1ZRCA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 59
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrcA01
3BY6A 4LJZF 4GYIA 5EEHA 2XAFA 3L00A 2K9ZA 1S6LA 3MYXA 4Q0QA 4HF1A 1O3TA 3MDPA 1EH8A 4U7BA 2FOKA 2ESHA 1I6XA 2V9VA 4HQEA 2M5WA 2A69F 3ELKA 3V8JA 2ISZA 5ILSA 4G9YA 3ML6A 3RIRA 2GQQA 2GA2A 3GX4X 3ZN0A 2XV4S 4S04A 2EV6A 1XGOA 1WKMA 3QPHA 5LEJA 5KHJA 4GCVA 4YRDA 2COMA 2FBKA 4O5VA 2M87A 1KYWA 3ZN1A 1JUHA 3I7DA 2ZO4A 4RB1A 3K0LA 4BH9A 3C7JA 1SFNA 2K4BA 5D5XB 2Q0AA 1RI7A 1ZRCA 2EAAA 1TLHB 4A6EA 1KQ8A 3K1MA 4RGSA 5EFUA 4ZU4A 1KU7A 3IIAA 2F2EA 2P4WA 5JSOA 1FXZA 2ZJ2A 4HMZA 4LG0B 2IA0A 4XBFA 1GXQA 1FT9A 5HOOA 4BHPA 4BXUA 4IEQA 4YFNF 5FLIA 2LNBA 4IETA 4PIXA 3KMHA 1FP1D 4KU7A 1XB4A 5E8IA 1FOKA 2OZUA 1B59A 3F72A 3M70A 4QM9A 2BBYA 1IRGA 1R00A 5HS8A 2LF8A 3NSTA 2PI0A 3J80K 2R7DA 4EROA 3H7JA 1QQIA 1H0MA 2O8QA 4O9EA 3UKVA 1SD5A 5HS9A 4XSXF 1QZYA 3CLPA 2H6BA 1FWZA 2K27A 4IJAA 1MGTA 4G6QA 3WW1A 1ZLKA 3WG9A 2TDXA 2M1BA 3FFQA 4F7ZA 1UCRA 2L3DA 3DPLC 1E2XA 3FF5A 3O2PE 4J1WA 1KQ9A 2P5VA 4M9ZA 2MLGA 5KVRA 5F64A 3D82A 5L3FA 1O7LA 4HOBA 4QMAA 4S05A 1T0FA 2Q1ZB 4P9FA 2D1VA 1RUNA 1W4MA 1XN7A 4YIIA 1W7PA 2HQRA 1P6RA 3B02A 1HKTA 4DINB 2HKXA 4GULA 3LA7A 2IXCA 5LRSA 1U8RA 1PUEE 4N0BA 2QM3A 3QU6A 1YUDA 4EWEA 4ZZDA 2I45A 1OPCA 2O03A 2EJRA 4MHGA 5E1ZB 5J3UA 2MC3A 3FM3A 4AQ6A 1CF7A 4UV8A 5FD5A 2OQRA 4CGZA 5A2QZ 4A0ZA 2PA7A 1L3LA 4BNCA 4XETA 4XFIA 3FXQA 1BI2A 2QUFA 4CXFA 2QJVA 4EJWA 3H9AA 2YX7A 2PLYA 3GFMA 2NNNA 5I0TA 4B8XA 2F5DA 1RL3A 4Q0SA 1EH6A 1X8EA 4Q4ZF 2XL7A 1YW7A 3KP7A 2BEOA 3I59B 1IXRC 4QGNA 3GBFA 3H7YA 2MH2A 3LAJA 4PIYA 4HN0A 3LAGA 1RUOA 4P9UA 4KNYA 1ULYA 3RZZA 5ICEA 2MNGA 3CDHA 4WBBA 3LFKA 5FLXZ 4LMYA 2PEXA 3MZHA 3I64A 1J5YA 2XKPA 5E8GA 4YG2F 4MGIE 5E1WA 3KEQA 4QX5A 4ONUA 1ZHFA 2RKHA 5FO5A 3BB6A 1YIOA 3BZ6A 2IP2A 3SXWA 1J59A 3W6KB 5D6EA 3BP8A 4P96A 5LHHA 3LA3A 1FNNA 3E5UA 3L09A 5JAXA 3UKNA 2NS0A 3M7GA 5H20A 4XFBA 1R1VA 4XLNF 1LRHA 4HBLA 2BNOA 3UKTA 1B4AA 4IRHA 4JTOA 4F8AA 1CAWB 1XMAA 4QGMA 1PM7A 1SFXA 4WF2A 2EK5A 2HR3A 5H6QA 2QBYA 3SCHA 2JSCA 1R1TA 2L01A 3M8EA 4IEWA 2O1QA 2D1HA 4MNUA 5JCTA 2OAZA 3FM5A 4RD7A 1XCBA 1MJAA 3TKYA 3ZMZA 3CO7C 3E6BA 1UIKA 3DEUA 3GZ6A 4XFFA 2HKOA 2Z99A 3G73A 1FBSA 1D5VA 5I8SA 1CAUB 3SZPA 4PGGA 3TGNA 3KLOA 4FBFA 2R7FA 3QPTA 5LGNA 3DFGA 2JZYA 3VFZA 5JFRA 4JV4A 5L3BA 5HI0A 2A6HF 2NYXA 1S29A 2A61A 4OFGA 2OA4A 4YARA 4LA2A 2GWRA 1CAWA 1NXMA 1H1MA 4GXOA 5K5OA 3HTSB 3HSFA 2Y48A 3ERED 4OIPF 3PFIA 3JZVA 4GGGA 4G6DA 2B8MA 3ABTA 2K7LA 3I5UA 1K6OA 3VHRA 4E70A 1G4DA 4X6QB 4P5OA 2XAHA 4EJUA 4UUVA 2XAJA 1ZRDA 4QLCU 4UXAA 2O6GE 3R4KA 2UYBA 5BQTA 3P9IA 3QP5A 1J3QA 1CAXA 1OD5A 4ZYEA 1U78A 4IHSA 1Z1DA 4AD9A 2CFXA 5E1XA 5E18F 1WSUA 2OZJA 1A04A 1ZVFA 4X6RB 5L3GA 1D8KA 3TO6A 1K78B 2PFWA 3W6JB 3OV8A 4KN7X 3HQXA 3WTTC 5EZWA 5K5RA 3E6CC 3RYPA 3NVCA 3WTUC 2X4HA 4UNOA 1J75A 3EYIA 1JGSA 3GEZA 2GZWA 2R3SA 4BHCA 2XHKA 3NL1A 5BPIA 2P5LC 2C6YA 1UPIA 1LB2A 5I0SA 1B1BA 4A2UA 5FFXA 2RGVA 1ZRFA 4N9HA 1IZ1A 1CGPA 3T1BA 5CVUA 1NHAA 3J81Z 3KFWX 2OPKA 2FMLA 1U12A 1XDUA 2XGXA 3WE3A 5E20A 1G3SA 5CVJA 4EWAA 3BCWA 3HYIA 1ZREA 1B9MA 4YFXF 4ORFA 1DZRA 3ETQA 3BWGA 2E7XA 3EQEA 3T0YA 2KRFA 5I0RA 1LDKB 4G7OF 4JQFA 1ONVA 2AXLA 1IN6A 4IRIA 2K86A 1F4KA 3JSPA 1FX7A 3JW4A 3H50A 2PYTA 3PQJA 4U7DA 3EBRA 3G7DA 3H3UA 2IXLA 2A5YB 4NB5A 3TNQA 1KU2A 3EUHA 4HSLA 1X82A 2Q30A 1MJBA 2IA1A 5HLIA 1YS7A 2H27A 1TQIA 3HRTA 2LSOA 3H8UA 1R7JA 3E5QA 3TNPB 1HSTA 1F5TA 2RN7A 1V4RA 2HGCA 2LDUA 2M30A 1LR5A 3EO6A 3BALA 4IEPA 4RB0A 3QOPA 4UHTA 2L54A 1YLLA 1DDNA 2EFWA 3R6SA 3B73A 3V8LA 2EV5A 4QWQA 2BNMA 2E9QA 3CJNA 1ZGJA 3OTFA 2WWYA 1FSEA 4P55A 2XLFA 3H3ZA 2A6EF 2FMYA 3R60A 1CF7B 3JTGA 3ZDSA 3MWMA 4G7ZF 5D5UB 1ZG1A 1OR7A 2HYGD 1VR3A 4O3MA 1FYMA 1IRFA 4KYWA 1ZAOA 3LQRA 1CX4A 2PHDA 1FZPB 2XAQA 1ZG5A 5I8TA 1J2XA 2UXXA 3CUOA 4LK1F 4HLXA 4EJVA 1YG2A 3ISPA 2Q2EA 5DDGA 2L02A 3C18A 1BM9A 3C1DA 1O7FA 4HDVA 1IXCA 4UVAA 1DP7P 4XEZA 5FQ0A 4PIZA 4HF0A 2UZKA 1X8MA 2KXLA 3EETA 2HWVA 3LWFA 5CLSA 5DYMA 2STWA 2EFOA 2D45A 1ZLJA 3DQVC 1PDNC 1SMYF 1U2WA 3TOBA 4BHBA 1T39A 3HT1A 2VECA 4AXOA 1Q43A 5E1RA 3CUQA 3GFJA 3FZVA 5BPXA 3BROA 2Z69A 2ZKLA 1Z05A 4RAZA 2V1UA 2AS5F 4M72A 2PJPA 1BN5A 3ECOA 1BOAA 3SFZA 3U2RA 1Z9CA 4A5NA 5IT3A 1R5GA 2DPDA 1OYIA 4UV9A 3OGJA 1S7OA 3LAPA 1XE8A 1YW9A 1J1LA 2EA2A 1ZG3A 2GIVA 2VE8A 5HDKA 2OA2A 1AOYA 1DZTA 4LB5A 1CAXB 4HLYA 2GC3A 2DK5A 4U0YA 5FD6A 3E3VA 2CG4A 4DQ2A 1HBXG 5JVTA 4BIFA 2IT0A 4WCGA 3F22A 2P6TA 4KFCA 3D5LA 4MUVA 2B0LA 2CSOA 1BC8C 4JTNA 2H6CA 3BJOA 4QM8A 2DO7A 3RKXA 4I02A 3REOA 4NVPA 5CVRA 1W7PB 4L0ZB 2IA2A 3KP5A 4KMUX 1EV7A 2QBYB 1STZA 2P8TA 2VT2A 4WX9A 3KCCA 2QWWA 1XGMA 3WGGA 3FXUA 4WWCA 4I98B 3NRVA 4CO8A 1QPMA 4D7SA 1UIJA 3VEPA 1OKRA 1O5LA 2ZKZA 2RC4A 2VODA 2RQPA 4EQQA 4EJOA 2JPBA 2EB7A 3ELNA 2YX4A 5L3EA 1SFEA 4HX8A 3F21A 4O6JA 4WXHA 4EJTA 4AVCA 2GH2A 3WW3A 1XGSA 3HOTA 2EA7A 1YFXA 3QU3A 4HW0A 1OI6A 2D5FA 3O6BB 5HDGA 3J81K 2HZTA 4UVCA 4IF4A 4N9IA 3V8KA 3TQNA 1YS6A 4YNIA 2XLAA 2RNJA 4ASNA 2VXZA 3IHUA 4ESBA 2D2WA 3RJPA 