1ZRCA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 59
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrcA01
3F8FA 2W24A 3E97A 3CO2A 1XGSA 3WTTC 3DPLC 4CZZA 1QBJA 3QU6A 5A2QK 1UB9A 5LRSA 1SQ4A 1BOAA 5JVTA 4XFGA 3WE3A 2CG4A 2EFOA 2M5WA 5HOOA 4WVZA 3QU3A 4NQWA 4MGRA 3T8RA 2VE8A 1ZN2A 2HKOA 2EAAA 1HW5A 5DCMB 2HEOA 5LLQA 2ETHA 5HLGA 4QMAA 5DYMA 5I8TA 4YFXF 2OU2A 2P6SA 4G6QA 2JZYA 1O7LA 1XGNA 2GWRA 4HAMA 1XCBA 4OIOF 3WTUC 2A07F 2VONA 1J3PA 1XRUA 1HXDA 1W4MA 4OIPF 1YG2A 2I45A 4OIQF 2OBPA 4LLGF 4UV8A 1USTA 5ICGA 1EV7A 2PQ8A 4H0EA 4HMZA 1P4WA 1D3YA 4H7LA 1S6LA 1LJ9A 4L5JA 3KLOA 1UCRA 5CYVA 2D93A 2HYGD 2IC1A 3PNAA 2O61A 5J48A 5J8CA 2B8MA 2EJRA 1ZG5A 4GYIA 4IRHA 4HX7A 2RN7A 3C7JA 2F2EA 2V1UA 1LVAA 4AVCA 4A12A 4AD9A 2H09A 4RAZA 1WA4A 4HQMA 1SD7A 5I0UA 3I53A 3S2WA 3ISPA 2KRFA 1H1MA 4Z2YA 3ELKA 2G7HA 5FO5A 3LWCA 2BEOA 3FM3A 1J2XA 5FFXA 2V1DA 1YS6A 5HS8A 3GVAA 4Q0VA 1ZYRF 3JSPA 3ST7A 1YFHA 2IA2A 1ZGJA 3E5QA 1NZCA 2M1BA 2D5HA 2QNKA 3RKYA 2GC0A 3MPBA 4I3PA 3DQVC 3OGJA 2IA1A 1TTYA 4LK0F 3V8KA 4HX4A 2R7DA 3SCGA 2ETEA 2V79A 1FBSA 4MNUA 4HLTA 4L9TA 3J81Z 3KEOA 2IXHA 2EA2A 4YIIA 2L3DA 2YR2A 4RB0A 1ZZBA 2GQQA 2K4BA 2VC0A 3IWZA 2W84A 1YFUA 3CUQB 4E2GA 3SHFA 2E7XA 4BHBA 3E6DA 4R1HA 2DQRA 5K5QA 2DK8A 2E1CA 1FSHA 4EM0B 1S7OA 2UZKA 4HN1A 1WRJA 2H94A 1OKRA 3EQLF 2QVOA 4P9FA 3GFIA 1MJ9A 3FXRA 1OMIA 2P7VB 3DEUA 5D4SA 4YFKF 1U8RA 2PBIA 1G3SA 4UHTA 1O3TA 3I64A 1C0WA 3N97A 2XKPA 4TLFA 2J5OA 3L9FA 2Z33A 5AVPA 3KE2A 5LEJA 4L18B 3CUQA 2O8XA 5D5WB 1S8NA 3M8FA 3FHZA 1LDKB 4KNYA 2EFPA 4EJWA 3BALA 2K4JA 3AAFA 2OQRA 4LFUA 1EP0A 4IEYA 1K78B 3OF1A 4MGYE 4M9ZA 4BNCA 3KP7A 2OPKA 2KJCA 3SCFA 4ZU5A 1IXRC 1FYKA 2FQ3A 3NVCA 4HN0A 5CVVA 1EH7A 2V9VA 1TQ5A 1FNNA 4UVBA 3H7YA 3NL1A 1ULYA 1O3QA 5FLIA 5L3FA 4R8HA 3Q9SA 4LA2A 3C1DA 4MQ9F 3GW2A 3COAC 1Z7UA 4IEZA 1RNLA 4YIFA 3F8NA 2LSOA 5ERIA 1FWZA 2ATFA 2OQGA 1VP6A 1YW8A 1SFEA 2K9ZA 1IW7F 2EVXA 3USSA 4IEPA 4IJAA 3HHHA 2OA4A 1B9NA 3O6BB 1ZH5A 3N4MA 3ZDSA 4XF3A 4HSJA 2XUBA 3E3VA 4LLNA 4UVAA 1H9GA 4A0ZA 1J58A 5J3UA 2YX4A 2IXIA 1LB2A 1X8EA 4AXOA 3LQQA 1JHFA 3RKWA 5CVRA 5HDKA 1AOYA 5DEQA 4MTEA 2ZKLA 3H50A 1V70A 1K79A 1FYLA 3KP4A 2IVMA 2Q1ZB 3ML6A 1TNSA 2Z2SB 4PJYA 1IZ1A 3L7WA 4GCVA 2XV4S 1W7PA 3LA7A 3E5XA 4XRFA 4LGWA 1SFUA 2JPCA 4LJZF 2FRHA 5HI0A 2UY9A 2CQKA 4OINF 2L4AA 3BJOA 2ZNYA 2Z69A 3BDDA 2XIGA 3IHUA 3HT1A 2PAEA 3I4PA 4MQVA 1EY2A 1LEAA 3P7NA 2QWWA 4AIJA 3IBMA 1J5YA 3JSOA 4IVNA 3GBFA 2GZWA 5HLHA 1WGPA 2QBYB 2FE3A 4KICA 2OZ6A 5BV6A 4UVCA 5FD5A 1L3LA 4L11A 2XAJA 1R1TA 3DKWA 1R5HA 4YG2F 5JR3A 1UPIA 2HR3A 1NYWA 3OOPA 3BP8A 2PLYA 2FF4A 4G8XA 1KU3A 1H1IA 5BS6A 3LSTA 5E8IA 2XLAA 1WSUA 4BH9A 3M1EA 2ZFWA 4YRDA 5LGNA 4RAYA 5D8KB 1B4AA 3BCWA 4YYOA 5E16A 1GXQA 1RUNA 2LNBA 4CO8A 3BJ6A 2AXLA 4KFCA 4LLOA 1STZA 1LRHA 1MJBA 5FB2A 2L01A 4IETA 1SMTA 2HWVA 1U78A 3KEQA 4LD5A 3TDZC 3ZN0A 5K5OA 2LKPA 2C0ZA 4EGYA 4RB2C 2O3FA 1Q3EA 1KQ9A 3ES4A 1U5TA 2K27A 2BBYA 5J7MA 3CJNA 1YS7A 2PTMA 2DBBA 1ZRCA 3FMSA 5DV5A 2B9UA 2GA1A 3MZYA 1IN8A 5E20A 1SD5A 4LUKA 3K1MA 4RS8A 3LWFA 5I93A 1OYWA 3TDUC 1FYMA 2TDXA 3FFQA 2P6TA 3W6KB 4FAHA 3PFIA 5DCFA 3GYHX 3BJAA 1JGSA 4FX4A 2HGCA 2VN2A 3KCCA 5AIQA 3VOEA 1IN6A 2DI3A 2PEXA 3F8CA 2XAFA 1RL3A 4FAGA 5BPDA 3KLNA 4RB1A 3KETA 1BIAA 3TO9A 1O4TA 2O6GE 4ZH4F 4ESFA 1U5TC 3FXQA 5LHIA 5DDGA 3BB6A 2E1NA 3F3XA 4CDGA 3FE5A 2NAZA 3REOA 3KMHA 3GEZA 3I59A 3CL1A 1GVJA 3IDBB 2R7FA 4MUVA 1OI6A 3ETQA 2FOKA 2DK5A 3LAGA 1FP1D 5E1ZB 2A6HF 2IP2A 1B1BA 3ZQ7A 2L02A 3WTWC 4LA3A 3IC7A 3VHRA 2XVCA 2F4PA 4CHUA 4XF4A 1FZPB 2FXAA 2XAQA 3JAMK 3HHGA 4K8FA 4L9NA 5DUKA 2P17A 3ZMDA 2D1HA 1HW1A 5HS7A 4BYYA 4EM1A 1REPC 2H6CA 3V8JA 1LEBA 3M70A 1G6NA 2XROA 2P5KA 3RKXA 2ZBKA 4Q4ZF 5D6FA 5BMZA 1ZVFA 2VQAA 3TO7A 1KQ0A 1IAWA 1FOKA 2HZTA 2NRAC 2KXLA 1Q1HA 1J9IA 2BYVE 1W7PB 2IRFG 2FBHA 1J75A 2MH2A 3RTRA 2D45A 4IEXA 5KK1A 4XEZA 3U0ZA 4XLPF 1LDJA 4M74A 4RGUA 3IRQA 3M9AA 3PQJA 3HYIA 2KIFA 4L9JA 3I0TA 3GX4X 5LEKA 5JSOA 2FBIA 3QP6A 1I27A 1HSTA 2PI0A 4YNIA 1PP8F 1JUHA 2ISZA 2V09A 4IF4A 3SXWA 4Q29A 3P9CA 3BZ6A 3LAPA 1Q43A 3V7CA 4N0BA 2A61A 1FC3A 3U11A 1G4DA 5ICEA 5F64A 2IXLA 1CAXA 3S7EA 1TNTA 3JAMZ 5L3EA 3T0YA 2P7CB 3SQNA 3HIFA 5E8GA 3EYYA 2RGVA 1CAWB 2LF7A 2UY8A 2PAKA 5JAXA 3MAJA 2P5VA 4LB6B 2CW0F 1XE7A 1ZARA 4JK1X 2BV6A 1SEFA 4KN7X 4HW0A 2VPVA 4M71A 4ZZDA 4WWCA 1F9NA 2NNNA 3ULQB 1UHMA 1VR3A 2IW5A 1P4XA 3C3WA 2UXXA 1ODDA 3GYDA 4EJOA 1XDUA 4F7ZA 1YWKA 1YW7A 3K0LA 2ACJA 3WU1B 2EFQA 4XFBA 2E9QA 2BE5F 4LK1F 4JVAA 2X0LA 2Y75A 3CEWA 4PGGA 2OYZA 4HVQA 4JV4A 1HKTA 3VB2A 1DZTA 5KHHA 4XFAA 1IRFA 5LHHA 5FLXZ 4P55A 1O3SA 4DNCA 2JT1A 1I1GA 4HV5A 2AS5F 1QXJA 5TRDA 4IRIA 4JQFA 5FLXK 3Q9VA 2QLZA 1UIKA 5BQTA 5ED4A 3CF6E 1G3YA 4D0PA 3GLXA 4CYDA 2B5HA 2GIVA 2GU9A 3KP5A 1V4RA 2QZ8A 2EFWA 2L54A 5AIPA 1BI2A 2MH9A 4QLCU 5I8YA 2RVCA 2NYXA 2H0VA 2EB7A 3UKNA 1J59A 4EV0A 2CWEA 4OMYA 4Q48A 4HLYA 2CYYA 1U2WA 2ZCWA 2ADUA 4XSXF 2O03A 3VEPA 4L9VA 4WXCA 2MD5A 1KU9A 1HKQA 4I02A 1KQ8A 3P9IA 1BC7C 2COMA 1R1VA 3J81K 1CAWA 4ZZLA 2VBWA 3R4KA 2M45A 4QX5A 