4BQ2A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
746
structure length
746
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 746
sequence length 746
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq2A02
4JKKA 3ZM8A 2VRKA 2E9MA 1HL9A 1V6UA 1WZAA 1OT1A 3GXMA 1QHOA 3BSHA 4W86A 4AZ6A 3T0AA 8A3HA 3WD1A 1MW0A 3ZJ7A 3O6AA 2Q1FA 4PMDA 1XSKA 1CENA 1OKOA 1RD6A 3I3DA 2BHZA 3VM5A 5I24A 5HDRA 4ACZA 1E6PA 4TTGA 4Q22A 5TD4A 1JZ2A 1GOKA 1GQKA 1W1VA 4HMDA 3BAIA 1OD8A 1NWTA 4PSPA 3EDEA 3GH7A 2ZWYA 5C8BB 3WELA 1ZB5A 4W7WA 3AZSA 4P7LA 1US3A 2CYGA 3WDIA 3K4AA 1G9HA 2F61A 5A6SA 2QMJA 3GBEA 4J7RA 4R5EA 2WSKA 1JFHA 1KGXA 1TCMA 1BPLB 1DWHM 1KGUA 4J27A 1JL8A 4Q7NA 2ZUMA 3ZO9A 2BY3A 3CH9A 5D8WA 1L8NA 1HP4A 3CZJA 3DECA 2CKSA 3CHEA 4B9YA 1JZ7A 4H8HA 1NH6A 3DYOA 2BY0A 2Q8XA 2PWHA 3ZT6A 1B3XA 5FL0A 3WMBA 2PB1A 2JEPA 4W85A 4YPJA 3TTYA 4D6CA 3GXIA 3MANA 1FH9A 7A3HA 4S3KA 4X0NA 3EDKA 4ATLA 3B9AA 4KMQA 1UZ1A 4PTWA 4X0VA 2J62A 3MU7A 5BRPA 1UZ4A 1WMXA 2E3ZA 4NRRA 2FDMA 4ZXLA 5DO8A 3VNYA 5A8PA 3RJXA 1Q6GA 2J79A 2W92A 1OGSA 3IJ7A 4U5IA 3ORJA 3ZIZA 5M03A 1F4AA 5JBDA 1E4NA 1OH3A 1HXJA 3BMWA 3EYPA 1GWMA 3UESA 3UG4A 2YA0A 3F95A 2RGMA 5BYWA 3WF2A 4IISA 3N15A 1GWKA 4J3WA 1EIBA 1CZ1A 1FH7A 3CMGA 3ARWA 3IANA 3HMCA 2ZXBA 2PI6A 1R87A 1OINA 2XM1A 2ZX5A 2F8QA 4GQRA 3WF1A 2W91A 2J8FA 4PSRA 1R86A 4D71A 3MUY1 4KRUA 5F7UA 1OM0A 4HU8A 1HKIA 4MNLA 1KCKA 3BAJA 2D2OA 2E0PA 1X6LA 1ECEA 3GXFA 8CGTA 2VC9A 5DEZA 3W27A 1NWRA 2O9TA 4BZYA 3K46A 1KXVA 1HF6A 4NRSA 2CIPA 1V3HA 4TTUA 3VDCA 5E70A 2VVSA 2XFRA 2CERA 3A47A 1J01A 2WB5A 1HJWA 1WDPA 1MWOA 4WK9A 1HT6A 1SYTA 3MV01 1NARA 2IUZA 3WKZA 3HN3A 5ABGA 1EDTA 3UERA 2J4GA 1UR2A 3AXIA 1HJUA 1V0NA 4JKMA 4OKDA 5A8MA 4GXPA 4ZFMA 2XVLA 1BG9A 2J7EA 1O6IA 2ZXDA 3SUUA 1CDGA 4Y7EA 5A6MA 1GQIA 4UQBA 3WN6A 1EQCA 1UR1A 4ZXOA 2V3EA 3PZNA 2JF6A 1M01A 3CZEA 1ZU8A 1HX0A 1BGGA 5M5DA 4E2OA 1BYDA 4W5UA 2LROA 3UR8A 3W4RA 1H49A 1I75A 3UG3A 4JKLA 4OZOA 1KBBA 3SCNA 3WD3A 1UH4A 1HJVA 2WXDM 2EPKX 2XHYA 4GO8A 4D6EA 3MUZ1 4CD7A 5D21A 4ZEPA 2J7CA 1V6XA 3ZT5A 2ZUTA 3PZ9A 3E1F1 3MKKA 2VMFA 2DT1A 1C93A 3VGGA 3EBVA 3ZJKA 2FH8A 1BVNP 3T2PA 4J3TA 2WYFA 1I1WA 3W24A 1KR1A 4MPKA 1DWIM 2XWEA 3W6MA 1LJYA 5GNYA 2YBUA 5ABFB 3K8LA 2FHFA 3MMDA 5E09A 1B31A 4JFWA 3M7SA 3WQWA 3ARRA 1GW1A 1V3IA 4YW7A 4WJXA 1CXLA 2XWDA 2ZXAA 4UQCA 4U2ZA 3WBEA 1RP9A 5LA1A 2JWPA 2WKLA 3SCTA 1CGUA 4CP9B 1GUVA 3OGSA 4RE2A 3N13A 5IHSA 3QHNA 2PWGA 4DUVA 3PTQA 5JUVA 1VBUA 3AHVA 2NT1A 4OIFA 1E1FA 4UNIA 4AL9A 1WAWA 3PBGA 1JD7A 3VKKA 4DUWA 2Z1SA 1DP0A 3WH5A 5EB8A 1WE5A 3W81A 1WNOA 3IJ8A 1CPUA 1JF5A 2QPUA 3VD4A 2J25A 4H8UA 2J7HA 5BROA 3IJ9A 4FLRA 2D0GA 3SUTA 1K6AA 3VILA 3AHYA 2DT0A 4B3KA 2DQXA 1E5JA 1EHAA 3CHDA 3DYMA 4GO9A 1TVPA 4M82A 1QOXA 3T09A 4LYRA 2VVNA 5IFTA 1KQZA 3K8KA 5CSUA 1W9XA 4CN1A 1ZBWA 2WAGA 3W0KA 3WDHA 1KGWA 4PTMA 3ZYHA 4OBRA 2G3MA 1R7AA 5AC4A 2J8GA 2JIEA 3WH8A 1JDCA 4QFUA 5BWFA 1W2PA 1IZJA 2VTFA 4HU0A 1VFOA 1EXPA 1E70M 1UWQA 4AD3A 2CPUA 1R7OA 4ZENA 4IPNB 3WD2A 4MTVA 2DEPA 3OGVA 2VJXA 2WZHA 3BSGA 1ZBKA 3S2CA 3AHXA 1HL8A 4CU7A 1J0HA 3G6MA 1JG9A 1E0XA 3N11A 3OB8A 2ZX6A 4C7DA 2ZIDA 4W8BA 4OUEA 2WCAA 3ARTA 2WBKA 4CVUA 4U3CA 6A3HA 3FN9A 1BG4A 4WKHA 3FAXA 4JCLA 3VD3A 2E4TA 2WVTA 1JAEA 3ARPA 2EEXA 3FHAA 3TTQA 1LF1A 3BAYA 1GORA 1LLOA 2UY3A 1OD0A 3QOKA 1NOWA 4M29A 2EPMX 1MXDA 1BYCA 5IXEA 2D3NA 1QNRA 1J0KA 3FW6A 3WNOA 5I3DA 1W8WA 4LQ1A 2E8ZA 4PEEA 4U33A 4EKJA 2DH3A 5FOOA 3AFBA 3TTOA 1QI4A 1NOFA 4LX4A 4QP0A 1BGAA 4MNKA 1MYRA 4TXEA 4HTYA 2BHYA 1JI2A 3BC9A 4OJYA 3U7VA 2J75A 1JXKA 2WK2A 1KWKA 1ODZA 3AIVA 5FCZA 4ACYA 3FHQA 5GNZA 4BS0A 4L4OA 1AQHA 4HMCA 1GOMA 2DSVA 1JDDA 3WH6A 1JF6A 1DHKA 2GUYA 4HP5A 4H8VA 2G3JA 3GXDA 1CIUA 2EBNA 4RE4A 5IFPA 2EPNA 5I77A 4LK7A 1QNQA 1C7TA 1GHRA 3AJ7A 3CMJA 1FFRA 1BVZA 2DIJA 2J7DA 1W90A 1B3WA 2UWFA 4C7FA 3NSMA 3VGDA 2CEQA 3BAWA 1NWSA 2ZUNA 4JHOA 4ACZB 3AMCA 1UD6A 1E3XA 4UZUA 2WCSA 1V02E 5DF0A 1XV8A 3GH4A 2XIIA 1MFVA 2OSXA 2VL4A 5CG0A 1PEZA 2CBUA 1Q4NX 1NOUA 1Q6CA 4A3HA 1MVYA 2V5DA 2ZUSA 4CVWA 3SUVA 1QVBA 2VNCA 3W26A 4CPBA 4AZ5A 1V02A 4GI8A 2VUYA 4RL3A 1V6YA 1ZBCA 3O2LA 3N1AA 5HXMA 4HPHA 5A6BD 3CGTA 4GZJA 1E4IA 3MUIA 3AS2A 5FKYA 1RH9A 4AXNA 1X1NA 2BFGA 1BAGA 2WVUA 4WKFA 3AZRA 4UZSA 3WDRA 5BXPA 4HA3A 1M03A 3KE0A 3AIEA 9CGTA 4HOWA 4LJHA 2O9PA 1JGIA 3ARYA 4TVCA 2VO5A 1KXHA 4F9DA 5A6BA 4CN6A 4UQEA 2YDRA 1JNEA 3L4UA 3AZTA 4TVDA 1FOBA 4LXFA 3VINA 3OLIA 5CPSA 4AD0A 2DT2A 3WD4A 1BYBA 1VBRA 2QV4A 3PZUA 1FP9A 2BVYA 3VM7A 2GJRA 5KEZA 1OGBA 2NW0A 1VFMA 2VT0A 3LPPA 4QCFA 4V27A 2XVPA 3PZOA 4MNJA 1E0WA 3VGEA 1JZ4A 5I78A 2BNJA 1C8QA 1CTNA 4UQAA 2OWXA 1QPKA 1ODUA 1X6NA 3AHTA 4CU8A 3THCA 4CP9A 3N17A 1ISZA 2CETA 1UA7A 2YDQA 4UOJA 3ZSTA 3VO0A 4WKAA 4UR9A 3KL0A 4W8LA 5M3WA 1PX4A 4PN2A 5D9PA 3S6TA 4C7GA 2CXGA 4MB3A 1TFVA 2CNCA 1W9VA 2BY2A 2FGZA 2WANA 3KWXA 3RM8A 4ZE4A 3QOMA 4IM4A 2W61A 1FHDA 1V0LA 4UOQA 3U57A 3B8SA 3T2QA 3OLEA 1BTCA 5EBAA 3MSGA 3AS0A 1W9UA 1WZKA 3CZ8A 4X9YA 1PIFA 2V3DA 1UKPA 4UCFA 3T08A 2G3NA 1W9FA 3N04A 3N12A 1OSEA 1EOKA 2CITA 4MAZA 2GVYA 2PWDA 