1ZRCA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 59
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrcA01
5FB2A 4AQ6A 1J58A 2XL7A 4ORFA 1LRHA 2HQRA 1SFEA 1DUXC 3IHUA 2XAHA 2HWVA 3J7AO 3F6OA 3TO6A 4QXKA 1T0FA 1I6XA 2ZNYA 3G73A 2HKXA 3PLQA 3WW4A 3RJPA 2M87A 1NHAA 5JSRA 2DK8A 1EPZA 3ELNA 3ROUA 5DYMA 2GZWA 1G3WA 4HMZA 1WLTA 4EWEA 1KU7A 2XAFA 2LDUA 5DD4A 3DPTA 5L3GA 2ZMEB 2XAGA 3C3WA 3GFMA 3KP3A 1PUEE 4P9GA 4HN0A 5ICGA 3BALA 3KZZA 4PCQA 4XF3A 5AIQA 5ICEA 4YSFA 2VBXA 2P7CB 2QVOA 4XEZA 2O3FA 4HVQA 4CHUA 3P7NA 3K69A 5DCMA 4QWQA 4MEXF 2HJIA 1I27A 1YFWA 3E6CC 5LEKA 2OBPA 3M70A 3BROA 1WWXA 3WE3A 2RN7A 5L3FA 2VOPA 4I0AA 3FZVA 4IEXA 3V8LA 1FWZA 5BPIA 4M9SA 4MGKE 1ODDA 2ETEA 3I0TA 3NQOA 3SHFA 4LMYA 2OZ6A 3JAMZ 3M8EA 4B8XA 3H92A 4KWJA 2VN2A 1FX7A 2VBYA 2F5CA 3TNQA 1IN4A 2I45A 1QNTA 2LNBA 3Q5FA 2DK5A 2HZTA 4HV5A 2XL9A 2XHKA 3KLOA 3ZPLA 2YX4A 3FMSA 4H7LA 2FOKA 5L3BA 4MV2A 2GA1A 1CAUB 4MGZE 4HVRA 5FGMA 3MYXA 5FDBA 2P5VA 4XRFA 2PAEA 3RKWA 1ZZ8A 3TOAA 4YFKF 1VJ2A 4UBHA 3CLPA 5KHGA 1I5ZA 2F5FA 5FLJA 3HHHA 2KJCA 5K5QA 3LA7A 4WVZA 4Y15A 2HYGD 3O2PE 2NYXA 2NNYA 1QGPA 3VFZA 2VT2A 4KN4X 4ZYDA 4TLFA 3ACLA 1P4AA 1XSXA 4G6DA 3TO9A 4YIIA 2IW5A 1Q5OA 4XFIA 1YW9A 3ZN0A 1G6NA 1F5TA 2Z33A 3C3VA 4E70A 2ET1A 2Q0OA 1MJ9A 4OLLA 3JW4A 2ADUA 2CO5A 3NL1A 3H7YA 5JHUA 1FXZA 1D8JA 3R6SA 1YFXA 4YARA 3Q9VA 3K2ZA 1J3QA 4P5OA 3RPQA 2FEZA 2GQQA 2WTEA 3U9GA 3SCHA 4IRIA 2XROA 3GYDA 2VQAA 3H1MA 5HOOA 2IPQX 3HRUA 3R0JA 1HW2A 4P96A 3IBMA 4BHCA 2O61A 4IHTA 4RB0A 4D7TA 2C0ZA 1RNLA 4I2OA 1ON1A 1FP1D 4A5NA 2O8QA 3HRTA 3USSA 1OPCA 3BJAA 4XFFA 3MZYA 3I59A 4RB1A 2IVMA 3FMQA 3HOSA 3HIFA 3K9TA 2EFPA 1T6SA 4I02A 3W6JB 1SMYF 1H1MA 5E1XA 4KIGA 1U12A 2G9WA 2IXHA 3I5UA 4MQ9F 4N9HA 1PP7U 3F21A 4HVOA 2V6CA 1IXSB 2D1HA 1CGPA 4KMFA 1CAVA 5FPXA 4UV9A 4KDPA 4F7ZA 1J5YA 1FSEA 2YU3A 2DU9A 3VB2A 5CVIA 2RV8A 3FF5A 5H6QA 1ZGAA 3F8MA 2EWNA 2Z99A 1Z05A 5ED4A 4EWAA 1QQIA 1IN5A 3KLNA 3RYRA 4I3PA 2DO7A 1EH8A 3H9AA 5E1WA 4Q47A 1J0RA 4HAMA 3DV8A 3CJXA 2JPBA 3NEUA 5BV6A 3J80Z 1ZAOA 3ZMVA 2FE3A 1DDNA 2OA2A 3ZMTA 2O03A 1R1UA 4UNOA 3D82A 1R5HA 5D5WB 3SZPA 5F6FA 3WE2A 2K4BA 1O5UA 4DINB 4X6RB 3F8FA 4A0YA 4AIJA 1ZHFA 2WC2A 3KCCA 5AVPA 2ESNA 2BEOA 2PQQA 4EM1A 3LSTA 2ZBKA 2OU2A 1B59A 1ZG3A 3MDPA 3B73A 3UKNA 3QOPA 4O9EA 1YW7A 5LRRA 2PI0A 3KP6A 4M71A 2H27A 4AXOA 3HHGA 3SCFA 4MHGA 4LTAA 1VR3A 3MFKA 2FBKA 2DPUA 4ESFA 1Y0UA 5FLIA 1HQCA 1OMIA 3GXOA 4HQMA 2X0LA 3WGHA 1Z6TA 1BM9A 3L2CA 4XLNF 5HVQC 3LWFA 2OPKA 5LRSA 3R4KA 2DW4A 2IXLA 2IJLA 2HS5A 4ZZDA 5ILUA 2FRHA 2GH2A 4U0YA 2EV5A 2DPDA 4N0BA 2ZJ2A 3WGGA 3WTTC 5HLIA 3FXUA 4R79A 1CF7B 4G7OF 1H0MA 1RGSA 2CAUA 2ZCWA 4KMUX 5DCFA 1UW8A 3HT2A 3SHRA 2H94A 5CU1A 1KU9A 1R1TA 5H20A 4JV4A 3FHZA 3LWCA 3V8KA 3WU1B 3E5QA 2PLYA 4OIQF 3RKYA 1ULYA 5ILVA 3FX3A 2MPFA 4OINF 3COAC 3BDDA 1LVAA 2IA0A 1LDDA 2MNGA 3NSTA 3KETA 2QBYA 5HDGA 1HSTA 3QPTA 1J1LA 2CAVA 3U2RA 2EFQA 4ZH4F 3LAPA 1KYZA 1S29A 3J80K 3RYPA 4NB5A 4HYEA 1LEBA 2HQNA 2IXIA 4OIOF 3DEUA 5JSOA 2OD5A 3FM5A 3VOEA 3KGZA 2ZKLA 2EFOA 4AIKA 2Q4SA 5CVRA 4L0YB 4WZCA 3RKXA 5FLHA 2EV0A 1KU3A 1U8RA 5J6XA 4A0ZA 4XFCA 3TKYA 4RGSA 5FO5A 3W6KB 1JXSA 4PGHA 2F5EA 4KIFA 1KYWA 1KA8A 3VHRA 3EDPA 3ML6A 2EA7A 4IJAA 1W7PD 3L9FA 2FF4A 1BN5A 1YS6A 3LFKA 2PAKA 1W5TA 1L3JA 3R0AA 3H50A 5I8YA 3EETA 1SFUA 4B09A 2AS5F 3IKTA 1FYKA 4ENJA 3ZQ7A 2Y48A 3E6DA 3E6BA 1MKMA 1V70A 5H6RA 3CO7C 3CL1A 1PP8F 1RUOA 1YHFA 1YW8A 5KHKA 3GLXA 3N4MA 2V09A 4OMYA 5LHHA 3RTRA 2EFNA 5LEJA 1VP6A 2FMYA 1ZRCA 5LHGA 4L9TA 1WGPA 4WK8F 2FA5A 1R7JA 3RIRA 4MGYE 5HLGA 3OGJA 3KP2A 5C6CA 4WF2A 4ON0A 4HZFA 5CVJA 5BS6A 2OYZA 4BXUA 1NYWA 4LB6B 1BIBA 2PFWA 4J1WA 1CAUA 2K4JA 1G4DA 1DGWA 4YG2F 3DN7A 1OYWA 4LJZF 2ELHA 4HF1A 4GYIA 1VTNC 1V4RA 2PMHA 3RZZA 2F5DA 5D4RA 4LLOA 3S0MA 3FXRA 2M1BA 1HW5A 3E6MA 1FLIA 3D0SA 4IEUA 1FYMA 4M73A 3F23A 3BZ6A 2XAJA 1OFNA 5KHIA 2LKPA 4BH9A 1EH6A 4I09A 2P4WA 1IXRC 4O6JA 4UXAA 4AVAA 2WV0A 4XF9A 2VOOA 2EA2A 3CJNA 3S7EA 2GC3A 5K5RA 1NXMA 2EFWA 2TDXA 3SQNA 1UHMA 3ZP5A 5E18F 1Z91A 1YWKA 1IF1A 5EZWA 4LULA 4CZZA 3KP7A 4MEYF 1FP2A 3NJZA 2K7LA 3DQVC 3EO6A 4MGRA 3IIAA 1TTYA 1AOYA 3RI4A 3SXYA 4XF0A 5DUIA 4A2UA 1QZZA 5J48A 1Z6RA 3OV8A 2ESHA 3GZ6A 1SFXA 4KU7A 1ZG1A 4LK0F 1EP0A 3QU6A 4A6EA 4D0PA 4R8HA 2XLGA 4IHSA 5J7MA 4E2GA 1W7PB 1TLHB 2Z2SB 5JVTA 5JCTA 1ZRRA 2VT3A 3H1WA 2D45A 4LB5A 4U7DA 5J8FA 2P5LC 5IT3A 2CG4A 4JQFA 4HF0A 1R5GA 4E2QA 2RC4A 4RAYA 5E16A 4GCVA 3FJSA 2GAUA 4P9UA 3OOPA 1K79A 1LDKB 4UHTA 2Q2EA 3V7RA 4HLTA 2BNOA 3CTAA 1MD0A 1FBSA 3KFWX 4ENKA 4H0EA 3WW1A 3O3KA 3E5XA 4WCGA 2ATFA 3DXJF 5BPDA 1HKTA 2V9VA 4UXNA 3HRSA 2IA1A 2CYYA 1RUNA 2RKHA 4ENNA 2PBIA 1XDSA 5I93A 4CICA 1L0OC 2ZNZA 3GFJA 3FWEA 2IP2A 1OKRA 3S7IA 1OD5A 2HOEA 2MD5A 4G9YA 4O9GA 4LUKA 3QP5A 2UY8A 4NVPA 2KKOA 1BJAA 3M7GA 1ZVFA 5F1RA 1UFMA 2PJPA 2EJRA 5CJ9A 2Y75A 5J3UA 4U0WA 3KP4A 3C7JA 1WI9A 1B1BA 2KIMA 3E97A 4WXCA 4P55A 1J7KA 1LDJA 3TGNA 3KEQA 3O6BB 4AVCA 3RDIA 4MUVA 1F1ZA 1NZCA 3T0YA 2GXBA 3NKTA 1IPJA 3D0JA 4XETA 1LNWA 1BI0A 2E7WA 4QGNA 2COMA 5L3DA 2PA7A 