4UNOA 2R3SA 3WW4A 3ZP5A 5ICFA 1G3TA 5KBFA 2WTEA 3MEXA 1GQHA 5H20A 2Q8KA 2PHLA 4DINB 3NSTA 4IESA 5I0RA 2PMUA 4AQ6A 2XGXA 2DLLA 1WI9A 4FHTA 1E2XA 4ONUA 2XAGA 1ON1A 5ICCA 3BPVA 1L3JA 4U0YA 4Q5SF 2RKHA 4L2NA 5D1IA 2MC3A 1GHCA 4I98B 2D5FA 2O8QA 2XL9A 5JSPA 3ZMUA 3H8UA 4IEVA 2MA3A 2QCSB 4PDKA 3V4GA 4EGZA 3S0MA 2ZO4A 3RYRA 1YYVA 1IN7A 3HTUA 1XSVA 1DPRA 4RGSA 1UIJA 2ESNA 4AIHA 3HSEA 2VT3A 2VBXA 4HSLA 3ZMTA 2QQBA 1KU2A 4R79A 1D5VA 5D8LB 1OD5A 3IL2A 3ROUA 2XAHA 1MJAA 1YW9A 1X8MA 1F1ZA 4PCQA 4HV6A 3M3IA 3EO6A 2VOPA 2Z9OA 1DDNA 1RGSA 4MHGA 5KVRA 4EVIA 2ZJ2A 2Q0AA 1T6SA 4UBHA 2RV8A 2C6YA 1DZRA 1BM9A 1F5TA 1USSA 4MEYF 3KGLA 4A2UA 4MH0E 4GO1A 4HYEA 3LZZA 3LFKA 1D8JA 3BWGA 5EEGA 4LUMA 1BI3A 2HYFA 1BJAA 4KDPA 5FGMA 3S7IA 1XDSA 4HX8A 2JPBA 3M7GA 3EJKA 2ET1A 3ABTA 3GFLA 2KIUA 4QGNA 1TBXA 4XETA 3VODA 3HRMA 4HOBA 3F6VA 5BPIA 3MCZA 3HSRA 4U7BA 2DT5A 3QAHA 5H6QA 3IKTA 2VT2A 3GO5A 2DAOA 2A3SA 5F1RA 3PQKA 3CO7C 4QGLA 3H3UA 1MGTA 2DCTA 5EFUA 1FT9A 5LGUA 2MPFA 3V8LA 3SHRA 1CGPA 3K1NA 1FPQA 4B09A 2MLKA 4M9SA 2UYBA 3Q5FA 1YFWA 2W25A 3GFMA 4HDVA 3FMQA 2W57A 4D7TA 1QXRA 3MDPA 1KYWA 3DFGA 3WTXC 2HKXA 2FU4A 1CAUA 1YFYA 3FMRA 3NQOA 1PP7U 3U10A 4ENKA 2Q4SA 1BBYA 4IHSA 4IEUA 1K78A 1VJ2A 4KN4X 4KIFA 1ON2A 5KHJA 4XF9A 2GXGA 3G73A 4WZCA 3NW4A 2HTJA 2O1QA 1YQAA 3CUOA 1SD6A 1R58A 4P96A 4Q47A 3GZ6A 3JZVA 3NRVA 1XGOA 4RGXA 4ENJA 3HOSA 5ILUA 4TV7A 4I0AA 4MEXF 1CX4A 1HKSA 2VBZA 3BY6A 4I01A 1K7AA 1ZHFA 5C8WA 4PGHA 1LKNA 4QXKA 1IPKA 5BUVA 5ILVA 4XF1A 4UV9A 5L3BA 1O7FA 1YLLA 4HBNA 4E2SA 4GYGA 5IT3A 2QENA 3WGIA 4G7HF 3KZYA 2VOOA 4ENMA 2PG4A 4IEQA 1WLTA 1ZG1A 4XBFA 4PIYA 3C18A 2Q0OA 4BHCA 3IIAA 4M6YA 1Z1DA 2M30A 3H1MA 4LMYA 5C6CA 3H9AA 2WWYA 3TNPB 1XD7A 1DPUA 1SD4A 3RZZA 3JTHA 5I8SA 3KZZA 3SZPA 4DQ2A 4YARA 1X7NA 4G7OF 3D82A 1EH8A 3ZPLA 3DN7A 4KT5C 2FEZA 1ZZ9A 2NS0A 3LQRA 1R5GA 3I5UA 3OD0A 3WW2A 3EYIA 3FXUA 1T98A 2KIMA 3TNQA 5K5RA 3ECOA 1B59A 5HDNA 4MGKE 1TQIA 3MWMA 4WX9A 3PLQA 2GAUA 4QM9A 3HRUA 1ZLKA 4U7DA 2EV6A 4LLLA 5I0TA 1Z9CA 2IXKA 3CTAA 3MZHA 2GC3A 3NKTA 3ZMSA 3H92A 3P9KA 1VTNC 3G7DA 5I0SA 1I1SA 3BROA 1A04A 4KIBA 1FI2A 2J5PA 2YU3A 4MX3A 3U1DA 3MYXA 1ZRFA 5ILSA 1I5ZA 3NJZA 5JI6A 1FBUA 1U6GA 3RPUA 1R36A 1PM7A 2CAUA 1TW2A 4U88A 4M72A 1MZBA 1YIOA 1BN5A 2HFHA 1X3UA 4Y13A 3H3ZA 4IRGA 1R23A 3TOBA 4EJTA 3LA3A 5J8FA 4OMZA 3IDCB 5EZWA 2ZKZA 1QZZA 4Y15A 5HDGA 4A0YA 1V3FA 1QPMA 1RUOA 2QUFA 2IXJA 4ON0A 1U12A 1UW8A 3CDHA 1W5SA 1MD0A 3R6SA 1LNWA 3DL3A 3KGZA 2CFXA 4EMSA 2A69F 4ETSA 3QPHA 2N7GA 4UXNA 3ACLA 1CF7A 3FF5A 3K69A 2STWA 2QJVA 2M87A 2Q2EA 2Y0OA 3CLPA 2GA2A 4EWAA 3I7DA 4YSFA 2HJIA 1BC8C 2PAMA 4IPAA 3HQXA 3H1WA 1RTVA 4AIKA 5F6FA 3ES1A 4KU7A 4I09A 3H1YA 1K6OA 4KMUX 2CAVA 1KA8A 1XSXA 2WV0A 2FQPA 2PMHA 3F22A 2ELHA 4WCGA 1DGWA 3EETA 1QQIA 3TQNA 4OU0A 2CO5A 3V7SA 4U0WA 4FBFA 4KU8A 3MFKA 1TQMA 4OOIA 2PHDA 2P4WA 1ONVA 1ZRDA 5D5XB 1CAUB 2W85A 5JSRA 3J7AO 1Q5OA 2XHKA 2LF8A 4KUMA 4MV2A 5CVUA 5CLSA 3WTYC 1MDMA 2CGPA 3KP6A 2DTRA 4R52A 2CSOA 4GGGA 3WTZA 3B73A 2H6BA 4META 2MNGA 1J1LA 1ZLJA 4XFHA 1Y9QA 2NNYA 1L0OC 3R60A 1R7JA 1HBXG 4BIFA 1EYBA 3GZ5A 4PZJA 4L0YB 1Z05A 1Y0UA 1Z6RA 5DCMA 4G9YA 3WW3A 4G7ZF 2QQ9A 4RGRA 2XLFA 3ZMVA 1DUXC 2FMLA 4CGZA 2K86A 1P92A 4E2QA 2DO7A 1F4KA 3WGHA 1OYYA 4FX0A 2RNJA 2HDCA 1XCVA 2WFPA 3JW4A 1TLHB 3FX3A 4LG0B 4G6DA 2ISYA 4B8XA 4CXFA 5IT9Z 2RQPA 1X82A 5JR7B 5TJJA 2OA2A 2PN6A 1ZX5A 4HVRA 1YFXA 1NE6A 2F5FA 4LG0A 1J7KA 2JTVA 1ZZ8A 1EH6A 1T2KA 3OTFA 3BPZA 3LOIA 3E5UA 3FJSA 4B29A 5FLJA 4EJUA 1ZZCA 2QQAA 5D5VB 1ZRRA 4JBAA 4IEWA 1I6XA 2F5CA 2QM3A 2HTSA 2IXCA 2YSRA 5BOXA 3IKVA 2ESHA 4WBBA 4KL1A 4ZYEA 1ZGAA 2L4MA 1S7AA 3HTSB 2STTA 4BAYA 3IWFA 2KKOA 2K02A 2FA5A 2FNPA 3GWZA 3G3ZA 4S05A 4Q0PA 2G9WA 2RDPA 3BOQA 3OV8A 2MHFA 5BPXA 5FQ0A 1KU7A 1P2FA 3K9TA 5LHGA 4EJVA 4GXOA 4KMFA 4UXAA 3SFZA 1W5TA 2VXZA 4M73A 3LAJA 1YO5C 4NVPA 5HVQC 3GF2A 4ESBA 3KSCA 1FBQA 1YLFA 2FSWA 4E70A 4X6QB 2E7WA 1IXSB 4A0XA 3WG9A 2FBKA 3OCPA 4A5NA 2V1XA 3IRRA 2EFNA 2F5DA 4AQ2A 5E17F 1YUDA 1HQCA 5EEHA 4KWJA 5K8SA 5CADA 2VBYA 1J0RA 4ZYGA 3DPTA 1DGRA 2QVSB 3EDPA 2VECA 2M8EA 5CVIA 3TGNA 2GXBA 4J1XA 4RB3C 4I0BA 1ZZ6A 4I7HA 3JTGA 4EROA 1PMIA 3WE2A 3CLOA 2XKOA 1S29A 1IF1A 4L0ZB 3W6JB 4HVOA 3DF8A 2XLGA 1BI0A 5KHKA 5E1RA 1QO0D 3RI4A 3ZN1A 1TQPA 4Q0SA 5LGTA 3GUDA 3HSFA 4PIXA 2P8TA 2BNNA 1TW3A 2DPDA 3FHIB 1E17A 3F72A 1OR7A 4WF2A 4OLLA 1FX7A 2HQRA 5A2QZ 3R0AA 2XASA 2IJLA 4MGIE 5E1XA 3EQEA 3B02A 4ZYHA 3I54A 2D2WA 3D0JA 4AVBA 1SMYF 4J1WA 4ESJA 1GXPA 1YTYA 1QZYA 3D5LA 3WW1A 3RDIA 1SAXA 4WK8F 5DD4A 2OZUA 1R1UA 3MQ0A 1ZNPA 1S3JA 4O6JA 3T5XA 3O2PE 4IXAA 2P5LC 3WGGA 3FWEA 4KWLA 4XSZF 4WXDA 4XF0A 2WC2A 1IRGA 3J80K 6PAXA 3RYKA 2BGCA 1J3QA 4O9GA 4ZYDA 1MDMB 3L2CA 1T38A 4Z82A 4ASNA 4KWKA 3UKVA 1P4AA 4IEOA 3U2RA 2GC1A 4KYWA 1G3WA 4NHJA 3HRTA 5FFZA 4AVPA 1O5UA 4IERA 2ZMEA 2PFBA 2EV5A 2PA7A 1BIBA 1U5TB 4N9IA 3WODF 2EK5A 1RI7A 1UHWA 4JTOA 1WWXA 2QYOA 1NXMA 2D40A 3M8EA 2F5EA 1JXSA 5D6EA 2IA0A 1B9MA 2QBYA 4XFIA 1R22A 5CU1A 5JCTA 3SCHA 2EA7A 5E1WA 1XB4A 3FZVA 1RC6A 3T8TA 3VFZA 4MGZE 2DQLA 