2FZ2A

Structure of turnip yellow mosaic virus at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
164
structure length
164
Chain Sequence
b'PSPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*C)-3'
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Virus/rna
total genus 25
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz2A00
4Y4YA 1VAKA 3JD71 1FMD1 1RUI2 1NG0A 1BBT1 1VBC1 1RUC3 1PIV3 2HWF3 4PDWB 3VBFB 2HWD2 1AYN3 1BMV2 2WFF2 1OOPA 2XBO2 2GH8A 1ZBE3 2RR12 4RQPC 1AR81 2X5IB 1C8M3 1FMD3 1AR92 1R1A1 3JB4C 1V9U1 1R091 2HWE1 3VDDB 5BNOB 3S6PA 4YVWC 4RHV1 2HWB1 1POV3 2DF7A 1AR63 1M06G 3JBG1 1K5MB 1NCRB 5JZGA 1AR83 4JGZB 4SBVA 2RS11 1RUG2 2RS52 1R1A3 5A32A 1ASJ2 1Z7S2 1VB2A 2R061 3VBRA 1R093 3NAPA 1PGW1 1D4M1 1HXS1 1QJY1 4Y5Z0 4GH4C 5AC93 1RVF1 3VDDC 5J98B 1HRV3 2WZR3 5BNOC 2HWB3 4FTEA 1RMU1 1VBE2 3JBG3 4WM8A 4YVSC 4WM8C 1NCRC 1MQTB 2TBVA 3VBOB 4CEYA 4CDWB 2RS13 1TME3 4CEYC 4QPGB 1QQP2 5ACA1 4GMP1 5CFCC 1NA1C 3DPRC 2RM22 3ZFFA 5BNNA 1NOVA 5C4WC 2PLV1 4IV3A 1RMU3 3VBSB 4Q4X2 4CDUC 5C8CB 1FOD2 2MEV1 1VBA1 1RUJ1 2R043 3LOBA 1ND2B 4N53B 1RUC2 4CDWC 1PIV2 4Q4V1 4QPGC 3VBUA 4CEWC 5BNPA 1AYN2 4N43A 1POV0 2VQ0A 1RUH1 1PO21 4Q4Y1 2PLV3 1MEC1 4Z92B 1ZBE2 1B35A 5A33B 1HX6A 4RS5A 5DDJ1 3ZFEC 1C8M2 4Q4W2 1RUE1 4RFT0 4RR3A 5K0UC 3TN91 1ND2C 1H8TB 1AYM3 2WS91 4WM7A 4WM7C 1RUH3 1PO23 1TMF1 1AR62 1R082 1QJX3 4CDQC 5DDJ3 4QPIA 1EAH3 4QPIC 1VBD1 1R1A2 1COV1 3J8F1 1FPN2 2HWC1 3TN93 1R092 1RUD3 1NCQA 1NCQC 4GB31 5AC92 1ND3C 1VBB3 1HRV2 5L7OC 2WZR2 5CFDB 4IV1C 3JBG2 4RQPA 2R071 3JD73 1PO11 1OHFA 4JGYB 1BBT3 1VBC3 5J96B 2RS12 1TME2 1COV3 1AR71 1AL21 2HWC3 5ABJB 4PDWC 4YVWA 4GB33 3VBFC 1ZBA1 2GSYA 2RMU1 1BEV1 5C9AB 3CJIB 1NY72 1RUI1 1AUYA 5CFDC 2R073 2RS31 3NAPB 3ZXAC 1RHI1 2X5IC 2HWD1 2R042 1V9U3 2HWE3 4JGYC 1BMV1 4GH4A 2WFF1 1AR73 4CDXB 3VDDA 3HAGA 1HRI2 5BNOA 5ABJC 4RHV3 1QJU2 1W39A 2XBO1 3IDEA 2RR11 4FTSA 4YVSA 1AR91 5C9AC 1K5MA 1RUI3 1NCRA 1K5MC 1E57A 2RS33 4JGZC 1RHI3 5CFCA 1NA1A 1RUF2 2R063 3DPRA 3ZFFB 1HXS3 1D4M3 2WFF3 1QJY3 1RVF3 1AYM2 4IV3B 2FZ2A 4CDXC 5C4WA 1PO22 3ZFGB 1PVC2 2RR13 4CDUA 1HQNA 1IHMA 3VBHB 1VRH1 1RUG1 2WLPA 1QJX2 2RS51 5D8AB 4AEDB 4EJRA 1ASJ1 1Z7S1 3VBUB 1MQTC 1EAH2 1PGL1 5ACA3 4GMP3 3VBOC 4CDWA 5BNPB 4QPGA 2HWF2 4CEWA 4N43B 1EV11 1RUD2 5GKAC 1VBE1 1VBB2 1B35B 4RS5B 2MEV3 3VBSA 3ZFGC 1VBA3 3VBSC 1VRH3 3ZFEA 5C8CC 1QQP1 3JD72 1RUJ3 4RR3B 1FMD2 5FOJB 1ASJ3 3VBHC 5D8AC 1BBT2 1VBC2 5K0UA 4NWWA 4Q4V3 1COV2 1ND2A 4N53C 2HWC2 2XPJA 1EV13 4Q4X1 4Q4Y3 2BPA2 1FOD1 1MEC3 4CDQA 4LLFA 1AR82 1GFF2 1QQP3 1C8NA 1RUC1 5A33A 1PIV1 1QJZA 1RUE3 1AYN1 1F2NA 1V9U2 2HWE2 1AR72 2WS93 1ND3A 1OOPB 5L7OA 1H8TC 1X36A 1SMVA 4RHV2 2HWB2 4IV1A 1TMF3 2ZTNA 1C8M1 4Q4W1 1CJDA 4GMP0 2BFUS 3FBMA 1DDLA 1VBD3 2RS32 1OPOA 1RHI2 3J8F3 4YVWB 2R062 1PGW2 1D4M2 1HXS2 4PDWA 3VBFA 1QJY2 2WWSA 1RVF2 3M8LA 1POV1 1AR61 5JZGB 1OOPC 2BFUL 1R081 1RMU2 5CFDA 5A32B 4Q4W3 1PO13 1CD3G 3VBRB 2X5IA 4GH4B 1FPN1 4JGYA 5ACA2 2QQPA 1AL23 5FMOS 5AC91 1HRV1 5ABJA 1ZBA3 2WZR1 2Y26A 2RMU3 1BEV3 1VB4A 4YVSB 4WM8B 2PLV2 1R083 5C9AA 5JZGC 4CEYB 2ZAHA 3CJIA 2MEV2 3CJIC 1VBA2 5FMOL 5CFCB 1NA1B 1VRH2 1TME1 4JGZA 3DPRB 1RUJ2 2HWD3 1FPN3 1WCDJ 1PGL2 3VBRC 4FTBA 5BNNB 3NAPC 1AL0G 2IZWA 4Q4V2 5C4WB 1F8VA 4CDXA 1EV12 4NWVA 4CDUB 1RUH2 2XBO3 1NY71 4Q4Y2 1MEC2 1AR93 2R041 1MQTA 5DDJ2 4CEWB 2BBVA 3VBOA 1RUE2 1HRI1 2ZZQA 3TN92 1QJU1 3ZFFC 5BNNC 1RB8G 5LK7B 2WS92 4IV3C 3ZFEB 3ZFGA 1TMF2 5C8CA 1RUG3 2RS53 2BUKA 3VBHA 5K0UB 1Z7S3 5D8AA 1RUF1 4AEDA 4AEDC 1VBD2 3VBUC 2RM21 3J8F2 4N53A 4WM7B 1AYM1 1HRI3 5BNPC 1QJU3 4N43C 4BCUA 4GB32 1VBE3 1PVC1 4CDQB 1QJX1 1A6CA 4QPIB 1B35C 2FZ1A 2R072 4RS5C 1EAH1 1PO12 1RUF3 4FSJA 2HWF1 1X33A 3JB8A 1NCQB 4RR3C 1ND3B 1RUD1 2RM23 5L7OB 1AL22 1VBB1 1H8TA 4IV1B 1ZBA2 4Q4X3 1PVC3 4RQPB 1FOD3 2RMU2 1BEV2 1ZBE1
chains in the Genus database with same CATH superfamily
5GLWA 1VAKA 3GDBA 3SHRA 1HKDA 1OD5A 1RUI2 3UJQA 1J59A 1OPMA 2D5FA 2HH9A 1VBC1 1BVVA 1OD3A 3ROUA 3MLKA 3NNLA 1UKRA 2GP5A 4AL9A 5HV4A 5IAVA 2HWD2 2QNKA 3R05A 4JTOA 1N1TA 1J3QA 1IS5A 1DGRN 2VL4A 5GZFA 2ZEWA 4WVMB 1UF2C 4OMCA 4AI0A 3HQUA 3ILFA 3POWA 2EAAA 4HXCA 2B45X 2WQ4A 3GNEA 2GH8A 4B4PA 1QWRA 2C9KA 4JQTA 1D0HA 1B09A 2X5IB 3TNQA 1UY0A 4XW3A 1HW5A 1SFNA 3PVNA 4JZRA 4XJWA 3V56A 5J36A 3E6DA 1ZNPA 1Y43B 3N9NA 2ENRA 1PM4A 4XACA 3S5AA 1V9U1 2HWE1 3RZJA 4BIFA 1N3QA 5A6XA 1XE7A 5JLVA 3O12A 4RHV1 4RD7A 4TLFA 2HWB1 2P17A 1W8WA 1POV3 1JYIA 1DFQA 4XQ4A 4BMBA 2XJTA 2PAKA 5I8SA 4FQ4A 2BNNA 2FHRA 1G86A 5J1XA 3W59A 4A4AA 4DQAA 1QDOA 4SBVA 2BWCA 2RS11 2RS52 2YU1A 1R1A3 2ZHLA 4C1WA 5FLJA 3WQ0A 2R061 2E31A 1LENA 4HLTA 3C2UA 3JZVA 2YPDA 2VNOA 3NAPA 4V2WA 1SZBA 1MACA 1QJY1 2BBAA 2Y6LA 1YLLA 4GH4C 1RVF1 4XAEA 5FZCA 1W6MA 1GP5A 2YFUA 2EVXA 5GLZA 1XU1A 3RNSA 1HRV3 4J1XA 2CL2A 4AHYA 1JH5A 5IVYA 1O91A 1JYWA 1VBE2 1NLQA 2QQWA 5FO7B 3JBG3 5KHKA 1WLCA 3A4UA 2BEOA 4LO8A 5EHDA 4AVVA 4WM8C 2XQRA 1MQTB 1R64A 4PJYA 3VBOB 2UU8A 5I0UA 5F32A 1TME3 1UXXX 1Q5OA 1S4CA 2QQKA 2DU1A 4QPGB 4Y1XA 3N7LA 2CSGA 4HN0A 5FBZA 5FZEA 3I54A 2VW1A 