2VNOA

Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
SRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CPE0329
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
total genus 42
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vnoA00
2VNGA 2VMIA 2VNRA 2VMHA 2VNOA 2YGLA 2VMGA 2YGMA
chains in the Genus database with same CATH superfamily
4LHLA 4P9JA 2OKXA 1RUD3 3DPRC 3QH6A 4AFAA 4M3CE 2A6ZA 4U36A 4LT5A 2AACA 4CDUA 5IVEA 5LW9A 3VD9A 3PVNA 4FXGB 5I0DA 3E5QA 1YFWA 2I74A 5F2WA 4ZU7A 1FNZA 1VLNA 4Q4V3 4CYDA 4EWDA 5K9YA 4AZZA 3ZN5A 3UT0A 1LB2A 4C91A 3GDBA 3POIA 2ZPXA 2Y64A 4XYXA 5K0UA 5F5CA 1OSGA 3WW2A 4E2QA 3CDZB 4Y33A 1UWWA 5JPNB 1YHFA 2DWRA 5L9VA 1NCQB 2WNOA 4YZ4A 3AX4A 4Q8LA 4LBQB 3HNMA 4UW3A 1AYM1 2W3JA 1OKOA 1O8SA 1GICA 1QGLA 2ZX1A 1BBT3 3RYRA 4D7SA 5A3LA 1EAH3 1W06A 2P17A 1ULOA 1QU0A 3MYXA 1FV3A 1MEC1 4ASKA 1HQWA 2RHPA 1PK6C 1MACA 2ZGNA 5G04L 4CUGA 3X29B 1LGNA 1SQ4A 5C6CA 4OHXA 5JCTA 1VBC2 3OYWB 4PLOA 1H9PA 3K3NA 1U0AA 2PTMA 1W6PB 2V5YA 1DIWA 5FY7A 3MDPA 1RUC2 2RM22 3DKQA 3JBG3 2O0OA 2H6CA 3N3HA 1W04A 4YW3A 3S6PA 2XVKA 4AEMA 1LGCA 1AX0A 2WKKA 3ZFFC 4V2VA 2HBUA 1ODNA 4QGMA 5BNPA 1IHMA 1SCRA 3VZLA 3ES1A 3VBOB 2ZGLA 3KT4A 3VDBA 1S4CA 1ZYBA 4I02A 1W2NA 3T0BA 4CUBA 2VAUA 1H8VA 4FFIA 4X8NA 2AREA 1XYNA 3E6BA 2WT0A 3EMRA 3LA2A 4RR3C 3RZZA 3EJKA 1POV0 2WO3A 3ZXGA 4COUA 2LALA 4OI1A 3WNMA 4GALA 4OUSA 3CJIB 1W9FA 4RL7A 4XJ9A 4RS5A 2D6NA 1FT9A 3C7FA 3EBRA 2JXAA 1RUG2 2WAOA 1I9RA 2JG8A 2VZRA 3U07A 1PGL2 2JG9C 3M70A 5BNOA 4XC9A 4XW3A 5FYUA 3RFRA 2FD8A 5JXHA 3EB7A 4P08A 3UKTA 5FLJA 1OOPC 1RUOA 1TMF2 1PO23 5I0TA 5T5PA 3R6SA 4FAGA 2BVBA 4DMIA 2WA3A 1J58A 1RUF3 4BQ3A 5C8WA 1F8VA 3VBFB 3VD7A 2ZHNA 4WVZA 2B42B 2DU1A 2ZZQA 5JIAA 2J1TA 2ILMA 5DDJ2 2H0BA 3POBA 3ZXEA 3ZVXA 5I0RA 5L7OB 1JZ2A 2GSYA 2NPIA 4XJUA 4YVWA 1XBFA 4ZZ5A 2YMZA 1K5MA 3TN92 3VLBB 2WS92 5D8AC 5C8CC 3OGGA 1XU2A 5KHGA 1CAVB 1HRI3 3K4AA 3KGZA 1HDKA 2JENA 4I0AA 3WP5A 2JX9A 3POSA 5FP7A 5T50A 1J3RA 5BYNA 1LOBA 2IXJA 4DY3A 4G3YC 4DUVA 5CYYA 3D5OA 2DU0A 3ECQA 2ZGSA 2VQTA 4O7XA 3U1XA 3DF0A 4CU8A 2C9AA 2VCBA 5IVVA 4CDWC 3A0KA 3T2PA 5EP9A 1LAJA 3IPVA 3BGAA 1TNFA 1YUDA 2BVVA 4LIUA 3OPWA 1Y9MA 5FLHA 2W1WA 3HWJA 5EPAA 4GA9A 4HBNA 4IEXA 5FOJB 4WZFA 5JR2A 3RZMA 2OS2A 3ZFFB 3ZSJA 2PYTA 4OI2A 4E9KA 1JTZX 1AR93 1UN1A 1WZXA 1OUSA 3MIGA 3HT2A 4FT8A 3I59B 4XILA 3ZX7A 1HRV2 1LRHA 5IVFA 5FREA 1WWYA 4GH4B 2RV9A 4C1XA 1G9BA 3H1YA 3HEIA 3LE0A 4FI9A 1AR62 1NKGA 2GMPA 1J84A 2WWUA 1VJ2A 2E7AA 4D8MA 3LDBA 4IV3A 4DUWA 1W2AX 2MEV3 4IGPA 4UOJA 2GNDA 4P02B 4CCLA 3VDDA 4D0QA 4XHXA 5HPOA 2WWSA 2CAUA 3FLPA 4D6SA 5FO8B 4OLLA 4BIFA 4PDWA 4JCKA 1US2A 4NPRA 3KZ4C 1NXMA 1VBC1 1C8M2 1H1IA 4TXWA 2D7FA 1XNKA 4DS0A 4R9BA 2RS33 3AYEA 4WM7C 4QAWA 1CJPA 1OQDA 2YC4A 4ZONA 4ISRA 2O14A 4EN0A 4M3CB 4UF0A 3WDWA 4R4ZA 1WCSA 1DGRA 3USUA 3V0BB 1VAVA 1GSLA 1ASJ2 5FOBB 4W50A 5FP9A 1VBA2 4P9LA 5DZFA 1AR72 1W6NA 1ND3B 2ZTNA 1GBGA 3ILNA 1XE0A 2PLV1 1SLTA 4MZUA 3VBSC 2XLGA 3ELNA 1PO13 1UOBA 1OQ1A 2VZQA 5KR7A 1WLTA 1DF0A 5SV8A 4XTMA 1O5LA 3INAA 2R062 3OBZA 3IMMA 3OBRA 4MGKE 1RUG1 4AHXA 5CFDB 1ZZBA 2C1FA 2ZKNA 1RHI2 5FV3A 4BQ4A 3DYPA 3K3OA 2Y6LA 2P3IA 2OUJA 1TMF1 4EN7B 2VZUA 3AXDA 2UYBA 4ASLA 3RZHA 1YCIA 2X5IB 3T2QA 1GOFA 3IN9A 5I8TA 2QQMA 2NQYA 5DDJ1 4CZSA 2IVIB 4AAXA 2B4KA 1RITA 3I2JA 3TEWA 3WQ1A 4H7LA 2D93A 1I1EA 5JI7A 5E89A 3TN91 2BUKA 5JMCA 1X33A 2WS91 1H2NA 1CD3G 2YU2A 4TLFA 1CX4A 1CONA 2BV4A 3SCFA 3U10A 4PQQA 1GV9A 1JHJA 4LK7A 2PAEA 2P3JA 2WNUC 3UJQA 1KITA 1LGBA 3LF7A 3ZYPA 1NLRA 2YUEA 5ACA2 4CDUC 4DXSA 5LB6A 3JD72 3VZMA 1FMD1 4F3JA 4L9BA 4UYBA 3MO4A 5FXWA 3MEPA 3TOJA 3AFKA 3ZIXA 4LLFA 4JTNA 2FDHA 1JN2P 3PTRB 1J59A 2D6LX 4YM3A 4PF1A 5K0UC 3WHUA 2A3XA 5H9QA 1DZQA 1NQDA 1AL21 4YM0A 4AI3A 2E7TA 3AMMA 3OF1A 2BW8A 2ARCA 4Q4X3 2VCAA 2RS53 3RI8A 3ILRA 1V6LA 1D0GA 1JYTA 2ENRA 5KHJA 2PAMA 5D1IA 4E4ZA 2VMDA 2B8MA 1RUD2 4QPWA 3VBSB 3ZSMA 1AR61 2GZWA 1RYYA 2XWJB 1DLLA 4CXYA 3AP9A 3KSCA 1VR3A 3AKQA 1UW8A 4Y5Z0 3UGFA 4PT6A 5GZDA 2ET7A 5BXXA 4Q4V2 1W8NA 4WM8A 3JB4C 2VG9A 1XNBA 3N9OA 4AQSA 5CFCB 3BALA 2X09A 1EP0A 3Q9OA 2WABA 1PVXA 2ZBJA 2KR2A 5FR3A 4Q0QA 3RWKX 2YXSA 4YGBA 1C8M1 5BNPC 2ZGOA 3KM5A 3WP4A 3HVDA 2ZHMA 5FY4A 3WP6A 3ZSKA 1G9DA 1BBT2 2R073 2V09A 1EAH2 4Y1ZA 3J7HA 4N7UA 4COZA 3OD0A 3NV4A 2WT1A 1VMHA 4QHOA 3VL8A 4HANA 3PU3A 3RZLA 4LK6A 4XJAA 4CDXA 3I2HA 4NIDA 4LBJA 1U12A 3IB3A 3PURA 3ZPOA 2P34A 4RS5C 1NT0A 4L2NA 1R1A1 2YBSA 2JG8C 2IXKA 5I0SA 1QKQA 1V6OA 5BNOC 3ZR5A 2NP0A 1C4RA 5M0TA 3RDIA 2XXZA 4YW4A 2ADDA 1JBCA 4AGVA 4NRPA 3ZFGA 2VZPA 4QB1A 3JBG2 1KS5A 2ARBA 5FMOS 1F31A 1S0BA 1BYHA 1QF3A 1OC1A 2XBO2 4MXWA 4X6RB 2GH2A 4AEDB 2R061 1W3XA 3RI9A 3AL6A 5K0UB 3GHNA 1O3TA 3H1MA 1H1AA 1QJX2 3WNOA 4YVWC 1GP5A 4LE4A 3EYPA 1TME3 1H4HA 1LOFA 3R4DB 4B4RA 1CAXA 3WDUA 1SFPA 2CGOA 4AHWA 2Z2SB 3GCWA 2NYYA 4E8DA 1W6MA 4R9CA 4H55A 4AVTA 4QGLA 1OLMA 4B3NA 3H7JA 1UKRA 3V65A 2QDNA 3LIGA 1TG7A 1W2UA 4KG0A 2JICA 1UY3A 3H1WA 2WYSA 3R0RA 1PO22 1WLDA 2RG4A 1OD5A 5A3TA 5IVJA 5DUUA 2CV6A 4NO4A 1RUF2 3CO2A 3POGA 5ACA1 3IIAA 4S2HA 