3WTVC 5CU1A 4L9VA 4NQWA 1LDDA 1UCXA 4XF0A 1OMIA 4MH0E 4ZYDA 1EYBA 1TNSA 2ZFWA 1J0RA 3S2WA 3NQOA 4H7LA 1DPUA 2IPQX 2IXHA 1ZN2A 4KMFA 3GFLA 2B9UA 2E7WA 4L9NA 4YIFA 1ZZ9A 1S7AA 4HZFA 1TQPA 2L4MA 4MTDA 4E2GA 4ZU7A 5FDBA 4FX4A 4M9XA 2J5PA 3GFIA 3HSEA 1ON2A 3ECHA 3M3IA 1QY4A 4QXKA 1USSA 2DQRA 1SAXA 4L18B 2CAVA 3M9AA 1IN4A 4EWDA 2P6SA 3PQKA 3ZMVA 2WV0A 4E2QA 1UB9A 1WRJA 3EYYA 3HOSA 5D4SA 1U6GA 3P9KA 2W57A 2DK8A 2VOOA 2H0VA 5DEQA 2VQAA 3NKTA 4RS8A 1G6NA 4MEXF 4L9JA 2MH9A 3TDZC 2DW4A 4LB6B 2QCSB 4HVRA 5H6RA 3KLNA 2XAGA 2XVCA 4OINF 4MX3A 2HTJA 3JSOA 1B9NA 5ICCA 4ENMA 3MZYA 3GUDA 1I27A 3ROUA 5HS7A 4LG0A 3DV8A 3FMRA 3WU1B 3BOQA 4QGLA 4LUMA 3QP6A 3T8RA 2PHLA 4I09A 4HVQA 1RGSA 1X3UA 4UBHA 1LQ1A 3F23A 2EA4A 2PAMA 1T6SA 4XFCA 2CW0F 3ZPLA 1GVJA 2FBIA 5KBFA 2Q0OA 2FNPA 3CLOA 3FHIB 1OYWA 1KYZA 2IW5A 2HFHA 4XLPF 3C3WA 4A5MA 2K4JA 1Y9QA 1FBQA 1REPC 3JAMK 2ZNYA 5HLGA 3PNAA 1EPZA 2E1CA 3MEXA 3SCGA 3R61A 3SHRA 5JSRA 4Y17A 1H1IA 4G7HF 5A2QK 2ETEA 4IRGA 2VT3A 4HQMA 4A6DA 2YPRA 1LDJA 3I59A 4FT8A 4WVZA 4OIRF 1XSXA 1BIBA 2DQLA 4MGKE 3F8NA 4I2OA 1P2FA 4RB3C 3FJSA 2MLKA 1EY2A 1VP6A 2FXAA 4A12A 1P4WA 2XROA 1V3FA 2HS5A 1ZRRA 1HSJA 2STTA 3LSTA 4Y15A 1UD1A 4GYGA 2W25A 1P4XA 2FA5A 3CUQB 1FLIA 4IHTA 4MEYF 4TLFA 2ZMEA 4K2EA 3FXRA 4UBGA 1X7NA 5CVIA 4FAHA 5DCMB 3C3VA 3MPBA 2WFPA 1SD6A 3N97A 1ZZ6A 1DUXC 1I1GA 3WTWC 1V70A 2HOEA 2PBIA 2VE9A 2V79A 3WODF 2DLLA 3SXYA 2MBFA 5D6FA 2GC2A 1W5TA 2GC0A 1ODDA 2NRAC 1U5TC 3HSRA 2BNNA 3U1DA 1BI1A 4M6YA 3JTHA 1HKSA 5JR3A 2FU4A 3P7NA 2EFQA 1WWXA 1S3JA 3Q9SA 4YYOA 3KP2A 3KP4A 2B5HA 4PZJA 3H1MA 3V7SA 4XF3A 3WTZA 3RPUA 3L7WA 4BAYA 3HIFA 1LJ9A 4PDKA 2HTSA 3RYRA 5ICFA 4PGHA 1MKMA 2FEZA 1JHFA 4L5IA 1GQGA 5HLHA 3BU7A 3F8FA 4HDUA 1CAVA 3GVAA 3O3KA 1IXSB 2O0YA 3EJKA 5BXXA 3KZZA 4M6XA 4IEUA 5I8YA 1WGPA 1XCVA 2Y75A 4AIHA 2XASA 3I0TA 3M1EA 1Q1HA 1AWCA 3WW4A 4HV6A 1FYKA 4L9TA 3LWCA 4YFKF 4ETSA 5D1IA 1PP8F 5J7MA 2C0ZA 4KDPA 2FE3A 1TQ5A 4OLLA 2DI3A 2DAOA 4MGZE 2KJBA 3S0MA 4HA8A 1UHMA 3RI4A 3RPQA 3T5XA 2X0LA 1PP7U 3RKYA 3N4MA 3IWZA 1YFUA 1SEFA 5DUKA 4OIQF 2OYZA 3K1PA 3HTUA 2NNYA 1FBUA 2ATFA 3IC7A 1ZZCA 4P9GA 1CAVB 2IRFG 1U3EM 2P7CB 3BPZA 2BYVE 3TDUC 3GO5A 4KWKA 3VB2A 5BUVA 4EVIA 1KGSA 1D3YA 3KETA 2IC1A 2VBXA 3DF8A 5LHIA 5J48A 1HW1A 2RDPA 4AIJA 1R58A 5EEGA 2CYYA 1ZH5A 2DPUA 3CF6E 4H0EA 1SQ4A 3HRMA 1SD7A 2CWEA 2VC0A 5KHKA 5D4RA 1XGNA 3SQNA 1IUYA 4ESFA 2QQBA 1QZZA 4KIFA 5ED4A 5LGUA 5KHHA 3Q5FA 1SMTA 1QBJA 2FBHA 2QLZA 5DUIA 2PMHA 1KU3A 1LNWA 5L3CA 3QAHA 3I53A 3I54A 1YTYA 1LEAA 4PJYA 2V09A 5C6CA 3OOPA 1IPKA 2EFPA 4JVAA 4Z07A 5I93A 2PTMA 5BPDA 4MZUA 1HQCA 4KICA 3WE2A 3L9FA 3L2CA 2DCTA 4BYYA 4Q29A 1LEBA 3K69A 2F5EA 3KSCA 4LA3A 4ZYGA 4Z82A 5BMZA 4Z2YA 1BJAA 4KL1A 3SZTA 3JAMZ 3TO7A 2W85A 1YW8A 4OIOF 5J6XA 4L2NA 3WW2A 2YU3A 3BPVA 5LRRA 3BPXA 5LHGA 2BE5F 4NHJA 4OMYA 4XFHA 2PMUA 2ISYA 2FSWA 2CGPA 2Q8KA 3ZP5A 1T2KA 3WTSC 2IXKA 2A68F 2KIUA 2O3FA 4XRFA 3I4PA 1WQ2A 1MDMB 5DD8A 1FI2A 2W84A 2HYFA 4CZZA 4I0BA 3IL2A 3F8MA 3TOAA 2VPVA 3CO2A 5AIPA 4KT5C 2FF4A 3RTRA 1K78A 3H1YA 2P5KA 3WTXC 4FAGA 3CJXA 4HSJA 1Q5OA 1U5TA 3KZYA 5FPXA 2EFNA 2VN2A 5KK1A 2CQKA 4HV5A 3CL1A 4TV7A 4IEZA 1KU9A 3BJAA 3FZ3A 2QYOA 1MD0A 3E6DA 1K79A 1B6AA 3R0AA 4CICA 1TBXA 5FLHA 2YSRA 4LEJA 4RAYA 3OF1A 4DNCA 4U0WA 4IPAA 1RC6A 1ZNPA 4Q0VA 2OZ6A 3G3ZA 3ZMTA 2V6CA 4MTEA 3NW4A 5DCMA 3AAFA 3KP3A 3NEUA 4Q48A 5JR7B 2ACJA 4I01A 1MDMA 3D0SA 4E2SA 2ETHA 4ENKA 2O61A 2D5HA 1HW5A 4ZU5A 1NYWA 1FYLA 2ET7A 4HN1A 2YR2A 3MQ0A 4U0VA 1G3YA 3FHZA 4HAMA 3DPTA 3GXOA 3U11A 3GZ5A 1R23A 5LBQA 1UHWA 4HLTA 2DT5A 4UXNA 3DKWA 2LKPA 5ILVA 1J58A 2H09A 5D5VB 2JT1A 4RB2C 1TNTA 4CDGA 5ICGA 2JPCA 1GQHA 1G3WA 2CAUA 4JBAA 1UW8A 1Z7UA 5FLXK 4HYEA 2Z3YA 1L3JA 1BI0A 4KIBA 1ZGAA 3QRFF 2HEOA 4M73A 1SD4A 2VBYA 4M71A 4A0YA 5ILUA 2KIMA 4ON0A 1F1ZA 5L3DA 5FGMA 1NE6A 5FFZA 5K1YA 1BIAA 2OQGA 2K0GA 4R52A 3ZMUA 4EGZA 2GXGA 3OD0A 5DD4A 2PAKA 3VOEA 3VODA 2HQNA 2RV8A 2OBPA 4BQAA 3CO6C 4IEYA 4EM2A 4HBNA 2ADUA 1ZZBA 2XRNA 2Y0OA 2ET1A 1GHCA 1JXSA 5I0UA 3F6VA 4L0YB 2ESNA 1QXRA 3HRSA 5TJJA 4ENJA 1FC3A 2OU2A 1RZ4A 4KU8A 5JHUA 2IVMA 1XSVA 1BI3A 2UY8A 1T38A 3HHGA 5E16A 1IN7A 1ZARA 3D0JA 5T3NA 1TQMA 3EDPA 2UYAA 1ON1A 4GO1A 2QZ8A 3ABUA 4LLLA 4AVPA 2J5OA 1YFHA 1DGWA 3DL3A 2UXNA 1CAUA 2D93A 1OFNA 3U9GA 1YWKA 3EHKA 3R0JA 3P9CA 2LF7A 1PMIA 3DXJF 4EMSA 3WU0A 4WK8F 4K8FA 1RTVA 1T98A 1D8JA 1P92A 5JI6A 1O4TA 3WTYC 3F8BA 3ZMSA 3S7IA 1J9IA 2DTRA 2QNKA 4XFGA 4IESA 2P17A 2QENA 2JTVA 1WA4A 1RNLA 1JHHA 5BOXA 1EP0A 2FQ3A 4ZYHA 2QVSB 1XDSA 4EGYA 4I0AA 1I1SA 2MA3A 4L5JA 1HXDA 3IKTA 3RNSA 4WZCA 3ES4A 2PFBA 3H92A 1H9GA 5F6FA 3BJ6A 5FPZA 3IWFA 3I71A 3KE2A 1FP2A 5J8CA 5K5QA 2KIFA 4IXAA 2FRHA 2PAEA 3ZQ7A 2VONA 3FX3A 5IT9Z 2K02A 4KUMA 3EQLF 1Z6RA 3FMSA 2BGCA 3WGIA 2UY9A 3MCZA 4LK0F 4RGRA 3MFKA 2HJIA 3IBMA 1TW2A 3IDCB 1BBYA 1U5TB 2WC2A 1VTNC 2XKOA 1XD7A 3MAJA 3SHFA 1HW2A 4MGRA 5CADA 2H94A 2UWMA 3ACLA 1FSHA 2P7VB 4IVNA 3V7CA 2D40A 3KEOA 2IXJA 3U10A 1R1UA 5CJ9A 3LZZA 2G7UA 1BC7C 4HX4A 4Q0PA 1XSDA 1LKNA 2ZXJA 2VBZA 4RGUA 2KKOA 4R8HA 4LUKA 