4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
b'SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
3FW6A 1RPKA 2CBIA 5I5RA 4U5IA 1OCQA 1GOOA 4MNJA 2E3ZA 1KXVA 4D1JA 3SCTA 1QW8A 3EDDA 1YQ2A 1L8NA 3BSGA 5CQ1A 3WMBA 4UFIA 2EPNA 1M53A 2QLYA 4OKDA 4AZIA 1VIWA 5A6BD 2WVTA 1I75A 2J7CA 3PZOA 4UZUA 3PN8A 4F9DA 1B3XA 1XC6A 2VX7A 2YDRA 5AC5A 4F66A 4ACYA 1KWKA 4HZ7A 4F8XA 2WZHA 1GQLA 4LJHA 4W8AA 2ZIDA 4HA4A 3EMQA 3VINA 3ARTA 1RH9A 2FHBA 1GWMA 4U33A 1NOUA 2Y8VA 3AIRA 3UEQA 1KGUA 3QHNA 4B15A 4YN5A 3ARXA 3WDHA 1W2VA 2QV4A 2WMJA 1V3IA 1B3VA 2YLLA 1PZ2A 2NT0A 1L7LA 3GNOA 4PTMA 1UUQA 3VIHA 3LPOA 2WKGA 1IZJA 2DSWA 1WMXA 4UQEA 1IZKA 4HU0A 3RM8A 2NSXA 1HXJA 1ZS2A 2VNCA 3FHQA 5A8NA 1QNPA 1QI3A 1WAWA 3PBGA 5EFFA 2QMJA 1FH8A 4MNKA 3N11A 5BXRA 5IHSA 2AMGA 1FP9A 4AC1X 4K68A 3DHPA 2Q8XA 2A3CA 7TAAA 1V3KA 1W9UA 3O9NA 2DT3A 1KGWA 4J3XA 5IHRA 1QI4A 4PEEA 1NP2A 4LPCA 3PTKA 4AW7A 4D6EA 1JZ2A 3TTYA 5DEZA 3L4VA 2V3FA 3VD5A 5BYWA 4OOUA 4V27A 2C7FA 2OYMA 3RJYA 4ZENA 2BY3A 1U2YA 1JG9A 2ZXBA 5IFPA 1W9VA 1I1WA 2D24A 2VQTA 2Y5EA 4W7VA 3LPGA 4QLKA 1H11A 2J78A 4CGTA 1W3KA 1TE1A 2D3NA 2J77A 4KGJA 1C7TA 1EQPA 2YJQA 4TX8A 5CSYA 4BF7A 5AY7A 1E3ZA 2BHUA 2BS9A 3OGRA 4UQCA 8CGTA 1OSEA 4M81A 5C8BB 1V3JA 2EEXA 4PMRA 3MSDA 2WLYA 1OT1A 2EXOA 2GJPA 1XSKA 4R27A 3ARYA 2G3JA 4Z2LA 2WSKA 1E70M 1UKQA 1VF8A 2VVNA 2BFGA 3AIVA 3SUSA 5JIWA 1W1VA 2X8RA 1FP8A 4MDPA 4NZCA 3ARVA 3AYRA 4F9JA 4MADA 1KQYA 4LX4A 1SYTA 2CIPA 4QCEA 3BH4A 2PWGA 1E0XA 1BYDA 1WDPA 3BAXA 2DIEA 3B9DA 1M01A 2XVNA 5M3WA 1GWLA 4Q22A 2VQUA 3IANA 1E9LA 4P7NA 3WELA 4LYPA 3CUIA 3L2LA 3EYPA 3WD2A 3A4WA 1WB0A 5E70A 4AZCA 1MQPA 2WLZA 2BV9A 1JL8A 3AMDA 3IJ9A 4NRSA 4XZWA 1ZBVA 1J10A 1DWAM 3A4AA 3MMUA 4YPJA 2PB1A 3W24A 1OM0A 1CXLA 3VMNA 4N42A 3II1A 1JYNA 1PBGA 2XIIA 1DP0A 4OZOA 1LL6A 3GH5A 3TTQA 1V02E 4X9YA 4W93A 5FIPA 5CSUA 3BCDA 1JDCA 1E6SM 4CU6A 3NDZA 2YBUA 1SMAA 1W2PA 2CETA 4AZCB 2DSZA 1W8UA 5CLWA 3OGSA 4WSJA 1G5AA 3WD3A 1EGZA 3ZR6A 5A6BA 3THDA 1E4MM 4ML4A 3AS2A 5I3DA 1UH3A 3ZT5A 1LWHA 1MWOA 3AHTA 3WDPP 3W4RA 3G6MA 1UR1A 5E6ZA 3TTOA 4PMUA 1H1NA 2W5FA 1MFUA 1J0ZA 3GH7A 1ESWA 4OIFA 4S3KA 1F4HA 1WZLA 3AQUA 4RE3A 4B3LA 4U31A 4JFUA 2YL5A 4RE2A 4UFLA 2CYGA 4JFTA 1WDQA 2DEPA 3K8LA 2VZSA 4UOQA 1BSIA 1W9PA 4GXPA 2J7HA 4MAZA 1H4PA 3M6DA 1HJUA 1LL7A 1UD3A 1BYAA 3WNOA 4AD1A 1C7SA 1JNDA 3VGHA 2D1ZA 3W6MA 2BVTA 5CPSA 3K1DA 2QPSA 1UD4A 4PMOA 2F8QA 4PN2A 9CGTA 1H09A 1RP9A 2WSPA 4B9YA 4PSPA 2WYSA 2V3DA 4YW6A 3WL0A 4YHGA 3CHDA 3I3DA 1OINA 3AISA 2CXGA 4U3CA 1VAHA 4HZ8A 5ABEA 4M1RA 5ABFA 2BY2A 2E9MA 4AIEA 3WDIA 3WNNA 4W89A 5A8PA 2ZWZA 3BAJA 1BG9A 4Z2IA 2JWPA 3NCOA 3N04A 4CCEA 2DPEA 1UZ1A 2Z1KA 3GBEA 3PZIA 4H7VA 1CGVA 4EANA 3BCFA 4ATDA 3ALGA 3PHAA 2A3AA 2F2HA 4NI3A 5ABFB 4D6IA 4MB4A 3THCA 2E9BA 3DYMA 2XIBA 4E8CA 3VX1A 1H49A 4C7DA 3SCWA 1R8LA 3NSNA 2XVPA 3CZEA 4C7GA 3VVGA 4WJXA 4HOXA 3VIPA 2JIEA 2VCBA 2ZUNA 1KQZA 3RJXA 1C8QA 4BS0A 3EDJA 1EDQA 1OGSA 4UFMA 1UWUA 2DDXA 1V6UA 3AXXA 5A6LA 3VD3A 2BHZA 1HP5A 3W0KA 1VFFA 3W28A 1XRVA 4F79A 1WE5A 4W84A 5D9MA 5F7UA 1E4IA 3BLPX 1UQYA 2OLHA 4CN1A 1JI2A 3WUFA 1OD8A 2PWEA 1LQ0A 1KXHA 2J62A 5CZKA 3WH5A 1V0MA 3WD0A 1B0IA 3NIYA 1JYVA 4W87A 3VGDA 1JDDA 1G9HA 2PC8A 4NF7A 2CNCA 3CTTA 3FAWA 1DTUA 1HJVA 4D1IA 1OGGA 4BQ5A 3MUIA 3A3HA 2BXYA 1NWUA 1CWYA 1MXDA 4OJYA 2V5CA 1GUVA 4W8BA 4BQ2A 4UOJA 1FHLA 1W90A 1H3GA 1QVBA 3SEPA 4PMQA 2ZXAA 5A1AA 8A3HA 4CP9A 4UFJA 2ZX9A 4D6CA 1NP0A 1JAKA 1E5JA 1DWGM 3ARPA 4MB1A 3KEHA 1XH0A 4OBRA 5DT7A 2XVLA 3SUVA 3GM8A 1CGWA 4AZ7A 4MJ4A 3VDCA 2VZVA 4JFWA 1E71M 1HN0A 3AIWA 4A3YA 5A94A 2J8GA 2NT1A 4PYSA 1JYWA 4BQ4A 1AVAA 2VRKA 1HKKA 1GCYA 3EDEA 3WQ5A 3VDBA 1XV8A 4IPNB 4PTVA 2PF0A 1ITXA 1TA3B 4UFKA 1XYZA 2DSUA 3BMVA 1K9EA 1M04A 4UOZA 1CGYA 3BAWA 1DWFM 4HA3A 4X0NA 4Y7EA 4KRUA 5E9AA 5A2AA 2Z1SA 2XGIA 2QMKA 2D22A 5JIPA 2WNWA 1TG7A 4GINA 3AZSA 1FOBA 3PZTA 4LK7A 3M7SA 2JIWA 4FMVA 4HPGA 2YDQA 3EDKA 2RGMA 2VCCA 2WWCA 3K4DA 4UNIA 1KBKA 3W82A 3CIVA 3OIHA 3UG3A 3WF4A 7A3HA 4PRWA 1JZ4A 2VR5A 3WMCA 1KGXA 3GXIA 3A47A 3OLIA 1V3LA 2VX5A 1KR1A 2WVVA 1HJQA 3VM5A 2C24A 4GZJA 4B9ZA 4FLQA 4QFUA 3N9KA 1W91A 4LKFA 2GJRA 4CN6A 1ZJBA 1QPKA 2OSYA 1JAEA 2CKSA 3D5HA 1JZ7A 1V02A 3SUWA 4BCEA 3MSGA 1E5NA 2XYLA 2CCRA 4AWEA 2ZUMA 2G41A 2CEQA 4MPKA 2ZX7A 3OA5A 1OBAA 5FCZA 3VDHA 3PTQA 1JFHA 3AXHA 2WVSA 2WVVB 4E8DA 2XTKA 2BNJA 1Q6GA 3HU7A 1QI0A 2YA2A 3RCNA 1QNRA 4PBGA 3F5LA 1UOJA 3W37A 1UR2A 1XD1A 2XVGA 3TP4A 1EQCA 4AL9A 2ZUWA 3B8SA 5E0FA 2VOTA 2GSJA 3U57A 3AMLA 3WSUA 1YHTA 2XJ7A 1MW2A 1P6WA 1EO7A 3VDAA 1DWJM 2E8YA 1GPFA 2WMIA 4PSRA 3TONA 3VX0A 1JF6A 4P8VA 2O92A 4GO8A 4E4PA 1OD0A 1V6VA 1KFWA 5E6YA 3A4XA 5FOOA 3IJ8A 5EFDA 2XWEA 4M80A 4WSKA 3S2CA 1UG6A 2LRPA 4RL3A 4CD8A 5LA0A 3WBAA 1PIGA 3MMWA 2WMGA 5FL1A 2W61A 3WQWA 1CGXA 4H04A 2D23A 3DYOA 4OOZA 1Q6DA 2G4FA 4LK6A 1ZBWA 1AMYA 1BQCA 2VVSA 2ZXQA 2X2YA 2WMIB 2WANA 3UG4A 3WQVA 1FH9A 1E1FA 3L2MA 1V0KA 2GVYA 3N1AA 3S6TA 3GTNA 5GNXA 2PI6A 3ZYHA 1MW0A 1CIUA 2GFTA 2BVDA 1WKYA 3RPMA 3UCQA 3GH4A 3L4TA 1GVYA 3VUPA 2J7FA 3MV11 4A4AA 1F4AA 