3VMPA 4P8XA 2NT0A 2XSAA 3GM8A 4FLOA 2O92A 5AYBA 2J7BA 1PAMA 1PZ2A 4BCEA 4M80A 2E9LA 2G4FA 2XGIA 4XUYA 2MANA 3AXXA 1UWRA 1V03A 3AICA 3VIMA 4Z2JA 1JFXA 1UG6A 2WLYA 2Y5EA 3NSXA 1VIWA 3QR3A 4MADA 4A4AA 3WIJA 2YL9A 3RILA 3CHFA 3M6DA 4D6IA 4HOZA 1FA2A 2OSWA 4OOUA 4Z2GA 1E0VA 3WFZA 1KR0A 1LG2A 5KZ6A 1UOKA 4LKFA 1HVQA 2WNWA 1QBAA 1CLVA 1UHVA 1BHGA 3LPFA 4GI9A 1E15A 2Y24A 1GQJA 2G41A 1C8YA 3ALFA 4KGJA 2CBIA 2VCBA 2WMIB 1VENA 4CU6A 3RPMA 2XPKA 3FY1A 4U2YA 1W3JA 4F66A 4H2CA 2YBTA 1UWSA 4UFIA 1VJSA 4D6DA 1IT0A 3WUEA 2W62A 2XIBA 5AYIA 5DT7A 1QW9A 4MB5A 3RMEA 4AD5A 2JALA 3K8MA 1ISXA 2X2YA 3WUBA 3WDQA 3RM9A 1J0IA 1D2KA 4WF7A 1JNDA 1L7LA 1LG1A 3VGFA 5E0CA 1CBGA 1W32A 1G1YA 3U7BA 2YL8A 3KL3A 1UD2A 2Y2WA 2WVSA 1PJ9A 1J18A 1B90A 1NP0A 4FK9A 1AVAA 3W6LA 1CGTA 1OIMA 4UOZA 1J0ZA 5EFFA 3G6LA 2ZXQA 3WMCA 3D5HA 5CXPA 3ECQA 2OWCA 5HBFA 3AIQA 4UFLA 1ISYA 4D1JA 3PTMA 1JZ3A 1NQ6A 4CN4A 4GINA 4AIEA 5HPCA 4W8AA 1QNOA 4AIOA 1CGYA 1NM9A 4M56A 7CGTA 3WD0A 1HKKA 1H3GA 4U3AA 3NDZA 2CCRA 2XGBA 4B16A 2EQDA 2G3IA 4QLKA 4V28A 3AYSA 2WZIA 3GYCA 2YJQA 1E1EA 3FNDA 2TAAA 4W84A 4D6JA 3WNKA 1WP6A 2VX4A 1BFNA 3ZR6A 4PMRA 4R27A 3CO4A 2A3BA 3SURA 1PPIA 5IHRA 4JAWA 6TAAA 2VX5A 4W7UA 2VQTA 2XFFA 1XGZA 1E6XM 1QNSA 1GZJA 3WQ4A 5JBEA 1MQQA 3N18A 3VDBA 3ARXA 4AW7A 1JZ5A 1CLXA 1E55A 1KXQA 2V3FA 3NSNA 2XJ7A 1QHZA 4EE9A 3N9KA 3WDPP 3AHZA 2WHMA 4BQ5A 3WEOA 4DM2A 3WEMA 1GJUA 1VF8A 2WM0A 4AZIA 4DWSD 3BAXA 3VIFA 3KEHA 1WPCA 2AOSA 4DWSB 4XB3A 3PZTA 1VRXA 1K9TA 4D6GA 4DM1A 4TUFA 5A6KA 3WMSA 3RJYA 1V3MA 1WZLA 4HZ7A 1VEPA 1ESWA 3ALGA 4MJ2A 1MQPA 2GSJA 1E6NA 5CSYA 1K9DA 3IAQA 1E56A 5CLWA 3VIJA 5CJ5A 3PZVA 1OGGA 1L0PA 1US2A 4K68A 2A3HA 2CKRA 3NCOA 3ZJ8A 1H4PA 1JDAA 3MV11 3L4XA 3AMDA 4D6FA 2JE8A 3ZYFA 3EMQA 2VCAA 3L4TA 3ARVA 5JIWA 2ZUVA 1GOQA 2XFYA 5A2BA 4KH2A 4LPCA 1CNVA 1B2YA 1MQRA 2EXOA 1JAKA 1QI5A 4E8CA 1CXIA 3CIVA 5CGTA 1XD1A 3W37A 3GZAA 2D0HA 1H0IA 1TMQA 1ZJBA 5A95A 1VEOA 3AMGA 2DIEA 1XCWA 3BCDA 4ATDA 3CBWA 3W82A 2J77A 3ZMRA 1M53A 2GDUA 1MW3A 3WY1A 4PMNA 1NWUA 3UR7A 2VR4A 2Y8VA 1W9BM 4UFKA 4MDOA 1GNXA 3DHPA 2VX7A 1A47A 3UEQA 4WLCA 1G5AA 3AS3A 4AD1A 1HJXA 4Z2LA 2D1ZA 5I79A 1MXGA 4HOXA 4J3SA 1H11A 2VZOA 4GQQA 2E9BA 4JFSA 5LA0A 1YHTA 6CGTA 3BXWA 3UCQA 2CHOA 4J28A 1FHLA 1HNYA 5A94A 5A6LA 4PCSA 2WMJA 1OCQA 5A8OA 1UR0A 5EMYA 2WC3A 4RE3A 1J10A 4M8UA 3WFLA 1W3LA 4AZ7A 2Y4SA 1JI1A 3VDHA 3W29A 5A69A 3VD5A 1XH1A 4PMOA 2D3LA 1GWLA 3PTKA 1ZBVA 1KBKA 3CUFA 3MS8A 3WQ8A 3ARSA 2WLZA 3OIHA 2CHNA 4JIEA 3W53A 4PTVA 1GJWA 1WO2A 4TX8A 3A4WA 1OIFA 2OWWA 4PMYA 2XM2A 1QHPA 4JCMA 1U30A 1J12A 1UR4A 4B3LA 2W5FA 1DWJM 1WKYA 3WDJA 2A3AA 5JBFA 3WSUA 5D9MA 3VTRA 2GJXA 4GPNA 1DWGM 3DHUA 1WDQA 1DWAM 4FMVA 3WF3A 4IPLA 3WBAA 3EMCA 2CBVA 1U33A 1UA3A 1GOWA 3POCA 4F9JA 2FGLA 3L2LA 4YHGA 1WCGA 3VGBA 2WMHA 4MDPA 1CXEA 2DDXA 1UH3A 3K1DA 1B3VA 1E71M 3I3BA 1Q6FA 2WYSA 5CGMA 2JEQA 4AC1X 1ZL1A 3ZT7A 4UQ9A 4M24A 4JFTA 1JYWA 1EHNA 4MJ4A 1W8UA 4FLSA 2RGLA 1V0AA 1E6QM 4QAWA 1B3ZA 4BQ4A 3CUJA 3OBAA 2GJXB 3MMUA 1R85A 5ABHA 3RCNA 2ZX9A 1EDQA 2HISA 3WL0A 5BXSA 5I23A 3ZJ6A 5M17A 2W4XA 3GNOA 4D72A 1CGVA 1SFSA 4YWAA 4CD5A 1Q6DA 5BXTA 1QI3A 4H41A 2YLAA 3VGHA 2DSKA 2OYMA 1GPFA 3SIMA 3J7HA 2WPGA 1B0IA 4D1IA 1CEOA 3EDJA 1U2YA 4WSJA 1GOIA 2JIWA 1H09A 1W3KA 2OLHA 4DUXA 2PWEA 4MB4A 1WZMA 2C24A 1O7AA 3SUSA 3AS1A 3WNLA 3WENA 3PZMA 4AYSA 3TTSA 2Z1KA 1V08A 1B1YA 2WHKA 4HA4A 4E4PA 4Z2KA 3AQUA 3THDA 3WUFA 5C70A 2AMGA 3ARUA 2VZSA 3SEPA 4URIA 1EH9A 3CZGA 2D23A 1LQ0A 1LWHA 4JFUA 4HZ8A 2EPOA 3VVGA 4PYSA 1KXTA 3AYRA 1J11A 1W3HA 2ZWZA 2WMKA 3WF4A 2UY4A 4TOQA 2VURA 5FL1A 2WMIA 2ZICA 4MB1A 2UY2A 2V3GA 4XZWA 1TUXA 2XUCA 3AOFA 1E43A 4UTFA 3AIUA 2VZVA 5D8ZA 1QI2A 5CLTA 2VZTA 3OZPA 1C8XA 2QLYA 4AIUA 1E4MM 2D20A 1UKTA 4HMEA 5FD0A 4CKQA 3O9NA 1VAHA 2QPSA 2XYLA 1XD0A 3CLWA 3RDKA 5E6ZA 2ZX8A 3UETA 1V6VA 1GVIA 2ZX7A 4YW6A 2X05A 4AZHA 2W63A 5GQBA 1RP8A 1E5NA 1XSIA 3NJ3A 2W66A 1C92A 3QHOA 1EO7A 3VDAA 1M7XA 3AMKA 1FFQA 1CECA 1WCUA 1UQZA 1OB0A 1W1PA 4OBSA 2BXYA 4GIAA 4S3JA 1IZKA 3PZQA 1W9PA 4L4PA 4PMUA 3POHA 1H0GA 5HPOA 4H04A 4EK7A 1UWIA 1CGXA 1E6ZA 2WHLA 3OLGA 2QMKA 1TA3B 1EDGA 4J3UA 3WQ5A 4FF5A 2PBOA 3CPUA 5DMYA 3IAPA 4CGTA 5AC5A 2VI0A 1VFUA 4NI3A 2J47A 4CPBD 3B9EA 1KWGA 3WUGA 4NF7A 5CZKA 1EOMA 1GONA 1UKSA 2G8ZA 3CZLA 2VX6A 3OG2A 3VX1A 4KWUA 5A2CA 4F79A 4LYPA 4JZ5A 2FH6A 3RIKA 3SCSA 3M07A 3WNPA 3L4ZA 1B9ZA 2VRQA 3ZQ9A 3SCRA 3D3AA 1E72M 2QHAA 5I0DA 2PWFA 3BH4A 4E8DA 1W1TA 1UQYA 4W93A 2XG9A 1HIZA 5I2UA 2D22A 1HN1A 2EPLX 4HZ6A 4AD2A 1S46A 1C91A 4ZE5A 2B31A 5A2AA 2VQUA 5ABFA 2BS9A 2XVNA 1ZS2A 4NZCA 3F5JA 2JF7A 3FAWA 2X1IA 4LGXA 2XSBA 4B9ZA 4PTXA 1QW8A 1HP5A 4N0RA 3KL5A 2HVMA 5E6YA 2DSUA 2YL6A 3VIGA 3OZOA 4P8UA 1AMYA 1CXFA 3RO8A 2YIHA 3JUGA 3KZSA 3VU2A 3U5YA 3NUKA 2OYLA 1V3JA 1LL7A 2PF0A 5BRQA 3AMLA 2E8YA 1SMAA 2GK1B 1WDRA 3GNPA 4JHZA 2GK1A 4P8WA 1GHSA 1J0JA 3VIPA 2A3CA 2LRPA 2F2HA 4UFHA 3ZYBA 1XH0A 3TP4A 1TR1A 2WMGA 3VMOA 4W7VA 1UD8A 5A1AA 1CWYA 5EFDA 2WWDA 4QLJA 3BLPX 4QDMA 4AISA 3SCQA 5CQ1A 2D24A 7TAAA 2VXJA 1V3KA 4QCEA 3WEZA 3MSDA 1E9LA 1BF2A 