4LLOA 2XLGA 4MQ9F 2XL9A 3IRRA 3GWZA 2F5CA 4D7TA 1W5SA 4OU0A 1Z6TA 3GW2A 1G3TA 2PQ8A 5TRDA 1TTYA 3QACA 4EV0A 2CV6A 4D0PA 3F8CA 2FQPA 1FY7A 4O9GA 4OOIA 3IKVA 3ST7A 2DBBA 2IXIA 3CUQC 4LFUA 1TW3A 4LULA 1IN8A 2NAZA 3GLXA 2HDCA 1VJ2A 4KWJA 4J1XA 3HT2A 5J8FA 5FB2A 1XMKA 2V1XA 2A3SA 1H9TA 3OCPA 2ELHA 4LTAA 5JSPA 1QWRA 4HVOA 1LVAA 2IJLA 2BV6A 4HF2A 4Q47A 4AWXB 3PVBB 1R5HA 3HHHA 1ZX5A 2ZCWA 3RKWA 2G7HA 4JK1X 1O3RA 4FHTA 1Q3EA 2DU9A 3E6MA 2PQQA 3E5XA 2KJCA 2EVXA 1QXJA 3USSA 2EV0A 4AVAA 3IRQA 4I7HA 2CO5A 2OD5A 2F4PA 1MZBA 4WXCA 3PLQA 2W24A 1DGRA 6PAXA 2GA1A 3SMHA 4LD5A 5ERIA 4B29A 4G94A 2DFIA 2F5FA 4RGXA 3FWEA 1O3SA 1ZZ7A 3KGLA 3RYKA 1E17A 3H1WA 4OMZA 5I91A 4PCQA 1L0OC 5D8KB 3E97A 4KWLA 4LLGF 2PG4A 1R22A 1C0WA 4XSZF 1QNTA 5IT9K 1QO0D 1EH7A 5BV6A 1XRUA 3V4GA 4Y13A 2EWNA 1ZYRF 1P4AA 1HKQA 1YFYA 4L11A 1USTA 1YHFA 1WI9A 3LA2A 1NZCA 4AVBA 2Z5UA 5C8WA 4AIKA 4UVBA 4IEOA 1YYVA 3U0ZA 4KIGA 2QDRA 1S8NA 4XF9A 3GYHX 4ENNA 2Z2SB 3O14A 2M8EA 4B09A 3DN7A 1MJ9A 3K1NA 2XUBA 5F1RA 1RIOH 2MD5A 5AVPA 4LLNA 5FQ0B 5BS6A 3IDBB 2VOPA 3GF2A 1UFMA 1O5UA 1O57A 5CVVA 1R36A 2JRTA 2QQ9A 3KP6A 4A0XA 4R79A 3K9TA 2FNAA 4WXDA 2E1NA 2V1DA 3LQQA 1IF1A 2ZBKA 3COAC 5FCCA 1KA8A 1O3QA 3CTAA 3F6OA 4Q0UA 1WLTA 3Q9VA 1K7AA 2A07F 2VBWA 5DCFA 4EM1A 3HUGA 1SFUA 3L2HA 5FLJA 4AQ2A 4LGWA 2ZMEB 1YQAA 3RDIA 1QGPA 4IEXA 3K2ZA 3KGZA 1FPQA 5KHIA 1Y0UA 2GXBA 2ZNZA 3ES1A 3DP7A 5BY5A 1ZZ8A 5K8SA 1IN5A 3TO9A 4R1HA 5LGTA 2GAUA 2XIGA 5DV5A 4XF4A 4U88A 3ZMDA 2QQAA 1J7KA 4M74A 1NE4A 2GU9A 5AIQA 3NJZA 2N7GA 2M45A 2WTEA 3T8TA 4G8XA 1OYYA 5HDNA 3ULQB 1XE7A 4XFAA 2VC1A 3V7RA 4IEVA 4MV2A 1Z91A 1IPJA 1YFWA 4CHUA 3SCFA 2G9WA 4ZZLA 1F9NA 5AONA 4MGYE 1IAWA 4Q5SF 2Q4SA 1IW7F 3J80Z 3F3XA 1DPRA 1W7PD 2Y0MA 1JE8A 4HX7A 4M9SA 5LEKA 2MHFA 3S7EA 3FMQA 5KHGA 4YSFA 3HRUA 5E17F 2GC1A 2Z9OA 4KN4X 2MPFA 1KQ0A 5CYVA 2O8XA 2QVOA 2Z33A 4KA4A 4META 4I3PA 3I58A 2L4AA 3M8FA 4CYDA 4IERA 4MQVA 3LOIA 2RVCA 3WGHA 3FE5A 4ESJA 4ZH4F 5D5WB 1YO5C 4XF1A 1GXPA 2PN6A 4FX0A 5HVQC 1Y3TA 1J3RA 3J7AO 1YLFA 5LLQA 3GYDA 3CEWA 1J3PA 5D8LB 3BDDA 4EM0B 1I5ZA
chains in the Genus database with same CATH superfamily
4LJZF 3U37A 4GYIA 5EEHA 2XAFA 2Q8CA 1NG0A 1GLNA 4RYDA 4COWA 2JE7A 3L2UA 2W3JA 5F5CA 3K51A 4AEKA 5FPUA 1HC8A 1AYM3 2QF7A 2CJJA 4CDQB 4LHNA 5ABJC 2YC4A 4M0NA 4MADA 2V9VA 2GDFA 4HQEA 2A69F 5DQ0A 5T5PA 3V8JA 3K7AJ 3BR3A 2GQQA 3GTGJ 3H0OA 5JPNB 4K1YA 2QQPA 2XV4S 4S04A 4FPEA 5LEJA 4GCVA 1G9AA 2GNMA 2FBKA 4O5VA 1MS8A 3I7DA 3K0LA 2Q0AA 2EAAA 3WNKA 4A6EA 3K1MA 4RGSA 1KDKA 4AYBN 4ZU4A 3CZUA 3Q9OA 1KU7A 1AJOA 3R4SA 2P4WA 3OS0A 4ZDOA 1FTTA 4OYUA 1OCTC 4XBFA 1GXQA 3N7JA 1MQTC 5HOOA 2AXTC 4BXUA 2JD4A 2E34A 2KDZA 4IEQA 2K85A 3QH7A 4RQPB 5FLIA 2LNBA 4IETA 3JRAA 1FP1D 5ANQA 5JHFA 4XILA 1C5IA 4QPOA 3O0XA 4X0GA 1B59A 4AFMA 4M3CF 1R00A 5HS8A 1LOCA 1ODNA 1RUH1 2LF8A 3NSTA 1AX0A 2CQNA 3J80K 3J7HA 2ZGOA 2R7DA 1LGNA 4EROA 1AHSA 2HOSA 1S0DA 2D97A 3EMRA 1QQIA 1UMZA 1H0MA 4IV1C 4O9EA 1RJ8A 1DQ6A 1OCCH 3WUCA 5HS9A 4XSXF 1QZYA 2H6BA 1MSFC 4XOTA 1UY3A 1FYUA 2YGLA 3O1PA 3FFQA 1QHHD 3O2PE 2RS12 4P9XA 5CQGA 2TEPA 1OSGA 4M9ZA 1GBGA 2MLGA 1YQ6A 5L3FA 1MMDA 1O7LA 1GOGA 3FKIJ 4HOBA 3CP8A 2D1VA 3ZOIA 1ULGA 2MSYA 2HQRA 3WDTA 3AMQA 1P6RA 4FISA 4V2GA 2E2IJ 3M3QA 1GUUA 3ZQIA 5JVVA 3ALQA 3I4IA 1LESA 2QQMA 4ZZDA 5A32B 2GN3A 5F2SA 2F5VA 1UN1A 1MNEA 2EJRA 4LHSA 2GOMA 5DMYA 3FM3A 5FD5A 5B1BH 2G1MA 4BA6A 2ZEXA 1AR93 3WHBA 5A2QZ 5FZOB 3MKYB 3B9IA 4BNCA 3FXQA 1BI2A 2QUFA 1GZWA 2J7MA 3H9AA 2PLV1 2ZABA 1W8WA 2PLYA 3GFMA 3WNNA 2M2EA 1IXRC 5EP9A 1ND3A 1DYPA 4C8DA 4XOGA 3DBRB 4P9UA 4KNYA 4YGCA 1HRI2 4IQJA 3CDHA 5CKNA 2RVAA 4YM1A 2LRDA 2XKPA 4YG2F 3KEQA 1UKRA 4PF1A 1OA2A 2DVBA 3VHPA 5ACA1 3VYUB 3W6KB 4DY3A 1GU3A 3BP8A 3AMMA 4IGOA 3LA3A 4G6TB 1FNNA 3L09A 3WDXA 3DU5A 3VBUA 1ETXA 2NS0A 2ZGSA 3UKTA 4CP1A 1WJDA 4IRHA 4JTOA 3WLUA 2V5YA 2WZEA 4NHLA 3FBYA 5A3WA 4LBQD 2LYCA 3ZYIB 4IE6A 4WF2A 3JBG2 2B42B 1X19A 2GH8A 3F9KA 2JB4A 2HWB1 1R1TA 3V56A 2L01A 5BNOB 2YGMA 4YW4A 2NLRA 2O1QA 2XGCA 2DURA 2VULA 3NAPC 4DFSA 3MV01 4D5CA 1W0OA 5LD2C 1C8M3 2OAZA 3FM5A 2R1BA 1FOD1 1SCRA 5A3LA 1UIKA 2LTPA 3FFZA 5K0UB 3S15J 1FBSA 1ZRIA 2R073 1NG6A 1CAUB 1XNTA 1Y9MA 2HWE2 3ACGA 4A3BJ 4CDXC 2VMHA 3TGNA 3I4MJ 3I9V2 3LEKA 3QPTA 3AB0A 1DF0A 2K3PA 4COVA 4BQ2A 2J1EA 5FZOA 4EZHA 1D2SA 3FK7A 4UAPA 4ES9A 1H1MA 3K4AA 1GSLA 2RS52 2RE9A 3IM0A 5K5OA 4Y33A 1Y7BA 3ERED 4X8NA 3AG4H 3VKMA 1E3OC 4KBZA 2F4LA 2ZSIB 3QQAA 2B8MA 1NA1C 4AHZA 5FROA 5JZGA 2ZFUA 4EQVA 4E70A 3V64A 2LR8A 2WUHA 2XAJA 1ZRDA 2HI3A 2XVGA 5FZ1A 1JS9A 2W00A 5BQTA 5E3MA 4UW6A 2M7BA 1MBJA 3KPHA 5FZ6A 2QUOA 1CAXA 1A34A 3WP4A 2B63J 2MG4A 1MS3A 2CFXA 1BYHA 2L9LA 2VQ0A 1M06G 5H9SA 4XL9A 2JRMA 3TO6A 2WDBA 3ITQA 1JHNA 4W6XA 2IS6A 1T2XA 4AFBA 1JN2P 1LECA 1F9KA 3G2BA 5A6XA 4A3IJ 3I55I 4LK7A 3NVCA 2YMZA 3BLYA 1U5XA 1MSEC 3GEZA 2R3SA 4PLOA 1R082 1UWWA 1BEV1 1UPIA 2V26A 4A2UA 3Q8FA 3FUQA 1P7IA 1TT0A 1GICA 2CUJA 3BR2A 4D5FA 5CVUA 3LIGA 3FBIB 1LGCA 4RGAA 2HYKA 1U12A 2VL4A 4DXRA 5FO9B 5CVJA 3BODA 3HYIA 1HJFA 4C2UA 1PO21 1PX3A 3ETQA 