4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
3QOKA 5GQBA 3ZT5A 3IAPA 1MQRA 2DSZA 1LLOA 3BMVA 4EAMA 1V0NA 4LYRA 4PUDA 1WZKA 1CXHA 5D9PA 4IPLA 1FFRA 2QPUA 4QP0A 1CECA 3TOPA 1UR2A 4U31A 2FHBA 2YA1A 3O2LA 1I75A 4EK7A 5HPOA 4ZXOA 3ZT7A 3EDEA 4QLJA 1JFXA 2HISA 3AISA 3WD2A 1HKIA 1G9HA 1W9DM 5FKYA 3RIKA 1V0LA 1V6WA 2BXYA 3WEOA 4AW7A 1W1VA 3VUPA 2GJXA 5JUVA 4AXNA 4CN6A 4GQQA 4UNIA 6CGTA 1VFOA 2O9PA 3SIMA 3BH4A 1W1PA 1E6PA 3AHTA 5GNXA 4AZCA 3A47A 3ZSTA 5FCZA 5C8BB 2XVGA 3VDHA 5A6SA 4K68A 1W9PA 2WHJA 4AD3A 2XVLA 1E6ZA 5BXPA 1UKTA 5CSYA 2VZVA 3BLPX 3S6TA 2CIPA 4JAWA 3VGGA 1IT0A 4JFTA 3KEHA 2JFEX 4P7NA 4MNKA 3WY1A 3WDJA 1RPKA 2W62A 3ZOAA 2ZXDA 2JEQA 1NARA 4NRSA 3WFZA 1XC6A 4MNMA 2J78A 1CGXA 2OYLA 2YA0A 5D4YA 1HP4A 4P7LA 5E6YA 3VGBA 2XFYA 1ZBKA 4CUCA 3ZYHA 4E8CA 5CLWA 3W6MA 2OWXA 4W87A 4CD5A 3A4XA 1E15A 3NSNA 4GIAA 2GFTA 4J27A 4MPKA 1LG1A 1LG2A 1W2VA 4HMCA 1V6YA 3RJYA 5A2AA 1DWHM 4UFKA 1FFQA 3AHVA 1CNVA 1XCXA 5A2BA 3WMBA 1W1TA 1EOKA 4ACZA 2C0HA 2RGMA 4OIFA 2VC9A 3APGA 1TCMA 1KR1A 1GVYA 3WF1A 1Q6EA 2CNCA 3BLKA 4D6JA 4V2XA 1VENA 1G01A 4TVCA 1VFFA 2G3JA 1KCLA 2VMFA 3AZSA 2E4TA 3DYMA 5D8WA 1PAMA 1UKPA 3NDYA 3GH4A 2VT0A 3N13A 3K4AA 3VINA 1XYZA 3BMWA 5M5DA 4AYSA 9CGTA 1QI2A 1JZ8A 3VM5A 1UKSA 1BG9A 3RM4A 3T09A 2WSKA 4BQ2A 1KGUA 1QBAA 1WDSA 1EXPA 4J3WA 5D9NA 3UERA 3G6MA 1E6QM 4XB3A 1HN0A 2JWPA 3RM8A 4UQEA 1E71M 3W29A 4UR9A 3GXIA 1C7TA 1JF6A 3PTKA 4HPGA 1EDTA 1JYVA 2VQTA 2G3NA 3WKZA 2VNCA 2EEXA 4YW6A 1J18A 4FLSA 4AD4A 4C7FA 1TA3B 1HVQA 1PIFA 5D9OA 3U5YA 2QLYA 2UWFA 1KFWA 3FAXA 1DWJM 3AQUA 3B8SA 1ISWA 2J47A 4QFUA 2MANA 1MXGA 1JYXA 4D6EA 1Q6GA 2CYGA 1WE5A 3UCQA 2FGLA 2XTKA 2V5DA 4M82A 3ARVA 3F5LA 1UD8A 3AS3A 4H2CA 1JAKA 3B9DA 2E8YA 3SCRA 3FY1A 4YWAA 4OBSA 1CGUA 2CCRA 1EOMA 1HL9A 4QCEA 3UG3A 5HXMA 4GO8A 7A3HA 1CGVA 2YOCA 5ECUA 4W7WA 4H8UA 3L2MA 3W24A 5IHRA 3EMZA 2X05A 3S2CA 3PZUA 2FGZA 3TTYA 1IZJA 3L4WA 3AMKA 1QNOA 1UHVA 2WB5A 1E0VA 1ESWA 2QHAA 1UYQA 4EE9A 1X1NA 2WW5A 3AHXA 4QDMA 2ZOXA 2BHUA 1BSIA 3CUJA 1JZ3A 1K9TA 3WNLA 3VMNA 5LA1A 3CMGA 1UH4A 5CJ5A 3K8LA 4KGJA 1I1WA 1W32A 2WWDA 1GWKA 1HNYA 1GQJA 1HKJA 2WVVB 4ZE4A 2E9BA 3U7BA 3VD5A 3MS8A 1W2PA 4AMCA 2PB1A 5CXPA 1B3XA 2WSPA 5DFAA 3W28A 1EQCA 4PMDA 3AJ7A 2GDVA 1W3HA 3CO4A 3PZQA 5E70A 5DF0A 4BCEA 4FMVA 3THDA 2J74A 4AISA 4JCMA 1BF2A 1XH1A 2J4GA 2J8FA 3E1F1 3WL1A 1LL4A 1NH6A 4HZ7A 1M7XA 1WO2A 1VF8A 1ISZA 2W61A 3VGFA 3GH7A 1UKQA 2VTFA 4HA4A 2NT1A 3CHCA 5CPSA 2EXOA 4U2ZA 1K9EA 1YQ2A 1JZ4A 3N15A 2BVDA 3VDBA 2DEPA 4CKQA 4BS0A 3T08A 2YKKA 5E09A 3TTSA 2WPGA 3EMCA 3G6LA 4GI6A 1KGWA 4XZBA 1ZJBA 3U7VA 2A3HA 2OSXA 3VKKA 4CCEA 1RP8A 2WAGA 2YL6A 2PC8A 5GNZA 1H41A 3MV11 2J7GA 2Y5EA 1PX8A 3W26A 3WUFA 4PMNA 5DO8A 1WZXA 2G4FA 4AZBA 1DWFM 3FHAA 2ZUTA 3ZT6A 4LK6A 1WDQA 2WMHA 5BXTA 1GOKA 1TMQA 1J0ZA 3MUAA 3WH7A 2VZUA 3GBEA 4MADA 1EIBA 4OJYA 1GWLA 2XJ7A 3VD4A 2X2YA 1FHLA 4W86A 2CESA 1GHRA 2J8GA 1WDPA 4H8VA 4N42A 3VPLA 3AMGA 5A6AA 1W3KA 5A8NA 4AIUA 2W5FA 4GZIA 3NYDA 3BGAA 1E72M 2D3LA 3MSGA 2FHCA 3N9KA 4PMVA 2YJQA 5A6JA 4MTVA 3WDHA 1B1YA 3LPPA 5ABFB 5EBAA 4LQ1A 2VQUA 1CLXA 3ARWA 5I24A 4OOUA 4DWSD 4UFLA 1UR4A 1Z32X 3UESA 4D6DA 1E3XA 3GZAA 2WVVA 1UOKA 1BYCA 3RM9A 3D5HA 2JIWA 3SCWA 4UTFA 3DC0A 4JHOA 1NQ6A 4D6FA 1QPKA 4PYSA 5DMYA 1ISYA 2D23A 5BWFA 1WAWA 3WD4A 1QNQA 2EPNA 5A6MA 1H0IA 5M3WA 1OIMA 2E9LA 1CPUA 4AZIA 1JI1A 1VFUA 3AXIA 1MQPA 4W84A 2EPLX 3BAXA 4GI8A 1BTCA 3WQ5A 4U3AA 2PWGA 2XM2A 3DHPA 2GJRA 2TAAA 3KE0A 5FD0A 4MAZA 4P7RA 1IZKA 4U33A 2FDMA 2WBKA 2AOSA 4XX6A 1C8QA 1V3IA 5CPTA 2YA2A 3W37A 5IFPA 1EA9C 2OWCA 3ARTA 4W8BA 1LWJA 2F61A 1W9XA 4PCSA 4FLOA 4J3TA 3SCPA 2WLZA 4TOQA 3WBEA 1JNDA 1GORA 4F9DA 3ZYBA 4XZWA 3QR3A 2GVYA 1XRVA 1QI3A 4WSJA 2E9MA 5CZKA 5AYIA 5I0DA 1WDRA 4ATWA 3QHOA 3ZJ6A 2W92A 1JDCA 2W91A 3HN3A 1A47A 1E70M 3BC9A 2D2OA 4W5ZA 2CEQA 1JL8A 4AL9A 1B9ZA 1H49A 4GKLA 1MW3A 4BA0A 3SURA 1HX0A 3AMCA 2X09A 5IDIA 1V0AA 4U5KA 1CZ1A 1JI2A 2ZICA 3MKKA 3ARPA 1OBAA 1JYWA 4W8AA 4MB3A 1DTUA 3GXMA 1UD5A 1E1EA 3FN9A 3WEMA 1Q6FA 3TA9A 4CPBD 4UCFA 4KMQA 2WYFA 4HMDA 2YIHA 2XVNA 3I3EA 2D20A 4UZSA 3SCOA 7CGTA 2UY3A 3OZOA 3VIHA 1HP5A 1Q6DA 2ZX7A 1S46A 2Y24A 1W9VA 3OGSA 3W38A 4PMUA 3BSHA 4FK9A 3WL0A 4WIWA 1GOMA 1WCUA 1TR1A 3OZPA 4GPNA 5JBFA 1JD7A 2J7FA 2WC3A 1QHOA 1KQYA 1E73M 2VRKA 1XCWA 2UY2A 4P8WA 2WBGA 2EQDA 1WB0A 3MSDA 2O9OA 4JKMA 4AD2A 4F79A 3F5KA 1NWUA 5A2CA 5A8OA 1ECEA 3CTTA 5I23A 1VJSA 1HIZA 1TE1A 3WENA 4KH2A 5CGMA 2VZSA 4U3CA 4P8UA 2WWCA 5BYWA 5LA2A 4TVUA 5GPRA 3FXYA 2QMJA 5EMYA 4ATDA 2D3NA 2GUYA 2W66A 3GXDA 4IISA 4AZGA 3VX0A 2DT2A 4W88A 4M81A 3CUHA 1VEMA 3TONA 2VURA 1ZB5A 4MAVA 1UH3A 3VDAA 1WCGA 1B30A 2CKRA 4WLCA 2EJ1A 4U2YA 1JIBA 1ZJAA 1H5VA 3ZMRA 4AIOA 4AC1X 1JAEA 2XIIA 3RCNA 5JBDA 4AZ7A 2VX5A 1GQKA 4QLLA 1DEDA 5I5RA 1E6RA 3QGVA 4UQ9A 4D1JA 3EMQA 1MW1A 2W67A 1U2YA 3L4ZA 3PZIA 2EBNA 3F4VA 2A3CA 3ZJ7A 4E8DA 4W7UA 4TUFA 4AEEA 1D7FA 2XVKA 3M07A 1OINA 4Z2KA 3SCTA 1SMAA 4QLKA 4C7GA 1DWGM 4DWSB 2WCSA 2DT3A 3AIUA 1E9LA 3DECA 4H7VA 3AMDA 3CMJA 5EFDA 4D1IA 1QOXA 4AZ6A 4HPHA 