2OS2A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys36
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
347
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2os2A01
2YBSA 3KV9A 3AVSA 4D6SA 5FZ8A 4ASKA 5FBJA 3KVBA 5FYVA 3N9MA 3K2OA 5FYBA 5FYHA 2OX0A 5FPBA 4AI9A 4DIQA 2XUEA 4DO0A 5ANQA 3NJYA 5FZCA 4BU2A 2XDVA 4XDOA 5LY1A 5FXVA 5FYSA 5FY0A 4CSWA 2XXZA 2YU2A 3K3OA 5FPLA 5FP9A 3KV5A 3N9QA 3KV4A 4UF0A 4Y4RA 4GAZA 2VD7A 5A7SA 3LDBA 5FZ7A 5A7WA 5FJHA 5LY2A 1VRBA 3PURA 5FZEA 4EZHA 5A3NA 5F5IA 3ZPOA 5FXZA 4QX8A 5A80A 4QX7A 4LITA 3KV6A 5FZOB 5FZAA 5F2SA 4LIUA 3AVRA 2P5BA 3LD8A 5FZBA 3PU8A 4CCLA 5FZOA 3U4SA 4LXLA 5FZHA 5FXWA 5FY9A 5IWFA 4EYUA 4QXCA 5FZ6A 4QWNA 3PDQA 3U78A 5A3TA 2Q8DA 3ZLIA 4QXHA 4NUBA 5FZ9A 5K4LA 5FXXA 4D6QA 4CCKA 5IVYA 3N9LA 5FZ1A 5FYZA 5FP4A 3OPWA 5FY8A 4URAA 5FYYA 5A1LA 5F37A 5F5CA 5FZKA 3PUQA 2Q8EA 4QXBA 4IGPA 5FP8A 4QU1A 2YPDA 4D6RA 5FP3A 4LIVA 5LW9A 5FZGA 5IVBA 2OS2A 2YBKA 3PUSA 2PXJA 4GJYA 4GJZA 5FZLA 5FZDA 3N9NA 5F3CA 4C8DA 4CCJA 5FPUA 5FYIA 5F3EA 5FYTA 5FZIA 5IVCA 5FV3A 3N9OA 5A1FA 4IGOA 5FYCA 5IW0A 2W2IA 4AAPA 5FY1A 4IGQA 5FUNA 5FUPA 2YBPA 2GP3A 3DXTA 5FPVA 5LWBA 3PU3A 4XDPA 5FZ3A 5IVFA 5E6HA 4Y33A 5F32A 5A7OA 5FPAA 4BISA 5FZ0A 4GD4A 5FY4A 5FJKA 5CEHA 5F5AA 3DXUA 5FZMA 5FYMA 4E4HA 2YU1A 2XMLA 4CUGA 5A3PA 4Y3OA 3OPTA 5FZ4A 5A7PA 2Q8CA 2OT7A 4UF0B 2OQ7A 5F2WA 4HOOA 3K3NA 4V2VA 3UYJA 5A7NA 4BXFA 4CCNA 2OQ6A 4HONA 5IVEA 5IVVA 5A7WB 5A7QA 4CCOA 2GP5A 4CCMA 3AL5A 3RVHA 2WWJA 4V2WA 5F3GA 5FWEA 3AL6A 5FYUA 5FP7A 5FZFA 5ISLA 3PTRB 4EZ4A 2WWUA 5F39A 5A3WA 5FY7A 5FWJA 3N9PA 3PUAA 3KVAA 5F3IA 4TN7A 5IVJA 5FY5A 5KR7A
chains in the Genus database with same CATH superfamily
3B01A 5KHIA 4MG2A 2EVXA 3JZVA 1O6UA 1MS8A 4GQ7A 3AZXA 5FYVA 3ZFEB 2OUJA 1U5IA 5JR2A 1HKDA 2X09A 3K2OA 2N7GA 4HBNA 3ALQA 4IV3A 4N53C 2ZGRA 1I3HA 5FDBA 4DY3A 4FPCA 2D98A 1GZ9A 2HWD2 2EIGA 4BIOA 1US2A 2HJIA 2YU2A 3ACGA 3AMMA 3E5XA 2GAUA 3K3OA 4GWIA 3RDIA 3LOBA 1W9FA 4UF0A 2XJRA 3VBRB 4IE5A 3RYRA 2ZAAA 5J96B 5JIAA 5LY2A 4Z2AA 3ES4A 3HAGA 4H7MA 2VMGA 5F5IA 3MV01 5FXZA 2VAUA 1IZ3A 1ULPA 4LITA 3NQHA 3M3IA 5FOJB 5C9AA 1NY72 3WNMA 4JQTA 2A6WA 3H0OA 1HXS3 4XF4A 4XYXA 1GP6A 1E5SA 1TVGA 2VUJA 2IXKA 2WLPA 4LXLA 3T4HB 4QPGB 4L11A 1XNDA 2P3IA 3Q8EA 4LULA 4XE9A 2DCJA 2W5FA 2K46A 4DB5A 1PK6A 3POJA 1SLTA 3ZVXA 2JDZA 1JZ5A 3K77A 3E6CC 3OYWB 4YGDA 2EXKA 2PELA 3WX5A 1UOBA 4YARA 1D4M1 1OF3A 5D8AB 5LBBA 4AHYA 5FZ1A 2A7AA 3QH7A 3KGLA 2Z42A 4M3CE 2QZ3A 3B9CA 1E5HA 3GCXA 3LQCA 3MW3A 3POGA 4QPWA 2PHTA 4AVSA 5F5CA 4EN0A 4J6GA 1VR3A 4QMAA 5FP8A 4A44A 5AFBA 1ZRDA 5CIRA 5C4WA 1GQHA 1WLTA 1CIWA 2GC3A 1ZBA2 4K8RB 2B45X 5I8YA 2JE9A 1RUH2 5JPNB 1LB2A 3OEAA 3VGIA 4UI9L 1UZWA 2RJLA 5F7UA 4DXTA 3NV3A 5FZIA 5FV3A 1G9DA 3ZFFB 4EQVA 4FPHA 1NE6A 3AKPA 4IGOA 3BALA 1MS1A 1G9CA 1QEXA 2RR12 5FAXA 3VBFC 3O1VA 1UY1A 2P6CA 4NRPA 2DF7A 4Q8LA 2RHPA 2Z4FA 4XIKA 5GM0A 3ZSLA 4WM8A 5E8AA 4XIOA 1NZIA 4L0PA 4H3WA 4XDPA 3A0NA 4XXPA 1TME2 4AQTA 4I30A 4CUBA 5JWPA 2UU8A 2R1DA 2WRAA 1UN1A 2VCCA 1UMHA 5FOBB 2JG8A 4EN7B 2AR6A 4P9IA 1C57A 3I7DA 3DXUA 5DXDA 2VQUA 1V6NA 1QOTA 1NLRA 2UURA 1EP0A 4OHXA 3O0VA 1W6OA 1KXGA 3AKTA 4IV1A 1WMXA 4NPRA 5A7NA 1FNYA 2OQ6A 3NAPC 2AENA 4PDWA 3E1F1 4BB3A 3I2OA 1NA1B 2FZ1A 4FFGA 3AL5A 1S0DA 4IEVA 2DTWA 5DZEA 1R082 1HRV2 4LR4A 5KWRA 1WW6A 3WP3A 5FK7A 5L7OA 3V0BB 4XW3A 4YGCA 5A3LA 5KC6A 3IDBB 3JXSA 2V4VA 1QF3A 1JS9A 3NV2A 2QQUA 4QGNA 3RZMA 1WWYA 3U1XA 3POBA 1R1ZA 2R071 2A3XA 4Q27A 4E8DA 3AB0A 2HWD3 1CAVB 3MFAA 2MEV2 4YW5A 5FLHA 3K4ZA 1UX7A 2QQVA 2VE1A 5C3SA 4FPKA 2ADDA 3H1YA 3DPRC 4S2GA 2OX0A 4XUTA 3SMHA 1CR7A 3POSA 5DPNA 3TNPB 1NUKA 1COV1 4FBFA 4OZXA 1W6PA 5FXVA 1GZWA 3IAQA 2WFF1 3AKQA 4FTEA 1AR63 5IYYA 2H0BA 5C3PA 3I2FA 4CCCA 2EAKA 2JD9A 3URFA 1WMEA 4FPOB 5HXVA 4BOWA 4KG8A 1MZ5A 2KXLA 5DABA 1SG3A 3SKJE 1T6GC 1GUIA 2C24A 2O8QA 2VBPA 3BGAA 4W8JA 4QX0A 4XFGA 4BMEA 1H2KA 3WF3A 2HWD1 2OZJA 2ZGTA 4XETA 2NN8A 1J84A 1K5MC 2BV4A 2RS33 5LB6A 1W06A 3SXWA 3O1SA 3KSCA 4FXKB 4MX3A 4Z82A 1IS5A 1LOBA 1P8JA 3LA3A 1LODA 1O3SA 3ZYJB 2VC9A 2D6OX 3WW4A 1CJDA 1HRI1 1RJ8A 2GZWA 1LNSA 2VQ0A 3HIFA 4AFCA 4CE8A 1NY71 3O1MA 2YHJA 3MDPA 3VBFB 2YC4A 4FAHA 1AX1A 1IGOA 1S0FA 1PVXA 1ENSA 3KM5A 1AR92 1DF0A 4Q0UA 5FY8A 3W21A 3KGZA 1RUH3 1OVSA 4IEQA 5GLZA 4D3WA 1KJRA 3CU7A 4OCTA 3BKZA 1FMD3 3IMMA 4C1XA 4MADA 1AYN1 1G9FA 2DVGA 2GDFA 1I5PA 2JDKA 1JMUB 2VZRA 1JU4A 2E9QA 3HNBM 5DUVA 5CB7A 1WD4A 3PHMA 4NHYA 2JDUA 2VZ3A 3I8TA 1YRZA 2FMYA 3M3OA 4AHXA 2VZSA 4U2AA 4KGGA 3E97A 4XFHA 5HCFA 1Q8OA 2GMMA 1QXRA 2W2IA 4JAAA 1AHSA 5LA1A 1OURA 1JYCA 1TME3 4BM8A 3WNNA 1POV3 3ILFA 5BNNC 4YGBA 5HXMA 5L9RA 2GP3A 1ZBA1 5CG9A 3CF6E 2FDGA 1QY4A 1RUH1 3G7DA 3FUOA 2NQYA 1JZ3A 2BERA 1F9KA 4QPIB 2WLQA 4WVMB 1IHMA 1W8FA 1WW5A 2RR11 2XL7A 3MICA 1S55A 3PMEA 4DZGA 4E4ZA 3I3EA 1S2KA 2K2SA 2E7TA 3HNYM 5JIUA 5JZGB 4NIGA 1R083 3VBSA 1O7FA 1UQXA 1HRV3 4RQPA 3AJYA 4FPEA 4QXKA 2Q5TA 5C3OA 1JZ7A 1RUI2 1TME1 3DPRB 3VBUC 1I5ZA 2OUHA 2ZX2A 3N36A 2V09A 1AYM2 2QVSB 2WL1A 5I8TA 3MFCA 3ZN6B 4V2WA 3AMPA 1DGWA 4KBZA 1ZVFA 3WW2A 1GICA 1F31A 3CDZB 4YM1A 1PMIA 3I2IA 1HB2A 3VDCA 1AL22 2VMFA 4TLFA 4XUNA 3LA2A 5DDJ2 1JZ8A 1YO8A 3W5MA 1RB8G 1ASJ2 1RUD1 3KS7A 4FPLA 2DVFA 1SMVA 2VOXA 1GWMA 1G8WA 2YBSA 2VMIA 4QHZA 3FFZA 2ZX1A 4PT6A 1R081 1W3VA 1HRV1 2VUAA 2GNBA 4CXYA 1K5MB 2Z5WA 3C2UA 2HWB3 4AGGA 1NCQC 1ZRCA 3ZFGA 5ANQA 3S5AA 1H4GA 3N4MA 4HVOA 3HBKA 4NRQA 4AFMA 3OTFA 1CD3G 1XU2A 4KMQA 3U11A 5FPLA 2FD8A 1E57A 1FPN2 5BNPA 3FJSA 1W8UA 2MEV1 2HBTA 4HL0A 4LQRA 4RSUA 4X6QB 3SCGA 3T2OA 3FE5A 2YROA 1UOJA 5IAVA 3SNMA 4D8MA 4IEUA 3T0DA 1CGPA 4BQWA 5K0UC 4XJAA 1AF9A 5T55A 5EXOA 4EYUA 4IQPA 4BQ5A 5B2GB 1DZTA 4GXLA 3OY8A 1AR93 4Y5TA 2Q8DA 3H7JA 3R4DB 3ZFEA 2VMHA 2C4XA 4NUBA 1FOD2 3A0KA 3ZR5A 2XR4A 1AUYA 1AX0A 1UPSA 4MGZE 5CKQA 1G86A 3VKOA 5BNNB 4F3JA 3WNLA 2P3YA 3RRDA 2UY8A 3TYJA 5FYYA 4DS0A 5JVVA 3PJYA 1QJY3 5A1LA 4LO5B 4YWAA 3Q8AA 2FCVA 1DHKB 1ZZ8A 2RDNA 3VBRA 3IIAA 3ACLA 1N1TA 1OBNA 3SISA 1V0AA 3AYDA 4XUOA 3LEIA 5AC93 2E26A 4GJYA 1F8VA 3KCXA 4Q4Y2 2VZ1A 3N9NA 1CESA 3FLPA 4GMP3 4TYSA 4XURA 5EJ1B 5EJ3A 3T30A 1AR91 3WNKA 4AQ2A 1CZSA 1POV0 3U75A 2JECA 1V00A 2A3YA 5DUXA 4R4ZA 5IW0A 1WLWA 2FQPA 2PHRA 1J1TA 4P9GA 1UL9A 3GZTB 1V9U1 2H6BA 4IGQA 3NNJA 2YBPA 1YEWA 4LBNA 5T5OA 2HYXA 5KXCA 3BVCA 2YG0A 3U10A 1RUC2 1TMF2 2W1WA 3FHIB 1ACCA 3MO4A 2VXJA 3PMSA 2P4EA 1PGL2 5D8AA 1N3OA 1S0CA 4R8HA 2JKXA 4L92A 1AR82 3ZX7A 1RUI3 2VOTA 2OIIA 4LORA 4MYEA 2R0HA 1ENRA 1AYM3 3ZMOA 2VR4A 4BA6A 1VP6A 5AVPA 2ZABA 4GB33 1Y4WA 2OQ7A 2C0ZA 4COUA 4PLMA 4L9BA 1MZEA 2Y60A 1JYTA 2D97A 2HLEA 4COYA 3L2YA 1ASJ3 2GP5A 5IFTA 1ODNA 3FMGA 1MQTC 4XJ8A 3VD9A 2VM9A 2VVEA 2ZMKA 4PLNA 2LS6A 3ZFFA 4D94A 4HG6B 4P9YA 5SV8A 1ZZBA 5KC5A 1OD3A 2VJXA 3H9AA 2YXSA 1LHOA 1W90A 2XJTA 1Q8VA 3N9PA 4TN7A 1RUI1 4ET7A 5IVJA 3OGVA 3KHBA 4ZPIA 4AYUA 3JBG2 2EIDA 1AYM1 3ZSMA 5J48A 1QNYA 3ATGA 4XAEA 5E88A 3VDAA 3N9MA 4MSVA 1FPN3 3AFGA 4WVVA 5FYHA 4QB1A 4EWDA 1AL21 3K51A 5DDJ1 3BPSA 3CNAA 4P08A 4BU2A 3I2DA 1Q8SA 2O14A 5FYSA 3LSDA 3MGUA 1A3KA 3N9QA 5DAWA 1ONAA 1QNWA 4XF0A 2VZUA 3ZXDA 1BEV3 5A7SA 4JKLA 1C8NA 4ES9A 4N53A 4FAGA 3FBYA 1NA1A 2G1MA 4OI2A 4A41A 3PVNA 2WR9A 5A80A 3UGHA 2RVAA 1LU1A 1MZ6A 1SLAA 2PQSA 2CTVA 2PLV1 2P5BA 5JLVA 2ADEA 1UU6A 5JMOA 4RHV3 3J7LA 3V0BA 5E89A 1U5XA 4CCLA 5H9RA 1FPN1 1OF4A 1O3RA 4N7UA 3T08A 1DQ6A 3ZDSA 4CUCA 1FOD3 2I74A 1LGBA 5FZHA 1IKQA 1BXHA 5DG2A 4GIQA 1OSGA 1CAVA 1DGWX 2JG9C 5HV4A 1G9AA 5KHKA 5FZ9A 1DFQA 3P5BA 1PNGA 3LPGA 3MPBA 1CN1A 3H3UA 4CCKA 4YYOA 4B8EA 4I0WB 5KHGA 2RM21 1KDMA 1G7YA 2Y34A 2VCMA 4OUSA 4AG4A 1US3A 2BPA2 3M1HA 1RHI1 1DLLA 3NNLA 2ATFA 4COZA 2DDUA 1BVVA 2CAUA 2B8MA 4K8FA 2VGDA 2YC0A 2IWGB 3ES1A 3PUHA 4GMP0 3LDKA 5FZDA 2C9KA 4Q26A 2WAAA 2XWJB 4BQYA 2AH2A 1LESA 2DUOA 3ASIA 2AYHA 4KH9A 4AGVA 3S5QA 2VOKA 1TMF3 1X8EA 1RYYA 2LW8A 4G4FA 1H1MA 1H9WA 2RDQA 3POYA 4BQ4A 3WT3A 1ZZ9A 2AZ5A 4XFAA 5JZGC 3J7MA 3OUJA 1MQTB 5LA0A 4YVWB 1B35C 3AMQA 1W3XA 1UD1A 3D3AA 4Q4Y1 2WZPP 2ZMLA 5FPAA 3VBFA 3P3NA 2P3JA 1LAJA 4LHNA 4OMCA 1W6OB 3IN9A 2JIGA 2B5HA 5C7GA 1PX3A 2ARCA 2YU1A 3KT7A 1EY2A 2Y6JA 2WNUC 4NHKA 5TSWA 3VHNA 4YZ2A 2ZA9A 1RUC1 1TMF1 1FYUA 1GP4A 1X50A 2XQRA 1W6QB 1ZX5A 3O7OA 4K40A 5F2WA 3WQ7A 2WNOA 4LLOA 3RI8A 4COVA 4WBBA 1PGL1 5FREA 4P5HA 1JBCA 1SBDA 1AR81 3ORJA 1X8MA 2HWE2 4RGKA 2EXJA 2FDJA 3QD6A 2JD4A 3TN92 1XBFA 3NAPA 4HN0A 5A3WA 3WP4A 1NOVA 2QQWA 3H42B 3ZXJA 4AL9A 5KR7A 1ZRFA 1PNFA 1V6LA 3I54A 3UNPA 2ZZQA 3D4KA 5L73A 3RI9A 4Q4X3 1CAWB 2ZGOA 4NIDA 4CA9A 4BQXA 4OULA 5CZKA 3VDDC 1DP0A 1WBLA 4QPIA 1L7RA 4HKOA 5GZGA 1D7PM 3ACIA 4Z2WA 1LENA 4QB6A 4QQ2A 2Y6GA 3HEIA 1W0PA 5JZGA 4JKMA 4CEWC 2EIEA 1RUF2 3OBZA 2CWSA 2JX9A 4XJUA 3JBG1 2PYTA 3VL8A 2HWC2 2XGXA 4LK7A 4E4SA 3DPRA 3LAGA 4AHZA 1U0AA 3B7MA 1GOHA 5I8SA 3ZN6A 3LF7A 1H1IA 5A6ZA 4PJYA 5ANNA 1YLLA 4O9GA 3ZPYA 2WQZC 1TEIA 3RG0A 5JXJA 5M0TA 3WNPA 1XNAA 4Q8KA 1UYZA 4XF1A 2W52A 2NYYA 4Q0QA 1WCQA 5IT6A 2WDBA 2D43A 1V70A 1DBNA 2UWAA 2VULA 3HQXA 3WF4A 1QU0A 2DBIA 3THDA 3GZAA 2A71A 4ZU5A 3A7QA 3MW4A 5D21A 1H2MA 5C33A 2AREA 1K5MA 3C7OA 4QDQA 5D1IA 1VBD2 3GGLA 3TEWA 2X29A 3VLBB 3T09A 2B4KA 4R9BA 4URAA 3SLIA 4KWJA 1MVQA 1NXD1 4J1WA 4YZ4A 3WUDA 4AGRA 2GU9A 5IK4A 2GSYA 