3OGVA 1R7AA 4HMDA 1FH7A 2VTFA 1ZBCA 3CZ8A 4JFSA 1B2YA 2QHAA 3VNZA 4OBSA 2GJXA 4PTXA 4AZGA 1QNOA 1FA2A 1L0PA 1RD6A 5A2BA 1GONA 3AIUA 4DUXA 1OT2A 3E1F1 3F5KA 4X0VA 2ESCA 1PIFA 3BAIA 4TTUA 2DIJA 3U5YA 3WUBA 1BGGA 1U30A 5A8MA 1UR9A 3M07A 4ZE5A 1UQZA 2XHYA 5DT5A 1TUXA 3W81A 4BZYA 3OLDA 1ZL1A 1GJUA 1TZ7A 1BYCA 1UD5A 1BGAA 2A3HA 1VBRA 4UZSA 3GXDA 5EB8A 1QBAA 2GJXB 4W88A 2BY1A 1LG2A 4PCSA 1R7OA 3MANA 2PBGA 3ARZA 3PZNA 4S3JA 4C7FA 1WZXA 3QR3A 3OLGA 1GHRA 1CXHA 2CKRA 1W9XA 1C91A 4LYRA 1IT0A 2DSVA 2PWFA 1W1PA 2J7DA 3U5UA 3BAYA 1TFVA 3SURA 1PJ9A 4YWAA 4HMEA 1GOMA 2UY5A 3BXWA 5KEZA 3KZSA 3U7VA 5ABGA 1CENA 1E15A 2UY3A 1K9DA 1GQKA 2VRQA 3LPPA 4NRRA 1HKIA 4WKHA 1CXKA 1X6LA 7CGTA 3IAQA 3IAPA 1C3FA 3AI0A 3BMWA 4J3TA 1V3HA 2WMFA 3VD7A 2X05A 3TOPA 3ARSA 1E40A 5AYBA 2J79A 1QI2A 3AIBA 4CCDA 2FHFA 2JEPA 4TUFA 1CXEA 1E43A 3W53A 4P7OA 2KR2A 3UETA 4MDOA 1XYFA 4HZ6A 2VL4A 5D8ZA 4AD2A 4PUDA 3VIIA 2CBUA 2WHLA 2HISA 3FNDA 4PMDA 5A6KA 3AHXA 1V3MA 1WCUA 4WF7A 5I24A 3SCPA 2O9OA 1E6NA 3GXFA 1OH3A 5GNYA 4J3SA 2CHOA 2G3IA 5GNZA 5BRPA 3NUKA 3WBEA 4KGLA 4PUEA 4MB3A 1G94A 1VEPA 5HOSA 4M56A 3F4VA 2GDUA 3CZGA 4URIA 4EAMA 5HDRA 3WQ4A 1JZ3A 2J75A 4Z2JA 2VI0A 1QNQA 5E09A 3VIOA 1CZ1A 2YA0A 2D20A 5DMYA 4EE9A 4JL1A 1BTCA 1PAMA 3O6AA 1Q6FA 3WQ6A 3W38A 3SUUA 4P8XA 2CERA 2WC4A 1UH2A 4V2XA 2VX4A 2VX6A 1ZJAA 3MUY1 3QHOA 1NH6A 1E73M 1XGZA 3PZQA 4E2OA 3CBWA 2J25A 3A6OA 2EPKX 1HT6A 3KL3A 1LG1A 3OLEA 4D6FA 1UHVA 6TAAA 3LPFA 3K8MA 4Z2GA 4LXFA 2XG9A 3CMJA 2D0HA 4BQ3A 4NSBA 2OYKA 3WH9A 1W8TA 1UYQA 3RM4A 5D9PA 4JCLA 3T0AA 1OIFA 4GPNA 1E4LA 1VFUA 1XH2A 1JNEA 1RP8A 1UWSA 1H0IA 2EO7A 1JD9A 1B3ZA 2XVKA 4WIWA 4P8WA 6CGTA 4J7RA 4ACZA 2OWWA 3OG2A 1PX4A 2FDMA 4W85A 1U33A 1G0CA 1UOKA 3MMDA 3GZAA 1J0YA 3RIKA 4FK9A 1HF6A 5D4YA 4PMNA 3GDBA 3T09A 3BAKA 2CBVA 1UD6A 1JDAA 1V6WA 2EPLX 3ARWA 5KZ6A 3FHAA 2XFYA 3ZJ7A 3WMSA 2OYLA 2VC9A 3VGFA 3MO4A 1QW9A 5CGTA 4ACZB 5CGMA 2JF6A 3WIJA 3AJ7A 3W6LA 3EBVA 1GORA 3BGAA 1ITCA 1WCGA 1XD0A 2PBOA 1B9ZA 2CBJA 5LA2A 3ECQA 1JI1A 2MANA 1PZ3A 1CLXA 1QHOA 3F95A 5BXPA 3N13A 3AOFA 5D8WA 2VRJA 1UR0A 2C8NA 3VO0A 2GDVA 4OUEA 2YL6A 2DSKA 4D6DA 3ALFA 3ZYFA 1EO5A 4MB5A 4XZBA 1H5VA 3FY1A 3QOKA 1DWIM 2D0FA 1J0HA 4UQBA 4TVDA 3AXIA 3NSXA 1GOWA 1FHDA 3KL0A 3VIGA 3N15A 3F5JA 3AMKA 1J12A 2VJXA 3QOMA 4XB3A 3HN3A 5LYRA 4AIOA 1GQJA 2D2OA 2VO5A 4HA1A 3RM9A 3ZT6A 1V0LA 2UY2A 4AISA 2QF8A 4JHOA 1WP6A 4B3KA 2IUZA 2V5DA 5D9NA 1VJSA 2UWFA 3B9EA 4CVWA 1GZJA 4JKMA 1EHNA 3K46A 4GQRA 4ATWA 3AMCA 4QLJA 4LGXA 4KH2A 3T0DA 1HL8A 1SFSA 1WO2A 3L4YA 3VU2A 3KWXA 4GO9A 1US3A 1E6ZA 3SCQA 1EA9C 1E6RA 2Y2WA 3CMGA 1VB9A 3WF1A 1UR4A 1WZKA 2FGZA 1JFXA 2ZX6A 1GOKA 5EBAA 4P7RA 3L4WA 4MNLA 1EXPA 3DC0A 4JKLA 2LROA 3NDYA 3J7HA 3ZYBA 1CNVA 1AQMA 4CP9B 3HMCA 2IXUA 4B16A 4JKKA 5HXMA 4GIAA 1JXKA 4WK9A 2HVMA 3WD1A 1E56A 4KWUA 1PEZA 3CUFA 2JF7A 5BXSA 3FN9A 2YIHA 1SMDA 1W9DM 4JL2A 2E40A 5IXEA 1E6XM 1HNYA 4D72A 1PPIA 1KB3A 5HPCA 2WK2A 3FXYA 1KWGA 4DWSC 1CYGA 4EK7A 2WVUA 1FFQA 1BAGA 3VOCA 5A8QA 1MQQA 2VUYA 5BCAA 3POCA 4WKAA 3TA9A 1CEOA 3HJEA 1BFNA 3PZ9A 2ZWYA 2VXJA 5D9OA 1W1TA 2XSAA 4M8UA 2O9RA 2W62A 1NWSA 1QI5A 1W1YA 3W25A 3VKKA 3AIEA 2O9PA 4CVUA 2WB5A 1CXIA 2F61A 1HVXA 1UA3A 4P7QA 5A6JA 4W5ZA 4AEFA 4L4OA 1E55A 2DH2A 4JHZA 4P7LA 2YL8A 3RO8A 1ZBKA 4CD4A 1BHGA 1TR1A 2WMKA 3NSMA 1EH9A 1W9FA 1UD8A 2O14A 1EOKA 4CKQA 1BVZA 1CLVA 2XM1A 1MFVA 3GNPA 3IJ7A 5FKYA 4Q7NA 2ZX5A 4AEEA 4GI9A 2J8FA 3SCRA 2J74A 4TXEA 1O7AA 2A3BA 1UWIA 2WM0A 4UCFA 1G01A 1E4NA 4UQAA 4W7WA 3VMPA 4AD4A 2DT2A 3KL5A 3ZSSA 2X1IA 1B90A 1K9TA 4PTWA 5JUVA 2XWDA 2XFRA 2C0HA 2YA1A 2D0GA 1HIZA 1ZU8A 5A6AA 2FGLA 2WYFA 1D3CA 3AHYA 2W92A 3ZO9A 3CUGA 5CPTA 1WPCA 1C92A 1C8YA 4ZFMA 4AD0A 2WXDM 2DQXA 2VZOA 1CECA 1UA7A 3CZKA 1BG4A 4XUYA 1HJWA 1H2JA 2CESA 5I0DA 2OWXA 4QLLA 2ZX8A 1C93A 2Q1FA 1NOFA 3CHFA 1S46A 2ZE0A 1J0JA 1CXFA 3M46A 3CUHA 4L4PA 3WDQA 4YW7A 1Q6EA 1ISWA 5A2CA 2WHMA 3PZUA 4CN4A 2WAGA 5I6SA 4PMYA 3OB8A 3TTSA 5ABHA 2WC3A 1JGIA 2V3GA 1G1YA 1KXTA 1VFOA 4M24A 2W63A 1K9FA 3WEMA 1A3HA 5HBFA 5DFAA 4PCTA 4W8LA 1WZAA 2EBNA 1X1NA 4M82A 1US2A 4MJ2A 2XFFA 3MV01 3T2OA 1Y7VA 4WKFA 4CD6A 4R5EA 3WD4A 3W27A 1OKOA 4FLOA 2FHCA 1NWRA 1AQHA 1GQIA 4GI6A 3WF3A 2E4TA 1LF1A 1J0IA 3AS1A 4JIEA 3MU7A 1XSIA 1EDTA 4BA0A 4W86A 3ORJA 3RILA 4GQQA 1R87A 1HN1A 3VGEA 3PTMA 1OIMA 6A3HA 4FLRA 4LKEA 2PWHA 3CO4A 1UKSA 2DT0A 1NOWA 1W9BM 3RDKA 3WF0A 3CH9A 4GI8A 4Z2KA 1XCWA 3WEZA 1UD2A 3UR8A 3DHUA 1CGTA 3AFBA 5IDIA 1KR0A 3VIMA 2WC7A 4JAWA 2XUCA 1V08A 1HKMA 4DWSA 2BXZA 5HNNA 5JBDA 3PZVA 3WFZA 5JBEA 3UG5A 1GOQA 1JZ6A 2WMHA 5M17A 1B1YA 3N18A 5DF0A 1DWHM 1N82A 3B9AA 3WUGA 1EOMA 1HJSA 1OWQA 3WEOA 1M7XA 1JZ8A 5FD0A 1O6IA 1K6AA 5FL0A 1NM9A 3AROA 3ARQA 1JZ5A 1OGBA 5BXTA 1W8WA 3OZOA 2YKKA 4AMCA 4DWSB 5IFTA 4P8UA 2TAAA 3VD9A 1J11A 4A6SA 2E9LA 2YDSA 2WZIA 5I78A 4TVCA 1X6NA 4DM2A 3SCVA 4V28A 2CITA 5A3HA 1W32A 4KMQA 3PZGA 4H41A 1R86A 1UWQA 1V0NA 3SCOA 1M03A 5AYIA 2WHJA 5C70A 3VTRA 5CLTA 1ECEA 1J01A 1UKOA 3I3EA 3ZJ6A 5M5DA 2ZUVA 4WLCA 1MW1A 4D6GA 4CPBA 3SUTA 3VIJA 3SCSA 3W26A 