4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
1OGBA 1Y7VA 1IZKA 5I3DA 1B3ZA 2WMJA 3RMEA 4W87A 2ZE0A 2VZOA 2XGBA 1TR1A 4TUFA 3IANA 5DEZA 4M82A 2VJXA 3S6TA 1D7FA 3T0DA 1EO5A 4AZCA 3K1DA 2A3HA 1UWRA 3ORJA 1WE5A 3ARPA 1QW9A 5I5RA 5AYBA 3WEZA 4D6FA 1WZKA 3O6AA 3PZGA 2AOSA 3T08A 1NARA 3WF1A 1UA7A 3AI0A 1JDDA 3W0KA 1O6IA 1XRVA 1VAHA 3ARVA 4H8UA 3VOCA 1MXDA 4UCFA 3RM8A 1NQ6A 2CCRA 3MUY1 1ISZA 2YIHA 3AHZA 4W88A 5M5DA 1AQ0A 1B3VA 5IFPA 4ZEPA 3NUKA 3VD3A 3CHCA 2KR2A 3VGFA 2LROA 3TA9A 2PWFA 2YLAA 2G3MA 3TTOA 1US3A 2CEQA 2Y2WA 2J7FA 2WLYA 4W86A 2WBKA 1CXFA 1FH8A 1GOQA 2IXUA 3CBWA 1HL8A 5A3HA 1US2A 1EA9C 2QHAA 4AXNA 4GO9A 4RE3A 3BXWA 3FAWA 1JXKA 4WF7A 3RPMA 1EXPA 3A4WA 1VBRA 2WC7A 2C8NA 2NT0A 2XVPA 4RE4A 2CERA 3F4VA 4YPJA 2XWEA 4JHOA 4M1RA 3K8KA 2DT1A 3AZSA 2DIJA 3AHXA 5D9OA 5HXMA 2ZX7A 2QPSA 4GQQA 4UQ9A 1MXGA 3A47A 4TVUA 2VXJA 1ESWA 2EO7A 1NP0A 3VD5A 4B9ZA 3GTNA 4JFSA 4Z2GA 3WL1A 3VDAA 1R7OA 4UQDA 1ISVA 1E6RA 4HMCA 3POHA 4ATWA 1W9VA 2ZXDA 3VIFA 4HOXA 1WZLA 1OINA 5ECUA 1PAMA 3T0BA 4RE2A 1LF1A 4ATLA 4KMQA 4UOQA 3TP4A 2X0HA 3OG2A 5LYRA 4R5EA 1GCYA 3DHPA 2K46A 3FHQA 3VIGA 2E9MA 1FHDA 4PRWA 1PZ3A 1GORA 4A3HA 4AD1A 3OB8A 3PTMA 3CUGA 2G3JA 3M6DA 1V6VA 4JIEA 3FAXA 4ZFMA 1E1FA 2CYGA 1GQIA 2WVVA 4PN2A 2W61A 4F66A 4WIWA 1BYCA 4W85A 5TD4A 1QNRA 2FHCA 2ZWYA 2CBVA 4YW7A 2DH3A 4W5ZA 2J75A 1IZJA 4LX4A 3HU7A 1R87A 1V6UA 4TVCA 3AXHA 2J74A 4W7UA 1GWLA 3AIEA 1TUXA 1JF5A 4J3SA 5AY7A 1J0HA 2PWDA 4UQEA 1HF6A 1CGVA 3WSUA 2WZEA 4JFUA 4OIFA 1NWTA 2C0HA 5D8ZA 1G94A 1JYWA 3RIKA 1JFXA 1BGGA 1GQLA 3RILA 1W32A 1PIGA 1ODUA 2GDVA 1F4AA 4H04A 3SEPA 4P7QA 1HJVA 1LQ0A 4NZCA 2VX6A 4UFIA 3WDIA 2O9PA 1O7AA 1FHLA 4ZXOA 1J0JA 4QP0A 1UR9A 3FW6A 4WKFA 3ZIZA 3F95A 1UZ1A 2FGLA 3K4DA 4J3WA 1J0YA 3RM4A 3J7HA 4F9DA 5GNYA 1EDTA 1VIWA 1E71M 2XUCA 4AD4A 1KXHA 4MAVA 4HPHA 3SIMA 3M46A 2PWGA 4DM2A 1VRXA 3ZT6A 2VRQA 1X6NA 4PTMA 3SCTA 1ZBWA 1LLOA 1C8YA 3BCDA 4H41A 1WAWA 5CQ1A 3FXYA 3TTYA 2WYFA 3SCNA 3VX1A 5E6YA 3VIJA 2BNJA 1PEZA 4AIUA 1W9PA 3N18A 5GNZA 1AQHA 2QLYA 1HX0A 1HVXA 2XIIA 4B9YA 3PTQA 1UYQA 1ZU8A 3OBAA 2Q8XA 4BQ2A 4URIA 3SUWA 4Z2HA 2E9LA 4LK7A 1M01A 1CGWA 4OKDA 1BYAA 4EKJA 4P7RA 4ZE5A 3CIVA 2VX4A 2WMIB 3FHAA 4PMZA 2WC4A 1DWHM 1VBUA 1NWUA 2JWPA 3OGRA 3AIVA 4V2XA 3WD2A 2FHBA 4UOJA 6A3HA 2YL9A 4E8DA 3W29A 4DWSD 1OWQA 5DFAA 3CTTA 1E4LA 2QF8A 3EDJA 1KR0A 3VM7A 5DMYA 1SR0A 2QMJA 1P6WA 1UD8A 3WFZA 1HJQA 3SUTA 2D23A 2HISA 4LGXA 1V3MA 1K9FA 2XFRA 3A4XA 4D6HA 3AS2A 1GOOA 5DF0A 1E5JA 1RD6A 3MSGA 3CH9A 5HDRA 5BXSA 3L4YA 3RDKA 3K8MA 3BMVA 1XYFA 4AZCB 4TX8A 3WUGA 4ACZA 1KBBA 1JL8A 1I1WA 1J01A 1LWHA 1H0IA 1KCLA 4M81A 4J3TA 2O9RA 2V5DA 2GJRA 1JI1A 1GUVA 4R27A 2OSXA 4CKQA 1R86A 3PTKA 1W1VA 1XCXA 1XSKA 1UH3A 1RP9A 1E15A 1E43A 3GNRA 5CZKA 3WD3A 4Z2LA 2W5FA 2VZUA 2YJQA 1Q6DA 1V6YA 1PX8A 2VCAA 3BLKA 3PZIA 3VD9A 2J7GA 1OKOA 1ZJAA 3U57A 5IDIA 4GZEA 1HN0A 1FFQA 3K4AA 3ARQA 1UR4A 3AMKA 2UY4A 1HJSA 3VGDA 2VVNA 2GJXA 4W93A 3PN8A 2J7EA 3GNOA 2BHZA 2Y5EA 3AZTA 1E3XA 5ABGA 3VINA 4TTGA 4CN4A 5A69A 1YHTA 1CGUA 2XTKA 4OUEA 5ABFB 2OLHA 4UOZA 1W90A 2VNCA 3DECA 3OZOA 5I0DA 3KWXA 4OBSA 1C8QA 1MW1A 4FLQA 3BSHA 2J47A 4X9YA 3L2LA 1OD0A 1W9DM 1H09A 4PEEA 3VPLA 1G01A 4W89A 1JZ8A 2WHMA 3EMQA 4N42A 1WCUA 3QR3A 4UQCA 1U33A 2CETA 4DM1A 9CGTA 3A6OA 4M8UA 1AVAA 3FNDA 2WMKA 4GI6A 5BCAA 4GI9A 4MB1A 1D2KA 4M24A 1B3WA 1GOWA 3G6LA 2EPNA 5A1AA 3E1F1 1BSIA 1ZJBA 5EFDA 2RGLA 4PMYA 4BCEA 4OBRA 3ZYBA 2J79A 2FH6A 4PMRA 5FL0A 1KBKA 5HOSA 1K6AA 1CXEA 4D6JA 2VT0A 5D9PA 3W6MA 3UG4A 2NT1A 1WDSA 3IK2A 3LPOA 4AISA 2O14A 3ALGA 1DEDA 3WNLA 4MNKA 1K9TA 2OWWA 1C8XA 3N13A 3AHVA 3F5KA 3ZMRA 1C92A 4CN1A 2QMKA 2UY2A 1G5AA 1GNXA 4U2ZA 3WMSA 3SCWA 2DEPA 1UD2A 3AJ7A 4S3KA 1BVZA 5A6KA 2LRPA 2UWFA 3W53A 1W91A 4AZBA 3VMNA 3AS0A 3TTSA 1H2JA 2XPKA 3GZAA 4UQAA 4OOUA 2GFTA 1LL6A 4U5IA 5FCZA 1EH9A 4EK7A 3VIIA 1W9FA 1E4MM 1BPLB 4CN6A 1J10A 2ESCA 4JKMA 5E0FA 1PPIA 1W8ZA 1KB3A 4MDPA 1HJUA 3W24A 1UR1A 3KEHA 2WLZA 3CZEA 1LG1A 1MWOA 4NSBA 1XH2A 1A47A 5M3WA 1LL7A 3UR8A 1IV8A 1A3HA 1FH7A 4JFTA 4CCEA 3HMCA 2BFGA 3N04A 3SUVA 1FA2A 4PMVA 2Q1FA 5HNNA 2WCSA 2D22A 5BWFA 1W9XA 4H7VA 2GK1B 5HPCA 1VJSA 1JYNA 4LQ1A 3WN6A 3THCA 1KR1A 1DTUA 3AS3A 2CIPA 2YDRA 3SUUA 2ZUTA 4ACYA 1DHKA 2J8GA 4Q22A 5A8QA 5JIPA 5CLWA 2CKSA 1EGZA 2WVTA 4AEEA 1VEPA 2MANA 3T0AA 2GUYA 3AIWA 4UTFA 4QLLA 1QI3A 4U33A 3APGA 4FLSA 3GNPA 3AQUA 3OLDA 5KEZA 5BRPA 5BXPA 4HMEA 2PWEA 3T2PA 1CXKA 5I24A 4V27A 8A3HA 1OIMA 1C93A 2ZOXA 1WMXA 1BGAA 3QGVA 1MW2A 1QNSA 1UH2A 1JI2A 2FDMA 4A6SA 4AD3A 4HOWA 3CUJA 1GHSA 4B3KA 2BHUA 5E0CA 1TMQA 2CESA 2VOTA 3BAWA 3WDRA 2WCGA 2WKLA 3PZUA 4M29A 4D71A 1QBBA 5CLTA 3KL3A 1BFNA 1E70M 3TONA 3DC0A 1V6XA 2ZUWA 1VB9A 4IPLA 3WQ4A 3L4WA 1UD4A 1BVNP 4UZUA 3VIKA 1OGGA 1VFUA 3WBEA 3D5HA 3OZPA 1UQZA 2E8ZA 4DUWA 4XV0A 4UNIA 3CUHA 3NJ3A 2WCAA 1UG6A 3JUGA 3EDEA 2F61A 3GDBA 2J77A 3ZM8A 3WDPP 4DUVA 4QFUA 3ECQA 3UERA 1JNDA 2J4GA 5LA1A 1NWSA 2GVYA 3VKKA 5E9AA 2CHOA 2ZUMA 1QVBA 4D6EA 1G9HA 2WZIA 5I79A 3EDFA 3W37A 1EDGA 4AL9A 4YW6A 1ISYA 3MO4A 2EPOA 