2CDPA 4P9JA 3SQOA 3ZIWA 4JRAA 4LBKA 5BXXA 2W91A 1OLRA 3WV6A 1MS4A 5DQ0A 3H8UA 4PBOA 5CBLA 3GCWA 2PXJA 4PIXA 3LE0A 1O8PA 1EAH2 4GZ9A 1CJPA 4CVUA 5KXEA 3HQUA 1OQEA 3SHRA 5LCWL 1C28A 2IC1A 1FATA 4NAMA 4A2UA 4AEJA 1UU4A 3Q8FA 5IVCA 3K75B 2WNUB 4CEYC 5FYCA 3HT1A 4AI3A 3UKVA 1HXS2 3ZSJA 4NROA 2IFWA 4QM8A 5FUPA 5KXDA 1K5JA 4J25A 1LR5A 4TWTA 3N7LA 1UYYA 2W95A 1H1AA 5FIXA 5C3QA 4OYUA 2WSVA 4XF3A 2BFUL 3MV11 3ST7A 2FCTA 5BNNA 2XJPA 1YQ8A 4JZRA 3LDRA 3R4SA 1SCRA 4MZUA 4A7ZA 2TBVA 3T2PA 4XCAA 4WV8A 2F4LA 2O1QA 2RS52 5BYNA 2WNVC 1YQ2A 4FO9A 4LBJA 2WINB 3VL9A 3TB0A 2CGNA 3VDDB 3UYJA 4QGLA 5AVAA 2PAMA 3F95A 2WS92 3TN93 2X10A 4CCOA 1BQPA 4BWOA 2VZTA 4XEZA 2DVBA 3PLQA 5FWEA 1BJQA 4CEWB 4OI0A 1UW8A 2PAEA 3GM8A 5GALA 4BE3A 5ISLA 3VBUA 2JDNA 2W1SA 2Y64A 1A8MA 2A3WA 1AJKA 1Q8PA 3C8XA 3WF0A 1REDA 4XVHA 4ZHNA 4UXAA 4KWLA 4C0BA 3HOBA 4D6SA 1JUIA 2HWE1 3KVBA 2RV9A 4KG0A 1RUF3 2J42A 3VKMA 1AZDA 2HWC3 5FPBA 1N47A 2XUEA 5T50A 4KBBA 2IXIA 1IPKA 4B1LA 3NL1A 4L97A 4AEKA 4CSWA 3E6BA 2BP6A 1VBE1 4TLGA 1BVP1 2VPVA 4YZ3A 3VKFC 5JR7B 5BV6A 4AE2A 3LIHA 1NCQA 2E33A 1YUDA 3PURA 1RTVA 1IS3A 5EQUA 1UYPA 3PVOA 2D6LX 2BVBA 2ZS6B 3IIIA 2R062 3OBTA 4XFCA 4CU8A 4E4DX 4HPKB 1UU5A 1WUVA 2YYOA 4Q5OA 4OI1A 1SDDB 1O59A 2A1XA 2ZTNA 3O14A 1RUF1 3OY8B 2V5YA 3OBRA 2HWC1 4BQ1A 4ISQA 1VBD3 4LO6B 1UZYA 4DQAA 3D0JA 1TNRA 2BEOA 3VHOA 1UKGA 4DOUA 1UCXA 3HBZA 2Q1MA 4CEYB 2DCZA 3GZEA 3MW2A 4FPFA 3ECQA 5K0UA 4BYYA 1OLQA 4XJZA 3M2MA 3MF9A 4NR1A 2XJSA 4MO3M 1LOGA 1LGCA 1JYWA 4GKXA 1CVNA 1DYOA 4CP0A 2B9VA 2ILMA 2Q8EA 1EAH3 1H8TC 1PMJX 3INAA 1AR62 3WDYA 5A1AA 4CXXA 4D6RA 3FZ3A 3WDXA 3BTZA 2GNMA 5GLUA 1IOAA 1QIQA 1YFXA 2BFUS 3PIJA 1H0BA 1VBD1 2D40A 1UPIA 3RPQA 4CCJA 1RIRA 1NCRC 1RL3A 4UFJA 3RMXA 1YFYA 2G9GA 2LRPA 2A70A 4LLFA 4K20A 4RL7A 2WZ8A 5BY5A 2ZGUA 4FOWA 2RS32 3TEZA 4I01A 4OUEA 2F4PA 3N7KA 1LOAA 3VKNA 3EO6A 5JXIA 4DNYA 1SQ4A 1OFSA 5JUVA 1LRHA 1EPZA 1RXFA 3I49A 1EAH1 4LTAA 4Y20B 1ZNPA 2RS53 2YMZA 4E8CA 4QQLA 1Z0HA 3GHNA 1QQP3 2XVKA 4Z92B 5G05L 1HXS1 5CEHA 3ZYIB 3S7IA 1D0HA 2WS93 3IDAA 1ZA7A 1N1VA 4L2NA 4TZDA 3BOPA 2ETEA 4OHZA 1UY2A 3OGSA 4KWUA 1LULA 4CTEA 3MZHA 1DCSA 1FMD2 2XL9A 5IVVA 2FDIA 3I3DA 3GJBA 1H9PA 3GXUA 3HNMA 4JCKA 5CNAA 3ZKUA 4ZKTB 1PM4A 1PMHX 3IWZA 3I3QA 3O5SA 2VTFA 5F3GA 1ZRIA 4Y22B 5LBEA 3C7HA 2WUHA 1DQ0A 2ARBA 3J7HA 1PZ7A 1SFNA 3D8CA 4PHZA 1W28A 2ET7A 2BZDA 5LBFA 2R0FA 5FR3A 3PUAA 2GC0A 2XKOA 5CVRA 5FY5A 1CX1A 2WO3A 1MQTA 4YVWA 4G3YC 3USUB 3WG2A 3WNOA 4FSJA 3RZGA 1VBC2 1HW5A 3DCQA 5JDBA 4AWDA 1ZZ6A 4CDUC 4LHSA 1VAVA 1T2XA 1WW4A 2XDVA 1DDLA 3JCIA 3A4UA 2E31A 3GJAA 5FY0A 1FX5A 1O91A 2HBUA 1KDKA 4N53B 2CDOA 1LHWA 2R32A 4N8MA 2D6KA 4BH9A 2B46X 2VECA 3H50A 4DINB 2R063 1W6QA 1UF2C 3KF3A 5DAPA 1LGNA 2NZ9A 4OQ8A 1KEXA 2DUQA 5IK7A 4RGGA 2FBEA 2CU5A 2XUMA 4LA2A 4AVCA 1W0OA 1GYKA 4AI0A 4FI9A 1RINA 2OPKA 4BPZA 1O5LA 1O4YA 1H8TB 2MHFA 4W4ZA 3AYCA 5J36A 1DZQA 2XBO2 2QUOA 4BHPA 1X33A 4LA3A 2ZHKA 1JUHA 3B3QE 1YJLA 2VO5A 5CU1A 1VBA2 4JDMA 4NVPA 5FXWA 3S30A 2JDYA 1CAWA 2VL4A 4A7KA 1OPMA 1MR5A 1GWLA 3TAYA 4HT1T 5T3NA 2GMPA 4CP9B 4E2GA 4OVEA 2HWB2 4E9KA 3PTYA 4IXLA 3FHQA 5FMOL 1Z78A 5APAA 3BTAA 2BW8A 2P6HA 2JG9A 3C3VA 4QM9A 1KITA 5FP3A 5GJ6A 2C26A 5IAXA 3WHTA 1NXMA 1M4WA 1XNBA 2HEVF 2JDAA 3DEMA 1GNZA 5F3CA 3B9IA 4KQ7A 2UYBA 3OSDA 3P6BA 2XJUA 3MIBA 2C5DA 5FLIA 2C1FA 3U37A 1HQLA 4Y4YA 1H2LA 3KMHA 3VBOC 2UWBA 1AVBA 2P3KA 1LTEA 2HYKA 1AR61 4LE4A 1WA4A 1W2OA 3MIDA 1GZCA 3HVDA 2DV9A 5FPVA 1VMFA 4HLTA 3H8RA 5LWBA 4JTOA 4O9EA 1VB2A 4PF5A 4RS5C 2KD7A 3DV8A 1J3RA 4UW6A 3K46A 1XC6A 1EYBA 3CJXA 3UETA 4QHOA 2RS31 1OA3A 4AQ6A 1B35A 2Q4SA 4CUGA 1QJY2 4IL7A 3U14A 3OPTA 4XZUG 5I93A 1C8M2 1RUNA 4AXOA 1Q8QA 1UNBA 2VNVA 2BRTA 1YCIA 2VOWA 2CV6A 4CXWA 2VMEA 1TG7A 4CDUB 1NT0A 5AC92 2BYVE 1GMMA 2E7AA 4XQDA 5E1RA 3NAPB 1F35A 1XSRA 5KBFA 4YRDA 5FYUA 5FP7A 2DCYA 2DU0A 2WNUA 3E5UA 4IUGA 4XXAA 3WUCA 1HB4A 1NG0A 1BLZA 3UGGA 3ZSEA 1OMIA 4A42A 4IERA 4OFGA 4UFIA 1VBC3 1SACA 5SV5A 1FMD1 1YIPA 4I0AA 3R6SA 1KQRA 3AX4A 4RYDA 4CUAA 4R4XA 3FL7A 3GBGA 2CY6A 4D0QA 3VD5A 1YI9A 1U5ZA 1YI7A 2XOMA 4Y5SA 4AI9A 4NPMA 3RWNA 5BNOC 3J8F2 5FZCA 3S7EA 3MLLA 3ROUA 3KQRA 4FOYA 1DLCA 2BGPA 4BQ2A 1V6MA 1POV1 2P34A 3J26N 1KRIA 5LATA 1W2UA 4Y24A 1WBFA 5FO8B 1QOSA 3VDDA 3BI3A 1ZYBA 2QQOA 3ME2A 2DTYA 4GALA 1OVPA 1QDOA 4GB32 3LCPA 2BDRA 4HFSA 5FZ7A 2XPJA 5FQ0A 4AHWA 2XBO3 4F8AA 3M3CA 2XJVA 2YGLA 3PNAA 4YG3A 3O1OA 1YWKA 1ENXA 1VBA3 3AP9A 4CEWA 5FFOC 3WINE 2X8KA 3CLPA 3TNQA 1PX4A 3FLTA 1UIKA 3JB8A 2VNRA 1JOJA 2VZPA 5CA6A 5L19A 1PGW2 1GNYA 5FY9A 1SFPA 1W2NA 5F8PA 4OQ9A 5KHHA 1V6IA 1QJU3 2G9ZA 4OI4A 2IVJA 3NV4A 4QWNA 4PQQA 1JHNA 1YFWA 1MS9A 5F5QA 3VBOB 1KD7A 5CAZA 4D6QA 5C5TA 4PIYA 3VD3A 3F2ZA 3O1TA 2XBO1 4BMBA 2ENRA 2JB8A 3C7FA 1DYKA 3VZJA 3MUY1 1G6NA 1HB3A 1ULGA 1VBA1 2MNGA 2QZ2A 3KB5A 4R9AA 4RS5B 4AR2A 3OCPA 4CU7A 1UY4A 2JDMA 4IEYA 4AFBA 1XE8A 2R16A 4DEVA 1BEV2 3WLUA 4MHRA 1CZTA 2Q1ZB 1PO22 4AVBA 4ASMB 2HWB1 4BDVB 1BBT3 3NVCA 3B69A 1RMU3 3TEYA 3FHAA 4HPKA 3N9OA 4UBHA 3LIGA 3TWIA 4FTBA 4SBVA 3WG4A 4YW1A 4AAPA 4RHV2 3ZXKA 2W1UA 1ZZCA 2A6YA 1UO9A 4ZZ5A 1RUOA 2JB4A 2Y8KA 1NLQA 1OKOA 2FZ2A 5E6HA 4CEYA 5ABJC 4ONUA 3ZYHA 1LHVA 1C8M3 1DQ1A 3G6JB 4HKWA 3FN9A 1VBB3 2BBAA 4YVSC 3WQBA 1O3QA 2XMLA 1Y9GA 3LEMA 3ZIXA 1EUTA 4UW5A 3T0BA 3P1IA 4IW3A 3K4DA 3UESA 3VN4A 1VRH2 2ZEZA 2ZXQA 4CDQC 1V6JA 3LSEA 4DUVA 5C9AC 2BJSA 2WQ4A 4Y1ZA 3RZKA 1WW7A 3VBUB 2QBXA 2BOJA 1QMJA 2WNVA 1N3PA 1GKBA 3NNFA 1AX2A 1LU2A 5F9TA 2F6BA 1N1SA 3TBDA 5A70A 1QJY1 2DWRA 1C8M1 3PTRB 2YPJA 3FC0A 4LO8A 5FY7A 2D7FA 3BPZA 1HN1A 2PHLA 1YJKA 1PK6C 3WDWA 1KGYA 3BIEA 5EYYA 1D2QA 1D2SA 5A33B 3BCWA 3J8F3 5AC91 5GKAC 4Y20A 2EICA 2ZHMA 4NMIA 5DAVA 3CKHA 4GMP1 4S2FA 5J98B 4I02A 5JMCA 2VBBA 4B4RA 1URXA 4DIQA 4DO0A 2NMOA 1L3JA 2BOIA 2WA4A 3V0AB 3HPNA 4CDWC 1UZZA 2J22A 1NCQB 1OT5A 3ZO0B 3IB3A 3LKJA 3AKSA 4GAZA 4DXSA 5FO7B 4HVQA 5GZFA 4DUWA 2ZBJA 1PO13 2GALA 4UYBA 2ZAHA 4IE4A 4QX7A 3IDCB 4Y22A 5DN2A 3J8F1 4GULA 4YW6A 1OQDA 5EYXA 4LNVA 4OHVA 4N9HA 2NMNA 1R092 2D3PA 3KQ4B 3ZN5A 2VZOA 2VBDA 1HLCA 4N9IA 4GB31 5K0UB 2XWBB 2ZHNA 3HD8B 4QXCA 2JWPA 4FQ4A 4UT5A 5EPAA 2WO2A 4B29A 2WO7A 4C1WA 4CPBD 3BIWE 5C71A 2YDEA 3ELNA 3USUA 1JHJA 1W99A 4O65A 1ASJ1 1OUSA 4Q4X2 3MIFA 5JOXA 4QT6A 2WBKA 2K9ZA 2R043 3RS6A 3AM2A 3MUZ1 1XNCA 4ISRA 4RA0A 4XOGA 3AXDA 5DG1A 1MVEA 4W6YA 4JC1A 3LWCA 2LM3A 4M3CB 4P5YA 5AFEA 5I91A 1PO23 1PGW1 3EXUA 2C6SA 4NHLA 1A8DA 5ABJB 1CQ9A 2XLGA 4PDWC 1Y3TA 4NJ4A 3TOJA 2JENA 4O7XA 1UMIA 4XC9A 4YFZA 2AEZA 3BUCA 3LA7A 2AUYA 4MOAA 4QD2A 3ZN4A 1ZA4A 3MIGA 4YVSB 1SDWA 3ZSKA 3HT2A 1H8TA 4X8PA 1MS0A 5LA9A 2VNOA 5EIYB 3OEBA 4YM3A 4K1YA 5D2AA 3T3YA 1O5UA 4CDQB 4CU9A 1BEV1 4LK6A 3NJVA 5LA2A 1NCRA 2VW2A 3WW3A 4CCEA 4Y33A 5A6YA 1FI2A 1DQ5A 5K7PA 1SFYA 3ZYRA 1PVC2 4CP9A 2A6VA 3LEKA 5FZ0A 1PGSA 1NX9A 3Q8BA 5FY4A 2AGSA 4MV2A 3D5OA 2EXHA 3I59B 4RHV1 3UGFA 3OG2A 1HN0A 1VRH3 3NSTA 1Y9QA 1ND3C 1FOD1 3AKRA 2QFEA 3D82A 2E53A 3EBRA 3NNGA 4N7IA 4DEQA 3M8LA 2OT7A 1TNFA 2F17A 1GP5A 4MHUA 4CPBA 2SLIA 1KFXL 4HONA 1QJX2 5LK5A 5A7WB 3Q9OA 2Y6LA 2VG9A 3WG1A 2LUWA 1OUXA 4D7TA 4CDWB 1RUG2 3UK9A 4Q1PA 3OJBA 4AQSA 1C4RA 2WT0A 2XKPA 4HMZA 2QJVA 2IVIB 3QOPA 1M06G 3C7EA 2TEPA 2W46A 4HK8A 1JXNA 2J1EA 4RN5A 2LROA 1CAUA 5I0TA 5CFDC 1KS5A 2SBAA 4N43C 5JCTA 1QDCA 3J7NA 4F83A 5EV7A 1D0GA 4PF1A 2GN7A 2XB6C 4XPVA 4RR3C 4KI5M 5A3MA 3PVBB 4DY5A 4FOVA 3NRUA 3CBNA 1JU3A 1W04A 1Q43A 3AYEA 4Q4V2 1CWPA 3D0SA 1WCKA 5FMBA 3B5LB 3I3BA 4GH4C 2BU9A 5FP9A 3KV5A 2IXJA 3OUHA 2EIBA 2ZGPA 1FAYA 2OPWA 3B00A 3RZHA 3LDBA 4FQZA 1R093 2D5HA 3CZJA 4HZFA 4CDUA 3M70A 4QDSA 2JE8A 4XF9A 3T1MA 3W58A 5A6XA 2BBVA 2G9FA 3ZYFA 5FZBA 2AC1A 2ORXA 2PA7A 1STMA 3EMRA 5LZ6A 5DZGA 2E6VA 4FFFA 4O61A 3EJKA 5CG8A 2W68A 5FZ6A 1CONA 4CP2A 2GMEA 1W03A 1YQ5A 1JI6A 2J1AA 3IMNA 4YLZA 3UKNA 1R091 3DL3A 4HSJA 2JG9B 4EROA 2QTWB 4JDNA 4AFAA 4AI2A 2XVGA 4QKDA 2QQPA 3BODA 5FZKA 2VVFA 4QX2A 1EPWA 4MUVA 3R0RA 4JX0A 3R4UA 2YC2A 3N7MA 1REEA 2QQIA 4L99A 1W6NB 2CYFA 4Q4X1 4LIVA 1VB4A 2OS2A 1DZRA 2HWF3 1QHDA 2W92A 2W08A 5C6CA 1OHFA 3WCRA 1JODA 2ORZA 1WCSA 4GA9A 1I6XA 1ND3B 2VMDA 1AL0G 5FKBA 4ZXKA 5A1FA 1VE0A 1TQ5A 2O8OA 5GZEA 4LE3A 2H6CA 2Q1FA 4I3GA 3FFQA 1VAMA 4QPYA 2OXBA 3SKVA 4XILA 1PVC3 3CIHA 3FWEA 4IEOA 3NWKA 3KZ4C 2XVLA 4JTNA 1W8WA 4P9XA 3CQOA 2IFRA 2Y6KA 2P37A 3VBOA 3AYAA 1DGRN 4COWA 3BN6A 1UY0A 1ODMA 1B35B 3IDEA 3MLKA 5ERLA 1S1AA 3EB7A 3KT4A 4XBNA 3WDUA 2EXIA 1S2BA 4CRQA 1K3IA 4YM0A 3VBHC 5J1XA 4JDOA 1QJX3 2WC2A 4RS5A 2EALA 5CFDB 2B9UA 2Q8CA 1RUG3 2JKBA 4Y26A 2D6PA 3BOWA 1GOGA 2EA7A 4XFFA 4CCNA 2CSGA 4NHXA 4ZZ8A 1SZBA 3BYWA 4DRRA 4H14A 3IAPA 3RVHA 1OLMA 4EN8B 4B7KA 4GH4B 4WM7C 1R1A2 2JE7A 1WGPA 1X82A 5T5PA 5EJZB 3BTYA 1UAIA 2WZR2 2WWUA 1VPHA 2BGOA 4NIHA 3FBMA 1PM7A 1W9WA 1QJX1 2GH8A 1HIXA 5DUUA 2VUCA 2V4AA 2FDKA 3I3MA 3KV9A 1BK0A 1MEC3 2TNFA 4KGQA 4Q4V3 5EZWA 5FMDA 1XPWA 1IS4A 1RUG1 2Y6FA 5FBJA 5K8SA 2HEYF 3QH6A 3ZYGA 2BTVC 1I9RA 3WW1A 1QQP2 1NE4A 4LKFA 5EFUA 1QJFA 2DCTA 1XOYA 2OW4A 2ZPXA 3NW4A 1WLDA 1KJLA 2Y38A 4UW3A 4NIAA 3CJIC 5J09A 4BLJA 1N1YA 4Z8BA 2JXAA 2VD7A 2DVAA 1C1LA 2XONA 2RG4A 3VDBA 1NKGA 4HN1A 3L9JT 4WVZA 1WLCA 3MIHA 3OGGA 4PIZA 4YW2A 2PFWA 4Q4V1 4K3UA 3OPZA 3FLRA 3N7JA 3NMBA 5CFCC 