1CGWA 3AIBA 3PZGA 3NDYA 4PMXA 5A6AA 2VCCA 1HN0A 2YDSA 2DSZA 2IXUA 2XVKA 3LPGA 3HJEA 2OSYA 2FHBA 2ZOXA 2D0FA 2DGAA 4FLQA 2DPEA 3TA9A 1K9FA 1J0YA 3AROA 3DC0A 3TOPA 3IK2A 1Y7VA 1H5VA 2Y8KA 1VEMA 4PCTA 3SUWA 2J78A 2WWCA 1MW2A 4AEFA 3L2MA 4CD4A 1OT2A 3F5LA 4AZBA 2WW5A 4W88A 3W38A 4XZBA 1DWFM 2WCGA 1W8TA 2GJPA 1TE1A 4P7RA 4AEEA 3WQVA 1UKOA 1B30A 1UKQA 4LKDA 1H41A 1GCYA 5HOSA 3BCFA 1H2JA 1JIBA 1W8ZA 1UR8A 4N42A 4P8VA 1TZ7A 3VIHA 1KQYA 3CZKA 4LK6A 1W9DM 1PBGA 1B3YA 1UH2A 3APGA 2FHCA 4UFJA 2BHUA 4DWSC 1ISVA 4CD8A 4W5ZA 3AI0A 4JL2A 3A4XA 3GBDA 4HPGA 2XTKA 2KR2A 5A6JA 1HVXA 2J7GA 4GI6A 2WVVA 5DT5A 1XHGA 4CD6A 5BCAA 3WNMA 1N82A 5LA2A 2O9RA 5IDIA 4BA0A 1UD4A 2V38A 5D9OA 1VFFA 1GOOA 1JZ8A 5CPTA 1AQMA 2VRJA 2DT3A 1UWTA 3CHCA 2O14A 3VMNA 2OYKA 4AMCA 1E3ZA 1UR9A 5E0FA 4B15A 2K46A 4AZCA 2XVGA 1UOJA 3SCVA 1J9YA 4AZCB 3HU7A 1M04A 3B9DA 3MUAA 4PMVA 1XYFA 4WSKA 2WZEA 3UT0A 1TVNA 3VUPA 1W1YA 3BGAA 1BLIA 1UWUA 2WVVB 1MW1A 4JFVA 3F5KA 2VOTA 3ARZA 3LMYA 4KRTA 1UUQA 2BXZA 1XSJA 5FIPA 3BAKA 4IUGA 1G94A 4HA1A 3RM4A 1LL6A 1WB0A 2BVDA 4XV0A 3A6OA 3QHMA 1TA3A 3LPOA 3ZR5A 4EANA 1ITXA 4M1RA 3UG5A 5BXRA 2X8RA 1V3LA 1JYXA 4P7NA 3GNRA 3VD9A 3AIRA 2O9OA 3MMWA 4TX6A 2YL5A 1ITCA 5ECUA 4KGLA 3VNZA 5ABEA 2BVTA 1TG7A 2YKKA 3CUIA 4UQDA 1DTUA 2ZE0A 1I1XA 1Q6EA 1CXHA 2YA2A 3NIYA 3SCOA 3PZIA 1EO5A 5GNXA 1C3FA 4A3YA 5HNNA 2IXVA 5GPRA 4DWSA 1EA9C 4A6SA 2DSWA 1PIGA 3A4AA 4CCEA 1RPKA 4M81A 3MO4A 1XRVA 3OLDA 1EGZA 3T0BA 4F8XA 3VPLA 5E9AA 1P6WA 3ZOAA 2EJ1A 1LWJA 1UD3A 3WH7A 3WQ6A 1WZXA 1V6WA 3CTTA 1C7SA 3DYPA 4Z2IA 2C8NA 3EDFA 3AIWA 1D3CA 1W2VA 2ZUUA 2GDVA 2PC8A 4AD4A 3EMZA 3FXYA 3AXHA 1KB3A 1PX3A 1ISWA 1D7FA 2C0HA 4NSBA 2NSXA 2JFEX 1XC6A 3WNNA 4CCDA 3VIIA 1Z32X 5D9NA 2QF8A 4U5KA 2CESA 1G0CA 4CUCA 1KCLA 4H7VA 3VIOA 1BSIA 1QNPA 2BV9A 2VZUA 4MAVA 1HJQA 1JD9A 3QGVA 3GH5A 1XH2A 1XYZA 4XX6A 3SCUA 4PMZA 4W89A 4LKEA 1JYVA 1CXKA 1FH8A 1FP8A 5AY7A 5D4YA 3BLKA 3II1A 4PBGA 1C90A 2C7FA 1WDSA 2ESCA 3CUGA 1A3HA 5JIPA 1QBBA 2WC7A 3W25A 5I6SA 1VB9A 2CBJA 1XCXA 2BY1A 2WBGA 3K4DA 3I3EA 2X0YA 1E4LA 1SMDA 4OOZA 2V5CA 1HKJA 2WSPA 3BMVA 2W67A 3ARQA 4BF7A 4YN5A 4JL1A 1IV8A 4P7QA 2AAAA 4BQ3A 1PX8A 1JZ6A 4J3VA 2WHJA 3TONA 3NYDA 1GQLA 3L4VA 5A8QA 1E73M 3OA5A 3WL1A 1PZ3A 2DH2A 2YA1A 4PMQA 1E40A 2J74A 3GDBA 1F4HA 1V0MA 5DFAA 3L4YA 3SCPA 4GZEA 2X09A 1JYNA 1K9EA 4GZIA 2PBGA 4AY1A 3PHAA 3T2OA 3VD7A 1QI0A 2WKGA 3OGRA 1VJZA 3CUHA 3WF0A 1HKMA 3F4VA 4AWEA 1V0KA 2YLLA 4PUEA 4W87A 3GTNA 5C71A 4V2XA 4J3XA 4GKLA 4D6HA 2UY5A 3U5UA 2E40A 3AISA 1CYGA 4PUDA 1OBAA 1GVYA 1DEDA 4MNMA 3ZSSA 1UYQA 4WIWA 1R8LA 1UD5A 5A8NA 1HJSA 1LL4A 1H1NA 3W28A 5CPQA 2J7FA 4YHEA 4AZGA 5A3HA 1W91A 3L4WA 4QLLA 4EAMA 1YQ2A 2WMFA 3WH9A 4PRWA 3VOCA 1EQPA 2EO7A 4CCCA 4UFMA 1NP2A 3VIKA 4BQ2A 3T0DA 1ZJAA 2VR5A 1BYAA 2YOCA 1G01A 4P7OA 5LYRA 1AQ0A 1JXJA 5I5RA 2X0HA 2WC4A 3PN8A 2GFTA 1E6SM 4ATWA 1OWQA 2ZUWA 1SR0A 3M46A 3VX0A 3A3HA 3EDDA 4U31A 2A3EA 4ML4A 1E6RA 1MFUA 4LYQA 1BQCA 3SCWA 4TVUA 1KFWA 4Z2HA
chains in the Genus database with same CATH superfamily
5FQ0A 2VRKA 4AK3A 2JGQA 2VXRA 5BW6A 3IIOA 3RZLA 3ITYA 4NYYA 1IQAA 3IDBB 3GXMA 4AZ6A 3T0AA 1WKFA 4HKLA 3BV4A 3CO8A 2QFEA 1MW0A 2QAFA 4WBBA 3TOYA 4UBPC 2JDPA 3TYJA 4ZONA 1X98A 1FX5A 4IEVA 3HQXA 4G2DA 4QKDA 4DJFD 1OKOA 5LXEA 2WO5A 4Y5TA 4YNIA 1PHMA 4R34A 4TTGA 4ZA0A 1IHMA 1AYM2 2ID4A 4XXPA 4FEZA 5AC8A 1BVP1 3GRIA 1Z78A 4MWAE 4Q8KA 3HBLA 4NO4A 4GUGA 4D0QA 4NAFA 4FXKB 1N8FA 5JXHA 5A1LA 2V63A 3M0LA 2E6AA 4UW4A 1SFPA 2J8TA 1EA0A 3Q8BA 4JR5A 3HM7A 3TU9A 2CYGA 1TMF2 4PUWA 4H7MA 4LBNA 3LN3A 2E33A 4P5YA 5LNRA 4EXAA 1DQXA 5FYZA 1T8XA 1XNTA 3ZSLA 1LLZA 3E0VA 1SU5A 4R5EA 2GU9A 1JFHA 2QJIA 2ZHKA 4OULA 2NUWA 2PURA 1DWHM 1LJ7A 4RX0A 4Q7NA 2ZUMA 3ZO9A 1HJFA 1RHI3 2BY3A 3TCEA 2IMRA 3CZJA 5FP7A 2CKSA 1JZ7A 4AHQA 4B9YA 3CU7A 4HFSA 1RUC2 2BY0A 1S0EA 3LOBA 1B3XA 2L9LA 1FWWA 4NX5A 3HJRA 1X97A 3N6QA 4QPGA 1GQNA 3MANA 3AFKA 3O7UA 2ZGQA 1VFTA 3G1XA 3U75A 5LCWL 4FZIA 4CXYA 4MYXA 4PIZA 4IUOA 3B9AA 2AAMA 1V6OA 5CBJA 5KHJA 4JQAA 3PG8A 1D4M2 3O12A 1OCBA 1WMXA 4QQ3A 4LV9A 3H21A 5FEPA 3J4UH 4V2WA 4MGZE 1RUNA 2FDMA 3I3QA 4H6KA 1RJPA 3GAYA 1XLAA 3KV6A 3FDKA 3IJ7A 2B7OA 2D43A 4HD5A 5A33A 3ZIZA 1VBE3 4QQUA 4EAYA 1C9WA 5JBDA 2J66A 1HXJA 3UG4A 4WZHA 2YA0A 4NIAA 3O16A 1KFBA 3MYOA 1HJGA 4IISA 2OXBA 1CZ1A 1PZ8A 5CBLA 4AOCA 2D6KA 3HMCA 4XZHA 3TE9A 2PTXA 3V56A 1QU0A 2V09A 4C6EA 3QZAA 1R87A 3QM3A 3S9ZA 2QDNA 2F8QA 3LUTA 4MGSA 1NCQA 4UTWA 2J8FA 1VRH2 4XAAA 3LU2A 4NIRA 1N1VA 1EKOA 4H2HA 3AK0A 5F7UA 1JCXA 1J96A 2HXUA 1KCKA 3DI0A 1SPPA 3AXEA 1VCVA 1PGL1 3LCLA 2E0PA 1VB2A 2DCZA 1X6LA 3W27A 1NWRA 4XIAA 4HVQA 5FZ3A 4GH4C 3ATGA 4QS5A 3K46A 1KXVA 2HEYF 4Q29A 1H7RA 1PCKA 3UZXA 4NRSA 1VBD2 3A47A 5K0UA 4I0WB 3INPA 1MWOA 3IJ6A 2HWB3 3NL3A 1E9ZB 4DXXA 2B4GA 2J9XA 4V33A 3WKZA 2AH2A 3HN3A 5BNOB 5ABGA 4QKBA 3M0KA 4O1FA 4Z1BA 3UERA 2J4GA 3AXIA 1HJUA 2YV8A 4QE1A 1NA1B 1V0NA 4JKMA 4DNYA 1S5TA 2WLQA 2ASHA 3RYPA 1FWAC 1SDWA 4M00A 5EYWA 4ASMB 2J13A 3W23A 1MEHA 3F2ZA 3NVCA 1O6IA 3RI8A 4HN1A 2ZXDA 4DBWA 4Y7EA 2OOFA 4UQBA 1UR1A 2QJJA 