4MADA 4PHZA 3JD71 5JOZA 2VZ3A 3A7QA 5EXOA 3GZEA 4KU7A 5C3OA 1XU1A 1S2EA 4QM9A 2W52A 3MIBA 3PU8A 1W9SA 1D4M1 5FZGA 2F6BA 3WHTA 1AZDA 5C3PA 1OVPA 2YROA 5FYIA 5F3EA 4YW2A 1HRI2 1MS8A 4Q27A 4ZS3A 5F3GA 3GYDA 2WRAA 2ZEXA 5HCHA 3NL1A 1M4WA 5FKCA 3ZXFA 4IV3C 4XXAA 2Y6FA 3MBWA 3HPNA 1VBB1 1N1TA 2EIEA 4JVAA 5FJHA 2G9GA 5FZLA 2JDZA 4LIVA 2ZX0A 4JQTA 1JS9A 2HH9A 1NZCA 2JG8B 5SV5A 4YW1A 4LLOA 1QJZA 1QDOA 1RUD1 4LBQD 4PDWC 3RZKA 1F9KA 2FCVA 5A6XA 1LHUA 4R8HA 5FPAA 4AFBA 3OBTA 3N9MA 2FDGA 2XL7A 4Q4V1 5JXIA 4YM2A 2XPJA 1AR92 4FPEA 4N53B 4GB32 2JWPA 2A6VA 3VN4A 3ST7A 3AKSA 4YVWB 2Q8DA 4XF3A 1K5MB 1Q5OA 1NCQA 2QQNA 2XGXA 1KDMA 3PIGA 4EQVA 5A7OA 2YZ4A 4URTA 1BBT1 1ALYA 3MF9A 4IEYA 5F39A 1UU4A 4P5HA 1CAWA 4P9WA 3VBRB 5GZGA 3B01A 5EWSA 3USSA 1KRIA 1H2MA 2ZGMA 4IE6A 2HEYF 3VB9A 5J48A 3IPVB 1NAEA 1F4HA 1SACA 3NKGA 2UURA 2W9XA 4FO9A 4PBPA 3N36A 3WY6A 4OCTA 5EFUA 3WINE 4AAPA 3D4KA 2OXBA 4HMZA 4SLIA 4LKDA 2SBAA 2OZ6A 1UOJA 3JBG1 2WUHA 2VBDA 2Z4FA 3OPTA 2C9KA 4P9XA 1J1LA 2C24A 3VHNA 2VO5A 3B94A 1QNWA 1ZVFA 3MLJA 3NNGA 3VBOA 3C3VA 5GLTA 1UO9A 2YGLA 2WO1A 3PL0A 3NNMA 3KV6A 3OOXA 3GM8A 1NCRB 2GP3A 1MZ5A 4FPHA 2XG3A 4LBLA 5E88A 1PO12 2XJSA 2XUEA 5L9BA 1AXZA 2F17A 3VDDB 1IS6A 4F83A 5GZCA 2GAUA 3WW1A 1A34A 5T52A 2YC2A 2WO2A 3THPA 4YVSB 2LROA 1DCSA 5FZ3A 5EJ1B 3K48A 1XC6A 4H3WA 1PO21 1W6OB 4IEZA 5C70A 3IMNA 3VBFA 1RUF1 4QU2A 3AJYA 4A6SA 3FHAA 4CEYB 1XPWA 1XXNA 1QNYA 3LAGA 1F4AA 1X9PA 1W0PA 3KT1A 3MLKA 1U5IA 4OQ9A 5L36A 4I0BA 4QWNA 4YWAA 3AZWA 1HRI1 2Y6JA 1RXFA 3F2ZA 3TEXA 2AYHA 2WYFA 2XJTA 4XFIA 1K12A 3ZXAC 2CYFA 3O1UA 1PNGA 4PIZA 5FIXA 4QHZA 4LJHA 3CL1A 4QX0A 4A42A 5FFOC 5C4WB 1N1YA 1GOGA 1EUTA 2ETEA 2MNGA 2OT7A 3HNBM 4OI0A 4XIKA 5EHDA 4P14A 4N9HA 1V6KA 3OTFA 1F5JA 3R05A 1ENQA 3HQUA 3QBQA 4HKOA 4BQWA 4CU6A 3RJ2X 3GGLA 4LORA 4Q4X2 1WBLA 1AR91 1P8JA 2RS52 1QEXA 3R4SA 4JKLA 1FAYA 2PHUA 1AYN3 4K21A 4GH4A 2P37A 4CDXC 4FBFA 2WSUA 1OFNA 1XNAA 4BQ2A 3FHQA 2VY0A 1REDA 2BZDA 3M1HA 4MGZE 2SLIA 4WV8A 2VC9A 2MEV1 1EUUA 2GNMA 1ZNPA 2JKXA 4LR4A 4NN0A 4ZHNA 3ZFGC 4OUEA 1OUXA 5A1FA 1D2SA 3NJXA 2F4PA 4EWEA 4HVQA 3PJYA 4YM1A 1H6XA 2ZEZA 2ES3A 3NJZA 4MGTA 4JAAA 2HJIA 2XOMA 1PGSA 2ZMKA 5HXVA 2RS31 2QJVA 3AFGA 2XQXA 2R072 1OF3A 4YFZA 4EROA 1LOFC 4YYOA 3LEIA 3LB9A 3V0BA 3KWVA 3ZIWA 5JUVA 1WCUA 3N9QA 4FPLA 1VRBA 2OQ6A 2BNNA 3VD4A 2Y60A 3TRSB 5FDBA 1ND3A 2WLPA 1H30A 3E1F1 2E51A 2ZGTA 4HKWA 4PIXA 4E4HA 4HK9A 4XFHA 1POQA 5T54A 2BBAA 1Q56A 5BNNB 1WW7A 1GU3A 2QQUA 2RR13 4IQPA 1PO11 5CADA 4Q1PA 2P2KA 1WCQA 4Y1VA 4XDQA 4MGSA 4WM8B 4A2UA 2WQ4A 2E31A 3RG0A 3ORJA 5CFDA 4K8RB 2WBKA 3PUIA 4QHBA 1VBE3 2W39A 4PIYA 3ZSEA 4ARXA 1AYM2 4KGQA 4XEZA 1TME2 2RS13 4NJ4A 5AVPA 1KXGA 4CP9A 4UBHA 4BU2A 1UMZA 3WF2A 2X5IA 1ST8A 4HOOA 1H2LA 3ITQA 5FY9A 1C57A 5CIRA 2ZABA 2BWCA 5FTTC 3AVSA 3WW4A 1JZ3A 2ZEWA 4IV1A 1IGOA 1R1A3 1W8TA 2VUAA 3ZR6A 5AFBA 4BH9A 4QX3A 3CJXA 3THCA 2MHFA 4YW5A 4BMBA 1AXKA 5LASA 3VZNA 1HIXA 4LOTA 2TNFA 1IZ3A 2D43A 3JCIA 5L9RA 5ANNA 4LKFA 4DFSA 2QQJA 2FMDA 4MOAA 4MSVA 2OUHA 2XUMA 3ZXJA 1JZ6A 2TEPA 2X8KA 1D7PM 4WVMA 3K4ZA 4BQXA 3WV6A 2GNTA 2EAAA 4RQPB 1NCQC 1QJEA 3ZKYA 2D40A 4Z8BA 4E2GA 5GM0A 3SKJE 1VMFA 1JH5A 1OQEA 2FBEA 3PMEA 3CU7A 2GDFA 4Q1RA 4Q4X1 2VUCA 5EZWA 1IKPA 4DEVA 4YZ5A 2WQZC 1DQ0A 4IE4A 4XF4A 5IVBA 1WD4A 2DVBA 4YW7A 1JYIA 1QOTA 4R52A 1I3HA 3QACA 5FCCA 2E53A 4NOTA 1URXA 4XUQA 3IDBB 2YHJA 4N7IA 4YSFA 2JEMA 3PHMA 4RHV1 3H8OA 1J83A 3LZZA 2AZ5A 4FPOB 4UI9L 3RVHA 4BZ4A 3A23A 3VHRA 3CQOA 2Q0AA 1GZTA 4XFAA 5JOWA 1PZ9A 5CFCA 4YZ2A 1YQ8A 3SLIA 1D4M3 4XPVA 3DL3A 1DQ4A 5DUWA 4B1LA 4YFWA 3AMHA 4YGEA 3ZSLA 3VBOC 4QX8A 2EIBA 1DZRA 1QDCA 3FMGA 4K20A 4XOGA 5KHHA 5A80A 3V56A 3RJRA 4IE5A 2CGPA 2R071 2VH9A 5T5LA 1HV1A 4LEJA 4U2AA 3ZM8A 1LU2A 5FYZA 2A6WA 3MIEA 3KQ4B 3ZYJB 3HR9A 4QDRA 5DABA 2OX0A 3BOPA 4HL0A 4QQHA 4YNIA 3BUCA 4FPYA 1BLZA 4BIOA 1GNYA 3SXWA 3L2HA 5DQ0A 2HWE3 3UGHA 1VRH3 5GKAC 5J3UA 1C8NA 1BZWA 4P9IA 3AP5A 3K2OA 1WD3A 2HWD3 1UY0A 3AYAA 5J96B 5JXJA 1SLCA 2V73A 1LOEA 2YGMA 4AEDA 3VBFC 4Q5OA 3I3BA 1HN0A 5KWRA 1FV2A 2GN3A 4CCCA 3I8TA 4V1PA 2XJRA 3FJSA 5L7OC 4GKYA 4B7KA 4GIQA 3QOPA 1CN1A 1XSRA 3GZUC 3R4UA 1TME1 1R64A 4XJZA 3OB8A 5F37A 3BIEA 1I6XA 1OMIA 4XBLA 1CAWB 2IXIA 1LHVA 2RDQA 2R30A 1V9U1 3CLPA 2A75A 3SEPA 4KWKA 1MPXA 2D3PA 2B39A 1JI6A 1L3JA 5B4XA 4OFGA 2JJ6A 1O3QA 2X05A 4OMCA 3WG1A 3ZOIA 4K7JA 4ZU5A 4DO0A 1Z0HA 4Y1XA 1QQP3 5FXVA 3HBZA 1C5HA 1FXZA 1GZWA 1DYPA 1S0IA 3LD8A 4E4SA 1UCXA 2ARAA 2VJXA 4HSJA 4IEPA 4DXZA 2LS6A 3NQHA 1RJ8A 1YIPA 5JWPA 5CZKA 1TVGA 4UFHA 1RUH3 1MVQA 4L99A 1GWKA 1PHMA 3DYOA 3IAQA 5C5TA 2PLV2 2ZZJA 4GH4C 4AGGA 2AH2A 4ITCA 5LA0A 4YZ3A 2Z42A 5FP8A 1XJAA 5F3IA 3ME2A 5LY1A 4O9GA 1G9FA 3ETPA 4HPKB 2ORXA 3WNLA 2RDSA 4XMAA 3IKWA 1NE6A 1SHWB 3NNLA 5D2AA 3KVBA 2W91A 3RS6A 4RYDA 4DPNA 2JDUA 3GZTB 3UGGA 2FDFA 3BN6A 3RSJA 4AHZA 4YARA 4XQWA 1SBEA 3IDAA 4XBNA 1C5IA 4CCKA 2J22A 1JYXA 1ZZ8A 4BJ0A 1S0CA 2RJLA 4EWAA 1DGLA 3ZFEB 2JB8A 3H7YA 5GLVA 2DBIA 2LRPA 4Z1VA 2EICA 4NHXA 1UX7A 4CCMA 2TUNA 3SCGA 4N53A 2VBBA 3HJRA 1WW6A 2H0VA 2JE8A 4ORFA 3ZXLA 3I2OA 3GBWA 