4FXGB 4QPGC 1ULFA 1BZWA 1YNAA 3ZKYA 1GZTA 2ZEWA 2VU9A 2WT1A 2VCBA 1ZM1A 3KF5A 5A33A 3BB6A 3T1LA 1RITA 3M7AA 3TN91 2J1RA 3VHRA 1DQ2A 5A3TA 2JJ6A 1YFUA 1X9TA 4FPGA 4Q0VA 4XABA 4XHXA 4PQ9A 4LPLA 1VMJA 2ARAA 1J59A 3RYKA 3V0AA 4WZFA 3JQWA 2FDHA 4XTPA 4H2AA 4LOTA 5T52A 4XMIA 5GZDA 1Z7S3 3PUQA 1HX6A 4IGPA 2RMU3 3K48A 2YPDA 4AK3A 3THTA 1FNZA 4QDRA 5LW9A 1XXNA 4LBLA 2W1QA 3VBHB 5DAQA 4GJZA 3EYPA 2G4IA 4EV0A 1C5HA 2QQMA 1MACA 1U5YA 2ARXA 3POIA 3TRSB 2ET1A 2ZMNA 1QXPA 2DBNA 4E2SA 4EWAA 3IBMA 2R072 2WN2A 4XHBA 2P17A 3ITQA 5LK7B 1HV0A 3WEZA 5FBZA 4SLIA 1W2TA 5JI7A 2BUKA 2P2KA 2WWSA 1WMFA 2RS12 3LB9A 1GV9A 5I0UA 5A7OA 1B09A 4WM7B 2VTXA 3UJQA 4AOCA 3ACFA 2KR2A 2WFF2 3CZUA 3H3ZA 2HKXA 4FTSA 2DUPA 4W6WA 2I07B 5GLWA 3KWVA 4M3CA 2PHUA 2IXHA 3N35A 4PI2A 5FRAA 2VW0A 4HK9A 1S0BA 1J1LA 2W3JA 1ULEA 3LZZA 4IE7A 4META 3L2HA 5ABJA 1L7QA 2J1VA 1NA1C 2WNVB 1R1A3 4ZU4A 4QQOA 4Y1YA 2VZVA 2WZR3 3ZXLA 1S2EA 4YVSA 2QQLA 4ES8A 2WWJA 5ACA2 5HV0A 2R49A 2DFCA 4ZS2A 3CJIB 1D4M3 2QKDA 5FZFA 2WO1A 1F2NA 1CAXA 1IQDC 1HRI2 2W9XA 5C8CC 5JSRA 1AXZA 4CDQA 4B3NA 4A7YA 2BGCA 4XBQA 1HB1A 1W6MA 5LEJA 4ORFA 1G9BA 4UFLA 3AP4A 3RJ2X 4M00A 5CFCB 4NN0A 3THPA 1R1A1 5L9BA 4M4PA 3I59A 5I0DA 1UIJA 1QOOA 2WZR1 4S2DA 5IK5A 1AYN2 4OHYA 2FMDA 1D4VB 3O0XA 2A6ZA 2ZGKA 1KFUL 3KV4A 5JOWA 3S0MA 1BYHA 1UKRA 5A7WA 4LHLA 4X8NA 2RS51 3T2QA 4GWJA 4JGYC 4CDWA 1XQNA 4QX8A 1J3QA 2ERFA 1QQP1 3SH3A 2QCSB 1LEMA 1PIV2 3CEWA 4PCRA 5E16A 5LBCA 1IG3A 4AFDA 4EWEA 3RZJA 2VTXJ 4QKNA 2WS91 4UFKA 1VLNA 4U36A 2YV8A 5FZOA 3O1PA 4IEZA 3E5QA 3AP7A 4QQPA 4AW7A 1LHUA 2WT2A 1JZ6A 4YM2A 4RD7A 2XHNA 3RNSA 3OGJA 4XJWA 2B39A 5JSPA 1SLBA 4LO4B 2YY1A 1DIWA 1ZRRA 3PDQA 3IPVB 3ZLIA 4MGTA 2E63A 1UOGA 1K42A 1C1FA 1GLHA 1OFNA 3ZXGA 2B7YA 3ZXFA 2ZKLA 5IHRA 5C5UA 3IM0A 3WG3A 3X29B 3OPWA 4XACA 1S4CA 3JB4C 2ZGQA 2VUDA 3GYDA 5CADA 4K1ZA 1OI6A 3C7GA 3DUIA 2BNNA 1WA6X 4XQWA 5LRSA 5T5JA 3A22A 1OXCA 3AFKA 2R073 4I09A 2E32A 4YG0A 2Q30A 2VNGA 5F6LB 4XAAA 1RUD2 4ZS3A 1O4ZA 5F3EA 2WN3A 1J83A 4ASLA 2D93A 2D6NA 4OZOA 5JOYA 4MLOA 4JQRA 2BNOA 1W8ZA 2RS13 3CHXA 1NCRB 4ZY9A 1COV3 3FUQA 2WZEA 4XDQA 5B4XA 1LKNA 4QGMA 2WFF3 2R061 3O0WA 3PJQA 1DGRA 5FUNA 3DYMA 1JTZX 4CDXC 3DYPA 5CISA 2FCUA 1JYXA 3B94A 2XLFA 4C0HA 2VXRA 1QJU2 3AC0A 4QPIC 4S2HA 1UYXA 2PAKA 4EN9B 4KWKA 2YUEA 2KM2A 4BISA 3QLQA 5C8CB 2ZKNA 1J3PA 1YXWA 1GQPA 3FX3A 1OOPC 1QJEA 2MPFA 3OF1A 4XCBA 2ZCWA 2H0VA 2CL2A 3SCHA 4IEXA 3UKTA 4C91A 5A7PA 2G19A 5ACA3 4CZSA 3RMYA 5A32B 2WYSA 4Q0PA 1W6NA 2RS11 2VQTA 2UWCA 2CAVA 4V1PA 2NM1A 2QQJA 2PN5A 4YSFA 3OGRA 1HRI3 3ON7A 1NYWA 2PHXA 3WCSA 1ND3A 3DF0A 1Y43B 1BBT2 4RFRB 1JYNA 1RMU2 1ZREA 4HXCA 1CAUB 3WP5A 3I2KA 1EUUA 4OLLA 1W2AX 4IEPA 3AJZA 1UWWA 5FKCA 2XJQA 4EZ4A 3BTXA 4LUKA 4XMAA 5HCAA 3MBWA 4JGYB 2JEMA 1PZ8A 3HN3A 3AVSA 5I0SA 1GFF2 1ND2C 1AR72 1AYN3 3GNEA 3AZYA 5IJRA 1X7NA 5FZ8A 4ASKA 4JV4A 5ACA1 1QJZA 5IFPA 4MXWB 1LHNA 2A73B 3AZVA 3I97A 4IE6A 2Y0OA 2WAOA 1CPNA 2ZGMA 1K12A 3WD5A 1VBB2 2QDNA 5CFDA 3UT0A 3LGRA 4FP3A 4PI0A 1SHWB 2A6XA 1JOBA 3GZUC 4LBOA 1BMV2 3QBQA 3M4FA 4N43A 4UFHA 2I2SA 1XRUA 1X36A 1PIV3 1YIFA 3WOGA 3IKWA 1H8VA 1ZBA3 4RR3A 2R7EB 4A3XA 5FJHA 3GF6A 1NLSA 1C5IA 5A3NA 3S57A 4LBQB 4LO7A 5LASA 3VV1A 1DG6A 1V9U2 5FZAA 4GH4A 4AEDC 4YNIA 4P14A 2X5IC 1OH4A 3AVRA 4LIUA 3KHCA 1GR3A 4LHKA 3ILRA 1L7LA 2RR13 2WKKA 4UBGA 3W9AA 2BWAA 1OKQA 4HANA 4M0HA 4NIIA 3U4SA 2VQAA 3DN7A 3M3QA 4MGYE 5IWFA 4CU6A 3PL0A 1F15A 2UY9A 4Q1RA 4L8QA 3MEPA 1PIV1 5HCBA 2D5FA 1E5RA 2WABA 4P00B 3NO8A 1MZFA 1SLCA 1YQCA 3ZDVA 1OPOA 4AVTA 1Y7BA 5FP4A 3PUIA 4CDXB 3AP6A 2IUWA 1APNA 4LOSA 1VBC1 4QXBA 1W39A 4ATFA 1RUD3 4E27A 5FMOS 4FPJA 2RJ2A 3S6PA 4D7SA 2J7MA 4OUMA 2CGOA 2NPIA 4KL1A 5I0RA 5IVBA 1U12A 1XYPA 2JDPA 1OOPB 2PMWB 3WQ1A 2OZ6A 1K45A 4JGZC 1PO12 1SEFA 2PHWA 2V72A 2VW1A 3A23A 4XUPA 4H7LA 1VALA 4NWVA 1MS5A 1VAKA 1GU3A 3RFRA 1YYNA 3MLJA 4B7EA 2PQQA 5GZCA 3ILNA 1IPJA 2I45A 4Q0SA 5HPOA 1JYVA 3DGTA 5HI0A 2D6MA 3PU3A 3APBA 1WMDA 4K6BA 1ST8A 2MEV3 5GLTA 4QKBA 2W47A 4UWDA 5A6QA 1LOFC 4LEJA 4DUXA 5JOZA 2Z2SB 1W8OA 4A6OA 4LKDA 3U0ZA 3V56A 2Q8OA 3VZMA 2R042 4RFT0 4AI1A 2FDFA 5F5AA 5FZMA 3OOXA 5IUQA 1IKPA 1QGLA 4AF9A 4E4HA 2XLAA 3THCA 1ND2B 4D69A 5C70A 3DKQA 4UW4A 1PHMA 3WZ1A 1QJU1 3N3HA 1WD3A 2PLV2 1GWKA 3LEGA 3VBHA 1W05A 2RDSA 2VOVA 2ES3A 3J4UH 1LECA 5A7QA 2XQXA 2Z79A 1BK1A 1SPPB 5H9PA 4DFSA 3ABZA 3POWA 1HQNA 1UXXX 2ZJCA 4ITCA 3VD7A 1AR73 1S0IA 1F5JA 2Q0AA 4BXSV 4NOTA 5L9VA 1NZCA 1I1EA 3TEXA 4IV3C 2RDRA 4EE2A 5DUWA 1T6BX 4AEDB 2RM22 3T4VA 2X5IB 4WM7A 5EHDA 4GKYA 1RHI2 5DAXA 4RGAA 1BBT1 1RMU1 2IXLA 2EAAA 4EJRA 4XQ4A 4NPLA 4A3ZA 4Q4W2 1HQWA 1X9PA 3ENRA 2ZGNA 5T54A 5IATA 5KHJA 3NJYA 4HKLA 4BLIA 2QNKA 3W59A 2GC1A 4YG6A 2PTMA 3VZOA 2J1SA 4BK4A 1GSLA 2XXZA 5BNOB 3E6DA 3I2JA 1RUJ2 1V9U3 2TUNA 3EHKA 3ZYPA 4NO4A 3RSJA 1AR71 1O4TA 4GWNA 3VD4A 5K9YA 4FFHA 4XFBA 4LT5A 3AZZA 2QQKA 4DXRA 4M3CF 4AZZA 1GOFA 3OD0A 4LBMA 3CJIA 2V73A 5HCHA 5F1RA 1W0NA 1VBB1 3GBWA 1WKYA 1MPXA 4JRLA 1BMV1 5FLJA 4HSLA 3PU8A 4LKEA 2Y33A 3H1WA 4BZ4A 3T0AA 4W65A 3ZOIA 2VY0A 2WQ8A 2GH2A 4YFWA 1JW6A 1NQJA 4JGZB 3ZR6A 2WFPA 1QXJA 2VZQA 3U78A 3P3PA 3VZNA 1XNKA 4QXHA 3USSA 4ATEA 5CFCA 1LOEA 4IETA 5C4WC 4QPGA 4DRVA 1YQ6A 4TSVA 5T5LA 3VB9A 5C8WA 3BU0A 1JOPA 3N9LA 1GQGA 4JKKA 4LMFA 3OYWA 4MGKE 1C3HA 3I2HA 3JU9A 4P9WA 3B02A 5CKMA 4IESA 5L36A 1RVF2 3PVEA 4Z07A 1S0GA 5F6KA 1XJAA 2GNDA 1KS4A 1EV12 1GNHA 2J1TA 2QDRA 3JD72 4MGQA 4Q29A 5FZGA 5FZLA 4QB2A 4ZU7A 3SC7X 3JQXA 1UMZA 1HV1A 3H7YA 1SBFA 4WM8C 4AI8A 4C8DA 5KXBA 2DYCA 1RGSA 2RJKA 1AL23 1SBEA 5DDJ3 3VZLA 2W0XA 5JPMB 5FY1A 1Y9MA 4R9DA 2GN3A 4YVWC 3SH4A 4BQ3A 4BK5A 1DU3D 2JG8C 2GNTA 2HH9A 1VJ2A 1UOFA 4XTMA 5FZ3A 1ULDA 3AP5A 4UFMA 3O1RA 3IPVA 1PO11 3M3EA 3MYXA 4IV1C 2K0GA 2YZ4A 3WDVA 2DU1A 5FJKA 3R05A 2PLV3 1RXGA 4IV3B 3VUOA 4I3PA 1A34A 3CO2A 1ZZ7A 2ZOEB 4Y1VA 3O1UA 4QX1A 2R6QA 4Y3OA 5FZ4A 3IZOA 2XHKA 2ZX0A 1XSQA 3UL2A 4UF0B 2WJSA 2ZGSA 4DPNA 3K3NA 5BUVA 1AXYA 1A6CA 5L7OC 1WCDJ 3NV1A 2CHHA 2D3SA 2JDHA 2VVDA 4R52A 4WZCA 4YGEA 2B42B 2A75A 4B1MA 3MI8A 2HWF2 2R041 2Y0IA 3CL1A 1CAXB 1JZ4A 2WSUA 2DCKA 1FT9A 4Y1XA 5C9AB 1O8SA 1HDKA 2YGMA 3I2GA 4ZONA 2RM23 1W6MB 3SEPA 2FHRA 1PO21 4G9SB 5FPZA 1BCXA 1RHI3 2OKXA 3HJRA 1W8TA 1IQAA 5JSOA 4H55A 1J58A 2ZGLA 4Q4W3 3LPFA 5A3OA 1FV2A 3KT1A 2A5ZA 2ZZJA 1PK6B 4LBQD 4OHWA 3WF1A 1VMHA 1DYPA 1TZOA 2BNMA 2VMCA 3QCWA 3SITA 1IS6A 5C8CA 3MHZA 5CKNA 1RUJ3 1O3TA 2ZX4A 1WZXA 1NQDA 5A3PA 4LKSA 1OD5A 3WQ0A 2DURA 1UXZA 4MVTA 5LY1A 4M0NA 5FQ0B 1W8NA 1S0EA 2DFBA 3LOIA 5A32A 2OA2A 4Y4RA 5C4WB 3UJOA 1Q56A 3BU7A 3WY6A 1XNTA 3Q8CA 1VRBA 5FZEA 3RWKX 4Q4Y3 4M01A 4I0BA 4YW7A 1XYOA 4W50A 4IE0A 4ZXEA 4Q4W1 3WR0A 1F5FA 3ZPOA 4AAXA 1H6YA 5FZOB 3NKTA 1UZ0A 3GALA 1R64A 1VRH1 1QH6A 5G04L 4FP2A 3UV9A 1W9SA 1RUJ1 2IZWA 4LJHA 4JGYA 2L9LA 4A45A 1IPSA 1GANA 1XE0A 3OBAA 3RGBA 1RUC3 1OC1A 2Y26A 3GBFA 4WM8B 3HR9A 3VHPA 2HEWF 1QH7A 1PZ9A 2C9AA 1MEC2 2Z69A 1OH3A 5LRRA 4A6SA 4ARYA 3MF6A 2YFUA 5H9SA 5FXXA 1LEDA 2LTNA 2NLRA 1RVF3 1XE7A 4INDA 1AR83 1RUE2 1Q3EA 4KU8A 4MXVA 4MXWA 1NAEA 2O0OA 5FYZA 5IVYA 1EV13 3JD73 3VZKA 2JG8B 4FFIA 2ZACA 2J1UA 5F37A 4URTA 3J9SA 3SEEA 3LFMA 3T2TA 4B4QA 1DGLA 2X53S 4F7ZA 3NJXA 3V64A 4QU1A 5CYYA 4W6XA 4IV1B 1UY3A 4I2OA 2E51A 3RJRA 5J3UA 2YBKA 3PUSA 4LBQA 4FPYA 4PDWB 2BVVA 3ETQA 3B93A 2VH9A 3DKWA 5FYIA 4XZPA 1Q5OA 4ARXA 1W9TA 4K9SA 1ULCA 1W8HA 3QACA 4D7YA 2JICA 4QU2A 5L7OB 1JH5A 3MPPG 1LOCA 1RVF1 3POFA 5FMCA 3PIGA 3WSOA 3NKGA 4YZ1A 2WA3A 1EV11 1SLIA 1ZBE2 1W9YA 2D44A 2ZEYA 3AZWA 3DXTA 3JD71 3JBG3 3POEA 3KCYA 2WNEA 4N90A 1JYIA 1HJGA 2XG3A 3DYOA 4DXZA 2P1BA 4QHBA 2W87A 3MIEA 4QKFA 4RQPC 3VBSC 2BQPA 2LALA 2QE3A 1SCSA 3WXPA 3A21A 2BWCA 1VBE2 3LFIA 3O12A 4CDXA 1YHFA 4Q2FA 5FYMA 1W6PB 4MH0E 1MS3A 4OMDA 1GZWB 3AMNA 4PBPA 1Z7S2 4QQHA 4UAPA 4YPJA 4WVMA 2KA3A 3AMHA 2RMU2 2PHDA 4HOOA 4TXWA 4V2VA 4BXFA 2NP0A 2IXCA 4EN6B 2XH6A 1OOPA 3JUUA 4JHTA 3V65A 5FK8A 3ACHA 5EP9A 4CCMA 4XFIA 1OA2A 1QWRA 3AL6A 1LJ7A 4AEMA 4YZ5A 4P9LA 5JXGA 4XUQA 2R1BA 5GLVA 1ULOA 4UOJA 5F39A 5J7MA 3H1MA 1CIYA 5FWJA 4CP1A 4YW4A 4JVAA 4LUMA 1XU1A 3ZFGC 3RZLA 3GDBA 4PLOA 4AVVA 2HWF1 5LEKA 3DECA 3U4XA 5BNPC 4BIFA 2X05A 5HBAA 1ENQA 1AXKA 5FYBA 4N43B 3ZXAC 4DMIA 2YB7A 1OQ1A 4XDOA 4KNCA 4RR3B 1PVC1 1ND2A 3SH5A 4YW3A 1POQA 2W39A 3HN1A 4E2QA 3WF2A 4P02B 1VIWB 1RC6A 5FUIA 1N3QA 3KCCA 4EZHA 1OA4A 3H8OA 2VCAA 3RQ0A 1E5IA 1SPPA 3WDTA 3KV6A 4NE9A 1BKZA 1LCLA 5F2SA 3LD8A 4XBLA 4MGIE 2D3RA 1REFA 1D4M2 3ZFEC 2ZHLA 1SLLA 4NHMA 3W5NA 2OVUA 4NWWA 4BJ0A 2CNAA 4A4AA 2PHFA 5JAXA 2DVDA 1RUE3 3OD4A 4GWMA 5FO9B 1FV3A 3IT8A 5FTTC 5H9QA 2X5IA 3WP6A 3WVJA 4AEDA 1HJFA 3RYPA 5JI9A 2UYAA 5B4NA 3NNMA 4JHZA 4IDZA 3VBRC 5K4LA 3ZMNA 3KD4A 4Y5Z0 1S0JA 2Y6HA 2CGPA 2YFZA 2AEYA 4M4RA 4B4PA 1IG0A 4BCUA 1DQ4A 3H3LA 3ZM8A 1FXZA 4QAWA 2GC2A 2EF6A 4C90A 3AK0A 5BNOA 4AVAA 3VBSB 3I4IA 1XB9A 2R30A 4QX3A 4RQPB 1MEC1 1H6XA 3W20A 1BHGA 1GBGA 1WCUA 2JIJA 2ZX3A 3OB8A 5FCCA 3SCFA 5A3UA 1UZVA 5FPXA 5DMYA 1RUE1 5BPXA 2HWE3 1OLME 5FPUA 3WNXA 5FYTA 1ZBE3 4FT8A 4TTGA 5EWSA 4HETA 5BNQA 3ZXEA 5J37A 2ID4A 5DZFA 2ZEXA 1RJ7A 4QX5A 4R9CA 3NJZA 1TE1B 5D8AC 1UX6A 3ETPA 3D6EA 3HMYA 4JGZA 1VBE3 5C3RA 5IK8A 5IVFA 1H4HA 2CWMA 5F32A 3KLSA 3RZZA 3AXEA 4Z1VA 4FOQA 4GD4A 3VKLA 3GHMA 1V6OA 2V5DA 1ALYA 4IEWA 2OYZA 3ZFGB 4CYDA 4FCAA 4NRMA 4K7JA 1ZBE1 2E7QA 1YC61 2W94A 1A78A 3ZFFC 2WIIB 2RE9A 1LOFA 4FVVA 5BNPB 3WHUA 4CCDA 3HWJA 1JZ2A 1V6KA 2QQNA 1CZVA 4KU7A 5IVEA 1CX4A 4WVWA 3OUIA 1QKQA 3EQEA 3U07A 4Y1UA 1F4AA 2AACA 3CMGA 3K4AA 4NAOA 1XYNA 3H8XA 4MGSA 1JN2P 3HQRA 4X6RB 1Z7S1 1AJOA 4J1XA 3ZYBA 1CPMA 2WYFA 1COV2 4K21A 4XJ9A 2RMU1 5JXHA 3KVAA 5F3IA 1H2NA 1F4HA 4HVRA 1H30A
