2OS2A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys36
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
347
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2os2A01
3KV5A 4IGPA 4AAPA 4EZHA 4ASKA 2GP5A 4CCKA 2YU1A 2OQ7A 3K2OA 3K3NA 5FPBA 5IVEA 5FZ4A 5F37A 5FP4A 2Q8CA 5F3GA 3AVSA 4IGQA 3LD8A 3NJYA 2OT7A 4DIQA 5FZAA 5CEHA 5FYHA 3PUQA 2XDVA 5FYUA 5FP7A 3PURA 5FZ0A 5F3CA 3DXTA 5ANQA 5FP3A 3KV6A 4DO0A 5F32A 2W2IA 5FWJA 3KVAA 5FYBA 5LY2A 3PUAA 5F5IA 5FUPA 5FYCA 3AL5A 4LITA 5KR7A 4QX7A 5FYVA 4QWNA 5F3IA 5FZOB 5FYYA 3N9OA 4URAA 2Q8EA 5FPVA 5IVYA 5A7PA 5FZKA 4GAZA 5FZDA 5IWFA 4HOOA 4D6QA 5FZIA 2WWUA 5FUNA 3K3OA 3N9PA 4NUBA 4E4HA 5FZCA 5FYTA 5A7WB 5A7SA 5FZ9A 5F3EA 4BXFA 5F2WA 3N9MA 4GJYA 5FZFA 3PDQA 4XDOA 4QXCA 4AI9A 2YBKA 4UF0B 5FP8A 5FPLA 5FYIA 4CCOA 5ISLA 5A7NA 3U4SA 3UYJA 3PUSA 4GJZA 5FZBA 5IVJA 2P5BA 4BU2A 3U78A 2PXJA 5FZ6A 2Q8DA 2WWJA 5A7QA 5FXWA 4EYUA 2GP3A 4CUGA 5A1LA 2YBSA 4QXHA 4Y3OA 3N9LA 5F5AA 3ZPOA 4LIUA 5F2SA 2YPDA 5FZOA 5FZ7A 5FWEA 5F39A 5IW0A 4LIVA 2XMLA 5FBJA 4GD4A 5FYMA 5FY5A 5LW9A 4V2WA 3LDBA 3DXUA 5A3TA 5FYSA 2YBPA 5FZ8A 5FY9A 5FY4A 5FZMA 2XUEA 5IVCA 4Y4RA 5FXZA 3ZLIA 3PU8A 5FZLA 5A7WA 5FZGA 5A80A 4CCLA 5E6HA 5FZ3A 3KVBA 5FXXA 4XDPA 5FYZA 4BISA 5FPUA 4UF0A 4QX8A 3KV4A 3KV9A 3RVHA 3OPWA 3OPTA 3PTRB 5IVBA 4C8DA 5LY1A 1VRBA 4D6SA 5FY7A 5FZEA 3AVRA 5F5CA 4IGOA 2OQ6A 4D6RA 5LWBA 4V2VA 4TN7A 5A3NA 5IVFA 4Y33A 5FXVA 4CSWA 4CCJA 2VD7A 5A1FA 5FP9A 5FPAA 5FY1A 3AL6A 4QXBA 2YU2A 5FY8A 5FY0A 5IVVA 5FJKA 5FV3A 4CCMA 2OX0A 3N9QA 2OS2A 4LXLA 5A7OA 5K4LA 5A3WA 3N9NA 5FJHA 4EZ4A 5A3PA 4CCNA 2XXZA 4HONA 4QU1A 3PU3A 5FZ1A 5FZHA
chains in the Genus database with same CATH superfamily
1D0HA 3TWIA 4GWJA 3WNKA 3FFQA 4NAMA 1NZIA 4URTA 1Q8PA 1ZA7A 1EUUA 1SLLA 1W39A 3H3UA 3OB8A 3W9AA 3ZFEB 3JB8A 4JAAA 2O1QA 3KGZA 1NLRA 2QQWA 3ZYHA 3MPBA 1QXJA 2PLV2 4A3XA 5JZGA 3OD0A 4YW2A 1YQ6A 3EO6A 4L99A 2P3KA 3VBOB 4NHMA 4DXTA 5IATA 5FO7B 4LKEA 5LA1A 1SPPA 3T2TA 3ME2A 1ZBA3 1ND2B 1O4TA 1WA4A 2VZ3A 3KV6A 3M4FA 3M8LA 1RUJ3 4FP3A 4AFMA 4BJ0A 4Y24A 3U4XA 4G3YC 3IM0A 3VZMA 5JR7B 1O8SA 1DQ6A 1V6LA 4COWA 5I0DA 2BFUL 3BUCA 1TG7A 1MEC3 4LITA 3A0KA 3CJXA 3OGSA 5FYVA 2UWBA 4GB31 1AL22 3A7QA 5JI9A 4QB1A 5HXVA 1XU2A 5FYYA 4XUTA 4Q4V3 2JIGA 1ODMA 2W46A 3POBA 5A7PA 5I8TA 2VBDA 4P9YA 2P17A 4IL7A 4NO4A 5EZWA 4CDXC 4XUPA 4N53A 2GNMA 3TYJA 2BJSA 3ETPA 3GBFA 1OPOA 3M1HA 3NNGA 3ZXLA 4RR3B 1ZZ9A 2VBPA 1OOPA 4WVVA 1AR91 1KD7A 1V9U2 1W8ZA 1EV11 1H6XA 2WQ8A 3I7DA 4MGKE 1Z7S2 5F5QA 2CWSA 3CNAA 1SFPA 2JXAA 5FPXA 3N4MA 1PZ8A 5D8AB 4GZ9A 1UPSA 3U4SA 3LEMA 4FTEA 1GICA 5IVJA 2DCJA 4UYBA 4A7ZA 1DQ2A 1B35C 1BLZA 3AJYA 4Y1ZA 3SHRA 2L9LA 1FPN2 2A6VA 4EYUA 3UNPA 1LKNA 4ARXA 1S1AA 5JOXA 3BIWE 1HRV3 2RDRA 3N9LA 2Q1ZB 1V6IA 4DINB 2R061 1I1EA 3PJQA 2YMZA 4XXPA 4QKFA 4NHXA 2ZGLA 4QPWA 4LIVA 3IB3A 4XW3A 4P9WA 3T30A 1AXKA 2WWSA 3POFA 3SKJE 4Z1VA 2G4IA 2Y6JA 3HJRA 4YNIA 5CFCB 1NCRB 1C8M3 3Q8FA 4IEUA 4OMCA 2ZX2A 4W50A 1WCKA 5FZ8A 3THPA 1DZTA 5KBFA 3NV1A 1BQPA 1SLCA 3GM8A 5J48A 3GJBA 2EALA 1HXS3 4CU9A 3H8XA 4H3WA 3NV2A 4IEYA 4YGCA 1REEA 3KVBA 2FCTA 5AC91 3I54A 3GHNA 3KT7A 3KV9A 1VE0A 1A78A 4FI9A 3WQ7A 5G05L 3IDBB 4E9KA 2C0ZA 4JGYC 1VAKA 1LOCA 1DIWA 2VOKA 5C71A 2XL9A 4CXYA 2BBAA 4IUGA 5LK7B 1LGNA 4L0PA 2YU2A 3O5SA 2RR13 3HOBA 3OCPA 4XBNA 2HWF2 3LA2A 3VDBA 2VJXA 4UFJA 2Y6LA 2DFBA 4C0HA 4C1XA 3N9QA 4X8PA 4XF1A 4EWAA 3IIIA 1EPZA 4MX3A 1QDCA 2XXZA 3GXUA 3NJXA 4LHKA 1TVGA 2HWD3 4FSJA 2Y64A 3MV11 1OT5A 4HKLA 1OUXA 3PUIA 1DP0A 3POSA 4RA0A 1AX0A 2RE9A 3OUJA 2WNOA 2D6OX 1POV3 1S0GA 5A3OA 4I0WB 1TNFA 4S2GA 4AW7A 1NKGA 3MLKA 2RMU2 2QJVA 1HKDA 4YG0A 3AXDA 3WHUA 4K6BA 1J3RA 5I0UA 2Q8OA 3WR0A 3VDDC 2A3XA 2WT1A 4LKFA 3VBFB 3HNYM 2E26A 4R9BA 4YM2A 4IEZA 2E51A 1IPKA 4I3PA 1CX1A 1CQ9A 1WLDA 3B69A 2WL1A 5F5IA 1ULGA 1YIFA 3OSDA 2QVSB 3ZYRA 4DXZA 5KC6A 3MZHA 3LB9A 5D1IA 4QDQA 2JDNA 1Q8OA 2C24A 4M4PA 4O9GA 5EYXA 4B29A 1P8JA 4DMIA 3A22A 4ITCA 3H1WA 4EJRA 2PAMA 4B4QA 2UWAA 1OLME 1CESA 2LALA 5LATA 1D4M2 4YGBA 1QIQA 1C1LA 1KS4A 1HJFA 3U14A 3OEAA 1ONAA 4MHUA 1UZ0A 1ZZCA 2DVDA 4FFHA 1UX7A 3NWKA 1QJX1 1W8WA 5IAVA 5HCFA 3QH7A 3ATGA 3TEZA 1LOAA 4QDSA 1UW8A 3UYJA 2WIIB 1WW6A 2BTVC 4N7UA 4Y1YA 4JGYA 4DXRA 5BPXA 1JH5A 1RHI3 5FLIA 1HIXA 4UBGA 1IHMA 2G9FA 1LCLA 3PNAA 2D98A 4Q4W1 5DDJ2 5GZGA 1OQDA 4QQ2A 4D0QA 4ATFA 3VHOA 1LECA 4W6YA 5KHKA 3ZMOA 3ZPOA 1NA1B 2W1UA 1D0GA 1XNKA 4CYDA 1N3QA 3PVEA 4AG4A 2EXKA 3WZ1A 2DV9A 4J1XA 3KS7A 4V2WA 2CV6A 2V73A 2GH2A 5CNAA 4DS0A 2YBPA 2F17A 2XUEA 4Y4RA 3ACIA 3HT1A 5FXZA 2W92A 5A70A 1PO21 3LFIA 4P9JA 2IVJA 2ERFA 2E7AA 2PYTA 4A2UA 1UY0A 4TWTA 1WWYA 2BPA2 4XABA 1VRBA 4ZHNA 1Y9QA 1V70A 2WYSA 4O9EA 3IIAA 5A3NA 1LHWA 2XL7A 3UL2A 3VDDA 1IS4A 4LO7A 5DXDA 2VO5A 1TMF3 2WUHA 3M2MA 3MLLA 1UN1A 1RUE1 4GQ7A 4GULA 4NN0A 3UETA 1CVNA 4P02B 3WQ0A 4NWVA 1JN2P 4RYDA 1YHFA 2J1RA 4PDWC 1JOBA 4G9SB 3FN9A 3VBRB 1A8MA 1AR61 2X29A 3MEPA 3N9NA 2WQZC 4CCNA 4BB3A 1FOD1 1KITA 2IZWA 3VN4A 3O1TA 3VUOA 2Z4FA 3DYMA 2JE9A 1LODA 2XVGA 2GP5A 5JWPA 4CUBA 2OYZA 1YFWA 1W6QB 3SH4A 5DABA 2JB4A 4FPFA 3FLRA 2P3IA 1R091 4Y20B 4W4ZA 2BRTA 3ON7A 3S57A 1GQHA 2ID4A 3ZVXA 5FP4A 5JLVA 4QU2A 1UZWA 1IG0A 2QE3A 3AVSA 3MIGA 4ISRA 2WO7A 3ZO0B 3Q8AA 1Y9MA 4C90A 1JU4A 5LEJA 1IS6A 5IK7A 2VOXA 4Y22B 2J22A 5FYUA 1AYM3 1COV2 3AJZA 3POWA 5FMOL 4OHWA 1VBD1 1OF4A 4AWDA 4E2SA 5L7OC 1VAVA 2X5IB 4CTEA 3OBAA 3NW4A 4IE5A 1S0DA 1XSRA 5DAWA 4BLIA 2DBIA 2WNUA 4I0AA 4X6QB 4GMP3 2YFZA 1Q5OA 1QQP3 5F3IA 3TEYA 1EAH2 4IERA 5AFEA 4GWIA 1TEIA 2W94A 1H30A 2XWBB 2ZXQA 4M4RA 4Q1PA 1LHOA 1YFXA 2QTWB 4QT6A 3UJQA 2XHNA 5C9AB 1FAYA 4A42A 5J1XA 1LB2A 1UZZA 2HWE3 3ZSJA 2VW1A 3TEWA 2HWF3 3LA7A 3L2HA 3NKGA 3ZDSA 3KCYA 1SLBA 2EAAA 4XDQA 1HRI2 4MSVA 1BMV2 5A7SA 2EIGA 5JXGA 2HJIA 2VQUA 1TE1B 2PLV1 4XETA 1UOJA 1A6CA 2QUOA 3RG0A 3T4VA 2WJSA 1MQTB 4BQWA 1XSQA 1Q8QA 3RZHA 4LOSA 1QJU3 5FKBA 3PUSA 4YG3A 2FHRA 3H8OA 3BKZA 1VBB3 3RJ2X 2VTFA 1ULEA 5CKQA 5A7QA 5FFOC 1IQDC 1AYN1 1UXZA 1UY2A 3QBQA 2NPIA 3JQWA 1TNRA 4JDMA 3ECQA 5F5AA 3WNOA 4OHVA 2HWB3 4PDWA 1UXXX 5FZOA 2A5ZA 1YQ2A 2Q30A 3AYCA 3CDZB 2HWC1 1RUF1 4Q5OA 1UU4A 1WD4A 4IE7A 2AZ5A 2W0XA 4LBQA 5GZFA 3FLPA 1BCXA 3WNLA 1B09A 1QNWA 2FDJA 3F2ZA 1C1FA 4WVMB 5CISA 3RPQA 2WFPA 1ASJ2 1XOYA 2ILMA 3V56A 4HVQA 1MZ5A 1BZWA 5T50A 2F4PA 3ZN6B 4QXKA 3ZXGA 3I3EA 5ABJC 4KL1A 3ZXJA 1FYUA 1RUG2 5FYZA 3GHMA 3JCIA 4LO8A 4Q4X2 4UW5A 3ZR5A 5A6ZA 4CDWB 4QX5A 1CZTA 1IGOA 4CDQB 4WBBA 1ODNA 2B5HA 1D4M3 5IVFA 3H50A 3NNJA 5FXVA 2MEV2 4J25A 4B1MA 3I2HA 1FPN1 4LK7A 1S0FA 2PA7A 4AVSA 5CFDB 2VOTA 1SBEA 5L7OA 2JG9C 1W6NA 1W8NA 1PO11 2VE1A 4GH4B 3KWVA 4FPYA 1I9RA 2P3YA 2Y33A 5T54A 2E31A 2FDGA 2PAKA 5A3PA 3ITQA 1ZZ6A 2EAKA 1OF3A 5FZ1A 1RUOA 1N1TA 3CLPA 5BNPB 2IFRA 1J83A 1NE6A 4BPZA 1W0PA 1JW6A 1RUI3 2RHPA 4ASKA 2IXIA 2AGSA 2A6ZA 3FFZA 4HLTA 1X36A 1SLIA 4CDUC 2FQPA 2FCUA 3Q8CA 3CKHA 3ZXEA 4Y5SA 4QPIB 4IGQA 2YXSA 4ZY9A 2VOWA 2XLAA 1WW4A 3RMXA 5BNOC 1YO8A 5FYHA 3MO4A 3RWKX 2ZEWA 4LNVA 1LULA 1NQJA 4AZZA 4OI4A 4EN6B 2JDHA 5FKCA 3OBTA 1N3PA 3MF9A 1G9CA 5F32A 3KVAA 4LHLA 3WD5A 4GB32 1DZRA 4R9DA 2PQQA 1UIJA 5EFUA 3TAYA 1XXNA 2ZEYA 3RI9A 3X29B 4BK5A 1PZ9A 1R1A1 2ARBA 4OFGA 4BXSV 2Z2SB 4ZZ8A 3V0AB 2JDUA 2X05A 5LBFA 3HQRA 2WO1A 2VY0A 1VMHA 2LUWA 2P6HA 2B9VA 1F31A 4GAZA 1HQLA 4FPLA 4AE2A 1RMU3 3RGBA 2EIEA 2VQAA 3CQOA 1AR92 4H7LA 4U36A 1EV12 1Q56A 2VXJA 5FPZA 1BEV1 2JDKA 2PHXA 4LO5B 1BXHA 2HEYF 2WZR1 1FT9A 4TSVA 4YW5A 5FZFA 4E4DX 4OUMA 5ABJA 3VKFC 1NCQB 1MS0A 3MUY1 2RMU1 4QXCA 4BZ4A 1YI7A 5A6YA 4OYUA 4HPKB 3GALA 4YRDA 5L19A 2VCCA 1TME3 3S0MA 4Z2WA 3HQUA 2AEYA 1JHJA 1POQA 2C26A 4HSLA 4LBLA 4Q1RA 4NIDA 2W9XA 2QQJA 4TYSA 4DZGA 1NX9A 3VBOC 2CSGA 3B3QE 2JG9A 1CZSA 5C3QA 3OY8B 2XQRA 1W2NA 3O0WA 3ZKYA 2DDUA 1XU1A 1BBT1 5F2SA 3SH3A 4MH0E 4F83A 5A3UA 1COV3 3SC7X 4L11A 4QQLA 1LEDA 3PHMA 1OLQA 3KQRA 4YVSB 5K0UC 5I8SA 3DXUA 1AR72 2E9QA 2VCBA 1OMIA 1ZBE3 2RV9A 1JYTA 3ZLIA 3SEPA 2TEPA 5FZGA 5CAZA 5A80A 4BQ4A 2K9ZA 2JEMA 5E6HA 2B45X 3I2KA 1GOFA 4QKNA 3WW1A 1AHSA 2Y6KA 4LBJA 1F5FA 2GMPA 4RR3C 3ZDVA 2DCZA 4BISA 1DDLA 2YYOA 5BNOA 3HMYA 4IEPA 1GOGA 3U10A 1MZFA 5C3OA 5LA0A 1PIV3 4RSUA 5DG2A 2ZAHA 4DY3A 3WG4A 5H9SA 1C57A 2ZHLA 3IBMA 5DDJ1 2DYCA 4LOTA 3SMHA 4EN7B 3I59A 5EQUA 4OQ9A 5F9TA 3HPNA 5DUUA 1KDMA 1UD1A 5FV3A 2PHTA 3ZYBA 2R32A 4AEDB 1V00A 1SHWB 2XJUA 4H14A 4RFRB 3WSOA 5JUVA 2ZGRA 2G19A 4XHBA 3ACGA 2ARCA 2XB6C 1L7LA 1VAMA 3OBRA 4QU1A 1YJLA 1WA6X 4YVWB 1FMD3 3I3QA 3MLJA 3OG2A 2FZ1A 2X09A 4OZOA 4EZHA 4CP9A 1VBA3 2VW0A 3ETQA 2VQTA 2BERA 2J1EA 1WLWA 2OUHA 1ZRDA 2BWAA 1W2UA 1WZXA 3DPRC 2CGOA 4L97A 5IK4A 1UMHA 2OT7A 2JDAA 5CZKA 4DIQA 2FD8A 2CU5A 4Q4Y2 1ZYBA 2HLEA 3AP4A 3NAPB 4FBFA 5FP7A 5KXDA 1JZ3A 1FATA 4LUKA 4BE3A 1DGWX 3KD4A 4XF4A 1OURA 2BU9A 2PAEA 5ANQA 3ZXAC 1KEXA 2J1AA 5L9VA 2N7GA 2W2IA 5LB6A 3ZFFC 3MW4A 4IV3C 4XURA 2VU9A 3B5LB 4MG2A 3O14A 4M3CF 1EP0A 5CYYA 2OW4A 1POV0 2C5DA 3KMHA 5K7PA 3FBMA 2BNOA 3DKWA 1C5IA 3MIDA 1YLLA 1DHKB 4D69A 3N36A 2ZOEB 3JBG3 3WT3A 2BUKA 2GC0A 3KLSA 5K0UA 3THDA 2GMEA 4COUA 1F4AA 1L7RA 2GH8A 2JECA 4JC1A 4IV1B 4FFIA 5A7WB 4BXFA 5KC5A 2W3JA 4AR2A 1OD3A 5BNNC 2V4VA 1W0NA 2WZ8A 1QWRA 2CGNA 4KU7A 1RJ7A 1W6PA 2B9UA 5HI0A 5IHRA 2JB8A 4IEQA 1PGL1 1YEWA 2DUPA 2VZRA 