4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
5M03A 3VIHA 1PZ3A 2EQDA 2VQUA 3VTRA 3W81A 2JEPA 2ZXQA 2GJXB 3N9KA 1E3ZA 1WZMA 3AIUA 1H4PA 3M46A 2DSWA 5BCAA 4HZ6A 4B3KA 2J8GA 2GJXA 1C8QA 1W3HA 3TTYA 1AMYA 3N13A 1QVBA 4W86A 1MXDA 4J3XA 4UQ9A 1ECEA 2VCCA 3WMBA 4CKQA 5A8OA 1B1YA 4PUDA 4U5IA 4EE9A 1C93A 1HP4A 4GIAA 3VGEA 5FOOA 5E0FA 5DMYA 5LA1A 3E1F1 5GNXA 2A3BA 2ZXDA 5IFTA 2G3MA 2UWFA 2YIHA 3I3EA 3UG4A 1ITXA 4D6FA 4Z2IA 5BXTA 1KGXA 1IT0A 1HXJA 1EOKA 2DQXA 1GW1A 1EGZA 2VNCA 2JF7A 4GO9A 1UD3A 2V38A 1J12A 4XZBA 1JG9A 3SUVA 1UD4A 2J79A 3RMEA 4U2YA 1UR8A 1VFOA 3A47A 5I23A 3CUIA 3W37A 3ZJ7A 3CZ8A 4RE2A 1FHDA 4TTUA 3II1A 1CIUA 1CXHA 1LQ0A 2WHLA 3OGRA 3VIGA 1NWRA 3AIWA 4QLKA 1AQHA 4JCLA 5BXSA 1UKSA 2V3FA 4D6EA 4GI9A 7A3HA 4W7VA 1VEOA 3G6LA 1E6ZA 5M5DA 3CZKA 2QMJA 4D72A 4UQBA 3BCDA 1QI3A 4Z2JA 2VCBA 3GBDA 3AZRA 3BH4A 1E73M 1HKMA 2YDSA 4JFUA 4H04A 3WBEA 2MANA 2GDUA 4F79A 1W32A 1X6NA 3POHA 4ML4A 1B2YA 1E6QM 1BYCA 1V0MA 2EPKX 3F5JA 2X0HA 4E8DA 1E6XM 3BAXA 2EJ1A 5BRQA 2XGBA 3GXIA 5I3DA 1CXEA 5CG0A 2BFGA 3HJEA 1O6IA 3DYOA 4LKFA 2CITA 3PZMA 3GTNA 2DT3A 4EAMA 1OB0A 5AC5A 4PMOA 1JZ3A 4UQDA 1ESWA 3MMUA 3S2CA 3W38A 1UH2A 3OLEA 1WB0A 3SCOA 3AIEA 4AD4A 2PWDA 4J27A 1GWMA 1B30A 2YL5A 4WSJA 4GINA 1JF6A 3GNRA 4ACZB 4W93A 2V3GA 1BFNA 1QW9A 2WAGA 4N0RA 5E6ZA 1K9DA 1BQCA 1MYRA 5M17A 1MW0A 4JIEA 1H2JA 4JHZA 3WF1A 1ZU8A 3VGFA 2WB5A 3D5HA 4BA0A 1GCYA 2YLAA 1MQPA 4AZIA 3CZEA 3W25A 5A6AA 2VCAA 4BQ5A 1Z32X 1GZJA 1WAWA 3GDBA 4UOJA 5C71A 3ARSA 1BG9A 1SMDA 1WZXA 3UCQA 4AMCA 1EHAA 2G3JA 1RPKA 1QI5A 1E5JA 5JBDA 1W8ZA 2OYKA 2JALA 3WH8A 4JKMA 3A6OA 1O7AA 2WBGA 3KL0A 3ZR6A 1KGWA 1NM9A 2VC9A 4QAWA 5I79A 3WUGA 1J0IA 1XV8A 1G94A 1Q6GA 4PN2A 3MUZ1 3M07A 1VFMA 1KXTA 4H8VA 3B9EA 2CHOA 3WMSA 3NCOA 2WLZA 2YL6A 4FLQA 1ISXA 2CCRA 4Z2LA 2WC7A 1JAEA 4GI6A 4AZGA 2YDQA 4W5ZA 5A3HA 2DT1A 1R7AA 5ABGA 3WH6A 5I77A 1PZ2A 4UZSA 1UH3A 2VR5A 1UR2A 3HMCA 5F7UA 2WPGA 5A2BA 1X1NA 3MMWA 5E6YA 1V6UA 1DEDA 2XVKA 2D23A 3CHCA 4CD4A 3A4AA 5LYRA 3AROA 4A4AA 5A6MA 1J0ZA 3DHPA 2WCSA 1CZ1A 2BXYA 3WN6A 1HJWA 1NQ6A 1LJYA 2WSPA 3BAWA 4P7NA 3EMZA 3ZYHA 4FF5A 5BROA 3WF3A 3WQ5A 3VKKA 3QR3A 4IUGA 5FIPA 1G9HA 3AYSA 3T0AA 4LKDA 1M03A 4JAWA 2WC4A 3WMCA 4PUEA 2XVNA 2VZVA 1SMAA 2E9BA 1J18A 3WFZA 4H7VA 1OD8A 1Q6DA 3PZUA 2KR2A 4HMEA 4R27A 4KRTA 3BSGA 1QNQA 3EBVA 2VX6A 3BAKA 3VIJA 2YA2A 4MB1A 5TD4A 2E9LA 3TP4A 5D21A 2J7EA 5FL1A 2WK2A 1VFFA 3T09A 1ISYA 1LWHA 1GVYA 1VENA 1JAKA 3CHDA 3I3DA 1H41A 2AMGA 3MUAA 5M3WA 3CO4A 3AHTA 2K46A 3VIOA 4TVUA 3GNOA 4D6DA 1FP9A 3O6AA 4PMDA 4V27A 2CNCA 3VMNA 1B0IA 2YOCA 1VBUA 5CLWA 3AMCA 3AMKA 2QPUA 4CCCA 4OIFA 3THCA 1UWIA 5LA2A 2G4FA 2D1ZA 1PX3A 2HISA 2OLHA 3F5LA 3U5UA 1HIZA 4CD6A 4NRSA 2J7DA 3CHEA 3GXDA 3QOKA 4AIUA 2AOSA 4TTGA 2PB1A 3DYPA 4QDMA 4CP9B 1BVNP 1KCLA 3F4VA 3RILA 3BAIA 3L4ZA 4UQCA 3WL0A 2WKLA 4CP9A 1C91A 2X8RA 2CKRA 1LL6A 3LMYA 3ALFA 5JBEA 1WCGA 3WQVA 5FCZA 1QI2A 3ZT6A 2XSBA 2ZICA 3VIFA 4RL3A 3RM4A 3PZTA 2YA0A 2WC3A 3MANA 1J11A 1UR1A 4NI3A 5BXRA 1JIBA 3M7SA 1CLXA 3AHYA 3S6TA 2DDXA 4YHGA 2EPOA 3QHOA 2BS9A 4GQRA 4J3TA 3MO4A 5AY7A 8CGTA 2ZX8A 3WNLA 2WXDM 2ZX9A 4HP5A 1VFUA 5EMYA 3AXXA 3W27A 4LPCA 2WMHA 4M1RA 2GFTA 2VL4A 1F4HA 4V2XA 4GI8A 5I24A 4HA1A 2WMIA 3SIMA 3ZJKA 3ZO9A 1PBGA 1UD8A 4PTXA 1H1NA 1E40A 3ZT7A 1HP5A 4P7QA 3PHAA 3U57A 3TA9A 2ZUMA 1H11A 1C90A 4XX6A 1V6XA 5JIWA 4B16A 2OYMA 3CMJA 1CXKA 1C92A 1Q6EA 2B31A 2VX7A 3L4WA 1JXJA 2D24A 4KWUA 3WBAA 4U5KA 3ZQ9A 4URIA 4CPBD 1JYWA 2JIEA 3L4UA 2BY3A 3OLGA 2DSUA 2DIJA 3MU7A 3WNMA 4MNMA 3UETA 1U2YA 1W3JA 3WNPA 2CBVA 2YDRA 4XB3A 1W3LA 3RIKA 2V3DA 3U7BA 1FA2A 1GQLA 3SEPA 1E0VA 5HBFA 4JFTA 1OGGA 3WQ6A 3EDEA 3LPOA 4AD2A 4D1IA 1E4IA 1TMQA 5CJ5A 1NP2A 5I78A 3NJ3A 1TA3B 2E9MA 4AZHA 1UR0A 5EFDA 2WVUA 4QLLA 1EDTA 2J7HA 4PRWA 4W85A 5I0DA 1EDQA 2F2HA 2OWXA 1Y7VA 2WLYA 4GO8A 4HOXA 2ZXBA 4HTYA 4UR9A 1CGUA 3VM7A 4AL9A 2YBTA 4QCEA 1BYDA 2ZUSA 2Y5EA 1GOQA 4ZFMA 3IJ8A 3HN3A 1W9BM 2IXUA 1HJUA 1TG7A 3UT0A 1GOWA 4GKLA 5GNYA 4NRRA 1Q4NX 4MPKA 4K68A 3UERA 5CSUA 4QFUA 3SCTA 5E9AA 4JFSA 3N1AA 5JIPA 4PSRA 3WQ8A 2EXOA 1HKIA 3QOMA 2VVNA 3F5KA 4F8XA 2BY2A 3QHNA 1MVYA 2NW0A 2BXZA 1E55A 1W1YA 2DH3A 2ZUWA 1MXGA 2X09A 4AYSA 3WH5A 4PMXA 1V0AA 3WD3A 3SCVA 1XH0A 2WYFA 6A3HA 5CGMA 3WD0A 4HU8A 3WENA 2WZIA 4ZE5A 3NYDA 1D7FA 3BC9A 1PIGA 2JIWA 3ARXA 1FH9A 1R85A 2UY2A 4M8UA 1B3ZA 1QBAA 1VAHA 1IZJA 1G01A 1WDQA 2CIPA 3ALGA 3VM5A 3MSDA 1QOXA 3OGVA 2C24A 5A2AA 1AQMA 4OBSA 1D2KA 1C8XA 4MNKA 4PSPA 4CVWA 1PX4A 5I2UA 2QV4A 1HJSA 1OGBA 2WMGA 4IPNB 3T2PA 1MQRA 3EDKA 1K9FA 4AXNA 1HKKA 5DFAA 1W9FA 3EDDA 3WNNA 1XYFA 4ATDA 1ZBWA 2IUZA 2YLLA 2FH6A 3L2MA 1KXQA 2X2YA 1UOJA 2EO7A 4J3VA 5DF0A 3AQUA 4UFMA 3GYCA 3ZSTA 4W8BA 2YJQA 1HNYA 4DUVA 1UUQA 3OB8A 3NSNA 3CMGA 1FOBA 1DHKA 9CGTA 1V3MA 4M24A 4NZCA 3ZM8A 3VILA 4N42A 3RJXA 3QGVA 2ZUNA 1H09A 1W9VA 2VQTA 3AISA 1MQQA 3CZGA 3ARZA 3WDRA 3BCFA 4PTVA 5ECUA 4EANA 1BSIA 4J3SA 2OWCA 4CCEA 2WNWA 3CUJA 4BZYA 4RE3A 5CPSA 5AYIA 2XIBA 1CGXA 3RDKA 2Q1FA 1E71M 1BG4A 2G3IA 2XIIA 3WD2A 1UKPA 2PF0A 3VDCA 