3RZHA 1D4M2 4B4PA 3PUIA 4OAYA 4CTEA 2A75A 4LORA 3CIHA 1WJAA 1E5SA 5KCMA 3KCYA 4JQFA 2P3KA 4LKDA 3CJIC 2AXLA 4IRIA 1F4KA 2Y2ZA 3JW4A 1Y6IA 5EZGA 2PYTA 3U78A 1O59A 3PQJA 4U7DA 3H3UA 4Q4X2 1KU2A 1X82A 4ZONA 4HT1T 3CDZB 1MJBA 2M0CA 1SC7A 4N53B 4YG3A 5JIUA 1TQIA 2LSOA 3TNPB 1HSTA 2HGCA 3S1QJ 3H8XA 3BALA 1UY4A 2HPIA 4S2HA 1T33A 2ZX4A 1YLLA 2EFWA 4XUOA 4HEA2 1X4OA 3HBLA 4QXHA 2BNMA 3GGLA 1VQNI 1MQTB 3OTFA 4P55A 2VQLA 2XLFA 2XQRA 1FMWA 3R60A 4KMQA 4Y7NJ 4J19A 1OR7A 3V0BB 2L5QA 1IRFA 3H9QA 1ZAOA 2PHDA 2J1TA 1MZFA 5I8TA 2UXXA 4Q8KA 3CUOA 3ISPA 3C18A 2UURA 3AYDA 1TMF1 1O7FA 3FIWA 1IXCA 2VUMJ 3TBIA 1UMQA 3DCQA 4Y20A 2ZA9A 3ENRA 2KXLA 1SVOA 1B35B 4CP9A 3LWFA 1GWKA 4YW3A 3K3OA 1JTXA 1FPN1 2EFOA 2D45A 1ZLJA 5FV3A 3ZXFA 1U2WA 1GDTA 1T39A 2EIBA 5M5XJ 1HXS3 4CEWC 4BQ4A 2F4IA 3GFJA 5BPXA 2ZHMA 4OZXA 1OBNA 2Z69A 2FQ4A 5LBCA 4RAZA 2CTVA 4MVTA 4Q4V2 2V1UA 1UOBA 1M4WA 2ZMKA 5GLZA 2WJSA 2H0BA 3HUGB 1S0EA 4A5NA 4BEHB 3AZVA 2DPDA 1UOFA 3OGJA 1S7OA 3WDUA 1PGL2 2VE8A 1AOYA 1RB8G 1DZTA 3ACFA 3G6JB 1CAXB 2H8WA 2DK5A 5CB7A 1EV12 4XQFA 5JVTA 1D7PM 2ZTNA 4WCGA 2Y6GA 2JUGA 3TBDA 2B0LA 4NDLA 2W7NA 2ERFA 3RKXA 4AGGA 1IDYA 3AP9A 4RLQA 4NVPA 4DEQA 3ABMH 3GTQJ 4QXBA 2P8TA 5GAHJ 3GZUC 2VT2A 4NNJA 4WX9A 4LBLA 3EXUA 3M3OA 4ISRA 3FXUA 1YJKA 2HEYF 4I98B 3NRVA 2MW8A 1K4SA 4D8MA 4YZ3A 1PMJX 1OKRA 3UETA 2ZKZA 4COYA 2RQPA 2EB7A 3QPSA 5L19A 5ISLA 1SFEA 4MLOA 3GLLA 4HX8A 1WW6A 5F8PA 1PK6C 3WW3A 1XGSA 1V6OA 1NLRA 4FQ4A 3QU3A 3LB9A 4P9WA 3O6BB 5HDGA 2K9QA 1AYM1 2ZX3A 4YLZA 5EIYB 5FP8A 1WWYA 2XLAA 3I2FA 1HN0A 2RNJA 2VQCA 2J22A 4QKDA 4ESBA 1OFSA 1QJU1 3RJPA 5CU1A 1EYBA 1TNSA 2ZFWA 1J0RA 3S2WA 5GLUA 2LP0A 1UHSA 5EXOA 3PVOA 2YFZA 5FYUA 1ZZ9A 4AHYA 3JRBA 3K3NA 2L4MA 2QA4I 4NE9A 4ZU7A 2VUAA 4FTHA 1QY4A 5A32A 4G4FA 1SAXA 1JYIA 1CX1A 4EWDA 1DYOA 3RQIA 4J6GA 3DTIA 2FBEA 1Q56A 2E2HJ 4FCAA 1YIFA 1HDKA 2VOOA 1WCKA 4NHMA 5DEQA 2LUWA 1RUH3 3FK6A 4RS8A 2K46A 2SLIA 2O14A 4YZ4A 4LB6B 2QCSB 5T54A 4E4DX 2BTVC 3OMYA 4OINF 2KQRA 1K45A 1KD7A 1R64A 1S2EA 3OY8B 4ENMA 1GANA 4B7KA 3ZXKA 2Z1DA 2VQTA 2VM9A 5FFOC 4XKCA 4UFIA 5HS7A 3WU1B 4OHZA 3QP6A 1QQP3 3CCRI 1YXWA 3VGIA 4W8JA 1X3UA 3KIOA 4GWNA 3LPGA 5EV7A 3PO2J 3F23A 1T6SA 4IL6C 3JRDA 4XFCA 2CW0F 3S8PA 3ZPLA 1BZWA 1CJPA 2FBIA 5KBFA 4N4OB 2Q0OA 2VAUA 1C8NA 2HWE3 2DA6A 3HEFA 4BJ5C 2VXRA 2IW5A 5FY8A 2QQKA 3HOZJ 3DTEA 2B39A 3B3QE 3PIPF 2OV7A 2WQ4A 3PM1A 3VYRB 1OH4A 2E1CA 3SCGA 3IPVA 3T2OA 5JSRA 4XBQA 4Y17A 4G7HF 5A2QK 4J25A 1YI7A 2ETEA 5F0CA 4IRGA 4HQMA 3VD7A 4DIQA 1LDJA 5C9AB 1RETA 3F8NA 4PHZA 3FJSA 4Q26A 2FXAA 4A12A 1JKOC 2STTA 4FP2A 3ZR6A 1UD1A 1JW6A 4FPHA 2K3FA 5FMBA 2JB8A 1R083 2FA5A 3TOJA 3T2QA 4Q4W2 3RMXA 2X8KA 1FLIA 3PIJA 2BY1A 1IQDC 4W97A 3RJRA 4UBGA 2FJ1A 4AM3A 5FKCA 4HNTA 3C3VA 2WFPA 4PJLA 4QQ2A 3ONQA 1I1GA 1V70A 5CG9A 1O91A 2HOEA 2M8GX 2WS91 4KISA 3LGRA 1JOBA 3CF2A 5CBLA 1OJLA 4E9KA 1DG6A 3MW4A 3M2MA 1U5TC 4H4KC 1GQPA 1BI1A 4M6YA 4AOCA 1F5JA 5A33A 1HKSA 5JR3A 2FU4A 2WNVB 3P7NA 2EFQA 5JMCA 1WWXA 4AEDA 1IOAA 3V0BA 1RUC3 3IH2A 1H30A 3H1MA 1ALYA 1VBA1 1V6LA 4N53C 3ZOBA 5KR7A 4ZXKA 3POFA 3L7WA 2BOLA 1WCUA 4WZFA 1HRI3 3DLLF 3RYRA 3ZMNA 1MKMA 5BNGA 1ZBE2 1JHFA 4MXVA 4L5IA 5M3FJ 3VZOA 3UKGA 1CAVA 1K42A 2VKVA 3O3KA 2TNFA 1IXSB 5BXXA 3KZZA 4M6XA 4HPKB 1WGPA 1FV3A 1OOPC 1PO22 1Q8VA 4QDRA 3WW4A 3SEPA 4IKFA 1JU4A 1REDA 5D1IA 2LVSA 4O7XA 5J7MA 2C0ZA 4AL9A 2FE3A 1TQ5A 4JYKA 3GF6A 1G86A 1LEDA 4HK9A 5IY5H 4ZS2A 2BY2A 5FRMA 1UHMA 3RI4A 2JG8B 4NPMA 1PGSA 1OCRH 3RKYA 4CU6A 2VE1A 2Y0SN 4AGRA 3I2DA 2OYZA 3K1PA 4YVSA 3POSA 3D6EA 5FUNA 2BJSA 1FBUA 4CDXA 4PBOA 1ZZCA 1VQ7I 1CAVB 1W8NA 2P7CB 2Y6KA 5C8CB 2GMPA 4LBQB 4KWKA 5J47A 4BGDA 4JGYA 3AJYA 4YM2A 4RR3B 4KI5M 2IC1A 4FFHA 3DF8A 1N3PA 3EPZA 5A1LA 1FX5A 2V72A 2RDPA 1NY71 2QDNA 5EEGA 2Y9ZA 2CYYA 1PX4A 3HRMA 2VC0A 2X5IA 2R042 5IHRA 4NN0A 2VMGA 2AH2A 3SQNA 2QQBA 4CU8A 2PN5A 5LGUA 4BPZA 5IPAA 3J9SA 1RUE3 2FBHA 3DGTA 4QPGA 3TN93 4A3ZA 5GAEJ 1A5JA 2HDDA 3VBSB 3VYTB 3I53A 5C6CA 2FZ1A 3HZJA 4Z07A 4A3XA 1UYPA 4NHKA 4CZCA 2DCEA 3IZOA 4CUBA 1JZ5A 3J4UH 3WE2A 2DCTA 1QQP2 4Q29A 4HSRA 1W8ZA 2R93J 1QKQA 4LA3A 2GMEA 1RUC1 2R0HA 3O8HA 1QJY2 3LFUA 1WUVA 1JKRC 3FDYA 1YW8A 2MABA 2WRAA 2CMPA 2YU3A 2Y0SA 3HVDA 3BPXA 2XB6C 1UY2A 2VJXA 5FREA 5FY1A 4QX3A 2P37A 4ASMB 3WNOA 2FSWA 3FXKA 2W1SA 5KHDA 1OLME 2FZ2A 1T2KA 3WTSC 3R4DB 4XRFA 4CXXA 5L7OA 1WQ2A 4CCLA 2W84A 1SBEA 4YW6A 4CZZA 1UXXX 3AYEA 2FF4A 1K78A 3WTXC 5EWSA 1Q5OA 3ORJA 1U5TA 5FXWA 1LHWA 3S57A 3SYTA 1LODA 3A23A 3Q0UA 1Q8PA 3WF4A 4B7EA 5E8AA 5DM6F 3VBRA 3QYBA 1XMXA 3FZ3A 2QYOA 3JU9A 3E6DA 3ZSJA 2LC2A 3I2HA 3U4SA 4AVZA 3LSHA 4LE4A 3BPSA 4LEJA 1HB3A 4XBNA 2VB6A 1RC6A 3WDVA 4MTEA 5E3OA 2AREA 3P3NA 4Q48A 2AR6A 4CUCA 1XB9A 1XPWA 2O5RA 4ENKA 3PSIA 2D5HA 1NYWA 5K7FA 2J1SA 2W1OA 2ET7A 3MQ0A 1H8TB 3PNTA 4NC6A 2AO9A 4U0VA 3WG2A 4BMEA 3GXOA 3ZFGC 4HLTA 3OYWB 2DT5A 1AYM2 1MZEA 1FAYA 1D0HA 2LKPA 3FBMA 2XJTA 1RUH2 4EYUA 2KPMA 1TNTA 3ZQHA 4E4SA 4JBAA 4LBMA 1GZWB 1ZGAA 4XPVA 2HEOA 3OJBA 4M73A 3BIWE 2VBYA 3T1MA 5HV4A 4ON0A 1YITI 1H2MA 3FXJA 4DY5A 2IWGB 