2C7FA 2EEXA 3WF0A 3D3AA 1GVIA 3WNPA 4KH2A 3WMBA 3IAQA 5AC4A 1JZ2A 4NRRA 1UHVA 4UR9A 2WMHA 2DT3A 1KWKA 3ARZA 2GDUA 5D8WA 2BXYA 4CVUA 1XH0A 4C7GA 1JDAA 1CPUA 1QHZA 4CCDA 5I2UA 1CLXA 4FLOA 1GQJA 3CHFA 1E4IA 2BY0A 2CBUA 5CGTA 3AYRA 3OIHA 2VX5A 2A3EA 1H11A 1H5VA 2X8RA 2G4FA 1H4PA 2VZSA 4W8LA 5A6BA 1W3HA 2VC9A 1XCWA 2V5CA 1LJYA 5A6AA 5CJ5A 1JAEA 1V0MA 2GJPA 5A2AA 3VU2A 4F8XA 5EBAA 2WC3A 2Z1KA 4U2YA 4J3XA 1GOIA 1KXTA 3GH4A 3U5UA 1XD1A 3EMCA 3VVGA 1M53A 3WD4A 6TAAA 5FL1A 2CHNA 4C7DA 1CGTA 3IAPA 1V0AA 4MAZA 4QDMA 3NSXA 3U7VA 1WPCA 3AXXA 3BMWA 3WKZA 4L4PA 3SCOA 1OH3A 3BAIA 3KL0A 4LYPA 3CGTA 3KZSA 1CZ1A 1N82A 2A3AA 4PMUA 4YWAA 3CMJA 3PZNA 3CZGA 1J0ZA 1TVPA 2PBGA 2W4XA 2EXOA 4HZ8A 5A6JA 3HN3A 3VO0A 1W3JA 4JZ5A 4AIOA 4BQ3A 2FGZA 3AIBA 4P8UA 3ZR5A 2WM0A 1H1NA 4X0VA 3OLGA 3ZO9A 4DWSA 3NYDA 1OT2A 2XIBA 1VFOA 3BGAA 3F5JA 1CGXA 3AICA 3WNMA 4TVDA 4U3AA 1FP9A 1KGXA 3N1AA 2YA0A 4MNLA 2ZXQA 3W81A 5EFFA 4K68A 1W8TA 4P8XA 1QI5A 2EPKX 3MSDA 2Y8KA 4AZGA 4MB3A 1XV8A 4AZ5A 4YN5A 4HTYA 4AZIA 1EOKA 4AEFA 1W3LA 3WH8A 2WMGA 3PHAA 1UWUA 4BF7A 2J78A 3AS1A 5HPOA 1B31A 3KL5A 1MW0A 3MUIA 3WNKA 1UOJA 1E40A 3BLPX 1ISWA 1E9LA 1Q6GA 2JEQA 2YA2A 1GONA 3I3DA 4EAMA 1EHNA 2YL5A 4LJHA 4MB5A 2E4TA 5LA0A 4PTVA 3OGSA 1Q6CA 1E72M 3NSMA 2O9OA 1VFMA 3W4RA 1BG4A 3WQ8A 1HIZA 3MMDA 4LXFA 3CHEA 4PCTA 2VX7A 3U7BA 2OWXA 5CXPA 4PUDA 2CNCA 1MFUA 2OSYA 2X05A 1D3CA 2BY2A 2VCBA 3VNZA 2W63A 4HZ6A 2VZTA 4PBGA 2D3LA 3WH9A 4PYSA 1XSIA 4GPNA 4TTUA 2XVGA 2ZICA 3II1A 1XD0A 2JIEA 4U5KA 2W92A 2D0HA 3U5YA 3VDHA 4AWEA 4AD0A 5FOOA 1QNQA 3B9DA 1J9YA 1F4HA 2ZUSA 3CUFA 2WK2A 1NM9A 1UH4A 3VGBA 1CIUA 4GI8A 3WDJA 2J25A 3WEOA 4UFJA 4Y7EA 4UZSA 2DPEA 5KZ6A 1EHAA 1IT0A 2FHFA 1WP6A 5A8MA 3MV01 1G0CA 4LYQA 2BHYA 4KRUA 3UCQA 3WQ6A 1JZ4A 2WWCA 1B90A 4BQ5A 1CDGA 5C71A 1BG9A 3VUPA 1PZ2A 4A3YA 5JBEA 2WXDM 2XGIA 3ZJ7A 1UKQA 2V3DA 2D0GA 3ZJ6A 4D72A 1UWSA 1TA3A 4Z2IA 5BRQA 1TFVA 3SCSA 1JG9A 4BS0A 4P7NA 2YBTA 3ARXA 1VJZA 1V3KA 1JAKA 4GIAA 1OIFA 1CENA 3A3HA 1E0WA 5HBFA 3THDA 7TAAA 1UD5A 3L4TA 3GM8A 5M03A 1JYVA 2CITA 3MANA 4PMXA 2J8FA 4YHGA 3L4UA 3MUZ1 1U30A 3QOMA 4MJ4A 1JXJA 1GWMA 1EQPA 3LPGA 1FOBA 4MPKA 3VD7A 3N12A 3WDQA 2ZX5A 3ZR6A 1PIFA 3L4XA 4MJ2A 4LKFA 1GVYA 5IHRA 4Q7NA 1B1YA 4WKAA 1HL9A 2PI6A 1DWAM 4Z2KA 3AXIA 2EQDA 2VRJA 3WDHA 4AC1X 1W1YA 4CUCA 4NRSA 3WD1A 2QV4A 2BS9A 3CZLA 1CXLA 5D4YA 2F2HA 1V02A 1MQRA 5A94A 2XM1A 3N11A 1NWRA 1PBGA 5EMYA 1K9EA 3CO4A 2D24A 4HA1A 2ZXAA 1RP8A 2WANA 1QNOA 3MUAA 4DUXA 5C8BB 1B2YA 3WUBA 2BY3A 3IJ9A 3AZRA 2CPUA 1ZL1A 3KE0A 4B16A 3K8LA 3TTQA 2DSZA 1KQZA 1MVYA 1QI2A 4BQ4A 3F5LA 2W67A 1HKIA 4D6CA 1EDQA 1W1PA 2F8QA 1E6XM 1DWIM 3WH7A 3BAXA 4CU6A 1H3GA 1KXQA 1C90A 2JALA 1FH9A 3UT0A 1CXHA 4AYSA 4CD8A 3MKKA 3OLIA 3VIPA 1V3IA 3NCOA 5A95A 1E6ZA 2WVVB 3AMGA 2DT0A 1R8LA 4PCSA 2A3BA 1AQMA 3EMZA 3AHYA 4GINA 5AYIA 3W26A 2BXZA 1WKYA 3ZJ8A 1JGIA 2X1IA 4OZOA 3NSNA 4WK9A 1H41A 2Y8VA 2YL6A 1VFFA 1BTCA 1M03A 5A2BA 1TCMA 4CPBD 4JFVA 1UD6A 1CBGA 2PF0A 4FK9A 3SCQA 4HZ7A 4UFMA 4AZ6A 4MNMA 1V08A 4CD4A 3VGGA 4E2OA 2XJ7A 1XSJA 1HJXA 2WNWA 5GNXA 1NOWA 2JEPA 2ZUVA 1W2VA 1EQCA 1C3FA 1BQCA 4WLCA 1U2YA 4LYRA 2PC8A 1SFSA 4GQRA 4DWSB 5BYWA 3PZ9A 3I3BA 3DYPA 1OBAA 3GXMA 2DSWA 3L2MA 4WJXA 2VR5A 1LWJA 2D2OA 5IHSA 3ZYFA 4JAWA 3WEMA 2V3GA 1OCQA 3VTRA 1JD9A 1FP8A 1E73M 4EE9A 2ZIDA 4KGJA 2VQUA 3VM5A 2YBUA 3N17A 1ZB5A 2V38A 4FMVA 2WAGA 3RJYA 4QCEA 1MQQA 1XYZA 1CLVA 3M7SA 4PMQA 1W2PA 4HP5A 1VEOA 1WO2A 4HPGA 1E0XA 2J62A 2DH2A 4CD5A 2VL4A 5ABEA 4LKDA 3AFBA 3HJEA 2FH8A 4J3VA 3GH5A 2IXVA 4NI3A 5GPRA 1WZAA 4BA0A 1MW3A 2VO5A 4QLKA 3W6LA 3PZVA 3N15A 3AHTA 4OOZA 1E56A 2BV9A 1AMYA 4ZENA 2ZUNA 2VQTA 1E55A 2JIWA 1ITCA 8CGTA 5IFTA 2XYLA 4GO8A 3EYPA 4JCLA 4CU8A 2YDQA 1V3HA 4HA4A 1C91A 1GPFA 4ML4A 2EJ1A 3IJ8A 1DP0A 1JIBA 2YLLA 3ZYHA 3CLWA 4W8AA 1B3YA 4M56A 3O9NA 1ITXA 1GQKA 1XC6A 1MQPA 3GXIA 3WUEA 1NOFA 3SCRA 3WNNA 5AC5A 3ARYA 1CYGA 2CBIA 1JD7A 2PWHA 3WL0A 2WZHA 4XZBA 1QPKA 4CP9A 4CU7A 1QBAA 1E6NA 3UEQA 4QLJA 1X1NA 1HN1A 3LPPA 3ARRA 2G3NA 3W82A 1V0LA 4B3LA 3VGEA 4CGTA 2QPUA 3AMCA 2X0YA 5C70A 1CNVA 1JZ7A 1KXVA 3BH4A 1KGUA 5I6SA 1UKOA 4E4PA 2DT2A 1CECA 4PMOA 4ACZB 5FD0A 3M07A 4W5UA 1C7TA 5A2CA 2X2YA 2BVDA 1TA3B 3VILA 3BC9A 3MMWA 4JCMA 1W9UA 2OSWA 4AD5A 2XWDA 5ABFA 2G3IA 1JFHA 3ARUA 2A3CA 3WNOA 5BXTA 2JFEX 5JIWA 4AW7A 4UFLA 1UA3A 1PJ9A 4N0RA 1B30A 2EPMX 2D3NA 4AZ7A 4E8CA 2GJXB 3WUFA 2XSBA 3AIUA 5A8PA 4P7OA 2ZX9A 4JKKA 2XFYA 2XM2A 4ZE4A 2AMGA 4HU0A 4JL2A 1V6WA 4UQBA 2J7CA 1WDQA 2WSPA 1K9DA 2XFFA 3VIHA 3DHUA 4HA3A 3CMGA 1V0KA 5A8OA 4MDOA 3AMLA 2WPGA 3WY1A 5CGMA 3AYSA 1UKPA 1TE1A 1Q6FA 3UR7A 2E9BA 3GBEA 3CZJA 3N9KA 1VF8A 1UWQA 4W7VA 2W66A 4W8BA 4CVWA 1H0GA 4ZXLA 1WZMA 4XB3A 4S3JA 4JHZA 4P8VA 3GBDA 1UD3A 4PMNA 3VGHA 3EDDA 1XH1A 2EBNA 2OYKA 1SMDA 1W1TA 1JNEA 1E0VA 2XVKA 3W27A 2VR4A 3S2CA 3BAYA 2JF7A 3O2LA 3ARSA 1JDCA 3ZOAA 3NIYA 5FKYA 1JYXA 3UG3A 2OYLA 1EO7A 2J7BA 3L4VA 4BZYA 3CPUA 4TX6A 1UWIA 4GZJA 1OSEA 1XGZA 2E3ZA 1W3KA 4D6GA 2ZX8A 1GHRA 1UKSA 5JUVA 2AAAA 3UETA 2E0PA 1MFVA 4CCCA 1YQ2A 2WHJA 