1ZRCA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrcA01
2G7UA 4CXFA 3TOBA 3ZMTA 3E6DA 4HSLA 1QPMA 5ILSA 3VEPA 3K9TA 5LRSA 1WQ2A 3SXYA 1USTA 1V70A 4QMAA 3VODA 2EA2A 4UBHA 4LLNA 3QP5A 3QPHA 4QGNA 1L0OC 4P96A 1C0WA 4MX3A 3DKWA 1IN6A 1SD5A 2VN2A 4I2OA 4R8HA 1YW7A 3HRMA 3HT2A 3TO6A 2GC3A 4OMYA 4RGXA 1SFXA 3SCHA 4WXHA 2EA7A 4KMUX 3HHGA 3LZZA 1EH6A 1GQHA 4OU0A 2V1DA 4A6DA 2P5VA 4OLLA 4EGYA 1W7PB 3MZYA 5KBFA 2EV0A 2HEOA 3I53A 4XSZF 4WXDA 4MZUA 3R60A 3F22A 3D5LA 3T8RA 2K27A 3L2CA 3F3XA 3JAMZ 2VBYA 3CUQB 1QBJA 3S2WA 1JUHA 1XCVA 2XROA 3R0JA 2P17A 4OIOF 3ZP5A 4GYGA 1VR3A 2OZ6A 2DPDA 2M5WA 2LF8A 4U0WA 3LQQA 1P6RA 4HF1A 1DP7P 4M6XA 2F4PA 3WW3A 4I0AA 4UUVA 4AVBA 3ML6A 1SFUA 4XFGA 1PDNC 1ODDA 1R22A 3P9IA 5I0SA 2ZJ2A 1J75A 4FT8A 4TLFA 2ZMEA 2CAUA 2DQLA 3CO7C 1P92A 4ENNA 3FMSA 2IXIA 3LWCA 1KU3A 3WW2A 2MLGA 3TNPB 1X8MA 3HRTA 4ESFA 2D1VA 5FLXK 2K0GA 1LJ9A 5FCCA 1LEAA 4ZU4A 2DBBA 4QM9A 5KHKA 1HSJA 3C18A 1BN5A 5D6FA 5ILUA 3EYYA 2K7LA 4EVIA 3RZZA 2GZWA 2K86A 4EM1A 3WGGA 2RQPA 5LGTA 4HSJA 1ULYA 1Q3EA 2Z5UA 4OINF 2CGPA 1MGTA 1U5TC 4HX4A 2FSWA 4ONUA 1ZVFA 4UHTA 3KP3A 3J81Z 3WE3A 4GO1A 3OD0A 5JSPA 2STTA 2W24A 4JK1X 3HUGA 5KHGA 3J7AO 3FZVA 2HJIA 1XMAA 4KWLA 5KK1A 4LG0B 3ZN0A 5BQTA 3HQXA 2MNGA 3IKVA 5ILVA 2G9WA 3TGNA 2E1NA 4ENMA 2MC3A 4UXNA 5C8WA 3KP7A 1DZTA 3HIFA 4EM0B 2WFPA 2UY8A 4FX0A 3MDPA 4WXCA 1QO0D 1RL3A 5K5RA 1B9NA 4EJOA 2XAHA 4H7LA 1MKMA 3MQ0A 2YX4A 4Q5SF 4KMFA 1K78B 4RAZA 3MZHA 1EYBA 3U1DA 5DCFA 5E8GA 2ZKZA 3FM3A 3N4MA 2FMLA 2OZUA 5BMZA 4G7HF 2QVSB 1TQPA 2BNNA 2W84A 4EGZA 4M73A 4ORFA 2B0LA 1MDMA 5BPIA 2V1XA 2R7DA 3HSEA 2GQQA 4MQ9F 2MA3A 1WRJA 5H6QA 3TOAA 1RUOA 3ZMUA 1U8RA 1CF7B 4M71A 4NB5A 2O61A 1J5YA 1R1UA 2IT0A 3NKTA 2M8EA 5HLIA 1ONVA 2W85A 3SQNA 3V8LA 3IRRA 4R52A 5DD4A 1KU7A 1GVJA 3IWFA 1XGNA 3GFIA 2HKXA 5ICEA 5F1RA 2B5HA 2QDRA 3EYIA 2TDXA 3WTVC 3FMQA 2GC0A 3ETQA 4FBFA 2COMA 4LEJA 4ASNA 2DQRA 2ZBKA 2KJCA 3IC7A 2PQQA 1USSA 3H3ZA 2F5EA 2PJPA 2EFQA 4A6EA 3ES4A 3FF5A 2KRFA 2Y0MA 4RB2C 2KIFA 5H6RA 2Q30A 5I0RA 4MTDA 3U2RA 3NQOA 2EK5A 4MH0E 3E5UA 1ZZ8A 1OPCA 1IXRC 5E17F 2P6SA 1OMIA 3GF2A 4DNCA 3Q5FA 5EEHA 2UYBA 3T1BA 4IERA 2VE9A 3CLPA 1XGSA 4MTEA 3KZYA 2UZKA 1FYLA 1FP2A 1Z6RA 4CHUA 2A69F 4G6QA 1KQ8A 4ENJA 4IVNA 3FZ3A 3FHZA 3PFIA 3GFLA 3F8MA 5FQ0A 1BBYA 1ZAOA 1BIBA 1ON2A 1O4TA 4J1XA 3R4KA 3FJSA 1IN4A 1ZRRA 2XKPA 3VFZA 2K4JA 1J59A 4XF3A 2QQBA 1S29A 1L3JA 4ZU5A 1B9MA 1R00A 1G6NA 3WG9A 1E2XA 4CDGA 4NHJA 3HOTA 1T39A 1YG2A 1FOKA 2NRAC 3I7DA 1NE4A 3R61A 4XRFA 2W57A 2M1BA 3Q9VA 5J6XA 5BY5A 4JQFA 4H0EA 4U0VA 2ESHA 4HX7A 3REOA 4RB0A 4META 2DPUA 4L5JA 2XLFA 4BIFA 4CGZA 4EROA 1WLTA 2ZCWA 2V79A 4BXUA 1J7KA 1UHMA 3KGLA 3U10A 4IXAA 1YS6A 1I6XA 3HSFA 2FOKA 4IRIA 4HZFA 3OV8A 5FLHA 3I0TA 4Q47A 2MBFA 3ZDSA 2DCTA 5FD5A 5I8YA 4QM8A 3ZQ7A 5FLJA 5ICGA 3HRSA 1HSTA 2XLGA 3PLQA 5BUVA 5L3DA 1KGSA 3G3ZA 3SMHA 1IUYA 3M8EA 2XAFA 1YW9A 4UV9A 4LUKA 3WODF 4ZYDA 3WTZA 3K69A 1JGSA 2Q0OA 3H1YA 2Z99A 2OYZA 3SZTA 1YFYA 3TDZC 2PA7A 4G8XA 5E18F 3BZ6A 3P9CA 4MGIE 3P9KA 4AVAA 2QQ9A 4XF0A 5FB2A 3M3IA 3EDPA 2Z69A 4UBGA 1I5ZA 5HS9A 4UV8A 2R3SA 1CAWB 2B9UA 4RS8A 4D0PA 4CZZA 4WZCA 4O9EA 3O2PE 2FRHA 1UW8A 3JAMK 4YSFA 2RV8A 4IEPA 1PUEE 3K0LA 2OPKA 1IN7A 1H9GA 4XBFA 1GXPA 2P5LC 1CAXB 5K5QA 2UXNA 4A2UA 4AD9A 5BV6A 1LNWA 3EO6A 1SD4A 2MHFA 2A5YB 2HZTA 2ET7A 2M87A 4EWAA 3GXOA 4AVCA 4A5MA 4FAHA 3K1MA 5AIQA 4A0XA 2V9VA 3ERED 2JRTA 2O03A 4HN1A 1IN8A 1FI2A 4X6RB 4XFBA 4HVQA 3RJPA 4N9IA 5LEJA 5JFRA 3ECHA 2E7WA 1H9TA 4HBLA 2FBKA 2UWMA 3COAC 2C6YA 1BI0A 2HTJA 2DAOA 5FLIA 5FPZA 1DZRA 4L5IA 1LKNA 4G9YA 3E3VA 1MZBA 4P5OA 4HDVA 1ZGJA 3J81K 3RPQA 4EJTA 2OAZA 4MQVA 2ATFA 3NVCA 2KKOA 4EMSA 1TQIA 2V1UA 4B29A 1FSEA 5FGMA 3ZMVA 3BCWA 4IRHA 1V4RA 3QAHA 4BHBA 2QENA 3QRFF 2KJBA 1Y9QA 3U0ZA 3QPTA 1R36A 1U3EM 4WCGA 2UY9A 3TKYA 4X6QB 3C1DA 1FY7A 3QP6A 2XAQA 2BBYA 3DF8A 3C7JA 2EVXA 2DTRA 4XETA 3BWGA 2XASA 2JPBA 4IJAA 1Y0UA 1RNLA 5K1YA 1DDNA 5LHGA 1ZRDA 2F5FA 3FM5A 1ZZ9A 3RKYA 1F9NA 4RGUA 2FMYA 3BJOA 4UVCA 1ZG1A 3ST7A 5D5VB 3UKVA 3L09A 1L3LA 1F4KA 1AWCA 2IXJA 2BNOA 1BIAA 1CAVB 4PJYA 2OD5A 5F6FA 1TW2A 1STZA 3H7YA 4HQMA 3ECOA 3IBMA 3KEOA 3GZ5A 2ESNA 2UYAA 3M9AA 1HBXG 4ZZLA 2XV4S 5T3NA 3V7RA 3WE2A 2Q2EA 5CVUA 1LB2A 1R1VA 1VJ2A 2BYVE 3KFWX 4AVPA 4IPAA 4YFXF 2QBYB 2FEZA 1TQMA 2VT2A 3V7CA 3DEUA 2F2EA 4L9NA 2VE8A 1T2KA 4KT5C 1U5TB 4D7TA 4FX4A 2JZYA 3MFKA 4K2EA 1LR5A 1V3FA 5D5WB 4P9UA 1O3QA 2HDCA 3CL1A 1FC3A 2V6CA 1DGWA 1J58A 2H6CA 1Z1DA 2VODA 5HLHA 5I0TA 3SCFA 1IRGA 1QWRA 3DFGA 2VECA 4RB3C 1ZH5A 1UIJA 3H1MA 2J5OA 3D0SA 2QZ8A 4N9HA 3TO9A 4AWXB 4HX8A 2XKOA 5CJ9A 4ENKA 5LRRA 2P5KA 3JZVA 4IEXA 4K8FA 1QGPA 1S3JA 1SFEA 1ZZ7A 1VTNC 1ZZ6A 5D5XB 1IRFA 3MWMA 4D7SA 5CVRA 2PAKA 1J1LA 1WI9A 2VT3A 5CLSA 4NVPA 3F21A 1RI7A 3E6MA 4HVOA 2ZKLA 3BALA 4AXOA 4Z2YA 1FNNA 2IA0A 1F5TA 3HSRA 4HV5A 3U9GA 2VPVA 3KSCA 2YPRA 3IRQA 1NXMA 2BEOA 4E2GA 1YFHA 3KP6A 3RYRA 3GUDA 3R6SA 2PAEA 1LRHA 2EAAA 2XIGA 4JBAA 1ZREA 4AQ2A 1QY4A 2NNNA 2D2WA 2D93A 1UCRA 1O3RA 4PGGA 3RKXA 4YNIA 4JTNA 3WTXC 2CV6A 