4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
2EJ1A 1ODUA 2ZXQA 3VGDA 1FP8A 2QPSA 4X0NA 1GWKA 2O9RA 1HKKA 2GDVA 1EOMA 4U2YA 5CXPA 2WHLA 4GPNA 1LL4A 3CZGA 1W9XA 2W61A 2ZUMA 5ABFA 1JYXA 5I3DA 2J7DA 5JBEA 5A95A 2XVNA 2VO5A 3PZGA 4EAMA 1TE1A 3VD5A 1ISWA 2ZE0A 3AYRA 3HJEA 3SCVA 3WEZA 1BYCA 2MANA 1UR1A 1FH8A 4AZ5A 4LX4A 1EDGA 4MPKA 3UETA 3EDFA 1GOMA 1WZAA 1US2A 1KWKA 3CZ8A 3O2LA 1W2PA 3VIGA 3GH4A 3OLDA 1F4HA 2WCGA 3NSXA 1OWQA 3AMGA 3PZNA 1JG9A 3OA5A 2CIPA 3FHQA 2D20A 1PZ2A 3EMQA 4GQQA 4X9YA 2XWDA 1MQPA 3PZIA 4UQDA 5FD0A 1VIWA 4W8LA 5DO8A 5TD4A 1J9YA 1TCMA 1NWRA 3SCTA 3K46A 5ECUA 3AHXA 2YIHA 3BSHA 2D0FA 4BF7A 1OD0A 1E4NA 1DWIM 3N1AA 4CD8A 1QI3A 1BAGA 2WMIB 2CKRA 2VX4A 1AMYA 3DYMA 1E6RA 3OGSA 5BYWA 1HP5A 4MDOA 3JUGA 4NZCA 1CXLA 1XH2A 1KR0A 1NOWA 1WZXA 1WDQA 4M82A 4WKFA 3AIQA 3BSGA 4D6EA 4W89A 4DM1A 4DWSB 4F9DA 3W28A 1MW1A 1A3HA 1W3HA 2EPKX 2A3CA 1PZ3A 4ZEPA 1V0KA 3G6LA 5HPCA 4MB5A 4HOZA 4A3HA 4W8AA 3MS8A 3SUUA 3SCPA 4HPGA 2WMGA 3T2OA 1QOXA 1W9VA 4CCCA 3WH7A 3APGA 3NUKA 1TG7A 1Q6CA 1EDQA 3BCDA 1ODZA 1CDGA 1CLVA 1KXTA 2VZTA 4WF7A 4PYSA 1CXEA 4CU7A 1UR0A 4TTUA 4AEFA 3UEQA 1BYDA 1K9DA 4AXNA 2ZXBA 2ZOXA 4OKDA 1WZKA 1CWYA 1XD0A 1CGWA 3W82A 4AD1A 1QPKA 2D1ZA 3K4DA 1UH3A 4UCFA 4CP9B 2VURA 2J7GA 5DFAA 4HMDA 3THCA 1QHPA 3OZPA 1MFVA 4IUGA 3MMUA 3K8LA 5I23A 1V6YA 1W1YA 1WAWA 1VEOA 1GVYA 1PIFA 2EPNA 1G94A 4HZ6A 3I3BA 2WXDM 1FA2A 1HKJA 4UQ9A 2XSBA 2J74A 1J0JA 3NSNA 3WD0A 5I5RA 3F5JA 4BS0A 2XTKA 3VKKA 4PMNA 4WKHA 1BGAA 3CGTA 3GBEA 3WL0A 4HMEA 2GVYA 1TVNA 1JGIA 3MSDA 4GI8A 2WCSA 2DEPA 3I3EA 4NI3A 3GZAA 3BC9A 3W29A 3WNLA 1R7AA 2C0HA 1BVZA 4WLCA 3IJ8A 3LMYA 3VIMA 4JHZA 3ARUA 3FHAA 1E6SM 2PC8A 3A6OA 2BVDA 3ARRA 4ML4A 2WM0A 1WNOA 3SCNA 4PMYA 1VEPA 1V0NA 4U5KA 4HOWA 4H04A 1BFNA 1PX8A 3N04A 1FFQA 2PF0A 3N17A 5A8OA 7TAAA 1E6PA 2CBIA 1QI0A 4Z2IA 3O6AA 4J3WA 4YHGA 3SCQA 4AISA 2JALA 2BHZA 3VNYA 5GPRA 4R5EA 2VVNA 4TVCA 4CD5A 4LPCA 3CHEA 3L2LA 1HN1A 1WB0A 4QLKA 5BCAA 4HP5A 1GJUA 1GQLA 1NOUA 1O6IA 4D6GA 4CP9A 4AC1X 3PN8A 3F4VA 2Z1KA 3AISA 4D71A 1E5JA 2V5CA 4J3TA 4UQCA 4CN1A 2E9BA 5ABGA 3EYPA 2FHBA 1OCQA 1UWQA 1V3LA 2Z1SA 4YW7A 2VRQA 4UZUA 2ZX5A 5GNYA 3II1A 2UWFA 4MJ4A 1QW8A 3N13A 1IZKA 3EMCA 3L4ZA 3UR7A 2EPMX 4C7GA 3AIBA 2VC9A 3OIHA 3KEHA 3W25A 1PEZA 2DSUA 3CIVA 1IT0A 2VUYA 1WZLA 3U5YA 1UWUA 1N82A 1ZBVA 1X6NA 3KWXA 4H41A 2ZUUA 1RP9A 2G41A 5A6LA 2XUCA 5IFPA 4CUCA 4PMDA 3SCSA 3CHDA 3L4WA 2WWCA 2WVVA 2JFEX 3QHOA 3ALFA 5FCZA 5CGMA 3VIHA 2Y8KA 1VJZA 5E09A 4AEEA 3L4TA 1GUVA 5CLWA 3VDBA 1XGZA 2QHAA 4WSKA 1E4MM 1H1NA 4PEEA 5D9PA 2CCRA 3W38A 3A4XA 1E6ZA 2JEPA 1M04A 1UH4A 4DWSD 3VOCA 5JBFA 5IHRA 1WP6A 4CD7A 4KRTA 1W1VA 3L4YA 4NRRA 5D9NA 3GXIA 2ZXAA 4P8WA 4NSBA 2YBUA 1E72M 2OYKA 1BVNP 4Y7EA 3ARPA 2IXVA 5M3WA 1KR1A 4QCFA 5D9MA 3VPLA 5F7UA 3OGVA 2GK1B 2WBGA 1DEDA 1XH1A 2CHNA 4UFIA 4CVWA 3ARZA 1V3KA 4HTYA 1ISXA 1TZ7A 4EKJA 3WQWA 2XHYA 1E15A 1C7TA 3GXMA 4QLJA 4AZ6A 4KWUA 2WMKA 1QNRA 3O9NA 3WF1A 4AZCB 4W86A 1HKMA 2FH6A 1E0VA 4M8UA 3WQ8A 4JAWA 1SR0A 2PWEA 4UQAA 1ZBCA 1ZU8A 3WNKA 2ZXDA 3AYSA 1W8UA 3WUBA 1BPLB 3SUSA 1UOKA 1U33A 1SFSA 4P7NA 4EANA 4LKDA 2UY2A 4BQ3A 5CPTA 1JF5A 1ZBKA 4MAZA 2OWWA 3WDJA 5BXPA 1D3CA 5HOSA 1LQ0A 1EDTA 3AXIA 3B8SA 1KBBA 1EHAA 1EHNA 3CUFA 4M1RA 3M07A 4PUDA 2J7BA 4CD6A 1MYRA 1XH0A 1JYWA 3N12A 3WH6A 1UWSA 4PCTA 3MO4A 2XYLA 4D72A 3UG3A 2BV9A 3IAQA 4Z2LA 4UFLA 4JKLA 1UYQA 1MW0A 5EFDA 3W24A 4ATWA 1VFUA 4ATDA 2A3EA 2EPOA 2W4XA 1JDDA 3BGAA 2F2HA 4ZE5A 3CZEA 1GNXA 2J75A 4CPBD 1UA7A 3ARVA 2QF8A 5LA1A 8CGTA 2DIJA 1QBAA 4H8HA 1H4PA 1UD6A 2VZVA 3VINA 2XM1A 1WMXA 1WZMA 2DSKA 1UKSA 1J01A 3AOFA 4ZFMA 1ISVA 3QHMA 4H7VA 5A6BA 1G5AA 4RE4A 1XSIA 3UERA 3VGEA 3T08A 1MVYA 3N18A 4FLRA 1CXIA 1NM9A 2CBUA 1OGGA 4JKKA 4QCEA 2ZWZA 3GM8A 1E4IA 3ZIZA 3QOMA 1DWFM 3L4UA 2RGLA 4AZCA 4Z2GA 4P7LA 4CN4A 3WMCA 4YWAA 4UZSA 1L8NA 5A8NA 4JFVA 3PHAA 4TVDA 2J7HA 3F5KA 5BRPA 1R87A 4S3JA 2VR4A 1HVQA 3PZOA 3OLEA 1YHTA 3AJ7A 2VL4A 2C24A 4TOQA 1UD3A 2GJRA 1H5VA 2VMFA 2Q8XA 3E1F1 1V3MA 3VD4A 3AXHA 1TA3A 3MANA 1M7XA 3BXWA 1EO7A 1JIBA 5EFFA 2V3EA 3PTKA 3WFLA 1W3LA 3K8KA 2OYMA 3WEOA 2CESA 4ACZA 2PWGA 4LKEA 5AC5A 3CZLA 1OINA 3TONA 4GKLA 1KXVA 2WK2A 3ZR5A 3LPFA 1JNDA 2F8QA 4EE9A 3ALGA 5BXSA 2W5FA 4OIFA 3OBAA 2DSVA 3OLIA 4LKFA 3SCRA 3ARWA 1JXJA 4MB4A 1J0KA 2WSPA 5M17A 2ZX6A 1M53A 3AI0A 3WUFA 1HN0A 2YL8A 3VIIA 4HPHA 1XD1A 4NRSA 3SCWA 5EB8A 4PTMA 1JYVA 1FH9A 1FFRA 3WF0A 1GOQA 1C8YA 3RMEA 4ACYA 1KGXA 2XSAA 1YQ2A 3CUIA 4UFJA 4CVUA 1MQQA 3CZKA 4GZJA 4GO8A 2JIWA 4MNJA 3ZMRA 2WC3A 2VZOA 2ESCA 3FW6A 1C91A 1V02A 3TTOA 2EO7A 3CMGA 1B0IA 4JFSA 1QI4A 5LYRA 5FIPA 4FLQA 3BH4A 3WENA 1JYNA 3L2MA 2DT2A 2D23A 2YDRA 1CIUA 5CZKA 1E70M 5A6BD 1RPKA 2RGMA 4CCEA 1KXQA 2F61A 3NCOA 1QVBA 1HJUA 1FP9A 2KR2A 4D1IA 3DYOA 1CEOA 1NP0A 4PBGA 3RM8A 2D22A 3VIKA 2BS9A 2E9LA 4AZGA 1H0GA 2LRPA 4DWSC 1ITXA 4CD4A 1DWHM 3MUAA 2VCBA 3SURA 2VQTA 3W0KA 2J7EA 5DMYA 1B9ZA 2WLYA 2XGBA 1OB0A 2DH2A 3WEMA 3ZJKA 3WNPA 5GNZA 4MADA 4H8VA 5CGTA 3BAWA 4GI6A 4PSRA 5LA0A 2WCAA 1VFOA 3VTRA 3W6MA 1CYGA 