4ZXLA 1OM0A 3SCUA 3A4WA 1TZ7A 3QHMA 2ZUMA 3SEPA 1KQZA 2CPUA 3BSGA 1GVIA 4UQCA 2WXDM 2ZUWA 3UT0A 1KXHA 1P6WA 2AMGA 1QW9A 2VX7A 4MDPA 3M46A 1V0KA 2O92A 4CCCA 5ABHA 3KZSA 2WHLA 2PWEA 3N17A 3VM7A 2XSAA 1VBUA 2BXZA 4MB4A 4B16A 1W8ZA 3ARSA 1OGSA 1OT1A 3IANA 3EDJA 4J3XA 1PEZA 1UD4A 1NM9A 4TXEA 2GK1B 3EDDA 2BVYA 4Q7NA 1V08A 5A8MA 1JZ2A 3VIFA 3L4VA 1GHSA 1JDDA 3ARRA 2WK2A 2WANA 3CZKA 4LYPA 1SFSA 3CZ8A 7TAAA 2UY5A 1FH9A 1GUVA 4QAWA 3UR7A 1IV8A 2X0YA 4TTGA 3UG4A 4MB5A 3WQ8A 1OH3A 1L7LA 2BY2A 3T2QA 3VNYA 1B3ZA 1NOFA 2E3ZA 1EO5A 2A3EA 1UZ1A 2G41A 4HZ6A 5IHSA 1BGAA 1GW1A 1X6LA 5I77A 4LKEA 3CZEA 1ITXA 4YPJA 1HJVA 5I79A 4HA3A 3AIRA 3ARQA 3VMOA 2ZUNA 4BQ3A 4Z2IA 1SYTA 1C7SA 5ABGA 3GNRA 3WDPP 1PJ9A 4LKFA 1R86A 1H1NA 2Y8KA 2J25A 1M01A 5BROA 1OIFA 2ZE0A 5I3DA 3VIIA 3UETA 3T0DA 4CN4A 4JZ5A 4UFIA 1BPLB 2VL4A 2OSWA 3AHYA 1G0CA 4CD4A 4TVDA 3K1DA 3NDZA 3ZM8A 1B3WA 1R7OA 2CBVA 3CZJA 1GZJA 3T0AA 4Z2JA 4PSPA 1BQCA 1J10A 2ZWYA 3WQ6A 2Z1SA 1KXVA 4M56A 4GI9A 3AZTA 1C91A 1J0HA 1E56A 4PTWA 1UQYA 4LYQA 3LPOA 4DWSC 3PHAA 4W93A 5EFFA 2WMIA 1UWTA 4NI3A 2X8RA 2X1IA 3GDBA 1C8YA 2IUZA 2V3GA 3I3DA 2VXJA 1ZU8A 4AZCB 4JKLA 3ORJA 4GXPA 4UFHA 1LL7A 3AHZA 3RO8A 4R5EA 2DT1A 3IAQA 1E55A 2WKGA 1QHZA 2WMIB 4OBRA 5DEZA 4AZHA 1VEPA 2W4XA 2V3FA 3WNMA 1UA3A 1ZBWA 2CBUA 2V5CA 4GZJA 1SR0A 3ZSSA 4JHZA 8CGTA 3ZYFA 3GXFA 1V3HA 2JF7A 4PRWA 4FLQA 1CEOA 1VIWA 1VEOA 8A3HA 3KL5A 4CVWA 1E4MM 1MYRA 4HU0A 5FL0A 1PBGA 1GQLA 1EDGA 3GNOA 3ARYA 5AY7A 2PWDA 3LPGA 3AZRA 4CP9A 1CLVA 1M04A 4OOZA 1E5JA 3NJ3A 1K9FA 4B15A 3WFLA 4LKDA 4BZYA 1W3JA 2VRQA 2DDXA 2C24A 2D22A 2PBOA 4NRRA 3IJ7A 1CGWA 4AIEA 1XH0A 1GWMA 1BVZA 3F5JA 1O7AA 1GCYA 3WDIA 5BCAA 4MDOA 3FNDA 1FH8A 4NSBA 4H8HA 1ODUA 2RGLA 4RE4A 4D6IA 2XVPA 4HA1A 3SUWA 5A1AA 4J3UA 2VVSA 1LQ0A 1OD8A 2VRJA 3ECQA 4XV0A 5LA0A 4A3YA 4ATLA 1EQPA 3PZMA 1WKYA 4LGXA 2J7CA 2DSVA 2WC4A 2VOTA 1V6XA 1EHAA 3AIWA 3VU2A 3KWXA 4DM1A 4WSKA 2Z1KA 3OA5A 2C7FA 1NWSA 1C93A 1G94A 1JG9A 1KCKA 1XSIA 1C3FA 2ZXAA 1GJWA 1HJSA 3VO0A 1UH2A 1W90A 3L4UA 1X6NA 1KWKA 3VMPA 4PSRA 1ODZA 1G5AA 4UFMA 3CZLA 3QOMA 1US3A 3OGRA 2XUCA 2XWDA 2J7EA 3VDCA 1XSJA 1WNOA 5A94A 3WMSA 3UG5A 5ABFA 2VR5A 1DWIM 4JFWA 4PTMA 4X0NA 2BY3A 1V02E 2JALA 1EH9A 1DP0A 3TTOA 3VIMA 5JIPA 1HKMA 3K4DA 3UEQA 1D2KA 2VO5A 3CHDA 4M8UA 5CPQA 4F66A 2YDQA 4GZEA 2NW0A 3NIYA 2XIBA 1V3KA 3W25A 4M80A 1M03A 2OSYA 3MMUA 4RE2A 2WVUA 4AWEA 2BY0A 1J0IA 1OGBA 4UFJA 2WKLA 1XYFA 1US2A 1V0MA 4YHEA 2Y8VA 1LL6A 3BAYA 1E43A 1WPCA 4JFUA 1CTNA 3ZQ9A 1GOIA 2GSJA 4PMZA 2Q1FA 3W4RA 1AVAA 2XFRA 1LWHA 1C92A 4J3VA 3WH9A 1W91A 2DIJA 4GO9A 2VUYA 4PTVA 2PI6A 1JXKA 1JD9A 1KXTA 3PZGA 2YL9A 1J12A 2EPMX 5FIPA 4MJ2A 4WJXA 1ITCA 1GJUA 4P8VA 5AYBA 3W53A 2BS9A 4BQ4A 1XV8A 2WVSA 3PTMA 1HF6A 2O9RA 4F9JA 2BNJA 2WZIA 4Q22A 4URIA 2DIEA 1L8NA 1VBRA 4YN5A 2WZEA 4LX4A 4TTUA 3POHA 3TP4A 1BFNA 1RD6A 4CU8A 1R85A 1AQMA 1DWAM 4JFSA 1BHGA 3GTNA 1V02A 1CIUA 1TA3A 1UKOA 4J3SA 4LPCA 2FH6A 3AXXA 5E6ZA 3EDFA 4ML4A 5A95A 5IFTA 4KGLA 1AMYA 4PBGA 2QMKA 1PZ3A 2CETA 2WYSA 4YHGA 2BV9A 4MNLA 1UR9A 2BFGA 2BY1A 2VR4A 1QVBA 3PZVA 2XWEA 2YLLA 5DT7A 2YLAA 1J0KA 3L4TA 1LF1A 1VAHA 4TX6A 3MV01 3L2LA 1XHGA 2CHOA 3ZJKA 1UWIA 4AD5A 1W8UA 1QW8A 1VFMA 4PCTA 1UD6A 1B0IA 5D9MA 3MUZ1 4HOZA 3BAKA 5M03A 2G3IA 2DT0A 4L4OA 3SCSA 1ISVA 4H41A 4S3KA 5FOOA 2CHNA 4HOXA 3AS1A 2ZXQA 3ZR5A 1WZMA 1G1YA 1QBBA 5A8PA 5D21A 3PBGA 1OWQA 1V3LA 3MUY1 4ZENA 4V27A 5C71A 4CVUA 5JBEA 4MNJA 4BQ5A 4U5IA 3WF0A 5CGTA 5I6SA 3BAIA 3GH5A 2XGIA 3LMYA 1DHKA 4DM2A 2XYLA 1UD3A 1QNSA 2VX4A 3WH6A 1W8TA 1UUQA 2DSWA 4OUEA 5A6BA 1JNEA 2KR2A 3O6AA 3VILA 5HOSA 2DPEA 4NF7A 1MW2A 3N12A 1NP0A 2VZTA 4HZ8A 3RMEA 5CG0A 3W27A 4D71A 3I3BA 3A6OA 4RL3A 2BHYA 2IXVA 3SUUA 4UQAA 3AIEA 5E0CA 2WMGA 3O9NA 1LJYA 3AS0A 4UQBA 3RJXA 5BXSA 1E1FA 4L4PA 2WC7A 6TAAA 3GM8A 2WMFA 3VX1A 3WN6A 4WF7A 1NP2A 1PPIA 2CBIA 3HU7A 3II1A 5KZ6A 1CENA 3AXHA 1ZBCA 4PMOA 2FHFA 3ZR6A 4JKKA 2PBGA 3AROA 4UOQA 1HL8A 2NT0A 4Z2LA 3OGVA 4LK7A 3PN8A 1E4NA 3DYOA 2WLYA 3WEZA 1JF5A 1UG6A 1UA7A 4RE3A 3ARUA 2QV4A 3VVGA 1OKOA 3ALFA 1J9YA 3T2PA 2A3AA 4Y7EA 2WVTA 4X0VA 2V3DA 4WKFA 5BRPA 1OD0A 1TG7A 3AYSA 2WHMA 3VD9A 4C7DA 3NCOA 1QI4A 3A3HA 2VX6A 1JYNA 2YL8A 4DUXA 2AAAA 2ZX6A 1JZ6A 1CBGA 3WF3A 3IK2A 5HBFA 4DWSA 1QI5A 4B3KA 1C90A 1EHNA 4OZOA 2XM1A 3POCA 3NSXA 4X9YA 1JZ5A 2NSXA 1Y7VA 3SUTA 1E4LA 4CP9B 4B9YA 1K9DA 3SCNA 1J0YA 1XH2A 5I2UA 1Q6CA 4M24A 1W9BM 3SUSA 4ACYA 2YBUA 3CLWA 3WBAA 3CBWA 4B9ZA 4IUGA 1H3GA 1B3VA 3IJ8A 2J79A 4GQRA 4FLRA 1GONA 3AFBA 1HJXA 1L0PA 3VIJA 3BAWA 2A3BA 1UWSA 1JXJA 3WUGA 1XD0A 4ZE5A 1QHPA 3WELA 3EYPA 1E4IA 4GINA 2VI0A 4DUVA 1H0GA 2Y2WA 3WDRA 2LRPA 4Z2HA 4J7RA 1BLIA 3GBDA 1MXDA 4HP5A 5JIWA 4HU8A 4YW7A 5GNYA 4B3LA 2OLHA 4F8XA 5KEZA 1CWYA 5HNNA 2WZHA 3FW6A 4XUYA 2E0PA 1OT2A 3QHNA 2G3MA 1PX3A 3T0BA 3CUGA 3CUIA 1QI0A 2QPSA 1KBKA 4CCDA 5ABEA 5F7UA 4W8LA 4D6HA 5E0FA 4UOZA 1TVNA 5E9AA 3VGEA 2CERA 3BCFA 2F8QA 1ZBVA 3K8MA 3WQWA 3CGTA 2D24A 1OCQA 4PMRA 4S3JA 3K46A 4ZFMA 3MU7A 5AC4A 2OYMA 2V38A 2VCBA 3N1AA 4AY1A 3AIQA 1WZLA 5HPCA 1FHDA 