1ZRCA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 59
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrcA01
3FMRA 4UUVA 1K79A 2XL9A 1R36A 1JUHA 2HOEA 2P5LC 4AIJA 4WX9A 3CO2A 2I45A 4H7LA 3SCHA 4AVCA 4RS8A 3KGLA 1FT9A 5I8YA 2A6HF 2ZMEB 1ZZCA 2M1BA 4XSXF 3GEZA 2OA2A 2VPVA 4U0YA 2GAUA 3EQEA 3TNQA 2EJRA 3TKYA 3JSPA 1CAXA 5LGUA 3DKWA 4HYEA 5CLSA 3SZTA 4UNOA 1XCBA 4GULA 1OYWA 3U0ZA 3WGHA 4MGZE 1IRGA 5FLXK 2BNNA 1UHMA 3T0YA 2PMHA 3BJAA 5T3NA 3VHRA 5K5OA 2VE9A 3F21A 3O2PE 3TOAA 1YLLA 1FSEA 3LOIA 2Q0OA 1ZRDA 3I53A 2VBYA 1IF1A 5DUIA 4Y13A 2F4PA 2IC1A 2YX4A 4LLOA 3I54A 4JQFA 2OPKA 2DO7A 3HQXA 3H7YA 4NHJA 4MEYF 4M73A 1KU2A 2MHFA 4UVBA 2E1CA 4B09A 4KU8A 4MNUA 2QNKA 1SD5A 1BI3A 5J8FA 1Y9QA 2F5CA 2V09A 3PNAA 3DV8A 3COAC 2IXLA 1MZBA 2A6EF 4FAGA 2TDXA 3HHGA 3M8EA 4YG2F 1RTVA 5BUVA 2QUFA 1R5GA 1ZX5A 1YTYA 3V7RA 2VOPA 4U0WA 2DPDA 4XETA 3LSTA 5LHGA 2HYFA 1YFHA 2IW5A 1RL3A 1IXRC 2DPUA 4HLTA 3R0AA 4GXOA 3H1MA 2BBYA 4GGGA 5KHGA 2NNNA 1EYBA 2NNYA 2R3SA 4ENMA 2FXAA 1P4WA 3I58A 3SQNA 4HDUA 4OIPF 4U7DA 1LQ1A 1NHAA 3WE2A 5JSOA 4CYDA 4Q48A 5D8LB 1Z6RA 3OV8A 1A04A 1H1IA 1WLTA 4PIZA 5AONA 3R4KA 3IRQA 3IRRA 1IAWA 5D1IA 3E6DA 4AVAA 5LRRA 2D45A 4QM9A 4XF1A 1WI9A 2FNAA 2UXNA 3MQ0A 3WG9A 1G3TA 2P5KA 1UFMA 1ZRRA 4KMFA 1F1ZA 2VODA 1OMIA 5ILUA 4L5IA 1U78A 5FLXZ 3G73A 1Y3TA 2ET1A 3WTVC 3ECOA 4ESFA 3BY6A 2OQGA 3UKTA 4KMUX 4HN1A 3LA3A 3EHKA 6PAXA 1ZRCA 2PYTA 1Z9CA 2PAKA 3KGZA 1F4KA 3OF1A 2ZFWA 1TLHB 4UVCA 3SFZA 1R5HA 2ATFA 4IEQA 1Z7UA 5JSRA 4M6XA 2B8MA 3CTAA 2F2EA 2A07F 4KU7A 1ZN2A 3CO6C 1G6NA 1FWZA 1IZ1A 2K4BA 5H6RA 4ESJA 1TNSA 5BPDA 1SFNA 3PLQA 1BI2A 5F6FA 3E6BA 2M45A 2FQPA 4A0YA 3M8FA 1YIOA 3KP6A 3CL1A 4EGYA 2W25A 1YWKA 5D5XB 3I59B 1MDMA 3GZ6A 4G94A 4E2GA 3JW4A 3ABTA 2PEXA 4MQ9F 1TNTA 5ERIA 5LBQA 4O5VA 2VC0A 2A5YB 2DK5A 4M9ZA 3I59A 5JAXA 4NQWA 4KN7X 4UVAA 4KIBA 5J8CA 1SEFA 4XSZF 4QGLA 2K86A 4MGKE 4E2SA 2V6CA 1R23A 5H20A 5DUKA 3ELKA 4M74A 5JFRA 1QZYA 1FYMA 1D8JA 4L9TA 4BHPA 2CSOA 3RYKA 2EA4A 5LRSA 3KLNA 4EJOA 3RPUA 3SXYA 5HS8A 4EGZA 5FQ0B 2Z9OA 1FY7A 4D0PA 1LDDA 3R6SA 1EH8A 5E1WA 3TO6A 3WU0A 1YLFA 2CV6A 4OIQF 4OFGA 2FBIA 2GWRA 2PQ8A 5FQ0A 2XAQA 1W4MA 1SD4A 2PG4A 1UD1A 2PHDA 3ELNA 2VE8A 2WV0A 4TLFA 1TQMA 2RKHA 2XV4S 5JR3A 5EFUA 1SD7A 1XD7A 2IA0A 3Q5FA 4HA8A 2E7WA 1Z1DA 2HKOA 4MV2A 3NSTA 3I4PA 4ZH4F 3N4MA 1Q1HA 2FNPA 3IC7A 1PP8F 2ETEA 2DT5A 3D0SA 2O8QA 1XMKA 4CDGA 4BHBA 5HDGA 5HS9A 2XAJA 4I01A 3RNSA 2HTSA 4DINB 2D5FA 5A2QK 1QBJA 4Q0SA 3MAJA 5CVRA 3V8LA 3HOTA 5TJJA 2A3SA 1O5LA 1XSXA 4CICA 3EDPA 5I0UA 4HVOA 3E5QA 1HXDA 4YFNF 4OLLA 1ZGJA 4FT8A 4AVPA 4IJAA 2CAVA 1NYWA 1JHFA 1FXZA 3FZVA 1I27A 2V79A 3ZMDA 4AVBA 2QJVA 2HKXA 4PGHA 3J7AO 4WBBA 2JZYA 1J58A 1FOKA 4Z2YA 3QOPA 1UB9A 3WW4A 3P9CA 1MJBA 2KXLA 4MGRA 5KHIA 3FXUA 2GC0A 2J5OA 2ZJ2A 3F3XA 1CAVB 4Q0VA 3GUDA 4KDPA 2B9UA 1ON2A 4QMAA 1DP7P 2ISZA 3BPVA 1BIBA 2RDPA 3IWFA 2XLAA 1VP6A 2FBKA 5ICEA 3K69A 4Q29A 4LK0F 2HEOA 5EZWA 4RGSA 1IUYA 1YHFA 2OAZA 2FF4A 4KIGA 5E1RA 1PP7U 4S05A 4HQMA 4AD9A 2ESHA 3I0TA 4OOIA 4LLGF 2V9VA 1OYIA 3ZMVA 2YX7A 3REOA 2IXCA 5FD6A 1J3QA 4YYOA 4JVAA 3MZYA 1CF7B 5I0TA 1DPUA 2BV6A 1VTNC 1BC8C 5DCMA 1H1MA 2YR2A 2GQQA 3OOPA 3FM5A 1WGPA 2NRAC 2G7UA 3F6OA 1ZLKA 3WGIA 1X3UA 1RIOH 5BS6A 5L3EA 1CF7A 3LFKA 1YFXA 5FB2A 3SMHA 4G6QA 2IA1A 1LEAA 4ORFA 3SCFA 4B29A 4IEZA 3C18A 4OMYA 3BPZA 3LQQA 3C7JA 5JR7B 3ST7A 3T8RA 4WCGA 3GBFA 3GVAA 5HLGA 1BI0A 5A2QZ 3ZMSA 1Z91A 2UXXA 3HIFA 1X7NA 1O5UA 4XF0A 1K7AA 1KU9A 3IIAA 1YO5C 3NQOA 3H50A 5CVIA 4FHTA 5AIPA 2LKPA 4L5JA 3KETA 2DTRA 1RUNA 1HKSA 3K0LA 1FYKA 4O3MA 1K78B 1FX7A 4JV4A 2EV5A 4MGYE 4UV9A 2RQPA 1U8RA 1BJAA 3DPTA 3RTRA 1E17A 2FU4A 1ON1A 4MH0E 1FBSA 5C6CA 4EJUA 3QU3A 1K78A 4XLNF 3H3UA 2UY8A 3BJ6A 1W7PD 3T8TA 4IRGA 1V3FA 1ZGAA 4HLYA 4UHTA 4CO8A 4A5MA 2CW0F 3PVBB 4L0ZB 5HDKA 4KICA 1FLIA 3TDZC 2KIMA 4LTAA 1BBYA 2CGPA 4BAYA 4AIHA 4HVQA 5L3DA 4MQVA 1QZZA 3V4GA 2EFNA 1MKMA 3MPBA 5KHKA 3H1YA 2V1UA 4R52A 5BOXA 2ETHA 2DW4A 3AAFA 1UPIA 4L9VA 3GLXA 5E20A 2PAMA 2FSWA 4HSLA 4ESBA 1EH7A 1LVAA 4KUMA 4XFIA 5ICGA 1T98A 3DXJF 1EP0A 1YFUA 2Z69A 3F22A 3RKYA 3V8KA 1KQ8A 2P6SA 3S7EA 1QXRA 4YARA 3HHHA 3GZ5A 2VONA 4PIYA 4MUVA 4PJYA 4L9JA 4ZYHA 3OD0A 4LEJA 4WXCA 2Q1ZB 3BOQA 1X8EA 2FBHA 2XAHA 1ZZ8A 5KVRA 1BN5A 1O57A 5FPZA 2GZWA 4FAHA 4AQ6A 5FD5A 3ZP5A 2IRFG 1J1LA 2L4MA 4LB5A 4EM2A 2OD5A 2QQBA 3L00A 1ZVFA 2ZMEA 1W5SA 5LLQA 2IP2A 4QGNA 2HJIA 5HLHA 1Y0UA 3F23A 4KIFA 3HUGA 2UYBA 2PBIA 2PFWA 2Y48A 2WFPA 3QPHA 2CQKA 5L3BA 4A2UA 3D0JA 1ZG3A 1ZH5A 2XAGA 2L3DA 4U88A 3FM3A 1XE8A 3WW3A 4HQEA 2HYGD 2L4AA 4M72A 4WK8F 4BNCA 4QXKA 5FLIA 4OIOF 5D8KB 2KJBA 5FLHA 1WSUA 2Z3YA 1TW2A 1TBXA 1BOAA 2GA1A 2EAAA 3K1NA 4I98B 3KSCA 2YSRA 5L3CA 2QCSB 5FCCA 4Q0QA 1UW8A 2UYAA 4META 3IKVA 5FPXA 5J3UA 3LQRA 4CXFA 5E17F 4AWXB 4XBFA 4NB5A 3QAHA 4D7TA 1TQIA 4JK1X 2OZ6A 1C0WA 3BP8A 2JSCA 1ZREA 4ENNA 4HF1A 2PA7A 4IETA 3NRVA 1NZCA 2XUBA 3GFLA 4BQAA 2DAOA 5F64A 2K0GA 5E1ZB 2RC4A 3NW4A 3KCCA 2PI0A 4RB1A 2Z33A 2GC1A 4HF0A 2DLLA 2PMUA 5K5QA 1G3SA 2N7GA 2Q4SA 3J81K 2XASA 4IVNA 