1BAGA 1BYDA 3T2OA 1HP5A 1HXJA 4LK6A 1J18A 2CXGA 5M17A 1W8WA 5CPQA 4KGLA 4UFHA 2BVTA 3BAJA 4QCFA 1UOKA 1Z32X 1E6QM 1E3ZA 4H2CA 5A6BD 1I1XA 5JBDA 2VURA 1SMAA 1CGYA 3ALFA 3QHOA 4IM4A 2GK1A 4D6DA 2BVYA 3PZTA 4KWUA 3NDYA 4MTVA 1OB0A 4GKLA 2VUYA 3ZT7A 1HVQA 5A6LA 2GSJA 3AIRA 2XG9A 3RM9A 1ODZA 2OYMA 2DDXA 2UY5A 3T09A 3WF3A 3EDKA 6CGTA 1LG2A 2Y4SA 5BXRA 1V02E 2Y24A 4J27A 4LPCA 2WHKA 5I77A 3WBAA 5A6SA 2DIEA 3VIOA 2WVSA 3ARTA 5DO8A 3WENA 1BHGA 2W62A 3QHMA 1BLIA 4WKHA 3WH5A 2J7DA 3I3EA 7A3HA 3A4AA 3ZSTA 4KRTA 3PZOA 1GWKA 1L8NA 2DGAA 5I78A 1QHPA 3ZJKA 4Z2JA 1OM0A 4CD7A 2UY3A 1L7LA 1GOMA 3IJ7A 4P8WA 2V3FA 4HOZA 3SUSA 4AZHA 1ECEA 2YOCA 3PZMA 2D1ZA 2TAAA 1TG7A 2B31A 2OWCA 1XHGA 2WBGA 3MMUA 1QI4A 3GYCA 1I75A 3WQVA 3SCPA 4FLRA 3VDBA 1MYRA 1DWJM 4UFKA 3DYOA 3VMOA 1E6SM 3WQ5A 1BYBA 1HT6A 3WIJA 4HU8A 2RGMA 4V28A 4YHEA 1WZXA 2NW0A 4A4AA 4DWSC 1GZJA 1JF6A 4JKLA 2YKKA 1H49A 4W7WA 1J0KA 4GXPA 3RO8A 3B8SA 1G1YA 3VNYA 5LA2A 3FN9A 4F9JA 1EOMA 5IXEA 4C7FA 5I23A 5CPSA 3GXDA 3OLEA 1X6LA 1KCKA 2VZVA 1R7AA 4J28A 1QW8A 1ZS2A 1RPKA 1UWTA 1W9BM 4MADA 2G41A 1UR2A 2VTFA 4D6IA 1Q6EA 4GZIA 4AD2A 5D21A 3SURA 1M7XA 2Z1SA 5DT7A 4CD6A 2E8YA 2DQXA 4CP9B 2E40A 1B9ZA 3WF4A 2CBJA 1UR8A 3MS8A 1FFRA 3EBVA 2VCCA 3BSGA 4NF7A 4XUYA 5ABHA 1ISXA 4J7RA 3LMYA 2YL8A 4XZWA 1S46A 1WCGA 2WVUA 3VIMA 5JBFA 3SCUA 1R85A 3TOPA 3T2QA 1CEOA 4D1JA 1CXIA 2X09A 3W28A 2O92A 5F7UA 2DSKA 1LL4A 3VDCA 2WMFA 1OGSA 4CPBA 2PB1A 1W8UA 3MU7A 4PSPA 1QOXA 4RL3A 2O9TA 4U3CA 4W84A 4F79A 5CPTA 2D0FA 3CUIA 2CKRA 2D20A 1QI0A 2G8ZA 3ARWA 3VMPA 1KGWA 2HVMA 1UZ4A 3CZ8A 2XHYA 1RH9A 3NDZA 3POCA 5EB8A 4HMDA 1UKTA 5DT5A 1CWYA 1C7SA 2C24A 3LPFA 3MV11 1SYTA 3B9EA 2XVLA 7CGTA 2WHLA 1BF2A 4J3UA 2XVNA 3B9AA 1WB0A 1JZ3A 1OT1A 2BY1A 2XSAA 3L4ZA 3PBGA 3BAKA 1EIBA 1HKJA 1TVNA 3GXFA 1HKKA 1UUQA 1GJWA 2WB5A 1E5NA 5D9MA 1V3JA 1WDRA 3UESA 5CSYA 5CSUA 4L4OA 1KQYA 2EPLX 3CZKA 1V03A 2DSVA 2NSXA 4H8VA 2DSUA 3UG5A 1ZBVA 5A6MA 4PMDA 1QNPA 3ZQ9A 3DYMA 4EANA 1V0NA 1UQYA 1L0PA 4MB4A 3PZQA 3AROA 1V3LA 1E6PA 3OGVA 1E4NA 4PUEA 5GQBA 3WFLA 4MNJA 3AIQA 1HNYA 1NH6A 4U31A 1QHOA 3QOKA 4M80A 4P7LA 1JZ5A 3AMDA 1GJUA 3RJXA 1TZ7A 2VVSA 1E1EA 1CTNA 4PSRA 4D1IA 1ZBCA 5BROA 1J0IA 1DWFM 1NP2A 2ZUUA 4AY1A 2JE8A 3WH6A 1GOKA 2ZWZA 3WELA 2ZX6A 2J7HA 1DWGM 3WD0A 4TXEA 1HKMA 1KFWA 3W25A 2WSKA 1HP4A 4AIEA 5D9NA 3WQWA 3W38A 2IUZA 3AOFA 3SCVA 1B3XA 4TOQA 3AISA 1J11A 1OD8A 5FIPA 1JZ6A 3VD4A 3FY1A 1J12A 2VRKA 5E09A 3OA5A 5E70A 4XX6A 2PBOA 1PX3A 2WW5A 3RCNA 4IPNB 1HJWA 1WDPA 4IISA 4QAWA 3WMCA 1GW1A 4IUGA 2YA1A 4ATDA 3BCFA 4FF5A 4JFWA 3QHNA 2WMIA 4OJYA 4JL1A 1M04A 3ZT5A 3WF2A 2WKGA 1WNOA 4PTWA 1Q4NX 4AMCA 5E6ZA 2YDSA 3G6MA 3CHDA 4B15A 1ZBKA 4PTXA 3ZSSA 1VENA 2JF6A 4H8HA 3VX0A 2VMFA 1B0IA 1PX4A 5A8NA 4LKEA 4X0NA 1NOUA 2ZXBA 4WSKA 2VI0A 1KWGA 2V3EA 2WYSA 3GH7A 3K46A 5CG0A 1UR0A 2WWDA 1VEMA 4WSJA 2W91A
chains in the Genus database with same CATH superfamily
2QNKA 3HTWA 4WM8B 1AYN1 4JTJA 1OGBA 3C2YA 1B3ZA 3OZMA 2X41A 4K6BA 4W87A 2VZOA 1V00A 2BODX 1PIV2 2HKXA 2F38A 1IZCA 3IANA 1JRCA 4CYDA 2Y6KA 1YDVA 5DEZA 4JAAA 4QHBA 3T0DA 1EO5A 3QY8A 1IEIA 2PDBA 1OD5A 5C9WA 1UWRA 5FA5A 3MY9A 3ARPA 1P0DA 4YM3A 2YCIX 8RUCA 4E2QA 4Q4X2 5A3PA 4L9BA 5FZIA 2AOSA 2A6NA 4RV3A 1QK2A 2FB2A 2HWGA 1JDDA 3CJXA 1O6IA 4Z2WA 1XRVA 1OI6A 1G9AA 2VUNA 1RJ7A 2ILMA 3O12A 2G19A 3GVGA 3MF6A 3LIHA 2G9GA 4ISQA 2YB7A 4NRQA 3ARVA 4I9TA 1W3VA 4Y9NA 1MXDA 2ZMNA 1NQ6A 3EWDA 2GH8A 3U10A 2ISWA 1GZTA 2QCHA 4L65A 5JXIA 2YIHA 2AMXA 2OQ6A 4IGMA 1W2UA 4MF4A 3G18A 3GHMA 5KC6A 5CJNA 3SKJE 2WJEA 3NV1A 2O4QA 3VD3A 4Q0QA 3PB2A 4FX7A 3TA9A 2B7PA 1UCWA 3NW4A 1OQFA 3NXLA 4W86A 4GIEA 1Y43B 2YPDA 4FNTA 5FMDA 4GABA 1AR91 1L9WA 2I14A 1US2A 4L11A 2QHAA 5FI8A 5CC5A 4WDTA 4JGYA 4ZB0A 3U0HA 4LEJA 5JOXA 1UPPA 3AXEA 4EVZA 3A4WA 1KNWA 4GKTA 4IHCA 2JDMA 3HNYM 2C8NA 2NT0A 3T55A 4LSBA 4RE4A 1W3IA 2AKZA 5K8SA 4FXRA 3P7YA 2CHHA 3ZFGC 4IMFA 2TRSA 3WBYA 1Q8PA 1JCXA 4R85A 2HWD2 4BISA 3MB9A 5KINA 2QPSA 1OMIA 3TEZA 4MM1A 1FWEC 3B05A 4F0MA 3HGJA 1YNAA 3VD5A 1NP0A 3UJRA 3DKLA 1D0GA 4JFSA 3P81A 4H6KA 4AVVA 4IGNA 4KWOA 5C9AA 4QJ1A 4ERIA 5DY2A 4HMCA 3GCWA 3TX9A 3POBA 3POHA 1V9U3 3NL5A 2XHKA 3QY6A 3MYXA 4GI4A 1B57A 1W9VA 1XISA 3I59A 4Q8LA 4HOXA 2W46A 1OINA 1OG0A 1KJLA 3G6JB 2PAJA 4I6VA 2DZVA 2Z7KA 1XPWA 2Y60A 3RMYA 1TR9A 3N73A 4W4ZA 2X5IB 5DUUA 4S39A 3TP4A 3WK2A 4R5EA 1LU1A 1YQ8A 1LOEA 3EMRA 3C8NA 3FGCA 3KDNA 3VBHC 2C3ZA 3VIGA 1E0TA 3E97A 4A3HA 3PTMA 4GC3A 3WZ0E 5AHEA 4JIEA 5C6MA 7REQB 2ZGNA 3PG9A 4ZFMA 1S1AA 1C28A 1WA3A 2CYGA 3O16A 2D6LX 3OGGA 1LAJA 2WVVA 2AR6A 2OXBA 3WO8A 4QQUA 4F2UA 1BYCA 3MIFA 3M47A 5TD4A 3JU9A 2Y64A 3AK0A 5EGRA 2DH3A 1UYZA 5JU6A 4LX4A 3VL8A 3H8RA 3CU7A 4JD4A 1LYXA 4IDZA 1GV9A 5CG7A 4IEWA 2HEJA 2J74A 3BW2A 1ME9A 1TUXA 2JX9A 1HF6A 4QQHA 1CGVA 1UIKA 7ODCA 2A1XA 2XONA 3POWA 1NWTA 1ZRCA 3L66A 4US5A 2C4XA 5D8ZA 4H6EA 3SQOA 2HWF2 1GQLA 3E12A 2DUAA 4DRSA 1W32A 3P80A 4YGCA 2PDPA 5EMUA 1ODUA 3UV9A 1HRV1 2C18A 3AYDA 1O60A 2E7AA 3P5ZA 4H04A 3WQBA 3B8UA 4P7QA 3DGBA 1O7FA 2OGJA 3VBOA 4O0QA 1G9BA 