4N4QA 3ZVHA 3IDCB 2AQWA 3FK4A 2UWCA 1ALYA 1WGPA 5DXYA 1GW9A 4JN8A 4E2OA 4QAIA 2RKXA 1BEV2 3SCGA 1H49A 1I75A 4YZ1A 3MSRA 4IF2A 4LF2A 2V5YA 1PVNA 3WD3A 4C6IA 3PNZA 2IXJA 3MDUA 1YMYA 2XHYA 4CD7A 1XG4A 3QY6A 4QXBA 3NZRA 2J7CA 1EAH3 1V6XA 4RSUA 3ZT5A 1HXS2 2ZUTA 3IEBA 1YIPA 3PZ9A 1VBA2 4C6KA 3Q8EA 1CB7B 1QJZA 1UYPA 5D2WA 1MUMA 4E0CA 2DW6A 5C9AC 1MEC3 1UU4A 1S38A 1K7EA 3BLDA 2FH8A 2FMYA 3T2PA 3DFOA 1XBFA 4XQWA 4J3TA 3WLOA 3QOPA 4IIEA 1AJZA 1JYCA 2P3ZA 3S8HA 5J3UA 1D3HA 3P61A 1LJYA 4FOVA 2XH4A 3K8LA 1ACCA 3MMDA 1A0EA 4JFWA 3M7SA 4LVFA 5HA7A 1BKZA 1V3IA 3LEKA 4Y90A 2V5LA 2EALA 2NLRA 1AYM1 2XWDA 4OECA 3I4KA 3OEXA 2ZXAA 4U2ZA 3WBEA 2HNEA 1VFLA 2HYXA 2JWPA 4BR1A 1VPHA 1YBQB 1MEIA 3NO3A 1CI1A 2FVLA 2CXEA 3DU0A 2W39A 4IW3A 1ENSA 3QHNA 5A80A 1UMHA 2WPBA 4B92A 2NT1A 4FOKA 4H6EA 4OIFA 2NP0A 3KAOA 4AL9A 1S5NA 3O6YX 4HANA 3VKKA 3UWEA 2QDHA 3GG7A 4E4HA 3CAQA 3B94A 2RG4A 4I2OA 1LOSA 3LEPA 7REQB 1CPUA 4PE8A 1UIPA 3BL3A 1KS4A 1JF5A 2QPUA 2WWUA 1X6UA 3GALA 4AYGA 2BFUS 2XH7A 4FPJA 5CKMA 1K6AA 3KBVA 4KETA 4B3KA 4FPCA 1DJIA 3CHDA 1S0GA 2PUZA 2XINA 4ADTA 1QOXA 3SHRA 1E0UA 4TLFA 3CJPA 5IFTA 4FX8A 5H8MA 3CQOA 1ZBWA 3RUBL 2Z2AA 3VFCA 5FJKA 2FPVA 3ZYHA 4S3EA 2G3MA 1R7AA 2VEMA 2OX0A 1TV7A 5IAVA 5C9AA 3V0BA 1JCLA 3GFXA 3H26A 5EMKA 4ATFA 1REQB 4AD3A 3KD4A 3OUHA 3AAMA 2VBPA 1R7OA 1V5XA 4ZENA 2DEPA 4DXZA 3KLKA 3AP5A 4HKOA 4Z1VA 1CAUB 1TELA 4LHKA 2Y0IA 4CU7A 4H55A 1JDEA 2BW8A 1J0HA 4M6VA 1V6LA 5TNVA 3SH4A 2MNGA 3A9IA 1VLIA 1PUDA 3N11A 4LUYA 2JG8B 4NL1A 4O12A 5FCCA 2OZ3A 3BMXA 2WBKA 5FPUA 6A3HA 2OZ6A 3PL0A 4TIMA 3N2XA 3FN9A 1A5MC 2PDLA 4JCLA 3Q94A 4NZ1A 3T9PA 1US0A 3ARPA 1VCGA 2BX7A 3PULA 1CVNA 3RMYA 1GYNA 3QW3A 1LF1A 3SQSA 1AD1A 1DIEA 3CL1A 4XE9A 5JQ9A 1NOWA 4MFDA 5IXEA 2D3NA 1EF2A 3UZ5A 3V4BA 2VECA 3WNOA 2DZUA 2VDGA 4HPNA 1W6TA 1WD3A 4U33A 3C61A 3J9SA 3NO1A 2WO3A 1OVPA 5L7OC 4Q4KA 4LX4A 3EB7A 4NHLA 3IIXA 3K51A 1X9PA 1W0NA 2JBMA 2PLJA 3ITGA 2SBAA 4OJYA 3SCFA 1MEC2 2DVAA 4BEQA 2WK2A 1D7KA 2X16A 3FHQA 1VBC3 4BS0A 1XIHA 2VAUA 2XLFA 1YX1A 1E9IA 3PPHA 1B54A 3LFIA 4XHXA 4H8VA 2JGYA 3GXDA 4QBXA 2O7QA 2EBNA 4KWLA 2EPNA 1XYLA 1SACA 5I77A 5FQ0B 4LK7A 2ZEZA 3OCPA 4OI1A 3CQKA 2G19A 2PTWA 4IEQA 3CB3A 1QNQA 3C8FA 3ORWA 4GX8A 2C19A 1QT1A 4LAMA 4XOGA 3N4FA 4J2MA 4YTSA 5F1RA 2QCDA 1U1HA 2J7DA 3WUDA 4IZGA 1CT5A 5HK4A 2CEQA 3GAKA 4OUMA 1AZDA 1NWSA 3G6JB 3SNMA 5C5UA 3STEA 4DJDC 3USUA 2R041 3AMCA 3WCRA 3E5UA 4JDNA 1PVC3 3MW2A 5CISA 3TR2A 1RVGA 4XF3A 1RUG2 1SR9A 1NT0A 4LAZA 1OH4A 3GH4A 2D6MA 3JZUA 4AG0A 1XNKA 5CFDC 2VTXJ 3OVPA 1BYHA 2ZGMA 1HDKA 3OPTA 3EX3A 3FJ6A 4I5XA 1UUOA 1W28A 1BMV1 1YDYA 2CBUA 4O14A 4A29A 2HVNA 4JTTA 5K7JA 4DEQA 1MNSA 1MVYA 1Q6OA 4CVWA 4CUAA 4YZ4A 4Y2WA 3ACFA 2ZRVA 1QVBA 4D8MA 4J2PA 4RL3A 4EWJA 1P8JA 4ZODA 3H50A 1UZHA 2EAAA 2YYOA 5HXMA 4I5UA 4GVIA 3TC6A 3BPSA 3PBWA 3BO9A 4M1BA 1W3VA 2ALDA 2ZGSA 4M3CF 1YIXA 1V77A 3WP6A 3WDRA 3B00A 2PP3A 2O9PA 1N1SA 3OBZA 4LUKA 2BODX 2JIGA 2KM2A 4CDWA 3SJ3A 1JYIA 1LU1A 4CN6A 5HCHA 4AR2A 4BIOA 2QQIA 2YDRA 1JNEA 2V5BA 4JTIA 4XBJA 1JVNA 4XF1A 4NX0A 4C1NB 3EB4A 2VM9A 3NQFA 2VTXA 3BODA 2BNOA 2JDAA 3JBG2 4JAAA 2QCFA 4KG0A 3ZFFB 1XXXA 4JZRA 1OOPC 2E7QA 1C8M3 3ATYA 3WD4A 2QV4A 5I3IA 3NA8A 3AYDA 2BVYA 5KEZA 2VT0A 3LPPA 4QCFA 3NQAA 1DORA 2NVDA 5A3MA 4DO5A 1Q13A 3VGEA 3RGBA 4LTSA 4ZQOA 2OWXA 2XUMA 3RLUA 1ODUA 1S0CA 5T5PA 3N17A 4K20A 2CETA 3C2UA 4NHMA 3CHVA 4UOJA 1TWIA 1MZ6A 4H9TA 3WZ0E 1SMVA 4JTNA 5M3WA 3JQWA 1RTVA 3KGZA 2BGQA 2BY2A 2FGZA 4ZE4A 3QOMA 4UTTA 5F5CA 4OQVA 1TJRA 4X61A 3TZFA 4XFBA 3HVDA 4F4RA 3UPMA 3GB6A 6REQA 1GICA 5I3GA 2NX1A 2OGJA 3K2OA 1YPFA 3CAVA 3CIWA 4RR4A 5EBAA 1REFA 3MSGA 1XNDA 1EJUC 1W9UA 1WZKA 3CZ8A 2NQ5A 3WDUA 3UV9A 2VOVA 2WNVB 2Q1MA 4BI7A 2IC1A 1YPXA 1PIFA 1T8QA 1PNFA 2JICA 5BOEA 3TEZA 3M9YA 3TYAA 1IG0A 4KKXA 3I2OA 2RR11 5K0UB 4HCLA 3KT1A 2UURA 1YW1A 3CYVA 4GWEA 1AL7A 2GJLA 2NT0A 3HMYA 2XSAA 4FLOA 5DDJ3 2OGYA 3TCSA 3H54A 2GYIA 2J7BA 1PAMA 3IPVA 4HGXA 5FRAA 1LLWA 2E9LA 2G4FA 3AXXA 2DF7A 3F2DA 3VIMA 2A3LA 2RDQA 1BXBA 3URBA 4RD7A 1L9WA 1UG6A 2VYOA 1I2NA 4I5RA 5DAVA 2AKMA 3NSXA 3GTHA 1VIWA 3QR3A 5EMUA 1EV12 1QOSA 2YL9A 4HSOA 4FB7A 4P00B 1CAXB 4QJ4B 5LNSA 4IV3B 3CHFA 4D6IA 2A73B 1TJ2A 4HOZA 5CC6A 1O5KA 1OG6A 2OSWA 4OOUA 1W9YA 1V6TA 4MMWA 3NM3A 3TN93 1F07A 3MKCA 1KR0A 1TME2 1I0BA 1TZOA 4PL1A 3K1GA 3UNPA 2GUUA 4LLFA 2OQ7A 4D7SA 3I6EA 1PB0A 3M0YA 1OABA 5FJUA 1UHVA 3W7DA 1WAUA 1E15A 5E88A 1P0BA 3RXZA 5M1TA 3SY1A 3ALFA 4TR9A 4EPKA 4GOAA 1HXS3 2Q09A 1D2QA 7REQA 4HXCA 1TIMA 1K45A 1W3JA 1NSJA 5CAZA 4LS1A 2WO2A 4QG9A 4FXRA 5C4WB 4LS2A 4XHBA 1ZENA 1MS3A 2W62A 2PN5A 3KQ4B 3E2QA 3HPFA 4UTUA 3KM5A 5AVHA 2CAUA 2GGEA 2BVWA 5LA9A 2RFGA 1EY2A 1HB1A 4N43B 2UYAA 5DUXA 3WDQA 4XUOA 5D2YA 3VGFA 4J4KA 3QLQA 2GAUA 1XXNA 4AX6A 1W32A 2CV6A 1G1YA 3DH7A 5LBFA 3KL3A 1W6PA 3USUB 1GANA 2JDYA 3LQGA 3LRMA 1J18A 4X8PA 4JQ2A 3WFAA 5DMLA 2XWBB 1AVAA 1CGTA 3KHBA 1NAEA 4MGKE 3G6LA 3WMCA 4BISA 1NCRC 4TXWA 4AHXA 2AGKA 3T40A 2XH0A 1X50A 1HZYA 2OKTA 3BKZA 2NQ9A 1Q7ZA 1EX1A 2YXOA 1NQ6A 3P5ZA 3R11A 4NXSA 5HPCA 3OZYA 4W8AA 2YYUA 1C1LA 