4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
3WH9A 1AQ0A 5I2UA 3ZT7A 3GXMA 2YL9A 3VDHA 3AIEA 1PX8A 2XVLA 1EH9A 3BLPX 4D1JA 2VX7A 2WW5A 3BCFA 4PRWA 4KGJA 1UR9A 1QI5A 2VR5A 3A4AA 2WLYA 3AYSA 1GOOA 1E6NA 4LXFA 4U31A 2DSUA 3WNOA 4UOZA 1I1XA 4X9YA 4AD0A 1DWAM 1R86A 3GNPA 3NSXA 4UTFA 2PB1A 1MW3A 2BVYA 3WNMA 4W8AA 3T09A 1JD7A 4CGTA 2WVVA 2J7HA 3ECQA 4CCEA 5A6LA 4QLLA 4ZENA 1LL7A 3BAKA 1NWSA 2PBOA 2VVSA 2ZXDA 2V3GA 1W90A 5CSYA 1W8WA 5DT7A 2W66A 2WVUA 3QHMA 3GDBA 1V0KA 2E3ZA 1VEMA 1W32A 3BXWA 2WMKA 3U7BA 5A8OA 1HN1A 3VX1A 2EEXA 1KCKA 2VURA 1F4AA 2XSBA 1B30A 1R7AA 1MXGA 4J3XA 1B31A 4UQ9A 3AFBA 3EDDA 5EFDA 1W1YA 1US2A 3UETA 1ODUA 2WXDM 4LK6A 1E4MM 2ZUVA 1BPLB 3OLDA 8CGTA 4W7UA 5A8NA 1MW0A 1E72M 4W89A 4PTWA 4TVCA 2WB5A 1WDQA 1DP0A 2DT2A 4D6GA 1TA3A 1K9DA 1CIUA 1K6AA 2ZUTA 4WLCA 4MNLA 4AY1A 3OA5A 1TVPA 5AC5A 1WAWA 1W2PA 1LQ0A 3AZTA 4HA1A 2PWGA 2WHJA 5FIPA 3UCQA 4JCMA 1NQ6A 1V02E 3SIMA 2NSXA 2D20A 1BG9A 4AIEA 3SCOA 1DWGM 4AZBA 4AZ6A 1WZXA 2D0HA 3ARPA 4UQDA 3NSMA 5I77A 4UZSA 4CU7A 2WCGA 4H8VA 1WZMA 3U57A 4E8CA 4BQ4A 3D3AA 4W8BA 4FLRA 4S3KA 3SEPA 1IV8A 2XWEA 4W84A 2XFFA 1FFQA 1FHLA 3SCSA 1M53A 1S46A 4YPJA 3FAXA 4XZBA 5A2CA 3W29A 1JNDA 1NP2A 4KGLA 1W9BM 3AIQA 2DSZA 3FY1A 5I3DA 5CGMA 2D0GA 4JHZA 5E6YA 4L4OA 2BY2A 1ISYA 1JI2A 2O9OA 3VX0A 3DYPA 1LWHA 4D6HA 3WUBA 3GH4A 3CUHA 4FLQA 1HN0A 1BYBA 1GWLA 4CPBD 3PN8A 1UZ1A 1JAEA 1XSKA 4OUEA 2OSYA 1EHNA 4P7QA 5CLWA 3B8SA 3L4VA 3ARQA 1QHOA 1TCMA 4GO9A 4CU8A 3WF1A 4W8LA 1FFRA 4P8UA 4LQ1A 2VXJA 3CUIA 1V0MA 1KWGA 1X6LA 2K46A 4MTVA 3B9AA 3HU7A 3AMKA 4QLJA 1W1PA 1BG4A 1W3LA 2WBKA 3RJYA 3VMNA 1I1WA 4BQ5A 2QMKA 2WC7A 2JE8A 1ZBWA 2CHOA 2WMIA 2FGZA 3HN3A 2X0HA 5A2AA 3WNNA 3CZKA 2XGBA 2W5FA 2Q1FA 4FK9A 2ZWZA 5HNNA 2PC8A 2EPKX 2YJQA 1LWJA 5FOOA 1ISWA 4M81A 3ZQ9A 1B2YA 3THDA 4MJ2A 1NP0A 1KXHA 4PMYA 4GKLA 3TOPA 1CXFA 1H49A 5IDIA 4PEEA 3A4WA 4H2CA 3POHA 1XH0A 3WF4A 3WQWA 3RDKA 4AD2A 4P7RA 3LPFA 1XCXA 3WH6A 1OGBA 2JIWA 1QBBA 2OYMA 1C92A 2BY3A 1WDPA 3WEOA 1ITCA 3UG5A 5A95A 1NWRA 1GVIA 5I24A 3POCA 5A69A 1UWIA 3F5KA 1JGIA 2J75A 3AROA 2NT1A 4BA0A 4P7NA 1PBGA 4AISA 1KB3A 2WMJA 2X2YA 4D6DA 5CPSA 5E9AA 4C7FA 1UUQA 2CYGA 2NT0A 3WF2A 3T2QA 3BC9A 3F5JA 4DUWA 1HL8A 1V3HA 2XVGA 1XD1A 1E71M 5JIWA 4A3YA 5C71A 2CBVA 3LPOA 1SMAA 3AXXA 4CN4A 5D9MA 2VRKA 2VX5A 3WD1A 2GDUA 5ABFB 4F8XA 1WPCA 4AD5A 3L2MA 3EBVA 4F9JA 5KEZA 3OBAA 2A3EA 2JEQA 3K8LA 1W9XA 3ZR6A 3SUUA 5I78A 1HJVA 5M3WA 3VIGA 1KQZA 5A6MA 1J10A 1HJUA 2QLYA 3ARXA 4PTMA 3UESA 5HDRA 3WH5A 5E6ZA 2Y24A 2D22A 2WZHA 1G9HA 3WNPA 1CWYA 2EQDA 5GQBA 4RL3A 1PX3A 2VR4A 2J62A 4A6SA 1J0KA 1KXTA 3K8KA 3PZNA 4M1RA 1UA3A 1GUVA 1ZB5A 1H5VA 3EMCA 3FNDA 3D5HA 5CJ5A 4OBSA 3II1A 4PSPA 4CVWA 4D72A 1BLIA 2CBJA 4AEEA 2WBGA 1V08A 4DM1A 1XC6A 2QHAA 4KH2A 2ZWYA 2WMIB 4AZCB 3CHDA 3VGHA 4CVUA 2G3MA 1OD8A 4TVDA 3TTSA 1F4HA 1MFUA 3CGTA 4ACZA 3SUTA 4P7OA 2VUYA 4Z2KA 1BTCA 4YW6A 1D2KA 1V3LA 3WY1A 4WSJA 2G3JA 3ZJKA 1XRVA 5ECUA 4W87A 1OGGA 1JZ3A 5D9NA 3W24A 3WD0A 3ZOAA 1SYTA 1ZBKA 2DPEA 3K46A 1V3MA 4CD6A 1JZ4A 2CKSA 4E4PA 1NWTA 3AHTA 1E6SM 2WLZA 2XUCA 4HOWA 3DECA 1B90A 3CZEA 3W28A 1OT2A 5LA2A 5A6AA 2WWCA 4MNJA 4PCTA 4LX4A 1VENA 3WFZA 1UOJA 5IFPA 1WO2A 4F79A 5HXMA 4PMDA 4J3WA 3AXHA 3VUPA 4GI9A 5CXPA 2CPUA 4LJHA 1G1YA 3BMVA 1EO7A 3BAJA 5A6BD 1HJQA 3MV11 2J78A 3AICA 4B9ZA 1V3IA 4UFKA 3WD2A 4L4PA 3VILA 3MMUA 2WNWA 3CUFA 4XZWA 1Q4NX 4GZJA 5GNZA 5CSUA 3GZAA 2DEPA 4AXNA 2GVYA 4JKLA 4P7LA 3ZO9A 4EK7A 1NOUA 3WH8A 4HZ7A 1NARA 4EKJA 1JI1A 4QCFA 4CCDA 5IXEA 4E8DA 1WCGA 4HZ8A 3AIUA 4AC1X 4LKEA 5C8BB 1VFUA 2WKGA 1LF1A 4XUYA 4W5ZA 4M8UA 4AD1A 3CTTA 4F66A 1CGTA 3CMJA 2WYFA 2CNCA 1W2VA 2F2HA 1ZBCA 1QPKA 3B9DA 3L4UA 1J0YA 1HT6A 1MW2A 5D21A 3AXIA 5FCZA 1PZ2A 1DHKA 2W91A 3W82A 4PMXA 5E70A 4DWSD 4W5UA 1VIWA 1E6ZA 2WANA 3MS8A 3RM8A 3ZSTA 5JBFA 6A3HA 3BAIA 3AZSA 1HVQA 2GK1B 2VZUA 3VIJA 1GQIA 5A6KA 1E9LA 5TD4A 1QI0A 4GPNA 1J9YA 2GDVA 3ZR5A 2C7FA 4J7RA 4JFWA 1UD6A 2VCAA 4U3AA 3PZUA 3ZJ6A 3KL0A 1JZ6A 1UH3A 1SFSA 5JUVA 2WYSA 1AQHA 3MUIA 4U5KA 4Y7EA 2E9MA 1JYXA 4H8UA 4NF7A 2Y2WA 3WDQA 1MQRA 1HNYA 4UNIA 4AZCA 4S3JA 2XG9A 5AY7A 2YLAA 2E40A 2YA2A 3NDZA 1WZKA 1JYWA 1B9ZA 1MQPA 4RE2A 3WFLA 3E1F1 2W63A 4U5IA 4DWSC 1MW1A 1HP4A 3EDEA 1HVXA 1E0XA 4R27A 4PMRA 1V0NA 3BH4A 1EXPA 3ZT5A 1CGWA 2JIEA 3VIIA 1QNSA 3MSGA 4YN5A 1I75A 2CCRA 1GJWA 3VGBA 5FL1A 1AMYA 2AMGA 1EQPA 1GOQA 2QF8A 1WKYA 3EDJA 1V6YA 3W53A 4PTXA 4CD4A 3OLEA 1H4PA 4LKDA 2WM0A 3CMGA 1V03A 1CDGA 3K4DA 3WUGA 4XX6A 1VB9A 2DT0A 1QI4A 2WMFA 1ODZA 4HTYA 3CBWA 3PHAA 2VNCA 4UFHA 3AIBA 1V3KA 3F95A 3CUJA 1J0HA 1QW9A 1YHTA 3PTKA 3OG2A 2V3EA 4AZ5A 4HZ6A 4ZEPA 1GHRA 4M82A 2YKKA 4UFIA 3ZJ8A 1C3FA 2EXOA 2XVKA 3IJ7A 3PTMA 3FHQA 2D3NA 2OLHA 2A3CA 2C0HA 1XSIA 1EO5A 3OGSA 3PZOA 3GYCA 4IPLA 1GOWA 4AL9A 2Z1KA 1UWSA 2WWDA 4CUCA 4FMVA 3SCNA 3CHEA 2Y8KA 2W4XA 2D23A 2J8GA 1GWKA 4QFUA 1K9EA 2GJPA 4DWSA 1Q6CA 4HU8A 1QI3A 1L8NA 1W8TA 4EANA 1LL6A 3QHOA 3VDBA 4JZ5A 2WMHA 3SCTA 3ZJ7A 5EFFA 3RILA 4CN6A 3VDAA 3IJ9A 1LG1A 1OWQA 3ARTA 3PZMA 4P8VA 2PWFA 2OSWA 1R85A 