3BTXA 5DAPA 3TYBA 1QJY1 4FOVA 2TSYA 1CAXA 1Y5VA 1ZZ9A 2EG6A 5F4XA 2ASHA 1OF8A 4DJDA 3RYKA 4QDRA 1BXNA 2PHRA 1LWIA 3MIEA 3R13A 4E2VA 2CXEA 3I2JA 3W7CA 3I8TA 1VE0A 1KFEA 1YWKA 3ZKYA 3GW0A 2E25A 4Q6JA 1DGWX 4O9EA 1EDTA 4GLEA 3M46A 4NN0A 2VNOA 2PWGA 1X6NA 3WBXA 3QMSA 1ADOA 2W52A 4MYAA 3JR2A 4W8JA 5CQ1A 3TTYA 3LCFA 1WBFA 1CIYA 3J7LA 1IWPA 4Z92B 5BNPC 4I09A 1P6BA 4ATFA 2BNJA 3N3TA 4I9MA 1U5VA 1XGEA 1EL3A 1AQHA 2HXUA 4XFCA 5L9BA 4B9YA 2AREA 2NZ9A 3PTQA 1UYQA 2UYBA 2QIWA 4FR6A 1LECA 2XJUA 4Z2HA 3T7VA 4LK7A 1M01A 4CQCA 4EKJA 4DO0A 2FMYA 4PFMA 1SM9A 4DZHA 1JYCA 3EBRA 2A6YA 1FOD3 2R1BA 3L65A 4K3ZA 3ICJA 2HWC3 2RDTA 1BWLA 1FATA 5LB6A 3HOBA 3LB0A 4YW5A 2IQTA 5IW0A 5HUPA 1NWUA 3S5YA 3ID7A 3OGRA 3AIVA 2JKEA 3WQ1A 3WD2A 3WQDA 2ZBTA 4ASTA 4LS1A 4UOJA 2P76A 2Q1ZB 4E8DA 3W29A 5DFAA 2YFZA 3BQ6A 4WZHA 3MWAA 2B39A 1OCBA 4YARA 3EDJA 4I7WA 4HQVA 4LBRA 1KR0A 1SR0A 4S3GA 5EPDA 4C6EA 4B8EA 1AYN3 4IEYA 2X7WA 3QPEA 3U2OA 3B3QE 4QR6A 1BLZA 1MS4A 2BV4A 1HFBA 4YZ5A 4Z8BA 4YS1A 4QISA 3URQA 5CBJA 1EUUA 3IPVA 3PBWA 4CDWB 2YZ4A 1P5BA 1D8CA 3WW2A 3AS2A 5DF0A 1MZ5A 3L23A 5FLJA 2A7PA 3W7EA 3OIXA 4HNLA 3PWGA 5BXSA 3L4YA 3RDKA 3TNPB 1LT8A 4QQ3A 3BMVA 4DEVA 4AZCB 3RYSA 3MQTA 1I1WA 3KS6A 1LWHA 1H0IA 4M81A 1H9PA 2V5DA 2O9RA 3ACGA 2ZRYA 1NQJA 4R27A 2JDKA 2NMOA 4JQRA 4BDVB 3DGRA 3BLLA 3VNIA 3ITQA 5K0UB 1I1EA 5A7WA 1Q6DA 3R4IA 2VCAA 3BLKA 1XX1A 4GNVA 1JBCA 1ZJAA 1PHQA 1DFQA 2ZRWA 1OQDA 2WT1A 3U57A 4CDQC 4W6XA 5AVHA 5AB3A 3K4AA 1FFQA 5T3NA 5LNSA 3IMNA 4ET7A 4K9SA 2P0IA 1C29A 3PTYA 1PGW1 1SCRA 1AR93 3PN8A 2FCUA 4KI5M 3AZTA 3DFOA 3GR8A 3UG8A 2WNNA 2XH4A 2WNUC 1TVLA 3LF7A 5A69A 2FFCA 2RMU1 2XH7A 4CP2A 2DFCA 4LR4A 4N9CA 4LBQB 2XJPA 3GHTA 1W90A 1AXZA 3L67A 3OZOA 3KWXA 4TWTA 3BWWA 5GZEA 4H9UA 5DAXA 1MW1A 1EBHA 2PRLA 2PTMA 3C3VA 4GH4A 2HQAA 3GB6A 1DPMA 3STPA 4N43C 4NJ4A 4O1FA 3VZXA 2I7GA 3BN6A 2RS31 2HBXA 3MI3A 4O14A 1KTCA 1VFHA 4PL1A 3UKVA 2OOFA 4UBPC 1K42A 1BBT1 1JZ8A 2CDOA 3RR4A 2R1PA 4GE8A 1WCUA 5FF2A 2E6AA 3QR3A 3ABSA 4UQCA 1NCQC 5EP9A 4LORA 1U33A 4AG0A 6XIMA 2INEA 2EALA 3E9AA 1FWIC 4AEDB 3A6OA 3PBUA 4BYYA 3FNDA 4N90A 4J2PA 3QGKC 4RGGA 4KG0A 4MB1A 1D2KA 2VZ1A 2WS91 4FFFA 1B3WA 1BTMA 2NQLA 2EPNA 2ATSA 2VVEA 1PK6A 4TV5A 1ZJBA 2BVWA 2RGLA 2MPFA 3VABA 4OBRA 4MWAE 3BGGA 3ZYBA 5FYCA 4JIIX 3LFMA 3HG5A 3E49A 5HOSA 2QJGA 4D6JA 1TMHA 4WVMB 1F31A 4NYUA 1TTIA 3QLQA 2VT0A 1XLMA 3AO0A 4Y96A 4HLTA 3SJNA 3R0KA 1EF2A 3W6MA 4ERGA 1R3QA 2PRHA 4MY1A 3QZ6A 3KP0A 3W72A 4BK5A 3VKDA 3I7SA 1O6UA 1Y3TA 3ALGA 4ZS2A 1JMUB 1WX0A 2Y5JA 3AHVA 3F5KA 3TYEA 2VTXA 2DF7A 2QCMA 5BNOA 2QMKA 2UY2A 4U2ZA 1GNXA 4F2TA 3IIZA 3SCWA 3VCRA 1TME1 2ZC1A 5A6KA 2UWFA 3W53A 3ATGA 4PA8A 2YC2A 1AR71 3OGJA 1PVC1 3TQ0A 2NXIA 4O10A 1Q2RA 3V65A 3WK3A 1GQGA 3V4BA 3VKLA 2C5DA 2OUHA 4OOUA 2NX1A 2PF8A 2PHFA 4EK7A 1W9FA 1BEUA 1E4MM 2VD8A 1BPLB 1J10A 4LOTA 5E0FA 1PPIA 3VBSB 1HG3A 3CK5A 1HRV3 4HNOA 2ALDA 4Q4V2 4MDPA 1B9BA 3KEHA 3L2YA 2Z29A 5MKGB 2JD4A 3H8OA 4LO7A 3AZVA 4XKYA 3VZNA 1XH2A 1QJY3 4U2AA 2YCEA 2VGDA 1JUBA 3DFYA 3K4ZA 4M7TA 4NVTA 4YVVA 4Q4RA 4AI1A 5LATA 3HMCA 4CEYA 4M3CF 5HNNA 2WCSA 1SFNA 3T4WA 4JDBA 4LAUA 3T3YA 1Q66A 1VJSA 3T40A 2QYGA 1JYNA 1Q63A 3J9SA 4HPKB 2PLKA 4AGVA 2BASA 3WN6A 1R091 1KR1A 1TIWA 2ZUTA 2DFAA 3M7WA 4UW3A 4ACYA 1QOTA 4Q22A 2VPVA 5A8QA 2IXIA 3KD4A 3NVTA 2CKSA 1J93A 4ZQNA 3WX7A 1Q5MA 3T0AA 3AIWA 4EWDA 3HM7A 3N9OA 5A70A 1QI3A 4H9XA 3ILRA 2YCJA 3APGA 4FLSA 4E27A 2MNRA 1UZ0A 4ZU7A 1W8SA 5KEZA 2X16A 4GA9A 4R33A 2DZAA 2R0FA 4JTCA 1OC7A 5I8SA 3ZFHA 1QJFA 3FLRA 3UKTA 4IOTA 5LIWX 3QYSA 5IYYA 1CXKA 1OIMA 3PNAA 1VBE1 3LQLA 1WMXA 4IV1C 5IBXA 2XQRA 1QNSA 5FIXA 1OVSA 1RVF1 3S57A 3S4TA 1HRI2 1H4HA 1WCDJ 3PLQA 1YI7A 1RJQA 1NT0A 1ZCOA 1NEYA 3UWQA 4B3KA 5AC8A 5E0CA 3THAA 2QCNA 2HEYF 2VOTA 3OO2A 1DJZA 2WC2A 1ZPTA 3C2VA 3I54A 4EN7B 4URAA 3RITA 2BGSA 4D71A 5D09A 2ABBA 2ZTKA 4A3UA 5A3NA 4JDOA 1NELA 3KTCA 2O0TA 2VZPA 4IV3A 2ZUWA 4IPLA 1YFYA 5JSPA 3Q67A 3IJIA 2XN0A 2VUDA 3QLDA 4LUTB 4MFEA 4ZO6A 1R0MA 4Z07A 1OGGA 2DVAA 4AI2A 1OZMA 2EF9A 4XABA 5ABJA 1KV8A 1J2BA 4R9DA 3PVBB 4S2DA 4XUPA 2E8ZA 2G3FA 4R9XA 2E1WA 4ZXKA 1RLDA 1W06A 3KV9A 5F5QA 3CUHA 3O0FA 3QV7A 5F4WA 1W2AX 3T78A 3C3UA 3EDEA 3PVEA 4DB7A 3GDBA 2J77A 4ZQRA 2ZGPA 3ZM8A 4YG6A 3KRZA 4ES8A 1W04A 4YNGA 5HQLA 4QFUA 3L5AA 3UERA 2G1MA 4WVZA 3D0JA 2Q71A 2J4GA 4GUJA 4LE3A 5LA1A 5JOYA 5GVJA 1DGRN 5E9AA 4YYFA 1NA1C 1W9SA 5D38A 3VBUA 4FNUA 2UYAA 3WOGA 4D6EA 2P6CA 3NQHA 1OG6A 1N8IA 3K30A 4DEQA 3W37A 4E3TA 2YDEA 2Q8OA 4QT6A 3AAMA 4X60A 2EPOA 2VEFA 4FX8A 2C7FA 2EEXA 1TWIA 1M4WA 3T4VA 2GL5A 2YYUA 3NWKA 3WF0A 5JPMB 2ISDA 5AC4A 2WA4A 1JZ2A 1LR5A 4O65A 1J1LA 3TCEA 2AYHA 2DT3A 4LW7A 1SJDA 3S1WA 3AXKA 2OA2A 3NV4A 2ODOA 1DHPA 3E38A 1M41A 3PWAA 4AVOA 1OBNA 2DCYA 5DMNA 4LALA 1JDAA 4E4SA 4EP8C 4XAPA 1UOFA 1XQNA 5CH9A 3T4CA 1CLXA 2D6KA 4LB3A 3QQ1A 2XWBB 2RHGA 3CHFA 3KBJA 4WRHA 4META 4XUNA 3MP5A 3OY8A 1K7FA 5CGTA 2OPKA 3AYRA 4JIQA 3MHFA 3I2GA 4XVEA 2VX5A 3M3QA 2RS33 3K3NA 2GAUA 3TDFA 3O6CA 2FZNA 5T9BG 5FY4A 3O1SA 2X8RA 1YIPA 4W8LA 4Y33A 4UTWC 3WLPA 3GTXA 