3J80K 1FBQA 4HLXA 3HOSA 4I0AA 3JTGA 1QWRA 4IEYA 3E97A 1R7JA 4GYIA 5C8WA 3TGNA 2HTJA 1HBXG 4XRFA 4MTEA 2EFOA 1K6OA 1J0RA 5AVPA 3LAJA 4H0EA 5CADA 1D5VA 2FEZA 4IEXA 1MJ9A 3W6JB 5DV5A 3CEWA 4HV6A 5DDGA 1XMAA 4J1XA 2HFHA 5KK1A 4FX4A 3IDBB 1OI6A 2HWVA 2V1DA 4Y17A 3ML6A 5DD8A 4KFCA 1B4AA 3GYDA 3F8MA 3CJXA 1QNTA 4M71A 2EFWA 2IXKA 4RGRA 1O7LA 1KA8A 3QU6A 3UKVA 4ZYDA 4Q4ZF 2Y0MA 1SD6A 3HSEA 1TTYA 2R7FA 5DD4A 3QRFF 4I02A 2X0LA 5CJ9A 2JPBA 3KLOA 1EV7A 1O3TA 2STTA 3NKTA 3ROUA 4GYGA 2F5EA 4HX7A 3LAGA 1W5TA 1R1UA 3RPQA 4IERA 1S7AA 3F8CA 4EV0A 4YNIA 3MWMA 4IXAA 1SMTA 1UHWA 3L7WA 1U5TB 1L0OC 3ZN1A 4ZU7A 2QQAA 4XFBA 1YQAA 1PUEE 4CZZA 2D93A 3CO7C 1R58A 1YW9A 4WWCA 4QGMA 2KIFA 3ZMTA 3ZMUA 1XGOA 2MPFA 5D4RA 1F9NA 2E7XA 2ZO4A 4CGZA 2IPQX 1XDUA 4RB3C 2O61A 4UV8A 1LKNA 2IT0A 3SXWA 2D1HA 4U7BA 1S3JA 1HSJA 5KBFA 2W57A 3KP3A 2ET7A 3L09A 3J81Z 2L01A 1S8NA 5K1YA 3J80Z 1ZG5A 4F8AA 3MFKA 3RDIA 1ZZ6A 5JVTA 5BPXA 3RKXA 3ZMZA 5LEJA 1RC6A 5HS7A 3O6BB 4R8HA 3D82A 3SHRA 1MD0A 1ONVA 1IN8A 2NAZA 3EQLF 3HRTA 2H6BA 1USTA 3M3IA 2P6TA 3LWFA 1P4AA 2PAEA 2MLGA 2ACJA 2GXGA 2LDUA 1WQ2A 4G7ZF 2VN2A 4MX3A 3U9GA 1W7PB 1XSVA 3VFZA 4QX5A 2QENA 5HI0A 2MH2A 4LK1F 4I0BA 3K2ZA 1LJ9A 3KEOA 2ZNYA 1YYVA 4PCQA 4HN0A 2PHLA 3P9KA 3QP5A 1L3JA 1W7PA 2IXJA 4KWJA 2HS5A 3KFWX 3GF2A 2QDRA 1LR5A 2ESNA 4G9YA 2IA2A 4P9FA 2Y75A 1HKTA 2VECA 3HSRA 3KMHA 3TNPB 3WW2A 1IRFA 3U2RA 3HTUA 1FBUA 1I1GA 4IEPA 3DQVC 3V7SA 1DZRA 1HQCA 1J7KA 4UBGA 1KYWA 3KP7A 3GFJA 3IHUA 3LA7A 4IEVA 1IPKA 4EVIA 2VT3A 1FP2A 2K27A 3H3ZA 1I5ZA 2LNBA 2D1VA 4BYYA 2P7VB 2L02A 1OPCA 4UXNA 1EH6A 2LF7A 2M5WA 5D5WB 5CVVA 3BCWA 5HLIA 5BXXA 3HRUA 2L54A 1XRUA 4Z82A 2QYOA 3DP7A 1FYLA 2IXHA 3E5XA 3N97A 2PLYA 4O9GA 3V7CA 4A5NA 3CF6E 4XFGA 3WTSC 3IWZA 3Q9SA 3W6KB 1Q43A 1QQIA 4HF2A 1CAUB 1DUXC 1R22A 3JAMK 1ZG1A 4XF4A 1IW7F 2FOKA 4K8FA 2DQRA 3DEUA 4M9XA 1ZZ7A 5ICFA 4MZUA 2DI3A 2EV0A 1CAVA 4P96A 4LA2A 3CUQC 1XN7A 1CAUA 1AOYA 3HSFA 1T38A 3BB6A 1G4DA 2VBXA 2LSOA 4XFHA 3GXOA 4U0VA 4ETSA 2E9QA 5CVUA 1BC7C 3LA2A 1FPQA 2UWMA 1YW7A 2D2WA 4BH9A 4EM1A 1SFEA 4BIFA 2Q0AA 2PJPA 3L2HA 2EA2A 4KL1A 2H27A 3H92A 4EROA 2ELHA 2BYVE 4Q5SF 4RB2C 5FDBA 2ZXJA 4YFXF 1D3YA 1RI7A 3QACA 4JBAA 4EWAA 2GC2A 1RUOA 5EEHA 4M9SA 5DEQA 1JHHA 5FGMA 3FMSA 1DPRA 1IN4A 3FF5A 5ED4A 2KIUA 2PQQA 1ODDA 2EFQA 4JTNA 4P9UA 4RGXA 5JI6A 3IDCB 2JT1A 2R7DA 3R61A 3U11A 1T2KA 1H9GA 2RNJA 2M87A 3EUHA 3V8JA 1R1TA 3KE2A 4A6DA 3L2CA 1U3EM 4G6DA 4HOBA 2MA3A 2X4HA 1F5TA 2XROA 4E2QA 2ZBKA 4OINF 1FSHA 1BI1A 3KEQA 2CG4A 4YFKF 3F72A 3F8BA 4DNCA 2G7HA 3LAPA 1GQGA 3ES4A 1HSTA 2XVCA 3ULQB 1H9TA 4X6QB 1XE7A 4O9EA 1HW5A 4P9GA 2NYXA 1XB4A 1J59A 4WF2A 4XFCA 3E6CC 2JTVA 2EK5A 2QQ9A 2XAFA 3ACLA 3PFIA 3GWZA 3CUQB 2DQLA 3FFQA 3IBMA 2M30A 2RGVA 1DZTA 3BJOA 2O1QA 3T5XA 4ENKA 4ZZDA 3FHZA 2ZKZA 1T6SA 5E16A 1JE8A 3RYRA 4EWEA 3JAMZ 2CYYA 3VEPA 4AQ2A 1SFXA 3CUQA 3NL1A 2BNMA 3WE3A 4ASNA 3BALA 2BNOA 1I1SA 4IRIA 4ZU5A 2Q2EA 3WTZA 2QVOA 2H94A 2GC3A 5HOOA 1R00A 1QPMA 2VC1A 2QBYB 4TV7A 3TO9A 3H9AA 4GO1A 4DQ2A 3RZZA 5I8TA 4LLNA 2DFIA 1FC3A 1LNWA 3MEXA 4Y15A 2UY9A 2O03A 1PDNC 3KP5A 3E3VA 4ZZLA 1KQ9A 4JTOA 2QBYA 1YS6A 4ON0A 3HT2A 1FZPB 5BV6A 2GA2A 2HDCA 3H8UA 2DU9A 1TQ5A 4XFAA 2WWYA 2DCTA 2WTEA 1ZZBA 3OCPA 5BMZA 1J9IA 1ZNPA 3GW2A 4RGUA 3L9FA 5BPIA 2KRFA 3DFGA 4LG0B 5D6FA 1XGSA 4Z07A 1DDNA 2BGCA 3PQKA 3KZZA 1NE4A 5FLJA 2JPCA 1S29A 3QPTA 4RD7A 3KP4A 4LG0A 1CAWB 4A6EA 3CUOA 3I64A 3WU1B 2MD5A 2MH9A 2V1XA 1FNNA 4A12A 1CX4A 5CYVA 3LZZA 1CAXB 4AIKA 4MEXF 1CAWA 3RI4A 3C1DA 3MDPA 1O4TA 3K1PA 1AWCA 3HRSA 3PQJA 4AXOA 1ZAOA 5E18F 2QVSB 3VOEA 4LULA 4RAYA 2P5VA 2OZJA 2QLZA 4UBHA 3GX4X 5FFXA 5BY5A 2CAUA 3IL2A 1R1VA 4KA4A 3FX3A 4L9NA 1O7FA 1ZYRF 4QWQA 1XCVA 2EWNA 2ISYA 1G3YA 2QM3A 1UIKA 4HVRA 4LGWA 2Q30A 4PGGA 4HSJA 1S6LA 2QWWA 4R79A 2ZNZA 3FXRA 4I09A 4Q0PA 2K9ZA 1P92A 4XLPF 3R0JA 1Q5OA 3JZVA 3NEUA 4IESA 3TDUC 4KYWA 2LF8A 3BROA 2VOOA 4IEUA 4HBNA 1PMIA 4RAZA 1IXSB 3HTSB 3VB2A 3BU7A 3P9IA 1PM7A 4P55A 2H09A 3SCGA 1YFWA 1U5TC 3BDDA 1T0FA 1CGPA 2VBZA 3M1EA 1WKMA 4HBLA 1BM9A 5J6XA 3LWCA 2VT2A 1G3WA 3HRMA 2NS0A 4XF9A 4HX4A 3IKTA 1LRHA 1VR3A 4HMZA 1DGRA 3RKWA 4A0XA 4K2EA 4ENJA 3M70A 4G8XA 2OA4A 1ZLJA 4YRDA 2FA5A 3D5LA 4EM0B 1O3QA 1D8KA 3ZPLA 3JTHA 2OYZA 2O0YA 4MTDA 3E5UA 5IT9K 1GHCA 4KWLA 2E1NA 4E70A 2PTMA 3HYIA 2FE3A 3TO7A 4G7HF 2XLGA 3G7DA 5L3FA 2FRHA 4P5OA 4UXAA 1O3RA 2MLKA 3JSOA 2B5HA 2KKOA 3ECHA 1IN6A 5H6QA 1JXSA 4G7OF 2P17A 1LB2A 3DF8A 2GXBA 2XHKA 1P4XA 1QXJA 1ZZ9A 2C0ZA 4KWKA 3S7IA 3I71A 1LEBA 1HKQA 1RGSA 4ZYGA 2ADUA 5AIQA 1J5YA 2H6CA 5CVJA 4L11A 3F8FA 2DK8A 4OIRF 1VJ2A 2C6YA 2FMLA 2AXLA 2K7LA 4GCVA 1U12A 2XLFA 2O3FA 2UZKA 1JGSA 1QGPA 5KHJA 1H0MA 4EJWA 3OTFA 1NXMA 3CLPA 1B6AA 1P6RA 1TQPA 3O3KA 4HX8A 1WWXA 4M6YA 4L2NA 4LUKA 3CDHA 1U5TA 1UCXA 4BHCA 2GIVA 4WVZA 3EETA 1YFYA 3TQNA 5D4SA 3WGGA 3B02A 1MDMB 4HDVA 2VXZA 3FXQA 1OYYA 2XRNA 2P8TA 2O8XA 1X8MA 1B1BA 2P7CB 1T39A 5JHUA 3DPLC 1J75A 2OZUA 4PIXA 4L0YB 3WW1A 1XDSA 5LHHA 4EJTA 1MJAA 4FX0A 3ERED 1KU3A 1V4RA 1YW8A 4KNYA 4ZU4A 1XGNA 1WRJA 1I6XA 4OMZA 