2PHUA 2VZVA 1GBGA 4QKDA 1OA4A 4XFHA 4UBGA 1F31A 1UZZA 4BK5A 5FP7A 4XIKA 5C4WC 4L2NA 1SBEA 3B02A 2YXSA 2BTVC 1O4YA 1RMU3 3PNAA 3WZ1A 1GQPA 3RZGA 4XZUG 1FOD2 2MEV1 4BQWA 3T2OA 4YARA 3HBKA 3PTYA 1LU2A 3HJRA 4FPHA 2VOVA 2P37A 5C3SA 4PIXA 4MOAA 4I3PA 1VALA 1O3TA 2HEWF 2OUJA 2CGOA 1UPSA 4DY3A 1OQEA 1F5FA 1XYOA 4XURA 1CGPA 2QQIA 2YFZA 4H2AA 1KD7A 1AYN2 1UX7A 4LUMA 1S0BA 1ZX5A 1QNWA 1W8UA 1POV0 3UETA 1FT9A 2VQ0A 5I0RA 3LZZA 1ULOA 3ETPA 2P6CA 3PUIA 4IE5A 2PLV3 4E2QA 3JQWA 4QGLA 4TSVA 1UY4A 5SV5A 4S2DA 2HJIA 1YRZA 4FXKB 3SCFA 3THPA 3VHRA 3AMPA 3J7LA 4IUGA 1HX6A 1ULFA 1H6XA 1UW8A 2C5DA 3KT4A 1W3XA 4Q4W2 3SEPA 5B2GB 3WF2A 1RUE1 2GMEA 3SKJE 4RR3A 2GNBA 2FDIA 2RDSA 3TN91 1ND2C 1JZ2A 5A7WA 1H8TB 1AYM3 5CAZA 2WSVA 2CWSA 3OD4A 2J22A 4WM7C 4BM8A 4A3ZA 1PO23 4BQ2A 5C3PA 1X9TA 2VBDA 2ZGMA 4EN9B 2WNEA 1WBLA 4ASMB 1OF4A 3H3LA 4QKNA 3D0JA 4QDSA 3WEZA 4PCRA 2QQMA 4CDQC 2XWBB 4PIZA 5AVPA 5LY2A 3C7HA 5DDJ3 3EJKA 4NROA 5CB7A 3FC0A 3OOXA 4DXZA 5FP4A 2OQ7A 3CBNA 5C33A 1UU6A 2ZGOA 1R092 5F37A 2DDUA 4EV0A 4A3XA 4UI9L 2I74A 1X8EA 3WLUA 1ZRDA 1VBB3 4BLIA 2J1UA 5KHIA 5CFDB 3THTA 5T54A 1JXNA 1OT5A 5FRAA 1YFWA 5FXZA 3WD5A 3WF0A 2AUYA 3I2IA 3MZHA 2LTNA 2UWCA 3JD73 3AVRA 1Q8VA 3VL9A 1MZ6A 4KU8A 2VNRA 4JGYB 3VZLA 4JKKA 1W6QB 1GZWA 3RPQA 3MLLA 4OQ9A 2HWC3 5ABJB 4QPWA 5LRSA 2QQOA 1LOCA 5F8PA 5FJHA 2J42A 2VBBA 2ZEXA 3PLQA 4ZY9A 1NZCA 1ZRRA 2H6BA 4P14A 2Q8CA 3ZXEA 1YQ6A 4DNYA 3AMHA 2VW2A 4XQDA 4AK3A 1OKQA 5KWRA 4Q1RA 1NY72 3ZKUA 1F35A 1BLZA 2EXJA 2R073 3GCXA 1YI9A 3FUOA 4ORFA 2OA2A 1KDMA 2YZ4A 4LKDA 2YHJA 2ZGNA 3ZKYA 2ADEA 1U5YA 3UT0A 3NJZA 4EE2A 2OUHA 3FBYA 4BQXA 1BMV1 4GH4A 4CDXB 5BYNA 4B29A 3LCPA 3GGLA 1A8MA 2C6SA 5FZOA 1HRI2 2VC9A 3WNXA 1IS3A 3CNAA 4FPKA 2XBO1 2VVFA 4GKXA 4A7ZA 4GQ7A 3KQRA 3BODA 4HFSA 4NHYA 5LA9A 4XMAA 3WG1A 1ACCA 4IEWA 1RUI3 4UF0A 1K5MC 2JB8A 1YIPA 4LIUA 1DGRA 2RS33 4LBKA 1YHFA 3AXEA 4GA9A 1RHI3 3E5QA 5IHRA 3BTZA 5C5TA 5A3UA 1BJQA 2W46A 2ES3A 3FN9A 2D93A 2DURA 2VMGA 4OYUA 1PX3A 4PIYA 4XJUA 4NHLA 5FZGA 4P9WA 2KXLA 3I3BA 4FPLA 5C4WA 3ZPOA 3WINE 5CKQA 3SLIA 1GUIA 1PVC2 2VNVA 4HK9A 2CGNA 3VKNA 2ZA9A 4A7YA 4BQ5A 1D4VB 4XHBA 3MIHA 1VRH1 4YNIA 1RUG1 4EJRA 1BVP1 1QJX2 4AFCA 4CCEA 1LHOA 3LEMA 5G05L 4A6OA 4S2HA 1ASJ1 4TZDA 5HCHA 3SMHA 2D40A 1EAH2 4MGZE 3VBUB 4LKFA 1NXMA 2VMIA 5ACA3 1LGNA 5FZ0A 1DGLA 3NW4A 5J3UA 2X09A 2HWF2 3V0AB 4I0WB 2MNGA 5T5OA 3BCWA 2ZABA 3ZOIA 4A42A 3R6SA 1ULGA 1XPWA 3WNNA 1GP4A 4YW7A 1JYXA 2XWJB 4IEXA 4J25A 3T1MA 4AGGA 2VMFA 2D44A 2WO1A 4I30A 3ZN5A 1EUUA 4LA3A 2IXLA 3VBSA 3W9AA 2WUHA 4JHZA 3ZFGC 5CNAA 5FY1A 4E4DX 2A3WA 4XZPA 5HCFA 1RUJ3 5E8AA 5FOJB 2WT1A 2Y6GA 5D8AC 5FR3A 4ZHNA 1OKOA 1VBC2 5HXMA 2DUPA 3ORJA 2GC0A 1JU3A 4GULA 4Q4V3 4AQ2A 1ND2A 1NT0A 1W9TA 5JVVA 4MXWB 4N53C 3AMMA 1CPMA 1QOTA 1O5UA 3LFIA 1O3RA 4KBBA 4AFBA 4YW4A 1FI2A 3M3CA 2BPA2 1MEC3 1WUVA 3C7OA 4HBNA 2CHHA 1CAUA 2RV9A 2BZDA 4CDQA 1EUTA 1XJAA 5FV3A 2ORZA 3LF7A 5CU1A 5FBJA 3PVBB 3NKGA 5A33A 2HBUA 1MZ5A 4K3UA 5JSRA 2KA3A 1O3SA 2GN3A 1V9U2 3AB0A 1LKNA 2HWE2 3POFA 3QH7A 2E7AA 4AAXA 4BHPA 4XJ9A 3NSTA 5FIXA 3S30A 2PFWA 2Y34A 4UFMA 3OEAA 2H6CA 2VZTA 3DYMA 5FDBA 3CU7A 4RHV2 2WKKA 2A6VA 3GXUA 1RXGA 3HVDA 5JOZA 3POEA 2HWB2 4LK6A 2VOTA 1TMF3 4R4ZA 1QEXA 2Z79A 4FPGA 4O65A 3B00A 2A6ZA 4YYOA 5LEJA 2ZX3A 2DV9A 3DCQA 3POGA 1JS9A 4CCJA 1VBD3 3CZJA 3DXTA 3O7OA 1SPPB 4YVWB 1HB3A 2R062 4COZA 1W04A 5FYSA 3K75B 1QJY2 2XKPA 2A3YA 5FQ0A 1JODA 1LHWA 1RVF2 3AXDA 3ACFA 3M8LA 3EHKA 4XCAA 5HCAA 3T3YA 2W52A 4KI5M 4MG2A 1FV3A 1R081 5F9TA 5FZ9A 4XUTA 4O9GA 4NUBA 1IQAA 3GYDA 3OSDA 4CCCA 4Q4W3 1PO13 1A8DA 2XJUA 4QHOA 4QHZA 1N1VA 1FPN1 3H1WA 5A7OA 4AZZA 4CCOA 4LKSA 4NJ4A 4D94A 2XHKA 2QDRA 3OBTA 1AL23 1OLMA 2JIJA 5AC91 5IVCA 3O1UA 3WDXA 1UYYA 2WZR1 3QH6A 5A6ZA 1J1TA 3CKHA 3KS7A 2ZX2A 2VULA 4ZXEA 2CWMA 5JSPA 3IDAA 4B7EA 4KGQA 2WNOA 2WL1A 3KGLA 5CYYA 2BYVE 2QTWB 5JZGC 4QD2A 2FDGA 1W06A 1S2BA 4CEYB 3HT2A 3QLQA 3CJIA 2MEV2 4IEZA 5A1AA 1LHNA 3NNFA 5FMOL 5FUIA 1NA1B 4QHBA 2DBIA 3T2QA 3PVOA 1X82A 1UL9A 3FHAA 1OA3A 1WCDJ 1PGL2 3OY8B 3VBRC 3HN1A 5IVFA 2FMYA 2P5BA 5FZLA 2WAOA 5F6KA 4OULA 5F5CA 3I2FA 3AVSA 4CUGA 4XCBA 1GZ9A 5FPAA 1BK0A 1SLAA 4HVOA 1EV12 2PAEA 5FYMA 4E8DA 4DUWA 5IWFA 1H2MA 2XL7A 4LOTA 4QAWA 4Y1VA 3IMMA 1LODA 3OPWA 5AVAA 1SDWA 2AEZA 3B01A 3DN7A 3WV6A 1KS4A 3OPZA 4Y1UA 4R52A 4HVQA 4Q8LA 1YI7A 3B94A 4Q8KA 1PMJX 4XTMA 1W6NA 2R32A 1FAYA 1VAMA 4LOSA 3TOJA 4RA0A 1NYWA 3VL8A 2VQUA 3DXUA 3I2GA 1RUE2 4LITA 4X8PA 2K0GA 2J1VA 4D3WA 2EALA 4CRQA 2JG9C 2ZZQA 5K9YA 1GYKA 3MBWA 1RINA 3TN92 1QJU1 4PI0A 3WNKA 3PTRB 2VAUA 5LK7B 4JAAA 3RI8A 3BTAA 1H1MA 3WY6A 1WZXA 4XE9A 4ZU4A 3ZFEB 3ZFGA 4JRLA 2VBPA 2WYFA 3FL7A 3KCYA 3JCIA 3EYPA 3IB3A 2VUAA 2BUKA 4BK4A 3LFMA 5J7MA 4AHWA 1UU4A 5D8AA 5LRRA 3MLJA 1G8WA 3AFKA 4QXBA 1WW4A 2J1AA 3FWEA 4EWDA 1F5JA 4E4SA 2X29A 4YM3A 1AXKA 1QGLA 4N53A 4ZONA 1HRI3 4LORA 4HT1T 5GLTA 5A3OA 3UKVA 5LEKA 3Q8FA 1JZ8A 2ZX1A 2XONA 2R30A 3O1TA 2YU2A 2BGOA 5FYTA 4FFIA 5I8YA 2C9AA 1J1LA 1OSGA 3IPVA 4CYDA 1ZZCA 2DBNA 4EQVA 1GICA 1QF3A 4PLMA 2G4IA 4RS5C 5AFBA 5LZ6A 2RVAA 4FCAA 4FSJA 1V0AA 5DUWA 