1JFHA 3PZOA 2OWWA 2XPKA 3U5UA 3A4AA 3BXWA 5A6LA 2VJXA 1U33A 3WQ4A 1XSKA 2YDSA 2OYKA 1HJWA 5A6BD 1UOJA 3EBVA 1CGTA 1PZ2A 1D3CA 3OB8A 3NUKA 1R87A 1ZS2A 2EO7A 1BAGA 4CGTA 1MQQA 3WH8A 3CHFA 3OLEA 1GNXA 1V3MA 3KL3A 1HXJA 1N82A 4IM4A 4WK9A 1NWRA 4Z2GA 4CD8A 3FAWA 2DH3A 4A6SA 4PMXA 1QNPA 3OLDA 4V28A 4HTYA 4LJHA 1AQ0A 1EO7A 3MANA 1KWGA 4H04A 3VNZA 3PZ9A 2VCCA 2ESCA 3UR8A 1WMXA 3AI0A 2UY4A 4AZ5A 4E2OA 2GDUA 4D6GA 2YBTA 1E6SM 1ISXA 1HJUA 1UWRA 1YHTA 4BF7A 2E8ZA 1BYDA 5AC5A 4HOWA 3ZIZA 5I78A 4PEEA 3DHUA 1VJZA 2JIEA 1B90A 2J75A 4PUEA 4UQDA 1H09A 3VIKA 3WF2A 2O14A 2VCAA 3FHQA 1FP9A 1UQZA 1V6UA 1NOWA 4WKAA 3MMWA 1B2YA 4W7VA 4CN1A 2JF6A 2DSUA 1JDAA 3B9EA 1V03A 1UR0A 4P8XA 4CD7A 1RP9A 2HVMA 3J7HA 3OG2A 1CXLA 4CU6A 3HMCA 1JZ7A 3ALGA 4ACZB 1Q4NX 2J77A 5D8ZA 1J0JA 2XFFA 1E40A 3RILA 2XSBA 1PIGA 2XGBA 3WSUA 4PTXA 3MMDA 1V6VA 1PX4A 3WQVA 1FOBA 4AEFA 2DGAA 3VIOA 1OSEA 1UZ4A 4AD1A 3BCDA 3TTQA 1W9UA 2D0GA 1E5NA 1WZAA 2G8ZA 2WMJA 1GOQA 2J62A 1K6AA 3RPMA 2GJPA 5A69A 2LROA 2IXUA 1BGGA 3WNOA 2WMKA 3EDKA 3OIHA 2CITA 3WMCA 3N04A 1UR1A 2WHKA 3VIGA 1E0XA 2YL5A 3M7SA 2ZX8A 1FA2A 1HVXA 3W0KA 3AMLA 1F4AA 3ZO9A 1UWQA 3JUGA 3VTRA 3GYCA 3AIVA 1U30A 4R27A 3WF4A 1RH9A 2JEPA 4D6CA 3SCQA 1HN1A 3CHEA 1KGXA 1HJQA 1H11A 1E0WA 3ZJ8A 1SMDA 1CXFA 3D3AA 3WDQA 1FP8A 5EB8A 1CGYA 3CIVA 2BHZA 2D0HA 2GJXB 4PMQA 5FL1A 3U57A 4CU7A 5C70A 3WD1A 3PTQA 3PZTA 2WM0A 1CXIA 1CYGA 3VGHA 2QF8A 2ZUVA 3BAJA 3SUVA 1GOWA 2WCGA 4W85A 4KRTA 4UOJA 3M6DA 2FH8A 2YDRA 3CH9A 3WH5A 3HJEA 4M1RA 4A4AA 4MJ4A 4JFVA 2PWHA 1WP6A 1B31A 5CQ1A 4E4PA 1E6NA 2EPOA 3W82A 4N0RA 1TFVA 4M29A 2ZWZA 2VZOA 2ZXBA 3N11A 5IXEA 3AS2A 5HDRA 3K8KA 1GQIA 3VGDA 1UWUA 1MWOA 1BVNP 1GPFA 4UZUA 4EANA 2GK1A 1F4HA 4FF5A 2Y4SA 1BG4A 4NZCA 3DYPA 3N18A 5CLTA 2EPKX 3VOCA 4AD0A 1XD1A 2D1ZA 3ARXA 2CXGA 3THCA 4PMYA 3WD0A 4P7OA 3F95A 2WCAA 2XHYA 1CDGA 1J11A 2W63A 1C8XA 1CXKA 1A3HA 2K46A 3RDKA 3CPUA 1H2JA 3WD3A 1I1XA 2J7DA 3VIPA 2ZUUA 3ARZA 3AIBA 5DT5A 5A3HA 3AOFA 3WUBA 4IPNB 1BYAA 4W5UA 2PWFA 3WNPA 1J01A 3PZNA 3LPFA 1E3ZA 3AICA 3AYRA 1FH7A 4OKDA 3SCVA 1MFUA 5CSUA 1H4PA 2D0FA 3L4YA 4HMEA 2CBJA 2CKSA 2ZIDA 4PN2A 1O6IA 2F2HA 1W9FA 3WNNA 1W8WA 1V3JA 6A3HA 3T2OA 1UD2A 3WUEA 1OGGA 1OB0A 1KB3A 3L4XA 3W6LA 1QNRA 3VD7A 1HT6A 3KL0A 2J7HA 3CUFA 5A8QA 2DH2A 1R7AA 3NSMA 4MB1A 1R8LA 4P7QA 5M17A 2VVNA 1NOUA 1NWTA 2Q8XA 2XG9A 2X0HA 2DQXA 4TX8A 1BYBA 3IJ9A 5A6KA 5BXRA 2E40A 1GOOA 3CZGA 3W81A 4DUWA 1MVYA 1B3YA 4EKJA 1AQHA 1KR0A 3WIJA 2ZUSA 3MO4A 4ZEPA 3GNPA 4KRUA 4CD6A 1XGZA 3OBAA 2ZX9A 3OLIA 4JCLA 1EGZA 1VB9A 2O9TA 4WKHA 1TVPA 4QCFA 2C8NA 2V3EA 3VD3A 1MFVA 2JE8A 1KXQA 4LXFA 1W1YA 3MUIA 1JGIA 3WNKA 1M53A 5LYRA 4KWUA 1KBBA 1CXEA 1VRXA 1EDQA 4JIEA 4CPBA 4J28A 1TUXA 3B9AA 4W89A 1ZL1A 2DSKA 1HKKA 3OLGA 4D72A 2J7BA 2ZX5A 5TD4A 2WNWA 4JL2A 1MW0A 2BVTA 4JL1A 1W3LA 4A3HA 5BRQA 1E6XM 1UR8A 2B31A 2PF0A
chains in the Genus database with same CATH superfamily
1POV1 4E9KA 1XJBA 5IT6A 3HQNA 5MF5A 4Q4W1 3LGDA 1AR93 3OW1A 1XC4A 4YZ1A 1VQTA 4H2HA 1D7KA 3UGFA 2BGQA 3CB3A 3NQVA 3MIDA 5EJ1B 4LYRA 3P8JA 1WZKA 4IGPA 1LWIA 4ILSA 4PF5A 4B2DA 5ECVA 1HXS1 3N2CA 5BNPA 4A8IA 2WABA 1OFSA 4IW3A 4A3UA 7PTDA 3HEIA 3OZMA 1UZDA 2WQ4A 3GZ3A 3KB5A 4UTJA 4BDVB 4ERAA 1S0DA 3BIEA 1IQAA 3I3QA 2ISSA 4YTSA 1IS5A 4DS0A 5E1QA 3V0AB 1UR2A 3V0UA 2R1DA 3LIGA 1NOVA 1V6OA 1DGWA 3YPIA 1BK1A 3ACHA 2P3YA 5TAOA 3M0MA 3T8LA 2BGPA 4EK7A 3LB9A 1XWYA 5A6TC 1JFXA 3TEXA 2ZCGA 1XM3A 3AISA 4LOCA 3DDMA 2WZTA 1W9DM 4PQQA 4PTDA 4AU0A 2YU2A 3RIKA 2YPJA 4FOVA 4Y9MA 1V0LA 1J8VA 1WOBA 4RGGA 1IWPA 4D0QA 1YXYA 3MBDA 1RPXA 3PUOA 3CQHA 4AW7A 3ACIA 1TPFA 1MRAA 3Q8FA 1DJXA 4EWDA 2HBTA 4PB3A 5JUVA 1KD7A 3QFEA 1QJFA 3GO2A 2NV1A 6CGTA 4JYDA 3DOPA 4H7LA 2DUAA 3K2GA 1ZRCA 3SM0A 1H2MA 2P8BA 5KETA 1JCLA 3AHTA 5GNXA 1UY2A 4MG4A 4NZ4A 1XKYA 4EF9A 2WKKA 3FFZA 1VLIA 4NJGA 5CBIA 1GLHA 3VDHA 1W9PA 3LKJA 4KEZA 4AD3A 4OWGA 4B5UA 4UTWC 3AU2A 1VBB2 3I6EA 4DYKA 1LGNA 2FPVA 4P7NA 1OFBA 3WY1A 4H6QA 1Q6LA 2FGBA 2W62A 2ZVRA 3ZOAA 4AXOA 2ZXDA 4Q4PA 5D38A 3O1UA 2P88A 4AVCA 1X7IA 2CWSA 2J78A 1EB3A 4Q0UA 1AX2A 4G1KA 4P7LA 4M0XA 3B93A 3QTGA 5D4YA 5E6YA 3I4IA 2HS8A 4X3ZA 1EX1A 2PLMA 4MUVA 3LOTA 1QR7A 4XSLA 1AZ1A 5HATA 4QPYA 4AYGA 3GNDA 3A4XA 1M06G 1LKNA 3ST7A 3DF0A 2R063 3QGKC 1W2VA 2BOGX 3C0QA 3B4YA 4IP7A 4BI6A 4P9WA 5GLZA 3APBA 4HMCA 3I8TA 3KV5A 1GU3A 4TMCA 3RJYA 2ZDSA 1AR71 2IWGB 4HKOA 1ICSA 3N14A 4ALDA 1RUC3 4IXLA 3AP5A 1CNVA 3I4KA 4GMP3 1W1TA 4I9TA 2IFRA 2C0HA 3BTAA 3T4WA 1V6LA 1CIWA 4QX5A 1TJ0A 1RZMA 4HBKA 2YPDA 5IVJA 1TCMA 3LGEA 1W3IA 3WF1A 3CV7A 2QQNA 3ZIWA 2AAMA 3A64A 4QU2A 1Q6RA 4TVCA 1VFFA 4DRRA 3J4UH 2WJZA 2YC0A 3AZSA 2E4TA 3DYMA 4LLFA 5FJJA 5FQ0A 1W5MA 4FNUA 3HGJA 3OCPA 3N13A 4CUGA 1O94A 1XRTA 3HQOA 2JD4A 3C3UA 3Q8CA 4L1GA 1VS1A 1F3EA 4C1WA 5F2WA 1W31A 3TQKA 1GOFA 4LHLA 1Y8BA 2NLIA 1UKSA 1YNAA 1FBAA 1BG9A 3RM4A 3EB7A 2CZ5A 5JOZA 4JYFA 5GJPA 3UERA 1QBAA 1WDSA 1EXPA 1JQVA 4AB4A 1ZM1A 3G6MA 1TQXA 1E6QM 3WG2A 1EC8A 3M16A 5AFDA 1A5SA 1TME1 1ULFA 1C29A 3GG7A 1DXFA 4UQEA 3IV8A 1R1A1 1D3HA 1OF4A 3W29A 