1HT6A 4MAZA 3T2OA 3FHAA 4HA4A 3UR7A 1B90A 2DT0A 1US2A 2G8ZA 2XVPA 5A6BD 4KRUA 5BYWA 1SFSA 1TE1A 3AMGA 3KE0A 4W84A 2Y8KA 2J7CA 2O9RA 3VPLA 4E4PA 3CH9A 1HJXA 1LL7A 3WD4A 4CCDA 1NH6A 4PMVA 1JZ4A 1GNXA 1W8UA 2W61A 2WMFA 3WIJA 3FAXA 4DM1A 5CPQA 4UTFA 1UYQA 2YL9A 2XFFA 3THDA 1V02A 1V08A 4MJ4A 4ZXLA 3WUEA 3W29A 2E4TA 5D9PA 4YWAA 4QLJA 1JL8A 4IISA 2WYSA 1QHZA 4CU7A 2PBOA 5FKYA 2V5DA 2D3NA 3WH9A 3ARPA 1U33A 1EA9C 1LLOA 1E72M 1L0PA 1TR1A 5IHSA 2BVDA 2O92A 1MW3A 2XJ7A 4PMNA 1WDSA 1JDCA 1UZ1A 3VGBA 1HN0A 1E5NA 1NOWA 1B9ZA 1WZAA 4W5UA 4M56A 5ABHA 4ACZA 2VZOA 1JDDA 3GXFA 4WKHA 1W1VA 4BF7A 1V0KA 2PI6A 4P8XA 3NDYA 4JFWA 2UY4A 3VDHA 4AW7A 4MJ2A 1E9LA 4MB5A 2XHYA 1V02E 1ZJBA 3FNDA 2DSZA 2W67A 1P6WA 2HVMA 3OIHA 1AQ0A 4YPJA 1E15A 2PWFA 2V3EA 2VJXA 1NWTA 5AC4A 1MFUA 3ARQA 4CUCA 3VD9A 4DUXA 4DUWA 4GXPA 4HZ8A 3CZJA 1R86A 1A3HA 4H2CA 2ZE0A 3AOFA 3JUGA 3W6LA 1CTNA 3ZMRA 3WNKA 1UR9A 3VGHA 3UR8A 1QNRA 2VOTA 2WSKA 4TXEA 4UFLA 1WP6A 2YA1A 1CPUA 2A3EA 3BLKA 2CBJA 3K8MA 3DC0A 1I1WA 3IAPA 2BY0A 2D0HA 1W8WA 3OA5A 2PWEA 1NWSA 4S3KA 4R5EA 2BVYA 2BHUA 1HX0A 2CHNA 1UOKA 1TFVA 4YN5A 3WY1A 5I5RA 2VUYA 3SUSA 2LRPA 1D3CA 4LYPA 4AZ7A 4LX4A 3ZJ6A 1LF1A 1WZKA 4FLRA 2D22A 4U3CA 4F9DA 1M01A 1GPFA 1UA3A 1UWRA 1GHSA 1W9XA 2NSXA 1C7TA 8A3HA 4MB4A 3CLWA 5D9NA 3KZSA 2O9OA 4D6HA 2XSAA 3VIIA 1M53A 1MW1A 4CD8A 4CU8A 1UWSA 1E0WA 4B15A 5A6KA 1GUVA 1TUXA 4HPGA 1WO2A 1QPKA 1JD9A 1UQYA 3UEQA 1U30A 5AYBA 3WUBA 2Z1KA 3W53A 3F95A 2QPSA 4XUYA 1G5AA 5KZ6A 1H3GA 3EDJA 1GQJA 2A3CA 5HOSA 4MB3A 4J28A 3SCNA 1CENA 6TAAA 2CETA 1BTCA 2GDVA 3WF4A 4DM2A 1EO5A 1PAMA 1G0CA 4UOZA 2Y8VA 4OJYA 3VIMA 3NDZA 1JZ5A 1PPIA 1NWUA 5ABFB 3ZSSA 1XCWA 5CQ1A 1NOFA 1W8TA 5I6SA 1EIBA 1OD0A 3VGDA 7TAAA 2CERA 3VD5A 5A69A 3OGSA 2ZXAA 2GJRA 3BLPX 5ABFA 2ZUVA 5GNZA 4JL2A 2DEPA 3KEHA 1GOMA 4CPBA 2CEQA 2VI0A 4U2ZA 3SCPA 1ODZA 4PMUA 4AWEA 2QMKA 2ZWZA 1Q6CA 3CTTA 1BGAA 1ISVA 1V3JA 1XC6A 5BWFA 5D8ZA 5CXPA 3GH4A 3B9DA 4PCSA 1J10A 4TVCA 5EB8A 3WQ4A 1HF6A 1UD6A 1XH1A 1XSJA 4BQ2A 3UESA 3WDJA 4CD5A 3WF0A 2X05A 1VF8A 3L4YA 2ZX5A 4OOZA 3NSMA 4AISA 1KGUA 4AD0A 1W1TA 1VB9A 1DWFM 1ZBVA 4PMYA 3TTQA 1M04A 3IANA 2YL8A 5CGTA 4CU6A 4AIEA 3L2LA 4LYRA 2WWDA 1EXPA 3RO8A 1XRVA 1KCKA 2PC8A 4UOQA 4LK7A 3APGA 1BHGA 3AMDA 1XSKA 3EMCA 1KB3A 4ZEPA 4Q22A 1RH9A 1ZL1A 4PTMA 4J3UA 4OKDA 1UA7A 3TTSA 5C8BB 1CLVA 1E70M 1HJQA 1CGWA 1HJVA 3WELA 3WSUA 1JI1A 1BYAA 2J62A 2J7GA 4UNIA 1UH4A 3L4XA 1GQIA 2NT1A 2J8FA 2J78A 2WHJA 4Y7EA 3A4WA 4CN1A 2ZIDA 5BXPA 2DSVA 3PZGA 3L4TA 3BSHA 4Z2GA 2WCAA 2V5CA 1K6AA 2OSWA 4TX8A 3PZNA 3ARWA 3GNPA 4MAVA 2VZTA 1JZ8A 1ITCA 2VZUA 3FAWA 4NSBA 2RGLA 3AIRA 5IXEA 4DWSC 1OT2A 5CPTA 4CN6A 3IK2A 1GOKA 2J7FA 4PEEA 1E6NA 3AJ7A 1JNEA 3OZPA 4WKAA 4FK9A 1WNOA 2WMJA 2OSXA 1ZJAA 1CGYA 2WANA 2DT2A 4NF7A 4PMQA 3N11A 3ZJ8A 5A8PA 4BQ4A 3FW6A 1RP9A 2WBKA 4D71A 1E4LA 1OWQA 3AHXA 1J0KA 2LROA 3J7HA 4C7DA 1BF2A 3PZ9A 1V6YA 2GK1B 4JZ5A 2WZEA 3MUY1 4D1JA 1BLIA 2VZSA 4HA3A 3BGAA 3W82A 3AI0A 4B3LA 1V03A 3VD3A 2OWWA 1LG1A 2GK1A 1OBAA 4AD1A 1OKOA 3ZR5A 1E43A 1DP0A 5A8MA 1NP0A 4C7GA 1E56A 1EQPA 1V0LA 2XVLA 3AICA 1ISWA 1TA3A 5CSYA 1KBBA 1N82A 1JD7A 3RM8A 4TX6A 3VVGA 2WVVB 1IZKA 3IJ9A 2Q8XA 5HNNA 2J77A 4KMQA 3VNZA 2O9TA 2E8YA 1GJUA 2J74A 4XV0A 4FLOA 3LPPA 1VJSA 4IM4A 2WVVA 2XFRA 4KGJA 4D6IA 3LPGA 4QCFA 5C70A 5D8WA 1A47A 1UWQA 2WW5A 1CGVA 3SCQA 2W5FA 1C3FA 3HU7A 3WKZA 2E40A 3UG3A 1JZ7A 4H8UA 3ZOAA 2DGAA 4W8LA 1TVNA 3CGTA 3TTOA 2DH2A 4W7WA 1E6PA 3VINA 4X0NA 1HKJA 1WDRA 1H0GA 5A6BA 1UKQA 1TCMA 1XD0A 3CPUA 4L4PA 1EOMA 3WDIA 5E09A 1V6WA 2C7FA 3FY1A 1DWIM 2XYLA 2ZUUA 3GM8A 1QBBA 4WKFA 1R8LA 4P7LA 1PJ9A 2FHCA 4A6SA 1W3KA 4WLCA 4MTVA 1HL9A 3T0DA 2VR4A 3SCSA 1KWGA 2C8NA 1KXHA 3MS8A 4OUEA 4MNJA 3T2QA 1YQ2A 5CLTA 2O9PA 1CXLA 4UQEA 1S46A 3WQWA 3G6MA 4WK9A 2PWGA 2ZX6A 4AIOA 2YKKA 4JKLA 1ZB5A 4V28A 1W2PA 1KXVA 3WDQA 4JKKA 3PZIA 2E3ZA 1UZ4A 2EEXA 3ARRA 3K8KA 4YHEA 4JL1A 2XM1A 1PX8A 1UQZA 5IFPA 1RP8A 1JZ2A 4H41A 3W4RA 2EPLX 3MSGA 2D0FA 2WCGA 2A3AA 1VIWA 1ODUA 1FFQA 2W66A 1UG6A 4ATLA 1B31A 3SUUA 1Q6FA 4F9JA 4ACYA 1UD2A 2WMKA 3WFLA 1JFXA 1HVXA 2AAAA 1B3XA 1E6RA 1XYZA 5A1AA 4UQAA 1KWKA 2WHMA 2DPEA 3PTQA 4PMRA 1FH8A 2JF6A 1QNPA 2WZHA 3A3HA 4MDOA 2VRQA 1UHVA 2D3LA 4KH2A 3N17A 5ABEA 4MNLA 3AHVA 3VX1A 2E0PA 1GOIA 3WDHA 4DWSD 4H8HA 3VMOA 1OIFA 2W62A 4WIWA 3I3BA 2WKGA 5A6JA 3ARVA 4UFIA 1E1EA 1L7LA 2BNJA 2ESCA 4MADA 1GWKA 1K9TA 2WVSA 3AXHA 4PTWA 4E8CA 1BPLB 3OLIA 4WSKA 2CYGA 2XWDA 4AEEA 3FHQA 1CGTA 3WDPP 3GZAA 1B3YA 3AYRA 1JDAA 4AZCB 1JGIA 1QI4A 3OZOA 1CXIA 4E2OA 2G3NA 4PCTA 5A6LA 3GBEA 1UWTA 3SUTA 3B8SA 3NSXA 4JCMA 5GPRA 3PBGA 3AZTA 3VNYA 5IHRA 2XVGA 3D3AA 3TOPA 5A94A 2G41A 3PTKA 2O14A 3MUIA 4AZCA 5JBFA 3ARTA 3K1DA 1JZ6A 2RGMA 3PZQA 4GZEA 1IV8A 3EMQA 3VD4A 2VVSA 2PBGA 4UFJA 5CZKA 1J9YA 4U33A 1C7SA 2EBNA 1V3IA 4M80A 7CGTA 3IJ7A 4XZWA 2XG9A 2J47A 4AD5A 2X0YA 3WL1A 4U3AA 3FXYA 4Q7NA 1H5VA 2J7BA 1XH2A 3CUGA 2CBIA 1GVIA 4MDPA 2JEQA 2F61A 2QLYA 5DO8A 2VXJA 1R87A 1CBGA 3VIKA 4YW7A 4B9YA 2VMFA 4GZIA 2XM2A 1I75A 5KEZA 1JYNA 1FHLA 1WCUA 5E70A 