4I98B 1J75A 1HBXG 3RYKA 4G8XA 2GC2A 2STWA 4IF4A 3GWZA 3P9KA 2VXZA 2ZO4A 5AIPA 2FQPA 4K8FA 4UVAA 3CEWA 2CGPA 4NQWA 1T39A 3IRRA 5BOXA 4Y13A 4UBGA 2HTSA 2QJVA 3J81Z 3F72A 3I64A 1TNSA 2K27A 1J9IA 3WGIA 2FBHA 2DBBA 3IKVA 1YFYA 4RGXA 2G7UA 1DPRA 2BYVE 5D5XB 4RD7A 1H1IA 1ONVA 3GW2A 4UVCA 2LF8A 3CF6E 2OA4A 3ZMDA 1H9GA 3BPZA 2R7DA 4U7BA 1O7FA 4AD9A 4L9VA 4XLPF 3IC7A 4A6DA 3CUQA 5D5VB 3E3VA 1DZTA 2LF7A 2A68F 2UZKA 2HKOA 2VBZA 4OOIA 1YQAA 4ASNA 2DT5A 3F22A 1FNNA 4M9XA 4ETSA 3I53A 4KYWA 2V1DA 3D5LA 2XV4S 2B5HA 2ETHA 1O3QA 1YIOA 4Q48A 1E17A 3JSPA 4MH0E 2P6SA 4WXDA 5HS8A 1XMAA 2OAZA 3GEZA 3L09A 1BI1A 4IVNA 1SMTA 4MGIE 1MDMA 3Q9SA 2MH9A 1CAXA 2BNNA 1XCBA 5LLQA 2VC1A 3SZTA 1ZH5A 1R00A 2CW0F 2QENA 1T38A 3NRVA 3EUHA 4MZUA 2MC3A 3H3ZA 4M74A 1X7NA 5FQ0B 1OI6A 1YG2A 1U5TB 2D93A 2RNJA 3K1PA 4ZU4A 4K2EA 3BWGA 3T1BA 1KU2A 3U1DA 5HS9A 3MAJA 4HSJA 1TQPA 1FZPB 2D5HA 4WXHA 4PJYA 1FT9A 1JHHA 4ZU7A 2EAAA 2O1QA 4NHJA 1XSVA 1PM7A 2A69F 2Z3YA 2ISZA 3NVCA 1B4AA 3MWMA 3S2WA 2PAMA 3EQEA 1FBQA 3HSRA 2XUBA 2PFBA 2B9UA 4FT8A 3L00A 3I58A 1XGOA 4L9JA 4WBBA 3BP8A 1L3LA 2PTMA 2D1VA 2PHDA 2VE8A 2J5OA 2A5YB 3CO6C 3HQXA 1SD4A 4U0VA 1U78A 3U0ZA 4PZJA 3FZ3A 2QQBA 3JZVA 3IWZA 4HDUA 1T2KA 2VE9A 1ZYRF 4LD5A 2EB7A 1BIAA 2L3DA 5I0RA 4XF1A 1S6LA 4M6YA 1UIKA 3ZMUA 3BB6A 4EJWA 3N97A 3F8BA 2GC1A 3CO2A 3U10A 4KWKA 1JGSA 1IRGA 1SD6A 1RI7A 5DEQA 3GVAA 1UPIA 1ZNPA 4A12A 4G7ZF 2PG4A 2Y0OA 3K1NA 2EA4A 4DNCA 2HR3A 1JHFA 2XGXA 2J5PA 2P17A 5ICFA 4ENMA 2W85A 3ABTA 2WFPA 1PMIA 5K5OA 1XD7A 1SAXA 2DAOA 1W5SA 2A6HF 2Q0AA 2FBIA 4QM9A 4IPAA 3GX4X 4U88A 4EWDA 2XRNA 3PFIA 3J81K 2ET7A 2Q8KA 3MQ0A 2PMUA 3GFIA 4R52A 3TQNA 1ZZ7A 2XLFA 5FCCA 2R3SA 4RS8A 3ES1A 1XB4A 1R23A 1R36A 3ETQA 2ZXJA 2FMLA 4AIHA 5FLXZ 2F4PA 5JR7B 3LQRA 1ZLKA 4YRDA 3DFGA 1HW1A 4HA8A 2P5KA 1WA4A 1X82A 6PAXA 4L9NA 3G3ZA 1EH7A 3WG9A 4AQ2A 3I71A 1OYIA 5D4SA 2CWEA 2K9ZA 2GWRA 2KXLA 4HN1A 4KU8A 4ONUA 4EJOA 2GA2A 2EK5A 4ZYHA 4E2SA 4M72A 1GXQA 4CDGA 1CAVB 3GFLA 1YO5C 1P4XA 4HX7A 1JUHA 5I0UA 3C18A 3KP5A 1WKMA 4IXAA 4ZZLA 5DCMB 2FQ3A 1ZARA 2A3SA 3F3XA 5HI0A 1UD1A 1TQ5A 1R58A 2PN6A 1O57A 4I01A 4JBAA 4IEOA 1XGNA 2KJBA 5TRDA 1TQIA 5DD8A 1AWCA 2GXGA 3SMHA 2G7HA 4L5JA 4JK1X 4GO1A 5DV5A 1LB2A 5CADA 1SEFA 1D8KA 3ABUA 1Z7UA 4BYYA 4IERA 1LKNA 1P4WA 2L4AA 3P9CA 4FAHA 1BI3A 4LA3A 1MDMB 5D6FA 4EM2A 4PGGA 5DUKA 4LFUA 1DGRA 2QNKA 2PHLA 2XVCA 2M45A 4YFNF 1TQMA 3KZYA 2PYTA 2RGVA 5I8SA 2M8EA 1G3TA 1FY7A 4LUMA 3ERED 5HDNA 3U11A 4F8AA 1SD7A 4GULA 1XE7A 5E17F 1ZN2A 3HTSB 4L0ZB 2QVSB 1YFHA 1USSA 3WTWC 3BJOA 1QXRA 3CUQB 3QRFF 4B29A 3V7SA 4QX5A 1H9TA 2NAZA 1FC3A 3CUQC 5ILSA 4EM0B 3SXWA 1Q43A 1Z9CA 2P6TA 3GO5A 5KBFA 5AONA 2JZYA 4KL1A 3WW3A 5BUVA 1BOAA 1O3SA 2AXLA 2ZKZA 2L01A 1K78B 1ZZBA 3ZDSA 1YLLA 1QWRA 4XBFA 5JI6A 1J3PA 3I4PA 3EHKA 3I59B 2E1CA 4JTOA 5E1RA 4LLGF 2BV6A 5L3CA 2O0YA 3JTGA 1O4TA 2MBFA 2HFHA 1TNTA 3GYHX 2MHFA 4EQQA 3KSCA 3I7DA 2HYFA 4QMAA 3LZZA 4S04A 4CXFA 3F6VA 5CVVA 1YLFA 2CV6A 2Q30A 2FNAA 1KGSA 1IW7F 3HRMA 2BE5F 2XKOA 3ZMSA 1REPC 3V8JA 4HBLA 3EQLF 3WTSC 1KQ9A 1IN6A 5JAXA 4LA2A 4TV7A 3WTVC 1X8EA 3GF2A 3SCGA 4MX3A 5ICCA 1ZX5A 2VODA 4IEZA 1ZG5A 1QXJA 2JSCA 1IAWA 1B6AA 1MGTA 3DF8A 3TDUC 2VECA 4AVBA 1K78A 4GYGA 4Q0PA 1FOKA 2MH2A 1ON2A 4META 5D1IA 1RL3A 3TO7A 3TOBA 4I0BA 2FSWA 2QUFA 3IWFA 3AAFA 2M30A 3QP6A 5KHHA 1K6OA 2YX7A 5I0SA 3KMHA 5C8WA 1GVJA 3IRQA 1Q3EA 4UVBA 2DCTA 1CAXB 2A07F 4FHTA 2JTVA 1IN7A 4AWXB 5FD6A 2IXJA 1FSHA 2QM3A 4KN7X 1HKSA 1K7AA 4YNIA 1IZ1A 1LEAA 1B9MA 5D8LB 5KVRA 4QLCU 1V3FA 5J8CA 2L02A 2HDCA 1RTVA 5CVUA 1WSUA 4LLLA 4EMSA 1D5VA 5D6EA 3HT1A 1UCXA 4UV8A 1HKQA 3IDCB 4LEJA 4J1XA 2Z69A 3B02A 2GU9A 3UKTA 1P92A 4HBNA 1D3YA 5LGTA 1ZZ9A 3LOIA 5KHJA 1E2XA 5CLSA 1X3UA 3T5XA 2H6BA 2BNMA 2WWYA 4LG0B 3MZHA 5HLHA 1STZA 3PQJA 2Q1ZB 1W7PA 2Y0MA 1KQ0A 5EEGA 2QZ8A 1U3EM 4XFAA 1B9NA 4YIFA 5T3NA 2DI3A 2HEOA 3K1MA 1LR5A 2UWMA 4XFGA 3GBFA 1DP7P 1UIJA 3BPVA 1O7LA 1UHWA 3KE2A 1IN8A 1Z1DA 1XCVA 4EJUA 4X6QB 4HF2A 1I1SA 2QDRA 4IRGA 1HXDA 3WTXC 5EFUA 2IXKA 2OQRA 3M9AA 1LJ9A 1BC8C 1RZ4A 3WTUC 4BNCA 3V4GA 4BIFA 2OZUA 4N9IA 4EJVA 3DL3A 3EBRA 2X4HA 1QZYA 4CYDA 1W4MA 2YSRA 3WTZA 1EY2A 2FNPA 4MQVA 4L18B 3QPHA 2QBYB 4HSLA 1WRJA 2IC1A 4HOBA 2W24A 2N7GA 1X8MA 1YFUA 3ELKA 4KIBA 3PQKA 4BHPA 4MTDA 2V1XA 4P9FA 5I8TA 4HQEA 2E9QA 1ZRDA 1U5TC 3WU0A 4ESBA 1WQ2A 4EVIA 4G6QA 4HDVA 3V7CA 5FLXK 4XSZF 3H8UA 4RB3C 4GGGA 2CFXA 4GXOA 4JVAA 3OD0A 4IEWA 4Y17A 4PIYA 2A6EF 2HGCA 2QQAA 1JE8A 2M5WA 3ES4A 1GQHA 5A2QZ 1NE6A 4A5MA 1BC7C 1QO0D 2IXCA 4IEQA 4KUMA 3VEPA 3NW4A 1TW3A 3LA2A 1PDNC 4IEVA 3R61A 5LGUA 3BY6A 3DPLC 1YYVA 4FX0A 4IETA 2Z5UA 2KIFA 1IXCA 2XIGA 3F8CA 1DZRA 3TDZC 4PIXA 1YS7A 4M6XA 4HLXA 5D8KB 2DQRA 2D2WA 2QQ9A 4OIRF 1P6RA 3WODF 1G3SA 2JRTA 1O3TA 2XASA 4JTNA 3IDBB 4O5VA 1A04A 1S8NA 4IEPA 2RVCA 1CF7A 1F4KA 4XF4A 3TNPB 5F64A 2MA3A 5FD5A 5JR3A 4UUVA 3OTFA 2E1NA 5BY5A 4BHBA 2NS0A 3CUOA 1J2XA 4LLNA 3VODA 2VC0A 2VBWA 2PQ8A 1Y9QA 4BAYA 2W57A 2IT0A 2W25A 2L4MA 3T8TA 2E7XA 5D5UB 4BQAA 1Q1HA 4OFGA 4MNUA 5IT9K 4KT5C 2O8XA 5BPXA 1OYYA 1XSDA 2FXAA 