2OS2A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys36
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
347
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
total genus 109
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2os2A01
5F5CA 2Q8CA 5FZOA 5FYIA 5A3WA 5FXZA 4EZHA 4LIVA 5FPAA 3KV4A 5IWFA 2YU2A 3N9QA 4V2VA 5F3CA 4CCNA 5A3PA 5LY2A 2P5BA 5F37A 3KV5A 5IVYA 5A7WB 3UYJA 4QX8A 3PURA 3NJYA 5FBJA 5FZCA 5FYVA 3PTRB 5F3EA 2YBSA 5FZ9A 5FZHA 5FPUA 3AL6A 5FYHA 5K4LA 4CCJA 3AVRA 2XDVA 4QWNA 5A1FA 5FP3A 5FYCA 3KVBA 5FYYA 5FXVA 5FZAA 4EYUA 5FYUA 5F3IA 3DXUA 4CCMA 2OS2A 3PUSA 5E6HA 4XDOA 4IGPA 2YBPA 4DO0A 2W2IA 2YU1A 5A7NA 2OX0A 4NUBA 4GAZA 3ZPOA 5IW0A 3ZLIA 3LD8A 5F32A 5FZ1A 5FZKA 5IVFA 3N9LA 3KVAA 5FP7A 5IVBA 5FZIA 5F2WA 2OT7A 2Q8EA 4CUGA 5A3NA 5A80A 4QXHA 3OPWA 4Y3OA 5A7QA 5A7WA 3KV9A 2OQ7A 3PU3A 4QXCA 2WWJA 4LXLA 5F5AA 5FZ7A 5A7OA 5FZOB 5FY1A 4DIQA 5FUNA 5FY0A 5FZ3A 4C8DA 4HONA 2XUEA 5F5IA 5FPBA 5FZ8A 2OQ6A 5FPVA 5F2SA 4QU1A 5FXWA 4Y33A 4AI9A 5LW9A 4IGOA 4D6QA 3OPTA 2Q8DA 5FXXA 2YBKA 4BISA 1VRBA 2PXJA 5FZGA 3N9MA 3RVHA 4GD4A 3AL5A 5FZ4A 4LITA 5F39A 2YPDA 4CCKA 5ANQA 3K3NA 3PDQA 4TN7A 5FWEA 5FYZA 4D6RA 4CCLA 5FZFA 5LWBA 5FY7A 5FY9A 4E4HA 5FY5A 4BU2A 5LY1A 5FY4A 5IVJA 2VD7A 3N9OA 4HOOA 4Y4RA 5FZMA 4GJZA 5FZEA 5F3GA 4CSWA 5FJKA 4QX7A 4UF0B 5FYBA 4GJYA 2XXZA 5FZDA 5FZBA 5FP9A 5FP8A 5FYSA 3LDBA 4D6SA 5IVVA 5A3TA 5FZ0A 3N9NA 5FYTA 4V2WA 5FZLA 3PUQA 4IGQA 4QXBA 5IVEA 4LIUA 5FYMA 4EZ4A 4XDPA 5FZ6A 3AVSA 5FP4A 3PU8A 4ASKA 5ISLA 3PUAA 4URAA 2XMLA 2GP3A 5FY8A 5A7SA 3N9PA 4BXFA 5CEHA 4AAPA 5FJHA 3K2OA 2WWUA 3DXTA 3U78A 2GP5A 4CCOA 3KV6A 4UF0A 3K3OA 5IVCA 5FPLA 5KR7A 3U4SA 5FV3A 5FWJA 5FUPA 5A7PA 5A1LA