3O2LA 4JZ5A 1FFRA 1ISZA 4CD7A 1WDSA 5A6MA 2ZUSA 3ZOAA 4EKJA 2VR4A 2AAAA 4HP5A 2WBGA 3ARUA 1BVNP 1E3XA 3ZQ9A 4LYQA 4CUCA 3CGTA 2XGBA 4JCMA 2J4GA 1LJYA 3CPUA 3VMOA 4HU8A 4UFHA 1SR0A 2EPOA 3UERA 4PMXA 1VRXA 4J28A 4CU7A 4DUVA 4XV0A 3CLWA 1JYXA 4D6HA 3WDRA 2WW5A 1KCLA 2O9TA 4GKLA 3K8KA 3PZMA 2J7GA 3VIFA 2Y4SA 2OSWA 3WH8A 4AXNA 5CJ5A 2ZUTA 2X0HA 1W3LA 3AZRA 3MKKA 3I3BA 3ZJ8A 1GHSA 2GUYA 1KCKA 4IPLA 4AYSA 1GVIA 4H8UA 4J3VA 2G3MA 3ZT7A 5JBFA 1QBBA 2J7BA 2EQDA 4IUGA 2WCAA 1CDGA 3VM7A 2EJ1A 3UT0A 3CHEA 5A69A 4FLSA 1BYBA 1GOIA 4AZ5A 3AS0A 2J47A 4GZEA 2NW0A 1TCMA 4ZEPA 2GK1A 3K4AA 1DHKA 3CZLA 3NJ3A 1A47A 1Q4NX 2AOSA 1V0AA 3AIQA 3ZSTA 3AICA 2VCAA 3WQ8A 2ZUUA 3GXMA 1PX3A 1KBBA 1W3HA 3AZTA 1ISXA 2WHKA 3BC9A 3W29A 3WUEA 1JIBA 3LMYA 1HX0A 1GNXA 3ZMRA 2FH6A 4HMCA 1QOXA 1E1EA 1CPUA 2BHYA 2GK1B 1HVQA 3BLKA 3IK2A 1BF2A 4U3AA 3N12A 2YL9A 1MXGA 1J9YA 4HOWA 4MAVA 5LA1A 3QGVA 1Q6CA 3WENA 5HPOA 1J18A 4CU8A 3POHA 1QHZA 4MNMA 1ZB5A 2W91A 4QP0A 4AY1A 5CXPA 1VJZA 3VD4A 2D3LA 1VBUA 1E72M 4HOZA 1E0VA 4U5KA 1TMQA 3OZPA 1LWJA 3CUJA 1V6XA 1IV8A 1VEOA 3MUAA 4U2ZA 2PWDA 4LKDA 2A3EA 4J3WA 4IM4A 1B3YA 3UR7A 5D21A 1E0WA 5A6SA 3GYCA 1XSJA 1EHAA 4CD5A 5I2UA 4DM1A 2WZEA 3MS8A 5I79A 1E6QM 1VENA 2QPUA 3JUGA 4GZIA 1CBGA 3WNMA 3AHZA 4DUWA 5E0CA 3EMZA 5A95A 1UKTA 2EPMX 2FH8A 2V3EA 4AZHA 1W3JA 4KRTA 4UQ9A 2CHNA 1ODZA 1JD7A 2X09A 2VZUA 3WNKA 4ZXLA 3D3AA 1BLIA 4LQ1A 3WFLA 2K46A 1JXJA 1V03A 1LL4A 3AS3A 4AD5A 3WF2A 1DEDA 2ZOXA 1NWTA 1UWTA 1ODUA 2X0YA 1C8XA 3DECA 1WZMA 1B30A 1J0KA 2OWCA 1I1XA 2JALA 5A8OA 1HL9A 4QDMA 1MYRA 3GBDA 1V6YA 1D7FA 4IISA 4PMVA 3SCNA 3VGGA 3WDJA 3FAXA 3NYDA 1GJWA 3ZR5A 1H0GA 3U7BA 4PMZA 1E6PA 2XSBA 5ECUA 1PX8A 3ZM8A 4RE4A 1OB0A 1UH4A 4CCCA 2RGLA 1ISYA 3UESA 2ZICA 3L4XA 4W7UA 5BROA 1KXQA 2W4XA 2J7EA 1TA3A 4QCFA 3AYSA 1XHGA 1C90A 5GPRA 4U2YA 1UR8A 1WNOA 4H2CA 3APGA 3WH6A 2VZTA 4JFVA 3L4ZA 3VGBA 1D2KA 2WPGA 5TD4A 1R85A 2VURA 3OBAA 1QNSA 3QHMA 1HP4A 1TVPA 3ZJKA 2XPKA 2WKLA 3T2PA 1UWRA 3WL1A 3GNRA 3VIKA 1WDRA 5GQBA 5I23A 1CGUA 3T08A 3KE0A 4DWSD 2YBTA 1QHPA 4MTVA 3T0BA 3WH7A 4H8HA 4ZXOA 1HKJA 5DO8A 1GW1A 4YHEA 5CG0A 2WBKA 4J27A 3T2QA 4M29A 4TOQA 3SCUA 2W66A 1W8ZA 2W67A 1MVYA 3CHCA 2Y24A 2G8ZA 3N17A 3ZIZA 3VNYA 2E8ZA 4FF5A 3CZJA 3WKZA 4D71A 4Z2HA 2DGAA 2B31A 2Y8KA 1AQ0A 3SIMA 4AIUA 3WNLA 4HTYA 3MUZ1 2UY4A 1EIBA 3AHVA 4J3UA 1TVNA 1BPLB 3VILA 2YLAA 1CTNA 1UKPA 5I77A 2BVYA 4AZ6A 1MW3A 4XX6A 3G6LA 2V38A 1LLOA 1GWKA 4HPHA 1HJXA 1NQ6A 2BY0A 4H8VA 2XM2A 5EMYA 3WN6A 3L4UA 4UQDA 4AD3A 1B3WA 2DH3A 4UTFA 3EMCA 5AC4A 4A3HA 3EDFA 3DYPA 5M03A 2JFEX 2ZXDA 1XH1A 4W5UA 2OSXA 4UR9A 1XCXA 5BRQA 2WCSA 1EDGA 4CPBD 1UZ4A 2G3NA 4QAWA 2E0PA 3WY1A 2CPUA 1NARA 4TTGA 1VFMA 2VT0A 4N0RA 4AZBA 4ZE4A 2JE8A 2WWDA 2DT1A 5C71A 3VPLA 1H41A 3AMGA 1JF5A 1VEMA 2WCGA 5CPQA 1Z32X 1B31A 1MQRA 3WNPA 2VMFA 2YOCA 3ARRA 4TVUA 4D6JA 4ATLA 1ISVA 3RMEA 3BSHA 4TX6A 2IXVA 2JEQA 5BWFA
chains in the Genus database with same CATH superfamily
1RPKA 5BV6A 1OCQA 1XPWA 4UTJA 3T40A 1M1BA 3SCTA 4GUHA 4A7ZA 2CGNA 1L8NA 3VYLA 1XRUA 5CQ1A 4D8ZA 2PHWA 2YG0A 3RRAA 3MLLA 5AHNA 1I75A 4RNFA 3RVHA 4Y24A 3UGGA 1FDYA 3PN8A 2DYCA 2VX7A 2VW0A 5I07A 3GWQA 4ACYA 1LQ2A 4HZ7A 1W0PA 2V5YA 5A3MA 1GQLA 4LJHA 4MY9A 3CIXA 3W1AA 1YXWA 1LESA 3WQEA 1JPHA 3W84A 2J22A 4PBOA 1IEVA 3FUOA 2YMZA 3AIRA 3EWXA 3UEQA 3QHNA 3HNYM 3HM7A 4IXXA 5C8CA 1SJAA 1VIWB 1PWMA 3IPWA 1KRMA 1YNYA 2V72A 3W7NA 4Q0VA 1HZYA 4CYDA 5K3VA 3CLPA 1L7LA 1UUQA 3B01A 1XXXA 5EPDA 2WKGA 3VIHA 3VBOC 1COV2 5LZ6A 1RUH3 3FMGA 3LFMA 1AH3A 4ZOEA 2CTVA 5A8NA 4CZSA 1ZS2A 5JXIA 2ZC8A 1WAWA 5EFFA 2QMJA 2VOMA 3RMJA 1MZHA 2ZX4A 3POYA 4GX9A 1S0IA 4K68A 4AC1X 3UYIA 2PD9A 1K8XA 2ICSA 2WSVA 4HLTA 1S3TC 1V3KA 5B80A 3O9NA 3I2DA 2ALRA 1O8SA 3IDAA 3BGGA 4BK9A 3SFKA 2A6WA 3BQ5A 1RHI2 1D7KA 4AMAA 3TJ4A 5DEZA 1OH4A 3HEIA 1W37A 2V3FA 4S2FA 4V27A 4N4QA 4DEFA 2XJRA 3ATZA 3RJYA 3HG4A 3GDMA 1JG9A 3B03A 4NZ4A 3M16A 4MMWA 3VZMA 1PS9A 2Y5EA 1G4EA 5I3HA 3LMZA 4CGTA 1FVPA 5FMCA 4O10A 1M9HA 1R1A2 2J77A 4KGJA 1K7FA 2QR6A 5T54A 2YJQA 4AAXA 4MGKE 4BF7A 3H21A 4GGBA 1H8TC 1RALA 3WUDA 4UQCA 4M81A 4NNCA 4YLZA 4DBSA 2WZMA 5D37A 1XPGA 4PMRA 3KBWA 2VC5A 1OT1A 4R4ZA 5FJKA 4JS3A 2X1RA 4ZQCA 2EXOA 2GJPA 4RR3B 4IV3C 5FY1A 1UQXA 1AYN2 3GDLA 1VBA1 2G3JA 2DF7A 3KP0A 3ZPYA 1E70M 1VF8A 2VVNA 3LEKA 3SGGA 3AIVA 2ZEXA 4C1NB 4DB7A 1VIZA 4NZCA 1LROA 2C6QA 4F9JA 5LY2A 2PGRA 4IQEA 1VBE2 2CIPA 4UMAA 5FPLA 3ITGA 2I07B 3JU2A 4FXSA 3OPWA 4XBJA 2Y34A 4O1FA 1ASJ1 2VQAA 1O4UA 4G7EB 4OV4A 5DMMA 3AU2A 4H9UA 2G19A 2KXLA 1FWTA 5A70A 4QQ3A 3W01A 3RR1A 4WZFA 3K3NA 2BBFA 1ZREA 4NP7A 2QCFA 2I45A 4X63A 3G2GA 3H24A 3WD2A 4GA8A 1M6JA 4AZCA 3FX3A 4DY5A 3A23A 4BB3A 2PQSA 5JMOA 1JL8A 3IJ9A 3CAQA 3ZSKA 1Q6LA 4IIGA 5T5PA 3NFUA 1DWAM 3UA3A 3A4AA 3BG5A 4F48A 2QXWA 3W24A 2JEMA 4KCTA 4HGXA 2VUAA 1KXGA 3T4VA 4JDYA 2QUNA 2XIIA 1W3NA 3UP8A 3O0XA 4ZB5A 4W93A 5AZ0A 5FYSA 5CSUA 4CU6A 1ZZ9A 2V81A 4ZB2A 4QRNA 1W8UA 3CWHA 3KXQA 3G8RA 2G9GA 3BTNA 3BALA 2VBBA 3JB4C 2I74A 2YBPA 3THDA 4NROA 4NAFB 3ITYA 5BNPA 3UZYA 4K1GA 2VENA 1DZTA 