4EWEA 1XE8A 5I91A 5H6RA 2FMYA 2PYTA 2PQQA 2UYAA 2K0GA 2VODA 1ZZ7A 1EPZA 3RNSA 3L09A 5KHIA 4MTDA 3F23A 3L00A 2GC2A 5FPXA 4BQAA 4HZFA 3CUQC 4G94A 3FM5A 3L2HA 3HUGA 1KGSA 3SXYA 4BXUA 4KA4A 3KFWX 3F6OA 5L3DA 2K7LA 2IT0A 3ZMZA 3GXOA 3R0JA 3K1PA 4QM8A 4O5VA 4S04A 5FDBA 3RJPA 3HOTA 5LRRA 3LA2A 1XGMA 1BI1A 5CJ9A 2DFIA 2PFWA 1OYIA 3RPQA 4Y17A 3ERED 2QDRA 4EQQA 1NHAA 3E6MA 4D7SA 1Z6TA 3H7JA 1O57A 1PDNC 1SFNA 1PUEE 1QY4A 2BNMA 1FP2A 2JRTA 1Y3TA 2MLGA 1HSJA 4XFFA 1FLIA 2ET7A 2DPUA 5CVJA 3QACA 5FD6A 4FT8A 4Z07A 4HQEA 3EBRA 2GH2A 1GQGA 4Q0QA 1U3EM 1XMAA 1B6AA 3TOAA 1RIOH 3PVBB 4EWDA 2V6CA 1XSDA 3CJXA 3QP5A 4A6DA 2YX7A 1JE8A 4F8AA 3D0SA 5JHUA 4O3MA 1WKMA 3F21A 4JTNA 1LDDA 1HW2A 4AVAA 2ZMEB 1CF7B 1FY7A 2X4HA 4Q0UA 4N9HA 2MBFA 1IUYA 1WQ2A 1UCXA 3DP7A 3E6CC 4LTAA 5BXXA 2UXNA 3SZTA 4P5OA 4L5IA 4YFNF 1T39A 4LULA 3KP3A 1DP7P 4ENNA 1AWCA 5E18F 4HA8A 5FLHA 3E6BA 1FSEA 3CO6C 4PIZA 1ZREA 2KJBA 2O0YA 3I59B 4ZU7A 3ELNA 5J6XA 1JHHA 2HS5A 3HRSA 3WU0A 5KHGA 3EUHA 4HF2A 3RYPA 4LB5A 1QWRA 5K1YA 4P9UA 1CAXB 4X6RB 1NE4A 4A5MA 1IPJA 2IPQX 1J3RA 3QPTA 1QNTA 1CAVB 2G7UA 5LBQA 2PJPA 5HLIA 2D1VA 5AONA 1H9TA 4UBGA 4QGMA 4XLNF 3RIRA 2EWNA 2Z5UA 2DW4A 3WTVC 3U9GA 3O3KA 1KYZA 2RC4A 3I58A 5IT9K 5FQ0B 4U0VA 3TO6A 3GFJA 2OZJA 2CV6A 1ZG3A 1OFNA 2EA4A 1W7PD 2DU9A 4RD7A 4ORFA 2Z99A 2VE9A 3T1BA 4EM2A 1UFMA 5L3CA 1LQ1A 2EV0A 1T0FA 5JFRA 1IN4A 4A6EA 4OIRF 4HLXA 2XRNA 3FZ3A 2ZNZA 4WXHA 4P9GA 2A68F 2JSCA 4M6XA 2A6EF 2BNOA 1ZAOA 3BPXA 1SFXA 4BHPA 3KP2A 4HF1A 1H0MA 4HF0A 3WTSC 3HT2A 1IN5A 2Z3YA 4UUVA 4K2EA 3BU7A 1QGPA 1YHFA 1D8KA 1UD1A 4M9XA 2XL7A 4HDUA 3EHKA 2OD5A 2ZXJA 4HBLA 1XMKA 5FCCA 1XN7A 3UKTA 5DD8A 5T3NA 5L3GA 2Y0MA 5DUIA 3ABUA 2OAZA 3V7RA 2H27A 5HS9A 2Y48A 5D4RA 3F8BA 3J80Z 3SMHA 2B0LA 3ECHA 1OPCA 3F8MA 1O3RA 3QOPA 4LEJA 4XFCA 4O9EA 4KIGA 4I2OA 4CICA 2YPRA 3C3VA 4GULA 2LDUA 3I71A 4IHTA 3R61A 4QWQA 1RZ4A 3DV8A 1LR5A 3NEUA 2FNAA 2Q30A 1CAVA 2UWMA 1P6RA 3O14A 4AWXB 3DXJF 4OFGA 3K2ZA 1O5LA 1MKMA 2VC1A 1FXZA 4MZUA 2HOEA 4ZU4A 1IXCA 1R00A 5BY5A 2HQNA 1Z91A 4NB5A 2A5YB 5FPZA 5D5UB 3TKYA 3QRFF
chains in the Genus database with same CATH superfamily
2W24A 3OWTA 5DABA 5IAXA 3WCRA 1VQOI 5A2QK 1UB9A 3CCEI 1B35A 1Y1WJ 1BOAA 1HRV3 2DFBA 3T2TA 2ZGLA 4WVZA 3QU3A 4R9DA 1XNTA 4BDYA 3LSIA 4QD2A 3AFHA 3BOPA 1KONA 4OUEA 1X1AA 5DDJ1 5F0HA 4A3KJ 1HW5A 3BG6A 2ETHA 1X2NA 5I8TA 2BHYA 2CJJA 2XQXA 1H2NA 4LO8A 2XJRA 1CN1A 1O7LA 1XGNA 1D1CA 2GWRA 2ZX3A 4NO4A 4XPVA 4L9BA 1GICA 1FMVA 4OIQF 1CESA 1XU1A 1D0HA 2VW0A 4XL9A 2BFUL 5GADJ 5ICGA 2PQ8A 2DUOA 5JVVA 4TN7A 5KXCA 2LD5A 4DNYA 4H7LA 2LH9A 2EXJA 5CPRB 3AZWA 1UCRA 3DTIA 2HYGD 3OYHA 2IC1A 1UZVA 4B47A 2CY6A 3O1RA 4RL7A 5JPNB 4AFBA 5LFAA 1VI0A 4IRHA 2VQ0A 4HX7A 3C7JA 2F2EA 2V1UA 2VUCA 4NRMA 1KXGA 2EH3A 4A12A 3ILNA 4AD9A 2H09A 2VNGA 3NJXA 2L9LA 5T5JA 4IE7A 1Z7S2 5I0UA 4C1XA 1YE9A 3PUAA 1RPWA 3WZ1A 5FY0A 1QPIA 3RZMA 3NNMA 5FO5A 3LWCA 1YOVB 2BEOA 4ISRA 1SLIA 5A3PA 4A3DJ 2V26A 1MQTC 2HXIA 1VBC2 3FM3A 2JVHA 4KISA 1YS6A 3OYAA 3HUGB 5B4XA 3PIOF 4M3FA 2WO1A 5FO8B 1WVRA 4PJLA 3NWKA 1ZGJA 3E5QA 3GCWA 2WNVC 2QNKA 3MPBA 3ONQA 1DQ4A 1MBJA 3DQVC 3UYJA 2A1XA 1TTYA 4LK0F 3V8KA 3ZXLA 3JRCA 2V79A 5FLMJ 1FBSA 4L97A 4L9TA 3J81Z 3J7ZI 2EA2A 1U5YA 2K4BA 3K4ZA 4BE2A 3SHFA 1RUJ3 2E7XA 4BHBA 3E6DA 2E1CA 1DF0A 5J1XA 5GZDA 1S7OA 5FZHA 4DRRA 2VBDA 3JD71 1WRJA 1OKRA 3EQLF 2QVOA 5KXEA 3GFIA 4JDNA 1OMIA 4YFKF 3AK0A 1O3TA 3I64A 5LW9A 1ND3A 3N97A 2XKPA 4F55A 4AM3A 2VO5A 4LXLA 3L9FA 3EUKL 1REDA 3RMXA 1CZVA 2PHTA 2VOTA 2QKLB 4F3QA 3CUQA 3T2OA 1F4HA 4DOZA 2WAEA 3FHZA 4EJWA 1WBLA 2HVQA 1IV8A 2OQRA 4LFUA 1K78B 2QF7A 2BVLA 1GV5A 4BNCA 2KJCA 3ZFEA 3RZJA 1R4NB 1FYKA 3THTA 2FQ3A 3NVCA 2V6EA 1WA6X 4AK3A 5CVVA 2BWCA 1KS5A 3NL1A 1ULYA 1OCTC 4HK9A 4YZ2A 3Q9SA 4LA2A 3C1DA 3KT7A 4DEVA 2WR9A 4MQ9F 1SLCA 5DN2A 3IPVB 2HWE2 4G6TB 3MBWA 4IEZA 1RNLA 4QPYA 3CDLA 2PMZN 5A70A 3ABMH 3ERMA 5ERIA 2OCEA 2CGNA 1FWZA 1UG2A 1VP6A 1SFEA 4I30A 2E34A 1B9NA 3O7OA 3FDYA 1ZH5A 3N4MA 1CWPA 2DMUA 5T54A 2ZEYA 2YX4A 1X8EA 4AXOA 3LQQA 1JHFA 3OSDA 5CVRA 5HDKA 1AOYA 3LEGA 3H8XA 4IV1B 2M7AA 1K79A 3KP4A 1AX0A 4CA0A 5C33A 2W95A 2VNVA 2F6BA 3L7WA 3T09A 1W7PA 3LA7A 1PIV3 4NJ4A 3KM5A 1SFUA 3LEIA 1H2MA 3JUUA 4HKLA 1A8MA 2UY9A 1V5GA 2ZXWH 3BJOA 2WUHA 4B8EA 5C7GA 3HT1A 2CWSA 1R1ZA 5T5PA 5FZDA 1ZK8A 1EY2A 4QB2A 4G3YC 4RQPA 5LY2A 5HLHA 2DBNA 2QBYB 4YWAA 2OZ6A 2HQAA 3U37A 2X05A 1AYN3 1R5HA 2EZLA 3K2OA 3LEMA 5IVCA 2KP6A 3FBYA 3M8JA 5T50A 1VAMA 1UZCA 1V9U1 4AEDC 2TBVA 1KU3A 1OH3A 5FJ8J 4PSWA 2ARBA 4GKXA 2X5IB 1TWCJ 1BLZA 2X48A 1WCDJ 4XYXA 1U5IA 2LP0A 3L1PA 1MS8A 5E16A 1LVKA 3W20A 5GPAA 1AXKA 4BQ2A 4A7YA 1JKOC 1QHHD 4XJWA 3WQ1A 3DKXA 4Q4V2 2OJED 4CO8A 3BJ6A 1STZA 3M4FA 2J1EA 5FB2A 2L01A 2FX0A 1SMTA 4JP0A 5L73A 4W6WA 4FI9A 2E2JJ 1MBEA 2RS31 3TOJA 1JYTA 3JCUC 4CXXA 4HSTA 4EGYA 5JHFA 3ES4A 1U5TA 1MNEA 2WNUA 2PTMA 4AG4A 4D0QA 2K85A 1UAAA 1RIRA 4FFHA 2ICWG 2B9UA 1YXWA 1RYYA 4FP2A 4H7MA 2VNOA 3K1MA 4XBNA 4RS8A 2MEV2 1C8M2 3BR0A 5I93A 1OYWA 3TDUC 1BBT3 2P6TA 2CUEA 2JIGA 3BJAA 4OUMA 4BK4A 2HGCA 3IZOA 