4JTLA 4LKSA 1BBT3 1YEWA 4AQLA 1LJYA 3CQKA 2V30A 4ZQPA 3EB3A 1RIRA 4RQPB 5CJ5A 2PELA 1MUWA 3UJEA 3MF9A 3WP3A 1TZZA 3C8XA 1H7OA 4F8XA 2WC3A 1ZTVA 2BJSA 3MVIA 4GQ0A 4YTUA 3VNKA 1XD1A 3EMCA 3IJQA 3EB7A 4H00A 4RR4A 4B5NA 3TLQA 4Q8UA 5GJNA 3PU8A 3NL1A 3WD4A 2WS93 2XJTA 3UNDA 4C8DA 4LO5B 5F1RA 1LQAA 5G4WA 1VHNA 2CHNA 4C7DA 4QX8A 1CGTA 2FZBA 3S5NA 3LBMA 1YIXA 4ML9A 1QDCA 3BMWA 1OH3A 1FNYA 2OCZA 2V4AA 3BAIA 1VKFA 4LYPA 3OBEA 3VBRA 3KZSA 4O1DA 4LBQD 1CZ1A 3KVLA 3MT1A 3HNBM 3ZX7A 2PYTA 3M0IA 4N02A 3B01A 4PRRA 5LXXA 5IATA 2P1BA 1QJX2 3U4AA 1G7YA 4BPZA 3HG3A 4DQAA 5JAXA 2ZZ3A 3M0LA 1J0ZA 1HW6A 4QNWA 4UYBA 5A33A 5C3PA 1B54A 1ZJHA 2PBGA 3SXWA 4RFRB 4HPNA 2OUJA 3VV1A 3I7RA 4HZ8A 2D69A 3B0UX 4AFCA 4G7EB 1LOBA 2B7NA 1TME3 5DZFA 4BQ3A 1ENUA 2FGZA 3UA3A 1JOBA 2DCTA 1AR73 4P8UA 4ZTYA 1K8CA 2TBVA 1PVC3 4Y1ZA 1H1NA 4QPWA 5DG2A 1DJGA 5JIUA 2R6QA 1YRZA 3NYDA 4PTNA 1VD6A 1RXFA 4RDYA 1VFOA 3BGAA 1Z42A 3EKZA 4BKNA 3UJOA 3L9JT 5AZ1A 1NFPA 2DZWA 3LD8A 2YXSA 1CGXA 2ZMLA 2OQYA 3L5MA 2PU0A 5EJ3A 1VP5A 5K9DA 1O66A 3WNMA 3MSYA 3BCWA 1SGJA 5F37A 3O15A 3CHVA 2FQIA 2PGWA 4ZFCA 5CAHA 5IK4A 1KGXA 1RAKA 2WQZC 3M3EA 1CT5A 5EFFA 2ARXA 3ATYA 4K68A 1W8TA 3W81A 1PKYA 5FAGA 4BJHA 4GQGA 2FVKA 3A12A 5JIAA 4YN5A 4AZIA 2YPIA 2VQ0A 3LLFA 3RUBL 1WBJA 1UWUA 2DV0A 2J78A 3AS1A 3H21A 5E88A 5FWJA 4NXKA 2VD7A 1L7QA 3ACIA 1EJRC 2XIJA 4R9CA 5J48A 4IL2A 4PDWB 2PLMA 1CCWB 3LCXA 1E9LA 1Q4WA 5RUBA 1R093 4NIHA 1Q6GA 4JNMA 1GONA 3UXLA 3O1UA 2PLV2 2ZJCA 3THTA 1EHNA 2YL5A 4LJHA 3OJGA 2ZEXA 2ZRUA 1Q6CA 4JDMA 2O7QA 1PM4A 3G1DA 1PZ9A 3WDWA 4QHOA 4LXFA 1V6TA 1ONXA 4HHHA 4PCTA 1YXDA 2VX7A 5JMUA 1S5TA 3U7BA 1DHKB 3VNJA 5CXPA 4I2OA 4PUDA 2CNCA 1RUNA 2WIIB 1MI3A 1JXNA 2OSYA 5I8TA 4EPBC 5CEHA 1PNGA 2BVBA 1RUC1 4H4IA 4PBGA 3WH9A 1VPHA 1LQ2A 4UI9L 4B4QA 1YEYA 1RUJ2 3UZ5A 4TTUA 1BCXA 2Q5TA 1EF3A 4OI4A 1VBE3 1XINA 3II1A 2B8MA 3W02A 1QCWA 2IC1A 4MIMA 3DFQA 1UB3A 4U5KA 3DG3A 3SY8A 1RVF3 3PUDA 2Q8ZA 3AZZA 5KHGA 3TKFA 5FOOA 3AYCA 2HSAA 1NQKA 1TQ5A 4I0BA 3CUFA 2QE3A 3T05A 3ZXJA 1X9PA 3QJAA 4GI8A 4L4MA 3TJ4A 3WDJA 3V18A 4Y7EA 2QUMA 4DPPA 2DPEA 3W7PA 1OA3A 1O5RA 3LRLA 1C8M1 4Q4Y2 1OC5A 4NZ4A 1IS4A 2Y6LA 1WP6A 4PIXA 4O50A 1XXXA 3AKRA 2NLYA 2PDKA 4KF1A 3WQ6A 3NAPA 1QIQA 1XOYA 3QLLA 2PN5A 5C71A 3N34A 1W1A1 1F76A 4C6NA 3S6DA 1SBFA 5C9ZA 1AW5A 4E8GA 5L73A 5T50A 1UKQA 3KLLA 2GP3A 1AR82 1Q3EA 3ZJ6A 3NNMA 1TA3A 2OXNA 1RMU1 3BLDA 1JG9A 4P7NA 2ISSA 3ARXA 4AF0A 2LALA 1VJZA 1JAKA 1DQ6A 3BPWA 1OIFA 1R5YA 4OYUA 3THDA 7TAAA 1DCSA 3AALA 4NAEB 3W7OA 4UTKA 1JYVA 3LNPA 3V5CA 2PWUA 1JW6A 3MANA 1QKQA 3FMGA 5EA9A 1A5UA 4FOJA 2Q30A 3M5XA 3VGIA 1EQPA 3CU2A 4O16A 5I3HA 3LGEA 4QPIC 2VMCA 5HXVA 4MVAA 3VD7A 4JICA 1G86A 3CBNA 3UNPA 3TOYA 1XGDA 1EFZA 2WWUA 1M7OA 3HURA 3I2DA 1QOOA 3IIPA 4OGZA 4WDWA 1XYLA 2D6MA 2X53S 1A5CA 5IHRA 2VCMA 1KQRA 1HL9A 1R9ZA 4ES9A 1VYPX 1DWAM 1TTQA 4Z2KA 4Y6GA 1NQDA 3VI2A 1KM1A 4CDXA 2QCDB 2PDXA 1EGMA 4G2DA 3ZLIA 5TQLA 4WHBA 1XG3A 2YB4A 4LYKA 1XFCA 3DEQA 4OFCA 2X1UA 2CNAA 1QEXA 3OEBA 4H2AA 1PWMA 5C5TA 1XIHA 1GEQA 5A94A 3AMPA 1UPMB 2DDUA 1IEWA 4HPJA 5EMYA 3CO4A 1D4M1 1ONAA 3BUCA 4HA1A 4ZQMA 3VE9A 4EACA 1DQWA 2PDJA 1RP8A 4D0QA 3PPHA 4C6QA 2EXJA 1FHVA 1JCJA 4CEWB 5C8WA 3AZRA 3CV6A 3N4AA 1TCDA 1ZAJA 3VFCA 5F3EA 3EO6A 1I0DA 4IERA 3TTQA 4AG4A 3GW3A 2G4IA 3GY1A 1OLRA 2JGQA 1EDQA 1W1PA 1DWIM 2Y38A 3RAOA 3ZXWA 4P9YA 2UZ9A 4CU6A 3FGCB 1KXQA 3AFKA 1C90A 4AVFA 5FK8A 3WP4A 3DFTA 4ERAA 2XKOA 1FH9A 3STEA 4F0LA 1SZBA 1JU3A 3NO3A 5CKMA 2VG9A 4FNPA 4CD8A 4UT5A 1V3IA 5LY1A 2Y5SA 1E6ZA 2WVVB 3T6CA 1Q7ZA 3UYIA 3BJTA 2A3BA 3W1RA 3LHWA 1UX7A 3IIVA 2P3YA 3KHDA 5AYIA 2XBO2 3TYAA 4UB9A 1ICSA 4C6CA 2IW0A 2ADEA 5A7OA 1FXZA 1CX9A 3EPMA 3R0RA 3RRAA 1H41A 3ZVHB 3ALQA 1M03A 2WR9A 3HEIA 3ZN6A 4BQWA 4MZYA 3K2OA 1UD6A 1CBGA 4IMEA 3N36A 3V75A 5C2CA 2FPVA 2IPWA 3APYA 1OLMA 3VGGA 3ZKUA 2XJ7A 3KVJA 3JU2A 1Y4WA 4MHUA 3GNDA 3STFA 3ZN5A 2IKIA 1NOWA 4LQRA 3K4WA 3AMHA 1C3FA 3W58A 1U2YA 4QITA 1OADA 3GG8A 5JXJA 4FIRA 1ASJ2 5C2XA 4DWSB 1H63A 1ZRIA 4HKLA 5BYWA 1GQPA 4M00A 3M0HA 1GANA 1K5MC 4G3YC 3EZ4A 1OBAA 5F5AA 1ONEA 3SISA 4WJXA 2CZFA 4A2RA 1IHIA 5IHSA 4IEUA 2OO0A 1WW4A 4FEZA 4WVVA 4CXYA 4KGJA 1UN1A 3OG3A 1GZCA 3D4KA 3I4EA 2V38A 4EWND 5EPAA 1KKOA 3FFZA 2R94A 4QCEA 3RJYA 3AUJA 4RZ4A 3VC5A 5FP7A 4HP5A 3ZWSA 1NAL1 2J62A 4OHXA 3Q58A 4HANA 1N8WA 1ZZ7A 4Q3MA 2XL9A 2IXVA 4I7VA 2XZ9A 4BOWA 1TUFA 4NI3A 2YDAA 2YW4A 3G8EA 4QLKA 3PZVA 4ZOCA 2DUPA 4AFAA 1NY72 1I2NA 1L2QA 1G6CA 2A6LA 3U75A 3ZFGA 2JDYA 3SRDA 3L7RA 1VRH1 1AMYA 1IG0A 3HPAA 1M5WA 1Z78A 4NILA 3WHTA 1SFTA 1P1XA 2OVLA 1TJ1A 4NZ5A 5EMKA 1H51A 1RBAA 2XYLA 3AL6A 4JCLA 4XURA 1RUC3 3NO5A 1K12A 3LIGA 1V3HA 4HA4A 1V70A 4BIOA 3ES7A 2X8KA 1DP0A 5A6YA 5JDBA 3ANYA 4M6UA 2VGGA 2VR2A 4E9KA 1RR2A 3ZYHA 2ARCA 1XG4A 3UWZA 2DVDA 5BMWA 3O9NA 3ITXA 4H9MA 1XYBA 1XYMA 2NZLA 4B91A 3OBTA 4JCKA 1G9DA 5AFDA 4YFWA 2POZA 1GQKA 4LAMA 1XC6A 3TC3A 3FJSA 3BW3A 4WDXA 3NR0A 3WNNA 5AC5A 1PCWA 1C8M3 3W5NA 4EWJA 2CBIA 1P1MA 2PWHA 4LIVA 3RFAA 4CP9A 3SCHA 1QBAA 3VBHA 3LPPA 3ARRA 5CFCB 2IXKA 3RNDA 