2VOWA 4UBGA 1D4M1 2VWSA 1VBJA 3K30A 5KXEA 3GTFA 3WYZA 1GQGA 1HDKA 2VZ3A 2Q3OA 2A70A 4Y1VA 4PMUA 1H1NA 2W5FA 1KFUL 2YC4A 3QOPA 4Q27A 4YFZA 4E3VA 3NQGA 2AKMA 1BJQA 1MFUA 3N9PA 1XUUA 3C4UA 4JQRA 4LPLA 3LD5A 3A4JA 2DZWA 3GH7A 4S3KA 4ERIA 2P0IA 3QH7A 3MF9A 1A6CA 5FO7B 1DE5A 4DJDC 3NAPB 4DO7A 4RE2A 5DCBA 1RVF1 1S2EA 2CYGA 4NPLA 1IXQA 3VBOA 3K8LA 4NL1A 1QNYA 1LHOA 3R1ZA 1WLDA 4QM9A 3CEWA 1BSIA 1W9PA 2DWRA 1A49A 1ZZ7A 2DJXA 3OQ8A 2E28A 2HKXA 1XNKA 4JNZA 1SFTA 4M6PA 1VBHA 4DBWA 2EG7A 3RZJA 1S5TA 2QCDB 3K1DA 3OBKA 1UD4A 5C2XA 4GJZA 1K70A 4AGGA 4K40A 2PTZA 5FZLA 3UJSA 2XBO3 4B7EA 2V3DA 5FA5A 4Q4W3 4H2AA 4F0KA 1S39A 3CAKA 1I2QA 1TQ5A 4S3DA 1K45A 4NRQA 5H9PA 3AISA 5CC3A 3RI9A 5IAXA 2DCKA 1VAHA 4HZ8A 4Q4RA 2E6VA 1ZALA 3U2CA 3KD4A 4UTIA 5GZGA 2K0GA 1W2OA 3V4BA 4F0SA 2G5WA 2WNQA 5FZ0A 1TTIA 3AMNA 3WNNA 5EGRA 1F76A 1UC5A 5IVBA 1MS1A 4Z2IA 2QUVA 4M1BA 3WCZA 4Z8BA 4CCEA 2DPEA 1UZ1A 1AD1A 5I7GA 4C0HA 2GC2A 3PZIA 5BY5A 1K42A 2LALA 2VNVA 4EANA 1AYM2 3VBHC 1NELA 1H7XA 1LTEA 3MW3A 4IV3A 2HWGA 3CL1A 4LF2A 3ISIX 3ALGA 3PHAA 1CAUB 4MXWA 2OFJA 5ABFB 3BYWA 3THCA 1KBLA 4CP0A 3OTRA 1KLYA 2E9BA 3GD6A 4Q4PA 3KHDA 1Z78A 1JMUB 3SCWA 1AMKA 3VZZA 3RGBA 4DXTA 4RA0A 3WDVA 4DJFD 4WJXA 3O1SA 3OUIA 3KRZA 4WVMB 1C8QA 3LEGA 3C2EA 3W1TA 1URXA 1EL3A 3PTYA 1KV5A 5JMUA 4IP7A 2WS92 2PWVA 3AXXA 1CWPA 3NQMA 1ONXA 4MX3A 3ACLA 1NA1B 5E1QA 1AJ2A 2R0HA 1O3SA 1P5BA 3GVWA 4GBUA 2Q8DA 3TZNA 2ZX3A 3W83A 5FY9A 3AMQA 4P5HA 3BLPX 4XZPA 4CN1A 1XNAA 4RGKA 2PWEA 1KXHA 3KLSA 2J62A 3U6WA 5L6UA 1SW7A 1HW6A 3BV4A 1JYVA 1D3GA 1JDDA 1H6XA 2J6VA 3E2QA 3N7LA 4BIFA 3CTTA 3NL1A 5LW9A 1EB3A 2OZ8A 3M44A 1HJVA 4D1IA 1F5FA 5C6CA 3FBMA 2Q01A 4UF0B 1IF2A 2QJIA 3MUIA 2A5HA 3N7JA 1CWYA 3H53A 3TDFA 1GUVA 4W8BA 2PLV2 4AGVA 2XLGA 4NVTA 2R072 4UOJA 1EZ2A 1LBMA 1H3GA 2OG9A 1J2BA 3SEPA 4PMQA 1RUG1 2YCLB 8A3HA 5DAXA 4NJKA 2I5IA 2PUZA 1AG1O 1QJEA 1DWGM 3ARPA 5FJOA 3UKVA 3VCCA 5FZCA 5DT7A 5JOYA 3SUVA 3NWKA 5JSPA 3GM8A 4FFIA 1B5TA 4FOWA 4GI4A 2B9VA 2EPHA 1OYCA 3E5PA 1XRTA 3RRDA 1I9CB 4K7YA 4L5ZA 1JPKA 3S2LA 1KDKA 2VRKA 3DHFA 3ENRA 1NYWA 5LHEA 3N29A 3LSBA 5CKSA 4PTVA 4QU1A 5I02A 1VBA3 1RUC2 3ZIWA 2ZA3A 1R2SA 1M04A 1H4GA 4DJDA 3O1UA 3EOLA 1MNSA 1MZ6A 5F3GA 5L9VA 4N6FA 2DORA 3BANA 1D2QA 4ISQA 4X0NA 3MPPG 3P60A 4Y7EA 5HANA 3PWGA 4DXXA 5A2AA 4DNYA 4F3JA 3MCMA 2H0BA 1ASJ3 3H7YA 2XSXA 3KCLA 4GINA 1FOBA 2JQXA 2WNVB 2E5BA 3OQEA 3Q65A 4HPGA 1VRH1 1H50A 2PEVA 1CPNA 1TZZA 2WWCA 4JIHA 4JIPA 3Q8BA 1KBKA 4PHZA 3DC8A 2TBVA 4Q26A 4QX5A 3WQCA 2GSEA 3MPBA 4KWSA 3UG3A 4PRWA 5H6HA 2BGPA 3L5LA 4N43A 1PXGA 3LSEA 4NOTA 3GXIA 3A47A 4K7JA 4O14A 3PIJA 2J1AA 1JCJA 2VX5A 2AQOA 4BE3A 2LW8A 1VPXA 3PL0A 1T99A 1KR1A 3BW4A 3SQOA 2C24A 3TYJA 5FBJA 3G3DA 3N9KA 3ONBA 3AXEA 3ZFGC 3EB7A 2CZDA 2GJRA 3MDPA 1ZJBA 3WZ1A 2R82A 2JGQA 4GBDA 1ENSA 4B4HA 3TEWA 4MWAD 1RMU2 3OF1A 4O1DA 1L6YA 5HNRA 1N3PA 1E5NA 3B04A 4AWEA 4H6EA 2D5HA 3VBHA 2I5QA 4WY0B 4Z42C 1ZSXA 1LGNA 4TV6A 1W0OA 1T96A 4YNGA 2GUBA 3H9AA 3BSMA 4PRTA 2WVVB 4ENLA 2XTKA 1D4M3 2PA7A 1PKNA 3MYOA 4LMFA 3ZMNA 1UZYA 4GQGA 4K2SA 1YWKA 3KMHA 2OLAA 4CNTA 2A79A 3IDEA 3ERPA 4CEWB 1KRAC 1UOJA 3N7MA 4WDTA 1SW3A 2P3JA 3W37A 4LY4A 2YFNA 3EXUA 3QLLA 1UZ0A 4R9OA 5FCCA 3FV9A 3B8SA 3VCRA 2JG8C 2WSUA 4ZS3A 3DFOA 2GQ8A 2GSJA 2PDBA 1EJRC 3OPSA 1RVF3 3AMLA 4PE8A 4WV8A 5T9BG 5A3OA 1MW2A 5DRCA 4AHOA 1O4YA 1VPHA 4C0BA 3FLPA 3VDAA 3M5YA 4LHKA 3W02A 4O52A 2WMIA 1DFQA 4P8VA 3KRBA 1IQAA 4E4PA 1X8CA 2QJMA 3KDOA 1KFWA 3K3OA 4PLMA 3IJ8A 5EFDA 2OEKA 4QB2A 5LIKX 1TR9A 3U0HA 1R092 3VBFB 2LRPA 1OFEA 5LA0A 3MMWA 3TCSA 4GH4C 1LORA 2VTXJ 5FL1A 3DYOA 4PR4A 3LLXA 5K7PA 4FXJA 4EIVA 2PDXA 4MOAA 3D0JA 4LK6A 1FNYA 5M1TA 1HB4A 3MI2A 4W6XA 2XIMA 1YE4A 3OUHA 3LA7A 2E67A 2X2YA 3WQVA 2TSYA 1W6NA 1QXJA 1E1FA 1IS5A 2IKHA 3KCYA 3S6TA 2A4AA 5JVVA 3AM2A 3Q8AA 5FSEC 2X41A 3WJWA 1OLMA 2BVDA 1WKYA 3RPMA 3QGAC 4GA9A 3VUPA 1TTJA 1R081 3I7DA 3V7PA 2CC0A 1F4AA 3IGSA 3FA4A 1FDJA 2NVCA 3CC1A 4JTCA 2OPWA 2ZZ5A 5F8PA 4I5RA 4GY7A 3UU0A 3K51A 2FKPA 2V63A 4RX0A 4PTXA 4HVOA 2YC0A 3TNOA 5CG8A 4LVAA 5A2BA 4E27A 3ASIA 1J58A 3AIUA 4DUXA 4WVXA 2FDGA 2BB0A 1KGYA 4X0VA 3O7OA 2ESCA 2V30A 5AC92 1SSDA 3QC3A 5FQ0B 3FE5A 1U30A 5A8MA 1UR9A 4GVIA 3AYTA 2VUCA 1UQZA 5DT5A 3SH5A 4BZYA 1Z3NA 3ICJA 4UYBA 1W03A 3B3DA 1BYCA 5K2ZA 3R0DA 5REQA 1DQUA 3M3QA 3V0BB 3FA5A 4C6PA 5AYZA 3VAVA 2VWTA 3ABZA 3N9QA 5EB8A 2O4MA 2GJXB 4JTEA 4W88A 2HE5A 2W79A 1B09A 1W6QA 4Z07A 3N9RA 1E9YB 2Z1WA 1ZA7A 3MHGA 4OMDA 2AKZA 4XIKA 3P0WA 1EJSC 4O54A 1MI3A 1ONWA 5IK4A 1FCQA 3PZNA 2BW8A 1UP3A 3EAUA 1WZXA 2GWNA 4O8AA 4S3JA 4JIRA 4C7FA 1PK6C 5A6TC 3G1VA 2H8ZA 1AL0G 3OHIA 1D9EA 4IXLA 4L56A 3H3LA 4QHOA 4LYRA 2JJ6A 2Y60A 1YO8A 1NQKA 3FGCB 1Q4WA 3TN3A 3P5BA 2QEZA 3ABSA 3HGRA 3BAYA 4XD3A 3PFRA 3QLQA 4HVQA 3JBG1 3CJIC 3HBLA 3KM5A 5G2WA 2WQ8A 1GOMA 1JUIA 2UY5A 2KX9A 2ISWA 1FPN1 1XINA 3KZSA 3KV9A 3MBFA 1SLLA 3ZFGA 5DMNA 2X5IC 3AVRA 4H55A 2BOEX 1OCJA 2WLPA 3BG9A 4LO7A 1S38A 3MUCA 4OT7A 7CGTA 3VL9A 3IAQA 3IAPA 3S5YA 2WMFA 3VD7A 1RUG3 1IWPA 2QT3A 4DXVA 2PAMA 3MWCA 3W86A 5AYBA 4QITA 3AIBA 