1VAHA 3AOFA 3CHFA 2YL6A 3WD3A 4MAVA 2WCAA 4AYSA 2W92A 4D6EA 1E56A 3TTOA 4J3VA 1JDDA 1OH3A 1DWJM 2J77A 4HPHA 1EDTA 4H41A 4PMUA 1WNOA 1KQYA 1TMQA 4WK9A 1BFNA 2VVNA 1VJZA 3VIHA 4TTGA 3LPPA 1GPFA 4NRSA 1B3VA 4PUDA 3MUY1 2LRPA 1CXKA 2VCBA 1CGUA 4M56A 1M01A 1UH2A 3CH9A 3WD4A 3SCQA 1K9FA 3VIFA 5I6SA 2GUYA 1GOKA 2MANA 5ABGA 4Z2GA 3ARVA 2UY4A 4J28A 4OOUA 1TE1A 5ABFA 4N0RA 4D6CA 2GFTA 5CZKA 4JHOA 2XJ7A 1GOMA 4UOJA 5HPOA 1OCQA 2E4TA 3WBAA 1R8LA 1XGZA 3UR7A 1CTNA 4YWAA 1A47A 4D1IA 3VKKA 1WCUA 1V02A 2X0YA 1M7XA 4MJ4A 3VMOA 1XYZA 4CU6A 2PWEA 3AISA 2FHBA 3AHXA 2BS9A 3N18A 3OZOA 1E5JA 2X8RA 4HPGA 3VNYA 4KMQA 4UZUA 4FLSA 4QDMA 4H8HA 2J7FA 4A4AA 1GQKA 1CPUA 1KXVA 2ZIDA 4AWEA 3MANA 2VO5A 4TTUA 2OYKA 3F4VA 1EDGA 2PWHA 4YHGA 1GQLA 3HMCA 2YIHA 5IFTA 3KL5A 3WKZA 4WSKA 2FH6A 2FHCA 5DF0A 1MYRA 4AIUA 3N17A 4C7DA 1NM9A 2F8QA 1IZKA 2PF0A 3EMZA 3RMEA 1ISZA 3KL3A 4MB1A 3CPUA 3L4XA 1E0VA 1KCLA 1B3YA 2J7CA 3NYDA 4PUEA 1CGXA 1UWUA 3WIJA 4PCSA 2XSAA 1PJ9A 1XH1A 1J12A 3ARYA 4UQCA 1DWIM 2CBIA 9CGTA 1J0ZA 4ATLA 2VOTA 1C91A 2OWWA 2DSVA 3VDCA 1E15A 3AMDA 3CUGA 1H41A 5DT5A 2NW0A 2WHLA 1GZJA 5JBDA 4TUFA 1WB0A 1X1NA 4KRUA 4Z2IA 5A6SA 2G3NA 1H11A 1ITXA 2ZX9A 1H3GA 3SURA 4U33A 3U7VA 1RP9A 1MQQA 4FF5A 2W62A 2O9RA 5EBAA 1O7AA 2XM1A 3VPLA 1US3A 3PTQA 1TR1A 3VD7A 1HIZA 5BRQA 3N04A 1ECEA 1UG6A 1TVNA 1KGWA 4UQAA 1CXHA 4MB3A 1G94A 4BF7A 4B15A 2WZEA 1EIBA 1QBAA 1B3XA 4CP9A 5IHSA 4AZGA 2PWDA 5A1AA 5EB8A 1WP6A 3U5UA 4ML4A 4UFLA 2EPMX 4BQ3A 3ZYBA 1CNVA 3NIYA 3WH7A 3WL0A 3A3HA 1HJXA 3OLIA 5AYIA 2EBNA 3M7SA 1JFHA 2WMGA 2BHZA 4X0NA 4W85A 4JL2A 3NCOA 4MB5A 3N9KA 8A3HA 2YDRA 3WDRA 4CP9B 1YQ2A 3W27A 3GXDA 4QP0A 5A6JA 2VRJA 3K4AA 3AZRA 2LROA 2PI6A 4JL1A 1WZAA 1EHAA 1RP8A 5DMYA 4OZOA 3A47A 4MB4A 1JYNA 1ISXA 3F5LA 3L4WA 4CKQA 1CECA 3ZT6A 2VX4A 3WUEA 2BHUA 1C8YA 3O6AA 1QHPA 1CZ1A 3ZSSA 3CIVA 4Z2LA 2CETA 1EGZA 5M17A 1E3ZA 2DH2A 3EMQA 1E55A 4U3CA 1V6UA 1W9VA 3N11A 2JF7A 2Y5EA 1E70M 5D9OA 3B9EA 2F61A 4PYSA 2C8NA 2JFEX 3QOMA 1J18A 3BAWA 4AD3A 2BV9A 2VCCA 1W3KA 2WHKA 1OSEA 5HPCA 1QNRA 2WPGA 4JFVA 1JNEA 4JFUA 3W38A 2YBTA 1ISVA 4U2YA 1E1FA 5A2BA 1ZU8A 3EYPA 1OB0A 1U33A 4YHEA 1UKOA 4URIA 1CENA 3AI0A 1VEOA 3FAWA 2ZX5A 3VD3A 3W4RA 2WKLA 3APGA 5KZ6A 4HOXA 2J74A 2YL8A 3WF0A 1VFMA 2XYLA 5ABHA 3L4YA 3S6TA 5BXPA 4B3LA 4B16A 1WDSA 1OT1A 2GJXA 5DEZA 1VBRA 3AHYA 1KR0A 4IUGA 2FGLA 2IXVA 2XHYA 2DT3A 1W9FA 3T0AA 5E0CA 3AS0A 2VRQA 4FLOA 3S2CA 1UR8A 2YOCA 3VM5A 1B3ZA 4ATWA 4XB3A 2VZSA 1FH9A 3I3DA 1VFOA 1EQCA 1UHVA 5FD0A 1TZ7A 3J7HA 1JZ8A 4J27A 3MU7A 3DC0A 2ZUUA 3QOKA 5I79A 2B31A 3N15A 2DSKA 2ZE0A 4PBGA 4LYRA 5HOSA 1UH4A 2A3BA 1IZJA 4MDOA 5A8PA 3WQ5A 2J7EA 1BGAA 1WE5A 3W81A 5BWFA 2ZUSA 1GW1A 3AMGA 3ZMRA 1UQZA 1UR0A 3PZ9A 3VD4A 2J7BA 1KR1A 1J01A 1W9UA 4GQQA 3U5YA 1UD8A 2VZTA 2XIBA 3PZTA 1O6IA 3AIVA 1HKKA 4WF7A 1CXIA 3K1DA 3CZLA 3IJ8A 5D9PA 1J0JA 3T0DA 3DHUA 3GBEA 1PIFA 4QLKA 2ZXBA 1QHZA 2VJXA 4PN2A 1QI2A 3AIRA 3TTQA 3VIKA 3MO4A 1GVYA 1C7SA 1EOMA 1WZLA 3CZJA 1E4IA 3VIPA 4CCCA 5A8MA 2XFRA 1UD3A 2ZUWA 4PMVA 1G0CA 1H09A 2G3IA 4J3SA 4HOZA 1TUXA 6TAAA 2BVDA 2XVNA 4W7WA 2YBUA 4AEFA 1UA7A 1RH9A 2BHYA 3GH5A 1XV8A 1QNQA 3BSHA 3AHZA 1UZ4A 4NI3A 4DUVA 2QPUA 3W6LA 2EPLX 3THCA 2WK2A 5GNYA 1V3JA 3MKKA 2OSXA 1EDQA 4CD8A 3RPMA 2XWDA 3FN9A 1UWTA 3L4ZA 3VMPA 3TP4A 3W6MA 3SUSA 1PIGA 4UR9A 1GCYA 2D1ZA 2CXGA 3BCDA 3HJEA 1HKJA 3IANA 1BAGA 1VFFA 1CXLA 2VT0A 2BY1A 4V27A 1HL9A 3FW6A 1BGGA 3L4TA 4ATDA 3AHVA 3M6DA 2XIIA 3WDJA 3NUKA 4LYQA 3QR3A 1DEDA 2X05A 3SCRA 1KBKA 4E2OA 2D2OA 1NOWA 2D0FA 3WN6A 2XFYA 2V5DA 2DDXA 5D8WA 1Q6DA 3VINA 2WVTA 1JDCA 1C93A 7TAAA 2J7DA 5ABEA 2J25A 5LA1A 1VBUA 2W67A 1OGSA 4GZIA 1E43A 4AZ7A 2YA0A 3A6OA 4Q22A 2UY2A 1H1NA 3WSUA 3ZM8A 2X1IA 3WUFA 3AMCA 1A3HA 1PAMA 5M5DA 1UYQA 3O9NA 2RGMA 2WVSA 4V2XA 2OYLA 1NOFA 1HKIA 3SCWA 2ZXAA 2EPOA 4NSBA 1JF5A 1UKTA 3VU2A 1TA3B 1Q6GA 1BHGA 3VM7A 1DWHM 2BNJA 4D6JA 5FL0A 1W9PA 1SR0A 4P8XA 2ZXQA 5E0FA 2YA1A 1ZJAA 1QVBA 4AIOA 3DYOA 3SCPA 3KWXA 1FH7A 3ZYHA 3VGFA 3VD9A 1VF8A 3WDIA 2WZIA 5AC4A 3I3EA 2GJXB 2YL5A 5CGTA 1E4LA 2C24A 3AYRA 1CLVA 3VNZA 2BY0A 1CEOA 1GWMA 5AYBA 1CLXA 1J0IA 1FP8A 4ZXOA 3WL1A 4C7GA 4OIFA 5A8QA 2UY5A 1UQYA 3BLKA 5A6BA 1KXQA 4TX8A 2VTFA 3MUZ1 2J8FA 2QPSA 1P6WA 2PBGA 1FP9A 2HVMA 2VMFA 2CERA 3AS2A 1JAKA 3AQUA 3OIHA 3LMYA 4W93A 3WEMA 2VI0A 5CPQA 2KR2A 3BAXA 3IAQA 4MADA 4ZFMA 3WNLA 1R87A 4WKAA 4AD4A 3VGGA 4MNKA 2ZX7A 3QHNA 5I0DA 5FKYA 1XD0A 1FH8A 5C70A 1UR4A 3ARWA 4M24A 1OINA 5BXSA 1XSJA 4IM4A 4JAWA 4GQRA 3IK2A 1HKMA 1GORA 2ZUMA 1D7FA 3N12A 1LL4A 1ZL1A 1DWFM 2Q8XA 3MUAA 4LPCA 4DWSB 1FHDA 2WVVB 3EDFA 5JIPA 1L7LA 3L2LA 4OJYA 1JF6A 3G6LA 2V38A 3W25A 3AS1A 1MFVA 3O2LA 3FXYA 3M46A 4QCEA 1UKSA 2YLLA 2O9TA 2FHFA 3VGEA 2RGLA 3ZIZA 4JFTA 3SCUA 3AIWA 1D3CA 2YDSA 5JBEA 4IISA 2JWPA 1E6RA 2E9BA 4K68A 1V6XA 3BSGA 4HU0A 1E1EA 3GTNA 2FDMA 4CPBA 2WHMA 3RIKA 4GXPA 2ZX6A 4PMQA 5BXRA 1B1YA 1C8XA 3W26A 2XVPA 2QMJA 5M03A 2G8ZA 4MDPA 3ORJA 3RJXA 4TX6A 2VC9A 3WBEA 4JIEA 4AMCA 1HJSA 4D6IA 4UFMA 4GO8A 4HMDA 1HP5A 4MNMA 1BSIA 4LYPA 7A3HA 1AQMA 