5DUXA 3JB8A 2NM1A 5FUNA 3TEZA 1RUD1 2RM23 4XDQA 4LTAA 4XMIA 1S2EA 2CNAA 3H0OA 5L7OB 1YQ2A 4K8RB 2VM9A 4DB5A 2NYYA 1E5HA 2W3JA 2VTXJ 2JB4A 4LPLA 5JXHA 3CZUA 4IV1B 2W68A 4EN6B 1NUKA 3E1F1 1PVC3 1VMFA 3LQCA 3RS6A 1LULA 2YYOA 5FPBA 5JIAA 2ORXA 2VUJA 1FATA 3HWJA 3AM2A 3OYWA 2VMDA 4R9AA 5FYVA 3CHXA 1GOHA 1R1ZA 4LHSA 5DAXA 1CAXB 1BBT1 1MS9A 1WCUA 1UY1A 4M3CE 1RUC3 4FPEA 1PIV3 1WD4A 2HWF3 4AEJA 1PK6B 5HCBA 1UKGA 4JC1A 4XFBA 1S0EA 4XETA 1ZRCA 3LEIA 3DECA 1BMV2 1XC6A 2J7MA 3NJXA 3GBFA 5JUVA 3K4ZA 2D6KA 5JOWA 2XBO2 4AHZA 4Z2WA 2JX9A 2B9VA 5FZ7A 1DQ2A 1GSLA 1AJOA 2WNUC 4RQPC 1G9DA 1AR81 2N7GA 1U12A 4CUAA 2CDPA 3BALA 1C8M3 2XG3A 4LBQD 1ZYBA 1H2NA 5FPVA 4DMIA 1YO8A 3JB4C 4GWIA 1V6JA 3I7DA 1R091 4W8JA 4S2GA 2GNTA 2DU0A 3I2JA 2OYZA 4RGKA 3S6PA 2X05A 1IGOA 4LBMA 1D2QA 4QQPA 2XJQA 4A41A 1DGWA 3WG3A 2TNFA 4M4RA 5CG9A 3O1RA 5KHHA 3DGTA 3LGRA 2DF7A 2C24A 1AR63 5ANNA 2JD9A 1MS8A 1N47A 5J09A 2L9LA 4EN8B 5JZGA 5IVEA 5DG2A 4L9BA 3KF3A 3THCA 1CX4A 5GZEA 2VO5A 3FHQA 4YZ4A 3RYKA 1RUG2 4CCDA 1QDCA 1XQNA 2FDHA 2DYCA 1UZVA 1ASJ2 3FMGA 1VB2A 3ME2A 2Y6HA 4CCKA 3VBRA 3NVCA 5FP3A 5T55A 4ZKTB 1PGW1 1D4M1 2JG8C 3AKTA 3O1VA 3NKTA 3K48A 3NMBA 1AXZA 3TBDA 2VJXA 1AVBA 2ZKLA 3ZR5A 2PHTA 5E1RA 2WZEA 3CIHA 2YGLA 1UCXA 2HWB3 2B39A 2XDVA 3USUA 4YWAA 4OCTA 2FCVA 3E5XA 2MHFA 1M4WA 4Y1ZA 1GWLA 4BQ1A 3H8RA 3AP5A 3V0BA 3FLPA 2XUMA 1UYPA 2IXHA 1XXNA 2PTMA 3RG0A 2RS13 5FZFA 5LW9A 4AOCA 1WMFA 3E5UA 4Q0SA 4GMP1 5CFCC 1K3IA 3MW2A 3U75A 1DU3D 1PX4A 2FMDA 3K3OA 2EXIA 4GIQA 4UAPA 1C1LA 4HKWA 2JG9A 1XNAA 4AEKA 5L73A 4OQ8A 5IK7A 1HB1A 1ZRIA 2EF6A 5FYYA 1S0GA 2ARAA 2IVJA 4B4QA 3BPZA 2DCJA 3I59A 3GHNA 5IVVA 4Y22A 1O5LA 3OGGA 4CDUC 2XLGA 1ZZ6A 3AK0A 2IXKA 3PHMA 2BDRA 1VBA1 1X7NA 1LOBA 3EMRA 3FZ3A 3O1MA 1GWKA 4OI0A 1UOJA 3FJSA 3FLTA 5L9BA 1JOPA 2GP3A 4META 2R043 5DQ0A 1YFXA 3KF5A 4ES8A 1GOFA 5LATA 2ZGRA 4LIVA 4QPGC 3I3DA 4MSVA 5DUVA 4CEWC 4FT8A 1WCSA 2RE9A 2Y38A 1RUH1 2LS6A 1NZIA 1LEDA 1W99A 2WSUA 3LIGA 2XR4A 5ERLA 5C70A 5B4XA 4Z92B 4FFGA 5L36A 2BRTA 4KQ7A 2AACA 1ZBE2 4RS5A 3TEXA 5FZ4A 4AI9A 3RZZA 2XJSA 5A80A 3BOWA 4RFT0 4XHXA 3TNPB 4NAMA 4BWOA 4AQ6A 4PLOA 3POJA 2Q30A 2WS91 4ZS3A 2E6VA 3NRUA 3PJYA 2OPKA 4FPYA 2B4KA 2E51A 4IGQA 1SACA 5F1RA 3M1HA 1YC61 3N7KA 4LXLA 2W92A 1R082 5A1LA 3LEGA 5HPOA 4QPIA 1BCXA 2LRPA 2YMZA 3B9IA 2Y6KA 1SLLA 3OBRA 3KZ4C 4M3CF 3J8F1 4CP1A 3EO6A 4XBLA 2PELA 4N7UA 1FPN2 1APNA 4RL7A 1STMA 3TN93 1NCQA 2W94A 2BP6A 5DZFA 3O0VA 4JDOA 4AWDA 1WA6X 4GB31 4YSFA 5AC92 3MIBA 2E7QA 3RZLA 5IK4A 4GALA 1N1SA 2WZR2 3BU7A 3GJAA 2G9ZA 1SLIA 1KEXA 1VP6A 3ZN6A 2YGMA 4O9EA 3AJZA 4OUMA 2WNUA 3GZUC 3ABZA 1IQDC 4QGMA 4RQPA 5FMCA 4COVA 1JOJA 2D7FA 2I07B 2ZS6B 5DPNA 3RMYA 5A3NA 4JTNA 2PQQA 2V4AA 5FZ1A 3VD3A 3I4IA 1TNFA 2A6XA 1GP6A 4V2VA 5FZBA 4B7KA 2VY0A 2UY8A 4W65A 4PDWC 3VBFC 1ZBA1 1WW7A 2GSYA 4CCNA 1OVSA 4Q26A 2VH9A 3I3MA 2RMU1 2ARCA 1BEV1 4OZXA 5T3NA 3VZOA 1REFA 1D2SA 2GNMA 1XSQA 2GC1A 4WVMA 3FFQA 3IIIA 1UOBA 4LJHA 4TYSA 1GZTA 5C71A 5CFDC 4XPVA 1SFYA 3Q8CA 4Q27A 3A23A 3NAPB 1FV2A 4C91A 3S57A 3AX4A 1WD3A 2RG4A 1W6MB 2JG8A 4JGYC 4MV2A 2R0HA 1DYPA 2WFF1 2VPVA 1HB2A 3OGSA 5ABJC 1GANA 2WAAA 5I0SA 1QJU2 4FOVA 3IDEA 5A3TA 4XTPA 1ZA4A 3WOGA 1IS4A 3JXSA 1W2OA 2E53A 4FTSA 1AR91 4YGBA 4AF9A 4D7YA 3BTYA 1KJLA 4JX0A 1E57A 2VGDA 3ASIA 3WUCA 4XXPA 3S0MA 4HSLA 4PF1A 5FPUA 4L8QA 4JGZC 3HOBA 4LMFA 1JZ7A 1VIWB 1YQCA 3VN4A 5CFCA 4YGDA 3RQ0A 5IAXA 2NP0A 1KDKA 1KFUL 3JQXA 3RJ2X 4DXSA 1HXS3 1XBFA 4Q1PA 4R4XA 3ZYJB 3A0NA 3ZR6A 1Y9QA 1OQ1A 4MH0E 4N9HA 1UY2A 5CBLA 1OFSA 4CDXC 3UGGA 1PVXA 3WG4A 3M7AA 2GDFA 5HV0A 1G9FA 1S0FA 4DEQA 4CDUA 1YUDA 3RI9A 4P00B 5E16A 4BQ4A 3BPSA 2FBEA 1IHMA 1W03A 5D21A 2IUWA 5EV7A 4AEDB 1DQ0A 4P9GA 1Z7S1 2TEPA 1PGL1 3B93A 3K3NA 3AMQA 3WNOA 1LTEA 4QDQA 4QPGA 5FK7A 4CEWA 5EPAA 3PDQA 1CQ9A 2X8KA 5F3GA 5BPXA 4KGGA 1EV11 1RUD2 2V09A 1PZ8A 4QGNA 3U78A 2JDAA 1K45A 4C8DA 4ZU7A 1U0AA 1UMHA 5FTTC 2WJSA 5C5UA 4ONUA 3ES4A 3V65A 2OZJA 2Q1MA 4IEYA 5KXEA 1L3JA 4EZ4A 1W05A 1F4HA 3VBSC 3VZNA 2XXZA 2PN5A 1VRH3 4KG0A 4NRMA 4JV4A 4R8HA 5DAQA 5C8CC 1QQP1 3JUUA 4E27A 4RR3B 1ASJ3 5IYYA 1O6UA 5FY5A 1BBT2 4I09A 5A7WB 3N7MA 2JEMA 4RGGA 1COV2 3ZXLA 4Q2FA 4AI1A 5KHGA 1J83A 2ZGKA 4BB3A 2Q1ZB 4BA6A 3ZYIB 1YWKA 4HMZA 3ILNA 4NHKA 4Q4X1 5EZWA 2V72A 4HANA 1T6BX 2OQ6A 4Q4Y3 1VAVA 2WWUA 3AKSA 2TUNA 1C4RA 2VU9A 2ZAAA 3VUOA 4UT5A 4BZ4A 3WQBA 2ET1A 1Q8OA 1AR82 3C8XA 1C8NA 3U07A 1BHGA 1WLTA 1KQRA 1LB2A 4BXFA 4Y24A 3LD8A 3OD0A 1ENXA 1AR72 4I01A 1OOPB 4JVAA 1LJ7A 4B3NA 2WQ8A 4IL7A 2CGPA 4QQHA 4C0BA 1JZ3A 2VOKA 2F6BA 1CAWA 3KLSA 1W9YA 2NPIA 5FPZA 3I2KA 3WT3A 4BLJA 2AH2A 1MS4A 1WKYA 2V5DA 4NN0A 1Q8QA 3N3HA 3AYCA 2JIGA 2P3JA 1YQ8A 5FWEA 3MF6A 1LOGA 3BVCA 5C7GA 1H1IA 2LROA 5C8WA 1H1AA 1GZWB 5FZ6A 2BFUS 4QB2A 1H2KA 3MO4A 4SLIA 3OB8A 4BIOA 4OLLA 4F3JA 5FAXA 3UKTA 1NQDA 1PGW2 1D4M2 4LE4A 4PDWA 3VBFA 5FOBB 2DCZA 1F9KA 2WWSA 3A0KA 4N7IA 4W6XA 1SCRA 1POV1 2WABA 4XF1A 1T6GC 3B7MA 3ZYGA 2WC2A 3HNYM 4I3GA 1V6LA 3POSA 3POIA 1WA4A 2E32A 5CFDA 5FMDA 4QB6A 1MR5A 2VOXA 2K2SA 1QXJA 3HNMA 5A32B 3SITA 1JU4A 1WWYA 4L0PA 4LHLA 4RGAA 5I93A 