1ZREA 3BPXA 1UB9A 1HSJA 2K02A 2L54A 4Z82A 3HOTA 1U5TA 1BI2A 1CAWA 1ZGJA 3DP7A 2EVXA 2MLGA 3QAHA 5FFZA 1KQ8A 1XGMA 2BGCA 1OR7A 2YPRA 2LSOA 5LBQA 3RNSA 5E8IA 1RC6A 3JAMK 1DPUA 4HW0A 3C1DA 5E8GA 1QPMA 5I0TA 4ZYEA 2FU4A 4IEYA 2W84A 1R22A 3PVBB 3LQQA 3WW2A 4HLYA 2CSOA 3ULQB 2OQGA 1XGSA 3DKWA 3BCWA 1XDUA 3M1EA 4KWLA 5EEHA 1J3RA 1UCRA 1S7AA 2RQPA 4G94A 2BBYA 2GIVA 4WWCA 2P7VB 1J59A 2RDPA 4QGLA 1IUYA 4L11A 5CYVA 2VONA 3JSOA 3HUGA 3PNAA 4RB2C 4Q4ZF 3K0LA 1EYBA 2A61A 5KK1A 5L3EA 4RGUA 2P8TA 1CAWB 4KICA 3QACA 4I7HA 5LHIA 3QU3A 3I54A 3RPUA 3MCZA 4PDKA 2F2EA 2R7FA 1QY4A 3MEXA 2QWWA 1R1VA 3ZN1A 5BMZA 3HSFA 3LAGA 4FBFA 1O5LA 1SFNA 4Q0SA 1TBXA 4L5IA 5FFXA 2K0GA 1GHCA 5IT9Z 1GQGA 1NE4A 2NNNA 1XMKA 1GXPA 3H7JA 3ST7A 3FM3A 3SFZA 3LA3A 5FQ0A 4IESA 3L2HA 4EGZA 4A0XA 3FE5A 4HV6A 2HTJA 3FFQA 1O3RA 1XRUA 3ECOA 4Q0UA 1ZZCA 3UKVA 2STTA 5E20A 2UYBA 3REOA 3L7WA 1MJBA 2JPCA 4OMZA 4Q29A 3HTUA 1FI2A 4HX8A 4HX4A 3KEOA 1BBYA 3EYYA 3BJ6A 1TW2A 5BQTA 1S3JA 2H6CA 5ERIA 2UXXA 2DFIA 1F9NA 1FYLA 3O14A 2YR2A 1XE8A 5HS7A 1EV7A 2EV6A 2QYOA 5BXXA 4L2NA 4KFCA 4EJTA 3FMRA 4KA4A 1P2FA 1C0WA 4FAGA 2PEXA 1IPKA 2ACJA 3ISPA 4M9ZA 3CDHA 3BOQA 3HSEA 2D40A 2IRFG 2B0LA 4YFXF 2H09A 2XLAA 4CO8A 3LAJA 2ZFWA 3M8FA 1Y3TA 2OZJA 4EV0A 2O6GE 5JFRA 3FHIB 2UY9A 3ZMZA 3H3UA 3GZ5A 2B8MA 2CQKA 4ZYGA 4Z2YA 2K86A 3BU7A 3F8NA 4R1HA 5HDKA 1ZLJA 2IA2A 4LG0A 4Z07A 3E5UA 2DTRA 4Q0QA 2VPVA 4FX4A 4CGZA 3GUDA 1FBUA 1XN7A 3G7DA 1T98A 5K1YA 5I91A 3JTHA 2XAQA 3IL2A 2QLZA 4Q0VA 1MJAA 2DLLA 2C6YA 1QBJA 2D5FA 1SQ4A 3MPBA 2H0VA 5DDGA 3HYIA 2Z9OA 3P9IA 4OIPF 1YTYA 1ZZ6A 4ZU5A 2DQLA 2KIUA 4AVPA 4QGMA 1CX4A 5E1ZB 2UYAA 4XSXF 2XKPA 4Q5SF 4G7HF 3T8RA 3EYIA 4EROA 5LGNA 4DQ2A 4LGWA 1YUDA 1USTA 4S05A 3ECHA 2ZMEA 4YYOA 2MLKA 1G3YA 2GC0A 3FXQA 3M3IA 5JSPA 4RGRA 2NRAC 4KNYA 1S7OA 2QCSB 1I1GA 2V79A 4PIZA 2JT1A 3WTYC 2ISYA 3H1YA 3OCPA 3CLOA 4D7SA 3OF1A 1ZRFA 1LQ1A 4WX9A 2UXNA 1FPQA 1IRFA 5A2QK 4OU0A 4XFBA 5K8SA 1U6GA 1SD5A 4RAZA 1MZBA 5TJJA 4MTEA 4LK1F 1U2WA 1RIOH 4O3MA 4IRHA 3KGLA 5FPZA 4ESJA 3EJKA 4QM8A 2V1UA 4EGYA 2KRFA 3R60A 4XFHA
chains in the Genus database with same CATH superfamily
3PFYA 3DPUA 4BEHB 3ASOH 1V9U2 1AR62 3G71I 1PM4A 3CJIC 4IL7A 4XW3A 3HN3A 1DYPA 1FOD3 3POWA 3J7AO 3TO6A 1T0FA 5BNNA 1BEV3 5IP9J 3THDA 4XMYA 3WW4A 3BIWE 4DFSA 1MR5A 2AYHA 2JA5J 1EPZA 1PK6C 4WVWA 1IDZA 5DYMA 1DG6A 4Q4Y3 1RHI1 2LALA 5EZHA 2QFEA 4HMZA 1WLTA 3GXUA 4EWEA 1MMNA 2BVLA 4P9GA 3JB8A 5ICGA 4PCQA 2YUEA 3MFCA 2A1XA 3RRDA 3DU5A 1SFKA 1RUI3 3I2DA 2ZMLA 3KT1A 3P7NA 3H8OA 4QWQA 4MADA 1Y9GA 3AJZA 1RHI3 1UG0A 4PJMA 1DGWX 1UYZA 2DOFA 1U5IA 1JTXA 1A5JA 2WADA 3E6CC 4UUSA 5FR3A 2OBPA 3FXLA 1ST8A 1YITI 1D4VB 1JZ7A 2RN7A 1HDKA 3WG1A 3FZVA 4J19A 2CUJA 5AVAA 1FWZA 4JAAA 4YGDA 1JYTA 4NC8A 4M9SA 2JICA 3DPRC 4LOSA 2VJJA 4XUNA 3A0KA 3NQOA 5EV7A 2PLV1 4OAZA 3GMEA 1WLWA 4A42A 4BEHA 2EF6A 1FIPA 2VN2A 5HCFA 2JE7A 2I45A 1LJ7A 1I39A 3P5JA 4FTHA 1E5HA 1Q8SA 2VAUA 2WQ4A 1V6IA 1DFQA 1FOXA 4PDWC 2XL9A 3ILRA 3G6JB 2WQ8A 3B00A 3LFUA 2ZX0A 5K7HA 2PN5A 2WJSA 5BNQA 1AR92 2HWE2 3H36A 4AI3A 2YX4A 5KAIC 4C0BA 1TME2 3MIHA 4MV2A 4MGZE 1KQRA 1LHOA 3WNOA 5EHDA 5FDBA 2Y0SA 3RKWA 1ZA7A 3C7EA 1F9KA 4AAPA 4AHYA 4A3BJ 1ZZ8A 2OXBA 3VDDA 4YFKF 1VBD1 5LWBA 2EIDA 2HOSA 1Z78A 1I5ZA 4HXCA 4E4HA 2XC7A 1I5PA 1V6OA 2HYGD 1PJRA 4KGGA 2DFEA 3VFZA 4KN4X 4ZYDA 4TLFA 2GBYA 3ACLA 4BPZA 4QPWA 4DB5A 1NA1B 3MBWA 1NLQA 1QRYA 1G6NA 2E19A 2JB8A 2ET1A 2Q0OA 5L9VA 1HRV1 3NL1A 3H7YA 4IXLA 1BZWA 1XC5A 4CDXB 4KNCA 3Q9VA 4HSTA 1AR72 4OULA 2ZMEC 3UYJA 3RPUD 2Q8EA 3U9GA 1WJEA 4XKBA 4URTA 1Y1WJ 5DM6F 2RS11 1N3PA 2WZ8A 5HOOA 2D6OX 3SH5A 4XKCA 2AGSA 1R082 4NC7A 1ULFA 4BHCA 4IHTA 1GOHA 3DPRA 1AL21 4LIUA 2ZA9A 3BJAA 3MZYA 1I3AA 1SPPB 2P3IA 4YVSC 1NA1A 2EFPA 1T6SA 3W6JB 4NRPA 2Q5TA 2ZGKA 3DXTA 4F93B 3J26N 4PFOA 1H2KA 2G9WA 5C3QA 1APLC 4TLGA 3ATGA 4YM3A 5FY9A 1PP7U 4YZ4A 2GP3A 3UGFA 4BQWA 5FPXA 3IKWA 5A7NA 4IE0A 3D5OA 5FJ8J 4A7KA 3N7JA 2RV8A 1SZBA 1HN1A 4XBNA 3BG6A 2Z99A 5ED4A 4JRAA 2DO7A 1VMHA 3H9AA 3CD6I 3ACIA 3FBIB 1KRIA 1ENQA 2PHWA 2JPBA 5FUNA 4B4RA 2PX9A 2PMWB 1YOVB 4Y22B 2WS93 1EJ9A 2W82A 2P4EA 3LEGA 1HRV3 3SZPA 5F6FA 1O5UA 4X6RB 4IV3B 4IGQA 3EUKL 2WC2A 4DOZA 2GALA 2WA3A 3MF6A 5AVPA 2ESNA 2H1KA 4WVMA 3LSTA 4QQHA 1SFYA 2OU2A 3ZMOA 1B59A 1ZG3A 4O9EA 1YW7A 3BZCA 1ULDA 3KP6A 4L97A 4M71A 3WP3A 3BTZA 4AXOA 3N9QA 3HHGA 4MHGA 3SNMA 2DPUA 2W1WA 2M7AA 1VBD3 5FLIA 4AFBA 3EPZA 4WZFA 5L9BA 1UMHA 1ONAA 5ANNA 2IEKA 2Y6HA 3K7AJ 4BY7J 2OPKA 2WYSA 3R4KA 1W6OA 2IJLA 4ARYA 5ILUA 2A3YA 4YVSA 3LSJA 4P14A 5DPNA 5IPAA 2FRHA 2ZJRF 5L9RA 5FZGA 3SLIA 3VBFA 2EV5A 4N0BA 2RMU2 5IUQA 2GDFA 2ID4A 3VHNA 5HLIA 4RGAA 3CCYA 3FXUA 4R79A 2WO3A 4ISQA 4G7OF 3AMPA 4PK4A 2R0FA 2NS7A 2CQQA 2IBDA 1EPWA 1R1TA 5H20A 1UYXA 2EIBA 3V8KA 3E5QA 3W2AA 1POV0 2E7TA 5C33A 1PZ8A 4HG2A 1K61A 1ULYA 1JMUB 5ILVA 3GTJJ 2MPFA 2MNGA 2IA0A 1LDDA 4IOAF 1HSTA 1NLSA 2CAVA 1ZTRA 4ZH4F 1UY2A 2R5YB 3AMNA 3J80K 4NB5A 2BQPA 4NIDA 2OC6A 1UY4A 3T0AA 3ON7A 5JSOA 4E6KG 4WM7B 4I30A 1LOEA 4NWWA 2N8GA 5J3LA 3S3MA 1SLCA 3CLQA 3ERMA 