1HKSA 5CVIA 5HDKA 2P8TA 4F8AA 3IL2A 1PP8F 4TV7A 1XMKA 1RGSA 1RUNA 3F8NA 4KIGA 4AQ6A 2QM3A 4KN7X 2FF4A 4L9TA 2Q1ZB 4LB6B 2OBPA 2IVMA 3KLOA 4DINB 3W6JB 3KCCA 4I01A 1B59A 2RNJA 5HDNA 4J1WA 2LSOA 4L9JA 1O5UA 1XD7A 4IEZA 1GQGA 5J48A 1REPC 1S7OA 3E5XA 2LKPA 1XSDA 4MV2A 3Q9SA 1GHCA 2JT1A 3NSTA 4JVAA 1X3UA 3EHKA 2L4MA 5KHHA 4PIXA 3BJ6A 4PDKA 1WKMA 3CUQC 3F8FA 1EH8A 5A2QZ 5E1XA 2QYOA 3H1WA 3ZMDA 1TQ5A 4MNUA 4OFGA 1ZN2A 2K4BA 4OIRF 2OU2A 2FQ3A 4KYWA 4Q29A 1HXDA 2RDPA 4KWKA 1SEFA 2ZMEB 2WTEA 2X4HA 3V7SA 5CVJA 2QLZA 1XSXA 2HYFA 2KIUA 3K1PA 1EV7A 4IEQA 1YO5C 1QNTA 3HTSB 2HTSA 4EWEA 3BOQA 2FA5A 1O3TA 3I59A 4I7HA 4O3MA 2P4WA 1XDUA 5LGUA 2E7XA 4YYOA 4KL1A 4HW0A 3V8KA 4Q4ZF 1G3WA 4A0YA 2A6EF 4I3PA 2QQAA 3EETA 1ZNPA 1YFXA 3RKWA 1MJBA 2CYYA 1PP7U 4EWDA 1T98A 5FDBA 5E1RA 2D45A 1ON1A 3CO2A 1DUXC 4M9SA 1YFWA 5LHIA 1VP6A 1K6OA 4XF4A 4I98B 3FMRA 2D1HA 4UVBA 2XL9A 4ESJA 2L02A 1YIOA 1ZYRF 1RC6A 4MGKE 1XGOA 5FO5A 3SHFA 4EJVA 1H1IA 2PMHA 4KNYA 2EFOA 1OD5A 2Y75A 4U7DA 2O6GE 4FAGA 1G4DA 2GC2A 1ZLKA 1SQ4A 1R58A 3VHRA 1BC8C 3F6VA 5JSOA 1IZ1A 1W7PD 4MGYE 3ULQB 1H0MA 1FWZA 1P4AA 5I8SA 1ZZBA 5JHUA 5CU1A 1HQCA 2CQKA 3V8JA 1FYKA 5E8IA 1YHFA 4RD7A 5I8TA 4YRDA 4KN4X 4XSXF 1S7AA 1SD6A 1CAUA 5I93A 4O9GA 1UHWA 1LDJA 3F8CA 3JSPA 2J5PA 4Y17A 1NHAA 2IP2A 2O8XA 4G6DA 5DCMA 1MDMB 2IXLA 4MUVA 3LQRA 2DU9A 2PAMA 4HN0A 4KDPA 5L3FA 5FFXA 3PNAA 3CTAA 2LDUA 3I4PA 2HS5A 3KP4A 4Q48A 2IW5A 1X8EA 3TDUC 2M45A 4CYDA 1D3YA 1R7JA 2Z9OA 3FX3A 2STWA 4QLCU 4KFCA 3KGZA 2XVCA 4RGSA 3DPLC 2W25A 4FHTA 2B8MA 4UXAA 1P4WA 1XDSA 4GXOA 3HTUA 2A68F 1YYVA 4KUMA 1J3PA 4L0YB 3HT1A 1KU2A 1YFUA 5AVPA 2QNKA 1KQ9A 2OZJA 2P7VB 1A04A 3NL1A 2FU4A 2ISZA 2YX7A 3V4GA 3FXRA 5D5UB 3WGHA 5IT3A 1SMYF 3BP8A 1RZ4A 5J8CA 2A3SA 2H6BA 5HDGA 1R5GA 2GXBA 2XUBA 2GH2A 2WC2A 1G3YA 4XLPF 2IJLA 1B1BA 2RVCA 4LULA 3EQLF 3NEUA 4ZYHA 4G7OF 1BI3A 2PYTA 1IPKA 5KHJA 3ZMSA 5DEQA 4YG2F 3M7GA 3QACA 3GW2A 4OIPF 5FQ0B 5BPXA 2UXXA 4U7BA 3PVBB 4R1HA 4L2NA 1AOYA 4DQ2A 2BNMA 1D5VA 2ACJA 4JTOA 3T8TA 4MEXF 3S7IA 5BS6A 4PGHA 2ETEA 4OOIA 3O14A 4KA4A 2GU9A 5D8KB 1ZHFA 3E5QA 1O3SA 1S6LA 4HDUA 1IPJA 1Q43A 1FX7A 2NS0A 2F5DA 4PCQA 3DXJF 3KZZA 2IRFG 4LA2A 5D6EA 4GYIA 4CO8A 5KHIA 3SCGA 4Y15A 4LTAA 4BAYA 5DYMA 2H09A 2E9QA 3N97A 2LNBA 1OYWA 2Q8KA 2PQ8A 1IF1A 4WX9A 4MGZE 1TBXA 2XAJA 4P9GA 3ISPA 4E2SA 2QWWA 1SAXA 5DDGA 1JXSA 2PG4A 2HFHA 1LDDA 1ZGAA 2GWRA 4LJZF 4PIYA 2L54A 2DI3A 1LEBA 1ZX5A 4ESBA 3BDDA 1OYIA 2Z2SB 4I0BA 2PFWA 3EBRA 2XRNA 4ZH4F 4RGRA 3F8BA 3T5XA 2ZXJA 5J8FA 4GULA 4XFAA 1NZCA 4L11A 2L4AA 1YLFA 1W7PA 3CO6C 5D4RA 2CFXA 3BJAA 3GYDA 2D40A 2QJVA 3I54A 1DPRA 2CSOA 4LB5A 3CUQA 4HBNA 3HHHA 3BU7A 1UB9A 1YQAA 2NNYA 5J3UA 3LAPA 2WWYA 1O5LA 1YLLA 2EA4A 5EFUA 1E17A 3BPVA 5L3GA 5A2QK 3CF6E 5LLQA 1RTVA 2EV6A 1FP1D 1FBUA 3GZ6A 5FPXA 5JVTA 4WBBA 4LMYA 4YFKF 1QXJA 4M74A 4O6JA 2L01A 1HW2A 2MLKA 4IEOA 3B73A 3I58A 3OF1A 4LK0F 2PEXA 1YUDA 1BM9A 2IA2A 3PQKA 4RB1A 3WU0A 3MCZA 4LGWA 1EP0A 4N0BA 4AIKA 4BHPA 4ETSA 1TTYA 3H92A 4F7ZA 3SXWA 2BE5F 1QZZA 5TRDA 3CDHA 1CGPA 3TO7A 2D5FA 4IESA 1O7LA 4Z07A 4U88A 1HKTA 1Z91A 3EUHA 3SZPA 3K2ZA 1XE7A 3EJKA 3FXUA 2PFBA 4P9FA 5DUKA 4LA3A 1IAWA 4IRGA 4EQQA 4ZU7A 1PMIA 1OI6A 5JI6A 5ICCA 3J80Z 4ZYEA 3H9AA 2IA1A 3GWZA 3HRUA 4Q0SA 3BB6A 2DO7A 5IT9Z 3WTYC 3WW1A 2Y48A 5D1IA 2FQPA 5FD6A 2HKOA 3P7NA 4LG0A 2O8QA 3D0JA 1WSUA 1YTYA 4M6YA 3CUOA 2XLAA 1NYWA 1RIOH 2QCSB 1F1ZA 5HLGA 3NW4A 3HYIA 3L00A 1J3QA 3MAJA 2ZNZA 3C3WA 3E6BA 4YARA 2XGXA 4XFFA 2FNAA 2R7FA 5HVQC 3OGJA 3RDIA 1K78A 1Z05A 2L3DA 4IETA 6PAXA 4Q0PA 3UKNA 3KEQA 3RYKA 2HGCA 1OYYA 2PLYA 3F72A 3IKTA 4O5VA 1UPIA 3CJNA 4BH9A 4LD5A 4I09A 4YIFA 1TNSA 2MH9A 4XEZA 2HQRA 1B6AA 4QGLA 3HOSA 5LGNA 3TQNA 2ET1A 5E1WA 2CAVA 2XAGA 2CG4A 2C0ZA 2F5CA 4IEWA 1ZARA 5I91A 1FPQA 1TLHB 2JPCA 4MEYF 2FBHA 1J3RA 2ZO4A 4GCVA 3LFKA 1CF7A 1W4MA 4BHCA 1I1GA 3OOPA 1Q1HA 3ZMZA 3LAJA 3GFMA 1GXQA 2JSCA 1XGMA 2O1QA 4UVAA 2IPQX 1XCBA 2IXKA 2HWVA 2PBIA 1MD0A 4EV0A 4LFUA 3RPUA 1FXZA 1BJAA 1R1TA 3LOIA 2FXAA 1FBQA 4ZYGA 1QXRA 4AIHA 3JTHA 3KP2A 3DN7A 2VQAA 2GAUA 2PI0A 2QUFA 4HLXA 4HV6A 1XE8A 4Q0VA 1QZYA 4E2QA 4KWJA 3L7WA 5JAXA 3DV8A 2O0YA 3ROUA 1U2WA 2VBXA 5LBQA 4QXKA 3SFZA 5E1ZB 3DL3A 2GIVA 5DV5A 2Y0OA 4M72A 3KMHA 4HLYA 3BPXA 2BV6A 4JV4A 2RC4A 1YW8A 3DQVC 4L9VA 5JCTA 3CJXA 3IDCB 4R79A 3GLXA 3KETA 2OQRA 4QGMA 5EEGA 1PM7A 2DT5A 3OCPA 4S04A 2JTVA 4M9ZA 2IXCA 3O6BB 4KU8A 2X0LA 4QX5A 1ZZCA 1X7NA 1JE8A 3R0AA 2FBIA 1FBSA 2DLLA 1CX4A 5E20A 1NE6A 2GA1A 2QVOA 4WF2A 3IIAA 4IHTA 4LLLA 2DK8A 3ELNA 3I71A 1D8KA 3NJZA 1DGRA 2ADUA 1EY2A 3EQEA 2ELHA 2KIMA 5H20A 5ICFA 3WGIA 1KU9A 2WV0A 4HA8A 3GO5A 3ABUA 4E70A 4BNCA 4CICA 3IHUA 1R23A 3MPBA 3BY6A 2ZNYA 3KE2A 3PQJA 4KU7A 4B09A 3T0YA 3D82A 2ETHA 1LVAA 5BXXA 4U0YA 2NYXA 3LWFA 1OFNA 2G7HA 4LLOA 1XN7A 1BI1A 2VXZA 4WVZA 2BGCA 4Z82A 3JW4A 5HS8A 4WWCA 3DP7A 2GA2A 2VBWA 1G3TA 3U11A 2RGVA 3K1NA 4KIFA 3LAGA 1K7AA 3SHRA 3GVAA 3ABTA 3H50A 4I02A 1TNTA 2IXHA 3H7JA 1OKRA 1ZG3A 4NQWA 1UIKA 1LQ1A 4LUMA 2VC0A 1H1MA 3RI4A 1YWKA 2AXLA 3FE5A 1IXCA 4IF4A 1FLIA 1MJ9A 