4H14A 3U1XA 1R49A 1IN6A 4COYA 2P5BA 1QHGA 2QCOA 2VW1A 4ZC3A 2YPJA 2XAFA 4RS5A 2A70A 1PX4A 1RL3A 3KLNA 4D69A 4RB1A 1POV3 1BIAA 1O4TA 1XNAA 3RZGA 2VMIA 3NV4A 4ZH4F 4A3ZA 3FXQA 2GNDA 2D7FA 4D1QA 3AZXA 4CDGA 3R05A 4BLIA 3DEWA 3I59A 2ELKA 5GAGJ 1MMGA 2FOKA 3WT3A 1UMHA 1FP1D 1GV2A 1N78A 1BJZA 4ATFA 3H9JA 1LGNA 1T6BX 3CJRB 2XR4A 3O1PA 1P7IA 1PX3A 2JX9A 2XVCA 1PO11 2F4PA 1MEC1 5IUQA 2FXAA 2R042 3I4IA 2WQ8A 4K8FA 4OZOA 2COBA 1ITYA 1MH4A 2ID3A 4BYYA 4EM1A 1AR73 3ZQGA 4XJ9A 4XRMA 1PUFB 1WWYA 2XROA 3BR5A 1S2BA 3OS0A 2ZBJA 1UY3A 2P5KA 3ZQFA 2Y9ZA 2VQAA 5BMZA 1RUD1 2GSYA 1FOKA 1MVEA 3MUZ1 2ZAAA 3IV5A 5DTDA 1W6OA 1W7PB 3P3NA 3V42A 1J75A 3RTRA 2DCKA 5JUVA 5F3CA 1FX5A 2LVSA 2Y6LA 4V19K 4PF1A 3GX4X 1LEDA 5IP7J 2ZACA 3I2GA 2CW7A 2PI0A 1BK0A 4AVVA 5C3RA 4GZ9A 5EZHA 1JUHA 3WDTA 2V09A 4IF4A 3SXWA 3CDZB 5JMOA 1BMV1 2PHXA 4UW5A 1W9FA 4D8MA 3LAPA 3MIFA 3K7AJ 1QRYA 2XWBB 2JICA 3U11A 2XUEA 3ZQIA 2Q2EB 1CAXA 1OPMA 2NOGA 3S7EA 1LUJB 2RGVA 5FZOB 4HNVA 2PAKA 1MS0A 2P5VA 2R062 3ZSMA 2G9GA 2CW0F 3OR2C 3FMGA 3LDKA 4JK1X 2BV6A 3GMEA 3SLIA 2IW5A 1SACA 2XGDA 4IOCF 5C4JJ 2UXXA 4AIDA 2VKVA 4F7ZA 1FOXA 1LU2A 3K0LA 4OHZA 3WU1B 2OYZA 4HVQA 1RUF3 4CCJA 1MEC2 1DZTA 4TWTA 5KHHA 4QSHA 1NA1C 3GBGA 1MS1A 2XB5A 5FLXZ 1O3SA 3DU5A 4QAWA 1ULOA 3ZFFB 3M3YJ 2AS5F 5ABJB 4IRIA 3LDRA 1IJWC 3N9LA 1YITI 4A41A 2HU9A 1WZ2A 1FNYA 4XTPA 1UIKA 4DZGA 5BQTA 3DYPA 3MLJA 4CYDA 2B5HA 3AZZA 1MMDA 3W5MA 1V4RA 3TN93 3N35A 2L54A 1BI2A 3ZPYA 4QLCU 2H8RA 2EB7A 3K4KA 2ORXA 4HLYA 1U2WA 2HEVF 1YI7A 1HKQA 3ZKUA 5BNPC 2BP6A 2COMA 4Q4Y1 2JJ7A 1C4RA 2JDNA 4ZZLA 1YIPA 2JG8C 1ASJ3 3ZQCA 1RETA 2M45A 4QX5A 3ZP5A 1QJU2 5ICFA 2EIGA 2PHLA 4CCKA 1OVSA 4A6SA 1NK3P 1S0FA 1BVVA 5A6XA 2XAGA 1L3JA 2IGKA 4U0YA 4PK4A 3DGTA 4M3CF 2RKHA 1GHCA 1ZBE2 3FHQA 2VPLA 4IEVA 1ETYA 3OUHA 3H8UA 5FXVA 4XK4A 4EGZA 1OA4A 1YYVA 2AR6A 1S0EA 1IN7A 4QX8A 1WJCA 2ESNA 2KIQA 4XABA 3HSEA 3VGIA 3ZMTA 3C7HA 5KHDA 1D5VA 5D8LB 4UY8I 5A1LA 3VBHC 4DXRA 1MJAA 1YW9A 1X8MA 4J19A 3PIJA 1F1ZA 3M3IA 4PCQA 1DGLA 3EO6A 2DOAA 3OIPA 1DG6A 4QHOA 5KVRA 4EVIA 1GNZA 1AVBA 1UMIA 4CDQB 2C6YA 4D6QA 1F31A 3KGLA 4XQDA 1D4M1 1E57A 2ID4A 4A2UA 3VZJA 5EPAA 2X51A 4HYEA 3LFKA 2IXSA 3IDEA 5EEGA 5FAXA 4NHMA 2E5NA 2XVGA 4XORA 4MADA 3V56A 3DKQA 1XDSA 1BR2A 4UUSB 1GBGA 3ABTA 1TBXA 2WZR1 1MSFC 1RKTA 4U7BA 3H0GJ 5FYUA 1Y39A 3GTGJ 2VT2A 3ZRGA 5C8CA 3PQKA 3CO7C 3G4SI 1QGLA 2RAEA 4TXWA 1PVXA 2M7BA 1MGTA 5BYNA 3AP7A 1NOVA 2LY2A 1FT9A 4ASLA 2YZ4A 2OX0A 1ZR4A 4QX2A 2CGOA 2CQ7A 5EZGA 5C3OA 3V8LA 2UWBA 4GWIA 3SHRA 4IDZA 3K1NA 2YB7A 2YPDA 3B5LB 2D43A 3P5JA 3Q5FA 4ET7A 1YFWA 4D7NA 1PVC3 3PJQA 1QIQA 2W57A 1VBD3 2P3KA 4LHKA 2FU4A 2HNHA 1DU0A 1UU4A 2VR4A 3OGSA 3FMRA 2VLAA 1C8NA 2FCUA 3C2UA 4BDZA 3J7NA 1BBYA 4IHSA 3PNYA 2PHUA 3AMNA 3S1QJ 5JVGF 5E8AA 1ON2A 4XF9A 2J1VA 1JT0A 3HBZA 1IS6A 3NW4A 4WZCA 2HWB3 3PVEA 2WYSA 2BJSA 3V64A 4QTRA 1SD6A 5JLWA 1R58A 3JZVA 3HOVJ 4HG2A 1DYOA 1XGOA 1PM4A 3HOSA 1AR62 4I0AA 2PELA 4K7JA 4QB6A 5J1YA 1PMHX 3BY6A 4I01A 1XC6A 2YU9J 3WF3A 3K3NA 2ZGSA 4QXKA 1G8XA 5BUVA 5JWPA 1NAEA 5D2AA 3LIGA 1OISA 2VOOA 2PG4A 4IEQA 1WLTA 4MLOA 4UFHA 2FZ2A 2HWE3 1F4AA 1RR7A 3JD72 3IIAA 4NWVA 5APAA 5C6CA 4CU8A 2R7WA 4G4FA 5F5AA 3VB9A 1DPUA 3WUDA 4GMP1 1CR7A 1NUKA 5I8SA 3ABLH 4R4ZA 2IFWA 3SZPA 1VNDA 2XB0X 2QE3A 3OYGA 3D82A 3TRSB 2VNRA 4UFMA 3DN7A 1X1PA 5TISC 4QT6A 3BTJA 3OD0A 4FPFA 4J01A 1NH3A 4C3JJ 3HXLA 4X6AJ 5T5OA 1TME2 1VBA3 4BUPA 3VBRA 1W99A 2WS92 1T98A 1W2AX 3TNQA 5F5QA 1PIV2 4IW3A 5HLTA 2Q8OA 2XJPA 3MWMA 2DXIA 1W36C 3W2WA 4DJAA 4FVVA 2GMPA 2X5IC 4LLLA 1NX9A 5E3LA 3AKPA 1RC9A 3CTAA 4CE8A 2BY1A 3MI8A 1WZXA 3P9KA 1VTNC 2CMPA 5I0SA 1OKQA 3BROA 1J84A 1JZ5A 3KV9A 2YG0A 1JN2P 1IGOA 4MGSA 1TEIA 2FUG2 2Y31A 3Q8FA 1ZRFA 5ILSA 4UUTA 4XIOA 5KAFC 1ETOA 1IKPA 1I5ZA 3U1KA 1H6XA 3I3DA 2UUZA 3NJZA 4CDUB 1R36A 4JYKA 4RBOA 2VJ5A 1H8TA 2P3YA 1CJDA 5CKNA 1BN5A 1X3UA 4IRGA 5JPMB 3TOBA 4EJTA 3LA3A 5J8FA 4OMZA 2IS2A 2EZKA 1RUG3 1IQDC 5FZ4A 4Y15A 5HDGA 2A6WA 4BJTA 1RUOA 1UW8A 5HNFA 2W48A 3UNPA 5DMYA 2L9RA 3BI3A 4Z92B 4UFJA 3FLPA 1CF7A 2QJVA 5FRMA 3BR1A 1V6NA 3PSFA 1O8PA 3FKJA 2JE8A 5M5YJ 2PAMA 3D3AA 1MVQA 4IPAA 1CZSA 3TEZA 3NAPA 3HQXA 1K3IA 3LPGA 2RMU2 4AIKA 4A6OA 2R5YA 1Q8SA 4BQWA 1Q56A 3IM0A 2OXBA 5EGOA 1T08B 1XTAA 2C5DA 2P81A 1TG7A 2FCVA 2RDSA 4PLNA 2M2EA 5F04A 4WM8A 2Y33A 4J00A 4EN8B 2L2OA 1QQIA 2QQMA 1OURA 3TQNA 3I55I 3VHOA 1K4TA 2G19A 1HC8A 1W06A 2LY1A 2PXJA 4OOIA 3U4SA 4CYCA 1ZRDA 2EXIA 1HA8A 5JSRA 2YFZA 2CQQA 1Q5OA 4Y1YA 2DMTA 5A3LA 2LF8A 5HCFA 2JA2A 5LBBA 4MV2A 5CVUA 5A3TA 1V0AA 1A36A 1OUSA 2RJKA 4UT5A 2KM2A 2CSOA 4GGGA 5IAVA 1G9DA 3W6VA 4A4AA 1AXYA 1ZLJA 1MBKA 3AM2A 4L0PA 3I9V2 4XQ4A 5FZAA 1WH5A 3VYUB 1HBXG 4B4RA 1FMD1 4OVEA 4E4HA 2HOTA 3THCA 3WDVA 1Z6RA 1UHSA 3OYNA 3VL8A 2WYFA 5DCMA 5IJRA 4G9YA 2LBFA 3JBG2 3VBOC 2G9ZA 4RGRA 1WBFA 2XLFA 4IHXA 3SEPA 2FMLA 3FIWA 3HL2A 4FISA 4OI1A 1WCKA 1VMHA 1OYYA 1LCLA 2RR11 4G6DA 2JKBA 5FY7A 4B8XA 3CMMA 5JR7B 3VZMA 4JDMA 4MIMA 1UYPA 2OA2A 4Q26A 2D6KA 2ZZJA 2F5FA 2R7TA 5LZ6A 4RR3A 5F08A 4W6XA 2W2IA 3LOIA 4OUSA 