2P4WA 5IT9Z 2MC3A 3WODF 2RV8A 4HV5A 3RIRA 4IHSA 4YIFA 2VQAA 1Z05A 3KZYA 4N9IA 5LGNA 3H1WA 2Z5UA 2IXIA 2F5FA 5L3GA 3GYHX 1P2FA 2HQNA 3ISPA 4X6RB 3S0MA 3WTWC 1Z6TA 3MCZA 1EY2A 1KU7A 2HR3A 3NVCA 3F6VA 1RNLA 1J2XA 2K4JA 3U1DA 2ZCWA 4QLCU 1YS7A 5BQTA 2XKOA 1RZ4A 5DCFA 1SFUA 4IHTA 5JCTA 5I93A 1XSDA 4ZYEA 3O14A 2O6GE 4EMSA 1B9MA 1YG2A 1GXPA 5I0RA 3T1BA 2EB7A 3FE5A 3BPXA 4HW0A 1FP1D 5ILSA 3ZDSA 1E2XA 5E8IA 3FHIB 5HVQC 1L3LA 3WTTC 4IEWA 2HGCA 4I3PA 1ZRFA 1X82A 1UIJA 3KP2A 1B59A 1EPZA 5ILVA 1XGMA 4LB6B 2XIGA 3QP6A 4LMYA 4EJVA 1U2WA 5HDNA 4YIIA 4N9HA 2D5HA 5K8SA 1GQHA 2YU3A 1V70A 1J3PA 1OKRA 4B8XA 3WTYC 4IEOA 3GO5A 4ONUA 5I91A 3K1MA 3RYPA 4KT5C 2MBFA 2A69F 4MHGA 4L18B 5D5VB 2PN6A 3M7GA 2GH2A 3FJSA 1KGSA 3P7NA 1Q3EA 3EJKA 4LUMA 4WXDA 5EEGA 3GFIA 3R60A 1DGWA 3I7DA 2FQ3A 1MGTA 1NE6A 2K02A 2A61A 3CJNA 2OBPA 2AS5F 1HW2A 2FMYA 3USSA 2J5PA 2WC2A 3ABUA 2XKPA 2Y0OA 2CO5A 2BEOA 5I8SA 1HW1A 4HZFA 2W85A 4IPAA 5E1XA 2EV6A 1BIAA 5DCMB 2RVCA 4YSFA 4BXUA 2XL7A 5J7MA 3WTXC 1REPC 5IT3A 2CFXA 4PZJA 4A0ZA 5E8GA 2STWA 5LEKA 1KQ0A 3EO6A 3FZ3A 4I2OA 1SQ4A 1IN7A 4IRHA 1U6GA 5I0SA 2MNGA 2W24A 1B9NA 4O6JA 3Q9VA 3HT1A 1GXQA 2Z2SB 3NJZA 1FI2A 4EWDA 3S2WA 1OD5A 4QM8A 5TRDA 1LDJA 3GFMA 2HZTA 4LFUA 5K5RA 1O3SA 4XF3A 3I5UA 3DN7A 5LHIA 5KHHA 4LLLA 2IVMA 3G3ZA 3C3WA 1IN5A 4OU0A 5FO5A 3ZN0A 4S04A 5DYMA 1YUDA 2DBBA 2ZKLA 4WZCA 4MGIE 2OQRA 5D5UB 4KN4X 2COMA 4XFFA 3B73A 1STZA 3BWGA 2EFPA 3BZ6A 1S7OA 2PFBA 3SZPA 3FMQA 2VBWA 3EBRA 2B0LA 2A68F 5FFZA 2YPRA 2CWEA 3SHFA 5LGTA 5ICCA 3RJPA 3WTUC 4XEZA 3MYXA 2JRTA 3ZQ7A 2OU2A 2Z99A 4CHUA 4EQQA 1IPJA 1J3RA 1SMYF 2Q8KA 2W84A 3K9TA 4IF4A 3E6MA 4LA3A 4N0BA 5D6EA 2D40A 3ES1A 3FWEA 2GU9A 2G9WA 2F5DA 1QO0D 3ETQA 3EYIA 1ZARA 3H7JA 2IJLA 1GVJA 4WXHA 1QY4A 1TW3A 1OFNA 5CU1A 4J1WA 3CLOA 1OR7A 2QZ8A 4F7ZA 4HAMA 5F1RA 3OGJA 2M8EA 4NVPA 2HQRA 3EYYA 1USSA 2RN7A 1ULYA 4LD5A 4PDKA 4LJZF 4Q47A 4FBFA 3VODA 3TOBA 3C3VA 3F8NA 2H0VA 1SAXA 3UKNA 5J48A 1WA4A 4R1HA 2XGXA 4I7HA 1KYZA 2BE5F 3MZHA 4D7SA 3U10A 4Q0UA 1IXCA 3M9AA 2EA7A 2KJCA 5JSPA 3DL3A 2EVXA 1ZHFA 1UCRA 1LDKB 4RB0A
chains in the Genus database with same CATH superfamily
2YXSA 3SNMA 2ID4A 1R36A 4RS5A 4UAPA 1VRH1 1VBC3 2HOEA 2P5LC 2IS4A 4AIJA 3WHUA 4WX9A 4QDRA 2E34A 1JZ3A 5I8YA 5FY9A 3VKLA 5AC91 2OKXA 3J7LA 1SFKA 2OA2A 4UOJA 4CUGA 4U0YA 4BY1J 2DVDA 3TNQA 3S5AA 1K83J 2C9KA 2G19A 3TKYA 2BRTA 5LGUA 2WFF2 2OJED 3PJYA 5CLSA 1T8IA 1O6UA 1XCBA 1XS9A 3M4FA 1AXYA 1C4RA 3TL4X 1IRGA 1UHMA 4W6YA 2R062 3CZUA 4KH9A 2PMHA 3H5RA 4IDZA 5CEHA 5K5OA 1FSEA 1RJ7A 3I53A 2P3IA 3L2RA 2CWSA 1JOPA 2DO7A 4RFRB 3HBKA 4FTSA 2AEYA 5KC5A 2JUCA 2E1CA 1IGNA 5FYBA 1LFPA 1VQ4I 4BUPA 1Y9QA 2RE9A 2F5CA 2ZEYA 5KXDA 3COAC 1LOFC 3VL9A 2A6EF 3HHGA 3DWLE 4YG2F 3CJTB 5SV8A 3HOWJ 1QQP3 4RN5A 1SVLA 2VOKA 5IFPA 2BY2A 5DUVA 1V6LA 3U37A 2Y34A 3R0AA 2YU2A 4RHV1 4K7JA 1SG3A 2QQNA 4FPFA 2BBYA 1TC3C 4EEFG 4D7NA 2QFEA 4S2GA 5H9QA 1ZR4A 1U9NA 2YPDA 2R063 4B43A 4DRRA 1QA6A 3SQNA 3I58A 3ZPOA 4URTA 3CJIB 2O0OA 3AG2H 4DEQA 4Q48A 3TEYA 5D8LB 4AFBA 1Z6RA 4N7UA 4PIZA 1WLTA 5AONA 4XUQA 1CJPA 5D1IA 4AVAA 5FY0A 2R5YB 3ASOH 3SEZA 4QM9A 4XF1A 2FNAA 2UXNA 1ND2C 3N7MA 1TZLA 1Z7S2 1BK0A 3LKJA 5EWSA 4CPBA 2Z16A 5C3EJ 4BQ2A 5M3MJ 4DRVA 3RG0A 5FLXZ 2ENRA 4JCKA 1QH6A 2ET1A 3WTVC 4EQVA 5DZGA 4ESFA 3J7MA 3E0JB 3MLJA 1RIRA 1VBE2 3UKTA 4CTEA 1Y7BA 4H14A 3AYAA 3JUUA 6PAXA 1J84A 1H2KA 4D5CA 1U5YA 3WG2A 2G9FA 1C5IA 2PYTA 2E71A 1Z9CA 1NK3P 2LKXA 2CNAA 4XN3A 1RMU2 4Y20A 5IK8A 1TLHB 1UPSA 5FK8A 1N25A 4A7KA 2IVIB 3ONQA 1LOFA 3DEMA 4M6XA 2F2EA 1NY72 5F6KA 3D5OA 5H6RA 4ESJA 2O9LA 4KBZA 2QF7A 2GP3A 3M8FA 3KP6A 4EGYA 1GWKA 3FN9A 4AI9A 4RL7A 4E2GA 4MGSA 1HRV2 2WN3A 2B63J 4WM7B 2ADDA 2RS11 1GR3A 5AFBA 2A5YB 3PUQA 3I59A 2YFZA 4B47A 4OHZA 3CCLI 4YW2A 3NNFA 5FXZA 5J8CA 1JU4A 3OBZA 2BVBA 4QGLA 4FPKA 1ND2A 2BY0A 5DUKA 3ELKA 3DBRB 1QZYA 1W8UA 3ZSJA 2XB6C 1Y8QB 3H5AA 2XQXA 1RMU3 5HS8A 4EGZA 5A3NA 1MIJA 1CD3G 1WMDA 1LDDA 4IXLA 1YLFA 1FMWA 3RJRA 4NC6A 5CKMA 5KNLA 5CBLA 3CD6I 1E3OC 4ZTJA 1FOD2 1UD1A 4CU7A 4NRQA 2VW1A 2AZ5A 3ELNA 1W8FA 1X33A 1SD7A 4CDWC 2V4JC 1MMSA 3OL3A 3NSTA 4DZPA 1SFYA 1PUFB 3IC7A 3UGGA 2P37A 1HRV3 2O8QA 3UGFA 2VJIA 4FASD 5HDGA 4QPIA 2F6CA 5HS9A 2XAJA 4I01A 5FP9A 5A2QK 2KDZA 4IV1B 4TWTA 3HOTA 1VE0A 2JECA 4HL0A 2OTLI 3MMYB 1V9U1 3JB8A 5L7OA 3E5QA 5CISA 3VV1A 1QDCA 3G6EI 4AAXA 4BGDA 3JB4C 1DYOA 3GTOJ 1C1FA 2BVMA 1I27A 2V79A 4Q4V1 1YRNB 1LTEA 5D8AB 4PUSA 5C3OA 1W8ZA 4WBBA 2WAFA 2JZYA 3VBUB 3QOPA 3DTEA 2D7FA 4L97A 4KISA 3P9CA 1XNTA 1DG6A 3HBZA 1PZ9A 1PGW1 1P8JA 1FOD3 1CAVB 2IBDA 3APBA 1DQUA 3ASIA 2P81A 3OS0A 3O7OA 4PF5A 1NUKA 2XLAA 4CEWC 1VP6A 3WUDA 4X8NA 1MBEA 1RVF1 2IZWA 2RM23 4MGTA 2DUPA 5EZWA 4LBQB 1FAYA 4P5YA 1WJBA 4S05A 1JYNA 3B7MA 1JOJA 5EDNA 1R71A 1S1AA 2IXCA 2HU9A 2NPIA 5FKMA 4JVAA 5I0TA 2ORZA 3DYMA 4CDWA 2BV6A 3S17J 1NAEA 4ATFA 4Q4W1 2D5VA 1WW5A 4N43B 3GHNA 3IZOA 4ZONA 2WNEA 4W4ZA 2YR2A 2G7UA 3NV1A 3HD8B 4YZ3A 5ERLA 1RIOH 3KZIC 1CF7A 2QA4I 1F35A 4XDQA 4JP0A 4ORFA 3CC7I 2W46A 2C9AA 4HKWA 3C18A 5IVYA 3ST7A 2Y38A 5LATA 