4UR9A 1JF6A 3IM0A 2NQ9A 4ZQPA 1EDTA 1JRBA 2OTDA 2IC1A 1UIKA 2VNCA 4I0BA 3B7MA 2VBDA 3MLLA 4YVWA 4FLSA 4NILA 4WY0A 4AD4A 5JI7A 1DGRN 4UF0B 1TA3B 1US0A 3G8RA 3AXMA 5HR7A 4BQXA 3NQ7A 1O12A 3GRIA 1OLQA 4O28A 1PO11 2CYGA 4M6PA 1WE5A 3PK7A 2FGLA 1LU2A 3M6YA 3ARVA 1RXGA 3F5LA 1RBOB 1UD8A 3SCFA 4A42A 2DVBA 3KX6A 4QRNA 2OX1A 1F76A 3Q65A 4I30A 2R041 4OBSA 2CCRA 1HL9A 3S5ZA 1LHNA 3O0VA 3WDVA 4QSHA 3GHTA 1M1BA 3IK4A 4XIKA 3D82A 3SC7X 1VBGA 3L2MA 5HJLA 1VBE2 1ZFJA 2F6KA 1Q8QA 4QE4A 1HQNA 3EX6A 2X05A 2OEJA 3EMZA 3AALA 2G96A 1EPXA 5JMOA 3PZUA 1Q6QA 3FHIB 1IZJA 4JQRA 4ROPA 4DI8A 5EPAA 1QNOA 2WRAA 1IKPA 1UHVA 4W50A 5JOXA 2P5NA 3DFOA 5TF0A 1GOHA 3NTYA 4NZJA 1X1NA 2A7PA 5D8AA 1UP2A 3GY1A 4H6RA 1AL7A 2BHUA 3RJ2X 4FPSA 5LRRA 4DMIA 5HV4A 2POZA 4L6HA 3JQXA 2Z4FA 1FOD2 2MEV2 1O1ZA 4L80A 2E53A 4IG2A 5U7SA 1JUBA 3UZZA 2WWDA 4QQ2A 4AEOA 3SI9A 4D94A 1EAH2 1HNYA 4JGZC 2Y7GA 3PLQA 4AH7A 4ZE4A 2E7AA 4DJFD 1VPQA 3GYEA 3T55A 3LCFA 2F2KA 1XF0A 1QEXA 5DZFA 3NXLA 3SAZA 3W7IA 7REQB 4IFKB 3W28A 3EXSA 5FLHA 4WM8A 3QR0A 1W37A 2V69A 2XKOA 2WNVA 3IJDA 4L61A 5M1TA 4F0MA 3VKAA 3J8F3 5LIXX 5DZGA 5E70A 3HV8A 3DUIA 2ZZ2A 4JCMA 1XH1A 3IWPA 1A0EA 3T8QA 2J8FA 4MMWA 3E1F1 3UWWA 4EX4A 3DKLA 1ZALA 1M7XA 3GXNA 1VF8A 3JR2A 5IUQA 1UKQA 1R3RA 4LA2A 2BVVA 4HA4A 5FF0A 3N9MA 5F5AA 2EG8A 4Q4SA 4HONA 1GZGA 4HLTA 1YQ2A 1ZZ7A 1R47A 3VDBA 3XIMA 3S1XA 3T08A 2AL2B 4LVBA 3FSTA 4PI0A 1JBCA 5GJMA 1QJU3 1SO6A 3EMCA 4JIHA 4GI6A 3K3OA 2A3HA 3MEPA 2YCKX 4Z1VA 2YL6A 2PC8A 4E2DA 3EXRA 5CSRA 3NSTA 4Z92B 3WBYA 1LULA 3MV11 4QQ3A 1UASA 2Y5EA 4WOZA 1NY71 1BXNA 3CEPA 1PX8A 4PMNA 3O07A 3L7RA 1WZXA 1PIV1 1LAJA 4XUPA 4LAKA 1IEVA 3WLIA 2XJRA 4DPQA 1TWDA 3UPWA 1PZ1A 4QX3A 2XOMA 3FHAA 1PSCA 3NAPA 1RL3A 5FUPA 3LCHA 3V5CA 1RMU1 3ZT6A 3PVNA 4R7OA 2WMHA 1GOKA 1CN1A 3CWNA 4GBUA 5FJHA 3DFQA 3GBEA 3HOJA 4JDBA 4MADA 1B35B 1EIBA 2CL2A 4OJYA 3E0LA 2FYMA 2XJ7A 1V6IA 3VD4A 2X2YA 4W86A 1VFHA 2CESA 4K8GA 1GHRA 2ONEA 3MB9A 4I01A 3VFLA 4QPIC 4Q4W3 4YGBA 5L9VA 2HMCA 3GNNA 1S5TA 3PAJA 4UMCA 1YFXA 1HW5A 2MPFA 3INAA 3T6CA 5LIUX 1W3KA 5U4NA 4QHBA 2I14A 4GYJA 3COTA 3LXBA 1TB3A 1OH4A 1LHWA 4P9GA 4DXTA 1E72M 4OV4A 4IMAA 4MGSA 3PNAA 2ZGNA 2JDKA 5FYBA 4PMVA 1Q66A 5DAPA 3OBTA 4IQJA 3PPHA 1QPRA 4I8YA 3VBUB 2B0MA 4RFT0 4UAPA 4HNNA 5C8WA 2VQUA 2TBVA 3ARWA 5I24A 3AKQA 1RLCL 3ILFA 3UESA 1QASA 2UZ9A 3FX3A 3GZAA 1VBE3 5CEHA 1UOKA 3RR1A 1KLZA 2D6LX 3HGOA 3CB8A 5GZFA 5FP3A 4B29A 2ATSA 2OQYA 3TOYA 4D6FA 2FMNA 3NQ8A 1XJAA 4KETA 2BOFX 4P9JA 2CGNA 4PDWA 1WAWA 5EJZB 4N2YA 1QNQA 4W65A 2QDNA 5A6MA 2DJXA 4YMZA 4B7EA 1WD4A 3IVSA 4KU8A 1FATA 2YXOA 2E9LA 4CP0A 3S4TA 4D9PA 5B80A 2YXXA 1JI1A 4BYYA 4MZYA 3WQ5A 3KLKA 4IEXA 3ZSEA 2FDIA 2PWGA 1R30A 5CJMA 2GJRA 3FXGA 2TAAA 2Y6ZA 3KE0A 2VZQA 4MYEA 1LRQA 3VDDB 2A73B 2WZPP 4ASTA 1UZZA 1L8PA 1E1CA 4LORA 3H2CA 4LYKA 2WBKA 3NNTA 1XYAA 2AOSA 4X63A 1QOSA 1CVNA 4MY8A 1DGLA 2YA2A 4H19A 1T6GC 3UGHA 4WVWA 1EA9C 5FQ0B 2OWCA 3O6CA 3KAOA 3ARTA 4LUTB 4GI4A 4DXZA 3M0VA 1PVC3 1LENA 2GGGA 3MPBA 4FFGA 2F61A 5E9XA 4UW6A 1W9XA 1XLLA 4LHSA 4IZGA 1LOAA 5LWBA 3VHPA 4TOQA 1JNDA 2YY1A 4UXDA 3QR3A 1LRNA 5ABTA 1NQJA 1UJPA 4I9JA 2PHLA 3GHRA 3LU2A 2F6UA 3J7NA 3TMLA 4WSJA 2WJEA 1G4EA 3G24A 1R9YA 3NL5A 4YSFA 4ATWA 3KCYA 3UCDA 4XQDA 1F35A 2W92A 1SLLA 4GK8A 1R0MA 3K30A 5G1YA 1RIRA 1W6MA 3WP3A 3VOFA 2ZZ5A 4PBEA 1JL8A 2W0XA 1B9ZA 4GKLA 4QQOA 1GKQA 4RDZA 4NI8A 4NAEA 4UTLA 2PDCA 2X7WA 2W46A 3SURA 4HSNA 1L9WA 2V0TA 3UWVA 3R1ZA 5IDIA 1H7WA 1CZTA 3MZNA 2AGSA 5FKCA 1JI2A 4YTUA 1I60A 1PCWA 4JNMA 3N3MA 4BHYA 5FY1A 3OVPA 2X1SA 1JYWA 1DZQA 1TVLA 3LV5A 4OQ9A 4MB3A 1LRTA 1QNWA 3GXMA 1UD5A 1ZBA2 3PUEA 2VOWA 3VZXA 4KMQA 2WYFA 4HMDA 1VBC1 1Z7S3 4FOQA 3I3EA 2HV5A 3E0WA 1NFGA 3SRKA 1WKEA 4GAZA 3DBPA 3W1PA 1NCQA 5LATA 5DUUA 4B5XA 3MF9A 7CGTA 3OZOA 1Q6DA 1Y5XA 2ZX7A 2Y24A 1QDCA 4LBKA 4WM7C 1O5LA 3BSHA 3M0YA 4RSUA 2ARXA 1UC4A 1FWEC 3KRSA 3M5VA 2DZAA 1TR1A 3OZPA 5I3HA 4GPNA 5T52A 4Q4V2 5C5UA 3LEMA 4BQ1A 2J7FA 1QHOA 4NP7A 4XK2A 1KQYA 4C6OA 1AK5A 1E73M 2VRKA 4CEYB 5FYSA 5FPBA 2UY2A 2OGYA 5GALA 2Z2SB 3CQOA 3C0SA 2MHFA 4K20A 1WB0A 3DFSA 4JKMA 1F07A 4S2HA 1AYN2 1Q5MA 3QLLA 1LECA 1AW5A 1K1DA 1WCDJ 3SMHA 1JUEA 5I23A 4NASA 3UVIA 4QG9A 1RHI1 2FJKA 1RVF3 4MX3A 3PVFA 4PA8A 5CGMA 2VZSA 4QX4A 4XZHA 2WWCA 2VVFA 5FJOA 1E5RA 5KZMA 1TTJA 2AUYA 2QMJA 5EMYA 4AQSA 2GUYA 2W66A 4X9SA 3TCEA 1IEXA 4AZGA 2WJSA 5I09A 1PYFA 2DT2A 3QPEA 2R82A 4W88A 4H6KA 1A6CA 3C2EA 4QPGC 3P2VA 1X36A 2NX1A 4RL7A 1VPXA 3RAOA 3LCPA 1ZB5A 3VBHA 4N53B 1ZVFA 3M0JA 2CKRA 3HBLA 4K3ZA 4I90A 4U2YA 2AQWA 4MHRA 4QE1A 4TXWA 3UXLA 1O3TA 1RVF1 4O9GA 3RITA 2DCTA 4AIOA 3EWBX 2DZPA 3W3OA 4HPJA 2BOIA 3CAQA 4O1BA 1A4LA 1QJX3 3LX9A 2HWC1 4AAJA 2XXZA 4O7XA 4ORMA 2DP3A 4IQDA 4UQ9A 3K77A 4FFFA 2PDYA 1SBEA 4XZPA 5EWSA 2GJNA 4RNIA 2EJAA 4INFA 3L4ZA 3HV9A 4O0ZA 1EJTC 2WZR3 2EBNA 3THAA 5IATA 3F4VA 1OMIA 4YZ3A 4YTTA 1J79A 4FOYA 3XINA 4S3GA 4GOAA 5CPNA 3IT8A 4UTTC 4M7TA 3HFYA 4BXFA 4YTRA 1OINA 4XUGA 2HXTA 4Z2KA 3N4AA 1MZEA 4QLKA 4H2AA 4BM8A 4C7GA 1JYIA 4Y1XA 2WCSA 4DWSB 5FPUA 1GNHA 1F61A 3V5OA 