3E5UA 3I3LA 3FJSA 4CCCA 5FLJA 3U07A 3C2BA 2K40A 2WJSA 2QQAA 1ZRRA 4NC6A 4AGRA 2F5CA 2A75A 2QM3A 2NYYA 2VVDA 4AQTA 4QHZA 1UKGA 4OHVA 2YSRA 2IS6A 1D1BA 4XBQA 2BBAA 3IUOA 5IK7A 2RJ2A 4ZYEA 1ZGAA 3CMEI 1FPN3 2D6OX 3WX5A 5FKMA 2PJRB 4E4ZA 4BAYA 3POYA 2KKOA 2FNPA 2IFRA 3OYMA 3G3ZA 4WM8B 2VMCA 4Q0PA 2CDPA 1WW7A 3T3YA 2MFZA 3K9TA 1QJY3 4KMFA 5C9AC 1JJ6C 2VXZA 3LAJA 5KC6A 2A6VA 1OFCX 2HPIA 1YO5C 1V6JA 1OA3A 1SFYA 3LKJA 2KDZA 3IAM2 4LHSA 4GH4C 3PUSA 3W21A 2EFNA 5E17F 1RUC2 3BQYA 2VG9A 1HQCA 4M3DA 2LC2A 4Y20B 1E0EA 1ULEA 4MVTA 3ZYIB 4BIOA 5K8SA 3A7QA 3I4MJ 3SZGA 2VBYA 4KWUA 1DGRA 2QVSB 4CU9A 3EDPA 5LA2A 5CVIA 4QHBA 4ASKA 4RB3C 1ZZ6A 3VBOA 1FMD3 4EROA 3OUJA 4XKVA 3J9SA 4FOQA 3AVSA 3CLOA 2XKOA 1S29A 1IF1A 4TSVA 2W0XA 3BR6A 3RZKA 1FATA 3ACIA 3PDQA 1JZ6A 3SH5A 1BI0A 3DXUA 3S2HJ 4C30A 1TQPA 4R9AA 5LGTA 2JKXA 1SFOJ 2VM9A 2JK3A 4PF5A 1N75A 2DYSH 2P8TA 4ZDPA 3NAUA 2AGSA 3M3CA 4QPGC 5L7OC 3HEFA 1ODNA 2KT0A 4IV3C 3EQEA 3B02A 2JA5J 1SVOA 4PJ0C 2OVUA 5SV8A 4YVSC 2A6ZA 2A73B 2HH9A 2GNTA 1ZBA2 3VBFB 4HG6B 2OS2A 4LQRA 1SVMA 2V4JC 1D4M2 4PLOA 4XC9A 1KFUL 3ILRA 1WLCA 4LO7A 3ZYPA 1R1UA 3MVPA 1RUI1 4EZHA 3HOXJ 3O2PE 4IXAA 4KWLA 4IO9F 4BQ4A 3LNQA 2AC1A 3RYKA 3VBUA 1GFF2 2CSGA 4O9GA 4BM8A 5FKOA 4IEOA 3U2RA 4CVUA 3CCMI 1CPNA 3DLAA 2R7EB 5EIYB 3S30A 1G3WA 4ZZ5A 1IG7A 2GMEA 1GANA 1GYKA 5FFZA 4CDXB 1O5UA 3W2AA 2W39A 4IERA 2ZMEA 4YW7A 2EV5A 2EK5A 1N1SA 3N7JA 5GKAC 5CQEA 1HXS2 1WWXA 2QYOA 5ABJA 1VMFA 4P9LA 1QJU1 5D6EA 3AKQA 1B9MA 4YW2A 3D5RC 4JRLA 1G9BA 4XFIA 1R22A 1Y9MA 1O4XA 3BUCA 5CU1A 5JCTA 2AH2A 5A3NA 2R16A 3FZVA 2C6SA 3TBDA 1XE8A 3RI9A 2ZGOA 2FMYA 2ZXIA 2PYTA 2UYAA 5GTIC 4MTDA 1UKRA 4ABZA 4O61A 3HUGA 5A7QA 4RN5A 5L3DA 5D8AB 3ZMNA 4AE2A 3R0JA 4JC1A 5BNOA 2VC9A 4O5VA 3OYIA 2JG9A 4Q4W3 3CC2I 1H2LA 3HOTA 3VUOA 4OQ8A 2J1TA 5LRRA 3IH4A 3WNLA 3M2MA 3LA2A 5FZKA 1BI1A 3VBSB 3N9PA 4BQNA 2XVLA 4XKBA 4Y17A 3ERED 4QXBA 2QQIA 3AYDA 2KDOA 1PDNC 2DVFA 5IVEA 3NNFA 2BNMA 2TUNA 2V9KA 1Y3TA 1HSJA 1SBFA 5FXWA 1FLIA 3BG7A 2E7TA 2VAUA 2ET7A 4YRVA 3OOUA 3MV01 3MKLA 4NHXA 5FMBA 5FD6A 3ZQLA 4Z07A 2E31A 2R061 5FTTC 2HVRA 1CIWA 2EILH 4JQTA 2GH2A 4ARYA 4Q0QA 2B7EA 3WHCA 4KQ7A 3TOAA 4EWDA 1MZFA 1XSDA 3TL4X 1X33A 1COV1 2Q8CA 3JU9A 1RKWA 1LAJA 4OHWA 2LRDA 1W6QB 3FUOA 3F21A 2WWUA 2WSUA 5FZ9A 4DUVA 3PO2J 2VOKA 4N9HA 2MBFA 1WQ2A 3CESA 2XH6A 3E6CC 3BG9A 4CP0A 1MS4A 3PVNA 5BXXA 2UXNA 2E2HJ 3CBNA 4CEWA 4L5IA 2WA4A 4ZTJA 2HEYF 1T39A 1IOAA 1W04A 4UFIA 1REEA 1H9PA 1ONAA 4FPGA 3E6BA 5KXBA 3SQOA 1FV2A 1X3ZB 1N1YA 2RDNA 5GZEA 2KJBA 2O0YA 2HBTA 1X3WB 3ZFGC 3WU0A 4HF2A 4LB5A 4X6RB 1RUE3 4FFIA 1Z7LA 1DU3D 3DTEA 1L7QA 3OGRA 4LKDA 3BLYA 2Y64A 4YG0A 3UJQA 3JCIA 2D1VA 4NOTA 2G1MA 2WNVA 5JOYA 4UBGA 2HVSA 4XXPA 1ZRIA 5D21A 2R041 4IV1A 5IT9K 2IS4A 4BQQA 5FQ0B 5GZGA 3TO6A 2OZJA 2V5DA 1M1EB 2XJTA 2CV6A 1MIJA 2LALA 1W7PD 4ORFA 1UELB 3DCQA 2Z99A 4IHYA 1RITA 3D5SC 4Y3OA 1SHWB 1R1A1 3U14A 1JI6A 1T0FA 5FMOL 4ZXEA 4BJ0A 5FY4A 1G9AA 2VU9A 2BOLA 4ITVA 4AC0A 2A68F 2J7MA 3VV1A 2R93J 4AHYA 2A6EF 1QJY2 4QKBA 4YM2A 1SFXA 3CLQA 4GRIA 1WMFA 1PK6C 3P5BA 2QSHX 3WTSC 3HT2A 2DCEA 4UUVA 2JG8B 3AL6A 3ZYRA 1DQ1A 5CFDA 3DLLF 1AJKA 4LR4A 1GZTA 4RQPB 2ADEA 5L3GA 2Y0MA 2RV9A 4DOUA 4INDA 2BZDA 3RWNA 1WUVA 2Q5TA 5D4RA 2ARCA 3ZN6A 2XJQA 1VQ8I 2OTJI 2OQ7A 2B0LA 1OPCA 1VMJA 3F8MA 3CJIB 4LEJA 3OY8B 1V6KA 5CB7A 4CICA 1WMXA 2CV1A 2BW8A 5FYYA 4O65A 5FPUA 4LJHA 2FNAA 5JOXA 3JREA 2Q30A 3J7MA 3DPUA 1CAVA 3DXJF 2K3FA 3S3OA 4OFGA 1MKMA 2VC1A 1FXZA 3D8CA 2WABA 2DOFA 1R00A 3HGGA 5D5UB 4Q4V1 3MV11 1V00A 3WTTC 1QBJA 1MZ6A 2XQRA 5LRSA 3OD4A 4JX0A 4QX3A 5JVTA 2VOXA 4XFGA 5JXIA 3S17J 2DFFA 3T0AA 2EFOA 2M5WA 5HOOA 4D7YA 3CCJI 4NQWA 2Y0SN 1BYHA 1V9U2 3F2ZA 1B72A 1W6QA 1GOHA 4EN6B 1JUPA 3BPSA 4Q1RA 1W0UA 3GZEA 5LLQA 2R92J 5DYMA 5FRAA 2P6SA 2JZYA 2VZ1A 4O7XA 5IOZA 2VXRA 1JW6A 4OIOF 1AL21 1SAUA 5L19A 3ZGKA 4OIPF 4YVSA 2VIXA 3KS7A 4COVA 1YG2A 3F95A 2NP0A 1UOJA 1OXCA 3VDCA 2D6MA 4LLGF 4UV8A 1RUE2 3HOWJ 1USTA 3TMOA 5DS9A 4HMZA 1P4WA 1IO2A 1OLMA 2ZEZA 1LJ9A 1F36A 3KLOA 2NVXJ 2D93A 3BODA 1AYN2 2ELJA 1Y7BA 3PNAA 2LKSA 5LBEA 5J48A 3LSKA 2FBEA 3ZXSA 2B8MA 2YDEA 4Y1VA 2L9SA 1Y1VJ 2VGDA 4NPMA 4XHBA 3A22A 3I2IA 4J25A 2D97A 1LFBA 3B9IA 3KVAA 5CNAA 3I4NJ 3GF6A 5E3OA 2KRFA 1XPXA 1CZTA 1H1MA 4NPLA 2E2IJ 4Z2YA 2R5YB 3ELKA 4OAZA 2BTVC 3P3PA 3OJBA 2V1DA 5FKBA 2ZGPA 3GVAA 4Q0VA 4CEYA 3HG9A 2R7XA 2P6HA 2ZGUA 3ST7A 1YFHA 5JZGC 1ENXA 4KGGA 2D5HA 2GC0A 1UZ0A 3KV5A 2PJRA 1OHFA 2DVGA 3OGJA 4XCAA 5F37A 3AG1H 3HQRA 2X85A 1G9CA 2R7DA 3DYMA 4MNUA 5JXHA 3ZXFA 2YC2A 1C8M3 4ARXA 1CX1A 4DY5A 5ANQA 1AYN1 2L3DA 2WB1N 4XLEA 2JSPA 1WJEA 3NAPB 2HBUA 4UI9L 1JOPA 2OKXA 3PUBA 3C7OA 4LKEA 3ETPA 2FOWA 2W91A 1RUE1 3RS6A 5K5QA 2DK8A 2A3WA 2QFEA 3Q9OA 4EM0B 2UZKA 3SITA 2H94A 4P9FA 5HCHA 2JIJA 1MJ9A 3FXRA 1RUI3 5D4SA 1SCSA 1U8RA 2PBIA 1G3SA 1RUC3 4MSVA 4RR3C 2VW2A 3QPLA 4KG0A 1S72I 4CYCB 3UGHA 4UW3A 2Z33A 1VZ0A 2WO2A 4L18B 2O8XA 1W8TA 2VCBA 5HXVA 2EFPA 2DFHA 2K4JA 3DPRC 4W4ZA 1S0CA 4IEYA 3OF1A 3ZPOA 4M9ZA 1SFKA 1LNSA 4C8DA 3WG1A 4Q8KA 2O8KA 2JEMA 3M1CA 4W50A 