2VNOA

Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
SRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords CPE0329
total genus 42
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vnoA00
2VNGA 2VNOA 2VMHA 2YGLA 2VMIA 2VMGA 2VNRA 2YGMA
chains in the Genus database with same CATH superfamily
2J22A 2PAEA 2ARCA 4AFDA 4MX3A 2V73A 4Y33A 4IV1A 2D6KA 5JLVA 1W06A 2C24A 4BE3A 2JDMA 3U4XA 2HBTA 2BDRA 4JC1A 1GZ9A 3POJA 2NMNA 4FVVA 2FZ1A 4K40A 3B93A 4XPVA 1LU2A 5IVYA 5M0TA 1LB2A 5EWSA 1DZQA 1S0FA 1H30A 2P5BA 3JD73 4RGKA 5A6ZA 1DGWA 4NROA 3J26N 1V0AA 1WCDJ 5J98B 5FJHA 1GFF2 5I91A 1RJ8A 1ULGA 1L3JA 4CCKA 2Q8DA 5EHDA 1IS3A 2CNAA 5F5CA 4BIOA 1P8JA 4DEQA 3KV4A 3RYPA 3TEXA 4YLZA 4YGBA 4CVUA 1WW6A 4CDQC 2DVFA 3FHQA 4DXZA 4XFFA 4XQWA 3WG3A 4AGRA 3D6EA 2VJXA 1UYPA 3I2DA 2QE3A 2GN3A 2VVEA 2ZCWA 5FP8A 5FZ9A 4DINB 5FPBA 1YEWA 1QJY2 4BQXA 4Z2WA 2VM9A 1LODA 3UKNA 3B3QE 3OJBA 1V6OA 3NV3A 3OPTA 2UURA 5FDBA 2VR4A 2D98A 2O1QA 1H1IA 2WRAA 3ACIA 3BIWE 1R1A3 1KITA 1OFSA 1PVC3 4FPYA 4HFSA 4IEVA 3U0ZA 2HWC3 4QPWA 1CAWA 1AYM3 1MQTB 3POFA 5CIRA 5H9SA 2K2SA 2QQJA 3HNYM 5CKNA 5EXOA 2W1QA 3BTZA 1DCSA 2Y8KA 5GLZA 1A34A 4JGZB 3ITQA 2IVJA 2CL2A 1L7QA 4J1WA 4H14A 3POIA 5FY4A 1WW5A 1UOJA 1XB9A 1I9RA 4MGYE 5LBEA 1A3KA 1PK6C 1UN1A 3ELNA 2AREA 1BK1A 1OLQA 2BNNA 4LORA 3USUB 5JI7A 1O7FA 1NA1A 3OOXA 1VBD3 4IEUA 4FP2A 5FBZA 4Y1YA 2JD4A 1AR91 1V9U3 2BBAA 3W59A 3WQ0A 1S2EA 2EAKA 3N9MA 1UYXA 3OD4A 4FT8A 2BBVA 2C26A 1N1TA 4KBZA 5DN2A 4AI0A 3M2MA 2R072 4WM7C 2NN8A 2G1MA 1URXA 4JGZC 1MS8A 2Y60A 1JOBA 4MGQA 2GC1A 4GXLA 3AP6A 4YGCA 5A3NA 4HSJA 1POQA 1ONAA 2XKOA 4R9DA 1ZREA 3WW2A 4AI3A 4PI0A 2HEWF 5E88A 3LEIA 4J6GA 2CWSA 5CB7A 5BNNC 1QKQA 4MGKE 4W6YA 3WNPA 4IV3C 3UYJA 1PIV3 1ASJ1 1W9SA 5JXGA 4OHYA 3POEA 3AZZA 3LIHA 3JB4C 3K48A 3I7DA 3NKTA 4M0HA 3VBRB 3FHAA 2OX0A 3VLBB 2XBO3 3MHZA 1NXMA 2V5DA 2X10A 4QT6A 1RTVA 4FCAA 5E8AA 5C6CA 1PX4A 5BNNA 1O3RA 1D4M2 1VB4A 4IV3A 2JKXA 5TSWA 4N9IA 1HLCA 1SPPA 2R1BA 3AYEA 4RSUA 4Q2FA 4X6QB 5FPXA 3EBRA 4K7JA 3WZ1A 2ZHMA 1ULPA 1ZRCA 4OQ9A 4W50A 1XBFA 3VHNA 2NPIA 3CBNA 3KCYA 2PHUA 4R4XA 3TN92 1OF3A 4XBQA 2WS91 4I3GA 5FLHA 4DZGA 4LOTA 3MI8A 2FDGA 2AEYA 4SLIA 4NIHA 2XVKA 1ZRDA 1AYN3 5FZMA 4LUMA 1AL22 4LA3A 4NAMA 3MF9A 3PU3A 2QQOA 4XCAA 3EXUA 1AR62 2CTVA 1BK0A 1ZZ7A 4RHV1 2XWBB 3IBMA 2ZAAA 2BU9A 4XJUA 1FPN2 4Y4YA 1GWLA 2JDAA 4QXCA 1SFYA 3O1PA 4CRQA 1HRI1 3MW2A 3AYAA 4IXLA 5LWBA 3O1SA 2LROA 4DRRA 4FSJA 4DS0A 1YLLA 3ACFA 2WT1A 2DFCA 1G7YA 1KFUL 2D6NA 2WQ4A 3HJRA 1LEDA 2EXIA 4TLGA 3PLQA 4COVA 2DVGA 1SCSA 1WMFA 1S2KA 2Y6GA 2YHJA 5LY1A 3M7AA 3ZFGA 1YFWA 3NAPB 2VTXJ 3E5UA 1W8HA 2R063 2BEOA 1HIXA 1GWMA 1Y9GA 2PHLA 4FPLA 4QXKA 2VO5A 2W92A 2VUAA 3OGSA 4Q8LA 4CCEA 2FCTA 5GZGA 3C3VA 4YM3A 3ZFEB 1VMFA 3HNBM 4RQPA 4EZ4A 1RMU1 3EHKA 1EUTA 3GHNA 4QKBA 3RVHA 3USSA 4AF9A 2Y34A 5DAVA 1RUE3 1C8M1 1W39A 2D5FA 2PHDA 3RSJA 4AEMA 2JEMA 1V6MA 5L7OA 3T3YA 4G9SB 4AG4A 4BPZA 1UF2C 3SQOA 4I2OA 4NIAA 4KQ7A 1NZIA 3AL5A 2IWGB 4FXKB 4NUBA 1PNGA 4WM8C 2OYZA 4XVHA 4Q29A 1UQXA 3H8OA 2Y6FA 3RRDA 1U5XA 3K51A 5GKAC 1LJ7A 1HRV3 1YI7A 2IXHA 3NSTA 4BCUA 1PMHX 4XJ8A 2XVGA 4PF5A 2ATFA 4OI4A 4Q4X3 4FTSA 2VD7A 1NLSA 5CFCC 4HVOA 1V6KA 3WNOA 2RS52 2WQZC 5FYBA 2R073 3W5MA 2D6LX 4UFHA 3ZVXA 3X29B 4BA6A 2JE9A 2IXCA 1K45A 1YO8A 3EB7A 4HK9A 4IV1B 4CP0A 1GZWA 1SLTA 4D3WA 2BGCA 4FAHA 5BUVA 4XDOA 4XDQA 1UZWA 1LHNA 3CDZB 4XF1A 1RXGA 2HWF3 2MEV1 1LNSA 4P08A 3BI3A 3HVDA 4QQOA 2WA3A 3GCWA 4JRLA 4M3CA 2VE1A 4DOUA 5C3SA 4NRMA 3KWVA 2UU8A 3AMNA 5E1RA 5T3NA 1TNRA 3WF0A 2QDRA 3DXUA 2DCKA 2PA7A 4LE3A 3SLIA 5LK5A 3VL8A 2ZS6B 4C0BA 2XJVA 1PZ9A 5HI0A 4O7XA 1CR7A 1UIKA 1QJFA 2WO3A 3CJIA 1H2KA 3KS7A 4M3CF 1UZZA 3P3NA 1YQ2A 3MUZ1 5FRAA 4DY3A 5C9AB 1DQ1A 3TN93 3E5XA 3EMRA 1U0AA 1LR5A 3OEBA 1IS4A 1UY3A 5GLWA 2VQUA 3U75A 3O1RA 2X5IA 5DDJ1 1J3PA 2GMEA 3HOBA 4Y5Z0 3N9QA 4W6WA 1F5FA 3IDCB 2QTWB 2DVAA 2XGXA 2ENRA 4DMIA 4UF0B 1IPSA 5IAVA 4CDWA 4U36A 4CXWA 1CWPA 1FXZA 1TZOA 3IIAA 2W1SA 2OA2A 5EPAA 3AXDA 4JHZA 4EWDA 3RDIA 4MV2A 4N43B 5K0UC 1DIWA 4E2GA 4Q4X2 4JGYA 3SC7X 4JTOA 4LMFA 1DZRA 1UO9A 3L9JT 2ET1A 5JMCA 4Y20A 4RD7A 2RMU2 1GUIA 2NQYA 1WA6X 4QXHA 5LEKA 3O1VA 1IQDC 1ND2B 2YU1A 4AXOA 5F2WA 1EV11 1JI6A 2QZ2A 2WWUA 5DXDA 1RUNA 1F8VA 5J09A 2VL4A 5A32B 5FPAA 4KH9A 1IS5A 4CXXA 1VPHA 2N7GA 3MLKA 5LA0A 2VGDA 2AR6A 2B45X 4ZU5A 4PDWB 4DXRA 4AVBA 1HQWA 4HG6B 2OZJA 1ZZBA 1S55A 2JECA 4GH4A 5A6YA 2GC0A 4RFT0 4XXPA 5FTTC 4A44A 3I4IA 1XOYA 3E6DA 5F7UA 3VBSC 4N43C 4QB2A 1AJOA 1KEXA 3HQUA 2HWC1 3JD71 3BIEA 2ES3A 4RYDA 4C1XA 1QH7A 3QOPA 2WQ8A 1WCQA 3I2KA 1MQTC 1R1A2 2E33A 3VBSA 5GZDA 4WM8A 2O8QA 1GNZA 3TNPB 4CCOA 3RS6A 1JHNA 2BJSA 1SPPB 1VAMA 1DLCA 3LF7A 3KV6A 4GJZA 4I0AA 3NQHA 4YZ4A 2JDUA 5KHJA 2VOTA 4META 1GZTA 2K9ZA 3RNSA 3D4KA 3ZSLA 1S0CA 5KXDA 4PQQA 1OT5A 2W3JA 5LBFA 1RUI3 2H6CA 1W6OB 2O8OA 4HKLA 4PIXA 1FV2A 4COZA 2QQUA 4IL7A 4XYXA 5KHGA 4OHXA 2YFZA 1EPZA 2CV6A 3WUCA 2F4PA 1AXYA 4HN1A 4HZFA 1IKQA 1BVP1 1G6NA 5FMCA 2DV9A 1UYYA 2B8MA 2C5DA 1RUG1 1SBDA 4UBHA 5C4WC 2HKXA 1MS9A 4UW5A 1N3QA 1D4M3 4OHZA 