5A1FA 4PUSA 5CVRA 3S3OA 4WZCA 4QB2A 2L5QA 2EV0A 4AEDB 4Y22A 1OPMA 4ZONA 2LY9A 1MBFA 3W6KB 5FO5A 4PGHA 1XQNA 3X2QH 4IQPA 1CQTA 3EDPA 3ML6A 4QPIB 3QODA 2DFCA 4A93J 3LFKA 1QHHD 2PAKA 2FHRA 5H9RA 4RQPC 2X6OA 1L3JA 2EINH 3R0AA 2W5FA 1YCIA 1HDPA 1OA4A 3K10A 1GNYA 4D8MA 2O9LA 3IUOA 3S30A 1A8DA 4AFDA 2ZJCA 4ENJA 3ZQ7A 2VL8A 1AR61 1V9U1 4YLZA 1LGBA 2IVJA 1V70A 3CL1A 2VPLA 5A6XA 1RUOA 2G4IA 3RZLA 4M3EA 5J1YA 1LFPA 4P08A 5LHHA 1XYNA 3PU8A 3ZFFA 2YBKA 4C2MJ 5LEJA 1VP6A 5LHGA 4L9TA 1UU4A 2F4OB 4XMIA 2FA5A 3WNNA 3OYEA 1F5FA 2R5ZA 4Z92B 1B35C 5K7PA 4ON0A 1ZR4A 1ZELA 1SLBA 3UETA 1NYWA 1JKRC 1DGLA 5CQEA 2PFWA 1A8MA 1JTZX 4G4FA 2K4JA 1DGWA 1W2OA 2GSYA 2RDRA 3NJXA 2LY2A 1VTNC 4HK9A 1W0PA 1V4RA 1QHDA 2F5DA 3S0MA 5LBCA 1FYUA 4FFGA 2M1BA 1ERDA 2DCEA 3ASIA 3D0SA 5T50A 2XPWA 2X09A 1OFNA 5KHIA 2LKPA 4BH9A 2OTJI 1OURA 4I09A 4OMDA 3W59A 2WA0A 1H8TC 2QA4I 1IXRC 4O6JA 4UXAA 5AC91 1RITA 3ZDVA 2VOOA 2XG3A 3WHTA 1MMAA 1NXMA 2EFWA 2DN0A 3SQNA 1UHMA 3ZP5A 5E18F 4YZ3A 1PHMA 1YWKA 3JU9A 1IF1A 1JODA 4J25A 2PHRA 4MEYF 1FP2A 2K7LA 5GAEJ 4XONA 2UWBA 1WPKA 1TTYA 2K3FA 5DAXA 1Z6RA 3RFRA 3LSPA 2XJQA 5AFBA 4LK0F 1O8SA 2YROA 1EP0A 4A6EA 4FPJA 2ZACA 5J7MA 2JDNA 1A6IA 3HEIA 1FTZA 3HM5A 3H1WA 4U7DA 2HVSA 3NNFA 2L9SA 1JXNA 2CG4A 1ND3C 3POBA 4HF0A 1R5GA 1LHWA 4E2QA 4H2AA 3M2MA 3V7RA 2E71A 3BN6A 5C9AC 3BUCA 1IZ3A 4H0EA 2IAIA 1QJEA 2ATFA 1GT0C 3DXJF 1UXZA 1XPXA 4CU7A 4LHSA 5ACA2 4UXNA 1MZ6A 2VZOA 2LFBA 3M8JA 2RKHA 3DKYA 1AL22 4CICA 1L0OC 2ZNZA 1X3WB 4A41A 1OKRA 1VNDA 1JZ4A 2W4SA 1AHDP 3VZJA 2IVIB 5CFDC 4G3YC 5F0CA 3G4SI 3QP5A 4CCDA 4FISA 2Y0SN 4DGWB 1BJAA 3BOPA 1ORKA 3M4FA 1UFMA 1VFCA 2PJPA 1V6JA 3MKWB 2VU9A 5J3UA 1OCPA 3C7JA 4QKFA 1B1BA 2WBKA 2OUMA 1J7KA 4S2HA 2B45X 2ZEXA 3O6BB 4IE7A 1NZCA 3AZZA 2BY2A 3HBKA 1VI0A 2GXBA 1W9YA 5J36A 3NKTA 3D0JA 2XPVA 3I4MJ 4XETA 5BNOB 4YFWA 1CR7A 1T33A 4GJYA 1SVOA 4DNYA 3RCOA 1UOFA 3SC7X 3POEA 4DMIA 4BJ6C 2PHUA 3F9KA 2STWA 3X29B 1K5MB 4QQLA 4W50A 5FYCA 3DYPA 2DJIA 4N7IA 1B72B 4UVAA 3IAPA 2ZX3A 4QU2A 4UBGA 2QJVA 3J81Z 1ALYA 1J9IA 4BDZA 4L9BA 4RGXA 5D5XB 3AKTA 4NN0A 4RD7A 1ONVA 3JRDA 3GW2A 2RE9A 2XAUA 1XU2A 1RUC2 4Q4W3 1PVC1 3IH3A 2LF8A 1D2SA 5JXGA 1H9GA 4BM8A 1X4PA 2HNHA 3WF0A 4ASMB 5IHRA 3AZWA 1S0CA 2ZX4A 5CB7A 4MLOA 4QDQA 2VBDA 4RSUA 4Y5Z0 2E26A 1S2EA 4D1QA 1VPHA 4AD9A 4L9VA 4XLPF 1YX3A 3IC7A 1C5IA 2LF7A 2UZKA 1ASJ1 2VBZA 2ZAHA 4YM0A 2YUSA 4YM2A 4GMP3 4KYWA 4OUEA 4X8NA 3D5LA 2R49A 4XOPA 2RMU1 3VUOA 2ETHA 1O3QA 1YIOA 4Q48A 1E17A 2MYSA 2P6SA 3SDBA 3K3NA 2OAZA 2WT2A 4EYUA 3L09A 1JJ6C 2DVBA 1QQP3 4AG4A 1JU3A 4MGIE 2ZSHB 4CCLA 2JA6J 5FO9B 1R4NB 5BNPC 1UOJA 4DBQA 2QENA 2ARBA 3NRVA 1T38A 4CU6A 4HSRA 4RDUA 3AMHA 4B3AA 1ENRA 1OI6A 1YG2A 2R7EB 3VBSA 1M4WA 3MICA 3LF7A 2JE8A 2IUWA 3BWGA 2DA5A 2XB0X 5HS9A 5LD2C 4BE3A 4WM7A 1SEUA 4PJYA 3EXUA 2ZTNA 3F95A 1D0YA 4PSWA 5IFTA 3LQCA 4ZU7A 2EAAA 3BGAA 3PVNA 4NHJA 1PM7A 2Z3YA 1PIV2 2Y26A 3MLLA 2XUBA 2AREA 2B9UA 4FT8A 2BBAA 3L00A 1XGOA 2CHHA 3WG4A 2AENA 2PTMA 4FOWA 5DMYA 5JVVA 2PHDA 1WBLA 3VN4A 2A5YB 3HQXA 4NMIA 1L7RA 1LKXA 3T1MA 1EUUA 2WNOA 3MFAA 3PUHA 1D7PM 4GDFA 4L99A 4XF1A 4O65A 1UIKA 1QH6A 1W6OB 1MBHA 1YQ2A 1TP4A 4ZDOA 4IKFA 1JGSA 1O91A 5DEQA 5SV5A 2NZ9A 1ZBE3 1ZNPA 4A12A 4RS5C 5IATA 2M7BA 2CY6A 2OPWA 3K1NA 1JHFA 3GTGJ 2GN7A 4C30A 3KWVA 3SKJE 4QDRA 2P17A 1IQAA 5F04A 1PMIA 1XD7A 1D1BA 1SAXA 4WVMB 3GDBA 2A6HF 3D4KA 2DFBA 3GX4X 5LA0A 4U88A 4DYCA 3MEPA 3WR0A 3PFIA 3J81K 4GB33 2Q8KA 4CEYB 4XC9A 1GBGA 3P3NA 2LKSA 4NWVA 1GNHA 1CZVA 3PIGA 2P3YA 3JCUC 1ULEA 5H9SA 2BWCA 3WP4A 1PO23 1JZ5A 5CKNA 1BVVA 4GALA 3RZJA 3ETQA 2EIEA 1HXS1 1KDMA 1HW1A 2P5KA 1WA4A 1X82A 5IY5H 3WQBA 2K9ZA 5B1BH 5GAHJ 2CWEA 2NVYJ 3ZPOA 3MIEA 4KU8A 2C9KA 4YWAA 5JOYA 1TWGJ 2GA2A 2EK5A 2ZAAA 3W21A 3O1SA 2LG4A 4M72A 5F37A 3GFLA 4DYQA 4FE4A 1P4XA 3PUSA 5LZ6A 4BQ4A 1RVF2 4FPFA 5DCMB 2FQ3A 5GAGJ 4QPOA 5EF6A 3KQ4B 4D9JA 2HZDA 1AYN3 3DTEA 1UD1A 2PN6A 1NAEA 1VQ9I 5F27A 2YB7A 4BIOA 4NRMA 2J1AA 4V19K 1TQIA 2QQLA 1OH3A 5FIXA 4FE7A 4GWNA 1R092 4Q1PA 4GO1A 4BYYA 4IERA 3NRUA 4JGZC 2L4AA 2RM23 3THCA 5LA9A 3PO2J 5DUKA 4JKMA 2OS2A 5F1JA 1LOGA 4BZ4A 2ZS6B 2XVCA 4XXAA 4LO8A 4YFNF 1TQMA 2XVLA 2TRTA 2JDPA 4YW4A 2M8EA 2LROA 3CCVI 4FASD 5HDNA 2NVQJ 4E4DX 4TXWA 3HTSB 5FZ4A 5ACA1 2QVSB 1YFHA 1USSA 4UFJA 2PXJA 3QRFF 4B29A 3EMRA 4B1LA 4DY3A 1H9TA 3FN9A 4TN7A 3DWLE 2CW7A 3CQOA 5CNAA 1GLNA 1Q43A 1Z9CA 3GO5A 2HBUA 2LYCA 5AONA 2JZYA 1BOAA 4LJHA 5KNLA 1OCRH 2EZHA 1YLLA 1SC7A 4KMQA 4XBFA 1BJZA 1J3PA 3I4PA 3TBDA 3AP6A 4JTOA 5E1RA 3GTQJ 2BV6A 4A3GJ 5IAVA 1R083 1GP5A 1TNTA 5DXDA 3GYHX 2MHFA 5A6ZA 3LSMA 3KSCA 4XQWA 4QMAA 3LZZA 4XORA 1OSGA 3F6VA 5CVVA 1GWKA 3WDWA 3UT0A 1NXD1 1JYXA 1JKOC 2W1UA 4W65A 4S2FA 1PO12 2KA3A 3J7AY 1KGSA 5FPAA 2BE5F 2WT0A 1IN6A 3CC4I 1O4YA 4CDWC 2XH6A 1FNYA 2NVXJ 1X8EA 2W48A 3U4XA 2FJ1A 4UFMA 1QDOA 4JC1A 1ZX5A 4XZPA 3AM2A 3W3CA 3QPSA 2XWJB 3A4CA 1ZG5A 4QX3A 1B6AA 1MGTA 3ZPYA 4F3JA 4ZDPA 5D8AB 3GZTB 4XHBA 1AKHA 1FOKA 1ON2A 1RL3A 4YZ2A 5J1RA 3IWFA 5F5AA 2M30A 3QP6A 1G59A 3CJTB 5GLVA 3KMHA 2I10A 4AYBA 4P5YA 2AO9A 