3T4VA 1AYN2 3KLSA 4QPIB 1CZTA 5HCBA 1RUJ3 1SDDB 1ZBA3 4AI9A 3S5AA 3SCHA 4LBOA 3KB5A 1C1FA 1ND3C 3GF6A 2VW2A 2VTXJ 4AW7A 5FPVA 2IFRA 3VBRA 1OH3A 4FPJA 2YPDA 3SQOA 3ON7A 3W58A 3TEZA 1BK1A 2CGNA 1FMD2 5FJKA 5FZKA 2IZWA 1X7NA 4XXPA 1KD7A 5DG2A 1UKGA 4HLTA 4EJRA 3KQRA 1RINA 5CFDC 1JUIA 4XBQA 3I3DA 3V0AA 5E6HA 2CL2A 2UYAA 3C8XA 2VCMA 2BGOA 1DHKB 1O8PA 4O9EA 4P00B 2BWAA 1AL22 2AR6A 3H8XA 5FZHA 5A3UA 4N43A 2BJSA 3AZXA 2XVGA 2JD4A 1AR83 2DCJA 3OUIA 3P6BA 4C0BA 1SLAA 3KGLA 2ZACA 2X5IC 2B9VA 3GJBA 5F32A 1JYNA 3ZPYA 3I4IA 4PJYA 2VXJA 4I0WB 3UK9A 4BCUA 1JHNA 2CAVA 1O91A 2WR9A 1EPWA 1AL0G 1IS5A 1WBFA 2XL9A 1H6YA 4CCOA 3J8F1 4UWDA 1NCRA 2PHWA 4XFCA 4XUTA 2WNEA 1HLCA 2RR12 1UIJA 1VE0A 2ARXA 1UY4A 5CG8A 1Q8SA 4BDVB 2WZ8A 4GWMA 4HFSA 4C8DA 1KS4A 4MXVA 2Y6GA 3SISA 5CEHA 3ACHA 2ZX3A 4B7EA 4YVSA 5FK7A 3WNXA 1VBE2 4Q2FA 1EV13 4XFGA 1QH6A 2DTYA 5J37A 1PX3A 4O61A 1W6OA 4AWDA 2RS12 4URAA 5C3QA 1WCKA 3G6JB 3LQCA 5LA2A 4CEYA 2BEOA 1FX5A 3OY8A 4P9GA 4FFHA 1R083 1W2OA 2HWB3 5C3RA 5FY5A 2G19A 3UKVA 5IHRA 1LR5A 5A70A 2B45X 1RXGA 1ZRDA 1REFA 2VECA 2IXLA 3K75B 1R1A2 4NIIA 1H8TA 3J26N 4L0PA 4NAOA 3KMHA 1MQTB 3OGVA 3RGBA 3FUOA 1J1TA 3I2DA 2VE1A 2QQPA 3OUHA 5J09A 4LE3A 4P9YA 1C3HA 1X8EA 3PMSA 3QLQA 1VMJA 1IG3A 5C4WA 2JE9A 1DGRN 2DTWA 5CFCC 1IQAA 1ACCA 4IL7A 4HK8A 3N7KA 1WA6X 3I2GA 4M00A 4ZKTB 5FPBA 1O59A 2K0GA 2W94A 3NRUA 4CP9B 4XZPA 4H2AA 4BISA 3O1OA 3A0NA 2QNKA 5AVAA 2Q8CA 4XUOA 2WINB 3I2KA 2GU9A 2ZGPA 3P3PA 5EIYB 1AYN1 1NOVA 4XVHA 1LHOA 1O4ZA 2RVAA 1V0AA 4IV1B 3J7LA 3RNSA 3MFCA 5IFTA 1KEXA 3O1TA 3WG3A 3APBA 3RZJA 1ZZCA 3B3QE 3NWKA 4INDA 3VKMA 4B4PA 1HB2A 1UPSA 3W5MA 3MW3A 3I3MA 3VUOA 3WR0A 2JE7A 2VNRA 1UD1A 1CGPA 1LOGA 1UYYA 2YPJA 4QKFA 1IS3A 5LBFA 4AEDC 1D4M2 4D6QA 4HT1T 3NW4A 2VULA 4XTPA 5BY5A 4WVMB 5FZ6A 1DGWX 2GN7A 2E32A 2CSGA 3ILFA 2KM2A 4DEQA 4IE0A 1YFUA 4OHYA 5DAVA 1GQPA 4CCDA 4CDQB 4LO6B 4ARYA 4L97A 4WVVA 1MS0A 4GWIA 3BCWA 3ZLIA 1NG0A 4JDMA 4AI0A 3B02A 5F2SA 5IVYA 4A3XA 3LFMA 5F6LB 1VBB2 4JGZB 1LNSA 1UMIA 1RUI3 2E33A 1YEWA 4AVSA 3H0OA 2VOTA 4Q0PA 3VKFC 3U4XA 2ZX4A 3PUHA 4XQ4A 1N3PA 1W9WA 1VRH2 2HWE2 4CUCA 3AZVA 5FP4A 5DZGA 1A6CA 5FZEA 3ACGA 5BNNA 3FFZA 5C71A 4RHV3 1XRUA 1GR3A 2P5BA 1HQLA 1ZZ6A 2RR11 4Q26A 5T3NA 4J1XA 1JU4A 4ES9A 5FXZA 2HWD2 4CU9A 5E8AA 4JX0A 1R093 2GC2A 2R0FA 4ZU4A 1MS5A 2Y0OA 2FCUA 2QVSB 3VD5A 4QB2A 4ASMB 3NMBA 3QD6A 3W20A 2D3SA 2EAKA 5EYYA 1A8DA 1J3QA 1GFF2 1VBE1 2WNVB 5AFEA 1XYOA 1TE1B 1MR5A 1AXYA 2WN2A 3B93A 1DG6A 4LHNA 4M4PA 5DAQA 1ULDA 2P6CA 4QXHA 1S2KA 2RS11 3H8RA 3BVCA 4MLOA 1RTVA 2VCCA 2WA4A 1UZYA 2WWJA 3PJQA 1IG0A 2EXKA 1XNCA 4UFIA 5GZFA 5LY2A 2AEYA 4Y1YA 3D0JA 2PAKA 2PHDA 4LO8A 2ZA9A 5FO7B 3WQ0A 5F3CA 1PIV3 4M4RA 5KC6A 1OVSA 1Z78A 4G9SB 1KGYA 3O1PA 1QHDA 1Q8QA 4KGGA 3E5UA 1ZZ9A 2EALA 1S0GA 1LESA 1QQP2 5DG1A 5AC93 4UAPA 3GXUA 1JXNA 1V6MA 3BPSA 2XKOA 2VQAA 1XNTA 3OCPA 3ZYRA 4OYUA 5IW0A 5FQ0B 2WSVA 4N53C 2J1AA 1RUH2 1ENRA 3M3EA 3N9LA 1IPJA 3I2IA 3TNQA 4IESA 4FCAA 2A7AA 3MPBA 4GD4A 3L2YA 1K5MC 4QMAA 3T4HB 4RQPA 2R043 3KD4A 4I3PA 1CIWA 1EYBA 3CKHA 1TZOA 2P3YA 5DAXA 5I8YA 1LHNA 3MV11 1V9U3 3VBRC 5FWJA 2ZAAA 3OBAA 1NA1B 5F5IA 3C2UA 1QY4A 4QD2A 4F8AA 4JHTA 3NKTA 4GWNA 3OGJA 4Y5SA 3W59A 1DGWA 1AX1A 4MGYE 2QZ2A 3ZYGA 4A7ZA 5HI0A 4Z82A 2ADEA 4P5YA 3W5NA 2Y6HA 3E6DA 2QBXA 1SZBA 3AB0A 3VKOA 1GZWB 3CEWA 4TZDA 1S2BA 2P1BA 3WX5A 2VZVA 1CWPA 3ZMNA 1SMVA 1ULCA 1Y9QA 5LEKA 2ZMNA 1D2QA 4KI5M 5DUVA 3AVRA 3ZMOA 2CU5A 2QFEA 4AQTA 4UW4A 2OZJA 1RUJ2 5JI9A 3LWCA 4AGRA 1OA2A 3SHRA 3U37A 4WZCA 2IC1A 2QE3A 4GQ7A 2JECA 1NCRC 4CP2A 3B69A 3H50A 1DQ1A 1U5YA 5A7WB 1Q8OA 2W92A 2XHNA 4CEWB 2Y33A 3JUUA 3VDDC 1YIFA 4E2SA 5LA1A 1YFXA 2CTVA 2VR4A 2A3YA 4Y22A 2YFZA 4J6GA 4QQOA 4FOWA 1ZRFA 4MO3M 1ZA4A 4RD7A 4XAAA 2HWE1 1CVNA 1VRH1 3Q8BA 4YVSC 5FYBA 3NSTA 1LKNA 2BOJA 1PGW2 4BYYA 5FBZA 1UL9A 2PQSA 4RGKA 5JXGA 4LMFA 4KMQA 2JB4A 1AR82 2HWD1 2XJQA 4KBBA 5J7MA 3VV1A 4JRLA 4MUVA 4CEYC 2O8QA 4IGQA 4XJ8A 2BPA2 2UY9A 4XURA 1RB8G 2VVDA 1YNAA 4W6XA 3WNNA 1OKQA 4MH0E 1HB1A 1LHWA 2WFPA 1UZWA 2BFUS 1SLIA 2VMIA 2JDMA 3ZO0B 1C28A 1H8TC 3CMGA 2MEV2 2X29A 3WG4A 4QXKA 4JKKA 4TTGA 1W0OA 2ERFA 4NAMA 1O3RA 1DU3D 2YBKA 1UYXA 4IEOA 4JGYA 3KHBA 5FY1A 4RGAA 5C4WC 2D6KA 3DCQA 3V0AB 1DBNA 4BXSV 5A6ZA 1EV12 4BQ1A 1XSQA 4I2OA 5IT6A 2FHRA 2RS32 3FL7A 5F7UA 1CIYA 1QQP1 3ES4A 4N43B 3EQEA 1Z7S3 4RFRB 3WDYA 3DYMA 1VAMA 4JC1A 4W8JA 4NIAA 1R082 2HWB2 4E4DX 4EZHA 4PLMA 1CR7A 2HEWF 1RUH1 2VOWA 4GXLA 4FXKB 3MIHA 2DUPA 3MLLA 2YFUA 1YRZA 3K51A 3T3YA 1BXHA 3J8F3 3OGRA 2HWF3 1T6BX 5FRAA 1HB3A 3DXUA 4N90A 1B09A 1YWKA 3DUIA 4HPKA 1K42A 1UNBA 1WMXA 3AYDA 4UFKA 1G86A 3VKNA 4J1WA 4KG8A 3NJYA 5DZEA 2J1UA 5IJRA 1WMEA 1WMDA 4HVRA 2ATFA 1C1LA 2C26A 2P6HA 4K1ZA 4PCRA 4FPFA 4Q4W3 2UU8A 2PN5A 5ABJA 2GNBA 2VMHA 2DVDA 5E16A 1NUKA 3QCWA 3ZFEA 3LOBA 1GWLA 1HKDA 1JZ5A 3HOBA 1W3VA 4TN7A 3AK0A 5A3WA 2PHFA 1CQ9A 2VPVA 3OY8B 4PLNA 4W4ZA 2EXIA 4D94A 5JZGA 2BDRA 1LCLA 4QPIA 1W05A 2KD7A 2GH8A 4ET7A 2QQOA 3DN7A 1HW5A 1RUJ1 1ZBA1 3LPGA 4DZGA 4HN1A 1CESA 1H8TB 2BGCA 2HKXA 3GBGA 1PZ8A 2A6XA 5FLIA 2DDUA 