chains in the Genus database with same CATH superfamily
3B9IA 5F5CA 2B7YA 1UWWA 3LEGA 4FVVA 3H3UA 3KV4A 3IWZA 4IEWA 1K42A 3IZOA 2OVUA 4YWAA 3DGTA 1RYYA 2JENA 2E7AA 3N7KA 3HJRA 3BB6A 3GBGA 2B39A 1PNGA 1O3SA 3PLQA 1N3OA 4JDOA 4Q4X2 4YSFA 1APNA 4QX8A 4AGVA 2GALA 4FBFA 4META 3S57A 4LK6A 3HPNA 4R9BA 3NMBA 3PIGA 2W39A 1G7YA 4FPJA 5E16A 5FYHA 2TBVA 5A3OA 4JAAA 4E4SA 1J3PA 3VBHA 1RJ7A 1JUIA 4CCMA 4MADA 1UZ0A 2E63A 2WO7A 1ULDA 1TNRA 2P17A 2WJSA 3GZUC 3MBWA 2PQSA 5JSPA 3I49A 2Y6KA 4LORA 2BUKA 4HZFA 3J8F3 2J1EA 1SLIA 4R8HA 4ZS3A 1SPPB 5F32A 4BQXA 1XNCA 2GAUA 1EAH2 4N7IA 5GALA 4MXWA 4RQPB 5JVVA 3MHZA 1QXPA 5EPAA 2PYTA 4WM8C 1K5MC 5GLTA 5KHJA 1YUDA 4AF9A 4L0PA 2WA4A 4P9JA 1FXZA 4FQZA 1LHNA 1RITA 2MHFA 2IVJA 2R061 4FP2A 5FY1A 2OPWA 4D8MA 5I8YA 4GKXA 3LF7A 4AQTA 1MR5A 2BOIA 2ZGNA 2EXHA 1I6XA 4XUOA 3ZXDA 1OURA 2DVBA 5GLVA 3IKWA 2WAAA 4DFSA 5DUXA 1O59A 2WA3A 4Q8KA 4AGRA 2WNVA 4N7UA 2GMMA 3MF6A 4UFKA 4YVWC 3MPPG 1UYYA 1A8DA 1G86A 4QKDA 2Y60A 5BNQA 5EXOA 2IVIB 4Y20A 3WVJA 3CMGA 3S7EA 1NLRA 2H6CA 4CP2A 4CDWC 1YEWA 2V72A 5IAVA 1NQDA 3PDQA 1AZDA 4KG8A 1W39A 5FO9B 5FKCA 3NKTA 4UW4A 3N35A 4LBQA 2UURA 5C70A 1R1A3 3W9AA 2W95A 1W6QB 2CNAA 4P9IA 4AFAA 1TVGA 3MI8A 1JZ5A 2A6VA 2W52A 3VBFA 3WDUA 1YO8A 3FL7A 4GWIA 1F5FA 2Y38A 5C4WC 1ENRA 5A3UA 1OLME 4AHWA 3ZDSA 3MLJA 3T3YA 4BK4A 5IT6A 3M3EA 2F6BA 3SMHA 1S0IA 2OUHA 2ZEXA 2ZXQA 2ZGLA 3RI9A 1RUNA 1VBE3 2VOWA 4YRDA 3E6DA 1R64A 4ARXA 2Q5TA 1WCKA 1LODA 2WZR1 4RSUA 5H9SA 3MPBA 3TN93 4ZKTB 4KWJA 4D7SA 1K3IA 4QKFA 2Z4FA 4L99A 4MZUA 4PDWA 1GU3A 3ETPA 2DBIA 3ES4A 2BWCA 2B9UA 2JD4A 1YHFA 2A6ZA 2VNGA 4MGKE 4FP3A 5CFDC 2WFF1 