4J3TA 1KGXA 1GOIA 1JZ7A 3TONA 1BVNP 2BVTA 1W8UA 2E8ZA 3PZVA 4CD5A 3KEHA 4GIAA 1E6PA 3BGAA 1V6WA 1UD4A 1C7TA 1W1VA 2E0PA 3IAPA 3WQ6A 1V0LA 1DTUA 3VIOA 3WMBA 3CZ8A 4OBRA 3CO4A 1NWUA 4LKFA 1MWOA 4KWUA 2ZX8A 1HJWA 2FH8A 4BCEA 4A3HA 3A4XA 4RE3A 1MVYA 2O9PA 4UFJA 4AZHA 2JALA 5CPTA 1W91A 4UOQA 1WDRA 1HX0A 4QAWA 4M80A 1XYFA 1V0AA 3M07A 5D4YA 2O14A 1UKQA 4LK7A 1OD0A 1H0GA 1W3HA 2JF6A 1JZ2A 1VEPA 2EJ1A 4WIWA 3WDPP 2YDQA 4H04A 4DUXA 3RO8A 3VO0A 1BYDA 1VRXA 3GNRA 4CN1A 4M29A 1JDAA 4OOZA 3WELA 1RPKA 1OKOA 5D8ZA 4JFSA 2Y8VA 1MXDA 1JXJA 1JZ5A 2VL4A 1JYVA 3LPGA 3PBGA 1XCWA 1CGYA 4BZYA 3RM4A 3VTRA 4UCFA 3T2OA 3TA9A 4TXEA 4ACZB 1K9TA 2CHNA 2E9LA 1B0IA 4V28A 1R7OA 4MAZA 4R5EA 2D3LA 2V3DA 5CQ1A 1BF2A 1G5AA 1CYGA 2UWFA 2JEPA 4N42A 4UQEA 4IPNB 1E40A 3SCVA 3PZIA 2WCSA 1W8ZA 3VVGA 2XPKA 3VOCA 3N13A 1M04A 4HP5A 1UD5A 2V5CA 3W0KA 2X09A 1GJUA 4Z2JA 3GXIA 2J79A 2DQXA 4PMNA 3AMLA 3UR8A 3ZYFA 2ZUNA 1QNPA 1JFXA 3WQ8A 3GNOA 5CLTA 1GNXA 4U2ZA 4WKFA 4AW7A 3PZQA 3VD5A 3KZSA 1W1TA 4TOQA 3ARZA 1EOKA 1UWQA 2BFGA 3I3BA 1E3XA 1PZ3A 1BQCA 2OWXA 3MSDA 2E8YA 2DH3A 3WDHA 3VGDA 3QGVA 5BCAA 4WJXA 4PTVA 1Q6EA 2CEQA 4EE9A 1U30A 5BXTA 1XH2A 1JIBA 4HA4A 4XV0A 2Y4SA 3UG3A 2WSPA 1KFWA 4D71A 2GJRA 2J47A 3EDKA 1OM0A 2VZOA 1Z32X 4HMCA 2J4GA 2VQTA 3NDYA 1B3WA 1QW8A 3W37A 1E73M 1N82A 2OWCA 4JKMA 1E6QM 4HMEA 2ZICA 4Q7NA 1PEZA 1BYAA 1UR1A 3JUGA 5BROA 4GZEA 2DT1A 1GHSA 2V3FA 5EMYA 1Q6FA 2VX6A 1TG7A 2D24A 2CITA 2EPNA 1E6XM 2EO7A 1OIMA 1UR2A 1KBBA 3GBDA 3CHCA 4YW7A 4HA3A 3NJ3A 2HISA 3ALGA 3RCNA 3OGRA 1J11A 3BMWA 1QOXA 2BXZA 1QNOA 3MV01 5DO8A 1BVZA 4WKHA 3GM8A 3T2PA 2VZVA 4BQ2A 1IT0A 3UG4A 3WEZA 3UERA 4W88A 3DHPA 3MMWA 2WSKA 3WMCA 1CXEA 1CGVA 2Z1SA 1UD2A 1Y7VA 5DFAA 3BAYA 2IUZA 1HXJA 3WF3A 4JCLA 5A3HA 1U2YA 4GI8A 6CGTA 1ZBVA 2J7GA 1W3JA 4ZXLA 4J3UA 1GONA 1UWRA 4CD7A 2GK1A 5GNXA 4MPKA 2DSWA 5A94A 3SUVA 3G6MA 5E09A 3ARRA 3OB8A 3ARUA 1EA9C 2CBUA 2WC3A 3TTYA 4NRRA 4EAMA 1X6NA 2UY3A 1OBAA 3ALFA 4AZIA 4W86A 1H0IA 2CIPA 1ZJBA 3FHAA 1SMDA 3SUWA 1L0PA 1W9DM 1V6VA 1LLOA 3WNKA 2A3HA 1FA2A 2O92A 1G01A 2DIEA 2XM2A 1UOKA 3RM9A 2QV4A 2W61A 4ZE5A 4B3KA 3T08A 4W7VA 3UT0A 2AOSA 1OIFA 4BS0A 5HBFA 1JL8A 4D6FA 1RD6A 3CLWA 3NSNA 3OLGA 1PX4A 4JKKA 2A3AA 3WQ4A 2CKRA 1NH6A 4DM2A 4GI6A 1LG2A 5F7UA 3T0BA 1ZS2A 1KGUA 4KRTA 4Z2HA 1UKPA 2DGAA 1TFVA 4H7VA 3CZGA 3MMDA 1C8QA 1FOBA 1HF6A 1JD9A 1M03A 3ARSA 5IHRA 1LJYA 5I5RA 4NZCA 5LYRA 1AVAA 7CGTA 2BXYA 4UQBA 3PZGA 4PMOA 1C90A 2WC4A 5BRPA 4RE4A 3WMSA 5BYWA 3GXFA 4LGXA 5GPRA 4F9DA 2VQUA 2ZOXA 1JG9A 2ESCA 1PPIA 2IXUA 2G41A 4TVUA 2G4FA 4P8WA 3N1AA 3AJ7A 1E0WA 2AAAA 3GH7A 5I23A 3UEQA 3WQVA 1XHGA 4PSRA 4ZE4A 1WMXA 2GSJA 3K8MA 4PMZA 2DIJA 3OZPA 3DYMA 1JXKA 1E4NA 3VIMA 3OGVA 1VJSA 2WAGA 4GINA 1ESWA 5CG0A 4ACYA 3KE0A 1GQJA 1CBGA 3AS3A 5LA0A 1KWKA 4X0VA 1H2JA 2XGIA 4B9YA 2CESA 4OKDA 2TAAA 1E5NA 2XTKA 1BYCA 3WENA
chains in the Genus database with same CATH superfamily
4Q4W1 4CYDA 3FVMA 3GXMA 3LQGA 4WY0A 4QDWA 2QF7A 2XVLA 3BLPX 3PBUA 4D0QA 4L9XA 1MQTA 4PRWA 1SR9A 3NZ1A 3I2JA 1V00A 3CL6A 4HNCA 2RHPA 1UR9A 2VR5A 3A4AA 5DXDA 1LLWA 3HG3A 1JOBA 2WLYA 1T6GC 2DZVA 4LLFA 3LMZA 2P88A 4MSVA 7ODCA 3MW2A 2A70A 4PL2A 3WQ7A 3NSXA 2QDHA 3UKTA 1X98A 3TYBA 4N9IA 4PGLA 2BVYA 1MUCA 4ICMA 2LS6A 4W8AA 5D33A 3WD5A 1JD7A 3B9IA 1J2WA 4ORIA 3IMMA 2VNOA 2PBOA 2ZXDA 2VMIA 3R4SA 2W66A 2JG9B 2PLCA 3EXUA 3U07A 1X1ZA 3UJEA 2C1HA 1AJZA 5FYMA 3WW2A 5CG9A 1VEMA 4MM1A 4XDQA 3TAOA 3EZ4A 2WMKA 1HN1A 5FUPA 4NAMA 2GC3A 1D4M2 4FPJA 5FO8B 1W56A 2ZGPA 4HPNA 4YJ5A 2G37A 2VURA 3C5QA 1B30A 1X8MA 4FF7A 3LI0A 3EDDA 2NV9A 4DXKA 1W1YA 4LMFA 1ODUA 1WQ5A 5D09A 3UJFA 3T9PA 1IF2A 2VUCA 4JAAA 2OB3A 2Y33A 5IBXA 1PO21 4O28A 1E72M 3S5ZA 3W23A 2QAFA 5TF0A 4PTWA 5AOUA 1V6KA 2Z42A 1PIV3 3O6DA 4ZZ8A 1K6AA 3RYRA 2ZUTA 2W52A 4Q4X2 4AY1A 3STEA 1CB7B 1X8EA 1ULFA 1VMJA 4D2JA 2D6KA 2VOWA 1TVPA 1ZX5A 5KXEA 2VAUA 3MIEA 1LQ0A 4RGAA 1GP6A 3TH6A 3C2UA 3PTDA 3KF5A 3E0LA 3HB9A 4HA1A 4XE9A 5FIPA 3OBEA 1NQ6A 2NQ5A 4E4UA 1ZRIA 1BMV1 2D0HA 3VHPA 5DUXA 1B3OA 3ARPA 1Z41A 2F17A 5GZCA 1S5VA 5FZAA 5AFBA 4ATEA 1S38A 4BH9A 5PTDA 4I7UA 3U57A 3IARA 4IGSA 1XNCA 3SEPA 1IV8A 4ZONA 2QUTA 3LM3A 4GFIA 4MJMA 3L2HA 3FAXA 3H7VA 5JR7B 1JYCA 4KH9A 3L5AA 4QQHA 1Y5WA 1DJXA 1ELSA 4CDUB 2QXWA 3AIQA 2F7FA 4YG0A 1IXPA 1K4HA 2G5WA 5FUNA 4JHZA 1ISYA 1SHWB 4CEXC 2MPFA 3N2XA 2E32A 1UP3A 3QM3A 3RJRA 2VM8A 3MI6A 1AL8A 2QKDA 3WUBA 2PWUA 4DRVA 1GVQA 4QU2A 2WO2A 1HN0A 1GWLA 2D73A 2QEZA 4QKNA 1ONEA 3ZLHA 3VKJA 4B92A 4XBSA 2R6QA 4QPWA 5LBFA 3O1RA 1JAEA 3IDCB 4S3GA 5AECA 1AR81 2OSYA 1EHNA 4P7QA 5CLWA 5FDBA 2WSYA 3DBNA 4L56A 4HANA 2OX0A 1AZDA 1VBE1 4GO9A 1O5RA 1RB8G 3WF1A 3KCJA 4W8LA 4IGMA 1KM0A 2OU4A 3OYXA 1O3RA 2VEFA 2GJNA 3CV1A 4L9BA 3HU7A 3TXVA 4IIDA 5K9XA 1GPWA 3N9OA 1ZAHA 2I9EA 3V4BA 4H19A 5E93A 4O54A 1RINA 3FJ6A 5F4WA 3LERA 5EV7A 1I1WA 3RR1A 4AOCA 4V1PA 2HCVA 3QW3A 1FNYA 2IXKA 2X29A 2WMIA 2CHOA 2FGZA 5C5UA 4DY5A 2HWB2 5A2AA 3N14A 2XGBA 3TQVA 4JTLA 2BGCA 2VW1A 5E88A 5CBBA 2HWD1 1RLDA 7PTDA 2R073 5DAWA 1ISWA 1VHCA 2FZ9A 5FYZA 4MFDA 3PJQA 