2FDKA 1OLRA 3FLRA 5BNNC 2EIGA 3FHIB 4AFCA 4CSWA 4W65A 3POEA 3URFA 1SEFA 1FNYA 1AF9A 3HBKA 1SBDA 3J4UH 4GZ9A 2RM23 5FZAA 4OHZA 4FAHA 4BK5A 1GOHA 3LSDA 4ZXKA 4WM8C 4HKLA 1QMJA 1YQ5A 4FPKA 1YFYA 1X82A 4XFFA 4K1YA 4LOSA 4A41A 1OPOA 3SMHA 4OHVA 1QJY3 3D0SA 4CVUA 1JZ7A 5J1XA 5GLWA 1JMUB 4I30A 5KC5A 1LU1A 1PGW1 2ET1A 3WF4A 4ZS2A 5CKQA 5FZMA 5FZIA 1AR81 5ERLA 4LUMA 2UWAA 3BI3A 3LOIA 1AX2A 1DQ2A 1MS3A 1ZA7A 3UV9A 3WDXA 2ZX2A 1RUI2 1KQRA 2QZ3A 3T09A 2ZAHA 1W90A 3VBUB 4XABA 5FWEA 4D3WA 4LBNA 1V6NA 2MPFA 4NHKA 1BQPA 1KJLA 2ZCWA 3ZN6B 4RHV2 3IDCB 3VZJA 1YQ6A 3I54A 1CJDA 1UX6A 2OYZA 2D6MA 4QQ2A 2VUJA 3WXPA 4NIGA 2ZS6B 4PF5A 1R092 5FYYA 1W9YA 3U75A 2BERA 4RA0A 3DV8A 4DUXA 1DDLA 2W47A 5FZBA 2VQ0A 5CKMA 2X10A 3P3NA 1EV11 4A44A 3H3LA 4IUGA 1HX6A 2R1BA 4KWUA 1SDWA 3WLUA 2BFUL 5L73A 5FZ4A 5FPXA 4RQPC 3ABZA 3KV4A 2K9ZA 1GQGA 2XHKA 1Q8PA 5A7QA 5HCAA 5IUQA 1R081 2HWB1 4FP3A 4JRAA 5APAA 3MHZA 3ZDVA 4EE2A 2XR4A 1PIV2 4R9AA 4YW6A 4AEJA 4AYUA 5BUVA 3I3QA 3VBHB 3A22A 5CNAA 5FMBA 2RDNA 2YB7A 1GLHA 1MQTA 4HG6B 5A7SA 3ZYIB 5IK7A 1VBD3 2GC3A 2PQQA 1HQNA 4S2DA 2Y0IA 4XF1A 1RUE3 2WO7A 3KF3A 1FI2A 3M3QA 2YYOA 3U4SA 5AC92 2Q4SA 1VALA 3AYCA 4PI0A 3FE5A 4A6OA 1YI9A 1OH4A 5A33A 3ACFA 4NHMA 5JIUA 4XACA 2E26A 4EZ4A 3WUDA 4NE9A 1KJRA 3K4DA 2PHLA 4XF0A 4C90A 2GC1A 1BJQA 4JHZA 4OHWA 4LO4B 1GNHA 4GMP3 1ULGA 2Q1ZB 2R042 1DLCA 4YGCA 4BWOA 4CP1A 3WW3A 3HD8B 3NAPA 5H9RA 3N35A 1QXJA 1Q43A 1V9U2 1VIWB 5A7NA 2GC0A 1W28A 3CBNA 1QH7A 5FMCA 3VDCA 4BHPA 3MZHA 1CZSA 4B8EA 3GHMA 3WZ1A 5C9AB 4K8FA 3T2OA 2W0XA 3AKTA 3OEBA 5LBEA 4AFDA 4EYUA 5LA9A 2W08A 3I2FA 4EN6B 5KXDA 2YDEA 4NROA 5JSRA 1Q8VA 2BU9A 2Q1MA 3ATGA 3ZN4A 2WZEA 4AI2A 3F95A 2OIIA 5C33A 4C0HA 2BYVE 2WT2A 3D82A 5FZ8A 4Z2AA 1SLBA 1RMU3 1UZ0A 2PHXA 2GP5A 2Z79A 4V2WA 4CXXA 4QU1A 1ULEA 1PMHX 3KVAA 2IXCA 1NYWA 4C1WA 1VB4A 4LHSA 4AOCA 3ZXDA 5A1LA 4B29A 4CDQA 3WP3A 5A6QA 1CX1A 4QXBA 4QX7A 4AQ6A 3KV9A 2W95A 1TQ5A 2W1UA 3VHPA 1SFYA 4XCAA 5BPXA 4JGZA 3AMPA 4JV4A 5DN2A 1RUI1 2J42A 4UFLA 1JZ8A 2VOXA 4KWLA 4OZOA 3HQRA 2Y38A 4JGYC 4M0HA 1FOD3 1T6GC 1W39A 1NQJA 1VP6A 2BP6A 3J7MA 4XDOA 5FZOB 1N3OA 2DFBA 2YC0A 4DNYA 2A70A 1ULFA 2V4AA 3DXTA 3W9AA 1R091 1ZM1A 2QQIA 3KS7A 5FY0A 3N7JA 2WJSA 2J7MA 4HETA 3WCSA 2AENA 2GMMA 2CY6A 4IEWA 1QJFA 2OPWA 2OW4A 3BU7A 3MPPG 2ZOEB 4LHKA 2WNVA 4OVEA 4BXFA 4DB5A 3EXUA 5HCFA 1UMHA 4H7MA 2XH6A 1G9AA 1ZRIA 1JYWA 2XJUA 2DCKA 1MVEA 5IWFA 4QX2A 2VMEA 1J3PA 4LXLA 3MIFA 3Q8EA 5D21A 3SNMA 3ZYHA 4JKMA 2GALA 3MV01 3PVOA 4GMP0 4ES8A 2ID4A 4A45A 4BQYA 5CA6A 3IIIA 3U78A 5IYYA 3LEMA 1XQNA 4I01A 5GZEA 1IOAA 1PIV1 4Y22B 3PDQA 2HWC3 4TSVA 2WIIB 4NHYA 4QQLA 4Y24A 3THDA 5ABJC 1POV3 2IXHA 2ZMLA 5AC91 4UFMA 5JPMB 4PBOA 3ZFEC 2CWSA 2C0ZA 1DYKA 3IT8A 5CBLA 1JOJA 1Z7S2 3A4UA 4KH9A 4Y3OA 4FOYA 4QQPA 3M2MA 1PX4A 4E8CA 5FQ0A 2X53S 3AP7A 4WVWA 1S55A 4XAEA 4IW3A 5LRRA 2D98A 3BTZA 5JZGC 1I5PA 3OGSA 5FBJA 3J8F2 4QPIC 4CCNA 3SC7X 3OG2A 1PM4A 2R041 2P4EA 2WNUA 3JQXA 2W46A 3AZZA 2YBPA 2PHTA 1NA1A 3KCYA 4NRMA 4CP0A 4XQDA 3HAGA 2EXJA 1U5ZA 1UXXX 4CCJA 4JGYB 1DQ5A 4O65A 3FC0A 4Q4W2 4AVBA 1LJ7A 2G4IA 3POWA 4Z92B 2LUWA 4YLZA 3CZJA 1DFQA 1UPIA 2WAAA 3FZ3A 4RSUA 4AG4A 1HXS3 4AI8A 5LRSA 4KQ7A 3LEGA 2VZ1A 2R7EB 4M3CF 3WG2A 1X9TA 1RGSA 1GWMA 1JODA 1OHFA 2VZSA 4Y20B 3ROUA 3THTA 3WQ7A 4XMIA 4NUBA 2WC2A 1N47A 1K45A 2Q5TA 3ACLA 5H9SA 4XFBA 3O0VA 1F15A 4DXTA 4Q4Y3 3RYPA 2JDKA 4DXRA 5FYSA 1ZBE3 1FYUA 1JW6A 5JOXA 4D7TA 1WLCA 1YLLA 3SKVA 4G4FA 4BK4A 3C7HA 4M01A 4BM8A 5LATA 5DPNA 1A3KA 2PMWB 5T5OA 2W5FA 4FFFA 5A7WA 1W0NA 1B35B 4CEWA 4ZZ8A 3UNPA 2DF7A 1PVC3 3RZGA 4AFMA 3Q8FA 2XLFA 2XBO3 4LBMA 4MHRA 1ND2A 5ABJB 4F7ZA 4XCBA 5K4LA 1QJY2 1RVF3 5JMOA 4XETA 3B9CA 1QJX3 1MZEA 3N7LA 3SH3A 2CNAA 2VVEA 3M3OA 1SG3A 3O0XA 3RYKA 1COV1 3OPZA 4QKNA 4LKSA 5B4NA 1BEV3 5KXCA 2ZKLA 3K77A 4RN5A 1OBNA 3OJBA 4HN0A 3WNPA 1MS1A 4A7KA 5JZGB 3WD5A 1RL3A 3NJVA 1DYOA 2G1MA 2J1VA 3FBYA 4MVTA 3U11A 4RFT0 3TBDA 2VQUA 2RJ2A 3E6CC 1GKBA 3PUSA 3DPRB 4X6QB 2NM1A 3IZOA 4CRQA 4Y26A 5KBFA 1ONAA 3ASIA 5JOYA 2W87A 1OI6A 1UXZA 1MQTC 2YV8A 4NWVA 1QOOA 4JTOA 4AEKA 1MZFA 1AUYA 5C7GA 1ZRCA 2Y34A 2QQVA 1N1SA 5EJ3A 1L7LA 5CB7A 4BLJA 3NV1A 1FPN3 4B4QA 2A1XA 2QQLA 5EV7A 2D3RA 3U0ZA 1XE7A 2QKDA 3MW2A 3DEMA 1O4TA 3GJAA 3S30A 1N1VA 1YO8A 3GBFA 4MHUA 4Q29A 3W21A 2WLQA 1Z7S1 1QXRA 3NAPC 2BTVC 3AMNA 2FCTA 2PELA 1PK6B 5B2GB 4FVVA 3MW4A 2D5HA 2D44A 2C4XA 3AKPA 2C6SA 1AHSA 5JLVA 4IV1C 4CTEA 1A8MA 1OD3A 1SPPB 2HWF1 2RDRA 2Q1FA 2VNOA 1VBD2 2VUDA 3AMQA 5FXXA 3H3UA 5FAXA 3VDAA 1RUE2 3POYA 4L8QA 2ZGRA 1UY1A 5I0UA 4AXOA 1OLQA 4QB6A 2WZR3 4BA6A 5CG9A 3FN9A 1PNFA 3MUY1 1S1AA 4GB33 4Q4W1 1U5XA 1VPHA 3LA7A 3B00A 3RMYA 1CAUB 2AGSA 2C5DA 2EIDA 3KCXA 3LDKA 3PNAA 3BTYA 4N9IA 2PHRA 3NVCA 2A6YA 3HNYM 3GNEA 2RE9A 4RR3B 4CDQC 5IK8A 1G7YA 5FZDA 2AUYA 3S0MA 3NV3A 3GZAA 5I93A 4MG2A 3D3AA 1DQ6A 3SH5A 2E9QA 4JGZC 3NNJA 3RQ0A 3CIHA 3VD3A 2JG9B 5HBAA 4FTSA 5LEJA 1W6QB 1OOPB 1YJLA 1VB2A 4LKEA 5EYXA 4XUPA 4BB3A 2D97A 3FWEA 4AVAA 1ZRRA 3BYWA 4YZ1A 4COWA 1S0DA 2IVJA 4Z07A 1RUC1 1LOCA 3ENRA 2RM21 3SITA 4UBGA 1HN1A 3VL9A 3BPZA 