2DW4A 5D8LB 4YFNF 1CAWA 1YS7A 1J9IA 5JSRA 3E97A 1U78A 3RIRA 4A5NA 4IEVA 3QU6A 2CO5A 2EV5A 2VOOA 4ZZDA 2O3FA 3WTUC 3LA7A 1WWXA 1CAXA 1P4XA 2IC1A 3S7EA 4KICA 5FLXZ 3DPTA 4XF9A 1JHFA 1B4AA 1Y3TA 4RAYA 1KYZA 2MD5A 5EZWA 3GEZA 2NAZA 3ZPLA 1J2XA 3ELKA 3LSTA 1BI2A 1DPUA 1KA8A 5J7MA 4B8XA 3GYHX 1ZG5A 3MEXA 3I59B 3H3UA 3WTWC 3I5UA 3LA2A 3ZN1A 4BYYA 4XFIA 5K8SA 4BQAA 4HLTA 1BOAA 2GXGA 5ED4A 2EJRA 3F6OA 2P6TA 1FZPB 2YU3A 5BOXA 4HOBA 3KLNA 4KIBA 3H8UA 2N7GA 4MGRA 2OA2A 5I0UA 2XHKA 4ON0A 3S0MA 5KVRA 5CVVA 1UCXA 1ZLJA 1MJAA 4LK1F 3RNSA 1ZRCA 1EH7A 2HYGD 5JR3A 5BPDA 2ZFWA 5ERIA 1HW5A 2OQGA 2GC1A 3I64A 2MPFA 3VOEA 2PTMA 3J80K 1UD1A 2YR2A 1T38A 2V09A 3CEWA 3CLOA 3M1EA 2KXLA 1WGPA 2LF7A 3LA3A 3GFJA 5IT9K 5HOOA 4Y13A 2AS5F 5C6CA 2M30A 5HI0A 3C3VA 5F64A 2A07F 4L0ZB 2K9ZA 1QQIA 4LLGF 4S05A 1TW3A 4WK8F 4IHSA 5AIPA 4XFCA 2VOPA 2FE3A 3WTTC 3M70A 1K79A 4MHGA 2MH2A 3ACLA 4A12A 1UFMA 3O3KA 2VBZA 3G73A 4YIIA 3FXQA 3TNQA 1O7FA 4HF0A 4OMZA 5D4SA 3E6CC 3WW4A 1CAUB 3QU3A 2PHDA 4IEUA 1Z9CA 1S8NA 1ZRFA 4XF1A 1J0RA 1XSVA 3OTFA 4HVRA 4HYEA 2H0VA 5JR7B 3BPZA 4G7ZF 5DCMB 2HOEA 3G7DA 2OA4A 4PIZA 2CW0F 1W5TA 5TJJA 1HW1A 3FWEA 2I45A 1I1SA 1Z7UA 3L2HA 3M8FA 5CYVA 2PMUA 2XL7A 1EPZA 2H94A 3FHIB 1CAVA 4G94A 4L18B 1SFNA 3IWZA 2DFIA 1D8JA 2EFWA 1I27A 1X82A 2EB7A 5L3CA 3RYPA 1FSHA 3GX4X 5CADA 5LHHA 2Q4SA 4HQEA 1XRUA 4UNOA 5L3BA 1IW7F 2VONA 3QOPA 3MYXA 5FFZA 2E1CA 1IN5A 2QBYA 1JHHA 4OIQF 3KP5A 2EWNA 1KQ0A 1OR7A 3VB2A 2P7CB 4XLNF 4EJUA 1U12A 2YSRA 1WA4A 2HR3A 4HF2A 4HMZA 2Z33A 1FT9A 1U5TA 3JSOA 2Q0AA 1SD7A 2A61A 2FNPA 4M9XA 3FFQA 2A6HF 2EFNA 1O57A 2PN6A 3WU1B 1LDKB 1T0FA 4P55A 4XFHA 2RN7A 2ISYA 5AONA 5HS7A 2D5HA 4IEYA 4EJWA 1SMTA 3WTSC 3USSA 2PHLA 1U6GA 1W5SA 1R5HA 1Z6TA 4A0ZA 3RTRA 1XB4A 3JTGA 3L9FA 4Q0QA 2H27A 4AIJA 4Q0UA 5E16A 3AAFA 1G3SA 2Z3YA 2K02A 1P2FA 4EM2A 1HKQA 4HAMA 5DUIA 4GGGA 3ES1A 1IXSB 2EFPA 4QWQA 1KYWA 5LEKA 2VC1A 1Q5OA 3W6KB 3NRVA 4PZJA 2DK5A 1T6SA 5DD8A 3IDBB 1BC7C 3GBFA 3BROA 2CWEA 5L3EA 3UKTA 3F23A 5K5OA 2RKHA 3B02A 2HQNA 1FYMA
chains in the Genus database with same CATH superfamily
3VGIA 2H1KA 3TOBA 5CFDB 4JDOA 1N75A 5ILSA 5FY7A 4E7SA 4AHWA 4K1YA 3K9TA 1NY72 1USTA 1MBJA 5GLVA 1VI0A 4UBHA 4LLNA 3LD8A 2K9LA 1WJCA 5JI7A 3PMSA 5FZAA 1MQTA 1D5YA 3HT2A 4Y5Z0 3SCHA 2JK3A 3TB0A 1CPMA 1W05A 1VQKI 4PJMA 1J09A 3UETA 4RL7A 2EXIA 2ILMA 4A6DA 4PDWA 1RMU2 3AFHA 4CCLA 1GDTA 4F93B 1W7PB 4CDWB 3BG5A 4XL9A 2RS33 2ARAA 1V0AA 3D5LA 3G71I 1D4M2 4Q27A 3F3XA 1B09A 3CUQB 4OHWA 1Y43B 3ZP5A 4GYGA 1W3XA 2M5WA 1HXS3 4UB8C 3S93A 3ZOIA 4LBQB 4JHTA 5J37A 2D44A 3Q8BA 2ZEWA 1R1A1 4AVBA 4DY5A 2ZXQA 5BNOB 1ODDA 3P9IA 2X29A 2DCYA 4FT8A 3SEEA 2CAUA 2X48A 5J40A 3BG7A 2IXIA 3LWCA 4OZOA 5DAVA 1KU3A 3WW2A 1AL22 3O5SA 3HRTA 1TEIA 2O0OA 5KHKA 4V2VA 5LZ6A 2F4MB 4CZCA 5ILUA 2VXDA 2GN3A 3B6CA 3FBNB 3HWJA 3HJRA 2BVMA 4XBLA 1LULA 2BY2A 3KV4A 3VBRC 3X29B 1FOYA 2R0QC 2RQPA 3A1YA 1Q3EA 2Z5UA 1VQPI 2CGPA 2FSWA 2B7YA 4IW3A 3G6JB 5B2GB 3O1PA 3H3VK 4Q8LA 3HUGA 4BE2A 5L7OB 1CN1A 1XMAA 3WG4A 4KWLA 1LOFA 2Z1DA 4OI1A 4FPGA 4XW3A 1ULDA 4AEDA 1YI7A 5ILVA 2WAOA 4UOJA 4UXNA 1RYYA 1P8JA 4AK3A 3FUQA 3A4UA 4P9YA 4A3MJ 3HQUA 4EM0B 4XILA 3HOUJ 4IKFA 4BJ6C 4WXCA 3RWKX 5DUWA 1Q8PA 2NOJB 1O6UA 1B9NA 1Z0HA 1VFCA 3ACGA 4RAZA 1PIV1 1V6JA 2HYKA 2FCUA 1EYBA 4XCAA 1WMDA 1HN0A 3U1DA 4RM2A 2VCAA 5DCFA 3NQHA 1RB8G 4Y1YA 2XH6A 1BVVA 2ZKZA 5BMZA 2CUZA 4A6OA 1NCQB 1DG6A 2BNNA 3AYDA 5A6QA 1I1EA 2IWGB 4K9SA 2DT7B 2QQNA 5CBLA 5FY1A 2B0LA 1COV3 1G9FA 2CL2A 4RQPB 5BPIA 5BNNA 1WLCA 3B93A 4GD4A 3ZSLA 3BZCA 2E6VA 4A3FJ 4MQ9F 1JN2P 1VLNA 2RM22 3DYPA 2FUG2 4PQQA 2BW3B 3TOAA 4NB5A 1BK0A 3GGLA 2YYOA 3NKTA 2AQEA 3OEBA 3IRRA 1TL8A 2JWTA 3VZKA 3ZXFA 3VD5A 3RZHA 2HKXA 1QQP1 5DAWA 5H9QA 3HG9A 4AFMA 1LNSA 2WQZC 3WTVC 2GC0A 4QDSA 5GZCA 3ZGKA 3ETQA 2OTJI 2BERA 1XNAA 2XONA 2KJCA 3IC7A 2PQQA 1USSA 3H3ZA 2X05A 2Y2ZA 4PFPA 4YZ5A 2V9KA 4ZYAA 1VBD2 3B9IA 4QXBA 5LY1A 2XQXA 4NOTA 2ID6A 3LIHA 2Y0MA 4K8RB 5EWSA 3NQOA 2L9VA 2BW8A 4MH0E 5LA0A 2DMNA 3FXOA 4COVA 2RS52 3GF2A 4DNCA 2WFF2 3UGGA 5E6HA 4LNVA 2VE9A 3WNLA 1Z6RA 2XB0X 2VJ4A 3SZGA 4IVNA 2HWC1 3BUCA 5IYDJ 3LSKA 1X4PA 2DVDA 3BVCA 1ETKA 1A5JA 1XNTA 4E8DA 1OLME 2XKPA 3VFZA 3CCQI 1HJFA 3QQAA 2WKKA 1B9MA 1E2XA 2NN8A 4NHJA 3RI9A 3IT8A 1T39A 1YJNI 3W2VA 1CR7A 4XRFA 3U78A 3RZGA 3HEFA 2W57A 4TWTA 1BJQA 3PJYA 3AMHA 1BEV2 1Y39A 2ZAHA 3LPFA 4L5JA 3ZQIA 1PK6C 1WLTA 2ZCWA 1QJY2 3MICA 4BXUA 1J7KA 2FX0A 3KGLA 3CMMA 4IGOA 3ZFGC 3T4HB 1I6XA 3HSFA 2VUCA 3DXTA 2F6CA 3ZDSA 1R71A 2HEWF 5FD5A 2XR4A 3HRSA 3I2OA 2V9PA 4QT6A 3TAYA 3G3ZA 4XLAA 2XAFA 4W6YA 2FZ1A 4PHZA 2BY3A 3NWKA 3EYPA 1ND3B 2OYZA 2Z99A 3SZTA 4UUSA 3LSMA 2BY1A 2EQRA 4G8XA 4FO9A 4AFCA 1FPN1 3CC4I 1OD3A 2QQ9A 1IDZA 2QUOA 3EDPA 4N43A 2Z69A 3DKXA 5HS9A 2B9UA 1RHI3 1QKQA 3JUUA 2NVUB 1TG7A 2JB8A 5FKMA 4YSFA 5J09A 1RUI1 2OPKA 3THCA 2P5LC 1OQDA 3FHAA 4Y1VA 1DYPA 1BKZA 4CP9A 3WD5A 1QNWA 1LNWA 1MEC1 4COYA 2ZBJA 1SD4A 5KC6A 4BMEA 2MHFA 2WAAA 4NDLA 2HZTA 4Y24A 2M87A 2D5VA 4FFHA 4EWAA 4AVCA 1IDYA 2JG8B 4Q4X2 2QQKA 2XBO3 