA 3AVSA 3SISA 5EZWA 4P14A 5M0TA 2XQXA 2NP0A 4QX5A 3NJVA 1OA3A 5FK8A 3ZR5A 1ENSA 3ETQA 3THCA 1H4HA 1IQAA 1NA1B 4S2GA 3OD4A 4R4ZA 1HW5A 3ECQA 1V6OA 1F9KA 2RJKA 4TYSA 1HX6A 5KC6A 2ADEA 3PVNA 2ZXQA 1IQDC 3EB7A 2JICA 4P5HA 4QPYA 1XU2A 1HKDA 1VBB1 5FZAA 1LGBA 1OLRA 3QCWA 4CCEA 4B1MA 2WFF1 5JVVA 1OOPC 4JTOA 3GDBA 2XOMA 3JZVA 1XE7A 3O0VA 5JI9A 4FPJA 4Y4YA 4IE5A 4MHRA 4N43B 4FBFA 1Y3TA 2N7GA 4JGZA 1WW6A 2CGPA 2J22A 3DECA 4Y5SA 2QZ2A 3LKJA 4XF3A 4B4PA 3PDQA 5DAPA 1GOFA 5A80A 3GM8A 3ES4A 4UF0A 4XE9A 4XTMA 1A6CA 3OBRA 2DDUA 3U14A 3UKTA 5LK7B 4E9KA 4CXWA 1JZ5A 3PIGA 1W3XA 2ARCA 1NXD1 3MI8A 4NHXA 3RI9A 1W8ZA 1REDA 2XLAA 4NN0A 5C8CB 3O1OA 1UD1A 2GALA 4WBBA 4YZ5A 3LEMA 1V9U1 2QFEA 3ZIWA 5C6CA 3VV1A 5C5UA 5GZCA 4GMP1 2VOTA 3OEAA 5I8YA 1RUD1 3MF9A 3HWJA 3HT1A 1HRV1 4CTEA 2DFCA 2D93A 2X10A 3GZEA 2W46A 1IS4A 2PQSA 3F95A 4UFLA 5L9BA 4FTEA 1IG3A 2PELA 2WWJA 3GCXA 4P9IA 2Y8KA 5FYZA 5C4WB 1ZVFA 2WFPA 5FR3A 4ZZ8A 3O1MA 5FZLA 2DBNA 3N9NA 1GZ9A 1OOPA 2GC0A 2XJTA 5HXVA 3KVAA 4KG8A 2FZ2A 1QJU1 2GMPA 1YFUA 2VZTA 1R083 4UW6A 4NO4A 3SCGA 2RS31 1LECA 1FOD3 3OCPA 1SLCA 2RDQA 4E4ZA 1CIYA 3E97A 1UZZA 3J7HA 3LDRA 5FO7B 5FPAA 1BYHA 3POEA 1K5JA 4FQ4A 5IK7A 2GN7A 4EYUA 1UMZA 3C7FA 3I3QA 3E5QA 4W8JA 4W50A 4DB5A 4RR3C 4YGEA 1PO22 5C5TA 2K9ZA 2DV9A 1W28A 1OHFA 3OGSA 2ZJCA 3T1LA 5CFDC 1YI7A 2JG8A 4GB31 3KZ4C 2DUOA 2QQIA 4CEWC 2XXZA 2PAKA 2Q1ZB 3O1SA 1G8WA 1LOAA 2B46X 5CKNA 5DAVA 1IPKA 4OFGA 2WNVC 4XQ4A 1RUH1 1PZ7A 2BPA2 3VBUB 2W1UA 2IXJA 4L11A 4A42A 3KV9A 2PHRA 4AVAA 1YQ6A 2E7AA 2Y60A 3N36A 1JYTA 4F83A 3C3VA 1UPIA 3HAGA 3HN1A 5ABJC 3ZIXA 1LULA 1G9CA 1RUC1 4M01A 1LESA 5LWBA 2HEYF 1ULOA 3BPSA 1WKYA 3LPGA 3VDCA 3SCHA 3TEYA 1F5FA 1NCRB 2C4XA 4DUWA 4B4QA 5EIYB 5L19A 1GP5A 5JXGA 4Q4V1 1XNKA 1F15A 1MS4A 4IQPA 4CCDA 4OUEA 3VKMA 4YFWA 1KDMA 1AXYA 3S5QA 2RMU3 3NJYA 5FYSA 3ZDSA 4XAEA 3OEBA 2CWSA 4PJYA 3VZMA 1CQ9A 3HN3A 3KGZA 5GJ6A 4RR3A 4FPYA 3PMEA 3ZX7A 1SLAA 5FKCA 1CAWB 1DLLA 2EXHA 3J4UH 1RXGA 1XJAA 3E6DA 4B1LA 5CFDA 2ZEWA 1YQ5A 4PDWA 4CEWA 5KHKA 3JQXA 3OYWB 4GULA 2LM3A 2G9ZA 4UXAA 1SHWB 5IW0A 2PA7A 4COVA 4WM8B 3A0KA 4XBLA 4I0WB 2WNVA 5KWRA 1WD4A 1DYPA 1JU4A 1O59A 3I54A 4OI2A 5A3UA 2BERA 3FBYA 2D98A 2EF6A 3GHNA 3J7LA 5DZEA 1JOPA 3F2ZA 3VGIA 3OUIA 1S0CA 5FPVA 3WINE 5ABJA 3ZFGB 3K4AA 5IVEA 5H9RA 4XF9A 4FPEA 4ASMB 1ZBA2 1AR83 1CWPA 2Y26A 3R4SA 4XZPA 3WF2A 2W9XA 4OCTA 1UAIA 3MV11 4QHOA 1FMD2 4GXLA 3TEXA 2QE3A 3Q8FA 1KFXL 3ZXGA 5JSPA 3W9AA 1D4VB 1ZBE1 4BA6A 2NLRA 2GN3A 2C9KA 1OD3A 5A7NA 4M0NA 3ETPA 1Y43B 5CU1A 1W8TA 3H50A 1VBD3 4L8QA 3K4ZA 4RFT0 1RUE1 2P2KA 1LB2A 4N90A 4NWVA 1CPNA 3DKWA 2FDKA 3E6CC 3LEKA 3H7JA 3WP5A 1QXPA 2KR2A 3RWNA 4FFGA 5J3UA 4BQ1A 5FV3A 4CDQB 3RI8A 3FHAA 2DWRA 2E7QA 3NNGA 1MZ6A 5DZFA 1CGPA 5ANQA 2WC2A 5GZGA 1PK6B 3TN91 1OLME 1M4WA 3O0XA 4ZPIA 3UJQA 5JZGB 2SLIA 4A6OA 3V64A 1G9AA 4D6RA 4Z8BA 3WDWA 5C3OA 1QJY2 2VGDA 1G9FA 3ZVXA 3V56A 2VZUA 2JDKA 2ZGLA 3NAPC 4UOJA 2XDVA 2DCYA 3E6BA 4NMIA 3WG1A 4XHXA 2EXJA 4OUMA 1JZ8A 1EV12 1PO21 5LASA 4AEKA 1ZREA 1RC6A 2A6VA 2D7FA 3DEMA 1Y9MA 4D69A 2XBO3 4NHMA 4YM3A 2A1XA 1YRZA 3M4FA 4FPHA 5IFPA 4QXKA 5FPUA 2RM23 1W05A 2VG9A 4KWUA 5I0RA 1ZRFA 1C5HA 1QNWA 4XCAA 2FDGA 2GNMA 2ZTNA 3LA3A 4GH4B 3AYEA 