4Q4W2 4BU2A 4AHWA 4LK6A 2OA2A 2YB7A 4YFWA 3W5NA 2O14A 4N9HA 2GP3A 1ULDA 5FXWA 3VBFC 4WM7C 4YGEA 1MR5A 2WSUA 4XF3A 1ENQA 1G7YA 3KCCA 3P6BA 3SQOA 1EAH1 4HETA 3T1LA 4RS5A 3M3QA 4NPLA 2Y26A 5ACA2 5T5LA 5JAXA 3M3OA 3C7FA 2A1XA 3OGJA 5FQ0B 3RZJA 5EJ3A 1JYXA 5FY5A 1H8TA 4P5HA 4QHBA 3LEKA 1W2OA 3WF4A 2GC1A 2ZGPA 4D7YA 5F1RA 1X9TA 1BMV1 4CP2A 2RS32 3ZX7A 3AMQA 2ZZQA 4JQRA 1V0AA 1DYOA 2VNOA 3VBHB 2A3WA 3JD71 4AXOA 2VMFA 1DFQA 2XKPA 3DPRA 4O61A 4YW6A 4UF0A 4RFT0 4QX8A 3M3IA 4BIOA 1A34A 3LEIA 3G6JB 3VB9A 1RUE2 4YM1A 4BOWA 4XFGA 1PM4A 3ROUA 3RQ0A 5FP9A 3O1SA 4KG8A 4R52A 1KQRA 1LOBA 4PI0A 4COVA 5JMOA 2AYHA 2J1UA 3IDEA 4IV3A 3ZFFA 3BIEA 3SCHA 1XNBA 2NN8A 3LDKA 1S55A 1HN1A 3THCA 1A3KA 1FOD2 1NZCA 3DN7A 3DL3A 5A7OA 2UURA 4INDA 2A6WA 3VHRA 2FDHA 1R1ZA 3PIGA 4FXKB 1FNZA 2PTMA 1R092 4PCRA 2R063 3P3NA 2R6QA 2XJTA 1JUHA 2OQ7A 4XTMA 5FPBA 2DCTA 1RUNA 3TN93 4GWMA 1CAWB 1DYKA 1ZRRA 5T3NA 1RUG1 1DQ0A 2GSYA 1XYOA 4Q4X1 4EN9B 3FX3A 2Q8CA 5BNNA 3GZEA 3ZFGB 4K20A 2R072 1X33A 1PMJX 1U5IA 4RGGA 5FZAA 4Y4YA 4CPBD 5GKAC 1K3IA 3R0RA 2KR2A 2Y34A 1VBD2 4QPGC 2VAUA 1X7NA 1UU5A 5CIRA 3JZVA 5HV4A 5AC93 3U11A 3GZTB 1MPXA 2VL4A 1WMFA 1NXD1 3E1F1 1J58A 2XUMA 3MIHA 4XXAA 4CEYB 5FWJA 3LF7A 5IJRA 2K46A 5F7UA 1C4RA 1KXGA 4UWDA 5DUWA 1YCIA 4QD2A 1GZ9A 2KD7A 2ZX4A 2QQLA 1ENRA 4E4SA 1AXZA 1QJY1 4YZ1A 1V6JA 1EY2A 2JD4A 3LPGA 3VBRC 1RVF1 2XQXA 5JSPA 1SDWA 3A0NA 4N9IA 1NG0A 4P5YA 4CCEA 4NUBA 1CAVB 5A32A 1UU6A 1VIWB 2ZEZA 3C7GA 1DQ5A 1W8FA 2Q4SA 3MF6A 1KFXL 4KBZA 3WOGA 4XPVA 4GMP0 3LOBA 1FNYA 3VGIA 3S30A 1PMHX 1OD5A 2Y8KA 4XJ9A 4CU8A 1JU3A 3MBWA 3VBUA 4NPRA 3AYEA 4CEWC 1ULPA 5JXIA 4JKMA 1XC6A 1AYN2 1UQXA 2FCVA 2WS92 3AFKA 3I2DA 4NIAA 2A6XA 3U78A 3UT0A 4AVAA 2WWJA 1DGRN 1OA4A 4RHV3 4GALA 2XG3A 2BVVA 1NLQA 3NL1A 4COZA 1O91A 3EBRA 3WNPA 5CKNA 2HWC2 1RUF2 1N1SA 4NJ4A 3AZWA 4YLZA 1SFNA 3M70A 2QQVA 4NHYA 2QKDA 3B00A 4ZONA 3S5QA 2Y0IA 4DEQA 2JD9A 1PK6C 3LDBA 4PI2A 3GZAA 4XC9A 1UY1A 5IVCA 1GBGA 2ORXA 3BVCA 3R6SA 1OUSA 1ZZ8A 5HXMA 1JS9A 1FV2A 4IE0A 3S7IA 5FXXA 5F6LB 3V65A 1I5PA 2O8QA 1LR5A 1QJEA 3UGFA 1W6MA 4D6SA 4F3JA 4QPGA 4LBMA 4OMDA 1VBE3 5T52A 3CJIB 3H1MA 4UT5A 4ATEA 4E4ZA 3FUOA 3ZKUA 2YC2A 2ZGSA 2RDQA 3M3EA 1BHGA 1AZDA 1E57A 2WC2A 1CPMA 1PO12 1QJX3 5A1FA 2BBVA 5IVVA 5FIXA 3V0BA 1RUH3 5A3MA 2A75A 3GCXA 5L73A 5FRAA 3USUA 2OS2A 4WVZA 3WF2A 3AB0A 1SEFA 5FJHA 4BMEA 2ZZJA 2P6CA 2IC1A 2VMHA 1O6UA 2VUJA 4E2GA 2VNVA 4LKDA 3BTXA 1AR71 1AR82 1XYNA 4A6OA 2HBTA 4C1WA 4BWOA 2J1VA 2QBXA 1HQNA 2RJKA 3M7AA 2YC4A 4RS5B 4XFBA 1ULCA 2JDPA 5T55A 4XBQA 2YU1A 1CR7A 3I2OA 2QQNA 4JDNA 1LOEA 3IZOA 1H8TB 3IAPA 3AMNA 1K5MB 1QXRA 3POEA 2LRPA 4P9IA 5C3RA 4N8MA 3LGRA 1Q43A 3HEIA 1WMEA 4A41A 2ADDA 3D0JA 1S2KA 4MGSA 3INAA 5C8CB 4MADA 2P2KA 4RQPB 1Q8SA 4JX0A 4HKOA 2RS11 3EB7A 4PHZA 4NRPA 5C3SA 1PO23 4I01A 4CEWA 2NLRA 5F3CA 1RUD3 5B4XA 3D6EA 1JYCA 2R042 4BQ5A 1QMJA 4OCTA 2B46X 1DLCA 4XEZA 2WZPP 1QKQA 1GMMA 3ZYJB 4LE4A 1R1A2 4RN5A 2GNBA 1QJFA 4ES9A 1GYKA 4KWJA 2BYVE 2ZGOA 5JDBA 2WNVB 2XLFA 5DAQA 1I3HA 1R083 2RDSA 2XBO2 1S0IA 1U5ZA 4FCAA 1UYXA 4GH4C 4MYEA 4B1LA 2Q8EA 1ALYA 1T6BX 4F7ZA 1PK6A 1BEV2 4Z8BA 4PF1A 1F15A 5ERLA 2WZR2 3N9PA 1AR63 4RD7A 2DU0A 1EPWA 4OVEA 1JZ6A 2W87A 1N47A 4M3CA 1QGLA 1TQ5A 3N9MA 4R9AA 2VMEA 2ZX0A 5FREA 1XB9A 5BXXA 1JZ5A 1NLSA 4Q4Y1 2PMWB 1B35A 3D4KA 4QQHA 5DN2A 5FYIA 4HL0A 3E97A 1SMVA 4DY5A 4AK3A 4LBOA 1J59A 1A8DA 1LHUA 4JKLA 3O1VA 2D7FA 3LDRA 4I0BA 3VKLA 2BEOA 2P5BA 2YG0A 1PX4A 4HVOA 1JZ2A 1AXYA 3UGGA 1RUJ1 4AFBA 4BM8A 5LA9A 1CAXB 1G9AA 1BBT2 4N43C 4NMIA 4LHSA 1OC1A 1H2NA 3CZJA 5A1LA 5BNQA 1MEC1 5K8SA 5JOWA 2AEZA 2VZUA 1DGLA 1VBD3 2QDRA 3ZR6A 2QNKA 1LOFC 4IE4A 3A23A 3VLBB 4Y1XA 4KH9A 4YM3A 4ZPIA 2ADEA 3N7LA 2Z5WA 3WXPA 3OYWA 1D4VB 2R7EB 1V6MA 4XJAA 3VHNA 1YFUA 2RJ2A 1US2A 2ATFA 2ZGNA 2CYFA 3A21A 4QGLA 3KV4A 5JZGB 4MO3M 4O65A 4WV8A 2HBUA 2I74A 3TOJA 3PMEA 1HQWA 2HYKA 4UFMA 4D94A 4TN7A 2PLV3 3HBKA 3ZIXA 3T3YA 4U2AA 1SPPB 5DG1A 1GOHA 4ARYA 2XKOA 4QQOA 5L9RA 3FL7A 4QXBA 2Q1FA 3FHIB 3OJBA 1W03A 1LRHA 3K4ZA 4PT6A 1QHDA 3JU9A 5ACA1 4XIOA 2JENA 2VMCA 2V4AA 5FUIA 4BQXA 4RGKA 2VTXJ 4KQ7A 4Y5TA 4ISQA 1AYN3 2HH9A 4KG0A 2D5HA 3LSEA 3IPVA 3NSTA 4Q2FA 2OZ6A 1U5YA 1AL23 1V6NA 1XE0A 4S2FA 3RDIA 1UMZA 1G6NA 2ZMLA 2RS31 3T2PA 1J1TA 2QFEA 3K2OA 4N53B 4YW1A 3NNMA 4R4XA 1CONA 5CKMA 3AFGA 2HWC3 2G1MA 2DCKA 2YGMA 4XQWA 4OULA 1IS3A 4FFGA 3U75A 1WBLA 2TUNA 3ACHA 1OOPB 1IKQA 3H9AA 2QQMA 1W6OA 2EXJA 3P1IA 4BA6A 4I02A 1UIKA 4K21A 2XJPA 1V9U3 3ILNA 1CGPA 5HPOA 2XDVA 1Z7S3 3E5QA 3ST7A 2WLQA 4AAXA 4CRQA 3E5XA 2VZ1A 3KSCA 3AXEA 4NVPA 1OQEA 4Q0PA 5C5TA 3H3LA 5D21A 4AI1A 5FYBA 1E5HA 5LY2A 4N43A 4CP0A 5I91A 1ZX5A 1I5ZA 5FYCA 2ET7A 5BV6A 3LAGA 1JOPA 1W3XA 4XMIA 1FPN3 2P34A 5DUXA 3WF0A 2K2SA 2DUQA 3GBWA 4A6SA 4A45A 5GZEA 1GZCA 1ZA4A 4AHYA 4DRVA 3EYPA 4URAA 5CG8A 1LOFA 3JQXA 3VZNA 2NZ9A 4LEJA 2KM2A 4HZFA 1CX4A 1WUVA 1XNCA 2P4EA 4P9XA 4E4HA 3WY6A 3PLQA 2JG8C 2CNAA 2QCSB 5EWSA 4ZU7A 1G9FA 4IEXA 2R071 1POV1 4AI2A 4FAHA 3HBZA 3BTZA 3ILFA 2IWGB 5JI7A 5TSWA 3WW4A 5FO8B 1PGL2 3EHKA 4LO4B 3DUIA 4LBKA 5LRSA 5FPLA 3J8F1 1UPIA 5GALA 1VLNA 4IEVA 4HK8A 1C28A 1LU1A 1SFYA 2AUYA 4UW4A 3ES1A 5FZ6A 2R0FA 1MS4A 4HG6B 1S0CA 1DYPA 3D8CA 3W20A 4QXHA 4RGAA 1CIYA 3BTYA 2QZ3A 4AHXA 4QX1A 5LASA 4HT1T 1GZWA 3C7OA 2DWRA 4LIUA 5FZ7A 1RXGA 5C4WC 1ZRIA 2LROA 4JHZA 1JTZX 2XJSA 5LCWL 3B7MA 4P14A 2BGCA 3RZGA 1OLRA 2R49A 2DTYA 1CD3G 3IMNA 2F4LA 4IESA 3THTA 4CXWA 1R1A3 1MVQA 4JGZC 3SEEA 1YYNA 3G7DA 4WM8C 4XFFA 2RM22 4Y5Z0 4CDXB 3JD72 4Q0UA 4DUWA 5DZEA 1QH6A 3R4UA 3PIJA 4MGYE 3WDVA 3BCWA 1MS3A 4MLOA 4HANA 4XUQA 1XYPA 2WBKA 3H8UA 3OPTA 5LY1A 3T0AA 2VZPA 2VUCA 2WS91 4LMFA 4PBPA 2XOMA 2ZHMA 4MUVA 4W6WA 4NROA 3TB0A 4ES8A 2WFF2 1RHI1 4N7IA 3AKPA 2RMU3 4JHTA 2CL2A 3RI8A 3VKMA 1O59A 2RS52 4UW3A 4ZS2A 3T08A 2WN2A 1BJQA 2H0VA 2Y6GA 3PJYA 2A7AA 2WN3A 1O5UA 3BYWA 1F4HA 3AKTA 3VBSC 3LQCA 2ZHKA 1HB3A 3IT8A 5C33A 3PU3A 5J37A 1SACA 3N3HA 2VXRA 3IAQA 2XR4A 2BZDA 4SBVA 1WLTA 1QNYA 5BYNA 4EQVA 1NY71 2O0OA 5I93A 2JG8A 2RG4A 5IVEA 3MDPA 2NP0A 3LPFA 1V6KA 3KB5A 3BTAA 4MHRA 2D40A 3RSJA 3H8RA 4YW4A 3VBHC 4XJWA 4M3CE 4HXCA 3S7EA 1GANA 1OVSA 3MFAA 4AQ6A 4JGYB 1GR3A 4MGZE 1DU3D 1TMF1 4AGVA 5KXCA 1AX2A 1ND3C 1VBC2 3O7OA 5E1RA 2AREA 3RZMA 2XJVA 1S2BA 4W8JA 2PHUA 2WR9A 3H42B 1IG3A 3MV01 5C7GA 1QJY2 4Q8KA 1C8NA 4QWNA 2BP6A 2FBEA 5DDJ3 1RVF2 5JOYA 1UOBA 4YG6A 1AR81 3OPZA 2ZPXA 5CA6A 3AX4A 4OUSA 2DFCA 4ZXKA 4Z92B 4FO9A 1W2TA 3KT1A 3GF6A 3MW2A 2WWUA 3MFCA 2PHLA 3HWJA 4JGZA 2IXLA 4WM8A 5FYTA 5FZCA 4AEJA 4BMBA 1IPSA 1US3A 3J7NA 3VDAA 1OFSA 1YQ5A 4QKDA 1J1LA 1UYPA 2WA3A 2YBKA 4JZRA 1UYZA 3AYDA 4E8DA 1AYM1 4CPBA 3RZLA 2R041 4TXWA 1OKOA 5DAXA 1UY4A 3VDDB 4XZPA 3LWCA 1KDKA 3I2JA 1N1VA 1WMXA 3T09A 1ACCA 5EP9A 3E6CC 1RC6A 1UZVA 1CJPA 4EE2A 4PIZA 3QLQA 3H0OA 4Q29A 4CP1A 1RUC1 3R4SA 2VNGA 3NJZA 5A33A 4YW7A 2ZBJA 3WW2A 1OA3A 1OHFA 2XBO1 1W0OA 3VBSA 5DZFA 1PGW1 2XMLA 1V6OA 3AYAA 4GD4A 4CVUA 1MS1A 2R1BA 3APBA 2VCAA 1ULFA 3DV8A 1BK1A 3VD7A 1CAUA 5FZMA 3ZYGA 4FPOB 1ULOA 1VRH2 4OI1A 3ZFEC 3UJOA 3LZZA 3CU7A 3JUUA 4PLMA 5FMBA 3CZUA 2CDPA 2TNFA 1NE4A 2ZABA 1PGSA 1MS9A 2WDBA 1GP5A 1U5XA 1X8MA 1MZ6A 1UOGA 2ENRA 2EIDA 3DYPA 4IGOA 4Q8LA 5E88A 1PNFA 1UYYA 1ND2C 3AMMA 3DECA 4Y33A 1KFUL 3ASIA 3WP5A 4COYA 5BUVA 2V09A 3O1RA 2RJLA 5T5JA 1ND3A 2R16A 3TEXA 1OVPA 2BWCA 2E6VA 2WNUB 1PVC1 3WVJA 5FDBA 3LA3A 3U07A 5E8AA 4KGGA 3WG1A 4PBOA 3KM5A 4QDRA 4FOYA 2JIJA 3D3AA 4FPEA 4AHZA 4CDUA 3DEMA 1EAH3 4XF0A 1QXPA 3SH5A 1KGYA 2K0GA 2MHFA 5I0TA 4UFKA 3VZJA 4AGRA 2VW2A 3POYA 5J36A 3T2OA 2QDNA 2NYYA 3LEGA 4NAOA 1JHNA 3MICA 2RS12 5D8AC 1HRI3 4YW3A 2ZKLA 1YRZA 5JSRA 2MNGA 4DXSA 3PUQA 4DUVA 2XVLA 4A7KA 5BY5A 4KWLA 1UZYA 4GXLA 4XOGA 2EXHA 3PURA 2EICA 1LOGA 1Q8VA 2YFUA 2IXHA 2C9KA 4EN0A 4XQDA 2DURA 3ENRA 1UWWA 1QF3A 3SXWA 1SQ4A 1YNAA 5KR7A 1GWLA 1CJDA 1UL9A 4J6GA 4PDWB 5FZOB 3RNSA 3EQEA 4UI9L 4B3NA 1CWPA 2VM9A 3WNMA 5CFCC 1NCRC 2ORZA 5FZDA 2JKBA 1H8VA 2H6CA 4LBQB 1WCUA 5C70A 5FUNA 5CB7A 3URFA 3K3OA 4AVBA 3EXUA 4AEMA 3Q8BA 4OQ8A 1GWKA 2LW8A 4QGMA 1REFA 3ZFEA 1QOSA 2Q5TA 4XJUA 5EXOA 1XE7A 3DCQA 3I2IA 4MZUA 1ASJ3 4TLGA 2VZTA 5I0SA 4MV2A 3AP7A 4JVAA 2HKXA 2IVIB 3VBOA 1MZEA 5HV0A 1Q3EA 5M0TA 1RUG3 1RUJ2 4GJZA 4Q4X3 3U37A 4YFZA 3MGUA 1UO9A 1MEC2 5GLUA 2MPFA 1UX6A 2QZ2A 2JKXA 2ZGTA 1NXMA 5L7OB 2A6YA 3ZYIB 4AVTA 3S5AA 1W6NB 1RJ8A 2MEV3 2ZACA 4W6XA 2DU1A 1O3RA 3SLIA 5K9YA 5JCTA 4XCBA 1W3VA 3ZSMA 2H6BA 4QGNA 5HCHA 3D5OA 5T5OA 5KHGA 5FYMA 1W2AX 3H7YA 1Y9GA 1OPMA 2VPVA 1RMU1 2CHHA 2VZVA 4OHYA 1LEMA 2I45A 4UFHA 2WLPA 1VP6A 3LIGA 4RR3A 4HVRA 5FZLA 2ZAAA 2D44A 1LNSA 2B42B 5LRRA 1RVF3 5CU1A 1PM7A 2UY8A 2GZWA 4LA2A 2DVBA 4QX3A 1JUIA 4AF9A 4XJZA 5FPUA 3B94A 4OUEA 5D8AA 3GZUC 3T0DA 3HN3A 4WZFA 2A73B 1TME1 2NM1A 5FZEA 1DCSA 2VNRA 5LWBA 4M0HA 4AVVA 4XUNA 3QD6A 4B7KA 1HRV2 3ZM8A 4A4AA 3E5UA 5IT6A 1JYWA 1TZOA 1RITA 4I3GA 1YIPA 3ZSEA 1DBNA 3AP5A 2G9ZA 2P37A 3W5MA 5A3WA 3AP6A 1G8WA 3MIFA 1OXCA 1C8M2 2ZJCA 3BU7A 4GB33 3KT4A 3HN1A 1ZVFA 4NOTA 1RTVA 5FAXA 4CCDA 4Q0QA 1GNYA 1Y7BA 4KI5M 4M01A 5A33B 5CFCA 1NCRA 3I49A 3OEBA 1ZBE1 2RM21 2Z69A 3AMHA 4L2NA 4CCKA 4DEVA 5FK8A 2VVEA 2W1WA 1OQ1A 3W58A 3AMPA 5FZ4A 4CXXA 4META 4FPHA 4K8FA 2ZX3A 3FJSA 3K51A 4EN8B 4LHNA 1AR93 