1KDMA 1FMD1 1FPN3 5IWFA 4GMP0 5EJZB 5LRSA 1W04A 2D6NA 1HDKA 1JI6A 1W9SA 2VCCA 2VNRA 2VOVA 4XPVA 3ZXGA 5ACA2 1XNDA 4I30A 1ND3A 3WQ7A 3X29B 1TE1B 2YBSA 4OHZA 2VUJA 3POJA 1IPJA 1QJU1 3WUCA 1QF3A 5FYCA 3IT8A 4GH4B 1XSRA 3IB3A 3AYAA 3WNXA 2A5ZA 1HRI2 1QJX1 4F83A 3VDDC 4UW5A 2VZ1A 2BU9A 2EAKA 4AI0A 2BNOA 2IFRA 3KF3A 1WCSA 4JKMA 4MXVA 3FFQA 3I7DA 3KVAA 3ZXAC 4CUBA 4QPGB 4NJ4A 1AR92 1UPIA 3HNYM 5B4NA 2XBO2 4YW6A 1ASJ2 3MIBA 5K0UB 2J1AA 2Y6FA 4K21A 4CXXA 4C1XA 4N43B 2YDEA 2OQ7A 2VMFA 2D40A 3WDYA 3IDEA 4LXLA 4PT6A 2XJTA 4TLFA 4AEDC 2K2SA 3NV2A 1QXJA 4Z2WA 1PIV3 3D6EA 5L73A 4EN7B 4OI1A 1SLTA 5G04L 5FZ8A 3U1XA 2AGSA 1OXCA 3VKMA 2HBTA 3IBMA 2CHHA 2YFUA 1EAH3 3WHTA 2NPIA 4XFHA 4RL7A 3WNOA 1CPNA 1NAEA 2R071 3LAGA 1QWRA 5AFEA 2D3SA 4RR3C 3VDDA 1JW6A 4KGGA 1HXS3 5FMCA 4FPKA 1HRI1 1HRV3 1QJX2 1W8TA 2PAKA 3OBZA 4CCLA 2QJVA 2NLRA 1NT0A 1RUI1 4QQOA 3EJKA 1C28A 2ZAAA 4NRQA 3FN9A 2A3XA 4AVAA 3KM5A 5BY5A 3NJZA 5CBLA 1UYXA 1SEFA 1UCXA 3A21A 1YYNA 3QLQA 4HVQA 4RHV2 2YG0A 5JZGB 4GJYA 1URXA 2XUMA 3RYKA 5FP8A 1C3HA 1IOAA 4Q4V2 1ASJ1 2JDAA 3IDBB 5FZLA 1XC6A 4G4FA 3LSEA 4JGZC 3KS7A 5C5UA 3E1F1 4IEUA 3HEIA 5FYMA 3WW3A 1EP0A 1H6YA 3H9AA 3I2DA 5FZ6A 4E9KA 4DZGA 2Y33A 4ZZ8A 2J22A 4PF1A 3DYOA 1VMJA 4BHPA 3WQ1A 3IIIA 3PUHA 1NY71 3ETQA 2GP3A 3T09A 4B3NA 1V0AA 3WLUA 1ULOA 2ID4A 4CU6A 1ZBE2 4Y4YA 1VAVA 1F15A 5KXCA 1W9YA 3K2OA 2D93A 1OUXA 1WLTA 1LR5A 3TRSB 2VU9A 2WQ4A 1O3TA 2VVEA 2VBDA 3WDXA 3U4SA 1HJGA 1TNFA 2A7AA 4KWKA 5A1LA 2HWE1 2YMZA 1YRZA 1W8HA 4QHOA 1AX0A 3IN9A 1FV2A 1LGCA 2ZMKA 5TSWA 4A6OA 1OOPA 4E2QA 2LRPA 3VHPA 4AAXA 1RUD2 4CCNA 3QOPA 4FQ4A 4Z82A 2X29A 4Y5TA 1SDDB 3WF1A 3W5MA 3A0NA 3BTAA 3CL1A 