1DZTA 3N9NA 5A33B 1S0EA 2ZGKA 3AL5A 1N3QA 1RMU2 5I91A 3ALQA 5D8AB 1SLLA 2LM3A 2WNVC 1QJY1 2ZHLA 4AL9A 5C8CB 4NPMA 5FZ7A 1E5HA 3NAPB 5EJZB 2WFF3 1GYKA 1D4VB 1RUNA 2EVXA 1IS4A 2VM9A 5F9TA 1H9WA 2VMFA 3HQXA 4CDWB 1LULA 5HV0A 4KL1A 3H8UA 3VBUA 5JDBA 1KDKA 1PMJX 2B46X 4QX5A 4IE7A 4QPGA 1UY2A 1FOD2 2NZ9A 3UESA 1PGL1 3ZN6A 2BRTA 4YGDA 4JZRA 4AVVA 1APNA 1UAIA 5GJ6A 1OA4A 4GULA 2FZ2A 2OA2A 2PA7A 4R4XA 1PZ7A 4GJYA 4OI4A 2VL4A 5JSOA 4J25A 3IDEA 1UOGA 3AJZA 5FPZA 1Y3TA 3BODA 1H1MA 4KWJA 4PQ9A 2BNMA 4DINB 5CAZA 2VTXA 3MI8A 5A7PA 3M3CA 2V72A 5IK4A 3LSEA 2VD7A 2A5ZA 2F4LA 1UU5A 4IEVA 4GWJA 3ZXKA 5EQUA 4OUMA 5FYMA 1NA1C 1Y7BA 2KA3A 2DV9A 4Z2WA 3VBHA 2DYCA 2HWC2 1UU6A 3H9AA 5CU1A 5ISLA 1JU3A 1WW4A 3FLTA 5FP3A 5LK7B 3SH4A 4AQ2A 1VBD1 1O5UA 4WM7B 1MS4A 1RUE1 2YU1A 4COYA 2OVUA 3AXEA 3UKNA 2IUWA 4LULA 4HONA 4QPYA 4QXCA 2NMOA 1ZX5A 1BK0A 4EN9B 1IPSA 5F8PA 4TWTA 1OXCA 3WF1A 3BTAA 2J1EA 3S57A 2VVFA 2R16A 2WQ8A 4XDPA 1HRV1 4LITA 3T1MA 5CISA 4GMP1 4FPCA 2Z5WA 3ZKUA 4NRQA 4XE9A 1CZVA 4LO5B 1E5RA 3UYJA 2OPKA 2Y6KA 3OSDA 4ATEA 4FOVA 3PLQA 2V5DA 4AR2A 5IK5A 1W2TA 5FYVA 2DURA 2W1SA 5FZ9A 4Y4YA 2JDYA 4NWWA 4CEWC 1Q3EA 5DMYA 4A4AA 3WNKA 5C9AA 4NHLA 4HXCA 1QJU3 1XNDA 3JQWA 1OT5A 3O1MA 1S0JA 2I07B 1ND2C 5H9PA 2HYXA 2VZTA 3D8CA 1BCXA 3N7MA 4AF9A 4CA9A 1ZREA 5IATA 1LEMA 1HXS2 2EA7A 1HB4A 3GALA 2L9LA 2RMU3 5IAVA 2QQKA 2IFWA 3AZYA 2WZPP 5HXMA 5ANQA 3O1SA 1AJKA 3O12A 3EO6A 3LCPA 5K7PA 3TEYA 2I2SA 1RMU1 2YG0A 4Q4Y2 4UW6A 1S0FA 1ZBE2 3KV5A 4OQ8A 1ASJ1 3CZUA 5F1RA 1VBA1 3POFA 1GZ9A 1AR71 2QUOA 1RJ7A 3N4MA 2WNUB 4META 4XJWA 2QDRA 4UT5A 4CDUB 3OD4A 2WN3A 1R1ZA 5GLUA 1JYCA 1UYPA 1WKYA 1US3A 2JD9A 1H2KA 1YQCA 1PVC2 4BLIA 5IAXA 1EPZA 5JR7B 1BVP1 4A3ZA 3OUJA 2A73B 5A32A 2Q30A 4Q0SA 1WLWA 4DY5A 2ORZA 2QCSB 1FOD1 3LFIA 1RHI1 1RVF2 1W8WA 3WDVA 1K5JA 2DUQA 3OEAA 5FZOA 4COVA 1IPKA 2HYKA 1AYM3 2E63A 1UF2C 3ETQA 3HN3A 2JIGA 4GAZA 3ZDSA 1YI7A 4N43C 1W8FA 1F35A 1YXWA 2E7QA 3I49A 1BEV2 1H4GA 2J1RA 4OZXA 3M8LA 4YG3A 2ZEYA 4X8PA 1MEC3 5FO9B 3U14A 1ZBA2 5FZCA 2DCYA 1UZVA 1W8OA 2YY1A 1NLSA 2XWBB 2B9UA 1IQDC 1G6NA 5BNQA 4FPGA 1NXD1 1AVBA 1L7RA 1OF4A 2VNVA 4CCEA 2N7GA 4R9DA 5FUPA 2R0HA 2Z69A 4ISQA 4NR1A 5FPUA 5FK8A 1LEDA 2ZGQA 4RGGA 1JZ4A 3BOWA 4KU8A 4A7YA 3T2TA 3O5SA 2HLEA 4CE8A 5J36A 4YRDA 1TNRA 1WCDJ 1ND2B 2HWC1 2XVLA 1FPN2 5BNPB 4AI1A 4H14A 3RWNA 3POJA 5FYCA 1POV1 1W99A 4K6BA 4XHBA 3PUQA 1COV3 3NO8A 1SBFA 1O7FA 4UXAA 1LECA 4W6YA 2PFWA 2JDPA 4PI2A 2A3WA 2K46A 1SCSA 2J1SA 1YJKA 2R6QA 4RS5B 3S5QA 3ZYFA 1Y43B 4AHYA 2IWGB 2LW8A 1OPMA 2XDVA 1MS9A 2XONA 3BIWE 3E97A 4Q0UA 5BNOB 3RRDA 2R32A 3TWIA 3IM0A 3I7DA 3GCXA 2JIJA 5KXEA 2VGDA 3MICA 3LA3A 4D69A 2WZR2 5FY8A 3P5BA 1LTEA 5FZFA 4FQZA 4XUNA 4YPJA 1X50A 2AC1A 2VNGA 4FTEA 2I45A 4JDOA 5FUIA 1BMV2 3HN1A 5E1RA 3WDTA 4LBQA 3WF0A 2ZGUA 1HXS1 2NMNA 1WMFA 3DGTA 3T30A 3P1IA 1QIQA 1ENXA 1EAH1 2EXHA 4Y20A 2FMYA 4NPLA 4Q8KA 3M3IA 2ZHKA 2XB6C 4LA3A 4Y4RA 1XE8A 2FDIA 4Q4Y1 1X36A 1ZBE1 1VAKA 1O6UA 2P3KA 3N9PA 2TBVA 1JYVA 3VBUC 3OYWA 4XZUG 4NVPA 4QPGC 3KF5A 3PIJA 1LOAA 3DECA 1W6PA 1Y4WA 1B35A 3ZYBA 3UETA 3WVJA 2GMEA 4L11A 1PVC1 5A3OA 1M06G 1K3IA 1V6IA 4S2GA 2D5FA 2XBO1 3O14A 3DKWA 3T0DA 1RC6A 2Y8KA 3CNAA 1ODMA 3VHOA 1JUHA 4K3UA 3AC0A 5KHIA 1RVF1 3S7IA 5FYHA 1KFXL 1QJX1 1W9TA 4QKDA 4IEQA 4NIHA 5K8SA 3C7EA 3JB8A 2WFF2 4ATFA 1RIRA 2WDBA 4IV3B 3BTXA 1BEV1 3BU0A 2DFCA 1PM7A 3A21A 4QDQA 1OURA 5TSWA 1LODA 4OULA 1OA3A 3CJIA 2XJVA 5FMOL 5DXDA 3DPRA 4OMDA 4PDWB 5C5UA 1VBC3 3VBHC 5A3NA 2JDAA 5A3PA 2R1DA 3AP6A 3ACIA 3CHXA 3HMYA 2V4VA 2D6PA 3EHKA 3JXSA 4LTAA 4MGQA 4ZY9A 3UL2A 2VXRA 1RUC3 2K2SA 3BB6A 1OLME 2W2IA 1HV0A 2BNOA 4UF0B 2PXJA 3V64A 5L7OA 1V00A 4JDNA 3G7DA 3USUB 5G05L 1FPN1 3WOGA 4CPBD 2NLRA 4IEUA 3JU9A 4FFGA 1A78A 4FP2A 4HZFA 2JDHA 1W6NB 1YYNA 2XKPA 3H3ZA 1CAVA 2PLV3 4LUKA 5J98B 2FDJA 4DQAA 1F2NA 5FZ0A 1PK6A 5F5QA 5L19A 1UZZA 4KBZA 3J7NA 3FX3A 1RUG3 2HBTA 3H42B 3RPQA 4QPGB 1FATA 1QWRA 1SPPA 5LBCA 3T1LA 2AEZA 4CPBA 5BV6A 3VKLA 4QX1A 5C9AC 4MV2A 1KFUL 3O1RA 1GUIA 3C7GA 1E57A 1TMF3 3O1VA 2VW0A 1GP4A 2G9ZA 5KXBA 4QKBA 3WQBA 1NY72 3ZFFA 2WZR1 1CPNA 5I8SA 4HSLA 3AP4A 4EV0A 5DDJ3 1NX9A 1YQ2A 3I59A 4GB31 4CUAA 3LIHA 1IKQA 1CAUA 3MF6A 4DIQA 1BMV1 5CKNA 5FZ1A 3TN93 4D6RA 1G8WA 2WS93 1GNZA 2DVAA 2G9FA 3AKRA 3WT3A 1O4YA 1X8MA 1O3SA 3I3EA 3HT1A 3FUQA 1UOFA 3LEKA 4RR3A 5LK5A 1XOYA 2D6OX 3CF6E 1F5FA 4FSJA 5JAXA 5LWBA 2Q8EA 3WEZA 1UYZA 1FMD3 4W6WA 4QT6A 4BE3A 4CXWA 2JG9A 4ZPIA 1UIKA 2W1QA 2VW1A 3VZOA 1QJU2 2JKBA 1W6QA 2DVGA 1OOPA 1BHGA 5F5AA 4YG6A 3I97A 3B5LB 4DRVA 1I5ZA 1W8HA 5LCWL 4IXLA 2XLAA 2BBVA 2Y26A 1AL23 2ZJCA 2RMU2 2NN8A 4LA2A 4UW5A 5GLZA 5T5JA 4AVCA 4TYSA 5KHKA 2VMGA 4UFJA 5A6YA 1LENA 2VZOA 4M3CA 3D6EA 2CDPA 3BKZA 5DUXA 1ULPA 2ZXQA 5D8AA 1HRV3 2R49A 2B5HA 3LPFA 5C8CA 2UWBA 4E27A 1D0HA 3M4FA 2CDOA 1BVVA 1AR63 1ZZ7A 3AM2A 1PMIA 3FBMA 2WFF1 3VGIA 3K46A 1NE4A 2WL1A 3WF3A 4XF9A 4BPZA 4CU7A 1REEA 2EF6A 4CDWA 2XMLA 3PUAA 5DAPA 4LBKA 4TLGA 1NLQA 3HIFA 4D7YA 3Q8CA 2DCZA 1QXPA 2CHHA 4AK3A 2DBNA 4LO7A 3T08A 3WUCA 3IAPA 2QQWA 1GMMA 5FMDA 3M7AA 5FYTA 4BMEA 