5ABJB 1PVXA 1YI9A 1EV13 2I2SA 4KNCA 3M3CA 3IWZA 4F8AA 3C3VA 4FOQA 1YFYA 2YPJA 1YC61 4K8RB 1JOJA 5G04L 3K4DA 1PIV1 5KHHA 3VKOA 2WFF1 2X53S 4PLOA 4OI2A 1K45A 1RGSA 3DXTA 5H9QA 2E7QA 2RS51 5FP3A 1L7QA 1W9WA 3FMGA 4PIYA 4XFCA 3J7LA 1O3QA 4ET7A 2VBBA 1UKRA 4GIQA 2JG9B 4XVHA 3ZSKA 4XACA 5FUPA 3AL5A 1NA1C 4K1ZA 2D43A 4PF5A 5LEKA 2HWD2 1W05A 1OH4A 4XAAA 2WAAA 4HMZA 4XFIA 4D8MA 5LBCA 1VBA1 2PHWA 4O7XA 2TBVA 1O3SA 1J3QA 3JB4C 4R8HA 5FZ9A 1AR73 2XH6A 4FTSA 1NQDA 4CDUB 3J8F2 3B9CA 4FP2A 4R9CA 3TNPB 2V5YA 4CCOA 2ARAA 5BNOB 4DNYA 1DGRA 2PELA 4OHZA 3NJVA 2A70A 1X8EA 2AR6A 3DF0A 4MVTA 3VBFA 3BU0A 1VBC1 2Y6HA 4WM7A 2FDKA 4MGTA 2PFWA 1CPNA 1T2XA 2UU8A 2VCMA 3I59B 4KMQA 5DAVA 4OLLA 4XZUG 3OF1A 1KJRA 2GC2A 2BW8A 3BOWA 2VMIA 4LR4A 1W8TA 4Y3OA 4FQ4A 3AZZA 5IW0A 2HEWF 2QQIA 2W68A 3LFMA 1F8VA 3I2FA 5GJ6A 2YV8A 5IFPA 1C3HA 2J1TA 4UOJA 1FX5A 1RL3A 4CP9B 4J1WA 2FDIA 2JWPA 5AVAA 3VD3A 5IFTA 2WT0A 2P3JA 4LTAA 3RYRA 2JE8A 1GV9A 1UMIA 1QJZA 5FZ3A 4NPMA 4IDZA 2W47A 3ZSLA 4H7MA 5LA2A 2G9GA 4QAWA 4MGIE 4QM9A 2WINB 3O1UA 1Y3TA 1O3TA 5FMCA 1GZTA 1RHI2 3PTRB 1ZREA 4C8DA 4JTNA 1GQGA 4Y1UA 4YZ5A 3KGLA 1XNTA 2OQ6A 5GLWA 2I07B 3ZMNA 1J84A 1Y43B 2W1SA 2BGPA 2X5IC 4Q4Y3 3FUQA 4JV4A 4XUOA 2W5FA 2C1FA 1O5LA 1O7FA 4L9BA 3ZYPA 1W8UA 4P00B 3N7JA 1NA1A 1BVP1 2C4XA 2B39A 1NUKA 4Y1VA 3PL0A 1YXWA 5K4LA 4AI3A 5C9AC 1H9PA 2XGXA 3Q9OA 1NY72 1WCQA 2D93A 4PQQA 5AFBA 3QOPA 1LTEA 5CBLA 2YROA 4OI0A 2BQPA 1M4WA 5K0UB 3WCRA 3O1MA 1VRH1 1W28A 2CAUA 4B8EA 2D6NA 4CU6A 1BVVA 4CA9A 4E27A 1GWMA 3GYDA 5FMDA 5FOJB 4UFIA 2O8OA 2WSVA 3AM2A 3OD4A 4NRMA 4AFAA 3KHBA 4BQ3A 1MQTC 2SBAA 2WKKA 3VL8A 2J7MA 3USSA 1WW5A 1M06G 3IDAA 3ALQA 1W6PB 1TMF2 4JCKA 1E5IA 2ZHNA 4BDVB 3J4UH 4YZ3A 1ZRFA 1W9YA 1O8PA 1D7PM 2GN3A 1W8OA 2BNMA 5I8YA 4GWNA 4Q4W3 1IKPA 4BHPA 3NKTA 3VBRA 4XMAA 2CTVA 2HYXA 4SLIA 4B4RA 4L92A 3RS6A 3N9OA 2VOVA 5FPVA 5GLVA 1AL0G 3GCWA 1GUIA 5FZIA 5ACA3 1WD3A 1UKGA 4MXVA 1W6QA 4QQPA 2YY1A 1W99A 3TN91 1S4CA 2VVDA 2ZEXA 4Y20A 5FMOS 4UBHA 2XVKA 1EYBA 3A4UA 4YZ4A 1AYM2 1DG6A 2RS33 2ZGMA 2ZX1A 1PX3A 3DPRB 4UF0B 5FP8A 4AI0A 4CDWC 4CDQC 3HT2A 4CU7A 5ISLA 3WDYA 3IDCB 1H1MA 1LENA 1U0AA 2E53A 4Y22A 2JX9A 3T0BA 3WDUA 3WQ1A 2D6LX 5J98B 5FR3A 1WCDJ 3B01A 5CFDC 5IK5A 5JXJA 2X5IA 1RUC2 5C3PA 2VQ0A 2ZCWA 4RL7A 3N7KA 1QQP2 3K77A 4MXWA 1RUE3 3ZFFB 3POGA 4IV3B 4TZDA 4IE6A 3DGTA 4LUMA 2W52A 2WT2A 1JMUB 1PGW2 1VJ2A 4LLFA 2ZMNA 4NIIA 3WF1A 5C5UA 2QQUA 4QX0A 5FWEA 2HWE2 1GKBA 1JXNA 2ZGKA 5BNPC 1VMFA 5C9AA 1HN0A 3NV3A 1FOD3 1ZNPA 2DBNA 1K42A 1RYYA 3FC0A 5J3UA 1XPWA 4EV0A 2W91A 5JOZA 4FAGA 3LKJA 1YUDA 2PQSA 3BGAA 1PZ7A 5GZDA 1R093 3CL1A 3LCPA 2Z79A 4QPIC 3AZYA 2VC9A 3HIFA 2AENA 4QB2A 4Y26A 4YYOA 1QJU2 4D3WA 1MQTA 1SG3A 5BNNB 5FOBB 1ZBA1 4FTBA 4GKYA 3PVNA 1VBB2 5IVBA 3RVHA 3OPWA 1KJLA 1SBDA 2NMOA 4FPKA 5FY7A 1H0BA 4D6RA 2R073 4V2VA 4QKBA 3TNQA 2ES3A 4AI8A 3ZXDA 5DAPA 1HB2A 1PVC2 2HWB2 3BN6A 1LHVA 3J8F3 4RHV1 4V1PA 4Q4V1 5CVRA 4CCMA 4WM7B 1K12A 4XILA 1X50A 2PN5A 4JKKA 2E32A 4QM8A 3LSDA 3FHQA 4WZCA 1WCSA 1F9KA 3WW3A 3V64A 4S2DA 1FV3A 1SBFA 2V5DA 5FZHA 4QHOA 4IGPA 3RFRA 2JJ6A 2V72A 1DGWA 4FFFA 4Q0SA 4WVMA 3FWEA 4LORA 4XFAA 5A32B 5SV5A 1OKQA 3ZN6A 1MACA 1NCQC 4FPJA 4DOUA 2YDEA 2D6PA 2LS6A 4CDWA 5CEHA 3HAGA 1NAEA 1VBE1 5GM0A 4BCUA 4CDQA 3SNMA 2VZSA 1UY3A 3VBUB 5KHJA 1DF0A 1AF9A 1HRV1 2JDZA 4DUXA 5FTTC 1LESA 1APNA 1YQ8A 2WYFA 3AKRA 3O1PA 2Y38A 3GGLA 4X6RB 3O0VA 5CFDA 1F35A 1JBCA 1KS5A 3AZXA 3WG2A 1RUH1 1W9FA 2B8MA 1CZVA 4QB6A 4AVCA 1QOTA 2WS93 4GH4A 5HCBA 3N35A 3LOIA 2ETEA 4BH9A 3HD8B 3ZOIA 1C8M1 2AACA 4ZS3A 3TBDA 1G9DA 4B4PA 4ZKTB 5CADA 2OXBA 1RUI2 2JDYA 1Y4WA 2WNUC 4YVSC 5BNPA 1HXS1 1RUF3 1RXFA 3VD4A 5IWFA 1OH3A 1CIWA 4HOOA 1VB4A 3FHAA 1QH7A 2CDOA 4PLNA 1W04A 2DCYA 2EIBA 1U12A 1JODA 1OFNA 3W59A 1GNZA 4GJYA 2WAOA 3VL9A 1LJ7A 1XJAA 3K48A 5EYYA 5SV8A 4QPIA 1ZZBA 3HNBM 4XDOA 4JDOA 1JYIA 2VUAA 3VHPA 4B7EA 5FCCA 3J26N 2ZS6B 3ACFA 5A7NA 2BOJA 2RR11 5A1AA 1KRIA 1W6MB 2YUEA 4QPGB 1RUD1 3OGRA 3UV9A 5FZBA 1LGCA 1ZZ7A 3NO8A 2A3YA 2NQYA 2VZOA 4AEDC 3V0BB 3IMMA 1W90A 4JTOA 1WGPA 3PVBB 2HWD1 1W06A 5F6KA 3T1MA 2GMMA 1PO13 3ES4A 3OUHA 1ZM1A 4X8NA 4KU8A 5FBZA 5GLZA 3USUB 3R05A 3V0AA 1R081 5EPAA 5F39A 1RMU2 2D6MA 2ZGUA 2OPWA 4P9LA 1PHMA 4YVWC 5J96B 3PUHA 2WNEA 4UAPA 5JVVA 4FVVA 4DB5A 1O4ZA 1GU3A 2R1DA 3NNLA 1F5JA 4HBNA 4I30A 2RDNA 1W8HA 5FY4A 3SCGA 2PHDA 2YHJA 1AR83 3WHTA 3IN9A 5H9RA 2VUDA 1NCQA 3B9IA 3OTFA 1TME2 4IEWA 4LO6B 1O4YA 4HK9A 1ENXA 1QU0A 4KWKA 4HPKA 1JYNA 3MHZA 2Y6FA 3NAPC 3NV4A 5EHDA 1GNHA 4CEWB 4MGQA 2YGLA 4XJ8A 3LE0A 5FPAA 5FY1A 4AFCA 1S0JA 5KXBA 2BNNA 3L2YA 4IW3A 3OY8A 3ZPYA 4TTGA 4AYUA 4DFSA 4YM0A 3FZ3A 3B02A 2R043 1G9BA 3I2GA 3ILRA 1CN1A 2AH2A 2VVFA 4LXLA 3QH6A 4QX2A 1YJKA 1HB1A 3D0SA 2X8KA 3L9JT 3U1XA 4EZ4A 4MXWB 4DQAA 1ZBE2 3CF6E 2C9AA 4XTPA 4YVSA 3WLUA 3WQBA 3FLTA 4Q0VA 2HEVF 3WP3A 4BLJA 3KV5A 1RUC3 4YZ2A 4XFHA 1E5SA 1PK6B 1SDDB 2XBO3 1GFF2 3AP9A 4IV1C 1H4GA 1YQCA 2EF6A 3K3NA 2J42A 4LQRA 2W39A 3I4IA 1E5RA 2YZ4A 1GP6A 1JYVA 1BEV3 5F37A 4H55A 4M3CB 3WF3A 2W95A 4K40A 2VULA 2WZR3 2ZTNA 1PIV2 1UAIA 1UCXA 4BQ2A 1JZ4A 3NJYA 2VR4A 1URXA 3AK0A 2DUOA 1B35B 1HX6A 2RVAA 3WNNA 3UKNA 4FPCA 2OIIA 3VV1A 3UKTA 5FZ0A 2GNTA 3O1OA 3MW3A 2E7TA 3J7MA 3WDWA 1OBNA 1HB4A 4KWUA 2WA4A 4AEDA 1LAJA 2D5FA 3OGVA 1JZ8A 1H2LA 4XF9A 3RJRA 3SCFA 4BQYA 2ET1A 1FMD2 3PVOA 3OOXA 1QEXA 1BBT3 1H1IA 2IXJA 3AZVA 3Q8EA 5JXHA 1VBA2 4YVWA 3OGGA 3EJKA 3PMSA 4XIKA 1AL21 4XAEA 5IVYA 4DRRA 2XPJA 1MVEA 1PVC3 2QQOA 1NT0A 4XE9A 3SKVA 2IXCA 3ACLA 1WW7A 1REDA 4ORFA 3KQ4B 4K9SA 3GJAA 4CE8A 3ZIWA 2D3PA 2R30A 3OYWB 4YWAA 3FBYA 1XRUA 1QY4A 1BK0A 1BYHA 1G86A 1LU2A 3AC0A 1GP4A 1V9U1 4MOAA 2ZKNA 2QQPA 2OVUA 1Z7S1 4D7SA 3NAPA 4P9GA 3P3PA 4AGGA 5EIYB 5AVPA 5DQ0A 2PXJA 3HNMA 5C4WA 3U0ZA 5F8PA 2ZGQA 2XHKA 3UGHA 1GQPA 4JRAA 2VTXA 3JBG2 2YPDA 1IS5A 1AJKA 5E89A 2OUJA 2XJRA 5C6CA 4AOCA 5LW9A 4NHKA 4UFLA 5IUQA 1SCSA 3WDTA 3IPVB 5FYSA 4CDXA 4LT5A 2JE7A 4IV1A 2D3RA 4NHLA 4Q27A 4QPYA 4R4ZA 5A7WA 4Z07A 4IXLA 2FDFA 3ZFGC 4OZXA 4ZZ5A 3J7HA 2P1BA 4EROA 1W6OB 4YPJA 3ZN5A 4OHXA 3LIHA 4XQ4A 4AL9A 3BI3A 2CGPA 3BPSA 4G4FA 2GALA 2B7YA 1DQ1A 2UWCA 3AVRA 4A44A 2DTWA 1XNDA 4GMP1 2VD7A 1QQP1 3VZOA 4CEYC 4Z2AA 5IYYA 3K75B 4CUAA 1D2SA 3AL6A 3K46A 5GLTA 2D3SA 2CY6A 4QHZA 5FJKA 5J09A 1XBFA 4N43B 2CWMA 2OX0A 2EVXA 3HVDA 1UF2C 4UW6A 2HWE1 2WO3A 4NR1A 4W65A 2HWF1 2F6BA 5DMYA 3NQHA 1VALA 3RZZA 1XNAA 5IK8A 4YARA 1H4HA 5FQ0A 5J7MA 3RMYA 4AAPA 3VZLA 3MPPG 3I8TA 4IETA 1HW5A 3HQXA 3VBHA 1QJU1 2A71A 2H0BA 1SZBA 1VBB1 5HCAA 3GBGA 1NYWA 2GN7A 5A6QA 3R4DB 3LD8A 3KHCA 1ZRCA 5LBEA 1DZQA 4LBNA 3UESA 1L3JA 2BGOA 4I2OA 2FZ2A 4M0NA 1RIRA 5DZGA 1LHNA 2HWB1 1DQ4A 4LA3A 3RZKA 3FE5A 5JIAA 5A6XA 4N90A 4PIXA 1K5JA 3EMRA 3K4AA 4KBBA 5I0RA 5KHIA 3T2QA 1H9WA 2ARXA 2XJQA 1IOAA 5LK5A 1H2KA 3I3BA 1GZWB 4HN1A 4Q26A 4C0BA 5GZCA 2KA3A 4AEKA 2R062 3BB6A 1X9PA 4QMAA 3KZ4C 5FZKA 1VB2A 2IUWA 3TN92 1VR3A 1WBFA 3MI8A 5L36A 1FXZA 5FLJA 2X10A 4EWDA 5DUVA 1CAWA 2OPKA 3ORJA 4LE3A 4XYXA 3NVCA 1D4M1 1AX1A 1UOFA 3ZFGA 4ASLA 1H1AA 5JPNB 3PDQA 2RM23 3JD73 3ABZA 2VGDA 5AC92 1MS5A 3S6PA 2D97A 3BOPA 3POJA 3CJIC 2PHRA 4BQ1A 1WKYA 4FOVA 4H2AA 4AQ2A 2XONA 4ZXEA 1JZ7A 4E2QA 2E33A 3I97A 3VD5A 2Q1MA 3WG3A 2IXKA 3JXSA 1W9TA 4I09A 4CEYA 1S2EA 1QDOA 5FK7A 3WEZA 1IZ3A 3RRDA 2WFF3 2YBSA 5JIUA 4S2HA 1AUYA 1J3PA 4XCAA 4HN0A 1LGBA 1RUI1 1RB8G 2RS53 3TRSB 3B93A 2WRAA 3T4HB 5FBJA 1BKZA 4L8QA 3CO2A 2EXIA 4RS5C 2WO2A 1FI2A 1WLCA 3WCSA 3VD9A 4FPGA 1CAVA 1GSLA 3MYXA 3WUDA 3VZKA 2J1SA 1H8TC 1K5MC 1H2MA 2JG8B 1GLHA 2Y0OA 1ZBA2 2BFUS 3H7JA 3VKNA 1VMJA 3KF3A 5EJ1B 2WABA 3NRUA 4K3UA 4XDPA 3AKQA 4IEOA 2XWJB 5C8CC 1ND2A 1RINA 4RQPC 3C8XA 4FOWA 4GKXA 4CUCA 4LLOA 1XE8A 1HDKA 2D6KA 5HBAA 4FQZA 5JSOA 1HLCA 2E63A 4RHV2 1H6YA 3WV6A 3SISA 4Q4V2 2VMGA 4HSJA 4GA9A 4NRQA 4CSWA 1WMDA 1IPJA 2BVBA 5FY8A 3O0XA 1N1YA 1PMIA 3WDXA 1QOOA 2JDMA 2WNVC 1AVBA 1VBC3 3UKVA 4NE9A 2GAUA 1R64A 3OUIA 4M00A 2JICA 2KXLA 4NWWA 5C4WB 1X82A 2YC0A 4LKSA 1QJY3 2SLIA 3CMGA 4JRLA 4KGQA 4ONUA 3O12A 3HR9A 4TLFA 2VMDA 1JI6A 4ASMB 1ENSA 4JGZB 2FMYA 4WM8B 5KXEA 3I3DA 3F95A 4UXAA 1I6XA 1S0BA 4XBLA 5KWRA 1N3OA 2DVGA 2VH9A 2UYAA 3ELNA 1NOVA 5A3LA 3RYKA 1OI6A 1VBE2 5F3GA 1IQAA 4AFDA 1OSGA 1W9SA 3MIBA 1SLAA 4FXGB 4A3ZA 5E16A 1QJX2 4AQSA 5LZ6A 3CJIA 2DVFA 1RUH2 4LULA 2W1QA 3E6DA 3SITA 4DO0A 3NNFA 2FMDA 1COV1 3C7HA 2IFWA 3PUAA 3QACA 2OKXA 2VZQA 4AQTA 4JQTA 5JMCA 5JR2A 3GDBA 3C7EA 3D82A 1HXS2 4LJHA 4QX7A 4YGDA 5EV7A 3VBSB 3CHXA 3MIEA 3ZN4A 3POIA 1C5HA 3CBNA 2UY9A 3CIHA 4LBQD 3W21A 2GC3A 4D6QA 2UYBA 1HV1A 3H3ZA 1AJOA 1CAUB 1SCRA 3PTYA 2VECA 4BIFA 1MS8A 2XLGA 4P08A 1K5MA 5APAA 5F3EA 5F2WA 4ZU5A 3IKWA 3WNXA 3E6BA 2CAVA 2RR12 1HRI1 1VRH3 4BYYA 1PO22 4EWEA 5JZGC 1XQNA 2Y60A 3DYOA 1RUD2 3N7MA 3VDCA 4AI9A 2AC1A 4WVWA 4CZSA 5B2GB 4RQPA 1PNGA 5C8CA 2ZA9A 5JPMB 3I3MA 2C6SA 2DVAA 3WINE 1T6GC 3MUZ1 1F2NA 1YWKA 2BDRA 2BV4A 1D2QA 4E8CA 3AKSA 2GDFA 4HKWA 3UK9A 5T5PA 2DF7A 4FT8A 2Q8DA 3VBUC 5IAXA 4IQPA 1ND3B 3NMBA 4BK4A 4CUGA 1R082 2OZJA 1FMD1 1Z0HA 4PJYA 2WNVA 4K1YA 1OLMA 3P5BA 5H9PA 5L9BA 3RYPA 2PHFA 2WQ4A 3J9SA 3WUCA 1AR62 4NIHA 3CEWA 2Q0AA 3BPZA 1Z78A 1DLLA 5A3TA 4N53C 4XHXA 3OBZA 3C2UA 5FY9A 5C8WA 3WP4A 1OA2A 4PQ9A 5FO9B 4C91A 3ZXFA 3PU8A 2Z42A 2B4KA 1OOPC 4NIGA 4D7TA 1SLTA 3WX5A 4CCLA 1ASJ1 4YSFA 5B4NA 3QCWA 2VG9A 3KCXA 2WZEA 4DPNA 2LTNA 1S0EA 2NMNA 4ZU4A 1STMA 2LM3A 1EUTA 5F5CA 2RS13 4LPLA 3H1YA 2W08A 4Z82A 4CCJA 3ZXKA 1CAXA 1HJGA 5EJZB 5CG9A 2GU9A 1VPHA 3DKQA 5ANNA 3GNEA 5FY0A 3BALA 2MEV1 4A7YA 3JBG1 3RWNA 4HFSA 5DPNA 2BOIA 5FLHA 2ZMKA 1HV0A 4K7JA 3WP6A 3ZYFA 2QQKA 2EA7A 5D2AA 3KF5A 4HONA 1UNBA 1ST8A 3BODA 5LBBA 2R0HA 2GNDA 4CCCA