4XHXA 1QJU3 5F39A 4CEWB 1QJX3 4CYDA 4GIQA 1UWWA 3ES4A 2R043 5FYVA 1AYN1 1E5HA 2JG8B 3JUUA 2XB6C 2EIDA 2MEV3 5FO7B 1LOAA 3U1XA 5FJKA 3WD5A 5LA1A 3W20A 4Q1RA 4E4DX 2A3WA 1OPMA 3WP4A 1RUJ1 3ZFEA 3PTRB 4BXSV 1V6LA 4RQPB 4W6XA 1TMF1 1GNHA 3KCXA 4XILA 3OUIA 4XMIA 4Q0UA 4AEDB 3WQ1A 1DDLA 1UMZA 2CDPA 1HX6A 1SQ4A 2VZ1A 2XPJA 2WDBA 2BWAA 3HAGA 2D7FA 2XR4A 1VBC3 3J9SA 4GMP3 4BQ2A 3ZXKA 3H7YA 4P9IA 1TME2 2R16A 1HKDA 4BQWA 2OXBA 5FYHA 3RZMA 1FV3A 1L7RA 4AVCA 4GD4A 2QCSB 1NXD1 4HONA 4TYSA 1R092 3R6SA 3WDXA 1H2MA 5C71A 3N7LA 3WUDA 4CA9A 5F3IA 4EV0A 4XEZA 2HEVF 3UESA 1MZEA 5KWRA 1BYHA 2OT7A 3H1MA 3ACGA 5GLTA 2WFF3 1PK6A 1EAH3 4PIYA 2WFF2 1S0IA 4HBNA 4LNVA 4IEPA 3H8XA 4Y5TA 2R071 2CYFA 2P3IA 4XABA 5IVJA 5CEHA 2XJUA 4LHSA 3LOIA 3SISA 3D0JA 5GLUA 1PZ8A 3DECA 3GJAA 3S0MA 3BTAA 2J7MA 1BBT2 3OY8A 4YW2A 3KGLA 5LZ6A 1KXGA 5CFDB 2D5HA 4AL9A 1MEC2 2HWF2 1ZNPA 4HPKB 1D4M1 4XFBA 4LHNA 1PGW1 4FQZA 4BM8A 1LECA 2PN5A 4Z82A 2YROA 1FX5A 3PUAA 2PQQA 3CJIB 1W6MA 5ACA3 2AGSA 4IEWA 1UY1A 4Q4Y3 1MZFA 1C8M3 4BB3A 5C9AA 1XNDA 3OPZA 4RFRB 5AVPA 3PMEA 1ZBA1 5FY5A 2YBSA 4XFIA 1B35B 4HKWA 2QQNA 3TB0A 4CU6A 3IKWA 4ARYA 5A3OA 4DEVA 3TRSB 4AVVA 1JODA 1X8MA 4LQRA 5FP4A 1BMV2 1H4HA 1H8VA 3LKJA 5C9AC 1GNYA 3B02A 4XFHA 4BWOA 3W5NA 5G04L 1CAXA 1EAH2 2ZGPA 5A7PA 2PELA 4OMCA 5J48A 2Y6LA 4QX7A 4Y26A 1U5YA 4LK7A 1W3VA 4NRPA 1BXHA 3E6BA 3OF1A 4YW6A 2BPA2 1W8OA 1RVF2 1RUD3 4LO5B 2GC2A 2HBUA 1UXXX 1OD3A 2VZSA 1RUH2 2LTNA 3NKGA 3TYJA 4KL1A 4ZHNA 2HLEA 1OUXA 1R093 2A75A 4L97A 4L9BA 1BLZA 2C9KA 5APAA 4CPBD 2RJLA 1OHFA 4FFIA 1YXWA 1O8SA 1W0OA 2G9FA 2BTVC 4LBMA 1BMV1 1EP0A 1OA2A 4Y1VA 4ZY9A 1VB2A 3S57A 3K75B 1TQ5A 3BKZA 3I97A 3VBRA 3AP9A 4IDZA 2EIGA 2W5FA 3LFMA 3NNGA 5BV6A 2WS93 5DABA 4YVSA 4ORFA 2W47A 4A7KA 1W6PB 4DY5A 5FV3A 1SACA 5T5LA 5A70A 3ZMOA 2VZTA 5HPOA 1O4YA 4Q26A 4S2FA 3DCQA 5JOZA 1YIFA 1G86A 2V5YA 3MZHA 1D4VB 1GBGA 2UYBA 2XDVA 3MFCA 1IOAA 3O0WA 4QPIB 4R4ZA 4B4QA 1SZBA 4IE5A 1RUH1 3OD0A 3HQRA 2KM2A 2HEYF 4AR2A 4CCNA 4YGDA 1NLQA 2FDFA 5I0TA 2YGLA 1AYN2 2BP6A 3FX3A 5LRSA 5CVRA 4CDXC 2B7YA 2DF7A 3VBUA 1C5HA 1SFNA 2WA4A 4Y1UA 1OA3A 2RHPA 2UYAA 4N9HA 5GZEA 1HJFA 4NPRA 3U4SA 1JH5A 1EY2A 1XPWA 3HT2A 1Z0HA 4W4ZA 1GQHA 5FMBA 3WDWA 5DG2A 2IC1A 3AVRA 2ZMKA 3WT3A 2ZGRA 2VMIA 2JJ6A 1ZZ9A 5C8CB 3ZN6B 3D0SA 3UETA 3WP6A 5A33B 1QMJA 3JU9A 2W1WA 1R1A1 1UMHA 4K8RB 4C8DA 2XBO1 4O9EA 5FZOB 3F95A 4MH0E 4XJZA 4EN6B 3RMXA 3HNMA 3S6PA 4NHXA 1VBE2 4YW4A 1YCIA 3D3AA 3ZFFA 1FOD3 4TLFA 5FZKA 5K9YA 5FXZA 2GNDA 3NAPA 1ULCA 3PJQA 3VHOA 3LWCA 1AR83 4L8QA 1UKGA 1JZ3A 4XF0A 4UOJA 2PLV1 1DP0A 3DUIA 3MIBA 3AP4A 4R9BA 4ARXA 3OGJA 3WQ7A 3MLJA 3U14A 4CUGA 1ZRRA 2DUOA 1AX0A 4LLFA 1VAVA 1F4HA 4JAAA 3OGRA 5IATA 3NAPC 4LHKA 5KBFA 1YFXA 3FN9A 5A3UA 5EYYA 5HCFA 4QU1A 4D7SA 4O65A 5L7OB 3WINE 4KI5M 3R4UA 1DGRN 3MV01 4UFKA 1VBE1 2JG8A 4H7MA 1TVGA 3POBA 2E32A 4LUKA 1MEC1 2BOJA 5BPXA 3WCRA 1YC61 1V9U2 2RDRA 2ZAHA 1QOSA 4MVTA 4R8HA 4BISA 3GZAA 1NOVA 3LDBA 2GNBA 2DCTA 3I49A 3RJRA 3BODA 3T08A 4DO0A 1RUC3 1W9FA 4NIGA 2SLIA 3TNQA 1W9YA 3PJYA 1RUD1 1CZTA 2WNOA 1VLNA 2VBPA 3POYA 1QJX1 1DQ2A 3I2HA 3SNMA 2VUDA 3N4MA 1RUI1 1MVEA 1DGRA 4XTMA 3ZMNA 4AEKA 1YQCA 2F17A 5FO9B 3WDUA 4A45A 1PHMA 2P17A 3IDBB 4AEDA 3AB0A 5A3WA 2W39A 4AI8A 3RZGA 1JZ2A 2JWPA 4C0HA 3DF0A 1H8TB 1MPXA 1WCKA 1FNZA 3IMMA 1ZBA3 3J8F3 3FWEA 4IW3A 1IG0A 4D7YA 5C8CC 3KVAA 3KQ4B 1AYM1 2BQPA 3QH7A 3WG4A 4IE0A 5FREA 3I2FA 3K4ZA 1QJY3 5BYNA 1NY72 1RL3A 3OUHA 3NO8A 3ZSKA 5AC92 1FOD2 1QJEA 1W8FA 1W0PA 1PM4A 3WR0A 2JD9A 3R4SA 2FD8A 3EJKA 5IAXA 3NL1A 3E1F1 2JB4A 4YFZA 1KDKA 2WWJA 3CJXA 1ZVFA 3NNJA 4A6SA 3RGBA 4COUA 1RB8G 3ZFGC 1PO23 1PVXA 2TEPA 4P9LA 5IK5A 1X82A 4CCJA 1ZBE1 2PHTA 4FI9A 1OLMA 1XYPA 3AMHA 3T0DA 3J8F1 1NAEA 1SLAA 5CBLA 1EUUA 2VOVA 2WFF1 3Q8BA 1JZ5A 3HT1A 1TEIA 3WG1A 4P5HA 2YC2A 4D94A 5KXEA 2NLRA 1GYKA 1WBLA 3UL2A 1D7PM 1QOTA 4V2WA 4N53B 4E27A 2D6OX 4QAWA 2P2KA 2ZGMA 4UF0A 4OUEA 3HR9A 3MW4A 2OUHA 3VDDB 5ABJB 4ZS2A 5FO8B 3U11A 4E4HA 4D69A 2EXHA 2LUWA 1I5PA 1RYYA 2E63A 4N43A 3FMGA 1OKOA 2AH2A 1LOGA 1FOD1 1B35A 4ES9A 1S0BA 5F5QA 4GB32 1K5MA 3V0BA 3AZXA 5BNQA 2IXJA 2DCYA 1W28A 3WNKA 4B29A 5JAXA 4LITA 5E6HA 2Z79A 2B42B 2ZX1A 1IPJA 4BK4A 3INAA 3WOGA 2QFEA 1W04A 4DXTA 1HW5A 1RUJ3 4QX3A 5C5TA 4ZZ8A 1W8UA 4LO7A 4NWVA 5DMYA 1QIQA 3T0AA 2VMFA 3FLRA 3KT7A 2I74A 5JVVA 5T5OA 2CHHA 3VKLA 2E26A 5J1XA 1R083 5EIYB 4MOAA 1S0DA 5FQ0A 3I2JA 1AF9A 2B5HA 2XL7A 3RPQA 3VBHA 1MS1A 2V72A 4LBQB 2PHXA 3OYWA 2W08A 4GQ7A 1ND3B 3LEGA 5HV0A 1I3HA 2ADEA 3LE0A 1CGPA 2X8KA 2ZOEB 3ZSMA 1HB1A 1KQRA 3GCXA 3Q9OA 3WW4A 4HLTA 4P02B 1OH3A 3JBG3 1I6XA 4R9AA 3ACHA 1T6BX 5F2SA 2E9QA 5BNOC 5IK7A 5CA6A 1RUF3 2PHFA 3VBSB 3LOBA 1Q8QA 1HB2A 2VMGA 2Q30A 3AFKA 5C3PA 1QU0A 2VCCA 5FXXA 2VUJA 3V56A 1SG3A 3AKTA 3B9IA 3DPRC 4ZU4A 3LD8A 4AWDA 1JZ7A 1RHI2 1GZCA 3APBA 4YFWA 1UIJA 4IE4A 2XWJB 3VD9A 1YFYA 3SEPA 2E31A 1MS4A 5EQUA 2Y0OA 3GDBA 3QH6A 2VXJA 4HT1T 4KWJA 1OQEA 2FHRA 5EJ3A 4V1PA 4YG6A 2ZGQA 3SCGA 1RUI2 3BOWA 3VBUB 4KBBA 4A4AA 1CN1A 4Y22A 3GZEA 4CCDA 1UW8A 5FOBB 3SKJE 5CFDC 4IGQA 1X8EA 2ORXA 