2JG9C 4QT6A 4CCNA 4KBZA 4XDOA 3EHKA 1ZZ7A 4UYBA 2Y34A 4OHXA 3U10A 1OUSA 3OSDA 1XNDA 1D2SA 3MIDA 3IIIA 4BWOA 2RR11 1YQ2A 3KCXA 4NHKA 2G9FA 4AK3A 2BNOA 3KVBA 1GUIA 5GLZA 4IV1C 2DCKA 3SNMA 5A3LA 2K2SA 2BUKA 2D97A 4PLOA 1UW8A 2P6HA 4ZHNA 3I2OA 4YM0A 2YFUA 1YC61 1J3PA 1MEC1 4V2VA 4XIKA 5F5AA 3T0BA 3H1WA 4ZU4A 3VD4A 2RJLA 4URTA 1GANA 3NAPA 1O6UA 4XPVA 5EJZB 1DU3D 1W6NB 1Q8SA 4AFMA 4EWDA 2QBXA 4LT5A 4FSJA 4CEYC 4OULA 1CVNA 3U78A 5A7WA 4YG3A 5FMDA 1OH4A 3S0MA 1HDKA 1VMJA 4EN7B 1R64A 3J7NA 1KJLA 4LHSA 3KCCA 4YW5A 5BNNC 5BNPB 2ETEA 3KHCA 4BE3A 1JTZX 1JHNA 2BDRA 2J1TA 4FO9A 4ISQA 5JR7B 3T09A 3AMMA 3N9PA 2WZ8A 4AR2A 2IXLA 2YMZA 4PBPA 4AL9A 1POV0 2QKDA 4UW4A 2XVGA 2CYFA 4AGGA 3A4UA 1V00A 1YIPA 1SZBA 4INDA 5DG2A 4Q4Y2 1TEIA 4KWKA 4EV0A 5IHRA 3WUDA 2JXAA 3H1YA 4Z82A 4BLJA 3A22A 2JG9A 1W8HA 3I3DA 1FPN2 3BYWA 5F39A 5CISA 1QXRA 2ZGTA 4U2AA 1W9FA 4I02A 2OQ7A 2WNUC 5HPOA 1H9WA 3DYPA 2PHUA 4XZUG 5AFBA 5CNAA 2C5DA 4MSVA 1OVPA 2P3KA 1V9U3 5FUIA 4DUXA 4MADA 3B9IA 3FLPA 4CU9A 4XXPA 4IESA 1NLSA 4IV1A 3IAPA 3T0AA 3CNAA 4FOWA 2WS92 1M06G 1SQ4A 3B02A 4MO3M 1HRV3 2XJQA 2YFZA 3ZXJA 3BTXA 1S0JA 2WQ4A 5CYYA 4A3XA 1VIWB 2P17A 4C8DA 2O1QA 5JSOA 1WCSA 2ATFA 2QQNA 4ZONA 4OQ9A 4FPKA 2F6BA 4CEYA 1W6QA 1J59A 2B9VA 3VBOB 5K0UC 1DQ1A 4FTBA 2PLV3 1SCSA 2NPIA 2RS53 4AXOA 3AX4A 2QDRA 2ZZJA 1WMDA 2NMOA 1RUG3 1POQA 3UGGA 3UT0A 2R30A 1WBFA 4UFJA 4ZXKA 5CFCC 1HB3A 1RHI1 1H1AA 4LBJA 2X5IB 2ENRA 4N9HA 3D6EA 2HWF1 1QH6A 1XNAA 3ALQA 3AZZA 1BJQA 1Q8OA 4OI4A 3RZJA 1H6YA 4WVMA 1KGYA 5GKAC 2HH9A 1SDWA 1QJX1 2VMFA 2VNOA 2CV6A 3AP9A 3M8LA 5DN2A 4I09A 1DQ2A 5ACA2 2WNUA 3HBKA 1IOAA 2E63A 1QJY1 2R042 1V6MA 3I59B 1PMHX 4U36A 5E1RA 5FZEA 3RZMA 2XKOA 1O5LA 3QH7A 1RUF2 2AREA 1EV11 4NWWA 2GU9A 5DDJ3 2OYZA 1NQJA 3HD8B 4DEVA 1ULEA 3ZFFB 1J1LA 1YLLA 3V65A 3KT1A 4CRQA 5C71A 1OUXA 2FCVA 4N53B 1L7RA 4D7TA 2DUPA 1GNHA 2FDFA 3V0AB 1CJPA 3OTFA 5HCBA 4LTAA 4MYEA 4DIQA 4Y3OA 5C3QA 1DLCA 3MFCA 1CZSA 1ENXA 5K0UA 1PO12 3POGA 1T6GC 4LUKA 1PM7A 5EP9A 1NYWA 3N4MA 5FZIA 3I2GA 3MEPA 3WQ7A 2HWD1 1GZWA 4QB2A 4LQRA 1AX2A 2H0VA 3GZTB 5GZFA 1S0EA 2VBPA 3ZKUA 1UU4A 4LIUA 1D4M2 4DRVA 4J25A 4GQ7A 2VZVA 1OQDA 3BOWA 4KWLA 3I3MA 2Z42A 1GICA 2B4KA 2ZGOA 1UL9A 3VDDB 3VZLA 5BNOB 5FZ1A 3PMSA 4ZS2A 4KNCA 1QJZA 3DUIA 2Q1FA 3NV2A 2E6VA 2Y0IA 4I3GA 2R063 1UZWA 1W6PA 1UO9A 2B42B 3H3LA 4AQSA 4QM9A 5FXXA 3FUOA 4K9SA 3SXWA 5C3PA 1V0AA 2R6QA 1EAH1 3PL0A 4RHV2 1ZA4A 1ZZ6A 5IWFA 4XJZA 2GC3A 5FPBA 1UZVA 4A7ZA 4MXVA 3VD3A 3RFRA 4K1ZA 3ZYPA 2IXKA 1HQWA 3AKPA 5FY8A 1W2UA 2VW0A 1AR73 4HLTA 1JZ2A 2BV4A 4LBQD 2ZMLA 3MZHA 3UNPA 3VUOA 4Y22A 5F3CA 1VBE2 3V0BA 1POV1 1N1SA 3TEWA 1X8EA 5IUQA 3WX5A 3KD4A 4D94A 1AR62 2WO3A 1JBCA 1LHVA 3S57A 1PGL1 1YQCA 1FX5A 3E1F1 4Q4V3 1F4HA 5CBLA 3OUJA 1RIRA 5BUVA 1CR7A 3BKZA 1IS6A 4JV4A 3RYPA 2JECA 1PZ9A 5CAZA 5CB7A 1HIXA 1VJ2A 4GKYA 3UYJA 3RJRA 4BQ3A 4QM8A 2JDMA 3EQEA 5FPZA 1OFNA 5FO8B 4ITCA 1VAMA 4BCUA 2HWC2 4LHLA 3WDVA 3OY8B 1Q5OA 1QH7A 1RYYA 1LOBA 2ZAHA 5FZFA 4E8DA 1PMJX 5D8AB 5GZEA 4K7JA 3WCSA 1WCDJ 4XQDA 2HBUA 2ZKNA 2Y6LA 3PU8A 2EALA 1DQ6A 2WS91 1MS0A 1WCKA 2KA3A 4AGVA 2BNNA 1NCQB 2A3XA 3PHMA 1PMIA 1JU3A 4A7KA 1J84A 2YBKA 4E4DX 2GSYA 4O65A 2UWAA 2W1SA 4XFGA 1QU0A 3NWKA 2VCAA 