1FWSA 2H0VA 3AVSA 1UMYA 5AECA 4M00A 3ERPA 4LC6A 2XONA 4ZXLA 3SCUA 5LGXA 3A4WA 4AFAA 1ITQA 4K6BA 3CV6A 1OQEA 2WA4A 2CPUA 2DCJA 4UQCA 1M3UA 3SRHA 2QAPA 3UT0A 4XUTA 5C5TA 2AMGA 4KERA 2AENA 5C9XA 4MDPA 1G8WA 1MVEA 1SZEA 1TWZA 3LOBA 2POTA 1YNYA 3LTSA 3VL8A 2NQLA 1MS8A 4CCCA 2HVOA 2AQOA 2ABAA 2HWE3 2XH0A 5JSRA 5I07A 1XQKA 4AGRA 4B16A 3ARSA 1ST8A 4CDXC 3GLCA 3P8IA 1PEZA 3BG3A 4MJZA 2Z69A 2BVYA 1FV2A 2XU2A 1REQB 1H6XA 4O0KA 1ONEA 2Y63A 1GHSA 1JDDA 1UOGA 3ARRA 4L1WA 2WQPA 2WANA 4OHXA 3CZKA 4LYPA 4IEQA 2DJLA 4L4LA 2R073 2UY5A 3MLKA 1S4CA 4M01A 5A7PA 1FH9A 4N8MA 1UMLA 3OODA 4AEKA 2WT0A 3UR7A 1O5RA 4Z1CA 1YCIA 4UMAA 2X0YA 1KFEA 4IGOA 4CQDA 3UG4A 3VOHA 3QR1A 1JH5A 3WQ8A 4Q6JA 2NVCA 4ZOAA 2IQTA 1K03A 4WVZA 3FZ3A 1B3ZA 2E3ZA 3GXUA 5FK7A 3ZN6A 1PS9A 1BKHA 4FI9A 1BGAA 1GW1A 3PIJA 3W84A 5FXZA 3B0PA 3NPWA 1EJ7L 4Q0SA 4DQAA 4MUZA 1EJWC 1TV4A 1XIFA 4XOGA 3KT4A 1KS4A 1WXYA 2D2GA 4LFYA 3DGBA 4OUSA 4BQ3A 1DLCA 3ITLA 3TWIA 3GIPA 1Y0EA 1PJ9A 1QK2A 3GR8A 1H1NA 3ZFHA 4WCJA 2ZRYA 3CQIA 1M01A 1OIFA 5F5CA 2ZE0A 4AVSA 3ZPYA 4KFNA 3UETA 1G9FA 4YG0A 2J9XA 2WFPA 1VKFA 3UXIA 4YLZA 3T07A 1ZA4A 4YM2A 1XLMA 5JR7B 1VGAA 1VCFA 3AHYA 3CJPA 2WAAA 1G0CA 5L19A 4LBMA 3DV8A 3NDZA 4QMAA 1W8GA 4PCFA 4LVDA 1HB2A 4GIEA 3W1XA 4DNMA 4DEFA 4E2QA 1AD1A 4PEKA 1SW3A 1J10A 1WA4A 2PDFA 4X8NA 5L7OB 3OQEA 5G1MA 4HPKA 2ATMA 5JZGB 3CJIA 5C9AA 1YMYA 1C91A 1K77A 3OBZA 4Z2AA 1XLAA 2ZTKA 1I1EA 5BNPC 1TSIA 3UA3A 1D0GA 5J36A 1UWTA 4L4MA 1VRH3 2X1IA 2EF6A 4AZCB 5F4XA 3I6RA 5C3PA 1EUAA 3CO2A 3EWDA 3P7YA 3AHZA 2IUWA 1UZ0A 3B0YA 1LCOA 1ZRDA 5IAVA 4N9CA 1FXPA 2W2IA 4AX7A 1E55A 2WKGA 1QHZA 4XD6A 3RU6A 3R5EA 5I93A 3MBWA 2W4XA 2PA7A 5HV0A 2V3FA 1UA3A 2V5CA 4LUSB 3R0KA 2ARAA 4QXKA 2DZTA 3ZSSA 4KWKA 4JHZA 1AR62 3GFZA 5FPXA 1V6TA 1V3HA 1UD1A 3LFMA 2A5HA 3W1QA 1C1FA 2HKXA 4ZXEA 4Q8WA 4FLQA 3MW2A 4NPMA 3H2AA 2ZCWA 4LRTA 2QJMA 8A3HA 4GYPC 1CT5A 3KL5A 3UR5A 3GDMA 5C2CA 1W9YA 3WY6A 1OQDA 3RPQA 1P0DA 2VD9A 5AY7A 1YPIA 2PWDA 2GOKA 3KVLA 3LHVA 3PJXA 4BK9A 1NA1A 5HQEA 3T81A 5FP7A 1E5JA 3DKJA 4ARYA 5KITA 4COUA 3CS2A 3Q94A 1J93A 3WW2A 3KFTA 2REQA 2VRQA 3D0JA 3VHNA 4M6QA 2ZAAA 1W2UA 5ANQA 5KBFA 2D22A 2J88A 2VXNA 2YW4A 3ZLFA 3DFHA 2PBOA 4NRRA 4GA8A 4IE5A 3ME2A 4J1OA 1GWMA 3GVRA 5FMOS 5F4SA 1BVZA 3F5JA 5FF7A 1O7AA 4GVIA 4GYKA 3FNDA 2VNOA 1ZZBA 2ARBA 3MPPG 4V2WA 4NSBA 4H8HA 2Y6GA 1NELA 1A5LC 1LQ0A 1DJGA 1ME7A 3BGJA 1I2RA 2VRJA 3ECQA 3M44A 2HWD1 3UVAA 1XNBA 2VU9A 4ATLA 3FV9A 1RJRA 1W6OB 1WKYA 4IQLA 1XIGA 1RUC1 2I16A 1DIKA 5DAVA 3RRXA 1V6XA 4QISA 1EYBA 4X22A 1VP5A 4E4HA 3PUSA 2E77A 2OOFA 5EQUA 1OF6A 3AIWA 3VU2A 3KWXA 1IGOA 5HAOA 2ISFA 1O3RA 5GLUA 1FMD1 3KCCA 1RUD2 1MZRA 1IF2A 3O1SA 1EF3A 2VENA 3DFYA 1MS0A 4ATFA 4Y1UA 1M9HA 1W90A 1GP5A 1WDWA 3NQFA 2BTVC 1IPKA 5FO7B 4GJ1A 2D69A 3O6YX 3VMPA 3W7CA 4PSRA 4XBQA 5MHBA 3BUVA 1QOQA 1G5AA 1Z8AA 3CZLA 5C9ZA 1OF8A 2XWDA 2BGSA 3CF6E 3VDCA 1PK6C 2PU0A 3R13A 1EC9A 5A94A 4YVXA 5C4WA 1YNQA 1B4KA 1DWIM 2VR5A 2JIGA 5CFCA 5JSPA 3RZHA 1U5ZA 1TJPA 1Y65A 2BX7A 2BY3A 2JALA 3NO8A 3C2UA 3PBWA 1NF7A 3HF3A 2EKGA 2KZHA 3H8AA 4N9HA 1HKMA 3HQPA 4QXBA 3M64A 4A22A 1OKQA 1D2KA 3CHDA 1EY2A 3A22A 2XH6A 2ZGKA 4XJ8A 3TRSB 1O8PA 1XYMA 1IXNA 3WCZA 5IVYA 1LB2A 4GCXA 3UPBA 2YZ4A 4LO6B 1TMF1 3GDRA 1RHCA 1XLKA 3FCPA 1ICPA 1RUF3 3W25A 2GC1A 3KHCA 4DF0A 4XACA 4RE2A 5C3OA 4E27A 1QQP1 4CCZA 4FNTA 1KFLA 1J0IA 3TZNA 3O05A 1XYFA 4N7IA 2HEJA 4YHEA 2Y8VA 2HJPA 1UU6A 5FZOA 4ET7A 1G9DA 1E43A 1WPCA 3STFA 3SDOA 1P4CA 2GSJA 4C5ZA 3N2OA 5I02A 3W4RA 2R062 2WC2A 1OFAA 3P3PA 1KD0A 1OOPB 4NX5A 3NVCA 2QTWB 5BOEA 2RS51 4YU1A 3JB4C 2YL9A 3JD71 4CP1A 1XNDA 1LHVA 5FCCA 1XXNA 4P8VA 4B3ZA 1VRBA 3LIHA 1RBLA 1IQDC 5AYBA 4Y9PA 3W53A 3USBA 4NHYA 4BQ4A 3CL6A 4XAAA 2HBXA 1HF6A 1OFOA 5REQA 4LNCA 4J4KA 1VBRA 1GBGA 4YN5A 4BA6A 2JDYA 5D04C 4JN7A 1RD6A 2JX9A 3GCWA 1X50A 3ZLGA 2WWSA 4CU8A 2P5BA 1DWAM 1ENSA 4YTQA 4JFSA 2HYKA 1K7EA 1EBGA 2YDAA 1OI6A 4E2GA 4E2VA 4DVOA 3PVEA 1B57A 4WDTA 3U4FA 3E0FA 4LW7A 3LEPA 3SR7A 3T40A 3S8HA 4H14A 2RHGA 1J1LA 1UMIA 2D97A 1IEWA 2ZX3A 3VUSA 3AXXA 4AXKA 5DXDA 2CZFA 3EDFA 4KG8A 2J1VA 5A95A 2WKJA 2DYCA 5IFTA 4KGLA 2WNEA 1AMYA 1OA3A 1HRV2 4J6GA 4JTUA 4WM8C 1VMHA 4LBUA 4YVSC 1PZ3A 2CETA 4YHGA 2BV9A 5FYVA 3LSBA 4IIEA 1KJRA 3PZVA 1QVBA 2E5CA 1FT9A 1Q13A 2YLAA 5DT7A 3L4TA 5DXYA 4TX6A 3WW4A 3MV01 3ZFFB 2VEMA 1A3KA 3VL9A 1QW8A 1OYAA 4BKNA 4JVAA 3GC2A 4NX0A 1DV7A 3UYJA 4RZ5A 4HOZA 3HB9A 4IP5A 2ZHLA 3BAKA 3I59B 4YWSA 5C9AB 1FWDC 2GSYA 4GMP0 1FAYA 3W74A 4ERGA 1EKOA 1YDNA 3V4BA 4S3KA 5FOOA 3VA8A 4HOXA 3AS1A 4LNYA 2A0NA 3DG3A 4NZ1A 1QBBA 2QS8A 4DJFA 5D21A 4GLEA 4KIEA 4AR2A 3NQCA 4B5TA 3REQA 1KRIA 3KTCA 4IUOA 4YCOA 4FNSA 5C71A 3LRMA 1MEC1 3S42A 1KBIA 4BQ5A 3WF0A 4X2RA 5I6SA 3GH5A 4I09A 4LIUA 4QAIA 1JODA 1UY4A 3QC3A 4GUJA 3USZA 4M3CB 3LMYA 3MIBA 2XYLA 4S23A 2JB8A 2PZ0A 1IXQA 1LUCB 1W8TA 2C1HA 2RS31 1UUQA 2ZRXA 2Y6JA 1WQ5A 3F2ZA 5HOSA 3ZYPA 3ZSLA 2O1QA 4LBQB 2DPEA 1WUFA 4Q4Y1 4L6OA 2PWUA 4AIBA 1MW2A 4CDXB 2VZTA 4HBNA 1NP0A 2PP1A 5C7VA 1FDYA 1FWJC 3RMEA 4X2PA 1ZAJA 4JNYA 3W7DA 3DC8A 