1BW6A 2BW3B 1BIAA 4R52A 3AYCA 3AL6A 3KV6A 3NJVA 4XMYA 3H36A 3MW3A 2PAKA 2RV8A 4AQTA 3C2UA 2GSYA 2LKXA 3PMEA 2C24A 3S2HJ 1ZZBA 5IOYA 4XE9A 2VASA 1NKGA 1W06A 2D3RA 1IS6A 2Y0OA 3T1LA 3ZXEA 2ET1A 5FRNA 2BU9A 3AP6A 1X50A 4K1ZA 4L0YB 3WNXA 2X1CA 3UR3C 1RZ4A 1CZTA 3KT4A 4DYQA 3CU7A 2DYCA 4AVTA 5FYMA 2XJSA 4RDUA 1IN7A 3D0JA 4ZTFA 1TQMA 1ZBE3 1ON1A 4GO1A 3D4KA 4LLLA 1LOFC 1L7LA 1CAUA 1HQLA 1OFNA 2ZS6B 4M6VA 3APBA 4QPGC 2LF7A 5A7WA 3M7AA 4SLIA 1NCRC 5AC91 4K8FA 1KJLA 1AL0G 4F3QA 3NWKA 5JI6A 4M3EA 3WTYC 4LJHA 2CV1A 1J9IA 5CFCC 3MFAA 1AR92 1UU4A 1H89C 3BVCA 5FPAA 1W28A 4XXAA 2JTVA 1WA4A 2VZ1A 5FWJA 1BHGA 4PUSA 5BOXA 1EP0A 1RMU3 1HLVA 2IGOA 1XDSA 2NOJB 1DIWA 4I0AA 2B7EA 3THDA 1LU1A 4L5JA 3DF0A 4LE3A 5T52A 2KDOA 4E7SA 4BQWA 2L9VA 1LAJA 2XC7A 4OI0A 4P14A 1P7JA 1F36A 2ZEWA 3AKSA 3VZMA 3HGGA 3IWFA 5FPZA 1WJEA 3N7LA 4FPOB 1J84A 2WBKA 2X6WA 4IXAA 2QFEA 3ZQ7A 1YOVB 2PJRA 5IT9Z 3WF1A 1Z6RA 4JRAA 3MCZA 5HODA 4RGRA 2IGNA 3CLQA 2WYFA 4JGZB 1BBYA 1U5TB 2WC2A 3IMNA 1HW2A 3MO4A 1VBD2 3JBG1 3N7MA 1LFUP 5GKAC 5LA2A 1SVMA 1PHMA 4BDZA 3W2AA 3PDQA 5A3TA 3V42A 2D40A 4A4AA 3U4XA 5JI9A 2XWJB 2YROA 4LPLA 2G7UA 2ZHNA 4KGQA 4HX4A 3N3HA 2KL4A 2ZXJA 2OC6A 2W08A 2QQVA 4MQ9F 4GD4A 3B6CA 3GWZA 4OU0A 3N9LA 1G3TA 3N35A 1JJ6C 4ZDPA 4EV0A 1YQCA 1QZEA 3K70D 3CCUI 4Y52J 4OOIA 2PHUA 2ZJPF 2DBBA 2IXIA 3D5OA 1IKQA 2R7SA 3VHNA 4AWDA 1IN8A 2HDCA 1VJ2A 1TP4A 3S16J 1XSRA 1XOYA 1W6NA 4GA9A 2HVQA 5FB2A 4PLMA 2V1XA 1H9TA 1W2NA 5IJRA 2X09A 3ZN6A 1LVAA 3HBZA 4HF2A 4Q47A 1B72A 3KM5A 3PIGA 3PVBB 5C3OA 1WCDJ 4L9BA 2XUMA 2CW7A 3J7AY 2PQQA 3QWLA 3JCUC 1QXJA 3USSA 3MLJA 2PMZA 4I7HA 2CO5A 1UZVA 1HF0A 4LD5A 3FLRA 2MD0A 2DFIA 4XIKA 1S1AA 2LMDA 4TSVA 1E17A 4PCQA 5M0TA 2BHZA 2GXAA 3RS6A 3E97A 3M3YJ 2PG4A 5JDBA 1PIV1 4ZXEA 1R22A 4C3HJ 1C0WA 1KRIA 2BV4A 4XSZF 1RMU1 2ZAHA 2IAIA 5IT9K 1EH7A 1SMVA 4QU1A 3V4GA 3KVAA 3W2VA 1HKQA 1YFYA 1R4NB 4BMBA 1I9RA 1NZCA 4AVBA 3I3DA 4AIKA 4UVBA 5EG0A 4CCOA 1C1FA 3GYHX 4ENNA 4YELA 5BNPB 2W5FA 5ABJA 4RAGA 1NT0A 3K1NA 5F1RA 3S3OA 3ZXJA 4AG4A 1TME3 2W1WA 4V2WA 2AC1A 5FYTA 3BTXA 4XBLA 3ZQCA 3IDBB 1KXGA 5CVVA 1W9WA 2JRTA 2AUYA 2RM23 1CVNA 4R79A 2GP3A 1W3VA 3JQXA 2VJ5A 3FBNB 3GHNA 3Q9VA 1K7AA 3Q0WA 1PUFB 4C9YA 1XG1A 1DU3D 3HUGA 5FLJA 5K0UC 3UT0A 4IHYA 1YQAA 1QGPA 4IEXA 3GTLJ 2PHWA 4GMP1 1SLLA 1COV3 2E5NA 2ZNZA 2JA6J 4NO4A 1JKPC 3DP7A 3BT9A 5K9YA 1MBHA 1HRI1 1Z7S3 4XF4A 5JVGF 4P02B 3CP2A 1NE4A 3UJOA 4E7KA 3OSFA 3KB5A 3FHNA 2M45A 4BS9A 4Y1UA 1OYYA 4OAZA 2VJIA 2KA3A 1XE7A 1H8TC 2EIJH 1HB2A 2Q8DA 2E7QA 1JZ2A 3IAS2 5AONA 4MGYE 3LFMA 3B5LB 2PHRA 5HV0A 4Q5SF 4LIVA 5JZGB 3AKQA 2R5YA 4QQPA 2PHTA 4IO9F 4AAXA 1JE8A 4HX7A 4M9SA 1D4M3 2HWB2 5AFEA 3I2IA 2DA5A 2W52A 2VO5A 4ATEA 2WB1A 2WSUA 4E7HA 3TP3A 4QPIA 2MPFA 1KQ0A 2QQLA 5F3GA 2Z33A 1YE9A 4I3PA 1OCZH 2E33A 1WJ5A 3M8FA 1ETQA 4CYDA 2HWE1 3LOIA 4LO4B 3PVEA 4Q8LA 4ESJA 2ZKNA 4Q4V3 2DYSH 2PN6A 3E1F1 1Y3TA 3J7AO 2C4XA 5CKTA 5D8LB 2Y6LA 2VVFA 3DXUA 3BDDA 5C70A 4I99C 3S6PA 1S6LA 3CJRB 5AC93 3MYXA 4Q0QA 2JDHA 1RRJA 3DKXA 1O3TA 1GT0C 1EH8A 3H8OA 2XQXA 2FOKA 3R0RA 2ESHA 3GTOJ 3WQ1A 5J36A 3HGYA 4MGSA 2M5WA 4F93B 2ISZA 4FXGB 3RIRA 2GA2A 4FPKA 2WO7A 3ZN0A 3WNPA 1VZ0A 2WNOA 1JUSA 1CQTA 4MO7A 1WKMA 3QPHA 4JC1A 5IWFA 5KHJA 1A35A 1N3OA 1KYWA 4FPLA 1VQ8I 1JUHA 3ZSEA 4BQXA 5FZHA 2EZLA 2N8GA 1VQPI 2HLEA 3TWIA 3ZYJB 2K4BA 5D5XB 4XKWA 2YXSA 4QSHA 4GB31 5A3OA 2R30A 4BE1A 1JT0A 1T95A 1LOEA 3VZLA 3TEWA 2ID3A 3IIAA 4QHZA 4LG0B 2IA0A 1W9YA 1FT9A 1V5GA 2HH9A 2CQ7A 3VBSC 3HJEA 4KU7A 5E8IA 2JDZA 1KDMA 5B2GB 2OZUA 3F72A 4KITB 3KV5A 5FYVA 4BK5A 2PI0A 2I07B 3IP4B 5C4XJ 3K75B 3H7JA 4MXWA 2NXNB 3QBQA 4UYBA 1SD5A 1FWZA 5FY0A 2K27A 5GZGA 5F3IA 1BOBA 2A3YA 3OG2A 4RHV2 2CWMA 3ZPYA 2DTWA 3WG9A 2M1BA 1YO8A 4F7ZA 2YBKA 2L3DA 3DPLC 2P5VA 3QODA 1OPOA 1QJZA 5LCWL 2QQUA 1FEXA 2VY0A 3W3CA 4ZZ8A 4TYSA 1D4M1 3ZR8X 1UMHA 2CU7A 2VKDA 2ZMNA 4IW3A 1N1YA 1VQ4I 1B09A 2ECCA 1H8AC 3SKVA 1XN7A 1UG0A 4H14A 4U2AA 3VBUC 3N9OA 5IVYA 3B02A 1HKTA 4DINB 1O4YA 2HKXA 4GULA 2IXCA 3SDGA 4N0BA 2QM3A 3ABKH 4HSTA 2P6HA 3QU6A 5JI7A 2RDQA 2OPWA 3V65A 2BOJA 1ND2B 4UT5A 2O03A 4GB33 4MHGA 1YI2I 2XDVA 2EICA 5DUXA 2MC3A 1YRNA 1CF7A 3NAPA 2V7FA 3DCFA 4UV8A 3WOGA 3J7YJ 2XJVA 2AYHA 4A0ZA 3G1OA 4XUTA 3QCWA 4C1WA 1PYVA 3ZCOA 2M0MA 2ZGPA 2ECBA 3Q3SA 3MKLA 1H4HA 3ILRA 2Z5WA 2DVGA 2F5DA 1RL3A 5FYYA 2CL2A 1YW7A 4QGNA 3I59B 2MH2A 4RQPA 1PK6A 3LAJA 1KEXA 1SFKA 1RUOA 1SDDB 2F6BA 4W50A 3J8F3 4N43C 2O9LA 3LFKA 1DLLA 5GJ6A 3WVJA 4LMYA 2QBXA 3MZHA 3KZ4C 2I74A 3I64A 5C9AC 2DMUA 5E1WA 3NMBA 4QX5A 4ONUA 2RKHA 1W05A 1FMD3 1YIOA 1QOTA 4H55A 2Z79A 1N1TA 2IP2A 3ZXSA 2XH6A 5LHHA 1W0NA 3HN3A 3E5UA 5JAXA 2LH9A 3KS7A 4BCUA 3WD5A 2I10A 3UKNA 2EZIA 3M7GA 4FPGA 1FTZA 1LRHA 2BNOA 1B4AA 4F8AA 1DGRM 4QGMA 2R061 1DQ5A 1SFXA 5CG8A 2QQWA 5FY9A 2BW3A 3SCHA 2JSCA 4YGDA 2EZKA 4PJNA 4CA0A 5IYBJ 5DABA 1AKHA 3OS1A 5JCTA 1NOVA 4RD7A 1XCBA 3TKYA 2HXOA 2MC4A 3E6BA 4XFFA 3G73A 4XAEA 5I8SA 3QH6A 4YEJA 3SZPA 4PGGA 3NARA 1H9PA 4QPQA 2R7FA 4CCJA 3OEAA 2JZYA 3N7KA 4QQLA 4RQPC 2XSDC 4R4ZA 3ZIXA 2QGUA 4V2VA 2RDNA 