3ZYRA 1V00A 3IGHX 4L4LA 4S2DA 3C8NA 1ZUAX 5FRAA 3P8IA 4J3ZA 3W53A 1XLBA 3GSMA 1XUZA 5I3KA 4JYEA 3P7YA 3S5ZA 2UY8A 2Q8LA 2VL4A 3WQ0A 3B8TA 4KWWA 2Z5WA 3TYEA 2XH4A 7XIMA 5EPAA 1UOGA 3VIIA 2Z2SB 3GYEA 2HISA 5I3JA 1NT0A 1W1IE 1XQLA 4H19A 3KRUA 4S3CA 4PBFA 3U48A 1FV2A 1NIUA 4WF7A 4OU1A 3OYWB 2A75A 2EAAA 2JG8A 1IPKA 1OH3A 1NFBA 4YJ5A 3CV7A 3WDTA 1UP2A 5GNZA 2HLEA 1KTNA 1OBNA 2E63A 3RZHA 2RDXA 4H8NA 3U37A 3KV4A 3H2FA 3H55A 4PUEA 4JRLA 5HOSA 3T1LA 4H7LA 3F4VA 1W5NA 4EZHA 3CZGA 4JTTA 3TMLA 5GM0A 1RA5A 3W59A 2VEMA 5FZIA 3QCWA 1P6CA 4UWMA 2DTWA 4B4PA 1GKQA 2HS8A 3WQ4A 2JDPA 4C6IA 4OI1A 4GH4A 4OI2A 1QNQA 5E09A 1VRH3 1W9YA 5MF5A 4YVWC 1ADSA 1CONA 1AZ2A 3VB9A 3WDUA 4EE9A 4YIWA 3IK4A 4JL1A 1X1OA 2RKXA 5KMYA 2IFWA 3WZ0E 1GOGA 3V0AA 4GQ0A 4PDWC 1PAMA 5BWAA 3F2DA 1XB9A 3CL7A 4AVVA 2BEOA 2CERA 5B7YA 1UH2A 5IUQA 2VX4A 4YL2A 1UXZA 2FCUA 3CPRA 3MUY1 1TIMA 3ACFA 5AC7A 4TX9A 3UBPC 1QMLA 1NH6A 3NL3A 1EF3A 3PZQA 3UWEA 3ZDSA 3A6OA 2DFBA 1LG1A 5TF0A 1OX6A 3VZXA 5FKBA 3Q8FA 2RS31 2FVMA 4EXBA 2RDNA 1YIXA 3K8MA 4LXFA 4CU9A 2XG9A 2D0HA 3T6CA 4REQA 3HG2A 1VLIA 1IHIA 3HPAA 2GL5A 3WH9A 4MUPA 2PHTA 5D9PA 2WFF2 2V4VA 4Z08A 1OIFA 4GPNA 1XH2A 4PUKA 2EVXA 4N2YA 5FYHA 5EQUA 1S0DA 1ZM1A 5CGQA 3VBOB 2EGZA 3UZWA 3GNEA 2FIQA 1S2WA 1XNCA 2XVKA 4GHRA 3LV5A 2D2HA 4RV3A 6CGTA 3AZXA 2OWWA 2WZR1 4B3ZA 4KGQA 3OG2A 4PT6A 4ORFA 3WQGA 4IQJA 4GOAA 2B4KA 3AALA 3MMDA 3NOEA 1XYMA 1J0YA 1LWIA 4GC4A 3U4AA 2VMHA 4PUUA 4NJJA 4AFCA 1OFSA 5D4YA 5A6ZA 3T09A 3HIJA 4LO6B 4IWWA 3QTPA 3BCWA 3ZMOA 1SZRA 1RY0A 1G4PA 1UD6A 1GOHA 4HYWA 4AVBA 1PK6A 1V6WA 3NV3A 1J3QA 5KZ6A 4WDUA 3RFAA 1FCBA 4DVOA 3W5NA 5A1LA 3WMSA 1SO6A 2VC9A 3HQPA 3MO4A 3VGFA 4ACZB 2JF6A 3IGUA 5F2IA 2NUWA 5CNAA 2CL2A 3X29B 3CJIA 2WRAA 4XQWA 5GZEA 3AL5A 1ENXA 2MANA 1YTEA 4BH9A 3C2VA 4G4FA 3OZMA 4E0CA 4M3PA 4ZL1A 2FZBA 3AJXA 2X5IA 2D43A 1H8TB 2VRJA 4FAHA 3V36A 5LY1A 2ODOA 3R0RA 1TKKA 4OUEA 2QAFA 2AGTA 4BJHA 3G0UA 1VGAA 3H1YA 2VUNA 1JYIA 4ERGA 3LNMA 4TWTA 3EOOA 4EXQA 2MEV1 4ITCA 4IV3B 4IGHA 3G7DA 4QQLA 3UY7A 4LO8A 3WQ1A 1TTQA 4BLIA 4NIHA 4E2DA 4B4QA 5DBTA 2QZ2A 2G37A 2OX4A 1R083 4A3RA 4GQ7A 2YYTA 2XWJB 4M3CF 3KL0A 3N15A 4Q8QA 4QWNA 5BNNC 3LRMA 4HKPA 4C6JA 1VLNA 3AMKA 3TROA 3NMBA 3VHRA 1WKEA 3HN3A 4AFDA 4BISA 3A13A 4AIOA 2XU2A 1HJFA 2VNRA 3RWNA 5LASA 3TVAA 5C54A 2ZTNA 4UTMA 3GZ3A 1R46A 2D2OA 3K2OA 2VAUA 3CL6A 3RM9A 3ILRA 3KX6A 2F6BA 3VZYA 2DBNA 1VJSA 2UWFA 1Y0EA 2WWSA 2CGOA 1R9XA 2POTA 1O68A 5KINA 1Y3TA 3KVKA 1EHNA 4ATWA 4O1BA 1Y5WA 3AMCA 1BQPA 4QLJA 4MXVA 2Y7DA 3NXFA 1U1JA 3L4YA 3P8JA 1GVQA 1H61A 2CWNA 2F7FA 1ITUA 3D3FA 4S3EA 3SCQA 1EA9C 4YVWA 1PKYA 3LCFA 5BU6A 3M0YA 1UR4A 4AOCA 1T6BX 4IQLA 3ATGA 4C6QA 2ZX6A 3RZMA 4PDWA 2VPVA 3UZXA 5EBAA 3OPZA 5JXHA 5IATA 2QDGA 3BLDA 3HV9A 2Y6HA 4DZ5A 3NDYA 3SIZA 2YV8A 2O8OA 3GNDA 3T1GA 3JBG3 4EOUA 1G9CA 5IDZA 1RUF1 2Z42A 4XUNA 3WD1A 4Y4RA 1GJPA 1K5MB 1T8XA 3G1HA 2ZZ4A 1FPN3 3STGA 2JF7A 3EPNA 2YFUA 4O0ZA 4Y8FA 1ENQA 4XVEA 1X1ZA 2QCSB 1SMDA 4JL2A 1FOD1 3L67A 2J1EA 1OA4A 5AOUA 2G97A 1V9U2 1RUE1 1XRSA 1KB3A 5HPCA 2WK2A 2C26A 1KWGA 3O1NA 4LCRA 4EK7A 3S4TA 5IM51 2NWRA 3S9YA 4XUPA 1ULGA 4NQ1A 1XI3A 5A8QA 2VUYA 5FP9A 4OFGA 1CEOA 1HFBA 1S0CA 1A5AA 2NSOA 1SLIA 4RQPB 5D9OA 1IT7A 5LIYX 4GLEA 3H42B 3CWNA 4FOUA 3EWYA 1D4VB 3W25A 5F2MA 1QOQA 3APYA 3AIEA 3NJZA 3BI3A 2OVLA 3KVBA 2CDPA 2RS52 3EX1A 4QROA 4CCLA 4QB6A 3TYZA 4V15A 1EP3A 1PVC1 3HGSA 4OUMA 2W68A 1B3OA 4P7LA 4AHXA 3H3ZA 4UW3A 3IT8A 1BHGA 4H9TA 3NSMA 1EH9A 2GYIA 4ADSA 3H6OA 4KNCA 1KRCC 2O14A 4NUWA 2XM1A 3I6RA 1FV3A 3IJ7A 4K8RB 5ACA1 5I3IA 4DO5A 1V77A 2ZX5A 5JPMB 2P17A 3Q4DA 1H2KA 1O7AA 1H6YA 2DU0A 4DMIA 1RR2A 1WBFA 1G01A 4UQAA 4K21A 5FEWA 4XQ6A 3ZSSA 4Q4X1 3ZVIA 1UWWA 2XFRA 2DCYA 2C0HA 2YA1A 4DJEA 1MEC1 2D0GA 5A6AA 2WYFA 3AHYA 2VC7A 1UU4A 2W92A 4AI2A 1QPOA 1CIYA 2DZTA 4AF0A 5HMSA 3TFCA 1IG3A 4ZFMA 5C2CA 3LQLA 2MPFA 4NIAA 3F4DA 3UWUA 3ZLIA 2VZOA 1WX0A 3HT2A 1M7OA 3M7WA 3CZKA 2P6HA 2OB3A 3PBWA 1H2JA 4AG4A 1OEPA 3GKAA 3FJLA 4G1KA 3D8CA 1AXZA 2OWXA 3TU9A 2RUSA 2Q1FA 3O1VA 1VBC1 1NOFA 2LTNA 3TJXA 4YZ3A 1DVJA 4OVEA 4D94A 3H8AA 4QQHA 1Q6EA 5FZMA 2XQXA 3WJXA 4RZ4A 3W7PA 2P1BA 3RQ0A 4CN4A 3DFTA 1ZAHA 4LULA 5FZ4A 1Z89A 5I6SA 5BNNA 2Y8UA 5CAZA 5KWRA 3TTSA 1UZWA 3SCHA 5ABHA 3LCLA 3NYZA 2E5CA 4HCLA 2BBAA 4BA6A 1TREA 1VFOA 4XZLX 3H7JA 2Y70A 3UWVA 3BPSA 2PDNA 3QM3A 1UP0A 3D0SA 5B7ZA 3EPOA 3FDKA 4BXFA 1IWBA 5DFAA 4HT3A 3VBRB 4XDOA 2YPDA 3FJSA 5AYYA 2EBNA 4V2VA 4AFMA 3IV3A 4EPKA 3W9AA 4GUFA 1QWKA 4NJIA 2VXRA 4Y96A 3R10A 3C2OA 1BSLA 2YDAA 2WZR3 3T2OA 1H1ZA 4GIEA 1Y7VA 3LIHA 4CD6A 2WN2A 4W4ZA 3KBVA 4L9XA 1YIFA 4Q0SA 1Z7AA 2FHCA 4H83A 2A73B 2J66A 2PLMA 1NKGA 1IEQA 3MU7A 2EIDA 4J9JA 4V1YA 1DZRA 4GIRA 1DYOA 3BB6A 2OEJA 4RYDA 1R87A 3VGEA 1OX4B 4HMNA 1RXFA 3HJZA 3TC3A 4XSLA 4CDQB 1FWGC 3KVLA 4HXCA 5FMBA 1A5SA 5F5AA 4DNMA 5A3WA 1RUJ2 1NOWA 1W9BM 3N6JA 4XBLA 5J5DA 1NF0A 1B54A 1LRHA 3CKHA 2Q8CA 3B06A 1VCVA 1XCWA 4UNLA 2ZX0A 1UZHA 4R52A 3HAGA 1TPB1 1LT8A 1O59A 4IEUA 1EKOA 1YYNA 2HV5A 3H4XA 2WNEA 2YPJA 1Z6KA 3AFBA 3MF6A 1PM4A 1QWGA 1H9WA 