2GU9A 5A7PA 4QM9A 1W28A 1H4HA 1DIWA 4GH4B 1QJFA 4HN1A 4DUXA 3WSOA 4JGYA 2HYKA 1XNTA 3VD5A 1F15A 1UO9A 1W6QA 3N4MA 3AZZA 1AHSA 4KWKA 1HRV1 4Q0VA 5ABJA 1UAIA 2HBTA 3E6CC 4YM0A 3WDTA 1VB4A 3LSEA 4WM8B 4DXTA 1R083 4UBHA 3NNMA 4FP3A 2WN2A 3CJIC 4Z1VA 1VBA2 1TME1 4JGZA 4CU9A 3HMYA 4YG6A 1W2TA 1IS6A 3WW4A 3NV4A 2CU5A 4AI8A 4ATFA 1W2NA 2HWD3 2W1SA 1FPN3 3OUIA 3L2HA 2GH2A 1ENRA 2D6MA 2GNDA 2Y64A 3NJYA 4OMDA 3T30A 4EN7B 5BNNB 4INDA 5C4WB 5JIUA 4HONA 1F8VA 5FYZA 4CDXA 3KMHA 4CP9B 4R9DA 1I3HA 1RUH2 1QJEA 2DVGA 4K1ZA 2GN7A 4LBNA 1VRBA 3J9SA 3ZM8A 2PQSA 1LECA 1RXFA 3QCWA 4KH9A 2AC1A 1OFNA 4QU1A 3GZEA 3NL1A 2MPFA 2W5FA 4IE0A 3T09A 4A6SA 1LOFC 4HPKA 5F5QA 5FP8A 3RSJA 4XAAA 4Q0PA 2UYBA 3IIAA 1GQGA 3VHPA 2R1BA 3IDCB 5HXVA 2E63A 3LAGA 4FPFA 1J84A 3CO2A 2EIDA 2QUOA 1UU5A 3HPNA 2A70A 4ZPIA 3ZFFC 1GNHA 1U5IA 2WS92 5IK5A 2B5HA 5EP9A 1ODMA 2EA7A 4IV3C 4QXKA 3WUDA 5M0TA 3TWIA 4D6RA 5A6QA 1C3HA 3GZAA 3O1OA 2B7YA 3ZDSA 5C8CA 2Z69A 2RS53 3H3UA 5F2WA 2HYXA 3VLBB 2VECA 4D8MA 3EB7A 3IBMA 5K7PA 1RUF1 4EWAA 4ASKA 5CVRA 1IKPA 2BV4A 5CA6A 4AFDA 4YRDA 2FCTA 4DEVA 3J8F2 4WM7B 3G7DA 1AYM1 4JKLA 4MGKE 4YGCA 5BNPC 3IZOA 1QJU3 3AZXA 3D82A 1ZZBA 4N43C 5GZDA 4GB32 4IXLA 1VBE3 1ZZ8A 4MLOA 2Q8DA 1CAUB 4IESA 3HD8B 4K1YA 3POBA 2P3YA 4JCKA 5A7QA 4CDQB 3P6BA 1US2A 2W1QA 3PU8A 1GOGA 1B35C 1TVGA 3M4FA 4E4HA 2FZ1A 2BW8A 2WNVC 1YCIA 5F2SA 3RZMA 2A75A 2A71A 4B1MA 3MF9A 4W6WA 1S0JA 5EYXA 3KCXA 5FO9B 4NIHA 2QQLA 2UWAA 2ET7A 4QMAA 4R9BA 4TLGA 5FY7A 3WDYA 1VBB1 3K2OA 2ZOEB 1ZBA2 3J26N 1H2LA 1OBNA 1ZZ7A 3J7NA 4CPBD 5JXIA 3CDZB 1FOD3 2RMU2 1BEV2 1ZBE1 5KR7A 4IE6A 4MHRA 3JD71 4XIOA 5T5LA 1FMD1 4CXXA 4XJZA 1Q56A 1AF9A 1IG0A 1NG0A 1AX1A 1DZTA 2GMPA 2RJLA 1URXA 2ZZJA 1ULEA 1KJRA 2JDYA 3W21A 2BGPA 1AYN3 4ZZ8A 1WMEA 1QXPA 2EAKA 2W9XA 2WFF2 3URFA 3WHTA 5DXDA 3C7FA 2EICA 3IAPA 1JN2P 2WO7A 4W4ZA 3ZSJA 1GR3A 4CVUA 4GWNA 2WINB 5FYUA 4ATEA 3AYAA 2PAMA 2QDNA 3L2YA 1TNRA 3W58A 4Z2AA 4LUKA 4AW7A 1AR92 3O14A 3FUQA 4XEZA 1HN1A 1KITA 2AR6A 5CZKA 3BU0A 1RITA 5HBAA 2DVAA 4RFRB 5FXWA 3VDDB 3WW2A 1FNZA 5BNOB 5EJZB 3SEEA 2D3PA 4BYYA 5LK5A 2ZACA 1W9WA 3O5SA 2WYSA 5EQUA 5FMBA 3WNMA 3J7HA 4HL0A 1JZ5A 2OPWA 2VXJA 1K5MB 4RYDA 1NCRB 5AFEA 3H42B 1Q8SA 2XOMA 1GWMA 4PF5A 5FPLA 1AR83 4K7JA 4XVHA 1I6XA 3HN3A 4M0HA 4WVWA 3UL2A 2BNMA 2YG0A 3AP4A 4QM8A 4AGRA 1Z7S2 2Y60A 2DTYA 4MGQA 2YC4A 2P6HA 3ZN4A 1R093 2VVDA 2B8MA 2WO3A 4YG3A 4AAPA 3PVEA 4CUCA 5FKBA 4MO3M 1UYZA 5F39A 3SXWA 3LOIA 1XOYA 2JJ6A 3MV11 3CLPA 2FDKA 1C5HA 3EXUA 4GKYA 4W6YA 3WVJA 3N9QA 3LPFA 2Q4SA 2BVBA 2YC2A 2E26A 3ZIXA 4YVSC 2QJVA 3S7EA 5C3RA 1Q43A 1W6NB 2Q8EA 1LOFA 4NOTA 2BERA 3K4DA 4CEYA 2A1XA 2YV8A 4A45A 4CDWB 1K42A 3KT1A 1QQP2 4ARXA 5ACA1 4O7XA 1CJPA 3DPRC 1N3OA 2P2KA 5FPXA 1DYOA 2JDNA 4M3CA 1POQA 4YW2A 3ZFFA 2PXJA 5JI7A 2VTFA 2R1DA 2GC3A 1NOVA 2VMHA 4AQTA 4IV3A 4Q4X2 3H3ZA 3AKRA 2ZMKA 1JI6A 2VCCA 5F6LB 3LWCA 1EPWA 2Y8KA 3GF6A 4NPLA 1RUJ1 2W0XA 3N9PA 4YFZA 4CPBA 3ZLIA 1UYXA 2C4XA 2IXIA 2YBSA 3R0RA 1BZWA 2XVLA 4N53B 4QX5A 3FE5A 4XILA 4YW6A 1NLSA 1V6MA 5F5AA 5JDBA 2W1WA 4Q4V1 1YJLA 1U5XA 3MW3A 4QT6A 5FY4A 4DO0A 1W2AX 5J37A 1W8HA 4C90A 3TB0A 5BNPA 1H4GA 1LHVA 4N43A 1KRIA 3P3NA 4E2SA 3CQOA 3H1MA 2WN3A 2WWJA 1S0IA 1MEC1 2QZ2A 3ZXJA 1C5IA 4LBJA 3OBZA 4URAA 1Z0HA 1QHDA 2SLIA 1B35A 4XYXA 3PU3A 3VHNA 2WNVA 1VJ2A 4QX1A 3SCGA 2XQXA 3SH4A 1YFYA 5IT6A 1S2KA 3LDBA 5F3IA 4LO4B 2ZGSA 4NAOA 1OURA 3ZX7A 5K0UC 4LLOA 3DKWA 4NE9A 1Y3TA 4U2AA 1MS0A 2A6WA 2JE9A 1ZM1A 3MYXA 1H9PA 1RUH3 1HIXA 1CAVA 4QKFA 1J3RA 3DYOA 3AZWA 3OYWB 4Y20B 1JHJA 2P34A 4DINB 1TMF1 5KXCA 2V5YA 4ITCA 5EWSA 4CU6A 3CMGA 3WP5A 1QJX3 3X29B 3HT1A 2WA3A 4FOYA 1EAH3 2ATFA 1Y4WA 4QPIC 3UYJA 2A6YA 2K46A 1VBD1 1QXRA 1FXZA 3M2MA 1I5PA 1ODNA 4IEUA 4PI2A 1R1A2 1COV1 1ST8A 5CIRA 2BWAA 3MIFA 4Y5TA 4I2OA 1VMJA 1NCQC 3MIGA 1N3PA 4P9IA 3R4SA 4UW4A 5FFOC 2FD8A 1ND3C 1DHKB 4QX2A 1HRV2 2RDRA 1HJGA 1EY2A 1OF3A 1XNDA 2RDQA 4FQZA 4PHZA 4Y3OA 3KV5A 1PNFA 3GHMA 5JAXA 2HKXA 1SEFA 2ZGQA 3JBG2 3WF1A 1YYNA 2ARXA 3LB9A 3W20A 1JYVA 2UURA 4BOWA 5ISLA 1DBNA 1PO11 4QDRA 3U10A 1OHFA 4CU7A 2JXAA 2JWPA 1VBC3 3GZTB 2W47A 5J96B 3WQ7A 1TME2 3B69A 1CAXA 1WLDA 1AR71 1AL21 2WR9A 4FPJA 4D6QA 4IERA 3M3IA 1ZREA 4FVVA 1JUHA 4GB33 5GM0A 3LE0A 4DRVA 3R4UA 3T0AA 1JTZX 2JENA 4NIDA 1LHUA 3GALA 2JKBA 2ZXQA 3VKFC 5C9AB 1YJKA 2WIIB 3UGFA 3AP7A 3SQOA 1W6OB 1OUXA 2QQUA 2O0OA 1LEMA 4PBOA 4URTA 5IVJA 2XGXA 3I2DA 3SH5A 2FDJA 3D4KA 4M0NA 3T2PA 5BY5A 1GNZA 1RC6A 3ZYFA 1IG3A 2X5IC 3CJXA 1OLRA 1CZTA 2VR4A 2P4EA 1I1EA 2I45A 4IETA 5EJ1B 1V9U3 2HWE3 4XF9A 4Y33A 3QBQA 5FREA 1JMUB 2Y6FA 5H9SA 3THDA 5B4NA 5DMYA 2Z5WA 3H7YA 3U4XA 1PHMA 4YZ2A 4RHV3 3VD7A 1CESA 1W39A 3R4DB 1KXGA 2ADDA 2DUOA 3INAA 3WX5A 2DUQA 2RR11 3V0BB 3OF1A 4B1LA 1WCKA 2DVBA 3K46A 4YVSA 1REEA 2NMOA 2ZX4A 4UFHA 4ARYA 1Z78A 2DVFA 1IKQA 2LM3A 4CUBA 1CZSA 2VCMA 2CTVA 4NIAA 4BQ3A 4PBPA 5LA1A 5FYBA 3SISA 1BK1A 1RUF2 2R063 3DPRA 4MUVA 5IFPA 1G9AA 2A3XA 4D69A 1QJY3 2WFF3 1O8SA 3AKPA 5IFTA 4NIGA 1RVF3 1YNAA 4KBZA 4COWA 4CTEA 2AZ5A 2JDZA 1AYM2 3I59B 2WZPP 1HJFA 2A7AA 5FP9A 2FZ2A 4FAGA 3W5NA 5LBBA 1PO22 