2VH9A 5H9RA 2LM3A 5EV7A 2VZQA 4GJYA 1GP6A 2GNTA 2WNVA 3LEMA 3WDTA 3Q8FA 5BNPB 3NV4A 5C8CA 3H7JA 2J1EA 4LKEA 1G9CA 3MIDA 4CP9B 5F1RA 3VUOA 5A7SA 2WO2A 5EJZB 4DFSA 4EYUA 1OUSA 2YXSA 4DRVA 2QQMA 1JU4A 2Z5WA 3I3DA 2O0OA 5EJ1B 5L9VA 1K5JA 3RYRA 1OKQA 3MBWA 3ORJA 3J4UH 1AUYA 4XJAA 1H6YA 2QJVA 1J3QA 3L2YA 5DG1A 2A7AA 3ETPA 4Q5OA 5FXWA 1T2XA 1RMU3 2HH9A 1CZSA 1O59A 4LKFA 3ZYRA 5A3LA 3KCCA 3ACLA 1A78A 1V6NA 4CDQB 1UU6A 2HWB1 4BYYA 1W3XA 1DLLA 2DTWA 4K1YA 4FTEA 4IEXA 1N1SA 4LBKA 1QDOA 4Q0PA 2VNOA 3ENRA 3URFA 3WDVA 1NQJA 1JTZX 1PGL2 5IUQA 3VBFC 1UOBA 4Q4W2 2D6PA 5L9RA 3DYPA 2RS31 4JRAA 1BQPA 1HQLA 4NPMA 2XJPA 4QM9A 2C1FA 3UJQA 4EN9B 3O12A 1VBE3 1QJZA 2TUNA 3GZUC 1C28A 3VDDC 1XXNA 2ZACA 1RUC1 2D3SA 2RJKA 2VCMA 1VP6A 4FFHA 5AC93 3RZZA 4KU7A 2UWCA 3ROUA 1AR93 2C4XA 3WXPA 3ZXAC 5I0RA 3OY8B 1PZ7A 1NCQC 4H3WA 4FP3A 5LW9A 3A23A 3N7JA 3MIHA 1YFUA 4CXYA 1UZ0A 2A1XA 4LOSA 3T2OA 4LHLA 4J25A 3RI8A 1UZYA 4FPKA 5FZ3A 1Q5OA 2B46X 2Y26A 2AYHA 1LESA 3VZJA 3KB5A 3CKHA 4X6RB 4CDUA 4J1XA 2XUMA 4JTNA 1FAYA 4QB1A 3V0AB 2W94A 3R05A 3T4HB 2HWC2 2A71A 2ZZQA 1AVBA 3HN3A 2J1TA 2E53A 1WLCA 2WSVA 2ZA9A 5LY2A 4AAPA 1RIRA 3DEMA 1UU4A 2XKPA 1E5SA 2GNMA 5IT6A 1G9FA 5BNOA 3RYKA 1PGW2 1SMVA 3DN7A 1E5RA 2O14A 5T5JA 3I3EA 4AVSA 1YQ5A 1Q8OA 2Z4FA 3FBYA 3L2HA 2PFWA 5FPVA 1RUC2 2BERA 1VBC1 3UGHA 4X8NA 3S5AA 1QJU1 3B7MA 1POV3 1W6QA 5CU1A 3UJOA 5J37A 3ZFEC 3IT8A 3I3QA 1DYOA 2WZR3 4L92A 3GJBA 5F8PA 4K9SA 4AK3A 1MS5A 1O4TA 3LZZA 2VVDA 4YYOA 2WYFA 2BNOA 1JYCA 1N47A 1LGNA 1ZZ8A 3VB9A 3PU8A 3HD8B 1AXKA 5FYTA 5HBAA 2QVSB 5ERLA 5DUVA 5KC5A 4Z07A 1NYWA 5LEJA 3VKFC 2VZOA 4LR4A 1RUG2 3H42B 1OURA 5K0UB 2AACA 1KGYA 1OOPA 3KM5A 1ND3C 1OQ1A 4WVWA 5T5PA 1J1TA 2AUYA 4QDQA 2H0VA 4CZSA 1I5ZA 5FYIA 4WVMA 1WD3A 4YG0A 1J1LA 1FMD1 3AKQA 3H3ZA 3NRUA 4GKYA 4AGVA 4XE9A 4ZONA 2QQIA 3KV5A 1V00A 3HBKA 1RUG3 2WLPA 4OVEA 4UFMA 4ZS3A 1W6PA 4QPGB 4CUCA 3IMNA 5FZGA 3B00A 2ADDA 2QQLA 4AFBA 3WF1A 1PGSA 1UY4A 4YZ2A 3NNFA 2QQWA 2XL9A 4YARA 4XUNA 5CG8A 5C7GA 3OYWB 1YQ8A 2VECA 4XAAA 2UY8A 4QU2A 1RITA 1DBNA 1LGBA 1VBA1 2QZ3A 2PAKA 1A8MA 4O9GA 4URTA 4ZXKA 1J59A 1R091 4AI9A 1HN0A 1J83A 2GMMA 3WF2A 4IV3B 1REFA 1OBNA 1XSQA 2YUEA 4R52A 1WMDA 1WGPA 5CADA 1VBB3 4M4RA 3T2TA 2R32A 2BW8A 1YI9A 4OQ8A 1FPN3 1OFNA 5A80A 3KF3A 1ZA7A 3POGA 4IQPA 1SBEA 2A6WA 4B7EA 2VC9A 3GYDA 4YRDA 4GWJA 3VBFA 1LTEA 1S1AA 4WM7B 1XQNA 4MGIE 1AL23 4HK8A 3MIFA 4LBOA 1COV3 3AK0A 2WZ8A 2FBEA 3UGGA 4KG0A 5FFOC 3ZM8A 1IGOA 1GQPA 3AMQA 2VBDA 4IEQA 4NAOA 2HJIA 4Y5SA 2VZ3A 5JXIA 3B9CA 4Z2AA 5LATA 1RMU2 2RDQA 3OUJA 4Y24A 3E5QA 5IK8A 4IEYA 1ENSA 2I2SA 3OGGA 4MXWA 3PUHA 2FMDA 2UY9A 1IKPA 1XNAA 2WNVB 1BHGA 5BNPA 1F4AA 3N7MA 2DCZA 3AKPA 1CIYA 2WZPP 3VDBA 4QKDA 4PJYA 3H8RA 3IWZA 2AEZA 1POV1 4CEWC 4EWEA 2YPJA 5IK4A 4FQ4A 2J1UA 3N9NA 3RI9A 1EV13 4BH9A 5DZEA 1W2AX 5A3PA 4AVAA 1F15A 4L11A 1U5IA 4MYEA 3ES1A 5JIAA 4LA2A 4AHZA 5D8AB 2OVUA 1O8PA 3T30A 4BLIA 1D2QA 4XACA 4QDRA 4Q4W3 3VD5A 4EQVA 4XBLA 2OKXA 1XC6A 1QNYA 2CY6A 1NCQB 1UCXA 2EF6A 1ZBE2 3WNMA 4AI2A 2XLFA 3VZMA 4FPEA 4AQ2A 5F3EA 3VD3A 3UNPA 2OQ6A 1KDMA 4JVAA 2TNFA 4N7UA 4PQ9A 3A0KA 2ZXQA 2V09A 3ASIA 5CYYA 5K7PA 4CDQA 1HV1A 1EV12 5I0UA 1IS6A 4XUOA 1Q3EA 1ODNA 1W9TA 2JIGA 1PIV1 1JHJA 4E8DA 2JIJA 3GBWA 3VBUC 1JOJA 3FLPA 2C9AA 4NN0A 3U37A 2FDHA 4WVVA 3NJYA 3TN91 2Y33A 3IPVB 2DCJA 2X05A 3C8XA 2OQ7A 2W2IA 4CUBA 3LA7A 3RWKX 4UYBA 3ZYJB 3DPRB 3WX5A 5JXJA 1B35C 5K4LA 4OULA 2EICA 5F3CA 1HXS1 2RVAA 1UKRA 1G9AA 2VZUA 1LKNA 2P3KA 3DKWA 4UAPA 5KXBA 4E9KA 4QQPA 2D40A 2HWE3 3CMGA 3A21A 4XUTA 5FKBA 4DUVA 5JR2A 1WMEA 4UXAA 5I8SA 3SHRA 2BOIA 2JG9A 3RZLA 4CDXA 3JXSA 2R49A 4UW4A 5FZCA 1IHMA 4NPLA 3ON7A 5GJ6A 1SLLA 1FPN1 1E5IA 1UPSA 1XYOA 5DAPA 2NYYA 4AE2A 4AOCA 4BHPA 3IAPA 3Q8AA 1NA1B 3GNEA 2SBAA 2YZ4A 2YB7A 2B9VA 4QX2A 5FCCA 4AFMA 5T52A 4DUXA 4LO6B 1BEV1 5DAXA 1WBFA 3P5BA 5FYSA 1Q8PA 3BPSA 5HCBA 4BQ4A 5C3OA 1HXS2 2B4KA 4CUAA 1ULFA 3PL0A 4LT5A 1CAUA 3MV11 1N3PA 3QLQA 1CX1A 4JGZA 4UFIA 4QQHA 4D8MA 1HV0A 5BNOB 2XG3A 5FP3A 3ABZA 4M3CE 5FZ1A 2D44A 3VBOA 2IXIA 4EJRA 5FUNA 1YWKA 1PMIA 4JCKA 5DPNA 1OLRA 3T09A 1NA1C 2R061 4MG2A 3PVBB 4LO8A 2X09A 4I30A 4XC9A 2RDSA 2XBO2 5A1AA 3BGAA 3ZYHA 2XVLA 2B39A 3PVNA 2A6ZA 1CJPA 2FDJA 4AEDC 4S2GA 1W2UA 3ZO0B 4IGOA 2ZKNA 2ZJCA 5BNNB 2ZX3A 4BQ5A 3ZPYA 1W8WA 2P3JA 2VMCA 4YZ3A 4AAXA 1YQ6A 3BU7A 4RR3A 4FPHA 1UY0A 3PDQA 5FQ0B 1VRH3 1H2LA 1UXZA 1CJDA 1ZX5A 1K3IA 4P5YA 3HWJA 4CP1A 2G9GA 3GGLA 3NNLA 1GV9A 1NT0A 2R062 1OOPB 4QHZA 4Q4Y2 4UBGA 3ZXDA 3NWKA 4MHRA 2XJSA 2YFUA 4QX0A 4RR3C 3G6JB 2VCAA 4WVMB 1HXS3 1H0BA 3C7HA 2ZHNA 3A4UA 5D21A 1JU3A 4B3NA 1UOFA 2PHWA 3A7QA 3LGRA 1GOFA 1VBD2 4OHWA 1SDDB 4PDWA 4MGZE 3K3NA 1ENRA 5L9BA 3H9AA 1AR73 4GB33 2HWD3 5ABJC 4AQ6A 3VKOA 3KF5A 2LRPA 2P6HA 4N53C 2AZ5A 3JQWA 1HB3A 2RG4A 1O3SA 1SDWA 3MDPA 4ES8A 5BY5A 3I2GA 4QD2A 3KSCA 3Q8EA 2WNEA 1AR63 2P3YA 5A7QA 3FJSA 4ZZ5A 2FDKA 1W8ZA 3AJYA 1XSRA 1UOGA 5FXVA 4K21A 1ZYBA 1OMIA 4P9JA 3ZFGB 4BJ0A 1LOCA 1LULA 4XFAA 3AP7A 2WFPA 3SCHA 1ASJ3 1WCSA 4YVWA 1XU2A 5I0DA 2GMPA 1SCRA 1W90A 1CPMA 3OSDA 1W0NA 2HWD2 2IFRA 