3VIMA 3M3IA 2XUCA 4XD6A 2ZAAA 4QSHA 3MFCA 2Y6ZA 1AUYA 3DEQA 3S6PA 4RFRB 1FWCC 2BXZA 4YU1A 1O8PA 4DO4A 3VOFA 1MS4A 3WFZA 2MEV3 3UG5A 2D6LX 1GOQA 5GJPA 1PGSA 2WMHA 1B1YA 1I3HA 3N18A 5EMJA 2ASHA 3B9AA 2QQJA 3VUSA 3M6YA 4E8GA 2XPJA 1HJSA 1EOMA 3V1HA 1DYPA 4DEVA 1M7XA 4RDZA 1JZ8A 1DGLA 5HMFA 1O6IA 5FL0A 3G1YA 3DL3A 3I2HA 3DBNA 5F2SA 2GC1A 3ES1A 3V0UA 2Z7GA 1NM9A 1TWWA 2HJPA 3LDRA 4LBSA 1IKQA 3LX9A 3OZOA 3N4FA 4YWSA 3KF5A 4AMCA 1EIXA 2Z24A 3DHDA 1M4WA 7REQB 3TYCA 1W6QB 4LRTA 5APAA 2Y5JA 1X38A 1SQ4A 5KXCA 3MSRA 5I78A 5IJRA 3O1MA 1S3HA 3EX3A 4QNWA 1ND3C 4B7KA 4V28A 1PIV1 1UN1A 5A3HA 5T91A 3TR2A 3ZFFC 2X10A 2ARXA 1V0NA 4GB32 2AAMA 2VYOA 1M06G 1WW7A 1AH4A 2UWCA 3ZKUA 3M0IA 5AYIA 2WHJA 4ARYA 3A3XA 4KCVA 2JDZA 2VZPA 4AI0A 3SADA 3B02A 3E6DA 1UKOA 5LNRA 1VCGA 1Y5VA 3PJQA 3UJ2A 2WJFA 1MW1A 2E1WA 4D6GA 4N9DA 1SCSA 3ZFGB 3M5VA 2EF9A 3OU8A 1TV2A 1CVNA 3VIJA 4QQOA 2ZX2A 3SCSA 3ME2A 2OQHA 3EOUA 3MPGA 4JZ5A 1FFRA 5FBZA 5K4XA 1SGJA 1AQFA 2PSNA 1ISZA 4LUTA 2J9XA 5CZ0A 4CD7A 4CXYA 1SPQA 2ZUSA 4HNCA 4JTHA 4HP5A 3PJTA 3ZQ9A 5LNVA 5FUNA 3CGTA 2XGBA 5JZGC 1RUF3 1G4SA 1I2OA 3HNBM 3CPUA 4YGEA 1PKLA 2PHFA 4OBTA 4FR1A 3CAWA 2PAJA 3VMOA 3CL8A 2VZ1A 4XF3A 4MSSA 4ICNA 3UERA 4IMGA 5HBAA 1FOD3 1VRXA 2D93A 1WKDA 2V6AA 5JQ9A 2WAOA 2VBDA 3W5MA 4RNJA 5G4EA 1RUE3 2HWC1 4YGCA 2VU9A 3ZLFA 4XFAA 2NQLA 3UK9A 1KCLA 2O9TA 4GKLA 1YJKA 4ZODA 1TCDA 3POSA 2BGNE 2J7GA 3BGJA 3AZZA 5FZOA 2EICA 2XL7A 4XCAA 4ZXKA 4L9ZA 2JG8B 3NL6A 3CMFA 4O13A 4CQAA 1EXBA 4QPWA 2B7YA 1W3LA 4KBBA 1ZBE2 5L19A 3MKKA 4WVZA 2JKEA 1J84A 2VFFA 5TNVA 3E6EA 3NQDA 5J37A 4AYSA 1GVIA 5IOBA 3CDZB 1UY0A 3VE7A 4ZO8A 4Q4Y2 1QBBA 3RUBL 1PVC3 3UJOA 3LS9A 3U4SA 4IUGA 2X1UA 1CDGA 3VM7A 3UT0A 2Z00A 4FQZA 1WCQA 3CHEA 3G77A 3AS0A 2J47A 3SFWA 3WP3A 5FZDA 4GH4B 5FJPA 3W2LA 3B9NA 4WM7A 2GK1A 3W70A 1BXCA 5ACA3 3ZVHA 3THUA 4XKYA 3ZSTA 3SECA 1RJRA 3AICA 3WQ8A 2VW2A 4ADTA 2RDSA 4DO0A 3GXMA 1DOSA 4NIRA 1A3WA 4Y22A 1W3HA 3AZTA 2HDJA 3UWYA 3OCPA 1ISXA 5JXGA 1SO4A 3BC9A 3TOJA 3T0CA 1C28A 4Q4X3 3W29A 2GMEA 1W3VA 5HR6A 1XDLA 1LJ7A 1DIKA 1YNQA 1K1DA 3TZFA 1MEC3 3ROUA 4JTQA 4YZ4A 3QQWA 1OURA 2E68A 1WD3A 3C56A 2C0AA 3ORWA 3U8GA 1R0MA 4FOKA 3JRKA 4YSFA 3BODA 3LDKA 1BBT2 2PDFA 1UMZA 5JR7B 3FIGA 4JY8A 1PDYA 3LHWA 1FT9A 2B42B 3R4SA 3POHA 1QHZA 2Q8EA 3VKLA 3L7RA 1KC7A 1ZB5A 1XIHA 3B8WA 2ZA1A 5CXPA 3VD4A 2A85A 4ONVA 3M0MA 1VP5A 3LB0A 2GP3A 3IACA 3MJMA 2ZZ1A 2A1YA 5FAGA 3STEA 3VOGA 3FX4A 3Q58A 4U2ZA 2PWDA 1AXKA 3PUOA 4S3BA 3AWOA 2VFDA 2B81A 1XRFA 3POGA 3DCPA 1DLLA 5JSOA 4J3WA 3NNGA 4O16A 4LAKA 2WNUC 4IM4A 1B3YA 3UR7A 4NHYA 5A6SA 3N2BA 3POWA 1XSJA 3GYCA 1EHAA 4PEKA 4PUWA 2VEPA 4ZQPA 1V6JA 4AHWA 2WZEA 3S1GA 2Z6IA 1ND3A 4GZIA 2R32A 4AEJA 4DF2A 2ZZ2A 3KP1A 2PP1A 4QE5A 1CB2A 3WP6A 3ZFFA 4NZ3A 1PZ7A 4HZMA 3TMQA 3EEGA 5F3EA 1UKTA 4FI4A 3SBFA 5FYVA 4B1MA 3P5YA 2WFPA 4QS6A 1RYYA 1C4RA 5DAWA 1W3JA 5FDBA 3HBKA 3VNMA 2NQYA 4UAPA 4AHYA 4AQTA 4HVXA 3RK8A 3BTXA 1BEV2 4E2BA 1BYHA 2HEJA 3TN91 1V03A 4L1XA 4A7YA 4DUOA 1LOAA 4PQQA 1NOVA 3MZHA 1GP4A 3RPTA 4MKNA 2A1XA 3QSRA 2A6ZA 5TBOA 4QX7A 2V0TA 1I4NA 1UU5A 1AR82 2VEKA 3OVRA 3N3HA 4A3UA 2GQ9A 3C0QA 3GBDA 1DJGA 5G04L 1VMHA 3USUB 5JMCA 1V6YA 3VGGA 5CZSA 4CEUC 2XG3A 5TQLA 2VD9A 3FAXA 4QKNA 3THPA 1GJWA 5I8YA 1X97A 1H0GA 4L0PA 1COV1 4EF8A 2VXNA 2A3XA 2OVUA 1OK6A 4PMZA 1U5XA 1H4HA 3NNMA 2P88A 4L9YA 4A8LA 5FZ1A 3ZM8A 1RBLA 2OJPA 1ZTVA 3MJYA 4HSHA 4FPLA 1BKSA 3NDOA 4EV0A 3N9NA 3GO2A 3J7MA 4JGYC 2B0MA 4QJ4B 3VOJA 3NURA 1OFPA 3L4XA 4W7UA 1WDWA 5BROA 3TW6A 2INEA 1QGLA 3M2MA 2RMU2 1KXQA 3KCCA 2CLLA 1V6IA 1EZWA 1XHGA 2YPIA 3AYSA 4GKTA 4QE1A 1ELSA 2GPTA 5FZHA 1OFRA 4NWWA 2K9ZA 3L4ZA 4K7VA 4W4QA 1F05A 1ZBA2 4LRSA 2PODA 4C6CA 4I01A 4P9WA 3QHMA 3KT1A 1HP4A 4QXBA 3LKJA 4K9SA 3ZJKA 3DFPA 2C1HA 1S5VA 3IGXA 3R94A 4OHVA 1F3WA 5DAPA 1UWRA 3WL1A 1SEFA 4O0KA 6XIAA 4NG3A 1X9TA 5DPNA 3T08A 2W3ZA 1XLGA 3T0BA 3WH7A 4ZXOA 2XH0A 2CWXA 4M6VA 4YHEA 3KOWA 1O1ZA 5JXQA 1PIV3 4F0MA 1J1TA 1MDRA 4A41A 3K13A 4IT1A 4Z1BA 2Y24A 2W1SA 1YEYA 4FF5A 2REQB 2GOKA 4D71A 3KQRA 3U1XA 1AQ0A 5K7JA 1I0BA 4ET7A 2JGYA 4QIUA 4XJ9A 2KZHA 5A6XA 1PO11 3WNLA 1AJZA 5BMWA 3YPIA 3SGZA 2F4PA 5FPZA 4CP1A 3HB9A 3KVMA 4IEVA 1KFEA 1UKPA 3LI0A 1SU5A 1RSCA 2OQYA 4I3PA 2BVYA 3PB2A 4TMCA 1VYPX 1MW3A 4GXMA 4BK5A 3G6LA 2V38A 3FVMA 2PCQA 1GWKA 2RS11 1BQGA 1RAKA 4RPQA 3D47A 1XPYA 3N9MA 3LUTA 1IS3A 5EMYA 4I5UA 3NQHA 4UQDA 1B3WA 1H8VA 1UKRA 4AI9A 5EIYB 1RD5A 5C7HA 2F4LA 4A3HA 3PTDA 3OG3A 4MZ1A 3EDFA 3NJVA 5IAVA 2C1GA 4W5UA 2HWC3 2OSXA 4N9IA 5CSSA 3RN6A 2AACA 1HRI2 3WT3A 4HNNA 5LBFA 2GZWA 3RSJA 4CPBD 2G3NA 1D0GA 4JX6A 1GYKA 4ES8A 4TTGA 4AU0A 1OVPA 2QQLA 2VT0A 4Z17A 4AZBA 5T5LA 3AYDA 3C2RA 1VBD1 4R88A 2WWDA 3HMJG 4JQ1A 2JDAA 1H41A 3S5AA 1PV8A 4Q8VA 3LTPA 3N73A 4NPRA 1VPQA 4ZA0A 4Y3OA 5B4NA 3NVTA 1YPIA 1M65A 1ZPTA 2ACQA 2DCTA 2WCGA 4Q1RA 2DCZA 4O8RA 4Q4MA 2SBAA 1J5SA 3MW7A 4XOGA 3P67A 2Z7KA 3H4GA 4UR8A 4R85A 4D6JA 4FFHA 2OA2A 1UY3A 3P3BA 4DX3A 2J1TA 2ZYFA 2YU2A 3UW6A 3OJGA 3S1WA 5JOXA 1N1SA 3FSUA 2CBIA 4U5IA 3ABQA 3FDGA 5F37A 4OULA 4MNJA 1IOAA 4SLIA 