4E7JA 3RFRA 1S29A 2R5ZB 2UV1A 3AKZA 2DBNA 4HG6B 2X48A 4OFGA 2GWRA 4CCKA 2A1XA 5T50A 4GXOA 3MGUA 4P9YA 5C7GA 4K20A 1X58A 4GZ9A 4OIPF 3PFIA 1Z7S2 4BISA 4GGGA 2ADDA 2IXSA 3ABTA 2DUOA 3I5UA 3VHRA 2JICA 2IGKA 1ZYBA 2E1OA 2DMQA 2AEZA 4UXAA 3NNGA 3NJXA 3QP5A 4ZYEA 4WM7B 4AD9A 1WVRA 3EUAA 4FOQA 1WSUA 1EF4A 5A6YA 1ZVFA 1D8KA 1K78B 2PFWA 2HWF3 5HBAA 4B43A 1GOFA 1N1SA 4MO3M 5HLTA 4KN7X 2WZPP 2JA5J 5FP3A 3ZYPA 5K5RA 4J00A 2A6WA 1ND3C 3EUHC 3E6CC 5JOYA 4UNOA 3EYIA 2VR4A 1JGSA 3VWBA 2XHKA 1RMU2 4N43A 3PL8A 5BPIA 4RS5C 3J7MA 4BQ1A 2E71A 2P5LC 2C6YA 1S2BA 3S1NJ 4RN5A 1B1BA 4NC8A 2XGEA 5FFXA 1ZRFA 1ETWA 4N9HA 3T1BA 4ANJA 1UZYA 9ANTA 4XKVA 3J81Z 1GV5A 2ME0A 1ZKGA 3KFWX 2FMLA 1XDUA 1QJFA 1PJRA 3POWA 5E20A 3RZGA 4EWAA 2QEXI 3BCWA 2ZEZA 1ZREA 2E1MC 4YFXF 5B5EC 4P00B 4ORFA 3TAYA 3BWGA 1RUI3 3MV11 3T0AA 3RZMA 1DP0A 2XPWA 4PDWC 5GAGJ 2KRFA 5I0RA 2PQSA 3KQRA 4I6ZA 1IN6A 1SPPB 2JWPA 1W04A 4LG3A 4YRVA 2OKXA 4NAOA 3HN1A 3H50A 1HRV1 2R7QA 3AP5A 1WJFA 2A5YB 1GVDA 4PI0A 5HLIA 1WGXA 1QEXA 3AFKA 1W9FA 3OWTA 2Y0IA 3H8UA 1ULDA 5IVEA 2RN7A 1UY1A 4A7YA 3ZYFA 1RUG2 2CDPA 4RB0A 3RWNA 4FP3A 4UHTA 2L54A 1MPXA 1BMV2 4DZJA 1JH5A 2GALA 2EV5A 4YVWC 5FZ0A 4IHXA 4YW2A 5IYCJ 1JU3A 5FZAA 5FZBA 3ZDSA 3AZYA 2NZ9A 5D5UB 2VUCA 3N9PA 2OQ7A 3HBKA 1N3QA 4M3DA 2HYGD 2XUEA 3RSJA 1FYMA 3LQRA 2W2IA 1QF3A 1ZG5A 1VQLI 4XRSA 1P8JA 2DVAA 2L02A 3KCXA 3DYPA 2NMNA 3C1DA 2PJRB 2LBFB 2ZX2A 4B8EA 5C44J 1ZR4A 4UVAA 4LLFA 3R05A 1YHQI 4CU9A 5DZFA 1ND2A 4YZ2A 2D6KA 1XYPA 3F95A 2XF6A 4URAA 2JUCA 5F32A 1PDNC 3TOBA 2KMUA 2R5ZA 1ASJ1 4AXOA 1Q43A 3OPWA 2DDBA 4UUTA 1VBE3 3CQOA 1GP6A 1MS5A 3WQ0A 3BROA 2ZKLA 3AZZA 2A71A 2OUMA 1EAH2 1S2KA 3ECOA 2V9PA 3CCQI 4BK4A 3T30A 1SLBA 1GP4A 1Z21A 1C57A 4WVWA 2YS9A 4AEDB 1DCSA 3LAPA 3B9CA 1XE8A 1YW9A 4BB3A 1J1LA 3ZFFA 2EIKH 5FAXA 2O8KA 3X2QH 2VXDA 2X85A 2ARCA 2XBO1 5FKMA 4HLYA 4CDWA 3MI8A 4CCNA 4U0YA 1HQWA 4E4ZA 3E3VA 4KGGA 2L0KA 1Q8OA 1HBXG 4GB32 2YFUA 3F22A 2P6TA 2EQRA 2QQOA 2YV8A 4ASKA 2V4AA 4MUVA 3PUAA 2VBPA 4K9SA 4B4QA 3BJOA 4DBRA 1QVUA 4LBNA 5JXGA 2DN0A 5CVRA 1Z78A 4AF9A 3KP5A 4KMUX 1STZA 2QBYB 3A7QA 1JUPA 4AYBA 5DDJ2 4OI4A 1BJZA 3DBLB 3KCCA 3UGHA 2WLQA 1XGMA 1XSQA 1U8BA 4D7SA 4CVUA 3ZFEB 2VODA 1CZSA 1W8UA 5L9BA 3ELNA 1AXKA 1BR4A 1MBEA 4AFDA 1JOPA 4JKMA 1DGLA 5F6LB 3PUHA 2WSVA 2WNUA 1Z67A 1VALA 1OI6A 4L0PA 3WG3A 5F5IA 1TE1B 2ZX1A 2HZTA 4PFPA 4UVCA 4D94A 4O65A 4YNIA 5A1FA 3OIPA 2VXZA 1VB4A 3O8GA 1RR7A 2HEWF 3WTVC 3GJAA 4XF0A 4FOYA 1OMIA 4ZYDA 2IPQX 2IXHA 1ZN2A 4CSWA 3CC4I 3ZKYA 3GFLA 2RS31 4FVVA 1RHI2 2YUEA 4HZFA 2LBFA 4E2GA 3KT7A 2DCJA 4QHOA 1UMIA 4M9XA 5B4XA 2E60A 3HSEA 4AHWA 4QXKA 4NUBA 2CAVA 5CPRB 4A7KA 4X6AJ 3OGVA 1LFPA 3PQKA 2WV1A 3AK0A 4E2QA 1JTYA 3PNVA 3H0GJ 3EYYA 1XU2A 3HOSA 5D4SA 3JRFA 3P9KA 2W57A 2DK8A 1ENXA 3CESA 4P08A 2H0VA 2FDIA 1ZELA 1S55A 3NKTA 3K4NA 4IV3B 3PURA 1XNCA 2E53A 2J1VA 3TDZC 2D6LX 4MX3A 3JSOA 2K9SA 5ACA3 1ULFA 4IX7A 1W2TA 1TNFA 4LG0A 2FCTA 5FWEA 2ZMEC 5FZ8A 3A4CA 3KX2A 3OYLA 2LALA 5JZGC 1R093 2NQYA 1BR1A 1TZLA 1QVTA 3WEZA 2PAMA 3S32A 2EXKA 3VL9A 3BG5A 1QJY1 2R072 4R9BA 2QE3A 5F27A 3A0BC 2G9GA 1D0YA 3BTYA 1KYZA 1WJCA 4XLPF 1YJ9I 4A5MA 5C3RA 2K4JA 1SAUA 3HQRA 1IG0A 4EATA 4QU2A 4YVSC 5HLGA 3VBRB 4W4ZA 1OVPA 1VBD1 2DA3A 4V19K 3UV9A 1BBT3 2VT3A 2YPRA 4RS5A 1D0GA 3LNQA 3DEMA 1WHUA 4XQ4A 2IBDA 2DQLA 4UWDA 1NCRA 4MGKE 1QDCA 4RB3C 3D3AA 2KZVA 2XROA 3OSGA 4LR4A 4IZZA 2WLPA 4YGEA 3W20A 4GJZA 2D6PA 1XNDA 2W25A 1P4XA 1I3HA 2LY2A 4YZ1A 1LEMA 2JA8J 4IHTA 5C8CA 4K2EA 1X7NA 3B6AA 5CVIA 4COZA 5DCMB 1QJX1 3RJ2X 3MPBA 1XNBA 2LW8A 1SD6A 1MNDA 3S5AA 5CZKA 5J37A 1ZZ6A 4QAWA 4EEFG 3VKOA 4NAMA 3WTWC 4XDQA 1VBB3 2PBIA 5FPLA 5IYYA 1A6CA 4CPBA 1UOJA 2MBFA 5D6FA 2GC2A 2R063 1VMHA 2CFOA 1UNBA 2NRAC 1VBE2 2B4KA 4ZDLA 1YQ5A 2KM2A 2OJED 5E3LA 4RHV3 2CUEA 1VBC1 5ABJB 1W6MA 5DG2A 3ESWB 1EUTA 2WIIB 4A3LJ 3GMEA 4YYOA 3KP2A 2IZWA 2DOEA 2CGOA 3SQOA 3V7SA 2KLOA 2IFWA 4XF3A 1MS0A 3OBZA 2R0QC 2ZGQA 4AEJA 1LJ9A 1WW4A 4ARYA 2FEZA 2L2OA 3AL0C 3VKLA 2ICWG 1D1CA 3A1YA 5GM0A 3SFIA 1QPIA 2CS3A 4OI2A 2L7MP 3IB3A 1RVF1 4GH4C 1AX2A 4K40A 3RZJA 1VAKA 4EJRA 3G6EI 1WCMJ 3NNLA 2VTXA 3OR2C 2Y75A 1H88C 3I56I 1VAVA 4LBOA 3M1EA 1RXGA 1Q1HA 4XVHA 3HOUJ 2RQQA 1FYKA 3LWCA 4YFKF 3BR1A 1CD3G 4IXLA 1SHWB 3THTA 4NPLA 4OLLA 4MGZE 1XE0A 3TEDA 3S0MA 4HA8A 1NZIA 2X0LA 2A6YA 5F39A 1SEFA 4XZUG 1AYN1 1MVEA 1S72I 4OHVA 3ON7A 3C7GA 2ATFA 2F4OB 1OCOH 3AZXA 3ZYHA 3QYFA 1U3EM 3SEZA 2BYVE 3GO5A 5BUVA 2A73B 2GIZA 4EVIA 2BBAA 2VNOA 4V2FA 4PJMA 3OYMA 1RUG1 5AC92 1TL8A 3JD73 2QZ2A 3L2QA 1LGBA 3M3EA 1LU2A 4AIJA 1R58A 2VOKA 4YFWA 4URTA 5LBBA 4WM7C 2DPUA 3EYPA 2J1RA 3O1VA 3PMSA 1YNAA 1SD7A 3ZFEA 4R9AA 4D6RA 5KHKA 2W95A 1FOWA 4YVWB 1XGNA 3B93A 3QLQA 1JKQC 1BVP1 1WH5A 5ED4A 4RA0A 4RFRB 3VBOB 4NOTA 1RUJ3 1SMTA 3E7LA 1D0ZA 2CY6A 1YIPA 1YRNB 3BIEA 1ACCA 1ENHA 3B7MA 4XYXA 4IOCF 5DUUA 3I54A 1YTYA 4OQ9A 3LIHA 4NHYA 4DYRA 4RR3C 4QB1A 2D5VA 2NVXJ 5FYSA 2Y6FA 3WG1A 2KIQA 4TWTA 2W68A 2PTMA 3I2KA 2A6ZA 5FO8B 4MZUA 1HQCA 2JG9A 3L2CA 3BOWA 2YZ4A 1WFXA 1H4GA 5LA9A 2VH9A 3LSIA 1EAH3 