4SBVA 4IV3C 3N3HA 4G3YC 4QKDA 4Z92B 4XJAA 4YRDA 2V09A 5JIAA 3AZYA 2HYXA 4NIDA 1AXKA 1TQ5A 4B3NA 4Q0QA 2WSUA 3OG2A 5T5JA 3K51A 3MBWA 4LKEA 5LEKA 1GKBA 2P37A 1BEV2 1QF3A 3P5BA 2D44A 1HXS2 3PURA 3M3QA 1DYKA 2VW1A 1VALA 3WDYA 4HOOA 4BU2A 3ZYBA 4BISA 1S55A 5C7GA 4AI1A 4YSFA 5CG9A 3WW4A 5LEJA 4E2GA 2Z4FA 2DBIA 2P3JA 4UBGA 4QMAA 4JKLA 3K77A 4HSJA 2X05A 2YY1A 4P9YA 3KS7A 5FZ6A 1W06A 1RUF1 4IXLA 2GMEA 1PIV1 4RYDA 1UY3A 3THPA 4P02B 4AHXA 1AL21 4AFCA 2QNKA 3JB8A 4QQOA 2VD7A 3AFKA 1UY1A 4NVPA 4LA2A 4IV3A 5JXJA 2ZAAA 1US3A 1AX0A 2BBAA 4YWAA 3WDUA 2IXHA 2VE1A 5JSRA 3ZYHA 5FYUA 1ODMA 1UY0A 4YZ4A 4GD4A 3SH5A 5J36A 2AEYA 2D5FA 2ZACA 1U5XA 1E5RA 2AH2A 1D4M1 5AVPA 1QMJA 4MOAA 4C90A 2E51A 2EAKA 4FVVA 3TEZA 2W0XA 5DAWA 5FZHA 2ZX3A 3T2OA 5BXXA 4E4HA 2PHDA 4G4FA 4IUGA 4XXAA 4YW2A 1LHOA 1K5MC 3RQ0A 1KJRA 3GBFA 2WFF2 4XOGA 3VBUA 3ZSLA 5CADA 2C26A 4CXYA 1KFUL 2H6BA 2B8MA 4IEYA 5SV5A 2DYCA 4HPKB 4YGBA 5T50A 4AI3A 3KGLA 2JWPA 2BBVA 2XHKA 2OW4A 2QZ3A 3KCYA 5FWEA 3FWEA 1KEXA 1NX9A 1OA4A 1RMU1 3ACIA 4J6GA 4LO5B 3SC7X 3VBSC 2A73B 3MHZA 4IEUA 2RS12 5IAXA 1GU3A 2BFUS 1UWWA 1JHJA 2JDHA 3UV9A 1R1A2 4AHYA 4XACA 3AKTA 5LK5A 3ROUA 4YGDA 5J1XA 2YBPA 1O3QA 2DURA 4QQ2A 4YVWB 3RZKA 1ZBA3 4RSUA 3VBFC 2TNFA 5T3NA 5T5PA 4Q8LA 3T2QA 4LORA 4FFFA 5LY1A 1FMD3 4A2UA 2PFWA 1VBC1 1MS5A 3DYOA 3FUQA 1QQP1 2ET1A 1RUD2 5A3OA 2WBKA 2ZEYA 2IVIB 3NNMA 2JDYA 2O14A 2VC9A 3CO2A 2B39A 1YI9A 1NQDA 5FQ0B 1I9RA 1UMIA 1W6MB 4WM8A 3VD5A 3GJBA 3ES1A 2QQPA 4MGTA 1IS5A 2VUDA 1K5MA 5FZBA 5LATA 1OT5A 2WR9A 3FN9A 3MIHA 2A75A 1BZWA 1QJU2 1S0DA 4QAWA 3W58A 1AYM2 1K42A 1QY4A 3P3PA 2ZGMA 1OVSA 2IUWA 2RS32 4W6YA 2EICA 1ZZ8A 5JZGC 4OHYA 1JH5A 2WKKA 2Y6JA 3ZXEA 1UCXA 1YFXA 4CU6A 1NE6A 4BJ0A 4XDPA 2VOXA 1ZX5A 1ALYA 2GC2A 4H14A 3VBSA 1UOFA 3VHRA 2ZHKA 1I3HA 3GXUA 4I30A 2D6MA 4QKNA 4QPIB 2VZQA 1DZQA 3RVHA 4LPLA 1QJY3 3MIBA 1VR3A 2YPJA 4GB32 3WR0A 1UYZA 3VBFA 4YW6A 1AYN2 1AR93 4PIZA 4Q27A 3NV4A 3POBA 1OBNA 4BLIA 3H3UA 1DCSA 3J8F2 3K4DA 4LO6B 3ZFEB 1EV13 4YW1A 1RUH2 2FMDA 5FXWA 3ZXLA 4Y20B 3PIJA 4FT8A 2IWGB 2H0BA 5A3TA 4IEXA 5L7OB 1KS5A 5JI7A 4AVSA 1C5IA 2GP3A 4J1WA 1GLHA 3QBQA 4DINB 4XC9A 2YV8A 3T2TA 1O4ZA 4Y24A 1PGW1 1LGNA 3ZYIB 2RDRA 2A3YA 4PI2A 3FZ3A 4RGAA 5FKBA 3ZM8A 4BXSV 3FLTA 1OQEA 2WO1A 2E32A 2XH6A 2QDNA 4GWIA 3O7OA 2O0OA 5JZGA 1A78A 2B7YA 2UYBA 4MX3A 1J1TA 2G9GA 1NAEA 4WVVA 2VVDA 3I2KA 3K75B 3LWCA 3INAA 5C33A 2CHHA 4W65A 1AX1A 2XL7A 1JS9A 1JI6A 4H7MA 4NHLA 3H7YA 4PLNA 4BZ4A 5FUPA 3ITQA 4XCBA 4LEJA 1Y9QA 1OPOA 1UU6A 5F1RA 5A32B 3CDZB 3AM2A 4JQRA 2DVFA 4Q4W2 2V72A 1LHNA 1SLBA 5JIUA 3RNSA 4NIGA 2D3SA 4L9BA 3MW3A 5JCTA 5HBAA 1QOSA 3RZZA 2QVSB 5LW9A 1JODA 1JOJA 1ASJ1 4L0PA 4XFBA 4N7IA 3WNOA 1FAYA 4X8NA 3U37A 2YC0A 3DCQA 3GZUC 3ZLIA 3VKOA 1CAUB 1OKQA 4FOYA 2D3RA 3WW3A 4XF0A 1MZEA 1OKOA 3VZOA 1RXFA 4BQ2A 3FBMA 4QXCA 5FXZA 2KM2A 3VBRC 4Q4Y3 2QQJA 1HQLA 1GQPA 1LTEA 4TSVA 5LA9A 4A7YA 5IVFA 1JN2P 4ZS3A 2RS11 4XETA 5KXBA 1FPN3 1X33A 2DUQA 1HLCA 1R1A1 3C7OA 4XIOA 1ZBE2 2ZCWA 5FYHA 4CZSA 4AEDC 5FP4A 1SMVA 2HKXA 4A41A 1B35B 2JG8C 4AAPA 5E8AA 1C4RA 4YW7A 2P1BA 3VL9A 4LBKA 1W8NA 4HG6B 4LIVA 5DZGA 2HEWF 1EP0A 1HN1A 4FP2A 2WS93 3RYRA 3CJIB 5IVVA 3VBOC 1RUE2 3LEIA 1OF3A 4JKMA 5LB6A 