1C8M3 1GP6A 3SEEA 2OQ7A 1UQXA 3TYJA 2QTWB 4AE2A 4FOQA 4NMIA 4K40A 4Y5TA 5IVCA 5GALA 4BOWA 3FFQA 3LGRA 2H6BA 2O1QA 4IDZA 4ZXEA 5LBBA 3KHCA 3Q8AA 3MGUA 1MEC2 3B9IA 5HV4A 4MX3A 3KCCA 2XQRA 1ASJ3 1GQHA 1OFSA 2VOVA 4IERA 1VBA3 5DAWA 4CDXB 1AR73 3B7MA 1CPMA 1W8ZA 3QH7A 4LPLA 4DOUA 2LTNA 2FQPA 2VTFA 1XB9A 2XJPA 3MFAA 4L92A 2FZ1A 4GKXA 4MYEA 2BGPA 3ZFGB 1DP0A 4GJZA 1G9CA 1MZ6A 1ENSA 4DRRA 5A3MA 1WUVA 1JOBA 2DVFA 1V6JA 1GANA 2UWCA 3L9JT 4SBVA 4MXWB 2R063 3JZVA 5A32B 2BQPA 5LZ6A 1H0BA 1RHI3 3IBMA 4LQRA 2DCTA 4QDSA 1TEIA 4QM8A 4S2FA 4YG0A 3MUZ1 4WM7A 3O7OA 4XIOA 5C3SA 1HJGA 2HEVF 3LDRA 4I09A 4EN8B 1BKZA 4M0NA 1COV2 1YC61 4Y1UA 4FQ4A 4I3GA 1CAXB 1NY71 4LNVA 5F6KA 5T55A 4B1MA 1QOSA 1GZCA 2RJKA 2VU9A 5FKBA 5FUNA 2VOKA 1WA4A 5JSPA 1W6MB 3TNPB 1EY2A 2RS51 2VBPA 4K9SA 3NV2A 3WCRA 2A71A 1E5SA 1T2XA 2Q8OA 3VBSA 3J9SA 4HVOA 1WGPA 4QGNA 1XYPA 4FTBA 3VZKA 1STMA 3IWZA 1W8UA 3TB0A 2UY8A 3RMXA 5ACA3 5A1AA 3PVBB 4N8MA 3PTYA 2KXLA 3MIDA 4ONUA 1Y9GA 1B35C 3JD73 1W03A 4Q0VA 2JDNA 2CWMA 1WW5A 3E5XA 2O8OA 5CVRA 3C7OA 3LKJA 4IGOA 4JQRA 5JVVA 1QJU1 3UJOA 2E6VA 1L7QA 5IFPA 5FPLA 2VMCA 3S7EA 2B7YA 2DUOA 1JOPA 2RMU1 3T0AA 1NZIA 1SFNA 2W68A 1AJOA 4MGIE 3KT7A 1E5IA 4IETA 4KNCA 1VBB3 2BOIA 4BQ5A 1V70A 3O0WA 3TAYA 3NNFA 4WBBA 3PVEA 1HJFA 3CJIC 2HWF2 3WSOA
chains in the Genus database with same CATH topology
4LHLA 4P9JA 1RUD3 3DPRC 3QH6A 4AFAA 4M3CE 2A6ZA 4U36A 4LT5A 4CDUA 3PVNA 4FXGB 3E5QA 1YFWA 2I74A 4ZU7A 1FNZA 1VLNA 4Q4V3 4CYDA 4EWDA 5K9YA 3ZN5A 1LB2A 4C91A 2ZPXA 4XYXA 5K0UA 1OSGA 3WW2A 4E2QA 5JPNB 1YHFA 2DWRA 1NCQB 4YZ4A 3AX4A 4Q8LA 4LBQB 4UW3A 1AYM1 2ZX1A 4D7SA 1GICA 1QGLA 3RYRA 1BBT3 5A3LA 1EAH3 2P17A 1QU0A 3MYXA 1FV3A 1MEC1 1HQWA 2RHPA 1PK6C 1MACA 2ZGNA 3X29B 1LGNA 1SQ4A 5C6CA 4OHXA 5JCTA 1VBC2 3OYWB 4PLOA 1H9PA 1U0AA 2PTMA 1W6PB 2V5YA 1DIWA 3MDPA 1RUC2 2RM22 3JBG3 2O0OA 2H6CA 3N3HA 4YW3A 3S6PA 2XVKA 4AEMA 1LGCA 1AX0A 2WKKA 3ZFFC 4QGMA 5BNPA 1IHMA 1SCRA 3VZLA 3ES1A 3VBOB 2ZGLA 3KT4A 1ZYBA 4I02A 1H8VA 4X8NA 2AREA 1XYNA 3E6BA 2WT0A 3LA2A 4RR3C 3RZZA 3EJKA 1POV0 3ZXGA 4COUA 2LALA 4OI1A 4GALA 4OUSA 3CJIB 4XJ9A 4RL7A 4RS5A 2D6NA 1FT9A 3EBRA 2JXAA 1RUG2 1I9RA 2JG8A 1PGL2 2JG9C 3M70A 5BNOA 4XW3A 1RUOA 3UKTA 5FLJA 1OOPC 1TMF2 1PO23 5I0TA 5T5PA 3R6SA 4FAGA 2BVBA 4DMIA 2WA3A 1J58A 1RUF3 5C8WA 1F8VA 3VBFB 2ZHNA 4WVZA 2B42B 2DU1A 2ZZQA 5JIAA 2ILMA 5DDJ2 2H0BA 3ZXEA 3ZVXA 5I0RA 5L7OB 2GSYA 2NPIA 4XJUA 4YVWA 2YMZA 1K5MA 3TN92 3VLBB 2WS92 5D8AC 5C8CC 3OGGA 1XU2A 5KHGA 1CAVB 1HRI3 3KGZA 1HDKA 2JENA 4I0AA 3WP5A 2JX9A 3POSA 5T50A 1J3RA 5BYNA 1LOBA 2IXJA 4DY3A 4G3YC 3D5OA 2DU0A 3ECQA 2ZGSA 3DF0A 2C9AA 4CDWC 3A0KA 3IPVA 1TNFA 1YUDA 2BVVA 5FLHA 3HWJA 4GA9A 4HBNA 4IEXA 5FOJB 4WZFA 3ZFFB 3ZSJA 2PYTA 4OI2A 4E9KA 1JTZX 1AR93 1UN1A 3MIGA 3HT2A 4FT8A 3I59B 4XILA 3ZX7A 1HRV2 1LRHA 5FREA 4GH4B 4C1XA 1G9BA 3H1YA 1AR62 2GMPA 1VJ2A 2E7AA 4IV3A 2MEV3 2GNDA 3VDDA 4XHXA 2WWSA 2CAUA 3FLPA 5FO8B 4OLLA 4BIFA 4PDWA 4JCKA 4NPRA 3KZ4C 1NXMA 1VBC1 1C8M2 1H1IA 2D7FA 1XNKA 4DS0A 4R9BA 2RS33 3AYEA 4WM7C 1CJPA 1OQDA 4ISRA 4EN0A 4M3CB 3WDWA 4R4ZA 1WCSA 1DGRA 3USUA 3V0BB 1VAVA 1GSLA 1ASJ2 5FOBB 1VBA2 4P9LA 5DZFA 1AR72 1W6NA 1ND3B 2ZTNA 1GBGA 3ILNA 2PLV1 1SLTA 4MZUA 3VBSC 2XLGA 3ELNA 1PO13 1OQ1A 1WLTA 1DF0A 5SV8A 4XTMA 1O5LA 3INAA 2R062 3OBRA 4MGKE 1RUG1 4AHXA 5CFDB 1ZZBA 2C1FA 2ZKNA 1RHI2 2P3IA 2OUJA 1TMF1 4EN7B 3AXDA 2UYBA 4ASLA 1YCIA 2X5IB 3IN9A 5I8TA 2NQYA 5DDJ1 4CZSA 1RITA 3WQ1A 4H7LA 2D93A 1I1EA 5JI7A 5E89A 3TN91 2BUKA 5JMCA 1X33A 2WS91 1H2NA 1CD3G 4TLFA 1CX4A 1CONA 3SCFA 3U10A 1GV9A 2PAEA 2P3JA 2WNUC 3UJQA 1KITA 1LGBA 3ZYPA 1NLRA 2YUEA 5ACA2 4CDUC 3JD72 3VZMA 1FMD1 4F3JA 4L9BA 3MEPA 3TOJA 3AFKA 3ZIXA 4LLFA 4JTNA 1JN2P 1J59A 2D6LX 4YM3A 5K0UC 3WHUA 2A3XA 5H9QA 1DZQA 1NQDA 1AL21 4YM0A 4AI3A 2E7TA 3AMMA 3OF1A 2BW8A 4Q4X3 2RS53 3RI8A 3ILRA 1V6LA 1D0GA 2ENRA 5KHJA 2PAMA 5D1IA 4E4ZA 2B8MA 1RUD2 3VBSB 3ZSMA 1AR61 2GZWA 2XWJB 1DLLA 3AP9A 3KSCA 1VR3A 3AKQA 1UW8A 4Y5Z0 5GZDA 2ET7A 4Q4V2 4WM8A 3JB4C 2VG9A 1XNBA 4AQSA 5CFCB 3BALA 1EP0A 3Q9OA 2ZBJA 1PVXA 4Q0QA 2YXSA 4YGBA 1C8M1 5BNPC 2ZGOA 3KM5A 3WP4A 2ZHMA 3WP6A 3ZSKA 1G9DA 1BBT2 2R073 2V09A 1EAH2 4Y1ZA 4N7UA 4COZA 3OD0A 3NV4A 2WT1A 3VL8A 4HANA 4XJAA 4CDXA 4LBJA 1U12A 2P34A 4RS5C 4L2NA 1R1A1 2JG8C 2IXKA 5I0SA 1QKQA 1V6OA 5BNOC 2NP0A 1C4RA 3RDIA 4YW4A 4AGVA 1JBCA 3ZFGA 3JBG2 1KS5A 2ARBA 5FMOS 1F31A 1S0BA 1BYHA 1QF3A 2XBO2 4MXWA 4X6RB 2GH2A 4AEDB 2R061 3RI9A 5K0UB 3GHNA 1O3TA 3H1MA 1H1AA 1QJX2 4YVWC 4LE4A 1TME3 1H4HA 1LOFA 3R4DB 4B4RA 1CAXA 3WDUA 2CGOA 4AHWA 2Z2SB 2NYYA 1W6MA 4R9CA 4H55A 4AVTA 4QGLA 4B3NA 3H7JA 1UKRA 3V65A 2QDNA 1W2UA 4KG0A 2JICA 3H1WA 3R0RA 1PO22 1WLDA 1OD5A 5DUUA 2CV6A 4NO4A 1RUF2 3CO2A 5ACA1 3IIAA 4S2HA 5JOZA 3JD71 5EXOA 4KU7A 1XU1A 4QM9A 2W52A 3MIBA 1D4M1 2F6BA 3WHTA 1AZDA 2YROA 4YW2A 1HRI2 1MS8A 4Q27A 3GYDA 3NL1A 1M4WA 3ZXFA 4IV3C 4XXAA 1VBB1 1N1TA 4JVAA 2G9GA 2JDZA 2ZX0A 2JG8B 1NZCA 5SV5A 4YW1A 4LLOA 1QJZA 1QDOA 1RUD1 4LBQD 4PDWC 1F9KA 1LHUA 4R8HA 4AFBA 3OBTA 2XL7A 4Q4V1 4YM2A 2XPJA 1AR92 4FPEA 4N53B 4GB32 2A6VA 