5HNNA 2J77A 3QGVA 1GHSA 1GW1A 2WHJA 4MJ2A 1J11A 4URIA 2EBNA 1UR2A 4JL2A 4J7RA 2GJXB 1VFMA 3WQ4A 4HA1A 1H2JA 1A47A 5FKYA 5JBDA 3ZJ8A 1J18A 3FNDA 2X09A 3WMSA 4P8VA 5CG0A 4YHEA 3WNNA 3CLWA 1UKOA 3EDEA 3BAYA 2VRJA 7CGTA 4HZ8A 4BQ4A 1BLIA 4XX6A 2WVSA 4C7FA 2WPGA 2G3NA 2YBTA 1EXPA 3OG2A 1KCLA 3WF4A 1UR4A 3WQ6A 3SUVA 2G8ZA 3W26A 1WE5A 2C8NA 4V28A 2VCAA 4W7UA 3N15A 1CGVA 1V6UA 2VJXA 3AIVA 3GYCA 4AD0A 5BWFA 1U30A 3T0DA 1PPIA 3TTSA 3ZSSA 1GWLA 1EOKA 1EGZA 1OH3A 3CMJA 3U7BA 2YL6A 5A8PA 3CHCA 4AD2A 1VEMA 4CU8A 1OBAA 1TFVA 3EMZA 4AWEA 3AHVA 5IDIA 2WMIA 2DIEA 2W66A 4PMOA 1W9DM 1TVPA 3MV11 1WPCA 5IXEA 2XVGA 5CPQA 3WH5A 2CNCA 4IISA 4NF7A 3ZYBA 4DWSA 3SUWA 3SIMA 1EA9C 4Z2KA 5EMYA 3GTNA 1BGGA 2GJXA 1DWGM 4L4OA 3G6MA 6A3HA 1EO5A 3QOKA 4F8XA 3NSMA 5AYIA 5E70A 3WNOA 3AXXA 1C8QA 1H0IA 2BVYA 3M6DA 1XSKA 2LROA 3D5HA 2AAAA 1W3KA 3W4RA 5D8ZA 3DHPA 2XIIA 3A3HA 4OBSA 2OYLA 1E0XA 4AIEA 1W91A 1VBUA 3RCNA 4PMVA 3ZT6A 5I24A 2FGLA 2OWCA 1GOOA 2WW5A 3WDPP 1D7FA 1XSJA 2D0HA 4Q7NA 2YLAA 2D24A 1QHOA 5I2UA 1RP8A 1V6XA 2G4FA 1CGUA 1ZJBA 4M81A 3RDKA 4E4PA 4UFKA 3VU2A 1O7AA 1AQHA 3TTYA 1D2KA 3F5LA 3VO0A 4F9JA 3WELA 3VGHA 1CBGA 5HBFA 4BQ5A 3L4VA 3FN9A 2JWPA 3DHUA 2CPUA 1M01A 4W84A 1QW9A 4B15A 1GORA 1W90A 3K4AA 2UY5A 1QNPA 1V6VA 2QPUA 2J8GA 3POCA 2QMKA 1LF1A 3B9DA 4D6IA 4J3SA 1C7SA 3MUIA 1HT6A 2WSKA 4AYSA 3ARSA 4A4AA 3DECA 3CTTA 2K46A 1WKYA 2DSZA 1C8XA 3FAXA 4JIEA 3MU7A 5D21A 4CPBA 3WSUA 3QHNA 4W87A 4B3LA 1H41A 2W62A 5M03A 4LQ1A 2ZIDA 3EDDA 3SUTA 3WQ5A 3WD4A 1W1TA 3UG5A 1B30A 1B31A 1ITCA 1BHGA 2JF7A 5JIWA 3MMWA 3WBAA 2CYGA 3B9AA 2OSYA 4GQRA 2Y8VA 1IZJA 5ABEA 5HXMA 5AY7A 5E6ZA 1C93A 1JNEA 3MSGA 1ZBWA 1V0MA 2J78A 4E2OA 4TX8A 1KBKA 1JF6A 4GO9A 5I0DA 3AZTA 2CETA 2CBVA 2O9OA 1J0ZA 1UG6A 2CKSA 1LG1A 4V2XA 1WCGA 2ZX7A 4BQ2A 4CKQA 1UD2A 1B2YA 2X0HA 1JD9A 3AIUA 1Q4NX 4J28A 2WC4A 3UT0A 2VOTA 4U33A 4D6FA 1WDSA 1CGYA 3CUGA 2BY3A 1EQPA 4Z2HA 1LWHA 2O9TA 4FK9A 2VXJA 3BAKA 4GINA 4P7QA 1JZ7A 1W1PA 1XCWA 1C3FA 1HJXA 5BXRA 1WDRA 1J0HA 1XV8A 1AVAA 2E8YA 2YOCA 5CSUA 2E0PA 4BZYA 3BMVA 1LWJA 2VTFA 4UFMA 1LG2A 4OUEA 3VDAA 2OLHA 2DQXA 1R7OA 2DSWA 2IXUA 4XUYA 5A1AA 3ZYFA 1FHLA 2W63A 2HVMA 3PBGA 4JCLA 4QAWA 3RO8A 3GNRA 4TXEA 4PTXA 5AC4A 4UQBA 4KGJA 2CERA 3GBDA 2VNCA 2YA1A 1V3IA 2WZHA 1B90A 4M56A 1W2VA 2DT1A 5LA2A 1CNVA 4QLLA 2X1IA 3KZSA 4TTGA 3HU7A 1OM0A 1I1WA 1LL6A 2WZEA 1GOIA 3SCOA 4CU6A 3DYPA 4U31A 1CZ1A 4OJYA 3VM7A 2YL5A 4J3VA 3AFBA 3VGFA 4HMCA 3UCQA 3T2PA 3TTQA 3CBWA 3BAIA 5A3HA 3T09A 4W7VA 1V3JA 4KGLA 1PX3A 1NQ6A 4AIOA 1L7LA 4KRUA 2X05A 4ZE4A 2GK1A 1JL8A 2XVKA 3ECQA 2CHOA 1B3XA 2DH3A 3PZMA 4P7RA 2EPLX 2EEXA 3MMDA 2GDUA 3RJXA 4U3AA 3EDJA 1R8LA 2E40A 1OD8A 1KGUA 2G3IA 4GZEA 1JZ3A 4RE2A 4ZXLA 3LPPA 1E73M 1BTCA 3ZYHA 1JI1A 4WSJA 1H09A 4QDMA 3ARQA 4AIUA 3AZSA 2Y24A 1E9LA 5I6SA 4ZENA 2OSWA 2WVTA 5BROA 2D3LA 1MXDA 5ABFB 4A6SA 4LGXA 2NT0A 4PCSA 1WCUA 1NH6A 3U7VA 4B16A 1MQRA 4OBRA 2DPEA 4B9ZA 1H11A 3UG4A 1XC6A 3M7SA 4RE3A 1CTNA 5A6KA 3HN3A 1BYAA 1CXKA 1E71M 1Y7VA 3GNPA 3U5UA 1CGTA 2CITA 1UKTA 1VJSA 1QNOA 3AHYA 2JF6A 3DC0A 3NDZA 3ARTA 3AS1A 1BG9A 3VMNA 4JKMA 3RM9A 3VX0A 2PBOA 2YLLA 4LK6A 4N42A 3RILA 1HVXA 4MNKA 4MNLA 3VUPA 5GNXA 1ZL1A 2ZUVA 3WDQA 3AHZA 2EXOA 1OGBA 2BFGA 1FH7A 3ZOAA 2DT3A 1W8TA 1V08A 3HMCA 1OIMA 2FHFA 3AMKA 1W32A 1E43A 4AW7A 5D9OA 3RM4A 1KFWA 2DDXA 4TUFA 4MB3A 4UQEA 4LYPA 2Y5EA 5E0FA 7A3HA 3NIYA 4KMQA 3OB8A 1HJWA 1SYTA 1MWOA 4LXFA 4PRWA 1GPFA 3A47A 1CXFA 1HF6A 1ISYA 2VR5A 1AQMA 4AD4A 1KB3A 5C8BB 1V6WA 2BHYA 4JZ5A 1NWTA 4F79A 3NJ3A 1G01A 3S2CA 5M5DA 3UR8A 1JDCA 4XV0A 1PJ9A 3BLKA 4JFTA 3MV01 1E40A 2AMGA 3B9EA 4TVUA 5HPOA 4WJXA 2W67A 5IFTA 1OSEA 1GWMA 1Q6EA 3CHFA 3IAPA 4AD5A 2ZWYA 3AQUA 3N9KA 3K8MA 4FF5A 1B3YA 2YA0A 3ARYA 4KH2A 2G3JA 4MTVA 4YPJA 3TP4A 4FLOA 4F66A 1E6XM 1HL8A 2YDSA 1UKQA 3AS3A 3T0BA 3PTQA 1QNQA 1UWRA 4TX6A 2WMJA 1UZ1A 2VZUA 2IUZA 4PMUA 1JI2A 2W92A 3IK2A 4JL1A 1XCXA 3WH9A 1PAMA 1MW2A 4BA0A 1LLOA 4CGTA 4QP0A 2Q1FA 1U2YA 5EBAA 2A3AA 3VGBA 1J0YA 4A3YA 5A94A 3BAXA 1PIGA 5C70A 1OT2A 2CXGA 1Q6FA 1NARA 4WIWA 2XWEA 4V27A 1W3JA 3W81A 4GI9A 1HXJA 5JIPA 3LPGA 1UUQA 1K6AA 2CEQA 4JCMA 1W8ZA 2WNWA 1E55A 4J3XA 4UOZA 1KCKA 2ZUNA 1JZ2A 1HL9A 1JZ8A 2ZX9A 3CH9A 4B3KA 4DUVA 2O14A 1LL7A 1Q6DA 1NWSA 3PZQA 3EDKA 2XFYA 1KWGA 3VD7A 1KQZA 1Q6GA 5DT5A 1CGXA 2V38A 2WYSA 3FAWA 2UY4A 1I75A 3WF2A 1C92A 4L4PA 2J7FA 2WBKA 1SMAA 5E0CA 1Z32X 4D6CA 4E8DA 3WL1A 1E3XA 3BLPX 1DTUA 1M03A 3MUY1 2YKKA 3RJYA 5A8QA 4AL9A 3AS0A 1KXHA 5HDRA 1EQCA 1TMQA 2FDMA 1CECA 1JXKA 3WN6A 4GIAA 3WBEA 5CLTA 2ZICA 5DF0A 5JUVA 1L0PA 4FMVA 1MW3A 5D4YA 1E4LA 2PWDA 3IJ9A 1UH2A 1E6QM 1J12A 3GH7A 3N11A 1DHKA 5A69A 1GCYA 2NW0A 2XM2A 4Z2JA 1QBBA 4XZBA 2O9PA 3W53A 2WKLA 4U2ZA 4IPNB 3WD1A 2WC7A 4AZ7A 1JFHA 4UOQA 3BAJA 5KEZA 2WANA 1XYZA 3WNMA 4U5IA 1UD4A 1XRVA 1UA3A 2YDQA 1EIBA 2GSJA 1VFFA 3PZ9A 3F95A 1W9BM 1GJWA 1NP2A 4HZ7A 2NT1A 1JDAA 2V5DA 3WF3A 4EK7A 3CPUA 3TA9A 2D3NA 2YJQA 4S3KA 2VT0A 4ATLA 1NOFA 2XGIA 2CBJA 1FOBA 3ZJ6A 4PMXA 1JAKA 3VVGA 3KE0A 4C7DA 3FXYA 2JEQA 5I77A 4R27A 5I78A 