1GVJA 1C4RA 1JOBA 4G9SB 2A07F 1MQTB 5BNNB 4AWXB 2IXJA 3BR0A 1FSHA 4INDA 4KN7X 3AFKA 1HIXA 1LGCA 2WIIB 1PO22 1HKSA 2HOAA 2DMNA 4YNIA 1LEAA 1RUJ2 5E3OA 1I3QJ 2B39A 2DV9A 4A3JJ 4UWDA 4OI0A 4EMSA 2HWD1 4UV8A 2WY7Q 2CJJA 5FP7A 3P3PA 4CUBA 2VQCA 1HQLA 5GLWA 5LGTA 1W8TA 5CLSA 1X3UA 3T5XA 1P8JA 3GNEA 4KBZA 3LIHA 5FO7B 4BQ2A 4LG0B 1ETYA 1W7PA 1D4M2 1KQ0A 5EEGA 3ZFEC 1QVUA 2DFFA 2R041 2VKEA 2ZGTA 4ZPIA 4YIFA 1J84A 4JGYA 1H9PA 3S17J 1DBNA 3KHBA 3WNPA 1W8NA 1O7LA 2FDKA 3KE2A 2GMPA 1VAVA 5C3OA 3BTCA 3PNTA 4RHV2 3WX5A 4CCNA 1XCVA 3ZVXA 3BR5A 2YMZA 4X6QB 1I1EA 1I1SA 1QJY3 2R7WA 4IHYA 2XSJC 5IOYA 4AC0A 2IXKA 4OYUA 2X6XA 2VD7A 1BC8C 1RZ4A 2R7TA 3QOEA 2R6QA 3VV1A 3V4GA 4N9IA 3OEBA 1ZA4A 1DGRN 2J22A 3LD8A 3B69A 2DFHA 2FNPA 2IC1A 4M6VA 3OYJA 1X8MA 4KIBA 2V1XA 4P9FA 4R9AA 2LRDA 2EPFA 1YQ5A 5F3GA 2CWMA 3WU0A 4XKVA 4YG3A 4EVIA 3AVRA 4S0HB 5FLXK 2R32A 3OSGA 4ZYAA 4XE9A 4BQ1A 4RB3C 2MC4A 4GXOA 4JVAA 4IEWA 1AHSA 2JSPA 4PIYA 3H3VK 1ULOA 2QCOA 2CFOA 3NV2A 3CCQI 1NG7A 1MBJA 2IXCA 2WZR2 3VEPA 5FYHA 2HLEA 4Q4Y2 3LE0A 5GKAC 2YYOA 2XR4A 1T6BX 2VZPA 3J7MA 1E3OC 3BY6A 4IETA 2KIFA 1IXCA 2C4XA 3MV01 3NAPA 1S4CA 4PIXA 5D8KB 1RUI2 3OG2A 4YRVA 3WODF 2NMNA 1W0NA 4O5VA 1A04A 2RVCA 4CYCA 3UESA 3LSGA 3ZFEB 1PNFA 5F64A 4LORA 5FZLA 5T5PA 5IVFA 5KAFC 5BY5A 1RUF2 4QX7A 3CUOA 3SEQA 4LLNA 3VODA 4JZRA 1ZYBA 2VBWA 2PQ8A 1LEMA 2VKHA 1DP0A 2W25A 2L4MA 3RSNA 1DLLA 1A36A 1AR91 4BQAA 4OFGA 4MNUA 3AMQA 1RUE3 2J1VA 2BHYA 5F6KA 1KD7A 2VB6A 2Y64A 4BOWA 5IVVA 4AI8A 1D0HA 5JIAA 3DUIA 2PELA 2FXAA 1O4XA 4XDQA 3BPXA 1X3ZB 2L9VA 2IGKA 2W92A 2DCKA 3DP7A 5BNNC 1MQTC 5FFZA 1KQ8A 5JZGC 2BGCA 4AYBN 2YPRA 2LSOA 4LT5A 2XGCA 1S2KA 1DPUA 2BVBA 3JBG1 5E6HA 4P9WA 3C1DA 5E8GA 1QPMA 1JKQC 2C5DA 2P5BA 3AP9A 1JU4A 1VBE3 2K40A 1QOOA 1NY72 1IG7A 1TZLA 3L1PA 4KG8A 5EDNA 3A4UA 3LQQA 3U07A 3CJIA 1FPN2 3E0JB 3ZN6B 4OI2A 1XGSA 2KLOA 4ATEA 3DKWA 3K48A 2X6WA 1D1AA 4XVHA 4ABZA 1J3RA 2WKKA 1OFSA 2QKMB 3UKGA 1S7AA 5F0HA 2FX0A 4E9KA 2PMZA 3CC2I 3OIPA 2P7VB 4CDWB 2BTVC 1Y7BA 2W1SA 2RS12 1IUYA 1RKTA 1WMXA 5KK1A 1R081 1UU5A 5L3EA 3LPGA 1CAWB 4KICA 3MHZA 3QACA 3ZKYA 4I7HA 3HOXJ 4E7KA 3OSFA 2R7FA 5C9AB 3ECQA 1R1VA 4CA9A 5BMZA 3HSFA 2W47A 3GTMJ 4IHWA 3WINE 1VQLI 3A01A 2RS52 5FFXA 1B09A 1Z21A 1GHCA 2QQPA 4XLFA 5IT9Z 4CP2A 1X50A 2NNNA 3ST7A 2RS33 3U78A 1NCRA 5FQ0A 3D8CA 1WCSA 4HV6A 2HTJA 3FFQA 1O3RA 2FCVA 5FMBA 2VNGA 3LSEA 5FY8A 1MJBA 5CFDA 4HX8A 4HX4A 3NWSA 1STMA 4QTRA 1TW2A 4MHRA 1UELB 2CU7A 4AEDA 3ZN6A 2XSDC 4XIDA 3ABLH 2DFIA 1NCQC 5FJKA 1DQ1A 5BXXA 3CMGA 2W39A 4EJTA 1SG3A 3I2GA 3I2OA 4KA4A 3K70C 4FP2A 2ZGSA 2R1DA 1C0WA 4FAGA 2PEXA 1WLCA 3OS0A 1IPKA 2W3JA 2ACJA 4D0QA 2OW4A 3ISPA 1H8TB 4M9ZA 2WZR3 2AEZA 3CDHA 2E31A 3HSEA 1NCQB 5JMCA 2D6KA 2H09A 1K5JA 2J1EA 2ZFWA 1V00A 2GOXB 1BA5A 1UPSA 3IDEA 2OZJA 1WUVA 4EV0A 2O6GE 1LHUA 4XDPA 1DP3A 1GP4A 4XJAA 4C3IJ 4A6SA 3OOXA 3H1CA 3TL4X 4Z2YA 3VYSB 4XQFA 2HYXA 3CDZB 2R7QA 1WMDA 4NHKA 4R1HA 4E4SA 2P2KA 3FLTA 4UY8I 2DTRA 3ZSMA 1H30A 4FX4A 3CP2A 4J00A 1BHGA 3USUA 4DQAA 4DPNA 2QLZA 2VQUA 4ZKTB 1CIWA 4J01A 1QBJA 4YEJA 1SQ4A 2H0VA 4ZZ5A 4LHNA 3O1VA 2R042 4JGZA 5IK4A 1NH3A 1W8UA 4QGMA 3R4UA 4C1XA 3L2UA 1UY0A 1VLNA 1VRH1 2WO7A 2VUMJ 5E1ZB 4YPJA 4XRMA 4Y7NJ 2JB4A 5FREA 1C28A 1COV2 2HWF1 4DQ2A 1XNKA 2ZMEA 4FO9A 2HWB2 5JSPA 4RGRA 1I1GA 5FV3A 1RUH3 4XM3A 2L7FP 1FX5A 2WL1A 4WV8A 3H1YA 2Z79A 4D7SA 3OF1A 1UKRA 3CCJI 1LQ1A 4FTBA 5F5CA 5JXIA 4DO0A 1FPQA 1F31A 5A2QK 3K4JA 4XFBA 2JDKA 1SD5A 4RAZA 3FUQA 1MZBA 3KPHA 1A31A 1F15A 1DU6A 4AAXA 1X9PA 3U4SA 4IRHA 4JQTA 1Y43B 1BOBA 3SZGA 5FPZA 4RS5B 5F9TA 4GIQA 1LULA 4LG3A 2V1UA 4EGYA 4DS0A 1OD3A 4WM7C 4LKDA 1AZDA 2WFF2 4ORFA 4Q4V1 3HGGA 5DTDA 1LRHA 3IHUA 3V56A 1TL8A 2DMUA 3F6OA 1IJWC 1I6XA 3VWBA 4OQ9A 1XS9A 2DU0A 2FD5A 4K9SA 4HNUA 1PNGA 2CS3A 2F4MB 1H4GA 3DPTA 2PHXA 1URXA 3C3WA 1F36A 4HN0A 5AIQA 5GZFA 2VBXA 3A01B 3T2PA 2WYFA 4DYRA 4HFSA 4NPLA 2VW0A 2XHNA 4MEXF 3Q0UA 2UV1A 5IWFA 1YFWA 3KT4A 1CPMA 3M70A 4BJ0A 1WWXA 3WE3A 5FZBA 2VOPA 5T54A 3HKZA 1FNZA 3ZYBA 1TME1 5BPIA 5DDJ3 2CUEA 3M3YJ 5EJZB 3FKJA 3HOYJ 3ZYIB 1ODDA 2ETEA 2BERA 3S1NJ 2HI3A 3I0TA 1V0AA 3JAMZ 3VHPA 1W3VA 4GKYA 3TEDA 5DZFA 4KWJA 1MMGA 4XMAA 2F5CA 1VMJA 1IN4A 4FP3A 1VBA1 5FWEA 3JUUA 1SDWA 3ZRGA 4HNTA 2D6LX 3GTKJ 3ZPLA 2Y9ZA 4M3GA 3MLJA 1YEWA 2J1TA 2VTXA 3JRHA 3U75A 1V5EA 4XJ9A 1AUYA 1UN1A 2WZPP 4XRFA 2P81A 2IS6A 1IS5A 5F08A 4JHZA 1E5IA 2OVUA 1YIJI 3AB0A 4JP0A 2F5FA 2L7MP 5FLJA 3HHHA 4QX1A 4IL6C 2KJCA 4LO4B 4Y15A 5GZEA 2NYXA 4ISRA 1QJU2 5FZAA 1XSXA 1UY1A 3UR3C 3K4LA 2R5YA 4LQRA 4CCJA 4ZZ8A 1F5TA 2Z33A 3C3VA 2GOMA 3LDRA 1MJ9A 4JDNA 2EH3A 3FLRA 2Y6LA 2H8WA 1A78A 1MNMC 3UGGA 1D8JA 4YARA 3K4ZA 4LE4A 3K2ZA 4CP9A 2PQSA 2LTPA 3RPQA 1H8VA 1RUD1 2WTEA 4W1UA 1AXZA 3AL6A 3K46A 1IGNA 2XROA 3AXDA 3GYDA 4KJZA 3TRSB 3V0BA 1K5MC 2ADDA 3H3LA 2V4JC 3FKIJ 1DQ6A 4P96A 3ENRA 2YC4A 4D7TA 1SLLA 1NUKA 2HWE3 2Q1FA 4LBQA 1QJY1 5J98B 1R4MB 3USSA 4XFFA 5C44J 3HOSA 1COV3 1ASJ3 4I02A 2EZLA 5KCMA 5FYYA 2IXHA 2D5VA 1UZZA 2QQIA 3OUHA 4M0NA 4HOOA 2D1HA 4E8CA 4KMFA 1CAVA 2K9NA 4UV9A 4V2WA 