4XJ8A 1ULGA 4QPOA 1GP6A 2V9VA 3BG5A 4DRVA 1TQ5A 4UVBA 3H7YA 1IC8A 1JT6A 4P5HA 1COV3 5J4VA 4R8HA 4X8NA 1ENRA 3OR1C 3GW2A 2VUMJ 1YX5A 5LATA 1ZBE3 5E89A 5HCBA 1H89C 3FL7A 1N25A 1PUFA 4YIFA 3F8NA 2YC0A 2LSOA 1LOBA 2DVBA 3K70D 2OQGA 2DTZA 3MKYB 2QQOA 3NWTA 4N43A 5FYTA 2K9ZA 1VLNA 1IW7F 3QYBA 1Z7S1 2EVXA 5C4WC 2HEWF 4IEPA 3J4UH 2HYXA 4XCBA 3HHHA 2BZTA 3ZDSA 4NHKA 4YFWA 4DFSA 5G04L 1H9GA 3AYEA 1OD3A 3LFUA 5H9PA 4BISA 4RGAA 2BVMA 5DEQA 4XUTA 3H50A 1D1AA 5F32A 4EYUA 1TNSA 2Z2SB 1AR82 4C9YA 1IZ1A 4GCVA 1DZQA 2YBSA 4YGBA 1ENHA 2JPCA 4AI9A 2FRHA 1PMJX 5HI0A 1JBCA 4OINF 1Q8VA 4ZXKA 1QJY1 1IS4A 3K4JA 3SEQA 1ZTRA 3P7NA 2QWWA 4AIJA 2W1UA 4W8JA 3J7HA 1WGPA 4CZSA 1US3A 4KICA 1FPN1 1X9PA 5BV6A 4UVCA 3FC0A 1VALA 3WCSA 2XAJA 3VD7A 1TT5B 3ZR5A 3CF5F 4YG2F 4K8RB 5JR3A 2XHNA 2PLYA 2D44A 1H1IA 4MFDA 1S9HA 3PJYA 5IY5H 1WSUA 3M1EA 5A7NA 2ZFWA 5LGNA 5D8KB 1B4AA 3S3NA 4HL0A 1UAIA 3C8XA 1VQNI 1TMF1 1G2HA 2WKKA 3OYFA 4KFCA 1W0TA 3IAQA 3JB4C 1WW5A 1LENA 2WO3A 3KEQA 4R4XA 2RR13 5IP6A 2QQNA 3ZN0A 3WG7H 5K5OA 2E6VA 5DZEA 1CONA 2W94A 1KRIA 3WHTA 1B09A 2ZX4A 3OSFA 2K27A 4NC7A 2BBYA 1WJDA 4P14A 1YS7A 1TP4A 4HONA 4ZHNA 2DBBA 5DV5A 3POEA 4R9BA 1SD5A 2CQNA 4NRPA 3I2KA 1MS5A 5FBZA 3FN9A 2TDXA 1BKZA 4IHVA 3AFGA 3NJYA 2KFDA 4P9XA 3GYHX 2BVVA 2LM3A 1QU3A 3RSJA 3O0VA 3J7YJ 2VN2A 2ZEWA 1J1TA 4BQOA 1Y4WA 2KMUA 2DI3A 1IG0A 3PMSA 3F8CA 2A7AA 1V9U3 4FAGA 2H8WA 5BPDA 2DCYA 3KETA 1COV2 3VYSB 3SDGA 2WBMA 3NV2A 2WV1A 4L99A 1T6GC 4CEWC 1R082 3R4UA 1A6QA 3PU8A 3F3XA 2KLOA 4FTEA 2XAUA 1GP4A 2E5ZA 3CCSI 4OAYA 3KMHA 3REOA 1JHNA 4MUVA 2R7FA 1G9FA 4CEYC 1C5IA 2DK5A 3WINE 3T0DA 2DT6A 5E1ZB 5LA0A 1GMMA 3RZDJ 3VDDA 4YVWA 3OBZA 4CU7A 3SH4A 3WTWC 5HV4A 3IC7A 4P5YA 2JDZA 5A6ZA 5E88A 4YW6A 4XF4A 2DDBA 3ZFEC 2XAQA 3JAMK 1HCRA 3QODA 4AFMA 2EXKA 5FUIA 3SNMA 3HHGA 4L9NA 3FHAA 3ZMDA 4ZZ8A 2DTWA 2D1HA 3V65A 2YS9A 1HOMA 2V9PA 3HZJA 1IG3A 1POQA 1LEBA 3M70A 5FYIA 1G6NA 5IW0A 2IS1A 2NN8A 4JKLA 2ZBKA 1PGW1 5D6FA 1AX2A 5FZGA 3VZOA 2VE1A 2W7NA 4YG6A 1J9IA 2FHRA 3S6PA 3USUA 2IRFG 2VCAA 2FBHA 1JKPC 3U0ZA 4RGUA 1PJRA 2DA4A 1S0JA 2R5ZA 3RWKX 3HYIA 4CUGA 2KIFA 3ZFGB 3I0TA 3WVJA 2FBIA 1HDPA 5FWEA 3QP6A 2XJUA 1S5LC 4BE3A 3AKSA 4YNIA 4FP3A 1PP8F 1I3HA 3KHCA 2ISZA 1LGBA 3U78A 3ZDVA 4LIUA 1QJX2 1ETVA 1HXS1 3OSGA 4QDQA 1Q43A 3V7CA 2YBKA 1IRXA 1WH7A 2BHZA 4AVTA 2KR2A 5EWSA 1MZEA 2RVAA 1TNTA 3VKOA 3LQCA 2HWF1 2P7CB 5J37A 3EYYA 4XUNA 2X6WA 3TB0A 4FPJA 3OYDA 4GAZA 1ZARA 5JR2A 4HKOA 4GJZA 4NIAA 3O1SA 4M71A 2R073 3HOBA 1VQPI 1F9NA 4KI5M 2NNNA 1UHMA 1AZDA 3EB7A 1P4XA 1RUI2 3C3WA 5A80A 4FQ4A 1SC7A 2ACJA 3AFKA 2EFQA 1U0JA 4XFBA 2BE5F 3ASIA 1H8TC 3CEWA 1HKTA 3I8TA 5EGOB 5K9YA 4XFAA 3MD2A 1IRFA 1VRH1 4LE3A 3BN6A 4DNCA 2ZXQA 1Q8PA 4QPIC 3WF1A 3ZO0B 3SFIA 3H0OA 3ZVXA 4Z6YA 4E8CA 1IDZA 3S57A 1GZWA 2HWF2 3KP5A 2HWD1 2CYFA 1LE8A 2IUWA 4GJYA 2MH9A 3AL0B 4A3FJ 1GLHA 3HAGA 1GR3A 5JI9A 2CYYA 4ISQA 4LMFA 3TEDA 5DDJ3 5FOBB 1LU1A 4AI8A 3VEPA 4L9VA 4WM7C 1MS3A 4I02A 5F39A 1OQYA 2A6TA 1R1VA 3J81K 1N1TA 2GM4A 1QMJA 4FASD 2R3SA 3WW4A 4QPGA 1MPXA 5KBFA 4OYUA 2JJ6A 3MEXA 3OY8A 2Q8KA 2ZOEB 5DPNA 5I0RA 3WDUA 3ABKH 2XGXA 1WI9A 2VD7A 4FHTA 1E2XA 4ONUA 5IFPA 3O0WA 3SC7X 5M5XJ 5IYYA 1D0YA 4Q5SF 4ZTFA 2XL9A 3N3HA 2IEKA 4M3BA 5A3UA 1U5XA 1SLTA 2PLV3 5FPVA 2MA3A 3LD8A 3SYTA 2ZO4A 3RYRA 1JUIA 4RLQA 3O8GA 1H8AC 4OCTA 1POGA 4B4PA 4QDRA 2DWRA 2VT3A 1YRZA 1VQ7I 4Q5OA 2ZJQF 1QQP2 2XAHA 2XG3A 2W08A 2EZIA 2HWC2 2VOPA 3G1LA 1RGSA 2ZJ2A 4NAOA 3MFCA 2Q0AA 4XMAA 1ZA4A 1T6SA 3FXLA 2WS93 4UBHA 1DZRA 4YZ3A 2ZSHB 1DLLA 3VDDC 1F5TA 4GO1A 3LZZA 5JZGB 3BWGA 3QWLA 1W8NA 4LUMA 1V5FA 2HYFA 3VD9A 5A3WA 4Q4X3 3DTKA 1FOD3 2ET1A 4OI0A 4AHZA 5EDNA 5F1JA 1K42A 1R081 2DA7A 2DT5A 1YX3A 5H6QA 3GO5A 2A3SA 1ND3B 1E3PA 2RR12 4QPIB 2VMGA 2X29A 4NQWB 5LGUA 1QU0A 4QKFA 3OYWB 1CGPA 3VKLA 1FPQA 4B09A 1YJ9I 3JBG1 2NXNB 3BIWE 2UYBA 1FMD2 1ACIA 4HDVA 2ME0A 3CZ6A 4KITB 4IQ4A 1OA2A 1OQ1A 2BU9A 3CQZJ 1E5RA 1ODMA 1AR93 5FZOA 4XURA 5T52A 3RQ0A 2R1BA 1UNBA 4D6RA 5DG1A 1YFYA 3ZQQA 3NQOA 3JD73 3U10A 4KG8A 5CFCC 2Q4SA 1LTEA 4IEUA 1F35A 3JRDA 4KN4X 3HN1A 5EG0A 2HTJA 1HRV2 1YQAA 3BG3A 4FPEA 3EMRA 2B9SA 3HN3A 1UYZA 1IRZA 4EEFG 1A31A 1NLSA 4EJRA 2VULA 2MD0A 2E53A 5FREA 1T56A 2E71A 1CX4A 3K4AA 1HKSA 1YRNA 2YMZA 1K7AA 5IOYA 2OPWA 4JGYA 5C8WA 2RMU1 1TWAJ 2YFUA 1IPKA 1I3QJ 4XF1A 1O7FA 5FLVA 4G12A 1FPN2 4RDUA 2GP5A 3OGGA 2FD8A 4Y26A 2QQPA 4XBFA 3K2AA 4PIYA 5A7WA 4F92B 4MXVA 3MKWB 2Z5WA 1U9OA 4HPKB 4LBNA 4N90A 4AYBA 1XD7A 3RZZA 1ZELA 3JTHA 3T4HB 1GLNA 3KZZA 4RYDA 3MN2A 4XZPA 4QQOA 3ZX7A 1H8VA 1YI9A 2FEZA 3LQRA 5F9TA 3TW6A 3T2PA 3PIGA 4AEMA 4KJZA 1F5FA 3EYIA 1DU6A 5K5RA 5BNNA 1HN0A 4LHLA 5HDNA 4MGKE 5IVYA 1JKQC 2EALA 2XBO2 4WX9A 3KQRA 3ZFEB 3PLQA 1JZ8A 2GAUA 1BJQA 2EXHA 4CPBA 3HRUA 3C7EA 3GTLJ 2EV6A 1OF3A 3IKWA 1Z9CA 2IXKA 1JH5A 3ZYGA 5LY1A 3G7DA 2L7ZA 2J5PA 2I10A 2QTWB 4XLHA 2W82A 2ZHNA 4LLFA 2WIIB 1PIV1 1PM7A 2JWTA 1YIJI 1CQTA 2VCCA 1TME1 1U0AA 1MZBA 4YGDA 1QKQA 1ZBA3 2DA1A 1R23A 2WLQA 5GJ6A 3LIHA 1F8VA 4XRSG 5IWFA 2HXOA 1OBNA 4IV3B 3LSHA 2YYOA 2ZJPF 3VKNA 