1NP0A 4PMYA 1P1XA 2V5JA 2ZEXA 4MWAA 2PRHA 4PEEA 2BGSA 3A4WA 3WF4A 1XH0A 2P17A 4Y9OA 1XCXA 5IDZA 1CW2A 2JG8A 1LRHA 5A7SA 2OX4A 3R0RA 3USUA 1C92A 2BY3A 2YDEA 2ERFA 1WDPA 3KTXA 4YVVA 4N02A 1BVP1 3G1RA 2YU1A 1FHVA 4LS0A 4KEUA 3UG5A 4FHAA 5I24A 2VG9A 5A69A 2PPGA 1PVC1 4XXPA 1F7BA 1JGIA 2ZZ7A 2I2SA 2XJSA 3RITA 2NLIA 3AROA 1LRQA 3E49A 1DQUA 4PCFA 4GIYA 3OTFA 2QDRA 3W85A 1R2TA 1K4GA 1PBGA 2WMJA 2Y5SA 1UKGA 2X2YA 4D6DA 5FYBA 1M6JA 5CPSA 3MWAA 2A79A 1IKPA 1IYXA 1AR91 3WF2A 3RLGA 4M1BA 1RCOB 1BXCA 1WMFA 1DZRA 2GWGA 4C6PA 1PWMA 5LB6A 3JS3A 2ZGKA 5JIWA 5IW0A 3VFLA 2WQ4A 1ZSXA 3EMRA 3R89A 4CN4A 3LIGA 3NG3A 1WXYA 1FAYA 2CGNA 5D9MA 2VRKA 2XDFA 3WD1A 4NZFA 2HZGA 1WPCA 1TWDA 3L2MA 5HNTA 3EBVA 1EYEA 1IEIA 1H1MA 3DI1A 2A3EA 4AI0A 3BI3A 4HCHA 3SH3A 2SFPA 3ZR6A 3V75A 4WOQA 5TNVA 5I78A 2GP5A 2GSHA 3VIGA 1LOLA 3O1VA 5T5JA 1J10A 3CHXA 1HJUA 1VR6A 1ULEA 2QLYA 3UESA 3WH5A 5HDRA 3QEZA 1XLEA 1XX1A 2D22A 4FAMA 2UY8A 4XAYA 4I7VA 1G69A 1W8HA 3KBVA 2XGXA 2OT0A 1Z0HA 1GQHA 4JQTA 1H63A 4JQ2A 4A6SA 1J0KA 2NV1A 3K8KA 4M1RA 4S2DA 3HR9A 3GW3A 5BXXA 3GNNA 2YXOA 5H91A 2O1QA 4D72A 2YGLA 2DVTA 2PGRA 1A53A 4ROQA 3Q67A 4OWGA 3W7CA 3TR2A 3PPFA 2FBEA 4Z1DA 4BI7A 5FQ0B 4FPFA 1H30A 3CHDA 3VGHA 5LEJA 4CVUA 1F5JA 1D7KA 3C56A 1ODNA 3VBHC 4AQSA 5F5QA 3H54A 3IB3A 3ZXLA 4BIOA 3WLQA 3CGTA 2VUYA 4Z2KA 9RUBA 5FR3A 1X82A 4QKBA 3B69A 1PSCA 1WBHA 2EXHA 3WY1A 1U1JA 4WSJA 2V4AA 1FTXA 5ECUA 4LU0A 1JZ3A 1NU5A 5D9NA 2Q8EA 3WD0A 3ZOAA 5I07A 5AVNA 3TAYA 3D4KA 2R072 5DAVA 4AVOA 2XJUA 3CZEA 3HG4A 1OT2A 5LA2A 1XRUA 2WWCA 4MNJA 4IICA 2GSYA 5IK5A 3SCGA 4HNVA 3BE7A 4WX2A 3WFZA 4LO5B 5IFPA 5GLVA 3QSTA 5HXMA 1RAKA 1W9YA 4HXCA 3KS5A 5FBZA 2R041 4J3WA 1JUBA 3VUPA 1K8YA 3RZLA 3OYWB 1GICA 1OFPA 1KM4A 2QCCA 4TYSA 1HV1A 3VNLA 3BCWA 3NWKA 1PZ8A 3VFCA 1YI7A 3MV11 5MHBA 1R9XA 4XTMA 2XN2A 2A6YA 1PCKA 2NXHA 1V3IA 4B9ZA 3TN5A 3NQCA 3G3MA 1IGSA 3V0AA 4JXCA 2IQDA 3O0XA 4AI8A 3ITCA 4QGNA 4QQOA 4DF1A 3PVOA 3W7IA 3J26N 4EK7A 1NOUA 2PDHA 1FDJA 3AYVA 1TQ5A 2Y62A 4CCDA 3AXDA 4PT6A 1FI2A 2A2IA 2PDNA 4KFNA 3S8HA 4AYUA 1AYN3 4E8DA 5A1LA 1WCGA 5C3QA 1H9WA 3TYDA 4QGLA 4MIMA 2FMOA 5DMLA 4R88A 3LSDA 1LF1A 3RG6A 3O05A 3IKWA 4HN4A 4W5ZA 2YBKA 1NA1B 3CTTA 2B4KA 4F66A 1CGTA 5FTTC 1S0DA 2WYFA 2CNCA 1VPYA 2Z00A 1TX0A 3U2OA 2VGBA 2Z29A 1MRAA 2BBFA 4O17A 4OV9A 1HXS1 1HT6A 1MW2A 5D21A 3AXIA 4O8AA 4O18A 3QH2A 3O3RA 1PZ2A 4L4MA 1DHKA 1K5MC 4YL2A 2CHRA 2ZAAA 4PMXA 3I4IA 4A3QA 4DWSD 5C9AC 1KS5A 3PUAA 2Q3OA 1VIWA 4KU7A 1E6ZA 2ISSA 3ZSTA 5JBFA 4LVDA 2DZTA 2GK1B 3IVTA 2XDVA 2JDHA 1E9LA 3GFZA 3W76A 4L1GA 1EXBA 1QI0A 2CY6A 4I2OA 1N8FA 2J9XA 1UW8A 4OE7A 5DBUA 1AX0A 5ANQA 3V56A 2WAAA 4HYWA 1XLAA 2UV8G 3C0SA 4R52A 2OGJA 4U3AA 1VFSA 2ABBA 4QB6A 2VDHA 2Y89A 4IGQA 4BE3A 4NF7A 3GX9A 1MQRA 2WZMA 4XKYB 2ZA9A 4YTSA 4S3JA 5D8AC 1X96A 4ZOEA 2RKXA 4UTKA 1Z89A 2E40A 4IP4A 4GA9A 3NDZA 2J42A 5HCBA 5BUVA 4JC1A 4N6FA 3TCSA 2PHRA 4CTEA 3KS7A 3SQOA 1L6YA 3WFLA 3E1F1 2W63A 3I54A 1SDWA 3O1OA 4XEZA 4LKSA 2HTMA 1QFEA 3P6LA 1HVXA 1E0XA 4R27A 2HWF1 3R4DB 5HWNA 3N4AA 3CQKA 5T55A 1LRTA 3NFUA 3UV9A 4Z1VA 1CGWA 4Y9AA 1QNSA 4Q8PA 4YN5A 1K5MA 2E7FA 2QPXA 4R9XA 4RV3A 1B4KA 5LBBA 3U4XA 3ENRA 2WWUA 3HPNA 3B8UA 3G5EA 1W0OA 3VGBA 4CDQA 4PJYA 4AQ6A 5CA6A 3BG5A 4LUSA 4NZ3A 3WDYA 4OFCA 5C6MA 1EQPA 1XE0A 1QPOA 2PRLA 1RPXA 3OF1A 5FYSA 4EXAA 1WKYA 1XU2A 2CSGA 1HIXA 3TNPB 4QJ4B 4HHHA 4J40A 1MVEA 1IHMA 1BD0A 1UD1A 1CDGA 3K4DA 2IXCA 3GTXA 4XJ9A 4US5D 4XAGA 3URQA 2DT0A 2WMFA 3ZLGA 4G56A 3KHCA 1EPVA 1XLDA 4IV1C 3B04A 3M0VA 3PHAA 3NQMA 4N8MA 1RJRA 2VNCA 5IBXC 1KKOA 4UFHA 4AXOA 1DIOA 3UNPA 1V3KA 1AYM1 4PRRA 1YHTA 1SZBA 2BMBA 3PTKA 1UMZA 4GH1A 4Q0QA 5JQ9A 2ZCGA 1IQAA 4RGGA 2ALRA 2H6BA 4COUA 3V0TA 4LBOA 2RJKA 2PDFA 3G1XA 4E2DA 4TLFA 4UFIA 3S0CA 2Q8ZA 2EGZA 1EJUC 8XIMA 3SY5A 3RYKA 3PTMA 2ZTKA 1S4CA 4IEPA 1H9PA 2WZR3 2QVNA 3S47A 2VHLA 4XTPA 3PZOA 1VB4A 1RC6A 3GDTA 1GOWA 4LBUA 1REQA 4AVTA 2WWDA 1RUOA 1H6YA 4LTAA 3CHEA 2W4XA 3RMXA 3HBKA 4KQNA 1GWKA 4B3NA 3T05A 1V79A 5EHDA 2Q09A 4DBDA 4PI2A 4HU8A 1QI3A 2PU1A 1L8NA 1DJYA 2DFCA 4YGEA 3QHOA 4ASMB 3RJ2X 4PUMA 3C3VA 1L3JA 4JZ5A 2WMHA 5HWJA 4W8JA 3RILA 1HB2A 1OY0A 1XBYA 3O1MA 4CN6A 1OWQA 4P8VA 1RUF1 4H4IA 4XD6A 4J2MA 3W7HA 1R85A 4EPKA 3AFKA 2X41A 3CHFA 2ZRUA 5CFDC 2WCAA 4AYSA 2RDRA 3UYJA 1JDDA 4J3VA 4Z8BA 4L65A 4O8RA 5AHNA 2J77A 5G05L 2XL7A 1UU6A 1BFNA 2FMDA 3KDOA 3WXPA 1GPFA 5FPBA 3ZVHA 5BWAA 5CSRA 1RSCA 5FMDA 4BLJA 4HGXA 2Q3RA 5FY7A 1OA3A 1UH2A 3CH9A 4J1OA 3I2IA 4LUIA 3SCQA 2GUYA 3RS6A 4Z2GA 4J28A 4Z1AA 2QCDA 5I8YA 4AEDC 4UR7A 1PVC2 3FV9A 2KA3A 1QJFA 1AYN1 2B7QA 4EWEA 2PAMA 5A33A 2ZPXA 1C9WA 2XJ7A 3GHTA 5HPOA 4QBXA 5CJMA 5CAKA 1G4PA 2XJRA 5FYYA 1A47A 1FWRA 4XUGA 4OV4A 3VKKA 4CU6A 3GBFA 1M7XA 4XBKA 1HUVA 2PWEA 2D44A 4N9DA 3T55A 5IVBA 4FXSA 2FDFA 2VKZG 3H8RA 3W2LA 1E5JA 3PPGA 4KMQA 4UZUA 2CLKA 4QDMA 3JBG3 3WQOA 2ZZ6A 4QPGC 1KXVA 2ZIDA 4AWEA 4F3HA 4MZYA 3I97A 4TSVA 2VO5A 2OKTA 3M5XA 3F4VA 4LHNA 3VOHA 3M5VA 3HMCA 4ICNA 2R94A 4AF0B 5F1RA 4O15A 4XAEA 1E9ZB 2GPTA 3ZFEB 4RR3C 4JIPA 3IM0A 5ACA3 4FNSA 2YSWA 4QAIA 