2ME0A 1J5YA 1FSEA 5FKMA 4DZJA 3HNYM 2PJRA 2GXAA 1VQ6I 1X1PA 1UMQA 4EATA 4Q1RA 3FF5A 4AVZA 3J8F2 3F8MA 5CFDB 3NNLA 2EWNA 1Z05A 2VPRA 4EWAA 3Q0VA 1QQIA 1IN5A 3PMEA 2Z16A 4XN3A 4ASLA 1EUTA 1LOFA 1EH8A 1ZGWA 4IV3A 3Q0WA 1LTEA 3WF4A 5FZ1A 1W8FA 2A3WA 1AXKA 3NEUA 5BV6A 2IS2A 3Q8BA 2FE3A 3PTYA 2HWD3 2QQMA 3ZMTA 1R1UA 3D82A 2V5DA 2DUQA 1R5HA 5GTHC 5D5WB 3I49A 1NQDA 3WE2A 4DINB 3A02A 1ZHFA 4AZZA 3KCCA 3RS6A 1WW6A 4P5HA 2A5WA 1GZWA 3CC7I 5D8AC 1IHMA 5FP3A 5LRRA 2PI0A 3OIQA 3IZOA 4LBMA 3KX2A 5T52A 1JUPA 1X33A 5B5EC 4LTAA 1VR3A 5IYBJ 1MMSA 2FBKA 4DUXA 2VGDA 1Y0UA 1OMIA 2X0LA 2O8OA 3MPPG 1JBCA 1BM9A 4A45A 4PFPA 3L2CA 1JZ8A 4NJ4A 5HVQC 3AXEA 3LWFA 4NHYA 4CDWA 2HWC2 2HS5A 4EN8B 5CG9A 1QJX1 4NQWB 2M4GA 1C8M1 3ZQQA 1OXCA 5A7WA 2DPDA 3AYDA 3W6VA 2ZJ2A 3W2WA 3WGGA 1YI7A 1CF7B 1GR3A 1BBT1 4KBBA 2ZCWA 5DCFA 3VHOA 3NV1A 3L9JT 2LUWA 3SHRA 4Y1XA 5CU1A 1KU9A 3FHZA 3LWCA 3WDUA 3WU1B 1PGSA 4YGCA 1YYNA 1PK6B 1OR7C 4OUMA 3MW4A 1W2UA 1S7EA 2MABA 4NC6A 1GWMA 3KETA 1RUJ3 2EFQA 1KYZA 1VRH2 3RYPA 5D2AA 1LEBA 2E51A 2X10A 5FRAA 4OIOF 4ZXEA 1H2NA 3IN9A 1COV1 5EZGA 5FKNA 2ZKLA 4LITA 3GF6A 4XAAA 2RNGA 2CDOA 5FMOL 3OYFA 5FLVA 1XJAA 1XNBA 2NYYA 5BNGA 3WDVA 2YXSA 3VL8A 3TBIA 3A1YA 3OYBA 1QJU3 2ARAA 5A7PA 1JXSA 2E60A 2F5EA 2XBO1 4KIFA 4NR1A 1KA8A 3VHRA 4MFEA 2IGNA 2FF4A 2BGPA 3V0AB 5FZIA 3H50A 1OH4A 4AUXA 1K83J 2FQ4A 4FXGB 4B09A 4P9LA 1JTYA 4RL7A 4JGZB 1TC3C 2WFF1 4XKWA 3G1LA 1XMXA 3E6BA 3HVDA 1PP8F 4JQRA 1AR82 4E7HA 5KHKA 3AG1H 2V09A 4OMYA 3AKZA 2OCEA 4CVUA 3RTRA 1TWCJ 3KCYA 2FMYA 3T4HB 3GALA 3CDIA 1PVXA 1R7JA 4XUTA 3VKOA 1N1YA 1W99A 3K6GA 4MGYE 2K9SA 2XJVA 5IYYA 1NT0A 1JI6A 2CL2A 4WF2A 4HZFA 2K5CA 5BS6A 1D2QA 2M2EA 1HC8A 4J1WA 1CAUA 2KRCA 4AEDC 5FO8B 4N7UA 3PNYA 4GFBA 5FPLA 1G8XA 1UX6A 1JJ8C 3FK6A 2R16A 3BI3A 2CWSA 2VL4A 3KLSA 3RZZA 5DAPA 3VDBA 4XHXA 4M3DA 2CUFA 1FLIA 4IEUA 1FYMA 1E5RA 4M73A 5JZGB 3FFZA 2XAJA 4LOTA 3MI8A 1EH6A 1SBDA 3HMYA 4RAFA 2WN2A 1X9TA 2HWB1 1AX1A 5K5RA 3MIFA 3SQOA 2TDXA 2VMDA 4XNFA 4YM1A 4HETA 5J4VA 5EZWA 4LULA 3KP7A 3WOGA 3V42A 4OVEA 4MGRA 3IIAA 1W8OA 3S1QJ 2K3PA 5AFEA 4X1EA 2JJ6A 1AOYA 3RI4A 3I3MA 5JPNB 3DCQA 2IS4A 4ET7A 1QZZA 4JDMA 3WEZA 5EJ1B 2ESHA 4AGRA 3GZ6A 3QU6A 4OZOA 2C6SA 3I4IA 4R8HA 1W7PB 1TLHB 2HWC3 2Z2SB 5JVTA 3H0OA 2YHJA 1T6GC 1V5GA 3IH4A 4PF1A 4EQVA 3U21A 2D45A 4D94A 3RWKX 3L2YA 3M07A 4XBQA 3R4DB 1QZEA 2Z5WA 4LO6B 2SBAA 2ARXA 3DXUA 2RC4A 1BVP1 3PIJA 3FJSA 4OZXA 2GAUA 2ECBA 3OOPA 3VZOA 1LDKB 4UHTA 1N25A 2RM22 1FBSA 1GMMA 4AGGA 3WW1A 2Y6KA 2M4KA 3H9GA 1BR2A 1HKTA 1QU0A 5IP6A 2J1SA 5F5IA 1X19A 3HRSA 2IA1A 3JD73 1RUNA 4JYKA 1MH3A 3L2RA 2AUYA 2PBIA 2JA7J 1FOWA 3AP4A 5CKQA 3FWEA 3IIIA 2IP2A 2XPUA 1TNFA 1W06A 3DGTA 3RMXA 1Y6IA 1OD5A 4B44A 1IG3A 2X6YA 4AU7A 3T30A 2R93J 1MBGA 2CQXA 2UY8A 2BHZA 1RETA 4A7YA 3PSIA 5FKKA 1W9WA 1FMD2 3M7GA 5BNPB 5F1RA 1GP6A 1FEXA 2E5ZA 2ZHMA 1J09A 3A21A 4U0WA 1WI9A 1VBA2 2KIMA 3E97A 2DUOA 4WXCA 3T2OA 1U5ZA 4AVCA 1F1ZA 4LKSA 3ZM8A 1IPJA 1SLAA 1T95A 5DN2A 1O4ZA 1WW4A 1YX5A 5DUUA 4I98B 3ZSJA 1J83A 4G8XA 4IF4A 3GWZA 3P9KA 2ZO4A 2CRGA 4K8FA 5JWPA 4P1WA 3SJMA 2CGPA 2JDYA 3I97A 1NK3P 1UOGA 2VBPA 5BOXA 3OJBA 3LGRA 3I3DA 5C7GA 2DUPA 4UAPA 1YFYA 3MZ8A 1DPRA 1ENHA 3ZOIA 2R7VA 2AACA 2WO2A 2TEPA 4GB31 3LEKA 1PZ7A 2R7DA 4BS9A 1GV9A 1O7FA 4PJ0C 5K7ZA 3AP7A 4A6DA 3E3VA 3HC7A 4OOIA 2E6VA 4ASNA 3JRIA 2W0XA 2EZIA 4M9XA 4ETSA 1V5FA 3CNAA 1BEV2 2QKLB 2V1DA 1RUD3 2RREA 3JB4C 2GMMA 3GJBA 3QLQA 1BKZA 4AVSA 1DGWY 3VBOA 3JSPA 4MH0E 3ZR5A 1P7JA 2KRHA 2KPMA 5HS8A 3CCUI 2RAEA 3GEZA 2RR12 2VJ5A 2ZMKA 1ULGA 1SMTA 2Y33A 1KXGA 1D0GA 3BTLA 2MH9A 2EIGA 2BNNA 2WWSA 3OS2A 1W28A 1Q8QA 3BIEA 3SZTA 1ZH5A 1Y8QB 5DZGA 3N7LA 2R061 3IPVB 1D4M1 1SDDB 4IE5A 5FQ0B 1HLVA 4AHZA 1RHI2 4A44A 3RI9A 2D6MA 1T08B 1U5TB 2D93A 3OL3A 2RNJA 3K1PA 4ZU4A 4K2EA 3T1BA 1KU2A 1RESA 3PURA 1TQPA 1FZPB 4WXHA 2B4KA 5FZEA 3HL2A 1FT9A 1JHHA 4M3BA 4Y4RA 3ZN4A 4CP1A 2XVGA 4IW3A 3P6BA 3AYCA 3MWMA 3LSIA 1DCSA 2AZ5A 2YDEA 2JXAA 2PFBA 1W8HA 2BOJA 5M3FJ 3Q3SA 4F3QA 4YELA 3AKQA 3BP8A 4DJAA 2LP0A 2EIJH 2D1VA 2E32A 3ME2A 4E4ZA 3G2BA 5E3NA 3WT3A 1GUIA 3CO6C 1EAH3 4PZJA 3FZ3A 2QQBA 1ND3B 3JZVA 5HBAA 2XF7A 1POV1 4XXPA 3WUDA 3U1KA 2HWB3 2VQGA 2EB7A 4QWNA 5F2WA 1US3A 4Q26A 2FOWA 2LY1A 3N97A 3JD72 3CJIB 2P6HA 4FPKA 3U10A 2JJ7A 1RI7A 2WSUA 3WNXA 1UPIA 2VOWA 1OCTC 1VQPI 2Y0OA 1E5SA 4EN9B 2EA4A 1OQ1A 3OYLA 2J5PA 3JBG3 1GOGA 1G8WA 1CWPA 5ICFA 3RVHA 4N4NB 2W85A 4A3ZA 3OBTA 2A6XA 5K5OA 2DAOA 2HQAA 4P9YA 1W5SA 1ZR2A 4GXLA 2HVRA 5ANQA 2X1EA 2YGLA 3ZGKA 2FBEA 3I3BA 4EWDA 3VKNA 1SANA 4XIOA 2XRNA 3QYFA 2VXRA 3MQ0A 3GFIA 1UNBA 1GOFA 2BFUL 5JLXA 1S0DA 1N3QA 2R7SA 1WFXA 1AR71 1DF0A 5FLXZ 2F4PA 3LQRA 1F8VA 2JDAA 4CDQA 6PAXA 2GLOA 4AQ2A 1OYIA 2GWRA 4HN1A 4CA0A 1PMHX 4ONUA 4M3CF 2NMOA 3HZJA 3OL4A 2DCJA 1VQ4I 2QQVA 4E2SA 4HG6B 2BY1A 1KGYA 4LNVA 1YO5C 3FHNA 3PNVA 1JUHA 2BZDA 1OOPA 4IXAA 1WKMA 1WGXA 4EN0A 4QX2A 2Y31A 2A3SA 2ZGQA 4LKFA 1TQ5A 1RPWA 5FPBA 1XGNA 2KJBA 4NAMA 4GMP0 3ILNA 5DD8A 1AWCA 2GXGA 3CCLI 4XJ8A 2J7MA 2JENA 1PGL1 1W36D 1LB2A 4LHLA 1D8KA 5BNPA 