4RSUA 3KD4A 3ZXFA 4NVPA 2Q1FA 3QACA 4H7LA 4JHTA 3K51A 4XUOA 1W8FA 1W6PB 1HQNA 4GAZA 1SG3A 3VBHB 4G3YC 3ACHA 4CXYA 2WLPA 3MDPA 2GZWA 1RL3A 3RZKA 4YM1A 2ZPXA 4TXWA 1X50A 3KQ4B 1MQTC 4Q5OA 2IVIB 2QE3A 2WDBA 5KXDA 3VBOC 1U5ZA 3ZSMA 4AVTA 1US3A 5DN2A 3RMXA 3ZPYA 2KR2A 1JYCA 4UW3A 2YUEA 1OI6A 3HQXA 3ITQA 1WMDA 2DCKA 3RYRA 3PMEA 5GKAC 3DYPA 1JZ6A 1VBB2 2NQYA 1CX1A 3WR0A 3MIEA 5LB6A 4P5YA 4H7MA 3WNPA 3ILRA 2FCUA 2ZKNA 4RS5B 2WFPA 2MEV3 3A7QA 1ZVFA 2W2IA 2UY9A 5JI9A 3JD72 1FMD2 1J3PA 1TZOA 5K4LA 5C3QA 5A3LA 3LA3A 4AVSA 5CKMA 2O8OA 3OTFA 4KL1A 4ZXKA 3TRSB 4BPZA 4U36A 5K0UA 1FYUA 4NWWA 3O1SA 3KB5A 4GXLA 4FI9A 1LOAA 2OZ6A 2C1FA 2HWC2 3LIHA 2XPJA 1EV13 2O8QA 1SBDA 5G04L 3ETQA 4LBQA 1UX6A 2VUDA 2D97A 3DL3A 3T2TA 2WBKA 2QKDA 4ES9A 1T2XA 4AE2A 2VNGA 4XFAA 1PZ9A 3BIWE 3NO8A 3PJQA 4CP2A 3MI8A 1LGBA 1SFPA 4LLFA 2QCSB 1GFF2 1O8PA 1QQP3 2EXKA 2XUEA 3E6BA 4IEVA 3ZYRA 4J6GA 1RUC1 3L9JT 3WF3A 1PIV1 1QJZA 1RUE3 3VDBA 2ARBA 1L7LA 1RJ7A 5FYCA 3UK9A 5CKNA 1F2NA 2OW4A 3LDRA 2K9ZA 1ND3A 3S5QA 3WP6A 1S1AA 2R6QA 3LPGA 3MW4A 4IE4A 1H8TC 3KT7A 4UWDA 4MHUA 1SMVA 4H55A 1S0DA 5BUVA 2VE1A 3WP3A 2B9UA 4Y26A 4WBBA 1KS5A 1OLQA 1C8M1 3LSDA 3POYA 1QH7A 2PHLA 5D2AA 4D7SA 2RS32 5FYHA 4EZHA 1OPOA 1RHI2 2O1QA 4AVCA 5C6CA 4P9XA 5DZEA 5FO8B 5LBCA 1ZA7A 3OUHA 2QZ3A 3OGVA 4CSWA 3OGRA 5IVBA 1IPKA 4NR1A 3IWZA 1AR61 3PUAA 3OG2A 1OOPC 1QU0A 2BFUL 2WZ8A 2ZGLA 3APBA 4WVVA 4BJ0A 4E4ZA 4FAHA 3IMNA 4CCMA 3MFCA 1SDDB 1LCLA 4TN7A 1BKZA 4BISA 2VZOA 1CD3G 2JG8B 2X5IA 1A34A 3CL1A 4HSJA 2YBKA 2Z4FA 2R49A 4P9JA 2PYTA 3ST7A 1L7RA 2JECA 1QKQA 5ACA2 4AGVA 1RGSA 2QQPA 5T5JA 5JXGA 2UYAA 4NPMA 3PUSA 4UFIA 5ANQA 3U14A 3Q8AA 2WT0A 5GZCA 1RIRA 2IFRA 1I5ZA 2PHDA 2Y26A 5FJKA 5LBEA 3PL0A 4BE3A 3NWKA 1CONA 5LA2A 1LNSA 2NLRA 1DGWX 5FLHA 4DRRA 1Y9GA 1W90A 2VCAA 4MADA 4AI3A 2FDFA 1UIJA 3VKOA 2ZAHA 4A7KA 2JDUA 3ECQA 1DLLA 1GQHA 5CFCB 1HB4A 4OUSA 2EIBA 5EFUA 3VD9A 3U37A 1RUJ2 1V70A 3T1LA 5FK8A 4WZFA 1LAJA 3AKQA 4YPJA 1O4TA 4X6QB 2JKXA 2PHFA 1G9CA 4Q4V2 4KU7A 1W9FA 3D6EA 4YZ3A 2V4VA 1MVQA 3LEKA 3CEWA 1QOSA 4XFCA 4CDUB 4B4RA 1E5RA 2XBO3 4XUNA 1ULCA 4N8MA 2ZMNA 4FOWA 1MEC2 4AXOA 4OHXA 4XQWA 3FLRA 2KM2A 2XLFA 2J1RA 4NHXA 4X8NA 5F7UA 4QU2A 4XFFA 3F95A 4CCLA 2R041 5FZ8A 1MQTA 4CEWB 5JOYA 1AX0A 1DZRA 4QB1A 3VBOA 1WMXA 3AZVA 4LO7A 1PMHX 1OH3A 3LA7A 4MGIE 5BNNC 2WQZC 1RB8G 4MZUA 5LWBA 4OVEA 5JMCA 1Q3EA 2VVEA 2OXBA 1H30A 3MIDA 1TMF2 3GM8A 2E7TA 4QQLA 3K77A 2VZ1A 2YB7A 1NQJA 1RUG3 4DPNA 3CF6E 5DUUA 4HG6B 3WNLA 4QQOA 1UNBA 1YFUA 3WDUA 2DCTA 4AEDA 4PQ9A 1LU1A 1ENQA 1VBD2 3TAYA 2JE7A 3VBUC 1QNYA 1ULDA 2V73A 2ERFA 3MICA 5FZDA 3MUZ1 5FYIA 4S2FA 4K8FA 2HLEA 3NV1A 4BCUA 1UXZA 1XE8A 2Y33A 1W8OA 5GLVA 1OVPA 5FY8A 2H0VA 2W08A 5FWJA 3DV8A 4OHVA 4AG4A 2A73B 3ZMOA 1TQ5A 2QFEA 1ULPA 3WDWA 1ALYA 4OHZA 3H8OA 3BOPA 3AC0A 5I91A 1PO12 2JDKA 4OHYA 1RUF3 1ENSA 1X33A 1VR3A 2YROA 4LBLA 2B46X 4DS0A 3U4SA 2FQPA 3D3AA 2F17A 3GJBA 1PMIA 3N9LA 3PIJA 3KHCA 5TSWA 1AL22 4X6RB 1CAWB 4YW1A 4GJYA 2IFWA 3F2ZA 3WP4A 2Q0AA 2BOIA 4IEPA 4EWEA 1H8TA 2XHNA 1ZRFA 1MS1A 3I8TA 4XBNA 3V64A 5KC6A 4XFGA 5A7NA 1LOEA 1V6IA 2VMCA 2VMEA 1UMIA 4Q0QA 4Y4YA 1VPHA 2VZUA 3LKJA 1XYPA 4KMQA 5SV8A 3I49A 1GNYA 2A5ZA 2ZJCA 2YBPA 3ZVXA 3NNJA 5BXXA 1G9BA 3H50A 2AEYA 1TEIA 3NV2A 4K40A 1W0PA 4PDWB 3VBFB 3WCRA 2WA4A 4Y5SA 3GBGA 4XJ8A 4F7ZA 1EPZA 3AFGA 3FHIB 5FZKA 4YW3A 4LT5A 1OOPA 3C3VA 4XOGA 2Z42A 4UXAA 4AVAA 1MZFA 1ZBE3 4EROA 2RR12 3VKLA 2QBXA 1O7FA 1UY3A 3N35A 1FMD3 5JWPA 2OVUA 1UQXA 4M00A 1SLTA 4ZS2A 3O1PA 1R1A1 4XF3A 5GZGA 1UOFA 5GLUA 3H8UA 3IAQA 3SCHA 2WLQA 4QKBA 1C57A 5FZOB 1G7YA 4AEMA 2Z2SB 3B9CA 2YDEA 2VOWA 2WO2A 4YVWC 1DQ6A 4FP2A 1LGCA 2H0BA 3AZYA 1CN1A 4IEOA 5H9QA 2D6OX 3OPTA 4V1PA 2OS2A 1M06G 4ZZ5A 3JBG1 3O0WA 4UF0B 3J4UH 4EN0A 2W1UA 3UV9A 4COYA 4K21A 2IXCA 3M3QA 3HEIA 5A3WA 4JGZB 4DZGA 5LASA 4E2GA 4E8CA 1O59A 3VZMA 4JDMA 4XDOA 4L11A 5A32A 4E9KA 3RGBA 3AYDA 1FX5A 4GD4A 1X9PA 1HQWA 1HXS1 4NHMA 4P9YA 4Y5Z0 3AYEA 3IT8A 5AC93 4KG8A 2PHRA 1D0GA 5J98B 1TG7A 3VDDC 5FCCA 4IQPA 3ZIWA 4A44A 2WZR3 2VQAA 3I2HA 5GJ6A 5BNOC 5LCWL 1AJKA 4HZFA 2LW8A 2QQVA 3ELNA 4HVRA 4QX0A 1RMU1 3RRDA 4FTEA 1W9SA 4NRQA 4A2UA 2D6PA 2VTXA 4HPKB 4WM8A 2R7EB 5T5PA 4BMEA 2GAUA 1NCRC 3N7JA 3ZSLA 1DF0A 1WW5A 5F3EA 4WVZA 2TBVA 4PLNA 4CEYC 3WG2A 3QD6A 2D98A 2F4LA 5FZIA 2VG9A 1NA1C 5LY1A 4AFAA 3WDVA 4XF4A 1PGSA 3ZYHA 3BYWA 5J48A 4Z07A 1HV0A 5JCTA 4UFLA 2RM22 4LKEA 5BNNA 1V6NA 4OI4A 3BI3A 2PMWB 2VUCA 2PLV1 1IOAA 3LA2A 5FXVA 3VBSB 4AR2A 2J1EA 4AHXA 4CP9A 1K12A 5C8CB 2EXHA 2XJVA 1VLNA 1GLHA 2NN8A 4XABA 5FXXA 1XYNA 3KVBA 3RWNA 2PHXA 1E5IA 1HLCA 4HK8A 3WQ1A 5D1IA 3WW1A 1H8VA 3ACLA 1ND2B 1HN0A 1RUC2 3UGHA 4CDWC 1PIV2 1A78A 2NMNA 3VBUA 3MHZA 4G4FA 3V0AA 3UKNA 1AX2A 1C28A 3RJRA 3VV1A 1W3VA 3WXPA 2BNOA 5FUPA 1PO21 3AP9A 3ACIA 3Q8EA 3T4HB 4Q4Y1 4D6SA 1CVNA 4K20A 3VD4A 1WBFA 2VZRA 4ZU5A 5JMOA 1AXYA 4FFHA 1QOOA 4I0AA 5A33B 5DDJ1 2ZGPA 3ZDVA 3ZFEC 3RDIA 4IEQA 1C8M2 4JDNA 2XVGA 2VCBA 5EXOA 3U0ZA 4XUPA 1W2UA 1JUIA 1MVEA 3MGUA 2R16A 4MVTA 4UYBA 3Q9OA 3S7IA 3NV3A 4ISQA 3AJYA 4WM7A 1P8JA 4CU8A 3BB6A 4MXWA 3KV6A 4XFIA 