2RS11 2YC0A 1RGSA 3S7IA 3H8UA 3V65A 4Q4V3 2IUWA 3N3HA 4A7YA 1H9PA 4KNCA 3MW3A 5L36A 4YVWC 4GALA 3VKNA 2PHRA 1LOEA 3LAGA 2JENA 4Q4V1 5GZCA 1N1VA 4Y1ZA 2PLV2 3VD7A 3DL3A 4ZU7A 3V0AA 4QX1A 5DUWA 1Z7S3 1PIV2 1EYBA 2OPWA 3SKVA 3PUSA 4QMAA 2HYXA 3O1MA 4KWKA 1LEMA 4FBFA 5FIXA 1AL0G 5JOWA 3WP5A 3AXEA 5FZ0A 4D7TA 4B1LA 2IZWA 3POWA 5CFCA 1C1FA 1M06G 1W99A 3CQOA 4RS5C 5IVCA 5IFTA 2A73B 4P9WA 1TME1 2MNGA 1S0EA 1EPWA 2P1BA 3GHMA 2HWD1 2RS12 4GB31 2DVBA 4XF9A 3CU7A 1ZZCA 5C3QA 2A5ZA 3AZVA 2JDZA 2ZX2A 4FO9A 3PIJA 3T1LA 2OW4A 5J7MA 2Q1FA 4M3CB 2YMZA 4AI1A 1DGLA 1G8WA 2DBNA 2XJQA 4TXWA 2VG9A 3KVBA 4ITCA 1H1MA 2HWB2 2XLAA 3IB3A 1N3OA 4OI1A 2YYOA 3JZVA 2DURA 3IM0A 1F31A 1IPKA 4I01A 4DB5A 3V64A 2EXKA 1VRH1 3FE5A 4QPGC 1AYM2 4G4FA 2DYCA 3C7GA 4S2DA 2ZEXA 3MYXA 4OFGA 2XQXA 4M0NA 2ORZA 2VUCA 1RUE1 2VULA 1O4ZA 5FYZA 5BXXA 2EIBA 3OCPA 1NKGA 1VMHA 4AFAA 3AC0A 2VW2A 1DQ5A 4AGGA 3IDAA 4CSWA 1FYUA 1Y7BA 1CQ9A 3N9PA 4YGEA 4KGGA 4QX8A 1HQNA 3GBGA 4IETA 4NHYA 4PLNA 4AFCA 4C91A 2IFWA 5FZ8A 1AR82 2HWE2 3GM8A 3FBMA 1X33A 3NV1A 2G9ZA 3TEZA 2ZX0A 1PNFA 2ID4A 3DPRA 5C8WA 4CDUB 1Q8SA 1I1EA 1UD1A 4HL0A 4LBLA 1PK6B 1WWYA 3E97A 1Q8VA 4FPCA 4HVRA 4YW1A 5FK8A 5LA9A 4FPGA 1GLHA 2WR9A 4YM0A 2ZBJA 1JYIA 1JOPA 1OOPC 2JG9B 1VJ2A 3RWNA 2VOXA 4CDXB 4LBJA 2WYSA 5FMOL 4AQSA 2CGNA 3MF6A 3N35A 4XDPA 2W52A 2E7QA 4DPNA 1EAH1 5GALA 4QGMA 4BLJA 4TZDA 2VTFA 1UX7A 1ZRIA 2R30A 2VQ0A 4PT6A 2YBPA 5FY7A 3PURA 1RVF1 4FFGA 1RUOA 5H9PA 3JBG2 3M3EA 4WZCA 2WNVC 2LALA 4D6RA 4QKNA 5IWFA 4IUGA 3O1UA 1DYKA 4JZRA 4AYUA 1TG7A 2OPKA 2WKKA 2R0FA 1DG6A 1JZ4A 2P4EA 1AR81 1ULDA 1WW4A 2GP5A 3SXWA 5C3RA 5FKCA 4JGYB 3I59A 4MSVA 4HOOA 5I0SA 4GMP1 1CONA 1OF4A 2EALA 2UWAA 2WL1A 3I8TA 3KHBA 4GH4C 4JKMA 3KD4A 4GH4B 1OSGA 2YPDA 2RV9A 3ZIXA 1ZRFA 3ATGA 1UAIA 3RFRA 1GP4A 5KC6A 4BU2A 2W9XA 5JDBA 3LIGA 3WEZA 3SEEA 4NE9A 3CO2A 3VDAA 4COWA 3JBG1 1ND2A 2RM23 3PUIA 5LRRA 2ARBA 5FAXA 3ZLIA 1AX1A 1RJ7A 3RG0A 5ACA2 1X50A 3H0OA 3U10A 4AW7A 2WZR2 1IZ3A 2DUPA 3O0VA 3OB8A 3I3MA 1WKYA 2RR13 3UKTA 4JQRA 5EYXA 3SCFA 3O1OA 3FUOA 2A3YA 1W2OA 4M01A 3FFZA 2DVDA 3EQEA 1V9U1 4NMIA 2BGPA 2J1VA 4NOTA 3D82A 4UW6A 2DDUA 3VKMA 1K5MC 2WABA 3DYOA 3O14A 2GAUA 4YM2A 4CCLA 3KLSA 1LHOA 4YG3A 1H6XA 3FUQA 3DGTA 4PHZA 3T1MA 5JWPA 3H3UA 1BZWA 5JR7B 1MZ6A 4OUMA 3CF6E 1RVF3 3HEIA 3ZKYA 4BIFA 4B1MA 4ONUA 4S2HA 2MHFA 3KMHA 4P14A 2Q5TA 3P6BA 1M4WA 4LKDA 1TE1B 4RS5A 5DZGA 4JX0A 4NJ4A 4EWAA 1SLIA 4CDUC 4JV4A 4KWUA 4Q4W1 3AKRA 1CVNA 1CESA 1OH4A 4YVSB 5KHKA 1VBD1 2ZPXA 3UKVA 1V6IA 3C7EA 2Q1MA 5J3UA 3WCSA 3ZYIB 2Y0IA 3MEPA 2Z42A 2RE9A 1RC6A 4IE7A 3BUCA 2Z2SB 4YW5A 2ZEWA 1AR92 1X36A 3VBHC 3ALQA 3QD6A 4GA9A 4LBQD 2V4AA 4N7IA 3ILRA 5LA2A 2EXJA 2BWCA 2K46A 2RR12 2VOWA 4GULA 1CD3G 2WT2A 1ZZ6A 1ST8A 3HQXA 3ME2A 2CGPA 2ZGLA 4V2VA 4ASKA 1XJAA 1H4GA 3I2IA 2Q8CA 2R7EB 2RS53 3WHUA 5J96B 3VBRC 2PAMA 3WF4A 1J58A 4F8AA 2JDNA 4NIDA 3FZ3A 1H1AA 1FT9A 1UNBA 3LCPA 4XUPA 1ZBE3 4XIKA 3MFAA 2Q8OA 3ZXEA 1KFXL 3WW1A 4K8FA 3N9LA 4MXVA 4EZHA 3ZN6A 3J8F2 1YHFA 4E8CA 5A33A 1OVPA 1UX6A 2CSGA 2XXZA 2GALA 3CJIC 3GZTB 4WZFA 5DAWA 5FZOA 5T55A 5CZKA 5A7OA 1LCLA 1RXFA 3J7LA 3ZYPA 5FLJA 2EIEA 4YZ5A 1U5ZA 4FAGA 4H2AA 3PTYA 2G19A 2R042 4KMQA 3VD4A 3VN4A 1K42A 2OZ6A 2ILMA 3M3OA 2DUQA 2BGOA 2WO1A 5D8AA 1QJX2 5JSRA 5CG9A 3DYMA 2VZPA 1QJU2 5FZ6A 5L73A 4XUQA 4P9YA 3AM2A 5HCAA 1LGCA 1XNKA 1QGLA 3NW4A 1NCRA 2XH6A 2YGMA 3KT4A 2TBVA 2DBIA 1TME3 4C1WA 5A1LA 5FOJB 2ARXA 1FATA 2ARAA 4XTPA 2XMLA 2ZGOA 3AMPA 2PYTA 1DZTA 3LEKA 2VNGA 4MHUA 5A1FA 5E16A 3UK9A 1CAVA 1QQP3 3RMYA 1HN1A 2D3PA 1PMJX 3O0XA 1E57A 4LXLA 1O6UA 3T2QA 1JXNA 2I45A 4EN8B 4HKOA 4IESA 4W8JA 5KXCA 1KJRA 4OCTA 3CL1A 2JDKA 5EFUA 1NE4A 1AXZA 4PLOA 4IGPA 4ZXEA 2X5IB 2MEV2 4LJHA 1QF3A 2QQVA 3VZLA 3MUY1 4H55A 2VQAA 1QOOA 1QQP2 5IYYA 5JMOA 3LA2A 1JS9A 4BQYA 2FZ2A 3S7EA 1VALA 4AQTA 2IXKA 2WT0A 2WNUA 1HDKA 3TEWA 4BOWA 1FMD2 2BFUS 1SEFA 5LBBA 1H8TA 3ZXGA 3KT1A 1VR3A 3PUQA 1AJKA 2YDEA 2R6QA 4KGQA 2HYKA 3M3QA 4PIZA 3NNMA 1GP5A 2VU9A 3ZKUA 4D0QA 1AHSA 1WLTA 3ZX7A 2JXAA 2J42A 2WINB 3CZUA 4MGSA 1LU1A 4Y20B 1OA4A 4AHYA 5FY1A 1XNBA 4GKXA 1US2A 2NMOA 1H8TC 5C5UA 1FMD3 2VMHA 4B4PA 2NP0A 5D2AA 5DDJ3 2D43A 3QCWA 2E51A 2ZHLA 3GBFA 4GWIA 1GR3A 4KU8A 3UT0A 1WLDA 5L19A 3VZOA 2PTMA 3GALA 1QWRA 1CAUB 3MO4A 5FP9A 5JCTA 2ZEZA 1ZM1A 1W6NB 4TN7A 2E7TA 4ISQA 3ZDVA 3THTA 4EN0A 3CEWA 1OPOA 3A0NA 5LB6A 4RN5A 1C3HA 3FHIB 2RS33 4XJWA 4P9XA 3AP5A 4QDSA 4DNYA 2XQRA 5IFPA 1WCUA 4FPFA 1MACA 1YUDA 2VVFA 4EE2A 3HIFA 1ULEA 3WF3A 4UT5A 1W03A 5FMOS 4QGLA 2ZABA 3WSOA 5BNPC 2GU9A 1CAXB 2JE7A 3SH5A 3SITA 5DAQA 4BMEA 3KHCA 5ABJA 1RINA 3M70A 3OPWA 2VXRA 2PLV3 3ZSEA 4FFFA 4LEJA 1C4RA 4NRQA 4I0WB 4YW3A 4LKSA 4A6OA 4FOYA 2VOKA 2J1AA 5EZWA 4Y3OA 3B01A 4F7ZA 2ZGTA 3OTFA 1GANA 1QDCA 3ZSJA 4K1ZA 2RR11 4UFJA 5C4WA 3ST7A 4TTGA 1OLME 4URAA 2QDNA 3V0BB 4A42A 1PX3A 2RM21 4E4ZA 1JYWA 1VE0A 2JE8A 4QPIA 5CKQA 3WP3A 1WLWA 4PI2A 5ISLA 4HVQA 1WZXA 1V70A 4CCMA 1W6OA 1NG0A 4QHOA 5E89A 2IXLA 2VZVA 1SFPA 2C6SA 2Y6HA 3KGZA 5A7WA 4CP2A 2QBXA 5A6QA 3O1TA 2R0HA 4NWWA 4YVSC 2RMU3 4QKFA 