chains in the Genus database with same CATH topology
2YBSA 3KV9A 3AVSA 4D6SA 5FZ8A 4ASKA 5FBJA 3KVBA 5FYVA 3N9MA 3K2OA 5FYBA 5FYHA 2OX0A 5FPBA 4AI9A 4DIQA 2XUEA 4DO0A 5ANQA 3NJYA 5FZCA 4BU2A 2XDVA 4XDOA 5LY1A 5FXVA 5FYSA 5FY0A 4CSWA 2XXZA 2YU2A 3K3OA 5FPLA 5FP9A 3KV5A 3N9QA 3KV4A 4UF0A 4Y4RA 4GAZA 2VD7A 5A7SA 3LDBA 5FZ7A 5A7WA 5FJHA 5LY2A 1VRBA 3PURA 5FZEA 4EZHA 5A3NA 5F5IA 3ZPOA 5FXZA 4QX8A 5A80A 4QX7A 4LITA 3KV6A 5FZOB 5FZAA 5F2SA 4LIUA 3AVRA 2P5BA 3LD8A 5FZBA 3PU8A 4CCLA 5FZOA 3U4SA 4LXLA 5FZHA 5FXWA 5FY9A 5IWFA 4EYUA 4QXCA 5FZ6A 4QWNA 3PDQA 3U78A 5A3TA 2Q8DA 3ZLIA 4QXHA 4NUBA 5FZ9A 5K4LA 5FXXA 4D6QA 4CCKA 5IVYA 3N9LA 5FZ1A 5FYZA 5FP4A 3OPWA 5FY8A 4URAA 5FYYA 5A1LA 5F37A 5F5CA 5FZKA 3PUQA 2Q8EA 4QXBA 4IGPA 5FP8A 4QU1A 2YPDA 4D6RA 5FP3A 4LIVA 5LW9A 5FZGA 5IVBA 2OS2A 2YBKA 3PUSA 2PXJA 4GJYA 4GJZA 5FZLA 5FZDA 3N9NA 5F3CA 4C8DA 4CCJA 5FPUA 5FYIA 5F3EA 5FYTA 5FZIA 5IVCA 5FV3A 3N9OA 5A1FA 4IGOA 5FYCA 5IW0A 2W2IA 4AAPA 5FY1A 4IGQA 5FUNA 5FUPA 2YBPA 2GP3A 3DXTA 5FPVA 5LWBA 3PU3A 4XDPA 5FZ3A 5IVFA 5E6HA 4Y33A 5F32A 5A7OA 5FPAA 4BISA 5FZ0A 4GD4A 5FY4A 5FJKA 5CEHA 5F5AA 3DXUA 5FZMA 5FYMA 4E4HA 2YU1A 2XMLA 4CUGA 5A3PA 4Y3OA 3OPTA 5FZ4A 5A7PA 2Q8CA 2OT7A 4UF0B 2OQ7A 5F2WA 4HOOA 3K3NA 4V2VA 3UYJA 5A7NA 4BXFA 4CCNA 2OQ6A 4HONA 5IVEA 5IVVA 5A7WB 5A7QA 4CCOA 2GP5A 4CCMA 3AL5A 3RVHA 2WWJA 4V2WA 5F3GA 5FWEA 3AL6A 5FYUA 5FP7A 5FZFA 5ISLA 3PTRB 4EZ4A 2WWUA 5F39A 5A3WA 5FY7A 5FWJA 3N9PA 3PUAA 3KVAA 5F3IA 4TN7A 5IVJA 5FY5A 5KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBS A;  3KV9 A;  3AVS A;  4D6S A;  5FZ8 A;  4ASK A;  5FBJ A;  3KVB A;  5FYV A;  3N9M A;  3K2O A;  5FYB A;  5FYH A;  2OX0 A;  5FPB A;  4AI9 A;  4DIQ A;  2XUE A;  4DO0 A;  5ANQ A;  3NJY A;  5FZC A;  4BU2 A;  2XDV A;  4XDO A;  5LY1 A;  5FXV A;  5FYS A;  5FY0 A;  4CSW A;  2XXZ A;  2YU2 A;  3K3O A;  5FPL A;  5FP9 A;  3KV5 A;  3N9Q A;  3KV4 A;  4UF0 A;  4Y4R A;  4GAZ A;  2VD7 A;  5A7S A;  3LDB A;  5FZ7 A;  5A7W A;  5FJH A;  5LY2 A;  1VRB A;  3PUR A;  5FZE A;  4EZH A;  5A3N A;  5F5I A;  3ZPO A;  5FXZ A;  4QX8 A;  5A80 A;  4QX7 A;  4LIT A;  3KV6 A;  5FZO B;  5FZA A;  5F2S A;  4LIU A;  3AVR A;  2P5B A;  3LD8 A;  5FZB A;  3PU8 A;  4CCL A;  5FZO A;  3U4S A;  4LXL A;  5FZH A;  5FXW A;  5FY9 A;  5IWF A;  4EYU A;  4QXC A;  5FZ6 A;  4QWN A;  3PDQ A;  3U78 A;  5A3T A;  2Q8D A;  3ZLI A;  4QXH A;  4NUB A;  5FZ9 A;  5K4L A;  5FXX A;  4D6Q A;  4CCK A;  5IVY A;  3N9L A;  5FZ1 A;  5FYZ A;  5FP4 A;  3OPW A;  5FY8 A;  4URA A;  5FYY A;  5A1L A;  5F37 A;  5F5C A;  5FZK A;  3PUQ A;  2Q8E A;  4QXB A;  4IGP A;  5FP8 A;  4QU1 A;  2YPD A;  4D6R A;  5FP3 A;  4LIV A;  5LW9 A;  5FZG A;  5IVB A;  2OS2 A;  2YBK A;  3PUS A;  2PXJ A;  4GJY A;  4GJZ A;  5FZL A;  5FZD A;  3N9N A;  5F3C A;  4C8D A;  4CCJ A;  5FPU A;  5FYI A;  5F3E A;  5FYT A;  5FZI A;  5IVC A;  5FV3 A;  3N9O A;  5A1F A;  4IGO A;  5FYC A;  5IW0 A;  2W2I A;  4AAP A;  5FY1 A;  4IGQ A;  5FUN A;  5FUP A;  2YBP A;  2GP3 A;  3DXT A;  5FPV A;  5LWB A;  3PU3 A;  4XDP A;  5FZ3 A;  5IVF A;  5E6H A;  4Y33 A;  5F32 A;  5A7O A;  5FPA A;  4BIS A;  5FZ0 A;  4GD4 A;  5FY4 A;  5FJK A;  5CEH A;  5F5A A;  3DXU A;  5FZM A;  5FYM A;  4E4H A;  2YU1 A;  2XML A;  4CUG A;  5A3P A;  4Y3O A;  3OPT A;  5FZ4 A;  5A7P A;  2Q8C A;  2OT7 A;  4UF0 B;  2OQ7 A;  5F2W A;  4HOO A;  3K3N A;  4V2V A;  3UYJ A;  5A7N A;  4BXF A;  4CCN A;  2OQ6 A;  4HON A;  5IVE A;  5IVV A;  5A7W B;  5A7Q A;  4CCO A;  2GP5 A;  4CCM A;  3AL5 A;  3RVH A;  2WWJ A;  4V2W A;  5F3G A;  5FWE A;  3AL6 A;  5FYU A;  5FP7 A;  5FZF A;  5ISL A;  3PTR B;  4EZ4 A;  2WWU A;  5F39 A;  5A3W A;  5FY7 A;  5FWJ A;  3N9P A;  3PUA A;  3KVA A;  5F3I A;  4TN7 A;  5IVJ A;  5FY5 A;  5KR7 A; 
#chains in the Genus database with same CATH topology
 3B01 A;  5KHI A;  4MG2 A;  2EVX A;  3JZV A;  1O6U A;  1MS8 A;  4GQ7 A;  3AZX A;  5FYV A;  3ZFE B;  2OUJ A;  1U5I A;  5JR2 A;  1HKD A;  2X09 A;  3K2O A;  2N7G A;  4HBN A;  3ALQ A;  4IV3 A;  4N53 C;  2ZGR A;  1I3H A;  5FDB A;  4DY3 A;  4FPC A;  2D98 A;  1GZ9 A;  2HWD 2;  2EIG A;  4BIO A;  1US2 A;  2HJI A;  2YU2 A;  3ACG A;  3AMM A;  3E5X A;  2GAU A;  3K3O A;  4GWI A;  3RDI A;  3LOB A;  1W9F A;  4UF0 A;  2XJR A;  3VBR B;  4IE5 A;  3RYR A;  2ZAA A;  5J96 B;  5JIA A;  5LY2 A;  4Z2A A;  3ES4 A;  3HAG A;  4H7M A;  2VMG A;  5F5I A;  3MV0 1;  5FXZ A;  2VAU A;  1IZ3 A;  1ULP A;  4LIT A;  3NQH A;  3M3I A;  5FOJ B;  5C9A A;  1NY7 2;  3WNM A;  4JQT A;  2A6W A;  3H0O A;  1HXS 3;  4XF4 A;  4XYX A;  1GP6 A;  1E5S A;  1TVG A;  2VUJ A;  2IXK A;  2WLP A;  4LXL A;  3T4H B;  4QPG B;  4L11 A;  1XND A;  2P3I A;  3Q8E A;  4LUL A;  4XE9 A;  2DCJ A;  2W5F A;  2K46 A;  4DB5 A;  1PK6 A;  3POJ A;  1SLT A;  3ZVX A;  2JDZ A;  1JZ5 A;  3K77 A;  3E6C C;  3OYW B;  4YGD A;  2EXK A;  2PEL A;  3WX5 A;  1UOB A;  4YAR A;  1D4M 1;  1OF3 A;  5D8A B;  5LBB A;  4AHY A;  5FZ1 A;  2A7A A;  3QH7 A;  3KGL A;  2Z42 A;  4M3C E;  2QZ3 A;  3B9C A;  1E5H A;  3GCX A;  3LQC A;  3MW3 A;  3POG A;  4QPW A;  2PHT A;  4AVS A;  5F5C A;  4EN0 A;  4J6G A;  1VR3 A;  4QMA A;  5FP8 A;  4A44 A;  5AFB A;  1ZRD A;  5CIR A;  5C4W A;  1GQH A;  1WLT A;  1CIW A;  2GC3 A;  1ZBA 2;  4K8R B;  2B45 X;  5I8Y A;  2JE9 A;  1RUH 2;  5JPN B;  1LB2 A;  3OEA A;  3VGI A;  4UI9 L;  1UZW A;  2RJL A;  5F7U A;  4DXT A;  3NV3 A;  5FZI A;  5FV3 A;  1G9D A;  3ZFF B;  4EQV A;  4FPH A;  1NE6 A;  3AKP A;  4IGO A;  3BAL A;  1MS1 A;  1G9C A;  1QEX A;  2RR1 2;  5FAX A;  3VBF C;  3O1V A;  1UY1 A;  2P6C A;  4NRP A;  2DF7 A;  4Q8L A;  2RHP A;  2Z4F A;  4XIK A;  5GM0 A;  3ZSL A;  4WM8 A;  5E8A A;  4XIO A;  1NZI A;  4L0P A;  4H3W A;  4XDP A;  3A0N A;  4XXP A;  1TME 2;  4AQT A;  4I30 A;  4CUB A;  5JWP A;  2UU8 A;  2R1D A;  2WRA A;  1UN1 A;  2VCC A;  1UMH A;  5FOB B;  2JG8 A;  4EN7 B;  2AR6 A;  4P9I A;  1C57 A;  3I7D A;  3DXU A;  5DXD A;  2VQU A;  1V6N A;  1QOT A;  1NLR A;  2UUR A;  1EP0 A;  4OHX A;  3O0V A;  1W6O A;  1KXG A;  3AKT A;  4IV1 A;  1WMX A;  4NPR A;  5A7N A;  1FNY A;  2OQ6 A;  3NAP C;  2AEN A;  4PDW A;  3E1F 1;  4BB3 A;  3I2O A;  1NA1 B;  2FZ1 A;  4FFG A;  3AL5 A;  1S0D A;  4IEV A;  2DTW A;  5DZE A;  1R08 2;  1HRV 2;  4LR4 A;  5KWR A;  1WW6 A;  3WP3 A;  5FK7 A;  5L7O A;  3V0B B;  4XW3 A;  4YGC A;  5A3L A;  5KC6 A;  3IDB B;  3JXS A;  2V4V A;  1QF3 A;  1JS9 A;  3NV2 A;  2QQU A;  4QGN A;  3RZM A;  1WWY A;  3U1X A;  3POB A;  1R1Z A;  2R07 1;  2A3X A;  4Q27 A;  4E8D A;  3AB0 A;  2HWD 3;  1CAV B;  3MFA A;  2MEV 2;  4YW5 A;  5FLH A;  3K4Z A;  1UX7 A;  2QQV A;  2VE1 A;  5C3S A;  4FPK A;  2ADD A;  3H1Y A;  3DPR C;  4S2G A;  2OX0 A;  4XUT A;  3SMH A;  1CR7 A;  3POS A;  5DPN A;  3TNP B;  1NUK A;  1COV 1;  4FBF A;  4OZX A;  1W6P A;  5FXV A;  1GZW A;  3IAQ A;  2WFF 1;  3AKQ A;  4FTE A;  1AR6 3;  5IYY A;  2H0B A;  5C3P A;  3I2F A;  4CCC A;  2EAK A;  2JD9 A;  3URF A;  1WME A;  4FPO B;  5HXV A;  4BOW A;  4KG8 A;  1MZ5 A;  2KXL A;  5DAB A;  1SG3 A;  3SKJ E;  1T6G C;  1GUI A;  2C24 A;  2O8Q A;  2VBP A;  3BGA A;  4W8J A;  4QX0 A;  4XFG A;  4BME A;  1H2K A;  3WF3 A;  2HWD 1;  2OZJ A;  2ZGT A;  4XET A;  2NN8 A;  1J84 A;  1K5M C;  2BV4 A;  2RS3 3;  5LB6 A;  1W06 A;  3SXW A;  3O1S A;  3KSC A;  4FXK B;  4MX3 A;  4Z82 A;  1IS5 A;  1LOB A;  1P8J A;  3LA3 A;  1LOD A;  1O3S A;  3ZYJ B;  2VC9 A;  2D6O X;  3WW4 A;  1CJD A;  1HRI 1;  1RJ8 A;  2GZW A;  1LNS A;  2VQ0 A;  3HIF A;  4AFC A;  4CE8 A;  1NY7 1;  3O1M A;  2YHJ A;  3MDP A;  3VBF B;  2YC4 A;  4FAH A;  1AX1 A;  1IGO A;  1S0F A;  1PVX A;  1ENS A;  3KM5 A;  1AR9 2;  1DF0 A;  4Q0U A;  5FY8 A;  3W21 A;  3KGZ A;  1RUH 3;  1OVS A;  4IEQ A;  5GLZ A;  4D3W A;  1KJR A;  3CU7 A;  4OCT A;  3BKZ A;  1FMD 3;  3IMM A;  4C1X A;  4MAD A;  1AYN 1;  1G9F A;  2DVG A;  2GDF A;  1I5P A;  2JDK A;  1JMU B;  2VZR A;  1JU4 A;  2E9Q A;  3HNB M;  5DUV A;  5CB7 A;  1WD4 A;  3PHM A;  4NHY A;  2JDU A;  2VZ3 A;  3I8T A;  1YRZ A;  2FMY A;  3M3O A;  4AHX A;  2VZS A;  4U2A A;  4KGG A;  3E97 A;  4XFH A;  5HCF A;  1Q8O A;  2GMM A;  1QXR A;  2W2I A;  4JAA A;  1AHS A;  5LA1 A;  1OUR A;  1JYC A;  1TME 3;  4BM8 A;  3WNN A;  1POV 3;  3ILF A;  5BNN C;  4YGB A;  5HXM A;  5L9R A;  2GP3 A;  1ZBA 1;  5CG9 A;  3CF6 E;  2FDG A;  1QY4 A;  1RUH 1;  3G7D A;  3FUO A;  2NQY A;  1JZ3 A;  2BER A;  1F9K A;  4QPI B;  2WLQ A;  4WVM B;  1IHM A;  1W8F A;  1WW5 A;  2RR1 1;  2XL7 A;  3MIC A;  1S55 A;  3PME A;  4DZG A;  4E4Z A;  3I3E A;  1S2K A;  2K2S A;  2E7T A;  3HNY M;  5JIU A;  5JZG B;  4NIG A;  1R08 3;  3VBS A;  1O7F A;  1UQX A;  1HRV 3;  4RQP A;  3AJY A;  4FPE A;  4QXK A;  2Q5T A;  5C3O A;  1JZ7 A;  1RUI 2;  1TME 1;  3DPR B;  3VBU C;  1I5Z A;  2OUH A;  2ZX2 A;  3N36 A;  2V09 A;  1AYM 2;  2QVS B;  2WL1 A;  5I8T