3VD9A 4ZXOA 3WDHA 1RD6A 2A3HA 2OSXA 1E1EA 2VVSA 2WVVB 3M46A 3VMPA 3BCFA 3OZOA 3WY1A 1OGSA 4LYRA 1GOKA 5A2CA 3VX1A 4XB3A 3VIPA 3WD3A 1PX4A 1DWAM 3J7HA 3VIOA 3WFZA 2WMHA 5A6MA 1BYBA 1W8WA 3VGGA 5KZ6A 3UESA 4IM4A 2XJ7A 2JIEA 1CXHA 1VAHA 4UNIA 2J62A 3QR3A 3AIEA 1GONA 1BQCA 2ZUWA 5A2BA 2FGZA 9CGTA 1E1FA 1S46A 5FL1A 4D6JA 3VMOA 1BG4A 2WKGA 2QMJA 3OGRA 2J79A 3ZT7A 2NSXA 1NWUA 1X1NA 1K9EA 3PZTA 2PWHA 2VCCA 3AZRA 1UQYA 2WLZA 4UTFA 5DEZA 2BY2A 3GXFA 4PTWA 3CZJA 3PZUA 2JE8A 4XZWA 2J8FA 4DUWA 1R86A 1UKPA 4UR9A 1W9FA 2PB1A 1UWTA 3SEPA 1QHZA 3S6TA 3ZO9A 4FLSA 1V03A 4W5ZA 2E3ZA 3AROA 2X2YA 1V0AA 2A3BA 4W85A 3ZQ9A 2WAGA 1OIFA 1J10A 4PTVA 4BCEA 5A2AA 3RIKA 3T2QA 4AZBA 1G1YA 2ZX8A 4AD3A 1UD8A 1KGWA 2V3DA 3BMWA 1G9HA 4OOZA 2PBGA 3GDBA 1E3ZA 4H2CA 4IPLA 5E9AA 1XHGA 1LJYA 3ZSTA 4Q22A 2WVUA 3GNOA 2WB5A 2VX5A 1JZ5A 1JAEA 4WKAA 1HNYA 3KL5A 3ZT5A 5BXTA 5CSYA 3OLGA 3WMBA 4HA3A 5DT7A 5FL0A 2WZIA 2PI6A 4MAVA 1R85A 1UR9A 3WH8A 3PZVA 2XIBA 4UOJA 1P6WA 2YA2A 2G3MA 2VQUA 1TUXA 2YL9A 1PBGA 3NYDA 1GZJA 4AMCA 2BHUA 3VM5A 5CQ1A 5E6YA 2X8RA 4D1JA 5BRQA 2HISA 1BF2A 2ZUSA 5A6AA 1CENA 1ISZA 2OWXA 2Y2WA 2XVLA 6CGTA 2V3FA 2BVTA 3U57A 1OT1A 4HOXA 3WD2A 5ABHA 4GZIA 2D0GA 1GHRA 5FOOA 1HP4A 3IANA 4M29A 3ARXA 4J27A 3AIRA 4K68A 4J3UA 1E56A 5A6SA 2C7FA 2Y4SA 3W6LA 3ZR6A 1UZ4A 3WUGA 1W9PA 2WHKA 3D3AA 1MXGA 2VZSA 2VX6A 4M24A 3A4WA 3RPMA 5A6JA 1RH9A 2E9MA 3MUZ1 4U3CA 4CN6A 3GXDA 3PTMA 2VRKA 1VRXA 1H3GA 1X6LA 3VDCA 2WWDA 4OZOA 1B3VA 2WYFA 2J25A 4UFHA 1F4AA 4B9YA 1AQ0A 3ZJ7A 1DWJM 1HIZA 5CPSA 2J7CA 1MFUA 8A3HA 1ZS2A 3K1DA 3CO4A 1C90A 2FH8A 2FHCA 1JFXA 2VI0A 4WK9A 3WKZA 1GQJA 1HJVA 1QNSA 1DP0A 2W91A 4W93A 4M80A 1GQKA 4W88A 1UD5A 1B1YA 3W27A 4RL3A 1HJSA 4P8UA 2TAAA 3L4XA 1TA3B 4LK7A 3WIJA 1JZ4A 2GFTA 3POHA 4AY1A 2XVPA 3WDRA 5GQBA 4D6HA 4YN5A 4PMZA 1SMDA 1XYFA 2WHMA 3VNZA 1VB9A 4AZHA 4W5UA 3AMDA 3FY1A 4ACZB 3AS2A 1TR1A 3MKKA 2WMFA 1GQIA 1V02E 2BY0A 1FHDA 4P7OA 1CLXA 2V3GA 2XFRA 4YW6A 4E8CA 4PMQA 1E5NA 1K9TA 4DM2A 4GXPA 2DGAA 1IV8A 1HJQA 3IJ7A 4JFWA 2J4GA 1GOWA 4H8UA 2ZUTA 5D8WA 3AICA 2BXZA 5I79A 1US3A 3VILA 1B3ZA 1WDPA 1ZJAA 1UOJA 1ZB5A 5IHSA 5C71A 1UHVA 4P8XA 4DUXA 2QLYA 1UR8A 1K9FA 2O92A 3VIFA 3W37A 3KL0A 5A8MA 2PWFA 1V3HA 1GVIA 4PUEA 3VDHA 3AMCA 2J47A 1VENA 2D2OA 4HA4A 3I3DA 3LPOA 3GH5A 3VIJA 3CUHA 2E4TA 3WUEA 2GJPA 2GUYA 1I1XA 2BNJA 2EQDA 3ORJA 4D6DA 4W8BA 1UQZA 1UWIA 1CPUA 4PSPA 1H49A 1BSIA 5AYBA 1JD7A 1B3WA 4HU0A 3NDYA 1VF8A 3SCUA 1JZ6A 1OKOA 4OOUA 2DT0A 3TOPA 4HU8A 3AIWA 1E0WA 2XPKA 2BY1A 1E6NA 3EBVA 1VBRA 4X0VA 1HKIA 2QV4A 3WDIA 1WO2A 3ZM8A 2UY3A 1J0IA 6TAAA 4PMRA 4AZIA 4LYQA 1QI5A 3A4AA 1KQYA 1EH9A 2XG9A 2AOSA 4QFUA 4MNMA 2BXYA 2X0YA 3WQVA 3KL3A 2XFFA 5CJ5A 4MB1A 4LJHA 2B31A 3VD3A 1W9UA 4PN2A 4W7WA 2VX7A 4MDPA 1HX0A 4JFUA 3CUJA 1ECEA 1ESWA 1QI2A 1V0LA 4N0RA 2E8ZA 1G0CA 3THDA 3AHTA 4CCDA 3AMLA 4JHOA 3T0AA
chains in the Genus database with same CATH superfamily
2FDKA 1MZ6A 2NM1A 1HKWA 2EJ1A 2X29A 1ODUA 1TTJA 1I0BA 2ZBTA 4NHXA 3LYEA 4WY0B 3K3OA 4PE8A 1EC7A 1S0IA 2ZZJA 5L36A 1EOMA 3W1TA 3CDZB 5CXPA 2WHLA 2QDEA 2PTYA 2VUDA 1QJWA 2P4EA 3MYXA 1FWEC 3DEMA 1W9XA 4RXFA 1AX2A 2J6VA 4C0BA 2W61A 2BW8A 5BNNC 5ABFA 1KFEA 4L65A 3FLPA 5A6XA 2J7DA 1NSJA 5A95A 5GLVA 2JDHA 1S2CA 1S0GA 2PRHA 5FJKA 2JE7A 2P88A 2XZ7A 5FMOL 2REQA 2AAMA 3V1HA 3WEZA 4CEWB 3LCPA 4KKXA 1UR1A 4DBWA 3TSBA 4LX4A 2OUJA 3EDFA 1G86A 1HZYA 1TQ5A 3MW4A 1FOD3 1US2A 1RUD3 3I4IA 3O2LA 3IMNA 3WHUA 4WY0F 4JTFA 4DIAA 2WCGA 1URXA 4GMP3 3N9RA 2X8KA 1Q43A 4LW7A 2Y7DA 3AMGA 4N7UA 3TTEA 1GG1A 4URAA 2W79A 3BB6A 2VC5A 2D20A 1PZ2A 3P3BA 4GQQA 7REQB 1NFGA 2XWDA 4YVWC 4D6QA 4X6RB 3R4DB 1BKZA 1UXZA 5FD0A 1Q8VA 4W8LA 2ZZ3A 4E2DA 2NXIA 1TCMA 2CLMA 3PWIA 1K45A 5ECUA 3HM7A 4HVXA 5FYMA 3PPGA 3RNSA 2D0FA 1W17A 4BF7A 1E4NA 2FIQA 1W8SA 1YADA 1X36A 2Y7FA 2VNRA 1U83A 1UPMB 2PTDA 3U14A 1FHVA 2FTPA 3DYMA 1RR2A 3W02A 5BYWA 3KHBA 1HP5A 2LW8A 3FZ3A 4QXBA 1NG0A 4Q0QA 4NZCA 1T41A 4YWIA 1NOWA 5FUIA 3NPWA 4EWAA 3NNJA 4D6EA 2GVJA 2QJMA 1QTWA 1LQAA 4E2QA 4F9DA 8XIMA 3UGHA 2JBMA 1CT5A 2R0HA 4NAFA 1ML1A 1PKNA 1NE4A 2A3CA 4DO5A 1PZ3A 4DJEA 3CJIA 4ZEPA 3I97A 2PHUA 3K4WA 1LGNA 3HTWA 1WW7A 4HOZA 2A5ZA 4A3HA 5GKAC 3VDDA 3SUUA 3DGTA 1TJ1A 2CLEA 3S6OA 3GJAA 4Q4V3 1DQXA 4UI9L 6PTDA 2WMGA 4HLTA 3C0LA 4A42A 1RUJ1 3VZXA 1JCJA 2Z25A 3WH7A 3C2FA 1I1EA 5D2WA 3N7LA 1TG7A 4IEPA 3D0SA 3UW6A 1SPQA 2ISDA 1XB9A 1NCRC 3RCMA 4WF7A 4PYSA 1EV13 1ULOA 4O57A 4GUFA 2E9QA 5C2GA 3AL6A 3N73A 5BNNA 1J1LA 5LSMA 5LNVA 3FLUA 1XQKA 3UZ5A 4AEDC 4FPKA 4Q26A 2DVFA 1M7OA 2D43A 1MEIA 4Q8VA 4HVQA 2ZXBA 4OKDA 3TB0A 1CWYA 1HW6A 3H54A 4PULA 2TYSA 4AVFA 3HIJA 1QPKA 2D1ZA 2GC1A 3RSJA 4CP9B 2E6VA 2J7GA 2VURA 1R1A1 5T55A 4HMDA 5G5IA 1XYLA 2FZ1A 2WFF1 3H22A 1G4TA 1CPNA 4GX9A 1WAWA 2DZXA 1ULEA 2PLV3 2TNFA 1G94A 3GXPA 2RDUA 2HWB3 3V0TA 4H19A 5K4XA 2XSBA 2G9FA 2J74A 6ALDA 4S3DA 3DUGA 1VZWA 1VLNA 1XUUA 3LIGA 4LUIA 2GQ9A 4I5RA 2D6PA 2XTKA 1W9TA 5IK5A 4OTKA 4H3DA 1YXCA 3ENLA 5F32A 3UWYA 4YVWA 4WKHA 1C9DA 1AR61 1QH7A 3W01A 3HPSA 2QQWA 3CGTA 5FJJA 1P0EA 4DZHA 4GZ7A 