3VN4A 3ST7A 3AKSA 4YVWB 4XF3A 1K5MB 1Q5OA 1NCQA 2XGXA 1KDMA 2YZ4A 4URTA 1BBT1 1ALYA 3MF9A 4IEYA 1UU4A 4P5HA 1CAWA 4P9WA 3VBRB 5GZGA 3B01A 5EWSA 3USSA 1KRIA 1H2MA 2ZGMA 2HEYF 5J48A 3IPVB 1SACA 3NKGA 2UURA 4FO9A 3WY6A 4PBPA 3N36A 5EFUA 3WINE 3D4KA 4HMZA 4SLIA 2SBAA 2OZ6A 3JBG1 4P9XA 1J1LA 3VHNA 3B94A 1QNWA 1ZVFA 3MLJA 3VBOA 3C3VA 5GLTA 2YGLA 1NCRB 1MZ5A 4FPHA 2XG3A 4LBLA 5E88A 1PO12 2XJSA 1AXZA 3VDDB 4F83A 1IS6A 5GZCA 2GAUA 3WW1A 5T52A 3THPA 4YVSB 3K48A 4H3WA 1PO21 1W6OB 4IEZA 3IMNA 3VBFA 1RUF1 4QU2A 3AJYA 4CEYB 1XXNA 1QNYA 3LAGA 1W0PA 3KT1A 3MLKA 1U5IA 5L36A 4I0BA 3AZWA 1HRI1 2AYHA 2XJTA 4XFIA 3ZXAC 2CYFA 1PNGA 4PIZA 3CL1A 5FFOC 5C4WB 1N1YA 2ETEA 2MNGA 4OI0A 4XIKA 4P14A 4N9HA 1V6KA 3OTFA 1F5JA 3R05A 1ENQA 3QBQA 4HKOA 3RJ2X 4Q4X2 1WBLA 1AR91 2RS52 3R4SA 1FAYA 2PHUA 1AYN3 4K21A 4GH4A 2P37A 4CDXC 4FBFA 2WSUA 1OFNA 2VY0A 1REDA 3M1HA 4MGZE 2SLIA 4WV8A 2MEV1 2GNMA 1ZNPA 4LR4A 4NN0A 3ZFGC 1D2SA 2F4PA 4EWEA 4HVQA 3PJYA 4YM1A 3NJZA 2ES3A 4JAAA 2HJIA 5HXVA 1PGSA 2ZMKA 2RS31 2QJVA 3AFGA 2R072 4YFZA 4EROA 1LOFC 4YYOA 3LB9A 3V0BA 3ZIWA 4FPLA 2BNNA 3TRSB 5FDBA 1ND3A 2WLPA 1H30A 2E51A 2ZGTA 4HKWA 4PIXA 4HK9A 4XFHA 5T54A 5BNNB 1Q56A 1WW7A 4IQPA 2RR13 1PO11 5CADA 4Q1PA 2P2KA 4Y1VA 4XDQA 4WM8B 4A2UA 2WQ4A 3RG0A 5CFDA 4QHBA 1VBE3 2W39A 4PIYA 3ZSEA 1AYM2 4KGQA 4XEZA 1TME2 2RS13 5AVPA 1KXGA 4UBHA 1UMZA 2X5IA 1H2LA 1C57A 5CIRA 2ZABA 2BWCA 5FTTC 3WW4A 4IV1A 1IGOA 1R1A3 2VUAA 4BH9A 3CJXA 4BMBA 2MHFA 4YW5A 1AXKA 3VZNA 1HIXA 2TNFA 1IZ3A 2D43A 3JCIA 4DFSA 2FMDA 4MSVA 2OUHA 2XUMA 3ZXJA 2TEPA 2X8KA 4WVMA 3WV6A 2GNTA 2EAAA 4RQPB 1NCQC 2D40A 4Z8BA 4E2GA 5GM0A 2FBEA 1JH5A 1OQEA 3PMEA 4Q1RA 3CU7A 2GDFA 4Q4X1 5EZWA 1IKPA 4YZ5A 2WQZC 1DQ0A 4XF4A 1WD4A 2DVBA 1JYIA 1QOTA 4R52A 1I3HA 3QACA 5FCCA 2E53A 4NOTA 1URXA 3IDBB 2YHJA 4N7IA 4YSFA 2JEMA 3PHMA 4RHV1 3LZZA 4FPOB 2AZ5A 4BZ4A 3VHRA 2Q0AA 4XFAA 5JOWA 1PZ9A 5CFCA 4YZ2A 3SLIA 1D4M3 4XPVA 3DL3A 1DQ4A 5DUWA 4YFWA 3AMHA 4YGEA 3ZSLA 3VBOC 3FMGA 1DZRA 1QDCA 4XOGA 4K20A 5KHHA 3V56A 3RJRA 2CGPA 2R071 2VH9A 5T5LA 1HV1A 4LEJA 4U2AA 1LU2A 2A6WA 3MIEA 3ZYJB 3HR9A 3BOPA 4HL0A 4QQHA 4YNIA 4FPYA 4BIOA 3SXWA 3L2HA 2HWE3 1VRH3 5GKAC 5J3UA 1C8NA 1BZWA 4P9IA 3AP5A 1WD3A 2HWD3 5J96B 3AYAA 1SLCA 2YGMA 1LOEA 2V73A 4AEDA 3VBFC 5KWRA 1FV2A 2GN3A 3I8TA 4V1PA 2XJRA 3FJSA 5L7OC 4GKYA 4B7KA 4GIQA 3QOPA 1CN1A 3R4UA 3GZUC 1TME1 4XJZA 1I6XA 1OMIA 4XBLA 1CAWB 2IXIA 1LHVA 2R30A 1V9U1 3CLPA 2A75A 4KWKA 2B39A 2D3PA 1L3JA 4OFGA 2JJ6A 1O3QA 3WG1A 4K7JA 4ZU5A 1Z0HA 4Y1XA 1QQP3 3HBZA 1C5HA 1FXZA 1GZWA 1DYPA 1S0IA 4E4SA 1UCXA 4HSJA 4IEPA 4DXZA 1RJ8A 1YIPA 5JWPA 1RUH3 1MVQA 4L99A 1PHMA 2PLV2 2ZZJA 4GH4C 4AGGA 2AH2A 4ITCA 4YZ3A 2Z42A 3ME2A 4O9GA 1G9FA 4HPKB 4XMAA 3IKWA 1NE6A 3RS6A 4DPNA 3GZTB 3RSJA 4AHZA 4YARA 4XQWA 1SBEA 4XBNA 1C5IA 1ZZ8A 1S0CA 2RJLA 4EWAA 1DGLA 3ZFEB 3H7YA 5GLVA 4Z1VA 2TUNA 3SCGA 4N53A 4ORFA 3ZXLA 1WW6A 2H0VA 3GBWA 1AYN2 3KLSA 4QPIB 5HCBA 1RUJ3 1ZBA3 3SCHA 4LBOA 3KB5A 1C1FA 1ND3C 3GF6A 2VW2A 4AW7A 2IFRA 3VBRA 4FPJA 3W58A 1BK1A 2CGNA 1FMD2 2IZWA 1X7NA 4XXPA 1KD7A 5DG2A 1UKGA 4HLTA 4EJRA 3KQRA 1RINA 5CFDC 1JUIA 4XBQA 3V0AA 2CL2A 2UYAA 4O9EA 1DHKB 2BWAA 1AL22 2AR6A 4N43A 3AZXA 2XVGA 2JD4A 1AR83 2DCJA 4C0BA 1SLAA 3KGLA 2ZACA 2X5IC 3ZPYA 3I4IA 4PJYA 4I0WB 3UK9A 4BCUA 1JHNA 2CAVA 1O91A 1EPWA 1AL0G 1IS5A 1WBFA 2XL9A 3J8F1 1NCRA 2PHWA 4XFCA 2WNEA 1HLCA 2RR12 1UIJA 2ARXA 5CG8A 1Q8SA 4GWMA 4HFSA 1KS4A 4MXVA 3SISA 2ZX3A 4B7EA 4YVSA 3WNXA 1VBE2 4Q2FA 1EV13 4XFGA 1QH6A 2DTYA 5J37A 1W6OA 4AWDA 2RS12 1WCKA 3G6JB 4CEYA 2BEOA 1FX5A 3OY8A 4P9GA 1R083 2HWB3 3UKVA 1LR5A 1ZRDA 2B45X 1REFA 2VECA 2IXLA 1R1A2 1H8TA 3J26N 3KMHA 1MQTB 3FUOA 1J1TA 3I2DA 2QQPA 5J09A 4LE3A 4P9YA 1C3HA 1X8EA 3PMSA 3QLQA 5C4WA 2JE9A 1DGRN 2DTWA 5CFCC 1IQAA 4IL7A 4HK8A 3N7KA 4M00A 4ZKTB 2K0GA 4XZPA 3A0NA 2QNKA 5AVAA 2WINB 2GU9A 2ZGPA 3P3PA 1AYN1 1NOVA 1LHOA 1O4ZA 4IV1B 3RNSA 3MFCA 3WG3A 3APBA 1ZZCA 3B3QE 3NWKA 4INDA 3VKMA 4B4PA 1UPSA 3MW3A 3VUOA 3WR0A 2JE7A 2VNRA 1UD1A 1CGPA 1LOGA 2YPJA 1IS3A 4AEDC 1D4M2 4HT1T 3NW4A 2VULA 4XTPA 5BY5A 4WVMB 1DGWX 2GN7A 3ILFA 2KM2A 1YFUA 4OHYA 4CDQB 4LO6B 4L97A 4WVVA 1MS0A 3BCWA 4AI0A 1NG0A 4JDMA 3B02A 4A3XA 5F6LB 1VBB2 4JGZB 1RUI3 4AVSA 3H0OA 3VKFC 4Q0PA 3U4XA 2ZX4A 4XQ4A 1N3PA 2HWE2 1VRH2 3AZVA 5BNNA 5DZGA 1A6CA 3FFZA 4RHV3 1XRUA 1GR3A 1HQLA 1ZZ6A 2RR11 4Q26A 5T3NA 4J1XA 4ES9A 2HWD2 5E8AA 1R093 2GC2A 2R0FA 4ZU4A 1MS5A 2Y0OA 2QVSB 4ASMB 3QD6A 2D3SA 2EAKA 5EYYA 1A8DA 1J3QA 1GFF2 1VBE1 2WNVB 5AFEA 1XYOA 1TE1B 1MR5A 1AXYA 3B93A 4LHNA 1DG6A 1ULDA 1S2KA 2RS11 4MLOA 1RTVA 2WA4A 1UZYA 3PJQA 2EXKA 1XNCA 5GZFA 4Y1YA 3D0JA 2PAKA 2PHDA 4LO8A 2ZA9A 3WQ0A 1PIV3 5KC6A 1Z78A 4G9SB 1QHDA 1Q8QA 4KGGA 3E5UA 1ZZ9A 2EALA 1S0GA 1LESA 1QQP2 5DG1A 5AC93 1JXNA 1V6MA 2XKOA 2VQAA 3ZYRA 3OCPA 5FQ0B 2WSVA 4N53C 1RUH2 1ENRA 3M3EA 3TNQA 1IPJA 4IESA 4FCAA 2A7AA 3MPBA 4QMAA 3L2YA 1K5MC 4RQPA 2R043 3KD4A 4I3PA 1CIWA 1EYBA 5I8YA 1LHNA 1V9U3 3VBRC 2ZAAA 1NA1B 3C2UA 1QY4A 4QD2A 4F8AA 3NKTA 4GWNA 3OGJA 3W59A 1DGWA 1AX1A 4MGYE 2QZ2A 3ZYGA 4A7ZA 5HI0A 4Z82A 