4R4ZA 3RZKA 1H8TA 3ZFGB 1ZNPA 4JGZA 3AP4A 1BBT1 5CFCA 4AVSA 5IFPA 1ZBA1 3H8OA 2VUDA 1WCUA 5FYYA 4IDZA 2HYXA 1UOJA 2LW8A 2FDJA 1E5RA 3ZN6B 2K0GA 5E6HA 1STMA 1PZ7A 5A32B 1L7LA 1SBFA 2Z79A 2I74A 1W2OA 2XB6C 4XJ8A 1QOSA 3LKJA 4LT5A 5K0UA 2YHJA 1UKGA 2G19A 2XR4A 3HT1A 2YY1A 1NY72 3WG4A 1QXRA 3OUIA 3POIA 2B42B 2ZS6B 2JG8B 3AZWA 5KHGA 1ZBE1 3CU7A 2A6WA 4E27A 5IVFA 3VZJA 4OI0A 2GSYA 5FP7A 2JDUA 1JZ7A 3OYWA 1T6BX 5C8WA 2W3JA 4R9AA 5KXBA 1W6MB 5B2GB 2DU1A 2P2KA 3LEMA 3RS6A 3PNAA 2D3PA 2XJRA 4FFFA 1US2A 3ZSKA 4QXHA 1DQ2A 2HWE2 4CDQB 4CCDA 3H8RA 5HCBA 2RM21 1LHUA 3W58A 4PCRA 3PU3A 2XLGA 3HQXA 4NPMA 3H1WA 3H42B 5FUIA 3ZN4A 1GLHA 4XHXA 4BMBA 1AHSA 4CDQA 4RS5C 4A4AA 1LHVA 2FHRA 4NIAA 1MZEA 5A32A 3THTA 5IK4A 4TWTA 4CE8A 3C7HA 4Y22A 3O1TA 4QU1A 1IKPA 3WP5A 3O1OA 3JUUA 4LBNA 4QDSA 3ZKUA 1VP6A 1RMU1 3H7YA 3MUZ1 1RHI1 2PXJA 4UFLA 3LE0A 4DOUA 3N9MA 2PHWA 4XIKA 3A23A 2PN5A 3K4ZA 4P9XA 4YW5A 4WM7B 3AP7A 2GC1A 2XJPA 3ZXJA 1KRIA 3KWVA 3K51A 1JODA 4QPGC 4AQ6A 4BOWA 5FY7A 3NQHA 2A75A 5K8SA 5FY5A 2X09A 1PHMA 4COZA 4KI5M 3BN6A 2B8MA 4UFIA 5JUVA 3BOWA 4LBOA 4UF0B 1HQLA 5C9AA 5FZBA 3SEPA 2Y0IA 3O0VA 2ZBJA 3LA2A 4LBJA 3VDCA 4TXWA 5LB6A 1VR3A 2D5FA 2A71A 3H50A 3PUQA 3SNMA 3S6PA 3DECA 1S4CA 2WT2A 3KSCA 2D6MA 3LA7A 3AVSA 1OBNA 1C5IA 1R081 3H1YA 1MS4A 2JXAA 2PHUA 4XIOA 3KGLA 2FDIA 2IXJA 4Y26A 4ASKA 1CN1A 4PLNA 2FBEA 4N43A 3O1RA 4RFT0 1WW7A 4KL1A 3ZYFA 2ZACA 4QHZA 1UU5A 2EF6A 1K12A 5JXGA 2Y6JA 2IUWA 1OLRA 2D97A 3AZXA 4LKEA 1O5LA 3D3AA 4QPIA 4LBMA 2QQJA 5ABJB 3TEYA 2WWSA 4HKLA 1MS1A 2HLEA 2OKXA 4CP0A 5IVCA 1IQDC 2CU5A 2PELA 1WCQA 2LM3A 3UGGA 1RUF1 2PQQA 2C1FA 1WW6A 1PO12 1V70A 1VJ2A 3OY8B 4UAPA 1Z0HA 4AEKA 