2DEPA 2DVUA 4NI3A 3T3YA 2BBVA 3S5ZA 2CNAA 1R7AA 2A0NA 2C0HA 2YYTA 4N90A 4YVVA 4WLCA 1RUNA 3S9YA 4OULA 2IUWA 1ZQ5A 2ZX2A 1W03A 4JHZA 5FZKA 3KS6A 3VIMA 4YW5A 1LRNA 2VFDA 4B5TA 1WNOA 1UIKA 4QGCA 3TMQA 3FYYA 1ONWA 1VEPA 3GW3A 1V0NA 5E5CA 2YCKX 4PL2A 4CUBA 5JOYA 5B4XA 2KZHA 4XFAA 4C5YA 1XLLA 3QN3A 1PX8A 4BQXA 5ENLA 4IXLA 2CBIA 5J5DA 4GWIA 1HO4A 3EWUA 4Z2IA 1OQEA 4YHGA 3SCQA 4AISA 2H90A 2W2IA 2JALA 2YFNA 1AH0A 3VCNA 2ANUA 1AX0A 2BHZA 3VNYA 4H7CA 4R5EA 5T3NA 5A3MA 4TVCA 3WDVA 4LPCA 3SH5A 3CHEA 3L2LA 4MMWA 1WB0A 1VKFA 4QLKA 4P08A 1L2UA 4D7YA 1TWDA 4H6KA 1GJUA 2X1SA 4D6GA 1O6IA 1NCRA 1LCLA 4AC1X 3HG2A 2W52A 1KM5A 3F4VA 3GB6A 5G05L 4D71A 1A4LA 1FWRA 5FP4A 4UQCA 2ARCA 5FK8A 1E1CA 4H2AA 4AEDA 3NL6A 4YJ5A 1VMHA 4KL1A 1OCQA 3IJQA 1STMA 4Y3OA 1OVPA 4YW7A 2RR11 2VRQA 3ITTA 4M0NA 5E1QA 5ACA2 1S5MA 1PK6C 3WHTA 3EWWA 4HT3A 2PZ0A 2OUHA 3EMCA 3VKLA 2EPMX 1VBC3 5C9XA 2J1AA 1UY1A 3AIBA 2VC9A 3VBRB 3OIHA 1XDLA 1TO3A 1ZALA 2TPSA 1PEZA 3W1MA 2DSUA 1IT0A 1WZLA 4RDWA 1UWUA 3IGXA 2ZEXA 1N82A 4XJUA 4FXFA 1RK6A 2FVKA 1F9KA 5JR2A 1F6PA 1YHFA 1X6NA 4QRNA 4Y5TA 5U7SA 4AWUA 4JC1A 2F9RA 2ZUUA 2ZZ7A 3ITGA 2XUCA 5J5RA 1TWZA 1C9WA 1DBNA 1YUDA 1VRDA 2XMLA 3L4WA 3PTYA 4M01A 2WWCA 1AYN2 1SZRA 2R9RA 2JFEX 2F7FA 4IE0A 3QHOA 5FCZA 1IPJA 3VIHA 2Y8KA 4PL1A 1JRBA 1NQKA 5E09A 5CC7A 4ZQOA 5CLWA 1W5NA 3GO2A 1KJLA 3E5UA 5FJUA 3KUMA 1E4MM 1VP5A 5AC91 1WMDA 1MQTC 1K7XA 4GJZA 4O1AA 1OUXA 1M04A 1LBFA 3COTA 2FZBA 1UH4A 2E5BA 5KXCA 1WP6A 4L9XA 3T7VA 2VVDA 3X29B 1OC6A 5CNAA 3A22A 1NXD1 2PELA 1K3UA 3FSUA 1TX2A 3N3MA 3WJWA 2WWSA 2ZXAA 4P8WA 1BRLA 1E72M 1LTEA 5M3WA 1PKLA 5H2ZA 1KFKA 2XN0A 5D9MA 5BNOA 1OUSA 3B5LB 4CDXB 3AALA 3WLSA 1YEWA 3OGVA 2GK1B 2QCHA 1NE6A 1ASJ2 3AM2A 3MEPA 2WBGA 2CHNA 4RFT0 4RZ5A 4R52A 4D7TA 4CVWA 2VFEA 5FAXA 4CDWC 2OMAA 2XHYA 3WP6A 4JTLA 3LTYA 4UCGA 1XINA 3H4XA 2D6MA 1WXZA 4IJCA 1QOTA 1V6IA 4BE3A 4QLJA 1QNRA 3NR0A 4TIMA 3WD5A 4W86A 1E0VA 3WQ8A 1YXYA 4W50A 3R7MA 2ABBA 3MYPA 4YIWA 5GZGA 1EX1A 3T2TA 3QKEA 3EOOA 2YFZA 4IWWA 3WNKA 2ZXDA 3PUOA 1PK6A 3LD8A 1BPLB 2BV4A 3EOSA 4YTUA 2FGBA 4I3GA 4TWTA 3MJMA 4LKDA 1EJ7L 5IT6A 2UY2A 5CPTA 5T50A 4G7FA 3CMFA 2PDKA 5FZLA 4MAZA 3N9MA 2V4AA 3NW4A 3AXIA 1JUIA 4JTCA 1KBBA 4OV9A 1BXBA 4M1RA 1NQDA 1OLMA 4U2AA 1XXXA 2PHRA 4WM7C 3QPEA 1WXJA 4UMAA 2HWE3 3MMTA 5I3JA 5E1RA 5AFEA 3M0VA 5EJ3A 3RGTA 3GHUA 3ZXEA 1VALA 4HCHA 4JKLA 1MW0A 2YGMA 4ATWA 4A21A 1VFUA 3B3QE 5BWAA 1L7QA 4MGYE 2CU0A 1JDDA 3SSZA 3NO5A 3BGAA 1DQ2A 1UA7A 1MQTA 1ADOA 5LA1A 2QF8A 1QBAA 4FXRA 2P5BA 3VINA 2VMCA 3SAZA 1UKSA 3W86A 1J01A 1D8WA 3NV1A 4HTBA 1UOBA 4ZFMA 1SPPB 3CHXA 1FKWA 1DQ4A 1G5AA 1TJPA 2RDSA 4RV3A 3ANYA 4KWSA 4FLRA 2XIJA 4ERAA 5DXDA 1NM9A 2CBUA 1SEFA 3W21A 4C6MA 3NV2A 1ZZ8A 1E4IA 3K13A 2X1TA 2YUEA 4R3UA 4E4DX 3TJ4A 3UA3A 1UB3A 3LM7A 2H6BA 4EZ4A 4QX8A 1H50A 1W3NA 4NAEB 2Z1WA 4YWAA 3QW4B 3M44A 4HN4A 5A8NA 4JFVA 5FAJA 4JOMA 3UNPA 5C8CC 1EXBA 3S5OA 3U07A 4CDWA 1VPHA 1YFUA 5BRPA 4S3JA 5FYZA 1HVQA 1WA6X 5FJHA 3JQWA 3LCIA 3DV8A 3CUZA 1ZA4A 3UJRA 1G9AA 4L0PA 2CZDA 1ULPA 1Q65A 3VHRA 1OQDA 2Q8XA 5KETA 3VD4A 3AXHA 5K9YA 3RZZA 1SO4A 2RUSA 1M7XA 3TFXA 1XR2A 5EQUA 3BXWA 3GHNA 4Z07A 3U4FA 3P8IA 4B5VA 5EFFA 3CYJA 3GTIA 2V3EA 1LYXA 1W3LA 3QSTA 3TIMA 3K8KA 2X53S 2CESA 4IE5A 2VYOA 2FDJA 1TPVA 3CZLA 1OINA 3TN5A 4GKLA 2AC1A 2UURA 3WYZA 3ZR5A 2ZZ2A 3LPFA 4QHOA 2VEMA 2OGYA 3OBEA 4QXIA 2ZE3A 1JMUB 4R53A 3THQA 4OIFA 4MG2A 4AQSA 3TN91 3AXMA 2YU1A 3OLIA 4Y2WA 3OOXA 4WM7A 3VNMA 3TX9A 3SCHA 1MUWA 1NVMA 1J0KA 3N9LA 2WSPA 3FKRA 3GDRA 2YL8A 3CAWA 4J1OA 4HPHA 4E4SA 4JTKA 3SCWA 4DNHA 4CEWC 5FZ8A 1Q66A 5C3QA 1Q8PA 5JPMB 2P3ZA 1P1XA 1W3XA 3WF0A 2TUNA 3L2HA 1SCRA 5DABA 2W3ZA 2PHLA 5KXDA 3CUIA 3PUEA 4HJFA 1LB2A 3MCMA 1ZJIA 3M47A 3OBTA 2CYFA 3MP5A 1RUE3 2GVGA 3LHYA 3SY1A 2DW6A 1ENQA 2YCIX 4P5YA 1HQTA 1XIDA 2VZOA 1VMFA 2ESCA 4KI5M 1C91A 5CA6A 1V02A 2ISVA 3FW6A 3W1LA 1UP3A 4GULA 4WXZA 3VGIA 4ZO8A 1E51A 5BOFA 1MZ5A 1KFJA 1PXGA 2DT2A 1KGYA 3LEKA 2D23A 2NWRA 2YDRA 5CZKA 3ES1A 3BTXA 1E70M 3S57A 2R94A 1KO0A 2C1IA 2JGYA 4CCEA 2RGMA 2A7AA 2E68A 2IS7A 4XVEA 1RXGA 1W5MA 3AXKA 5F4WA 2F61A 3NQGA 4NVTA 4OHZA 1QVBA 2PD9A 5FR3A 4LU0A 3UG8A 3AP6A 3ZXWA 1POKA 1ULDA 3MI2A 1KM1A 5C8CA 2WL1A 1GZTA 1UYYA 4C5ZA 1U5YA 5BPXA 5REQB 5EMUA 2JEMA 2Q01A 1XYOA 3UWZA 1QJY2 1GNYA 2A6WA 3AVSA 3RM8A 1N55A 3VIKA 3EO6A 4GYKA 1T40A 3LG3A 3LLFA 5HUOA 3Q94A 1ITXA 3CLPA 3MUAA 1K7FA 4HNUA 3J26N 1QXJA 1RB8G 4GHRA 2ICSA 3VZOA 4LS2A 2D6NA 3MP4A 3ZJKA 4F0LA 3GW0A 3AJZA 5GNZA 4YYOA 5CGTA 3BAWA 4UAPA 1RVF3 4Q4SA 1AK5A 4HMZA 4GI6A 4ISRA 4HN1A 4UTMA 3WQ0A 4DO4A 1ZCCA 3UY7A 5JIAA 3VTRA 3W6MA 3EB7A 5HNNA 4PBOA 4MJ2A 5E8AA 4URIA 3ZKUA 4N6EA 2EBNA 1UR2A 3CK5A 2C0AA 4JL2A 4J7RA 1VFMA 3WQ4A 1H2JA 2Y7EA 3QSRA 1N1VA 4L4MA 1K8XA 1GYMA 5FXWA 2A6VA 2CV6A 4PFHA 1J18A 2FZ2A 2V6AA 3B40A 4P8VA 4RNHA 4HYWA 1B54A 1S2KA 5TSWA 1O60A 1OYBA 4CEWA 4FIRA 3CYVA 3BAYA 2WLQA 1PUDA 2C16A 4BQ4A 2Q8OA 3G8EA 5DMNA 3LAGA 2WVSA 3FEQA 2WPGA 4C7FA 3LLDA 2G3NA 2YBTA 1KCLA 3KBWA 1N1TA 3WF4A 5F37A 1PYFA 1R38A 1UR4A 4LR4A 1YNAA 4QXCA 4HHHA 