4WCGA 5DABA 4UUTA 4IE4A 2JD4A 3A0KA 4FPCA 3GVAA 2YV8A 3ZMSA 1Z91A 2ID3A 2ZJCA 4YW4A 4PI2A 4A4AA 4XJ8A 4B4QA 5A7PA 2XSJC 4ASMB 1QU0A 2LKPA 4UW5A 4Q8KA 5FRNA 2DTRA 4RA0A 1RUNA 1HKSA 1FYKA 1K78B 5FZMA 1FX7A 3I2IA 5F27A 3LPGA 5EJCA 1I3HA 3OPZA 4N53C 4J19A 3LEMA 1JN2P 3BZKA 1BR1A 4HNUA 3JD72 3PU3A 3THPA 4IL7A 3I2KA 3KT7A 1PGL1 2BZDA 3T8TA 4IRGA 4HLYA 4UHTA 4CO8A 3I97A 3R0RA 4XLFA 1TEIA 3WSOA 2CW0F 4CEWA 1A31A 3JRBA 3S15J 1GP5A 4KICA 2ADEA 3CDIA 1ETQA 3ZSKA 1FLIA 2FDIA 1RUE2 1BBYA 2CGPA 4R9BA 4RBOA 4AIHA 1XU2A 2XUMA 4BBRJ 1QZZA 2EFNA 2C26A 2HOSA 2QKLB 4LHKA 4R52A 5BOXA 2DW4A 1V6MA 1UPIA 4L9VA 3GLXA 5E20A 4BQYA 4A3KJ 3EPZA 3PUAA 1S55A 4ESBA 1EH7A 3H8XA 1CX1A 5A32B 5FMOS 3VBFA 3BTJA 5IYYA 1EP0A 1YFUA 4AL9A 2RDRA 3F22A 1B72B 4XL9A 3MV01 1QXRA 1G9FA 4YARA 3GZ5A 1GUIA 1FJLA 4ZYHA 4AEKA 1A35A 1RKWA 1SC7A 1HJFA 2XPWA 1E5HA 2FBHA 2XJTA 1OUSA 2NOGA 1ZZ8A 5GZCA 2J7MA 1XC5A 2EH3A 2CUZA 1BN5A 1LOBA 4LBKA 2K3FA 1VAMA 4AI8A 4PFOA 4Y1ZA 4QQHA 3JD73 3ACGA 4A3LJ 3VYTB 2R16A 5HCAA 4Z2WA 2HJIA 2XGEA 1ERDA 2JB4A 3F23A 2ARAA 4KIFA 4DYCA 1OJLA 4C3JJ 3HUGA 4GJZA 4N53A 1Y6IA 1RUE3 1WW7A 4D6RA 1S72I 2D3SA 3OYWB 1ZG3A 1EV12 3DKYA 1ZH5A 2JDNA 4LBMA 1XE8A 4XN0A 2HYGD 2L5QA 3BVCA 1D5YA 1FPN1 4BNCA 1DP3A 2BU9A 5FLHA 2H0BA 2Z3YA 1BEV2 1JKQC 1BOAA 2KD7A 4EZHA 1QJZA 1AR93 2MEV2 5L3CA 4Q0QA 5GPCA 4OAZA 5J3UA 2FHRA 3C2GA 2MGQA 3UJQA 3JCUC 1WMFA 3VKMA 1GLNA 4JDMA 4DXSA 1WH5A 2OZ6A 3AP4A 2OCEA 2JSCA 4DUWA 2K40A 1OH3A 2VH9A 1KDMA 2I07B 4IETA 3NRVA 5FZ7A 2ZEXA 4Y52J 3ZSMA 2PLV1 2RC4A 2ZX3A 1WD4A 3EB7A 2HNHA 2VVDA 1ETVA 3T4VA 3I2DA 2GC1A 5M5YJ 1MS0A 3HVDA 1ODNA 2P5BA 2Q4SA 1RUJ2 1LU1A 3J80K 1YYNA 2PHUA 1FBQA 4HLXA 3HOSA 3JTGA 4EN0A 3S5QA 2Q5TA 1EV13 1JKOC 1JXNA 2XR4A 1Z67A 3PUFA 4MTEA 5BYNA 2XF6A 1JUIA 1K6OA 1SLAA 5CADA 2E60A 3VYSB 1L7QA 3BTIA 5CIRA 2MEV3 3WZ1A 4J1XA 4OHXA 3J26N 4XJ9A 4O65A 3DLAA 3EXUA 3H1CA 2RR11 3PHMA 1VBA1 2BY3A 5LY2A 3I2HA 2D6MA 1QNTA 2IXKA 1O7LA 3PNVA 3VBOB 4XMIA 4XYXA 4JHTA 4FCYA 1GWLA 4PLNA 4BA6A 1NH3A 3HSEA 3S93A 3J4UH 2R7FA 4I02A 1NQJA 4OHWA 1W8HA 2X51A 1O3TA 3NKTA 3ZYBA 3R4DB 2F5EA 4HX7A 2A6YA 3LAGA 2DOAA 3RPQA 2QQLA 4YNIA 4CDUC 3MWMA 4IXAA 5T52A 2HZDA 1UHWA 1JOBA 1RUJ3 2WWSA 2LKSA 3OYHA 1LEDA 4AYBN 1ZK8A 2X09A 1UG2A 3DXUA 2JMWA 4CZZA 2D93A 3WF4A 4H55A 2KIFA 3AMHA 1YE9A 1PM4A 4YVSC 2QQWA 5D4RA 1F9NA 3ZR6A 4CP9B 2Y33A 4GDFA 3M1HA 4UV8A 4E4DX 2IT0A 3SXWA 4C90A 5D21A 2CQXA 4NUBA 5FYZA 1HSJA 1Q1VA 2ET7A 4XM3A 2L01A 4NHLA 1V5EA 3I3LA 3MFKA 2X9DA 4GMP0 5JVTA 1ZBA3 1ZQ3P 3LSRA 1HV0A 5C4WA 5LEJA 1O8PA 3O6BB 4R8HA 1NCRB 3SHRA 1RPWA 2Z5WA 3HQRA 4NO4A 1ONVA 3VSKA 3VZLA 1IN8A 4C8DA 3EQLF 4GKXA 4A3MJ 1DQ1A 2XVLA 2H6BA 1USTA 3H3LA 2PAEA 3IMNA 1W2OA 1RUG2 3ZQIA 1P7IA 1PVC3 3KT1A 4Y22B 1VIWB 3R05A 1UYYA 4NHYA 4GMP1 2VN2A 3U9GA 1W7PB 1XSVA 2QENA 2GP5A 1KZHA 2ZNYA 5IVVA 1YYVA 4PCQA 4LKDA 2PHXA 4D1QA 2HS5A 2QSHX 3MICA 1R091 3MIEA 4CDUA 2HWB2 4P9FA 3MIFA 1JYXA 3KMHA 3OR2C 4E7LA 2LBFA 3QPSA 2D98A 2DCEA 4KQ7A 4F3QA 4IEPA 4XTPA 3ZDVA 3DQVC 4F52A 3V7SA 1J7KA 3DEEA 4UBGA 1KYWA 2JWTA 2RG4A 1LODA 3UNPA 3LA7A 4FPEA 4YVSA 5GLZA 4IEVA 4LHSA 2ZGTA 1SFPA 4D6SA 3ZXSA 4KBBA 2CRGA 4WV8A 4BK5A 2D1VA 4AU7A 2WZR1 3DXTA 1OQ1A 2OXBA 3ZMNA 2RJLA 1WPKA 3QYEA 4BEHA 4GAZA 3Q8BA 2W52A 2M5WA 1D0YA 2QDNA 5GM0A 2FZ2A 1RUG3 5CVVA 4PDWB 4BZ4A 4M0HA 4OZOA 4Z82A 4YVWC 3W2VA 2DA7A 4QXCA 1CZVA 2R5ZA 4A5NA 3OYJA 4XR6A 3Q9SA 3W6KB 2RJ2A 4UUSB 1ZG1A 1GOGA 3HNBM 2WSVA 3GM8A 1PMJX 2VZOA 2WJSA 5FZ1A 3DEUA 3M3EA 2HWC1 2HYXA 1ZZ7A 5ICFA 2DI3A 1X3WB 2EV0A 5CKTA 3CUQC 1XN7A 3FBIB 2HWB3 2AO9A 1AOYA 1G4DA 4AGGA 3ECQA 2UWMA 1IRXA 4BH9A 3AYEA 3L2HA 2H27A 3OB8A 5EQUA 3MVPA 2BYVE 3T0DA 4Q5SF 1OHFA 2A3XA 4YFXF 1B09A 3POEA 3H8RA 2VQ0A 4M3CE 5EEHA 1JHHA 3X29B 1QF3A 2LMDA 2JA5J 2PQQA 4BQXA 4YGDA 3AP9A 4P9UA 4RGXA 5JI6A 1V54H 4P14A 4ZS2A 1LE8B 4DOUA 2R7DA 3R61A 2LY1A 2HDWA 5GAGJ 3M3CA 3SEPA 3U11A 3ZKUA 1A6IA 2RNJA 3I8TA 3EUHA 3KE2A 4A6DA 4IQPA 2X4HA 3I4IA 1JTYA 4P08A 3S3OA 4GD4A 3IAPA 2ZBKA 1W6MB 4XC9A 4OINF 2FQ4A 3KEQA 3ZXGA 2CG4A 4DNCA 5LW9A 4JQTA 3LAPA 4K21A 3K70D 1HSTA 3NV2A 4YVWA 4X6QB 1W6PB 2NYXA 4O7XA 3JBG2 3PFIA 5F3GA 2DQLA 2W1UA 3HR9A 4U87A 1QNYA 3ZYIB 3BJOA 4COUA 1HN1A 2O1QA 2RHPA 5A70A 1T2XA 4ZZDA 1N3PA 3FHZA 2ZKZA 2JE9A 1UAAA 2D6NA 1JE8A 3J8F2 4EWEA 2CYYA 3VEPA 3CUQA 2DJNA 2ZMNA 2BNMA 3WE3A 4ASNA 2D44A 3WD5A 4C91A 5IVJA 3C7HA 4CYCA 1R5ID 3SEQA 1I1SA 1E0EA 2JG8B 2H94A 3QCWA 5HOOA 2F48A 4IHWA 1QPMA 2VC1A 2QBYB 4XOPA 2OUHA 2HWD2 4GO1A 4DQ2A 1SBFA 2K9NA 1AL22 1FC3A 3ZXLA 1KFXL 1PDNC 3VZMA 3KP5A 2ZGQA 4JTOA 1FZPB 2RS32 1TQ5A 4XFAA 1N1TA 3B6AA 4UW6A 2GMMA 3OCPA 3NMBA 2GMEA 2OPWA 3K75B 3P3NA 3L9FA 5BPIA 4RR3C 4V2VA 3BTAA 5FZ8A 2ZHKA 1XGSA 4EN8B 1DDNA 3AB0A 3JBG3 2M4KA 2WQ8A 1UU6A 1GICA 4ZZ8A 4LG0A 3W58A 1XQNA 5LBFA 3K4ZA 2CV1A 3S6PA 2MH9A 1HIXA 3G2BA 2DT6A 3J8F3 5HCHA 3FBNB 5CFCC 4FE4A 4MEXF 5JI7A 3OY9A 2N8GA 3C1DA 3K1PA 2C1FA 2JIGA 3HRSA 1UNBA 1DU3D 4LOTA 4AXOA 1ZAOA 4E7IA 1XNAA 1HRI2 1S0IA 2DU1A 2VJXA 5KWRA 3IIIA 3WLUA 4J01A 5IAXA 2X8KA 2QLZA 3WEZA 5F0CA 2J1RA 