2DYCA 3WVJA 2JDUA 3NMBA 2RE9A 3WU2C 4JZRA 3LSHA 4XUPA 2H8WA 3GTPJ 1H88C 5F37A 1R49A 5CKQA 3B5LB 5A6ZA 1WVRA 2DN0A 2HZDA 4HBLA 4M3CE 2TRTA 1BI0A 4M3EA 2HTJA 2DAOA 4XIKA 4NE9A 3AYCA 5FPZA 1OURA 3GF6A 3JRGA 2OV7A 3SISA 1BCXA 4P5OA 3KLSA 2DVAA 1Q56A 5FPLA 3JB4C 4PI0A 2OAZA 2ZS6B 3CNAA 2CS3A 1PVC2 3GTGJ 2KKOA 2A71A 4YW7A 2V1UA 1FSEA 3BCWA 4IRHA 1EAH1 2KJBA 2ZX0A 4CEYB 3U0ZA 5F5QA 2QQVA 3DTIA 2QZ3A 4WCGA 3TKYA 2XB6C 2CV2A 1FY7A 1SANA 2EZLA 4D3WA 1IO2A 4C2TA 2JPBA 5FKCA 3OPZA 3ZR6A 4Y4RA 2JE8A 3FC0A 2DU1A 3WP4A 4FXGB 2A6ZA 2F5FA 1X1BA 2FOWA 1F9NA 3BJOA 4UVCA 3ZMOA 3HXLA 2Y0SN 3UKVA 2DYRH 2R071 3WOGA 5EGOA 1BIAA 2QKLB 1G59A 3RMXA 5F6FA 3WQBA 3H7YA 2Q8CA 3NWTA 1REEA 2JDMA 1WJAA 1FX5A 3KEOA 2ESNA 2NVQJ 3M9AA 1HBXG 2XV4S 5T3NA 1S0FA 3MHZA 1VMJA 1PO12 3KFWX 4AVPA 4LPLA 1O4ZA 3IMMA 3FIWA 3UGHA 1TQMA 2VT2A 3DEUA 5FY8A 3A21A 2L9SA 1T2KA 1S2BA 3Q8CA 4CXXA 3FXKA 3MV01 3MFKA 4K2EA 4TYSA 3S1QJ 4LITA 5D5WB 4YGCA 1O3QA 5FYZA 4NIHA 3CP2A 2HDCA 3CL1A 2OT7A 1J58A 5FREA 1WKYA 1OA4A 1O4YA 3SCFA 2R6QA 1WCUA 1JJ6C 2XG3A 1QHGA 2ZSIB 2L2OA 2ZEXA 3TO9A 5IK7A 4AWXB 1TT5B 2QQJA 1R4MB 4CU7A 3K7AJ 5GZFA 4P9XA 2FDIA 2WZPP 3SJMA 4GB32 1S3JA 5FO9B 3MWMA 3A0KA 1P7IA 4D7SA 2GNMA 2E32A 1HF0A 2VZVA 1HB2A 1FOXA 1RI7A 4DJAA 3JU9A 1FNNA 1XYPA 1XC6A 2P6CA 2WZR1 1ULEA 2R7SA 2V7FA 1F5TA 3IB3A 4MGTA 1RUE3 3UR3C 1KEXA 1UZZA 2BEOA 2VG9A 3RYRA 2PMWB 1LRHA 5K4LA 4AQ2A 1QY4A 3LSDA 2VE1A 1HCRA 3WF3A 2E1MB 1IHMA 5F5IA 3BTYA 4PGGA 3RKXA 4YNIA 1ASJ3 2W00A 1HKSA 2P8TA 4B3NA 4XHXA 5B3SH 1RUJ2 3FHQA 4LBMA 2ZB9A 1RGSA 4NHKA 4AQ6A 4V2FA 3GLLA 5AFEA 4G3YC 5FUPA 4DINB 3H0DA 3PHMA 4AZZA 1KJRA 2BGPA 4UW5A 4BQ3A 3CJIC 2VZ1A 2LKPA 3GALA 1GHCA 3EHKA 2L4MA 5KHHA 1R4NB 4PIXA 4WVVA 1HRV3 1DQ1A 4HRIA 2Z16A 4FOWA 3ON7A 4Y26A 3VD7A 3JRBA 5EDNA 5E1XA 3K4MA 4BMBA 3ZMDA 1TQ5A 1VBB2 1ZGWA 1ZN2A 2WJSA 2XMLA 3A4CA 4RHV3 3F95A 4Y20B 2FQ3A 3ZPYA 1HXDA 5GLUA 3IAQA 3UNPA 4CDXC 3FFZA 1SCSA 2XRLA 3MBWA 3ASOH 1JUPA 4ZXEA 3J8F3 1XSXA 1WLDA 2HYFA 2ES3A 4MSVA 1UF2C 4QB2A 5F9TA 5KWRA 5GAEJ 4QQPA 2PQSA 4I7HA 4O3MA 5EPAA 3OUIA 4CDQC 1H8TA 1VRH3 4ARXA 2RDNA 2E7XA 1MW7A 4KL1A 2D6PA 1B35A 1JYVA 4I3PA 1PK6B 5IYYA 5CG9A 1ZNPA 3RKWA 2M8GX 1OHFA 1PP7U 4EWDA 4D6SA 4DEQA 1TWGJ 1DUXC 2KZVA 2ZMLA 1YFWA 4M9SA 1AYM2 1WZ2A 2O8OA 1KD7A 3JRDA 2X9DA 4XDOA 1TE1B 2G1MA 4MGKE 1XGOA 3OR1C 4FCAA 1UZYA 3PJQA 4FAGA 4BK5A 1YO8A 3CCLI 4DRVA 3F6VA 3M1CA 1IZ1A 3QH7A 1BMV1 4MGYE 4M0HA 3ULQB 3AL0B 1P4AA 1ZZBA 2L9RA 5JHUA 4AU7A 4YWAA 1I3AA 2BBVA 1HQCA 2RS31 2YBKA 4DZPA 1U0AA 1YHFA 1QPIA 1LVKA 3PUSA 5GLTA 2DVFA 3TP0A 5ABJB 1SD6A 4M6VA 4XAAA 4EQVA 4E6KG 4AGRA 1HXS1 1VNDA 3JSPA 2W5FA 4FXKB 5JIUA 1OOPC 4G6DA 3OYCA 1JUIA 5DCMA 1MDMB 2P2KA 4MUVA 5KXEA 3U75A 2LBFA 3LSIA 3C7OA 4KDPA 3NRUA 3GDBA 1W03A 1APNA 3PNAA 3CTAA 2LDUA 4FETA 2HWB2 3WG2A 1O4XA 4ARYA 3GZUC 1TZOA 1RUF1 1SFPA 4UFKA 9ANTA 1QJU2 1TVGA 1D3YA 1R7JA 3GM8A 3NNMA 2R7RA 3VD3A 4KFCA 1ND2A 4RGSA 2WNUC 4GJZA 3WZ1A 5C4JJ 4FHTA 1P4WA 4GXOA 3OL4A 3PUAA 2A68F 3ZSKA 4KUMA 5J1XA 1BXHA 2OPWA 5AVPA 2WA4A 4JQRA 4QDQA 4BLJA 1J84A 5FYMA 3GCWA 3V4GA 2HQ5A 5D5UB 4ET7A 3PTYA 5JVVA 5BNGA 2ZTNA 3I2HA 3DTKA 1RZ4A 2A3SA 2JDZA 2RMU3 5FXXA 1R5GA 2GXBA 2HI3A 2DODA 4FI9A 2WC2A 1G3YA 4XLPF 4DOUA 5A7PA 1D1BA 3EQLF 2DTWA 2VVEA 5JOWA 5KHJA 4YG2F 3WF2A 4K7JA 1NG7A 2VC9A 5FQ0B 4LO7A 3K4NA 2UXXA 1LOGA 3PVBB 4R1HA 5A3PA 1YE9A 5CFCB 3RZOJ 1D5VA 5HNFA 1W39A 4IE6A 4JTOA 3T8TA 4LBKA 2WNVB 2I07B 4MEXF 2WBKA 5BS6A 3AC0A 3WG7H 4KA4A 3DBLB 4DXZA 1W3VA 2GU9A 3I2JA 5JOXA 4BLIA 5FPAA 1LEDA 3ZPOA 1OFSA 2DA1A 2R7OA 1QVUA 2NS0A 1COV1 1TNFA 5FROA 1NG0A 3A0HC 5C5UA 3KZZA 2IRFG 4LA2A 1Q1VA 4CO8A 5KHIA 2AENA 3T4VA 3TBDA 2BRTA 3ZMNA 2CGOA 1DQ5A 2LNBA 3K70C 4MGZE 2WR9A 1OXCA 2QWWA 2AR6A 3POYA 3JBG3 1E0EA 4CDUC 3W21A 2M34A 5H9PA 1LDDA 3D5RC 1E5IA 2GWRA 2ECBA 2DI3A 1LEBA 1GWMA 3BYWA 3VBFA 1UY0A 4XNFA 5FMOS 1VAMA 4JCKA 1B72A 1IRZA 3F8BA 3T5XA 2WT2A 4DZJA 3WSOA 3VBSC 1XJAA 3CO6C 2GNBA 4KH9A 3AFGA 3POWA 3BOWA 2CFXA 4FPHA 2GP3A 3MKYB 1DPRA 1G9BA 3HOWJ 3M3OA 1VBC3 3TMOA 5DG2A 2Q1FA 2V4VA 1O5LA 3AG1H 3S5QA 2EA4A 4BEHB 1YJKA 2CWSA 3PL8A 5L3GA 3KS7A 3CF6E 3ZOBA 4IV1B 5LLQA 3S3NA 2CW8A 3H0GJ 1RTVA 5FY4A 2LM3A 3MLJA 3NJVA 4FASD 4WBBA 4YFKF 2DFHA 2VD7A 2VULA 4C91A 2NM1A 2AGSA 2VMEA 5HCHA 2GXAA 2AC1A 5TISC 2WSVA 4RB1A 1V55H 4LGWA 1JHJA 5L19A 1EV11 1IQDC 2YGLA 4BHPA 1MS8A 3OY9A 3VKLA 4F7ZA 2WBMA 1W9FA 3SXWA 5HXVA 1QZZA 2XJVA 4NUBA 1CGPA 1XNDA 2IS1A 1A6CA 4BQ1A 3I3BA 3EUHA 3DWLE 3FXUA 3EJKA 4YM2A 3FBMA 1AR62 1IKQA 1JTZX 1IAWA 4IRGA 5C9AA 1DQUA 4EQQA 1RUC3 1PMIA 2CQ7A 1OI6A 5JI6A 1ALYA 3U1XA 4ZYEA 3H9AA 3OYLA 2IA1A 3PUIA 3GWZA 1RRJA 4KWUA 1MNMC 1PGW1 5J98B 3CCEI 2DO7A 3CMGA 1I3HA 3WW1A 5D1IA 3VDDC 1JI8A 1GZWA 1X58A 1ZTRA 4M6YA 1LU2A 3VSKA 4Z2AA 1F1ZA 2JJ6A 5AVAA 5HLGA 4U36A 2ZNZA 2ADEA 1REDA 1SFOJ 4XFFA 2FNAA 5CKNA 2KISA 2ZJQF 1K78A 3C2GA 1OUXA 4AL9A 2L3DA 1W2TA 4IETA 1S0CA 3UKNA 3RYKA 2PLYA 2SBAA 5FYSA 4AF9A 4M00A 1UPIA 3CCVI 1K5MA 4MXWA 1VAKA 4BH9A 3WUDA 2GBYA 4YIFA 4MG2A 1MS4A 3DYOA 4XEZA 2HWE2 1FOWA 