4Z2YA 1W2AX 2ZAAA 4MFDA 3AG1H 1ASJ2 1QOOA 4DNYA 2W85A 4OIOF 1POV1 5J1UA 2V4VA 3H35A 2E1MB 5LRRA 5LHGA 4UUSA 1EUUA 4II2A 4NHJA 4XFHA 2PMUA 3WT3A 2Q8KA 2BP6A 1AKHB 1JXNA 2LS6A 3KHCA 5FJKA 4FCYA 1X1CA 1F8VA 1S0JA 1RUF3 1XC5A 2X5IC 2W0XA 5IW0A 3I4PA 1XYNA 3ZXDA 4JDOA 1OH3A 1MDMB 3M4OJ 1FI2A 1Z0XA 2VZVA 4I0BA 3VZKA 5C4WB 3CO2A 5AIPA 2DWRA 5EYRA 1Z0HA 4RL7A 1LOGA 3CJXA 5I0DA 2XF7A 3AMNA 3BR6A 1T8IA 2Y6JA 1YC61 5KK1A 2CQKA 5KC6A 4HV5A 3CL1A 3MF6A 1KU9A 2FHRA 5BNPC 2D6OX 1K79A 3BCAA 4IEJA 3VPRA 3H42B 4BJTA 3KVBA 3ZXGA 5KNLA 2YSRA 1PVC1 1WW5A 3WQ7A 1NCQB 3LL7A 1RUG3 1NQJA 1OQYA 1UJ8A 5EEAA 1PVEA 4UW4A 4I01A 1MDMA 2M4KA 4E2SA 1FYLA 4F92B 1WZ2A 2YR2A 2OCCH 2XHNA 3IH3A 1OOPA 4YWAA 3U11A 3GZ5A 1CPMA 5LBQA 1JI6A 4QD2A 3NAPB 5IFPA 4UXNA 4D3WA 2L7ZA 2EH3A 3OY8A 3M3CA 1AR62 2JT1A 3WF3A 2CAUA 2KD7A 1Z7UA 3HR9A 1F5FA 4HYEA 2Z3YA 1BI0A 3QRFF 1SD4A 5GLWA 4M71A 3HOWJ 2KIMA 2WN2A 4Y22A 4JHTA 5FGMA 3NNFA 2LD5A 1MEC2 2H1LA 4R4XA 3MVPA 1ULOA 3P6BA 3ZMUA 2RV9A 4EGZA 1SACA 3L9JT 4E4HA 4D6SA 1I50J 1T6BX 2HDWA 4IEYA 3CO6C 3H5AA 1L7QA 4HBNA 3ZR5A 3QYEA 2O8OA 1VBB1 4I76A 5KAIC 2OPTA 1JXSA 3WR0A 2ESNA 3ZO0B 3HRSA 3WZ1A 3SJMA 3I3LA 4KU8A 4ZZ5A 5A7PA 5FMCA 2IVMA 5L36A 1Q8QA 5D8AA 4P9IA 2UY8A 2DT7B 1T38A 2GBYA 2ZXWH 3HHGA 4L5EA 4PI2A 1ZARA 2Q5TA 1RR8C 3EDPA 2WR9A 2UYAA 2HWC3 1W90A 3ABUA 3CC2I 3IT8A 2QQIA 1EJ9A 5CFDB 4C30A 3P5JA 2D93A 4BQYA 4BQQA 3BI3A 3A01B 1HV1A 2XSJC 4Q4W3 4JX4A 3UNPA 1VFCA 3TEYA 4XNFA 3DXJF 4EMSA 1D2QA 3LD8A 3VBOA 1RTVA 1T98A 1D8JA 2XJUA 4BU2A 1O4TA 4GKYA 2XGDA 2NMOA 4CDUA 3URFA 1X33A 4IESA 4A3GJ 1OHFA 4XFGA 3THCA 1FOYA 2DMNA 2P17A 2R0FA 1FMD2 2HYXA 2FQ3A 4ZYHA 4XLAA 3DBHB 2QVSB 4NPRA 4EGYA 1QHDA 1UYYA 4XIOA 5H9RA 1MH4A 1HXDA 2G19A 4NWWA 3CF5F 3BN6A 2OCEA 2PFBA 2DV9A 1PVC3 1H9GA 1QA6A 1XBFA 5D21A 2JVGA 5CQEA 3KE2A 1FP2A 1TEIA 5FBJA 5AVAA 5A7OA 1MZ6A 2FRHA 1RUD3 2A6VA 1OLMA 2G4IA 1K3IA 2VONA 2HBTA 4QX7A 2K02A 2DCYA 3FMSA 3U75A 4A3CJ 2UY9A 1BJQA 2HJIA 2WA0A 4XK4A 3DLAA 4TTGA 1K5MC 2XKOA 1XD7A 3SHFA 5IVBA 4MFEA 4JDMA 4PSWA 2H94A 4GAZA 3VDAA 3HPNA 3MIDA 1GP5A 2DFBA 1FSHA 3DTKA 4QT6A 2D7FA 3I3QA 3I3BA 4XMIA 2ARAA 3U10A 1GZ9A 1VLNA 5CJ9A 3ZYRA 3RWKX 5IATA 3AKPA 2HWC1 4Q0PA 1XSDA 5IK7A 4RGUA 4R8HA 4ISQA 4LLOA 4FI9A 1C5HA 2XLGA 2VZOA 1ETVA 2QKMB 1X36A 5BNNC 3VV1A 3NRUA 4NIGA 5L73A 1Z6TA 5FZKA 2SBAA 4NROA 2PQ8A 5TRDA 3QACA 4FASD 3IKVA 3ST7A 1BBT1 4UW5A 3OB8A 1GYKA 3CUQC 4BLJA 5IT6A 5APAA 3BTCA 2OQ6A 4J1XA 3HT2A 1JYVA 1VQ6I 1R091 2AGSA 1KFUL 1MS1A 1Y39A 1OF4A 2WFF2 4BQ3A 2VKHA 1ETOA 2ELHA 3GTJJ 2XWBB 1MR5A 2EINH 1RINA 4HVOA 1Z3YA 1PO13 4AWXB 2X05A 1RJ7A 5TSWA 2VOVA 3DPRB 2G7HA 1UZZA 3RG0A 1Q3EA 2A3XA 2PELA 2Y34A 2DU9A 2AHQA 2KJCA 2JDMA 2EVXA 5J09A 1QRYA 2E6VA 4AVAA 1JYNA 4DO0A 3IRQA 4WXCA 3PLQA 6PAXA 2LY9A 1IV6A 3E0JB 4DXSA 2R6QA 1VBD3 4G94A 2CHHA 4FFFA 4B1LA 3WG7H 2LY1A 1W36D 3HG9A 1AXYA 4EN7B 2RMU2 1L0OC 1UO9A 1WA6X 3ZX7A 2QKDA 2D6NA 1AUYA 4RHV1 1FIAA 1ZM1A 2WY8Q 1QO0D 1UELB 3VD9A 5J1YA 1PZ8A 2RS53 4HNVA 4S2GA 4Y13A 1S4CA 3WNMA 2NOGA 1USTA 1YHFA 4YZ5A 3LA2A 2JG8C 3PU3A 2Z5UA 1LHVA 3ABLH 4IEOA 3PSFA 4C1XA 2CV2A 4KIGA 1S8NA 2IFRA 2Z2SB 5T5OA 4M0HA 1MJ9A 2XPJA 1O8PA 3NV3A 4FE4A 2R7WA 2MD5A 3P3PA 2BY0A 3AG2H 4LLNA 2W87A 5FQ0B 3NAUA 2C9KA 5BS6A 2VOPA 3GTPJ 4HKOA 3HOYJ 3B00A 2QQ9A 1V6IA 4WXDA 2GMMA 5FCCA 4AAPA 3CTAA 3F6OA 5EQUA 2A07F 1W9SA 4EM1A 3VDDC 1GZTA 3ACHA 3VBFA 2DOFA 1TVGA 5CFCA 3TEZA 1SFUA 5C4WA 4AQ2A 4CP2A 4GFBA 5J96B 1Y8QB 3K2ZA 3EUKL 1F31A 5KHIA 4YM3A 3SH5A 2EIEA 3U07A 3TO9A 2ZOEB 1V00A 5DV5A 2HPMA 3RGBA 5A7WB 4KWUA 5JWPA 5FP4A 1UAIA 1HDPA 5AIQA 3NJZA 1NK3P 1A6QA 4IE4A 4FQZA 3T8TA 2BRTA 1MBFA 4M3GA 2A7AA 3OL3A 5ACA2 1V9U3 4ZY9A 3V7RA 1SBDA 2I5UA 4IEVA 4XUQA 1AHDP 4ZZLA 1F9NA 5LB6A 5FMOL 3N9QA 2JIJA 5IP6A 5FBZA 3AX4A 3IUOA 1IAWA 1DGWX 2VD7A 3J80Z 1X1AA 1DPRA 4ZYAA 3HMYA 2Y0MA 3ZXLA 4A42A 5DUVA 5JIAA 2MHFA 3FMQA 3A02A 3KYCB 4XM3A 1VRH1 1O6UA 5KHGA 4CDWC 1PNGA 5E17F 1SCSA 2GC1A 1K4TA 1FOD2 4BJ0A 4KN4X 2GM4A 5CYVA 2O8XA 2QVOA 4K21A 4KA4A 1W6PB 4META 2H1KA 5GZEA 3BKZA 4XHBA 2KRHA 4ZH4F 3OYKA 3VD5A 3CEWA 4LOTA 1J3PA 3MICA 1S7EA 2EIMH 4ZTJA 1VMJA 4A7ZA 2KISA 2P3IA 4EM0B 3AVRA 1WRJA 1XX5A 2K9ZA 4XJ8A 4AU7A 1ETKA 1FATA 1ZGWA 4HF1A 3CZJA 1T56A 3MDPA 4BJ6C 4U7BA 5FXVA 1I6XA 1RESA 3ELKA 5ILSA 3U1XA 1GMMA 1IRXA 2E63A 3TL4X 2VW2A 2AENA 4XABA 2ZJQF 2EV6A 1HJGA 2P2KA 1XGOA 3VZJA 2MEV1 4JZRA 3T09A 3T3YA 4YRDA 2JVHA 4IE0A 3ZN1A 2JE9A 5FP9A 5GPAA 4BH9A 1MMSA 3RZLA 3C7JA 3FXOA 1SFNA 1CESA 4OHXA 1WBFA 1ZRCA 2BFUS 5A7QA 5JXJA 3JUUA 3S17J 5EFUA 2W91A 1URXA 3M4FA 1AX1A 5CISA 4E7ZA 1MMNA 1FXZA 4B4CA 5IP9J 1YQ8A 4FXKB 4IQ4A 5C3QA 1JZ3A 4NQWB 3WSOA 4BHPA 5CKQA 3K46A 1COV2 4A41A 4BY7J 1SEUA 1G8WA 4UI9L 2PLV3 2ID6A 1I1EA 3ZFEC 4PJ0C 4PIXA 5J4YA 2QSHX 2VNVA 3VYSB 1L7RA 3NNJA 4GWJA 5DZEA 3BTZA 2HEVF 3AL5A 3M70A 4QM9A 2BBYA 5DM7F 3M1CA 2E35A 5FYZA 1UG2A 1LOBA 2X9DA 3VBRC 3AXDA 3AMPA 5HCBA 5C33A 5HNHA 3UKVA 1IC8A 3CLPA 1KJRA 1C3HA 3POJA 1QH7A 2Q8EA 4QXCA 5CFCB 5CEHA 2G9FA 4G6QA 3WW1A 4Z1VA 1ZLKA 2TDXA 4PQ9A 1E5IA 1UCRA 2VBBA 