4OZOA 1UKOA 3GXMA 3TONA 1WZLA 2D2OA 3SURA 1CXFA 4ATWA 4J7RA 1FP8A 1WE5A 2BY1A 2D20A 2J4GA 3N18A 5FL0A 2VRKA 4M82A 3DYMA 1CDGA 4OBRA 1EHNA 3K4DA 2VX4A 4P7OA 2PWHA 1SR0A 4M81A 1B3VA 1EO7A 4LYQA 3SCUA 1E3XA 2ZWYA 4ZE4A 2YBUA 2ZUTA 3WEZA 3VIPA 5LA0A 3VDBA 2FGZA 1W90A 1W91A 1E0XA 1NOUA 1QHOA 1ISZA 3VX0A 3T08A 4TOQA 4JHOA 1QW8A 2FDMA 3AFBA 4P8UA 1OM0A 5E0CA 1WMXA 1JI2A 3DHUA 2BVTA 4PMZA 1JF5A 3RPMA 3SCRA 4JFVA 1XD1A 2EPMX 5EBAA 3MKKA 3O9NA 5HPOA 4LGXA 5DT7A 4BS0A 2FHFA 1L8NA 4U31A 3ECQA 2W92A 3PN8A 4HZ7A 3CZLA 4QP0A 3VGGA 4FMVA 4UFHA 5EFFA 1JYXA 2FHBA 1GOOA 4L4OA 1GQKA 1R7OA 2XPKA 1XGZA 4UFKA 3W6MA 1CWYA 3RM9A 1JFHA 1GJWA 1AVAA 1LG2A 3U5YA 1OSEA 4EK7A 3WEMA 4P7RA 2DIEA 4TVDA 1EDGA 3POCA 3VDAA 5HDRA 1RD6A 3N15A 1KBKA 2VRJA 1KQZA 4W8AA 2QHAA 4A3YA 2VO5A 1V3HA 1CYGA 4W88A 4HMCA 2QF8A 2BV9A 3B9AA 1DTUA 1TVPA 4GPNA 3MV11 4AEFA 3EDFA 5A8NA 3AS0A 4UZUA 1VJZA 3W26A 2NT0A 1NARA 2C0HA 3NIYA 1JYVA 1K9EA 3BMWA 5A6SA 3PZOA 2W91A 4HMDA 4P8WA 2F8QA 3ARYA 4A3HA 1W2VA 1H0IA 1W9DM 1XHGA 1WDPA 3MV01 3W0KA 3PZVA 2WVTA 2WHKA 2W63A 3AIVA 1E1FA 2J75A 3ZYFA 1DWGM 2OYLA 1W9UA 1FFRA 3WUFA 1GHRA 1ZS2A 4D6JA 2GVYA 3ZYBA 2WM0A 1M7XA 3KL3A 1EH9A 1MW2A 1QHPA 1V3KA 3K4AA 5DT5A 4RE4A 5A8QA 2E8ZA 2UY5A 1UD5A 5JUVA 3WEOA 1LL4A 2JFEX 1OCQA 3AS3A 2IXVA 2D0GA 1HL8A 2GUYA 4W89A 4HOZA 4X0VA 3ARUA 2VTFA 1J0HA 1US3A 1J0JA 1CECA 4B9ZA 1VEMA 2OSYA 1VBRA 3EYPA 2FGLA 2VT0A 4LXFA 4C7FA 3A4XA 3KWXA 1KR0A 3AXIA 2X1IA 3LPFA 3NUKA 3VO0A 4CGTA 1CNVA 1PEZA 1JXKA 1QI0A 1BVZA 3CUHA 4AZ5A 3N04A 3IAQA 1I1XA 1J01A 3K8LA 4WF7A 3PTMA 3BXWA 3AIBA 3AS1A 4CD7A 2DSKA 4W87A 2J25A 1VRXA 2WMIB 1F4AA 3CBWA 2XUCA 4WJXA 3VMPA 2W4XA 1W1PA 1HVQA 4ZXOA 3VU2A 3OLDA 4IPLA 2EPNA 3SCWA 1MFVA 1PIFA 2BHZA 4EKJA 1BAGA 4Z2KA 1C8YA 4AD3A 5FD0A 1BYBA 4GQQA 3W24A 1OINA 4TUFA 4AZBA 4YW6A 4AC1X 1B3WA 1VEPA 2JE8A 1ZBCA 4LQ1A 5HXMA 1DWAM 3AZSA 4AY1A 3BAJA 1KR1A 3AMLA 3ORJA 2CXGA 4HPHA 3N12A 1ZBKA 4KGLA 1OIMA 1WKYA 4W7UA 3CHFA 1E4MM 4S3JA 1UR4A 1E6SM 1UWUA 3BMVA 3L4VA 5D9MA 3RJYA 3WD1A 2Y2WA 3BAYA 3WNOA 1QNOA 1KQYA 3RCNA 4PBGA 2Y4SA 1KFWA 4D6CA 2FH8A 1QNSA 1SYTA 2CPUA 3M6DA 3QHMA 5IDIA 2ZOXA 1J0YA 4PYSA 3WF2A 1MWOA 3CUFA 3AHZA 1YHTA 1V0NA 1H49A 3VOCA 4ZENA 3ZT5A 5D9OA 3KL5A 5D4YA 4J3WA 3O2LA 4BQ3A 4FLSA 1DWHM 5BRPA 3VD7A 1OT1A 1BGGA 1GORA 3WH7A 4P8VA 1LWJA 5GQBA 3GH5A 6CGTA 5A95A 2XFYA 4OOUA 2BHYA 4X9YA 3FN9A 3W28A 5DEZA 3ZIZA 4CVUA 2JWPA 1FH7A 4LJHA 4D6GA 4M29A 2GJPA 5A2CA 4F66A 2WWCA 4LKEA 1UKTA 2ZX7A 1XCXA 2CESA 2VX5A 3MMDA 2TAAA 1OGSA 2UY3A 5HPCA 4DWSB 4HU0A 2CBUA 2Z1SA 1WPCA 2GSJA 1TZ7A 3AS2A 4GZJA 1DWJM 2XWEA 3SUWA 4CN4A 1GONA 3OBAA 3AIQA 4Z2HA 4AZ6A 2VURA 4HOWA 1JNDA 1W9PA 1HN1A 4DWSA 2XTKA 3DECA 2A3HA 1V3LA 1OH3A 1XSIA 3OG2A 4BCEA 4LK6A 3VUPA 2CKSA 4UCFA 3U7VA 1X6LA 1G1YA 3GH7A 1V6VA 1E4NA 1CEOA 1EQCA 2XGIA 1GWLA 3CIVA 3UG5A 2Y24A 3T0BA 3K46A
chains in the Genus database with same CATH superfamily
2GJNA 3R4IA 3VIHA 2VQUA 2EQDA 4NXSA 3KWSA 3GAYA 3N2OA 1GKPA 2RR11 1Y4WA 3A7QA 5C9AC 3DFQA 3H55A 4LVAA 1JI6A 2ZX2A 1WZMA 2PLMA 3AIUA 4AIBA 4HSOA 2DVTA 2DSWA 4BK5A 1IHMA 3WVJA 3NXFA 4B3KA 5HWJA 3NZPA 3VBUC 1E57A 1WLWA 2X2GA 3OUJA 2KX9A 2NV9A 1W3HA 3WLPA 1UNBA 4G4FA 3N13A 5FAGA 3H2AA 2ZPXA 4UQ9A 2IS7A 2XBO2 1VYRA 1WBJA 1SPPB 4GJIA 3WBXA 4EE9A 2QQPA 1XX1A 4ZOCA 5FPAA 4GC3A 1R3WA 4PLMA 2XXZA 1L6SA 4JIHA 1HP4A 1EZWA 1OPOA 1RL3A 5E0FA 1P8JA 1S0BA 2V5BA 4H1ZA 3VLBB 1T6MA 5H8UA 3KCXA 4LOSA 1SPPA 2BASA 5IFTA 2YCIX 1MRAA 4A45A 3C7GA 2VU9A 3U10A 2YIHA 2YC0A 1QKQA 3GVVA 4Y22B 3I3EA 1ITXA 1NY1A 4MWAB 3I2KA 1CZVA 1AR73 5REQB 4IMCA 2DQXA 1C5HA 4AMAA 2VNCA 4YM2A 2JF7A 4GO9A 1J12A 2PA6A 1JG9A 4WGXA 1ZX5A 3SUVA 1YO8A 3KV9A 4DB5A 2BGQA 1GANA 2ZRYA 2HWB2 4MWAA 3IJIA 4FR6A 3SH3A 2EGZA 1WW4A 4QGCA 1ZVFA 1VFOA 3A47A 1XS2A 3BTZA 1MZFA 4W4QA 2PLV2 3O0FA 1YRZA 1FHDA 3TOYA 1O8SA 2JDHA 4N7UA 1CIUA 1WAUA 1WKEA 1XPGA 3LSBA 4C6CA 1CXHA 3NZ1A 1D7KA 1YQ8A 3PP7A 1NWRA 1AQHA 2OELA 2XIQA 3CIXA 3GBFA 3UJSA 5HINA 3ST7A 4GI9A 4CQBA 4BI6A 2LW8A 2HBTA 1LTEA 3G6LA 4DNHA 3CZKA 5CG7A 4D72A 3P62A 1IXNA 3EPNA 3ZVIA 1AW5A 4ZU7A 5CG9A 4AGRA 3KP0A 3M5ZA 2VW2A 1ENUA 2OZ6A 2QIIA 1CJDA 5G1YA 4JFUA 2VGIA 4LVGA 3HQNA 2HWE3 3POHA 3R13A 1KC7A 4YU1A 3MLLA 3GY1A 3UGHA 3ZYRA 5A6YA 5JOWA 2WZR2 1GG1A 4M01A 2EJ1A 2LALA 2ZX0A 4EQVA 1UZWA 1WW5A 1TX2A 3HF3A 1N1TA 5I3DA 2R073 5E0KA 1CXEA 5BNQA 3BUCA 1QXLA 4FNTA 1NU5A 3TQKA 3LUTA 3LNPA 4JGZC 3W9ZA 2CITA 4A2RA 3PZMA 2RJKA 2DT3A 4EAMA 4OVEA 1OB0A 1V93A 5CKMA 3RSJA 4CEWB 4CEXC 5AC5A 3VUOA 3RWNA 3S6PA 1POJA 1ESWA 2SFPA 4GQGA 5EU9A 3BWWA 2CLMA 4O54A 4MM1A 1G7UA 5T52A 1C57A 3APBA 4CEWA 4R33A 1OQEA 1Y65A 1UPPA 3P0XA 4UMCA 3SCOA 3TQPA 3AIEA 2VEFA 4AD4A 3L7RA 4J27A 7REQB 5H8PA 5T5LA 4E4HA 2YL5A 3DL3A 4LE4A 4ASKA 4AF0B 1S5VA 5RUBA 2RR12 2H3DA 4DXXA 4AFCA 1QPRA 1QW9A 3PVOA 3NEHA 1K9DA 1BQCA 3HT2A 1MYRA 3ZIXA 3FA4A 5CYYA 4JIEA 4EXQA 4Z08A 1ZU8A 1UY1A 1JCJA 5FESA 3DPRC 1KM5A 4TZDA 1UJPA 3VGFA 1YFWA 4NAOA 5EV7A 1XYCA 2DU2A 4BA0A 3PPCA 1GCYA 3AYTA 2YLAA 2A5ZA 4FPYA 5A6AA 1MS9A 4GX8A 3ELNA 1U1HA 