4XF9A 1A3KA 2RDRA 3SUVA 2OFJA 2P8CA 5FKCA 1VBGA 3AYAA 2JGQA 2C8NA 1JGMA 4TMBA 4AH7A 3M3CA 1YIXA 2PWUA 3SADA 7REQA 2VJXA 3OYZA 4G9SB 5HR7A 3G1VA 1K8YA 5F4XA 4NMIA 1FOD1 3A9BA 2Z2SB 1LWIA 4NR1A 1PPIA 4UYBA 3ZSSA 1QJZA 3LWCA 1EOKA 1WBHA 1EGZA 3CMJA 4AWTA 3U7BA 5FY1A 4O8RA 5A8PA 1VEMA 4YGEA 4WJ8A 1RUG1 2NX9A 2QQVA 2VTXJ 1Q6QA 4JN7A 4FTBA 1W1A1 3RRAA 4JQ1A 4QE5A 3WSOA 5BU6A 4NNBA 4F0MA 4Q29A 2XVGA 3P14A 1OYAA 1SLLA 2PDUA 1D9EA 5IDZA 1YTKA 2ZKNA 3HO8A 2PRLA 5JLVA 1LENA 4LWWA 2GP3A 4AXOA 1W9YA 1HO1A 4YW3A 2OS2A 4Z2KA 5DRIA 3QY6A 3AYDA 1GUIA 2XJQA 5IVCA 5AYZA 3QZAA 3PULA 2RHPA 1R091 3NSMA 3WNOA 3WINE 3M6DA 2ZTJA 4PLNA 4AEJA 4H4IA 1TVGA 1AFSA 4YTSA 1QJU3 4BMBA 1HQNA 5D8ZA 4Y24A 1PM4A 2XIIA 4FPSA 1QNWA 1J5SA 3BL3A 3LU2A 3MHUA 4XFGA 3KHDA 1ICPA 3BTYA 2MHFA 1RUJ2 1VBUA 3RCNA 3F2CA 3MIEA 3RLHA 3TYZA 4UB9A 1GOOA 1HJFA 5HMEA 5HJYA 4Q7NA 1OLRA 2YLAA 1TX0A 5AYXA 3VXGA 1FWCC 2IXJA 3BOXA 4XSLA 1V6XA 1OK6A 2G4FA 3PIGA 1ZPTA 4FAMA 1ZJBA 2V9DA 3RDKA 5D2TA 1EV11 3AZYA 4E4PA 2ZZ4A 4DPPA 1GPWA 3VZKA 1H63A 1YRRA 3L66A 2QJHA 1IEVA 3Q9OA 3NDOA 3POIA 2PD5A 3VBRC 4DO0A 5LK7B 4F9JA 3JU2A 1J2WA 2D6OX 4BQ5A 3L4VA 1YQ8A 1ZRIA 3G7DA 5C3RA 3ELNA 2D69A 4Q8WA 5D09A 4DZAA 2ADEA 1OJXA 4YM0A 1GEHA 4IV1B 1QW9A 1UY2A 1RHI1 5K0UB 3RZMA 1YNYA 1T96A 3EKLA 4B15A 5JOXA 2UY5A 3AKSA 1F5FA 2D7FA 1PKMA 2ZHLA 2QPUA 2C1HA 5H9PA 2W94A 3FJ4A 2J8GA 3EZ4A 4IQLA 3STEA 3ASIA 1RMU1 1YFWA 4IEZA 1L6YA 3GG8A 5HWMA 3T1GA 2GGIA 2PLV1 4O65A 1AR62 4D6IA 4DXSA 3APBA 1C7SA 3FA4A 2YV8A 1HT6A 2WSKA 3ARSA 3R13A 4AYSA 4AU0A 4FOKA 1SLCA 1EBHA 4WUIA 3H3ZA 4YZ1A 5CGQA 4MPQA 2AL1A 3HGOA 2ZRWA 2DSZA 3PFMA 3M7AA 3FAXA 4KERA 5F3IA 3TYDA 4LBKA 3MU7A 1N8FA 2DDUA 3UV9A 5D21A 2YB1A 3SN4A 4ERIA 3VA8A 3V18A 4HSOA 3WSUA 3S83A 3WOGA 3DFOA 2A1YA 1PNGA 3PB0A 2D5HA 4JIPA 4TZDA 4GGBA 4Y4YA 3VC6A 4IFRA 2VFFA 3NRUA 3WD4A 4YGCA 1B30A 4AUBA 1BHGA 4HHMA 4CDXC 3N7MA 1WCDJ 3EX1A 1GZCA 3MPGA 5AY7A 3TN3A 3GVVA 3R05A 1JNEA 3B93A 1XRFA 4K8RB 5AVAA 4LJ3A 1ZBWA 3FA3A 1HB2A 3L2IA 2DCKA 3MLKA 3NO8A 1G4PA 3IN9A 2ZEZA 4OHYA 1J0ZA 2OT7A 2G95A 3FS2A 2VD7A 3NYZA 5DXXA 4V2XA 4P2VA 4ZU7A 4I6VA 4HVRA 3POEA 4XFCA 1WBFA 3VDGA 2YMZA 3ACHA 1XNAA 5A70A 2CSGA 2X0HA 2HJPA 3WV6A 1ENSA 1JD9A 5IRPA 2IZWA 1XRSA 4BIOA 4LF2A 4Q4MA 2WC4A 3UT0A 1QDCA 4U33A 2XGXA 1Y4WA 2RR12 3HURA 4LTSA 3J7NA 1V9U3 5FPZA 5L9RA 5IVBA 1GZGA 3VBRA 3EMRA 3TQ0A 4FK9A 2Y38A 1LU2A 3M3IA 1DCSA 2VXJA 4GINA 2V5KA 4P7QA 1HXS3 1TWIA 4RGAA 2VWSA 5FO8B 4ICNA 2YYOA 3CIXA 4DZGA 1W05A 1HJXA 2R1KA 3O0FA 4ZXKA 4I8YA 1HV0A 3U11A 3WQ7A 1YI9A 1COV3 3MSYA 4IMCA 3D4KA 1XKJA 2E8YA 2YOCA 4B90A 3KF3A 3LK6A 4BZYA 4B2DA 3PU8A 2VTFA 4FP2A 4UFMA 1X50A 4EN9B 4FPEA 1PIV3 4GXMA 3F4CA 4IGOA 2BGQA 2OLHA 1PDYA 2DQXA 3F2BA 1V00A 2DSWA 3QV8A 4XUYA 1YC61 3O1OA 3MFCA 5A1AA 2E32A 3ZYFA 2GN7A 4W6WA 4U36A 2VENA 4JCLA 2RDWA 4NJIA 4OVEA 3GKAA 4GJ1A 3RI9A 5GM0A 4NAMA 3I6EA 1WLWA 1NDZA 2VNCA 3SBFA 1V3IA 1B90A 3QD6A 1OFSA 3I7DA 5AC92 5EIYB 4TTGA 3KZSA 1D7PM 1I1WA 4RPPA 2PHXA 1GOIA 3EXRA 4X6QB 1SVDA 5FJOA 4CQ9A 3PLQA 4I0WB 3HMYA 2B7YA 4CUGA 5FLHA 1Q56A 4BLIA 3UCQA 5J96B 1W3VA 4O19A 3GVRA 3R43A 1PGSA 2AQOA 5A3HA 1NAL1 3AMQA 4AOCA 3FGCB 4CDXA 2MEV2 3ES8A 5C9RA 4AFDA 3C7HA 2OJPA 4J2PA 2X05A 4DXKA 1R3RA 2QGHA 2GK1A 4A2RA 1X97A 3ECQA 1XKYA 5EYXA 3PZMA 2EPLX 4C6LA 2EEXA 4NXSA 4OCTA 4RNIA 2ZABA 1ONEA 4OE7A 4KWKA 2E40A 5D05A 3L0NA 4YMZA 5FWEA 4GZEA 1U5VA 3LPPA 2HPIA 5CBIA 3ZYHA 2B45X 1JI1A 1H09A 5E89A 2EAAA 4AX6A 2PLJA 2D98A 2FMDA 4AI3A 3EA2A 4R9CA 1QU0A 2NQ9A 1XIFA 1ALYA 2V4VA 2YC4A 2OSWA 2WVTA 4ZQRA 2D3LA 4PTNA 4DQAA 4NX0A 5LNUA 1VHCA 5KZEA 3W1UA 4KFOA 1W6OB 2ARAA 1S0DA 4PCSA 4DELA 3U7VA 1UIOA 2FZ9A 2DPEA 2PLKA 4B9ZA 4RHV3 3FA5A 2E7TA 4ATEA 3UG4A 1N2VA 4FXJA 1XC6A 3CV7A 4U4MA 1R2SA 4RE3A 1CTNA 5TNVA 3S0MA 4PFMA 1E71M 2VEPA 4QS6A 3WXPA 3HGJA 3GNPA 5FF2A 4YFWA 1IKPA 3H7YA 3MUXA 2RG4A 4DIQA 3P6LA 4UXAA 4UTHA 4GJYA 1R5YA 1OMIA 3JBG2 1QNOA 3AHYA 3B0YA 5FI8A 3DC0A 3W7JA 1VCFA 1EJXC 4GWNA 4HANA 1LRTA 3B97A 2QCCA 2WR9A 4A3ZA 4W9TA 2YLLA 4LK6A 1S2VA 1RUC3 1I3HA 4MNLA 3GUWA 1AX1A 3AZZA 1VJIA 4MF4A 1RZMA 4ZO7A 3VI2A 5T26A 1ZL1A 1KQRA 1VIWB 1GVOA 3WCZA 2HWE1 4K2SA 2EXOA 3MIGA 4P9LA 1FH7A 1OGBA 3ZOAA 2BOFX 3O05A 3ABZA 1TZ9A 1V08A 5FYBA 4ILSA 1OIMA 1E43A 3P82A 5FA5A 3SRDA 1A0DA 3AYCA 2RS33 3RM4A 1SPPA 1KFWA 2DDXA 4TUFA 3OOQA 4I30A 3BVCA 4B29A 1L2QA 5HI0A 4KMQA 4Y8EA 4XJZA 4DNYA 2DP3A 1MWOA 2WZ8A 4PHZA 4NASA 4MYEA 1U1UA 4IQJA 4AHPA 1VE0A 1F7BA 5JMCA 4NJKA 4EXAA 1V6WA 4JZ5A 4NAEA 4LYKA 4KIRA 1SUXA 3S2CA 5KC5A 1JDCA 2R061 1Q2RA 1PJ9A 4EWEA 5C4WB 4JFTA 2MNGA 3MV01 1TRDA 1ZNPA 1E40A 2VHLA 3UQNA 3SH4A 1ZBA1 3VHPA 4WDUA 3RZGA 1DZQA 1S2AA 4FZIA 4ROPA 2HBXA 4HK5A 3UPMA 4GC3A 4J6GA 2YROA 3L5LA 3ACLA 3CHFA 4BCUA 3I59B 1GZ1A 5H9QA 4FAGA 1VAVA 4AAXA 2ARBA 2X30A 3ARYA 3NNLA 4KFPA 1IS5A 2PP3A 3KCXA 4FFFA 1H1YA 4YPJA 4K1WA 2ZX0A 4QGNA 3BOWA 3LI1A 1ZJHA 4PF5A 1CAWB 3D46A 2YDSA 4Q0UA 1UKQA 5GLWA 1MO0A 3W1QA 4NZ3A 3KQRA 1VRH3 3AS3A 3MKCA 4BEUA 2EIDA 4QGLA 4IPIA 3IGHX 4QR6A 3FJSA 2VZUA 1DIWA 4V1PA 1TMF1 