3OYWA 2G3NA 1KM5A 1V0LA 3VGEA 3KTXA 3QKZA 4CGTA 5CKSA 4LNVA 4LLFA 3AMCA 3M0JA 7ENLA 2A0NA 2DUXA 1NG0A 2D93A 4A29A 1KXVA 4KEVA 2WSYA 2WNVC 3FJ6A 2JXAA 1RMU3 4FO4A 1UKOA 4E4PA 2DT2A 1CECA 4PMOA 5FJIA 4YW3A 1JUEA 3RZJA 1KD7A 4B3ZA 5SV8A 4H14A 2R32A 3I2IA 4IIEA 3E0VA 3CJIB 5IUQA 1FCUA 1SJAA 1YPIA 4MOZA 3KOFA 2OSWA 3UZYA 2XWDA 4QDWA 5ABFA 2G3IA 2GLKA 5FUIA 3E0FA 2RVAA 2C13A 1I60A 1I2RA 2A3CA 3WNOA 2F2KA 4AW7A 1SCSA 2BGQA 1MDRA 3E6EA 3M3IA 4PCRA 1PJ9A 2PAKA 3RS6A 3C86A 1XBZA 4KWVA 4XFFA 3GXNA 2JG8B 1K45A 3WUFA 4A05A 1T2XA 1A78A 3AIUA 4ZPIA 4OQ8A 2FLIA 2FZ1A 5A8PA 4Q1PA 4PQ9A 2YV8A 3GC5A 1S4CA 2Z4GA 1UZWA 4Q4W2 3HG2A 1AXYA 2XM2A 2H3DA 1OX5A 4I3PA 2AMGA 3BZGA 2W27A 3TFXA 4UQBA 3WW3A 1WDQA 2WSUA 4GH4B 2A5HA 1PO22 4LC8A 5AVPA 4XYXA 2CTVA 4KFPA 1ULDA 4GA8A 1RLCL 3KUMA 5DXXA 2PU1A 3H7UA 4A8RA 2X30A 4IEZA 3B4UA 1V0KA 4MDOA 4CXWA 1G7UA 3DHFA 1S0EA 3CL1A 3OUIA 3M3OA 1T5AA 2VOMA 1D2QA 3E3HA 4G1NA 5DXDA 3QPZA 1T6MA 3EWZA 4BF9A 1E51A 1D4M3 1D3HA 1R2TA 3O6YX 1VF8A 2CLFA 4XAFA 3NNLA 4I9JA 1UWQA 2RJHA 3N7KA 2W66A 4W8BA 4CVWA 1WZMA 4TSVA 1EY2A 4P8VA 5BNPA 1UD3A 3PJQA 4MOAA 1POV0 5JZGC 3TZNA 2ZZ5A 3EXTA 1VALA 4M5PA 1SLTA 1SMDA 1NAEA 1JNEA 1E0VA 2XVKA 2GDQA 3ANVA 3UYCA 2WQPA 2TUNA 4AH7A 2X10A 4JDYA 3MCOA 4PB4A 2Y6GA 3ARSA 5BU6A 2EF6A 3ZSMA 1JDCA 5HULA 3ZOAA 4N53C 1DVJA 1IEQA 5AECA 2Z26A 4DF2A 5ERLA 4LNYA 3AUOA 2Y6JA 5A6QA 3G0SA 3CC1A 2G96A 2QUVA 1TRIA 2VFFA 4QS6A 4D6GA 1W6MA 2YU2A 5HR6A 1XLAA 3ES1A 2Q6ZA 2O1QA 4MXWB 1POV1 1W17A 2E0PA 4ZOEA 5DN1A 3GR7A 3AKPA 3GYDA 3UJSA 3T2OA 1M6JA 4CP1A 1MS1A 1HXJA 1OURA 2RJLA 3W1QA 3LRMA 2ATMA 4BIFA 1YYNA 3LKJA 3GVQA 2OYZA 1K7EA 2HEWF 4CCLA 2R6OA 4UFHA 4Q4X1 3UGGA 4P00B 2ZRXA 2BVTA 4R7JA 1ZZ6A 3SFWA 2JECA 1QPNA 3G77A 1LZOA 5D2WA 2PDCA 4XCAA 4ZOBA 5A6BD 4IEPA 1I1XA 5JBDA 3QHOA 1MDLA 4JX6A 4DRRA 4D6DA 2BVYA 3W1LA 3EHKA 2QCEA 3BLIA 1A0CA 3N4EA 3V0AB 1HV0A 4GKLA 3ZT7A 3A3XA 3B0PA 5A6LA 2GSJA 2PDFA 2OZ6A 3MKCA 3I2HA 3WP5A 4MGQA 3T8LA 3WF3A 2XG9A 3P6BA 2DDXA 2VEPA 3S0CA 1F2NA 1LORA 4J27A 4A35A 1O5LA 2WHKA 3NNTA 5IVYA 5I77A 1U1UA 5DO8A 1BHGA 1D3GA 5GLUA 4CDQA 2W62A 3VOHA 2FVMA 1BLIA 2FTYA 1U5HA 3AU2A 3I3EA 5FY7A 3LM3A 1FWHC 4FPEA 1RUSA 4L97A 4KRTA 1X1ZA 2J1UA 5BNNC 1L8NA 1OF4A 1W8HA 4XUOA 3SFKA 4GALA 3QTGA 4Z2JA 1OM0A 4BWLC 4CD7A 3O3RA 3LQGA 1L7LA 2WNUA 5C8CB 5LIUX 1ZALA 1VLWA 1XRSA 2V3FA 3SUSA 4MJZA 2D1ZA 5FZCA 1DYPA 3UJFA 1JOJA 3JB4C 4DYEA 1U1HA 1F35A 2B31A 4M3CB 2OWCA 4CNOA 3FUOA 4IEQA 1QOPA 1VRH3 4N43A 4P5UA 1I75A 1ULGA 2DZXA 1MYRA 2P5BA 4C6OA 3DYOA 3Q45A 3JUUA 3S6OA 5F6LB 5DBUA 2W0XA 4O1CA 1HT6A 3WIJA 1XIJA 4FPSA 2DCKA 1WZXA 5HCBA 1LHWA 1NCQA 4KKXA 4JKLA 4LPLA 4DJDD 1VBB2 1RQHA 4EAYA 2P1FA 4GG9A 4IQLA 2W6RA 4Q0VA 1J0KA 1HB4A 1TPH1 2IVJA 1G69A 4GAZA 5F9TA 3QN3A 2ZZ1A 4WDUA 1SQ4A 1ND3B 5IXEA 4EWAA 1QU0A 4COVA 3QQWA 3MPPG 5I23A 4YGEA 3RGBA 3GXDA 4IMAA 4JTFA 1Z6KA 1QW8A 3BTYA 2ZKMX 2AKMA 2DVBA 1ZS2A 1RPKA 1UWTA 3QH7A 2ZHLA 4G1KA 3RZGA 4GQ7A 3FIGA 3SURA 3E0LA 1LU2A 4P5YA 3QEZA 5ABJB 1T7LA 3ZR4A 3KQ4B 2ET1A 1GZ1A 2F6KA 4JTQA 2E40A 2XJVA 1Z7AA 4CP0A 4CNUA 1VPQA 1PGSA 3NL2A 4XQ4A 4LCSA 3BSGA 4OE7A 3AMMA 3LMYA 4XZWA 5FYMA 1S46A 1U1JA 4OMDA 2X1RA 2WVUA 3A24A 3U11A 2HWF1 1RUH2 3PUSA 4GULA 2AACA 4HONA 3CV1A 4XD6A 3MW4A 4O1EA 3T2QA 1RK5A 1CEOA 3XIMA 3MC5A 2X09A 2DW7A 2CV6A 2Z00A 3H70A 5B80A 2XH0A 4QX7A 1JJKA 2UY9A 4HFSA 1VAMA 3HZ3A 3UU0A 2O56A 4MMWA 2I45A 2WQ8A 3BOPA 1JODA 1TMF3 3GXUA 2I07B 1SQ7A 4R4XA 3KV5A 4CPBA 3Q9OA 4PSPA 2O9TA 4MGZE 1W37A 3CUIA 2WOQA 4HIBA 1QJU1 1IS6A 2D6OX 3B69A 1AZ2A 1KGWA 2QS8A 3POCA 2DUOA 5EB8A 5FAJA 1C7SA 4XJ9A 3LPFA 2E28A 3R4SA 3QY7A 3GIPA 3M4FA 1AQFA 1FI2A 1RUG2 2X40A 5FPBA 3PUAA 3DUIA 2OZ3A 3V1HA 5MHBA 4CEXC 3PBGA 2R042 3TEYA 1HKJA 3MI8A 3MLLA 3G1HA 4P9IA 1QFEA 1B09A 4R7WA 3BG9A 1RXOB 2QQOA 4LITA 4KETA 4XZNX 3TSBA 1TYGA 1A5NC 1KDKA 3MP4A 4BI7A 4L4OA 1KQYA 2EPLX 5XIMA 3CZKA 4M4PA 4V2WA 2INFA 3GG7A 2FPTA 4GVGA 4I5RA 1K5JA 2XJSA 3OVQA 5FZGA 4DQWA 1ZBVA 4H2HA 4PMDA 4RW5A 5C3QA 3DYMA 3RDIA 2E6VA 3DFHA 4FHAA 3W7LA 1O5QA 3KOZA 1UYXA 4IV1A 4YM1A 2K9ZA 3IT8A 3AROA 3VBRB 3PZQA 1E4NA 1NDWA 2GUBA 5AZ0A 1PZ1A 2BG5A 1TWDA 2PTXA 1DQ5A 4BH9A 1KD0A 2HPMA 5C7GA 2VWTA 3ABOA 1TZ7A 1POV3 2VVSA 1LJ7A 1A3KA 3N7MA 4GD4A 4YW4A 1E1EA 1B4KA 1ZBCA 4XD4A 1UIJA 3PSVA 2GNTA 2ZUUA 2JE8A 3WH6A 4OUMA 1DZRA 4BEQA 1LRNA 2R91A 4DY3A 2ZAHA 3HQXA 2Y7EA 3POFA 2J7HA 2ZGUA 3RXZA 4IW3A 2WSKA 3HGOA 4NJJA 1R081 4DPQA 2I17A 1XJBA 2IXLA 3B97A 1CAUB 5I00A 1RUE2 4WD0A 1O4UA 5F2GA 3RQ0A 2QUNA 1B3XA 3PANA 4TOQA 5IK7A 1J12A 4YLWA 4IXHA 3B93A 1WXZA 3OA5A 3DI1A 2ZGLA 4Y20A 2IKGA 2YGYA 4O7XA 1A3XA 2R1MA 4RHV1 1AL7A 1UXZA 1NLSA 3C0JA 1WDPA 4IISA 3PPFA 1N1TA 1EWDA 2YA1A 3MJMA 2PURA 4ATDA 3SH4A 1NA1A 2CHRA 2NV2A 3QHNA 3RZKA 2WMIA 1ULOA 5H2ZA 4EZ4A 3ZT5A 2P5NA 4L56A 4US6A 5L7OC 3M0MA 1WNOA 1Q4NX 1SSGA 4DX3A 2UWCA 3UQNA 2HVNA 3CHDA 4B15A 4XISA 3TAOA 1EJTC 3GC4A 4AQ2A 4H8HA 1ADSA 2OT7A 1OKQA 5FJPA 2ZEWA 4NAFA 4FI9A 3DKWA 1BQGA 4Z2AA 1VFLA 3KVKA 3OYZA 4X0NA 4CE8A 2DYCA 2CLLA 4RNIA 4KGQA 2QZRA 4EN9B 4WSKA 