2VMCA 4ISRA 4H55A 3BIEA 2HEYF 1HB2A 4AFDA 3LEIA 3MW4A 5I91A 3ZDVA 1KDKA 2Y6GA 1UYZA 4MVTA 4LE3A 4FPGA 1DGRN 1Q8OA 5FPXA 1WW5A 2JDHA 3QH6A 4KBBA 1SFYA 4GALA 5L9BA 5A7WB 5I0RA 3I8TA 1R091 1UMIA 4QX0A 3M3IA 2QQWA 4NO4A 1GQGA 4WBBA 5F3EA 4E2SA 2RR11 5FPUA 4JV4A 1CAVB 1DGWX 2H0BA 2VH9A 4OUMA 3ZYHA 2KR2A 2ZX1A 5BUVA 4PDWC 1MVQA 5IAXA 3ECQA 1XSQA 5K9YA 1LULA 1LEDA 3FC0A 2ZGTA 5C5TA 5DZFA 4JVAA 1HN0A 1POQA 3I59A 4NPLA 2OS2A 4BQ2A 5FCCA 1GNHA 1R083 2E31A 1BEV1 3AYCA 1R082 3BKZA 3C2UA 1ENQA 1LOEA 1CAWB 3VHOA 2W2IA 3VZKA 1JTZX 4RGAA 3WP6A 2DVDA 1OKQA 1YXWA 3N3HA 1AR82 2HH9A 1POV1 1VIWB 1WCDJ 4NN0A 3VBUC 1R1A1 2HJIA 2WR9A 2YPJA 2AREA 3FLPA 3T30A 3BALA 3U07A 1AXYA 4N53A 1RUF2 3ZO0B 4AVBA 4Q27A 5AVPA 1OLMA 1FOD3 1W0NA 5A6ZA 2NMOA 3NSTA 4LA2A 4K8FA 1GWMA 2P1BA 2DUPA 2HEVF 2JIGA 5FY0A 2WBKA 2ETEA 2WZR2 4MXWB 4RQPA 3THPA 4B7KA 2QZ2A 1NXMA 5FPVA 5LK5A 1ND3B 2UU8A 1OD3A 4UBHA 1UX6A 2G9GA 5FDBA 2X5IB 2GNBA 1V6IA 3WCSA 3LWCA 5T3NA 3VBUB 5T5OA 1C8M3 2R7EB 1FMD2 2YPDA 3B7MA 3Q8EA 4D6RA 1HRI3 1HRV1 3MEPA 3JD73 3O0XA 1XB9A 2E53A 4DPNA 2G9FA 2WN3A 5FMDA 2R0FA 4JRLA 1AYN1 1AF9A 2Q30A 3NO8A 5ACA1 2QKDA 5LK7B 4BZ4A 3EMRA 2RJLA 4J1XA 4CP1A 4MV2A 4CCCA 2X5IC 1S0EA 5JXJA 5IK7A 4KH9A 2PHRA 4LBKA 1VBC3 1NCQB 2W46A 1QJU2 4IE5A 1JMUB 1JUHA 1ULGA 1W2AX 3ACIA 4QHBA 4BPZA 1QU0A 2ZEZA 3WSOA 2IXIA 2DCJA 3G7DA 2D98A 2W91A 2Y8KA 1DLLA 5L9RA 3RPQA 5HXVA 4JTNA 3MW2A 4LIUA 2VZRA 2GC3A 2GZWA 3APBA 3AC0A 4Y1YA 5LEJA 4QU2A 1JYIA 3UJOA 1LOFA 1QKQA 4AXOA 4XTPA 4QB2A 4EWAA 5B4XA 1CZSA 3WT3A 4HT1T 4XFGA 3ACHA 3V64A 1Q43A 4XUQA 3W21A 1KD7A 5F6KA 4W6YA 3TN92 1RMU3 2PTMA 3FBMA 5KC5A 5FPLA 5KR7A 4UW3A 4ZXKA 4OHWA 3NAPA 1O3QA 