5IJRA 3T0DA 1CIYA 2BU9A 4IDZA 3T0BA 3IN9A 4PQQA 1AR62 5DAVA 1OMIA 3RVHA 2RHPA 3AMNA 1HV1A 1WLWA 3AL5A 4TTGA 3ATGA 4NRPA 4GWMA 1O3QA 4HKLA 5CEHA 2XB6C 4LHKA 2QQJA 1DP0A 3G6JB 1RJ8A 4LBOA 5A1FA 4FOQA 3VDAA 1W8NA 1CZVA 1JOBA 1MS3A 1SQ4A 2HWC1 1RUD3 4Z82A 3ES1A 5FQ0B 3ALQA 1H9WA 2CV6A 2OKXA 2ZMLA 1RYYA 3WCSA 1X8MA 3KSCA 5A7SA 5L7OC 5K8SA 2XVKA 3N9OA 2AREA 4NPRA 4COUA 4IV1C 2ID4A 5A70A 5F3CA 2IXJA 3BUCA 2R071 2WRAA 1WGPA 1FNYA 5A6YA 5F5IA 2P3IA 2BQPA 2XLAA 3J7MA 4H3WA 2CAVA 3KV9A 4TWTA 3UJOA 4QXHA 1BBT3 1NKGA 4DUVA 2RS12 4I0BA 3ZSKA 4XUQA 1MPXA 1JW6A 1COV3 1PNGA 2E9QA 3SNMA 1OH4A 1L7QA 3OCPA 5FZAA 3B5LB 1XSRA 2G19A 4YFWA 1PK6C 2DWRA 4UFKA 4YVWA 1SPPA 5IUQA 1S55A 2Y0OA 2ZCWA 1W0NA 3FFZA 1S0CA 2GC2A 3VKMA 3I3EA 2Q8OA 3ZSEA 3H8XA 3CJIB 3BTXA 3IM0A 2DVDA 4P02B 1RUI1 1AUYA 2D3RA 3HBZA 4BDVB 1QH6A 3KCCA 1YQ5A 4XBQA 4M01A 5DABA 2JDHA 4QQ2A 5JXJA 1SLBA 2RS31 1IPSA 3E97A 4HOOA 3ZXAC 1RHI1 1EYBA 2HWD1 1W8ZA 1OQDA 2JICA 2R042 3WF4A 1JZ4A 3KWVA 3N36A 3OBAA 3I3QA 1AR73 1IZ3A 3IKWA 4CE8A 3VDDA 3BN6A 3DF0A 1KGYA 3HAGA 3MPBA 5E88A 4BQYA 1WCQA 5BNOA 5BV6A 3USSA 1OUSA 2ETEA 4YG0A 5E89A 1OXCA 4GJZA 2BGCA 4IGPA 3RWKX 1LRHA 1UMZA 3QOPA 5A3MA 1CIWA 1N1YA 1XNCA 2B42B 2SBAA 2XJRA 3M70A 4LK7A 4YM2A 5IW0A 5C9AC 1K5MA 1NCRA 3O0XA 4MXVA 3ZYPA 1SCSA 2J1SA 4L92A 3AL6A 2IC1A 1W0OA 1NE4A 2EIEA 1ONAA 1NA1A 2PA7A 3MEPA 1EP0A 4M3CB 5GALA 4F83A 5EYYA 3ZFFB 2VD7A 1D4M3 3KVAA 4GWJA 4YW5A 1JYNA 2XH6A 3NNGA 4JKMA 3PUQA 3OY8A 3ZXKA 1UD1A 1HQLA 2VZQA 4IV3B 5KC5A 2D5HA 2OT7A 2ZGTA 3TYJA 4C0HA 3ZFGB 4R9CA 1E5SA 3EQEA 4OHWA 2Q5TA 2RR13 3OJBA 5BNQA 2CAUA 3DUIA 4LR4A 2Y6JA 2EIGA 4Y4RA 2JE8A 5D8AB 4BH9A 2RS51 4Q0UA 2IWGB 1J58A 1UPIA 4LO6B 5A3PA 2W95A 3NJVA 2LUWA 4LQRA 4CA9A 2W39A 4GMP3 4CDWA 1BYHA 2YC0A 5BNPB 4N43B 1CPNA 1DQ4A 3ON7A 1RTVA 1GKBA 3VHOA 2OX0A 1D7PM 1XB9A 4JQRA 1VBE1 1NE6A 1XRUA 5FZMA 1C1FA 3IPVB 2W87A 3U11A 1B35B 1CR7A 4LULA 4LHNA 2WNVB 3HQRA 3M3EA 3RYPA 1ZZ9A 1UZYA 1VBA3 3I2OA 2LALA 4OI2A 3VGIA 3ZFEA 4W50A 4QX8A 4LO5B 2ZGUA 3VBHC 1DLCA 1OLME 4N9IA 4OZOA 4K9SA 3D0SA 1NAEA 1K5JA 4FO9A 1TE1B 4J1WA 3U1XA 2DFBA 2YY1A 2XKOA 2XJPA 4KWLA 1DG6A 4QX7A 5FY9A 5LA0A 3NQHA 4AI2A 1MS5A 4LNVA 5L19A 1CAVB 2CYFA 3LDKA 3ZXGA 3BKZA 3TEYA 1SLCA 1Y7BA 1FOD1 4DY5A 1QY4A 4YZ5A 2F4PA 4NO4A 4AQSA 3AP6A 5L9RA 4I02A 1GU3A 2JDMA 5IK8A 2ZBJA 3KHBA 5JSOA 2VZ3A 1LR5A 3DEMA 3I97A 2RJ2A 4DOUA 2G9GA 1W8TA 4OFGA 3H1YA 4NIIA 4Q29A 1AYN1 2C0ZA 3UNPA 4H14A 5JPMB 3BIEA 2WS93 1Y9MA 1OC1A 3GCWA 3IDBB 4XJAA 1REDA 3T08A 5CADA 3K4AA 5L7OA 1X36A 3H9AA 5CISA 2VZPA 1VMHA 4IV1A 3ZMNA 4YLZA 3SH3A 2ZTNA 3KV4A 5EJ3A 2ZEYA 4O61A 4Y20A 1NXD1 1UZ0A 5L9VA 3LOBA 1SHWB 4MGSA 1YEWA 5T50A 4Q4W1 4KWUA 2W91A 1CJDA 2AGSA 3D8CA 3FBMA 4GMP0 4QXCA 4AVBA 1DDLA 1UOGA 5E6HA 2YPJA 3SC7X 3WW3A 5H9PA 2GALA 3J8F3 1G6NA 1GZCA 3RFRA 3KM5A 1PK6A 3N9MA 1HXS2 3MPPG 2C26A 3H7JA 2QQNA 2KD7A 4KNCA 4B8EA 1YXWA 4ET7A 3W5MA 5KHJA 3BGAA 5JZGB 3P3PA 1WW6A 4D0QA 4C1XA 1HDKA 1RMU2 1XE0A 4G9SB 4M4PA 1JHNA 2O14A 4DXRA 1OA2A 2X10A 1MZEA 1PM7A 3MV01 3VBRB 2XMLA 3OEBA 2ZHKA 4JRAA 3A21A 5DAPA 3T4VA 4NMIA 2P3KA 5I0DA 2HEVF 4F8AA 2PHWA 5FMOS 3OGJA 2X53S 3VB9A 5I8TA 1ZBA3 3USUB 3FX3A 2Y0IA 2VW0A 3MFAA 3P1IA 2RMU3 1BEV3 4YVSB 1Q8PA 2JD4A 2D3SA 2QVSB 1H6YA 2PLV2 3ACGA 4MGYE 4UOJA 4YGEA 3KGZA 3ZXDA 4FBFA 5C9AA 2D6NA 3PUHA 3ENRA 4IE7A 2G1MA 1BXHA 3P5BA 5H9RA 4D7TA 1W6OA 1RUNA 2ILMA 2AYHA 2GMMA 1UN1A 3OUJA 1VRH2 3EBRA 5HI0A 4Y1YA 3DPRB 5FY0A 5CG8A 2RDNA 3VZJA 1SBFA 1XU2A 2RJKA 3VDCA 2JG9B 2CDOA 2UWBA 4FTBA 5EIYB 3NAPC 1AL0G 1PZ7A 2IZWA 1QMJA 1QIQA 4PT6A 1LESA 3Q8BA 4IW3A 4NWVA 4Y22B 1DQ1A 4P5HA 4XDPA 1DZQA 1V00A 4WZCA 1JBCA 1JYTA 1NY71 2NZ9A 3A22A 4Q4Y2 2D43A 5IATA 4ASLA 1UIKA 2DFCA 1AR93 2I2SA 4LA2A 4FPOB 4QPYA 5DZGA 2VXRA 4P9LA 4FXGB 3PMSA 5DDJ2 1UWWA 1CWPA 2BVVA 2BBVA 4Z8BA 1O4ZA 1IPJA 2BJSA 4QX3A 1NX9A 2HEYF 5JR7B 4AFMA 5JPNB 1VE0A 1DQ5A 2E33A 1HRI1 2ZHMA 4L99A 4MGTA 4FFFA 1I9RA 4EYUA 2R0FA 2G9FA 4LEJA 3WHUA 4N90A 5APAA 4OUEA 2VQTA 3M3OA 5FKCA 4K6BA 4P08A 4AYUA 1DCSA 3PIGA 4CXWA 1F4AA 3DKQA 5JOXA 1W6PA 2WT2A 2J1TA 3HR9A 3RZHA 1V6KA 3VBHA 5K0UB 1Z7S3 4IGOA 3MUY1 2AENA 2ZHNA 4LE3A 4UFJA 4AEDC 1BQPA 4XF0A 4QWNA 4ISRA 4MYEA 4KWJA 4HKOA 2RM21 4LBQB 3ZO0B 2P1BA 3VZKA 5LBFA 4YZ1A 1GMMA 1XNKA 5DG1A 4UW6A 1GV9A 5KXBA 1AZDA 4OI1A 2VZSA 1PVC1 4L97A 5FLIA 2ZEZA 3GBWA 5C3OA 2JDPA 5DAWA 3HIFA 3HNBM 3JU9A 4XXAA 1QJX1 1A6CA 4QPIB 3SKVA 5T52A 3D5OA 4CZSA 1NLRA 2R072 4GZ9A 1EAH1 2XL9A 1A3KA 4XC9A 1KFXL 4BXSV 5KBFA 3C7EA 4CP0A 3ZYBA 2HWF1 2CY6A 1H0BA 1NCQB 2DCYA 4RN5A 3PURA 2OIIA 4FPCA 4RR3C 1V6OA 5FZHA 4DFSA 1ND3B 2D6LX 2ZX0A 5FZ3A 4MX3A 4DIQA 1XNBA 4HETA 4BU2A 1RUOA 3B3QE 2DTWA 3UESA 5JR2A 4UW5A 4WV8A 3ZN6B 4Q4X3 2WNUB 4RQPB 2BOJA 1UZWA 3C7GA 3TEWA 1DYKA 1YIFA 5I0TA
chains in the Genus database with same CATH topology