3E2SA 2FHCA 1RUJ2 4DRSA 2R91A 4DFSA 1NX9A 2BNOA 2IQTA 2V5YA 4BF9A 3L66A 3RMEA 1N3PA 3HT1A 3I3QA 1ISZA 1OF3A 3AM2A 3ZN4A 4RZ6A 3C0QA 3G7DA 4Q4Y2 1X38A 4NIGA 4DY1A 2EXJA 3W86A 3QPYA 3NZRA 3MIGA 2XSAA 1PJ9A 1XH1A 4NXKA 3NXLA 2JGYA 3THPA 1CIWA 3HD8B 1R1A1 4HVQA 1DWIM 2CBIA 2KM2A 2QUUA 3NXFA 2VZQA 1J0ZA 1DORA 3LU2A 3NO5A 4ZMGA 1V5XA 2XISA 1Y43B 2DSVA 3H70A 1E15A 1OFBA 4FOJA 1H41A 1W6PB 4KBZA 3W2NA 2NSOA 3KZ4C 5FO9B 3DPRA 2DJXA 5FLHA 3RRDA 4NZJA 2EICA 5F4SA 1DL3A 3RX4A 4Z2IA 2WZR2 5LZ6A 1MUMA 3W3OA 5AVPA 4RW5A 1X8CA 4Q4RA 2Y26A 2G3NA 9XIMA 2P8BA 3GDLA 1RR2A 4K7YA 1R3WA 1IXOA 2ZX9A 4PBPA 4UBHA 3DKJA 4U33A 2NLRA 1KTNA 3BTNA 2W62A 3LCLA 4I9MA 5F2IA 3PBVA 2JDYA 3PMEA 2DZXA 5HANA 1RJ7A 3VD7A 3BTYA 1XGEA 3NDOA 2C26A 5H9PA 5I3HA 4NJGA 4TV5A 2TODA 2UU8A 1UY3A 1KGWA 1EYBA 1Q5OA 5J98B 1UXZA 3QY8A 1UIPA 4DO7A 3P3BA 2PAKA 3O5SA 1NLSA 1UZDA 3SH5A 2ZCWA 1HRI1 2VZRA 5I0RA 4JCKA 4AEDA 3K1GA 3WT3A 4H83A 3N3MA 4X2RA 4UTWC 1VZWA 1B3XA 1PKYA 1Q63A 3TNQA 2XIOA 4O53A 5IHSA 3PVFA 5A1AA 2E25A 2PWDA 3NVTA 4QS6A 1KFKA 3FJNA 3U5UA 2XJTA 3LAGA 4ML4A 4UFLA 5KTLA 1PVXA 3CKHA 1CAWA 4BQ3A 4S39A 1OZQA 1GV9A 3WL0A 5CPLA 3HNMA 4OBTA 1EJWC 4RD7A 1HJXA 1QPRA 4JEJA 4JR5A 3QC3A 3LQLA 2WMGA 3M7WA 2HBUA 4KCUA 4XF4A 4LUYA 3VZLA 4Y9NA 3GVVA 4YTRA 4W85A 5TAOA 3N36A 1T7LA 2RDUA 1UB3A 3NCOA 2XBO3 4YCOA 1W06A 3LA7A 3OYWA 2FDHA 1W2TA 3W70A 1YQ2A 3DPRC 3W27A 3ERPA 2VRJA 4QM1A 2LROA 1K42A 2D93A 2H3DA 1LLZA 5H9SA 5JSPA 1AJ0A 1DVJA 1WZAA 5G04L 1OF8A 5DMYA 4XVHA 4MB4A 4UW4A 1QNWA 1TJ2A 1JYNA 1TZZA 3N2OA 3A4JA 2RFGA 5FY9A 1EZ2A 2RVAA 2BHUA 1P0BA 2CZDA 5EQUA 1A5CA 4KESA 5EMJA 4AG0A 4GG9A 1ZY9A 1ZRQA 2DDUA 3R0KA 4RZ4A 3NVCA 1E55A 3UXDA 2ALDA 4U3CA 3TYEA 1HO4A 4QRNA 1Y65A 1Y8BA 1V6IA 1IKQA 4Y9PA 4EIVA 1W9VA 1RVGA 4LAMA 2J1TA 1N3OA 3WQFA 5FY5A 2Y5EA 1E70M 2OEMA 2C8NA 4Q0UA 1H1IA 4H6QA 4DHGA 3HURA 1PHMA 4QX0A 4JTSA 3WP5A 4NRMA 3BAWA 5JWPA 1ZA4A 1HW6A 2OQLA 2BV9A 2VCCA 2ARXA 3H12A 1OSEA 5HPCA 1QJU2 5E0KA 4UWDA 5FEWA 5ABJB 2I16A 4JFUA 3W38A 3N9MA 2QTWB 1E1FA 4AVNA 4BQ1A 4ZR8A 2JIJA 1JGMA 1OB0A 4O1FA 1U33A 3DG7A 1MO0A 1RUSA 4J1WA 3INAA 1K8CA 1TE6A 4WJ8A 2ZX5A 3W4RA 2WKLA 3APGA 3G0UA 2Z2BA 3GJBA 4QXHA 1AYN2 3WF0A 1T41A 3KS6A 3LB0A 3QYQA 3PFMA 2G9GA 3TWAA 3PUIA 3S6TA 3OG3A 1Z44A 3U6WA 5AZ1A 3JU9A 1QPQA 2WO5A 4B16A 1GZGA 1WDSA 4NMIA 4LEFA 3ABRA 4V2VA 4IUGA 3QMRA 1TPUA 1XYOA 3KLKA 3H7RA 3MIFA 1AR83 3GR8A 3AS0A 3V0BB 1THFD 3BJFA 3PR2A 1YE6A 5T54A 4AFBA 2XINA 4XB3A 1B57A 1TMF2 2E9QA 2GAUA 5IK7A 3FE5A 2B9UA 4CEUC 2W6RA 3O6YX 4XO7A 1Y0EA 3AVRA 2GVLA 4EWAA 3ZXJA 5JSOA 2PZ0A 4M5PA 4N6EA 5HJXA 4A22A 2YC2A 1SACA 3BICA 4ZA0A 5HOSA 1UH4A 2OT1A 3D82A 4TV6A 1IZJA 1M65A 1CX9A 1BGAA 3MPGA 2WQ8A 4C8DA 4IEVA 1WE5A 2XN0A 3W81A 4FO4A 2QZ3A 5BWFA 3XISA 1E0TA 3EWCA 1SQ4A 3E0IA 3ZLFA 3AMGA 3T4VA 3NPXA 3LLFA 3JXSA 4ZB2A 1DQ4A 2POTA 4PEKA 4ONUA 5H9QA 3FKKA 3R6IA 2IKGA 1W9UA 4YWSA 1SPPB 4E2SA 3KBMA 5GVJA 2YPDA 1UD8A 2Q01A 4ITCA 3ZFEC 1MEC3 5AC91 1HKVA 1FWNA 4QX4A 3KOZA 5FPXA 3N35A 4HPJA 3O06A 4FIQA 3PVEA 4JNMA 3R2GA 3SCFA 3RRXA 2WFF2 3ES7A 3HQXA 2XXZA 1B54A 3UJ2A 3NAPB 4S38A 3HM7A 1RUG2 4O16A 1G86A 4A7ZA 2IPFA 4TWTA 4RQPA 3ABQA 1QI2A 2ZZJA 4N43A 3AIRA 3ILRA 4CQDA 1PB0A 4AWSA 2CLPA 3TTQA 4HSNA 2VXRA 1HB4A 4CQBA 1HKDA 3AFGA 3B4UA 4RYDA 1NAL1 2YPJA 3GZUC 4IV3C 1UD3A 4J5NA 3LHZA 3PUGA 1L6GA 1XFBA 1QW7A 2QQWA 4XTIA 4PMVA 6TIMA 1RVF3 2XJVA 4JIIX 1FMD2 4LPLA 2ZGRA 3CAQA 1G0CA 3GKAA 4HOZA 3MW4A 4JTRA 1VLIA 3A5FA 4DXXA 2XVNA 1KLYA 2Z1XA 3W2UA 4BIFA 3W7EA 4AEFA 2Y70A 1RH9A 2BHYA 3TDFA 3W7JA 1OMIA 3POFA 1XV8A 1NUKA 3BSHA 2WQDA 5FKCA 3DG6A 2GGIA 3TK7A 3MSRA 2QUOA 2EPLX 4AQTA 3EPMA 4G9SB 3VDDC 1V3JA 3QC0A 4GKTA 3LOTA 4CD8A 2EIBA 1JU3A 5FZ3A 1RUI2 3G22A 1OC7A 3L4ZA 1V93A 3W6MA 3ZYJB 3EOSA 1F61A 5I0SA 2P1BA 3ALQA 2D7FA 1GCYA 3LK6A 3PVBB 1JPKA 2G4JA 3DGTA 3TC6A 3C8FA 1VFFA 1R3VA 3ZFGA 4V27A 2Y0FA 4PC8A 2I74A 1RUD3 1V6LA 4AAJA 2BGNE 1C5IA 5IVEA 4M7SA 1MNZA 3WDJA 3O1SA 1TREA 1W17A 1W3VA 1AD1A 4GB33 1XIDA 2HWB1 4LYQA 4N4PA 3CO8A 5FREA 2D2OA 4QE1A 4AFCA 1PVNA 1ENXA 3H8OA 2C9AA 5E6HA 4C1LA 5D8WA 4HVXA 3Q8BA 4OI2A 5LA1A 5A3TA 3JQXA 1LBLA 1OGSA 4CE8A 3F4WA 3RN6A 2DJLA 4JBRA 4LVAA 2NXGA 3I6RA 4Q22A 1XICA 1DIKA 1PKMA 3KCOA 2W1UA 1R0MA 1X33A 1C29A 4TMBA 4E8GA 1ZP3A 2K9ZA 7REQA 1A3HA 4H3WA 1D3GA 2WT1A 4LE4A 2EXKA 2ORZA 1CB2A 2RGMA 2DVFA 4LNCA 4I9TA 2HKXA 2X53S 3EAUA 4XZPA 3B9NA 1P1MA 1V7AA 3AZVA 4A8LA 1PE1A 1B09A 1H8TA 4B4PA 3PPHA 4H7ZA 3ILFA 3VU2A 5FEXA 1REDA 4GH4C 2BNJA 4D6JA 4LHSA 4P8XA 2ZXQA 2REQA 3GO2A 4FBFA 3ES8A 4HB7A 4US5A 1WW7A 2WNVA 4AIOA 1UCWA 5FKBA 2HBTA 4OHYA 4HBNA 1T5AA 3IGHX 3SCPA 2JJ6A 4INDA 2GDQA 3VDDB 1JPDX 3RWNA 2NUXA 2WJSA 4GYPA 3VGFA 4HNNA 4Y20B 4UTTC 1S0FA 2RM23 3VBUA 1KTCA 2OOFA 2YC4A 3WP6A 1HTIA 3VD9A 1A5KC 4UTUA 1JODA 2JDAA 4NKCA 2WZIA 2GJXB 1XISA 5C9WA 1JW6A 1E4LA 4MUPA 4PIYA 3NAPA 4IERA 2Q0AA 2VDGA 1UIKA 4Y1YA 2Q30A 2BTMA 1GWMA 3Q37A 4SLIA 1SGJA 5BNOA 1EA0A 1PO9A 3W7GA 3WL1A 4C7GA 4JIRA 3P81A 1WCQA 5DPNA 5F9TA 5A8QA 2UY5A 1UQYA 3BLKA 1IS6A 5A6BA 3FL7A 2C0AA 1ICSA 