1RJ7A 5JUVA 2PHTA 4MHUA 3PLQA 4QKBA 2MEV1 1VB2A 4XMAA 4OZOA 1YHFA 4KH9A 1DQ0A 1X36A 2WZR2 1N1TA 1BVVA 5CIRA 4YFZA 2D43A 1SLIA 1XOYA 3FX3A 4L2NA 4BM8A 2E53A 1BKZA 1NKGA 5FZKA 1AYM1 3TN92 3ZPYA 5KXCA 1ONAA 2VTXA 4H55A 1V6LA 1EUUA 3HT2A 1C57A 2P5BA 5FK7A 3EYPA 3ZYGA 1UYYA 1ZRRA 2A71A 5BYNA 3ZXAC 5JWPA 3VHPA 3VBRA 1QOTA 1ENRA 1PX3A 5LA0A 1IG0A 1WA4A 4Y26A 4CDWB 3VZJA 3ON7A 3T4HB 2JE9A 5FMBA 1X50A 5F9TA 3LF7A 2BWAA 1MZFA 2WSVA 1WWYA 5ACA3 1WZXA 5EWSA 2FD8A 1MQTB 1CAVA 2R043 3NO8A 4AEDA 2ES3A 4PDWC 4ARYA 2LW8A 3NQHA 4QD2A 4IGQA 2CDOA 1AYN1 1GSLA 2WO2A 3NNLA 4KGGA 3SH4A 1ND3C 1HJFA 1X9PA 2P6CA 3J8F1 1DF0A 1RUF3 2GP5A 4MG2A 3VBOA 2P3YA 4ZY9A 2G19A 4F8AA 2UY9A 4JX0A 1CAXA 1YFWA 3PUHA 1XB9A 3T3YA 3KF3A 1ST8A 4CSWA 1EUTA 2W91A 2NMNA 1CZVA 3ZN5A 4RS5B 2EIEA 2YG0A 1PO13 1TZOA 2RR12 5IJRA 4BYYA 2OPKA 3JD72 4CUCA 5BNOC 1ULDA 2VUAA 3WF0A 2OX0A 4TN7A 1PVXA 1L7QA 1XE8A 3DPRB 1PVC3 2YC2A 1ND2C 1MEC2 5FP3A 4CPBD 3AZWA 1VE0A 3R0RA 3TNQA 2FHRA 4META 1D2QA 3OBZA 3USUB 1RB8G 1VBA3 4MXWA 2C24A 4XTPA 4CYDA 1S2EA 2MHFA 2A5ZA 4GJZA 1Z0HA 4CP0A 5E89A 5GZDA 2VNGA 1BCXA 5J98B 4RHV3 2A6YA 3HIFA 4Q29A 5FUNA 3SKVA 4Q4W1 4XFIA 4V1PA 4DMIA 4URAA 1ND3A 1QNYA 1UNBA 2D6LX 1W8UA 2JKBA 3PTYA 4Z07A 4BK4A 4CDXB 1HB4A 3UKVA 4YPJA 3IDBB 2CWMA 1VBE3 3HBZA 1IKPA 5D1IA 1NY72 2EIGA 2XHNA 1ZRIA 4YNIA 1SDDB 4ZXEA 1AR63 4GWMA 1S0FA 2Y6HA 5I0SA 4R8HA 5LBFA 1DG6A 1UMHA 5KR7A 2LTNA 3RMXA 4ASLA 3N7KA 4QDRA 2D6KA 3D0SA 3WNLA 3EMRA 4K21A 5D2AA 3BCWA 1XBFA 4YG0A 3I3EA 4QHBA 4MGYE 4AEMA 1LKNA 2WZPP 5BNOA 4R52A 2BU9A 5H9QA 4K6BA 1YXWA 4YVSB 4D0QA 1LJ7A 2HWC3 2RVAA 1WW7A 4JQTA 3IIAA 4UAPA 1H8TB 4Y1UA 4P00B 1ND2A 1NCQC 2CAUA 3IM0A 4HONA 3U0ZA 4FPFA 3LSEA 5C9AB 3DL3A 3WOGA 4C91A 4BQYA 1COV1 4UFKA 2GAUA 3WD5A 4HSLA 4FOVA 4NPMA 4DOUA 5KXEA 1VPHA 4LBQB 1OC1A 4DXRA 1T6BX 2PXJA 4QPGB 3EXUA 1A34A 2DU0A 5FFOC 5JXHA 3RWKX 3MLLA 4LULA 3H42B 1X7NA 3ZN4A 4HKWA 1RHI2 4WM7B 4FAHA 3J9SA 2WZR1 3ASIA 4P9XA 5FZMA 2HWF2 4LBLA 3J26N 1RUJ1 4MGIE 1U0AA 5F8PA 2VZOA 1MACA 2BVVA 3LE0A 3AZXA 1QJX2 3WUCA 1JYXA 4M3CA 3KM5A 3SLIA 1BEV3 1G9BA 1HXS3 1NOVA 1SEFA 2CU5A 4JC1A 3KV5A 4LKSA 4LHKA 2W5FA 4A4AA 2VUCA 3LGRA 1YIFA 2DVGA 3RDIA 1XNCA 3ILFA 1FYUA 2CL2A 3SEEA 2C6SA 2NZ9A 3A7QA 3WNXA 3LSDA 1KXGA 2AENA 4CP9B 1NCQA 5JMCA 1GOHA 4HZFA 4JDOA 3NNJA 3TNPB 1H30A 4BIFA 2JIGA 2FZ1A 3BTAA 4NJ4A 4HVOA 1RVF1 3TRSB 1GQGA 1SPPA 3NKTA 4AAXA 2XB6C 4PI0A 3ABZA 3DKQA 3JU9A 5H9SA 4GALA 2OUJA 1WLTA 3PNAA 3CIHA 2HWD2 3POFA 2WDBA 2PN5A 4NAMA 5CA6A 2VXJA 2JDZA 2VVEA 1UX6A 1JOBA 3OGGA 4CUBA 3EO6A 4G9SB 4QHZA 3IPVB 2VBDA 4W6XA 4NHYA 4JCKA 3JD71 4F7ZA 5A7SA 1K45A 2BVBA 5F3GA 4LKDA 1FI2A 4H3WA 3ZKYA 1LODA 1W0NA 2V4VA 2XJRA 2C0ZA 5A1LA 4KGQA 5FP7A 4DXZA 5IVCA 2PHLA 2DCZA 2VMHA 3FL7A 3OGRA 4COZA 1I1EA 5F5IA 2VULA 1AF9A 1EAH2 1O8SA 3AKQA 4QXBA 5FZDA 4JDNA 4AVCA 3PUSA 4TZDA 4QDSA 4CCMA 4IEWA 5K4LA 3KF5A 5FZ8A 5K9YA 1KQRA 1VBB3 2C1FA 5F5QA 2OXBA 3WT3A 5ANNA 1WLWA 2A70A 2K0GA 1G6NA 5I8TA 1AL0G 2WFF3 3N9OA 4XMIA 4JGYC 1OLQA 3WDXA 2XWBB 4NPRA 4JGZB 2XVKA 5BY5A 1YCIA 1R091 3N9LA 2VH9A 3NVCA 4XF4A 1PGL2 3VKNA 2GNTA 2VZ3A 4UF0B 5L73A 2PHXA 2ZHNA 4D7YA 4Y5TA 1H1IA 3TYJA 3WP4A 3MLKA 4Q8KA 1ULCA 4NROA 1WMEA 4HK8A 1T2XA 1W04A 