4D71A 2AKMA 3I3BA 2C15A 1VRH1 4XDOA 4CYDA 2Q09A 4UQBA 4PRTA 3VKFC 4A44A 3TN92 3V0BB 1YRRA 4GC3A 9RUBA 3EQEA 3FLTA 4QD2A 2DVUA 5F3CA 3SH5A 2WC7A 5A3NA 4NZFA 3B9OA 2PLV1 3MDWA 1NP2A 1PPIA 2CBIA 3Q2DA 4RLIA 3ZYZA 3AXKA 4H9ZA 5HMDA 3E2RA 4X6QB 1FHUA 2VD7A 4IF2A 5AC92 3VK5A 1H1MA 4WRHA 1E5HA 1TZOA 2CDPA 2OR2A 1HL8A 3B8IA 3N2BA 3WHTA 4A7YA 3QYSA 2HE8A 1OOPC 3KOXA 3P62A 1J3PA 3ZO0B 3GU2A 4NOTA 4ORIA 5C2GA 5IYYA 3JW7A 4JBRA 2QZRA 1OKOA 2NXHA 2WAOA 1V4YA 2GMMA 1DQXA 2A3AA 2RV9A 4Q7IA 1KM2A 4X0VA 3MMTA 4ZQNA 4HVOA 1X97A 4MJMA 1DORA 3E97A 5DG1A 1ZBE1 2VX6A 3CIXA 2PDLA 4DUXA 2AAAA 3TWBA 1A5NC 1QI5A 4IIFA 1EHNA 3W1UA 2I9EA 4Q8NA 1KA9F 3D46A 3PANA 1QHDA 3MLJA 3V16A 3SUTA 5D2VA 2UY9A 1XH2A 5I2UA 3DXUA 4LO4B 4Q32A 2UURA 1O8SA 5DY3A 2DUXA 4YW4A 4A6OA 1H3GA 4ERIA 2J79A 4XFFA 4JQ3A 1ACCA 4RDWA 3ABZA 1SZNA 3AXDA 5BNNC 5FJTA 4NVPA 5FUIA 3FC0A 4HHMA 3S6PA 1H0GA 2WWJA 4AVFA 1RSCA 5DX7A 4MGIE 3ZFFC 1N2VA 1YW1A 3WX7A 1BLIA 3GBDA 4HP5A 1TZZA 3M70A 3A5VA 3UZWA 1PZ9A 4KW2A 4B3LA 5KEZA 3B40A 3FW6A 3O15A 4GY7A 1S5NA 1O1HA 3TFCA 1RUI2 3ITGA 3BWWA 2ZZ7A 3WD5A 1PX3A 4GISA 2E6YA 4M6VA 4ZGYA 4AZZA 1F5JA 3TX9A 2YB7A 3Q37A 2BJSA 5ABEA 2NQYA 1TWWA 3BURA 4OI4A 1VHNA 2PGWA 4D6HA 4QE5A 3INPA 4LY8A 1RALA 4XHBA 3A3WA 3IUIA 3H23A 3BCFA 1JMUB 1SPPB 1ZBVA 1OC7A 2BGNE 3BK0A 3CK5A 4F0HA 5FJIA 4ZB5A 3CJXA 1XPGA 4ZQCA 5SWUA 2EIEA 1JXNA 1MI3A 5LEKA 3C7HA 3K46A 2XJSA 3E0IA 3PBVA 5AC4A 4GD4A 3QPYA 1UIJA 1AR72 2V38A 3E6DA 3M0IA 3RZJA 4RR3A 5ACA3 5HPCA 1QDOA 4QM1A 1JFHA 3W59A 2VEIA 3S0MA 3A4AA 2VJXA 4YXGA 1U33A 1NAEA 4Q8OA 1KS5A 3UU0A 1R3WA 2IXLA 1PZ0A 2Y62A 1NUKA 1D3CA 4WVMA 3G0SA 3NUKA 3GFYA 2G4JA 1JJKA 2WDBA 4Q26A 2QVSB 4GXLA 3WH8A 1EV13 2VH9A 4E2BA 4N43B 1W5OA 1YI7A 3E5UA 2Z00A 5C6MA 3M2MA 4MIMA 3VYLA 1CJDA 3TKFA 1XS2A 4YFWA 3E6EA 1T99A 4S3FA 5IJRA 3FAWA 4UC5A 2DH3A 4PMXA 1H9WA 1M68A 4RX0A 3IZOA 4MZ1A 2HK1A 2WA3A 3LSEA 4RHV2 3TROA 5FDBA 4YJ5A 4CRQA 4PFHA 2Z26A 3MANA 3C0LA 4H04A 4A2SA 2VEPA 3H0OA 3HA1A 1OC1A 3I2FA 4JTRA 1SO4A 4DY1A 5EBUA 4V2VA 3KUMA 1WMXA 1XRSA 3LHUA 4AZ5A 2YBTA 2XG3A 4CEYA 1Q45A 4XAFA 1HJUA 1PHQA 1PV8A 3Q58A 5CPLA 1YHTA 4BF7A 1BYDA 5I78A 3ZVXA 1AW2A 3BYWA 1OCJA 4L92A 5JVLA 1I2PA 2VFEA 3W01A 1N3QA 4JIRA 3PWIA 4BB3A 2DVFA 3UQNA 1HJGA 3H3LA 4R52A 5J96B 4KCVA 4Y33A 3M0ZA 1H09A 1QPNA 3FYOA 3VIKA 2O14A 3SGZA 4GY1A 3JVAA 1AJKA 3Q8AA 1JYTA 1FP9A 3BICA 3QH6A 1K6WA 3W21A 1K02A 2ZZ6A 4LUYA 4HD5A 4WKAA 4PCNA 3MMWA 2YXSA 1B2YA 5GLWA 3EO6A 4X61A 2FVKA 2DZXA 2JF6A 2QQWA 2DSUA 3GKFA 2PU1A 3OBKA 3TW6A 4IP4A 3RX2A 1SO5A 4P8XA 1WW6A 5CZSA 4BI7A 4C8DA 1ZZMA 3UGRA 4FS9A 5C8CB 2CLIA 4Q0PA 4QGLA 3TN93 2RDWA 5EMMA 2PD9A 1GQPA 3BLDA 2FPTA 3GTFA 5AHMA 4UTTA 4TU1A 3TEYA 1YLVA 3MKVA 1TTIA 1JPDX 1TWIA 1EC7A 4CTEA 1RCQA 5D8ZA 3APYA 1HUVA 1J0JA 2ORZA 2XFFA 2XGZA 2VFGA 3WSUA 1AYM1 3MMDA 1V6VA 3HPFA 3WQVA 1FOBA 5I0RA 1UMHA 4FFIA 1M4WA 2PAJA 4AEFA 3BUCA 4B4PA 1R081 3P14A 3U10A 4CDQA 1VBD1 1TV5A 3HQUA 4Y4RA 5AC8A 2RS33 3QMTA 3M3CA 3BCDA 3NKTA 4MLRA 1JPHA 3VNKA 3WYZA 1Q6OA 4I3GA 1K6AA 4XAYA 2LROA 2JBMA 2ZE3A 3HWJA 3AU6A 3EBRA 1X96A 2YPIA 4L56A 4LCSA 2GJLA 1J1TA 3FUOA 4Q8VA 2WZR2 5FY4A 1CAUA 3O1RA 4WJEA 3S46A 2WHKA 3MI2A 3VIGA 1E0XA 1E5SA 2YL5A 2PN5A 3W7LA 1HVXA 2OU4A 3W0KA 1FKXA 4DBWA 3TBDA 4H9YA 4N4PA 3JUGA 2V72A 4IV3B 3B8DA 2V2CA 3WF4A 3VGIA 1RH9A 4AOCA 1RUJ1 1POQA 1X8EA 4NYUA 4D6CA 3PAOA 3R8RA 1HJQA 3L5AA 1C57A 4JTLA 3N4FA 1X1ZA 5LNVA 1VRDA 1H2LA 4QKNA 3D3AA 3JBG2 2Y60A 1CGYA 3VNDA 3CIVA 4NIGA 2BHZA 2D0HA 3S9YA 2B4KA 1I6XA 1UAIA 2QQIA 3U57A 5C70A 1WX0A 1TIMA 2GU9A 2BYVE 2RJHA 2V5YA 3FWEA 2WM0A 1CYGA 1IPSA 3OF1A 3RVHA 5CG7A 4AHXA 2FHRA 2GGEA 2ZUVA 3GVGA 1GOWA 1HQWA 2WNUA 1F9CA 4W85A 4TSVA 2IS7A 2PODA 4I7WA 2FB2A 2A6XA 1R3YA 2F6XA 3LNMA 3LV6A 4M1RA 3IDCB 3UW6A 5EXOA 1UBSA 1ULCA 3C86A 2Z1XA 2BODX 4JTQA 1SBDA 4FFHA 5D37A 3S9IA 1W0NA 3N11A 2XH7A 2INEA 5IXEA 2O7QA 1HGWA 2HJIA 1VBA1 3C2OA 2VGBA 3IS4A 3NEHA 3W00A 4GUFA 1MWOA 4Y2WA 4UZUA 2VGIA 3T78A 2XIOA 1H2NA 4EROA 1BG4A 4BQYA 3QOPA 4XF3A 3NOYA 4MYAA 4B8EA 3NQBA 2BZNA 4C90A 5J04A 5LK5A 3PJYA 1WCSA 2D3SA 4QB1A 5F3IA 4LT9A 2SFPA 1LEDA 2XHYA 3BOWA 3TFXA 3OVQA 4NRMA 3MVIA 4Y8FA 1C8XA 4NZ5A 3CPUA 3NJXA 1ASJ3 5TBOA 7ENLA 3ARZA 1MUCA 2JG8A 3M8LA 3WXPA 1F73A 1NY1A 2Y6LA 2G37A 4Y24A 3W1LA 5AN7A 1H1YA 1S5WA 1Y9QA 4N7UA 3CIHA 5G2WA 5FA5A 1PMIA 2QGHA 3GBFA 3AICA 3LPFA 1M5WA 3H50A 1FH7A 3AYRA 3CASA 1MFUA 4MWAA 2WFF2 3KGZA 1RK5A 4H55A 4KG0A 4NHKA 2RVAA 4YFZA 2ZIDA 5K0UC 1UKGA 3N3TA 3WNNA 3RYKA 1KITA 1J4EA 3CYJA 2VEFA 2HNEA 3DXIA 3WUEA 1KB3A 3L4XA 2EIBA 3KL0A 4LE4A 4IIBA 5A7NA 2TUNA 2PLJA 3U2CA 5DG2A 2P0IA 1IE7C 3E2VA 2JB4A 1UCXA 1Q2RA 4ECLA 4Q4X2 2VZRA 1NWTA 3NPUA 2X0SA 4ZQRA 2X0HA 3VBSA 3N2XA 2PTYA 4AI3A 2VDGA 4XO7A 2XDVA 2VNRA 5BXRA 2MNGA 4WM8B 5DMLA 3MWAA 3W81A 4DUWA 5I8TA 4EKJA 1Y5VA 4PI2A 2I17A 4JDMA 3W7OA 2JG8C 2BQPA 5F1VA 1SHWB 3WVJA 1XLIA 3R0UA 4KQ7A 3VOGA 2WO7A 3PUQA 3R4DB 4HSHA 4LY4A 1NG0A 3O1MA 3IIPA 2D98A 2C18A 3OLIA 4JCLA 3TW9A 5BOOA 1UOBA 3CJIB 4JN8A 2ON3A 3VD3A 4HNLA 3I54A 4DZIA 2D3PA 2BRTA 