2JIJA 3BGJA 2V5KA 3N34A 3PBUA 2VUCA 3WQFA 3KQ4B 5F3EA 3I10A 4TIMA 3UY8A 1OA2A 3VL8A 3V0BB 1SMDA 2FVMA 3U6WA 4QAIA 3LTYA 1R0MA 3B03A 1EHAA 1XYAA 3DCQA 4CXXA 1KGYA 1QI5A 4JQRA 4F3HA 1YCIA 2JALA 3N9QA 1XGDA 4XUGA 4ZMGA 1RINA 4E2BA 1KGWA 3V0BA 1ONWA 2VC9A 1L3JA 5I79A 1VRH1 4K36A 1G94A 2OCZA 4XURA 4OV4A 4GY7A 1GVSA 1VFMA 1KXTA 1YDOA 1KRIA 4A21A 2CHOA 4YNIA 2F4PA 4Z1YA 2WLZA 2TNFA 2GOUA 3ZIWA 1YMYA 2CCRA 2GWGA 2WC7A 2Q8OA 1GV9A 4HYVA 2YDQA 1ZCCA 2DT1A 2YCLB 5EMUA 5F5AA 5ABGA 2G37A 4UZSA 1DGRA 1W2AX 3HAGA 1TWIA 2VR5A 4FO4A 4MV2A 3F2BA 3ABQA 3WHTA 3O6DA 2OVLA 1W6PA 3AJYA 2WPGA 4GWMA 4O1CA 3MMWA 3UL2A 4HK9A 5EPAA 1DEDA 2XVKA 3THTA 5CBLA 1NELA 3T4CA 3CJXA 3CHCA 3A4AA 5K2ZA 1UC4A 4H83A 1J0ZA 4LITA 1CZ1A 5FXWA 3WD5A 1UB3A 4QR6A 4WDTA 1LJYA 4P9YA 4WOQA 3W1LA 5GLTA 6PTDA 2WPBA 1Z7S3 3UYIA 5M2FX 4FF5A 5BROA 1RUJ1 3W73A 2ARCA 1ENQA 1A5OC 4IUGA 2D6KA 4AB4A 3ZFEB 3P82A 1Y43B 4PQ9A 4ZQMA 4DXKA 5TQLA 1W8OA 3AJXA 2XIMA 1PIV2 1GNYA 3V0TA 4E2VA 1QJU3 4NIDA 1HRV1 5LSMA 2UBPC 4JD4A 2B81A 2E9BA 4IGMA 1J18A 4H7VA 4NASA 4QQ2A 4Q1PA 5FZLA 1P7TB 5AHEA 4R27A 4KG8A 4KRTA 4RNHA 5JSPA 2ADEA 2J1TA 4HCHA 2VW0A 4OI2A 5TD4A 1P7TA 3C7HA 3TP4A 1K7XA 1FCVA 4ZPIA 4O4WA 2WK2A 2JDMA 2J66A 3T09A 3JUUA 5FQ0B 1LWHA 4GX9A 4FA3A 1F15A 3KLLA 1VENA 1JAKA 1DJXA 3CHDA 3GVQA 3QR1A 4ZO6A 4US5A 5M3WA 3B5LB 4H4IA 3AHTA 5FQ0A 1M7PA 3A3XA 2K46A 3T0TA 1TV4A 2V2DA 4MPQA 2VC6A 3GNOA 4D6DA 3O6AA 1A3KA 2LM3A 4GXLA 1HDKA 2FD8A 2CNCA 2IVIB 3VMNA 1B0IA 4MJZA 4O17A 3EA3A 3AMCA 2NQLA 3A5VA 2QPUA 4B29A 5J5RA 2ILMA 1UWIA 3RR4A 1AG1O 3RZZA 2ZZ1A 4WJEA 5I8SA 1HIZA 4NRSA 2J7DA 2AOSA 3EX2A 3B3QE 5JAXA 5BXXA 3FEQA 3P3BA 4NZFA 5IYYA 4BWLA 1BVNP 4AVCA 1TMF1 4LS0A 4O9GA 3VYLA 4Z17A 1S0EA 2AC1A 4IQJA 2R91A 3T0CA 3WLIA 3BAIA 2D6NA 3WJZA 4Z42C 1OKQA 4FPKA 3H3ZA 3S5ZA 1C91A 2X8RA 4CDWB 3PG8A 3MUCA 3GHNA 1LL6A 3S1UA 1OT5A 5DBTA 1WCGA 4WD0A 5FUIA 1TMLA 1RGSA 5FCZA 1PMHX 2J7MA 3PZTA 3GSMA 4A3UA 2ADDA 1OOPB 4JAAA 1DFQA 5BOOA 4RGKA 1UR1A 1M65A 2ZA1A 5BXRA 4DZHA 4S2CA 1JBCA 1T6GC 1KFUL 2VECA 3M7SA 3W7KA 3NPXA 1QOQA 4FX6M 1XICA 1UBSA 1RBLA 1OOPA 1LDCA 4ICMA 4J3TA 1SW3A 1S0JA 3TROA 4ASLA 4CEUC 3VBSB 3MO7A 1JUIA 2ZX9A 3PBWA 3ABZA 3FJ4A 3HGOA 5CC5A 1RUG3 4M1RA 1VBGA 3LXBA 1Q7MA 1FATA 3VBSA 2R062 4RL7A 2VDHA 1EJRC 1VZWA 2ZZ5A 5LXXA 3LIHA 5HULA 1XIDA 1OFNA 1EYBA 1VBD2 1JPKA 2OQLA 4JNMA 3ZT7A 1HP5A 1YYNA 4K8EA 1RUJ2 1XIGA 1TV2A 4NYYA 4IGOA 1LOQA 1EPXA 3BLFA 1W6NB 2ZGSA 3UXAA 3LEKA 4RZ6A 3OPZA 3CMJA 4B16A 3U3HA 4REQA 2RDQA 2RS52 1JXJA 1HB3A 1K7FA 2D24A 1HRV2 3GF6A 4FHAA 4WGHA 4MZUA 1EEXA 1JYWA 1YNQA 4C0HA 4K6AA 1GZ9A 7PTDA 2QUMA 1LQAA 5HCHA 1B09A 4YSFA 2P3EA 5I0SA 3OLGA 3WUDA 2DSUA 2DIJA 4NJIA 4A3QA 2YFUA 4GHRA 5HUOA 5LNVA 4E4ZA 3MZNA 1U2YA 3GW0A 4UT5A 1W3JA 4HNVA 4HN1A 2PDIA 3ZSMA 1IGSA 5D8AC 2A73B 2YDRA 5K4LA 4XB3A 1XLCA 4FI4A 1J79A 1GQLA 5FZFA 2MUCA 4DNMA 4DEFA 5FSEC 5A7SA 2ZGQA 4JFTA 3TQ0A 1HXS2 3IDCB 1PO23 1DJGA 2VNOA 2HWD1 3W72A 1X36A 4IIFA 5FK8A 3WDWA 4IFRA 4J1OA 3IB3A 4HVXA 1OCNA 3HV8A 4D9PA 2CZ5A 2FDKA 4OE7A 5C33A 4PRWA 3UP8A 2VE1A 4QKBA 1WDWA 4GO8A 1EIXA 3P7YA 4MGTA 2NQ5A 1AW2A 4UR9A 1MACA 1OY0A 3U4SA 1GK8A 2YBTA 4G1KA 2ZUSA 1GOQA 5FFOC 2OQ6A 4R9XA 1EGMA 2IXUA 3FFSA 1TG7A 2EG7A 2HZGA 4OVXA 1ZPTA 3UT0A 4PCRA 1U1UA 5K9XA 4LY4A 4NPRA 3BDKA 4K68A 2WNUC 1K03A 4AI1A 1HRI1 4IX2A 4KCWA 1PL9A 5FY1A 1XQKA 5FSDC 1ALDA 2HCVA 4LB3A 4LUIA 4RV3A 3GDLA 1Q6OA 2OOGA 4JFSA 3EWUA 1AR63 3M3QA 3NZRA 4NY2A 1Q8QA 4Z1AA 4KU7A 5LK5A 2Z4GA 1ZJHA 3WP5A 1UY4A 5F5IA 3OU8A 3I7SA 3LY0A 4OZXA 4AI8A 2BY2A 3H2OA 1XE8A 4O1AA 5K8SA 1BRLB 2WQPA 1VLNA 1T99A 4QM1A 3SGZA 5FZOA 3QPYA 4IJBA 3W7LA 1PZ8A 2GN7A 3WD3A 5LBCA 5CGMA 4KQ7A 3ZXGA 4HU8A 4C6FA 4J4KA 3KBJA 2IXJA 3AP4A 2WZIA 5FWEA 3SFWA 3WENA 4CLMA 3DI0A 4Y2WA 4Q27A 1QBAA 2DZUA 1HX6A 2PCQA 3S3GA 3LE0A 1VS1A 3W5NA 3VM5A 3F2CA 3MSDA 3N6JA 3EA1A 4YCPA 1EFZA 1WLTA 3PPHA 1D2KA 4N4PA 5G1TA 4MNKA 1AR93 4WVVA 3DXIA 4Z07A 1PO9A 5I2UA 2QV4A 4HKOA 3VBFB 3ITLA 3H3LA 4BOWA 4H3WA 3T2PA 1DZTA 1MQRA 3EDKA 2HWF3 4OMDA 3WK3A 4AXNA 1HKKA 2R30A 4NZ3A 3WP4A 1IG3A 1BKZA 4YVPA 1W8GA 2ZJCA 2IUZA 3VBFA 1KXQA 2XH6A 1XBYA 2B39A 5C9RA 1DHKB 1UOJA 2EO7A 3FDGA 3LI0A 4J3VA 2CLOA 1VPYA 2H90A 3EQEA 3AQUA 3GYCA 3IPWA 4V2WA 1H61A 3QGAC 4GIQA 5CFCB 1L6GA 2IKHA 4N53C 1R091 1W6TA 3FLTA 3T05A 3T42A 1HNYA 3IGXA 1UUQA 3N73A 4H01A 1FOBA 1K42A 1DHKA 4HL0A 3ZM8A 3DFHA 1AX0A 3NV4A 4YYFA 3DH7A 3WQGA 1GP5A 3WW2A 4LHNA 1NKGA 2RS11 4D6SA 5HR6A 1MQQA 3ARZA 1KFBA 3BCFA 3ZR4A 1URXA 3AX4A 4LBKA 3VZXA 1DG6A 3W6YA 4IPJA 2OWCA 4CCEA 2HWD2 4OV9A 3GIQA 1R46A 5DMMA 1NA1C 1S0GA 4PJYA 4RE3A 5GJPA 5CPSA 3DAQA 4MY8A 3FV9A 3RDKA 1LESA 3W58A 2Q1FA 5T5JA 1TE1B 1EP1A 2EG6A 3B0UX 4OHYA 4HIBA 1LOSA 3KLSA 1H2LA 1EF2A 5C9AB 5BYWA 4FZIA 4YCOA 4XTPA 1TE1A 3F7JA 3C3UA 5FPBA 4W84A 2J7CA 1LOBA 2ZHLA 3VBUB 4E4PA 1ZFJA 4H7CA 4F0RA 5LIXX 4PMVA 1ENSA 1GNXA 2W61A 3QV7A 1YQ6A 4IEQA 3QC0A 2OS2A 1JRCA 4NJ4A 5G04L 4UTFA 4BIFA 1YE4A 3CYJA 4LBNA 1WBHA 3THDA 1DJYA 1V08A 1ASJ1 5F2LA 3TFCA 3WUEA 2XLAA 4Q8MA 1I6XA 2D44A 3W29A 5D9PA 4QLJA 