4HETA 1O4TA 4QB6A 5G04L 3T08A 5F37A 1NY71 1P8JA 5DG1A 2AGSA 2RS13 2ZHMA 4QX7A 2VOWA 2ZMNA 1G86A 2O8OA 1TVGA 2DTWA 3WHTA 2WABA 3WG2A 5EV7A 4RQPC 4AFBA 1GBGA 5G05L 2RG4A 3WP6A 5BPXA 3POSA 4X8PA 2VMEA 4CE8A 5A70A 5C70A 2X53S 3T0DA 2CAVA 3WF4A 4X6RB 1LOCA 2FCTA 4GMP3 4FPCA 4QPWA 1RUD3 3APBA 4NRPA 3PJYA 5EHDA 3WQ0A 2FQPA 4YM1A 4OUSA 1QDCA 3WNMA 2W68A 1S0GA 3L2YA 1DFQA 1OOPB 2ARAA 1OF4A 4K8FA 3WEZA 5A3PA 1XRUA 4AI2A 2W1QA 5EQUA 2PAEA 2WLPA 3G6JB 1W6OA 4CDUC 2A7AA 2VCCA 3OB8A 5I0UA 3KV6A 4JGYA 5LBCA 1QJU3 3RRDA 2V4AA 2ZHLA 3URFA 2I07B 3VBHB 3W5NA 3IWZA 2RS33 4QPIC 4YZ3A 2Q5TA 3RJ2X 3B3QE 5A6YA 4S2DA 5FIXA 4BB3A 2IC1A 2YHJA 3WZ1A 3AMPA 5F3IA 3R4UA 4KL1A 1VMHA 5FYTA 2JDPA 2PHFA 3UESA 4AW7A 1JUHA 4HXCA 4RQPA 1C1FA 1LOFC 1W99A 4GB33 1PZ8A 2YUEA 5A6XA 1AYN3 1DGLA 4R9DA 2HWB1 4P9GA 1KDKA 5T55A 4QB1A 1W6MA 1CN1A 2FCUA 2VAUA 1RUH3 4LE4A 1QGLA 5FYBA 3GBGA 1V6IA 1PIV2 1TMF2 2R1DA 3UKNA 3VLBB 1J83A 3KT4A 1AL22 3EBRA 5FPLA 3CJXA 3HEIA 3D0JA 5I0TA 1RUC3 2B5HA 4AI0A 2ZGSA 1N3OA 5EPAA 1OSGA 1WA6X 4CDUA 3JBG1 2MNGA 3IN9A 3E5XA 2CTVA 2DU1A 3GHMA 1WW5A 2I74A 1BVP1 3ACFA 3AMNA 4JTNA 1BHGA 2VQ0A 2IVJA 2OVUA 2OZJA 3NJXA 1UOBA 2WA4A 1NA1C 1BBT1 2UWCA 3J7MA 4QPIA 5FLIA 5BV6A 1N3PA 4FPGA 3RZLA 3AFGA 5FJKA 4RR3B 2VZSA 1LHUA 1UYPA 2RDSA 3WW2A 1C28A 3I2IA 2OIIA 4XQWA 4EZHA 2ZBJA 1MS3A 3BIWE 3QD6A 1UOGA 4CEWB 4DFSA 4QQHA 3WQ1A 4M4RA 1VRH1 3LB9A 2ZX0A 4XUNA 3GGLA 1VAVA 3KHBA 4GA9A 1LOFA 4IEQA 2WNVB 3W20A 1WLCA 3T30A 1AJKA 2ZEXA 4COUA 1Z7S1 2WA3A 1GMMA 4DUVA 3R05A 4Q4W3 5AC92 2VVFA 1RINA 2WO7A 2XG3A 1UYXA 5DUWA 2FDJA 3S30A 5FYMA 2CGNA 2HYKA 4N43C 4B7KA 5ABJB 3ST7A 4XBNA 1UQXA 4A6SA 1ULPA 3FE5A 1RMU2 3VHNA 4OI0A 4MGZE 3AZVA 2VZPA 1R1ZA 3SITA 3ZN6A 1RUNA 1QDOA 4RGGA 3B94A 2JIJA 2W3JA 5JXIA 1UXXX 1CONA 2JX9A 3IZOA 2W52A 3N9MA 4Z2WA 3MW2A 2BP6A 1W9YA 3THTA 1N1YA 5C8CC 5GLVA 4FXGB 1S2KA 1NA1A 1VBC2 2ZGPA 1FV2A 1QJFA 4IDZA 2Q8EA 1QQP2 1KITA 3WG3A 1ZBE3 1W8FA 4IERA 2WNEA 4TLGA 2OQ6A 4LO4B 3RGBA 3Q8CA 5JMOA 4AF9A 2EAAA 1U12A 1IZ3A 2VL4A 1OXCA 2E33A 2GH8A 4WVWA 2XMLA 4BHPA 5C4WC 3ZR6A 1H2MA 5CVRA 1RUE3 4DZGA 1GQHA 3MLJA 4QX2A 5IT6A 5F7UA 4LJHA 3GYDA 2CSGA 5FZGA 4SLIA 4YZ2A 1WMXA 4K1YA 4N8MA 4E2QA 3I7DA 1RGSA 2Y33A 3LD8A 2WZR3 4JHTA 4Q0PA 3WNPA 2CNAA 4N43A 4QX8A 1MS8A 4C1WA 2BQPA 3H8XA 2J7MA 3WNKA 1A3KA 1NE4A 3MUZ1 4AOCA 4XJ9A 3ELNA 3AVRA 3TN93 1ULGA 4LITA 3P6BA 5FMOL 4Z2AA 5KHJA 2XJPA
chains in the Genus database with same CATH topology
1N1VA 1NXMA 1H4GA 2XLFA 4COWA 1RJ8A 1NLRA 3H0OA 2HWE2 5C8CA 1W0OA 2ZMKA 3RSJA 1PO23 4RD7A 5FDBA 3PVEA 1LRHA 3VBUC 1C1LA 1DGWX 5EFUA 4AWDA 4WV8A 2TUNA 3DV8A 1R081 2VMIA 2W08A 1PGW2 1TE1B 5C4WA 5A3MA 1SBEA 1F31A 4QGNA 4EN0A 1FOD1 3L2HA 4XFCA 1J3RA 5JAXA 1BMV1 1TMF1 1NCRC 4AQTA 1A8MA 3JB4C 4HBNA 3KSCA 3LCPA 1SACA 4JRAA 3LA2A 2QUOA 2RR13 1S1AA 1QKQA 2WWSA 5LRRA 3NAPB 2ZKLA 2R1BA 4Y1ZA 5EXOA 3WVJA 1RUI2 1MEC3 3O5SA 1ZRCA 4MLOA 3IDCB 3ZXKA 1XU1A 2VMGA 2X29A 3AB0A 4K3UA 4WM8C 2RE9A 3M3IA 4IEZA 4OVEA 2VPVA 1ASJ2 2A6XA 2OUHA 2XKPA 2KXLA 4IETA 5E88A 4EN8B 4RA0A 2UURA 5FLHA 1C8M2 5AC91 4IL7A 4M3CE 5HI0A 3ZFGC 2GDFA 2JG9B 3TBDA 2AUYA 4BMEA 3CL1A 3WW1A 4PCRA 1NCRA 3MPPG 3WP3A 3VL8A 1KS4A 4IV1B 2YZ4A 1SFNA 1PHMA 