1MDLA 3R79A 1U5YA 4LAUA 3SIZA 4HK5A 1D0GA 2YB4A 4EXBA 1EJRC 3T4CA 3ZSKA 2QIWA 3OJGA 4Q29A 3TBDA 2A7PA 3AS2A 1JAKA 5FXWA 4ZL1A 2AACA 1QO2A 3LMYA 1RLCL 5CPQA 2J6VA 2KR2A 4QDSA 4Q8MA 4FVVA 4MADA 4ZS3A 4ZFMA 3GJAA 4H55A 5IAXA 3VGGA 1XRTA 5JXHA 2CWNA 4XAPA 4MNKA 2ZX7A 3QHNA 4M6PA 1W37A 4GACA 1DYSA 4M19A 2ZMLA 1XD0A 1PK6A 4YNIA 1OK6A 2X5IA 3ARWA 4LA3A 4RNIA 3C52A 1W6MB 4CRQA 3GDKA 1XSJA 2ZRZA 4IM4A 4JAWA 2W27A 1HKMA 4Q26A 1N8IA 2ZUMA 3AXKA 3NM1A 4XVEA 1KITA 2QCFA 4AHOA 5DZFA 2J9ZA 1YKWA 3BPSA 5I8SA 1RMU2 3N34A 4MGQA 1L7LA 4LR4A 3SO7A 1VBB3 4OJYA 3PUSA 3G6LA 4AY7A 1MFVA 2C1IA 3O2LA 2W79A 4GJIA 2V2DA 4IXLA 2Y6ZA 2YLLA 2RS53 1E5IA 4K3UA 1P48A 2ZGOA 4EE2A 1LBMA 3MUXA 3VGEA 4QR6A 1W1IE 2FKPA 3ZSLA 3L0KA 5J5DA 4Q7BA 3ZKUA 5A3OA 1QWRA 1WLCA 2YDSA 3UWQA 3P5ZA 4IPJA 1OF6A 1V6XA 3PFRA 4NJJA 3GTNA 4KFPA 2OGYA 2WHMA 2D5FA 4JPGA 5JPNB 1VYRA 2EHHA 4PMQA 5BXRA 4WY0B 4QXIA 2FPTA 3W26A 4Z42C 3KBWA 3PUQA 3NJVA 2JKXA 2VGGA 4G3YC 4J4KA 5F5CA 3L5LA 3WBEA 4DOUA 4AMCA 1VAMA 4LNYA 4LC6A 4KBXA 4E4ZA 1WA3A 2HBVA 1GKRA 4RDYA 3DFYA 1ULPA 3UGVA 4LO7A 4ZCWA 3FKRA 4XFHA 1TZOA 1P8JA 1SFLA 2BVTA 2V2CA 3DAQA 3C2YA 3O07A 1LESA 5GLWA 3SBFA 1QJWA 1J83A 3C2VA 1C7TA 3IJ6A 5DN1A 1AQFA 2VM9A 2E0PA 3IAPA 3MPBA 1V0LA 1DTUA 3VIOA 5GJMA 4GA8A 2C6QA 3IWZA 4OBRA 2X42A 2IXLA 2A3WA 4J25A 1PGL1 4AFYA 4BCEA 3D8CA 5A32A 4ADTA 4CDQB 1TUFA 3DXIA 5D37A 4UFJA 1WUVA 3MP4A 4AZHA 5CPTA 2QUMA 1W5MA 3ZSJA 5C6CA 4RLIA 4UOQA 3AMHA 1JCTA 4QAWA 1RUG3 4PIXA 3OOXA 5FZOB 4A3UA 4L64A 1XYFA 1V0AA 3L5MA 4L8QA 4GFSA 1SG3A 4JYDA 4LK7A 2B7OA 2P5NA 3BW2A 5A8GA 4XC9A 3MB9A 1JCXA 5IVFA 5K9DA 3I68A 4FXRA 5BNNC 3PIJA 3LEGA 2VGDA 4IOTA 3LTPA 4PTNA 3C86A 4Y96A 3UJOA 4F2BA 4QPIC 1O8SA 4MGIE 3DH7A 4CN1A 2ZZ2A 4M29A 4E2VA 1JDAA 1RPKA 2IFRA 1TB3A 3CNYA 1OKOA 5D8ZA 1EYWA 1WLWA 3OEAA 1Q7MA 1TMF1 1JXJA 3TW9A 1AJ2A 3MFAA 3CWOX 5FYCA 1JUEA 3OVPA 2BUKA 4WZFA 2ZGMA 1WXZA 1SJDA 2PP1A 4E4FA 3P3PA 4QHZA 4BQXA 1JUIA 3C7FA 4CP2A 1QMLA 2PA6A 5A7OA 2DUXA 3N4MA 5DG1A 1W3XA 1HO1A 4QE5A 5C9RA 2E9LA 3GDMA 3P74A 1XLGA 1JPIA 4DRRA 2V3DA 5IVYA 1MNSA 1W6MA 1BF2A 5T5OA 1TMHA 5ERLA 6XIMA 2JEPA 1KBJA 1CQ9A 2VGIA 3RAOA 5E89A 1TWIA 1E40A 3RWKX 1F3TA 4OI4A 4UB9A 3I6TA 3TJLA 2VFEA 5JIUA 5I3FA 1CONA 3R25A 1YFXA 2H6CA 2VNGA 1SLLA 4WSHA 3CEPA 1YMYA 4O10A 3NOYA 3VKBA 4LCRA 1B4EA 2OR2A 3CIWA 3NV2A 4HYVA 4TR9A 2J79A 4TN7A 1WLDA 4PMNA 3AMLA 4ZU7A 3UR8A 2J1EA 2ZUNA 4O1DA 4JGYC 3EPOA 4AW7A 2HWF2 1GNXA 2PDBA 4D8LA 2PHDA 2VELA 4ERIA 5I0UA 3EGJA 3SRKA 2CLIA 2VUDA 3RMJA 3T7VA 1E3XA 2ILMA 4W4QA 2FMYA 5IAVA 3P3NA 2E8YA 3VGDA 3QGVA 4WJXA 3O0WA 4PTVA 1Q6EA 4XKMA 3VE9A 5L7OA 1OFNA 2DURA 3IUDA 4BMEA 4QNEA 3IS4A 4NX5A 2PLV1 5LNRA 1XH2A 2RUSA 2OXNA 1UJQA 3IIPA 2J47A 3WLOA 3OSDA 2VZOA 4HMCA 4YM0A 3WBXA 2VQTA 1XUZA 2ZRWA 3S9IA 4DNHA 1OFAA 2BOIA 1G7VA 2CLFA 2EAAA 1E6QM 5LWBA 5HULA 4Q7NA 5F6LB 4DZ5A 4XBQA 1IPJA 3RZKA 1UR1A 4K8HA 1IS3A 1TCDA 2DT1A 1GHSA 1ASJ1 2RJHA 4GZEA 2DP3A 2NUWA 3LNMA 4XIAA 1W2OA 4B7EA 1UR2A 4BZ4A 1EP2A 2QCMA 5BOEA 1F5ZA 4HA3A 3GHNA 1H7PA 1U5HA 3ALGA 4HU3A 5I06A 3RCNA 4MZUA 4BXFA 1J11A 4GY0A 1QNOA 2PTDA 1NG0A 3T2PA 1QRQA 2PURA 1JTZX 3I2DA 2HEJA 4GCXA 4WXZA 1W54A 3AYCA 3S5AA 3PLQA 3LRKA 3MBFA 4NRQA 2FZ8A 4HPKA 1Y7VA 5DAPA 1Y5VA 3GQYA 1GGOA 2ACUA 1E57A 3V5FA 3BAYA 1C8NA 1KV5A 3JD71 2J88A 2BNMA 4AGRA 5FPUA 4JTAA 1U2YA 6CGTA 1ZBVA 1W3JA 2DCTA 5DDJ3 2WJFA 3TVAA 2NX3A 3LDKA 1C5HA 2ARBA 3AXEA 1B9BA 2GK1A 1OJXA 4Q8VA 3OW1A 4O13A 3OJBA 5A94A 3SUVA 1QPNA 2UBPC 4PUKA 1NF0A 1UO9A 3OB8A 3ARUA 1EA9C 1FATA 1W1B1 2CBUA 2ADAA 3KV5A 5EZWA 4XXAA 1JOJA 2PDXA 3GS6A 4AZIA 2VFFA 4MO3M 1H0IA 3EOUA 1P43A 2CIPA 3M4FA 4MF4A 3ZO0B 3FHAA 5E9XA 4RN5A 4R9DA 3LFMA 1L0PA 3OY8A 1W9DM 1DGWA 1V6VA 2D6PA 2WO1A 1KM3A 1MSSA 3PB0A 4R9AA 5K2ZA 3EKGA 1G01A 1RYYA 3PK7A 2PUZA 4IP5A 1UBSA 2Z79A 3LDVA 3UT0A 1OIFA 2OUJA 1ND3A 2OT7A 1JL8A 4D6FA 3CQ0A 1RD6A 1ZM1A 3A9BA 2WNNA 3OLGA 1SLBA 2PWVA 2BVBA 3HFYA 2A3AA 1SFTA 1D4M3 3SRFA 2P76A 2ZA2A 4GI6A 1LG2A 4DJFC 3DFHA 5F7UA 1GVRA 2C1GA 2ZABA 3MDPA 4KRTA 1UKPA 2DGAA 3CZGA 1AH0A 3RU8X 3F03K 2EIEA 3MMDA 4DYKA 4DZGA 3OVGA 3HNYM 1N2VA 4IW3A 4HKWA 4R9BA 1R1A3 1SCSA 1F07A 5D8AA 4MWAD 4FALA 3GR4A 2HWD2 4NZCA 2VVFA 4HK8A 1W8FA 3UD6A 4UQBA 4YXGA 1TWSA 1LRNA 1SJCA 1EB3A 1TTQA 3RZJA 4AYGA 3MDWA 3T4WA 3K30A 4DO0A 3C0JA 1RIRA 2XG3A 1XSQA 4FPLA 1BSLA 1MI3A 5C8CA 3A7QA 4H7MA 3KHBA 1Q45A 3W02A 3LE0A 2BFUL 2ESCA 1R64A 2IXUA 3L0GA 1DIDA 1GT8A 4DB7A 4GLEA 3AJ7A 4A3RA 1PMJX 2D2GA 3STFA 1HG3A 1C8M3 5F3GA 2BLEA 3BQ6A 3B40A 4NJ4A 4WGXA 4IETA 4GHRA 4IL0A 4ZS2A 2RS32 3ZYIB 3LXBA 4TIMA 1F3WA 5IT6A 1YTEA 1SO3A 3CU7A 5C8CB 1AW1A 3JBG1 2AGKA 4HHLA 3OODA 1E4NA 1BEUA 1YFUA 1ESWA 4NVPA 3U4FA 3UBPC 2WR9A 4GYPC 3GE7A 4RCXA 3AYDA 1QWGA 2X1UA 4AXKA 4LNVA 4ZTYA 2YUEA 3M3OA 4X6QB 1EUUA 2RM21 2V73A 1HQWA 1KWKA 1TSIA 2C91A 2EPHA 5CZSA 1H2JA 5TBOA 1YQCA 1P0EA 4OKDA 2TAAA 1E5NA 2XTKA 1IOAA 1ZFJA 4JTKA 1FQ0A 1CZSA 1PHQA 2GJLA 3WH9A 2D69A 4OFGA 2YL9A 3E2RA 3N6QA 4MLJA 3VDHA 1EH9A 4HG6B 3PIGA 3BCFA 1W05A 5LIKX 4DBWA 5LNSA 3N6JA 4EVZA 4M3CA 