4X8PA 4ASLA 4COYA 2BRTA 4Q4Y1 5KR7A 2F4LA 2GN7A 2W0XA 4XFCA 4NVPA 1AR61 3WHTA 4GWNA 5I93A 1DU3D 1ZA4A 5AC91 1PGL1 1VBA2 1Y9MA 2W91A 1WA4A 4Z8BA 5LASA 3Q8CA 1ND3A 1CX4A 1SBFA 2CAVA 1W2NA 2BVBA 3HMYA 1HRI3 2CDOA 4DUWA 5LK7B 4WBBA 1GMMA 1KD7A 4IEZA 1A6CA 2Z69A 4RS5B 3ZFFB 1HRI2 4XCBA 1QH6A 2RM22 3TBDA 1GKBA 3PIGA 4ATEA 2BFUL 3VHRA 4YVWB 2CU5A 1H2NA 3T4VA 5FZDA 1LOFC 1LHUA 5FK7A 3BYWA 1GU3A 1VRH2 2XJTA 4QHBA 1BBT3 5GM0A 5AFEA 1DYPA 1VBB1 4XBNA 3H3LA 3VBOC 2ZGNA 4W65A 5IVEA 4LTAA 4B4RA 4F3JA 5DUXA 4TSVA 5IVFA 5DZFA 5ANQA 5JZGC 5B4NA 5A3MA 2VQTA 2JG8C 5FUIA 2JDHA 3VDCA 4PF1A 1VMJA 4CU7A 2JDPA 2K0GA 4LIUA 3W58A 4A41A 5FWEA 5J36A 1C8NA 3B94A 5A7NA 1RUE2 2RJ2A 2F6BA 1TNFA 2H6BA 2UWBA 3BPZA 1Y3TA 4R9CA 4AEJA 1QHDA 2BUKA 3ECQA 1X7NA 3RZKA 1ACCA 4MZUA 3K2OA 3OBZA 3TOJA 4JKLA 5CFCB 2E6VA 4QQLA 2ZHKA 5LCWL 5JUVA 2FDIA 2YY1A 1AZDA 4QX5A 3ZN5A 1D2SA 2AC1A 1X9TA 4OUSA 5HXMA 2XJRA 2ZGSA 4BQ1A 4XFGA 2C0ZA 2KD7A 2RS51 3LDKA 4E4SA 5C70A 4RHV2 1JYNA 1RUF1 3PHMA 2ZZJA 5IVBA 3OBRA 3VL9A 2ZMLA 1KS5A 3K3OA 5CKMA 1VRBA 5FYUA 4NIIA 1G9BA 5FZEA 1GWKA 2WN2A 4QQ2A 2IVIB 3WQBA 4AHWA 3BALA 1JUIA 1NCRB 2CGOA 4K20A 5CFDA 4L99A 3BN6A 1LHWA 1DGWX 2YBKA 1MR5A 4HPKA 4CEYC 3F2ZA 2AENA 3AL6A 2GDFA 1MS0A 2ZGUA 5FYYA 5IVVA 1PO11 2X53S 4A2UA 3AYCA 3THCA 2VNRA 1K12A 1W6MB 4QGNA 1R081 1SLBA 1H9WA 1J3RA 1HJGA 1PM7A 2BVVA 3HN1A 5FWJA 2D6MA 2QQKA 2YU2A 3ZYGA 3PNAA 1RHI3 4CEYA 3SH3A 4QPYA 2XLGA 2EAAA 4NO4A 3OBAA 4QB6A 2LW8A 1RHI1 3WNLA 2WLQA 2WN3A 1DFQA 4JHTA 4N90A 4H7LA 5GLVA 5IW0A 1MZ5A 4Y4RA 1NQDA 4BMBA 5JI9A 2CAUA 3LPGA 1T6GC 2W1UA 4XXAA 1Y4WA 4OYUA 5FBJA 5FMDA 4L0PA 4N53A 3O5SA 1FNYA 3M1HA 1APNA 4WVZA 1O5LA 5DQ0A 5FZLA 1YJKA 2RS13 1OC1A 2H0BA 4O61A 1C5IA 5I8YA 4MADA 5I8TA 4DXSA 4E2SA 1DF0A 4CE8A 3MPPG 1DHKB 1LRHA 1AX2A 1Y9QA 3N36A 3AVSA 1WUVA 4AVTA 3I3BA 1J84A 1WMXA 4Q0VA 3TWIA 1UZVA 4LIVA 3I54A 5T50A 4P00B 5L7OC 1CZVA 1ZBA2 3NV2A 2ZX4A 3MICA 3BTYA 3H50A 2XUEA 3TEYA 2BZDA 4FXGB 1SLCA 4I09A 5FPZA 1NLRA 2KA3A 1Q56A 3U78A 3W21A 1UU5A 4B7KA 2XONA 3MLLA 1AR71 2ZMNA 4ZPIA 1PO21 4YWAA 4JKKA 3O7OA 2DWRA 3D5OA 4RGAA 5FLIA 1HB4A 2WWSA 3I59B 2JICA 4XJ9A 4RQPC 4ISRA 4Q4V2 4D6QA 3S5QA 5A6XA 4YNIA 2W68A 1WD4A 1LOFA 1R1ZA 3P1IA 3DV8A 3KZ4C 3VBHB 4BZ4A 2A6VA 1W6QB 2GH8A 3IZOA 4LBQA 1UL9A 3FLTA 1Y43B 3I2OA 1QJY1 3H1YA 3IAQA 1ENXA 1COV2 2Y6JA 5FPLA 5FY8A 1V6JA 1VAKA 4OMDA 1UY2A 5JZGA 2JX9A 1NX9A 4OZOA 1YYNA 3A22A 1S0JA 2WC2A 4XZUG 2VY0A 3OBTA 3ILNA 3WG2A 3RJ2X 1B09A 4QWNA 4PBPA 4UW3A 4EN7B 1BBT1 4N8MA 5C4WB 4FOVA 4LE4A 2XHNA 1AL21 5DUUA 3THDA 3EYPA 1JYXA 4XURA 2RS32 3AMMA 1VBB2 3OGVA 1AR72 2WZR1 3P3PA 3EO6A 3QBQA 1U12A 3KV9A 5FYCA 1S2BA 2BYVE 4JQTA 5K8SA 3WNNA 1NY71 1REDA 4Q1PA 4YM1A 4PBOA 5F6KA 2WO7A 4HMZA 1F2NA 4XF3A 5JSPA 3GF6A 5DDJ2 1F9KA 2PXJA 1KRIA 3BVCA 4NR1A 1O3TA 4YSFA 3JQXA 2Q0AA 1VBA3 4QPGA 3WLUA 2X5IC 1MEC3 3WVJA 4MUVA 5H9QA 1S4CA 2BNMA 5A3TA 4P9GA 4NHMA 2RMU1 2P37A 3C7FA 1YIPA 2EA7A 1ULOA 1US3A 1ASJ2 5D8AC 1RUF2 1JBCA 3VV1A 4FPOB 4IE6A 2OS2A 2P6CA 4K3UA 4FTBA 3LB9A 2QKDA 2VNVA 3MPBA 4UI9L 5C33A 4JGYC 4XZPA 3T2PA 1W9WA 5GZFA 1G9DA 3FC0A 2W87A 3SH4A 3C7OA 3NJVA 4Y22B 5FZBA 2GH2A 1MVQA 1VIWB 2RDNA 2HWE1 4Q8KA 5JOXA 3IN9A 4JDOA 4BK5A 3AZYA 1XNCA 2VAUA 3S30A 1CPNA 3AJZA 1ENQA 4XHBA 4AZZA 2Y38A 1XE0A 3J7HA 1BCXA 3TAYA 3LPFA 1R082 2NM1A 4Z92B 1QEXA 2WS92 4OZXA 3ILFA 3OG2A 3VBFB 4XIOA 1VBC2 1S0GA 3ZXFA 4CCCA 3CIHA 1XYNA 1NUKA 2A3XA 3ZR5A 4I3PA 5SV8A 4LULA 3UV9A 4DQAA 4MGTA 3RQ0A 1ND2C 4TWTA 2Q8EA 5AVAA 1C1LA 3PVEA 3WY6A 4UFLA 1O5UA 2L9LA 2ZKLA 1LENA 1UPIA 4A3ZA 3E6CC 4GAZA 2I07B 2YC4A 5AFBA 1JZ6A 1HRV2 2JKBA 3B69A 2Q1ZB 1SHWB 4IERA 4A7ZA 2WAOA 2VCBA 1RUH3 3M3IA 3H1WA 4IEOA 3NJZA 1RUD2 3AKSA 3LSEA 3VZKA 1QNWA 1KS4A 4C90A 4U2AA 2GP3A 2YG0A 1GZWB 3WV6A 4XW3A 4OLLA 4CTEA 4DIQA 3AX4A 2FCVA 5FPUA 1WW7A 1CAVB 4LO4B 2ZGKA 4I0BA 4QXBA 4ZKTB 4CU9A 1DQ0A 2VMEA 3FL7A 3ZXJA 1NCQA 2PMWB 4BXFA 4FPJA 1GQGA 1D0GA 4BDVB 4AHXA 1PO22 3ZYBA 3WW3A 1Z78A 1C8M2 3MIGA 3LSDA 4Q27A 2FMYA 3UGFA 4EROA 5JIUA 1A8DA 3PMSA 4FOQA 4G3YC 5CISA 2NZ9A 3RZHA 1YJLA 1CAWB 1MQTA 1PO12 4MLOA 3VDDA 5ACA1 2HWF1 3JCIA 5KHHA 2WNUB 1ALYA 2Q4SA 5FY0A 2CWMA 1DQ6A 1F5JA 5F9TA 3K4DA 2VBBA 4XMAA 2G4IA 2VMDA 2JB8A 2GC3A 4SBVA 5LBCA 2ERFA 3JB8A 3R4DB 4HXCA 3N7KA 4CEYB 5CAZA 2DTYA 2YV8A 4F83A 4JDNA 4K6BA 4WV8A 1COV1 2W95A 3NVCA 1K5MB 3IPVA 4GMP0 2VW1A 3THPA 3OEAA 1BEV2 4NHKA 1JYVA 4YPJA 5SV5A 1D0HA 2D93A 3USUA 5JPMB 3PVOA 2KR2A 4Q4X1 5F3GA 3ZPOA 4M00A 3DXTA 1MS3A 5FUPA 3BOPA 4RHV3 2EVXA 3RZJA 4IV1C 4WM8B 3B5LB 2BV4A 4KWLA 4CDWB 4HETA 3MIEA 2PQSA 2WJSA 3LDRA 1TMF2 5F37A 1JZ8A 1NE6A 3D8CA 4RA0A 1OI6A 1Q43A 1W6NA 5JSOA 4PCRA 1FI2A 2D3RA 2HWB3 3W9AA 3M3CA 3DKQA 4HN0A 5B4XA 2A6XA 2J1RA 5G05L 2VW0A 3CLPA 2ZEYA 5KHIA 4XETA 2A70A 5FR3A 1CIWA 4XQ4A 2WUHA 1NCRC 5T54A 2DFBA 3LFIA 3MGUA 4ASMB 5EP9A 2WBKA 1GOHA 3ETQA 4M4PA 2WAAA 4LBNA 5F6LB 4GZ9A 4RGGA 5FY9A 5ANNA 5JOYA 5A32A 2DU1A 1OQDA 4HSLA 5F32A 3GXUA 4D6SA 3J7MA 1L7LA 2E7AA 1IQAA 1YNAA 3IDEA 4JDMA 1OVSA 2GZWA 5JPNB 4B8EA 3ZYFA 3CHXA 4A3XA 4L2NA 3VBOB 1BEV3 2VPVA 