4AZZA 1QHDA 2A1XA 4XICA 1MACA 3ZFEB 4B8EA 3ZXDA 3A01A 2E2HJ 4CCLA 1O7FA 2VMDA 2EWNA 1F5JA 1UIKA 4XOGA 4GRIA 3CCUI 3N9LA 1BHGA 4HSJA 4R79A 3ZYRA 1YO8A 4Q0PA 1VRH2 1P92A 2KPMA 1WJDA 1ENSA 2WNUB 3NEUA 2HOAA 2LF8A 4B3XA 2Y60A 1AR61 2GNBA 3BPSA 1IXSB 5BNOC 2R30A 3CC2I 1W39A 3ESWB 3NARA 1QJFA 5HPOA 4JX4A 3OYGA 1VNDA 1ALYA 3BDDA 1W8NA 3CF5F 2I5UA 2VBZA 1O4XA 3M1EA 4HBLA 3BU0A 3NAPC 2VT2A 1XU1A 2DODA 5LA0A 4HX4A 5DAQA 3K77A 1POGA 1UY0A 4EATA 1BLZA 4AVSA 1HRI3 4N90A 5A1AA 2EIKH 2WS93 3HOVJ 4A0XA 4K2EA 3H0DA 2HVRA 1K6YA 2WINB 2ZSHB 4YRDA 3MW4A 1O3QA 1Z78A 1H0BA 4D69A 4LO7A 3HAGA 3W5MA 5IT9K 5EHDA 2M0CA 2K9SA 2PTMA 1D4VB 1I50J 3CCRI 2XLGA 4Y24A 4BISA 3WP4A 3W20A 4UXAA 1LU2A 1MS1A 3JSOA 2B5HA 1IGOA 3OSGA 1IN6A 3OOUA 2ZXIA 1G7YA 3NKGA 3AX4A 2Y30A 2GXBA 2XHKA 1ENHA 1YQCA 1ZZ9A 4QQOA 2FDJA 2QSFX 2C0ZA 1OLTA 3I71A 2L7MP 3K4NA 1RGSA 4ZYGA 4W6XA 5F5QA 3IDEA 4XIOA 5IOYA 1HKDA 4OIRF 1VJ2A 4RHV2 2FMLA 1ZBE3 2O14A 2YY1A 3X2QH 3PIJA 2UZKA 1JKPC 2LTNA 5KHJA 1ASJ1 1U0JA 3OTFA 1NXMA 3CLPA 5BNOA 2R6QA 3T1LA 5GLUA 1P6RA 1TQPA 5FXVA 2BW3A 4QDSA 3Q8FA 1OLMA 4YLZA 3LFUA 3NAPA 1X1BA 4A93J 2X10A 5EPAA 1MDMB 3S3MA 1NKGA 1OYYA 4BACA 2O8XA 1X8MA 1H8TB 1V55H 4PIXA 4L0YB 4XJZA 3WW1A 1XDSA 1ZKGA 1IOAA 1TWFJ 4NQWB 1MJAA 4CDQB 1KU3A 5FYHA 2QQMA 1UKRA 1IZ3A 2WAAA 5EGOB 4MFDA 3A23A 2JDAA 5IK4A 4ZXKA 3HNMA 2MABA 3CCJI 4PJ0C 3GTKJ 3WODF 2RV8A 4HV5A 1QXPA 3RZMA 2VQAA 3KZYA 2JWPA 4NIIA 2VOTA 3H1WA 1W2UA 1IKPA 4RHV3 4BCUA 4X6RB 2DFBA 5A1FA 3S1NJ 1Z6TA 3MCZA 1EY2A 2R072 3F6VA 2XPUA 1YJ9I 1RNLA 2R1BA 2ZCWA 4QLCU 1U9OA 5ANNA 3W2WA 1RUC2 5FZOA 1DF0A 1RITA 3UYJA 5DCFA 2VMHA 1SFUA 4DUVA 5M3FJ 4CCCA 1Y4WA 4ZYEA 3O14A 3LEGA 5F5IA 1YG2A 4B7KA 3IDAA 2MYSA 3T1BA 5EV7A 2RS12 1RUF3 5GTIC 3H5NA 4BOWA 3TB0A 1X9TA 2VCCA 2YS9A 4WVVA 3JRIA 5HCBA 2SLIA 2DWRA 3WTTC 1MEC2 1W99A 1ZRFA 5EZGA 1B59A 2VOVA 4UT5A 3KYCB 2ZGSA 3INAA 1R1A2 4XXPA 5EJZB 4EJVA 3LIHA 1VI0A 3RCOA 1GQHA 2YU3A 3VD3A 5GZFA 1EUUA 4FFIA 3MI8A 4ONUA 1OXCA 1I3QJ 3OYIA 4ARXA 3CZJA 3K1MA 4KT5C 1WUVA 2R073 5F0HA 1QJU1 2KZGA 4CU8A 3O1VA 1D1BA 2GH2A 4ES8A 4ASKA 5ACA3 1RUC3 1WCUA 3A0HC 4LUMA 4B1MA 5A3MA 5J1XA 4LHNA 3R60A 2FQ3A 1DBNA 4B4RA 4E9KA 4DJAA 1NE6A 1JH5A 1MVQA 3VZOA 3D3AA 5FBJA 1DDLA 2RS13 3WG7H 4BK4A 5JOZA 1GANA 5CKQA 2L9VA 2OBPA 1O59A 2AS5F 5IP9J 5JI9A 4WVWA 3W6VA 1WZ2A 1C3HA 2CO5A 2BEOA 1E57A 3FXOA 1I6HJ 1MEC3 2CV0A 1IJWC 2DVAA 2EV6A 3N35A 3CCMI 2P0WA 4PZJA 2STWA 1R1A3 1VBC1 2LD5A 1VB4A 1IN7A 2JA8J 4NC7A 5J4VA 1C5HA 2P3YA 2IGMA 4ZPIA 1OD5A 5TRDA 4FQGA 3LOCA 2HZTA 3GZNB 3QODA 4LFUA 5K5RA 2P2KA 3PNYA 4AEMA 3DN7A 2LALA 1PGW2 4QT6A 1NT0A 1VQNI 3HG9A 2E35A 4S04A 2VZ3A 5DYMA 2MG4A 3HEIA 1R081 1JU3A 2VZSA 4FP3A 1RVF2 2JQ7A 4WZCA 1IHMA 3ON7A 4KN4X 4XFFA 4XZUG 1TWHJ 2WA3A 2NMOA 1OOPC 2CH0A 1W2AX 2A68F 2YPRA 3SHFA 5LGTA 3AZWA 3RJPA 3WY6A 4XEZA 1X2MA 3DYPA 5ISLA 3RQIA 3LPFA 5DZEA 4EQQA 3ZN4A 2EBIA 1NCQC 4Q4W2 1WFXA 4CA0A 1YIJI 1RR8C 1QJEA 4N0BA 3KS7A 3MF9A 5K9YA 3UNGC 1OF4A 3FWEA 4NMIA 2W0XA 2VZUA 3OBAA 4A3EJ 5F2WA 2LK2A 3L2UA 2ZTNA 3EYIA 1DCSA 5LY1A 2VMGA 2IJLA 3T4HB 4FFFA 1QY4A 4FPOB 2LTPA 1PK6B 2XUEA 3CLOA 2L9LA 3B6CA 1K42A 4F7ZA 1QQP1 5CZKA 2M8EA 2XGDA 1X58A 4A45A 1KXGA 2PMWB 4PDKA 3RRDA 3TOBA 4DYRA 1W0OA 1UZZA 1KRIA 1OSGA 1GNHA 4XRMA 3SKJE 5DDJ3 5EIYB 3HL2A 2XGXA 3HJEA 2R061 4BMEA 5J96B 1QJY2 3NJYA 4RS5B 4AW7A 4DFSA 2V6EA 3VDAA 1PGL2 1JUHA 5JIAA 1W6OB 3ATGA 5FMDA 3FLTA 3MKZA 1FT9A 5T5OA 2YBPA 3ZKYA 1ZZCA 2R1DA 4XHBA 3GEZA 2V5YA 1BW6A 1XE0A 4HT1T 3DKWA 3ZMOA 2L7KA 3SZTA 4UNOA 4GULA 1OYWA 4CUAA 5FYMA 1US3A 5F3EA 1NCQA 1S2EA 1AR83 5T3NA 4LBQD 3VHRA 4G3YC 5J37A 1O91A 1Q8VA 3LOIA 5T5JA 5JXGA 2DMQA 1IF1A 1W9SA 5DUIA 5GALA 5EYXA 2IC1A 4OUMA 4JDOA 1NK2P 5IVCA 3I54A 2OPKA 3HQXA 4MEYF 1X1CA 1QJY3 4M73A 2Q1FA 3N9QA 1RUD2 2MHFA 4UVBA 3B5LB 2VGDA 4KU8A 4HSRA 5E8AA 1SD5A 5J8FA 4ZXEA 2YROA 3DV8A 3KLSA 4DNYA 2IXLA 1D0HA 1MZBA 4ITVA 4I76A 4YGEA 2GNMA 3T0AA 5BUVA 2ZAHA 1ZX5A 3AYDA 3V0AA 2GNTA 4AVTA 2VOPA 3MPPG 3AJYA 1UG0A 2DPDA 3LSTA 2A6XA 2P3JA 3LFMA 1IXRC 4HLTA 1QVUA 2XRLA 2L7FP 4COYA 2E19A 2NNNA 4HG6B 1FPN2 4PSWA 2NNYA 1JJ8C 3I2FA 4LO6B 5JZGA 2WV1A 4A6SA 1RMU1 3B94A 1UMZA 2BOLA 4NE9A 1RUI2 3OV8A 1GV9A 3IRQA 2OC6A 1IAWA 3I3DA 5LRRA 2D45A 3P6BA 1WI9A 5FLMJ 4Q1PA 3MQ0A 3V0BA 2WT1A 2CU5A 1GQPA 2X5IC 1S0DA 1UFMA 1F1ZA 3K70C 4OWRB 3MD2A 1H2NA 1RUD3 1U78A 1MQTB 4OYUA 4IHXA 1Y3TA 5FR3A 4NIGA 3GTQJ 1HRV1 2PLV2 1ITYA 3LSKA 3OF1A 3QD6A 3T30A 3CCQI 4UF0A 4UVCA 1FV3A 4LO8A 2ATFA 2VZRA 2YDEA 4IEQA 4MXVA 1LESA 1Z3YA 4BE3A 2HEYF 1EA3A 1F2NA 4J25A 2F4IA 4XUPA 3O0XA 3CO6C 3R4UA 1KEXA 1SLLA 5F6FA 3HPGA 1IQAA 2DYSH 4A0YA 1RUI3 1VALA 3I3BA 5ABJC 1BJQA 4II2A 4BQOA 1TNRA 3I59B 3GZ6A 2RR12 3JW4A 1SVMA 3ABTA 2PEXA 1TNTA 5ERIA 1FOD1 3VWBA 5LBQA 1FTTA 5CB7A 2WAQA 1VBA2 4ISRA 3BYWA 2YUSA 5FXXA 2DK5A 5JAXA 3IM0A 4FQ4A 3WG1A 4BQ3A 2RM21 3OOXA 2Y26A 1UZ0A 1YQ2A 2WQ4A 2EXJA 2PLV3 4CCKA 4RQPA 1ND3A 3FK6A 4K1ZA 5FZ3A 1R23A 1H88C 2X5IA 1F15A 2PHWA 4XIKA 2HVSA 3IPVB 2D3RA 4GWMA 1FYMA 5J40A 2EA4A 4E7SA 2RAEA 1SZBA 4X1EA 4YGBA 