3JZUA 5ACA2 1XYBA 2JDNA 4FO9A 1ALYA 3WNOA 4LT9A 4OI1A 5I3IA 4UOZA 3VKCA 1AL23 2DBNA 4X9YA 4AD0A 1TYGA 5GM0A 3GNPA 1GTHA 3VV1A 4F0LA 3WNMA 4KQ7A 3T09A 3CJIA 1I4NA 4XURA 3KCYA 1NDVA 2WVVA 1R3QA 4GJ1A 4QLLA 1ZBE2 4LBLA 2VC5A 1LL7A 3BAKA 3KRBA 1XP3A 4ZENA 3XINA 4DI8A 4PDWC 5DY3A 2V3GA 1W90A 5CSYA 4LCSA 2I5GA 1XIFA 3TU9A 4AQLA 2BXVA 3QHMA 3R8RA 3GDBA 4CUBA 1RA5A 2E3ZA 4E0CA 1O95A 3PBWA 5I93A 3NQVA 4B5VA 3JD73 3AC0A 3W7KA 1KCZA 3G2GA 3U7BA 3VC5A 4F2UA 3VX1A 2EEXA 3UJSA 3FWEA 3ZN6B 4IGHA 3AFBA 5DRCA 5LNUA 3LS9A 1US2A 1VYPX 4LK6A 1E4MM 2ZUVA 2D3PA 4GVHA 3B94A 3J8F1 1GU3A 3GY1A 2P5BA 1BPLB 3R05A 2F84A 4JGZA 4L11A 3OLDA 4W7UA 3ST7A 3PWAA 3CS2A 1NE6A 4W89A 1Q6RA 3G1YA 3QTGA 4UF0B 1S3TC 2PHLA 3VZJA 1WGPA 2P6CA 1DP0A 1F8IA 3THUA 2DT2A 5A3PA 1OCNA 4D6GA 1TA3A 1ENRA 1NKGA 4TXWA 1EV13 3LNPA 1OQDA 4Y1ZA 4MUZA 4Z0JA 1KM2A 4R9OA 2EJAA 2WQPA 2GQAA 3SM0A 1ZVFA 2XIJA 1W2UA 4X61A 2NYYA 4QHRA 1QU4A 4JCMA 1BQPA 3SIMA 3OD4A 4GYKA 4QPIA 1VS1A 1UZHA 3KQRA 1WZXA 2R061 1CGPA 2FB3A 4PE8A 1A5NC 4LBKA 1RZMA 2ET7A 2A7AA 1Q65A 6ENLA 2CZ5A 1NA1C 4E2BA 5I09A 3FFZA 4R9CA 4FNTA 4BQ4A 2WKJA 2RV9A 2QQUA 3D6EA 1FHLA 4LAZA 3U9IA 2YROA 5FZOA 5A2CA 3TYZA 4O4WA 1JNDA 1NP2A 1UYXA 3BPWA 1RUH2 2DSZA 5I3DA 3I2HA 4XBLA 3JB4C 3ZXAC 5JH2A 3MEPA 2D0GA 2OOGA 2VH9A 4L4OA 2BY2A 1JI2A 5KXDA 3UXLA 1I2NA 4JN8A 4ZBCA 1CPMA 4D7YA 5LCWL 1UZZA 4D6HA 4XO6A 3URFA 4P5YA 3KM5A 2HEWF 4GKXA 4ZHNA 2G3FA 3VBFB 2QKFA 5F37A 2HBXA 4IGOA 1C4RA 4CPBD 5FZEA 3P14A 4IEWA 2WWJA 1UZ1A 1YQ6A 5CNAA 4OUEA 4QNWA 5A3WA 4NYYA 4GGBA 3L4VA 1XNBA 3TN91 2RMU2 3TSDA 1AA1B 5CC3A 1XRFA 3GZEA 5K9CA 1YFYA 4MXWB 4XSMA 1EP3A 2W0UA 4LQ1A 3CUIA 4XUOA 4GNJA 5BNNA 1EP1A 1X6LA 2K46A 3B9AA 1VBD1 2ZC8A 3MJYA 4P2VA 3S5OA 3TJIA 4KNCA 5KC6A 3NPUA 4QLJA 5DAXA 5BPXA 4Y2WA 1W3LA 1GYNA 2NQHA 1MS8A 2QMKA 3CQOA 4WVMA 2FPVA 2WNUB 3FJSA 2WC7A 1YE4A 1KV8A 2JE8A 1ZBWA 3HN3A 4LO8A 2B5HA 2X0HA 4MXWA 1RUC3 3VAVA 2Q1FA 3BODA 1WKFA 1RMU1 3WK1A 1VBJA 4FK9A 2H8XA 4ERGA 2Z1WA 1GKPA 1OX6A 2XKPA 4E2GA 1KM6A 1XBZA 4B3ZA 2YFZA 1MXSA 3TOPA 4H2CA 5A33B 1POV1 1A8MA 2R32A 3MYOA 4XZHA 4AD2A 4P7RA 3LPFA 1Q6OA 4XFCA 1OGBA 3GXPA 1ZZ7A 4UXDA 3WEOA 2Z2SB 1IHIA 1ITCA 5LBEA 4BYYA 1MS1A 1W2AX 1X6UA 1PIV2 3IIAA 4NXSA 1HW5A 1OEPA 3NYZA 2ZADA 4DB5A 3S7IA 1ZZMA 2NT1A 4K6AA 3POIA 2WSUA 5H6HA 1O5QA 4W6YA 4NJHA 3D47A 1UMHA 4O1BA 4YZ1A 4P7NA 1Q8VA 1TV3A 1WOBA 1VP6A 1CZVA 1UXXX 2W3JA 2ZZ4A 3N3HA 1UUQA 4C7FA 2CYGA 2FLIA 3UF9A 3M0MA 3PANA 3MWCA 1S1AA 5CEHA 1V3HA 3WQCA 4NPMA 2WZ8A 1J5TA 2E67A 3E6EA 1TV8A 4KL1A 3UZZA 3T78A 3LPOA 5D2YA 1SMAA 3AXXA 3SGGA 4DJEC 1PV8A 4YMZA 1WA4A 2VX5A 1TPDA 1Y9MA 3V16A 2QS8A 3TYUA 1AR71 3A0NA 4AD5A 5IVJA 3PBYA 3AU6A 4E2QA 4ZPIA 1VIZA 4F9JA 1XL9A 4DN1A 1IS4A 3TMLA 3VBSC 1UZ0A 5M3WA 3VGIA 3LB9A 2PLJA 2CL2A 2R043 1RUF2 3RX2A 1JR1A 3WNPA 1CWYA 4XW3A 1MS5A 4WZCA 5B7ZA 1R081 1TZ9A 2ZEWA 1I8JA 1PMIA 2J62A 2OZJA 2YCLA 3PZNA 2RH9A 3CWHA 1H5VA 3EMCA 5FJPA 3FNDA 3D5HA 1TV7A 1RCXB 3II1A 4PSPA 5FXXA 1ZZCA 1APNA 1D2QA 2LUWA 4AEEA 1M9HA 1XC6A 5C3PA 4BDVB 3S6DA 2EVXA 4AHQA 2DTWA 1S3HA 1B35A 3EKLA 4Z0SA 1OD8A 1ZAIA 5EGRA 4X63A 4PCRA 4YW6A 2DVXA 4XQ6A 4FNRA 3U0HA 5C9UA 1I5ZA 2YXGA 1RVF2 4W87A 3ZYPA 3RZGA 1FWFC 2Y64A 2E5DA 1HRI3 3W24A 5BW6A 2AQOA 2DPEA 3CNAA 1AW2A 1V3MA 3ZSMA 4GBUA 5KITA 4MGSA 2CKSA 3KVJA 6REQA 2XUCA 1CJPA 3R58A 1B90A 2PFHA 4LUKA 3RXZA 1LU2A 4UUIA 4WM7A 2EXIA 2VGFA 2XHKA 1KFBA 2BU9A 4NHVA 2NWSA 3AZZA 4M3CF 1AW5A 5MKGA 5ACA1 4GMEA 4PMDA 1DJIA 4ORMA 4Y1XA 3D5OA 1WUFA 5TQLA 1UROA 3AXHA 1K45A 1TIWA 1REEA 5F2SA 2A73B 4F0MA 3F2CA 5CXPA 4IZGA 1ZALA 1TTIA 1AG1O 2CPUA 1G1YA 5FO7B 4O1EA 3TSBA 2G9ZA 1ZRCA 1GP4A 3AICA 4G7EA 1OXCA 4UFKA 1KRMA 3B8WA 5IATA 1I2RA 5FY1A 4I5UA 2NQ9A 1KS4A 3CIHA 2IMRA 3ANVA 4XZWA 1F3EA 1AXZA 5G2IA 4JTNA 4QQ2A 1DIEA 3RNSA 1OA2A 2O7QA 5GNZA 5CSUA 2XJPA 2DEPA 4D8ZA 4ZSUA 1QQP3 4AXNA 5FMOL 3BU0A 4V33A 4LOTA 5IM51 1JCNA 2O8QA 5FXVA 5ABJC 3DEQA 4GUGA 1FWAC 3BCJA 3K77A 1CI1A 3UGFA 5IXEA 3D0SA 4P02B 3AIUA 2AEYA 4Q0VA 3VKAA 4JYFA 5JDBA 4X6RB 2WKGA 4XD4A 2EAWA 3CLPA 2HXUA 1UOZA 1O3QA 3CEWA 3ITYA 1ZBCA 1QPKA 3WDXA 2XJQA 1TJ0A 3B9DA 1J0YA 4C1XA 3LDBA 3ONBA 3UGGA 2CLMA 1Q85A 4CUAA 4O1CA 1DLLA 2J24A 5CJNA 3EWWA 4HKPA 3GNEA 4W5UA 4NROA 1I9CB 2WANA 3MS8A 3RM8A 1RUE1 4Q8UA 3FZ3A 3BAIA 3GIPA 4JQ3A 2HVNA 1OQ1A 1JYTA 4Y1UA 1RXFA 1GQIA 1RUH3 5TD4A 4NQ1A 4GPNA 5FUIA 4GBDA 1EX5A 2LALA 4Y3OA 3Q8FA 3EX2A 1DFQA 1ZPTA 3ZR5A 2GDVA 4J7RA 2EAKA 4ZO8A 2GQ8A 5C2CA 2VCAA 4M3CE 3COTA 2B45X 3PZUA 2AENA 4AAPA 3KL0A 2W9MA 4UBGA 5JUVA 2QR6A 2WYSA 3PUDA 3GSMA 3U8GA 3MUIA 4LO6B 3N3TA 3NW4A 4Y7EA 1XNDA 4PDWB 1JYXA 5FLJA 2Y2WA 5G4WA 3R0DA 4ONVA 1YYAA 1AHSA 3ETPA 4DF0A 1G9BA 5FQ0A 1I9RA 1XBFA 2YLAA 2C0ZA 4AHZA 2YA2A 1Z48A 1JYWA 4EN9B 2V09A 2V0TA 3ACGA 1B9ZA 4ASLA 1Q4WA 4RE2A 3S1UA 4XDPA 3IJIA 2JDPA 2PLV2 4FAGA 1OZMA 4DXTA 3BW3A 3GXTA 1QJX3 3T0CA 3PTRB 1YWKA 4OULA 4WZHA 3WZ0E 1TME3 1PS9A 1QQP1 3VUSA 1J58A 4Y24A 4ARYA 3ZT5A 2E6VA 2ZGNA 4YVWC 2JIEA 3VIIA 1ZCOA 3S2JA 1YTDA 4O52A 4DZIA 4NE9A 2RR11 1RUH1 1POKA 4DXZA 1GJWA 1HRI2 2R24A 