5GLWA 1VAKA 3SHRA 1HKDA 1OD5A 1RUI2 3UJQA 1J59A 1OPMA 2D5FA 1VBC1 1BVVA 3ROUA 3MLKA 1UKRA 2HWD2 2QNKA 3R05A 4JTOA 1N1TA 1J3QA 1IS5A 1DGRN 5GZFA 4WVMB 1UF2C 4AI0A 3ILFA 3POWA 2EAAA 2B45X 2WQ4A 3GNEA 2GH8A 4B4PA 1QWRA 1D0HA 1B09A 2X5IB 3TNQA 4XW3A 1HW5A 1SFNA 3PVNA 4XJWA 3V56A 5J36A 3E6DA 1ZNPA 1Y43B 2ENRA 1V9U1 2HWE1 4BIFA 1N3QA 1XE7A 5JLVA 3O12A 4RHV1 4RD7A 4TLFA 2HWB1 2P17A 1POV3 1JYIA 1DFQA 4XQ4A 4BMBA 2XJTA 2PAKA 5I8SA 4FQ4A 2BNNA 2FHRA 1G86A 3W59A 4DQAA 1QDOA 4SBVA 2BWCA 2RS11 2RS52 1R1A3 2ZHLA 4C1WA 5FLJA 3WQ0A 2R061 1LENA 4HLTA 3C2UA 3JZVA 3NAPA 2VNOA 3RNSA 1MACA 1QJY1 4GH4C 1YLLA 1RVF1 5GLZA 1W6MA 2EVXA 1XU1A 1HRV3 4J1XA 2CL2A 4AHYA 1JH5A 1O91A 1VBE2 5KHKA 5FO7B 3JBG3 1WLCA 3A4UA 2BEOA 4LO8A 4AVVA 4WM8C 1MQTB 4PJYA 3VBOB 2UU8A 5I0UA 1TME3 1Q5OA 4QPGB 4Y1XA 2DU1A 5FBZA 3N7LA 4HN0A 3I54A 2VW1A 2PHUA 1GBGA 1OA4A 4XFHA 4UBGA 1F31A 1UZZA 4XIKA 5C4WC 4L2NA 1SBEA 3B02A 2YXSA 2BTVC 1O4YA 1RMU3 3PNAA 3WZ1A 1FOD2 2MEV1 4YARA 3PTYA 1LU2A 4FPHA 2VOVA 2P37A 4PIXA 4I3PA 1VALA 1O3TA 2HEWF 2OUJA 2CGOA 1UPSA 4DY3A 1OQEA 1F5FA 1XYOA 1CGPA 1KD7A 1AYN2 4LUMA 1S0BA 1ZX5A 1QNWA 1POV0 5I0RA 1FT9A 2VQ0A 3LZZA 4E2QA 2PLV3 3JQWA 4QGLA 4TSVA 5SV5A 4S2DA 2HJIA 1YRZA 4FXKB 3SCFA 3THPA 3VHRA 3AMPA 1HX6A 1ULFA 1UW8A 2C5DA 3KT4A 4Q4W2 5B2GB 1RUE1 2GMEA 4RR3A 2GNBA 3TN91 1ND2C 1H8TB 1AYM3 5CAZA 2WSVA 2CWSA 3OD4A 4WM7C 4BM8A 1PO23 2ZGMA 4EN9B 2WNEA 1WBLA 4ASMB 3D0JA 4PCRA 4CDQC 2XWBB 4PIZA 5AVPA 5DDJ3 3EJKA 5CB7A 3FC0A 4DXZA 5C33A 1UU6A 2ZGOA 1R092 4EV0A 4A3XA 2I74A 1X8EA 3WLUA 1ZRDA 1VBB3 4BLIA 5KHIA 5CFDB 3THTA 5T54A 1JXNA 5FRAA 1YFWA 3WD5A 2AUYA 3MZHA 2LTNA 2UWCA 3JD73 1Q8VA 3VL9A 1MZ6A 4KU8A 2VNRA 4JGYB 3VZLA 1W6QB 1GZWA 3RPQA 3MLLA 2HWC3 5ABJB 5LRSA 1LOCA 3PLQA 1NZCA 1ZRRA 2H6BA 4P14A 3ZXEA 4DNYA 3AMHA 2VW2A 4XQDA 4AK3A 1OKQA 5KWRA 4Q1RA 1NY72 2EXJA 2R073 1YI9A 3FUOA 4ORFA 2OA2A 1KDMA 2YZ4A 2YHJA 2ZGNA 1U5YA 3NJZA 2OUHA 3FBYA 1BMV1 4GH4A 4CDXB 5BYNA 4B29A 3LCPA 1A8MA 1HRI2 3WNXA 1IS3A 3CNAA 4FPKA 2XBO1 2VVFA 4GKXA 4A7ZA 4GQ7A 3KQRA 3BODA 4HFSA 4XMAA 3WG1A 4IEWA 1RUI3 1K5MC 1YIPA 1DGRA 2RS33 4LBKA 1YHFA 3AXEA 4GA9A 1RHI3 3E5QA 1BJQA 2ES3A 2D93A 2DURA 2VMGA 4PIYA 4XJUA 4NHLA 4P9WA 2KXLA 5C4WA 4FPLA 3WINE 3SLIA 1PVC2 4HK9A 4A7YA 2CGNA 3VKNA 2ZA9A 1D4VB 4XHBA 3MIHA 1VRH1 4YNIA 1RUG1 4EJRA 1BVP1 1QJX2 4AFCA 1LHOA 4S2HA 1ASJ1 4TZDA 3SMHA 2D40A 1EAH2 4MGZE 3VBUB 5J3UA 1NXMA 2VMIA 5ACA3 1LGNA 1DGLA 3NW4A 3V0AB 2HWF2 4I0WB 2MNGA 5T5OA 3BCWA 2ZABA 3R6SA 1ULGA 2XWJB 4IEXA 3T1MA 4AGGA 2D44A 4I30A 3ZN5A 4LA3A 2IXLA 3VBSA 3W9AA 3ZFGC 5CNAA 4E4DX 2A3WA 4XZPA 5HCFA 1RUJ3 5E8AA 5FOJB 2WT1A 5D8AC 1VBC2 2DUPA 2GC0A 4GULA 4Q4V3 4AQ2A 1ND2A 5JVVA 4MXWB 4N53C 3AMMA 1CPMA 1QOTA 1O5UA 1O3RA 4KBBA 4AFBA 4YW4A 1FI2A 3M3CA 2BPA2 1MEC3 1WUVA 4HBNA 1CAUA 4CDQA 5CU1A 3PVBB 3NKGA 5A33A 4K3UA 1MZ5A 1O3SA 5JSRA 2KA3A 2GN3A 1V9U2 3AB0A 1LKNA 2HWE2 3QH7A 4BHPA 2E7AA 5LEKA 4XJ9A 3NSTA 3S30A 2PFWA 2H6CA 5FDBA 3CU7A 4RHV2 2WKKA 2A6VA 5JOZA 2HWB2 1TMF3 4R4ZA 2Z79A 4FPGA 3B00A 2A6ZA 4YYOA 5LEJA 2ZX3A 2DV9A 1VBD3 3O7OA 4YVWB 4COZA 2R062 1QJY2 2XKPA 2A3YA 5FQ0A 1LHWA 3AXDA 1RVF2 3M8LA 3EHKA 5HCAA 2W52A 1FV3A 1R081 5F9TA 4O9GA 1IQAA 3GYDA 4Q4W3 1PO13 1A8DA 2XJUA 1N1VA 1FPN1 3H1WA 4D94A 2XHKA 2QDRA 3OBTA 1AL23 5AC91 3WDXA 2WZR1 3QH6A 1J1TA 3KS7A 2ZX2A 2VULA 5JSPA 2CWMA 4B7EA 4KGQA 2WL1A 3KGLA 2BYVE 5JZGC 4QD2A 1S2BA 4CEYB 3HT2A 3QLQA 3CJIA 2MEV2 4IEZA 1LHNA 5FMOL 1NA1B 4QHBA 3PVOA 1X82A 1UL9A 1OA3A 1WCDJ 1PGL2 3OY8B 3VBRC 3HN1A 2FMYA 5F6KA 4OULA 1GZ9A 1SLAA 4HVOA 1EV12 2PAEA 1H2MA 2XL7A 4Y1VA 1LODA 5AVAA 1SDWA 3B01A 3WV6A 3DN7A 1KS4A 3OPZA 4Y1UA 4R52A 4HVQA 4Q8LA 1YI7A 3B94A 4Q8KA 4XTMA 1W6NA 2R32A 1FAYA 1VAMA 3TOJA 4RA0A 1NYWA 3VL8A 4D3WA 1RUE2 4X8PA 2K0GA 2EALA 4CRQA 2JG9C 2ZZQA 5K9YA 1GYKA 1RINA 3TN92 1QJU1 5LK7B 4JAAA 3RI8A 3BTAA 1H1MA 3WY6A 4XE9A 4ZU4A 3ZFEB 3ZFGA 4JRLA 3KCYA 3JCIA 2VUAA 2BUKA 5J7MA 4AHWA 1UU4A 5D8AA 5LRRA 3MLJA 1G8WA 3AFKA 1WW4A 3FWEA 4EWDA 1F5JA 4E4SA 2X29A 4YM3A 1AXKA 1QGLA 4N53A 1HRI3 3UKVA 4HT1T 5GLTA 2ZX1A 2R30A 5I8YA 2C9AA 1J1LA 1OSGA 3IPVA 4CYDA 1ZZCA 1GICA 1QF3A 4PLMA 2G4IA 4RS5C 5AFBA 4FCAA 4FSJA 5DUWA 5DUXA 3JB8A 2NM1A 1RUD1 2RM23 4XDQA 4LTAA 4XMIA 3H0OA 2CNAA 5L7OB 4DB5A 2NYYA 4IV1B 2W68A 4EN6B 3RS6A 1PVC3 1LULA 2YYOA 5JIAA 2VUJA 1FATA 3HWJA 3AM2A 3OYWA 4R9AA 1R1ZA 1CAXB 1BBT1 1MS9A 4M3CE 1RUC3 4FPEA 1PIV3 1WD4A 2HWF3 4AEJA 1PK6B 5HCBA 1UKGA 4JC1A 4XFBA 1S0EA 4XETA 1ZRCA 1BMV2 3GBFA 2D6KA 5JOWA 2XBO2 4AHZA 4Z2WA 2JX9A 1DQ2A 1GSLA 1AJOA 2WNUC 4RQPC 1G9DA 1AR81 2N7GA 1U12A 3BALA 1C8M3 2XG3A 4LBQD 1ZYBA 1H2NA 4DMIA 1YO8A 3JB4C 1V6JA 3I7DA 1R091 4S2GA 2GNTA 2DU0A 2OYZA 3S6PA 1IGOA 4LBMA 1D2QA 4QQPA 2XJQA 1DGWA 3WG3A 2TNFA 5CG9A 5KHHA 3DGTA 3LGRA 2DF7A 1AR63 1MS8A 1N47A 5J09A 4EN8B 5JZGA 5DG2A 4L9BA 1CX4A 5GZEA 4YZ4A 3RYKA 1RUG2 1QDCA 1XQNA 2DYCA 1ASJ2 3FMGA 1VB2A 3ME2A 3VBRA 3NVCA 5T55A 4ZKTB 1PGW1 1D4M1 2JG8C 3AKTA 3NKTA 3K48A 1AXZA 3TBDA 1AVBA 2ZKLA 2PHTA 5E1RA 2YGLA 1UCXA 2HWB3 2B39A 3USUA 3E5XA 2MHFA 1M4WA 4Y1ZA 4BQ1A 3AP5A 3V0BA 3FLPA 2XUMA 2IXHA 1XXNA 2PTMA 3RG0A 2RS13 1WMFA 3E5UA 4Q0SA 4GMP1 5CFCC 3MW2A 1DU3D 2FMDA 4GIQA 1G9CA 2EXIA 1C1LA 4HKWA 2JG9A 4AEKA 5L73A 5IK7A 2EF6A 1S0GA 4B4QA 3BPZA 2DCJA 3I59A 3GHNA 4Y22A 1O5LA 3OGGA 4CDUC 2XLGA 1ZZ6A 3AK0A 2IXKA 3PHMA 1VBA1 1X7NA 1LOBA 