3RF9A 4IIGA 3X29B 4LXFA 1XIHA 5ABJC 3WNKA 1MSSA 5LIKX 2V4VA 4JQ2A 2OMAA 3OUHA 1SU5A 4JIEA 4W4QA 1XIMA 4CPBA 3FGCB 4FP2A 5FXWA 3OLGA 4D72A 3U4AA 3LUTA 4KKXA 2ZX5A 5HUOA 4YW1A 4Y96A 3NZ1A 4DBEA 2PDHA 4FTBA 1MW0A 5L7OC 1XBZA 3WDYA 4OI2A 4KS0A 2JKBA 4I5UA 2GDQA 2B31A 4WY0B 4LO5B 2DBNA 3ZT5A 1HQLA 3IAPA 1MQRA 1LLOA 1NTHA 1J83A 2QJGA 1AL21 2V5JA 1W1B1 2D43A 4HA0A 4EAMA 1R38A 6REQB 2A6VA 4AI2A 2NXGA 3WR0A 4DQWA 3QW3A 3WLHA 2ZKNA 3R6IA 3ZXEA 1R093 3ELFA 2X16A 4QP0A 4QNWA 1XOYA 5AFEA 1XBYA 2I7GA 2R24A 4OV9A 3WQEA 4EV0A 3S1GA 1IIHA 4A05A 2YA1A 3S83A 5HPOA 1W0OA 3A23A 4ZXOA 4GH3A 3EDEA 5BMWA 4PL1A 2VMEA 3B9IA 1BEV1 3QGAC 1JULA 5CZJA 4Q4W2 1KM1A 1G9HA 2J42A 4Q2FA 3SW6A 4OBTA 2WNZA 1QQP3 3BCWA 5JPMB 1GANA 4XFHA 1W1VA 2Z24A 2XQRA 3VUPA 4AVVA 5FBJA 4XXAA 3CHVA 1BXCA 1NZIA 2BFUS 1H8TB 1Z7AA 4RZBA 1EYWA 2G3FA 2O9PA 2FDHA 5G4EA 1GVQA 1JPMA 4Y22B 2CHHA 4QNEA 4N6EA 3H2MA 3BTZA 3UXDA 5FCZA 4U36A 2R6QA 3C2VA 3F4WA 2OUJA 2EXHA 2IZWA 3P6BA 5EV7A 3N7MA 5A6SA 3W9AA 3M5XA 1F6PA 1J96A 2BBAA 1NLQA 3ZVIA 4EN0A 3QBUA 3VGGA 1LORA 2Q02A 1IT0A 3CNYA 1O5XA 1PM7A 4C6NA 3AYDA 1T6BX 3BARA 5HA7A 3VBFC 1LT8A 3P5ZA 2Q3OA 5K4ZA 5AZ1A 1RPKA 2HDJA 3PBUA 3CV1A 1LJ7A 3EX3A 2R8WA 1NARA 1UU4A 4NRSA 2YYTA 2W94A 1RJ7A 5CU1A 3M0XA 3GKAA 2YA0A 2PCEA 1QMJA 1HP4A 1JTZX 4CUCA 2XFYA 3SXWA 1XSQA 1EGMA 4XJAA 2HEVF 3A12A 3V1PA 3ZWSA 4GH4C 5CLWA 4O1AA 3W6MA 3TYDA 1QCWA 4PBFA 5EGRA 4NPLA 1S2CA 1UROA 2OWXA 4XUQA 3G1HA 3WLQA 4CD5A 1XU1A 3NSNA 1QNYA 2ARCA 4AHYA 3J9SA 2CTVA 3V0TA 1G9CA 1P43A 4MPKA 4DXXA 3MJYA 2FB3A 2VUCA 1PTDA 3ZPOA 3ABRA 4ZO6A 5H8UA 4QGNA 5FIXA 3PWGA 3T42A 1DJIA 1DWHM 2JIJA 4UFKA 1O66A 2BB0A 3WMBA 3C2FA 4AQLA 1QW7A 2AMXA 5BMXA 3QV6A 3BLOA 2VC9A 3SH3A 3LG3A 4UW5A 3N9LA 1Q6EA 4DXKA 4D6JA 3PB2A 1CAUB 3SQLA 4V2XA 1COV3 1GJPA 4BHPA 4AWDA 2VMGA 3BL3A 1KCLA 2Q8EA 3H7RA 5D8WA 5REQB 1PAMA 3GH4A 2OFJA 3K4AA 1XYZA 3BMWA 1XQNA 1W8FA 1JZ8A 3A21A 1X9TA 1YADA 4CXWA 2X1RA 3L68A 4FPHA 1BLZA 3NKGA 1YKWA 1KGUA 2YCLB 2XJQA 1XLHA 1CAWA 3KV6A 1N55A 1HRI3 2PHXA 2VZ3A 1HN0A 1OEPA 4QX2A 5A6ZA 2R072 4V1YA 3D4KA 2D7FA 3J8F1 4AFBA 4KWOA 2XLFA 1OG6A 1C7TA 5JDBA 4AGVA 3MP5A 4YZ2A 2CLHA 3W6YA 2IKGA 3LMZA 2HSAA 1VJ2A 2JDNA 3H8XA 1X7NA 2PQSA 4BEQA 1HVQA 4Q8TA 1XLCA 5HMFA 1XUZA 1KFWA 3FAXA 3GNXA 5DN1A 1VIWB 2IVJA 1ISWA 1R46A 2J47A 1JYXA 1FTXA 4ZU5A 3NZQA 3G3DA 3M9YA 2YYUA 6PTDA 4FPLA 3AS3A 1PO21 4DWDA 2ZPXA 2E8YA 4BIOA 4AFMA 1CGUA 4GYFA 4MWAE 4IEPA 1GKBA 4XCBA 1EOMA 2WOQA 5A8GA 1T6MA 1YUDA 2D6OX 3UG3A 4IXXA 3WK3A 2A1YA 1CGVA 2YOCA 5CKMA 1VD6A 3QKEA 2V2HA 3W24A 3M7WA 2V9DA 4CDUA 1Z44A 3ME3A 3TC7A 4FXRA 3S2CA 3TTYA 1BBT2 2BSLA 1ZAHA 4UTMA 3OTRA 3W7EA 1XNTA 5D33A 3ZR4A 2W27A 1D2QA 1ESWA 3FFSA 2OZ6A 4LU0A 1XFBA 3VBUC 3KWVA 4EZ4A 4D6QA 2WW5A 3LRKA 1OK4A 4JTKA 2C79A 2F7FA 2IXCA 2ZOXA 3M43A 3CUJA 1PMHX 3WNLA 5I3JA 1GP6A 4HQVA 3K8LA 4E2SA 1I1WA 1W32A 2R1PA 2ZC8A 3QV7A 4L5ZA 1GWKA 2GVEA 2HE5A 2E7TA 4AQ2A 4IL0A 5FP8A 2WO1A 1HKJA 2WVVB 2E9BA 2CAVA 3VD5A 1W2PA 4IESA 1E5IA 1A49A 4AMCA 5CJNA 1B3XA 1EQCA 2Q6ZA 4LS0A 4Q4KA 2GH8A 4GFSA 1Q7QA 5C7HA 4RFRB 2GDVA 5FYMA 3AJ7A 4IMCA 1IR2A 2BWCA 3CO4A 3W2MA 2RS12 5JAXA 5DF0A 2DZUA 4BCEA 1JGMA 1KM0A 1S0GA 3K4WA 2XQXA 1RUH2 3W23A 3W72A 3EWYA 2J4GA 3R79A 5AC7A 1Q8SA 1IKQA 3RZKA 2QJHA 1S2AA 3T7VA 1ISZA 1QATA 3GH7A 2VG9A 3CHCA 2P50A 1FWTA 2PPGA 3MTWA 4NROA 4IIDA 2X2GA 3N15A 1UP3A 2DEPA 5AYYA 2YKKA 5FZFA 4A7KA 1KRAC 5KC6A 3G6LA 1KBLA 1KGWA 1WW4A 4ISQA 2NQZA 4WDXA 4CEWC 3VBHC 1PCKA 2N7GA 4CCEA 1QT1A 2OSXA 4GCAA 1PZ7A 1XLBA 3MUCA 4G5DA 3W20A 4HNOA 2A70A 4LEQA 4Z17A 4KGQA 2WLQA 5GNZA 4EPKA 3GHNA 1H41A 1U5HA 3H26A 2J7GA 1YFUA 2NUYA 4LCQA 3SN0A 3W26A 2BEOA 4OHZA 1T7LA 3KXQA 4AZBA 3ICJA 1QO2A 3S2MA 2CXEA 5LBFA 2XWJB 1XYLA 2BDQA 3VZOA 1WDQA 3IACA 1DZTA 2GVGA 1A8MA 5K7JA 1W9TA 3L0KA 4ZO8A 4Y9OA 4E3TA 4ZZ9A 2ZGUA 4I6VA 1FHLA 4RUBA 5HCBA 1WDPA 2JDAA 4H8VA 2IPFA 3N9RA 4HCHA 4I7VA 5C8CA 4N42A 8RUCA 3VPLA 2ZFAA 1QGLA 4JEQA 3AMGA 2GC3A 4Q8LA 1RUH3 2BPA2 5G2IA 2W5FA 3G6JB 3ONCA 5JOYA 2D3LA 3MSGA 1DYOA 2FHCA 3OD4A 3N9KA 4ZU7A 4IFKA 4ARXA 1UY1A 4OMCA 4M5PA 2VC6A 3LA2A 4MTVA 3E5XA 1DJYA 1WMFA 2PRHA 1KM4A 3D6NA 4EP8C 3OY8A 4RPQA 4LQ1A 5AHFA 3AP6A 1BK0A 4IEWA 4LITA 1CLXA 2XIJA 9XIAA 4UFLA 4O19A 3RNDA 4C6KA 4G7EB 3SECA 1E3XA 2WT1A 3NV4A 3GUWA 3T3YA 1FWNA 3JZVA 3D5HA 3FIGA 4JHOA 4RR3B 4ICCX 2Z7KA 3QSTA 4XUOA 5A6YA 3BDKA 1EP2A 1U5JA 3TYCA 1MZ6A 2QCHA 2WN3A 2IXHA 3T2TA 5IK8A 3GQYA 1QPKA 3BCJA 5CC3A 4PYSA 3WK1A 5DMYA 3B04A 1ISYA 4PHZA 1RA0A 2D23A 1JCMP 5GNYA 3ON7A 3WD4A 3UZXA 5C5YA 2EPNA 3A3XA 1AJ0A 1ND2A 5F3EA 3DCQA 3TQ0A 3URNA 3OPSA 4AZIA 3MW4A 4FXGB 3Q9OA 3AXIA 5FYTA 2EPLX 2QKDA 3U4SA 4B1MA 3QRHA 2FDGA 3BO9A 1KM5A 3E5PA 3HG4A 5BRBA 4PTNA 4XKYA 1O4UA 4QS5A 2QCSB 4P7RA 1B3OA 1IZKA 2AL2A 4U33A 1UY3A 4XX6A 1K45A 3NVDA 5FSDC 5KXBA 4IE4A 1J2BA 3ZXDA 3NNLA 2ZA2A 4XAPA 1QWGA 1Z7S1 3W37A 5IFPA 2EF9A 1PDYA 1ZCCA 4W8BA 4YG6A 1LWJA 3RMYA 3PUDA 3JUUA 4PCSA 4JGZB 2J1RA 3KMHA 2WLZA 4NWVA 4PULA 4OHYA 2PLKA 5JMUA 4F9DA 1W05A 1EIXA 4GD0A 2GVYA 1XRVA 6TIMA 1V5XA 3G2GA 1TQJA 