4AVCA 3B05A 3PTRB 3LCWA 1JI2A 5E93A 4O9GA 1Q6LA 5I0TA 3TN92 5FYYA 3MI6A 1PAMA 3W59A 4BA0A 4CGTA 4QP0A 4ZU4A 2Q1FA 5EU9A 2A3AA 1J0YA 1WW4A 5EBUA 2QUNA 3H50A 5C70A 1C8M3 1N3PA 3JB4C 4WIWA 4A2SA 4ADUA 5A3OA 4GI9A 1HRI2 1OFQA 4Q6XA 4KEUA 5JIPA 1XG3A 3ME2A 4NJGA 3LPGA 3RK8A 1UUQA 4JCMA 1W8ZA 2VMEA 1WDDA 4GJIA 3I2GA 4UOZA 5RUBA 1KCKA 4IIHA 4B3KA 2HS8A 3T05A 1GTHA 3PR2A 4FNPA 1LL7A 1VPYA 2XFYA 1DBTA 1KWGA 1Q6GA 4LOCA 3I2JA 4XZPA 2XONA 2FJUB 3FAWA 2RS11 3OG3A 1K5JA 2J7FA 1PWMA 1S5WA 1XW8A 5E0CA 3L7RA 1DHPA 2Y6GA 2ZPXA 1E3XA 4LNYA 1KFUL 2ZMLA 2Q02A 4FOWA 3F7JA 3OTRA 1DTUA 2FFCA 3OYWA 1GVFA 4FPOB 3E6BA 3HOBA 2YKKA 1J2BA 3RJYA 4D94A 3PVBB 3U37A 2B5HA 1ZRQA 4EWJA 5T5LA 5FCCA 4JYEA 1SLBA 1YMYA 4GIAA 3WBEA 2EKGA 3G0XA 1KS4A 5C5YA 4YGBA 3UYJA 3LOIA 3ZSEA 4HBNA 4L92A 5JUVA 1L0PA 1MW3A 4RPQA 5REQA 2R041 5D4YA 2PWDA 2ATFA 3M0LA 3LF7A 4XF4A 4QDPA 3S9IA 2XISA 5LCWL 5FPBA 1E6QM 1QOQA 3G1AA 3N11A 1SFLA 4JX4A 1EA0A 2VELA 4I0AA 4EZHA 4J4KA 1N1YA 2XM2A 1W8NA 4LO7A 4HA0A 3WQDA 2O9PA 4MOAA 4C91A 3FYOA 3SNMA 1KRBC 4D8AA 4HT1T 4NROA 2GGHA 4HB7A 1LP6A 5I3IA 5J48A 3WLNA 1WD4A 5FESA 5JH2A 1NFPA 2XLGA 3AL5A 4AYGA 1QQP2 4XXPA 1OA4A 5KEZA 5KBFA 2A6ZA 2DUOA 2K0GA 2DWRA 1R2RA 2PS2A 4WVVA 2A85A 3LA7A 1UA3A 1VFFA 1W9BM 4I5XA 3WF3A 4AVVA 2B7NA 2JDUA 3TA9A 4TV5A 4ZQCA 1RY0A 3C2OA 2WZPP 1HRV1 2PAKA 4GISA 3E2QA 1RVF1 1PZ9A 1PYMA 2XGIA 3ID7A 5DMLA 4PMXA 4QB6A 2YZ4A 5LATA 5FF4A 4XZHA 4NHLA 3KTXA 3SXWA 1RBAA 5I77A 5I78A 1BXNA 2VMHA 2J13A 1AL0G 1MEC3 4RN5A 3WDHA 1MS8A 3ZKYA 1SJAA 1B35B 4NUBA 1QT1A 3OZOA 3WY1A 1NLSA 4LYRA 3EOEA 3GYDA 1K70A 4XB3A 3AJYA 2ZOEB 3OTFA 3J7HA 4P61A 2IPJA 5CYYA 1O8PA 4K37A 1OZMA 3TQVA 5A6MA 5CPOA 1O4UA 4IV1C 4WDTA 3WLQA 5K0UC 3VGGA 1ULGA 4W6XA 1RJRA 4N4QA 3MBDA 2QS8A 2VC7A 1R083 2JIEA 4CNSA 1ZREA 3IBMA 2J62A 5EPDA 3QR3A 3DFHA 4PCFA 1Z7S1 3INPA 5A2BA 1FOD2 1RUD2 2FGZA 1UP0A 4EN8B 1IZ3A 4RE0A 3WQBA 2POTA 2BJSA 3VMOA 4R9BA 2WKGA 3GHTA 1IGSA 5EJZB 2QMJA 3OGRA 3DEQA 4AX7A 2VWTA 2NSXA 1NWUA 2FD8A 4F2BA 4EQVA 1A50A 1UPIA 2H8ZA 1BMV1 1XIMA 1W99A 4INDA 5DEZA 4IGHA 4H9XA 4I5UA 4FB7A 3W3OA 3GXUA 5HANA 3URQA 3FLTA 3WLRA 4YZ3A 3CZJA 4JN6A 2JE8A 4PJYA 1FWBC 1CVNA 4XZWA 3H6OA 5HAOA 4DUWA 1R86A 1QHZA 2HRWA 3KF5A 3WQ1A 2V8ZA 4FLSA 2XH7A 1V03A 3W85A 4S3GA 2X2YA 2A3BA 4W85A 2YU2A 1TV2A 3ZQ9A 2ISSA 3VNLA 1R092 4EN6B 1VBE3 3AU2A 5A2AA 5FQ0B 2B7PA 1W0PA 2GL5A 2HWGA 1MS5A 2P3YA 1FWDC 3DKWA 5T5PA 4ZO6A 1X8CA 2NV9A 1G9HA 3N2XA 2PBGA 3GDBA 3RR4A 1W39A 3VFCA 4AQTA 2HVNA 5H6HA 4L11A 1G9DA 4Q22A 1TSIA 3C56A 3H8OA 2IPFA 3GNOA 2DQWA 2WO3A 1JAEA 4WKAA 4DY1A 3H2MA 4Q4Y1 1VCVA 1IS4A 3KL5A 5BXTA 3NWKA 5FK7A 5MHBA 2XU2A 3QY7A 4Q4V2 4GIRA 3GNEA 4KPLA 1H2KA 5LHFA 3N6HA 2WZIA 2PI6A 3M1ZA 4MAVA 4FCAA 1R85A 1XRUA 4QM8A 3WH8A 4UOJA 4HSNA 3CQKA 2YA2A 3WLTA 1TUXA 2EAKA 2PFWA 1S55A 1EV12 3B0XA 1XM3A 3G3DA 2V0TA 2ZUSA 1UMLA 3ZVIA 1CPMA 1CENA 1ZNNA 3C0QA 1UASA 3XINA 1QJX1 3OQ8A 2XVLA 6CGTA 2V3FA 2BVTA 4KS0A 2BGNE 4QQLA 5K0UA 1PMHX 3ZFGB 4GZIA 1DQWA 1FY6A 4M7SA 3KRSA 1GHRA 4XVHA 2EPHA 4GC4A 4ATFA 2GNMA 3IANA 4M29A 4J3UA 3AIRA 4K68A 5FP9A 1MACA 5JMUA 3W6LA 1WOBA 4H7ZA 3ABXA 1U5XA 2J9YA 2E26A 1RMU2 3D3AA 2VZSA 2PLV2 1FWJC 1F15A 4QE4A 4E4ZA 3ZYGA 4MY1A 3OJBA 5A6JA 3PUAA 1CW2A 1WKEA 3GXDA 4PDWB 2VRKA 3LHWA 4YRDA 1XSQA 3FEMA 1XIIA 4PI2A 1BKHA 2WYFA 2J25A 2OVLA 4UFHA 1FCBA 4B9YA 3QBUA 3THPA 4MUVA 3E0WA 2J7CA 4XD6A 3TYCA 5J1XA 4ONUA 3U1XA 3BLIA 3CO4A 4LSBA 3HPAA 5J8LA 2FHCA 3WJYA 4MSSA 5DG1A 3WKZA 4OUSA 1GQJA 1W6TA 4FF7A 1PTDA 1FNYA 1QNSA 3DFTA 4BMEA 3GNXA 1O8SA 2W91A 1W06A 4M80A 4W93A 3V64A 1GQKA 4W88A 2BGOA 1B1YA 3W27A 1TPDA 1HJSA 4P8UA 4A35A 2I7GA 1B3OA 3NQDA 1TA3B 1EWDA 2WQ4A 2BQPA 2RS53 4LK7A 3WIJA 4PIYA 1QU4A 4ZZ8A 2AGTA 4PIXA 3WDRA 2XHNA 3VYLA 1SMDA 1GANA 3BLDA 3LDVA 1FDJA 1R3TA 1H8TB 2EVXA 1TMLA 3AS2A 3GDLA 3W7MA 2Y0OA 3MKKA 4BXSV 2G0WA 3W5MA 1H1ZA 1GQIA 5A33B 4HL0A 1A5UA 1M7JA 4PRRA 5AECA 3BK0A 2ZFAA 2EIEA 5FV3A 3KOZA 1E5NA 1J3RA 4FFHA 5D1IA 1AG1O 2R073 2AKZA 4DM2A 2DGAA 2MNRA 4IIGA 1IV8A 3R25A 5HULA 1DGWX 3QACA 3MIBA 3ZXAC 2PZNA 4JFWA 3PG9A 3P62A 3B3DA 2W9XA 2WN3A 3M0XA 3RN6A 2HXUA 1VBD1 3H70A 3AZVA 1US3A 3EWXA 3NJYA 4IFKA 1WDPA 3G0UA 3PVOA 3V7PA 3PJWA 1FMD1 2ASHA 5C71A 4GWEA 5I02A 1SHWB 4UNLA 4P8XA 2YBKA 4CU9A 2GH8A 3VBFB 1OQ1A 4ZQPA 3FWEA 3WG3A 4TLGA 5A8MA 2B9VA 5A3TA 3RZHA 2ZCGA 2J27A 3AMCA 5LIUX 1VBC2 4YNGA 4HA4A 4NRPA 4S23A 5J37A 3VIJA 1AJKA 5LB6A 1COV1 2OPJA 5K4ZA 4GWMA 4W8BA 1Q8JA 1GYNA 1EJRC 1UWIA 2FB3A 1LHWA 1J6PA 2VNVA 1M7PA 1EFZA 1B3WA 4LKSA 1P6BA 2CZEA 3BLFA 3NDYA 4H8NA 1OKOA 3OUHA 4OOUA 2DT0A 3TOPA 4HU8A 3N4AA 1UN1A 2BY1A 3EBVA 1X38A 3WDIA 1XS2A 2UY3A 4LCSA 2R1LA 4QKFA 1V7AA 3LX9A 1J96A 2WSUA 1QI5A 2Q71A 3WK1A 3R94A 3RR1A 4Q8TA 1EH9A 3UXAA 1RD5A 4MNMA 4FO9A 3KL3A 1DGRA 5CG9A 2XFFA 5C9UA 5GJ6A 3W2JA 3TQKA 3VD3A 1I0DA 3W76A 3DXIA 1PZ1A 4IIFA 4NHVA 4AHQA 3WJZA 1P0DA 4MDPA 4O1CA 5C4WC 2DVBA 2QCFA 1ZSXA 2J22A 2NYYA 2A71A 1HX0A 1IWPA 4F0RA 1ZVFA 3EX2A 1ESWA 4WBBA 1XSRA 3HAGA 4Q2FA 2J7MA 3TXZA 1GG0A 3THDA 3NZRA 3O0WA 3GD6A 4GK8A 