chains in the Genus database with same CATH topology
3KV5A 4IGPA 4AAPA 4EZHA 4ASKA 2GP5A 4CCKA 2YU1A 2OQ7A 3K2OA 3K3NA 5FPBA 5IVEA 5FZ4A 5F37A 5FP4A 2Q8CA 5F3GA 3AVSA 4IGQA 3LD8A 3NJYA 2OT7A 4DIQA 5FZAA 5CEHA 5FYHA 3PUQA 2XDVA 5FYUA 5FP7A 3PURA 5FZ0A 5F3CA 3DXTA 5ANQA 5FP3A 3KV6A 4DO0A 5F32A 2W2IA 5FWJA 3KVAA 5FYBA 5LY2A 3PUAA 5F5IA 5FUPA 5FYCA 3AL5A 4LITA 5KR7A 4QX7A 5FYVA 4QWNA 5F3IA 5FZOB 5FYYA 3N9OA 4URAA 2Q8EA 5FPVA 5IVYA 5A7PA 5FZKA 4GAZA 5FZDA 5IWFA 4HOOA 4D6QA 5FZIA 2WWUA 5FUNA 3K3OA 3N9PA 4NUBA 4E4HA 5FZCA 5FYTA 5A7WB 5A7SA 5FZ9A 5F3EA 4BXFA 5F2WA 3N9MA 4GJYA 5FZFA 3PDQA 4XDOA 4QXCA 4AI9A 2YBKA 4UF0B 5FP8A 5FPLA 5FYIA 4CCOA 5ISLA 5A7NA 3U4SA 3UYJA 3PUSA 4GJZA 5FZBA 5IVJA 2P5BA 4BU2A 3U78A 2PXJA 5FZ6A 2Q8DA 2WWJA 5A7QA 5FXWA 4EYUA 2GP3A 4CUGA 5A1LA 2YBSA 4QXHA 4Y3OA 3N9LA 5F5AA 3ZPOA 4LIUA 5F2SA 2YPDA 5FZOA 5FZ7A 5FWEA 5F39A 5IW0A 4LIVA 2XMLA 5FBJA 4GD4A 5FYMA 5FY5A 5LW9A 4V2WA 3LDBA 3DXUA 5A3TA 5FYSA 2YBPA 5FZ8A 5FY9A 5FY4A 5FZMA 2XUEA 5IVCA 4Y4RA 5FXZA 3ZLIA 3PU8A 5FZLA 5A7WA 5FZGA 5A80A 4CCLA 5E6HA 5FZ3A 3KVBA 5FXXA 4XDPA 5FYZA 4BISA 5FPUA 4UF0A 4QX8A 3KV4A 3KV9A 3RVHA 3OPWA 3OPTA 3PTRB 5IVBA 4C8DA 5LY1A 1VRBA 4D6SA 5FY7A 5FZEA 3AVRA 5F5CA 4IGOA 2OQ6A 4D6RA 5LWBA 4V2VA 4TN7A 5A3NA 5IVFA 4Y33A 5FXVA 4CSWA 4CCJA 2VD7A 5A1FA 5FP9A 5FPAA 5FY1A 3AL6A 4QXBA 2YU2A 5FY8A 5FY0A 5IVVA 5FJKA 5FV3A 4CCMA 2OX0A 3N9QA 2OS2A 4LXLA 5A7OA 5K4LA 5A3WA 3N9NA 5FJHA 4EZ4A 5A3PA 4CCNA 2XXZA 4HONA 4QU1A 3PU3A 5FZ1A 5FZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  4IGP A;  4AAP A;  4EZH A;  4ASK A;  2GP5 A;  4CCK A;  2YU1 A;  2OQ7 A;  3K2O A;  3K3N A;  5FPB A;  5IVE A;  5FZ4 A;  5F37 A;  5FP4 A;  2Q8C A;  5F3G A;  3AVS A;  4IGQ A;  3LD8 A;  3NJY A;  2OT7 A;  4DIQ A;  5FZA A;  5CEH A;  5FYH A;  3PUQ A;  2XDV A;  5FYU A;  5FP7 A;  3PUR A;  5FZ0 A;  5F3C A;  3DXT A;  5ANQ A;  5FP3 A;  3KV6 A;  4DO0 A;  5F32 A;  2W2I A;  5FWJ A;  3KVA A;  5FYB A;  5LY2 A;  3PUA A;  5F5I A;  5FUP A;  5FYC A;  3AL5 A;  4LIT A;  5KR7 A;  4QX7 A;  5FYV A;  4QWN A;  5F3I A;  5FZO B;  5FYY A;  3N9O A;  4URA A;  2Q8E A;  5FPV A;  5IVY A;  5A7P A;  5FZK A;  4GAZ A;  5FZD A;  5IWF A;  4HOO A;  4D6Q A;  5FZI A;  2WWU A;  5FUN A;  3K3O A;  3N9P A;  4NUB A;  4E4H A;  5FZC A;  5FYT A;  5A7W B;  5A7S A;  5FZ9 A;  5F3E A;  4BXF A;  5F2W A;  3N9M A;  4GJY A;  5FZF A;  3PDQ A;  4XDO A;  4QXC A;  4AI9 A;  2YBK A;  4UF0 B;  5FP8 A;  5FPL A;  5FYI A;  4CCO A;  5ISL A;  5A7N A;  3U4S A;  3UYJ A;  3PUS A;  4GJZ A;  5FZB A;  5IVJ A;  2P5B A;  4BU2 A;  3U78 A;  2PXJ A;  5FZ6 A;  2Q8D A;  2WWJ A;  5A7Q A;  5FXW A;  4EYU A;  2GP3 A;  4CUG A;  5A1L A;  2YBS A;  4QXH A;  4Y3O A;  3N9L A;  5F5A A;  3ZPO A;  4LIU A;  5F2S A;  2YPD A;  5FZO A;  5FZ7 A;  5FWE A;  5F39 A;  5IW0 A;  4LIV A;  2XML A;  5FBJ A;  4GD4 A;  5FYM A;  5FY5 A;  5LW9 A;  4V2W A;  3LDB A;  3DXU A;  5A3T A;  5FYS A;  2YBP A;  5FZ8 A;  5FY9 A;  5FY4 A;  5FZM A;  2XUE A;  5IVC A;  4Y4R A;  5FXZ A;  3ZLI A;  3PU8 A;  5FZL A;  5A7W A;  5FZG A;  5A80 A;  4CCL A;  5E6H A;  5FZ3 A;  3KVB A;  5FXX A;  4XDP A;  5FYZ A;  4BIS A;  5FPU A;  4UF0 A;  4QX8 A;  3KV4 A;  3KV9 A;  3RVH A;  3OPW A;  3OPT A;  3PTR B;  5IVB A;  4C8D A;  5LY1 A;  1VRB A;  4D6S A;  5FY7 A;  5FZE A;  3AVR A;  5F5C A;  4IGO A;  2OQ6 A;  4D6R A;  5LWB A;  4V2V A;  4TN7 A;  5A3N A;  5IVF A;  4Y33 A;  5FXV A;  4CSW A;  4CCJ A;  2VD7 A;  5A1F A;  5FP9 A;  5FPA A;  5FY1 A;  3AL6 A;  4QXB A;  2YU2 A;  5FY8 A;  5FY0 A;  5IVV A;  5FJK A;  5FV3 A;  4CCM A;  2OX0 A;  3N9Q A;  2OS2 A;  4LXL A;  5A7O A;  5K4L A;  5A3W A;  3N9N A;  5FJH A;  4EZ4 A;  5A3P A;  4CCN A;  2XXZ A;  4HON A;  4QU1 A;  3PU3 A;  5FZ1 A;  5FZH A; 
#chains in the Genus database with same CATH topology
 1D0H A;  3TWI A;  4GWJ A;  3WNK A;  3FFQ A;  4NAM A;  1NZI A;  4URT A;  1Q8P A;  1ZA7 A;  1EUU A;  1SLL A;  1W39 A;  3H3U A;  3OB8 A;  3W9A A;  3ZFE B;  3JB8 A;  4JAA A;  2O1Q A;  3KGZ A;  1NLR A;  2QQW A;  3ZYH A;  3MPB A;  1QXJ A;  2PLV 2;  4A3X A;  5JZG A;  3OD0 A;  4YW2 A;  1YQ6 A;  3EO6 A;  4L99 A;  2P3K A;  3VBO B;  4NHM A;  4DXT A;  5IAT A;  5FO7 B;  4LKE A;  5LA1 A;  1SPP A;  3T2T A;  3ME2 A;  1ZBA 3;  1ND2 B;  1O4T A;  1WA4 A;  2VZ3 A;  3KV6 A;  3M4F A;  3M8L A;  1RUJ 3;  4FP3 A;  4AFM A;  4BJ0 A;  4Y24 A;  3U4X A;  4G3Y C;  3IM0 A;  3VZM A;  5JR7 B;  1O8S A;  1DQ6 A;  1V6L A;  4COW A;  5I0D A;  2BFU L;  3BUC A;  1TG7 A;  1MEC 3;  4LIT A;  3A0K A;  3CJX A;  3OGS A;  5FYV A;  2UWB A;  4GB3 1;  1AL2 2;  3A7Q A;  5JI9 A;  4QB1 A;  5HXV A;  1XU2 A;  5FYY A;  4XUT A;  4Q4V 3;  2JIG A;  1ODM A;  2W46 A;  3POB A;  5A7P A;  5I8T A;  2VBD A;  4P9Y A;  2P17 A;  4IL7 A;  4NO4 A;  5EZW A;  4CDX C;  4XUP A;  4N53 A;  2GNM A;  3TYJ A;  2BJS A;  3ETP A;  3GBF A;  1OPO A;  3M1H A;  3NNG A;  3ZXL A;  4RR3 B;  1ZZ9 A;  2VBP A;  1OOP A;  4WVV A;  1AR9 1;  1KD7 A;  1V9U 2;  1W8Z A;  1EV1 1;  1H6X A;  2WQ8 A;  3I7D A;  4MGK E;  1Z7S 2;  5F5Q A;  2CWS A;  3CNA A;  1SFP A;  2JXA A;  5FPX A;  3N4M A;  1PZ8 A;  5D8A B;  4GZ9 A;  1UPS A;  3U4S A;  3LEM A;  4FTE A;  1GIC A;  5IVJ A;  2DCJ A;  4UYB A;  4A7Z A;  1DQ2 A;  1B35 C;  1BLZ A;  3AJY A;  4Y1Z A;  3SHR A;  2L9L A;  1FPN 2;  2A6V A;  4EYU A;  3UNP A;  1LKN A;  4ARX A;  1S1A A;  5JOX A;  3BIW E;  1HRV 3;  2RDR A;  3N9L A;  2Q1Z B;  1V6I A;  4DIN B;  2R06 1;  1I1E A;  3PJQ A;  2YMZ A;  4XXP A;  4QKF A;  4NHX A;  2ZGL A;  4QPW A;  4LIV A;  3IB3 A;  4XW3 A;  4P9W A;  3T30 A;  1AXK A;  2WWS A;  3POF A;  3SKJ E;  4Z1V A;  2G4I A;  2Y6J A;  3HJR A;  4YNI A;  5CFC B;  1NCR B;  1C8M 3;  3Q8F A;  4IEU A;  4OMC A;  2ZX2 A;  4W50 A;  1WCK A;  5FZ8 A;  3THP A;  1DZT A;  5KBF A;  3NV1 A;  1BQP A;  1SLC A;  3GM8 A;  5J48 A;  3GJB A;  2EAL A;  1HXS 3;  4CU9 A;  3H8X A;  4H3W A;  3NV2 A;  4IEY A;  4YGC A;  1REE A;  3KVB A;  2FCT A;  5AC9 1;  3I54 A;  3GHN A;  3KT7 A;  3KV9 A;  1VE0 A;  1A78 A;  4FI9 A;  3WQ7 A;  5G05 L;  3IDB B;  4E9K A;  2C0Z A;  4JGY C;  1VAK A;  1LOC A;  1DIW A;  2VOK A;  5C71 A;  2XL9 A;  4CXY A;  2BBA A;  4IUG A;  5LK7 B;  1LGN A;  4L0P A;  2YU2 A;  3O5S A;  2RR1 3;  3HOB A;  3OCP A;  4XBN A;  2HWF 2;  3LA2 A;  3VDB A;  2VJX A;  4UFJ A;  2Y6L A;  2DFB A;  4C0H A;  4C1X A;  3N9Q A;  4X8P A;  4XF1 A;  4EWA A;  3III A;  1EPZ A;  4MX3 A;  1QDC A;  2XXZ A;  3GXU A;  3NJX A;  4LHK A;  1TVG A;  2HWD 3;  4FSJ A;  2Y64 A;  3MV1 1;  1OT5 A;  4HKL A;  1OUX A;  3PUI A;  1DP0 A;  3POS A;  4RA0 A;  1AX0 A;  2RE9 A;  3OUJ A;  2WNO A;  2D6O X;  1POV 3;  1S0G A;  5A3O A;  4I0W B;  1TNF A;  4S2G A;  4AW7 A;  1NKG A;  3MLK A;  2RMU 2;  2QJV A;  1HKD A;  4YG0 A;  3AXD A;  3WHU A;  4K6B A;  1J3R A;  5I0U A;  2Q8O A;  3WR0 A;  3VDD C;  2A3X A;  2WT1 A;  4LKF A;  3VBF B;  3HNY M;  2E26 A;  4R9B A;  4YM2 A;  4IEZ A;  2E51 A;  1IPK A;  4I3P A;  1CX1 A;  1CQ9 A;  1WLD A;  3B69 A;  2WL1 A;  5F5I A;  1ULG A;  1YIF A;  3OSD A;  2QVS B;  3ZYR A;  4DXZ A;  5KC6 A;  3MZH A;  3LB9 A;  5D1I A;  4QDQ A;  2JDN A;  1Q8O A;  2C24 A;  4M4P A;  4O9G A;  5EYX A;  4B29 A;  1P8J A;  4DMI A;  3A22 A;  4ITC A;  3H1W A;  4EJR A;  2PAM A;  4B4Q A;  2UWA A;  1OLM E;  1CES A;  2LAL A;  5LAT A;  1D4M 2;  4YGB A;  1QIQ A;  1C1L A;  1KS4 A;  1HJF A;  3U14 A;  3OEA A;  1ONA A;  4MHU A;  1UZ0 A;  1ZZC A;  2DVD A;  4FFH A;  1UX7 A;  3NWK A;  1QJX 1;  1W8W A;  5IAV A;  5HCF A;  3QH7 A;  3ATG A;  3TEZ A;  1LOA A;  4QDS A;  1UW8 A;  3UYJ A;  2WII B;  1WW6 A;  2BTV C;  4N7U A;  4Y1Y A;  4JGY A;  4DXR A;  5BPX A;  1JH5 A;  1RHI 3;  5FLI A;  1HIX A;  4UBG A;  1IHM A;  2G9F A;  1LCL A;  3PNA A;  2D98 A;  4Q4W 1;  5DDJ 2;  5GZG A;  1OQD A;  4QQ2 A;  4D0Q A;  4ATF A;  3VHO A;  1LEC A;  4W6Y A;  5KHK A;  3ZMO A;  3ZPO A;  1NA1 B;  2W1U A;  1D0G A;  1XNK A;  4CYD A;  1N3Q A;  3PVE A;  4AG4 A;  2EXK A;  3WZ1 A;  2DV9 A;  4J1X A;  3KS7 A;  4V2W A;  2CV6 A;  2V73 A;  2GH2 A;  5CNA A;  4DS0 A;  2YBP A;  2F17 A;  2XUE A;  4Y4R A;  3ACI A;  3HT1 A;  5FXZ A;  2W92 A;  5A70 A;  1PO2 1;  3LFI A;  4P9J A;  2IVJ A;  2ERF A;  2E7A A;  2PYT A;  4A2U A;  1UY0 A;  4TWT A;  1WWY A;  2BPA 2;  4XAB A;  1VRB A;  4ZHN A;  1Y9Q A;  1V70 A;  2WYS A;  4O9E A;  3IIA A;  5A3N A;  1LHW A;  2XL7 A;  3UL2 A;  3VDD A;  1IS4 A;  4LO7 A;  5DXD A;  2VO5 A;  1TMF 3;  2WUH A;  3M2M A;  3MLL A;  1UN1 A;  1RUE 1;  4GQ7 A;  4GUL A;  4NN0 A;  3UET A;  1CVN A;  4P02 B;  3WQ0 A;  4NWV A;  1JN2 P;  4RYD A;  1YHF A;  2J1R A;  4PDW C;  1JOB A;  4G9S B;  3FN9 A;  3VBR B;  1A8M A;  1AR6 1;  2X29 A;  3MEP A;  3N9N A;  2WQZ C;  4CCN A;  4BB3 A;  1FOD 1;  1KIT A;  2IZW A;  3VN4 A;  3O1T A;  3VUO A;  2Z4F A;  3DYM A;  2JE9 A;  1LOD A;  2XVG A;  2GP5 A;  5JWP