A;  3MFC A;  3ZN6 B;  4V2W A;  3AMP A;  1DGW A;  4KBZ A;  1ZVF A;  3WW2 A;  1GIC A;  1F31 A;  3CDZ B;  4YM1 A;  1PMI A;  3I2I A;  1HB2 A;  3VDC A;  1AL2 2;  2VMF A;  4TLF A;  4XUN A;  3LA2 A;  5DDJ 2;  1JZ8 A;  1YO8 A;  3W5M A;  1RB8 G;  1ASJ 2;  1RUD 1;  3KS7 A;  4FPL A;  2DVF A;  1SMV A;  2VOX A;  1GWM A;  1G8W A;  2YBS A;  2VMI A;  4QHZ A;  3FFZ A;  2ZX1 A;  4PT6 A;  1R08 1;  1W3V A;  1HRV 1;  2VUA A;  2GNB A;  4CXY A;  1K5M B;  2Z5W A;  3C2U A;  2HWB 3;  4AGG A;  1NCQ C;  1ZRC A;  3ZFG A;  5ANQ A;  3S5A A;  1H4G A;  3N4M A;  4HVO A;  3HBK A;  4NRQ A;  4AFM A;  3OTF A;  1CD3 G;  1XU2 A;  4KMQ A;  3U11 A;  5FPL A;  2FD8 A;  1E57 A;  1FPN 2;  5BNP A;  3FJS A;  1W8U A;  2MEV 1;  2HBT A;  4HL0 A;  4LQR A;  4RSU A;  4X6Q B;  3SCG A;  3T2O A;  3FE5 A;  2YRO A;  1UOJ A;  5IAV A;  3SNM A;  4D8M A;  4IEU A;  3T0D A;  1CGP A;  4BQW A;  5K0U C;  4XJA A;  1AF9 A;  5T55 A;  5EXO A;  4EYU A;  4IQP A;  4BQ5 A;  5B2G B;  1DZT A;  4GXL A;  3OY8 A;  1AR9 3;  4Y5T A;  2Q8D A;  3H7J A;  3R4D B;  3ZFE A;  2VMH A;  2C4X A;  4NUB A;  1FOD 2;  3A0K A;  3ZR5 A;  2XR4 A;  1AUY A;  1AX0 A;  1UPS A;  4MGZ E;  5CKQ A;  1G86 A;  3VKO A;  5BNN B;  4F3J A;  3WNL A;  2P3Y A;  3RRD A;  2UY8 A;  3TYJ A;  5FYY A;  4DS0 A;  5JVV A;  3PJY A;  1QJY 3;  5A1L A;  4LO5 B;  4YWA A;  3Q8A A;  2FCV A;  1DHK B;  1ZZ8 A;  2RDN A;  3VBR A;  3IIA A;  3ACL A;  1N1T A;  1OBN A;  3SIS A;  1V0A A;  3AYD A;  4XUO A;  3LEI A;  5AC9 3;  2E26 A;  4GJY A;  1F8V A;  3KCX A;  4Q4Y 2;  2VZ1 A;  3N9N A;  1CES A;  3FLP A;  4GMP 3;  4TYS A;  4XUR A;  5EJ1 B;  5EJ3 A;  3T30 A;  1AR9 1;  3WNK A;  4AQ2 A;  1CZS A;  1POV 0;  3U75 A;  2JEC A;  1V00 A;  2A3Y A;  5DUX A;  4R4Z A;  5IW0 A;  1WLW A;  2FQP A;  2PHR A;  1J1T A;  4P9G A;  1UL9 A;  3GZT B;  1V9U 1;  2H6B A;  4IGQ A;  3NNJ A;  2YBP A;  1YEW A;  4LBN A;  5T5O A;  2HYX A;  5KXC A;  3BVC A;  2YG0 A;  3U10 A;  1RUC 2;  1TMF 2;  2W1W A;  3FHI B;  1ACC A;  3MO4 A;  2VXJ A;  3PMS A;  2P4E A;  1PGL 2;  5D8A A;  1N3O A;  1S0C A;  4R8H A;  2JKX A;  4L92 A;  1AR8 2;  3ZX7 A;  1RUI 3;  2VOT A;  2OII A;  4LOR A;  4MYE A;  2R0H A;  1ENR A;  1AYM 3;  3ZMO A;  2VR4 A;  4BA6 A;  1VP6 A;  5AVP A;  2ZAB A;  4GB3 3;  1Y4W A;  2OQ7 A;  2C0Z A;  4COU A;  4PLM A;  4L9B A;  1MZE A;  2Y60 A;  1JYT A;  2D97 A;  2HLE A;  4COY A;  3L2Y A;  1ASJ 3;  2GP5 A;  5IFT A;  1ODN A;  3FMG A;  1MQT C;  4XJ8 A;  3VD9 A;  2VM9 A;  2VVE A;  2ZMK A;  4PLN A;  2LS6 A;  3ZFF A;  4D94 A;  4HG6 B;  4P9Y A;  5SV8 A;  1ZZB A;  5KC5 A;  1OD3 A;  2VJX A;  3H9A A;  2YXS A;  1LHO A;  1W90 A;  2XJT A;  1Q8V A;  3N9P A;  4TN7 A;  1RUI 1;  4ET7 A;  5IVJ A;  3OGV A;  3KHB A;  4ZPI A;  4AYU A;  3JBG 2;  2EID A;  1AYM 1;  3ZSM A;  5J48 A;  1QNY A;  3ATG A;  4XAE A;  5E88 A;  3VDA A;  3N9M A;  4MSV A;  1FPN 3;  3AFG A;  4WVV A;  5FYH A;  4QB1 A;  4EWD A;  1AL2 1;  3K51 A;  5DDJ 1;  3BPS A;  3CNA A;  4P08 A;  4BU2 A;  3I2D A;  1Q8S A;  2O14 A;  5FYS A;  3LSD A;  3MGU A;  1A3K A;  3N9Q A;  5DAW A;  1ONA A;  1QNW A;  4XF0 A;  2VZU A;  3ZXD A;  1BEV 3;  5A7S A;  4JKL A;  1C8N A;  4ES9 A;  4N53 A;  4FAG A;  3FBY A;  1NA1 A;  2G1M A;  4OI2 A;  4A41 A;  3PVN A;  2WR9 A;  5A80 A;  3UGH A;  2RVA A;  1LU1 A;  1MZ6 A;  1SLA A;  2PQS A;  2CTV A;  2PLV 1;  2P5B A;  5JLV A;  2ADE A;  1UU6 A;  5JMO A;  4RHV 3;  3J7L A;  3V0B A;  5E89 A;  1U5X A;  4CCL A;  5H9R A;  1FPN 1;  1OF4 A;  1O3R A;  4N7U A;  3T08 A;  1DQ6 A;  3ZDS A;  4CUC A;  1FOD 3;  2I74 A;  1LGB A;  5FZH A;  1IKQ A;  1BXH A;  5DG2 A;  4GIQ A;  1OSG A;  1CAV A;  1DGW X;  2JG9 C;  5HV4 A;  1G9A A;  5KHK A;  5FZ9 A;  1DFQ A;  3P5B A;  1PNG A;  3LPG A;  3MPB A;  1CN1 A;  3H3U A;  4CCK A;  4YYO A;  4B8E A;  4I0W B;  5KHG A;  2RM2 1;  1KDM A;  1G7Y A;  2Y34 A;  2VCM A;  4OUS A;  4AG4 A;  1US3 A;  2BPA 2;  3M1H A;  1RHI 1;  1DLL A;  3NNL A;  2ATF A;  4COZ A;  2DDU A;  1BVV A;  2CAU A;  2B8M A;  4K8F A;  2VGD A;  2YC0 A;  2IWG B;  3ES1 A;  3PUH A;  4GMP 0;  3LDK A;  5FZD A;  2C9K A;  4Q26 A;  2WAA A;  2XWJ B;  4BQY A;  2AH2 A;  1LES A;  2DUO A;  3ASI A;  2AYH A;  4KH9 A;  4AGV A;  3S5Q A;  2VOK A;  1TMF 3;  1X8E A;  1RYY A;  2LW8 A;  4G4F A;  1H1M A;  1H9W A;  2RDQ A;  3POY A;  4BQ4 A;  3WT3 A;  1ZZ9 A;  2AZ5 A;  4XFA A;  5JZG C;  3J7M A;  3OUJ A;  1MQT B;  5LA0 A;  4YVW B;  1B35 C;  3AMQ A;  1W3X A;  1UD1 A;  3D3A A;  4Q4Y 1;  2WZP P;  2ZML A;  5FPA A;  3VBF A;  3P3N A;  2P3J A;  1LAJ A;  4LHN A;  4OMC A;  1W6O B;  3IN9 A;  2JIG A;  2B5H A;  5C7G A;  1PX3 A;  2ARC A;  2YU1 A;  3KT7 A;  1EY2 A;  2Y6J A;  2WNU C;  4NHK A;  5TSW A;  3VHN A;  4YZ2 A;  2ZA9 A;  1RUC 1;  1TMF 1;  1FYU A;  1GP4 A;  1X50 A;  2XQR A;  1W6Q B;  1ZX5 A;  3O7O A;  4K40 A;  5F2W A;  3WQ7 A;  2WNO A;  4LLO A;  3RI8 A;  4COV A;  4WBB A;  1PGL 1;  5FRE A;  4P5H A;  1JBC A;  1SBD A;  1AR8 1;  3ORJ A;  1X8M A;  2HWE 2;  4RGK A;  2EXJ A;  2FDJ A;  3QD6 A;  2JD4 A;  3TN9 2;  1XBF A;  3NAP A;  4HN0 A;  5A3W A;  3WP4 A;  1NOV A;  2QQW A;  3H42 B;  3ZXJ A;  4AL9 A;  5KR7 A;  1ZRF A;  1PNF A;  1V6L A;  3I54 A;  3UNP A;  2ZZQ A;  3D4K A;  5L73 A;  3RI9 A;  4Q4X 3;  1CAW B;  2ZGO A;  4NID A;  4CA9 A;  4BQX A;  4OUL A;  5CZK A;  3VDD C;  1DP0 A;  1WBL A;  4QPI A;  1L7R A;  4HKO A;  5GZG A;  1D7P M;  3ACI A;  4Z2W A;  1LEN A;  4QB6 A;  4QQ2 A;  2Y6G A;  3HEI A;  1W0P A;  5JZG A;  4JKM A;  4CEW C;  2EIE A;  1RUF 2;  3OBZ A;  2CWS A;  2JX9 A;  4XJU A;  3JBG 1;  2PYT A;  3VL8 A;  2HWC 2;  2XGX A;  4LK7 A;  4E4S A;  3DPR A;  3LAG A;  4AHZ A;  1U0A A;  3B7M A;  1GOH A;  5I8S A;  3ZN6 A;  3LF7 A;  1H1I A;  5A6Z A;  4PJY A;  5ANN A;  1YLL A;  4O9G A;  3ZPY A;  2WQZ C;  1TEI A;  3RG0 A;  5JXJ A;  5M0T A;  3WNP A;  1XNA A;  4Q8K A;  1UYZ A;  4XF1 A;  2W52 A;  2NYY A;  4Q0Q A;  1WCQ A;  5IT6 A;  2WDB A;  2D43 A;  1V70 A;  1DBN A;  2UWA A;  2VUL A;  3HQX A;  3WF4 A;  1QU0 A;  2DBI A;  3THD A;  3GZA A;  2A71 A;  4ZU5 A;  3A7Q A;  3MW4 A;  5D21 A;  1H2M A;  5C33 A;  2ARE A;  1K5M A;  3C7O A;  4QDQ A;  5D1I A;  1VBD 2;  3GGL A;  3TEW A;  2X29 A;  3VLB B;  3T09 A;  2B4K A;  4R9B A;  4URA A;  3SLI A;  4KWJ A;  1MVQ A;  1NXD 1;  4J1W A;  4YZ4 A;  3WUD A;  4AGR A;  2GU9 A;  5IK4 A;  2GSY A;  2CDP A;  4P9J A;  3SQO A;  3ZIW A;  4JRA A;  4LBK A;  5BXX A;  2W91 A;  1OLR A;  3WV6 A;  1MS4 A;  5DQ0 A;  3H8U A;  4PBO A;  5CBL A;  3GCW A;  2PXJ A;  4PIX A;  3LE0 A;  1O8P A;  1EAH 2;  4GZ9 A;  1CJP A;  4CVU A;  5KXE A;  3HQU A;  1OQE A;  3SHR A;  5LCW L;  1C28 A;  2IC1 A;  1FAT A;  4NAM A;  4A2U A;  4AEJ A;  1UU4 A;  3Q8F A;  5IVC A;  3K75 B;  2WNU B;  4CEY C;  5FYC A;  3HT1 A;  4AI3 A;  3UKV A;  1HXS 2;  3ZSJ A;  4NRO A;  2IFW A;  4QM8 A;  5FUP A;  5KXD A;  1K5J A;  4J25 A;  1LR5 A;  4TWT A;  3N7L A;  1UYY A;  2W95 A;  1H1A A;  5FIX A;  5C3Q A;  4OYU A;  2WSV A;  4XF3 A;  2BFU L;  3MV1 1;  3ST7 A;  2FCT A;  5BNN A;  2XJP A;  1YQ8 A;  4JZR A;  3LDR A;  3R4S A;  1SCR A;  4MZU A;  4A7Z A;  2TBV A;  3T2P A;  4XCA A;  4WV8 A;  2F4L A;  2O1Q A;  2RS5 2;  5BYN A;  2WNV C;  1YQ2 A;  4FO9 A;  4LBJ A;  2WIN B;  3VL9 A;  3TB0 A;  2CGN A;  3VDD B;  3UYJ A;  4QGL A;  5AVA A;  2PAM A;  3F95 A;  2WS9 2;  3TN9 3;  2X10 A;  4CCO A;  1BQP A;  4BWO A;  2VZT A;  4XEZ A;  2DVB A;  3PLQ A;  5FWE A;  1BJQ A;  4CEW B;  4OI0 A;  1UW8 A;  2PAE A;  3GM8 A;  5GAL A;  4BE3 A;  5ISL A;  3VBU A;  2JDN A;  2W1S A;  2Y64 A;  1A8M A;  2A3W A;  1AJK A;  1Q8P A;  3C8X A;  3WF0 A;  1RED A;  4XVH A;  4ZHN A;  4UXA A;  4KWL A;  4C0B A;  3HOB A;  4D6S A;  1JUI A;  2HWE 1;  3KVB A;  2RV9 A;  4KG0 A;  1RUF 3;  2J42 A;  3VKM A;  1AZD A;  2HWC 3;  5FPB A;  1N47 A;  2XUE A;  5T50 A;  4KBB A;  2IXI A;  1IPK A;  4B1L A;  3NL1 A;  4L97 A;  4AEK A;  4CSW A;  3E6B A;  2BP6 A;  1VBE 1;  4TLG A;  1BVP 1;  2VPV A;  4YZ3 A;  3VKF C;  5JR7 B;  5BV6 A;  4AE2 A;  3LIH A;  1NCQ A;  2E33 A;  1YUD A;  3PUR A;  1RTV A;  1IS3 A;  5EQU A;  1UYP A;  3PVO A;  2D6L X;  2BVB A;  2ZS6 B;  3III A;  2R06 2;  3OBT A;  4XFC A;  4CU8 A;  4E4D X;  4HPK B;  1UU5 A;  1WUV A;  2YYO A;  4Q5O A;  4OI1 A;  1SDD B;  1O59 A;  2A1X A;  2ZTN A;  3O14 A;  1RUF 1;  3OY8 B;  2V5Y A;  3OBR A;  2HWC 1;  4BQ1 A;  4ISQ A;  1VBD 3;  4LO6 B;  1UZY A;  4DQA A;  3D0J A;  1TNR A;  2BEO A;  3VHO A;  1UKG A;  4DOU A;  1UCX A;  3HBZ A;  2Q1M A;  4CEY B;  2DCZ A;  3GZE A;  3MW2 A;  4FPF A;  3ECQ A;  5K0U A;  4BYY A;  1OLQ A;  4XJZ A;  3M2M A;  3MF9 A;  4NR1 A;  2XJS A;  4MO3 M;  1LOG A;  1LGC A;  1JYW A;  4GKX A;  1CVN A;  1DYO A;  4CP0 A;  2B9V A;  2ILM A;  2Q8E A;  1EAH 3;  1H8T C;  1PMJ X;  3INA A;  1AR6 2;  3WDY A;  5A1A A;  4CXX A;  4D6R A;  3FZ3 A;  3WDX A;  3BTZ A;  2GNM A;  5GLU A;  1IOA A;  1QIQ A;  1YFX A;  2BFU S;  3PIJ A;  1H0B A;  1VBD 1;  2D40 A;  1UPI A;  3RPQ A;  4CCJ A;  1RIR A;  1NCR C;  1RL3 A;  4UFJ A;  3RMX A;  1YFY A;  2G9G A;  2LRP A;  2A70 A;  4LLF A;  4K20 A;  4RL7 A;  2WZ8 A;  5BY5 A;  2ZGU A;  4FOW A;  2RS3 2;  3TEZ A;  4I01 A;  4OUE A;  2F4P A;  3N7K A;  1LOA A;  3VKN A;  3EO6 A;  5JXI A;  4DNY A;  1SQ4 A;  1OFS A;  5JUV A;  1LRH A;  1EPZ A;  1RXF A;  3I49 A;  1EAH 1;  4LTA A;  