4CDXB 2WYSA 3J9SA 3GO2A 4GYPC 3T4HB 5FLHA 2PBOA 1QY4A 5FKYA 2CZDA 4ERAA 3ARPA 3U2OA 1EA9C 3SY1A 3LSCA 1XLDA 3B9IA 1LLOA 4CDXA 5FJPA 2IXIA 4JTQA 4M19A 3IDEA 2YROA 4LBQD 5IHSA 5J7MA 4HJWA 3TEVA 2PHUA 5J5DA 1FWGC 5FJUA 1WDSA 1LOFA 4JTUA 1JDCA 1AYM2 5FF2A 2PDLA 2OODA 5FO7B 3F4CA 3KGLA 1NOWA 2VGFA 4W5UA 1QUMA 4M56A 2P37A 4ACZA 1VP6A 1YE6A 4IEYA 4TLFA 1L6WA 5FZGA 4Y4YA 2IKGA 1FDYA 3NDYA 4FSJA 4JFWA 1W1ZA 3WNXA 2UY4A 1YNAA 3LTSA 3VDHA 1PGW1 4LUKA 2WNVB 4O18A 1KDMA 1W9YA 2DJLA 3LIGA 2XHYA 1RY8A 3FNDA 2DSZA 4JTRA 4RD7A 5CC6A 2P5BA 3OIHA 1AQ0A 4P5UA 1E15A 4AOCA 3OD4A 2GMEA 2V30A 1ZBE2 1OYCA 2WNVA 4LBUA 3UXIA 3WLKX 4ZU5A 1S1AA 3ISIX 3WLMA 1NWTA 4G56A 5AC4A 4QPIC 1MFUA 3WSOA 1UU4A 4GVHA 2AQVA 1V00A 4GE8A 1A5AA 3N9SA 2OEMA 4LORA 3MP5A 2W95A 3GXNA 4X8NA 4ZQNA 3VFCA 1R092 5FJJA 2Q1MA 4DUWA 2EG8A 4GXPA 1R86A 5LXEA 5FDBA 5KHJA 3QC3A 2QCHA 4LVFA 3JUGA 3LEPA 5LCWL 2HE8A 4JTTA 4JGZB 1Q6QA 1UR9A 4S3DA 1OFEA 3UR8A 3WCZA 2PAKA 3V75A 4MO3M 2BFUL 1XQNA 1WP6A 1OG6A 2YA1A 2A3EA 2ZRXA 3N2MA 3Q8FA 1RUF2 3V36A 3H7YA 4GBDA 2PTXA 4DXZA 2F17A 2FPTA 3H2EA 4TV6A 3WY6A 1NWSA 2FVLA 4LAKA 5FY9A 3SFKA 1TPEA 3QPEA 2BVYA 4M1BA 1EPWA 4MOAA 1R6WA 2XGZA 3GXTA 3E6EA 2JD4A 3W2MA 3CS2A 2VUYA 3WG4A 2MNGA 3M7AA 1WZKA 2D22A 4LV9A 3O1PA 3G1HA 1ZLPA 2AMXA 3C2YA 4LNYA 4Q2FA 1Q45A 4MZYA 3FL7A 4NRMA 4JDBA 4D6HA 1YQ5A 4GRSA 5L9RA 2Y5SA 3FDKA 4O13A 4B5VA 3KCYA 3KOFA 3DPRB 1UWSA 1A78A 3SADA 3RJ2X 3MUXA 2Y89A 3URFA 4PB4A 3KT7A 4CUBA 4M3CB 3WBYA 2VWTA 3UEQA 1RJQA 2CZEA 1AA1B 1N7KA 5IVYA 1U30A 1JUBA 3DPRA 3VKFC 3NWRA 5G2WA 5AYBA 3WK1A 2Z1KA 4JTOA 4RXFA 4Q4RA 4K1YA 5JH1A 4V33A 4OTKA 3F95A 2HPMA 4M3CA 5JR2A 1BBT1 3O0VA 5F4SA 1S5WA 5IK7A 1IZ3A 4MB3A 1UYXA 4DOUA 4FB7A 1CENA 6TAAA 4IL0A 2WN3A 1W5QA 1QPQA 3ELFA 3GU1A 3V4BA 3ROUA 3WF4A 4Y1XA 1JZ5A 4OJYA 3NDZA 5ABFB 3M3OA 2Z69A 2BB0A 1XCWA 4XZIA 3U0HA 2DZPA 3OVGA 1F73A 3U4XA 5I6SA 1LGCA 2YU1A 3HEIA 3RLGA 1EIBA 4ECLA 3GUGA 3SY5A 2GJRA 1ULEA 5FJIA 4K8RB 3W85A 5ABFA 3W88A 5GNZA 2X7WA 2XINA 4XDPA 4CPBA 3UW6A 4C5ZA 1FOD3 1FPN3 1UIJA 3WR0A 5AC7A 2DZVA 3OPWA 3WUCA 1GOGA 1V9U1 1W39A 2ZWZA 4CNPA 1Q6CA 2X16A 7ODCA 2PYTA 3DKJA 2FCTA 3W7CA 1U5ZA 4QDRA 4QJ1A 2YUEA 3POBA 5KXEA 1MUMA 1XC6A 3FJLA 3NVCA 1IZCA 5BWFA 5FZ3A 2QKFA 3GH4A 1K4HA 3N9NA 3ES1A 5I93A 1QDOA 4TVCA 4GUIA 4HHPA 5AOUA 4BQ2A 3UESA 3BTXA 4CCZA 4Q8WA 3QEZA 3AKSA 3VCNA 4MH0E 4IOTA 3I59B 1LECA 3OIXA 5F2GA 3TTQA 3IANA 1PZ0A 3T8QA 2Z2UA 4CU6A 1DQ4A 2YXSA 1SCSA 1OFPA 3L2LA 3I59A 4KWWA 3USUB 1EXPA 4R7JA 2ODOA 5FPXA 1UMIA 3PTYA 2GP3A 2Y6KA 1KCKA 4UR8A 2PC8A 3O6YX 2OKOA 3EMCA 1OQ1A 2VULA 2G96A 3OO2A 4AHQA 4XF0A 4Q22A 4BXFA 4HONA 1TWDA 1ZL1A 4OKDA 3W7NA 1X8EA 2W47A 5KHHA 1VRBA 1JI1A 1BYAA 1B57A 3XISA 2GC1A 1UH4A 1GQIA 3LEIA 4CXYA 1H7OA 2VTXA 1KXGA 1A5LC 1U5YA 3FFQA 3PZGA 3FA3A 1MVEA 5F2IA 4Z2GA 3RZKA 4JRAA 3KRZA 1YEWA 3QZEA 3SQOA 1OYBA 2FDIA 1W0NA 4AAJA 3DX5A 1G86A 3AIRA 5IXEA 5CZSA 3VAVA 5CPTA 2ZAAA 2YBPA 4LO8A 5GALA 3KHJA 4CU9A 3AJ7A 4AUBA 3P5ZA 3QZ6A 3UJQA 2Q71A 3W7JA 3C0QA 2SLIA 2QVHA 1JXNA 4RPPA 4IE0A 2R6OA 3QD6A 3N11A 4GVFA 4ZZ8A 4GZ9A 3C7OA 2OO6A 2X1RA 1TVGA 4ARYA 3WYZA 5JI9A 3KVAA 1E5SA 4DHGA 1BF2A 3FLPA 3PZ9A 1HQWA 2WZEA 1IS5A 5C5YA 4HBKA 2VZSA 3BGAA 3W82A 2ZC1A 3CB8A 3AI0A 3VDDC 1V03A 4IMEA 4B3LA 4NVPA 2FDGA 3O3RA 3SM0A 1AR72 3P6LA 4QX3A 4C6LA 4DBDA 5JR7B 2OWWA 1PK6C 1YEYA 1JTZX 3VCCA 4AQLA 1OKOA 3SECA 3ZR5A 3KT4A 1VB4A 4Q1RA 3VOGA 4KNCA 4JGYC 2FZNA 3QQWA 5I0RA 3UU0A 2O1QA 1V0LA 1TNRA 3LG3A 5EY5A 2QDDA 1H7NA 2ZKLA 4FALA 1KBBA 4GUFA 3S0CA 5H1WA 2I5GA 2PWUA 4TX6A 3VVGA 4LHSA 4FCAA 4Q5OA 2QQNA 2Q8XA 1V9U2 1XQLA 1JRBA 2TBVA 2E8YA 1GJUA 1XCFA 1LT8A 2J74A 4KFNA 4XV0A 1ND2C 4H9XA 1TUFA 1VJSA 2XFRA 3HPFA 1OFRA 2C13A 4LB4A 5C70A 4H3DA 4XUOA 2E25A 2RHGA 4BQXA 2FZMA 1H8VA 3RYRA 4ZVJA 3K2OA 4IE7A 3N9RA 2E40A 2PAMA 1V6IA 1OQDA 2HWE2 3S5QA 2B7NA 3W21A 2Y7FA 2PGFA 4BQYA 3CGTA 1UQXA 2YXGA 3FE5A 3L2YA 4CNTA 4XEZA 4DY5A 4X0NA 2PDYA 1QJU1 2R072 5FXZA 3KCOA 5A6BA 1UKQA 4GJJA 4AHZA 4DBUA 1XD0A 4L4PA 3PAJA 1GT8A 2Q6ZA 2IXCA 3Q94A 3WDIA 2Z29A 1V6WA 5FPUA 1TVLA 1IKPA 5L9BA 5FYBA 4UI9L 5C2CA 3EHKA 4WKFA 1YXCA 4WVMB 2H0BA 2Y88A 4P7LA 2WIIB 3JR2A 3J7MA 1W3KA 3HQOA 2B9VA 3E0FA 4E2DA 3FEMA 3T0DA 3VBRA 4RUBA 4XIOA 1KXHA 3LU2A 2KA3A 2XL7A 4OUEA 3NAPA 2Y6JA 3TYJA 3B06A 4H8NA 4WVMA 3TR2A 1G7VA 2O9PA 1A0CA 1S46A 1OFQA 5D02A 3U4AA 2QIWA 1R2TA 5FZ9A 4ASTA 2VOKA 4AIOA 1S1PA 1JMUB 4KG0A 4YM3A 2G9ZA 4XBKA 3LMZA 1KXVA 1F8MA 1AZ1A 3PZIA 3POSA 5LIUX 3UGFA 4YHEA 3G22A 4P02B 3UBPC 3OJBA 4IXXA 5IFPA 4H41A 1GP4A 2A6LA 2VYOA 1EUAA 4HKWA 3J8F3 4F2TA 3S5YA 3IIZA 3OBEA 4HCLA 3ID7A 3UYCA 3ZS4A 4FOWA 2VR2A 2W66A 1UG6A 3S42A 1RPXA 4ATLA 2EF6A 2WNUB 1Q6FA 3OUHA 2C5DA 2GGIA 2QS8A 2V4VA 2V72A 4QPWA 2W79A 3LCIA 4LS1A 2EIEA 3S9ZA 3M0YA 2WMKA 3GB6A 1AMKA 3TVAA 3WFLA 4AEOA 5LIWX 1J84A 3ZX7A 4IT1A 4UQAA 2D97A 3C3VA 4NAEB 1NZCA 2VDIA 2DPEA 3BU0A 1ZRFA 3NZQA 2J1UA 3FGCB 4L8QA 3LNMA 1XNBA 1B5TA 1QNPA 4KEVA 1EXBA 5CKQA 3ALQA 4ZONA 3O1NA 1MSSA 2Z25A 1W6QB 1KFKA 4O8AA 4LOTA 1W1A1 4A7YA 3VX1A 3BLIA 2BOIA 