A;  4CUB A;  2OYZ A;  1YFW A;  1W6Q B;  3SH4 A;  5DAB A;  2JB4 A;  4FPF A;  3FLR A;  2P3I A;  1R09 1;  4Y20 B;  4W4Z A;  2BRT A;  3ON7 A;  3S57 A;  1GQH A;  2ID4 A;  3ZVX A;  5FP4 A;  5JLV A;  4QU2 A;  1UZW A;  1IG0 A;  2QE3 A;  3AVS A;  3MIG A;  4ISR A;  2WO7 A;  3ZO0 B;  3Q8A A;  1Y9M A;  4C90 A;  1JU4 A;  5LEJ A;  1IS6 A;  5IK7 A;  2VOX A;  4Y22 B;  2J22 A;  5FYU A;  1AYM 3;  1COV 2;  3AJZ A;  3POW A;  5FMO L;  4OHW A;  1VBD 1;  1OF4 A;  4AWD A;  4E2S A;  5L7O C;  1VAV A;  2X5I B;  4CTE A;  3OBA A;  3NW4 A;  4IE5 A;  1S0D A;  1XSR A;  5DAW A;  4BLI A;  2DBI A;  2WNU A;  4I0A A;  4X6Q B;  4GMP 3;  2YFZ A;  1Q5O A;  1QQP 3;  5F3I A;  3TEY A;  1EAH 2;  4IER A;  5AFE A;  4GWI A;  1TEI A;  2W94 A;  1H30 A;  2XWB B;  2ZXQ A;  4M4R A;  4Q1P A;  1LHO A;  1YFX A;  2QTW B;  4QT6 A;  3UJQ A;  2XHN A;  5C9A B;  1FAY A;  4A42 A;  5J1X A;  1LB2 A;  1UZZ A;  2HWE 3;  3ZSJ A;  2VW1 A;  3TEW A;  2HWF 3;  3LA7 A;  3L2H A;  3NKG A;  3ZDS A;  3KCY A;  1SLB A;  2EAA A;  4XDQ A;  1HRI 2;  4MSV A;  1BMV 2;  5A7S A;  2EIG A;  5JXG A;  2HJI A;  2VQU A;  1TE1 B;  2PLV 1;  4XET A;  1UOJ A;  1A6C A;  2QUO A;  3RG0 A;  3T4V A;  2WJS A;  1MQT B;  4BQW A;  1XSQ A;  1Q8Q A;  3RZH A;  4LOS A;  1QJU 3;  5FKB A;  3PUS A;  4YG3 A;  2FHR A;  3H8O A;  3BKZ A;  1VBB 3;  3RJ2 X;  2VTF A;  1ULE A;  5CKQ A;  5A7Q A;  5FFO C;  1IQD C;  1AYN 1;  1UXZ A;  1UY2 A;  3QBQ A;  2NPI A;  3JQW A;  1TNR A;  4JDM A;  3ECQ A;  5F5A A;  3WNO A;  4OHV A;  2HWB 3;  4PDW A;  1UXX X;  5FZO A;  2A5Z A;  1YQ2 A;  2Q30 A;  3AYC A;  3CDZ B;  2HWC 1;  1RUF 1;  4Q5O A;  1UU4 A;  1WD4 A;  4IE7 A;  2AZ5 A;  2W0X A;  4LBQ A;  5GZF A;  3FLP A;  1BCX A;  3WNL A;  1B09 A;  1QNW A;  2FDJ A;  3F2Z A;  1C1F A;  4WVM B;  5CIS A;  3RPQ A;  2WFP A;  1ASJ 2;  1XOY A;  2ILM A;  3V56 A;  4HVQ A;  1MZ5 A;  1BZW A;  5T50 A;  2F4P A;  3ZN6 B;  4QXK A;  3ZXG A;  3I3E A;  5ABJ C;  4KL1 A;  3ZXJ A;  1FYU A;  1RUG 2;  5FYZ A;  3GHM A;  3JCI A;  4LO8 A;  4Q4X 2;  4UW5 A;  3ZR5 A;  5A6Z A;  4CDW B;  4QX5 A;  1CZT A;  1IGO A;  4CDQ B;  4WBB A;  1ODN A;  2B5H A;  1D4M 3;  5IVF A;  3H50 A;  3NNJ A;  5FXV A;  2MEV 2;  4J25 A;  4B1M A;  3I2H A;  1FPN 1;  4LK7 A;  1S0F A;  2PA7 A;  4AVS A;  5CFD B;  2VOT A;  1SBE A;  5L7O A;  2JG9 C;  1W6N A;  1W8N A;  1PO1 1;  2VE1 A;  4GH4 B;  3KWV A;  4FPY A;  1I9R A;  2P3Y A;  2Y33 A;  5T54 A;  2E31 A;  2FDG A;  2PAK A;  5A3P A;  3ITQ A;  1ZZ6 A;  2EAK A;  1OF3 A;  5FZ1 A;  1RUO A;  1N1T A;  3CLP A;  5BNP B;  2IFR A;  1J83 A;  1NE6 A;  4BPZ A;  1W0P A;  1JW6 A;  1RUI 3;  2RHP A;  4ASK A;  2IXI A;  2AGS A;  2A6Z A;  3FFZ A;  4HLT A;  1X36 A;  1SLI A;  4CDU C;  2FQP A;  2FCU A;  3Q8C A;  3CKH A;  3ZXE A;  4Y5S A;  4QPI B;  4IGQ A;  2YXS A;  4ZY9 A;  2VOW A;  2XLA A;  1WW4 A;  3RMX A;  5BNO C;  1YO8 A;  5FYH A;  3MO4 A;  3RWK X;  2ZEW A;  4LNV A;  1LUL A;  1NQJ A;  4AZZ A;  4OI4 A;  4EN6 B;  2JDH A;  5FKC A;  3OBT A;  1N3P A;  3MF9 A;  1G9C A;  5F32 A;  3KVA A;  4LHL A;  3WD5 A;  4GB3 2;  1DZR A;  4R9D A;  2PQQ A;  1UIJ A;  5EFU A;  3TAY A;  1XXN A;  2ZEY A;  3RI9 A;  3X29 B;  4BK5 A;  1PZ9 A;  1R1A 1;  2ARB A;  4OFG A;  4BXS V;  2Z2S B;  4ZZ8 A;  3V0A B;  2JDU A;  2X05 A;  5LBF A;  3HQR A;  2WO1 A;  2VY0 A;  1VMH A;  2LUW A;  2P6H A;  2B9V A;  1F31 A;  4GAZ A;  1HQL A;  4FPL A;  4AE2 A;  1RMU 3;  3RGB A;  2EIE A;  2VQA A;  3CQO A;  1AR9 2;  4H7L A;  4U36 A;  1EV1 2;  1Q56 A;  2VXJ A;  5FPZ A;  1BEV 1;  2JDK A;  2PHX A;  4LO5 B;  1BXH A;  2HEY F;  2WZR 1;  1FT9 A;  4TSV A;  4YW5 A;  5FZF A;  4E4D X;  4OUM A;  5ABJ A;  3VKF C;  1NCQ B;  1MS0 A;  3MUY 1;  2RMU 1;  4QXC A;  4BZ4 A;  1YI7 A;  5A6Y A;  4OYU A;  4HPK B;  3GAL A;  4YRD A;  5L19 A;  2VCC A;  1TME 3;  3S0M A;  4Z2W A;  3HQU A;  2AEY A;  1JHJ A;  1POQ A;  2C26 A;  4HSL A;  4LBL A;  4Q1R A;  4NID A;  2W9X A;  2QQJ A;  4TYS A;  4DZG A;  1NX9 A;  3VBO C;  2CSG A;  3B3Q E;  2JG9 A;  1CZS A;  5C3Q A;  3OY8 B;  2XQR A;  1W2N A;  3O0W A;  3ZKY A;  2DDU A;  1XU1 A;  1BBT 1;  5F2S A;  3SH3 A;  4MH0 E;  4F83 A;  5A3U A;  1COV 3;  3SC7 X;  4L11 A;  4QQL A;  1LED A;  3PHM A;  1OLQ A;  3KQR A;  4YVS B;  5K0U C;  5I8S A;  3DXU A;  1AR7 2;  2E9Q A;  2VCB A;  1OMI A;  1ZBE 3;  2RV9 A;  1JYT A;  3ZLI A;  3SEP A;  2TEP A;  5FZG A;  5CAZ A;  5A80 A;  4BQ4 A;  2K9Z A;  2JEM A;  5E6H A;  2B45 X;  3I2K A;  1GOF A;  4QKN A;  3WW1 A;  1AHS A;  2Y6K A;  4LBJ A;  1F5F A;  2GMP A;  4RR3 C;  3ZDV A;  2DCZ A;  4BIS A;  1DDL A;  2YYO A;  5BNO A;  3HMY A;  4IEP A;  1GOG A;  3U10 A;  1MZF A;  5C3O A;  5LA0 A;  1PIV 3;  4RSU A;  5DG2 A;  2ZAH A;  4DY3 A;  3WG4 A;  5H9S A;  1C57 A;  2ZHL A;  3IBM A;  5DDJ 1;  2DYC A;  4LOT A;  3SMH A;  4EN7 B;  3I59 A;  5EQU A;  4OQ9 A;  5F9T A;  3HPN A;  5DUU A;  1KDM A;  1UD1 A;  5FV3 A;  2PHT A;  3ZYB A;  2R32 A;  4AED B;  1V00 A;  1SHW B;  2XJU A;  4H14 A;  4RFR B;  3WSO A;  5JUV A;  2ZGR A;  2G19 A;  4XHB A;  3ACG A;  2ARC A;  2XB6 C;  1L7L A;  1VAM A;  3OBR A;  4QU1 A;  1YJL A;  1WA6 X;  4YVW B;  1FMD 3;  3I3Q A;  3MLJ A;  3OG2 A;  2FZ1 A;  2X09 A;  4OZO A;  4EZH A;  4CP9 A;  1VBA 3;  2VW0 A;  3ETQ A;  2VQT A;  2BER A;  2J1E A;  1WLW A;  2OUH A;  1ZRD A;  2BWA A;  1W2U A;  1WZX A;  3DPR C;  2CGO A;  4L97 A;  5IK4 A;  1UMH A;  2OT7 A;  2JDA A;  5CZK A;  4DIQ A;  2FD8 A;  2CU5 A;  4Q4Y 2;  1ZYB A;  2HLE A;  3AP4 A;  3NAP B;  4FBF A;  5FP7 A;  5KXD A;  1JZ3 A;  1FAT A;  4LUK A;  4BE3 A;  1DGW X;  3KD4 A;  4XF4 A;  1OUR A;  2BU9 A;  2PAE A;  5ANQ A;  3ZXA C;  1KEX A;  2J1A A;  5L9V A;  2N7G A;  2W2I A;  5LB6 A;  3ZFF C;  3MW4 A;  4IV3 C;  4XUR A;  2VU9 A;  3B5L B;  4MG2 A;  3O14 A;  4M3C F;  1EP0 A;  5CYY A;  2OW4 A;  1POV 0;  2C5D A;  3KMH A;  5K7P A;  3FBM A;  2BNO A;  3DKW A;  1C5I A;  3MID A;  1YLL A;  1DHK B;  4D69 A;  3N36 A;  2ZOE B;  3JBG 3;  3WT3 A;  2BUK A;  2GC0 A;  3KLS A;  5K0U A;  3THD A;  2GME A;  4COU A;  1F4A A;  1L7R A;  2GH8 A;  2JEC A;  4JC1 A;  4IV1 B;  4FFI A;  5A7W B;  4BXF A;  5KC5 A;  2W3J A;  4AR2 A;  1OD3 A;  5BNN C;  2V4V A;  1W0N A;  2WZ8 A;  1QWR A;  2CGN A;  4KU7 A;  1RJ7 A;  1W6P A;  2B9U A;  5HI0 A;  5IHR A;  2JB8 A;  4IEQ A;  1PGL 1;  1YEW A;  2DUP A;  2VZR A;  4Q4W 2;  4BU2 A;  4AHW A;  4LK6 A;  2OA2 A;  2YB7 A;  4YFW A;  3W5N A;  2O14 A;  4N9H A;  2GP3 A;  1ULD A;  5FXW A;  3VBF C;  4WM7 C;  4YGE A;  1MR5 A;  2WSU A;  4XF3 A;  1ENQ A;  1G7Y A;  3KCC A;  3P6B A;  3SQO A;  1EAH 1;  4HET A;  3T1L A;  4RS5 A;  3M3Q A;  4NPL A;  2Y26 A;  5ACA 2;  5T5L A;  5JAX A;  3M3O A;  3C7F A;  2A1X A;  3OGJ A;  5FQ0 B;  3RZJ A;  5EJ3 A;  1JYX A;  5FY5 A;  1H8T A;  4P5H A;  4QHB A;  3LEK A;  1W2O A;  3WF4 A;  2GC1 A;  2ZGP A;  4D7Y A;  5F1R A;  1X9T A;  1BMV 1;  4CP2 A;  2RS3 2;  3ZX7 A;  3AMQ A;  2ZZQ A;  4JQR A;  1V0A A;  1DYO A;  2VNO A;  3VBH B;  2A3W A;  3JD7 1;  4AXO A;  2VMF A;  1DFQ A;  2XKP A;  3DPR A;  4O61 A;  4YW6 A;  4UF0 A;  4RFT 0;  4QX8 A;  3M3I A;  4BIO A;  1A34 A;  3LEI A;  3G6J B;  3VB9 A;  1RUE 2;  4YM1 A;  4BOW A;  4XFG A;  1PM4 A;  3ROU A;  3RQ0 A;  5FP9 A;  3O1S A;  4KG8 A;  4R52 A;  1KQR A;  1LOB A;  4PI0 A;  4COV A;  5JMO A;  2AYH A;  2J1U A;  3IDE A;  4IV3 A;  3ZFF A;  3BIE A;  3SCH A;  1XNB A;  2NN8 A;  3LDK A;  1S55 A;  1HN1 A;  3THC A;  1A3K A;  1FOD 2;  1NZC A;  3DN7 A;  3DL3 A;  5A7O A;  2UUR A;  4IND A;  2A6W A;  3VHR A;  2FDH A;  1R1Z A;  3PIG A;  4FXK B;  1FNZ A;  2PTM A;  1R09 2;  4PCR A;  2R06 3;  3P3N A;  2R6Q A;  2XJT A;  1JUH A;  2OQ7 A;  4XTM A;  5FPB A;  2DCT A;  1RUN A;  3TN9 3;  4GWM A;  1CAW B;  1DYK A;  1ZRR A;  5T3N A;  1RUG 1;  1DQ0 A;  2GSY A;  1XYO A;  4Q4X 1;  4EN9 B;  3FX3 A;  2Q8C A;  5BNN A;  3GZE A;  3ZFG B;  4K20 A;  2R07 2;  1X33 A;  1PMJ X;  1U5I A;  4RGG A;  5FZA A;  4Y4Y A;  4CPB D;  5GKA C;  1K3I A;  3R0R A;  2KR2 A;  2Y34 A;  1VBD 2;  4QPG C;  2VAU A;  1X7N A;  1UU5 A;  5CIR A;  3JZV A;  5HV4 A;  5AC9 3;  3U11 A;  3GZT B;  1MPX A;  2VL4 A;  1WMF A;  1NXD 1;  3E1F 1;  1J58 A;  2XUM A;  3MIH A;  4XXA A;  4CEY B;  5FWJ A;  3LF7 A;  5IJR A;  2K46 A;  5F7U A;  1C4R A;  1KXG A;  4UWD A;  5DUW A;  1YCI A;  4QD2 A;  1GZ9 A;  2KD7 A;  2ZX4 A;  2QQL A;  1ENR A;  4E4S A;  1AXZ A;  1QJY 1;  4YZ1 A;  1V6J A;  1EY2 A;  2JD4 A;  3LPG A;  3VBR C;  1RVF 1;  2XQX A;  5JSP A;  1SDW A;  3A0N A;  4N9I A;  1NG0 A;  4P5Y A;  4CCE A;  4NUB A;  1CAV B;  5A32 A;  1UU6 A;  1VIW B;  2ZEZ A;  3C7G A;  1DQ5 A;  1W8F A;  2Q4S A;  3MF6 A;  1KFX L;  4KBZ A;  3WOG A;  4XPV A;  4GMP 0;  3LOB A;  1FNY A;  3VGI A;  3S30 A;  1PMH X;  1OD5 A;  2Y8K A;  4XJ9 A;  4CU8 A;  1JU3 A;  3MBW A;  3VBU A;  4NPR A;  3AYE A;  4CEW C;  1ULP A;  5JXI A;  4JKM A;  1XC6 A;  1AYN 2;  1UQX A;  2FCV A;  2WS9 2;  3AFK A;  3I2D A;  4NIA A;  2A6X A;  3U78 A;  3UT0 A;  4AVA A;  2WWJ A;  1DGR N;  1OA4 A;  4RHV 3;  4GAL A;  2XG3 A;  2BVV A;  1NLQ A;  3NL1 A;  4COZ A;  1O91 A;  3EBR A;  3WNP A;  5CKN A;  2HWC 2;  1RUF 2;  1N1S A;  4NJ4 A;  3AZW A;  4YLZ A;  1SFN A;  3M70 A;  2QQV A;  4NHY A;  2QKD A;  3B00 A;  4ZON A;  3S5Q A;  2Y0I A;  4DEQ A;  2JD9 A;  1PK6 C;  3LDB A;  4PI2 A;  3GZA A;  4XC9 