4Y20 B;  1ZNP A;  2RS5 3;  2YMZ A;  4E8C A;  4QQL A;  1Z0H A;  3GHN A;  1QQP 3;  2XVK A;  4Z92 B;  5G05 L;  1HXS 1;  5CEH A;  3ZYI B;  3S7I A;  1D0H A;  2WS9 3;  3IDA A;  1ZA7 A;  1N1V A;  4L2N A;  4TZD A;  3BOP A;  2ETE A;  4OHZ A;  1UY2 A;  3OGS A;  4KWU A;  1LUL A;  4CTE A;  3MZH A;  1DCS A;  1FMD 2;  2XL9 A;  5IVV A;  2FDI A;  3I3D A;  3GJB A;  1H9P A;  3GXU A;  3HNM A;  4JCK A;  5CNA A;  3ZKU A;  4ZKT B;  1PM4 A;  1PMH X;  3IWZ A;  3I3Q A;  3O5S A;  2VTF A;  5F3G A;  1ZRI A;  4Y22 B;  5LBE A;  3C7H A;  2WUH A;  1DQ0 A;  2ARB A;  3J7H A;  1PZ7 A;  1SFN A;  3D8C A;  4PHZ A;  1W28 A;  2ET7 A;  2BZD A;  5LBF A;  2R0F A;  5FR3 A;  3PUA A;  2GC0 A;  2XKO A;  5CVR A;  5FY5 A;  1CX1 A;  2WO3 A;  1MQT A;  4YVW A;  4G3Y C;  3USU B;  3WG2 A;  3WNO A;  4FSJ A;  3RZG A;  1VBC 2;  1HW5 A;  3DCQ A;  5JDB A;  4AWD A;  1ZZ6 A;  4CDU C;  4LHS A;  1VAV A;  1T2X A;  1WW4 A;  2XDV A;  1DDL A;  3JCI A;  3A4U A;  2E31 A;  3GJA A;  5FY0 A;  1FX5 A;  1O91 A;  2HBU A;  1KDK A;  4N53 B;  2CDO A;  1LHW A;  2R32 A;  4N8M A;  2D6K A;  4BH9 A;  2B46 X;  2VEC A;  3H50 A;  4DIN B;  2R06 3;  1W6Q A;  1UF2 C;  3KF3 A;  5DAP A;  1LGN A;  2NZ9 A;  4OQ8 A;  1KEX A;  2DUQ A;  5IK7 A;  4RGG A;  2FBE A;  2CU5 A;  2XUM A;  4LA2 A;  4AVC A;  1W0O A;  1GYK A;  4AI0 A;  4FI9 A;  1RIN A;  2OPK A;  4BPZ A;  1O5L A;  1O4Y A;  1H8T B;  2MHF A;  4W4Z A;  3AYC A;  5J36 A;  1DZQ A;  2XBO 2;  2QUO A;  4BHP A;  1X33 A;  4LA3 A;  2ZHK A;  1JUH A;  3B3Q E;  1YJL A;  2VO5 A;  5CU1 A;  1VBA 2;  4JDM A;  4NVP A;  5FXW A;  3S30 A;  2JDY A;  1CAW A;  2VL4 A;  4A7K A;  1OPM A;  1MR5 A;  1GWL A;  3TAY A;  4HT1 T;  5T3N A;  2GMP A;  4CP9 B;  4E2G A;  4OVE A;  2HWB 2;  4E9K A;  3PTY A;  4IXL A;  3FHQ A;  5FMO L;  1Z78 A;  5APA A;  3BTA A;  2BW8 A;  2P6H A;  2JG9 A;  3C3V A;  4QM9 A;  1KIT A;  5FP3 A;  5GJ6 A;  2C26 A;  5IAX A;  3WHT A;  1NXM A;  1M4W A;  1XNB A;  2HEV F;  2JDA A;  3DEM A;  1GNZ A;  5F3C A;  3B9I A;  4KQ7 A;  2UYB A;  3OSD A;  3P6B A;  2XJU A;  3MIB A;  2C5D A;  5FLI A;  2C1F A;  3U37 A;  1HQL A;  4Y4Y A;  1H2L A;  3KMH A;  3VBO C;  2UWB A;  1AVB A;  2P3K A;  1LTE A;  2HYK A;  1AR6 1;  4LE4 A;  1WA4 A;  1W2O A;  3MID A;  1GZC A;  3HVD A;  2DV9 A;  5FPV A;  1VMF A;  4HLT A;  3H8R A;  5LWB A;  4JTO A;  4O9E A;  1VB2 A;  4PF5 A;  4RS5 C;  2KD7 A;  3DV8 A;  1J3R A;  4UW6 A;  3K46 A;  1XC6 A;  1EYB A;  3CJX A;  3UET A;  4QHO A;  2RS3 1;  1OA3 A;  4AQ6 A;  1B35 A;  2Q4S A;  4CUG A;  1QJY 2;  4IL7 A;  3U14 A;  3OPT A;  4XZU G;  5I93 A;  1C8M 2;  1RUN A;  4AXO A;  1Q8Q A;  1UNB A;  2VNV A;  2BRT A;  1YCI A;  2VOW A;  2CV6 A;  4CXW A;  2VME A;  1TG7 A;  4CDU B;  1NT0 A;  5AC9 2;  2BYV E;  1GMM A;  2E7A A;  4XQD A;  5E1R A;  3NAP B;  1F35 A;  1XSR A;  5KBF A;  4YRD A;  5FYU A;  5FP7 A;  2DCY A;  2DU0 A;  2WNU A;  3E5U A;  4IUG A;  4XXA A;  3WUC A;  1HB4 A;  1NG0 A;  1BLZ A;  3UGG A;  3ZSE A;  1OMI A;  4A42 A;  4IER A;  4OFG A;  4UFI A;  1VBC 3;  1SAC A;  5SV5 A;  1FMD 1;  1YIP A;  4I0A A;  3R6S A;  1KQR A;  3AX4 A;  4RYD A;  4CUA A;  4R4X A;  3FL7 A;  3GBG A;  2CY6 A;  4D0Q A;  3VD5 A;  1YI9 A;  1U5Z A;  1YI7 A;  2XOM A;  4Y5S A;  4AI9 A;  4NPM A;  3RWN A;  5BNO C;  3J8F 2;  5FZC A;  3S7E A;  3MLL A;  3ROU A;  3KQR A;  4FOY A;  1DLC A;  2BGP A;  4BQ2 A;  1V6M A;  1POV 1;  2P34 A;  3J26 N;  1KRI A;  5LAT A;  1W2U A;  4Y24 A;  1WBF A;  5FO8 B;  1QOS A;  3VDD A;  3BI3 A;  1ZYB A;  2QQO A;  3ME2 A;  2DTY A;  4GAL A;  1OVP A;  1QDO A;  4GB3 2;  3LCP A;  2BDR A;  4HFS A;  5FZ7 A;  2XPJ A;  5FQ0 A;  4AHW A;  2XBO 3;  4F8A A;  3M3C A;  2XJV A;  2YGL A;  3PNA A;  4YG3 A;  3O1O A;  1YWK A;  1ENX A;  1VBA 3;  3AP9 A;  4CEW A;  5FFO C;  3WIN E;  2X8K A;  3CLP A;  3TNQ A;  1PX4 A;  3FLT A;  1UIK A;  3JB8 A;  2VNR A;  1JOJ A;  2VZP A;  5CA6 A;  5L19 A;  1PGW 2;  1GNY A;  5FY9 A;  1SFP A;  1W2N A;  5F8P A;  4OQ9 A;  5KHH A;  1V6I A;  1QJU 3;  2G9Z A;  4OI4 A;  2IVJ A;  3NV4 A;  4QWN A;  4PQQ A;  1JHN A;  1YFW A;  1MS9 A;  5F5Q A;  3VBO B;  1KD7 A;  5CAZ A;  4D6Q A;  5C5T A;  4PIY A;  3VD3 A;  3F2Z A;  3O1T A;  2XBO 1;  4BMB A;  2ENR A;  2JB8 A;  3C7F A;  1DYK A;  3VZJ A;  3MUY 1;  1G6N A;  1HB3 A;  1ULG A;  1VBA 1;  2MNG A;  2QZ2 A;  3KB5 A;  4R9A A;  4RS5 B;  4AR2 A;  3OCP A;  4CU7 A;  1UY4 A;  2JDM A;  4IEY A;  4AFB A;  1XE8 A;  2R16 A;  4DEV A;  1BEV 2;  3WLU A;  4MHR A;  1CZT A;  2Q1Z B;  1PO2 2;  4AVB A;  4ASM B;  2HWB 1;  4BDV B;  1BBT 3;  3NVC A;  3B69 A;  1RMU 3;  3TEY A;  3FHA A;  4HPK A;  3N9O A;  4UBH A;  3LIG A;  3TWI A;  4FTB A;  4SBV A;  3WG4 A;  4YW1 A;  4AAP A;  4RHV 2;  3ZXK A;  2W1U A;  1ZZC A;  2A6Y A;  1UO9 A;  4ZZ5 A;  1RUO A;  2JB4 A;  2Y8K A;  1NLQ A;  1OKO A;  2FZ2 A;  5E6H A;  4CEY A;  5ABJ C;  4ONU A;  3ZYH A;  1LHV A;  1C8M 3;  1DQ1 A;  3G6J B;  4HKW A;  3FN9 A;  1VBB 3;  2BBA A;  4YVS C;  3WQB A;  1O3Q A;  2XML A;  1Y9G A;  3LEM A;  3ZIX A;  1EUT A;  4UW5 A;  3T0B A;  3P1I A;  4IW3 A;  3K4D A;  3UES A;  3VN4 A;  1VRH 2;  2ZEZ A;  2ZXQ A;  4CDQ C;  1V6J A;  3LSE A;  4DUV A;  5C9A C;  2BJS A;  2WQ4 A;  4Y1Z A;  3RZK A;  1WW7 A;  3VBU B;  2QBX A;  2BOJ A;  1QMJ A;  2WNV A;  1N3P A;  1GKB A;  3NNF A;  1AX2 A;  1LU2 A;  5F9T A;  2F6B A;  1N1S A;  3TBD A;  5A70 A;  1QJY 1;  2DWR A;  1C8M 1;  3PTR B;  2YPJ A;  3FC0 A;  4LO8 A;  5FY7 A;  2D7F A;  3BPZ A;  1HN1 A;  2PHL A;  1YJK A;  1PK6 C;  3WDW A;  1KGY A;  3BIE A;  5EYY A;  1D2Q A;  1D2S A;  5A33 B;  3BCW A;  3J8F 3;  5AC9 1;  5GKA C;  4Y20 A;  2EIC A;  2ZHM A;  4NMI A;  5DAV A;  3CKH A;  4GMP 1;  4S2F A;  5J98 B;  4I02 A;  5JMC A;  2VBB A;  4B4R A;  1URX A;  4DIQ A;  4DO0 A;  2NMO A;  1L3J A;  2BOI A;  2WA4 A;  3V0A B;  3HPN A;  4CDW C;  1UZZ A;  2J22 A;  1NCQ B;  1OT5 A;  3ZO0 B;  3IB3 A;  3LKJ A;  3AKS A;  4GAZ A;  4DXS A;  5FO7 B;  4HVQ A;  5GZF A;  4DUW A;  2ZBJ A;  1PO1 3;  2GAL A;  4UYB A;  2ZAH A;  4IE4 A;  4QX7 A;  3IDC B;  4Y22 A;  5DN2 A;  3J8F 1;  4GUL A;  4YW6 A;  1OQD A;  5EYX A;  4LNV A;  4OHV A;  4N9H A;  2NMN A;  1R09 2;  2D3P A;  3KQ4 B;  3ZN5 A;  2VZO A;  2VBD A;  1HLC A;  4N9I A;  4GB3 1;  5K0U B;  2XWB B;  2ZHN A;  3HD8 B;  4QXC A;  2JWP A;  4FQ4 A;  4UT5 A;  5EPA A;  2WO2 A;  4B29 A;  2WO7 A;  4C1W A;  4CPB D;  3BIW E;  5C71 A;  2YDE A;  3ELN A;  3USU A;  1JHJ A;  1W99 A;  4O65 A;  1ASJ 1;  1OUS A;  4Q4X 2;  3MIF A;  5JOX A;  4QT6 A;  2WBK A;  2K9Z A;  2R04 3;  3RS6 A;  3AM2 A;  3MUZ 1;  1XNC A;  4ISR A;  4RA0 A;  4XOG A;  3AXD A;  5DG1 A;  1MVE A;  4W6Y A;  4JC1 A;  3LWC A;  2LM3 A;  4M3C B;  4P5Y A;  5AFE A;  5I91 A;  1PO2 3;  1PGW 1;  3EXU A;  2C6S A;  4NHL A;  1A8D A;  5ABJ B;  1CQ9 A;  2XLG A;  4PDW C;  1Y3T A;  4NJ4 A;  3TOJ A;  2JEN A;  4O7X A;  1UMI A;  4XC9 A;  4YFZ A;  2AEZ A;  3BUC A;  3LA7 A;  2AUY A;  4MOA A;  4QD2 A;  3ZN4 A;  1ZA4 A;  3MIG A;  4YVS B;  1SDW A;  3ZSK A;  3HT2 A;  1H8T A;  4X8P A;  1MS0 A;  5LA9 A;  2VNO A;  5EIY B;  3OEB A;  4YM3 A;  4K1Y A;  5D2A A;  3T3Y A;  1O5U A;  4CDQ B;  4CU9 A;  1BEV 1;  4LK6 A;  3NJV A;  5LA2 A;  1NCR A;  2VW2 A;  3WW3 A;  4CCE A;  4Y33 A;  5A6Y A;  1FI2 A;  1DQ5 A;  5K7P A;  1SFY A;  3ZYR A;  1PVC 2;  4CP9 A;  2A6V A;  3LEK A;  5FZ0 A;  1PGS A;  1NX9 A;  3Q8B A;  5FY4 A;  2AGS A;  4MV2 A;  3D5O A;  2EXH A;  3I59 B;  4RHV 1;  3UGF A;  3OG2 A;  1HN0 A;  1VRH 3;  3NST A;  1Y9Q A;  1ND3 C;  1FOD 1;  3AKR A;  2QFE A;  3D82 A;  2E53 A;  3EBR A;  3NNG A;  4N7I A;  4DEQ A;  3M8L A;  2OT7 A;  1TNF A;  2F17 A;  1GP5 A;  4MHU A;  4CPB A;  2SLI A;  1KFX L;  4HON A;  1QJX 2;  5LK5 A;  5A7W B;  3Q9O A;  2Y6L A;  2VG9 A;  3WG1 A;  2LUW A;  1OUX A;  4D7T A;  4CDW B;  1RUG 2;  3UK9 A;  4Q1P A;  3OJB A;  4AQS A;  1C4R A;  2WT0 A;  2XKP A;  4HMZ A;  2QJV A;  2IVI B;  3QOP A;  1M06 G;  3C7E A;  2TEP A;  2W46 A;  4HK8 A;  1JXN A;  2J1E A;  4RN5 A;  2LRO A;  1CAU A;  5I0T A;  5CFD C;  1KS5 A;  2SBA A;  4N43 C;  5JCT A;  1QDC A;  3J7N A;  4F83 A;  5EV7 A;  1D0G A;  4PF1 A;  2GN7 A;  2XB6 C;  4XPV A;  4RR3 C;  4KI5 M;  5A3M A;  3PVB B;  4DY5 A;  4FOV A;  3NRU A;  3CBN A;  1JU3 A;  1W04 A;  1Q43 A;  3AYE A;  4Q4V 2;  1CWP A;  3D0S A;  1WCK A;  5FMB A;  3B5L B;  3I3B A;  4GH4 C;  2BU9 A;  5FP9 A;  3KV5 A;  2IXJ A;  3OUH A;  2EIB A;  2ZGP A;  1FAY A;  2OPW A;  3B00 A;  3RZH A;  3LDB A;  4FQZ A;  1R09 3;  2D5H A;  3CZJ A;  4HZF A;  4CDU A;  3M70 A;  4QDS A;  2JE8 A;  4XF9 A;  3T1M A;  3W58 A;  5A6X A;  2BBV A;  2G9F A;  3ZYF A;  5FZB A;  2AC1 A;  2ORX A;  2PA7 A;  1STM A;  3EMR A;  5LZ6 A;  5DZG A;  2E6V A;  4FFF A;  4O61 A;  3EJK A;  5CG8 A;  2W68 A;  5FZ6 A;  1CON A;  4CP2 A;  2GME A;  1W03 A;  1YQ5 A;  1JI6 A;  2J1A A;  3IMN A;  4YLZ A;  3UKN A;  1R09 1;  3DL3 A;  4HSJ A;  2JG9 B;  4ERO A;  2QTW B;  4JDN A;  4AFA A;  4AI2 A;  2XVG A;  4QKD A;  2QQP A;  3BOD A;  5FZK A;  2VVF A;  4QX2 A;  1EPW A;  4MUV A;  3R0R A;  4JX0 A;  3R4U A;  2YC2 A;  3N7M A;  1REE A;  2QQI A;  4L99 A;  1W6N B;  2CYF A;  4Q4X 1;  4LIV A;  1VB4 A;  2OS2 A;  1DZR A;  2HWF 3;  1QHD A;  2W92 A;  2W08 A;  5C6C A;  1OHF A;  3WCR A;  1JOD A;  2ORZ A;  1WCS A;  4GA9 A;  1I6X A;  1ND3 B;  