1KWGA 2V3EA 4DJED 4D9PA 1S3HA 4CNNA 3H8XA 1UR0A 3R1ZA 2WWDA 2DV9A 2A3WA 2OOGA 5D2AA 5L6UA 1Y7VA 1Q7MA 1IZKA 5I3DA 3BK0A 4MYXA 3H3UA 4Q33A 2PGRA 3C5QA 5F8PA 5HWMA 5CKQA 4OFGA 3C7EA 4YL2A 4TUFA 5T54A 1R46A 1MEC1 3E6BA 3IGUA 4UTWA 2V2CA 4HHPA 5I7GA 4M82A 3DL3A 2VJXA 1D7FA 4JQTA 4EIVA 4YXGA 5FMOL 2JE7A 2A3HA 2VEIA 2QKFA 4AVSA 2J1EA 4A2SA 1QY4A 2VE1A 1XDJA 1YDYA 5AYBA 3WEZA 5I5RA 2L9LA 1WZKA 3O6AA 1F7BA 1NARA 3WF1A 4Y22B 3ITGA 4TO8A 1VAHA 3CAVA 1A8MA 3W73A 4XF3A 1VBC1 4IJRA 3OF1A 3K51A 1KM0A 3VOCA 3IPWA 4N9IA 4MO3M 1OLQA 4UCFA 1WCKA 3UPMA 4KCUA 2CCRA 4DZIA 1AL0G 4KG8A 4KH9A 3LHYA 3DIPA 1ISZA 4ADSA 4W88A 4CNTA 4WR3A 4UW6A 4ZEPA 1PCKA 3CIWA 4EXAA 3SC7X 2KR2A 1SLAA 2DU2A 2EXIA 4KL1A 1YTDA 2XLFA 3BW4A 3FWEA 1FYUA 2VWSA 1US3A 1A6CA 4AF0B 2FFIA 4GXMA 2GMEA 3FLTA 2WBKA 2ZX4A 1CXFA 2IXUA 3RHGA 1DIOA 4N7QA 3KQRA 3A0NA 2JKPA 4AXNA 4IGQA 4RE3A 3B02A 3FSTA 3BXWA 2GZWA 1TJPA 1JXKA 4WF7A 2OT1A 4XBKA 1OOPB 4D6SA 1EXPA 4X22A 2C0AA 4JV4A 5IAXA 2X29A 2WC7A 1W54A 3WSOA 2XVPA 3VL9A 4WBBA 1X6UA 4JIPA 3GD6A 4FTBA 3AZSA 1TPUA 4XF4A 3O0WA 3AHXA 3RCMA 4GQQA 2YCKX 4AYUA 4K1YA 1MXGA 1VHCA 4TVUA 2IXCA 2QV5A 4LVFA 4I5UA 4DI8A 4BMEA 4GFSA 4UQDA 8XIAA 1E6RA 1PO12 4CDXB 2BB0A 5LSMA 4HN4A 2BP6A 3HQ1A 3K2GA 1ENQA 4EQVA 3TN3A 3VIFA 4INDA 4IETA 4GFIA 3W1MA 1F15A 1QJU3 3T0BA 2DVUA 3OZYA 1LF1A 1DGWA 2VM9A 4JYDA 5BUVA 1DYSA 1ONRA 2WO1A 3V0BA 4UOQA 2DVXA 2X0HA 1STMA 3N14A 3OG2A 1TMLA 4C1XA 2HS8A 1RL3A 5TBOA 2XGZA 2K46A 4H8NA 3TA6A 2ZX3A 4REQB 1F8VA 2G3JA 5FUPA 1RHI1 1HV1A 1V6VA 4TZDA 4F0HA 1UOGA 3EWUA 3DESA 3CKHA 1GQIA 2W61A 4F66A 4XKMA 3A9IA 5G1MA 1RJPA 4KS0A 3DC8A 4ARYA 2ZWYA 2R1LA 3ITTA 1KBLA 2ES3A 4HTBA 1D7PM 5B4NA 4F8AA 3BO9A 5CG8A 2J75A 3ZSKA 1R87A 3MMTA 3AC0A 3HBLA 4FPHA 1QK0A 3M0KA 2GN7A 3AXHA 3T4HB 5DAWA 1QH6A 3HMJG 1F3TA 4W7UA 1SJBA 1R3YA 1VYRA 3AIEA 5FYYA 4J3SA 3C7FA 5AY7A 1J0HA 4V1XA 2PWDA 2V5JA 3TUUA 4UQEA 1ZBE2 1BF6A 3CF6E 4QX1A 2XU2A 2D7FA 2C0HA 3RG6A 3FA3A 3ZS4A 4LY8A 3P62A 4TLFA 5REQB 1WLDA 3AVSA 3T1GA 2DZUA 2GDVA 4IX0A 4YYOA 1GVFA 4AEJA 1SLBA 1PSCA 4X6QB 4B92A 1LQ0A 4NZCA 2NVDA 1YHFA 3ENRA 4HK5A 1JCTA 3GF6A 4UFIA 4CUAA 4AEMA 1N47A 5H8PA 5FRAA 1FHLA 4ZXOA 1J0JA 2EG7A 5IVCA 1QGLA 1W6NA 2HBVA 2PCEA 1YUDA 4WKFA 2ZX1A 2QCFA 4I0WB 3K4DA 4ORFA 1T0OA 2ZKNA 3J7HA 2ATFA 4F9DA 1ZA7A 1R083 3AZYA 5BNKA 4Q0UA 1KXHA 2GWNA 3APTA 2WNOA 3SIMA 3QBUA 3ZFFC 2VNGA 2OB3A 4PTMA 5M0TA 1C8YA 3CWNA 3E2QA 3CL7A 5FY1A 4ARXA 4XAZA 4URTA 2WYFA 3VX1A 1X7IA 1RQEA 3BUVA 1SDWA 5E6YA 4RHV3 3H3ZA 4E4ZA 3DUGA 3Q37A 2B9VA 3BPSA 1PEZA 4A7YA 2GQ9A 3N18A 2EPHA 2O4MA 1LODA 1LCOA 4QPIA 2VDHA 2DP3A 2Q8XA 1XU1A 2CL2A 3SUWA 4EXQA 2YMZA 2H9AA 1GZWA 3HQOA 3DG7A 4DELA 1CB7B 3SLIA 1PGL1 2VX4A 2BLEA 1U5IA 1DWHM 2PHTA 1VBUA 3RMXA 1K1DA 4QQLA 1E1CA 2L5HA 1O5UA 4B5TA 1J6OA 2IFRA 2WINB 3ZFGB 4LTAA 2YL9A 3QOPA 3HV9A 1AZ1A 1OWQA 3IIXA 1FCQA 3CTTA 5HNUA 5I3FA 4ISRA 5DY3A 1KEXA 2BFUL 5DMYA 3VM7A 1I5ZA 1ZREA 3V0TA 1P6WA 3WFZA 3SUTA 1G4PA 2D23A 3LCGA 4E2GA 4R8HA 4CCOA 2EKCA 3KX6A 4AGGA 2WA3A 4AX7A 1LULA 1MEC3 1S0DA 4IL7A 3GR4A 1LBFA 3MPBA 3A4XA 2R24A 1EZ2A 2EVXA 3ABRA 4LF2A 2RS13 5FQ0B 2DTYA 3ZDSA 4BLJA 3CH9A 3JBG3 1JOPA 2BZNA 5A6ZA 5DRIA 1XYFA 3W9AA 4XMAA 3WUGA 3IEBA 3WLTA 2NV1A 5LBEA 1JPDX 1KBBA 4ACZA 1JL8A 1J01A 4J3TA 1AW2A 3P61A 1VBC3 2HRWA 4Z0SA 2V4VA 4BFAA 1GW9A 3PTKA 1W1VA 4IJBA 4A3RA 5DXYA 2BDQA 2JDZA 4RUBA 3CL8A 1E15A 5CZKA 1E43A 3GNRA 5E8AA 2R062 1W2NA 1B35C 2VZUA 2WT0A 1XLIA 2OZ8A 5G1YA 3OBKA 1S0FA 4QQPA 3VD9A 2XLGA 2J7GA 1OKOA 1W5PA 2Y6HA 1VFTA 2VMHA 3PIJA 4ZU5A 3PJXA 5CNAA 3ARQA 1PS9A 2IPGA 1VR3A 1LUCA 1UR4A 1KBIA 3MTWA 4HPXA 3S42A 2YX0A 5GLVA 3POEA 5FXVA 4XD3A 3TN92 3H2CA 2J7EA 3GNOA 4XAAA 4B5XA 3SQMA 3VINA 3Q8CA 1XIMA 4WM8C 3ELFA 4OUEA 1CGUA 5DX7A 5ABFB 4UOZA 4PI0A 2FDKA 4NPRA 4JNYA 3DECA 3ONCA 3LEPA 3VAVA 1O4YA 2YHJA 4XSLA 3G5EA 1W0OA 1FDYA 3S6PA 3TEVA 4OBSA 1SO4A 1ALYA 1C8QA 1CAWA 1VBJA 2D2GA 4FLQA 4QPGB 1SFLA 1W0MA 2IKJA 4M7SA 3PURA 1X8FA 3SRFA 3LCLA 4ADTA 2J22A 3WW1A 3Q2DA 3K77A 1OD3A 2J9ZA 4BWOA 1H09A 4QAIA 4PEEA 2WO2A 2OZTA 3VPLA 1CW2A 2WHMA 1EC8A 2V69A 3O1RA 2ZZJA 4J6GA 3IV3A 3NDOA 3ZLHA 4FCAA 1BXCA 2CETA 1W6TA 1K5MA 4DM1A 5C5YA 1EYWA 4LA3A 3W83A 3F2ZA 3CIXA 1OF3A 2CWXA 5BCAA 2BP1A 1ITQA 4PODA 3UWYA 4JTEA 2OGYA 1EAH1 5FMBA 5FPAA 4M24A 1OQ1A 1APNA 1RC6A 3KZPA 3PM6A 2X1TA 2D6PA 5EFDA 3GDLA 3CEPA 1AH3A 4BCEA 2BNNA 1RUD2 4ORMA 1E5IA 1O1HA 2B0MA 4BI5A 1NLQA 3N4MA 3FBYA 2I5GA 4HK9A 5CSRA 5H1WA 2WV8A 3EWBX 2WLQA 3WLMA 3FS2A 1K4GA 3DG6A 3O6DA 1Y0EA 4Q8KA 2W3ZA 4XCBA 1RHI3 4CA9A 3FYPA 3NOYA 2J1TA 2ZOEB 4B7KA 4PFHA 5AYYA 2NT1A 2NVAA 5BNPB 2ZFAA 3H2EA 4QRNA 6ENLA 4DNHA 4H1ZA 4N9HA 1CB2A 4JTKA 3OD4A 3IK2A 2O14A 2YCLB 5HQEA 3AP4A 1W6OB 1K9TA 1P7TB 4QG6A 2OWWA 1C8XA 3NM3A 3QSRA 2BSLA 4C6MA 2NN8A 3H2MA 3WMSA 4O11A 1UYPA 1MMFA 3U8GA 3O07A 4NRMA 1BKSA 2DEPA 5FXXA 4S3KA 4IE5A 1ME7A 2KAUC 2IWGB 4DXVA 2LRPA 2QUTA 4ADUA 3Q8AA 5FMCA 1W91A 4AZBA 3VMNA 1X96A 1V6JA 2I56A 2BDRA 4H01A 1XYPA 4Y8EA 1H2JA 2LW8A 3GZAA 2XPKA 3BMXA 4IL0A 2EA7A 3RWKX 4UQAA 5K9YA 4ZO7A 4CU9A 