1S2KA 2Y0SA 3RPUA 2XH6A 4ITCA 1U5ZA 2Z9OA 1Y9MA 4D0PA 1EH8A 1ULGA 4BPZA 3L2QA 3ACHA 5DS9A 4OFGA 5IP7J 2JA7J 2GWRA 2PQ8A 4QIWN 4XCBA 4N4NB 2XAQA 5EYRA 2WIIB 4YRVA 4IQJA 2RKHA 5JR3A 3GMEA 4QPIB 2VPLA 2HKOA 4MV2A 2BOJA 2HPMA 4HXCA 1UF2C 3LD8A 1EKEA 2ETEA 1Z0XA 3RWNA 5FPVA 1XMKA 4CDGA 2KFDA 4XE9A 5IATA 5L7OB 4Q0SA 5ABJA 2QTWB 2A3SA 1O5LA 3ASNH 3EDPA 1G2HA 4LR4A 1VLNA 1BVP1 1E5RA 1HXDA 3DU6A 3N36A 2A71A 3RZOJ 3S14J 3OY8A 4UFJA 3B9IA 3DBHB 1NYWA 1YX3A 1FXZA 4XONA 3NAUA 3ZMDA 2CDPA 2JDKA 3JRHA 2HKXA 3DTIA 4PGHA 3S1QJ 2QQVA 3ZLIA 2GLOA 3J7AO 3FKJA 3H36A 1BKZA 3UK9A 3TW6A 3LEKA 1UB9A 1R092 2E1MB 4COWA 2WLPA 5K0UB 3NJXA 4OHYA 1MJBA 2EINH 4BMBA 5DQ0A 3FXUA 2GC0A 4XHXA 1URXA 4FE7A 1HLCA 4Q0VA 1IUFA 1Y1VJ 2B9UA 1ON2A 5LA2A 5IP6A 3BPVA 2RDPA 3IWFA 3IKWA 2LRPA 4BKXA 3K69A 4Q29A 4LK0F 1IRZA 4DOZA 4RGSA 1IUYA 3FXKA 2OAZA 4KIGA 5E1RA 1PP7U 4CDWB 1D0XA 4DBQA 4AD9A 2BBAA 4LORA 2WZR2 3IH4A 1HB4A 5SV5A 3T08A 3MZYA 2A75A 1CF7B 2CUEA 1VTNC 2GMPA 3OOPA 3FM5A 1W9TA 2BOIA 2NRAC 3F6OA 2KR2A 4FETA 1VFCA 4JX0A 2QQ8A 1ZLKA 3JD71 3ZQLA 5L3EA 3S1MJ 3LFKA 1YFXA 5FB2A 4C9YA 3SCFA 4B29A 2V9PA 3WHCA 3KZ4C 4XUNA 5HV4A 3MO4A 2R7TA 3TEZA 3C7JA 2BHZA 3GBFA 1OC1A 4QPGC 1F31A 2W92A 2DFFA 4XQWA 2HWC2 5A2QZ 1RUE1 3HIFA 1X7NA 4XF0A 1KU9A 5LA1A 1YO5C 3MV11 4TTGA 4NC8A 5F8PA 4GA9A 2HI3A 1JGGA 4MGYE 5IVBA 4UV9A 1AR91 3RTRA 1E17A 3I4MJ 1ON1A 4Q4X3 4WM8A 1FBSA 5FPLA 5C70A 4EJUA 3QU3A 3HPHA 3H3UA 1MNDA 1W7PD 5KXEA 2K9LA 3G1MA 4XIDA 3CDZB 4A5MA 2EZLA 4QHOA 1VQLI 2XG3A 3AL0B 1QRYA 1HXS3 4LBLA 4LTAA 3S2DJ 1UAIA 1PO13 4BAYA 1W1WE 1HB3A 2YU1A 3K3NA 3LCPA 1BCXA 3H1YA 3VBFB 4NNJA 1YIPA 3VUOA 5IOZA 2PAMA 2FSWA 4DUXA 2D97A 3I9V2 5ICGA 3RMXA 2MFZA 1T98A 3TP3A 3NWSA 1QIQA 3OR1C 4F93B 3V8KA 5FOBB 2P6SA 5FJ8J 3CU7A 1W28A 2DUOA 3HHHA 2VONA 1MS5A 4LEJA 4WXCA 1LOEA 1X8EA 2XAHA 4LE3A 3OYBA 2MEV1 2LRDA 1UY2A 2RV9A 3I2GA 3RZDJ 4E4SA 1LPQA 4YG3A 4M4RA 4QXHA 3AL6A 3ZP5A 3HUGB 4M4PA 4EM2A 1XOYA 2OD5A 3O5SA 2X29A 2WZPP 1GOHA 2X1EA 5LLQA 2IP2A 4QGNA 4CXXA 2WL1A 3CJIC 2BDRA 5E88A 3KV5A 1S0CA 3WNKA 2Y48A 3OJBA 3QPHA 5L3BA 1UZWA 3D0JA 3G4SI 4U88A 3FM3A 4HQEA 3GZEA 1S0GA 3WHTA 3HXLA 5D8KB 1RUJ1 3J7YJ 5C4JJ 3ILRA 1TBXA 1HV1A 4XVHA 2M9HA 3KSCA 1AUYA 2E7TA 2QCSB 3WT3A 5FCCA 3GTMJ 3WR0A 2ZXQA 3IKVA 5FPXA 2IUWA 4CXFA 4AWXB 1M4WA 1M1EB 4AFMA 4DO0A 1BBT1 1MMAA 1CVNA 4JK1X 3TMOA 5A7OA 1CZTA 1ZREA 5FY5A 3WDUA 4P9LA 1JUSA 2VXDA 3B9CA 1QU3A 3G6JB 3F0CA 4Y33A 1NZCA 2WABA 2WO7A 5T55A 1GNYA 5F64A 1W9FA 1ZBA1 2K0GA 1FNYA 1UU5A 3MLKA 2HH9A 2XF5A 4RB1A 3USUB 2N7GA 4FOQA 1HN0A 3QPLA 4M0NA 2NM1A 3NWTA 5EG0B 3PL0A 2R7OA 2VQHA 2XJSA 3JCIA 1RHI3 3E97A 1R7JA 2ZJPF 5C8WA 1ULEA 1PVC1 2KIQA 1HBXG 4WM7C 4QQLA 1WI3A 2OCCH 2Q8OA 3CJIA 1J0RA 3RSJA 3LAJA 4H0EA 1D5VA 2FEZA 3CQOA 2J1UA 5KXBA 4KG0A 2OF7A 5DV5A 1GFF2 4QX8A 5C5UA 1AR62 5KK1A 4FX4A 2P4EA 2V1DA 5FAXA 2HYKA 1RUH1 2OQ7A 2IFWA 1W9YA 4JAAA 2X48A 4KFCA 2R92J 1CN1A 3AKQA 3GYDA 1BQPA 1XYNA 4FFGA 2DVBA 3BIEA 2AHQA 2ID6A 1VQ9I 2RS52 3QU6A 1YHQI 3UKVA 4Q4ZF 2Y0MA 2K9MA 3PVEA 3ZFGC 2JPBA 2WB1A 3KLOA 1WGXA 1MH4A 5CKNA 4IERA 3F8CA 2FDHA 3J7NA 3KD4A 3ABKH 3L7WA 1L0OC 3AVSA 1MW7A 3N9PA 4ZU7A 4PFPA 2Y2ZA 1YQAA 4L92A 3CO7C 1MBKA 1RUG1 4WWCA 5IHRA 3AG3H 3ZMUA 4QAWA 2E51A 4XILA 2E7XA 4M3EA 3WG4A 4CGZA 1REEA 1WH7A 3PSFA 4IV1C 1T56A 3RQ4A 2W57A 5C4WB 3KP3A 5K1YA 4Y26A 3J80Z 3CMEI 4M3CF 3JRCA 4WM7A 2HWB1 2XJPA 2WUHA 4FOVA 2V26A 2WDBA 1HQNA 2VOWA 2DA2A 2ERFA 3V64A 2XPVA 4P9IA 2E63A 2RS53 4QX3A 4OHVA 1ASJ2 4AVZA 1AYN1 4PJLA 3M3IA 3VBUC 1F36A 3ZR5A 1BR2A 4QPWA 1P4AA 1LEMA 1RXFA 3WQ1A 4XMYA 4QPYA 3T2QA 4XNFA 5C8CA 4XQ4A 2MLGA 5FP8A 1Y8RB 3WF0A 3POJA 1WQ2A 4G7ZF 2ZGPA 3VYUB 3MKLA 4MX3A 4QX5A 3K2OA 1XJAA 1XB9A 1LJ9A 4LITA 2KL4A 5IFTA 4Y1VA 1KONA 1W36D 3BODA 4AEDB 2PHLA 3P9KA 1L3JA 2XAUA 4QHBA 3ZFGA 1C8NA 2QQPA 4KWJA 2LBFB 3U21A 1IG7A 2A6ZA 2M4GA 3NNJA 1CR7A 3PIGA 1UO9A 1UZYA 1T33A 2WQZC 3KVBA 4YVSB 4UFMA 1IRFA 1JHJA 1XTAA 4N43C 3BTYA 2KISA 1W90A 3L9JT 1I1GA 4B7EA 4XQDA 1PUFA 1DZRA 3O1RA 3KP7A 3GFJA 3IAM2 3THDA 4BJ6C 4AI1A 5CPRB 2VT3A 2YPJA 1FP2A 2K27A 1K5MB 3N3HA 3NJVA 1HDDC 2CGOA 4BYYA 2DURA 5A7NA 3VBHB 4OCTA 3LSGA 5IWFA 2R5ZB 1NLQA 5F04A 1VBD3 2JE8A 1AHSA 3TW7A 4QKFA 4KITB 3HBLA 3N97A 3T2PA 2XGCA 3ZQHA 3KCXA 4AHXA 4O9GA 1GP4A 3IWZA 3RMYA 1QQIA 1DUXC 3VBUA 1R22A 3JAMK 1UX7A 1IW7F 2FOKA 5FMOL 4M9XA 4AAPA 4CA9A 1W6NA 3M1CA 3WCSA 1CAVA 4LG3A 2GNDA 1CAUA 3BB6A 3HSFA 3TEDA 2PJRA 2LSOA 4XFHA 1RETA 4ETSA 3LA2A 2UWAA 2D2WA 2ZOEB 1D1CA 3SH5A 1SMVA 4EM1A 2B4KA 4LBQA 3VDBA 2X1CA 1SFEA 1CONA 2Q0AA 1KITA 1X2NA 3K4KA 4EROA 3U4SA 2B7YA 1SACA 3JBG1 4JBAA 4F3JA 1V5GA 5DEQA 4UFLA 3POBA 1DPRA 4AC0A 4LK7A 3FF5A 1STMA 4D7YA 1U5XA 2VASA 2EFQA 4JTNA 4MO3M 4IX7A 2VW2A 3MEPA 5EYYA 1GVDA 1H9GA 3J8F1 3V8JA 2VXJA 3SFIA 3L2CA 1A6QA 1AF9A 1U3EM 4HOBA 2ELJA 1YRZA 4OQ9A 3ZSLA 1J1TA 2XROA 3VDXA 3R4SA 5L9BA 1FSHA 3F72A 4E8DA 3ME2A 2ZPXA 2FUG2 4HPKA 2GIZA 1B8IB 2ZX1A 3MIBA 3LSMA 1HW5A 4P9GA 5F1JA 3E6CC 3KHCA 1C8M3 4XDOA 4LLFA 3ACLA 4W50A 1GT0C 4D5FA 2VUDA 1A5JA 3CUQB 3IBMA 1VBC2 