5FLJA 1MVEA 2BW8A 3MIFA 4Y1YA 2B45X 2TEPA 1DZRA 3N7JA 4Z1VA 3KB5A 5JOZA 3WG4A 2VECA 4XBQA 4P9WA 2DVAA 1CAWA 4CEYB 1W6QB 3AYAA 2MEV2 1LU1A 4N7UA 3IT8A 3OYWA 2C9AA 4LBMA 5BNNB 5HCFA 3ZYJB 2NM1A 3RS6A 4CDQC 2R072 4GIQA 4EN6B 1C3HA 3M3EA 1REEA 3OPZA 3ATGA 1PK6C 4AGRA 2F4PA 4WVMB 1RHI3 5CG8A 3ZFGA 5FRAA 1QXJA 4MH0E 1V6JA 2HWF3 2SBAA 4BOWA 1V6NA 2WNUB 3VKFC 5GLWA 4XEZA 1QJX3 3Q9OA 4AVBA 1MS9A 3LOIA 4ES9A 4LUMA 5AVAA 4LNVA 5LRSA 4FTSA 1AZDA 1SCRA 3CLPA 2GH2A 4OHVA 1VBD1 2DTYA 2HWE1 3IBMA 1CJDA 1RUG2 3ZXFA 4LBQA 3S7EA 2ZGRA 3ZSEA 1H2NA 4HMZA 4LA3A 4FPLA 5K0UB 1LHWA 3G7DA 4GH4C 3D4KA 4LHNA 2DFBA 4WM7A 1GZWB 5FCCA 3MIEA 4CDQA 5CFCB 5IK8A 4FAGA 4JVAA 3AYDA 3GF6A 2HWD3 1PK6A 4B7EA 4LO7A 3PVOA 5FBZA 3FLRA 1XYNA 1IGOA 1MR5A 5FTTC 5K8SA 4XJ8A 2Q8OA 1DQ5A 2ZABA 3AJYA 3USSA 5JOXA 2IXIA 1A8DA 2VU9A 3BALA 1EAH3 1QHDA 1RUI1 2RM21 2Q30A 4Y22B 5BNPC 1H2KA 4H7LA 4GKXA 4HVQA 4ZU5A 3U11A 2E7TA 1POV3 4Q2FA 2PHWA 5BNQA 3WCRA 5KXDA 4PF5A 1C8M1 1OMIA 1Y7BA 5IK4A 4GH4A 3TAYA 3D5OA 2JE7A 3C2UA 4HANA 2WQZC 5T54A 3MFAA 2X8KA 2D3PA 5I91A 2JJ6A 3IPVA 2R062 5DXDA 2Z79A 3EJKA 1YUDA 4UW5A 2FMYA 1ENQA 3MIGA 4AG4A 1RL3A 3QH6A 4OHWA 1VLNA 1RUOA 3MDPA 1AJOA 1O5UA 1AR72 2WLQA 4Q0VA 1COV2 1W6NA 4E27A 1F5JA 5JLVA 3MGUA 4HFSA 4R4XA 3LZZA 4HN1A 3LOBA 2IFWA 4KG0A 3O0WA 1HRI2 2WIIB 3VBHC 5BNPA 3A0NA 2BGCA 2ARBA 1BK1A 4ISRA 1WUVA 2VQAA 3P3NA 2X5IC 3RG0A 1AUYA 2EXIA 1RUJ2 4PIXA 2R071 5C8WA 1GNZA 2P3IA 1APNA 3OD0A 1NG0A 2DCJA 2V73A 3RYKA 1F8VA 4YW3A 5DUUA 4XYXA 2MPFA 1Q8VA 3QLQA 1L3JA 4X6QB 4EWEA 1WBLA 1SBDA 3ZFFC 4DS0A 4KU7A 4N53C 4S2FA 4YARA 2PLV1 2RS51 1RVF2 2EXKA 3UJOA 1RUG1 3TWIA 1NZCA 3MW4A 3POYA 1PIV3 1TMF3 4IV3B 4Y1VA 1AL23 3VBHA 4AHZA 3OF1A 2A3WA 2ZGKA 1DGRN 4EJRA 4RL7A 2X5IA 3FMGA 3WHUA 4IEPA 4Y1XA 5JOYA 1TME2 3VDDC 1YWKA 4MGKE 5TSWA 1D0GA 4Q26A 1D4M3 2AR6A 2Z5WA 3L9JT 1V70A 5GM0A 5J96B 1REFA 3VZNA 3I59A 1Q8QA 5DDJ1 3UK9A 3KQRA 1BQPA 1AHSA 3BOPA 2LUWA 1DZTA 3ZFFA 5FAXA 3ZSJA 1SFYA 2XJUA 1R092 4N53A 5AC93 3NV3A 3AKRA 3OGJA 3NL1A 2JEMA 3V0AA 1YJLA 1UPSA 1RITA 1B09A 2Y0OA 2XVLA 2NN8A 2DVBA 2HEVF 4Q0SA 1RMU3 2OZ6A 4Q4X2 4NOTA 3ME2A 4DY5A 1ZZ9A 2GNBA 2WT2A 1IPJA 4LLOA 1WD3A 2E9QA 3FFQA 1URXA 1XXNA 3B00A 2ZS6B 3RPQA 5I93A 4M0HA 2R061 5D8AC 3VDDA 2XL9A 3SMHA 1VBC3 5A33B 2D6NA 2EA7A 1DGRA 3UL2A 3FJSA 1QQP3 5EJ3A 4UBHA 1WW4A 1IKQA 3BPZA 1K5MB 3PVBB 4R9CA 2ERFA 1TNFA 1AR71 4B8EA 1OFSA 2DVDA 3B93A 4KU8A 1O4YA 3RMYA 3SCFA 1H0BA 5T5LA 2V5YA 1G9DA 4AQ2A 1HRI1 1QOOA 3E5UA 5FOJB 3VBSB 1OQ1A 3JUUA 2ZX2A 3ILRA 1XYPA 3AXEA 4AFAA 2DF7A 3KLSA 5FO9B 1JW6A 3VBFB 5FPXA 4Y5Z0 1OI6A 1WLDA 2D5HA 1GZCA 3OY8A 2HJIA 2R32A 3NSTA 1H8VA 2NYYA 4AVTA 2HWE3 2HWB2 2LALA 4LLFA 5D8AA 1CX4A 1FNZA 3ILNA 2JD4A 5B2GB 2R0FA 3KT7A 1UN1A 4S2HA 2XJSA 4XILA 2XJVA 2XUMA 2R0HA 1UIKA 2XWJB 3OBTA 3BB6A 3M3OA 2VNRA 4O9EA 3S6PA 3H1MA 4IEOA 5T5OA 1PGSA 1LR5A 3JBG2 2OA2A 4HKLA 2BTVC 2UU8A 1DDLA 2D6OX 2GMMA 3N7MA 2YROA 5FREA 1ZRDA 2YYOA 1BBT2 4YG6A 4F3JA 2PAMA 4I0BA 1AR92 5HCAA 3FFZA 3AK0A 4YZ1A 3MF6A 5JPMB 3BU7A 2Q0AA 1DHKB 1TME1 2ZZQA 2UWBA 1VRH2 3ZXDA 2Z2SB 3AMHA 1RUI3 1LGCA 1LEDA 3AYCA 1KD7A 1Z7S2 4OI1A 4XJUA 1D0HA 1ZZBA 1F2NA 4LBOA 3VN4A 5L36A 5AFEA 1H9PA 1ASJ3 3VKLA 2VOVA 5FOBB 1XYOA 