4MH0E 3VZLA 1EH9A 1M7PA 5FO7B 3FJ4A 3LOBA 3UPBA 3VE7A 2ESCA 3LDRA 3AVRA 1W8ZA 3GU2A 4PF5A 4WGXA 1UR1A 3FLUA 3FDKA 1LG1A 1MWOA 2X5IC 4Q4KA 1RALA 5J04A 3URNA 2CZDA 4K7YA 3SO7A 3VCCA 4LHSA 4YW1A 3W71A 3UR8A 3BOWA 3B9OA 3ME2A 1RUF1 2V72A 2V5KA 4LMFA 4FOQA 2VFEA 3G0XA 4GD0A 1W9TA 2NXHA 2F6BA 4LA2A 3U4XA 2A85A 4MGTA 3N04A 2Q1FA 3DKQA 4JR5A 4QJ3B 1NE6A 1W9XA 1GNZA 4N8MA 4RK8A 2PE4A 1RZMA 2WNVA 4AFBA 5AC91 1EZWA 1R1A2 2PCQA 3OU8A 2YDRA 3SUUA 3P5YA 5A3MA 4IE6A 5ACA2 4E4FA 4JN7A 1ZP4A 4XC9A 4IXXA 1MPXA 2JENA 3E2SA 5LZLA 4J25A 4Y4RA 1VIWB 1VEPA 3CO8A 2GUYA 3TAKA 1BXHA 3B0XA 1A34A 4QM9A 5EYWA 1M68A 3HIJA 3NJXA 1HQTA 5FTTC 3BJSA 3GNPA 3AQUA 3TRSB 4CDUB 4CDQB 4XBJA 1AR62 5BXPA 4HMEA 2J27A 1V8EA 4IFRA 3S3GA 4F2BA 5D8AB 3R43A 3IKWA 4V27A 4Q0PA 2BBAA 4V2VA 3LRKA 3QGVA 4AEOA 4XFBA 2WAOA 1CX1A 3HFTA 1UH2A 4S2GA 3HT1A 2YC0A 4Q0SA 4HOWA 1OX4A 4HVOA 2WZTA 3CUJA 3P60A 1TTJA 1T8QA 3YPIA 2VXNA 2GQ8A 1Q8SA 1UU4A 2Y63A 5AOUA 4N43B 1TMQA 2CESA 3BAWA 2WCGA 2WKLA 2ALRA 4JTRA 2DBNA 5BMXA 3KV4A 1GK8A 1FPN1 1QBBA 5CLTA 3KL3A 1NZIA 1BFNA 3W7QA 1OEPA 3LMZA 3KBSA 4K37A 1Q8QA 3DC0A 2YU1A 1VBD1 1V6XA 3EOLA 1VB9A 5DZEA 1QWRA 1NCQB 4B7EA 1BVNP 2WQDA 2RDSA 3NSTA 3H1MA 3VHNA 3KFTA 3KM8A 1VFUA 3WBEA 1MEWA 3GALA 1OK6A 1Y9MA 4DUWA 4XV0A 4DI9A 4NHMA 4UNIA 5JZGA 5T55A 4FOUA 3NJ3A 2WCAA 3JUGA 2ICSA 3NQAA 2F61A 1UY3A 4DO4A 3IGSA 1AYM2 4TYSA 3M1ZA 4KFNA 1AD4A 1KFCA 2JQXA 1NWSA 3VKKA 2W1SA 3P1IA 1O5KA 2CHOA 2FDIA 2ZUMA 1ZGDA 4N53A 1G9HA 3C8FA 3V5OA 2WZIA 3KLKA 4YGBA 1RQBA 4WXZA 3AJXA 3H22A 4Z1YA 4YW6A 1ISYA 2XUMA 3CAWA 1R64A 1UY1A 4Z1VA 2VH9A 3TR9A 4XAGA 1WKFA 1PKNA 2UURA 1UHVA 5DLCA 5KC5A 2WMHA 4UR9A 5E16A 3VXGA 2Q02A 1ENRA 1Z41A 2ZS6B 1NUKA 1TX2A 4C7GA 4A8LA 4L7ZA 1IQDC 5C3RA 2Z2AA 3TN5A 3MBDA 3UYJA 1F73A 4CDWC 2PQSA 1XIFA 4KBXA 5K3VA 1O59A 2GWGA 4B4PA 1H11A 4UTMA 2ISFA 1H5VA 3MWCA 2VZSA 4MWAC 3EQEA 1IGSA 1ODNA 4HL0A 3TNOA 2VC9A 3WJYA 3C0SA 3S5AA 4HJWA 5A6AA 3JZVA 2QBXA 1WDWA 1ME8A 5HJYA 2FDSA 3MUXA 2BUKA 3NQGA 3ZYRA 2AAMA 2Z1KA 3LSEA 5A1LA 4U2YA 3H8AA 1KXTA 3VVGA 1Q8VA 1J58A 1EAH3 1YCIA 5JI9A 5G05L 3PVNA 5K0UC 2R9RA 4E0CA 1GGOA 5EV7A 2FPYA 4GUGA 1A80A 1D2SA 1V0AA 1GOHA 2QPXA 1CZVA 1FV2A 4QDMA 1J84A 1PDZA 1AX1A 1WPCA 3AXXA 2AL1A 3LDVA 4RNFA 4GY7A 4L4PA 3SCOA 5KHKA 5FZ7A 1D7KA 3CEWA 4BQYA 1V79A 5BNNA 4HA0A 2C26A 4FPKA 1NY71 4HCHA 3GUWA 1XDLA 1SR9A 1MQTC 4X6RB 4E4HA 3CMJA 5T5LA 3PZNA 1H1AA 4HNVA 4XD5A 1S0GA 4ZVJA 3M43A 4MY9A 1TVPA 3MLJA 1DXFA 3ZSLA 3IM0A 4LAKA 2F4PA 3VO0A 3SH5A 4XDOA 5FFOC 4QJ5B 1MNZA 5KHHA 3NQCA 3D6NA 4LCRA 5F3CA 5CBBA 2C9KA 3NQDA 3GQYA 2CWMA 2B45X 2WM0A 5AC7A 3D0CA 1SEFA 2ERFA 1NCRB 1UPSA 4DO6A 4EN6B 1SLCA 1OT2A 4K7VA 5M2FX 1W0NA 4FPLA 2A4AA 3F5JA 4GY0A 4Q32A 2WFF1 1VBA1 4H9YA 1LOAA 3INAA 2P8BA 1V9U2 2EIDA 4AF9A 4DXRA 4TVDA 4HSJA 4Z42C 3NQ7A 4U3AA 3S47A 1FP9A 5KXCA 4MNLA 4GWMA 4XIOA 3AP7A 3R10A 1S0IA 4BK9A 4KESA 3MSDA 1J83A 3M64A 1FX6A 2XGXA 4AZ5A 1RUF3 3P6LA 1ZSXA 3GXPA 3VKFC 5EXOA 4AEFA 1C4RA 1W3LA 1G9FA 5FCCA 4HNTA 3G3DA 3L9CA 4IP5A 4PI2A 2GVEA 3MUIA 3WNKA 1UOJA 1KFJA 5AC93 4NO4A 4KQ7A 5HMSA 3I3DA 3FVDA 3GZ3A 1V7YA 2DZPA 4MB5A 1JN2P 2VXRA 2B7YA 1XIGA 2QCSB 3OGSA 3LGRA 2O9OA 1VFMA 3LBCA 1BG4A 1LDCA 4NASA 3W4RA 3WQ8A 4LULA 4YM2A 3MMDA 3LDBA 3CHEA 2P88A 3PPCA 1TEIA 3NGJA 4FP1A 1F8IA 2FJKA 2OWXA 2O0OA 2EXHA 2IS7A 4Z08A 1ND2C 2QULA 2X05A 3LA4A 2OELA 1TKKA 2P0OA 2BY2A 1KRAC 3GDKA 3LXCA 2Y7FA 1K02A 4XZLX 4PYSA 4F3HA 3PULA 3RU8X 3FKKA 3LCIA 2XVGA 1GZ9A 3WX5A 2ZICA 3IUDA 2W3JA 3UNTA 3W86A 4LHKA 3VBSC 4NAFB 3FXGA 4QDQA 2JG9C 2W92A 3ZFEB 2D0HA 4E2SA 3T1MA 3VDHA 3THPA 1KXGA 3B9DA 1F4HA 1J9YA 1NDZA 4ZO8A 1UH4A 3VGBA 2ADDA 2WO3A 4N9DA 5K2ZA 1CIUA 5LRSA 1ULPA 1X1OA 2J25A 4JHMA 4XVHA 3H26A 5KZ6A 4UUIA 2WAAA 4S38A 1JCNA 1EV11 2P2KA 2FYMA 3LCHA 4RS5B 5H9QA 1OF6A 4AHQA 2W95A 3MV01 1G0CA 1FPN3 3I2FA 4BEUA 4MZ8A 2J1SA 3B06A 3UCQA 3OHMB 2WRAA 5LBCA 2WWCA 3HG4A 1B90A 3NAVA 2JICA 3R4UA 4BQ5A 1ZNNA 3WLNA 4RV8A 1VBD3 2J9XA 3PJTA 1FCVA 3NOEA 4QE1A 5JBEA 4D8LA 3PK7A 2WXDM 2XGIA 3OW1A 4FAHA 1SZNA 4QEHA 1XLLA 4D72A 1IT8A 4Z2IA 3LSBA 2WNEA 4BS0A 1YMYA 1A0EA 2NVCA 4GIAA 1UASA 2IVIB 4Q29A 5EQUA 2GC0A 1CENA 1E0WA 4NG3A 4LEQA 1RJ8A 4FB7A 3CWHA 1UD5A 4PF1A 3C61A 3GM8A 3L4TA 3R94A 4Q8QA 2IFWA 4YW2A 3CLPA 3UW6A 2WZR1 2Z0IA 4O19A 2J8FA 4YHGA 2ORXA 3VOIA 4FOYA 3FUQA 1U30A 3UWVA 3W07A 3QOMA 1JXJA 1V4YA 1SZRA 5XIAA 1GWMA 4C6PA 3LPGA 1FOBA 2A21A 2TEPA 5FKBA 1EP2A 4ENLA 2VECA 1FOD2 2RH9A 4G5DA 1J5SA 1LBLA 2HWC2 5KXBA 3ITVA 4M6QA 2J6XA 5T5PA 3NZRA 1U12A 4AHOA 1LEDA 3L4XA 1XNKA 3VKAA 4MJ2A 3P74A 1TZOA 4UIOA 4WKAA 2AQOA 3AXIA 1JTZX 2VC6A 4UTIA 4QBXA 3N29A 4CUCA 3W2NA 4NRSA 4QIUA 4K36A 2CAVA 2QV4A 3ITOA 4GCAA 5DQPA 3EKGA 3U48A 1Y9GA 4Q7BA 1MS9A 1AYN2 2HYXA 1S0JA 3BLOA 2BS9A 4IIGA 3W76A 4AQ6A 1CXLA 3O1OA 3EEZA 2F2HA 5D2XA 3HPZA 1H50A 4FA3A 1UMZA 1MQRA 2XM1A 1PBGA 2JKAA 2E32A 3LSDA 3B8VA 3DZ1A 3PVOA 4OULA 2D24A 5D02A 3C6CA 4V1YA 4NWWA 2ZXAA 4P61A 4FS9A 3G22A 2EG8A 2WANA 1OYCA 4DUXA 3HAGA 3MUAA 1ENSA 1Z7S1 3LZ5A 2WFPA 3WUBA 3IJ9A 3FC0A 5FP9A 2CPUA