3HR9A 2VIXA 4N53C 4CCMA 3ABUA 3LPFA 1LKNA 1P4WA 1LHVA 4LA3A 4CEYC 5F3CA 5D6FA 4EM2A 3ESWB 4PGGA 2VMGA 1DGRA 1Y4WA 5FRNA 5IOZA 3M1CA 2XRLA 2QNKA 2PHLA 2BV4A 3FXJA 4RQPB 5M5YJ 3NARA 3Q8EA 4QPIC 5A3TA 4QX8A 3I3QA 3VLBB 4XLHA 1FY7A 3OBRA 1S0JA 4GULA 4BE1A 2GNMA 1HOMA 1GU3A 5GALA 1EV13 3ZN5A 3BJOA 1QXRA 3K3OA 4COUA 3V7SA 1ITYA 4QX5A 1RUH1 3CUQC 1LHNA 2VG9A 3SXWA 2JG8A 2P6TA 2XB6C 3OD4A 5JI9A 4M3FA 4PJLA 1YJ9I 4BACA 3THPA 3M4OJ 1GANA 3ZDSA 2VH9A 4ZS3A 1O8PA 3HJRA 2H1LA 4ANJA 1QWRA 1UKGA 2Q8DA 3B01A 3EHKA 3I59B 2JDHA 1WBFA 4JX6A 3JTGA 2NPIA 4R4ZA 1ULPA 5E3LA 5FZ8A 2R071 4OHWA 5CKTA 4NIGA 3ZQCA 1YLFA 1CZSA 3I2IA 1OFCX 3SDGA 2BOIA 3DLLF 2FNAA 4CCOA 3VBUC 2DVFA 2J1UA 1Z7S1 3WVJA 4I6ZA 3ACHA 4EJRA 1W6PB 3KM5A 3ZXFA 1X36A 4TV7A 3ZO0B 3SEPA 1HB1A 3GF2A 2BWAA 2AH2A 3SCGA 4MX3A 1MMDA 5ICCA 4XYXA 1HB4A 1MNDA 4IEZA 1ZK8A 4IDZA 1U0JA 2F48A 3AG2H 4UW4A 4HL0A 4S2GA 4H55A 4W6YA 5C4JJ 3ABZA 2VECA 3RGBA 1W6NB 4Q0PA 2QQNA 2VO5A 1UZWA 2ZX2A 2FSWA 2HWD2 5D21A 4CEYA 5KHHA 1K6OA 2YX7A 5I0SA 3HKZN 4AM3A 4BQNA 4UVBA 5LK7B 2V6EA 2YC0A 4LMFA 2JD9A 5FD6A 4GQ7A 2ICWG 3RZGA 5DUVA 5JI7A 2CU5A 2KZVA 3RZHA 1WCQA 2E7AA 4YW6A 3FK7A 3Q9OA 4U87A 4GH4A 3TEWA 3KS7A 1S2BA 2L02A 4NUBA 4LLLA 5D6EA 2JECA 2VZTA 1W2NA 1GFF2 3B02A 2GU9A 2OQ7A 4HBNA 1QGLA 5JZGA 1EA3A 4RA2A 4RHV1 1ZZ9A 2A73B 3LOIA 5KHJA 4I99C 1E2XA 2BNMA 2HXOA 4PLNA 2WWYA 2V9PA 3NKGA 2YY1A 1TG7A 4CCEA 5EYXA 2QZ8A 1U3EM 5GZCA 5FOBB 2E5NA 4PJNA 4YVSB 2Y38A 1ETXA 3ETPA 3S5QA 3C7GA 4C2UA 2XWBB 4YIRX 5A80A 4XFGA 3AL0C 4AVTA 2K85A 1IN8A 1Z1DA 5A70A 1YRNA 1VBB3 1ZBA1 1AR93 2NOGA 5BNOC 4FXKB 4DXZA 1IS4A 1WD3A 4HF2A 1S55A 2QDRA 4FQZA 3WTXC 5H9PA 2VNRA 5GLZA 4BIFA 5JDBA 5K0UA 4EJVA 1IS6A 3EBRA 2LBFB 5GPAA 3ZXGA 1H6XA 4CYDA 4PLMA 1W4MA 2LTNA 4II2A 5FPVA 2Y6JA 2YSRA 2GMEA 1V6LA 3WTZA 4YW7A 2OKXA 1EY2A 4L18B 3QPHA 4HSLA 2W95A 4HOBA 1RXGA 2F5VA 3OPWA 4B4CA 1CPNA 1YFUA 1VQKI 5IW0A 3ZYGA 4WVVA 2VQ0A 3PQKA 3I2JA 2H0BA 2E9QA 4UB8C 3DBHB 2ZGMA 4HDVA 2KD7A 3V7CA 4RYDA 3H8UA 2XQRA 3C7FA 2HGCA 2QQAA 2M5WA 2ES3A 3ES4A 5A2QZ 3GCXA 2K9LA 2QQJA 3K2AA 3IAQA 4BQXA 2D6NA 3NW4A 4PDWB 5LB6A 4QD2A 3URFA 3LA2A 1U0AA 2A7AA 4IEVA 1F2NA 1F35A 2XPJA 3OR1C 4FX0A 2Z5UA 1OLTA 1BW6A 3TDZC 3O0VA 4Y1UA 3L2QA 5HCBA 3K51A 3VKLA 3RZDJ 2ZPXA 4B3XA 1QDCA 5EIYB 1WMEA 3DPRB 4HLXA 4Y5TA 2KR2A 2DQRA 2QDNA 2QQ9A 1P6RA 4AR2A 5I0DA 1K45A 2AEYA 3TP3A 1BBT3 2D44A 3IDBB 1MS5A 2JWPA 3TW6A 5IK5A 3Q8AA 1CF7A 5FBJA 2QEXI 4UUVA 3ZLIA 2E1NA 3HPHA 4HRIA 5DDJ2 3UGHA 2NS0A 3C8XA 2YS9A 4N8MA 1Y9QA 1W6MA 4BAYA 2WO1A 2LD5A 1ND3A 1MACA 3HBLA 4A3FJ 3AYAA 2QF7A 1SFOJ 3T8TA 4AVVA 5D5UB 5JLWA 1AU7A 4QPIA 3OBAA 1W1WE 2VZRA 5DG2A 1H2MA 5FYZA 2VQHA 1OYYA 2ELJA 3LFIA 4Q8KA 1XSDA 3VZKA 1UB9A 5CIRA 2BY0A 2K02A 3AG3H 1U5TA 2OUJA 2WQZC 1CAWA 5FZ3A 1ZGJA 3QAHA 5C70A 4B3NA 3RNSA 3JAMK 4RA0A 1P9QC 5CBLA 2VVDA 1ACIA 4NRQA 2JG8C 2W84A 3O1OA 1S0FA 1R22A 1GV2A 2BW8A 4XR6A 2ZGUA 3ZFGC 3K77A 3WW2A 5A3OA 5F32A 2CSOA 3ULQB 5A3UA 2XXZA 4XUOA 3AKSA 2OQGA 1FV3A 3BCWA 3G6EI 4JCKA 1XDUA 1B35B 4P9XA 4F52A 2L9RA 5C8CC 4IV1B 4G94A 2GIVA 2CMPA 3NO8A 1J59A 4Y5SA 1RUG1 3PNAA 1WJCA 2DYRH 4Q4ZF 5KXDA 3JCIA 4Z1VA 2YZ4A 4QAWA 5LHIA 1RUC1 2E2IJ 1N3OA 2JDZA 3BPSA 3I54A 4IHXA 3QH7A 1QJY2 1S9HA 3RPUA 3EB7A 4PDKA 2F2EA 3FXOA 4B4QA 2AQFA 5GLTA 3WQ7A 3KZIC 1MSEC 1SFNA 4PQ9A 1YIFA 4Q0SA 1JUMA 4L5IA 1QQP2 3WG2A 5B4NA 3CIHA 1VRBA 1GQGA 1NE4A 3FM3A 3KYDB 2VM9A 3SFZA 4B43A 2JVHA 4RN5A 4UF0A 4EGZA 1TZOA 3FE5A 4QHBA 4B1MA 1VBE2 1GSLA 1IC8A 3ECOA 1XRUA 2ADEA 1HF0A 3TP0A 5E20A 1JYNA 5L7OB 2X48A 1JT6A 3CCRI 2UYBA 5A33B 5T5LA 4B48A 3L7WA 3LMMA 4DXRA 1NG0A 3HTUA 3CZ6A 1H89C 4FQ4A 4UUTA 1QJX3 1Z0HA 1TWAJ 4YGBA 1DQ0A 2CGNA 5JVGF 2BW3A 3A0BC 3NAPC 1CVNA 5CKMA 2WN3A 2BXYA 2XB5A 4KFCA 1XB9A 3VD4A 5A6YA 4HPKB 4RAGA 5CG8A 2VTXJ 4Q4W1 4NIHA 4XN0A 4C1WA 3BOQA 2M3AA 2B0LA 2DCYA 4CO8A 2VZVA 2Y69H 2B9VA 1Y3TA 5EGOA 2OV7A 3H42B 3O7OA 2W9XA 4IEJA 3B6CA 1W8WA 1M1EB 4M3CB 2FD8A 2Z1DA 1LGNA 2XONA 1C8M2 3PJQA 3W58A 5HDKA 3C2BA 2NN8A 3DYMA 4LG0A 4D6RA 4Q0QA 2VPVA 4DZPA 4CGZA 4ES9A 1RUE2 2HWF2 4CH7A 3JTHA 1LU2A 2XAQA 4BJTA 1CONA 4Q0VA 1H88C 4KITB 3DEWA 5DDGA 4UFIA 1YC61 2VUJA 5JXHA 4OIPF 1ZZ6A 5DAQA 2V9KA 1YI9A 4KISA 3VBRB 4EN7B 4IV3C 3NNJA 2ZHNA 5FZ0A 3CDLA 2M9HA 2RQQA 3GGLA 2UYAA 3RZMA 2VVFA 3ZYHA 4XSXF 2XKPA 3JR9A 4Q5SF 1OPOA 3T8RA 3Q8FA 1LEDA 4IOCF 4SBVA 3O0XA 2MGQA 4QXBA 1UQXA 2DOAA 5EG0A 1J1TA 3FXQA 4DRRA 2GN3A 1S7OA 3NWTA 1OA3A 3JRAA 4A3KJ 1B72A 1ZRIA 1KFXL 2V79A 3C2HA 2JT1A 4M4PA 4XCAA 5B4XA 5CA6A 1RC9A 2ISYA 2KZGA 3D5RC 5JUVA 2VNOA 3CLOA 2JD4A 3PVOA 1W2AX 2XUMA 2JE9A 2O5RA 3LFMA 4Y52J 2QBXA 1K12A 5JOXA 3KGLA 2HPMA 2ZB9A 3MIGA 3BG3A 2WY8Q 2VMIA 4LLFA 1UJ8A 1MS3A 3R60A 2RDNA 4UW3A 3W5MA 2LVSA 5FB2A 4E7ZA 1PMJX 2W1QA 2HQRA 2W2IA 2WNUB 1SFEA 1DUXC 2WB1N 4UT5A 1R6RA 3FBYA 2CV1A 1UWWA 1ZKGA 5LA1A 3PLQA 3RJPA 5IK8A 5JSRA 4C90A 1W5CC 4NO4A 3ROUA 1W36C 1G3WA 3I9V2 2DMQA 3ZQLA 1MS8A 5BYNA 2LDUA 4BK5A 2HDWA 5L3GA 2ZMEB 3QWLA 3KP3A 5CQGA 3KZZA 5DUXA 2P7CB 4KH9A 4CDXC 2PLV2 2VLAA 4RGKA 2E34A 5FZOB 2LW8A 4D7YA 