4OTKA 2GSYA 3WDYA 2WABA 1HKKA 2B46X 5JMCA 1H3GA 4U3AA 1GQGA 1N8IA 4CP0A 4NVTA 2G3IA 1O5UA 1PMIA 2UV8G 4QLKA 3L5LA 1GUIA 5F4SA 3VBRC 4Q4Y1 2WIIB 1XINA 4XCBA 3GYCA 3W1NA 1FWGC 3FNDA 4N9BA 2HZGA 3CYJA 5MF5A 1UASA 3QMRA 4ZXKA 1ULDA 3WG2A 1XLBA 4C6FA 3ZR6A 4PMRA 5D8AB 4LANA 3TR9A 3VBOB 1PPIA 4LIUA 4IXXA 5GALA 4O4WA 5LY2A 4J9JA 2RDXA 1FQ0A 2A6VA 2R32A 3VC5A 1COV1 5G2IA 2NQHA 1UOFA 1ALDA 3LTYA 4RGGA 5FWEA 3LD8A 3M0JA 5DLCA 3WQ4A 5JBEA 1NCQB 4META 5HQLA 2R82A 2VNOA 4Q4X2 4F0SA 3ILFA 3ARXA 3MO7A 4L4MA 3KQRA 2XJPA 4AW7A 3NYZA 2OA2A 4KG8A 1V70A 3W7NA 2V3FA 2EICA 5ABJC 3ANUA 5DANA 2JDHA 4ATEA 4X8NA 3L9CA 3CL8A 4HT1T 3N25A 1VB4A 2PDHA 2A4AA 3AHZA 3WEOA 4XMAA 1S2KA 4EACA 3CKHA 4PUKA 2R071 4YWIA 2YYTA 3MBFA 5JZGA 3SN1A 3KEHA 1WPCA 1W0PA 2Q4SA 2AOSA 4QM8A 4US5A 2YDEA 3F4WA 2VENA 3PZTA 3HFYA 5BWAA 1AR83 1XYNA 5DZEA 4D6GA 5F3EA 2FHRA 4PCPA 1ECQA 1V3MA 1UOZA 2FB2A 4Q26A 4OHYA 4WM7A 4YVWC 3C4UA 3ABRA 5TQLA 1H51A 3FV9A 2AACA 3SH5A 1K9DA 3IAQA 3A9BA 4K7VA 1E56A 2Y6KA 4GQBA 1ZZCA 1L0PA 3VL9A 5C3RA 5FI8A 1UIKA 1Q8PA 2A3HA 3IIZA 1QMJA 1ZRCA 2DDUA 2ZCWA 3AUJA 4D6FA 5FAXA 3EMQA 3RCMA 2WJZA 1QOTA 1M68A 1UL9A 4KWSA 5U7SA 3I59A 4O8RA 3THTA 2F6BA 4KH2A 4Z17A 4P5HA 3G1SA 4DJEA 3OYXA 3URFA 2ZHMA 3PY2A 1XGEA 5K8SA 3UY8A 2TODA 4E8CA 4LBLA 1TX2A 1QO5A 1OD3A 3FEQA 3M0ZA 5CGTA 1FWCC 3IBMA 3BOPA 5FPXA 1NLQA 5F5QA 3HZ3A 5A7OA 1K5MC 2D0HA 3KBMA 1H0IA 3PPFA 1TMQA 4O16A 1S39A 1LHWA 3AMGA 1HV1A 2NZ9A 1W9WA 4NIDA 1OFRA 1LOQA 5F5IA 1H63A 4YW2A 3W71A 3W82A 3ZLIA 3HPXA 1M53A 1UPMB 4XDOA 3W1LA 5KR7A 3GNXA 2Y89A 1SDDB 1GZGA 3N3MA 4UFKA 3WJYA 2BOGX 4MDOA 2H3BA 4HVRA 4D8ZA 1RPXA 1ZREA 3WD5A 3U0ZA 3R8HA 1XM3A 2BGSA 2AEZA 4IEXA 4O52A 3PSVA 2ZZ2A 5I79A 3JU2A 1TE6A 4C5ZA 2G0WA 1MXGA 4FNSA 3KCXA 1DHPA 2VEPA 4Y9OA 4YVVA 5CBIA 1ULGA 2J1TA 4DFSA 1B4EA 1K5MB 4JCKA 4UW3A 3W1QA 1LORA 5GZEA 2REQA 5CKSA 3NEVA 3BWWA 4KESA 1HNYA 2C1FA 1TMHA 1I6XA 1ST8A 1WKEA 3EPNA 4M8UA 4LBKA 5DXXA 3WFLA 5ANNA 1IXOA 3N4MA 2R30A 3EX6A 1JI1A 5BU9A 4X2PA 1Z69A 2P50A 2HJPA 2ZKMX 1GZWA 3ZYJB 1O1ZA 4RDVA 1QU4A 1A3XA 1J2BA 4PMOA 5F2MA 2ENRA 3UCDA 4QJ3B 2RS51 3KXQA 3LSBA 3UVAA 3RPDA 3LCHA 2CWNA 3ARSA 4LLOA 3PJYA 2VELA 2CDPA 1AX1A 1WUEA 3NM1A 4AEDA 3RRDA 4AQTA 1CX9A 4Q1RA 2VR2A 1WO2A 1W6NB 1ADDA 1EJVC 3A4WA 3FYPA 4TX8A 3JBG1 1H9PA 1NTHA 1OIFA 5FF2A 3DXTA 1PIV1 3RR1A 1AXYA 2OODA 2WNQA 2X7WA 3H2AA 5AHFA 4JGZB 4BQ1A 5HNRA 4XQ6A 1YDOA 4XAFA 3MP5A 1T0OA 2Y6JA 1Q8JA 1UR4A 4B3LA 3VBUA 3VHNA 1WKYA 5JBFA 1VRDA 4TQTA 1DJGA 3D47A 5F2GA 4XC9A 1JYTA 4N4PA 1YFYA 1LCLA 4GPNA 2GQAA 3WQCA 3W7JA 5KXCA 4RV8A 4IPLA 2JKAA 3EMCA 1VBJA 3SJNA 3QACA 4I01A 4AUBA 3W74A 3AB0A 1OCJA 3VOFA 4NXKA 2YFZA 4C5YA 4WCJA 4FXJA 3VGBA 4BB3A 2WMHA 3DPRA 3C7FA 5CG8A 2DDXA 3BVCA 1WUVA 1UH3A 3K1DA 1E71M 2A85A 1TTJA 3TW9A 2ZZ3A 4LKSA 3W2UA 4AC1X 1LU2A 2YGLA 2WSVA 4UI9L 1MMFA 1ZL1A 2A6XA 4JTUA 2Z2UA 4ES8A 3AP7A 3S3GA 1R9YA 1UBPC 3CHXA 2W9MA 1W8UA 1OX6A 4YRDA 3KRBA 3R0KA 3EBRA 4GJ1A 3B97A 1O4ZA 4XEZA 1E6QM 4BQ4A 3OBAA 3S42A 2WS93 2GJXB 1LZOA 3PUEA 2IKHA 2RE9A 4O28A 5FZGA 1FCQA 4Q4Y3 5M17A 3UJQA 2QNEA 3W70A 4PHZA 1GVFA 1ME7A 3MDWA 5DBUA 4YWAA 1JPDX 2JE9A 3OU8A 1R083 4CD5A 5H9PA 4GYFA 3FJSA 1QI3A 3A3WA 1QATA 1CW2A 1R6WA 4XAGA 2YLAA 5G4HC 1XRFA 4EN9B 3SIMA 4FNQA 3J7HA 3THPA 1DF0A 2PHDA 4O54A 4FFHA 4D1IA 4BHPA 4BK4A 3M44A 3RQ0A 4XIKA 3PMEA 4US5D 3P0WA 4WSJA 1GOIA 2B7PA 1XJAA 1LRQA 2GVEA 4RNIA 1F5FA 4UB9A 4XSMA 5GLWA 5FF4A 4DUXA 5EFUA 1Y43B 4PIXA 5D8AA 5DCDA 1WZMA 1ME9A 4QGCA 4EIVA 2D6LX 4HBNA 4F0LA 5FZ8A 4BHYA 2OMAA 5HWJA 1IR1A 1QJY3 5T5OA 1UIOA 2A0NA 2YHJA 4PLMA 5CZ0A 1EB3A 4AYSA 2PWUA 3FVMA 5CKQA 3GXPA 2VMHA 1EEXA 5BNNB 1B1YA 5KBFA 1EZWA 3ID7A 4WZCA 3W7LA 4N43C 4KIRA 2AGTA 2WFF3 4I9MA 3SEPA 3WDXA 4HL0A 4JTKA 3CZGA 2E6VA 1YHFA 5I3KA 4AIBA 3ZYRA 1BLZA 3O1TA 3HGSA 2EPOA 1XIFA 4HT3A 2VNVA 3P81A 3AYRA 1J11A 1W3HA 2QQKA 2ZWZA 3ZLHA 5C4WC 1DXFA 3F7JA 1XYPA 2WMIA 3S6DA 3EPMA 2UY2A 3ITLA 3T4HB 3MC5A 5FZ6A 4PT6A 4C6LA 3PK7A 3S5YA 5EJ3A 3AIUA 1V9U2 4P08A 2I1OA 1QI2A 4XZMX 3OZPA 3WLPA 3T8LA 3OSDA 3AM2A 1I0DA 1TJ0A 5FUPA 5I06A 3B06A 3CJIC 3LM3A 1I6NA 4PDWC 1UZ0A 1CWPA 1VAHA 2PDQA 2YCLB 1ZAHA 3JW7A 4IFKA 2XYLA 5DMMA 2J1AA 2JDNA 1W9TA 3QYQA 1LENA 2PHUA 3LMZA 4DOUA 3EA1A 5A3LA 1V6VA 2ZX7A 4AZHA 3LNPA 2W63A 5GQBA 2JG9A 3TMQA 3QHOA 1U5IA 1M7XA 3MSYA 3BJTA 1WCUA 1XX1A 1UQZA 1QXJA 1UMLA 1OB0A 1QNVA 3JB8A 2TEPA 3K4ZA 5F8PA 1WW5A 2BXYA 2R1MA 4GIAA 4QDQA 3S5NA 3IUIA 1WA4A 3WG3A 1WXJA 1KRIA 3B5LB 1R30A 1ZBA3 3ZVXA 3BW4A 2R8WA 5DDJ1 2G50A 4B1LA 4H04A 1CD3G 3H7VA 1FNYA 4GVFA 3OLGA 4KGQA 2YCIX 2QMKA 1TA3B 4J3UA 2ORXA 1ASJ2 4L1WA 2DW7A 1S2VA 2AQVA 3GU9A 4R53A 2R063 3CPUA 3IAPA 4QPIA 2WSRA 4ZTYA 5AC5A 3FC0A 1BRLA 1VFUA 5DMNA 3NNTA 4CPBD 1IGWA 1ULCA 2DUOA 3N9MA 3BIWE 1VBA3 4Q1PA 1TNFA 2G8ZA 3U11A 4IV3A 4JX4A 3KVLA 5GLUA 4JN7A 1D4M3 4HHLA 3OG2A 3MIEA 1XDMA 4LOTA 1QY4A 4EPBC 4ZS2A 1RR2A 4DN1A 5JSPA 4DI8A 2RDWA 4JX6A 1UZDA 3OVQA 2IKJA 3NQ6A 6ENLA 2Z0IA 1N8WA 4S1FA 3APYA 4PTDA 2H6BA 2VRQA 3ZQ9A 3SCRA 1R64A 2HWE3 2RM23 3MI6A 4RHV1 2PZ0A 3ABQA 4CNOA 1SO4A 1DYPA 1SVDA 