3OYWB 2E9MA 4XISA 4MZ8A 5FKBA 4JY8A 2RJLA 1WDRA 1XU2A 3CC1A 3EEZA 3O63A 3QY6A 2HH9A 3ZJ6A 2P1BA 1JPKA 1JDCA 1HRI2 2BXVA 3GK0A 4R4XA 1A47A 1YIXA 4XBKA 3BC9A 1XXXA 5DRIA 1M7OA 1YPFA 1LDCA 3EZ4A 3P0WA 1QJWA 4TMBA 4FXSA 1PWMA 2QDDA 2X09A 4LS1A 2EG7A 1CZ1A 3BSMA 2PAMA 2ZICA 2IMRA 3ARPA 4AWUA 4BF5A 1CQ9A 2OO6A 3GTHA 5D02A 4IG2B 4W8AA 3BLIA 4R85A 4X6RB 3ZYRA 3BANA 3WEMA 2YC2A 3TA6A 2TEPA 3LA4A 1YQCA 3MHFA 1H50A 5C4WC 4IHCA 2D20A 4DIQA 2ZA9A 4WVVA 4AVNA 4AI0A 4HZMA 5B7YA 1DQ4A 3SCOA 2E5BA 4DY3A 1HP5A 3LHYA 1S46A 4UUIA 4LB3A 4CXYA 2KAUC 1ODMA 4ZY9A 2XR4A 3RG0A 6XIMA 1MZHA 3R89A 4EN7B 4Z0SA 5DPNA 3AYAA 3WL0A 5A1FA 3VDDA 4MKSA 5BOFA 2VVEA 1MS9A 1RUE1 4L11A 3RG6A 1I0DA 4G7FA 2QYGA 1AODA 2HK0A 2WC3A 1ULGA 4C6LA 1HXS2 1XCWA 4M0NA 2AACA 4XIOA 2EQDA 3MSDA 3BQ5A 3PU3A 3ANYA 4GHRA 5A8OA 2PHUA 4JTHA 1N8WA 1MDLA 3UJSA 2ISDA 2HWB2 1HIZA 1E9IA 1TE1A 5TIMA 3HPSA 3CPGA 2XHNA 1Z48A 2Z4GA 2YCEA 3CIWA 3P67A 3FXYA 2OODA 1EFZA 1VAMA 4HGXA 3WO8A 4ATDA 5JPNB 3GXDA 1Y7BA 5TQLA 4GA9A 1X38A 5FJUA 1V6MA 4EZHA 1W8SA 4GX8A 4M81A 2PUZA 5FV3A 3LHZA 4ZPIA 3N6HA 1JCNA 1V51A 4FI4A 1WKDA 2W08A 2ZQ0A 3E38A 3DHDA 1JDEA 3VDAA 3PWAA 3CZUA 2OCZA 3NWKA 3EB2A 4LF2A 1CX4A 1OABA 1JIBA 2V4AA 5C0QA 2OX0A 4KFPA 2QNKA 3N7JA 4XAGA 1XLDA 3CPRA 1W8NA 2XIIA 3WLTA 4AC1X 1NA1C 1UL9A 2DW6A 1GQKA 2VX5A 3QXBA 4L9YA 3R0DA 4L99A 2H9AB 4F0LA 1JHNA 2DORA 4EWAA 1F6YA 3PG9A 3RX3A 2EICA 3MKCA 1Q43A 4D1JA 1U2YA 1CB7B 5KINA 4K21A 3VKOA 4XJ9A 3H8RA 4PBOA 4HPXA 4B3NA 4HIBA 5A7WB 4E8DA 3PPCA 4DLFA 2AZ5A 4BZ4A 1ZREA 4ZTXA 5JOWA 4FALA 4RW3A 3A9IA 1H9PA 1SZGA 3WNXA 1BTMA 3M07A 1XIDA 1TYGA 5K4LA 3R58A 3B3DA 4NJ4A 3VBFA 1VIZA 3SCTA 1DF0A 1DWGM 1GZWA 1OPMA 4MKVA 3AIUA 3OVRA 3SY1A 1W5NA 1RCXB 3DECA 1UPPA 3KCJA 4FR6A 4S3BA 5SV8A 3CMJA 1WYIA 5EFDA 2PSNA 1QOXA 3ZIXA 4AZ6A 1OM0A 3PPFA 1VZWA 3QHMA 4OVXA 1KLYA 1HB4A 2O8QA 4DJFC 1XISA 3FEQA 1KXHA 1P6WA 1FCQA 1QW9A 4JRAA 3FLUA 3ETPA 2WNVC 2NLRA 4QHZA 1F74A 3DZ1A 2WHLA 2PWEA 5FFOC 2DCYA 3TNOA 3VM7A 1ICQA 2XSAA 3C3VA 3O0FA 2EG6A 3EB3A 3RI9A 1WD3A 3T1GA 1OGSA 4Y9AA 2OKXA 4J3XA 2PDXA 3UNTA 1NM9A 1CJPA 4P2VA 4TXEA 2QDHA 4YIWA 1WLTA 1KRCC 1V08A 1JZ2A 4OQ8A 3VIFA 4FOWA 3RMJA 3O06A 4OU1A 3CZ8A 1CW2A 3H55A 1TME2 1Z3NA 2F17A 1GUVA 3EKZA 1IQ8A 2ANUA 1JI6A 4Q4Y3 4Q0VA 4P9LA 4K2SA 1OH3A 3K3NA 3SGGA 4YGDA 1QPQA 2Z2AA 3IVTA 4Q4OA 3VNYA 5EU9A 4F83A 2A3EA 4HSJA 5EKYA 2G41A 5H9QA 5I77A 4LKEA 3O1TA 3WQDA 1TJ1A 1ITXA 1PVNA 3TMQA 4LQRA 1OCNA 4H9XA 4HA3A 2R042 1MZ5A 4OZXA 5CG8A 4WGHA 2PDIA 3AIRA 1GEHA 2D93A 2ZUNA 5FEWA 1SYTA 3AL6A 3MIHA 3AB0A 4FOJA 4LKFA 1R86A 3SB0A 1H8TA 1CWPA 1DVJA 2B45X 1PIIA 5BROA 5CFDC 5G2HA 2JE7A 2WO3A 2RKXA 3T0DA 1GUIA 4CN4A 1JW6A 3I6TA 4DN1A 4W6XA 1H2KA 4YARA 4LWWA 4C65A 4WGXA 4G3YC 3EKGA 4TVDA 4B4HA 3H4WA 1PO13 1TE6A 2BNNA 3LYEA 1H63A 5F2SA 2RJKA 4REQB 3T0AA 1GZJA 1VBHA 3H3ZA 3VCCA 1OFEA 2WV8A 4PSPA 4Z2JA 5L9FA 4LOSA 4AFCA 2GGHA 3TYBA 3FKKA 2ZWYA 4NJKA 2Z1SA 1SZBA 4M56A 3SSJA 4LO8A 1SLIA 1E56A 4PTWA 4HB7A 4DHGA 5FZOB 3PHAA 4W93A 1LODA 3IPVA 4B4FA 1E1CB 4JD4A 4LAOA 3OG3A 4GWEA 4Q33A 3I3DA 2IUZA 3B06A 1DDLA 3IKWA 2GN7A 4YYOA 1GWJA 4GXPA 1VBB3 4JTNA 4AFDA 1MRQA 1DTNA 4HNVA 1YBQA 2NZ9A 1T40A 4IMEA 2VULA 1ITUA 1AL23 1SSDA 2W52A 2WMIB 4OBRA 1GVOA 4Q4RA 4AZHA 5HR6A 1FWAC 3WJWA 3WNMA 3S47A 3BJSA 1ZBWA 2CBUA 1W5PA 2QDRA 2XJTA 1EXBA 2HEYF 5CFCC 4HSLA 1ENXA 1UB3A 3AYCA 3NWRA 5FZBA 3ZYFA 1IGSA 2PE4A 1HZYA 3IJLA 1R9ZA 4NIDA 1XRFA 3NAVA 3SCHA 1VIWA 2WSUA 5FXXA 1VEOA 4EYUA 3GW0A 3I2IA 2PTZA 5FPLA 5C3QA 1BEV3 1IG0A 4FO9A 1P8JA 4LE3A 4N9BA 2HVNA 2WJFA 2JE9A 3LD5A 3LPGA 5GZDA 5IVCA 1M04A 3A9BA 5CC7A 1VB4A 2DZBA 2R1KA 3NJ3A 1K9FA 4BZYA 1UX6A 1THFD 3CL8A 2TRSA 5DELA 3QD6A 2C24A 1TCDA 3MW3A 3TB0A 4L1XA 1JOBA 1Q7ZA 3C2RA 2ZX4A 2G9GA 1KTBA 3P0XA 3VBOA 3W22A 3WDIA 4C6MA 1FH8A 4NHLA 1AUSL 1ODUA 2RGLA 1TVGA 4RE4A 5FXVA 2GZXA 3B69A 3SUWA 4XAEA 2ID4A 3CEUA 3OO2A 4DYEA 4XBNA 4XV0A 5T91A 1NXMA 4A3YA 4DZAA 1KRMA 4PQ9A 4FNPA 3QBQA 3VBRA 1EQPA 1YXDA 2JDPA 3PZMA 4LGXA 3LY0A 1C8M2 1TNRA 3UG8A 4IJCA 3DBNA 3W2JA 4UW3A 3TNQA 3AZWA 1H1ZA 2X5IC 1UC5A 1I2NA 4CCNA 1RLDA 3T0TA 1LNSA 1NLRA 2Z1KA 4GG9A 5CBJA 4ZSTA 1XSIA 1C3FA 4F8AA 1ZZ8A 5DUVA 3LXAA 4MUPA 5HBAA 2CGOA 5FZ1A 4LALA 5FF4A 3E0VA 1N1TA 5JQ9A 2YGYA 2C1FA 3EPNA 4XABA 5E1RA 1XNKA 5L7OA 1QY4A 1SDWA 4UFMA 2ZABA 3W58A 5LBCA 3M4HA 2GQ9A 2B7OA 2J7EA 4DINB 1VCGA 3PFMA 4IGQA 5ABFA 4N9DA 1H61A 1GG1A 3JRKA 2FPYA 3AKRA 1EH9A 4C6PA 1DP0A 3T0CA 1JUHA 2WZMA 3TTOA 5JIPA 3K4DA 3KWSA 3B0VC 5K4XA 1X9PA 1TR9A 4JS3A 2GMEA 4G8TA 2PEVA 5DDJ1 1XL9A 3V18A 1X98A 1Z9AA 2GC0A 2Q0AA 4UTKA 3ANUA 1O4TA 2JGYA 1XP3A 2OSYA 3C7OA 5T50A 3MMUA 3POYA 4MY1A 4ICMA 4I02A 2OYZA 3UFYA 1HKWA 2WKLA 3BW4A 1US2A 1V0MA 2OQHA 1OOPA 3NPXA 3H2EA 2OT1A 3MVTA 1SLBA 1BWLA 1LL6A 4KEMA 3EPOA 4XJWA 4NZ3A 3LE0A 2Q5TA 2ADEA 3W7MA 3KVAA 5FREA 1CTNA 4K38A 3CWOX 3R6SA 4P08A 4MGYE 4PMZA 2Q1FA 1W1A1 3MSYA 3P80A 4K6AA 3O16A 4IQPA 2DIJA 4GO9A 3EMRA 4LVFA 1JD9A 3HPXA 4BLIA 2WJDA 2XIQA 3PZGA 4CCOA 2EPMX 4K3UA 1W0MA 4Q7BA 5FIPA 1WA3A 4WJXA 3ABSA 3JB8A 3O1PA