1JOJA 3EXUA 4A0YA 2QUFA 2IXJA 2AZ5A 4CDWA 1MMSA 3ACGA 2JUCA 3PUFA 3R6SA 1LNWA 4IL7A 1VQMI 2IBDA 1DP3A 1A8DA 4UXNA 3ACLA 4HT1T 3FF5A 4CA9A 5EJ1B 4JDOA 4XDOA 4EWAA 2F4IA 4M01A 1W2OA 3JB8A 1A78A 1UY4A 1EF4A 2EF6A 4CP2A 5F6FA 3ASNH 5FMOS 4KU7A 3CP2A 2GN3A 1G86A 2VVEA 4I09A 3LL7A 3M7AA 3H1YA 4XKCA 2ZGRA 3MFAA 2CAVA 1KA8A 3B01A 3I2JA 2CFOA 2YGMA 4Q4Y3 3E1SA 3AC0A 2FQPA 3F22A 1AR61 4DPNA 2VMHA 4XZUG 1SFPA 1W03A 5E3MA 1C1FA 1LOFA 3V7SA 2CO5A 2YHJA 4KU8A 3PJRA 1G59A 2P4WA 2XUMA 5FKKA 1H8TB 1ONVA 1OLME 1HJGA 1NCRB 5J47A 2VZOA 5HODA 2P3JA 1BR1A 2I8DA 4DBQA 1SZBA 4OULA 4R52A 1XB9A 3H36A 4QKDA 2H6BA 4META 4BXXJ 2MNGA 5IVVA 1J1LA 4XFHA 3DXTA 3BYWA 1WCQA 5KXDA 4Y7NJ 1JGGA 4BIFA 4SLIA 1OJLA 4X1EA 3GZ5A 1W6MB 1Z78A 4L0YB 1QDCA 1Y0UA 3ACFA 4G7ZF 2A3YA 3BZKA 1ASJ1 2GIZA 3ZMVA 1DUXC 5C3PA 4CGZA 2PMZA 3V0AB 1P92A 2JQ7A 4ZKTB 2VZTA 2JB4A 3WGHA 1GUIA 4FX0A 1MBHA 2HDCA 2DU0A 5BNGA 1XCVA 4Q2FA 2VZQA 3FX3A 4M3CB 2WY8Q 1AL22 1P9QC 4CXFA 2XPVA 1X82A 2PN6A 4HVRA 2OF7A 3NQHA 4FE7A 4AU7A 4GALA 2WZR2 4LG0A 1J7KA 2IZWA 1ZZ8A 2KHMA 1RXFA 1PO22 1KDMA 3WEZA 1VBE3 3OTFA 2O5RA 3H9GA 5FZIA 5LA1A 1K5JA 4EJUA 1JZ2A 3S93A 1KS4A 3ESWB 4JBAA 1UL9A 4IEWA 4Q4X1 2DA6A 4FXGB 5F8PA 2HTSA 2VBPA 2X10A 1H2KA 2ZMNA 3IKVA 1WFXA 4WBBA 2L4MA 3WV6A 3HTSB 4U36A 3O8HA 3OB8A 4PSXA 1DBNA 3HDDA 3PURA 3TN91 4GMP0 1R4MB 5FQ0A 2E36A 1P2FA 3VDXA 1DQ5A 4GXOA 4UXAA 3SFZA 4M73A 3DEMA 4PUSA 1POV0 4LORA 3KSCA 3ZQHA 1FBQA 1XMXA 1YLFA 4E70A 4W65A 1MR5A 2FBKA 1KJLA 3MIBA 1NCRA 2F5DA 1YUDA 1NKGA 3PU3A 2R072 1JYNA 1K61A 3KX2A 1W9TA 2CW8A 1ETQA 1BBT2 3WHBA 3DPTA 3TGNA 1E3OC 4J1XA 2FDKA 5E79C 3JTGA 5C4XJ 1HLCA 3VKFC 4IE6A 4RSUA 5CFDC 5E3NA 3K51A 4Q4Y2 4BK5A 5F3GA 1F2NA 3OPWA 3POSA 3ZOIA 2D3RA 4HVOA 2XLGA 5E1RA 2R5ZB 1H9WA 2PMWB 4E7SA 3JRBA 4PIXA 2BNNA 3AJYA 2DPDA 3F72A 1R1A3 4QQLA 2WWSA 2E51A 4SBVA 3R0AA 2A5WA 3I97A 1HB1A 1YO8A 2XASA 3AP4A 2BVBA 1Y9GA 1HV1A 3ZXGA 5CQGA 4ZYHA 1OLQA 2G0EA 3D0JA 5FY9A 3UGFA 4AVBA 1D0XA 5HBAA 3IPVA 2P4EA 4ASMB 2XB6C 1YTYA 5F6KA 1FV3A 4Y5Z0 2YC4A 3ZYJB 4FCAA 5DD4A 1JYVA 4B43A 3CJTB 4M4RA 4DIQA 2KQRA 3AG3H 1QA6A 3H5NA 3B93A 4RM2A 3T5XA 4PI2A 3WGGA 4AUXA 4XSZF 4XOGA 5LB6A 4XF0A 1GZWB 3PIPF 1IRGA 3J80K 1QNYA 6PAXA 2DYCA 4CCNA 2R7RA 1MDMB 4UB6C 4YZ1A 1S55A 4A69C 4MYEA 4ASNA 1H4HA 3UKVA 1P4AA 5FYMA 3V0AA 3CCQI 4IV1C 1AR71 4C2TA 2XONA 4MHRA 1AHDP 4AVPA 3BR2A 1V6MA 3OMYA 2PFBA 5FK8A 4N9IA 3ZR8X 3W59A 1MMAA 1ND2B 3GHNA 4LE4A 4AOCA 5T55A 3GHMA 3M8EA 3QCWA 1JXSA 2DUPA 2IA0A 1D0ZA 1R71A 3UT0A 2WT1A 2BFUS 2ZHLA 2EA7A 3AP5A 5GAEJ 5FFOC 2CTVA 3T8TA 2VQTA 4MGZE 1DGRN 3F9KA 2HOAA 2DQLA 4LBKA 5H6RA 1HV0A 2ILMA 3BU0A 3VBFA 3KQ4B 2WAQA 4HNUA 2Q1MA 2KA3A 1EPZA 3BIEA 2QSGX 3T08A 2GC2A 3F23A 3IH3A 4BQAA 4HZFA 3MIHA 2RHPA 5F3EA 3H8RA 1RUD2 4CEYB 1KGSA 1XSQA 2W92A 2P2KA 2ZZQA 4KA4A 2V72A 3NNLA 3F6OA 3LSDA 2IT0A 3MLKA 5FPLA 3K1PA 2VOVA 4QM8A 4OI4A 3H3LA 3VKMA 3E0JB 2K9LA 4M00A 5FDBA 3QH6A 1VFCA 2ZGNA 4TTGA 4CCLA 2ERFA 3KT1A 5F7UA 3GGLA 4RLFA 2W4SA 2DFIA 1RUF1 3MIGA 4EQQA 3A1YA 5I0DA 3H7JA 1O57A 1RR8C 4BBRJ 1SFNA 4H2AA 2EZHA 4WVMB 4FO9A 1FP2A 4XONA 2GDFA 4AF9A 2ZXHA 2PHRA 1I1EA 4OMCA 3QACA 5AC91 2DFEA 1OH4A 3OGVA 3JRFA 4HQEA 3EBRA 3JQXA 1SBDA 3J8F2 2TRTA 1XMAA 2V6CA 3ATGA 1Z0XA 1XYNA 3QP5A 3KZIC 1JE8A 3FBMA 4CDQC 5JHUA 4O3MA 1WKMA 3IDAA 1LHUA 5AC93 2WADA 1JKRC 1K5MA 5M5WJ 1PHMA 2X4HA 3L2RA 1UCXA 3AMHA 2QZ3A 2RM21 4LTAA 4E7LA 4DZJA 2MEV1 4YFNF 1LOCA 1YYNA 3SISA 1VQ5I 5BNNC 3GM8A 1UMZA 2ECBA 2XSJC 3AZVA 5E18F 1CIYA 4RS5C 2RS53 4MHUA 4DYRA 1FYUA 4F83A 1ND2C 3GJAA 5K0UC 4PIZA 1ZREA 3KF3A 2MG4A 3MW4A 3ELNA 4AGGA 3HRSA 2ZGTA 5KHGA 2IGMA 3EUHA 3ZIWA 3RYPA 2CWMA 2YGLA 2RS32 1QWRA 5K1YA 4P9UA 1WJFA 4A5MA 2Y6FA 3S32A 2N8GA 3DBLB 3HVDA 5LBQA 2K3PA 1LEMA 1OVPA 5HLIA 3ZSEA 3QBQA 3A0HC 2VL4A 4LHNA 1TVGA 4XLNF 2TEPA 3RIRA 2Z5UA 1PZ7A 2DW4A 1DIWA 1HRI2 3K4CA 3U9GA 5FZ0A 3O3KA 1KYZA 2RC4A 4I6ZA 1TMF3 4U0VA 2XRLA 3GFJA 1IPSA 1LJ7A 5FKNA 1ZG3A 2EA4A 2RNGA 4XRSA 2DU9A 1W6PA 4UFKA 3S5QA 1ZQ3P 4GDFA 1LQ1A 2NS8A 4UB8C 3NRUA 2WNVB 4A6EA 5F0FA 2WQ4A 4OIRF 3AB0A 4HLXA 1MW7A 2XRNA 1ENSA 2QQJA 2ZNZA 4P9GA 2JSCA 3N9QA 3S16J 2Q8DA 1AKHB 2BBVA 3CCRI 3KP2A 1LHVA 4HF1A 2RG4A 1XOYA 3HKZN 4AEDA 4G9SB 4RHV1 3OIQA 5FO9B 4K2EA 4BWOA 3BU7A 3ZYHA 5B2GB 5LWBA 1Q8QA 1OOPA 1YHFA 5C3EJ 2OD5A 4HBLA 3J26N 3G71I 1T2XA 3RMYA 4EATA 4QDSA 3POBA 5AFBA 3V7RA 5HS9A 4IEJA 5FKLA 2Y48A 4BXFA 2E26A 4BQYA 1RXGA 3ECHA 2Z16A 3JRHA 1ETKA 3QOPA 4PDWC 1SBEA 4O9EA 3PTRB 1GU3A 3NV3A 2DVAA 4S2DA 2OC6A 2E32A 2ARAA 2M4KA 1RUC1 3SH3A 1VE0A 5DM6F 1LR5A 3W5NA 5B1AH 1QDOA 2UWMA 1P6RA 5JDBA 4AWXB 2DV9A 4Z2AA 4D5CA 4MZUA 4A3CJ 3UK9A 2HOEA 1NT0A 2ZPXA 3LCPA 1RJ7A 2J42A 4AWDA 3GNEA 3BTXA 1Z91A 5FPZA 3TBIA 5FJHA 3TKYA 4AHXA 3F8FA 3DPLC 4CZZA 1YJLA 4RFRB 3QU6A 3OYCA 2TCTA 3TAYA 3WE3A 2CG4A 1C5HA 4CDUA 3D4KA 5FZEA 5IVBA 4MGRA 5H2FC 3T8RA 2VE8A 3U4XA 1QJX3 1LOAA 2HKOA 2LREA 5HLGA 1GZCA 4QMAA 4HRIA 1BQPA 2DTYA 1JZ3A 4YFXF 2K9MA 3K4MA 3S2DJ 4HAMA 1MQTA 2RS12 2ZJRF 4NIGA 2JA8J 1EUTA 1WJ5A 4XQFA 2YUEA 1J3PA 1JTZX 1XRUA 1XNCA 1HXDA 