3E6DA 3AB0A 3VKOA 1GZWB 3CEWA 4TZDA 1S2BA 3WX5A 3ZMNA 1SMVA 1ULCA 1Y9QA 5LEKA 2ZMNA 1D2QA 5DUVA 3ZMOA 4AQTA 2QFEA 4UW4A 2OZJA 1RUJ2 5JI9A 3LWCA 4AGRA 1OA2A 3SHRA 4WZCA 2IC1A 2QE3A 4GQ7A 2JECA 1NCRC 4CP2A 3B69A 3H50A 1DQ1A 1U5YA 1Q8OA 4CEWB 3JUUA 3VDDC 1YIFA 4E2SA 1YFXA 2CTVA 2A3YA 4Y22A 4J6GA 4QQOA 4FOWA 1ZRFA 4RD7A 1ZA4A 2HWE1 1CVNA 1VRH1 4YVSC 3NSTA 1LKNA 1PGW2 4BYYA 5FBZA 1UL9A 1AR82 2HWD1 2XJQA 4KBBA 5J7MA 3VV1A 4JRLA 4MUVA 4CEYC 2O8QA 4XJ8A 2BPA2 2UY9A 1RB8G 2VVDA 1YNAA 4W6XA 1OKQA 4MH0E 1LHWA 2WFPA 2BFUS 1SLIA 2VMIA 3ZO0B 1C28A 1H8TC 2MEV2 2X29A 3WG4A 4QXKA 1W0OA 2ERFA 1O3RA 1DU3D 4IEOA 4JGYA 4RGAA 5C4WC 2D6KA 3V0AB 1DBNA 1EV12 4BQ1A 4I2OA 5IT6A 2FHRA 2RS32 1QQP1 3ES4A 4N43B 3EQEA 1Z7S3 3WDYA 1VAMA 4JC1A 1R082 2HWB2 4E4DX 4PLMA 1CR7A 2HEWF 1RUH1 2VOWA 4GXLA 4FXKB 3MIHA 2DUPA 3MLLA 1YRZA 3K51A 1BXHA 3J8F3 2HWF3 5FRAA 4N90A 1B09A 1YWKA 3DUIA 4HPKA 3AYDA 1G86A 3VKNA 4J1WA 4KG8A 5DZEA 1WMEA 1WMDA 4HVRA 2ATFA 1C1LA 4K1ZA 4PCRA 4FPFA 4Q4W3 2UU8A 2PN5A 5ABJA 2GNBA 2VMHA 2DVDA 5E16A 3ZFEA 3QCWA 3LOBA 1HKDA 3AK0A 2PHFA 1CQ9A 2VPVA 3OY8B 4PLNA 2EXIA 4D94A 5JZGA 1LCLA 4QPIA 2GH8A 3DN7A 1HW5A 1RUJ1 1ZBA1 4DZGA 4HN1A 1CESA 1H8TB 2BGCA 2HKXA 3GBGA 1PZ8A 2A6XA 5FLIA 1OLRA 3FLRA 5BNNC 2EIGA 3FHIB 4AFCA 4W65A 3URFA 1SEFA 1FNYA 1AF9A 3J4UH 1SBDA 4FAHA 2RM23 4OHZA 3LSDA 4ZXKA 4WM8C 4HKLA 1QMJA 4FPKA 1X82A 1YFYA 4XFFA 4K1YA 1OPOA 3SMHA 4OHVA 1QJY3 3D0SA 5GLWA 4I30A 5KC5A 1LU1A 1PGW1 2ET1A 1AR81 4LUMA 2UWAA 3LOIA 1AX2A 1DQ2A 1MS3A 3UV9A 3WDXA 2ZX2A 1RUI2 1KQRA 2QZ3A 2ZAHA 3VBUB 4D3WA 4LBNA 1V6NA 2MPFA 4NHKA 1BQPA 1KJLA 2ZCWA 3ZN6B 4RHV2 3IDCB 3VZJA 3I54A 1CJDA 1UX6A 2OYZA 2D6MA 4QQ2A 2VUJA 3WXPA 2ZS6B 4PF5A 1R092 4RA0A 3DV8A 1DDLA 2VQ0A 3P3NA 1EV11 1HX6A 2R1BA 1SDWA 3WLUA 2BFUL 5L73A 5FPXA 4RQPC 2K9ZA 1GQGA 2XHKA 1Q8PA 5HCAA 5IUQA 1R081 2HWB1 4FP3A 4JRAA 1PIV2 4R9AA 4AYUA 4AEJA 5BUVA 3VBHB 5CNAA 5IK7A 3ZYIB 1GLHA 1MQTA 2PQQA 1VBD3 2GC3A 1HQNA 4S2DA 2Y0IA 4XF1A 1RUE3 3M3QA 5BXXA 1FI2A 3U07A 2YYOA 5AC92 2Q4SA 1VALA 3AYCA 3FE5A 1YI9A 5A33A 4NHMA 5JIUA 3WUDA 1KJRA 2PHLA 4XF0A 4C90A 2GC1A 1BJQA 4OHWA 4LO4B 1GNHA 4GMP3 1ULGA 2Q1ZB 2R042 4YGCA 4BWOA 4CP1A 3WW3A 3HD8B 3NAPA 5H9RA 3N35A 1QXJA 1Q43A 1V9U2 1VIWB 2GC0A 1QH7A 4BHPA 3MZHA 4B8EA 3GHMA 3WZ1A 5C9AB 4K8FA 4AFDA 2W0XA 3AKTA 2W08A 4EN6B 5KXDA 2YDEA 5JSRA 1Q8VA 2Q1MA 3ATGA 3ZN4A 4AI2A 2OIIA 5C33A 4C0HA 2BYVE 2WT2A 3D82A 1SLBA 1RMU3 2PHXA 2Z79A 1ULEA 2IXCA 1NYWA 4C1WA 1VB4A 3ZXDA 4B29A 4CDQA 3WP3A 4AQ6A 1TQ5A 3VHPA 1SFYA 5BPXA 4JGZA 3AMPA 4JV4A 1RUI1 2VOXA 4KWLA 2Y38A 4JGYC 4M0HA 1FOD3 1T6GC 1W39A 1NQJA 1VP6A 1N3OA 2DFBA 2YC0A 4DNYA 2A70A 1ULFA 3W9AA 1R091 1ZM1A 3KS7A 3WCSA 3N7JA 2WJSA 4HETA 2AENA 2GMMA 2CY6A 4IEWA 3BU7A 3MPPG 2OW4A 4LHKA 4OVEA 2ZOEB 4DB5A 2WNVA 3EXUA 5HCFA 4H7MA 2XH6A 1G9AA 2XJUA 2DCKA 1MVEA 1J3PA 3MIFA 3SNMA 2GALA 3PVOA 4GMP0 4ES8A 5CA6A 1XQNA 4I01A 5GZEA 1IOAA 1PIV1 4Y22B 2HWC3 4TSVA 2WIIB 4QQLA 4Y24A 5ABJC 1POV3 2IXHA 2ZMLA 5AC91 5JPMB 4PBOA 3ZFEC 2CWSA 2C0ZA 1DYKA 3IT8A 5CBLA 1JOJA 1Z7S2 3A4UA 4KH9A 4FOYA 4QQPA 3M2MA 5FQ0A 2X53S 3AP7A 4WVWA 1S55A 5LRRA 2D98A 5JZGC 3J8F2 4QPIC 2R041 2WNUA 3JQXA 3AZZA 2PHTA 1NA1A 3KCYA 4CP0A 4XQDA 3HAGA 2EXJA 1U5ZA 4JGYB 1DQ5A 3FC0A 4Q4W2 4AVBA 1LJ7A 2G4IA 3POWA 4Z92B 2LUWA 4YLZA 1DFQA 1UPIA 3FZ3A 4RSUA 4AG4A 1HXS3 4AI8A 5LRSA 4KQ7A 4M3CF 3WG2A 1RGSA 1OHFA 3THTA 4Y20B 3ROUA 3WQ7A 4XMIA 2WC2A 1N47A 2Q5TA 3ACLA 5H9SA 4XFBA 3O0VA 4Q4Y3 3RYPA 1ZBE3 1FYUA 1JW6A 5JOXA 4D7TA 1WLCA 1YLLA 4G4FA 4M01A 4BM8A 1A3KA 5T5OA 1B35B 4CEWA 2DF7A 1PVC3 4AFMA 2XLFA 2XBO3 4LBMA 1ND2A 5ABJB 4F7ZA 1QJY2 1RVF3 4XETA 3B9CA 1QJX3 1MZEA 3N7LA 3SH3A 2CNAA 2VVEA 3M3OA 3O0XA 3RYKA 1COV1 3OPZA 1BEV3 5KXCA 2ZKLA 4A7KA 3OJBA 4HN0A 1MS1A 5JZGB 3WD5A 1RL3A 4MVTA 3FBYA 3U11A 4RFT0 3TBDA 3E6CC 1GKBA 3DPRB 4X6QB 2NM1A 4CRQA 4Y26A 5KBFA 1ONAA 3ASIA 5JOYA 1OI6A 2YV8A 1MQTC 4NWVA 1QOOA 4JTOA 4AEKA 1MZFA 1AUYA 1ZRCA 1N1SA 5EJ3A 5CB7A 4BLJA 3NV1A 1FPN3 4B4QA 5EV7A 3U0ZA 2D3RA 1XE7A 2QKDA 3MW2A 1O4TA 3S30A 1N1VA 1YO8A 3GBFA 4Q29A 2WLQA 1Z7S1 1QXRA 3NAPC 2BTVC 3AMNA 2PELA 1PK6B 5B2GB 4FVVA 3MW4A 2D5HA 2D44A 3AKPA 1AHSA 5JLVA 4IV1C 4CTEA 1A8MA 2HWF1 2VNOA 3AMQA 1VBD2 3H3UA 5FAXA 1RUE2 3POYA 4L8QA 2ZGRA 5I0UA 4AXOA 1OLQA 4BA6A 2WZR3 5CG9A 1PNFA 1S1AA 4GB33 4Q4W1 1U5XA 3LA7A 3RMYA 3B00A 1CAUB 2AGSA 2C5DA 3KCXA 3PNAA 4N9IA 2PHRA 3NVCA 2A6YA 3GNEA 2RE9A 4RR3B 4CDQC 5IK8A 1G7YA 2AUYA 3S0MA 3NV3A 3GZAA 5I93A 1DQ6A 3SH5A 2E9QA 4JGZC 3RQ0A 2JG9B 5HBAA 4FTSA 5LEJA 1W6QB 1OOPB 1YJLA 1VB2A 5EYXA 2D97A 3FWEA 4AVAA 1ZRRA 4COWA 1S0DA 4Z07A 1RUC1 1LOCA 3ENRA 2RM21 3SITA 4UBGA 3VL9A 5A33B 3BPZA 1DZTA 1S0EA 2ZGKA 1N3QA 1RMU2 5I91A 3ALQA 5D8AB 1SLLA 2LM3A 2WNVC 1QJY1 2ZHLA 5C8CB 3NAPB 2WFF3 1GYKA 1D4VB 1RUNA 2EVXA 1IS4A 5F9TA 1H9WA 3HQXA 4CDWB 1LULA 4KL1A 3H8UA 3VBUA 5JDBA 1KDKA 4QX5A 2B46X 4QPGA 1FOD2 2NZ9A 1PGL1 3ZN6A 4AVVA 4YGDA 1APNA 1UAIA 5GJ6A 1OA4A 4GULA 2FZ2A 2OA2A 2PA7A 4R4XA 1PZ7A 4OI4A 5JSOA 3IDEA 3AJZA 5FPZA 1Y3TA 3BODA 1H1MA 4KWJA 4PQ9A 2BNMA 4DINB 5CAZA 3MI8A 3M3CA