5A6YA 4E9KA 2HXTA 5FY5A 1IXQA 3HEIA 1IOAA 4W6YA 5CISA 3VZMA 2QPSA 2O9RA 4X0NA 2XJVA 1H9PA 3LCLA 1OFNA 4U2YA 1NLRA 4BPZA 1A5MC 2K2SA 3J8F1 1W2OA 4DBSA 2QFEA 3T0CA 2ZUMA 3O12A 1W6OA 2H3DA 1JYXA 3OVGA 3THAA 2F38A 1Z78A 2XGZA 4EAMA 3INAA 3BN6A 5DUXA 3VD5A 5FY8A 4HG6B 3FOKA 1ISWA 2VGBA 2Y6JA 1I2PA 3A4JA 2VMIA 1V6MA 4FPHA 1RUH3 5K4LA 4AR2A 4MGQA 5AKQA 1SZFA 3U4XA 3AP9A 1DGLA 1NT0A 5DBUA 1W2PA 1ITQA 1XF0A 3WG4A 3GZEA 3GH4A 3M43A 1BWLA 3ZN5A 4JHMA 4BF5A 2ON3A 3NL3A 3W7QA 1OWQA 4C6PA 5HWJA 1B4KA 4GYPC 3R0RA 3LZ3A 1JG9A 3UJFA 2JKPA 3OA5A 4MX3A 2CIPA 4GFIA 1QIQA 5C3OA 3EMQA 2ZEYA 3MP3A 4AGVA 3CEUA 4NAOA 4X9YA 1MQPA 3PZIA 3R10A 4UQDA 1VIWA 1PO9A 2DURA 3L5MA 4NRQA 4ZB0A 4IP5A 5DO8A 4M1BA 1J9YA 1U0AA 3MBFA 3ZN6B 3W22A 1O68A 3VOIA 2VZ1A 2X7WA 4C1WA 4MFEA 1IEIA 3M41A 3IGUA 2YIHA 2HWE2 4HKLA 3R11A 2ACRA 4ZTYA 1OD0A 4YM2A 3N1AA 3GTFA 4CD8A 2P8BA 1EUNA 2XLAA 1NDVA 1RUC1 1WCQA 1YFXA 2IKHA 4N6FA 5D2XA 3VCRA 3P74A 2C18A 4IICA 1SFPA 1KR0A 1WZXA 4GH4B 4PI0A 1LOCA 2B46X 3P3PA 1FQ0A 1DJWA 1GGOA 2GQ8A 3E2SA 3OHMB 4DM1A 1LROA 4XIMA 5SV5A 1JUKA 2J9XA 1X8FA 3A0KA 2RS31 2YBVA 3W28A 3WLPA 3KB5A 2TSYA 1W3HA 1TREA 4UW3A 3C3NA 3M16A 3G6LA 5C4WA 4PCNA 5HPCA 1KC7A 1G7UA 5F5AA 2GDQA 2Z2UA 4EPKA 2VEKA 7ENLA 1M06G 2NSOA 3T2OA 1QOXA 1HTIA 3ABQA 1QWKA 1W9VA 4CCCA 3J9SA 3APGA 3I59A 3SN0A 3UP8A 3NUKA 1Q6CA 1EDQA 3FJNA 4FOYA 4NIIA 1L9WA 1CDGA 3I2FA 5FZ3A 1R30A 5DMMA 2J66A 2Z69A 2BTVC 4XBQA 5F5CA 1ZZBA 4TTUA 2D6LX 1YE6A 5AVHA 3KLSA 5F2IA 1AL21 1H1IA 3FX4A 4ASLA 2O7QA 3HGSA 1CAWA 2ID4A 4OV4A 1FT9A 2A5HA 1PB0A 2VGGA 2Y6FA 3O1SA 3K4ZA 3B7MA 2GYIA 3QF0A 3K4DA 3OSDA 1PO11 1D2QA 4UCFA 5DFAA 4E4HA 1FPN3 4GCXA 3H23A 3OZPA 3RX4A 3CBNA 5XINA 1LOAA 2OU4A 5I23A 2CGNA 3H2NA 4B4QA 1VEOA 3N9PA 4XAYA 4XAAA 4D6SA 4HZ6A 2ZGUA 1J6OA 1DYPA 2OKOA 1OX5A 1YNPA 4QKBA 3BCWA 3ZR4A 1NU5A 1NF7A 4GYPA 4EIVA 3R5EA 5C3SA 1W0MA 3MYOA 2I9UA 4Q4OA 1AXZA 4BM8A 3T40A 1FI2A 2OZTA 5FBZA 3FIGA 2O4MA 3MDWA 4S1FA 3NQ7A 1BGAA 1OCJA 1B35C 2PDWA 2QQIA 4DB7A 3U4SA 4HETA 2GVYA 1TVNA 1JGIA 3APTA 3ZYZA 3MQTA 3QC0A 2WCSA 1N47A 2OODA 2C13A 4GNVA 3VL8A 3GZAA 2IFRA 1O3QA 3BC9A 3WNLA 1C8M1 4LBSA 3W2MA 3FK4A 1PMJX 3A12A 2B8MA 1PO21 3FHAA 3A6OA 3ARRA 1S1AA 4ML4A 4GUGA 1NFBA 1W6NB 4CLMA 4IV3B 1H5YA 1VYPX 3TA6A 1EGVA 2RS12 1Z44A 3SCNA 4ADTA 4PMYA 2I9EA 2EAWA 4FPCA 5C9AB 2PAMA 1TPWA 1M6JA 2J1UA 4UW4A 1BFNA 1RJ8A 1ZTVA 1H7WA 1FFQA 1ENXA 2PF0A 2VR2A 5A8OA 1E6PA 2G97A 3E0LA 1QI0A 2Z7GA 2GWGA 3USSA 1RUE2 4LAKA 4TQTA 4N4PA 2RM21 3I2HA 3FVDA 5CG7A 1R3SA 3PJXA 5GPRA 3BW2A 2D3PA 3PBWA 4L2NA 1HN1A 5T54A 4KCVA 1GBGA 1U1HA 1BK0A 5BCAA 1YDNA 2EXKA 4B4FA 3WK0A 2DVXA 2Z0IA 4I7UA 5K9XA 2BBAA 3HA1A 1XQLA 4L4LA 2BYVE 5LBFA 3PN8A 5F1VA 4JGZB 2Z1KA 1E5JA 2V5CA 3F4WA 3PS7A 5ABGA 3EYPA 4XZUG 1RUI1 1EP3A 3QLQA 3LSDA 2Z1SA 4B1LA 4UZUA 2NQ5A 3U2ZA 3CPRA 3II1A 5JOZA 1SO6A 4JRLA 1REEA 4MJ4A 3N13A 1IZKA 4L7ZA 2QQJA 3I7SA 2AYHA 1HKVA 1ZM1A 3BODA 3W25A 2D6KA 1VQTA 3EB2A 1J4EA 1F6KA 4DBUA 2OEJA 2VUYA 3U5YA 1LHUA 1TTQA 3P84A 3LCFA 1HRV2 1ZBVA 3O8AA 3KRBA 2C6QA 3TAOA 3P67A 5HWNA 3WR0A 3KWXA 3RHGA 5I07A 1RVF2 3C5QA 1UXXX 5HINA 4ZS2A 4N9DA 3KVBA 4LLFA 4DFSA 5IFPA 4FNQA 3MLLA 4PMDA 3CHDA 4EACA 2LM3A 1WLDA 1B35A 1RBOB 1OH4A 1U5JA 3XIMA 3WG1A 1JUEA 4IDZA 2JG9B 3ALFA 4CXXA 1H8VA 2QQOA 4XF1A 4AEEA 4C90A 3O0VA 1OQFA 3VDBA 3ZX7A 3CL8A 2QHAA 1W0OA 4WSKA 4ZONA 1LQ2A 2PA7A 4XO7A 4EWND 3GDKA 3D82A 4PEEA 5D9PA 4FAHA 1QPOA 1AJOA 2JEPA 1DXFA 4XDQA 1OPOA 1XYNA 2XUEA 1Q5MA 3PHMA 5JBFA 4UTUA 2NZ9A 4WHBA 2QVSB 4Z0SA 4XTPA 1W1VA 2Q8ZA 3L4YA 1LOQA 2DZAA 4Y9MA 1NKGA 3W7DA 3RYRA 5HNTA 1WUVA 4HGXA 3ARPA 2DUAA 1KR1A 3KT1A 3HFYA 1S2UA 4QCFA 5DLCA 2F4LA 1GKQA 1EPVA 3QOPA 5DY3A 1HX6A 1AYM1 1QWGA 3GALA 3ARZA 4HTYA 1ME7A 1ISXA 1O4TA 2F6BA 4WX2A 2YGLA 1BMV2 2HVOA 3WQWA 5FTTC 1E15A 6XIMA 3W1AA 1IQAA 2FHRA 1C7TA 2I17A 2YHJA 4AZ6A 1XU1A 4KWUA 3OY8B 2WMKA 5HNRA 4AZCB 3C7OA 2FH6A 2PODA 4HK7A 3WBYA 1YRZA 3MC5A 3NQMA 2YCLB 2VZPA 3Q4DA 3ZOIA 1ZBCA 4IIEA 3WQGA 1P4CA 1ZU8A 3ETQA 1W56A 2BDRA 1LR5A 2BWAA 1ST8A 4C6KA 3PURA 1UOKA 1W9WA 2DJXA 4WEVX 1H8TC 2R8WA 1VCGA 2XL9A 1TPH1 5A32B 3RPQA 1FCQA 1RLCL 4LUSB 3M0KA 1K8ZA 3AWNA 1ZBKA 2OWWA 3ZFFB 1LQ0A 3BOPA 1YJLA 1YYAA 2OR2A 1W9SA 2FPTA 1Q7ZA 3W9AA 2G3FA 1DJHA 4UT5A 2J7BA 4CD6A 3PC0A 1JYWA 1QJU2 1MDRA 2VFGA 4OI0A 4DRSA 3MO4A 5EKYA 4C65A 4D72A 3S47A 3UG3A 4MXWB 2P0OA 3J4UH 1NX9A 4OT7A 4UFLA 3T8LA 5KR7A 2FCVA 2IWGB 1G8WA 4KBBA 4GBUA 2VOKA 4ATDA 1AR71 2ADAA 4GQGA 4P9WA 1Q3EA 4LV4A 2LS6A 4BI7A 5BNQA 1GNXA 3QLLA 3VBFC 1TJ0A 1QJX2 8CGTA 3SQOA 2VZVA 1UY0A 1A8DA 2DSKA 2R1NA 3S1VA 2YPIA 1OX4B 1PSCA 4LBUA 2EGZA 3QHMA 2EG7A 3WW4A 2P6HA 1VLWA 4FXGB 2QQ6A 3T08A 3AC0A 4PC8A 3AYEA 4CDQB 3LCXA 1JPMA 5CVRA 3H3UA 1OGGA 4CNOA 2ZWZA 3GM8A 3ZIZA 5FSEC 5CKNA 1BLZA 3E74A 5IBXC 3TC7A 3UCCA 2YZRA 1YE4A 3GY1A 4UZSA 1L8NA 4XUOA 3QBQA 3PHAA 2J1VA 3ELFA 3T44A 3O1NA 4X2RA 2YFOA 4YW4A 5AFDA 1G69A 1H2LA 4H14A 2G5WA 1D2SA 1ZY9A 4XUGA 4MHRA 4NT0A 1RL3A 1WD3A 2ZVIA 2OQLA 1FX5A 3N7JA 3AJ7A 3DN5A 1AH3A 1GK8A 4QSHA 3STPA 2CWMA 3ZPYA 2GJRA 3PBVA 