4XLHA 1DZTA 4CYCB 1SBEA 1O4YA 1T6SA 5E16A 3BTCA 3K4JA 4AQ2A 3BALA 4GH4A 2BNOA 4E4HA 4M01A 2K9QA 4ZDOA 1R00A 3H42B 1OT5A 5JOYA 1E3PA 2WYSA 1SCRA 4F92B 3TO9A 4ZY9A 3H9AA 1WBLA 2V5DA 2VJJA 1R082 1LNWA 2UY9A 1NQDA 2O8OA 2JDYA 1GKBA 2EZHA 4LOCA 1KQ9A 3GBWA 1YS6A 4ON0A 1HRI1 1E5SA 2WAQN 2WS91 4YW3A 4JDNA 1A8MA 1IKQA 4EJRA 3QBQA 1ZZBA 5A32A 5FO8B 2E6VA 4I0WB 5BMZA 1J9IA 1ETWA 4LG0B 3QYFA 2JDMA 2OUJA 2R7EB 5TISC 2QQKA 3ZM8A 1LULA 4Y1UA 1NE4A 1S29A 3F95A 2LREA 3MW2A 4XJWA 3WNLA 2L9NA 4XPVA 3BG5A 1AU7A 4BS9A 3BZCA 4A6EA 1DGWY 2Y0SN 3CUOA 4UB6C 1QGLA 3VBSC 5GZEA 2ZBJA 4IHYA 2MD5A 2DN0A 2V1XA 1FNNA 3OD4A 5A6QA 1W9WA 1CAXB 4AIKA 4HNVA 5IK5A 5E6HA 1QQP2 1NZIA 3ERMA 5E18F 1JYTA 2QVSB 4LULA 3K4DA 3A01B 2BVVA 2X6OA 1C28A 1ZBE1 1FIPA 4KJZA 3KB5A 1R083 5M0TA 4YZ4A 3M8JA 3OWTA 2CV2A 4YM1A 3BC8A 1R1VA 3QOEA 3LF7A 4HVRA 2OV7A 1A8DA 1CESA 4RFT0 4BQ1A 3UGHA 1JUMA 3VB9A 4AG4A 2ZNZA 4D0QA 1WJFA 3FXRA 4I09A 2HQAA 1KJRA 3OUJA 2JK3A 4XLPF 3VBOC 3R0JA 3JZVA 3Q0VA 1Z3XA 3UR3C 5DG1A 4HBNA 3MUY1 5FYVA 1PMIA 4A69C 1PM7A 2H09A 3SCGA 2R7QA 4Y7NJ 1YCIA 1WKMA 3SITA 5J6XA 5BNPC 1GUUA 2DFEA 5G04L 1G3WA 1JJ6C 3QLQA 2VLAA 3GTGJ 3WCRA 4FPHA 3WP5A 3DPRA 4W97A 4YW1A 1LRHA 3K4AA 3ZYGA 1JMUB 3GF6A 3VBSA 2OA4A 3Q0WA 3ACFA 1JZ5A 2DVGA 2W1WA 5J1UA 4EM0B 3G1LA 3ZXJA 4EN9B 3ZPLA 3JTHA 2O0YA 3UETA 3C7OA 3E5UA 3AL5A 2JB8A 3FXMA 3G7DA 5L3FA 3CCYA 4XAEA 2Q8EA 2WR9A 1NCRC 4P9XA 4A3DJ 2KKOA 3ECHA 4G7OF 1CQTA 1H1AA 4B4PA 5IAVA 2P17A 4TYSA 1R4MB 2CSGA 2ZXWH 1RUF1 5CFDC 3N9NA 3PMEA 5DUXA 4G9SB 1XPWA 1F5FA 1LEBA 1HKQA 3DYOA 1ULFA 3FFZA 4AE2A 2ADUA 3ZFFB 2YU9J 1TWCJ 5CVJA 1Z7LA 3F8FA 3VBOA 4RAGA 2QQUA 3HN1A 5FY7A 1GZTA 2R7XA 3BLYA 2BW3B 4JYKA 2O3FA 5HNFA 2KP6A 4B4CA 1H0MA 1AR72 5GPAA 3NAPB 2BQPA 4HX8A 3BG3A 3POIA 3OYEA 1ETYA 4L2NA 5H9PA 4LIVA 1YJNI 3BR5A 4CSWA 1DU6A 1UCXA 5LA9A 2R071 4QU1A 3BG6A 2GIVA 1VQ8I 5BNPA 5A3PA 1QZEA 4NWWA 3O12A 5IYDJ 2YZ4A 4HDVA 2VXZA 2JICA 3AKTA 2R0FA 5ACA1 1RUC1 5JLVA 3LOBA 5JHUA 1FV2A 3GCWA 5FZ6A 1PIV1 2L9RA 5LHHA 1MBGA 4FX0A 4P9YA 3AMMA 5LBEA 4ZU4A 2R7SA 5LWBA 1FX5A 4DBRA 1I6XA 4PDWC 5FPBA 4Z92B 2WY8Q 3A7QA 2P4WA 5IT9Z 1DQ0A 5FP4A 3ABLH 1HA8A 1MBHA 1LCLA 4AFCA 3BCBA 2PQSA 1MEC1 5F37A 2Y8KA 1XMXA 2KZVA 5L3GA 1RESA 3GYHX 1HDKA 5CFDA 1NTCA 1YOVB 1GZWA 1R1A1 2ZS6B 1UL9A 3VBRB 1AR73 4M3DA 1RJ8A 5DM6F 1YS7A 5BQTA 1R4NB 1FOXA 3BOWA 2IAIA 3BGAA 3ZGKA 2EAKA 1HLVA 1XSDA 4N4OB 3P5BA 3FBYA 2DA5A 5A7SA 2ZB9A 5FZLA 3AZZA 2EB7A 1A6CA 3BPXA 4D3WA 1FP1D 2CDOA 2VZTA 2DTYA 1RYYA 1GBGA 4BDYA 3HB9A 2RM22 3O1TA 4IEWA 2LR8A 1YJWI 5A3LA 2HGCA 4NR1A 2DCKA 3IV5A 3PL8A 1XGMA 3GHMA 4DZGA 2CQ7A 4OMCA 3QP6A 4LMYA 4YIIA 2COBA 2DOEA 3PIPF 2D5HA 1Z21A 1SFOJ 4B1RA 3OGRA 4H4KC 3ABZA 3WTYC 4IEOA 4CPBD 3NRUA 2Y9YA 2MBFA 4MHGA 2YG0A 5D5VB 5F0FA 1OQYA 1OA3A 3BI3A 3GCMA 1XSRA 2QEXI 4YW5A 5F6LB 5EEGA 2G1MA 1WD3A 2GDFA 1YNAA 1MGTA 2K02A 1ZA7A 2F4LA 3OIPA 3ZXAC 1FMD3 2V4AA 3MGUA 5DDJ1 1HW2A 2IFRA 4DQAA 4YPJA 2WC2A 3DGTA 2Y0OA 2GN7A 5I8SA 1HW1A 1OR7C 2W85A 4HZFA 2JG8C 3D5RC 2NVUB 1QJX3 5DCMB 1S7EA 3K3OA 4YSFA 1YX5A 4M3FA 3QYBA 4C0BA 5IY5H 1REPC 5IT3A 5E8GA 1V6IA 1OLRA 4IRHA 5I0SA 3UT0A 1XNCA 4IUGA 4CUCA 4DEVA 1B9NA 3Q9VA 3NJZA 1FI2A 5CQGA 3ZYJB 3DKXA 3WNNA 2UWCA 4RA2A 4QM8A 2ZABA 1UYPA 4XF3A 4LLLA 2QBXA 3C3WA 4OU0A 2NS8A 4YM0A 1JYCA 5DAWA 1MR5A 1G9DA 4GJYA 2XJQA 2OUMA 1AR81 3CJRB 2JDZA 1W8TA 2DBBA 3GJAA 4BJ0A 3EMRA 2OQRA 2COMA 3B73A 2ZGKA 1DHKB 2WZEA 1ZELA 2F4MB 3IAQA 2PFBA 3SZPA 1JTZX 3P1IA 2VBWA 2B0LA 2WADA 2CWEA 2X6WA 5ICCA 3RKQA 3T2OA 1JZ6A 3MYXA 3ZQ7A 3HOXJ 2Z99A 2WB1N 1J3RA 1QJY1 1Q8OA 4LA3A 3E6MA 5FYTA 2WKKA 1PMHX 1X1PA 1A34A 2NVYJ 1W05A 3AC0A 2GALA 3T3YA 1QO0D 1LHUA 3ETQA 1ZARA 3RZHA 3ZFEC 1TW3A 4RAFA 5A7WA 3HMYA 4J1WA 3JRGA 2FD5A 1OR7A 2JG8A 4ZHNA 2KM2A 4DY5A 3OGJA 5IK7A 3PUHA 2ME0A 3TRSB 4NVPA 1TNFA 1USSA 2RMU2 1ULYA 4Q47A 4LJZF 2W48A 3C3VA 3F8NA 2WNUC 2H0VA 1NXD1 3AMQA 1W36C 4JX6A 4QU2A 3UKNA 2VNGA 1I5PA 4FSJA 1BVVA 1KYZA 3RQ0A 1IXCA 2EA7A 3M4OJ 1APNA 1AR92 2KJCA 1VPHA 2EVXA 2FJ1A 2HLEA 1UCRA 2G0EA 3PTYA 4CCEA 4RB0A 1LGBA 3L2YA 3B69A 1B35B 2XL9A 2EPFA 2CHHA 4ABZA 4H7LA 4CVUA 1UMIA 4RS8A 4XW3A 3OS2A 1D4M1 1UQXA 1W8WA 4GWJA 1RUD1 2ZMEB 2M1BA 3KEYA 5KHDA 3EQEA 1NCQB 2EJRA 4XZPA 2DCJA 1UY4A 2AC1A 3B93A 4IE7A 5FWEA 2W7NA 1ONAA 5IT6A 4RLFA 3WGHA 2XQRA 4OUEA 4AEJA 2NVXJ 5LASA 4JX5A 5GZGA 3GXUA 2CW8A 2W9XA 4P1WA 5EEAA 2BNNA 3FC0A 2VUJA 2WT2A 3T0YA 2UUZA 1DQ6A 4LT5A 4MYEA 5DN2A 2RMU3 3F21A 1HDPA 1R49A 2J42A 2Q0OA 1ZRDA 4CEYC 5JXIA 2PX9A 5FZFA 4YW6A 3ZFEA 3L1PA 2F4PA 3PNTA 1EUTA 1LVKA 2YX4A 1U5IA 4K20A 4LO5B 3OGGA 4DY3A 2W1QA 1POQA 3VD4A 1G9AA 1ZGWA 1KU2A 1LHVA 1OVSA 5T5PA 4AFAA 3WDYA 1RUI1 1AYM3 3N7KA 2X05A 4B09A 5IJRA 2WNUA 1BI3A 2W4SA 1S0FA 2V09A 3PNAA 2P6CA 5JDBA 3M8EA 2KRHA 1R5GA 4A3GJ 4WVMA 1YTYA 1Q8SA 1JZ8A 5B3SH 4U0WA 5DM7F 3CF2A 4QKBA 4ISQA 5JZGB 2E32A 4CRQA 3SC7X 1YFHA 2IW5A 1RL3A 1MBJA 1D0ZA 2QQJA 1OFCX 4GB31 5FPAA 2DPUA 4GXOA 3HEFA 3VD7A 2A6TA 4J00A 2DTWA 3H1MA 3ZOBA 4GGGA 2R042 3PTRB 1BMV1 1RRJA 2GSYA 1H8TC 3CJQB 3VSLA 4ENMA 2R32A 2HYJA 