2VMD A;  1AL0 G;  5FKB A;  4ZXK A;  5A1F A;  1VE0 A;  1TQ5 A;  2O8O A;  5GZE A;  4LE3 A;  2H6C A;  2Q1F A;  4I3G A;  3FFQ A;  1VAM A;  4QPY A;  2OXB A;  3SKV A;  4XIL A;  1PVC 3;  3CIH A;  3FWE A;  4IEO A;  3NWK A;  3KZ4 C;  2XVL A;  4JTN A;  1W8W A;  4P9X A;  3CQO A;  2IFR A;  2Y6K A;  2P37 A;  3VBO A;  3AYA A;  1DGR N;  4COW A;  3BN6 A;  1UY0 A;  1ODM A;  1B35 B;  3IDE A;  3MLK A;  5ERL A;  1S1A A;  3EB7 A;  3KT4 A;  4XBN A;  3WDU A;  2EXI A;  1S2B A;  4CRQ A;  1K3I A;  4YM0 A;  3VBH C;  5J1X A;  4JDO A;  1QJX 3;  2WC2 A;  4RS5 A;  2EAL A;  5CFD B;  2B9U A;  2Q8C A;  1RUG 3;  2JKB A;  4Y26 A;  2D6P A;  3BOW A;  1GOG A;  2EA7 A;  4XFF A;  4CCN A;  2CSG A;  4NHX A;  4ZZ8 A;  1SZB A;  3BYW A;  4DRR A;  4H14 A;  3IAP A;  3RVH A;  1OLM A;  4EN8 B;  4B7K A;  4GH4 B;  4WM7 C;  1R1A 2;  2JE7 A;  1WGP A;  1X82 A;  5T5P A;  5EJZ B;  3BTY A;  1UAI A;  2WZR 2;  2WWU A;  1VPH A;  2BGO A;  4NIH A;  3FBM A;  1PM7 A;  1W9W A;  1QJX 1;  2GH8 A;  1HIX A;  5DUU A;  2VUC A;  2V4A A;  2FDK A;  3I3M A;  3KV9 A;  1BK0 A;  1MEC 3;  2TNF A;  4KGQ A;  4Q4V 3;  5EZW A;  5FMD A;  1XPW A;  1IS4 A;  1RUG 1;  2Y6F A;  5FBJ A;  5K8S A;  2HEY F;  3QH6 A;  3ZYG A;  2BTV C;  1I9R A;  3WW1 A;  1QQP 2;  1NE4 A;  4LKF A;  5EFU A;  1QJF A;  2DCT A;  1XOY A;  2OW4 A;  2ZPX A;  3NW4 A;  1WLD A;  1KJL A;  2Y38 A;  4UW3 A;  4NIA A;  3CJI C;  5J09 A;  4BLJ A;  1N1Y A;  4Z8B A;  2JXA A;  2VD7 A;  2DVA A;  1C1L A;  2XON A;  2RG4 A;  3VDB A;  1NKG A;  4HN1 A;  3L9J T;  4WVZ A;  1WLC A;  3MIH A;  3OGG A;  4PIZ A;  4YW2 A;  2PFW A;  4Q4V 1;  4K3U A;  3OPZ A;  3FLR A;  3N7J A;  3NMB A;  5CFC C;  4FXG B;  4QPG C;  1ULF A;  1BZW A;  1YNA A;  3ZKY A;  1GZT A;  2ZEW A;  2VU9 A;  2WT1 A;  2VCB A;  1ZM1 A;  3KF5 A;  5A33 A;  3BB6 A;  3T1L A;  1RIT A;  3M7A A;  3TN9 1;  2J1R A;  3VHR A;  1DQ2 A;  5A3T A;  2JJ6 A;  1YFU A;  1X9T A;  4FPG A;  4Q0V A;  4XAB A;  4XHX A;  4PQ9 A;  4LPL A;  1VMJ A;  2ARA A;  1J59 A;  3RYK A;  3V0A A;  4WZF A;  3JQW A;  2FDH A;  4XTP A;  4H2A A;  4LOT A;  5T52 A;  4XMI A;  5GZD A;  1Z7S 3;  3PUQ A;  1HX6 A;  4IGP A;  2RMU 3;  3K48 A;  2YPD A;  4AK3 A;  3THT A;  1FNZ A;  4QDR A;  5LW9 A;  1XXN A;  4LBL A;  2W1Q A;  3VBH B;  5DAQ A;  4GJZ A;  3EYP A;  2G4I A;  4EV0 A;  1C5H A;  2QQM A;  1MAC A;  1U5Y A;  2ARX A;  3POI A;  3TRS B;  2ET1 A;  2ZMN A;  1QXP A;  2DBN A;  4E2S A;  4EWA A;  3IBM A;  2R07 2;  2WN2 A;  4XHB A;  2P17 A;  3ITQ A;  5LK7 B;  1HV0 A;  3WEZ A;  5FBZ A;  4SLI A;  1W2T A;  5JI7 A;  2BUK A;  2P2K A;  2WWS A;  1WMF A;  2RS1 2;  3LB9 A;  1GV9 A;  5I0U A;  5A7O A;  1B09 A;  4WM7 B;  2VTX A;  3UJQ A;  4AOC A;  3ACF A;  2KR2 A;  2WFF 2;  3CZU A;  3H3Z A;  2HKX A;  4FTS A;  2DUP A;  4W6W A;  2I07 B;  5GLW A;  3KWV A;  4M3C A;  2PHU A;  2IXH A;  3N35 A;  4PI2 A;  5FRA A;  2VW0 A;  4HK9 A;  1S0B A;  1J1L A;  2W3J A;  1ULE A;  3LZZ A;  4IE7 A;  4MET A;  3L2H A;  5ABJ A;  1L7Q A;  2J1V A;  1NA1 C;  2WNV B;  1R1A 3;  4ZU4 A;  4QQO A;  4Y1Y A;  2VZV A;  2WZR 3;  3ZXL A;  1S2E A;  4YVS A;  2QQL A;  4ES8 A;  2WWJ A;  5ACA 2;  5HV0 A;  2R49 A;  2DFC A;  4ZS2 A;  3CJI B;  1D4M 3;  2QKD A;  5FZF A;  2WO1 A;  1F2N A;  1CAX A;  1IQD C;  1HRI 2;  2W9X A;  5C8C C;  5JSR A;  1AXZ A;  4CDQ A;  4B3N A;  4A7Y A;  2BGC A;  4XBQ A;  1HB1 A;  1W6M A;  5LEJ A;  4ORF A;  1G9B A;  4UFL A;  3AP4 A;  3RJ2 X;  4M00 A;  5CFC B;  4NN0 A;  3THP A;  1R1A 1;  5L9B A;  4M4P A;  3I59 A;  5I0D A;  1UIJ A;  1QOO A;  2WZR 1;  4S2D A;  5IK5 A;  1AYN 2;  4OHY A;  2FMD A;  1D4V B;  3O0X A;  2A6Z A;  2ZGK A;  1KFU L;  3KV4 A;  5JOW A;  3S0M A;  1BYH A;  1UKR A;  5A7W A;  4LHL A;  4X8N A;  2RS5 1;  3T2Q A;  4GWJ A;  4JGY C;  4CDW A;  1XQN A;  4QX8 A;  1J3Q A;  2ERF A;  1QQP 1;  3SH3 A;  2QCS B;  1LEM A;  1PIV 2;  3CEW A;  4PCR A;  5E16 A;  5LBC A;  1IG3 A;  4AFD A;  4EWE A;  3RZJ A;  2VTX J;  4QKN A;  2WS9 1;  4UFK A;  1VLN A;  4U36 A;  2YV8 A;  5FZO A;  3O1P A;  4IEZ A;  3E5Q A;  3AP7 A;  4QQP A;  4AW7 A;  1LHU A;  2WT2 A;  1JZ6 A;  4YM2 A;  4RD7 A;  2XHN A;  3RNS A;  3OGJ A;  4XJW A;  2B39 A;  5JSP A;  1SLB A;  4LO4 B;  2YY1 A;  1DIW A;  1ZRR A;  3PDQ A;  3IPV B;  3ZLI A;  4MGT A;  2E63 A;  1UOG A;  1K42 A;  1C1F A;  1GLH A;  1OFN A;  3ZXG A;  2B7Y A;  3ZXF A;  2ZKL A;  5IHR A;  5C5U A;  3IM0 A;  3WG3 A;  3X29 B;  3OPW A;  4XAC A;  1S4C A;  3JB4 C;  2ZGQ A;  2VUD A;  3GYD A;  5CAD A;  4K1Z A;  1OI6 A;  3C7G A;  3DUI A;  2BNN A;  1WA6 X;  4XQW A;  5LRS A;  5T5J A;  3A22 A;  1OXC A;  3AFK A;  2R07 3;  4I09 A;  2E32 A;  4YG0 A;  2Q30 A;  2VNG A;  5F6L B;  4XAA A;  1RUD 2;  4ZS3 A;  1O4Z A;  5F3E A;  2WN3 A;  1J83 A;  4ASL A;  2D93 A;  2D6N A;  4OZO A;  5JOY A;  4MLO A;  4JQR A;  2BNO A;  1W8Z A;  2RS1 3;  3CHX A;  1NCR B;  4ZY9 A;  1COV 3;  3FUQ A;  2WZE A;  4XDQ A;  5B4X A;  1LKN A;  4QGM A;  2WFF 3;  2R06 1;  3O0W A;  3PJQ A;  1DGR A;  5FUN A;  3DYM A;  1JTZ X;  4CDX C;  3DYP A;  5CIS A;  2FCU A;  1JYX A;  3B94 A;  2XLF A;  4C0H A;  2VXR A;  1QJU 2;  3AC0 A;  4QPI C;  4S2H A;  1UYX A;  2PAK A;  4EN9 B;  4KWK A;  2YUE A;  2KM2 A;  4BIS A;  3QLQ A;  5C8C B;  2ZKN A;  1J3P A;  1YXW A;  1GQP A;  3FX3 A;  1OOP C;  1QJE A;  2MPF A;  3OF1 A;  4XCB A;  2ZCW A;  2H0V A;  2CL2 A;  3SCH A;  4IEX A;  3UKT A;  4C91 A;  5A7P A;  2G19 A;  5ACA 3;  4CZS A;  3RMY A;  5A32 B;  2WYS A;  4Q0P A;  1W6N A;  2RS1 1;  2VQT A;  2UWC A;  2CAV A;  4V1P A;  2NM1 A;  2QQJ A;  2PN5 A;  4YSF A;  3OGR A;  1HRI 3;  3ON7 A;  1NYW A;  2PHX A;  3WCS A;  1ND3 A;  3DF0 A;  1Y43 B;  1BBT 2;  4RFR B;  1JYN A;  1RMU 2;  1ZRE A;  4HXC A;  1CAU B;  3WP5 A;  3I2K A;  1EUU A;  4OLL A;  1W2A X;  4IEP A;  3AJZ A;  1UWW A;  5FKC A;  2XJQ A;  4EZ4 A;  3BTX A;  4LUK A;  4XMA A;  5HCA A;  3MBW A;  4JGY B;  2JEM A;  1PZ8 A;  3HN3 A;  3AVS A;  5I0S A;  1GFF 2;  1ND2 C;  1AR7 2;  1AYN 3;  3GNE A;  3AZY A;  5IJR A;  1X7N A;  5FZ8 A;  4ASK A;  4JV4 A;  5ACA 1;  1QJZ A;  5IFP A;  4MXW B;  1LHN A;  2A73 B;  3AZV A;  3I97 A;  4IE6 A;  2Y0O A;  2WAO A;  1CPN A;  2ZGM A;  1K12 A;  3WD5 A;  1VBB 2;  2QDN A;  5CFD A;  3UT0 A;  3LGR A;  4FP3 A;  4PI0 A;  1SHW B;  2A6X A;  1JOB A;  3GZU C;  4LBO A;  1BMV 2;  3QBQ A;  3M4F A;  4N43 A;  4UFH A;  2I2S A;  1XRU A;  1X36 A;  1PIV 3;  1YIF A;  3WOG A;  3IKW A;  1H8V A;  1ZBA 3;  4RR3 A;  2R7E B;  4A3X A;  5FJH A;  3GF6 A;  1NLS A;  1C5I A;  5A3N A;  3S57 A;  4LBQ B;  4LO7 A;  5LAS A;  3VV1 A;  1DG6 A;  1V9U 2;  5FZA A;  4GH4 A;  4AED C;  4YNI A;  4P14 A;  2X5I C;  1OH4 A;  3AVR A;  4LIU A;  3KHC A;  1GR3 A;  4LHK A;  3ILR A;  1L7L A;  2RR1 3;  2WKK A;  4UBG A;  3W9A A;  2BWA A;  1OKQ A;  4HAN A;  4M0H A;  4NII A;  3U4S A;  2VQA A;  3DN7 A;  3M3Q A;  4MGY E;  5IWF A;  4CU6 A;  3PL0 A;  1F15 A;  2UY9 A;  4Q1R A;  4L8Q A;  3MEP A;  1PIV 1;  5HCB A;  2D5F A;  1E5R A;  2WAB A;  4P00 B;  3NO8 A;  1MZF A;  1SLC A;  1YQC A;  3ZDV A;  1OPO A;  4AVT A;  1Y7B A;  5FP4 A;  3PUI A;  4CDX B;  3AP6 A;  2IUW A;  1APN A;  4LOS A;  1VBC 1;  4QXB A;  1W39 A;  4ATF A;  1RUD 3;  4E27 A;  5FMO S;  4FPJ A;  2RJ2 A;  3S6P A;  4D7S A;  2J7M A;  4OUM A;  2CGO A;  2NPI A;  4KL1 A;  5I0R A;  5IVB A;  1U12 A;  1XYP A;  2JDP A;  1OOP B;  2PMW B;  3WQ1 A;  2OZ6 A;  1K45 A;  4JGZ C;  1PO1 2;  1SEF A;  2PHW A;  2V72 A;  2VW1 A;  3A23 A;  4XUP A;  4H7L A;  1VAL A;  4NWV A;  1MS5 A;  1VAK A;  1GU3 A;  3RFR A;  1YYN A;  3MLJ A;  4B7E A;  2PQQ A;  5GZC A;  3ILN A;  1IPJ A;  2I45 A;  4Q0S A;  5HPO A;  1JYV A;  3DGT A;  5HI0 A;  2D6M A;  3PU3 A;  3APB A;  1WMD A;  4K6B A;  1ST8 A;  2MEV 3;  5GLT A;  4QKB A;  2W47 A;  4UWD A;  5A6Q A;  1LOF C;  4LEJ A;  4DUX A;  5JOZ A;  2Z2S B;  1W8O A;  4A6O A;  4LKD A;  3U0Z A;  3V56 A;  2Q8O A;  3VZM A;  2R04 2;  4RFT 0;  4AI1 A;  2FDF A;  5F5A A;  5FZM A;  3OOX A;  5IUQ A;  1IKP A;  1QGL A;  4AF9 A;  4E4H A;  2XLA A;  3THC A;  1ND2 B;  4D69 A;  5C70 A;  3DKQ A;  4UW4 A;  1PHM A;  3WZ1 A;  1QJU 1;  3N3H A;  1WD3 A;  2PLV 2;  1GWK A;  3LEG A;  3VBH A;  1W05 A;  2RDS A;  2VOV A;  2ES3 A;  3J4U H;  1LEC A;  5A7Q A;  2XQX A;  2Z79 A;  1BK1 A;  1SPP B;  5H9P A;  4DFS A;  3ABZ A;  3POW A;  1HQN A;  1UXX X;  2ZJC A;  4ITC A;  3VD7 A;  1AR7 3;  1S0I A;  1F5J A;  2Q0A A;  4BXS V;  4NOT A;  5L9V A;  1NZC A;  1I1E A;  3TEX A;  4IV3 C;  2RDR A;  4EE2 A;  5DUW A;  1T6B X;  4AED B;  2RM2 2;  3T4V A;  2X5I B;  4WM7 A;  5EHD A;  4GKY A;  1RHI 2;  5DAX A;  4RGA A;  1BBT 1;  1RMU 1;  2IXL A;  2EAA A;  4EJR A;  4XQ4 A;  4NPL A;  4A3Z A;  4Q4W 2;  1HQW A;  1X9P A;  3ENR A;  2ZGN A;  5T54 A;  5IAT A;  5KHJ A;  3NJY A;  4HKL A;  4BLI A;  2QNK A;  3W59 A;  2GC1 A;  4YG6 A;  2PTM A;  3VZO A;  2J1S A;  4BK4 A;  1GSL A;  2XXZ A;  5BNO B;  3E6D A;  3I2J A;  1RUJ 2;  1V9U 3;  2TUN A;  3EHK A;  3ZYP A;  4NO4 A;  3RSJ A;  1AR7 1;  1O4T A;  4GWN A;  3VD4 A;  5K9Y A;  4FFH A;  4XFB A;  4LT5 A;  3AZZ A;  2QQK A;  4DXR A;  4M3C F;  4AZZ A;  1GOF A;  3OD0 A;  4LBM A;  3CJI A;  2V73 A;  5HCH A;  5F1R A;  1W0N A;  1VBB 1;  3GBW A;  1WKY A;  1MPX A;  4JRL A;  1BMV 1;  5FLJ A;  4HSL A;  3PU8 A;  4LKE A;  2Y33 A;  3H1W A;  4BZ4 A;  3T0A