1H5VA 2CHRA 3WP4A 3IVUA 1TA3A 1W2NA 1RALA 2FMNA 2FDGA 1F9CA 4YVXA 3UYCA 1U5ZA 4FNTA 2A70A 2VFIA 3VOJA 1C5IA 2TEPA 3V65A 4KCUA 1H8TA 4GKXA 2QQPA 4L1GA 3E2VA 4K39A 2PWGA 1L6GA 5AC5A 1AR81 2C9AA 3RI8A 3CKHA 3TONA 4AFMA 5A33A 2VXNA 3APYA 1LKNA 1HKDA 4MY8A 1KXVA 4QJ4B 4IEYA 2QR6A 5DZFA 3ALGA 4OHQA 2YB7A 1J5TA 3HPNA 2GC3A 4DO7A 3OBAA 4BZ4A 4AQ2A 4LKFA 2X1UA 4XJ9A 3LY0A 4XF3A 3ARWA 1D3GA 1JXJA 4LOTA 5DUWA 5LRSA 3H7VA 2I5IA 2CLKA 4A41A 3ZS4A 5HMFA 2HBVA 2QGYA 4BU2A 1M53A 2F6UA 4HCLA 1I2RA 1SACA 3WUFA 1HN0A 1JVNA 5LEJA 4Q8UA 4S2HA 4NRSA 2OLAA 4HFSA 2VY0A 1TCDA 2V82A 1QR7A 1JYVA 3I2KA 2J8TA 1VBD2 3NAVA 1FH9A 1YX1A 1FFRA 1NDWA 1RUF3 4COYA 1GOQA 4NHKA 4BLJA 5EXOA 4IGQA 3RMEA 2EIGA 1POV3 4ACYA 4WM8B 1FWTA 3VBFA 3CU2A 5GZDA 5AOUA 4GZJA 1OABA 2NQJA 2JIWA 1AVBA 1W2TA 4O4VA 3V75A 3FXGA 4M6VA 4RNFA 2E5CA 5BV6A 3MZNA 1I9CB 5HATA 2OYZA 3NQAA 5DZEA 3IEBA 4FLQA 3BH4A 3F2DA 2YYUA 5FF3A 5BRBA 3BJTA 1QEXA 1CIUA 1D0GA 1E5IA 5IBXA 1JOJA 5EPAA 4Q4QA 1COV2 1UZ0A 4Q4X1 3URBA 5F9TA 5FZMA 1KXQA 5AFBA 3ZXKA 2QXWA 1OFOA 3KT4A 5KHHA 2WA3A 1HJUA 4XACA 3P61A 4GYFA 3E5BA 4Z8BA 1F73A 4AHYA 3WO8A 4LBJA 4CQBA 1CONA 2NX1A 1NP0A 2G19A 4YVPA 4A6OA 4GH4C 2D22A 1W8FA 2BS9A 4K8FA 4RS5B 2E9LA 2Z2AA 3MUCA 1X6UA 3P5BA 1H0GA 1DJQA 4YG3A 4YSFA 3POYA 3U75A 3SURA 2NUXA 3M6YA 2PDMA 5L7OB 2YX0A 3W0KA 2HV5A 1ZRFA 1GSLA 1MNSA 5M0TA 5DMYA 4KBXA 1ZRDA 2YXOA 4M4RA 1K77A 4MVAA 1OF8A 2DH2A 3WEMA 1DLLA 4NIGA 2B0MA 2PPGA 3KS5A 2VGFA 4MADA 3AK0A 4H8VA 3LDBA 5EL1A 4OYUA 1R1ZA 3RUBL 1LHOA 3QR1A 3SC7X 2QQNA 1LRQA 1VFOA 2WCAA 3ONBA 1UOZA 1YYNA 1GFF2 2VM9A 2ZBJA 4JDNA 3QGVA 1GHSA 1GW1A 2YDEA 3N34A 3G6JB 4F48A 4RGGA 1IG0A 5I3HA 1TPEA 3PTDA 1XGEA 3HQRA 2GJXB 3GTHA 1REFA 4B91A 3ALQA 1RQEA 5JBDA 1F5JA 2GJLA 3FNDA 4EXQA 2X09A 5L19A 1UBPC 3J8F2 1ZLPA 3AFKA 3D0CA 4EF9A 3WNNA 1W28A 1JODA 2DBIA 1UKOA 1S0CA 3VZYA 3R79A 2IC1A 4NKCA 3IUDA 4RZ4A 4DYEA 1FATA 4OUMA 1XNKA 2ABAA 1B57A 1YBQA 2DZBA 1RCQA 3OQEA 5A6TC 4LC6A 4LLOA 1JYCA 3OG2A 2PHTA 4QPWA 3G1FA 5FXXA 1IXOA 3NXFA 2DBNA 3RS6A 2FVMA 4PQQA 2PDQA 3JW7A 3TV8A 6TIMA 1Y0EA 1BTMA 3REQB 3HPZA 3GNDA 2FYMA 3W26A 5EP9A 4RHV2 2P3KA 1LOBA 3RPDA 1XBXA 3PBMA 1ZFJA 3NZPA 4W7UA 4WVWA 4WDWA 4DY3A 3T0DA 2X40A 3IV3A 1AF9A 3ZN6A 1H6XA 2CLPA 4LHSA 3HV9A 4CEXC 3WLJA 4FFGA 4CU8A 1TFVA 1XE7A 1YO8A 2D5FA 1LHVA 3L23A 2YXXA 4IUOA 4BF9A 2P1FA 3HPFA 4XDOA 4AWEA 2P5NA 3V5CA 3VZNA 3ITYA 4MO3M 2I74A 4GB33 2W66A 4DXVA 3BGGA 3H9AA 1ZA7A 4CA9A 4IV3C 1TVPA 3MF6A 1RUC2 4LMFA 4PMJA 4ET7A 3AP4A 5ACA1 4GH4A 2VKZG 3KLLA 5CPQA 4P9IA 5C9AC 3D6EA 2J42A 2CNCA 3O6CA 4IISA 3WH5A 3E2RA 4Z17A 5CC5A 2Q5TA 4XF0A 1JW6A 1EIXA 1WUEA 3SQLA 1DLCA 3IDEA 5EMYA 3GTNA 1CD3G 1V70A 2UWCA 1AUSL 1DJYA 3NTYA 5CKMA 2PF8A 1V93A 3QOKA 4UBPC 2RS32 4F8XA 1UYXA 4PCPA 4HNTA 5A7SA 2BG5A 2V5JA 3NOEA 1A5CA 5F2SA 1VPQA 5EYYA 5CPMA 3DHPA 4K38A 3LGRA 4JNYA 4LUTA 4C6QA 3R2GA 1CESA 4OUIA 2DUXA 3ZYPA 1UP2A 3C8NA 1NAEA 4COZA 5I24A 3BLEA 3ZT6A 4JGZC 1XBFA 1YW1A 1VR3A 2WW5A 3NZQA 4I2OA 1RHCA 3BPWA 1D7FA 2D0HA 4AFBA 3U2EA 1OLQA 2GDFA 1QHOA 1GP5A 2F84A 1RP8A 1M4WA 3SFWA 3TLLA 3ZVHA 1WBJA 2EF9A 5C7GA 3M64A 4J3ZA 1CGUA 1I8JA 5GVJA 4NWVA 5ECVA 1ADDA 1CZVA 1VBJA 4M6PA 3FBMA 4O54A 4UFKA 2V81A 3VU2A 1O7AA 3ICJA 1AQHA 4D3WA 3TTYA 4XD5A 5A7WA 2Z5WA 1D2KA 2ZZQA 1LCOA 2AKMA 4ZXEA 4NWWA 3ANVA 3DHUA 1XLBA 2P53A 1M01A 3SJ3A 4W84A 4FQZA 4DXRA 1GVQA 4GKTA 1FTXA 4JRAA 3E0IA 3KCLA 3WLMA 1Z9AA 1K5MB 1GORA 5LGZA 2Q3OA 1GLHA 1VRH2 3ACFA 1YDOA 5BZAA 4HPJA 3GC2A 4JQTA 4X8NA 2CWNA 3POCA 2XBO1 2QMKA 2PDXA 2JG9C 1H1AA 2JKXA 1OFBA 3KRUA 4PLOA 4J3SA 3C7GA 4Y96A 4UXDA 4A4AA 3RXZA 2E7FA 3OZYA 4ES4A 5FZBA 2ZMNA 1PVC3 1XI3A 2Y70A 3P0WA 5I3KA 1UMYA 3K3NA 1C8XA 3EWZA 3NZGA 3NWRA 1EP0A 3TRSB 4YL2A 2A3LA 4Q0SA 3T6CA 5AHNA 1W6NA 3W7GA 2QJJA 5FZCA 1C8M2 1TPC1 4IV3A 1C8NA 1CX4A 1XIHA 4HQVA 3TOJA 4CPBA 1EJSC 3IJIA 5T9CE 4JR5A 4AVOA 4XAFA 5C9AA 3QHNA 1AR93 5B80A 3ZFEB 4W87A 4P9YA 2W62A 5D02A 3N4FA 1O3TA 2ZIDA 3SUTA 4R9AA 3LEPA 3P1IA 3UJOA 5JU6A 2O1QA 1Z6KA 4WDXA 3OPTA 3NQ8A 4QJ1A 1TV4A 4BK9A 2RAGA 3TCSA 1HFBA 4GQRA 2PGRA 4B3NA 4BK5A 5E6ZA 4O10A 1C93A 4A3UA 3MSGA 4GA8A 4META 3B94A 4E2OA 1KBKA 1H30A 3LN3A 1H4GA 1IZCA 3T1LA 2RJLA 2GGJA 4GO9A 2CETA 2CBVA 1AW5A 4JGZA 4EV0A 4TMCA 1LG1A 3FUOA 1YXWA 2ZX7A 4BQ2A 4M3CE 2GAUA 3W9ZA 1O94A 4RUBA 3DFYA 3OPZA 3WLOA 4L56A 2ENRA 3RQ0A 3AIUA 4N02A 2XQRA 4L6DA 2VOTA 1YI7A 2GZWA 1CB2A 3ZSJA 1FDZA 1RUSA 3FBYA 3AU6A 1H9WA 1WDSA 2FDIA 3SGGA 2E31A 3LHTA 3GZTB 1K6WA 1JPKA 3E0VA 3CQHA 5H91A 2H0BA 1JQXA 3SDOA 1W1PA 5C55A 3CV1A 1XCWA 1C3FA 4QJ3B 2WJFA 5BXRA 2Y5SA 3CT7A 1UKRA 3OZMA 3D6NA 1AHSA 3MHZA 1WDRA 2PXJA 4XYXA 4GXLA 1PV8A 3HFTA 5FZ9A 3UJ2A 2E0PA 5KMYA 3FJLA 1HLCA 4QISA 5EYWA 1LG2A 5G2HA 1DZTA 2PTXA 5D32A 4HNOA 2XXZA 4LE3A 3I65A 3VDAA 1V51A 3GG1A 3LSBA 2JG9A 1R7OA 5F6LB 1DPMA 4L6OA 1L6SA 3PANA 1FHLA 3WZ1A 4BY3A 2PUZA 3PBGA 4XTIA 4QAWA 4Y22B 1DJZA 2NQZA 3GNRA 4TXEA 2QULA 5FXVA 4PTXA 5B4NA 3D3FA 1UIJA 3G1XA 4MWAD 2QDNA 4TLFA 2CERA 3GBDA 1KD0A 4UF0B 3NAPB 1W2AX 1CAUB 2C0ZA 4QU1A 3QYQA 2PSNA 3KMHA