3EWBX 3RK8A 5EYYA 5I0DA 3COTA 3LCIA 4JTFA 2D7FA 3E5QA 5EZWA 1UQYA 3C7OA 4GXWA 4W93A 5EGRA 5I2UA 5CKNA 4FX6M 2X53S 2G9FA 3TYEA 1A8MA 3OY8A 4W65A 3UXKA 3UWZA 3K3NA 3C2EA 1X8CA 2QIIA 2VOKA 3TV8A 2QDDA 5ABFA 2BS9A 1R9XA 4OHXA 1ZS2A 5AB3A 2QEZA 3WQ7A 3AJZA 1TR9A 2JF7A 4HCHA 1TPWA 2I7GA 5FJJA 3EOEA 4K1GA 3CM4A 2DZAA 4TZDA 2HVMA 2ADEA 4Y3OA 2PA7A 3QH6A 4NVPA 3OIXA 4FX7A 1OLMA 3S4TA 4E4UA 3MW4A 3RRXA 2GH2A 3VUOA 1J6OA 2QUVA 3KHDA 3UFYA 1CXFA 3JUGA 3KZSA 4ERAA 2C6SA 1V7YA 1X7FA 1R5YA 1O94A 2EXJA 4FPGA 3KCLA 4MHUA 2DURA 4FI4A 3WINE 3AMLA 4SLIA 1OFAA 1LTEA 1O4TA 1VIZA 1IZ3A 4PLNA 5JPNB 1BZWA 1GHSA 3SQOA 2GNTA 2A3CA 1UOGA 4LUSA 3XIMA 1TR1A 4IEUA 1QWKA 5A1AA 4ZB0A 1CWYA 2G95A 4QSHA 2WWDA 4PDWB 1VAKA 1XSRA 4AISA 4ZGYA 3CJIB 5F5AA 1GLHA 5BXXA 2PAEA 5TBOA 5DN2A 3ITQA 4XFCA 4ZCWA 4H9XA 4OHWA 3O1VA 1Q8QA 3PZGA 3S1UA 2VGDA 4HMZA 2YR1A 3OVRA 1XB9A 4ASLA 5A6AA 3ITOA 5IK7A 2JD4A 2HK1A 2Z1VA 4INDA 1EBHA 2DSZA 3LPGA 2WJFA 4JICA 2OSYA 2XL7A 3B0YA 4BEUA 4AVBA 1N1TA 2DPEA 1J0YA 3DC0A 2A75A 3FDGA 3LHWA 3TOPA 4AVOA 3SUWA 4JQ3A 5FSDC 2V81A 4CNTA 2WWCA 1TO3A 4CD4A 1J5TA 4Q4V3 5C9RA 3GKFA 3P60A 2BU9A 2QJMA 1SW3A 1BTMA 3C5QA 4B5WA 1A5LC 5J1XA 3AMQA 1YUDA 1B30A 1H5YA 1H41A 5FYVA 1GCYA 2A6LA 4M7SA 2Z24A 5AVNA 1JOBA 5HOSA 1H2JA 4SBVA 1O5RA 4B7KA 4PUJA 1S2AA 2BYVE 4MFEA 4CEYC 2Q02A 4BXSV 2RS13 3VIHA 2VDIA 3BOFA 5G05L 2OQYA 1PBGA 1UH2A 1TPDA 1YXDA 3VBRA 4MX3A 1R0MA 3W1AA 5FLJA 1Q8AA 3LKJA 4UXAA 2XONA 4KCVA 2X2GA 4ZQCA 3WW3A 1R082 4NAEA 2WL1A 2E77A 1C29A 5L7OB 4GNVA 1XLEA 5CSSA 1OLME 4GK8A 1H62A 3EA2A 1P0KA 4L56A 2KR2A 2JKPA 2J7GA 1R3QA 2VEIA 3DG3A 3V7PA 1XHGA 5C3PA 4HCDA 2D44A 1N82A 5LNVA 4IGSA 5LA2A 1PYMA 2O9RA 1GU3A 3MJYA 2RS11 2KZHA 4WVMA 1SJCA 4MOZA 2JD9A 2VOWA 1GNYA 3HG4A 3B8DA 1GOOA 1RUI2 2IFRA 1AQMA 3VCRA 1B9BA 5J96B 5T5LA 3WT3A 2DT3A 2YBVA 2EAKA 1BMV2 4KWKA 3CHCA 3VBFB 3RJRA 1DYSA 5E0FA 2GWGA 5BPXA 3M16A 3VOHA 2NV9A 2JG8C 2WN2A 4R33A 2ISWA 3DN7A 4S2BA 3GW0A 1M04A 4QDRA 3T78A 2H9AA 4RZ5A 1DYKA 2YC2A 4Q27A 2I5IA 4PMVA 1TB3A 1VJIA 3L68A 4WSKA 2RS31 2BJSA 2WA3A 2WZEA 4P9WA 2VUDA 1XF0A 1TVNA 4QB2A 4BWOA 1W1YA 2PCQA 1BLIA 1FV3A 1UWUA 1VMHA 2YXXA 3MPBA 2DUPA 3VAVA 1WUFA 2W87A 4I7UA 4LO4B 1NDZA 1R3YA 2KX9A 3S6PA 3GKAA 4F48A 4RHV2 2XKPA 1YO8A 4MWAA 1G8WA 2BXZA 4ROQA 4PQ9A 3VGIA 1YADA 1AR62 2DVTA 3VV1A 4IUGA 3BAKA 3W1PA 2ZZQA 4CEUC 1VGAA 2PA6A 4XJZA 3UJSA 2ET1A 1WB0A 3V64A 2W47A 5HQMA 2BVDA 3A6OA 4WGHA 5HCBA 4DRVA 1QQP3 2VM8A 4M1RA 5CZSA 5D2XA 3VE9A 3T8QA 4MUVA 2Y7DA 3LHYA 4XJAA 1S5VA 4Z0SA 4WM7B 4Y9MA 3VD9A 3GNRA 1JJKA 3C2VA 3R58A 4TX6A 1DOSA 3BN6A 4L4LA 5BNKA 2R1KA 5ECUA 5ABJB 4ZR8A 5ABEA 2BVTA 2YKKA 5JWPA 5FUNA 4UQDA 2ZE0A 1I1XA 3W2MA 1O95A 4IE0A 1CXHA 3N4EA 3SCOA 4GD4A 1EO5A 1ENQA 2IXVA 1EA9C 1H7PA 3ZYGA 3ITXA 4DIAA 2NMOA 5FAGA 4DBEA 4GACA 4URAA 2CWSA 1DJQA 5HV4A 2PF8A 1YFUA 2Z4GA 5C5YA 3TSDA 3T0BA 4BI5A 5LBEA 3VPLA 5CFCA 3PIJA 4DS0A 2JG8A 4M6UA 4Y1ZA 1LWJA 3WH7A 3D0SA 1GV9A 4FXGB 1HRI3 1V6WA 3CV1A 2J22A 5JPMB 3AIWA 1D3CA 2BMBA 3PPCA 2GDVA 4AD4A 1G4TA 4Q0SA 1PX3A 1KB3A 1D7FA 8XIMA 4BF9A 3N7LA 3GR8A 1UY1A 4JDYA 5CCZA 3T1LA 3CH0A 3VIIA 2YCJA 4XO6A 4ET7A 2HEJA 3OQEA 1FX6A 4JYFA 3BG9A 4F0HA 2SLIA 1GJPA 1YFWA 1QNPA 1O3QA 2GC2A 4Z42C 2R042 5HNUA 2MEV2 1UXZA 1J6PA 3GH5A 3HGOA 1XH2A 5ACA3 4C6CA 4W89A 1RVKA 3SI9A 1WCSA 1JYVA 1CXKA 3S7EA 1FP8A 4LUIA 3L12A 3II1A 1UBSA 3LIGA 4PCNA 4AFMA 1K8YA 3TIMA 1OQ1A 3ZXKA 2DJLA 4PBGA 1C90A 1TEIA 2B4KA 2IW0A 1KD7A 2BQPA 5JMUA 1WDSA 3E5BA 1A3HA 4PBPA 1QBBA 2WC7A 2WT0A 1XIDA 5FO9B 6REQB 2BNMA 1XIJA 3TMLA 1E4LA 3PJXA 4WY0A 3M3QA 4Q5OA 4HNNA 4RZBA 3IIIA 1SGJA 4KCWA 2ZHLA 4OV4A 4R9AA 1W1ZA 3MP3A 4YN5A 4A8LA 1JU4A 4WVWA 3POWA 3QGAC 1Y3TA 3OPSA 2BP1A 4YVWB 3LSCA 1TNRA 5HMSA 4D6RA 1TPC1 1PGW1 1OHFA 3VK5A 5CC3A 2QCSB 1PX8A 4LTAA 2AL2A 3D3FA 3DN5A 3I3MA 3MI2A 1AW5A 2VMDA 4MG4A 1DJXA 5A8QA 4DO4A 3BOXA 3H4GA 3AJXA 3H55A 4NJKA 4PMQA 2J74A 3GDBA 2Y6HA 4FAHA 1BRLB 5EJZB 2DVDA 1VC4A 2GC0A 2P0OA 5FYMA 4AY1A 1IPKA 3EEZA 3T2OA 2A6NA 4COVA 3OGRA 4Q4X3 4IP4A 4GZ9A 4IWWA 1D8WA 4DB7A 3BYWA 2WZR3 1LBMA 2XBO1 1EJTC 4HK8A 3SLIA 3AJYA 3WQEA 3UJFA 4GIYA 3U5UA 4D6HA 1GGOA 2RS53 4CNUA 3VFLA 2QCNA 4PUDA 1LR5A 4WXZA 3IGHX 3MTWA 2YBKA 1GVYA 4P61A 3USZA 1DEDA 3Q4DA 4I3GA 4MNMA 5JR7B 4PCRA 4WIWA 3WLRA 3T7VA 1NLSA 1UD5A 3LXCA 3D4KA 1JOPA 1YNPA 5C3OA 2GPTA 3WP4A 1HJSA 4IICA 1UZYA 3GTFA 2X1RA 3TEYA 4XVDA 1LT7A 4S2FA 5A3HA 3G0UA 5DELA 5J36A 4XJ8A 5C2CA 2K9ZA 2EJAA 1PZ9A 2MUCA 2C0ZA 3N36A 4DZ5A 2DCYA 3WH9A 2P37A 4PRWA 1EQPA 2EO7A 3HWJA 4PI0A 2HK0A 1LHUA 1H4GA 5K0UC 1KNWA 4EP8C 4XIOA 5H1WA 2GZWA 4NHVA 2A1YA 2VR5A 1G01A 3WQFA 1U1UA 1X1OA 3LLXA 5FLHA 5LYRA 3TSBA 5HAOA 3W7PA 3VL8A 1AQ0A 2WNVC 2WC4A 4CUGA 4M0HA 4DQWA 5IK8A 1SFJA 4Q6XA 3NZGA 4WDTA 1LBLA 3QEZA 3GHTA 3KS6A 3RF9A 1QJU1 4QX1A 3VKLA 1TPB1 1TWWA 4U31A 1E6RA 1QHDA 1ASJ3 2J1UA 1H61A 2PDBA 4S39A 3TWAA 5DUVA 3GLCA 4AFDA 1BQCA 1MDLA 3DX5A 3NV4A 1O5QA 4IPPA 4XZIA 3CIXA 1BK0A 5FR3A 1KFWA 3M3OA 1K3IA 2CLEA 3QSRA 5LRRA 3MQTA 2C79A 1F5JA 3AMNA 2QPXA 5DBTA 1HL9A 4IGHA 1EYBA 4JIPA 5DCEA 1FMD2 