A;  1UY1 A;  5IVC A;  1GBG A;  2ORX A;  3BVC A;  3R6S A;  1OUS A;  1ZZ8 A;  5HXM A;  1JS9 A;  1FV2 A;  4IE0 A;  3S7I A;  5FXX A;  5F6L B;  3V65 A;  1I5P A;  2O8Q A;  1LR5 A;  1QJE A;  3UGF A;  1W6M A;  4D6S A;  4F3J A;  4QPG A;  4LBM A;  4OMD A;  1VBE 3;  5T52 A;  3CJI B;  3H1M A;  4UT5 A;  4ATE A;  4E4Z A;  3FUO A;  3ZKU A;  2YC2 A;  2ZGS A;  2RDQ A;  3M3E A;  1BHG A;  1AZD A;  1E57 A;  2WC2 A;  1CPM A;  1PO1 2;  1QJX 3;  5A1F A;  2BBV A;  5IVV A;  5FIX A;  3V0B A;  1RUH 3;  5A3M A;  2A75 A;  3GCX A;  5L73 A;  5FRA A;  3USU A;  2OS2 A;  4WVZ A;  3WF2 A;  3AB0 A;  1SEF A;  5FJH A;  4BME A;  2ZZJ A;  2P6C A;  2IC1 A;  2VMH A;  1O6U A;  2VUJ A;  4E2G A;  2VNV A;  4LKD A;  3BTX A;  1AR7 1;  1AR8 2;  1XYN A;  4A6O A;  2HBT A;  4C1W A;  4BWO A;  2J1V A;  2QBX A;  1HQN A;  2RJK A;  3M7A A;  2YC4 A;  4RS5 B;  4XFB A;  1ULC A;  2JDP A;  5T55 A;  4XBQ A;  2YU1 A;  1CR7 A;  3I2O A;  2QQN A;  4JDN A;  1LOE A;  3IZO A;  1H8T B;  3IAP A;  3AMN A;  1K5M B;  1QXR A;  3POE A;  2LRP A;  4P9I A;  5C3R A;  4N8M A;  3LGR A;  1Q43 A;  3HEI A;  1WME A;  4A41 A;  2ADD A;  3D0J A;  1S2K A;  4MGS A;  3INA A;  5C8C B;  4MAD A;  2P2K A;  4RQP B;  1Q8S A;  4JX0 A;  4HKO A;  2RS1 1;  3EB7 A;  4PHZ A;  4NRP A;  5C3S A;  1PO2 3;  4I01 A;  4CEW A;  2NLR A;  5F3C A;  1RUD 3;  5B4X A;  3D6E A;  1JYC A;  2R04 2;  4BQ5 A;  1QMJ A;  4OCT A;  2B46 X;  1DLC A;  4XEZ A;  2WZP P;  1QKQ A;  1GMM A;  3ZYJ B;  4LE4 A;  1R1A 2;  4RN5 A;  2GNB A;  1QJF A;  4ES9 A;  1GYK A;  4KWJ A;  2BYV E;  2ZGO A;  5JDB A;  2WNV B;  2XLF A;  5DAQ A;  1I3H A;  1R08 3;  2RDS A;  2XBO 2;  1S0I A;  1U5Z A;  4FCA A;  1UYX A;  4GH4 C;  4MYE A;  4B1L A;  2Q8E A;  1ALY A;  1T6B X;  4F7Z A;  1PK6 A;  1BEV 2;  4Z8B A;  4PF1 A;  1F15 A;  5ERL A;  2WZR 2;  3N9P A;  1AR6 3;  4RD7 A;  2DU0 A;  1EPW A;  4OVE A;  1JZ6 A;  2W87 A;  1N47 A;  4M3C A;  1QGL A;  1TQ5 A;  3N9M A;  4R9A A;  2VME A;  2ZX0 A;  5FRE A;  1XB9 A;  5BXX A;  1JZ5 A;  1NLS A;  4Q4Y 1;  2PMW B;  1B35 A;  3D4K A;  4QQH A;  5DN2 A;  5FYI A;  4HL0 A;  3E97 A;  1SMV A;  4DY5 A;  4AK3 A;  4LBO A;  1J59 A;  1A8D A;  1LHU A;  4JKL A;  3O1V A;  2D7F A;  3LDR A;  4I0B A;  3VKL A;  2BEO A;  2P5B A;  2YG0 A;  1PX4 A;  4HVO A;  1JZ2 A;  1AXY A;  3UGG A;  1RUJ 1;  4AFB A;  4BM8 A;  5LA9 A;  1CAX B;  1G9A A;  1BBT 2;  4N43 C;  4NMI A;  4LHS A;  1OC1 A;  1H2N A;  3CZJ A;  5A1L A;  5BNQ A;  1MEC 1;  5K8S A;  5JOW A;  2AEZ A;  2VZU A;  1DGL A;  1VBD 3;  2QDR A;  3ZR6 A;  2QNK A;  1LOF C;  4IE4 A;  3A23 A;  3VLB B;  4Y1X A;  4KH9 A;  4YM3 A;  4ZPI A;  2ADE A;  3N7L A;  2Z5W A;  3WXP A;  3OYW A;  1D4V B;  2R7E B;  1V6M A;  4XJA A;  3VHN A;  1YFU A;  2RJ2 A;  1US2 A;  2ATF A;  2ZGN A;  2CYF A;  3A21 A;  4QGL A;  3KV4 A;  5JZG B;  4MO3 M;  4O65 A;  4WV8 A;  2HBU A;  2I74 A;  3TOJ A;  3PME A;  1HQW A;  2HYK A;  4UFM A;  4D94 A;  4TN7 A;  2PLV 3;  3HBK A;  3ZIX A;  3T3Y A;  4U2A A;  1SPP B;  5DG1 A;  1GOH A;  4ARY A;  2XKO A;  4QQO A;  5L9R A;  3FL7 A;  4QXB A;  2Q1F A;  3FHI B;  3OJB A;  1W03 A;  1LRH A;  3K4Z A;  4PT6 A;  1QHD A;  3JU9 A;  5ACA 1;  4XIO A;  2JEN A;  2VMC A;  2V4A A;  5FUI A;  4BQX A;  4RGK A;  2VTX J;  4KQ7 A;  4Y5T A;  4ISQ A;  1AYN 3;  2HH9 A;  4KG0 A;  2D5H A;  3LSE A;  3IPV A;  3NST A;  4Q2F A;  2OZ6 A;  1U5Y A;  1AL2 3;  1V6N A;  1XE0 A;  4S2F A;  3RDI A;  1UMZ A;  1G6N A;  2ZML A;  2RS3 1;  3T2P A;  1J1T A;  2QFE A;  3K2O A;  4N53 B;  4YW1 A;  3NNM A;  4R4X A;  1CON A;  5CKM A;  3AFG A;  2HWC 3;  2G1M A;  2DCK A;  2YGM A;  4XQW A;  4OUL A;  1IS3 A;  4FFG A;  3U75 A;  1WBL A;  2TUN A;  3ACH A;  1OOP B;  1IKQ A;  3H9A A;  2QQM A;  1W6O A;  2EXJ A;  3P1I A;  4BA6 A;  4I02 A;  1UIK A;  4K21 A;  2XJP A;  1V9U 3;  3ILN A;  1CGP A;  5HPO A;  2XDV A;  1Z7S 3;  3E5Q A;  3ST7 A;  2WLQ A;  4AAX A;  4CRQ A;  3E5X A;  2VZ1 A;  3KSC A;  3AXE A;  4NVP A;  1OQE A;  4Q0P A;  5C5T A;  3H3L A;  5D21 A;  4AI1 A;  5FYB A;  1E5H A;  5LY2 A;  4N43 A;  4CP0 A;  5I91 A;  1ZX5 A;  1I5Z A;  5FYC A;  2ET7 A;  5BV6 A;  3LAG A;  1JOP A;  1W3X A;  4XMI A;  1FPN 3;  2P34 A;  5DUX A;  3WF0 A;  2K2S A;  2DUQ A;  3GBW A;  4A6S A;  4A45 A;  5GZE A;  1GZC A;  1ZA4 A;  4AHY A;  4DRV A;  3EYP A;  4URA A;  5CG8 A;  1LOF A;  3JQX A;  3VZN A;  2NZ9 A;  4LEJ A;  2KM2 A;  4HZF A;  1CX4 A;  1WUV A;  1XNC A;  2P4E A;  4P9X A;  4E4H A;  3WY6 A;  3PLQ A;  2JG8 C;  2CNA A;  2QCS B;  5EWS A;  4ZU7 A;  1G9F A;  4IEX A;  2R07 1;  1POV 1;  4AI2 A;  4FAH A;  3HBZ A;  3BTZ A;  3ILF A;  2IWG B;  5JI7 A;  5TSW A;  3WW4 A;  5FO8 B;  1PGL 2;  3EHK A;  4LO4 B;  3DUI A;  4LBK A;  5LRS A;  5FPL A;  3J8F 1;  1UPI A;  5GAL A;  1VLN A;  4IEV A;  4HK8 A;  1C28 A;  1LU1 A;  1SFY A;  2AUY A;  4UW4 A;  3ES1 A;  5FZ6 A;  2R0F A;  1MS4 A;  4HG6 B;  1S0C A;  1DYP A;  3D8C A;  3W20 A;  4QXH A;  4RGA A;  1CIY A;  3BTY A;  2QZ3 A;  4AHX A;  4QX1 A;  5LAS A;  4HT1 T;  1GZW A;  3C7O A;  2DWR A;  4LIU A;  5FZ7 A;  1RXG A;  5C4W C;  1ZRI A;  2LRO A;  4JHZ A;  1JTZ X;  2XJS A;  5LCW L;  3B7M A;  4P14 A;  2BGC A;  3RZG A;  1OLR A;  2R49 A;  2DTY A;  1CD3 G;  3IMN A;  2F4L A;  4IES A;  3THT A;  4CXW A;  1R1A 3;  1MVQ A;  4JGZ C;  3SEE A;  1YYN A;  3G7D A;  4WM8 C;  4XFF A;  2RM2 2;  4Y5Z 0;  4CDX B;  3JD7 2;  4Q0U A;  4DUW A;  5DZE A;  1QH6 A;  3R4U A;  3PIJ A;  4MGY E;  3WDV A;  3BCW A;  1MS3 A;  4MLO A;  4HAN A;  4XUQ A;  1XYP A;  2WBK A;  3H8U A;  3OPT A;  5LY1 A;  3T0A A;  2VZP A;  2VUC A;  2WS9 1;  4LMF A;  4PBP A;  2XOM A;  2ZHM A;  4MUV A;  4W6W A;  4NRO A;  3TB0 A;  4ES8 A;  2WFF 2;  1RHI 1;  4N7I A;  3AKP A;  2RMU 3;  4JHT A;  2CL2 A;  3RI8 A;  3VKM A;  1O59 A;  2RS5 2;  4UW3 A;  4ZS2 A;  3T08 A;  2WN2 A;  1BJQ A;  2H0V A;  2Y6G A;  3PJY A;  2A7A A;  2WN3 A;  1O5U A;  3BYW A;  1F4H A;  3AKT A;  3VBS C;  3LQC A;  2ZHK A;  1HB3 A;  3IT8 A;  5C33 A;  3PU3 A;  5J37 A;  1SAC A;  3N3H A;  2VXR A;  3IAQ A;  2XR4 A;  2BZD A;  4SBV A;  1WLT A;  1QNY A;  5BYN A;  4EQV A;  1NY7 1;  2O0O A;  5I93 A;  2JG8 A;  2RG4 A;  5IVE A;  3MDP A;  2NP0 A;  3LPF A;  1V6K A;  3KB5 A;  3BTA A;  4MHR A;  2D40 A;  3RSJ A;  3H8R A;  4YW4 A;  3VBH C;  4XJW A;  4M3C E;  4HXC A;  3S7E A;  1GAN A;  1OVS A;  3MFA A;  4AQ6 A;  4JGY B;  1GR3 A;  4MGZ E;  1DU3 D;  1TMF 1;  4AGV A;  5KXC A;  1AX2 A;  1ND3 C;  1VBC 2;  3O7O A;  5E1R A;  2ARE A;  3RZM A;  2XJV A;  1S2B A;  4W8J A;  2PHU A;  2WR9 A;  3H42 B;  1IG3 A;  3MV0 1;  5C7G A;  1QJY 2;  4Q8K A;  1C8N A;  4QWN A;  2BP6 A;  2FBE A;  5DDJ 3;  1RVF 2;  5JOY A;  1UOB A;  4YG6 A;  1AR8 1;  3OPZ A;  2ZPX A;  5CA6 A;  3AX4 A;  4OUS A;  2DFC A;  4ZXK A;  4Z92 B;  4FO9 A;  1W2T A;  3KT1 A;  3GF6 A;  3MW2 A;  2WWU A;  3MFC A;  2PHL A;  3HWJ A;  4JGZ A;  2IXL A;  4WM8 A;  5FYT A;  5FZC A;  4AEJ A;  4BMB A;  1IPS A;  1US3 A;  3J7N A;  3VDA A;  1OFS A;  1YQ5 A;  4QKD A;  1J1L A;  1UYP A;  2WA3 A;  2YBK A;  4JZR A;  1UYZ A;  3AYD A;  4E8D A;  1AYM 1;  4CPB A;  3RZL A;  2R04 1;  4TXW A;  1OKO A;  5DAX A;  1UY4 A;  3VDD B;  4XZP A;  3LWC A;  1KDK A;  3I2J A;  1N1V A;  1WMX A;  3T09 A;  1ACC A;  5EP9 A;  3E6C C;  1RC6 A;  1UZV A;  1CJP A;  4EE2 A;  4PIZ A;  3QLQ A;  3H0O A;  4Q29 A;  4CP1 A;  1RUC 1;  3R4S A;  2VNG A;  3NJZ A;  5A33 A;  4YW7 A;  2ZBJ A;  3WW2 A;  1OA3 A;  1OHF A;  2XBO 1;  1W0O A;  3VBS A;  5DZF A;  1PGW 1;  2XML A;  1V6O A;  3AYA A;  4GD4 A;  4CVU A;  1MS1 A;  2R1B A;  3APB A;  2VCA A;  1ULF A;  3DV8 A;  1BK1 A;  3VD7 A;  1CAU A;  5FZM A;  3ZYG A;  4FPO B;  1ULO A;  1VRH 2;  4OI1 A;  3ZFE C;  3UJO A;  3LZZ A;  3CU7 A;  3JUU A;  4PLM A;  5FMB A;  3CZU A;  2CDP A;  2TNF A;  1NE4 A;  2ZAB A;  1PGS A;  1MS9 A;  2WDB A;  1GP5 A;  1U5X A;  1X8M A;  1MZ6 A;  1UOG A;  2ENR A;  2EID A;  3DYP A;  4IGO A;  4Q8L A;  5E88 A;  1PNF A;  1UYY A;  1ND2 C;  3AMM A;  3DEC A;  4Y33 A;  1KFU L;  3ASI A;  3WP5 A;  4COY A;  5BUV A;  2V09 A;  3O1R A;  2RJL A;  5T5J A;  1ND3 A;  2R16 A;  3TEX A;  1OVP A;  2BWC A;  2E6V A;  2WNU B;  1PVC 1;  3WVJ A;  5FDB A;  3LA3 A;  3U07 A;  5E8A A;  4KGG A;  3WG1 A;  4PBO A;  3KM5 A;  4QDR A;  4FOY A;  2JIJ A;  3D3A A;  4FPE A;  4AHZ A;  4CDU A;  3DEM A;  1EAH 3;  4XF0 A;  1QXP A;  3SH5 A;  1KGY A;  2K0G A;  2MHF A;  5I0T A;  4UFK A;  3VZJ A;  4AGR A;  2VW2 A;  3POY A;  5J36 A;  3T2O A;  2QDN A;  2NYY A;  3LEG A;  4NAO A;  1JHN A;  3MIC A;  2RS1 2;  5D8A C;  1HRI 3;  4YW3 A;  2ZKL A;  1YRZ A;  5JSR A;  2MNG A;  4DXS A;  3PUQ A;  4DUV A;  2XVL A;  4A7K A;  5BY5 A;  4KWL A;  1UZY A;  4GXL A;  4XOG A;  2EXH A;  3PUR A;  2EIC A;  1LOG A;  1Q8V A;  2YFU A;  2IXH A;  2C9K A;  4EN0 A;  4XQD A;  2DUR A;  3ENR A;  1UWW A;  1QF3 A;  3SXW A;  1SQ4 A;  1YNA A;  5KR7 A;  1GWL A;  1CJD A;  1UL9 A;  4J6G A;  4PDW B;  5FZO B;  3RNS A;  3EQE A;  4UI9 L;  4B3N A;  1CWP A;  2VM9 A;  3WNM A;  5CFC C;  1NCR C;  2ORZ A;  5FZD A;  2JKB A;  1H8V A;  2H6C A;  4LBQ B;  1WCU A;  5C70 A;  5FUN A;  5CB7 A;  3URF A;  3K3O A;  4AVB A;  3EXU A;  4AEM A;  3Q8B A;  4OQ8 A;  1GWK A;  2LW8 A;  4QGM A;  1REF A;  3ZFE A;  1QOS A;  2Q5T A;  4XJU A;  5EXO A;  1XE7 A;  3DCQ A;  3I2I A;  4MZU A;  1ASJ 