A;  4W65 A;  3ZOI A;  2VY0 A;  2WQ8 A;  2GH2 A;  4YFW A;  1JW6 A;  1NQJ A;  4JGZ B;  3ZR6 A;  2WFP A;  1QXJ A;  2VZQ A;  3U78 A;  3P3P A;  3VZN A;  1XNK A;  4QXH A;  3USS A;  4ATE A;  5CFC A;  1LOE A;  4IET A;  5C4W C;  4QPG A;  4DRV A;  1YQ6 A;  4TSV A;  5T5L A;  3VB9 A;  5C8W A;  3BU0 A;  1JOP A;  3N9L A;  1GQG A;  4JKK A;  4LMF A;  3OYW A;  4MGK E;  1C3H A;  3I2H A;  3JU9 A;  4P9W A;  3B02 A;  5CKM A;  4IES A;  5L36 A;  1RVF 2;  3PVE A;  4Z07 A;  1S0G A;  5F6K A;  1XJA A;  2GND A;  1KS4 A;  1EV1 2;  1GNH A;  2J1T A;  2QDR A;  3JD7 2;  4MGQ A;  4Q29 A;  5FZG A;  5FZL A;  4QB2 A;  4ZU7 A;  3SC7 X;  3JQX A;  1UMZ A;  1HV1 A;  3H7Y A;  1SBF A;  4WM8 C;  4AI8 A;  4C8D A;  5KXB A;  2DYC A;  1RGS A;  2RJK A;  1AL2 3;  1SBE A;  5DDJ 3;  3VZL A;  2W0X A;  5JPM B;  5FY1 A;  1Y9M A;  4R9D A;  2GN3 A;  4YVW C;  3SH4 A;  4BQ3 A;  4BK5 A;  1DU3 D;  2JG8 C;  2GNT A;  2HH9 A;  1VJ2 A;  1UOF A;  4XTM A;  5FZ3 A;  1ULD A;  3AP5 A;  4UFM A;  3O1R A;  3IPV A;  1PO1 1;  3M3E A;  3MYX A;  4IV1 C;  2K0G A;  2YZ4 A;  3WDV A;  2DU1 A;  5FJK A;  3R05 A;  2PLV 3;  1RXG A;  4IV3 B;  3VUO A;  4I3P A;  1A34 A;  3CO2 A;  1ZZ7 A;  2ZOE B;  4Y1V A;  3O1U A;  4QX1 A;  2R6Q A;  4Y3O A;  5FZ4 A;  3IZO A;  2XHK A;  2ZX0 A;  1XSQ A;  3UL2 A;  4UF0 B;  2WJS A;  2ZGS A;  4DPN A;  3K3N A;  5BUV A;  1AXY A;  1A6C A;  5L7O C;  1WCD J;  3NV1 A;  2CHH A;  2D3S A;  2JDH A;  2VVD A;  4R52 A;  4WZC A;  4YGE A;  2B42 B;  2A75 A;  4B1M A;  3MI8 A;  2HWF 2;  2R04 1;  2Y0I A;  3CL1 A;  1CAX B;  1JZ4 A;  2WSU A;  2DCK A;  1FT9 A;  4Y1X A;  5C9A B;  1O8S A;  1HDK A;  2YGM A;  3I2G A;  4ZON A;  2RM2 3;  1W6M B;  3SEP A;  2FHR A;  1PO2 1;  4G9S B;  5FPZ A;  1BCX A;  1RHI 3;  2OKX A;  3HJR A;  1W8T A;  1IQA A;  5JSO A;  4H55 A;  1J58 A;  2ZGL A;  4Q4W 3;  3LPF A;  5A3O A;  1FV2 A;  3KT1 A;  2A5Z A;  2ZZJ A;  1PK6 B;  4LBQ D;  4OHW A;  3WF1 A;  1VMH A;  1DYP A;  1TZO A;  2BNM A;  2VMC A;  3QCW A;  3SIT A;  1IS6 A;  5C8C A;  3MHZ A;  5CKN A;  1RUJ 3;  1O3T A;  2ZX4 A;  1WZX A;  1NQD A;  5A3P A;  4LKS A;  1OD5 A;  3WQ0 A;  2DUR A;  1UXZ A;  4MVT A;  5LY1 A;  4M0N A;  5FQ0 B;  1W8N A;  1S0E A;  2DFB A;  3LOI A;  5A32 A;  2OA2 A;  4Y4R A;  5C4W B;  3UJO A;  1Q56 A;  3BU7 A;  3WY6 A;  1XNT A;  3Q8C A;  1VRB A;  5FZE A;  3RWK X;  4Q4Y 3;  4M01 A;  4I0B A;  4YW7 A;  1XYO A;  4W50 A;  4IE0 A;  4ZXE A;  4Q4W 1;  3WR0 A;  1F5F A;  3ZPO A;  4AAX A;  1H6Y A;  5FZO B;  3NKT A;  1UZ0 A;  3GAL A;  1R64 A;  1VRH 1;  1QH6 A;  5G04 L;  4FP2 A;  3UV9 A;  1W9S A;  1RUJ 1;  2IZW A;  4LJH A;  4JGY A;  2L9L A;  4A45 A;  1IPS A;  1GAN A;  1XE0 A;  3OBA A;  3RGB A;  1RUC 3;  1OC1 A;  2Y26 A;  3GBF A;  4WM8 B;  3HR9 A;  3VHP A;  2HEW F;  1QH7 A;  1PZ9 A;  2C9A A;  1MEC 2;  2Z69 A;  1OH3 A;  5LRR A;  4A6S A;  4ARY A;  3MF6 A;  2YFU A;  5H9S A;  5FXX A;  1LED A;  2LTN A;  2NLR A;  1RVF 3;  1XE7 A;  4IND A;  1AR8 3;  1RUE 2;  1Q3E A;  4KU8 A;  4MXV A;  4MXW A;  1NAE A;  2O0O A;  5FYZ A;  5IVY A;  1EV1 3;  3JD7 3;  3VZK A;  2JG8 B;  4FFI A;  2ZAC A;  2J1U A;  5F37 A;  4URT A;  3J9S A;  3SEE A;  3LFM A;  3T2T A;  4B4Q A;  1DGL A;  2X53 S;  4F7Z A;  3NJX A;  3V64 A;  4QU1 A;  5CYY A;  4W6X A;  4IV1 B;  1UY3 A;  4I2O A;  2E51 A;  3RJR A;  5J3U A;  2YBK A;  3PUS A;  4LBQ A;  4FPY A;  4PDW B;  2BVV A;  3ETQ A;  3B93 A;  2VH9 A;  3DKW A;  5FYI A;  4XZP A;  1Q5O A;  4ARX A;  1W9T A;  4K9S A;  1ULC A;  1W8H A;  3QAC A;  4D7Y A;  2JIC A;  4QU2 A;  5L7O B;  1JH5 A;  3MPP G;  1LOC A;  1RVF 1;  3POF A;  5FMC A;  3PIG A;  3WSO A;  3NKG A;  4YZ1 A;  2WA3 A;  1EV1 1;  1SLI A;  1ZBE 2;  1W9Y A;  2D44 A;  2ZEY A;  3AZW A;  3DXT A;  3JD7 1;  3JBG 3;  3POE A;  3KCY A;  2WNE A;  4N90 A;  1JYI A;  1HJG A;  2XG3 A;  3DYO A;  4DXZ A;  2P1B A;  4QHB A;  2W87 A;  3MIE A;  4QKF A;  4RQP C;  3VBS C;  2BQP A;  2LAL A;  2QE3 A;  1SCS A;  3WXP A;  3A21 A;  2BWC A;  1VBE 2;  3LFI A;  3O12 A;  4CDX A;  1YHF A;  4Q2F A;  5FYM A;  1W6P B;  4MH0 E;  1MS3 A;  4OMD A;  1GZW B;  3AMN A;  4PBP A;  1Z7S 2;  4QQH A;  4UAP A;  4YPJ A;  4WVM A;  2KA3 A;  3AMH A;  2RMU 2;  2PHD A;  4HOO A;  4TXW A;  4V2V A;  4BXF A;  2NP0 A;  2IXC A;  4EN6 B;  2XH6 A;  1OOP A;  3JUU A;  4JHT A;  3V65 A;  5FK8 A;  3ACH A;  5EP9 A;  4CCM A;  4XFI A;  1OA2 A;  1QWR A;  3AL6 A;  1LJ7 A;  4AEM A;  4YZ5 A;  4P9L A;  5JXG A;  4XUQ A;  2R1B A;  5GLV A;  1ULO A;  4UOJ A;  5F39 A;  5J7M A;  3H1M A;  1CIY A;  5FWJ A;  4CP1 A;  4YW4 A;  4JVA A;  4LUM A;  1XU1 A;  3ZFG C;  3RZL A;  3GDB A;  4PLO A;  4AVV A;  2HWF 1;  5LEK A;  3DEC A;  3U4X A;  5BNP C;  4BIF A;  2X05 A;  5HBA A;  1ENQ A;  1AXK A;  5FYB A;  4N43 B;  3ZXA C;  4DMI A;  2YB7 A;  1OQ1 A;  4XDO A;  4KNC A;  4RR3 B;  1PVC 1;  1ND2 A;  3SH5 A;  4YW3 A;  1POQ A;  2W39 A;  3HN1 A;  4E2Q A;  3WF2 A;  4P02 B;  1VIW B;  1RC6 A;  5FUI A;  1N3Q A;  3KCC A;  4EZH A;  1OA4 A;  3H8O A;  2VCA A;  3RQ0 A;  1E5I A;  1SPP A;  3WDT A;  3KV6 A;  4NE9 A;  1BKZ A;  1LCL A;  5F2S A;  3LD8 A;  4XBL A;  4MGI E;  2D3R A;  1REF A;  1D4M 2;  3ZFE C;  2ZHL A;  1SLL A;  4NHM A;  3W5N A;  2OVU A;  4NWW A;  4BJ0 A;  2CNA A;  4A4A A;  2PHF A;  5JAX A;  2DVD A;  1RUE 3;  3OD4 A;  4GWM A;  5FO9 B;  1FV3 A;  3IT8 A;  5FTT C;  5H9Q A;  2X5I A;  3WP6 A;  3WVJ A;  4AED A;  1HJF A;  3RYP A;  5JI9 A;  2UYA A;  5B4N A;  3NNM A;  4JHZ A;  4IDZ A;  3VBR C;  5K4L A;  3ZMN A;  3KD4 A;  4Y5Z 0;  1S0J A;  2Y6H A;  2CGP A;  2YFZ A;  2AEY A;  4M4R A;  4B4P A;  1IG0 A;  4BCU A;  1DQ4 A;  3H3L A;  3ZM8 A;  1FXZ A;  4QAW A;  2GC2 A;  2EF6 A;  4C90 A;  3AK0 A;  5BNO A;  4AVA A;  3VBS B;  3I4I A;  1XB9 A;  2R30 A;  4QX3 A;  4RQP B;  1MEC 1;  1H6X A;  3W20 A;  1BHG A;  1GBG A;  1WCU A;  2JIJ A;  2ZX3 A;  3OB8 A;  5FCC A;  3SCF A;  5A3U A;  1UZV A;  5FPX A;  5DMY A;  1RUE 1;  5BPX A;  2HWE 3;  1OLM E;  5FPU A;  3WNX A;  5FYT A;  1ZBE 3;  4FT8 A;  4TTG A;  5EWS A;  4HET A;  5BNQ A;  3ZXE A;  5J37 A;  2ID4 A;  5DZF A;  2ZEX A;  1RJ7 A;  4QX5 A;  4R9C A;  3NJZ A;  1TE1 B;  5D8A C;  1UX6 A;  3ETP A;  3D6E A;  3HMY A;  4JGZ A;  1VBE 3;  5C3R A;  5IK8 A;  5IVF A;  1H4H A;  2CWM A;  5F32 A;  3KLS A;  3RZZ A;  3AXE A;  4Z1V A;  4FOQ A;  4GD4 A;  3VKL A;  3GHM A;  1V6O A;  2V5D A;  1ALY A;  4IEW A;  2OYZ A;  3ZFG B;  4CYD A;  4FCA A;  4NRM A;  4K7J A;  1ZBE 1;  2E7Q A;  1YC6 1;  2W94 A;  1A78 A;  3ZFF C;  2WII B;  2RE9 A;  1LOF A;  4FVV A;  5BNP B;  3WHU A;  4CCD A;  3HWJ A;  1JZ2 A;  1V6K A;  2QQN A;  1CZV A;  4KU7 A;  5IVE A;  1CX4 A;  4WVW A;  3OUI A;  1QKQ A;  3EQE A;  3U07 A;  4Y1U A;  1F4A A;  2AAC A;  3CMG A;  3K4A A;  4NAO A;  1XYN A;  3H8X A;  4MGS A;  1JN2 P;  3HQR A;  4X6R B;  1Z7S 1;  1AJO A;  4J1X A;  3ZYB A;  1CPM A;  2WYF A;  1COV 2;  4K21 A;  4XJ9 A;  2RMU 1;  5JXH A;  3KVA A;  5F3I A;  1H2N A;  1F4H A;  4HVR A;  1H30 A; 
#chains in the Genus database with same CATH homology
 2YBS A;  3KV9 A;  3AVS A;  4D6S A;  5FZ8 A;  4ASK A;  5FBJ A;  3KVB A;  5FYV A;  3N9M A;  3K2O A;  5FYB A;  5FYH A;  2OX0 A;  5FPB A;  4AI9 A;  4DIQ A;  2XUE A;  4DO0 A;  5ANQ A;  3NJY A;  5FZC A;  4BU2 A;  2XDV A;  4XDO A;  5LY1 A;  5FXV A;  5FYS A;  5FY0 A;  4CSW A;  2XXZ A;  2YU2 A;  3K3O A;  5FPL A;  5FP9 A;  3KV5 A;  3N9Q A;  3KV4 A;  4UF0 A;  4Y4R A;  4GAZ A;  2VD7 A;  5A7S A;  3LDB A;  5FZ7 A;  5A7W A;  5FJH A;  5LY2 A;  1VRB A;  3PUR A;  5FZE A;  4EZH A;  5A3N A;  5F5I A;  3ZPO A;  5FXZ A;  4QX8 A;  5A80 A;  4QX7 A;  4LIT A;  3KV6 A;  5FZO B;  5FZA A;  5F2S A;  4LIU A;  3AVR A;  2P5B A;  3LD8 A;  5FZB A;  3PU8 A;  4CCL A;  5FZO A;  3U4S A;  4LXL A;  5FZH A;  5FXW A;  5FY9 A;  5IWF A;  4EYU A;  4QXC A;  5FZ6 A;  4QWN A;  3PDQ A;  3U78 A;  5A3T A;  2Q8D A;  3ZLI A;  4QXH A;  4NUB A;  5FZ9 A;  5K4L A;  5FXX A;  4D6Q A;  4CCK A;  5IVY A;  3N9L A;  5FZ1 A;  5FYZ A;  5FP4 A;  3OPW A;  5FY8 A;  4URA A;  5FYY A;  5A1L A;  5F37 A;  5F5C A;  5FZK A;  3PUQ A;  2Q8E A;  4QXB A;  4IGP A;  5FP8 A;  4QU1 A;  2YPD A;  4D6R A;  5FP3 A;  4LIV A;  5LW9 A;  5FZG A;  5IVB A;  2OS2 A;  2YBK A;  3PUS A;  2PXJ A;  4GJY A;  4GJZ A;  5FZL A;  5FZD A;  3N9N A;  5F3C A;  4C8D A;  4CCJ A;  5FPU A;  5FYI A;  5F3E A;  5FYT A;  5FZI A;  5IVC A;  5FV3 A;  3N9O A;  5A1F A;  4IGO A;  5FYC A;  5IW0 A;  2W2I A;  4AAP A;  5FY1 A;  4IGQ A;  5FUN A;  5FUP A;  2YBP A;  2GP3 A;  3DXT A;  5FPV A;  5LWB A;  3PU3 A;  4XDP A;  5FZ3 A;  5IVF A;  5E6H A;  4Y33 A;  5F32 A;  5A7O A;  5FPA A;  4BIS A;  5FZ0 A;  4GD4 A;  5FY4 A;  5FJK A;  5CEH A;  5F5A A;  3DXU A;  5FZM A;  5FYM A;  4E4H A;  2YU1 A;  2XML A;  4CUG A;  5A3P A;  4Y3O A;  3OPT A;  5FZ4 A;  5A7P A;  2Q8C A;  2OT7 A;  4UF0 B;  2OQ7 A;  5F2W A;  4HOO A;  3K3N A;  4V2V A;  3UYJ A;  5A7N A;  4BXF A;  4CCN A;  2OQ6 A;  4HON A;  5IVE A;  5IVV A;  5A7W B;  5A7Q A;  4CCO A;  2GP5 A;  4CCM A;  3AL5 A;  3RVH A;  2WWJ A;  4V2W A;  5F3G A;  5FWE A;  3AL6 A;  5FYU A;  5FP7 A;  5FZF A;  5ISL A;  3PTR B;  4EZ4 A;  2WWU A;  5F39 A;  5A3W A;  5FY7 A;  5FWJ A;  3N9P A;  3PUA A;  3KVA A;  5F3I A;  4TN7 A;  5IVJ A;  5FY5 A;  5KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...