1Z69A 3WDHA 1FWSA 5DY3A 2WM1A 4I09A 4H8HA 5FBZA 1OIFA 2W62A 5F4WA 1PIIA 3SQLA 4C8DA 1L7LA 3MW4A 2BNJA 1GWKA 2OEKA 4WY0F 1BPLB 1B4KA 1V6TA 4HETA 4Q0QA 3ABXA 2GC0A 4CRQA 3AYRA 3I2HA 2BWCA 2OO0A 2QR6A 4AZCB 1JGIA 3FVMA 3OZOA 4LXLA 1W3TA 1C3HA 2NVDA 2G3NA 4PCTA 3WK2A 3LV6A 4CP0A 3A24A 3G8RA 3AZTA 2XVGA 1TSIA 3O7UA 1EKOA 3TOPA 4Q0PA 1Z7S2 4AZCA 3G2GA 5J37A 1OLME 1SO4A 3LF7A 1H63A 2QJJA 4LYKA 2AYHA 1IV8A 4HQVA 1WOAA 1YFYA 4JNYA 5A3OA 4XZMX 3K5XA 3SDOA 4DIAA 3HPNA 4LULA 1ALYA 1QH6A 5L7OB 1QJU2 1XB9A 2ASHA 2VKZG 2PBGA 2WNEA 4J40A 2VQ0A 4N53B 2SBAA 1J9YA 3MP3A 5A3TA 2VFGA 1V3IA 1DORA 4M80A 7CGTA 2X1UA 5FKCA 4AD5A 5L7OA 1RHI1 3WL1A 2PURA 4IESA 3FXYA 4N53A 5FYCA 3TN3A 5LIYX 4Y9AA 5D04C 2CBIA 4M6PA 3EXUA 1K5MB 2YB7A 4MDPA 1LOGA 4I0BA 3KLKA 2D93A 3OYZA 3NV3A 2PHWA 5A3WA 5DO8A 3W02A 1PO21 4YW7A 1NA1B 4MWAD 3O1MA 1K5MA 4GZIA 4PFMA 3MYOA 2DQWA 1WCUA 1TWSA 5DDJ3 3PFMA 3UWYA 4OZOA 4O61A 1UKOA 3M9YA 4NWVA 1S2CA 2ATMA 1O7FA 2D2OA 1NF0A 4O15A 2BX7A 3PWAA 1CWPA 3O0XA 1NA1A 4YYOA 1R3TA 4J7RA 1FP8A 5E16A 2FQPA 3RLVA 2H6BA 5FL0A 1RJ8A 1CESA 3BCJA 1MZRA 2E7AA 4JYDA 3AC0A 2VXRA 4M82A 1AL7A 3DYMA 1CDGA 1U5IA 3ITOA 2WO5A 1EHNA 2WSYA 4RKAA 3URAA 1QCWA 2WS91 1VPHA 2E9QA 3FLRA 2ALDA 2PWHA 3Q8EA 1J5SA 4OHVA 4GK8A 2YSWA 4LUSB 4MKNA 4YVXA 4FPGA 3VIPA 3AU2A 5LA0A 2DIKA 1SZRA 3MKCA 2EAAA 1Q5OA 2ON3A 3E0IA 4K2SA 2FGZA 2E32A 5JMUA 1W90A 2PTYA 4LUSA 1BK1A 5EPDA 4PCFA 1O66A 1QHOA 2BWGA 1BXHA 4CZSA 3CAQA 2KZHA 5BW6A 3NJXA 4RFRB 4UW4A 3TYUA 3VX0A 3T08A 1SU5A 5C3SA 1TQJA 2FDMA 3AFBA 4E27A 1OD3A 1G9DA 5E0CA 3ILRA 3PTRB 1P1MA 1ZJIA 1EJUC 3DHUA 2C1HA 2UV8G 3TXZA 3FBMA 3HGSA 2OLSA 4IXHA 3U78A 3Q37A 2XWBB 3UXDA 2EPMX 4EZHA 4HU4A 3ACHA 3KDNA 1RHCA 3O9NA 3RYKA 3W20A 1Z0HA 5HPOA 5EQUA 3SY8A 4AC7C 2FHFA 1L8NA 4Z1CA 1D3HA 2W92A 1UROA 4KWSA 4QP0A 3VGGA 1OHLA 5BU9A 1JYXA 3TC3A 1PKYA 5FEPA 2YFNA 3B40A 3EGJA 1XGZA 4XZUG 2PHXA 1JFHA 1RUG2 1JW6A 1C8M3 2I9EA 3U5YA 3WZ1A 4EK7A 1V6LA 2J6VA 3EBRA 4XDOA 1LRQA 2TYSA 4PHZA 4BE3A 2WLQA 1NCQB 1EDGA 3POCA 3BB6A 3ZXFA 4NJHA 2QQLA 2VRJA 3QLLA 3MLJA 3SB0A 1Z6KA 1P0BA 3IGSA 4W88A 3W7MA 5CNAA 1NCQA 2BDQA 3FIGA 2QF8A 3EWDA 3DBPA 4ISRA 3B9AA 1EP2A 3PJQA 1TVPA 5E5CA 4XISA 5DAXA 4NP7A 2GQ9A 2G9GA 3NQDA 3C6CA 5HMDA 1R64A 4ZHNA 2YZRA 1VJZA 1N1VA 3NFUA 5KINA 1V4YA 4NMIA 1JYVA 1ADOA 4XJUA 2CZVA 2W87A 3PZOA 4HMDA 4MVTA 3EPMA 2Y5JA 4D8MA 2YPIA 3RU6A 2IW0A 2DVUA 1JDFA 9RUBA 5I3IA 1FWCC 4D7SA 3EX6A 1W9DM 1PO22 1WDDA 5B4XA 1WDPA 3UVIA 5LBEA 5LA9A 2A21A 2ZZ7A 1P0DA 1U5XA 1EBHA 4PBOA 1UBPC 3BGGA 2REQB 1SFTA 3DC8A 1JUKA 3AIVA 3OOXA 5EYYA 2J75A 1FFRA 2AAMA 3KDOA 3WUFA 1GHRA 1JCLA 2D43A 1VBHA 2VEIA 3OW1A 2ZX4A 4I9TA 2WM0A 2A3LA 3KL3A 3QXBA 1EH9A 1KITA 2REQA 2NN8A 2X29A 3BL3A 1X7FA 2ZE3A 1LULA 4RE4A 3L65A 1AK5A 3LXCA 3NKTA 2PMQA 4AQ2A 5GVJA 2CHHA 4V1XA 1OCQA 1SUXA 1SQ7A 3MI6A 1RQBA 3TFXA 1LOEA 2D6LX 2XMLA 4Y9MA 2TODA 1YXDA 1PGL1 1J0HA 1US3A 1WLCA 3SEEA 4GALA 3RFRA 4A7KA 1A5KC 1O5KA 1SW0A 3KTXA 4LCQA 4KPLA 4B9ZA 1AR62 2NVCA 1VBRA 3EYPA 4LVDA 2VT0A 1GQGA 4LXFA 3B0VC 3S2MA 5HNRA 1H7RA 4ILSA 1KR0A 2X1IA 2IVJA 3VO0A 2VMGA 2A3YA 2EIDA 3DG3A 1JXKA 1QI0A 3CUHA 1VLWA 3BW3A 3IAQA 1I1XA 1XJAA 3G6JB 4WF7A 1ST8A 2ZRUA 3PWGA 3IN9A 1Z42A 1VBE1 3AYCA 1A8DA 4HTBA 4CD7A 2V0TA 3LTPA 4WCJA 2XZ7A 3NYZA 1LP6A 2ZKMX 2XJPA 3MI2A 1QJY3 1WA4A 3E02A 2EIBA 3V18A 2OG9A 1Y9GA 3UWEA 4CNUA 2WFPA 1HVQA 1GZTA 3EX4A 4EXBA 3OLDA 3USSA 1GLHA 3RMYA 1MZEA 3HD8B 1PIFA 4US5D 3FMGA 3VNJA 4EKJA 3POYA 1J8VA 3M1HA 4YVSB 4AD3A 1V70A 1OINA 2Q01A 4YW6A 3KOYA 2CLFA 2JE8A 1ZBCA 4LQ1A 4J3ZA 2HWF2 5A3NA 1ULFA 4XFFA 4YVSA 3TYCA 1KR1A 4AAXA 3ORJA 4ENLA 4F0KA 3J7LA 4AE2A 3GVRA 4GA8A 2J13A 1AL8A 4QD2A 3UZYA 3CHFA 4CE8A 2JKAA 3EA2A 1UWUA 1JOJA 4IV3B 3BKZA 1UKGA 3BMVA 5D9MA 3ASIA 3RJYA 3WD1A 1XIIA 1MEC1 4PTNA 4A05A 1RUD1 2Y2WA 3BAYA 4ZKTB 2PUZA 2ZGKA 4PBGA 1KFWA 3CT2A 3NQ7A 1SYTA 2CPUA 1TRDA 4IV3A 2ZOXA 2B42B 4PYSA 4V2VA 2BTVC 1MWOA 3D82A 2PS2A 4B3ZA 4ZENA 3KOXA 3ZT5A 1KFEA 3O5SA 2Z1XA 5FA5A 4AWUA 3K30A 4JHMA 1H7PA 1UO9A 2XHNA 2ZYFA 1DWHM 2XISA 3EWXA 3VD7A 5BRPA 4I8YA 1BGGA 3ZPOA 3WH7A 4YMZA 3OBKA 3EXRA 4TSVA 2XIJA 2BHYA 3V35A 5BYNA 4JOMA 4Y90A 3NQAA 2BQPA 3W28A 3JU9A 2FZ9A 4YTSA 1FH7A 4FOUA 1PMIA 3RRDA 4JIPA 4DPQA 4YLWA 3DFPA 2YBSA 5D2XA 3QOPA 2UWCA 2WWCA 1UWAA 1UKTA 4BI7A 2BYVE 4FNRA 3UJ2A 1VE0A 5HPCA 4IGSA 1NOVA 4ZODA 4LEFA 5HMSA 1DWJM 4MFDA 3G0UA 2PTDA 3E5PA 3D4KA 4QG8A 3AIQA 1CIWA 1V7YA 1F61A 4GKYA 4HOWA 1A49A 5EJ3A 1W9PA 1IPSA 1OX6A 1A50A 4Y33A 4RNIA 4AI2A 1QASA 1H51A 1GW9A 2A3HA 3GC4A 3OG2A 1X8FA 1H2KA 2O0OA 2PHFA 1EB3A 4Y8FA 3WG2A 1H2MA 2ATFA 3U7VA 1ZRDA 4H7ZA 1KEXA 3TZFA 3GDKA 3EPOA 5HA7A 4WM8C 3UG5A 3GAKA 3T0BA 1XL9A 1FUYA 1HG3A 5T54A 4MMWA 2JEPA 2ZXQA 4F3JA 2XHKA 3VDDB 1YJLA 5C3RA 3N9KA 3T1LA 4NJJA 1F3TA 4E4FA 1TV3A 3M46A 3T7VA 3I54A 1PK6B 1RUE1 3T9PA 2W94A 3IIOA 1H9WA 4RS5B 5TAOA 3VDDA 4B91A 1VQTA 1SFPA 1C8QA 2E51A 1AMYA 2J9YA 5DZEA 2DFBA 4XD3A 5DUVA 1QVBA 2WJDA 1PK6A 1MXDA 5HCAA 4GMP1 4N9DA 1B4EA 5DN1A 4MJMA 4RS5A 4U5IA 2YGYA 1UP0A 1Q2RA 4GIAA 2OXNA 1S0FA 