2FXAA 2R4GA 3V0BB 3WNPA 1PYVA 3GDBA 2PMZA 1NHAA 3WE2A 2OVUA 4CDQC 4CYDA 1JI6A 1A04A 3VGIA 4KGGA 3IRRA 5FZ0A 3E6DA 2WY7Q 4ARYA 2CMPA 2CWMA 3MF6A 4RSUA 5DPNA 1VQOI 1G3TA 3DKQA 1BBT2 4CH7A 1ZRRA 2MW8A 3POFA 4CCNA 2WAEA 2VODA 1OMIA 5JOWA 4L5IA 2WWUA 3W3CA 5C44J 3G73A 2BTVC 1PGSA 5JPMB 4CEYA 5L19A 3ENRA 2WSUA 2Q8DA 3BY6A 5FZIA 1ZBA2 4XCAA 2ZJRF 1U8BA 3SKVA 4KMUX 4HN1A 1YITI 2ZKNA 4K1YA 4ZJZA 2X53S 2QZ2A 4GKYA 2VPRA 3VKFC 1UY1A 1ZRCA 1ZA4A 5BNNC 3POWA 4NPRA 4XURA 3KGZA 1F4KA 1Z0HA 2ZFWA 3K6GA 3OG2A 2J1TA 4ES9A 3SFZA 4JKMA 1PVC2 5FYIA 1Z7UA 3GBGA 2YC4A 2PHRA 5KR7A 1C1LA 2R043 2O5RA 1DGRM 3E1F1 4ZYAA 4KU7A 3HC7A 2VCAA 4R4ZA 2FCUA 4DMIA 5F2SA 2AACA 1FWZA 2BPA2 1H2LA 2A5WA 2XXZA 1TNSA 3PLQA 1BI2A 3E6BA 2M45A 1UOFA 2VZ1A 3CL1A 5D5XB 2CW7A 1MDMA 1RUH2 1YQ6A 4PJMA 4G94A 1BBT3 4A3CJ 4DZJA 2ARBA 4O5VA 3PSIA 2JDHA 2VC0A 3ZIWA 4RQPB 1ND3B 4E4ZA 1QOTA 2X5IB 4NQWA 4CDQA 2D43A 2E31A 5APAA 1W3VA 4XSZF 3TN93 1CZSA 2F17A 5H20A 5JFRA 3J9SA 1D8JA 4L9TA 2CSOA 4K9SA 4DPNA 3RYKA 5LRSA 3WXPA 4EJOA 3MBWA 2CUJA 1D2QA 3OBRA 3SXYA 1FY7A 3N7JA 1TWGJ 5E1WA 2R7RA 2JENA 2Y6KA 5C7GA 2CV6A 1H6XA 3W5NA 5KAFC 5FQ0A 1LGNA 2OQ6A 1W4MA 3C7FA 1SD4A 2PG4A 3H9QA 1XG1A 5BNNA 1X4OA 2VE8A 2WV0A 3AP7A 1TQMA 4OQ8A 4QX7A 1GDTA 1XD7A 2E7WA 1Z1DA 2HEVF 1FOWA 4A41A 3I4PA 1RUH3 2MD0A 2FNPA 1CIWA 1SLCA 2DT5A 2VKDA 3D0SA 1HB1A 5ABJB 2DOFA 1UN1A 4BHBA 3GTPJ 1POV3 4JGYB 2HXIA 2VKHA 2EXKA 2DA3A 2HTSA 3AJZA 3AFGA 3LSHA 3RNSA 4GFBA 3MAJA 2W68A 1JYIA 1AYN2 4NAOA 5JIUA 4QSHA 3D6EA 5LCWL 3OY8B 4XMAA 1XSXA 2ELKA 3MIDA 4CICA 5HV0A 3RZLA 2ARXA 3CCSI 4JRLA 5I0UA 5F5AA 3B01A 4Q4X1 4GWIA 1VAKA 2A3WA 4YFNF 4OLLA 1GYKA 1ODMA 1ZGJA 4FT8A 2Y6LA 4AVPA 4IJAA 3K4BA 1JHFA 3FZVA 3V65A 4E7HA 4AVBA 2QJVA 3OL4A 1HXS1 1VBB2 4LQRA 3TYJA 1P7JA 3WQBA 1J58A 4XTMA 1FOKA 1PO11 1BOBA 5C3RA 1WLCA 2WNVB 1QHHD 1MSEC 5KHIA 4MGRA 4MLOA 2E1OA 3JU9A 2ZJ2A 1OKOA 1F4AA 3CQZJ 1W0PA 2P1BA 1DP7P 1OVPA 5B4XA 2DMPA 1BIBA 3WP3A 3LQCA 3WU2C 4CU9A 2VB6A 2DFCA 2HEOA 1YQ5A 3J7HA 2FF4A 2C4XA 5CA6A 2ESHA 4DYQA 3I0TA 4OOIA 3S57A 2V9VA 1OYIA 2YX7A 4AFDA 2E33A 3REOA 3KV9A 1AYN3 1TMF2 1BC8C 2JVHA 3T09A 4MXWA 4FPJA 4NRMA 2GQQA 3AMNA 3CDLA 4PJJA 5K4LA 5GJ6A 1X3UA 5F08A 1ENRA 1QVTA 2HEWF 1LAJA 4G6QA 2CQQA 1LEAA 4TXWA 2E7QA 4OMYA 5A33A 3D5SC 4RS5C 1VBB3 5C3QA 3RVHA 3O1MA 4GALA 2FBEA 2VAUA 5HLGA 3RZKA 4DXTA 1BXHA 2YB7A 2UXXA 2EICA 3ZCOA 3BG7A 1K7AA 3CLQA 4OMDA 3LSPA 2ZEZA 1WCQA 4FHTA 5AIPA 4IV3B 1DFQA 3M3QA 3BOPA 3UJOA 3KETA 4WM8B 3K0LA 3N9MA 1EJ9A 2EV5A 2DDAA 4AQTA 3DPTA 2FDGA 1QEXA 1DQ5A 3HPNA 2RQQA 4IOCF 4G4FA 5C6CA 1LECA 4XLNF 2A6VA 2UY8A 1TME1 1V3FA 3LSDA 5JVGF 5E89A 4BXXJ 1TMF3 3PVBB 2Q2EB 4L0ZB 2XBO2 4JGZB 4HANA 4IE5A 4CUBA 1PZ8A 5LB6A 3TDZC 2KIMA 1SLIA 1LOCA 5FKBA 4HVQA 4Y1XA 1VQMI 2ZMKA 3MFCA 5L3DA 3NV4A 1JI8A 2ZACA 1H2MA 1MKMA 2NS7A 1SCSA 5JR2A 3AMPA 2V1UA 4HG2A 5J36A 2ETHA 2X6YA 1BZWA 3HKZA 3LFIA 4HSLA 5FUIA 1OF3A 1OCPA 1LVAA 4XKVA 4XFIA 1RHI1 2YBSA 5BNGA 3I3EA 3BIWE 1IS5A 3S7EA 1VMHA 2DBNA 4MADA 4Z1VA 4L9JA 3B00A 2Q1ZB 3BOQA 5L9VA 4S2FA 1L7RA 5KVRA 5IYCJ 3ZYFA 2Z79A 2IVJA 2VQGA 4BJTA 4M3BA 5FPZA 2GZWA 1YI7A 4AQ6A 4K3UA 3KIOA 5FD5A 1MNMC 1W6OA 1US2A 4CCMA 2IRFG 1S0BA 2L4MA 4LB5A 3K51A 2WLQA 1ZVFA 1MS9A 3H9JA 1ZRIA 3PURA 4X0GA 1WKYA 2BVLA 4P9WA 2XBO3 1Y0UA 2G9GA 3KPHA 3CMGA 1UHSA 1SDWA 2UYBA 1PO23 2EXIA 2PBIA 3O8HA 2WFPA 3MN2A 4FO9A 4QTRA 4A2UA 4BWOA 3ZN6A 2WS92 2L3DA 3WW3A 4QX2A 3IH3A 3BCAA 1MMDA 2L4AA 4M72A 2XPJA 5FLIA 5GP9A 1APLC 2KJBA 4FPYA 1WSUA 1FNZA 1TW2A 1MQTC 4YEJA 5FKLA 1WCKA 2BFUS 2NMNA 2GA1A 4R9AA 4Z6YA 4I98B 2YSRA 1UMHA 4N7IA 2DV9A 3LQRA 2L2OA 1LNSA 1XBFA 4UI9L 5FZ4A 1DGWX 4XBFA 3ZQQA 2Y0IA 3QAHA 4D7TA 1ZTRA 3BP8A 2VMEA 3NQHA 2VBDA 1SPPB 4HF1A 3Q3SA 3BQZA 2Y64A 1J09A 2W08A 3GFLA 4KI5M 2HPIA 4BQAA 1OLQA 2WFF3 5E1ZB 2ICWG 3Q9OA 4XLCA 1OLME 1FTZA 3H8OA 2Z33A 4HF0A 2DLLA 1ZBE2 4RR3A 2PMUA 3TOJA 5K5QA 1G3SA 2RS51 3HOUJ 3J81K 3BR2A 2XASA 4IVNA 4PBOA 1SLBA 1TZOA 4IEYA 2VULA 3TGNA 1SANA 2VUMJ 4MVTA 3KF3A 4LBNA 2HTJA 1H8VA 5B66C 5IVFA 2DCZA 2EFOA 4N8MA 1VQKI 2R7WA 1RC9A 5CFCA 5TGTA 4DB5A 1MJ9A 3CEWA 3TWIA 4HV6A 5DDGA 2EIBA 1XMAA 2HFHA 4A3IJ 3IDBB 1OI6A 5DXDA 5DD8A 4Y17A 2AH2A 1OKQA 1GV2A 1WCSA 4BJ5C 2P3KA 2EZIA 1MQTA 4U36A 4QQPA 1REDA 4BB3A 4CCOA 2EFWA 4RGRA 2ZX0A 4X6AJ 1SD6A 5DD4A 3QRFF 5B1BH 3C2BA 2M7AA 5FREA 1EV7A 2STTA 3ROUA 3DBLB 1W5TA 1R1UA 3FHQA 2LFBA 3Q8AA 1SMTA 1U5TB 1DQ2A 1J83A 3D4KA 4QPIC 4F83A 1MZFA 2QQAA 4XFBA 1PUEE 1R58A 1YW9A 3ZMTA 1VBD1 1XGOA 2MPFA 3ZXEA 3HOBA 2IPQX 1XDUA 3K48A 4RB3C 1PVXA 1W2TA 5L7OC 1ETKA 2O8KA 1Z7S3 1LKNA 4IEJA 5JLWA 4BE2A 1RUF2 2WWJA 1AHDP 3ETPA 1VBE3 5BPXA 3RKXA 3V42A 4BLIA 5C33A 1RC6A 5HS7A 5C8CB 1MD0A 4QB6A 2ZSIB 4C2TA 2P6TA 4QB2A 2E1MC 1OBNA 4RGAA 5K0UC 3FLPA 3IPVA 1XYOA 9ANTA 2GXGA 1H6YA 4KT6A 5J09A 1G59A 1SBDA 4FQZA 2P34A 1VRBA 5FUPA 4F55A 1Q56A 3ZFGB 1AX0A 3VFZA 4LK1F 2OW4A 4PQ9A 1HQLA 1RXGA 3KEOA 3U1KA 2QZ3A 3VPRA 3GJBA 4HN0A 4INDA 5ACA2 1T6BX 1LFUP 3QP5A 2IS2A 2YFUA 4KGQA 5EXOA 3D8CA 1PIV2 4PSXA 2QDRA 2ZJQF 1LR5A 4FPGA 2ESNA 2Y69H