5A3NA 3K69A 3PMSA 4ZXKA 1NA1C 3CCEI 1CJDA 2A05A 5LEKA 3BROA 1Y0NA 2V4AA 4DOUA 4ES8A 1TEIA 3V8LA 3MO4A 3C7HA 3OB8A 4MGKE 2MFZA 4MOAA 5LBEA 4LMYA 2OZ6A 2JA8J 3OYGA 3FC0A 3M8EA 4B8XA 3H92A 1NLRA 4R9BA 4CXYA 4IGPA 3CZUA 1FX7A 2VBYA 3TNQA 4Y24A 4XLAA 2W7NA 3Q5FA 4HNVA 3JRCA 1TVGA 3HQUA 2XHKA 3OYNA 2W1OA 2WAFA 2AXTC 2WB1A 3FMSA 3CCSI 4ARXA 2QQUA 2FOKA 4AE2A 2BGOA 2Q8CA 5J1XA 4NHLA 2PAEA 1E3PA 1K4SA 3TOAA 4AOCA 4AF9A 1X4OA 1UO9A 1VJ2A 3JXSA 5FZFA 1UU6A 3LKJA 4UBHA 5KHGA 1EKEA 3V64A 5K5QA 1WJDA 3LA7A 1MNEA 2MEV1 2NNYA 1PK6A 2VCMA 1NK2P 4ZC3A 3LSHA 2Y34A 2WNVC 1P4AA 4G6DA 3ZSEA 3EYPA 2R7OA 4YIIA 2IW5A 3CP8A 1I6HJ 1Q5OA 4FOQA 3ZN0A 1L7LA 2G0EA 5J1UA 2YU9J 1OOPC 1ETWA 2ADUA 2CO5A 3JW4A 1W6MB 1S0BA 5E79C 5JHUA 3R6SA 1V6NA 3S93A 3O0WA 1JGGA 3BTAA 1J3QA 4P5OA 2FEZA 2GQQA 3WHCA 3VDXA 4YG0A 1Y9MA 1W3XA 2E33A 2WNEA 2VQAA 1HN0A 3H1MA 3POGA 3B9CA 2NVTJ 3ZR8X 4N43A 2O61A 3FHAA 5FYSA 4AEJA 3BC8A 1ON1A 5FFOC 1HRV2 1OPCA 1KJLA 3I59A 2B7EA 2JUGA 4BK4A 2ID6A 3J7HA 4PHZA 5E1XA 1TMF3 1HKDA 1U12A 4KWUA 4MQ9F 3A0HC 4N9HA 4HVOA 3FXKA 2V6CA 1IXSB 4LK6A 4BUPA 4KDPA 3IM0A 4BL0B 2ZXWH 1ND2B 1OC1A 3U1XA 3ZYFA 4RS5A 2WFF3 1D4M3 5H6QA 1QVTA 4DRVA 4RLQA 2XJUA 3KLNA 3RYRA 5B1AH 4GD4A 5E1WA 4Q47A 1J0RA 1ETOA 2VOVA 2VZ1A 1WD4A 3J80Z 1ZAOA 3TOJA 5E3MA 4QB6A 1DDNA 4IQJA 4BQ3A 4UNOA 2RG4A 2DOEA 3VBFB 3J4UH 1IUFA 2K4BA 3F8FA 4A0YA 4AIJA 4MVTA 3NAUA 1ULCA 4M3CE 4CYCB 2HWC1 2PQQA 4EM1A 2ZBKA 4BXXJ 3TAYA 3MDPA 3B73A 3S3NA 3WY6A 3QOPA 3SEZA 1G7YA 3DU6A 4K6BA 4LBOA 5FZ9A 2FDIA 1WW5A 3MFKA 4ESFA 4XQ4A 4PCRA 3DBRB 1HQCA 2XDVA 3GXOA 3O8HA 1SACA 3T08A 1ZBE2 4JX0A 5LATA 1Z6TA 3S32A 4AI1A 4FPOB 2HDDA 4QQPA 1OKOA 5LRSA 2DW4A 5DS9A 3BT9A 1OA2A 4JKKA 1MEC2 1QXPA 4K20A 3VBSB 2GH2A 4U0YA 4LO5B 2NXNB 2CW8A 1PX3A 2WABA 2OJED 5F3EA 2A71A 5A3PA 1H8AC 1H0MA 1RGSA 2KP6A 4KMUX 1UW8A 5FZDA 3B94A 2A6YA 2PLYA 4GRIA 4ATFA 2DDAA 1RMU1 4MFDA 1US2A 4OIQF 1MVEA 2R073 3RKYA 2D43A 2F4LA 1S1AA 4M00A 1LVAA 3NSTA 3DF0A 4RBOA 5T55A 2GNBA 3QPTA 3VBHA 1S29A 3AJYA 4HYEA 2HQNA 3BQYA 5A3WA 1AYM2 3DEUA 4D5CA 1VQOI 1HRI2 2BY3A 1W03A 2OD5A 1IRZA 3FM5A 3VOEA 4ZS2A 2EFOA 2JN6A 4AIKA 2Q4SA 2W87A 1K4TA 5JPMB 1GYKA 1ETVA 5FLHA 3WCRA 4FTEA 1ZBA3 2WRAA 3C7OA 1KU3A 3ZXKA 4BXSV 4PBPA 2WLQA 1U8RA 1YXWA 1RUF3 1N1SA 4A0ZA 3TKYA 3CCMI 2YFZA 1KYWA 2LM3A 3LDBA 1BN5A 1YS6A 1W5TA 5GTIC 5GJ6A 3FXMA 1R093 1X1AA 3TMOA 1RUJ1 4PI0A 5FKBA 1R1A3 3EETA 1JYIA 2A3XA 3IKTA 5FY7A 1E3HA 4NIIA 3IT8A 5FAXA 3CO7C 3IMNA 3MV11 1YHFA 3HPNA 1YW8A 5JR2A 3B93A 3N4MA 5BNOA 3E7LA 2GIZA 2EFNA 4MO7A 1VBC2 4GWJA 3JQXA 3CMAI 4AGVA 3RIRA 1SFPA 2XBO3 3O1UA 2CQ7A 2A5ZA 2DA3A 3OSDA 4QU1A 1RIRA 1AF9A 3QD6A 3VDDB 2WBMA 4LXLA 5C6CA 2QQWA 2O0OA 4BXUA 1K6YA 2OT7A 5IP7J 1CJPA 3JBG2 3DECA 1BQPA 3HNMA 3ZXJA 4JGYB 5A32A 1G4DA 1EV11 1VZ0A 4BU2A 2ELHA 4HF1A 4GYIA 3ZXDA 2PMHA 3AG4H 1Y56A 4BBSJ 2DYCA 3OUJA 4XTPA 4Y1VA 1HW5A 2W91A 1GICA 5D8AA 4AFCA 3E6MA 5FTTC 2I8DA 3F23A 3BZ6A 1N77A 3HGYA 3WSOA 4XJWA 1E57A 1R9TJ 2P4WA 4XRSA 4AVAA 5C4WB 2WV0A 4XF9A 5FYBA 2NLRA 3MIDA 4BLIA 4IZZA 2GC3A 3CKHA 3MGUA 4L8QA 1IS3A 2TCTA 2RS32 4UOJA 2AR6A 3BR2A 4CZZA 3M3EA 1DU3D 3EO6A 2ILMA 3SXYA 5FZOA 2E36A 3M3QA 3OV8A 1SBFA 4KU7A 1ZG1A 5LK5A 1RRJA 3IP4B 4UF0B 3CMYA 3ZXLA 4BB3A 4D0PA 2FDGA 1G9FA 4E2GA 1JUSA 1PGL2 5J09A 4Q4Y1 1PVC3 4Q4V2 1ZRRA 2YBSA 3POJA 3V0BB 3AX4A 1O59A 1W0TA 1WH5A 4D69A 1MPXA 3ZFEA 4LB5A 2P5LC 4QQOA 5IT3A 2WLPA 3QBQA 3BR3A 4FCAA 5G05L 2WNUA 1C3HA 5J4YA 5E16A 4P9UA 1ZQ3P 4HLTA 3HAGA 2BNOA 3CTAA 1MD0A 1D0XA 3KFWX 4Q8LA 2EZKA 3RG0A 3O3KA 4JHTA 4RFRB 1TWFJ 3O1RA 3BU0A 1HDDC 5BPDA 4RR3A 3SFIA 2QSGX 4AI9A 2RV9A 5EYYA 2M0MA 4AHWA 1RR8C 5FY0A 4FVVA 2R7UA 1RUF1 5L19A 3VYUB 3RZKA 4H14A 4Y3OA 4ENNA 2DBIA 1IG0A 2XQXA 5I93A 1G9AA 1AYM3 1GZTA 3POSA 5KXBA 2MD5A 4G9YA 5GPCA 4WM8C 2JG9C 4O9GA 1IKQA 2Y60A 4I0WB 2M0CA 4Y4YA 2KKOA 4DW6A 1C5HA 4OCTA 1DQ5A 3A7QA 1CX1A 1RUC3 1ZVFA 1AXYA 2NVUB 3MN2A 2EJRA 3LOBA 2Y75A 4CUCA 1OVSA 3KP4A 5J47A 5DM7F 3WD5A 1RMU3 4P55A 2R043 3TGNA 1OCOH 3S8PA 3TN91 1H4HA 2VXDA 4PLOA 2VCBA 2W08A 2E7WA 1YHQI 1POQA 4DEQA 5ACA3 2R7ZJ 1J75A 3A23A 1Z7S2 3IMMA 4QPYA 1JYVA 1PGW1 2GC2A 1F4AA 5JXJA 3CEWA 4NQWA 4MXWB 3E1SA 3QCWA 3FISA 3IRRA 4MSVA 2HTSA 3F72A 2K2SA 2K27A 2DTZA 2GNDA 3WGIA 1FTTA 2YPJA 2D3PA 2G1MA 3N35A 1REEA 4TTGA 5TSWA 1H1IA 1RKWA 5C9AA 4UVCA 2J1RA 3H5NA 3CF6E 3ZMDA 1JT0A 2E1MC 4LIVA 5F7UA 4URAA 2FCTA 2VZ3A 1N78A 2CSGA 5D5VB 3CUQA 1DZTA 2A68F 1V54H 1YQAA 5IVEA 3WUCA 1WW7A 3HWJA 2VUAA 1VBA3 3SEEA 3OMYA 3DTIA 3MKZA 2EIMH 4CEWC 2XV4S 2B5HA 1IRXA 2G9GA 4RM3A 2Y8KA 1XMAA 5A3MA 1BI1A 2EXKA 2WV1A 5T5OA 2F6BA 5AC93 5IT6A 2OCCH 1CAXA 2RDSA 1XCBA 5LLQA 4HK8A 1LFBA 1R00A 2CW0F 4OQ8A 2V26A 1HXS3 4DBRA 4BBRJ 1JH5A 3H3ZA 2DT6A 3OYWB 3LSDA 3OBZA 1JZ3A 3B9IA 2LBFA 3FDYA 3PL0A 1GDTA 4HSJA 1HRI1 3ZMNA 4FPEA 2D5HA 3FBMA 4C91A 4Q4X3 1OF4A 4Y26A 2O1QA 3ZIWA 1XSVA 3VZLA 5JMOA 2ISZA 1B8IB 2FCUA 2ORXA 1B4AA 3HPGA 2PAMA 1XOYA 2E1OA 1FBQA 3ZFFC 2NOJB 3VD7A 3JD71 4CRQA 3OYAA 3I58A 1VBB2 2A6ZA 4L9JA 5DUWA 2KISA 2XGDA 1XYOA 2OIIA 2D98A 2DDBA<