3ZSKA 1Z78A 4LO8A 1C8M3 4XW3A 3M1HA 1HQNA 1MVQA 3B69A 2VOKA 5C6CA 4PQ9A 5F6KA 3DF0A 4XHBA 1AVBA 1FT9A 5EYYA 5J37A 2XGXA 5IK5A 4YLZA 1FATA 4WZCA 4YVWC 4DQAA 4Q4X1 1X82A 2AZ5A 1UKRA 3NV1A 1LOGA 1N47A 1R1A3 4QU2A 4XF1A 1HV0A 4HVRA 3AMQA 2O8QA 5DUVA 4YGCA 2GZWA 3ZMOA 2AYHA 4FP3A 1U5ZA 4PBOA 1JUIA 2MEV3 4JDMA 3GBWA 3ZO0B 2YGLA 4HN0A 4HPKA 4N9IA 2Q1MA 1WGPA 2R073 3D82A 2ZA9A 1AYM3 4ORFA 3VBRB 1ZBA1 1OD5A 3ENRA 2IXCA 1FMD1 4E4SA 1CPMA 4YVWA 3AKSA 4LR4A 4YM2A 1CAVB 4XFFA 4HL0A 2Y38A 1OA2A 1ZM1A 4AEDB 2JG8B 1UIJA 4QGLA 3ZFEC 4FCAA 4K40A 4ATFA 3WXPA 5L7OC 3AXDA 1CAXB 3R4DB 4GWNA 5BNNA 3J8F3 4EROA 1I5ZA 5FQ0A 1R082 1H2LA 4HK9A 1FOD2 4HT1T 4DRRA 1BMV2 1Q3EA 3AP4A 4EWAA 2DCTA 3MICA 4C0HA 2QCSB 1UKGA 1H1MA 1UZYA 3JCIA 1LEMA 2CY6A 1U5YA 3PJQA 4TLFA 4AE2A 1S2BA 3WLUA 4MXWB 1AR91 2FBEA 1YNAA 4YW4A 2IZWA 5KHIA 2IFRA 1OPMA 1PNFA 1S0BA 5CFDB 1EYBA 4FOQA 4MUVA 4PDWB 1G7YA 5JOWA 3ZFEA 3NKGA 1ND3B 3IDEA 2UYAA 3AP5A 4Y20A 1TNRA 5F6LB 3NW4A 5L7OA 2QJVA 5K7PA 1S0IA 1X8MA 3WDTA 3O14A 5SV8A 5CFCA 3WV6A 1PVC2 1DIWA 2WL1A 3I4IA 4LE3A 2RMU2 4I2OA 4OHZA 1VAKA 1VBA2 2BWCA 2WT1A 3ACLA 1BXHA 3I8TA 1SBFA 1EPWA 3SH3A 1B35C 3S7IA 1ND2B 4I0AA 1MS1A 2XLGA 1W39A 3I2DA 3AP6A 4AEJA 4OZXA 3CJIC 3N35A 3TOJA 5A32A 5GLUA 2VUJA 4LBNA 4PLMA 5E16A 1COV3 4PIYA 4BH9A 4C1XA 2PTMA 2BFUL 2Z69A 1CD3G 4ES8A 1Q56A 1LENA 1GV9A 2I2SA 1YFYA 3HQXA 1HRI3 5KHHA 1EPZA 4MZUA 1CAUA 4M00A 4B4RA 1J3QA 3ZYRA 3H8UA 1AR82 1IHMA 4C0BA 2D6PA 3LAGA 4Q4Y1 4QGMA 1VP6A 2BYVE 4M3CB 4OLLA 5JPNB 1RUJ3 1FPN1 1SLLA 1PNGA 4K20A 4B29A 2I45A 3U4XA 4CDWC 3R6SA 4BPZA 3POWA 1FNYA 2GC1A 4AVVA 4AHWA 5KBFA 3B01A 3VHOA 1MQTC 4D3WA 1AXZA 1VBD2 1B35A 1SLTA 4Q0UA 3CJIA 3OJBA 2P34A 1V6KA 2ET7A 2ZGNA 2ZGUA 4I01A 5J7MA 4AYUA 3ZMNA 1RVF3 1JXNA 3DN7A 3O12A 3ZSMA 4KWJA 4E2SA 1LU2A 2A6WA 3WY6A 4RS5C 3M2MA 4FQZA 1QWRA 1KRIA 1DGWA 1VB4A 4MV2A 3MYXA 2NQYA 1XNBA 4DNYA 2A6ZA 3DPRC 4KQ7A 1EY2A 2H6CA 4DY3A 5JDBA 1CESA 1ULFA 1TME3 2BEOA 1HV1A 2VY0A 3JD73 5ACA1 2R041 2CGOA 4UW3A 4L99A 4CDWA 2XBO2 2PQQA 4MVTA 3U07A 2XPJA 3QACA 1Q43A 1YYNA 4L92A 1MQTA 2RM22 4HKOA 2ZX1A 4EN9B 2ZOEB 3VZKA 4CDXC 4FXKB 4I3PA 2G4IA 1R093 2WT0A 4W6WA 1GFF2 1PO11 3D8CA 4AFDA 2B9UA 1J58A 4R9AA 3CF6E 4RS5A 1E57A 1C8NA 4TWTA 3CEWA 4Q4X3 1PVC1 2RMU1 3TB0A 1JYIA 4YVSC 2VW2A 2W39A 1VBB2 1VBA1 3DPRA 1H8TC 3M3CA 4ZU7A 2Q4SA 4FPOB 4P9LA 1DQ4A 1O3SA 3USUA 5C9AC 1ZZCA 4RHV1 5DUXA 2YXSA 1UU5A 3GALA 4Q1RA 3KMHA 2WJSA 3SHRA 1W6OB 4QPGC 1LCLA 3H9AA 4JGYB 4CP1A 1VBE1 3N7LA 4WM7C 4XJWA 1AR61 3B9CA 4CDXA 4Q1PA 1Q8PA 2PYTA 1RTVA 2RHPA 5T52A 1ZNPA 3MPBA 3W59A 4DPNA 4BIOA 4CP2A 1AR81 1V9U2 3IKWA 3IMNA 3AJZA 4RQPB 2HWC1 3NJZA 1JYCA 3M7AA 4KBBA 1ZYBA 3HMYA 1HRV2 1O3RA 4O9GA 5A33A 4XDQA 4YVSA 5FMOS 3X29B 3CU7A 1O7FA 2UY8A 4GMP0 1H8TA 3LA7A 2HWB3 3JQWA 1CIWA 2PLV2 4COYA 2RS52 3GZAA 4AQ6A 5C9AA 2R49A 3T1MA 3FHIB 2GNDA 1YJKA 3K48A 4R9BA 2ZPXA 3B5LB 4IEVA 1UF2C 4QPGA 4CDUB 4ATEA 2JENA 4JAAA 1LOEA 5H9PA 5J48A 4XFHA 1FV3A 3JBG3 1GYKA 4WVZA 4D7SA 1W0PA 1BEV1 2VXRA 1O91A 2ILMA 1HXS1 3B7MA 1BBT3 4L97A 5GALA 2TBVA 1GR3A 2ARXA 4M3CF 3AP7A 3M70A 3QOPA 1WMFA 2WINB 2YDEA 1XQNA 1MZ5A 1FXZA 1W6PB 2BNMA 5DDJ2 5I8SA 2EVXA 3FC0A 1VRH3 5KHGA 2XBO1 2R16A 4WZFA 1RUC2 