1ZA7A 2QCSB 1UOFA 1YNAA 4BQYA 5LA1A 1ULEA 2DFBA 3V0AB 2NZ9A 3T1MA 3PHMA 2DUQA 2R062 2BOJA 4OUEA 4M00A 1YQ2A 2RG4A 3ILRA 4K1ZA 2FMDA 4WM7A 3DV8A 2EXIA 3IM0A 4Q0VA 4WZFA 4BLIA 1BQPA 1VBE1 4CXYA 3PURA 2A3YA 1VBB1 1EY2A 5DUWA 1V6NA 2WNUC 3KCCA 3LOBA 3LEKA 4D3WA 2IFWA 4CU9A 3D4KA 4QKBA 3ZXLA 5FXVA 1ALYA 1UZYA 4XQDA 4DEVA 3IDAA 1IPSA 2J7MA 3ROUA 4CEYB 4BA6A 4XF4A 1TMF3 3WF0A 2D6KA 3BPZA 3HIFA 4CP9A 3VD3A 1U12A 1XE8A 2IC1A 1IG0A 5EJ3A 5GLZA 5J1XA 3LD8A 1ZBE3 2GNTA 1QJFA 1WW4A 3I2FA 3SISA 1QH7A 3SQOA 1IZ3A 1WWYA 2OZJA 1AXZA 3LIGA 4YPJA 4I2OA 1DIWA 1OF4A 1GICA 2GN7A 2ORZA 3N4MA 3KV9A 5LRRA 2VNOA 5F5AA 1UY0A 3OEBA 5CFDA 4BQWA 1GZWB 2P37A 3HWJA 1OT5A 2WYFA 3VD4A 4K6BA 3FFZA 4JHZA 5F7UA 2WNUA 2XUEA 3WEZA 3R6SA 4AEJA 1F31A 3U4XA 1DQ4A 3PJYA 5L7OA 5I93A 5LW9A 3OYWB 1YFWA 3U11A 4ATEA 1MS8A 5FXXA 1I1EA 2WUHA 3I3QA 4RS5A 5HV4A 3IPVA 4XURA 2ZHMA 1RUF3 3KQRA 4AFBA 2ZZQA 1Y3TA 2WFF2 4PBOA 2VG9A 5CA6A 2VBBA 1AYM3 3JD72 4JQRA 1JYVA 3VDBA 1SDWA 1RUE2 2J1VA 5FYZA 5FREA 5CVRA 1VB4A 1VRH1 2W1UA 2PAEA 1L7QA 4NIHA 2BNMA 2V4VA 4BU2A 3HAGA 2Q8OA 4PI0A 2XONA 3UNPA 3VHRA 3LA3A 3R4DB 2BJSA 5FJKA 4FTEA 4GB32 2J1TA 1N1SA 5FP9A 5KXDA 1ZVFA 4CDXB 2ARCA 5A3TA 5FO7B 5A6XA 3N9NA 1UW8A 3AKTA 1YQ8A 3MV01 3VDAA 2XVLA 1A78A 1QJY3 3ELNA 4B29A 2BVVA 5BNNB 4AWDA 4JDMA 1V6MA 1ZZ8A 3VKOA 2XH6A 3VKNA 2FDHA 3QCWA 4UF0A 3BYWA 2WNEA 3ZFGC 5C9AB 4KBZA 2BYVE 4J1WA 4PJYA 3C7GA 4OVEA 5A7PA 2ZGMA 4MGIE 2WS93 4CZSA 2XBO3 4QPYA 1S0GA 1CVNA 2MPFA 3JD71 4QPIC 4IW3A 3AK0A 5HCAA 4M3CE 4S2FA 1S0CA 2OA2A 1UNBA 1VRH2 1DYPA 1FATA 4Q4W1 5LBBA 1MS0A 1UF2C 1YJLA 2ARBA 1GV9A 2UWBA 2HWD2 1IKQA 4UW6A 4DQAA 1GNYA 3PTRB 1W6OA 1UPSA 2ET7A 