3ZIWA 4CDWC 2FCUA 3VHPA 4CU8A 2WIIB 1UYZA 2JG9C 1XE7A 2OIIA 1Z7S2 1W05A 5K0UA 2D97A 4ATFA 5F5AA 3BU0A 1OXCA 1NZCA 1POV0 4Y1XA 4E2QA 2FQPA 1JMUB 1BKZA 1PO13 3IIIA 4UWDA 3ZFFC 4ET7A 5JZGB 5FZ7A 5A7WB 2R041 4YW7A 1R64A 4XQDA 1YRZA 2OUJA 3CZJA 1XE8A 4OI2A 2P34A 4RR3B 2J1SA 3WNXA 1N1YA 1BJQA 3U07A 4CPBA 4I02A 4Z1VA 2MPFA 3HBZA 1O91A 2KXLA 4LPLA 1QXJA 3NMBA 1GICA 2JDYA 1UMIA 2X29A 1Z7S1 4NHLA 5FZAA 3VZNA 1O3QA 4CP9A 1TMF3 2A6YA 5FYMA 1IG3A 4WM7A 4YZ1A 3ZDSA 3CNAA 1BVVA 3N9OA 3BCWA 2ZTNA 1PVC2 4BQ3A 1F35A 1QY4A 5IJRA 4INDA 3C2UA 2WZEA 1LHVA 3K77A 4OHVA 1OD5A 2VZRA 4RL7A 5F5IA 1JYTA 1QXRA 4QM8A 2Y64A 2WNUC 3WDYA 4LK6A 1XRUA 4LLOA 2VTXA 4XOGA 1HRV1 5FZFA 2XOMA 1LOBA 5JXHA 3NJXA 5FZHA 4OI0A 1DQ4A 1KJLA 2GSYA 2QUOA 4PLMA 3ZN4A 3POSA 2XHKA 2B9UA 3FFQA 4CEWA 1STMA 1QXPA 4XAEA 4HANA 5HXVA 4FOWA 3KQRA 3ZR6A 1QQP1 2DU0A 1RUJ2 1XNTA 1ODMA 3ZXLA 1W2TA 1W8TA 3R0RA 1GOGA 3M4FA 4GWMA 3VGIA 1PVC1 2V4VA 3K46A 2LS6A 3AZWA 1JN2P 3M8LA 4XF4A 1C57A 2W46A 3BB6A 5FZIA 1X9PA 1GSLA 5HV4A 4Q0SA 2QQPA 1XU1A 2ETEA 2R1DA 3G7DA 3BTXA 5D1IA 4MO3M 2WSUA 2Y6KA 3JD72 4MXWB 3J7NA 2ET7A 3QACA 1LAJA 3K4AA 1REEA 3AYDA 4PDWC 3ZOIA 5HCHA 5IHRA 1W8NA 5CNAA 4KG8A 3HPNA 3LA3A 3SMHA 3T0BA 3LQCA 2QNKA 4Q0QA 1JUHA 5B2GB 4QPIC 5FP7A 1JW6A 3AFGA 5FZ4A
chains in the Genus database with same CATH topology
2PAEA 4AFDA 4MX3A 2V73A 4IV1A 2D6KA 5JLVA 4BE3A 3U4XA 4JC1A 1GZ9A 2NMNA 4FVVA 2FZ1A 4K40A 3B93A 4XPVA 1LU2A 1LB2A 5EWSA 1DZQA 1S0FA 1H30A 3JD73 1DGWA 3J26N 1WCDJ 5J98B 1GFF2 5I91A 1RJ8A 1ULGA 1L3JA 1IS3A 2CNAA 4BIOA 3RYPA 4YLZA 4YGBA 1WW6A 4CDQC 2DVFA 4DXZA 4XFFA 4XQWA 3WG3A 4AGRA 3D6EA 3I2DA 2QE3A 2GN3A 2VVEA 2ZCWA 4DINB 1QJY2 4Z2WA 1LODA 3UKNA 3B3QE 3OJBA 1V6OA 3NV3A 2UURA 5FDBA 2D98A 2O1QA 1H1IA 3BIWE 3U0ZA 1R1A3 1KITA 1OFSA 1PVC3 4FPYA 4HFSA 4IEVA 2HWC3 1CAWA 1AYM3 1MQTB 5CIRA 5H9SA 2K2SA 5EXOA 5GLZA 4JGZB 2CL2A 4J1WA 4H14A 1WW5A 4MGYE 1I9RA 1A3KA 1PK6C 1UN1A 3ELNA 2AREA 1BK1A 1OLQA 2BNNA 3USUB 5JI7A 1O7FA 1NA1A 1VBD3 4IEUA 4FP2A 5FBZA 4Y1YA 1AR91 2JD4A 1V9U3 3W59A 3WQ0A 2EAKA 3OD4A 4FT8A 2BBVA 1N1TA 4AI0A 3M2MA 2R072 4WM7C 2NN8A 1URXA 4JGZC 1MS8A 2GC1A 4GXLA 3AP6A 4YGCA 4HSJA 1ONAA 2XKOA 4R9DA 1ZREA 3WW2A 4AI3A 2HEWF 5E88A 4J6GA 2CWSA 5CB7A 5BNNC 1QKQA 4MGKE 4W6YA 4IV3C 1PIV3 1ASJ1 4OHYA 3AZZA 3JB4C 3K48A 3I7DA 3NKTA 4M0HA 3VBRB 3VLBB 2XBO3 1NXMA 4QT6A 1RTVA 4FCAA 5E8AA 5C6CA 5BNNA 1O3RA 1D4M2 1VB4A 4IV3A 5TSWA 4N9IA 1HLCA 2R1BA 3AYEA 4RSUA 5FPXA 4Q2FA 4X6QB 3EBRA 4K7JA 3WZ1A 2ZHMA 1ZRCA 3VHNA 2NPIA 3KCYA 2PHUA 4R4XA 3TN92 4XBQA 2WS91 4I3GA 5FLHA 4DZGA 3MI8A 4SLIA 2XVKA 1ZRDA 1AYN3 4LUMA 1AL22 4LA3A 3MF9A 3EXUA 1AR62 2CTVA 1ZZ7A 4RHV1 2XWBB 3IBMA 2ZAAA 4XJUA 1FPN2 4Y4YA 1SFYA 4CRQA 1HRI1 3MW2A 3AYAA 4IXLA 4DRRA 4FSJA 4DS0A 1YLLA 2WT1A 2DFCA 1G7YA 1KFUL 2D6NA 2WQ4A 1LEDA 2EXIA 3PLQA 4COVA 2DVGA 1SCSA 1WMFA 1S2KA 2YHJA 3M7AA 3ZFGA 1YFWA 3NAPB 3E5UA 2R063 2BEOA 1HIXA 2PHLA 4QXKA 4FPLA 2VUAA 4Q8LA 5GZGA 3C3VA 4YM3A 3ZFEB 4RQPA 1RMU1 3EHKA 3GHNA 3USSA 4AF9A 5BUVA 1RUE3 1C8M1 1W39A 2D5FA 2PHDA 3RSJA 4AEMA 2JEMA 1V6MA 5L7OA 4AG4A 4G9SB 4BPZA 1UF2C 4I2OA 4KQ7A 4FXKB 2IWGB 4WM8C 2OYZA 1PNGA 4Q29A 3RRDA 1U5XA 3K51A 5GKAC 1LJ7A 1HRV3 1YI7A 2IXHA 3NSTA 4BCUA 4XJ8A 2XVGA 4PF5A 2ATFA 4OI4A 4Q4X3 4FTSA 1NLSA 5CFCC 4HVOA 1V6KA 2RS52 2WQZC 2R073 2D6LX 3ZVXA 3X29B 4BA6A 2JE9A 2IXCA 4HK9A 1YO8A 4IV1B 4CP0A 1GZWA 1SLTA 2BGCA 4FAHA 4XDQA 4XF1A 1LHNA 2HWF3 2MEV1 4QQOA 2WA3A 4JRLA 4M3CA 4DOUA 2UU8A 3AMNA 5E1RA 5T3NA 1TNRA 2QDRA 2DCKA 2PA7A 4LE3A 3SLIA 5LK5A 3VL8A 2ZS6B 4C0BA 2XJVA 1PZ9A 5HI0A 1CR7A 1UIKA 3CJIA 1H2KA 3KS7A 4M3CF 1UZZA 3P3NA 5FRAA 5C9AB 4DY3A 1DQ1A 3TN93 3E5XA 1U0AA 1LR5A 1IS4A 5GLWA 2X5IA 5DDJ1 1J3PA 2GMEA 4Y5Z0 4W6WA 1F5FA 3IDCB 2DVAA 2XGXA 2ENRA 4DMIA 4CDWA 4U36A 1FXZA 3IIAA 2OA2A 3AXDA 3RDIA 4MV2A 4N43B 5K0UC 1DIWA 4E2GA 4Q4X2 4JGYA 4JTOA 1DZRA 3L9JT 2ET1A 5JMCA 4Y20A 4RD7A 2RMU2 2NQYA 5LEKA 1ND2B 4AXOA 1RUNA 1EV11 2QZ2A 5DXDA 1F8VA 5J09A 5A32B 4KH9A 1IS5A 2N7GA 3MLKA 2VGDA 2AR6A 2B45X 4ZU5A 4PDWB 4AVBA 1HQWA 2OZJA 1ZZBA 1S55A 2JECA 4GH4A 2GC0A 4RFT0 4XXPA 5FTTC 3I4IA 3E6DA 3VBSC 4N43C 1AJOA 2HWC1 3JD71 2ES3A 4C1XA 1QH7A 3QOPA 1MQTC 1R1A2 3VBSA 5GZDA 4WM8A 2O8QA 1GNZA 3TNPB 3RS6A 1JHNA 1VAMA 4YZ4A 5KHJA 4I0AA 4META 2K9ZA 3RNSA 3D4KA 3ZSLA 1S0CA 5KXDA 1RUI3 2H6CA 1W6OB 2O8OA 4HKLA 4PIXA 1FV2A 4COZA 4IL7A 4XYXA 5KHGA 4OHXA 1EPZA 2CV6A 3WUCA 2F4PA 1AXYA 4HN1A 4HZFA 1IKQA 1BVP1 1G6NA 2DV9A 2B8MA 2C5DA 1RUG1 1SBDA 4UBHA 5C4WC 2HKXA 1MS9A 4UW5A 1N3QA 1D4M3 4OHZA 4XHXA 1QJU3 4CEWB 1QJX3 4CYDA 4GIQA 3ES4A 2R043 1AYN1 3JUUA 2JG8B 2XB6C 2MEV3 5FO7B 1LOAA 3WD5A 4Q1RA 4E4DX 2A3WA 1OPMA 3WP4A 1RUJ1 3ZFEA 1V6LA 4RQPB 4W6XA 1TMF1 1GNHA 3KCXA 4XILA 4XMIA 4Q0UA 4AEDB 3WQ1A 1DDLA 1UMZA 1HX6A 1SQ4A 2XPJA 2BWAA 3HAGA 2D7FA 1VBC3 3J9SA 4GMP3 3ZXKA 3H7YA 4P9IA 1TME2 2R16A 1HKDA 1FV3A 4AVCA 2QCSB 1NXD1 4TYSA 1R092 3R6SA 3WDXA 1H2MA 3N7LA 3WUDA 4EV0A 4XEZA 2HEVF 5KWRA 1MZEA 1BYHA 3H1MA 5GLTA 2WFF3 1PK6A 1EAH3 4PIYA 2WFF2 1S0IA 4HBNA 4LNVA 4IEPA 2R071 2CYFA 2P3IA 2XJUA 