1JULA 4GMP1 4D1JA 3EDDA 2QJVA 2PP3A 2E9QA 1N2VA 2ZTJA 4QPYA 4UFIA 5I8TA 3H7UA 1XBZA 3H50A 3TJLA 5LCWL 2QLYA 4PA8A 5A6BD 2J7CA 5CEWA 4UZUA 5FF2A 5DXXA 3GVRA 2YDRA 1KWKA 3RHGA 1CIWA 2L5HA 2WZHA 1REQA 3RR4A 1P7TA 1AJOA 2CGPA 4HA4A 1DKWA 3EMQA 3VINA 4B2DA 5HR7A 3ITVA 3WLUA 3WXPA 3IB3A 5KHIA 3R8HA 3SISA 2BTMA 3WX7A 2Y8VA 4XBSA 4NIDA 3U3HA 4WGXA 2ZGPA 3F2BA 4JGYA 3TNQA 4B15A 2GNMA 4YN5A 3WDHA 3TNPB 5HV0A 1LOLA 2G1MA 3LD8A 2WMJA 1V3IA 3KS5A 5CBIA 1DBTA 2NT0A 4AQLA 4K1YA 4QU2A 3AXMA 3N9SA 3V18A 2QQMA 1KCZA 2PFHA 3CM4A 1EJXC 1IZJA 3UQNA 1XW8A 5IVJA 1WMXA 5DY2A 1DIEA 5LIWX 1IZKA 3NA8A 2NSXA 1STMA 2VNCA 3GNNA 1QNPA 1J96A 1S5WA 3PJYA 1QQP1 3PG9A 5D32A 2C15A 3NNLA 1O66A 1K02A 1W9UA 1S2BA 1KGWA 5E8AA 4TR9A 5IHRA 3L2IA 1QI4A 1NP2A 3PTKA 1XBXA 2ABAA 8XIAA 3QR0A 5A7PA 1OFAA 3TTYA 1L7RA 5L9RA 2OOFA 4Y1ZA 3DG3A 2BFUS 1KFKA 4YG6A 3AYVA 4ZENA 2ZXBA 1VHCA 1PM7A 1W9VA 1I1WA 3L9CA 1PO22 2C1FA 2MNRA 1PMHX 1TWZA 2FLIA 4W7VA 4DQWA 3VKMA 3TN93 4AI3A 1WA6X 1C7TA 1NLRA 3LN3A 5FJHA 3W23A 3E38A 2BS9A 5C8BB 4AY8A 2EEXA 4CDXC 4ZQNA 4LE4A 1MUMA 1XLJA 1TPH1 3EGJA 4WEVX 1GZWA 4F7ZA 3NQAA 3B69A 3C3VA 3NKGA 2WO3A 4QD2A 3L23A 3S2MA 1XSKA 1UPMB 5JOWA 5AECA 1Y65A 2ZMLA 4HNLA 4EN9B 3J7NA 1XJAA 1IZCA 2PZNA 1COV3 1G7VA 1UKQA 4AHPA 5EZWA 2F6XA 5CA6A 4QXCA 1W1VA 2X8RA 5G1TA 2ALDA 3G1RA 1K8ZA 1UW8A 2P34A 4IEPA 3A9IA 2EJAA 4MADA 1ULPA 4G9SB 1FKXA 3A9BA 4OI4A 4LX4A 4BWOA 2P3KA 1S0BA 2JG9B 1VAMA 4QCEA 1RQEA 3BH4A 3L0NA 4QT6A 1R3YA 1BXNA 3NV2A 1IG0A 1BYDA 3GUGA 3IUIA 2HROA 2Q71A 1P48A 3PU8A 2G50A 4F3HA 4B5VA 4CSWA 2DIEA 3B9DA 1M01A 2A0NA 4KG0A 2TNFA 4MLOA 2VQUA 3IANA 2PLV1 4OQVA 4IJCA 5JH1A 3WELA 3CUIA 1O5XA 4GK8A 3L2LA 1MQPA 1O4TA 4YVSC 2UZ9A 1A3XA 4NRSA 3GBWA 2V4AA 2Z26A 5FF4A 3MFAA 4BMBA 1ME8A 1JN2P 1PGW1 2Y7FA 1J10A 1KW1A 5IT6A 3RNDA 3JB8A 5HA7A 4YPJA 1OM0A 1I2NA 3VMNA 5FI8A 4N42A 2ILMA 1EWEA 3II1A 4KGGA 2YC2A 3KOFA 1PBGA 3TSBA 1AZDA 1DP0A 1IIGA 3LE0A 2V2CA 4QXIA 1QJU2 4C6LA 4JZRA 3VKFC 1E6SM 3G24A 1UMHA 2CETA 3PNZA 1PO13 2QCCA 1YQCA 4XTIA 3WD3A 2QQIA 1EGZA 2CXEA 3EKGA 4I9JA 1Z7S1 5KHKA 1RUNA 4XD4A 1E4MM 1PE1A 1RC6A 2XN1A 4GAZA 1MWOA 3AHTA 4EE2A 4GWEA 1F07A 3TTOA 1JYCA 2PPGA 3ITQA 2RS13 2VE1A 2HTMA 1TV5A 4UC5A 1VCFA 4DAIA 4BCUA 1ACCA 3GBFA 4O0QA 1M5WA 4UNKA 1F4HA 1H51A 4GVHA 1KCXA 3WUCA 2YL5A 1W8SA 5JIUA 3LRLA 2ERFA 3AC0A 3K48A 4JFTA 1H2LA 5CFDA 2EIGA 3GFXA 3UJFA 3ZLGA 3U9IA 3WINE 4S23A 3O0FA 5LHFA 2YXSA 3ZSJA 1OQFA 4KPLA 4Y6GA 2HBVA 3PBYA 1A0CA 4UOQA 2W39A 1J59A 3URAA 4ZCWA 4GXPA 1W6MB 3VZOA 1VBD3 5C3OA 3M6DA 2GJNA 1C7SA 3VGHA 2D1ZA 2WQDA 1F2NA 3GLCA 4BLJA 3URBA 4XKYB 4AQ6A 4CRQA 4PN2A 1Z8AA 1U83A 4FPGA 4Y22B 2RHPA 4B9YA 4PSPA 3NVDA 4ZQOA 4O17A 2FMYA 2NUYA 1VPYA 4YHGA 3ZWSA 2RG4A 3CHDA 1OOPA 3I3DA 3MIDA 1K77A 2CXGA 2JDYA 2TUNA 5AYXA 4U3CA 3TOYA 4I8DA 3LA4A 4M1RA 4F0RA 3T07A 3OEXA 2ZRWA 2PDKA 1QUMA 2E9MA 3MYXA 3MLJA 3WDIA 1NCRB 2QQKA 1KFLA 5K4ZA 1Q45A 4W89A 3RPDA 4GMP3 3R25A 3UF9A 1VB4A 4NAEB 1BG9A 4RN5A 4Z2AA 1EC9A 2JWPA 4LHSA 4CDXA 3WQ7A 3GU9A 3HPSA 3SW6A 2P37A 3T44A 1HXS2 4C1WA 2P3YA 3Q8CA 3FJ4A 1IR2A 4ZR8A 2JE9A 2WUHA 1ONRA 1OX5A 1NY1A 1WCKA 1NAL1 3W21A 2DVAA 4JICA 1WBLA 3DYMA 4D8AA 1IKPA 4E8CA 1H49A 2XVPA 1SSGA 4PLOA 1ENRA 4XDQA 5GLZA 4HOXA 3GFYA 3FLUA 2ZUNA 2RR12 1XYLA 3EDJA 1EDQA 4KT2A 1GGOA 5LIUX 1I2RA 4NR1A 1BKHA 3JCIA 1V6UA 4PF1A 1EAH2 1WYIA 1MQTB 1HP5A 3DFHA 1ND3B 3FL7A 1LZOA 1EV12 1WMFA 1GTEA 4MUZA 3W0KA 3W28A 1XRVA 3PAJA 1WE5A 5IVYA 4ICCX 4QXKA 3WQBA 4CEXC 4GIQA 2RH9A 1BRLA 1POQA 2AL1A 1XDMA 1OK4A 4NILA 3VK5A 1JI2A 3WUFA 2HPMA 4QSFA 1L2QA 1LQ0A 4YVSA 4ZVJA 3P93A 5A7QA 1SZEA 1YKWA 2DUAA 1FATA 2NV2A 4Q4KA 3VKJA 3F4WA 4N9BA 1X50A 1QQP3 4XMAA 3ID7A 3NIYA 3VGDA 4NUBA 4PULA 5DUWA 1QRQA 4UMBA 1DPMA 1X8FA 1AD4A 3B0PA 4L65A 1UJQA 3HNMA 2ZGQA 3FYYA 3SRHA 3RWKX 3KCJA 5FO8B 2A7NA 4X9SA 1P8JA 3O0WA 4G8TA 2FCVA 3DOPA 1MXDA 2V5CA 5CIRA 1OABA 2BXVA 4BQ2A 3CYVA 1R3QA 4J6GA 4XFBA 5F3IA 3V56A 1FHLA 5LBEA 3S30A 5JZGB 1QVBA 2WQPA 2HWE2 5A1AA 2QNEA 4CP9A 1XLMA 5FEPA 4MSVA 3N4MA 3OD4A 2ZX9A 3ZYJB 4D6CA 2YHJA 3PR2A 2AC1A 3MYPA 5J96B 1UR3M 3C2UA 3FLTA 3QYSA 2XVLA 1CGWA 1FMD1 3VDCA 4MJ4A 4C6EA 1AA1B 1E71M 2Z1XA 1YBQB 3AIWA 4IPPA 4A3YA 3LQGA 2GNBA 1TZ9A 4FAGA 3LOTA 5ABTA 4PYSA 4XFIA 4YVVA 3N2CA 3EA2A 4TU1A 1AVAA 3J9SA 1DQ1A 1GCYA 3PBUA 3WQ5A 1XLKA 4QX3A 1PGL2 4EWAA 5I93A 2XOMA 2DFAA 2DQWA 4EQVA 3PURA 3C3NA 4Q0UA 5BNQA 2DSUA 3BMVA 4J1OA 1K9EA 4AI8A 4AWSA 4UOZA 1R64A 1CGYA 3BAWA 4LS0A 1S55A 3K4ZA 1DWFM 4IDZA 3LCGA 4PGLA 1Q5OA 3WOGA 1WCDJ 4QEHA 1AH0A 1R38A 2QMKA 5KBFA 1X82A 4Y1UA 1C57A 5T3NA 2D22A 2X7WA 4JTUA 5JIPA 1GKRA 2XH6A 3JD73 4Q29A 3AZSA 5BU9A 7PTDA 4MZ8A 2R1NA 4LK7A 3M7SA 4FMVA 4XZUG 1JH5A 3R5EA 3AVSA 1RHCA 3PIGA 3BUCA 4Y2WA 4HN0A 1W8NA 3K4DA 1G7UA 5KZDA 3GZUC 1XQNA 3H2MA 4XJAA 3W82A 1EYWA 4IEWA 1W56A 2J1RA 5EFUA 3OIHA 2VDHA 3LLDA 4D69A 3BPZA 4KEVA 1YXDA 1KGXA 1NF7A 3V5OA 3UNPA 3E12A 1KDMA 3MIFA 4IEYA 4UMCA 4XUQA 4QR6A 2YXGA 1V8EA 3VM5A 3SLIA 3BTZA 3BWWA 3EA3A 3A7QA 2WSQA 3URFA 1WWYA 3GVVA 2H9AA 1AJ0A 5MHBA 5FF3A 1PZ8A 1W31A 3R6SA 