4QX2A 4QGLA 1IS3A 3HOSA 5LGNA 3RJRA 5CZKA 2ZEYA 2VZRA 3HB9A 5E1WA 2CAVA 1NA1C 2XAGA 2X51A 4IZZA 5GPAA 3KT7A 1TLHB 1YIFA 2JPCA 4MEYF 5B66C 2ZO4A 1L7LA 1CF7A 1GOGA 3TWIA 1TC3C 2Q2EB 3ZMZA 2XJSA 4RM3A 4RS5B 3C2UA 1OR7C 1NH3A 2HWVA 4KISA 3CCYA 1FMVA 4EZ4A 4LFUA 1SLCA 4A45A 3IAPA 1PJRA 1REFA 2VOWA 5AC93 5EXOA 1XSRA 3S8PA 1YJWI 2OTLI 4GMP3 3BG9A 4N53B 1LCLA 1BJAA 1W6NA 4HNUA 4OAYA 1W2OA 2JWPA 3ZQHA 3LOIA 4CU9A 1AXKA 2ZGPA 3JTHA 2K9NA 2LREA 2VVFA 4HLXA 4HV6A 1XE8A 4Q0VA 5GKAC 3IMNA 5JAXA 2O0YA 2ZGLA 3SFZA 2GIVA 3KMHA 3MLLA 2RC4A 4KG0A 2B7EA 2JA7J 2DA6A 3CJXA 3TEYA 5DMYA 5DTDA 2W92A 5EEGA 3OCPA 1CESA 4YM1A 3D3AA 3RVHA 5LD2C 2YB7A 4DPNA 3FL7A 4KU8A 4QX5A 4BWOA 4A3DJ 1W99A 2BOIA 4IOCF 1FBSA 4KNCA 4FFGA 1AR83 2QVOA 4IHTA 1GOFA 1OOPB 2XWBB 1DGRA 4YW1A 3OJBA 1HKDA 1NKGA 3USUB 1EY2A 3EQEA 2KIMA 3JRFA 5FP7A 3WGIA 4AQTA 2Y33A 3ABUA 2WRAA 4QB6A 3MPBA 4B43A 3KE2A 1AR92 3D82A 3W20A 3OBRA 4LHLA 1UQXA 5BXXA 2C26A 1SFYA 2CUEA 1OFNA 2RG4A 2WL1A 1I3QJ 2ZFUA 1TWAJ 2H0BA 1LJ7A 4BE0A 1XN7A 1BI1A 2WNUB 3M8LA 4Z82A 4BA6A 1GZ9A 4Y1UA 2GA2A 2VBWA 1PNFA 3MIBA 4YVSC 5IVEA 3U11A 2KT0A 2HEVF 3LAGA 3MIDA 3KF3A 4I02A 2WQ8A 4P14A 1YNAA 4GH4C 2DA2A 4UY8I 1WCKA 1FOD2 2IXHA 4JDNA 1JZ4A 2OPTA 1OKRA 4NQWA 2CHHA 3BOPA 4LUMA 1DIWA 1BR1A 3RI4A 1YWKA 2TEPA 4D7YA 2LLKA 1IXCA 1OQEA 1FLIA 1MJ9A 1CAWA 1YS7A 5K9YA 3FBIB 1ZBE3 2KFDA 4IEVA 1MNEA 3QU6A 2ERFA 1QU3A 5J36A 3DLLF 4GWNA 2XPJA 4H4KC 2ZMEC 2JUGA 2IC1A 2CGNA 1P4XA 4KICA 5FLXZ 3DPTA 4XJWA 3OYWB 1Y3TA 5EZWA 5JMCA 3ZPLA 1OLQA 4LIVA 3SITA 3WEZA 4QPOA 2W1UA 3ELKA 3OS2A 3P6BA 1DPUA 3ZQLA 1E3OC 2WZEA 2W82A 4D6QA 3I59B 3P3NA 3ZN1A 2XVGA 4EN9B 4BYYA 4XFIA 2F4LA 2WYFA 2GXGA 2EJRA 1JS9A 1FZPB 5H9SA 3F0CA 2N7GA 4MGRA 2PHXA 1UN1A 2HXIA 2OUJA 4DY3A 3KYDB 2OA2A 4PLNA 5FRMA 2VMCA 5CEHA 2JMWA 4JGZB 2DYSH 1WWYA 3IIIA 3S0MA 3LE0A 5FZ4A 4BQ4A 2C4XA 3TN93 5KVRA 3LKJA 5CVVA 1ASJ1 2DOEA 4AI8A 2JENA 1EH7A 3IDEA 2HYGD 5JR3A 4BY7J 1POV3 4JRLA 3S1MJ 1HW5A 2Z42A 1S0GA 4CDUB 2OKXA 1T38A 3LA3A 1WBFA 4Y13A 1A8DA 5C6CA 1GV9A 5HI0A 2R0HA 4YGDA 3N9MA 4AYBN 4DBRA 2ZHMA 5FKNA 3C3VA 1WMEA 2A07F 1RVF2 4S05A 3AKQA 1XOYA 4NHLA 5AIPA 4FP3A 1QJX3 2HPIA 2CWMA 1HRV1 5M5YJ 4RR3A 5FWEA 3ACLA 3O3KA 4L97A 3G73A 2WQ4A 4R9BA 5D4SA 1I39A 3HN1A 2PHDA 1GVDA 1HV0A 3WXPA 5GAGJ 2DCKA 2WT0A 3OB8A 4URTA 1XSVA 2R7XA 2ZKNA 4RHV1 1R1ZA 1JTYA 2IBDA 4LO8A 2CW0F 2KDOA 5TJJA 2AYHA 3CIHA 5C4WB 1ZBA3 1I1SA 2I45A 3E1F1 1ZA7A 5B1BH 2L7KA 5CPRB 3DCFA 5C3RA 1AYN3 4A93J 1WW7A 2CDPA 4XUNA 3J8F1 4RN5A 1QOSA 4L18B 3CKHA 3IWZA 3AZXA 2V4JC 2YC2A 1RUD3 1I27A 3FXJA 1X82A 4IGPA 2CY6A 1VRH1 5FTTC 1APLC 1AR73 2LD5A 3GHMA 4ASLA 1R9TJ 3MMYB 1IN5A 4OIQF 5BNQA 3POIA 5A3LA 3VB2A 2P7CB 1D0XA 2YSRA 1U12A 4W97A 2HH9A 4SLIA 2R7UA 3O0VA 5FBZA 2Z33A 1FT9A 4I0WB 3JSOA 1SD7A 3CESA 2E5ZA 4FPOB 4J01A 1RXGA 2VU9A 2A6HF 1QF3A 2DT6A 1O57A 3WU1B 2WO2A 2E7QA 2WB1N 4GXLA 4XFHA 5LK7B 3DPUA 3LF7A 3A22A 1K12A 1U5YA 3O1MA 1IPSA 4C1XA 2PHLA 4QB1A 2JA6J 5IOZA 1OLTA 3N05A 4L99A 3SH3A 4IEJA 4EM2A 1GUIA 1LGCA 2ADDA 5IP7J 4HANA 3RQ4A 2X6XA 1KYWA 2D3RA 2IGMA 1Q5OA 3ZFEA 5A6YA 4NWWA 1RMU3 1T6SA 5A1FA 3L1PA 1BC7C 2JDKA 3AZVA 2B39A 2CWEA 2WWSA 1V6NA 4XONA 1FV2A 1XSQA 4Y3OA 2N8GA 2DMTA 1PIV2 1D4M3 3FK6A 1XYNA 1CQ9A 1W9YA 3C7GA 2ZGSA 3E6DA 4OULA 1QPMA 5LRSA 1WQ2A 3SXYA 1V70A 4QMAA 4KT6A 3VODA 2NVYJ 3QP5A 4QHZA 1KITA 2ZMNA 4P96A 2J1UA 4BGDA 4DMIA 5KC5A 1DFQA 1O8PA 4RS5A 4I2OA 1SD5A 2CUJA 3N9NA 1WA6X 1YW7A 4NHYA 3TO6A 1ENRA 2GC3A 4OMYA 4RGXA 1SFXA 1R6RA 3FN9A 4WXHA 2EA7A 1AL23 2XXZA 1PM4A 3LZZA 3VDAA 1GQHA 3GZTB 2V1DA 4B4QA 1W36C 4IV3A 3B00A 5J4YA 4EGYA 5FK8A 3TBIA 3SC7X 1RIRA 3LMMA 1Y1WJ 2EV0A 3KV9A 4MZUA 3R60A 3F22A 3L2CA 3HOZJ 4BE3A 2OJED 2VBYA 1QBJA 2HU9A 3S2WA 2RMU1 3VHOA 2P17A 4OIOF 1RUH2 4M6XA 3V0AB 3WW3A 2BHZA 3OYJA 1H2KA 2E5NA 4UUVA 2QGUA 2NPIA 4XFGA 1GR3A 1PDNC 4HKLA 2VUMJ 3DPRB 4TLFA 2RR12 4ENNA 2NVTJ 5JZGA 2MLGA 4R9DA 4D69A 3LFIA 3JCIA 2VUAA 3AKSA 1LEAA 2DJNA 3D8CA 1HSJA 3C18A 4S2HA 3ERMA 3AK0A 4LE3A 2CSGA 1LECA 2HWC2 4JKKA 2K7LA 5A33B 1A78A 4EM1A 3OEAA 1UU4A 4XQDA 3O1RA 3PUHA 1KGYA 2X8KA 3PURA 5LGTA 1N77A 2QTWB 1RR7A 3MEPA 1URXA 3CLQA 1JZ3A 4HSJA 3QPSA 2QE3A 4A3KJ 5LBBA 1DU3D 1MGTA 5IFTA 4DGWB 1EUTA 4UHTA 3KP3A 4A42A 3L9JT 4GO1A 2P5BA 4YVWA 2VJ5A 2STTA 3JBG1 4XHBA 4A7KA 3PFYA 3J7AO 4NHMA 3I49A 4BUPA 5BQTA 2MNGA 3IKVA 4YVSB 4ENMA 2RM23 1V9U2 2MC3A 5J4VA 3KP7A 1DZTA 3G6EI 5G05L 1LOCA 4AWDA 3CZ6A 3GNEA 2UY8A 4GH4B 1QO0D 1RL3A 1QMJA 5K5RA 4Y5TA 2VCMA 1V5FA 3BCBA 5IVCA 1UOGA 3ASNH 4PSWA 4XRSG 2R7VA 5C8CA 5JOZA 1E5RA 5E8GA 4HETA 4QKNA 1VBC1 5A7QA 3FM3A 1BJZA 4IXLA 3M07A 1TQPA 2LS6A 3VZLA 2J1RA 2A5WA 1X19A 1VBD3 1N3QA 5M5WJ 3WP3A 5A32A 2R7DA 1VQ9I 5F6LB 3TP3A 1X1CA 5KAIC 4ZC3A 2MA3A 1YQ6A 2LUWA 4DIQA 2WFF3 3I8TA 4DXTA 5H6QA 1QJZA 3LSGA 3PJRA 3ZMUA 3LDBA 1U8RA 3HL2A 3CC7I 1R1UA 3QYEA 2IT0A 5HLIA 5DD4A 2VNVA 1MQTC 2VUJA 4B1LA 3SDGA 1U5ZA 4YW3A 3J7YJ 5ICEA 5F1RA 1IUFA 3ZQGA 1EUUA 4BXXJ 1W6OA 2NQYA 3W5MA 3WHUA 2BPA2 2BVBA 2LG4A 1UL9A 2COMA 4E4ZA 2ZGUA 2X5IA 2AQFA 1J83A 2F5EA 1RUC1 