5SV5A 1WZAA 4LC6A 1C8M1 2VP8A 3T0CA 4AU0A 2VW1A 4L61A 5EKYA 4B5TA 2E5BA 2FPYA 3T4CA 3ZJ7A 1EC9A 3EOUA 3KTSA 2HROA 4NRQA 2Q1FA 4QWNA 1XSKA 2DBIA 1GWJA 1CENA 1RD6A 3B8IA 4YWSA 2BHZA 3S30A 3VM5A 5JI9A 1EV11 2YUEA 4XZPA 5KINA 2VE1A 4LY8A 1DQ6A 4Q22A 5TD4A 4GB33 1HIXA 3F1QA 3FJNA 1MRQA 3MVTA 2B9VA 3R79A 1ZRDA 3GO2A 1PK6A 1GOKA 3BAIA 3H0OA 1X7NA 4ZZ8A 1NWTA 4PSPA 5EU9A 1T5AA 3EDEA 2IZWA 5D30A 2D98A 4GWIA 3SY8A 4BYYA 2Y85A 3WELA 1ZB5A 4QIUA 3LXAA 1CJPA 1JCNA 1US3A 1PO12 1GYLA 4Y1UA 3WDIA 3K4AA 5DG1A 5EV7A 3B9IA 2RR13 2BBVA 5A6SA 3GBEA 5AYZA 5KITA 5HBAA 2PP0A 4KL1A 4LO6B 3BPWA 2ZFAA 2IUWA 1DQ1A 9RUBA 2GC1A 7ENLA 1BPLB 4KWJA 3Q67A 5FKBA 1SCRA 1WMDA 2VHLA 2OVUA 1RVF3 2MNRA 2FZNA 4YU1A 3ENLA 1HQWA 5FXWA 2O7SA 4WZFA 4H8HA 1OQFA 2G9ZA 2PWHA 1RUJ1 3C8NA 4X22A 3E0LA 2PB1A 1J5SA 3GXIA 4ZQRA 3MLKA 3W3OA 7A3HA 2HE8A 2YSWA 3LSDA 2WQ4A 4NAOA 4KMQA 3SISA 3H8OA 2OB3A 2J62A 1ULOA 2NM1A 4C91A 4KPLA 2ODOA 2WZ8A 1QPQA 1BBT3 1YJKA 1X8EA 4ZXLA 4CEWA 3LIHA 5F4WA 1PIIA 4XSLA 3OZMA 3MCMA 1FYUA 1V6IA 2W92A 4QQOA 4QPYA 2J79A 3O07A 3TYDA 4ES4A 3URNA 1F4AA 4LXLA 3KP1A 4M19A 1RLDA 4D8AA 1E4NA 4UF0B 5L9BA 1OH3A 3GCXA 4Q7BA 3EYPA 3UESA 4YSFA 3OOXA 1T7LA 4JHTA 1H4HA 3Q8FA 2RGMA 3WF2A 1CZTA 6PTDA 4NQ1A 1GWKA 4KERA 4UTMA 3ARWA 3V5FA 1WDDA 3IANA 4N9IA 2ZX1A 3VBFC 3MWAA 3CS2A 4XFGA 2OJPA 4QX0A 4GQRA 1WX0A 5H91A 2Q3RA 4AEMA 1OI6A 2C18A 4B2DD 4E2BA 2A70A 4D71A 2G3FA 3WMLA 3MUY1 4B5NA 1OM0A 5IJRA 4MNLA 4PRTA 2OW4A 4O0QA 3S1WA 4WX2A 2Y88A 2NXHA 3P5YA 3EX4A 2CZ5A 1ECEA 2VC9A 3PB2A 2TUNA 4G7EB 2QTWB 3I2KA 4QG6A 4FA3A 3OGJA 4XETA 1SQ4A 4NZJA 3DUIA 3KDOA 1QWRA 3LFMA 3EOOA 1ZCOA 2VVSA 2WB5A 1HJWA 5FZLA 1GZ1A 2DTWA 1HT6A 5FMOS 5EY5A 3E6EA 1RUD1 3GU1A 3KV9A 1WCKA 4CTEA 4IXHA 1TRDA 2V6AA 1FDZA 5C2GA 1XNBA 5FP3A 4IGNA 2HPIA 4IL7A 3BQ6A 4KWOA 4LNYA 3NQ7A 4M4PA 1PHWA 5FACA 3RMJA 3QBQA 5T8GA 5FZBA 1Y4WA 3GHSA 3JZEA 4QX2A 3W83A 1P7TB 2HMCA 1BG9A 2QNKA 1QDCA 1VS1A 4M51A 2YZ5A 3SUUA 3MY9A 1CDGA 3HQNA 3UCCA 1QR7A 2QW5A 4NI8A 2X42A 4LF1A 4PF5A 3PZNA 4YYCA 1RITA 1ND2A 1BGGA 1HX0A 2W0XA 2C9KA 4BCUA 1W8HA 4W5UA 2LROA 2J27A 4AX7A 2YU1A 1KBBA 3SCNA 3T0TA 3AMMA 2QGYA 3E2VA 1HJVA 3MICA 3U0HA 1Z7AA 3GGLA 2QS8A 2XH2A 1UROA 3OPZA 2ADAA 7ODCA 1KM6A 1XWYA 2Z28A 3E1F1 4XFAA 5D38A 1W3TA 1MS1A 1QDSA 2HH9A 3E5XA 4R4XA 2OPJA 3EBVA 1TPEA 2R1BA 2PYTA 4CQBA 1BVNP 1QW7A 5F37A 5E0KA 2AQOA 1OCNA 2WYFA 4Q33A 1IF2A 1DWIM 3FWEA 4Y8FA 3W6MA 2NVCA 5GNYA 5C9XA 2WZR2 1RJ8A 2DUXA 5KHHA 2Y7GA 1XCFA 3WQOA 1B31A 4K8EA 4X9SA 3HTWA 5HMDA 1GW1A 3TNPB 2HBUA 5CBBA 4YW7A 1LRTA 2V9DA 4S3AA 1SZBA 5TF0A 3Q8AA 4DRRA 1W0MA 1RP9A 4LNCA 5LA1A 2QJVA 1P0DA 4MGGA 1LOEA 2CWXA 4E2QA 3ETQA 1ZRRA 3T07A 4AVAA 1JULA 1Y8BA 4RE2A 4HPKA 1TUFA 3PTQA 1VBUA 3AHVA 1EJWC 1PZ7A 1AW1A 1WAWA 4JV4A 2QVNA 2PDKA 2IWGB 1BQGA 2ACRA 4WGXA 4ZO6A 4JTJA 5ACA2 3UZZA 4Q3MA 5EB8A 3NQ2A 1XLFA 4N6EA 1K4HA 2QZ2A 3HNMA 1FWDC 1NFPA 3V1HA 3KRZA 1SJDA 1F61A 3OBEA 4G9SB 4GYPA 4FBFA 3SUTA 4CZSA 1GKPA 1KKRA 3AHYA 3KCOA 2DQXA 1O12A 3VBRB 1KS5A 1XS2A 1CPMA 5FTTC 1UWWA 2P0IA 3KM8A 1Q43A 2FCTA 3UPWA 2VVNA 4A21A 2XJTA 3RR4A 5BZAA 5CSUA 3A23A 3HPAA 4PDWA 3EJKA 1KGWA 2WS91 4JTQA 3GG1A 4NPRA 4OBRA 4WVXA 3VBSA 4KFNA 1HQTA 3LCGA 5AC4A 5JH1A 4GY0A 1JDCA 5D09A 1WMFA 1W6OB 4JTRA 1AL0G 4P9GA 2MPFA 1IZJA 2VTFA 3I7QA 3UW6A 5C9AB 4GFIA 1VFOA 1NCRB 4LVBA 4ZMGA 1E70M 1UWQA 3QN3A 1AL22 3TXZA 1SZFA 4CEYB 4RNHA 3WD2A 4AVCA 2H8ZA 3NGJA 4XACA 2XQXA 3BSGA 3SO7A 3FA3A 3OHIA 1W3NA 4D2JA 3QF0A 3CQJA 2C6QA 1FXZA 3QQWA 1GNHA 1DL3A 4XBLA 4XUNA 4JTCA 2DCKA 1XYBA 2XU2A 3OB8A 1DV7A 1F3WA 3LNMA 4DJFA 2V72A 5TSWA 4OUEA 2POZA 4MLJA 1H1AA 1SSDA 3M0IA 3LE0A 2VW2A 2GL5A 3EWUA 3ZKUA 1BG4A 1VBC2 1Y9QA 3DFYA 3FAXA 2PLKA 2WVTA 3LX9A 4QB1A 1A53A 2CL2A 2INEA 3BG3A 4LIVA 1XRSA 2EEXA 3V0SA 2QQWA 1XIEA 1TV4A 3N2MA 4NIIA 1O5XA 1NA1C 2BASA 3VABA 3QPEA 2WNNA 4BI6A 1MXDA 4XBNA 3QW4B 4F2TA 1QNRA 3FW6A 1W8WA 5FY7A 3FZ3A 3WCSA 5JAXA 2WQDA 2YGYA 2O8OA 1K3UA 1OURA 5CYYA 3C0QA 2ZGRA 1ICPA 4M0NA 5FOOA 3AFBA 3B8TA 3VNJA 2JECA 1KV5A 4V2VA 2PTYA 3KZ4C 4FIRA 4ASKA 4TU1A 2Z1XA 2X8KA 4TXEA 3J8F1 4H1ZA 3IDEA 1POV3 3KB5A 4YVPA 3GVGA 4OFGA 1WV2A 2I45A 1V6KA 1NUKA 4FPOB 4B1MA 1NIUA 5FCZA 3E3HA 4IV3C 1VAMA 5GNZA 4GYKA 1AQHA 3TN4A 1Z7S1 1EP1A 2X0SA 1T99A 2D5HA 3M0MA 1AL21 2VOMA 2GUYA 2Y61A 3AX4A 4HP5A 1SCSA 2J6VA 4LCRA 3SCHA 5JDBA 4OFCA 2ET7A 4CP2A 4RHV3 1EJXC 4UTJA 1J79A 1GHRA 4XXAA 3QFEA 3PWIA 2ZDSA 3CMJA 1EF3A 3B02A 2W1UA 5FP9A 2Z7KA 5E5CA 1M4WA 2DIJA 4R9XA 1XYMA 1LM1A 1UD1A 3UYCA 1OYAA 1B3WA 4RZ6A 1TTQA 4C7FA 1GKQA 1RUJ2 1YXYA 2JXAA 3NSMA 5FYCA 2P88A 3R4SA 2V68A 2V5KA 3BAWA 3KVBA 2ZUNA 4PBEA 1FVPA 2LTNA 3ZWSA 1BKHA 3ES8A 1GNZA 2WCSA 5DF0A 3A4UA 3MZ2A 4GCXA 4V1YA 1DKWA 2XIIA 5GZGA 3WLTA 2OSXA 4BE3A 4Y22B 2R061 3ZLFA 1EJSC 4E2SA 1QJX1 2ATSA 2CZEA 5I7GA 3W7EA 5CG0A 1Q4NX 3P3NA 2V5DA 2ZUSA 4EN0A 3M47A 3GX9A 1UX6A 4XIMA 2NSOA 4RJEA 3SUVA 1XBXA 1IR2A 5FFOC 4AZ5A 4GI8A 4FFGA 2VUYA 3NR0A 1VBHA 2OEKA 1V6YA 3SRHA 2Q8DA 1ZBCA 4O0ZA 3M41A 1VRH3 4GZJA 1E4IA 1HFBA 3AS2A 3PJTA 4YW4A 3LB9A 4LHLA 1YNYA 2WVUA 4DI9A 4N9DA 3H7JA 