4XFHA 1TJPA 4LEFA 2CCRA 1HX6A 2ZUMA 2G41A 1QXRA 4MPKA 4F40A 3AKQA 2ZHLA 3R79A 1TEIA 1TV8A 3VDHA 4RHV1 1Z7S3 3L0GA 1EP2A 4GVGA 4LW7A 1N3QA 4C6KA 3W2KA 5I03A 5CBBA 2WC2A 3HU7A 3PPHA 2YA2A 1RUH2 1W3XA 2Q5TA 3GC5A 1OC6A 1QNRA 3TH6A 1GYNA 2WNUB 3KW3A 1CCWB 1U1HA 4PBGA 3OBEA 4XBKA 4LA3A 3USBA 2DVFA 1GW9A 4XF0A 3WDXA 3TP4A 2ZUWA 3EO6A 2QDRA 2VOTA 3TC6A 1OC5A 4Y20A 3WSUA 1YHTA 1LB2A 1P6WA 4AG0A 1KRBC 2YY1A 3M0LA 5FYCA 3ZS4A 4XFGA 3C3UA 1JF6A 1WMDA 2O92A 4GYJA 3GU1A 3QEZA 3A4XA 4Q6XA 3QF0A 4GNKB 3B8DA 1T2XA 4M80A 4LB4A 3S2CA 1HG3A 1UG6A 4CD8A 4NHXA 2JICA 2ISVA 2W61A 3WQWA 1CGXA 4O18A 3KV5A 4O28A 3TUUA 1PTDA 5FO9B 1E1CA 1BQCA 6REQA 4ZFCA 5HNTA 2W46A 4PTNA 3UG4A 1VZWA 4FTBA 3RG6A 2QAPA 4CQDA 4HK5A 1FH9A 2W9XA 3JZEA 4Q7IA 5EYYA 3L2MA 1FCUA 1V0KA 3NAVA 2WFF1 5CPMA 4RR4A 4I3GA 3N1AA 4LT5A 3AKSA 4JOMA 3GTNA 4KF1A 2PI6A 1TVLA 4LUSA 3D4KA 3A3WA 1IR1A 1N8WA 2J6XA 3GH4A 5A7OA 4AEDC 2J7FA 3BN6A 1NEYA 4YW5A 2VTFA 1ZBCA 4JFSA 5JR2A 5H9SA 3QZEA 1VHNA 3VNZA 4OBSA 1AR71 3E6BA 4HVRA 5AHFA 2XQRA 3VNIA 3EHKA 4AZGA 1L0PA 4A3ZA 1TQJA 3IMNA 1OZMA 1RCXB 4P08A 4JCKA 4UXDA 3F5KA 2EF6A 2D6MA 1PIFA 5KZMA 5BW6A 3PJUA 4HN4A 4HSNA 1H7PA 3T55A 2XJTA 1IXNA 1AJKA 3REQA 2I1OA 5DXDA 2J1SA 1ZL1A 1I5PA 4FPEA 4AQSA 1TZ7A 5I09A 3VUOA 4IZGA 1RJQA 2A3HA 4HCDA 4C6FA 4UZSA 5LRSA 4AVCA 4X22A 1XS2A 3GXDA 2QGHA 4ATEA 2DV9A 4OHZA 1EPVA 1W6PA 4PCSA 3HIFA 3L12A 3NV4A 4JIIX 4EPEC 2ZAHA 1R7OA 3MANA 2CLEA 1DJQA 2JBMA 2PBGA 5HINA 3OLGA 3KZ4C 1GHRA 3GXUA 2CKRA 5HJXA 1JCMP 5CCZA 2J7MA 3G1XA 1J1LA 4K6BA 1AR91 2DZAA 1QWRA 1W1PA 3SH4A 2PFWA 1KM6A 2J7DA 3U5UA 2PE4A 1GNYA 1HLCA 3PB0A 3BW2A 3XISA 4CUGA 4IV1B 4HMEA 4QXHA 3BXWA 2GGIA 1N1YA 3DKQA 1DZQA 3U7VA 5ABGA 3UGHA 2UY3A 1QJX1 2BFUL 2VRQA 1EUUA 4IIFA 4NRRA 1LCOA 4WKHA 1BMV2 3HTWA 4J3TA 4FIRA 1GZWB 1V3HA 2PDMA 4LHNA 1QO2A 5C9WA 2EKGA 2HEYF 4FVVA 3KOXA 1DYKA 2HZGA 1UIJA 4CCDA 2FHFA 4QX4A 2RDRA 3HQNA 1SMVA 5FZ9A 1XE0A 1FYUA 1FBAA 2XKOA 3NGJA 4EN7B 1CXEA 4AAPA 1FMD3 1LRNA 3RLHA 1ZENA 3PBMA 1QDOA 3UETA 1TJ0A 1XYFA 1E51A 1SZGA 4OHQA 2HYKA 2OZ6A 4HZ6A 1JPDX 3R43A 1OVDA 5D8ZA 5L9FA 2JKBA 1TJRA 3OJBA 4XAPA 4XFFA 2JDHA 4XDPA 4QDSA 3ZOIA 2VR2A 5AKQA 2WHLA 2XUMA 1GUIA 3L21A 4XVDA 5A6KA 1V3MA 4GCXA 2WN3A 4U2AA 3M1ZA 3SCPA 1Y8BA 4KEZA 2J9ZA 1PCWA 2YW4A 4J3SA 5I06A 3RZLA 1YTDA 5U4NA 1LR5A 3WLHA 1I2PA 1HUVA 3NUKA 3WBEA 3MA8A 1JXNA 2W6RA 4B5NA 2XBO2 1JQXA 4NIIA 4MB3A 3V0SA 4KG8A 3A12A 3W7HA 2YXXA 4M56A 4Q4W2 4K8HA 3AO0A 3CQKA 4JDNA 1W3IA 2WPBA 5T9CE 4EAMA 4LE3A 3GFZA 4DY1A 4AY7A 3H2NA 3QFEA 2R14A 2J1VA 3H1MA 2RJKA 1JZ3A 3NNFA 5BYNA 1O3RA 1XBVA 3WQPA 3VIOA 2TPSA 1HKVA 5LBCA 1MR5A 4FXKB 4FCAA 5DDJ2 2YA0A 2P53A 3OTFA 4LV4A 4MG4A 2XJPA 1RUD1 1PHMA 3O6AA 1EGVA 4DJDD 3LZ5A 3SUUA 3BK0A 4RZBA 3T1MA 3P3NA 4H9XA 4GNVA 1SBEA 4QKDA 1A3KA 5IYYA 4HKLA 3POIA 2LLEA 3H2CA 1E73M 3IPVA 2MUCA 1XGZA 4QHZA 2FD8A 4CEYC 3BLEA 3CBWA 4L1WA 5TAOA 2OUJA 2C14A 4AEDA 3F2ZA 3KL3A 1AL22 1XE7A 3OLEA 1E0UA 1UHVA 4OQ8A 1YRRA 4LTAA 4KWJA 4LBMA 6TAAA 2A6NA 2GSHA 3MI3A 3UL2A 4Z2GA 2G9ZA 3ES7A 3CMJA 3LEMA 3I10A 4JHMA 4QTGA 2P10A 1H0BA 2PDQA 1OHLA 3BMXA 4A8IA 4NSBA 3PUHA 2OGJA 1UYQA 1JODA 2EAKA 4RHV3 1LRQA 3EWWA 4JCLA 3WBYA 1VFUA 2XHNA 1JNEA 1ZP3A 1J93A 1UWSA 1H0IA 5L36A 5A5WA 3GNXA 2EO7A 1XE8A 1JD9A 1B3ZA 3GHMA 4S38A 1QR7A 5A3NA 3W7JA 1PX4A 2XH7A 2BP1A 4F8AA 1U33A 2O0OA 3FS2A 3RZKA 3FKKA 3PFMA 1HF6A 5KHJA 1QOTA 2PGWA 1FWDC 5KITA 3UPMA 3UZZA 3H2EA 1IEXA 3MP5A 4IL0A 4OGZA 1UUMA 3B9CA 1KM1A 3ZR4A 2XFYA 3OGGA 1D7PM 4IE6A 3WIJA 3AJ7A 1WKFA 3W6LA 2IVJA 3AP5A 1EJ7L 1ITCA 1Q6OA 2PBOA 4JDOA 1B9ZA 3E0WA 5F4XA 2NQ9A 3ECQA 2NWSA 1FXPA 3GIQA 3GR4A 3O6CA 2I9EA 3FEQA 5FJJA 4Q1PA 4AVTA 1XIGA 2J24A 4DINB 2NX9A 1QHOA 5K9YA 3F95A 5BXPA 3N13A 3AOFA 5D8WA 1BWKA 2E7FA 2FPYA 3DKJA 3USZA 1UR0A 5E93A 3DGRA 3VO0A 3GIPA 4ZTXA 3BOWA 2R6QA 2ARCA 1DYSA 1N7KA 2VEIA 3IEBA 4GGHA 2ZJCA 2OKXA 3ALFA 4CCMA 4QGMA 3SCGA 4LAMA 3FY1A 1NE4A 1JU4A 3QOKA 5JDBA 2AENA 3W7MA 5A33B 2R1MA 1EEXA 1VBA2 1V4YA 3FFSA 4L99A 2VFHA 4BY3A 3BOFA 2DJLA 1HKDA 3WDWA 3E5XA 1OCNA 5LK7B 4Q2FA 3TX9A 4J25A 1D2SA 2X1SA 3O1TA 2GVLA 1T6GC 1FHDA 3LXBA 4DAFA 1VH7A 4NE9A 4E4UA 1OFOA 2FZ8A 3B8UA 4I9AA 2E6DA 2WO1A 2VJXA 3E2RA 1EUAA 3KB5A 5FJUA 1AR73 5CFCB 1MS0A 4GWIA 4XB3A 5LA9A 1ASJ2 3QD6A 1S2KA 4IMCA 1AX1A 3KV6A 4H6KA 4Q4SA 1NLSA 1GQJA 3VBUC 3TN5A 4WM8C 3BQ6A 3ZT6A 5I3FA 5C5UA 2I57A 4AISA 4ZXEA 2ET7A 1WP6A 3WLNA 3B9EA 1KJRA 3S7EA 2GMPA 4CVWA 1OJXA 3S3GA 1YFUA 4JKMA 4YVSB 1LUCA 9XIMA 1BVWA 3LDVA 3K46A 4H1ZA 5A7WA 4GQRA 2J8TA 4XF4A 3T0DA 3OD0A 5L73A 1SFSA 1WO2A 4TV5A 3RNSA 4NRMA 1E6ZA 4WVWA 3M1HA 1E6RA 4Z0SA 2BJSA 4ORMA 1XYPA 1VB9A 2UYBA 2QUTA 4QX8A 1BWVA 2RJ2A 4IEXA 1GOKA 5D04C 2ZCGA 3I65A 4I90A 3L4WA 1AR93 2B7OA 4JKLA 2LROA 1HKWA 2D44A 1YQ8A 1LOEA 3I4IA 3J7HA 3ZYBA 4CP9B 3CNAA 1AQMA 4DRSA 4QHBA 4NJ4A 4Q0PA 3HMCA 5FV3A 5HXMA 4B16A 2BTVC 1MO0A 1KEXA 4WK9A 2HVMA 3BO9A 3U4FA 1PEZA 4A6OA 4MGTA 3MICA 3L2YA 3FN9A 1LOGA 1O5UA 3CS2A 1CZVA 1GEHA 4CEYA 4KWOA 1D4M2 1QJX3 1E6XM 1HNYA 3CASA 5T26A 1PPIA 2W9MA 5C9UA 3JZUA 4DWSC 1CYGA 5FPAA