3GNEA 4AI8A 4NR1A 1Z7S3 5EYXA 3HR9A 1N3QA 4BMBA 4JGZC 1O3TA 4XFAA 5J09A 5KC5A 3V0BB 3H3ZA 2D40A 3DGTA 5GLTA 4Q4V2 2ZX4A 2ZGQA 3ZN6B 3BODA 4YYOA 2YGMA 4JRLA 1DBNA 1I6XA 4J1XA 4ZKTB 4QQPA 4ONUA 1IS3A 1YO8A 3SISA 1U5IA 4P9JA 5EZWA 4P14A 2NP0A 4QX5A 1OA3A 1ENSA 3ETQA 1H4HA 1IQAA 1NA1B 4S2GA 3OD4A 4R4ZA 1HW5A 3ECQA 1V6OA 1F9KA 2RJKA 4TYSA 1HX6A 5KC6A 3PVNA 2JICA 4P5HA 4QPYA 1XU2A 1HKDA 1VBB1 1LGBA 1OLRA 3QCWA 2WFF1 5JVVA 1OOPC 4JTOA 3JZVA 1XE7A 3O0VA 5JI9A 4FPJA 4Y4YA 4N43B 4FBFA 1Y3TA 2N7GA 4JGZA 1WW6A 2CGPA 2QZ2A 3LKJA 4XF3A 4B4PA 3ES4A 4XE9A 4XTMA 1A6CA 3OBRA 3UKTA 5LK7B 4E9KA 1NXD1 3MI8A 3RI9A 1REDA 2XLAA 4NN0A 5C8CB 1UD1A 2GALA 4WBBA 4YZ5A 1V9U1 2QFEA 3ZIWA 3VV1A 5GZCA 4GMP1 5I8YA 1RUD1 3MF9A 3HWJA 3HT1A 1HRV1 4CTEA 2DFCA 2D93A 1IS4A 4FTEA 2PELA 4P9IA 5C4WB 1ZVFA 2WFPA 1GZ9A 1OOPA 2GC0A 2XJTA 5HXVA 4KG8A 2FZ2A 1QJU1 2GMPA 1YFUA 1R083 4UW6A 4NO4A 3SCGA 2RS31 1LECA 1FOD3 3OCPA 1SLCA 4E4ZA 3E97A 1UZZA 5FO7B 1BYHA 4FQ4A 5IK7A 2GN7A 1UMZA 3E5QA 4DB5A 4RR3C 4YGEA 1PO22 2K9ZA 2DV9A 1OHFA 2ZJCA 3T1LA 5CFDC 1YI7A 2JG8A 4GB31 3KZ4C 2DUOA 4CEWC 2Q1ZB 2PAKA 1G8WA 1LOAA 2B46X 1IPKA 4OFGA 2WNVC 4XQ4A 1RUH1 1PZ7A 2BPA2 3VBUB 2IXJA 4L11A 2PHRA 4AVAA 2E7AA 3N36A 4F83A 3C3VA 1UPIA 3HAGA 3HN1A 5ABJC 1G9CA 1LULA 1RUC1 4M01A 1LESA 2HEYF 3SCHA 1F5FA 1NCRB 5L19A 4B4QA 4Q4V1 1XNKA 1MS4A 4IQPA 3VKMA 4YFWA 1KDMA 1AXYA 2RMU3 3ZDSA 2CWSA 4PJYA 3VZMA 1CQ9A 3KGZA 5GJ6A 4RR3A 4FPYA 3PMEA 3ZX7A 1SLAA 1CAWB 1DLLA 2EXHA 3J4UH 3E6DA 5CFDA 4PDWA 4CEWA 5KHKA 3JQXA 3OYWB 4GULA 2LM3A 4UXAA 2PA7A 4COVA 4WM8B 3A0KA 4XBLA 4I0WB 2WNVA 5KWRA 1WD4A 1DYPA 4OI2A 3I54A 3FBYA 2D98A 2EF6A 3GHNA 5DZEA 3VGIA 1S0CA 3WINE 5ABJA 3ZFGB 5H9RA 4XF9A 4FPEA 4ASMB 1ZBA2 1AR83 2Y26A 3R4SA 4XZPA 1UAIA 1FMD2 4GXLA 2QE3A 1KFXL 3ZXGA 5JSPA 3W9AA 1D4VB 1ZBE1 4BA6A 2NLRA 2GN3A 4M0NA 1Y43B 5CU1A 3H50A 1VBD3 4L8QA 4RFT0 1RUE1 2P2KA 1LB2A 4N90A 4NWVA 1CPNA 3DKWA 3E6CC 3H7JA 3WP5A 1QXPA 3RWNA 5J3UA 4BQ1A 4CDQB 3RI8A 2DWRA 2E7QA 1MZ6A 5DZFA 1CGPA 2WC2A 5GZGA 1PK6B 3TN91 1M4WA 3O0XA 3UJQA 5JZGB 2SLIA 3V64A 1G9AA 4Z8BA 3WDWA 1QJY2 2VGDA 1G9FA 3ZVXA 3V56A 3NAPC 2ZGLA 2DCYA 3E6BA 3WG1A 4XHXA 2EXJA 4OUMA 1EV12 1PO21 4AEKA 1ZREA 1RC6A 2A6VA 2D7FA 4D69A 2XBO3 4NHMA 4YM3A 1YRZA 3M4FA 4FPHA 4QXKA 2RM23 2VG9A 5I0RA 1ZRFA 1C5HA 1QNWA 2GNMA 2ZTNA 3LA3A 4GH4B 3AYEA 2JG9C 4QT6A 3EHKA 1ZZ7A 3U10A 4OHXA 1XNDA 1D2SA 3MIDA 4BWOA 2RR11 3KCXA 4NHKA 4AK3A 2G9FA 2BNOA 5GLZA 4IV1C 2DCKA 3SNMA 5A3LA 2K2SA 2BUKA 2D97A 4PLOA 1UW8A 4YM0A 1J3PA 1MEC1 4XIKA 3H1WA 4ZU4A 2RJLA 4URTA 1GANA 3NAPA 4XPVA 1DU3D 1W6NB 1Q8SA 4AFMA 4EWDA 4LT5A 4FSJA 4CEYC 4OULA 1CVNA 4YG3A 3S0MA 1HDKA 4EN7B 5BNPB 1KJLA 5BNNC 3KCCA 4YW5A 2ETEA 4BE3A 1JTZX 1JHNA 4ISQA 4FO9A 5JR7B 3AMMA 2IXLA 2YMZA 4PBPA 1POV0 2QKDA 4UW4A 2XVGA 2CYFA 4AGGA 3A4UA 1V00A 1YIPA 4INDA 5DG2A 4EV0A 4Q4Y2 1TEIA 4KWKA 5JCTA 3WUDA 2JXAA 3H1YA 4Z82A 4BLJA 2JG9A 1FPN2 1QXRA 2ZGTA 4U2AA 4I02A 2WNUC 1H9WA 2PHUA 5AFBA 5CNAA 2C5DA 4MSVA 2P3KA 1V9U3 3B9IA 3FLPA 4XXPA 4IESA 1NLSA 4IV1A 3CNAA 4FOWA 2WS92 1M06G 1SQ4A 3B02A 1HRV3 2XJQA 3ZXJA 1S0JA 2WQ4A 4A3XA 1VIWB 2P17A 2O1QA 5JSOA 1WCSA 2ATFA 4FPKA 2F6BA 4CEYA 1W6QA 1J59A 3VBOB 5K0UC 1DQ1A 4FTBA 2PLV3 1SCSA