3FZ3A 4OI0A 3FJSA 3FLTA 4META 2R043 1YFXA 4ES8A 2ZGRA 4QPGC 4MSVA 5DUVA 4CEWC 4FT8A 1WCSA 2RE9A 2Y38A 1RUH1 1LEDA 2WSUA 4Z92B 5L36A 4KQ7A 1ZBE2 4RS5A 3RZZA 2XJSA 3BOWA 4RFT0 4XHXA 3TNPB 4BWOA 4AQ6A 4PLOA 2Q30A 2WS91 2E6VA 3PJYA 2OPKA 4FPYA 2E51A 1SACA 5F1RA 3M1HA 3N7KA 1R082 4QPIA 1BCXA 2YMZA 3B9IA 1SLLA 3OBRA 3KZ4C 4M3CF 3J8F1 4CP1A 3EO6A 4XBLA 2PELA 4N7UA 1FPN2 1APNA 4RL7A 3TN93 4AWDA 1NCQA 5DZFA 3O0VA 4JDOA 4GB31 4YSFA 5AC92 3MIBA 2E7QA 5IK4A 4GALA 1N1SA 2WZR2 3BU7A 1SLIA 1VP6A 3ZN6A 2YGMA 4O9EA 3AJZA 4OUMA 2WNUA 3GZUC 4RQPA 4QGMA 4COVA 1JOJA 2D7FA 2I07B 2ZS6B 3RMYA 4JTNA 2PQQA 3I4IA 1TNFA 2A6XA 4B7KA 2VY0A 2UY8A 4W65A 4PDWC 3VBFC 1ZBA1 1WW7A 2GSYA 4Q26A 2VH9A 2RMU1 1BEV1 4OZXA 5T3NA 3VZOA 1REFA 1D2SA 2GNMA 2GC1A 4WVMA 3FFQA 4TYSA 5CFDC 4XPVA 1SFYA 4Q27A 3NAPB 1FV2A 4C91A 3AX4A 1WD3A 1W6MB 2JG8A 4JGYC 4MV2A 2R0HA 1DYPA 2WFF1 2VPVA 5ABJC 1GANA 5I0SA 1QJU2 4FOVA 3IDEA 4XTPA 1ZA4A 3WOGA 1IS4A 2E53A 4FTSA 1AR91 4YGBA 4AF9A 4D7YA 1KJLA 1E57A 2VGDA 3ASIA 3WUCA 4XXPA 3S0MA 4HSLA 4L8QA 4JGZC 1VIWB 3VN4A 2NP0A 5CFCA 4YGDA 3RQ0A 1KDKA 1KFUL 3JQXA 3RJ2X 1HXS3 4R4XA 4Q1PA 3ZYJB 3A0NA 1Y9QA 1OQ1A 4MH0E 4N9HA 5CBLA 1OFSA 4CDXC 1PVXA 3WG4A 3M7AA 2GDFA 1G9FA 1S0FA 4CDUA 1YUDA 3RI9A 5E16A 2FBEA 1IHMA 5EV7A 4AEDB 1DQ0A 4P9GA 1Z7S1 2TEPA 1PGL1 3B93A 3AMQA 1LTEA 4QPGA 4CEWA 1CQ9A 2X8KA 5BPXA 4KGGA 1EV11 1RUD2 2V09A 1PZ8A 4QGNA 4ZU7A 1U0AA 5FTTC 2WJSA 4ONUA 3ES4A 2OZJA 2Q1MA 4IEYA 5KXEA 1L3JA 3VBSC 3VZNA 2PN5A 1VRH3 4KG0A 4R8HA 4JV4A 5C8CC 1QQP1 3JUUA 4E27A 4RR3B 1ASJ3 1BBT2 4I09A 3N7MA 2JEMA 4RGGA 1COV2 3ZXLA 4Q2FA 4AI1A 5KHGA 2ZGKA 2Q1ZB 4BA6A 3ZYIB 1YWKA 4HMZA 3ILNA 4NHKA 4Q4X1 5EZWA 4HANA 4Q4Y3 1VAVA 3AKSA 2TUNA 1C4RA 2VU9A 2ZAAA 3VUOA 4BZ4A 2ET1A 1Q8OA 1AR82 1C8NA 3U07A 1WLTA 1KQRA 1LB2A 4Y24A 3OD0A 1ENXA 1AR72 4I01A 1OOPB 4JVAA 1LJ7A 4B3NA 2CGPA 4IL7A 4QQHA 4C0BA 2VOKA 2F6BA 1CAWA 3KLSA 2NPIA 5FPZA 3WT3A 4BLJA 2AH2A 1MS4A 4NN0A 1Q8QA 3N3HA 3AYCA 2P3JA 3MF6A 1LOGA 1H1IA 5C8WA 1H1AA 1GZWB 2BFUS 1H2KA 4SLIA 4BIOA 4OLLA 4F3JA 5FAXA 3UKTA 1NQDA 1PGW2 1D4M2 4LE4A 4PDWA 3VBFA 5FOBB 2DCZA 1F9KA 2WWSA 3A0KA 4N7IA 4W6XA 1SCRA 1POV1 4XF1A 1T6GC 3B7MA 3ZYGA 2WC2A 4I3GA 1V6LA 3POSA 1WA4A 5CFDA 1MR5A 2VOXA 2K2SA 1QXJA 5A32B 3SITA 5I93A 4LHLA 4RGAA 2GU9A 4QM9A 1H4HA 1DIWA 4GH4B 4HN1A 4JGYA 2HYKA 1W6QA 3N4MA 3AZZA 1AHSA 4KWKA 1HRV1 4Q0VA 5ABJA 1UAIA 3E6CC 4YM0A 3WDTA 1VB4A 3LSEA 4WM8B 1R083 4UBHA 4FP3A 3CJIC 4Z1VA 1VBA2 1TME1 4JGZA 5KXBA 3HMYA 4YG6A 3WW4A 1IS6A 4ATFA 3NV4A 4AI8A 2HWD3 1FPN3 3L2HA 2GH2A 1ENRA 2D6MA 2GNDA 5BNNB 4EN7B 4INDA 5C4WB 5JIUA 1F8VA 4CDXA 3KMHA 4R9DA 1I3HA 1RUH2 2DVGA 4K1ZA 2GN7A 4LBNA 3J9SA 1LECA 3QCWA 4KH9A 1OFNA 3NL1A 2MPFA 1LOFC 4HPKA 5F5QA 3RSJA 4Q0PA 2UYBA 3IIAA 1GQGA 2R1BA 3IDCB 5HXVA 2E63A 3LAGA 4FPFA 3CO2A 2QUOA 1UU5A 3ZFFC 2A70A 1GNHA 1U5IA 2WS92 5IK5A 2B5HA 2EA7A 4IV3C 4QXKA 3WUDA 3TWIA 1C3HA 3GZAA 2B7YA 3ZDSA 5C8CA 2Z69A 2RS53 3H3UA 3VLBB 2VECA 3IBMA 5K7PA 1RUF1 4EWAA 5CVRA 1IKPA 5CA6A 4AFDA 4YRDA 3J8F2 4WM7B 3G7DA 1AYM1 4MGKE 4YGCA 5BNPC 1QJU3 3AZXA 3D82A 1ZZBA 4N43C 5GZDA 4GB32 4IXLA 1VBE3 1ZZ8A 4MLOA 1CAUB 4IESA 3HD8B 4K1YA 4JCKA 4CDQB 1B35C 3M4FA 2FZ1A 2BW8A 2WNVC 1YCIA 2A75A 2A71A 3MF9A 4W6WA 1S0JA 5EYXA 3KCXA 5FO9B 2UWAA 2ET7A 4QMAA 4R9BA 3WDYA 1VBB1 2ZOEB 1ZBA2 3J26N 1H2LA 1ZZ7A 1FOD3 2RMU2 1BEV2 1ZBE1 3JD71 4XIOA 5T5LA 1FMD1 4XJZA 1Q56A 1AF9A 1NG0A 2RJLA 1AX1A 1DZTA 2GMPA 1URXA 2ZZJA 1ULEA 1KJRA 1AYN3 1WMEA 1QXPA 2EAKA 2WFF2 3URFA 3WHTA 5DXDA 1JN2P 3ZSJA 1GR3A 4GWNA 2WINB 4ATEA 3AYAA 2PAMA 2QDNA 3L2YA 1TNRA 3W58A 4LUKA 4AW7A 1AR92 3O14A 3FUQA 4XEZA 1KITA 2AR6A 1RITA 5HBAA 2DVAA 3VDDB 3WW2A 1FNZA 5BNOB 2D3PA 4BYYA 5LK5A 2ZACA 3O5SA 4HL0A 1K5MB 5AFEA 1NCRB 1Q8SA 4PF5A 1AR83 4K7JA 1I6XA 4M0HA 4WVWA 3UL2A 2BNMA 3AP4A 4QM8A 4AGRA 1Z7S2 2DTYA 3ZN4A 1R093 2VVDA 2B8MA 4YG3A 3PVEA 3SXWA 3LOIA 2JJ6A 3CLPA 1C5HA 3EXUA 4GKYA 4W6YA 3WVJA 2Q4SA 2BVBA 3ZIXA 4YVSC 2QJVA 3S7EA 1Q43A 1W6NB 1LOFA 4NOTA 4CEYA 4CDWB 2YV8A 3KT1A 1QQP2 5ACA1 1CJPA 3DPRC 1N3OA 2P2KA 5FPXA 4M3CA 4YW2A 3ZFFA 5JI7A 2R1DA 2GC3A 1NOVA 2VMHA 4AQTA 4IV3A 4Q4X2 3H3ZA 3AKRA 2ZMKA 5F6LB 3LWCA 1EPWA 3GF6A 1RUJ1 2W0XA 4YFZA 3LOBA 4QX5A 2IXIA 3R0RA 4XILA 1BZWA 2XVLA 4N53B 3V65A 3FE5A 5JDBA 1NLSA 1V6MA 4Q4V1 1YJLA 1U5XA 3MW3A 4QT6A 5J37A 4C90A 3TB0A 5BNPA 1H4GA 1LHVA 4N43A 1KRIA 3P3NA 4E2SA 3H1MA 1S0IA 1MEC1 2QZ2A 3ZXJA 1C5IA 4LBJA 1Z0HA 1QHDA 2SLIA 1B35A 4XYXA 3VHNA 2WNVA 1VJ2A 3SCGA 3SH4A 1YFYA 5IT6A 1S2KA 4LO4B 2ZGSA 3ZX7A 5K0UC 4LLOA 3DKWA 1Y3TA 4U2AA 1MS0A 2A6WA 2JE9A 1ZM1A 3MYXA 1H9PA 1RUH3 1HIXA 1CAVA 1J3RA 3AZWA 3OYWB 4Y20B 2P34A 4DINB 1TMF1 5KXCA 2V5YA 4ITCA 5EWSA 3WP5A 1QJX3 3X29B 3HT1A 2WA3A 4FOYA 1EAH3 2ATFA 4QPIC 2A6YA 3VGIA 1VBD1 1QXRA 1FXZA 3M2MA 4IEUA 1R1A2 1COV1 5CIRA 2BWAA 3MIFA 4I2OA 1NCQC 3MIGA 1N3PA 4P9IA 3R4SA 4UW4A 5FFOC 1ND3C 1DHKB 1HRV2 1EY2A 3VHPA 1XNDA 4FQZA 5JAXA 1PNFA 3GHMA 2HKXA 1SEFA 2ZGQA 3JBG2 1YYNA 2ARXA 3LB9A 2UURA 4BOWA 1DBNA 1PO11 3U10A 1OHFA 2JXAA 3GZTB 1VBC3 5J96B 3WQ7A 1TME2 3B69A 1CAXA 1WLDA 1AR71 1AL21 4FPJ