1WBLA 3AZRA 3AL5A 4UZSA 3O0XA 5BXPA 3M4HA 1M03A 2VWSA 4WEVX 4LVAA 4OCTA 9CGTA 2ZVRA 3F2CA 4WUIA 3WVJA 1TQJA 3DFTA 4G56A 1PMHX 3OOQA 3EB2A 2VO5A 1KXHA 4QTGA 4UQEA 3W02A 3L4UA 3AZTA 4GAZA 1FWJC 4HSHA 3ZZ1A 1LHNA 3NOYA 2R073 4MUZA 1L8PA 3VINA 3OLIA 4LITA 4AD0A 5BNOC 4BU2A 3DESA 1VBRA 4ZU4A 3VM7A 2Z26A 3P6LA 3MF6A 4E9KA 1OGBA 2NW0A 1H2LA 4KH9A 1RUD2 1JMUB 1SSGA 3PZOA 5F1VA 1E0WA 1LQ2A 3UQNA 1JZ4A 4GH4B 1C8QA 1RJQA 4UQAA 4ZOEA 3G24A 3RPQA 1J58A 1EWEA 1JXNA 1PVXA 1QPKA 4CCJA 1O59A 1FCUA 4CP9A 1PWMA 4PULA 1RMU1 1CIYA 1MSSA 2XHNA 3EPOA 1AXKA 4W6YA 4YARA 2YDQA 1K8CA 4HNLA 4GMP1 2CLKA 1CONA 3WR0A 1VR6A 4W8LA 1PX4A 3IIVA 4PN2A 3QD6A 2OU4A 2CXGA 4I90A 3NTYA 1KM1A 3RM8A 2W61A 4KCUA 2ZS6B 2VVFA 5CSRA 2O0OA 4JTLA 3AP4A 5MKGA 3CT7A 2Y6LA 4A3ZA 3VOGA 3HQUA 4O10A 4O1EA 1UU5A 1DJHA 1EYEA 3HD8B 5JMOA 2P2KA 3B8SA 1FOD2 3OLEA 1W0OA 2VUAA 2W68A 1BTCA 3LBOA 2IQDA 4XURA 3N7KA 5JXIA 1BD0A 1PKLA 3TK7A 2FLIA 1RUI1 2OT0A 4B5VA 3JVAA 3M1ZA 5T50A 4X9YA 3L2HA 4F0MA 2X29A 3EQEA 4Y96A 4UCFA 2D2JA 3T08A 2G3NA 1W9FA 3HAGA 4WXYA 4B5XA 4XW3A 3I4IA 3ZSEA 3W1MA 2GVYA 2VGFA 3WLSA 3TC3A 1ZJIA 2BG5A 5IAXA 4GIEA 1AYM3 1UQXA 3GXUA 3GM8A 1LGBA 5JIUA 3B9OA 5AYBA 1TQ5A 1PZ2A 1JUIA 5BNNC 2GQ3A 3UY7A 4QX3A 1OYBA 2ISSA 1BWKA 2XGIA 4XUYA 1SQ7A 2MANA 2RHPA 3AC0A 3E49A 5JOZA 3URAA 3TWIA 1L3JA 1GQHA 3FUOA 3AKTA 3HIJA 4LNVA 4ORMA 2VEGA 2UWAA 3VZJA 2Y5EA 4EF8A 3TOJA 4V1PA 4DAIA 4MADA 4A4AA 5LWBA 4KNCA 1A0CA 1DJZA 1QAPA 1NDVA 3UKVA 1DGLA 4FNPA 3G1FA 3EAUA 5A7QA 1XPYA 3WCZA 5FK7A 2J6XA 3DHFA 4Z2GA 3VZMA 3JUUA 5CJNA 1T6BX 3VZKA 1H6YA 1WA6X 1Z0HA 1K70A 3GFZA 3PBUA 1IQ8A 2P3JA 3NPWA 1UOKA 4LKFA 1XE8A 4O7XA 4RNJA 1D4M1 1QBAA 2YBSA 3UPBA 5EPDA 4G6CA 5AYXA 1J59A 4LMFA 4LY4A 2Y24A 5F4XA 4H9YA 5L9RA 4KGJA 4QQPA 1KCXA 2Y70A 2PMQA 4F83A 1POV0 3KRUA 4CU6A 5LBCA 3RPMA 3O0KA 1QH7A 1IZCA 4IH3A 2V2DA 2Q5TA 2I9UA 2J1RA 2YBTA 2EVXA 4UFIA 3R8GA 5FKCA 2XIBA 5DT7A 4AWTA 5FJOA 1VPQA 3W75A 2UY8A 2DFAA 2B7NA 1HQNA 2B7QA 3S2LA 3WLHA 3K8MA 1W6NA 2R7EB 5HWMA 3P7YA 1ITQA 2X2YA 2VC7A 4B2DA 3RM9A 1J3RA 1J0IA 4HPJA 1DJYA 2XLGA 5JLVA 2R062 2D73A 1JNDA 3W01A 1LG1A 3P2VA 3R43A 1CBGA 3WLKX 3SY5A 3UVIA 4QXHA 3W76A 2VZQA 3FKRA 1MEWA 4DHGA 2WVSA 3N9OA 2FZDA 3UBPC 1S2UA 4IT1A 1OD5A 4AI8A 2QGHA 4CQ9A 2Y8UA 3TYUA 4P9IA 4WM7C 1OIMA 2WAOA 3QH7A 2YX0A 3GWQA 3OF1A 4N53A 3D5HA 4F2UA 2OWCA 2FFCA 4LW7A 3AMHA 1RY8A 4UFLA 4LBUA 2J42A 3GDLA 1VPXA 2DTYA 4JX0A 5HQEA 2V82A 4I9TA 4E4ZA 2J1EA 1J3PA 3DCQA 4CN4A 4GINA 4WV8A 2WO7A 1RUSA 4JGZC 2DCJA 4GVHA 1OMIA 7CGTA 4JQTA 4LC8A 2WJEA 2POTA 4QROA 3GK0A 5D2VA 3SDOA 2CCRA 1KA9F 2XGBA 3D46A 2ZABA 2Y26A 4NRPA 3SQMA 3V65A 1H8VA 1YKWA 5HJLA 4WM8C 3AYSA 1XQKA 2WZIA 1YQCA 3H7UA 1JCJA 3DHDA 2E7AA 4OLLA 4QU2A 2OG9A 3WNKA 1VRH1 4AF0B 3HGRA 1WP6A 2VX4A 2NXIA 1BFNA 1I5ZA 4AVTA 4QM1A 2HRWA 3RU8X 5IHRA 1VH7A 1DGRN 3IMMA 4IOTA 2WO1A 3NGFA 2XN0A 1UMZA 3F4CA 1ZPTA 1XKJA 3RN6A 1FY6A 1QNSA 3LA7A 3GIPA 5D8AC 4MJZA 1MQQA 1LBFA 1DYOA 3NXFA 3LI0A 1A5AA 1SBFA 4O13A 1XLHA 4JGDA 1E55A 1AZ1A 4GYJA 1KXQA 1WD4A 3D8CA 2TSYA 3N9SA 1VYRA 1HUVA 3S57A 1OFSA 1A4MA 2GN3A 2VZPA 3M64A 2BOFX 3WDPP 2YB1A 1XRTA 1KBLA 1KTNA 4X3ZA 1ZBE3 4DM2A 3WEMA 1XYAA 3NL2A 5HI0A 4QGNA 3BAXA 2OZ8A 1JN2P 4RDYA 1VBE1 3LDBA 3PR2A 5J98B 4QNEA 4E4FA 5FZIA 1VRXA 1DZTA 1K9TA 2PU1A 3S46A 1JDFA 1YI7A 3IT8A 5IVJA 4TUFA 3B93A 2WNZA 4KBXA 4MVAA 1TVGA 5C7HA 1RUF2 2QUUA 4ONVA 2FDGA 1JCYA 1A5SA 3LDRA 1VEPA 2F6KA 3MW7A 2GSJA 5A7WB 2AKZA 4XDQA 2A7RA 3PUAA 2GLKA 1S3TC 3B3DA 1JPHA 5I0TA 3IVSA 5CJ5A 3SFKA 1OGGA 5DX7A 4J40A 1US2A 5H9QA 2RR12 1Q66A 3NCOA 3QFWA 4YW1A 1OLQA 1JOJA 1JDAA 2FD8A 2KD7A 3AMDA 3AZZA 3ZYFA 3R13A 3O1SA 3ARVA 2ZUVA 3VDDC 1Q45A 1KDMA 4IMFA 2ACQA 3D82A 4H19A 5EIYB 1L6GA 1CNVA 5BNNA 5FJPA 4MV2A 3O8AA 1JAKA 1QI5A 3GDTA 1XU1A 3TEWA 1ME8A 2QAPA 1R1A2 3FJLA 4COWA 1G67A 1XD1A 1KJRA 3W37A 1WBFA 1ZJBA 3WHUA 2DIEA 2VNRA 4Z2WA 1B35A 4AY7A 2ZEWA 4DPPA 5FY1A 2J77A 5C0QA 5C3SA 2GDUA 3K4WA 4E2VA 5FOJB 3M1HA 3U37A 1QO2A 3UR7A 4O65A 1A5OC 1W9BM 3PUIA 1DGRA 3SIZA 3DHPA 1R46A 4I7WA 1DG6A 3OODA 1ZAJA 3E0WA 1HJXA 4AD1A 4YXGA 3PBVA 2E67A 3ME3A 4J3SA 2GDQA 4ADSA 3TNQA 4IMGA 4P14A 2E9BA 1XJBA 6CGTA 3ZXGA 3E97A 4IJCA 1U0AA 3WX5A 3POSA 4I09A 4NUWA 4RDWA 2Y6GA 1FHLA 1NCQC 1RMU3 3MP4A 1SZGA 5A94A 4PCSA 1OCQA 2ATMA 3AUOA 3TQKA 3ZMNA 2WC3A 4Z82A 3LRKA 4OV9A 4RE3A 1YQ8A 1W3LA 5BYNA 1U5VA 1SLCA 1BXCA 4GNJA 4QGLA 3VDHA 2GH8A 3U3HA 3W29A 3LA2A 2OZTA 3ERPA 1AR73 1XH1A 3LBMA 2D3LA 2RDTA 4Q4MA 1WMEA 1EC8A 1ZBVA 2WRAA 4Z07A 2Z29A 3EWXA 3WQ8A 2ZMLA 3WLJA 2WZMA 1C8M2 4EQVA 2X1UA 2Z4FA 3QPZA 4RFRB 1VYSX 1LWIA 3A5FA 3GHRA 2OWWA 5I3JA 1IXNA 3MB9A 1NDWA 4PMYA 3IDAA 1DJNA 1F76A 1C1FA 1U30A 2WNUA 2VCMA 5D02A 5AZ0A 5KSWA 1GT8A 4AI3A 1JGMA 1FMD3 3PBYA 1ZHAA 2ZX3A 2A3AA 4X63A 5M0TA 2E5CA 1JR1A 3DFHA 1XE7A 3PPGA 4FMVA 5I93A 4GMP0 3MJMA 5AFDA 1IWBA 4XD3A 1GP6A 4HSNA 5XIAA 1HGWA 4F9JA 5FEWA 1SBEA 3S1GA 2JE7A 4EZ4A 3SMHA 3HNBM 2XG3A 1GEQA 3GBFA 2P76A 1CXEA 3R5EA 1QF3A 4DYJA 4NKCA 2VD8A 1X82A 3I3BA 2FDFA 1Q6FA 2OQ6A 3W7GA 2GMEA 2BV4A 4EOUA 3ZT7A 1LESA 1F6YA 3R0UA 1MS5A