3;  4TLG A;  2VZT A;  5I0S A;  4MV2 A;  3AP7 A;  4JVA A;  2HKX A;  2IVI B;  3VBO A;  1MZE A;  5HV0 A;  1Q3E A;  5M0T A;  1RUG 3;  1RUJ 2;  4GJZ A;  4Q4X 3;  3U37 A;  4YFZ A;  3MGU A;  1UO9 A;  1MEC 2;  5GLU A;  2MPF A;  1UX6 A;  2QZ2 A;  2JKX A;  2ZGT A;  1NXM A;  5L7O B;  2A6Y A;  3ZYI B;  4AVT A;  3S5A A;  1W6N B;  1RJ8 A;  2MEV 3;  2ZAC A;  4W6X A;  2DU1 A;  1O3R A;  3SLI A;  5K9Y A;  5JCT A;  4XCB A;  1W3V A;  3ZSM A;  2H6B A;  4QGN A;  5HCH A;  3D5O A;  5T5O A;  5KHG A;  5FYM A;  1W2A X;  3H7Y A;  1Y9G A;  1OPM A;  2VPV A;  1RMU 1;  2CHH A;  2VZV A;  4OHY A;  1LEM A;  2I45 A;  4UFH A;  2WLP A;  1VP6 A;  3LIG A;  4RR3 A;  4HVR A;  5FZL A;  2ZAA A;  2D44 A;  1LNS A;  2B42 B;  5LRR A;  1RVF 3;  5CU1 A;  1PM7 A;  2UY8 A;  2GZW A;  4LA2 A;  2DVB A;  4QX3 A;  1JUI A;  4AF9 A;  4XJZ A;  5FPU A;  3B94 A;  4OUE A;  5D8A A;  3GZU C;  3T0D A;  3HN3 A;  4WZF A;  2A73 B;  1TME 1;  2NM1 A;  5FZE A;  1DCS A;  2VNR A;  5LWB A;  4M0H A;  4AVV A;  4XUN A;  3QD6 A;  4B7K A;  1HRV 2;  3ZM8 A;  4A4A A;  3E5U A;  5IT6 A;  1JYW A;  1TZO A;  1RIT A;  4I3G A;  1YIP A;  3ZSE A;  1DBN A;  3AP5 A;  2G9Z A;  2P37 A;  3W5M A;  5A3W A;  3AP6 A;  1G8W A;  3MIF A;  1OXC A;  1C8M 2;  2ZJC A;  3BU7 A;  4GB3 3;  3KT4 A;  3HN1 A;  1ZVF A;  4NOT A;  1RTV A;  5FAX A;  4CCD A;  4Q0Q A;  1GNY A;  1Y7B A;  4KI5 M;  4M01 A;  5A33 B;  5CFC A;  1NCR A;  3I49 A;  3OEB A;  1ZBE 1;  2RM2 1;  2Z69 A;  3AMH A;  4L2N A;  4CCK A;  4DEV A;  5FK8 A;  2VVE A;  2W1W A;  1OQ1 A;  3W58 A;  3AMP A;  5FZ4 A;  4CXX A;  4MET A;  4FPH A;  4K8F A;  2ZX3 A;  3FJS A;  3K51 A;  4EN8 B;  4LHN A;  1AR9 3;  5ABJ B;  1PVX A;  1YI9 A;  1EV1 3;  2I2S A;  4KNC A;  3M3C A;  3IWZ A;  4F8A A;  3C3V A;  4FOQ A;  1YFY A;  2YPJ A;  1YC6 1;  4K8R B;  1JOJ A;  5G04 L;  3K4D A;  1PIV 1;  5KHH A;  3VKO A;  2WFF 1;  2X53 S;  4PLO A;  4OI2 A;  1K45 A;  1RGS A;  3DXT A;  5H9Q A;  2E7Q A;  2RS5 1;  5FP3 A;  1L7Q A;  1W9W A;  3FMG A;  4PIY A;  4XFC A;  3J7L A;  1O3Q A;  4ET7 A;  2VBB A;  1UKR A;  4GIQ A;  2JG9 B;  4XVH A;  3ZSK A;  4XAC A;  5FUP A;  3AL5 A;  1NA1 C;  4K1Z A;  2D43 A;  4PF5 A;  5LEK A;  2HWD 2;  1W05 A;  1OH4 A;  4XAA A;  2WAA A;  4HMZ A;  4XFI A;  4D8M A;  5LBC A;  1VBA 1;  2PHW A;  4O7X A;  2TBV A;  1O3S A;  1J3Q A;  3JB4 C;  4R8H A;  5FZ9 A;  1AR7 3;  2XH6 A;  4FTS A;  1NQD A;  4CDU B;  3J8F 2;  3B9C A;  4FP2 A;  4R9C A;  3TNP B;  2V5Y A;  4CCO A;  2ARA A;  5BNO B;  4DNY A;  1DGR A;  2PEL A;  4OHZ A;  3NJV A;  2A70 A;  1X8E A;  2AR6 A;  3DF0 A;  4MVT A;  3VBF A;  3BU0 A;  1VBC 1;  2Y6H A;  4WM7 A;  2FDK A;  4MGT A;  2PFW A;  1CPN A;  1T2X A;  2UU8 A;  2VCM A;  3I59 B;  4KMQ A;  5DAV A;  4OLL A;  4XZU G;  3OF1 A;  1KJR A;  2GC2 A;  2BW8 A;  3BOW A;  2VMI A;  4LR4 A;  1W8T A;  4Y3O A;  4FQ4 A;  3AZZ A;  5IW0 A;  2HEW F;  2QQI A;  2W68 A;  3LFM A;  1F8V A;  3I2F A;  5GJ6 A;  2YV8 A;  5IFP A;  1C3H A;  2J1T A;  4UOJ A;  1FX5 A;  1RL3 A;  4CP9 B;  4J1W A;  2FDI A;  2JWP A;  5AVA A;  3VD3 A;  5IFT A;  2WT0 A;  2P3J A;  4LTA A;  3RYR A;  2JE8 A;  1GV9 A;  1UMI A;  1QJZ A;  5FZ3 A;  4NPM A;  4IDZ A;  2W47 A;  3ZSL A;  4H7M A;  5LA2 A;  2G9G A;  4QAW A;  4MGI E;  4QM9 A;  2WIN B;  3O1U A;  1Y3T A;  1O3T A;  5FMC A;  1GZT A;  1RHI 2;  3PTR B;  1ZRE A;  4C8D A;  4JTN A;  1GQG A;  4Y1U A;  4YZ5 A;  3KGL A;  1XNT A;  2OQ6 A;  5GLW A;  2I07 B;  3ZMN A;  1J84 A;  1Y43 B;  2W1S A;  2BGP A;  2X5I C;  4Q4Y 3;  3FUQ A;  4JV4 A;  4XUO A;  2W5F A;  2C1F A;  1O5L A;  1O7F A;  4L9B A;  3ZYP A;  1W8U A;  4P00 B;  3N7J A;  1NA1 A;  1BVP 1;  2C4X A;  2B39 A;  1NUK A;  4Y1V A;  3PL0 A;  1YXW A;  5K4L A;  4AI3 A;  5C9A C;  1H9P A;  2XGX A;  3Q9O A;  1NY7 2;  1WCQ A;  2D93 A;  4PQQ A;  5AFB A;  3QOP A;  1LTE A;  5CBL A;  2YRO A;  4OI0 A;  2BQP A;  1M4W A;  5K0U B;  3WCR A;  3O1M A;  1VRH 1;  1W28 A;  2CAU A;  4B8E A;  2D6N A;  4CU6 A;  1BVV A;  4CA9 A;  4E27 A;  1GWM A;  3GYD A;  5FMD A;  5FOJ B;  4UFI A;  2O8O A;  2WSV A;  3AM2 A;  3OD4 A;  4NRM A;  4AFA A;  3KHB A;  4BQ3 A;  1MQT C;  2SBA A;  2WKK A;  3VL8 A;  2J7M A;  3USS A;  1WW5 A;  1M06 G;  3IDA A;  3ALQ A;  1W6P B;  1TMF 2;  4JCK A;  1E5I A;  2ZHN A;  4BDV B;  3J4U H;  4YZ3 A;  1ZRF A;  1W9Y A;  1O8P A;  1D7P M;  2GN3 A;  1W8O A;  2BNM A;  5I8Y A;  4GWN A;  4Q4W 3;  1IKP A;  4BHP A;  3NKT A;  3VBR A;  4XMA A;  2CTV A;  2HYX A;  4SLI A;  4B4R A;  4L92 A;  3RS6 A;  3N9O A;  2VOV A;  5FPV A;  5GLV A;  1AL0 G;  3GCW A;  1GUI A;  5FZI A;  5ACA 3;  1WD3 A;  1UKG A;  4MXV A;  1W6Q A;  4QQP A;  2YY1 A;  1W99 A;  3TN9 1;  1S4C A;  2VVD A;  2ZEX A;  4Y20 A;  5FMO S;  4UBH A;  2XVK A;  1EYB A;  3A4U A;  4YZ4 A;  1AYM 2;  1DG6 A;  2RS3 3;  2ZGM A;  2ZX1 A;  1PX3 A;  3DPR B;  4UF0 B;  5FP8 A;  4AI0 A;  4CDW C;  4CDQ C;  3HT2 A;  4CU7 A;  5ISL A;  3WDY A;  3IDC B;  1H1M A;  1LEN A;  1U0A A;  2E53 A;  4Y22 A;  2JX9 A;  3T0B A;  3WDU A;  3WQ1 A;  2D6L X;  5J98 B;  5FR3 A;  1WCD J;  3B01 A;  5CFD C;  5IK5 A;  5JXJ A;  2X5I A;  1RUC 2;  5C3P A;  2VQ0 A;  2ZCW A;  4RL7 A;  3N7K A;  1QQP 2;  3K77 A;  4MXW A;  1RUE 3;  3ZFF B;  3POG A;  4IV3 B;  4TZD A;  4IE6 A;  3DGT A;  4LUM A;  2W52 A;  2WT2 A;  1JMU B;  1PGW 2;  1VJ2 A;  4LLF A;  2ZMN A;  4NII A;  3WF1 A;  5C5U A;  2QQU A;  4QX0 A;  5FWE A;  2HWE 2;  1GKB A;  1JXN A;  2ZGK A;  5BNP C;  1VMF A;  5C9A A;  1HN0 A;  3NV3 A;  1FOD 3;  1ZNP A;  2DBN A;  1K42 A;  1RYY A;  3FC0 A;  5J3U A;  1XPW A;  4EV0 A;  2W91 A;  5JOZ A;  4FAG A;  3LKJ A;  1YUD A;  2PQS A;  3BGA A;  1PZ7 A;  5GZD A;  1R09 3;  3CL1 A;  3LCP A;  2Z79 A;  4QPI C;  3AZY A;  2VC9 A;  3HIF A;  2AEN A;  4QB2 A;  4Y26 A;  4YYO A;  1QJU 2;  4D3W A;  1MQT A;  1SG3 A;  5BNN B;  5FOB B;  1ZBA 1;  4FTB A;  4GKY A;  3PVN A;  1VBB 2;  5IVB A;  3RVH A;  3OPW A;  1KJL A;  1SBD A;  2NMO A;  4FPK A;  5FY7 A;  1H0B A;  4D6R A;  2R07 3;  4V2V A;  4QKB A;  3TNQ A;  2ES3 A;  4AI8 A;  3ZXD A;  5DAP A;  1HB2 A;  1PVC 2;  2HWB 2;  3BN6 A;  1LHV A;  3J8F 3;  4RHV 1;  4V1P A;  4Q4V 1;  5CVR A;  4CCM A;  4WM7 B;  1K12 A;  4XIL A;  1X50 A;  2PN5 A;  4JKK A;  2E32 A;  4QM8 A;  3LSD A;  3FHQ A;  4WZC A;  1WCS A;  1F9K A;  3WW3 A;  3V64 A;  4S2D A;  1FV3 A;  1SBF A;  2V5D A;  5FZH A;  4QHO A;  4IGP A;  3RFR A;  2JJ6 A;  2V72 A;  1DGW A;  4FFF A;  4Q0S A;  4WVM A;  3FWE A;  4LOR A;  4XFA A;  5A32 B;  5SV5 A;  1OKQ A;  3ZN6 A;  1MAC A;  1NCQ C;  4FPJ A;  4DOU A;  2YDE A;  2D6P A;  2LS6 A;  4CDW A;  5CEH A;  3HAG A;  1NAE A;  1VBE 1;  5GM0 A;  4BCU A;  4CDQ A;  3SNM A;  2VZS A;  1UY3 A;  3VBU B;  5KHJ A;  1DF0 A;  1AF9 A;  1HRV 1;  2JDZ A;  4DUX A;  5FTT C;  1LES A;  1APN A;  1YQ8 A;  2WYF A;  3AKR A;  3O1P A;  2Y38 A;  3GGL A;  4X6R B;  3O0V A;  5CFD A;  1F35 A;  1JBC A;  1KS5 A;  3AZX A;  3WG2 A;  1RUH 1;  1W9F A;  2B8M A;  1CZV A;  4QB6 A;  4AVC A;  1QOT A;  2WS9 3;  4GH4 A;  5HCB A;  3N35 A;  3LOI A;  2ETE A;  4BH9 A;  3HD8 B;  3ZOI A;  1C8M 1;  2AAC A;  4ZS3 A;  3TBD A;  1G9D A;  4B4P A;  4ZKT B;  5CAD A;  2OXB A;  1RUI 2;  2JDY A;  1Y4W A;  2WNU C;  4YVS C;  5BNP A;  1HXS 1;  1RUF 3;  1RXF A;  3VD4 A;  5IWF A;  1OH3 A;  1CIW A;  4HOO A;  1VB4 A;  3FHA A;  1QH7 A;  2CDO A;  4PLN A;  1W04 A;  2DCY A;  2EIB A;  1U12 A;  1JOD A;  1OFN A;  3W59 A;  1GNZ A;  4GJY A;  2WAO A;  3VL9 A;  1LJ7 A;  1XJA A;  3K48 A;  5EYY A;  5SV8 A;  4QPI A;  1ZZB A;  3HNB M;  4XDO A;  4JDO A;  1JYI A;  2VUA A;  3VHP A;  4B7E A;  5FCC A;  3J26 N;  2ZS6 B;  3ACF A;  5A7N A;  2BOJ A;  2RR1 1;  5A1A A;  1KRI A;  1W6M B;  2YUE A;  4QPG B;  1RUD 1;  3OGR A;  3UV9 A;  5FZB A;  1LGC A;  1ZZ7 A;  3NO8 A;  2A3Y A;  2NQY A;  2VZO A;  4AED C;  3V0B B;  3IMM A;  1W90 A;  4JTO A;  1WGP A;  3PVB B;  2HWD 1;  1W06 A;  5F6K A;  3T1M A;  2GMM A;  1PO1 3;  3ES4 A;  3OUH A;  1ZM1 A;  4X8N A;  4KU8 A;  5FBZ A;  5GLZ A;  3USU B;  3R05 A;  3V0A A;  1R08 1;  5EPA A;  5F39 A;  1RMU 2;  2D6M A;  2ZGU A;  2OPW A;  4P9L A;  1PHM A;  4YVW C;  5J96 B;  3PUH A;  2WNE A;  4UAP A;  5JVV A;  4FVV A;  4DB5 A;  1O4Z A;  1GU3 A;  2R1D A;  3NNL A;  1F5J A;  4HBN A;  4I30 A;  2RDN A;  1W8H A;  5FY4 A;  3SCG A;  2PHD A;  2YHJ A;  1AR8 3;  3WHT A;  3IN9 A;  5H9R A;  2VUD A;  1NCQ A;  3B9I A;  3OTF A;  1TME 2;  4IEW A;  4LO6 B;  1O4Y A;  4HK9 A;  1ENX A;  1QU0 A;  4KWK A;  4HPK A;  1JYN A;  3MHZ A;  2Y6F A;  3NAP C;  3NV4 A;  5EHD A;  1GNH A;  4CEW B;  4MGQ A;  2YGL A;  4XJ8 A;  3LE0 A;  5FPA A;  5FY1 A;  4AFC A;  1S0J A;  5KXB A;  2BNN A;  3L2Y A;  4IW3 A;  3OY8 A;  3ZPY A;  4TTG A;  4AYU A;  4DFS A;  4YM0 A;  3FZ3 A;  3B02 A;  2R04 3;  1G9B A;  3I2G A;  3ILR A;  1CN1 A;  2AH2 A;  2VVF A;  4LXL A;  3QH6 A;  4QX2 A;  1YJK A;  1HB1 A;  3D0S A;  2X8K A;  3L9J T;  3U1X A;  4EZ4 A;  4MXW B;  4DQA A;  1ZBE 2;  3CF6 E;  2C9A A;  4XTP A;  4YVS A;  3WLU A;  3WQB A;  3FLT A;  4Q0V A;  2HEV F;  3WP3 A;  4BLJ A;  3KV5 A;  1RUC 3;  4YZ2 A;  4XFH A;  1E5S A;  1PK6 B;  1SDD B;  2XBO 3;  1GFF 2;  3AP9 A;  4IV1 C;  1H4G A;  1YQC A;  2EF6 A;  3K3N A;  2J42 A;  4LQR A;  2W39 A;  3I4I A;  1E5R A;  2YZ4 A;  1GP6 A;  1JYV A;  1BEV 3;  5F37 A;  4H55 A;  4M3C B;  3WF3 