1W4MA 1ULCA 3SEEA 5FZLA 3CJIC 2OBPA 3A4UA 4IE5A 5DZGA 2K5CA 1EV7A 4H0EA 2C4XA 1OCPA 3PUQA 2WAAA 4XMYA 1S6LA 4L5JA 4CDWC 3WQ0A 5CYVA 3CCUI 3IMNA 2CRGA 2X1CA 2EJRA 4GYIA 3H8OA 4C2MJ 4GFBA 3BOWA 3HOUJ 1JUSA 1RHI3 4LPLA 4RAZA 4W6YA 1LODA 4Y22A 1WA4A 2XGCA 3RJ2X 3VBFC 1ZM1A 4KT6A 5FV3A 4E4DX 3S2WA 2B39A 4U87A 3Q8AA 2L7KA 1VBE1 4UFLA 5GLWA 3E7LA 1J2XA 3AG4H 5FFXA 5HS8A 2VH9A 3AL5A 4FSJA 5A1FA 3A21A 1ZYRF 5IFTA 3IN9A 4LBLA 3I2FA 1NZCA 1BA5A 1SLLA 3RKYA 4B3XA 1QVUA 2IA1A 4NIIA 5FR3A 3SCGA 2ETEA 2ZMKA 2LTPA 1UPSA 2BUKA 4HLTA 4B1LA 4FOYA 2LROA 1QOTA 2W47A 3KEOA 2IXHA 3NARA 1CPMA 2YR2A 2P6CA 3PMEA 4RB0A 1S7EA 2H1LA 1ZZBA 2GQQA 3MW2A 5C4WA 3IWZA 3VDBA 2W84A 4N43C 1OKOA 2Z1DA 4M3CA 4RGKA 1EUUA 2YU1A 1JI8A 4CP9B 2Y26A 3FBIB 2MW8A 3CMAI 1FSHA 1FAYA 2IWGB 2ZX2A 4NC8A 4HN1A 5DG2A 4CUCA 1A3KA 4DXSA 4YW4A 2P7VB 4UHTA 1S2EA 3THPA 2VKHA 2J5OA 5AVPA 1EAH3 1HIXA 1KITA 2E35A 5LEJA 2ZA9A 4AEKA 4DY3A 5L9VA 2RQQA 3M8FA 2DJNA 3AP9A 4KNYA 3BALA 3PL0A 1EP0A 3LFIA 3BTYA 4YLZA 2OPKA 3ACHA 4C0HA 3WF4A 4ZU5A 2LUWA 1AR83 1I9RA 4HN0A 2XGEA 5FBJA 1EH7A 1EAH1 1FNNA 3ZIXA 2H0BA 1XYPA 5FLIA 5L3FA 3O1UA 2NVTJ 3COAC 2ZC2A 1I50J 1LESA 2WNEA 1KD7A 4EZ4A 1ZR2A 4Y20A 3BCBA 1YIFA 4MXWA 2OUHA 3ZN4A 3LFMA 4PFPA 1DYPA 1WLWA 2ATFA 2QQVA 3GDBA 1XNBA 5EV7A 3T30A 3WP3A 3O6BB 4LKSA 2JG9B 4HSJA 3E3VA 2XUBA 2WS91 4LLNA 4UVAA 5J3UA 4B4QA 1LB2A 2GMMA 2Y6HA 4MTEA 2ZKLA 2EINH 1RUJ2 5GLZA 3FLRA 3S5AA 1YJNI 3ZLIA 3N7LA 5EEAA 4PJYA 2AQEA 2XV4S 2L7MP 4LGWA 5B4NA 1RHI2 3LOCA 4LJZF 4EE2A 4Y33A 1W9SA 2CQKA 5FP3A 2L4AA 2WB1A 2XIGA 3IHUA 2Y0IA 2PAEA 5FP4A 1LEAA 2XJSA 1J5YA 2JN6A 1JUMA 5K0UA 2FE3A 2XPJA 1H88C 2WQZC 4N53B 4L11A 1KDKA 2J1UA 2DJIA 1UPIA 1NYWA 2JDYA 2R0FA 3BP8A 4IL6C 1BVP1 2PN5A 2FF4A 4G8XA 4PJJA 2O9LA 5E8IA 2XLAA 4KH9A 5FXXA 3WDXA 2NOJB 4YRDA 3ZXEA 2FMDA 3AL0C 4EN9B 4NNJA 1XXNA 1JXNA 4B3NA 1GXQA 3QPSA 5EYRA 3AYCA 1RUNA 3VBSA 2LNBA 2OUJA 2AXLA 4XQWA 2E1OA 1LRHA 5L7OB 2EICA 4XLAA 4IETA 4DW6A 2HWVA 3UR3C 1U78A 1HX6A 3TDZC 1DQ2A 3B00A 1URXA 2C0ZA 2VTXA 4RB2C 4LBJA 2W1OA 3DYOA 1VBD1 4BB3A 2HZDA 3TEWA 3RZHA 5HPOA 3UL2A 3CJNA 1ZRCA 3FMSA 1PVC1 5C3QA 1CVNA 1FOWA 1IN8A 2K46A 1TC3C 4Q1PA 3G6EI 2I5UA 5IK4A 5EYYA 1ETXA 2Y0SA 5CKTA 1FYMA 3WF2A 3W6KB 5B5EC 5A32B 2W9XA 3ECQA 4Y1UA 2LKXA 3KCCA 5AIQA 2Y2ZA 3ENRA 4QB1A 1QJFA 1YQ2A 1UYXA 4YG3A 1UY1A 1EPWA 3TO9A 5CISA 1VAKA 3BTAA 2O6GE 4YELA 4IGQA 1Z3XA 3OBTA 3I2DA 5LHIA 5ISLA 5DDGA 3BB6A 5FYCA 4A3IJ 1S2KA 2E1NA 4XUOA 3W9AA 3WP6A 3H0DA 4YFZA 1U9NA 3HM5A 2Y9YA 1HXS3 2NAZA 4NUBA 3GEZA 3U75A 1OI6A 4AAPA 3LAGA 4DMIA 3KYCB 5K0UB 2IP2A 4NHLA 4C90A 5FUNA 4HOOA 3ZSLA 1APNA 4LA3A 3VHRA 3OEBA 1YRNB 4IXLA 4CHUA 2X8KA 5A3MA 2WA3A 2LRPA 5DUKA 3CNAA 3ZFFA 5C4WB 1HW1A 3ZN6B 3V8JA 4C91A 4B3AA 5FP9A 2A71A 5HNHA 4OZXA 3AMPA 1RRJA 4Q4ZF 2XOMA 1KQ0A 4OMDA 4LOCA 1IAWA 3ZXAC 2NRAC 2KXLA 1Q1HA 2JDUA 3D6EA 2BYVE 1ZBE1 2MH2A 2RJLA 3WD5A 4XEZA 4AI0A 3NJVA 4XLPF 3PFYA 4XM3A 3IRQA 4IQJA 3M9AA 1E5IA 3VSLA 4AYBN 1F43A 1GV9A 3VYRB 4B7EA 1XPWA 4W97A 4NIHA 1JODA 1I27A 2WRAA 2F48A 4IKFA 1VPHA 3CDIA 4FPOB 1X58A 4CPBD 4UWDA 2D6NA 3P9CA 3BZ6A 4CU6A 4IV3A 5F5CA 4QXCA 5M3FJ 4N0BA 4M3CE 1X2MA 1WMDA 4FTHA 3KIOA 4BQ3A 2IXLA 3FKIJ 2NLRA 3CJQB 5L3EA 3T0YA 4S2GA 4K1ZA 3SQNA 3HIFA 5E8GA 1CAWB 2LF7A 2UY8A 3NAPC 1BL0A 5JAXA 3URFA 3MF9A 4Y5SA 1XE7A 3HJEA 1SEFA 5CG8A 3VDDB 4A3XA 4BBSJ 3A01B 4WWCA 4AZZA 4LBQD 1VR3A 3THDA 1K83J 1SDWA 4EJOA 1XDUA 1YWKA 1YW7A 5EG0B 1NQDA 3Q0WA 5EF6A 2X0LA 5FP7A 4H55A 4PGGA 2P3IA 4JV4A 3LEKA 3VB2A 1F15A 3OBAA 5K7HA 5FYSA 1LFUP 2FCTA 2KZGA 4ITCA 3N05A 4LKFA 2JT1A 1I1GA 4RQPC 2UURA 3DPRB 1QXJA 2FD5A 5TRDA 2A5ZA 4QQ2A 3WNKA 1GOFA 1EV12 4JQFA 4YW5A 3A4CA 5FLXK 5ED4A 2HDDA 4D0PA 3GLXA 4YVSB 2GIVA 4E6KG 2GU9A 4PDWB 2QZ8A 4HEA2 2EFWA 4HXCA 5IHRA 3NMBA 5I8YA 2RVCA 3ZOBA 2WO7A 1J59A 4EV0A 2BPA2 5FZ8A 2DA5A 2ZCWA 2ADUA 4YM1A 1FTZA 5JIUA 4WXCA 2MD5A 4OHXA 3RRDA 1BMV2 1KQ8A 3P9IA 1BC7C 5CEHA 4QQPA 3MZ8A 3ME2A 3OS1A 1Q1VA 2VBWA 2ZMLA 2H1KA 4UNOA 1ORKA 4UYBA 5C44J 4AEJA 1G3TA 1OT5A 4DINB 3NSTA 4HFSA 5F0CA 2PMUA 5BNOC 2DLLA 4BU2A 1I3AA 3KD4A 2JDPA 5ICCA 3MMYB 2XJVA 3BPVA 4AEDB 1W3VA 5A1AA 4L2NA 4I98B 2O8QA 5JSPA 1VBD2 3ABZA 5LK5A 3V4GA 3GCXA 3CP8A 2DMNA 4K6BA 2VZ3A 4IQPA 4QU2A 3LSGA 1LOEA 5CZKA 4AI3A 1XG1A 4RGSA 3GZUC 3GLLA 1JMUB 4AIHA 1NG0A 3VBHA 2QQBA 2SLIA 1NZIA 4OQ9A 4Y24A 1AR91 5FUPA 3ZN5A 4NN0A 3IL2A 4URTA 4L8QA 4HV6A 3PO3J 3QOEA 2FJ1A 1DDNA 4YVWC 5A7SA 4P02B 2FDIA 4LOSA 2VMDA 1PO12 2DBIA 5FY1A 1USSA 3RG0A 2MC4A 4FPLA 4MH0E 1ST8A 3PHMA 3ZCOA 1BJAA 4KDPA 5FGMA 2NZ9A 1NCQB 3M7GA 5FK7A 5C8CB 1B72B 3VODA 5FZ7A 5FZFA 4YZ4A 5BPIA 3PNTA 2DDAA 5GLUA 2KD7A 4CDXA 3LOBA 5F1RA 5CIRA 4FE4A 5JOZA 1AU7A 2XXZA 5FPAA 3IP4B 4BCUA 5EFUA 5A6YA 2MPFA 1RHI1 2OIIA 3HPNA 1YJKA 2OUMA 1S0IA 1LOFC 1UMQA 2X6YA 2MLKA 4P1WA 2LR8A 1C8M1 2X53S 4AR2A 1WD4A 2AO9A 2D3PA 2NQYA 2X1EA 3NNJA 1RB8G 3CZUA 3LSRA 1QXRA 3IB3A 1DP0A 3MDPA 4JGYC 1KYWA 5CBLA 3ZXJA 4B1RA 5LK7B 1KQRA 1WCSA 1GSLA 2HKXA 2EIBA 2FZ1A 1AXZA 1PP7U 4DXTA 4ENKA 4FETA 1K78A 1ZA7A 2ID6A 2BOIA 1VJ2A<