2Z24A 2JGQA 4TMCA 5LA1A 2BGOA 4Q3MA 3E1F1 3GK0A 3VZOA 5GJNA 1WLDA 4XQDA 1ND2B 3S6DA 2UWFA 3CJIB 5EYWA 3JZVA 4CQ9A 5FY7A 3URBA 3WJYA 4IPIA 1KGXA 1OADA 5C4WC 2PZ0A 3SN0A 3M3EA 3NQCA 4XTIA 1EP0A 2HKXA 1EGZA 1ND2A 2XL9A 1EEPA 1UD3A 3I2FA 3CJIA 3WBWA 1UD4A 3ABOA 4UXDA 2J79A 4M6UA 3RMEA 5LIKX 1LR5A 3MFCA 2V81A 4LO7A 2ABAA 3HBLA 3W37A 3PUOA 3ZJ7A 4Q4X1 5T5OA 5DABA 4E2SA 4XUTA 1HGYA 1DU3D 1SM9A 1VPXA 1RA5A 3OGRA 3M5VA 5KETA 2XLGA 1VCGA 1J3RA 1UKSA 4D6EA 1Y7BA 1QH7A 4MY1A 7A3HA 2JDNA 4W7VA 2A1YA 2PWVA 1E6ZA 1XKYA 1LT7A 4DYKA 5M5DA 2WRAA 3M70A 3OBTA 2QYGA 3BCDA 4JQAA 3PPGA 2Y33A 4P9GA 3BH4A 1G69A 2YDSA 4DJFA 4BU2A 3FA5A 3VUSA 1IS3A 3WBEA 4MFEA 1KQRA 2OZJA 4D7TA 1SO5A 2HWC3 1W32A 1KJRA 2UURA 2RHPA 4FPSA 4H7MA 1V0MA 2EPKX 3PF3A 1SLTA 5JSOA 4E8DA 4QB2A 3IK4A 3BAXA 4XXAA 3E0LA 2XGBA 4META 4HJFA 4EOUA 3ZOIA 1VFTA 1DBTA 1W5MA 5CG0A 2YW3A 3GXUA 5FZMA 4K3UA 4BIOA 1MNSA 3DYOA 4BZ4A 4LFYA 2JDKA 4LEJA 3PANA 4IFKB 4B5SA 2ARBA 3A22A 5FY4A 4AVSA 2CWXA 3PBYA 3ZYJB 2IQTA 3S1WA 1JZ3A 1WBFA 4UQDA 5A1FA 1TYGA 1ZZ9A 3TJIA 1G9AA 4JQ4A 3C0JA 1Q8PA 2CLPA 4UW3A 3O1TA 2L5HA 1K1DA 4N9HA 2VZQA 1KFLA 1QTWA 3W38A 1TTPA 3O0KA 4XZHA 2OKXA 4BISA 1UH2A 1TME3 3OLEA 2E7FA 2B4KA 4P08A 1A5CA 1EAH1 5JOYA 2PWDA 1V6NA 1GWMA 1KW1A 2WJEA 2V5JA 1JF6A 1LM1A 4L9YA 3L21A 4B5WA 1BFNA 2HK0A 2EXIA 4JTCA 1Z3NA 3B8TA 2XG3A 2GH2A 5E6ZA 3TAOA 5M17A 2VUJA 1MW0A 2NMOA 1H2JA 4X8PA 1F3EA 3JQWA 4FOYA 3KBWA 1OG0A 2PDBA 1ONAA 4NROA 4CXWA 3D5HA 4C6MA 3R0KA 4YTTA 3MICA 3BLLA 3CZEA 4I0WB 3BMXA 4I5XA 2ORZA 3A9IA 4B4QA 1Z32X 4UBGA 3GDBA 1BG9A 2QCGA 2OR2A 3NM3A 4K8HA 1WZXA 3UCQA 4NVTA 3HOJA 1FOD2 3MSRA 3DGRA 1FPN2 3VGIA 3LN3A 3EX1A 1VAMA 4BA6A 1KM0A 2QPXA 1CX1A 3M0LA 4LY8A 1W31A 2BW8A 4YGEA 2K2SA 4QAWA 3W83A 2D3SA 3NRUA 3PVFA 1Q6GA 1MUWA 4O10A 2Z1WA 1BQPA 3B9EA 1PCWA 4DLFA 5F6KA 3WMSA 3NCOA 3VZKA 4Z82A 3ABSA 4L1GA 1EYEA 3E5XA 4FLQA 2Y0FA 2QJVA 4N9IA 1M3UA 2V69A 3MF9A 4AZGA 1NUKA 4AHWA 2FKPA 4W5ZA 5FZAA 4BB3A 3R4UA 2HXUA 4QNEA 5MKGB 4PDWB 1R7AA 3OOQA 3WH6A 3JD73 1LOAA 1AUYA 2VBBA 4IMGA 1VC4A 1UR2A 4K8FA 5A2BA 1HGWA 2GH8A 2FB2A 2OVUA 4PDWA 1FXPA 3SC7X 3H7JA 1QJX1 4JQ1A 4S38A 5KHGA 4FOKA 3R89A 3Q8BA 2D23A 3OPSA 1SR9A 3AROA 2XWJB 3DHPA 2WCSA 4YW5A 4QS5A 3WN6A 4DF0A 1F2NA 5AVHA 1WX0A 1NQ6A 2WSPA 3H8XA 5FYUA 3R4DB 1XRSA 3BAWA 3C5QA 3IIPA 4R9OA 3NURA 2W3JA 3UZJA 3CUZA 3ZYHA 3EMZA 1ZZ8A 4GUGA 5CFDC 4QG6A 4A41A 2ZZ2A 2J1AA 3VDGA 3QR3A 4RFT0 5K7JA 3AYSA 2RS31 3T0AA 5FO8B 3T3YA 3E12A 3UA3A 4LKDA 3BPWA 4KCTA 3WMCA 2WJFA 2VG9A 2XVNA 4AVFA 3LERA 2QZ2A 1OD8A 4MF4A 2ZZJA 3QV8A 3BJTA 1P1XA 3VZYA 1R083 5CBJA 4JDMA 5G4WA 4LCRA 1UYZA 3ETQA 4NHLA 2A4AA 3G24A 3BSGA 1RK5A 2CNAA 3C7EA 3I7DA 3M4FA 3N6QA 5F5CA 3UWQA 3WLTA 1DLCA 4NNBA 2E9LA 5E93A 5D21A 1RB8G 4DXTA 1I5ZA 2QXWA 4PLNA 4XJZA 5EKYA 5I0TA 1ISYA 4TYSA 2FZ2A 1GVYA 4PZVA 4WHBA 3NJZA 5A6TC 3I2JA 2P0IA 3MC5A 2C9AA 2ZBJA 4N8MA 4HK5A 4OI4A 3TKFA 5KC5A 3U9IA 3BOLA 1JYCA 4M6VA 3UFYA 4Z92B 3WX5A 2YOCA 3LSDA 5LZ6A 2YCKX 4Q4KA 3W5MA 1F6KA 4OIFA 1EX1A 3THCA 5LA2A 4QM9A 3NQHA 1PX3A 3VC5A 2HISA 4HD5A 3NMBA 3T40A 3WLSA 3F5LA 3EJKA 4WVZA 3PJWA 4CD6A 1PTGA 4HPJA 3CQKA 5DPNA 3QOKA 3W23A 3NNLA 4RYDA 3LXAA 4GFIA 3RO6A 5FK7A 3QBQA 4QDMA 2J6XA 4IEZA 3CYVA 4K38A 4MYEA 4DEQA 1FNZA 5DCDA 4HK7A 4L64A 1Y9QA 3WLQA 1JCYA 3ZFFC 5IBXA 1XLGA 3N25A 4AR2A 4EVZA 4EWJA 4YNGA 3CJPA 3PR2A 1STMA 4KBXA 1VBA1 2Z5WA 2ZAHA 3QV6A 5BNPC 1W2NA 4BPZA 4AQTA 4CCNA 4WM7C 1NX9A 2ZICA 3INPA 1D8CA 3RM4A 2YA0A 1A5SA 2WC3A 1HL2A 4WR3A 4X60A 4CCKA 4KH9A 2QCDB 2BBFA 4IGPA 1JIBA 2DZSA 3S6TA 2JKEA 5JDBA 4EACA 2DDXA 2EPOA 1EUTA 1MS5A 2TPSA 1E0TA 4GQRA 1D0GA 2QCDA 5EMLA 1SLIA 5ERLA 5LY2A 5DXXA 1QNWA 1WD3A 4YXGA 1NSJA 2ZX8A 2GC2A 1TTQA 3WNLA 4D8LA 3R0UA 1G7YA 2WXDM 2ZMKA 4HP5A 1VFUA 4R4XA 3AXXA 2B4GA 4LPCA 1Y3TA 4DNYA 2WMHA 3LDVA 3MHFA 1UMHA 5FJKA 2GFTA 1YFUA 1F4HA 2VL4A 4CP2A 4C91A 1O94A 1P5BA 1TV8A 4GI8A 1GZGA 4HA1A 4QRNA 4KRZA 4PODA 2PD9A 1ZZ7A 3R8GA 5EXOA 1A6CA 3WW1A 1GEHA 3CAVA 4DS0A 1TJRA 4LAUA 4P7QA 2X41A 3U57A 4NWWA 1FWWA 3TA9A 1C90A 4IHCA 4YTUA 1V6XA 3ZYZA 5JIWA 4B5NA 4RN5A 2VGDA 1CXKA 2WQDA 1C92A 4WUIA 3L4WA 5KC6A 2YZ5A 2QVNA 3WBAA 3HB9A 4FP2A 2OW4A 4URIA 4CPBD 4JN7A 1SG3A 3VKAA 1VBB1 3BIWE 2JGYA 3URNA 2W08A 3I7RA 1AYN1 4V1YA 2LS6A 3L4UA 1ENXA 3NL1A 3MU7A 3UETA 3LV5A 2Q1ZB 4FNQA 3DUGA 3J8F2 4C6DA 3W75A 1BQGA 2CBVA 2QCCA 1W3LA 1FA2A 4Q4SA 1UPMB 5FBJA 3LDKA 3R94A 1E0VA 5CCZA 4ZOBA 5HBFA 4PUUA 3WQ6A 3QSRA 4FO9A 2OUHA 3CT7A 4D1IA 1FMD1 1NP2A 2XJSA 2P2KA 1BEUA 2E9MA 3KV4A 3BPZA 1UR0A 3MCMA 2WVUA 2J7HA 4W85A 1T8QA 4P5HA 1L9WA 3KBNA 3MCOA 4O1DA 2WWUA 3RPTA 2F9RA 4X6RB 3S9YA 3OHIA 4FPFA 1Y7VA 1D4M1 1CI1A 2E53A 4HTYA 1CGUA 3ES4A 3S0MA 5I3FA 4PR4A 4GISA 1HJGA 1CQ9A 2DVDA 1VYPX 3IJ8A 3HN3A 4LQRA 4H9YA 1JHNA 4GH3A 4AQ6A 1Q7QA 3PVBB 4QE1A 1IEWA 3DFTA 4XTMA 1VRH3 3H12A 3F03K 4MPKA 3GFXA 3M0MA 4QFUA 1IEXA 3F4WA 3ME2A 4MWAC 4IL2A 3SCTA 5E9AA 4M00A 2E77A 1RAKA 1W28A 4XFGA 3ZXAC 2YCJA 1NYWA 3NEVA 1OEPA 4ONVA 2B7PA 5JIPA 2OX0A 4GXMA 4GY0A 4AI9A 4W50A 1HKIA 3IMMA 1DQXA 5FY0A 3UR5A 5XIMA 