3PVNA 5F39A 4FI9A 4L92A 1KD0A 4IFOA 2WM1A 2AMGA 5C3OA 4IP7A 2IKHA 1J6OA 3OEXA 4AAXA 2HYXA 5A7QA 5DMMA 3OLEA 3CMGA 2GGGA 3GF6A 1K5MB 1BBT2 4B4HA 3SDOA 3TFCA 4CDUC 4DXVA 1A5AA 4JDBA 3WUGA 1A0DA 1OH4A 1IS5A 3UFYA 5EYWA 2DUQA 1ODZA 5G4HC 5CBIA 5CCZA 3DFNA 4JGZC 4CCKA 4OECA 3AIBA 3OBTA 3WLLA 3BSMA 3KGZA 4XF0A 5FSEC 1J0HA 5L36A 3QH6A 5EU9A 5JMUA 3THQA 4AFDA 5D32A 2CNAA 2ZGUA 4FAHA 4AZ5A 4L0PA 3HBZA 1DBTA 4HZ6A 4NIIA 4NNAA 3HMJG 2O0TA 5CPNA 5JXQA 3AXMA 4GUIA 3CDZB 2UZ9A 1C3FA 4FOYA 2WZPP 5FCCA 1W8NA 2XVKA 3C2OA 2IXIA 1LHUA 3FHQA 4IE0A 4LBRA 1XQNA 5KZDA 5K4XA 3LEPA 1FKWA 1EO5A 1UP2A 3WX7A 3OGSA 4IPLA 5IK4A 4ZOCA 5EJ1B 2W0XA 4H2AA 3QH7A 3H2EA 4AEOA 3KP1A 2CAUA 4CUCA 4FMVA 2FFIA 1H2KA 4ISQA 3W1LA 3PURA 3NJXA 1OUSA 4Y26A 5J1XA 1YBQB 4A45A 1K9EA 4KI5M 4DWSA 3VL9A 5A7PA 4MKNA 1OQEA 1JBCA 4F4RA 2JEMA 3O7OA 2RDSA 1P7TA 2ETEA 3CLMA 1UWAA 4JTUA 2YC0A 2QVHA 4EANA 4POCA 5LXEA 1TV2A 2AH2A 3ZVXA 3ZJ7A 2CDPA 1DGLA 5HBAA 3UJQA 4C6IA 1SFYA 2AQVA 3P61A 2RJGA 4CDUA 4XAAA 2AREA 2RR12 4GJYA 4HOOA 4AK3A 3NQGA 1RUI1 2YL6A 1V6MA 1POQA 2R16A 1I1EA 4S3BA 1TV5A 4NP7A 3BOWA 2Q71A 5C9AA 2X2GA 1DWJM 5FZDA 2Y6KA 2Q8CA 5DBTA 4QM9A 1NXD1 2XH6A 1KFUL 2BZNA 3LPPA 4RDWA 3TJ4A 4UTWA 3MUY1 3WG1A 4H9YA 3W84A 1PO12 2VCBA 1GYKA 1JRCA 3HPFA 3WD4A 4IQPA 4YW1A 3H55A 2PHXA 2FTYA 1COV1 2FPYA 5A7WA 1NFGA 4JS3A 2MANA 5ABGA 3M16A 3FFQA 3ARVA 1ZAJA 3ASIA 3ZFFA 1GOGA 4CXYA 3DFOA 4OT7A 5ABFA 1LQAA 5CADA 3FUQA 5FSDC 4EROA 1DQXA 1Y4WA 5K0UB 1D0HA 1KGYA 5FYIA 4YW5A 2VC6A 4IJRA 4IMEA 3UR7A 3KT1A 3CU2A 5FZ6A 4DAFA 2ON3A 3R8HA 2X0YA 4MJ4A 3AISA 3HF3A 2FHBA 2YB7A 2BS9A 3N18A 3E5PA 1VJIA 1RUD1 5A3LA 4H8HA 2J7FA 3GHUA 3L2IA 3MANA 4EX4A 3MZHA 2OYKA 5FZ0A 2PWHA 4YHGA 1GQLA 3BG3A 1H6XA 1OBNA 2PA7A 3JU2A 3MKVA 1RBAA 3LV6A 4CCOA 2JB8A 2WO3A 2QCHA 3WKZA 3M3EA 3A3WA 3BL3A 1IWPA 2FH6A 4N53B 3N17A 1ZENA 3ACHA 5DUWA 3KSCA 3S9YA 3IIIA 4QX1A 4HK9A 3R94A 1ULCA 2X7VA 4IQJA 3NKTA 3CPUA 3IEBA 4YVSC 9XIAA 3FK4A 1KCLA 1NT0A 1Y3TA 5FYTA 1YNPA 7REQB 1LU1A 1B3YA 1ZBE3 2CZEA 3NYDA 4LSBA 5HNUA 4Q0SA 1CGXA 1UWUA 1W1ZA 5JZGB 4UMCA 4I90A 1OFQA 2IS7A 4YU1A 3UQNA 1ZTVA 2H9AB 1VBD3 3MZ2A 4I02A 4UQCA 3I6EA 1KCXA 1Y9GA 4ATLA 1QAPA 1MACA 2OWWA 3NNMA 1RUD2 1ZP4A 3CUGA 5REQA 2F38A 1M7JA 3KX6A 1QASA 5LATA 4G7FA 4LJ3A 2WNVB 4IT1A 1KRBC 4QPYA 2YHJA 5CAHA 1GZJA 4NAOA 4QDRA 1VFHA 5A6QA 4ADUA 1WB0A 3M70A 1X1NA 3EX1A 1LTDA 3ATYA 5F3IA 4XCAA 3HGOA 1LOEA 3IDAA 4L9YA 1O91A 2C14A 2JKAA 3CYVA 3ATGA 3LOBA 1ITXA 1H3GA 4HJFA 3CL1A 2O9RA 5EBAA 1US3A 3HA1A 1W6OB 4GAZA 5FJKA 3IUIA 5AC93 2VMEA 4RDVA 1S1PA 3KBNA 1VP5A 3ZFGC 3T8QA 4FI4A 3L21A 5D2XA 3FGCA 3T42A 1KJRA 5AYXA 2A5ZA 1OYAA 5CFCB 4MB3A 3BK0A 2D5HA 4HK7A 2QCLA 1G94A 1XYCA 3U2CA 4JGYA 4GWMA 4P08A 2YFUA 3GU1A 3W7PA 3CPGA 3DKQA 2GH2A 1Z7AA 1EIBA 2B81A 1QBAA 2GSEA 3F1QA 2R6OA 4I8DA 3PUHA 3M0JA 3WLSA 3GHMA 4AZGA 2Y7FA 4IEOA 1PL9A 2R063 3DIPA 2IWGB 2EPMX 2NUYA 1JDEA 1WYIA 1CNVA 3NIYA 3RPDA 2AUYA 2BDRA 3BTZA 1VBA3 1R093 5HQEA 3SN1A 1LECA 4QROA 1N3QA 3KUMA 4EF8A 4LF1A 5JOZA 1JFHA 1ZZ9A 3O7UA 3NR0A 5CIRA 3RU6A 5HWMA 4JL2A 1CX4A 4Y33A 3CMFA 4MB5A 4CCJA 4LF2A 4F3JA 4QG8A 1JXNA 1EPXA 2Y7GA 2ZC1A 3XIMA 2Z4GA 1IGOA 3K4AA 2YR1A 3MI3A 2Z26A 4COVA 1IG3A 3KOYA 1IWBA 2J7MA 4QB1A 2QCGA 5FAJA 4J9JA 1VPHA 4DY3A 2HK1A 4O19A 1EHAA 3WHTA 3E5BA 2Q5TA 4NY2A 3B3DA 3W20A 1TKKA 4RQPC 1VR3A 5C4WB 1QHPA 3ZN5A 3CIVA 4AQ2A 4PFMA 4Z2LA 2CETA 3SJ3A 3ZVIA 4HONA 1E3ZA 1Z7S3 4KF1A 4YLWA 2WNQA 1BCXA 2ZBJA 3PAJA 3A23A 4I30A 3TEZA 2OA2A 5DLCA 3BZGA 1WD3A 3HMYA 4IQLA 1AYM2 5D9OA 4L6DA 2QQNA 1C8VA 2F61A 4PYSA 1F15A 1XLMA 2DV9A 1VBHA 2CZVA 3LLDA 3W1AA 3DV8A 3GVWA 1H2LA 5FP8A 1J18A 4AD3A 4RR3A 3BURA 5T8GA 4NJKA 4C91A 1GYMA 3OPTA 4LRSA 3SXWA 4IIGA 2ZX1A 4D7TA 4MGTA 1QNRA 1EY2A 5FJIA 3P5YA 5GJ6A 4BEUA 3ZXFA 1TRDA 1W9SA 2YBTA 3ZIXA 2XLGA 1KFJA 3OEBA 4HKOA 4NZ4A 1R5YA 4JHTA 2FJUB 2OJPA 3T1MA 1XYMA 3K75B 4E5TA 1FWHC 4XD3A 3W01A 3MT1A 1COV2 1A0CA 4URIA 5BOOA 1PUDA 1VEOA 5CBLA 2CGOA 3W9AA 2ZX0A 3OTRA 3VD3A 4P9JA 4S23A 1VRDA 5GJPA 4HOXA 3CBNA 1TRIA 2MUCA 3M41A 3RYSA 5ABHA 4HZMA 1VE0A 5CSSA 1NFBA 3KRSA 3QN3A 4B3LA 3LCGA 2HWE3 3S1XA 2GJXA 5DEZA 1WDDA 3APYA 3IN9A 1LGNA 2FGLA 2XHYA 3E9AA 3EEGA 3G0SA 3MFCA 1EEPA 2DT3A 4GWIA 2VD7A 1G67A 5E0CA 3C7GA 5JU6A 3DG3A 2VRQA 3NNLA 1LOBA 4DJED 1YI9A 3APTA 1B3ZA 5FZKA 4JDOA 1JU4A 4YG3A 1FH9A 1VFOA 2I9UA 1SLCA 4HNOA 1KDKA 3K5XA 1FDYA 1AK5A 1DZTA 3EQEA 5L9BA 1VBC3 2JDUA 4Q4V3 1JZ8A 1VIWB 4A44A 1NCRC 3MU7A 4E4DX 4EN6B 2ZUUA 3QOKA 4H3DA 2ZE0A 3OO2A 4LYRA 4IV3B 4H7LA 1XPYA 2Z7KA 4XD5A 5JZGC 3WQ5A 2OQ6A 3PJXA 4JDYA 5CAZA 5RUBA 1GNHA 1DQ2A 2H3BA 3ITLA 1LENA 1UJPA 3QBQA 1ST8A 4H01A 2D98A 1GW1A 5JMCA 2WOQA 1XYLA 4NOTA 4BQYA 3PZ9A 1ENQA 1D9EA 3BVCA 4K21A 2D6OX 3ZYZA 3KCXA 1J01A 1KR1A 3IV3A 5DRIA 5T26A 3LSCA 4GQQA 3ZOIA 2GNBA 2WPBA 5FZ1A 4FTSA 3MIHA 2BVWA 1H1ZA 1GNZA 1OPOA 1HL2A 4AMAA 1PHWA 4COYA 1TELA 3BLDA 5T5LA 4A6GA 3MPPG 4WF7A 1CXIA 1R30A 2OEKA 1QOPA 3IJ8A 4CNPA 1WMDA 4IIFA 2AEZA 4XBJA 1T40A 3K3OA 3FEMA 1R082 4Q1PA 4YVWA 4LS1A 4GUJA 1VCGA 2ZXBA 3VOFA 1BBT3