1UAAA 2PJPA 3WNOA 1KJLA 2K85A 3K4JA 4PBPA 2JSPA 2K46A 3ES4A 2KIFA 1BEV3 3JB8A 2KP6A 4CH7A 4V2WA 1IXRC 1H6XA 1QJY3 2P6SA 4IHXA 5EEHA 5IW0A 3C7EA 5K0UA 2UZKA 3BODA 1K3IA 3Q0WA 3POJA 4LG3A 3I55I 1GU3A 3W2WA 1W0OA 2QSGX 3FHZA 3DEWA 1BBYA 1HB1A 1W2NA 5HCAA 2L7ZA 3CZJA 1ON2A 3R4KA 1S29A 4ZU5A 1US3A 3WDYA 4LOTA 1SLAA 3L2UA 3WG9A 3SKVA 5E8AA 2JG9C 4YELA 3HOTA 2PHRA 5JHFA 5FXVA 1YG2A 3I7DA 1NE4A 3R61A 2CV1A 3I2GA 2UWAA 3VBHB 4AC0A 5CKTA 3SDBA 3POSA 2VNRA 4AR2A 4ITVA 2GLOA 4JHZA 4JQFA 3PNYA 4F91B 4H0EA 2ESHA 4HX7A 1BZWA 5C4WA 1H9PA 2DPUA 1VQ4I 4EROA 1YQ8A 4B3XA 2V79A 2ZC2A 1UHMA 1WUVA 5JIAA 5FLHA 3I0TA 2E2HJ 5I8YA 2PX9A 3ZQ7A 2E51A 5FLJA 1LGBA 4TN7A 1U5XA 5A7WB 2W39A 1MMDA 3K75B 1LOFC 1IUYA 5EYYA 1YW9A 3HD8B 4XKVA 2BUKA 2J42A 2W1QA 4ZYDA 3K69A 4E8CA 1TNRA 2DF7A 1JGSA 2Q0OA 1A3KA 3TDZC 2PA7A 4ITCA 4Q4X3 5E18F 3BZ6A 3P9CA 4MGIE 5AC91 1CVNA 1W6MA 4AVAA 5FRAA 4GMP1 5FV3A 4JGYB 3M3IA 4UBGA 1I5ZA 2DFBA 5T5OA 4UV8A 2C5DA 2QQWA 3S5AA 1WLWA 4CZZA 4BB3A 2OX0A 1UG0A 3DGTA 4A4AA 1W9SA 1OCCH 2FRHA 1W04A 1V5GA 1UW8A 3JAMK 4CXWA 2JICA 4IEPA 1W9WA 2KMUA 5FZ3A 3EB7A 3LFUA 5A80A 1VBA2 3MIEA 1G2HA 2A6XA 4A2UA 5JI9A 5L73A 2BFUL 2ET7A 2CFOA 3LSRA 4ASMB 4F52A 3GXOA 2OS2A 4A5MA 3LNQA 1JJ8C 1PVC3 2CQNA 3K4CA 4A0XA 2V9VA 4UB6C 3ERED 4UI9L 2O14A 4O65A 1AR81 2WYSA 1XE0A 4X6RB 4XFBA 4XTMA 2OCEA 2VCBA 4WM8B 1OQYA 3RJPA 4UFIA 3J7HA 3ZX7A 1Y7BA 2LW8A 3VBRA 5EJZB 4HPKB 2UWMA 3E0JB 2C6YA 3ZYBA 4C8DA 4AI0A 1GUUA 3CJTB 2QF7A 1OBNA 2ZZJA 1LKNA 5J3LA 5CNAA 1YQ5A 1LHVA 5LBCA 4GWMA 2JIGA 3MVPA 3BTXA 3SH4A 3H35A 3J81K 2JJ7A 3RPQA 4GDFA 2YZ4A 5FZ8A 2LK2A 3AZYA 1UO9A 1TQIA 2X10A 3PIOF 3QAHA 4BHBA 2QENA 1QXPA 3RZMA 3WHCA 1Y9QA 2W1OA 4LO5B 5F27A 5FRNA 3QPTA 1V6LA 2XAQA 3UL2A 3K4KA 3QPLA 3DF8A 3C7JA 3M3QA 2E7TA 2EVXA 2DTRA 2IS4A 4IUGA 4N7IA 2VY0A 4IJAA 5EG0A 1ZBE1 2RREA 3I2KA 4E7IA 3RKYA 2FMYA 1ZG1A 3IPVA 1F4KA 1HLVA 5FLMJ 1FNZA 3LQCA 3Q9OA 4PJYA 2R7QA 2JIJA 3WY6A 1R082 1UU5A 3CQZJ 3LFMA 1STZA 2E34A 3IBMA 3BTIA 3GZ5A 2RJ2A 3V7RA 3OS0A 5BNPB 2EXKA 1LB2A 1R1VA 5DDJ2 4E7HA 2BYVE 4GB33 4IPAA 1DZQA 1WCMJ 2QBYB 2AREA 4NPRA 2J22A 2F2EA 4PBOA 4L9NA 4DXSA 3NO8A 2IUWA 4KT5C 3L2RA 2XVLA 4AHZA 3NJXA 4AGGA 4FX4A 1RETA 2WV1A 2O9LA 4XMIA 2C24A 3I3QA 3G1LA 1W6PA 1POV1 4AHYA 1UZ0A 4XLHA 4FTBA 1N3PA 1C28A 1Z1DA 2VKEA 3S15J 5FPVA 3MF6A 2G0EA 2E31A 5FZBA 3OYGA 2J5OA 3NNJA 3O1UA 3D0SA 1RUJ3 2DOAA 4HX8A 2XKOA 2X6WA 5CYYA 5LRRA 2P5KA 4WVMA 1GANA 1QJX1 4DNYA 1QGPA 3VHPA 2MG4A 1ZZ7A 4AE2A 4R4XA 5D5XB 5KXDA 1IRFA 1WJ5A 4QPGB 4QX8A 4AUXA 1I6HJ 1BHGA 5FMBA 2ZJRF 2PAKA 1WI9A 4II2A 4Y7NJ 2GOXB 4CRQA 3E6MA 4HVOA 1QDCA 3N7LA 2VH9A 2WNOA 4Z2YA 2NXNB 5EHDA 2VL4A 2IA0A 3HSRA 4YG3A 4HV5A 3UGFA 3POFA 4CP0A 3U9GA 5FZEA 2DBIA 4E2GA 3H5RA 4DO0A 3GUDA 3R6SA 1ZBA1 2EIGA 5JXHA 1AYN1 1VBB3 4FOYA 2C9KA 3W2AA 2EIMH 5HDKA 2JA8J 3ZFGA 3K4ZA 2QEXI 3IL2A 4MLOA 1QDOA 2R0FA 4L9BA 1RUD1 3HMYA 1XS9A 1JOBA 4KIGA 4BACA 5J96B 4I30A 1MQTB 4FPLA 4DOZA 2IVMA 1WBLA 3KCCA 4I01A 4XN3A 4L9JA 1O5UA 1AXYA 4IEZA 2PN5A 1RUF2 1REPC 4PDWB 4JOMA 3E5XA 3NAUA 4FE7A 1TMF2 2JT1A 4WV8A 4B1MA 2JA5J 1QHHD 4PDKA 4CA9A 1WKMA 2FD8A 3CUQC 3DU5A 3PL0A 2D98A 1W6QA 1PMJX 3ZFFA 3MW3A 5DN2A 5FKOA 3ILFA 3WF1A 1A34A 2ZAAA 1NG6A 3WLUA 4OFGA 1UYXA 3BGAA 2K4BA 1NY71 2DMPA 4OIRF 2RV9A 2A3YA 4KYWA 1CZTA 1AYM3 5BNOC 4F92B 1R092 3HGGA 1N3OA 4GRIA 3X2QH 1SEFA 1D4VB 2WTEA 1PX3A 5IHRA 2X4HA 1P9QC 1H2MA 3HVDA 4CUCA 2K5CA 2VZOA 1IJWC 3VN4A 1OPOA 1BYHA 1EV7A 1YO5C 1QNTA 4EWEA 3BOQA 2FA5A 4PJ0C 1S0JA 1RMU1 3H5NA 3CU7A 1VBE1 3UT0A 4HW0A 3V8KA 3W6VA 4Q4ZF 1G3WA 4A0YA 1D4M1 1JI6A 1A35A 1C1LA 3EETA 2K3PA 3D6EA 1RUG2 3VHNA 5M3FJ 4NN0A 4XOTA 1KZHA 4QQOA 4XE9A 1T98A 2XF5A 1ON1A 2E63A 1VP6A 4MHUA 4XF4A 4I98B 2D6KA 3N9QA 3FMRA 4MIMA 2XL9A 3HUGB 2VQCA 1ZKGA 1YIOA 3IAS2 3SHFA 4RGAA 4EJVA 3MV11 4KNYA 2XPUA 3B94A 5FYTA 4AEDB 2EFOA 2HWB3 1OD5A 2D7FA 1XU2A 1NTCA 1G4DA 1AL21 1AHSA 2GC2A 1R58A 3IH4A 2QQLA 1QJU3 3ILNA 1V00A 1W8NA 1JU4A 5CU1A 5DM6F 5FP8A 1OFCX 3M3YJ 3V8JA 1FYKA 3VYTB 1QVTA 4RD7A 2RS11 5I8TA 4XSXF 1NCQC 4K1ZA 1S7AA 4IQPA 2M2EA 1CAUA 3AKPA 4C2UA 3MIFA 5CAZA 1N1SA 4O9GA 2EIKH 1LDJA 3K2AA 4UW6A 1ACIA 3R4DB 4X8PA 1M4WA 1LOEA 4Y17A 4PCRA 2CNAA 4IHVA 4RQPC 2IXLA 4Q5OA 3LQRA 2RDQA 2DU9A 5BNNB 3QD6A 4AVTA 5FFXA 3I4PA 4BL0B 1B8IA 1NUKA 5JR2A 2HS5A 1OJLA 2LY2A 2HWF1 2BY0A 4LBOA 2M45A 3HPNA 4XQWA 3IN9A 4QLCU 2NVXJ 1GLHA 3DPLC 2R5ZA 4Q4W2 1FMD2 3HTUA 1FTTA 3RRDA 1YYVA 3ZSMA 3AJZA 2LALA 4L0YB 1FATA 3J26N 2QNKA 2DTZA 4RFT0 2VLAA 4GWJA 1PZ8A 2I5UA 3AG4H 5IT3A 4DUVA 5C3QA 2A3WA 5FIXA 2R062 3H1CA 4OMCA 2H6BA 5CIRA 2XUBA 2JDAA 2YY1A 3NNLA 2IJLA 4LULA 4B8EA 1Z3YA 2RM21 4ZYHA 4XDPA 1BI3A 2WA0A 2V26A 2PJRA 1IPKA 3UJOA 3CQOA 1MNDA 3C7HA 4H3WA 5FPBA 4BQXA 2YXSA 5ACA2 2E19A 3ZCOA 4L2NA 1A36A 4E7KA 2BNMA 2ACJA 3N3HA 3OYNA 3RG0A 3CF5F 5LA9A 2ETEA 2DVBA 2BP6A 3BG3A 1W0PA 4FQ4A 3BQYA 5D8KB 1ZHFA 1LHOA 4GZ9A 1O3SA 5G04L 4KITB 2D43A 4C90A 3VKFC 1LKXA 1QOOA 5C4XJ 2XB5A 1FX7A 1XPXA 1VBD1 5AFBA 1B35C 4PCQA 3RMYA 4HG6B 2G9FA 3DXJF 2BBAA 4UAPA 1PGSA 3VDCA 