3EO6A 1FV3A 3U0ZA 2NW0A 3NR0A 5KXDA 4HZFA 2KM2A 2A1XA 2EKGA 4ZTYA 1DJIA 4I7UA 2BLEA 1DF0A 3CAWA 1LAJA 4WZHA 3M8LA 4O53A 4AYSA 3POEA 3TEYA 4WZFA 4JTFA 1V0AA 5FZCA 3SCVA 5IVBA 2WYFA 2Q8CA 2H9AB 3VZNA 3TAKA 1D7FA 2WSQA 5CZTA 1UC5A 4MHUA 2BPA2 3K13A 1PIGA 3CUXA 5G2IA 1WBLA 2QDGA 1K12A 4AQSA 1GVQA 5JI7A 5FPZA 1IZJA 1WDQA 2CIPA 5CB7A 3ALGA 3EXSA 1O95A 1S2EA 3PPFA 2BV4A 4BQWA 2JG8C 4XACA 1UP2A 2E33A 1K70A 4NUBA 4PGLA 5G1MA 3VABA 4PSPA 3S7IA 4HU3A 1A53A 1JULA 3PTDA 2WMGA 2ICSA 3GE7A 5FR3A 3SJ3A 2QQVA 1K9FA 1XNKA 2GOKA 1FWFC 1RUSA 3G1RA 3WNNA 4R9BA 4GY1A 2IXHA 4Y96A 5FV3A 4ATDA 1ZBWA 4C6QA 2Y61A 3TOJA 2FH6A 3CWNA 5I3KA 3STCA 3N9OA 2Q3OA 3L2MA 5DDJ2 3FYOA 5DF0A 2JBMA 4CEWC 3AXKA 3ZSTA 4W8BA 2LUWA 4F7ZA 1LB2A 1RALA 1W0PA 4Y5TA 4NZJA 5DQ0A 2PRHA 3NSNA 3CMGA 1AJKA 1JS9A 5FJHA 1V3MA 5A1LA 3HQPA 5C0QA 4WBBA 4YZ5A 3EB4A 3SXWA 3QGVA 3L2HA 2PDFA 3WQ7A 5I91A 2ZUNA 1ME9A 2HH9A 4JX0A 2A3WA 1SJCA 3MWAA 1GQHA 5FY5A 2I16A 3MYXA 3QY8A 4O4VA 1SSDA 1LCLA 1KD0A 2WNWA 2GSYA 1JCTA 3IPVB 1CGXA 1ADSA 5H9SA 5AC91 4DB7A 4EF9A 4UTMA 1BG4A 2Z27A 4WM8B 3PS7A 3ZN5A 1D0HA 3UA4A 3WD2A 5LGXA 2ZDRA 3VDCA 5C8CC 1HT6A 1D4M2 2DJXA 3T2OA 3FHAA 3KHDA 4HA4A 4L1XA 3RGTA 3IPVA 4IIHA 1T2XA 4UYBA 4DJDA 1TTJA 4ICNA 2DUAA 1KKOA 1B90A 5A6BD 1US2A 2WZ8A 3TYAA 4I8DA 1SFSA 1LU2A 4WM8A 2FGBA 4PCNA 1TMF3 4LNCA 3SQSA 1AXZA 4LUTA 1EV11 2CGOA 3C86A 3CH9A 1GNHA 2DZWA 1LL7A 2ZA9A 1JZ4A 1ME8A 2WMFA 3WIJA 2QQJA 1BYHA 5L9FA 2H6CA 1XOYA 1W1B1 5CPQA 4KI5M 1QJY1 4J2PA 5I09A 2XFFA 3GZ3A 5I7GA 4R9DA 4C6BA 1UY2A 4MJ4A 3FYPA 4IXLA 3ACLA 2HS6A 5C9WA 1ZRIA 4YWAA 1PO11 1JL8A 1QHZA 4XAAA 1TPC1 4KWOA 1VRDA 3LS9A 1C8M2 1R1ZA 1AX2A 3GHMA 3WXPA 3PM6A 2V5DA 4IX0A 1GR3A 1HB1A 4UW5A 1QT1A 1U1JA 3TYEA 1BMV2 4FX8A 2HVOA 4D7YA 5FYZA 1IT7A 4UTUA 3RI9A 2BFUS 1TR1A 4ZQRA 3NQFA 3VNIA 2MHFA 3T1GA 2XJ7A 3E0WA 1X96A 4ERGA 4I90A 1MZ5A 3E5QA 2G4JA 4CDUB 1E5NA 5C55A 4XIAA 4Q8PA 3N4EA 3TYBA 3GG8A 4FAHA 1WKFA 5CPNA 4GWNA 3GXFA 2GGHA 5HNTA 3SHRA 2Z1BA 4BF7A 2DCYA 1V0KA 2HWGA 4UIOA 3BV4A 4P8XA 4CDUA 2VNRA 2Q8EA 1GBGA 3B0PA 4BR1A 3YPIA 2WOQA 1XUUA 4E2GA 4AW7A 3CPGA 4JTDA 4MJ2A 3O1RA 4Q8NA 4C60A 5HV0A 3SCHA 4MB5A 1V02E 4KEZA 1UD1A 4QSHA 5AHNA 5FOBB 4PUMA 2V5LA 4ET7A 4EAYA 4FF7A 1Q65A 4HNTA 5EBUA 2V3EA 1UIPA 1W2UA 1F8IA 1LQ2A 4IWWA 1UZZA 4YG3A 1XYOA 1RXGA 2PHDA 3ES7A 4ROQA 4CUCA 2BEOA 4J5NA 1Q5MA 2Y70A 2NSOA 2QUTA 5F3IA 3CZJA 1VAKA 4FQ4A 4FPJA 2ZE0A 3AOFA 2O4MA 1RYYA 4S2DA 3NQ8A 3W6LA 2TRSA 1ODNA 3LCFA 2D98A 3HNMA 4Z2AA 4DPNA 1NXMA 2VOTA 3AUOA 5IDZA 2GDFA 1L2QA 4YZ2A 2C1GA 2CBJA 3HZ3A 4URTA 2BMBA 1I1WA 3IAPA 3IVSA 3HG3A 5FP8A 1BVVA 4GKTA 4XKMA 4MXWB 5DAQA 5A3UA 4Y1ZA 4ES4A 2EA7A 1MI3A 4DQAA 4INDA 2E31A 3U11A 5T26A 2JDAA 3SUSA 3CWOX 1GFF2 4LYPA 4AZ7A 2DVBA 4LX4A 4DO6A 1JYTA 4G2DA 4F0SA 4JDOA 4U3CA 1EGVA 4MXWA 3REQB 1F5ZA 1GPFA 1M01A 1UA3A 2IPFA 1GHSA 1W9XA 2NSXA 2A2IA 4EN8B 3DN7A 4Y6GA 3OTFA 1TJ0A 5D9NA 1F5FA 1OC7A 3U48A 1HRI3 1PS9A 2DW7A 3QFEA 3W2NA 3REQA 1THFD 1TREA 2E6DA 3WJSA 2VVDA 1E0WA 3IMNA 4Y26A 2FMYA 1GUVA 1H62A 1TUXA 1V8EA 1JOBA 1SFLA 4AFMA 1R9YA 1WO2A 4HPGA 1QJY2 5FZ6A 4HHHA 1ZYBA 1VMHA 2Q09A 5ACA3 4SLIA 1ZZCA 1XFBA 2R1KA 3W53A 1XIHA 4XUYA 1H3GA 1QPNA 1EJXC 1QEXA 4Z2WA 2XIOA 3EDJA 4LW7A 3AXEA 1IOAA 4GYFA 2WN2A 2P50A 1PWLA 4J28A 3VZMA 3SCNA 2DURA 1ZNPA 5JSRA 1OPMA 2CETA 1C8NA 1K4GA 1ADDA 3LHTA 2QCLA 4QX7A 2WZTA 3KZ4C 1D7PM 1G0CA 2Y8VA 5FZ7A 3MDPA 5BY5A 3BE7A 4FFHA 1W0OA 2HYKA 4QJ4B 3PWIA 2R14A 5CQ1A 2B46X 1NOFA 1NCRC 2C16A 1NE4A 1W8TA 5EJ1B 3VBSC 1OD0A 1F35A 2VMIA 4LRSA 5IK5A 3VGDA 7TAAA 3GBGA 4KQNA 2DTYA 5A7QA 2YPJA 3ERPA 1W5OA 3FJSA 2CGPA 2PDMA 1XPYA 4QKDA 4YWIA 5L19A 2ZUVA 3W2UA 3SNMA 2XKPA 5EMJA 1M7JA 4D8AA 1QOTA 1ND3C 3KEHA 1A4MA 3WT3A 1GOMA 2A7AA 4TMBA 3SCPA 1PWMA 5CAKA 3G1XA 1O91A 1ODZA 4UR7A 4AWEA 1MEWA 2ZABA 1OK4A 2WWJA 2YYUA 3OUIA 4LS2A 3OYXA 2D69A 1V7AA 1ISVA 3ITYA 3HBZA 4E4UA 4GCAA 1XBVA 3B9DA 1PHQA 1Y8BA 4S1FA 1J10A 1ULPA 4FFFA 2OT1A 3HNYM 3OA3A 1W3VA 1UD6A 1XSJA 4TX9A 3K48A 5CFDB 2NV1A 1GYLA 4L0PA 4A3RA 4CD5A 2X05A 5AVPA 1FY6A 4MLOA 5HR7A 2HWC1 2PLCA 2DZAA 5DUWA 2I1OA 3I97A 2YW4A 5CFDA 2RS13 3SR7A 1M68A 3GXPA 1ZBVA 4Q0VA 4JQ3A 1QHDA 4C1KA 4B4RA 3HGJA 3CNYA 4FT8A 2RDTA 4QB6A 1XU1A 5JIUA 3DI1A 4WX2A 3RX2A 1PZ9A 2Y6FA 3SN4A 4U2AA 3OSDA 3G3DA 3UZZA 2V4AA 3SSJA 4LK7A 3APGA 1Q85A 3UNDA 4ONUA 4ZEPA 4IV1B 4Y24A 3KZPA 3MMTA 2ES3A 3SRHA 6REQB 4PTMA 3TTSA 1UA7A 5C8BB 1W9SA 1CGWA 5C54A 3WSUA 5LW9A 2P8BA 2R8WA 1LBMA 4UNIA 4KGGA 1C28A 1PSCA 2J7GA 3RITA 1EC8A 3AXDA 4IV1A 2VEGA 4YWSA 2J8FA 2J78A 5C5TA 1J2BA 4CN1A 2DSVA 3L4TA 3VOIA 2WCAA 3ANYA 4IETA 4TX8A 1FWEC 5CPOA 3ARWA 1ITCA 3ENLA 2I2SA 1YPXA 1AF9A 1QU0A 4Q4V1 3B69A 1IR2A 4DWSC 1N55A 1ASJ3 1OT2A 3DV8A 1OMIA 1LTDA 1XIBA 3IK2A 2J7FA 4XAPA 1JNEA 3H53A 2J22A 2WMJA 3O06A 2PDHA 4JX5A 4XO7A 2OSXA 3I7QA 1Q13A 4IPPA 5CC7A 4QU2A 1H7WA 4HPKA 1J1LA 3CQJA 4RW3A 3ZJ8A 4EIVA 3QMRA 3ACGA 3PSWA 4OHQA 2GC3A 1DXIA 1XISA 3KBMA 1R1A3 3DXTA 1E4LA 1S5MA 3AHXA 3FFZA 5HWMA 3LLXA 2Z7GA 1V6YA 2NQYA 3R05A 3MUY1 3ZFFB 4MG4A 1NLQA 2C15A 2BOGX