A;  2W95 A;  4K40 A;  2VUL A;  2WZR 3;  2ZTN A;  1PIV 2;  1UAI A;  1UCX A;  4BQ2 A;  1JZ4 A;  3NJY A;  2VR4 A;  1URX A;  3AK0 A;  2DUO A;  1B35 B;  1HX6 A;  2RVA A;  3WNN A;  3UKN A;  4FPC A;  2OII A;  3VV1 A;  3UKT A;  5FZ0 A;  2GNT A;  3O1O A;  3MW3 A;  2E7T A;  3J7M A;  3WDW A;  1OBN A;  1HB4 A;  4KWU A;  2WA4 A;  4AED A;  1LAJ A;  2D5F A;  3OGV A;  1JZ8 A;  1H2L A;  4XF9 A;  3RJR A;  3SCF A;  4BQY A;  2ET1 A;  1FMD 2;  3PVO A;  3OOX A;  1QEX A;  1BBT 3;  1H1I A;  2IXJ A;  3AZV A;  3Q8E A;  5JXH A;  1VBA 2;  4YVW A;  3OGG A;  3EJK A;  3PMS A;  4XIK A;  1AL2 1;  4XAE A;  5IVY A;  4DRR A;  2XPJ A;  1MVE A;  1PVC 3;  2QQO A;  1NT0 A;  4XE9 A;  3SKV A;  2IXC A;  3ACL A;  1WW7 A;  1RED A;  4ORF A;  3KQ4 B;  4K9S A;  3GJA A;  4CE8 A;  3ZIW A;  2D3P A;  2R30 A;  3OYW B;  4YWA A;  3FBY A;  1XRU A;  1QY4 A;  1BK0 A;  1BYH A;  1G86 A;  1LU2 A;  3AC0 A;  1GP4 A;  1V9U 1;  4MOA A;  2ZKN A;  2QQP A;  2OVU A;  1Z7S 1;  4D7S A;  3NAP A;  4P9G A;  3P3P A;  4AGG A;  5EIY B;  5AVP A;  5DQ0 A;  2PXJ A;  3HNM A;  5C4W A;  3U0Z A;  5F8P A;  2ZGQ A;  2XHK A;  3UGH A;  1GQP A;  4JRA A;  2VTX A;  3JBG 2;  2YPD A;  1IS5 A;  1AJK A;  5E89 A;  2OUJ A;  2XJR A;  5C6C A;  4AOC A;  5LW9 A;  4NHK A;  4UFL A;  5IUQ A;  1SCS A;  3WDT A;  3IPV B;  5FYS A;  4CDX A;  4LT5 A;  2JE7 A;  4IV1 A;  2D3R A;  4NHL A;  4Q27 A;  4QPY A;  4R4Z A;  5A7W A;  4Z07 A;  4IXL A;  2FDF A;  3ZFG C;  4OZX A;  4ZZ5 A;  3J7H A;  2P1B A;  4ERO A;  1W6O B;  4YPJ A;  3ZN5 A;  4OHX A;  3LIH A;  4XQ4 A;  4AL9 A;  3BI3 A;  2CGP A;  3BPS A;  4G4F A;  2GAL A;  2B7Y A;  1DQ1 A;  2UWC A;  3AVR A;  4A44 A;  2DTW A;  1XND A;  4GMP 1;  2VD7 A;  1QQP 1;  3VZO A;  4CEY C;  4Z2A A;  5IYY A;  3K75 B;  4CUA A;  1D2S A;  3AL6 A;  3K46 A;  5GLT A;  2D3S A;  2CY6 A;  4QHZ A;  5FJK A;  5J09 A;  1XBF A;  4N43 B;  2CWM A;  2OX0 A;  2EVX A;  3HVD A;  1UF2 C;  4UW6 A;  2HWE 1;  2WO3 A;  4NR1 A;  4W65 A;  2HWF 1;  2F6B A;  5DMY A;  3NQH A;  1VAL A;  3RZZ A;  1XNA A;  5IK8 A;  4YAR A;  1H4H A;  5FQ0 A;  5J7M A;  3RMY A;  4AAP A;  3VZL A;  3MPP G;  3I8T A;  4IET A;  1HW5 A;  3HQX A;  3VBH A;  1QJU 1;  2A71 A;  2H0B A;  1SZB A;  1VBB 1;  5HCA A;  3GBG A;  1NYW A;  2GN7 A;  5A6Q A;  3R4D B;  3LD8 A;  3KHC A;  1ZRC A;  5LBE A;  1DZQ A;  4LBN A;  3UES A;  1L3J A;  2BGO A;  4I2O A;  2FZ2 A;  4M0N A;  1RIR A;  5DZG A;  1LHN A;  2HWB 1;  1DQ4 A;  4LA3 A;  3RZK A;  3FE5 A;  5JIA A;  5A6X A;  4N90 A;  4PIX A;  1K5J A;  3EMR A;  3K4A A;  4KBB A;  5I0R A;  5KHI A;  3T2Q A;  1H9W A;  2ARX A;  2XJQ A;  1IOA A;  5LK5 A;  1H2K A;  3I3B A;  1GZW B;  4HN1 A;  4Q26 A;  4C0B A;  5GZC A;  2KA3 A;  4AEK A;  2R06 2;  3BB6 A;  1X9P A;  4QMA A;  3KZ4 C;  5FZK A;  1VB2 A;  2IUW A;  3TN9 2;  1VR3 A;  1WBF A;  3MI8 A;  5L36 A;  1FXZ A;  5FLJ A;  2X10 A;  4EWD A;  5DUV A;  1CAW A;  2OPK A;  3ORJ A;  4LE3 A;  4XYX A;  3NVC A;  1D4M 1;  1AX1 A;  1UOF A;  3ZFG A;  4ASL A;  1H1A A;  5JPN B;  3PDQ A;  2RM2 3;  3JD7 3;  3ABZ A;  2VGD A;  5AC9 2;  1MS5 A;  3S6P A;  2D97 A;  3BOP A;  3POJ A;  3CJI C;  2PHR A;  4BQ1 A;  1WKY A;  4FOV A;  4H2A A;  4AQ2 A;  2XON A;  4ZXE A;  1JZ7 A;  4E2Q A;  2E33 A;  3I97 A;  3VD5 A;  2Q1M A;  3WG3 A;  2IXK A;  3JXS A;  1W9T A;  4I09 A;  4CEY A;  1S2E A;  1QDO A;  5FK7 A;  3WEZ A;  1IZ3 A;  3RRD A;  2WFF 3;  2YBS A;  5JIU A;  4S2H A;  1AUY A;  1J3P A;  4XCA A;  4HN0 A;  1LGB A;  1RUI 1;  1RB8 G;  2RS5 3;  3TRS B;  3B93 A;  2WRA A;  3T4H B;  5FBJ A;  1BKZ A;  4L8Q A;  3CO2 A;  2EXI A;  4RS5 C;  2WO2 A;  1FI2 A;  1WLC A;  3WCS A;  3VD9 A;  4FPG A;  1CAV A;  1GSL A;  3MYX A;  3WUD A;  3VZK A;  2J1S A;  1H8T C;  1K5M C;  1H2M A;  2JG8 B;  1GLH A;  2Y0O A;  1ZBA 2;  2BFU S;  3H7J A;  3VKN A;  1VMJ A;  3KF3 A;  5EJ1 B;  2WAB A;  3NRU A;  4K3U A;  4XDP A;  3AKQ A;  4IEO A;  2XWJ B;  5C8C C;  1ND2 A;  1RIN A;  4RQP C;  3C8X A;  4FOW A;  4GKX A;  4CUC A;  4LLO A;  1XE8 A;  1HDK A;  2D6K A;  5HBA A;  4FQZ A;  5JSO A;  1HLC A;  2E63 A;  4RHV 2;  1H6Y A;  3WV6 A;  3SIS A;  4Q4V 2;  2VMG A;  4HSJ A;  4GA9 A;  4NRQ A;  4CSW A;  1WMD A;  1IPJ A;  2BVB A;  5FY8 A;  3O0X A;  1N1Y A;  1PMI A;  3WDX A;  1QOO A;  2JDM A;  2WNV C;  1AVB A;  1VBC 3;  3UKV A;  4NE9 A;  2GAU A;  1R64 A;  3OUI A;  4M00 A;  2JIC A;  2KXL A;  4NWW A;  5C4W B;  1X82 A;  2YC0 A;  4LKS A;  1QJY 3;  2SLI A;  3CMG A;  4JRL A;  4KGQ A;  4ONU A;  3O12 A;  3HR9 A;  4TLF A;  2VMD A;  1JI6 A;  4ASM B;  1ENS A;  4JGZ B;  2FMY A;  4WM8 B;  5KXE A;  3I3D A;  3F95 A;  4UXA A;  1I6X A;  1S0B A;  4XBL A;  5KWR A;  1N3O A;  2DVG A;  2VH9 A;  2UYA A;  3ELN A;  1NOV A;  5A3L A;  3RYK A;  1OI6 A;  1VBE 2;  5F3G A;  1IQA A;  4AFD A;  1OSG A;  1W9S A;  3MIB A;  1SLA A;  4FXG B;  4A3Z A;  5E16 A;  1QJX 2;  4AQS A;  5LZ6 A;  3CJI A;  2DVF A;  1RUH 2;  4LUL A;  2W1Q A;  3E6D A;  3SIT A;  4DO0 A;  3NNF A;  2FMD A;  1COV 1;  3C7H A;  2IFW A;  3PUA A;  3QAC A;  2OKX A;  2VZQ A;  4AQT A;  4JQT A;  5JMC A;  5JR2 A;  3GDB A;  3C7E A;  3D82 A;  1HXS 2;  4LJH A;  4QX7 A;  4YGD A;  5EV7 A;  3VBS B;  3CHX A;  3MIE A;  3ZN4 A;  3POI A;  1C5H A;  3CBN A;  2UY9 A;  3CIH A;  4LBQ D;  3W21 A;  2GC3 A;  4D6Q A;  2UYB A;  1HV1 A;  3H3Z A;  1AJO A;  1CAU B;  1SCR A;  3PTY A;  2VEC A;  4BIF A;  1MS8 A;  2XLG A;  4P08 A;  1K5M A;  5APA A;  5F3E A;  5F2W A;  4ZU5 A;  3IKW A;  3WNX A;  3E6B A;  2CAV A;  2RR1 2;  1HRI 1;  1VRH 3;  4BYY A;  1PO2 2;  4EWE A;  5JZG C;  1XQN A;  2Y60 A;  3DYO A;  1RUD 2;  3N7M A;  3VDC A;  4AI9 A;  2AC1 A;  4WVW A;  4CZS A;  5B2G B;  4RQP A;  1PNG A;  5C8C A;  2ZA9 A;  5JPM B;  3I3M A;  2C6S A;  2DVA A;  3WIN E;  1T6G C;  3MUZ 1;  1F2N A;  1YWK A;  2BDR A;  2BV4 A;  1D2Q A;  4E8C A;  3AKS A;  2GDF A;  4HKW A;  3UK9 A;  5T5P A;  2DF7 A;  4FT8 A;  2Q8D A;  3VBU C;  5IAX A;  4IQP A;  1ND3 B;  3NMB A;  4BK4 A;  4CUG A;  1R08 2;  2OZJ A;  1FMD 1;  1Z0H A;  4PJY A;  2WNV A;  4K1Y A;  1OLM A;  3P5B A;  5H9P A;  5L9B A;  3RYP A;  2PHF A;  2WQ4 A;  3J9S A;  3WUC A;  1AR6 2;  4NIH A;  3CEW A;  2Q0A A;  3BPZ A;  1Z78 A;  1DLL A;  5A3T A;  4N53 C;  4XHX A;  3OBZ A;  3C2U A;  5FY9 A;  5C8W A;  3WP4 A;  1OA2 A;  4PQ9 A;  5FO9 B;  4C91 A;  3ZXF A;  3PU8 A;  2Z42 A;  2B4K A;  1OOP C;  4NIG A;  4D7T A;  1SLT A;  3WX5 A;  4CCL A;  1ASJ 1;  4YSF A;  5B4N A;  3QCW A;  2VG9 A;  3KCX A;  2WZE A;  4DPN A;  2LTN A;  1S0E A;  2NMN A;  4ZU4 A;  1STM A;  2LM3 A;  1EUT A;  5F5C A;  2RS1 3;  4LPL A;  3H1Y A;  2W08 A;  4Z82 A;  4CCJ A;  3ZXK A;  1CAX A;  1HJG A;  5EJZ B;  5CG9 A;  2GU9 A;  1VPH A;  3DKQ A;  5ANN A;  3GNE A;  5FY0 A;  3BAL A;  2MEV 1;  4A7Y A;  3JBG 1;  3RWN A;  4HFS A;  5DPN A;  2BOI A;  5FLH A;  2ZMK A;  1HV0 A;  4K7J A;  3WP6 A;  3ZYF A;  2QQK A;  2EA7 A;  5D2A A;  3KF5 A;  4HON A;  1UNB A;  1ST8 A;  3BOD A;  5LBB A;  2R0H A;  2GND A;  4CCC A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  4IGP A;  4AAP A;  4EZH A;  4ASK A;  2GP5 A;  4CCK A;  2YU1 A;  2OQ7 A;  3K2O A;  3K3N A;  5FPB A;  5IVE A;  5FZ4 A;  5F37 A;  5FP4 A;  2Q8C A;  5F3G A;  3AVS A;  4IGQ A;  3LD8 A;  3NJY A;  2OT7 A;  4DIQ A;  5FZA A;  5CEH A;  5FYH A;  3PUQ A;  2XDV A;  5FYU A;  5FP7 A;  3PUR A;  5FZ0 A;  5F3C A;  3DXT A;  5ANQ A;  5FP3 A;  3KV6 A;  4DO0 A;  5F32 A;  2W2I A;  5FWJ A;  3KVA A;  5FYB A;  5LY2 A;  3PUA A;  5F5I A;  5FUP A;  5FYC A;  3AL5 A;  4LIT A;  5KR7 A;  4QX7 A;  5FYV A;  4QWN A;  5F3I A;  5FZO B;  5FYY A;  3N9O A;  4URA A;  2Q8E A;  5FPV A;  5IVY A;  5A7P A;  5FZK A;  4GAZ A;  5FZD A;  5IWF A;  4HOO A;  4D6Q A;  5FZI A;  2WWU A;  5FUN A;  3K3O A;  3N9P A;  4NUB A;  4E4H A;  5FZC A;  5FYT A;  5A7W B;  5A7S A;  5FZ9 A;  5F3E A;  4BXF A;  5F2W A;  3N9M A;  4GJY A;  5FZF A;  3PDQ A;  4XDO A;  4QXC A;  4AI9 A;  2YBK A;  4UF0 B;  5FP8 A;  5FPL A;  5FYI A;  4CCO A;  5ISL A;  5A7N A;  3U4S A;  3UYJ A;  3PUS A;  4GJZ A;  5FZB A;  5IVJ A;  2P5B A;  4BU2 A;  3U78 A;  2PXJ A;  5FZ6 A;  2Q8D A;  2WWJ A;  5A7Q A;  5FXW A;  4EYU A;  2GP3 A;  4CUG A;  5A1L A;  2YBS A;  4QXH A;  4Y3O A;  3N9L A;  5F5A A;  3ZPO A;  4LIU A;  5F2S A;  2YPD A;  5FZO A;  5FZ7 A;  5FWE A;  5F39 A;  5IW0 A;  4LIV A;  2XML A;  5FBJ A;  4GD4 A;  5FYM A;  5FY5 A;  5LW9 A;  4V2W A;  3LDB A;  3DXU A;  5A3T A;  5FYS A;  2YBP A;  5FZ8 A;  5FY9 A;  5FY4 A;  5FZM A;  2XUE A;  5IVC A;  4Y4R A;  5FXZ A;  3ZLI A;  3PU8 A;  5FZL A;  5A7W A;  5FZG A;  5A80 A;  4CCL A;  5E6H A;  5FZ3 A;  3KVB A;  5FXX A;  4XDP A;  5FYZ A;  4BIS A;  5FPU A;  4UF0 A;  4QX8 A;  3KV4 A;  3KV9 A;  3RVH A;  3OPW A;  3OPT A;  3PTR B;  5IVB A;  4C8D A;  5LY1 A;  1VRB A;  4D6S A;  5FY7 A;  5FZE A;  3AVR A;  5F5C A;  4IGO A;  2OQ6 A;  4D6R A;  5LWB A;  4V2V A;  4TN7 A;  5A3N A;  5IVF A;  4Y33 A;  5FXV A;  4CSW A;  4CCJ A;  2VD7 A;  5A1F A;  5FP9 A;  5FPA A;  5FY1 A;  3AL6 A;  4QXB A;  2YU2 A;  5FY8 A;  5FY0 A;  5IVV A;  5FJK A;  5FV3 A;  4CCM A;  2OX0 A;  3N9Q A;  2OS2 A;  4LXL A;  5A7O A;  5K4L A;  5A3W A;  3N9N A;  5FJH A;  4EZ4 A;  5A3P A;  4CCN A;  2XXZ A;  4HON A;  4QU1 A;  3PU3 A;  5FZ1 A;  5FZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...