3LOIA 3SISA 3D0JA 5GLUA 1PZ8A 3S0MA 3BTAA 3OY8A 1BBT2 4YW2A 3KGLA 1KXGA 5CFDB 2D5HA 1MEC2 2HWF2 1ZNPA 4HPKB 1D4M1 4XFBA 4LHNA 1PGW1 4FQZA 4BM8A 1LECA 2PN5A 4Z82A 2YROA 1FX5A 2PQQA 3CJIB 1W6MA 5ACA3 2AGSA 4IEWA 4Q4Y3 1MZFA 1C8M3 5C9AA 1XNDA 3OPZA 5AVPA 3PMEA 1ZBA1 4XFIA 1B35B 4HKWA 3TB0A 3IKWA 3TRSB 4AVVA 1X8MA 1BMV2 1H4HA 1H8VA 3LKJA 5C9AC 3B02A 4XFHA 4BWOA 1CAXA 1EAH2 2ZGPA 2PELA 5J48A 4Y26A 1U5YA 1BXHA 3E6BA 3OF1A 2BPA2 1RVF2 1RUD3 4LO5B 2GC2A 1RUH2 2LTNA 3NKGA 3TYJA 4KL1A 2A75A 1R093 4L97A 4L9BA 2RJLA 1OHFA 1YXWA 4LBMA 1W0OA 2G9FA 2BTVC 1BMV1 1EP0A 1OA2A 4Y1VA 1VB2A 1TQ5A 3VBRA 3AP9A 2EIGA 5BV6A 2WS93 4YVSA 4ORFA 4A7KA 1W6PB 4DY5A 1SACA 5T5LA 3ZMOA 1O4YA 4Q26A 4S2FA 5JOZA 1YIFA 1G86A 2V5YA 3MZHA 1D4VB 1GBGA 2UYBA 3MFCA 3O0WA 1IOAA 4QPIB 4R4ZA 4B4QA 1RUH1 3OD0A 2KM2A 2HEYF 4YGDA 5I0TA 2YGLA 1AYN2 3FX3A 5LRSA 5CVRA 4CDXC 2B7YA 2DF7A 3VBUA 1C5HA 1SFNA 2WA4A 4Y1UA 1OA3A 2RHPA 2UYAA 4N9HA 5GZEA 4NPRA 1JH5A 1EY2A 3HT2A 1Z0HA 3WDWA 1GQHA 5DG2A 2IC1A 2ZMKA 3WT3A 2ZGRA 2VMIA 2JJ6A 1ZZ9A 5C8CB 3ZN6B 3D0SA 3WP6A 5A33B 1QMJA 3JU9A 1R1A1 2XBO1 4O9EA 4MH0E 4XJZA 4EN6B 3RMXA 3S6PA 1VBE2 4YW4A 1YCIA 3ZFFA 1FOD3 4TLFA 5K9YA 2GNDA 3NAPA 1ULCA 3PJQA 3VHOA 3LWCA 1AR83 4L8QA 1UKGA 4XF0A 2PLV1 3DUIA 3MIBA 3AP4A 4R9BA 3OGJA 3WQ7A 3MLJA 1ZRRA 2DUOA 1AX0A 4LLFA 1VAVA 4JAAA 3NAPC 4LHKA 5KBFA 1YFXA 5EYYA 5HCFA 4D7SA 5L7OB 3WINE 3R4UA 1DGRN 1VBE1 2JG8A 4H7MA 4LUKA 1MEC1 5BPXA 3WCRA 4R8HA 1V9U2 2ZAHA 1QOSA 4MVTA 3GZAA 1NOVA 2GNBA 2DCTA 3RJRA 3BODA 1RUC3 2SLIA 3TNQA 3PJYA 1RUD1 1VLNA 3POYA 1QJX1 1DQ2A 3SNMA 3N4MA 1RUI1 1MVEA 1DGRA 4XTMA 3ZMNA 4AEKA 5FO9B 3WDUA 1PHMA 2P17A 3IDBB 4AEDA 3AB0A 2W39A 4AI8A 4C0HA 3DF0A 1H8TB 1WCKA 1FNZA 1ZBA3 3J8F3 3FWEA 4D7YA 5C8CC 1AYM1 2BQPA 3QH7A 3WG4A 5FREA 5BYNA 1QJY3 1NY72 1RL3A 3NO8A 3ZSKA 5AC92 1FOD2 1W0PA 3WR0A 3R4SA 3EJKA 3NL1A 4YFZA 1KDKA 3CJXA 1ZVFA 4COUA 1RB8G 3ZFGC 1PO23 1PVXA 2TEPA 4P9LA 5IK5A 1X82A 1ZBE1 2PHTA 1XYPA 3AMHA 3J8F1 5CBLA 1SLAA 2VOVA 2WFF1 3HT1A 1TEIA 3WG1A 4P5HA 4D94A 5KXEA 2NLRA 1GYKA 1WBLA 3UL2A 1QOTA 4N53B 4E27A 2D6OX 2P2KA 2ZGMA 3HR9A 3MW4A 2OUHA 3VDDB 5ABJB 5FO8B 3U11A 4D69A 2EXHA 2LUWA 2E63A 4N43A 3FMGA 2AH2A 1LOGA 1FOD1 1B35A 4ES9A 1S0BA 5F5QA 4GB32 1K5MA 3V0BA 3AZXA 5BNQA 2IXJA 2DCYA 4B29A 5JAXA 2Z79A 2B42B 2ZX1A 1IPJA 3INAA 3WOGA 2QFEA 1HW5A 1RUJ3 4LO7A 4NWVA 3FLRA 3KT7A 2I74A 5JVVA 5T5OA 3VKLA 1R083 1S0DA 5FQ0A 1AF9A 2B5HA 2XL7A 3RPQA 3VBHA 1MS1A 4LBQB 2PHXA 3OYWA 2W08A 4GQ7A 1ND3B 1I3HA 1CGPA 2X8KA 2ZOEB 3ZSMA 1KQRA 3Q9OA 3WW4A 4HLTA 3JBG3 1I6XA 4R9AA 5BNOC 2E9QA 5IK7A 5CA6A 1RUF3 2PHFA 3VBSB 3LOBA 1Q8QA 2VMGA 2Q30A 3AFKA 1QU0A 2VUJA 3V56A 3AKTA 3B9IA 3DPRC 4ZU4A 4AWDA 1RHI2 1GZCA 3APBA 4YFWA 1UIJA 2XWJB 1YFYA 1MS4A 2Y0OA 3QH6A 4HT1T 4KWJA 1OQEA 2FHRA 5EJ3A 4V1PA 4YG6A 2ZGQA 3SCGA 1RUI2 3BOWA 3VBUB 4KBBA 1CN1A 4Y22A 5FOBB 1UW8A 5CFDC 1X8EA 2VH9A 5H9RA 2LM3A 5EV7A 5C8CA 2GNTA 2WNVA 3WDTA 5BNPB 3NV4A 3H7JA 1G9CA 3MIDA 5F1RA 3VUOA 4DFSA 2YXSA 4DRVA 2Z5WA 2O0OA 3RYRA 1OKQA 3J4UH 1AUYA 4XJAA 2QJVA 1J3QA 3L2YA 5DG1A 2A7AA 1RMU3 3ZYRA 5A3LA 3KCCA 3ACLA 1A78A 1V6NA 4CDQB 1UU6A 2HWB1 4BYYA 1DLLA 2DTWA 4K1YA 4FTEA 4IEXA 1N1SA 4LBKA 1QDOA 4Q0PA 2VNOA 3ENRA 3URFA 3WDVA 1NQJA 1JTZX 1PGL2 5IUQA 3VBFC 4Q4W2 2D6PA 2RS31 4JRAA 1BQPA 1HQLA 2XJPA 4QM9A 2C1FA 3UJQA 4EN9B 3O12A 1VBE3 1QJZA 2TUNA 3GZUC 1C28A 3VDDC 1XXNA 2ZACA 1RUC1 2D3SA 2RJKA 1VP6A 5AC93 3RZZA 4KU7A 2UWCA 3ROUA 1AR93 3WXPA 3ZXAC 5I0RA 3OY8B 1PZ7A 1NCQC 4H3WA 4FP3A 3N7JA 3MIHA 1YFUA 4LHLA 3RI8A 1UZYA 4FPKA 1Q5OA 2B46X 2Y26A 2AYHA 1LESA 3VZJA 3KB5A 4X6RB 4CDUA 4J1XA 2XUMA 4JTNA 1FAYA 3R05A 2HWC2 2A71A 2ZZQA 1AVBA 2E53A 1WLCA 2WSVA 2ZA9A 1RIRA 1UU4A 2XKPA 2GNMA 5IT6A 1G9FA 5BNOA 3RYKA 1PGW2 1SMVA 3DN7A 5T5JA 4AVSA 1Q8OA 3FBYA 3L2HA 2PFWA 1RUC2 1VBC1 4X8NA 1QJU1 3B7MA 1POV3 1W6QA 5CU1A 3UJOA 5J37A 3ZFEC 3IT8A 2WZR3 4L92A 4K9SA 4AK3A 1MS5A 1O4TA 3LZZA 2VVDA 4YYOA 2BNOA 1JYCA 1N47A 1LGNA 1ZZ8A 3HD8B 1AXKA 5HBAA 2QVSB 5DUVA 5KC5A 4Z07A 1NYWA 5LEJA 3VKFC 4LR4A 1RUG2 5K0UB 1OOPA 3KM5A 1ND3C 1OQ1A 4WVWA 5T5PA 1J1TA 2AUYA 2H0VA 4CZSA 1I5ZA 4WVMA 1WD3A 4YG0A 1J1LA 1FMD1 3AKQA 3H3ZA 4GKYA 4AGVA 4XE9A 1V00A 1RUG3 2WLPA 4OVEA 1W6PA 4QPGB 3IMNA 3B00A 4AFBA 1PGSA 4YZ2A 2XL9A 4YARA 5CG8A 3OYWB 2VECA 2UY8A 4QU2A 1RITA 1DBNA 1LGBA 1VBA1 2QZ3A 2PAKA 1A8MA 4O9GA 4URTA 4ZXKA 1J59A 1R091 2GMMA 4IV3B 1REFA 4R52A 5CADA 2YUEA 1WMDA 1WGPA 1VBB3 3T2TA 2R32A 2BW8A 1YI9A 1FPN3 1OFNA 4IQPA 1SBEA 2A6WA 4B7EA 3GYDA 4YRDA 3VBFA 1LTEA 1S1AA 4WM7B 1XQNA 4MGIE 1AL23 4HK8A 3MIFA 4LBOA 1COV3 3AK0A 2FBEA 4KG0A 5FFOC 1IGOA 3AMQA 3V0AB 4IEQA 2HJIA 3B9CA 1RMU2 4Y24A 3E5QA 5IK8A 4IEYA 1ENSA 2I2SA 3OGGA 4MXWA 2FMDA 2UY9A 1IKPA 2WNVB 5BNPA 3N7MA 2DCZA 3AKPA 2WZPP 4PJYA 3IWZA 1POV1 4CEWC 4EWEA 2YPJA 5IK4A 4FQ4A 3RI9A 1EV13 4BH9A 5DZEA 4AVAA 4L11A 1U5IA 4MYEA 3ES1A 5JIAA 4LA2A 4AHZA 5D8AB 2OVUA 4BLIA 1D2QA 4Q4W3 4XBLA 1QNYA 2CY6A 1NCQB 1UCXA 2EF6A 1ZBE2 4AI2A 2XLFA 3VZMA 4FPEA 4AQ2A 1KDMA 4JVAA 2TNFA 4N7UA 4PQ9A 3A0KA 2V09A 3ASIA 5K7PA 4CDQA 1HV1A 