1E2XA 4IE5A 1KQ9A 2HQ5A 3N9MA 3INAA 4QMAA 4S05A 2Q1ZB 1D0XA 2JIGA 5JR2A 1W7PA 2A70A 3VSKA 2XXZA 1W1WE 2JG9B 3CHXA 3LA7A 1LENA 4XW3A 1DQ0A 1N47A 3KEYA 5FMDA 1YUDA 1HRV2 2RS32 2I45A 1IS4A 1OPCA 2VZQA 5E1ZB 4FOVA 5J3UA 3VD4A 2PHFA 2OQRA 1DU0A 4AQSA 3FLPA 2PA7A 5L7OC 2KRCA 3AM2A 4XETA 5LFAA 4Q4Y2 2P0WA 4IV3C 2QJVA 4WM8B 4XDOA 2KZGA 4Q0SA 1EH6A 2V1NA 1X8EA 3GBFA 3H7YA 4PIYA 1V0AA 3LAGA 5FLVA 4HN0A 4LHLA 1ULYA 3RZZA 3HOBA 1W8HA 1W6QA 2MNGA 1RIRA 4WBBA 3PJYA 3CCLI 2WKKA 2PEXA 4NIIA 4QQHA 3UGGA 1ZHFA 2RREA 5FO5A 5GTIC 4OUMA 3MD2A 5FKKA 1OQEA 5D6EA 4BKXA 4XCAA 4QKBA 2VI6A 2YC2A 4XFBA 4OHWA 1R1VA 3O1OA 3C7OA 1CAWB 4PT6A 2QCOA 1ZA4A 2HR3A 3UYJA 3M8EA 4XMAA 1WD4A 3GCMA 4IEWA 3PFYA 3Q8AA 2D1HA 4MNUA 3O1UA 2WQ8A 2JDNA 1APNA 2HBUA 3JRCA 1KITA 3CO7C 4Q4Y3 2HWC2 3DEUA 2Z99A 4D7MA 1EAH1 4GRIA 2FMDA 3ASIA 3FHQA 5J1XA 4LO5B 4OI1A 5LGNA 3DFGA 3VFZA 2K9MA 4XOPA 4LQRA 4XJWA 4YG6A 3WP3A 1YQ2A 1PGL1 5L3BA 3JRHA 2A6HF 3J7LA 2W48A 2XBO2 3KF5A 4NRPA 2ZJCA 1CAWA 1NXMA 4M3CB 5C9AA 3WDWA 1ITYA 3HTSB 2JDAA 3HSFA 4F3JA 2Y48A 2WFF1 1QJU3 2Y30A 4WM7A 4G6DA 3PIOF 1XNKA 2K7LA 2K9NA 5FJ8J 3ACIA 1K6OA 1OXCA 5D8AB 4DW6A 5GZDA 3VBSA 1N77A 4P5OA 2XAHA 2Q1MA 4UUVA 3C2GA 4QLCU 2O6GE 3ZQGA 2JDPA 3P9IA 3ZFFC 1J3QA 4QX1A 1Y43B 1R71A 1X3WB 4KH9A 5DDJ1 1Z1DA 3CC7I 5E1XA 5E18F 3ZYBA 1PK6B 1A04A 4AI3A 1GNYA 1MH3A 2JK3A 3W6JB 3OV8A 4HETA 2RMU3 1S0FA 3HQXA 3WTTC 4UW3A 3RI9A 3RYPA 3WTUC 1O4XA 2X4HA 1J75A 3OOUA 2FCVA 2GZWA 3AKRA 1C8M1 3OIOA 4BHCA 2ZGMA 3NL1A 2X1EA 3A03A 2HXIA 2VZPA 1DZQA 2ZGUA 1LB2A 5I0SA 4FPFA 5CAZA 2RGVA 3KZIC 1CGPA 3HD8B 2DTYA 2HOAA 3LEIA 3LEMA 3MF9A 5EYYA 1NHAA 1A8MA 4LO6B 5A33B 2OPKA 4JX0A 1QJU2 3ZYGA 1OA4A 3LSMA 2XGXA 1RVF2 1TME1 3TN91 4HXCA 1G9BA 4CUGA 1B9MA 2Y60A 1XTAA 4LIUA 4XORA 1RHI1 1ZA7A 3HNBM 5C71A 3EQEA 3ZM8A 5IK4A 3T0YA 4G7OF 4V1PA 4FTSA 3OSDA 1AYN2 1HXS1 1FX7A 2WINB 4CDWB 3WF2A 4Y22B 4TXWA 4S2FA 3G7DA 5GZFA 4Z6YA 3KT1A 4C0HA 3EUHA 4HSLA 3VBUB 2Q30A 1YS7A 2H27A 5DAXA 4UUSB 1OF3A 2LDUA 2M30A 3CCVI 1LR5A 1F35A 3EO6A 2IVJA 2VKEA 2F6CA 2IS2A 3FLTA 1DDNA 3B73A 5IAXA 1MACA 2E9QA 2YY1A 3CJNA 2WWYA 2NN8A 2FMYA 1CF7B 5BNQA 3MWMA 4B3AA 3BYWA 1UX6A 4GH4A 1NAEA 1ASJ3 1ZG1A 3GJBA 5TGTA 4RMNA 1VR3A 4O3MA 1S0BA 2VNRA 4KYWA 4LKEA 1XNAA 1FZPB 1G59A 1O8SA 1J2XA 1SFOJ 4LK1F 4HLXA 4EJVA 1YG2A 5FJHA 2Q2EA 3UNGC 5DDGA 2FDHA 1BM9A 2LLKA 3LPFA 1YI9A 2WS93 4HDVA 1US2A 4YIRX 3S1RJ 2BW8A 1NX9A 3HJRA 3JBG3 4DB5A 1VRH2 4XUPA 5A7SA 1ETYA 5FZ3A 1DP7P 4XEZA 1FJLA 4PIZA 2UZKA 3ZLIA 1X8MA 3WCSA 4HL0A 3OYIA 2ZGRA 1K61A 3TB0A 5DYMA 4Q1PA 2ZHLA 4LKSA 2Q1FA 3DQVC 1SMYF 4BHBA 3HT1A 4AC0A 2W4SA 2VECA 1BK1A 4WM8C 1W8FA 4RSUA 3AJZA 3D8CA 5M5YJ 3GZEA 4IOAF 3AFHA 3J7NA 2E32A 1Z05A 2X6YA 1VRH3 3OUIA 4I30A 1QDOA 2L9RA 3BCBA 1BN5A 1DQ4A 2JSPA 2X1DA 3HPHA 4RFT0 1ND3B 1DQ1A 1BOAA 3U2RA 2HNHA 3RQ4A 4HRIA 2F17A 4UV9A 1JYTA 4FSJA 3LEGA 4XJZA 4UFMA 2EA2A 1ZG3A 3CKHA 4XCBA 4II3A 1PO23 2WT0A 3RMYA 2R5YB 1K5MB 1RHI3 2XRLA 1QHGA 4JAAA 3ME2A 1UU5A 3MUY1 1OLTA 5CYYA 1RKTA 3CJIA 4BIFA 2IT0A 3WU2C 3PUFA 1MBGA 5FXZA 4LXLA 1GZCA 5A3PA 1ULEA 1VBE1 2BQPA 1BC8C 2DO7A 2JG9C 5KWRA 1AU7A 4G12A 3BC8A 3REOA 1SFYA 2P4EA 4A69C 2PMZN 5FZMA 4HPQA 1EV7A 3WNLA 2JEMA 1NA1B 4BXXJ 2KR2A 2QWWA 3WGGA 4BZ4A 2VZSA 2Z16A 4BM8A 2Y31A 3K10A 3W58A 1WCSA 2BUKA 1QPMA 1S5LC 1DLCA 4DUXA 3VEPA 5A1AA 1O5LA 3BTLA 2WWUA 2OX0A 2RC4A 2RS33 4EJOA 2XG3A 1CR7A 1BW5A 3O1TA 2VOTA 1U9OA 2LM3A 2BERA 2CQXA 4ZPIA 4EJTA 4AVCA 3HOTA 1OUSA 2EA7A 4B1RA 2WAOA 2VLAA 4HW0A 2D5FA 2ZGTA 3J81K 1MW7A 4DXTA 4IF4A 1W0PA 1YS6A 1IG7A 4RM2A 5FTTC 3VDBA 2R7RA 3KHBA 1DDLA 2ID4A 2BHYA 1SDWA 2B9VA 3IAPA 2VXJA 3G4SI 2WFF3 4RS5B 2D2WA 5H9PA 1QXPA 4Y24A 4L9VA 1LDDA 1UCXA 5BYNA 4MH0E 5J3LA 3D5SC 3M1HA 3WX5A 4OMDA 2NVUB 4H7LA 2ZB9A 3K4LA 3KQ4B 4KMFA 1UY0A 5JXHA 2GNDA 4L9NA 1SLCA 1HX6A 1S7AA 4MTDA 1TQPA 4LO8A 5FDBA 3WV6A 2J5PA 3GFIA 3L2RA 4AUXA 3ECHA 3M3IA 1USSA 2DQRA 3M9AA 1IN4A 3C7EA 5EPAA 2P6SA 4Y1XA 3PUBA 1W36C 4M3CA 3O5SA 1UB9A 3DEEA 3K4ZA 2OTJI 2DCZA 3OGGA 3RI8A 5FY7A 5L7OB 4AHXA 4XLFA 1W03A 1VQOI 4ASLA 1QGLA 1TZOA 4QX8A 5TISC 1TT5B 4L9JA 4LBQA 2DYRH 5H6RA 3AC0A 3KLNA 4ITVA 2M9HA 3Q8BA 2W9XA 2KFDA 2D44A 2RDRA 4AE2A 1W6MB 1H6YA 5HNFA 3FMRA 1AA7A 3U1KA 3BG7A 3BOQA 4Y20B 3T8RA 2PHLA 4XJ9A 4I09A 4HVQA 5J4VA 1KGYA 2VIXA 3RZOJ 5BNNA 2EA4A 2YC0A 2A5WA 2LRPA 1GVJA 3OOXA 1RUC2 1VB2A 1V54H 1WMDA 1BKZA 4JGZA 1LHOA 1IO2A 5FPVA 3NJYA 2C5DA 2JECA 2HFHA 3FXLA 5EG0B 4ZJZA 5T5LA 4XQWA 5FRAA 3C3WA 4MG2A 3OL4A 1Y9QA 2R7TA 1FBQA 3OUJA 4UFLA 1B8IA 2X53S 2VUJA 3ZSLA 2B45X 3JAMK 2V9KA 1J1TA 3B69A 3PNAA 2WZR2 3R61A 1N78A 2X51A 2XJQA 5M5WJ 4BQ5A 5T5JA 4A6DA 3I59A 3B01A 3WINE 1XSXA 1Y56A 4I2OA 1P2FA 2DFFA 1NXD1 1EY2A 1VP6A 2OTLI 4HFSA 1V3FA 2HS5A 4QPIC 3LSTA 4Y15A 1R1A2 3FKJA 4GYGA 1LE8A 3AP7A 3H8RA 4M00A 4XJAA 3CUQB 5CNAA 4MEYF 4TLFA 2ZMEA 3MW2A 4JKLA 4FAHA 2CNAA 2VPRA 3K4DA 4IHWA 5FY5A 1DUXC 2EILH 5DG1A 3C7HA 3VKFC 1DGRN 2DF7A 5JUVA 2VE9A 1I3QJ 2JD9A 2VMCA 3POGA 2DLLA 2XPVA 3SXYA 4BY1J 2E51A 1PGW2 3K4KA 2UUZA 2GC0A 3MLKA 2HOTA 3CCMI 4OUSA<