1M06G 2RS51 4BAYA 4XRSA 2WFF1 3N97A 1C4RA 5FZ1A 4IGQA 4CEWA 2XAJA 4XORA 2WAQA 2AZ5A 1SAXA 1K4TA 1FIPA 5DDGA 1JXSA 5IVYA 4A3JJ 2PG4A 1DQ4A 1Q8SA 1SPPA 4PSXA 3KZIC 4PIYA 1Y4WA 3CCRI 2IGOA 4ESBA 2Z2SB 5EJCA 3APBA 3K51A 1ND3C 4JC1A 2QZ2A 4Z1VA 1IV8A 4MYEA 2NMOA 1OCRH 4UUSB 3CJIA 5J8FA 2R042 2B9SA 4OUSA 2RVAA 1NLQA 4N43B 3L2WA 5BYNA 2QJVA 3MF9A 3ZXKA 2JRMA 4HBNA 3HHHA 2VXRA 2QKDA 2F48A 1UB9A 4HG2A 1AR63 1YCIA 2KD7A 1QJY1 5J3UA 4GFBA 4HKOA 5EFUA 1E17A 3BPVA 5A2QK 4I6ZA 2EV6A 5FYIA 4CP9B 1MZFA 3AMNA 4LMYA 4CCDA 3GZNB 2J1VA 4Y4YA 4O6JA 5JWPA 2E36A 2BWCA 4CDXA 1HW2A 2MLKA 2JDHA 4DFSA 3I58A 3OF1A 3QWLA 2PEXA 1ZR4A 1YUDA 2IA2A 5A70A 2JG8C 3PQKA 3QBQA 3WU0A 3MCZA 1KS4A 2ZACA 1UKGA 4AIKA 4S0HB 3JRAA 4ETSA 1TTYA 4XMYA 3JQXA 2BE5F 5E3LA 4CDQA 3TO7A 4EN0A 1O7LA 3SZPA 3ASIA 1CJPA 2PFBA 2W95A 2VJXA 2H8RA 4P9WA 3J80Z 5ICCA 1X50A 1LPQA 4MVTA 1LHUA 4K3UA 4Q0SA 3K70D 3ABKH 2P81A 2HWE3 2Y48A 4WM7A 5GM0A 2DDAA 2LFBA 4ES9A 1GP4A 4LG0A 4MXVA 4QPWA 1NCRB 1NYWA 1RIOH 2QCSB 3O1SA 5FZFA 3ZKUA 5E89A 3PIPF 5FZOA 4UUTA 4ZPIA 4CEYC 2XGXA 3LOCA 1SVMA 5EEAA 5EIYB 6PAXA 3VV1A 5IP6A 4Q0PA 3AG3H 2HGCA 1OYYA 2YUEA 3ZXGA 5A3MA 3ZIWA 4X8NA 2WT1A 2FD5A 3PVOA 3QOEA 1JYCA 4I09A 4BDVB 3GMEA 1UMZA 2MH9A 4JX0A 2QDNA 2XJTA 2HQRA 2ORXA 1F36A 1C8M1 2ET1A 3DEEA 4XLEA 5EGOB 1GP5A 3WCRA 2VMFA 4Q4V2 2CG4A 1UYZA 2C0ZA 4IEWA 1FPQA 2FBHA 1J3RA 4GCVA 1PVC1 5HODA 1T08B 4BHCA 3OOPA 3H36A 3GFMA 3ILRA 2O1QA 1NQDA 4UVAA 5FZLA 2IPQX 3AKTA 1XCBA 4Q26A 3VBFC 2A6WA 1Q8QA 1MD0A 1Z77A 3ZKYA 3KYLA 5GJ6A 2IFWA 3O0WA 1UPSA 1CX1A 3BTZA 4V19K 4UW3A 4XUQA 2FXAA 1F4HA 1FBQA 2JE9A 3ABLH 1JT6A 5DG1A 4AIHA 5L36A 1JKPC 3DN7A 3LEIA 2GAUA 2PI0A 4MO7A 1AR93 2DFCA 3NAPB 1QZYA 1X9TA 4KWJA 3L7WA 2XOMA 4E2QA 3DV8A 3ROUA 4QXKA 2VBXA 4OZXA 2ZABA 3HNYM 1DYOA 2Y0OA 3BPXA 4JV4A 3UESA 2J1AA 3IDCB 3GLXA 3KETA 2YROA 2F6BA 1PO11 4QGMA 4S04A 2JTVA 4M9ZA 1T2XA 1OF4A 2X0LA 3T30A 4IL6C 3KCXA 1VRBA 5TGTA 2HYXA 3R0AA 5I0DA 4LK6A 2FBIA 2DLLA 5E3OA 1FOD3 2A1XA 4HT1T 1YRNA 3IIAA 2UWCA 1X33A 4LLLA 1D8KA 2M0CA 2ELHA 2WV0A 2E1MC 3GO5A 4E70A 4BNCA 1ZA4A 5C9AC 3IP4B 4CICA 1WFXA 3IHUA 2QQUA 2R5YA 1R23A 3A02A 1HRI2 1EKEA 2GP5A 3T0YA 2ETHA 1LVAA 2PHFA 2VKVA 3CF2A 3PNVA 3INAA 3LWFA 2G7HA 3PUBA 4LLOA 4N4NB 3EXUA 3ZYIB 1RC9A 1HDKA 5L9BA 5J1UA 1LFBA 3VBUA 5FYBA 1W8TA 1ZELA 4GB31 2VQGA 1K7AA 2M9HA 2QQMA 3SHRA 1JW6A 3GVAA 5FJHA 3IV5A 4YRVA 1OLMA 1VQ6I 1E3HA 3AJYA 5F0HA 3S1NJ 1T56A 1UIKA 2DUQA 1LQ1A 2GNDA 1ERDA 2E35A 4XJ8A 4XLFA 3H9GA 2IVIB 2PLV1 3IUOA 3WT3A 3B7MA 2AXLA 1K5JA 2WINB 5E88A 2DW4A 4QHBA 4XYXA 1AKHA 3PIGA 1U78A 3RIRA 1DGLA 3CDZB 1D7PM 5C33A 2EV5A 4ZZDA 4OCTA 2O3FA 3OGRA 1LHWA 2DFEA 1CAXA 1RUJ1 2W48A 4XF9A 1B4AA 2B9VA 3MFAA 2X09A 1UY4A 2NAZA 1XC5A 1UZCA 1HB3A 5F5CA 3MD2A 1YJ9I 2VTXA 2Y6HA 2VPRA 4B8XA 3GYHX 1DLLA 1ZG5A 3H3UA 3PSFA 4M4PA 5LWBA 1WCQA 1RVF3 1H8TB 1WMFA 1BOAA 3GTKJ 5ED4A 3DU6A 2BV4A 4XTPA 3ME2A 5BOXA 2VM9A 3I2IA 4KIBA 1B35B 3H9JA 1OF3A 2K9QA 3KVBA 5F3GA 2JVGA 4AVZA 1JZ7A 3HDDA 3THPA 5FKBA 1VBB1 1GNHA 1ZLJA 5A1AA 1W8FA 1U9OA 2NS7A 5ERIA 2GC1A 3I64A 2R7WA 2MPFA 4N4OB 5CQEA 2V09A 5GADJ 3M1EA 4XKCA 5KCMA 1DGRN 2KXLA 4NRMA 4NPMA 3SQOA 4IE0A 3VDDA 4BCUA 5IT9K 2ICWG 3EUAA 4Z92B 3AL0C 2ARXA 4AAXA 3ZQCA 2A6TA 2K9ZA 1QQIA 1QJEA 3VKNA 4CA0A 2ARBA 2OUHA 2VNOA 4AGVA 3F9KA 3FHNA 2VBZA 2AEYA 5ABJC 3VD9A 1O7FA 5KAFC 4HF0A 4OMZA 4IEUA 1Z9CA 3ORJA 2XC7A 3CMYA 1S8NA 4XF1A 1J0RA 1F4AA 2XUEA 4HVRA 2H0VA 3M7AA 4MGSA 5DCMB 2HOEA 1AX1A 3GTQJ 3VWBA 1AYM1 2DCZA 1S72I 5GPCA 2OA4A 3J7LA 3WV6A 2LBFB 4YZ1A 3WX5A 4UF0A 2XQRA 3FWEA 4H14A 3L2HA 3M8FA 2PMUA 3LIGA 1ETOA 4G9SB 1JZ5A 1MBFA 1EPZA 3LCPA 4HOOA 2IZWA 1CAVA 2XJPA 1PZ9A 1NA1A 2DFIA 4YW5A 2EFWA 2KA3A 4BDZA 1UZVA 1ND2B 1SBFA 1ULPA 3B9CA 2EB7A 3RYPA 5CADA 3GX4X 3MFCA 5LHHA 2Q4SA 2BOLA 1XRUA 5L3BA 1EPWA 1Y8RB 2VTFA 5IAVA 3FXMA 5FFZA 2E1CA 2HNHA 2GNTA 5FO8B 3BR5A 1KQ0A 4PK4A 1OR7A 3OY8A 4XLNF 4K40A 5T54A 4ISRA 2HR3A 2KLOA 1U5TA 3PU3A 4MGQA 2W2IA 3IAM2 2EFNA 1PIV3 1T0FA 3U4XA 2RN7A 2ISYA 5HS7A 2PMZA 4HEA2 4IEYA 2HWB1 1BK1A 4EJWA 3J4UH 4QDRA 1NCRA 2ME0A 4A3IJ 4P9JA 4ZY9A 1Z6TA 1QJU1 2O5RA 3FKIJ 5LCWL 4AIJA 4A3CJ 5E16A 3AAFA 5CFCC 3I2FA 2Z3YA 3HAGA 2K02A 3U1KA 2WNVC 1WPKA 4QWQA 3PDQA 1UXZA 3WP5A 3NRVA 2HWD2 2DK5A 5DPNA 2DFFA 3BROA 2ZGNA 4I76A 4LHNA 2ZXIA 3F23A 1E3PA 1BVP1 2HQNA 2LVSA 3OIQA 1AX0A 3T1MA 5KXBA 1FYMA 2BU9A 2G7UA 3ZMTA 4HSLA 4FQZA 2IGNA 3OWTA 3AP9A 3GTMJ 1RUH3 4JX5A 2EA2A 3WDXA 1R5ID 3QPHA 1W06A 4QGNA 1L0OC 1YJLA 1POV0 2P3JA 2VN2A 1AL0G 3RSJA 4R8HA 3LSJA 1MVQA 4QX1A 4RMNA 2RR13 1W2UA 2UUZA 4LKFA 1H6YA 5FZKA 4KMUX 3HHGA 3VBFB 1EH6A 5FZIA 3JRHA 2EH3A 1B72B 3CJQB 4M3FA 2ID3A 2BJSA 2HWC3 2R32A 3V64A 1PZ7A 5DUVA 4Z2WA 4XSZF 1AVBA 1JYIA 3T8RA 3CD6I 3T3YA 4LXLA 5JPMB 3MUY1 1JUHA 1TWFJ 1W2AX 2XROA 1ETVA 1JYTA 2OZ6A 4PJJA 3SEPA 2DPDA 3NAPA 2VKDA 2LF8A 3LQQA 1P6RA 3UV9A 4IV1C 1ETYA 1DP7P 4I0AA 1U5IA 1HC8A 1WD3A 4HNVA 4DBQA 4FTSA 3U21A 3VZNA 2BFUS 5I0SA 3G1MA 2ZMEA 5C44J 1P92A 3MIHA 4A3XA 4D6RA 4PQ9A 2DVGA 4YG0A 1X8MA 5F39A 1Q8VA 1V9U3 4YW2A 