1EV12 5I0UA 1IS6A 1Q3EA 1PIV1 3GBWA 3VBUC 1JOJA 3FLPA 2C9AA 4NN0A 4WVVA 3TN91 3IPVB 2DCJA 3LA7A 3ZYJB 3DPRB 3WX5A 1B35C 4OULA 1HXS1 1UKRA 1G9AA 1LKNA 2P3KA 3DKWA 5KXBA 4E9KA 4QQPA 2D40A 2HWE3 1WMEA 4UXAA 5I8SA 3SHRA 2JG9A 4CDXA 2R49A 4UW4A 1IHMA 1SLLA 1FPN1 1UPSA 1XYOA 4AE2A 4BHPA 2NYYA 5B2GB 1NA1B 3GNEA 2SBAA 2YZ4A 5FCCA 4AFMA 5T52A 4LO6B 1BEV1 1WBFA 5HCBA 1Q8PA 4LT5A 1HXS2 1ULFA 1CAUA 3QLQA 1N3PA 4JGZA 4QQHA 1HV0A 5BNOB 2XG3A 4M3CE 2D44A 3VBOA 2IXIA 4EJRA 1YWKA 1PMIA 4JCKA 1OLRA 1NA1C 2R061 3PVBB 4LO8A 4I30A 2XBO2 2XVLA 2B39A 3PVNA 2A6ZA 1CJPA 4AEDC 4S2GA 1W2UA 3ZO0B 5BNNB 2ZKNA 2ZJCA 2ZX3A 3ZPYA 2P3JA 4YZ3A 3BU7A 4RR3A 4FPHA 5FQ0B 1VRH3 1H2LA 1CJDA 1ZX5A 3HWJA 4CP1A 2G9GA 1GV9A 2R062 1OOPB 4Q4Y2 4UBGA 3ZXDA 3NWKA 2XJSA 4RR3C 3G6JB 4WVMB 1HXS3 1H0BA 2ZHNA 3A4UA 4B3NA 2PHWA 3LGRA 1VBD2 4OHWA 4PDWA 4MGZE 1ENRA 3H9AA 1AR73 4GB33 2HWD3 5ABJC 4AQ6A 3VKOA 4N53C 2AZ5A 3JQWA 1O3SA 1SDWA 3MDPA 4ES8A 5BY5A 4QD2A 3KSCA 2WNEA 1AR63 3FJSA 3AJYA 4K21A 1ZYBA 1OMIA 4P9JA 3ZFGB 1LOCA 1LULA 4XFAA 3AP7A 2WFPA 3SCHA 1ASJ3 1WCSA 4YVWA 1XU2A 2GMPA 1SCRA 1CPMA 2RS11 2HWD2 2IFRA 2YC0A 1RGSA 3S7IA 3H8UA 3V65A 4Q4V3 3N3HA 4A7YA 1H9PA 4KNCA 3MW3A 5L36A 4YVWC 4GALA 3VKNA 2PHRA 1LOEA 3LAGA 2JENA 4Q4V1 5GZCA 1N1VA 4Y1ZA 2PLV2 3DL3A 4ZU7A 3V0AA 5DUWA 1Z7S3 1PIV2 1EYBA 4QMAA 4KWKA 1LEMA 4FBFA 1AL0G 5JOWA 3WP5A 3AXEA 4D7TA 2IZWA 3POWA 5CFCA 1C1FA 1M06G 4RS5C 2A73B 4P9WA 1TME1 2MNGA 1S0EA 1EPWA 3GHMA 4GB31 2HWD1 2RS12 2DVBA 4XF9A 3CU7A 1ZZCA 2A5ZA 3AZVA 2JDZA 2ZX2A 4FO9A 3T1LA 2OW4A 5J7MA 4M3CB 2YMZA 4AI1A 1DGLA 1G8WA 2XJQA 2VG9A 4ITCA 1H1MA 2HWB2 2XLAA 1N3OA 4OI1A 2YYOA 3JZVA 2DURA 3IM0A 1F31A 1IPKA 4I01A 4DB5A 3V64A 2EXKA 1VRH1 3FE5A 4QPGC 1AYM2 4G4FA 2DYCA 4S2DA 4OFGA 3MYXA 4ZKTB 4M0NA 5BXXA 1RUE1 2VULA 1O4ZA 3OCPA 4AFAA 2VW2A 1DQ5A 4AGGA 1FYUA 1Y7BA 1CQ9A 4YGEA 4KGGA 1HQNA 3GBGA 4IETA 4PLNA 4AFCA 4C91A 2IFWA 1AR82 2HWE2 3FBMA 1X33A 3NV1A 2ZX0A 1PNFA 3DPRA 5C8WA 4CDUB 1Q8SA 1I1EA 1UD1A 4HL0A 4LBLA 1PK6B 3E97A 1Q8VA 4FPCA 4HVRA 4YW1A 4FPGA 1GLHA 4YM0A 2ZBJA 1JYIA 1OOPC 2JG9B 1VJ2A 3RWNA 2VOXA 4CDXB 4LBJA 5FMOL 4AQSA 2CGNA 3MF6A 3N35A 2W52A 2E7QA 4DPNA 1EAH1 5GALA 4QGMA 4BLJA 4TZDA 2R30A 2VQ0A 1RUOA 1RVF1 5H9PA 3JBG2 3M3EA 4WZCA 2WNVC 2LALA 1DYKA 4AYUA 2OPKA 2WKKA 2R0FA 1DG6A 1AR81 1ULDA 1WW4A 3SXWA 4JGYB 3I59A 4MSVA 5I0SA 4GMP1 1CONA 2EALA 2UWAA 2WL1A 3I8TA 4GH4C 1ZRFA 3KD4A 4GH4B 1OSGA 3ZIXA 3ATGA 1UAIA 5KC6A 5JDBA 3CO2A 4COWA 3JBG1 1ND2A 2RM23 5LRRA 2ARBA 5FAXA 1AX1A 1RJ7A 3RG0A 5ACA2 1X50A 3H0OA 3U10A 4AW7A 2WZR2 1IZ3A 2DUPA 3O0VA 2RR13 3UKTA 4JQRA 5EYXA 3SCFA 3FUOA 2A3YA 4M01A 3FFZA 2DVDA 3EQEA 1V9U1 4UW6A 4NOTA 4WM8B 3D82A 3VKMA 1K5MC 3O14A 2GAUA 4YM2A 3KLSA 1LHOA 4YG3A 3FUQA 3DGTA 5JWPA 3T1MA 3H3UA 1BZWA 5JR7B 1MZ6A 4OUMA 3CF6E 1RVF3 4BIFA 4ONUA 4S2HA 2MHFA 3KMHA 4P14A 2Q5TA 1M4WA 1TE1B 4RS5A 5DZGA 4EWAA 1SLIA 4CDUC 4JV4A 4Q4W1 3AKRA 1CVNA 1CESA 4YVSB 5KHKA 1VBD1 2ZPXA 3UKVA 1V6IA 2Q1MA 5J3UA 3WCSA 3ZYIB 2Y0IA 3MEPA 2Z42A 2RE9A 1RC6A 2Z2SB 4YW5A 3VBHC 1AR92 1X36A 3ALQA 3QD6A 4GA9A 4LBQD 4N7IA 3ILRA 2EXJA 2BWCA 2RR12 2VOWA 4GULA 1CD3G 2WT2A 1ZZ6A 3HQXA 3ME2A 2CGPA 2ZGLA 1H4GA 3WHUA 5J96B 2RS53 3VBRC 2PAMA 4F8AA 1J58A 3FZ3A 1H1AA 1FT9A 3LCPA 1ZBE3 4XIKA 3MFAA 2Q8OA 3ZXEA 1KFXL 3WW1A 4K8FA 4MXVA 3ZN6A 3J8F2 1YHFA 5A33A 1UX6A 2GALA 3CJIC 3GZTB 4WZFA 5T55A 1LCLA 3ZYPA 5FLJA 4YZ5A 1U5ZA 4FAGA 3PTYA 2R042 3VN4A 2OZ6A 2ILMA 3M3OA 2DUQA 5D8AA 5JSRA 1QJX2 5CG9A 1QJU2 5L73A 4P9YA 3AM2A 5HCAA 1LGCA 1XNKA 1QGLA 3NW4A 1NCRA 2XH6A 2YGMA 3KT4A 2TBVA 5FOJB 1TME3 4C1WA 2ARXA 1FATA 4XTPA 2ZGOA 3AMPA 2PYTA 1DZTA 2VNGA 5E16A 3UK9A 1CAVA 1QQP3 3RMYA 2D3PA 3O0XA 1E57A 1JXNA 2I45A 4EN8B 4HKOA 4IESA 5KXCA 1KJRA 3CL1A 5EFUA 1NE4A 1AXZA 4PLOA 2X5IB 2MEV2 1QF3A 3VZLA 4H55A 2VQAA 1QOOA 1QQP2 3LA2A 2FZ2A 3S7EA 1VALA 4AQTA 2IXKA 2WT0A 2WNUA 1HDKA 4BOWA 1FMD2 2BFUS 1SEFA 1H8TA 3ZXGA 3KT1A 1VR3A 1AJKA 2YDEA 2R6QA 4KGQA 2HYKA 3M3QA 4PIZA 2VU9A 1AHSA 1WLTA 3ZX7A 2JXAA 2WINB 1LU1A 4Y20B 1OA4A 4AHYA 1XNBA 4GKXA 2NMOA 1H8TC 1FMD3 2VMHA 4B4PA 2NP0A 5DDJ3 2D43A 3QCWA 2E51A 2ZHLA 3GBFA 1GR3A 4KU8A 1WLDA 5L19A 3VZOA 2PTMA 3GALA 1QWRA 1CAUB 5JCTA 1ZM1A 1W6NB 2E7TA 4ISQA 3THTA 4EN0A 3CEWA 1OPOA 3A0NA 1C3HA 3FHIB 2RS33 4XJWA 4P9XA 3AP5A 4DNYA 4FPFA 1MACA 1YUDA 2VVFA 3HIFA 1ULEA 5FMOS 4QGLA 2ZABA 5BNPC 2GU9A 1CAXB 2JE7A 3SH5A 3SITA 4BMEA 5ABJA 1RINA 3M70A 2VXRA 2PLV3 3ZSEA 4LEJA 1C4RA 4YW3A 4I0WB 4FOYA 2VOKA 5EZWA 3B01A 4F7ZA 2ZGTA 3OTFA 1GANA 1QDCA 3ZSJA 4K1ZA 2RR11 5C4WA 3ST7A 2QDNA 3V0BB 2RM21 4E4ZA 4QPIA 3WP3A 1WLWA 4HVQA 1V70A 1W6OA 1NG0A 5E89A 2IXLA 3KGZA 4CP2A 2R0HA 4NWWA 4YVSC 2RMU3 4X8PA 4ASLA 4COYA 4Q4Y1 2GN7A 2W0XA 4XFCA 4NVPA 1AR61 3WHTA 4GWNA 5I93A 1DU3D 1ZA4A 5AC91 1PGL1 1VBA2 1WA4A 4Z8BA 1ND3A 1CX4A 1SBFA 2CAVA 2BVBA 3HMYA 1HRI3 5LK7B 4WBBA 1KD7A 4IEZA 1A6CA 2Z69A 4RS5B 3ZFFB 1HRI2 1QH6A 2RM22 3TBDA 1GKBA 4ATEA 2BFUL 3VHRA 4YVWB 1H2NA 1LOFC 1LHUA 1VRH2 4QHBA 2XJTA 5GM0A 1BBT3 5AFEA 1DYPA 1VBB1 4XBNA 3VBOC 2ZGNA 4W65A 4LTAA 4B4RA 4F3JA 5DUXA 4TSVA