2K0GA 5FCCA 1S55A 3ZVXA 4ZU4A 2DBBA 4QM9A 2VTXJ 3PMEA 3P1IA 1BN5A 3AVSA 4K21A 2YU9J 2COBA 2GMPA 3V0BA 3WGGA 3OSFA 1WHUA 1DGRM 1NQJA 4CCNA 2D3SA 5C9AB 2VAUA 1ULYA 2BGOA 2FDGA 4OINF 3OYDA 4HX4A 5M3MJ 2W1SA 3HGYA 5K7ZA 2BOJA 4OI0A 3D1NI 4XJZA 2MSYA 1UJ8A 3OD0A 5JSPA 4J25A 4JK1X 1IV6A 2WS92 3TW7A 4QIWN 3B01A 1X3ZB 1GZWB 3DKYA 3HQXA 1LODA 2XF7A 2G9WA 2E1NA 2W91A 3K3OA 5C8WA 3HIFA 2JKXA 3N7MA 1W36D 4D5CA 4BBRJ 1SMVA 1VQ7I 4FX0A 2QBXA 2BXYA 3PVEA 4DZGA 1ZK8A 4P02B 2WNEA 1LAJA 1X2MA 2XAHA 4H7LA 1MKMA 5EV7A 4KMFA 1K78B 2XPWA 5F2WA 1RKTA 3ZFEC 2DCEA 3ZN6A 1HLCA 1W0TA 5GZEA 4CSWA 3A01A 3SLIA 2FMLA 2OZUA 2XGCA 1AR61 3BLYA 1K5MB 4MXWB 3OBZA 2QVSB 3IM0A 5FZDA 1PVXA 1W28A 2Y0IA 1UZWA 4M73A 3VDXA 4KQ7A 5FZ0A 5LA1A 4Q4Y2 1YQ2A 4COWA 2V1XA 2WN2A 2VZTA 4AAPA 1Y9GA 1MS0A 1RXFA 4Y1XA 1CF7B 4M71A 2O61A 3K4LA 2M8EA 3V8LA 1ONVA 2W85A 4R52A 4RS5C 3FMGA 1XGNA 3S2DJ 1PNGA 3NARA 2VVDA 2B5HA 2D6OX 1U8BA 3AMQA 3V56A 4AFAA 2IS6A 4LEJA 4ASNA 5FO7B 4DUWA 3TYJA 2VMDA 3N9LA 1KXGA 1YYNA 4N53C 2AACA 1W6NB 2Q8OA 4AVSA 3WG1A 2Y26A 3FF5A 2KRFA 5H6RA 1HDDC 2HWE1 3U2RA 3OYEA 1F8VA 1FMWA 2Y30A 1OPCA 1AU7A 3Q5FA 4URAA 2WO7A 4CP1A 3T1BA 4IERA 2LRDA 4AI9A 1XGSA 4MTEA 4CHUA 1XNCA 3T0AA 2LTNA 4XIDA 4G6QA 4C3IJ 4ENJA 1KQ8A 4ZKTB 5FYUA 2CU7A 2OC6A 3GFLA 3F8MA 4FPEA 5ANQA 3NNGA 1ZAOA 5JPNB 1O4TA 4XDQA 4J1XA 5JZGC 2ZX3A 5E3MA 1IN4A 5J1RA 1MMGA 1MS3A 5LASA 1TME2 1WI3A 2QQBA 1L3JA 2W0XA 3AB0A 1L7QA 4CDGA 1BBT2 1SDDB 4E4DX 5IVBA 1LOBA 3JREA 1FOKA 4XN0A 2NRAC 4UYBA 3VBOA 4OAZA 2M1BA 2L9LA 3REOA 1YQCA 3OOXA 4META 5FKLA 3GZEA 4BIFA 4CGZA 4IXAA 4NIIA 1YS6A 2VQLA 2XWJB 4FPKA 1ACCA 3OV8A 4A41A 1YRZA 5J47A 4COZA 5ICGA 3PLQA 2XLGA 5BUVA 1VBA3 5EYRA 2DMUA 5L3DA 1KGSA 1SDWA 2JKBA 2VOXA 3CCMI 2CTVA 4NROA 1PO22 4N7UA 4LUKA 3WODF 4XJAA 4F3JA 1SG3A 4JAAA 3KX2A 3H1YA 2P1BA 3PVNA 5F08A 2D6LX 4QX0A 4NQWB 5FB2A 4QHOA 4M3CF 2XGDA 1UY1A 1WD4A 4YGBA 2OW4A 1LTEA 2R3SA 2ZHLA 3HBLA 4XAEA 3OYAA 1CAWB 1LESA 3B3QE 4D0PA 5DUXA 5K7FA 3LPGA 4O9EA 3O2PE 5JDBA 3AXDA 1YITI 5FZCA 1AR91 2RV8A 2A73B 3K0LA 1IN7A 4XBFA 1X1PA 4P5HA 4ZDPA 4PF1A 4BOWA 2I10A 4JP0A 5BV6A 3HKZA 3EO6A 4YG6A 4IX7A 2A5YB 1UNBA 3I3DA 3I97A 2V6EA 2NLRA 3OIPA 2WA3A 3HEIA 4FAHA 3K1MA 3ZXAC 1VF9A 1SBEA 4QXHA 2M4GA 2MEV2 1FI2A 4W6WA 3CBNA 2WWUA 4JGZC 5LEJA 5JFRA 2E7WA 3PU8A 1H9TA 2EF6A 2FBKA 3COAC 3A23A 4PI2A 2GDFA 5FJKA 2ZGOA 1DZRA 2YU1A 3KD4A 3WDWA 5C3SA 3S2HJ 1PGL2 1MZBA 3KZ4C 3WHBA 2P4EA 1ZGJA 1FNYA 5SV5A 4EJTA 5B4XA 4MQVA 2ATFA 2AUYA 1IS5A 2LR8A 1R083 2EAKA 1C3HA 2HEYF 3HBZA 4B29A 2YC4A 2EZKA 5FGMA 3TW6A 1V4RA 4PUSA 1MZEA 4RR3B 1QHDA 2VPLA 4UFLA 3DYMA 1R36A 5DDJ3 2ID4A 1WCSA 3C1DA 3QP6A 4WZFA 2HVRA 1HQNA 3BWGA 4NIGA 1GBGA 1PMHX 3AXEA 2DURA 4C9YA 3NKGA 1BR2A 1S0IA 2P37A 4RGUA 3OBAA 5C4WC 2HQAA 3RWNA 3ST7A 3BT9A 4XLCA 2IXJA 2BNOA 3GCMA 2Y64A 5GTIC 3HNBM 1MH4A 3J7MA 5APAA 2OD5A 3BPSA 4QPYA 1TW2A 1ZR2A 1OA2A 3NNFA 1TWHJ 4FOVA 3DKQA 4AM3A 3SNMA 3M8JA 2UYAA 3Q8AA 2WUHA 4ZZLA 1OKQA 3WE2A 1FJLA 1ZYBA 1RVF1 4A3GJ 2QQOA 3KHCA 5CVUA 1UKRA 1N25A 1VJ2A 4YFXF 2YG0A 1JBCA 4GALA 4XUTA 1PUFA 4UW4A 1CD3G 5DZGA 3P5BA 4AEKA 1F5FA 4E7ZA 1AHDP 4D7TA 3WQ0A 2JZYA 1V3FA 1ODMA 2SLIA 1VBE2 3VKMA 4NIAA 1DGWA 3G2BA 5HLHA 2KHMA 3R4SA 4LR4A 1IRGA 3DFGA 2VNGA 1K4SA 2YFUA 4EYUA 1UIJA 3G1OA 3H1MA 1QRYA 5KHDA 1VQMI 5FP4A 5LBFA 1C57A 4FOQA 5CJ9A 1Z78A 2Q8DA 4GKXA 2Y6JA 3EMRA 2RQQA 3VPRA 1SFEA 1VTNC 1ZZ6A 5A1LA 1RHI1 2VBPA 3ZFEB 4TXWA 2EINH 1J1LA 1UOBA 5CLSA 4F3QA 1RUF3 4NVPA 3F21A 1CQTA 4CCOA 1A6QA 1EJ9A 4QSHA 1TMF3 3BALA 4HSRA 3PO2J 1UX7A 4NIDA 2JG9A 4PLOA 1MMAA 3VZOA 2VPVA 3KSCA 2YPRA 3IRQA 3CCUI 5T5LA 1YFHA 3KP6A 2PAEA 2RS12 4JBAA 5DZFA 2GMEA 1XBFA 3BIEA 4UFMA 4ZONA 2D2WA 1HIXA 3F2ZA 3E1SA 3BIWE 4P00B 4LT5A 4JTNA 1MMSA 5IT6A 3MO4A 5D2AA 3UYJA 2ECCA 3FK7A 4F8AA 3Q0VA 2XBO1 5FP9A 1PP8F 3KM5A 2X1DA 1R093 2QM3A 4KN7X 2FF4A 3H3LA 4XBNA 4LB6B 5FYVA 2QQ8A 1U0JA 1S9HA 5HDNA 4B4RA 4CYCA 1GQGA 5J48A 4IV3B 2HWF2 1S7OA 3NSTA 4JVAA 1X3UA 5FUNA 3BTCA 5JLWA 3BJ6A 2I2SA 3VUOA 4LHSA 2FCVA 5CQGA 3F8FA 1YEWA 4HONA 5A3NA 4BPZA 2QYOA 2RJLA 2FJ1A 3ABZA 1RUG3 1F15A 2TNFA 1PYVA 2MD0A 1A6IA 2EIJH 4NC7A 2LKXA 3DPRC 3ZRGA 1XNKA 4I99C 3JD72 1MMNA 2X1EA 5CB7A 5JZGB 2VBBA 5CVJA 2QLZA 4M4RA 3RCOA 2JX9A 2KIUA 3K1PA 2A7AA 4BJTA 2VKHA 2F4OB 2KQRA 3T0DA 2HTSA 1O3TA 5JXIA 3K3NA 5EF6A 2M7BA 2P4WA 2XPVA 4CU6A 5LGUA 2YDEA 4YYOA 3OR2C 4QPIA 3KT1A 3PM1A 4KBZA 2BXZA 1MJBA 1NK3P 2CYYA 2ZJPF 2D45A 3CO2A 1RUH1 1SLIA 4H2AA 2DXIA 5LHIA 1K6OA 3WHTA 4BXSV 4YVWB 2D1HA 4UVBA 5A7NA 4QX3A 2L02A 4W4ZA 1ENSA 1RC6A 1SLLA 5EQUA 1H1IA 2PMHA 2W87A 2OF7A 2VQTA 2RR11 4GKYA 4U7DA 4A3EJ 2O6GE 4U87A 2W47A 4IL7A 3WF0A 1ZLKA 1SQ4A 3S57A 3VHRA 1BC8C 1CZVA 5JSOA 1W7PD 2D6MA 4OQ8A 1FWZA 4ANJA 4E7LA 1H8VA 4Y22A 1S7EA 4NBQA 2WDBA 2R1DA 1GYKA 4Q4W3 4AQSA 1FMD3 3K48A 1R64A 5C8CB 2B42B 4YRDA 3Q8FA 1ITYA 4J00A 5HV0A 2XF6A 1UHWA 4LBQD 1HOMA 5FOJB 1Z7S2 3I3LA 2VZ3A 1EV13 3F8CA 1Z3XA 2J5PA 1GKBA 2YUSA 1AJOA 1NHAA 4S2FA 1GNYA 2B46X 4B1RA 4RLFA 2R063 5A32B 1LU1A 1MS5A 3M3EA 3AFKA 5M5XJ 5A7SA