3CZJA 1RUC3 5FYVA 1CESA 3AVRA 1RMU2 3P5BA 2VCBA 4WM8B 2CGOA 4OULA 1JBCA 3RZZA 1D2QA 1O4TA 3FUQA 3FHAA 3T08A 4AOCA 3OJBA 2R6QA 2VGDA 4XW3A 3RJRA 1H0BA 2JKXA 2KA3A 2JB4A 4RS5B 2VR4A 3BUCA 2HWF3 1SCSA 2ZABA 1AXKA 4XHBA 1OQ1A 1WGPA 2BTVC 2OXBA 2RS31 4AI3A 5CFCB 1AJKA 4DRVA 4E8DA 4RHV1 3VZMA 5C33A 1PMHX 1WLDA 3POGA 5F2WA 5L36A 3M2MA 4H14A 4UYBA 3H1MA 3MV11 2UYAA 5LA0A 3JZVA 3NL1A 4XUTA 4ASMB 4E4ZA 4AL9A 4GMP1 4G9SB 3ZVXA 1ULPA 4HETA 2UYBA 4Y5Z0 4Q4Y1 5GZFA 3DYMA 1UL9A 4UFJA 5CFDB 3RDIA 1W8OA 2RS11 4LK7A 4XQWA 5A7OA 1W8NA 2VVFA 4AGGA 1V6OA 4XJUA 3IPVB 4FOWA 3Q8AA 2W68A 3WV6A 4C8DA 5BNOB 4LLOA 4O65A 1DP0A 3A7QA 2QQPA 1W6MA 5F2SA 3RGBA 4IGOA 5JCTA 4OFGA 2MNGA 1HB4A 1WMXA 2DTYA 4Q29A 4QQHA 1D4M1 3OGRA 2CGPA 5CFCC 5J7MA 3U0ZA 4CCEA 4GULA 3CJIC 3B5LB 1DCSA 2AR6A 4LJHA 1TMF1 1NA1A 3RWKX 2XLAA 5BNPA 1ST8A 3UGFA 1RUD1 1WUVA 1QDCA 5FAXA 1BVVA 3RZGA 2VD7A 1UQXA 4LO7A 3HBKA 5T55A 4MOAA 4FAGA 3M4FA 4GJZA 4CEWA 3C7FA 1HQWA 3AJYA 2CV6A 3AZVA 1B35A 2R0HA 4B1MA 2OPKA 4D7TA 1COV1 2NQYA 4QB1A 1ZZCA 2D3RA 3ZN5A 3EO6A 1RVF1 4FTBA 2X8KA 2ZOEB 1LGNA 3CJXA 1PIV2 1QMJA 3SC7X 3NV4A 3M1HA 2H6BA 2GNDA 5FR3A 3BI3A 1EV13 1NCRA 5EFUA 2XMLA 1ZRDA 2VCAA 4QGLA 1VBB3 3N9PA 2VZUA 1F4AA 1X36A 1ZRIA 1DQ6A 3VBSA 4CCOA 4I02A 3GF6A 1WBFA 3KV6A 2VNVA 2O14A 1HB3A 4KQ7A 4QX2A 3HN3A 3CJIA 5DAQA 1DZQA 1OH4A 4GA9A 4A42A 5KHIA 5LCWL 1ULFA 1D0GA 1D4M2 1ENXA 2WZEA 2QVSB 1X9PA 4NOTA 2W94A 1AR73 2EA7A 3M8LA 4NHKA 4LOSA 1W6NA 3U14A 4FPLA 4TLGA 3IDCB 3M3CA 5JIAA 2X53S 1W3XA 3K4AA 5GKAC 5F37A 3UYJA 3SCHA 1IS6A 2LUWA 2PFWA 3ILFA 4Y20B 3WDTA 2VPVA 3K46A 1AR61 3CO2A 1W9WA 2OUJA 3HNBM 4HN0A 1FI2A 1TME3 2WQZC 3WX5A 4Q0PA 1RUOA 4EE2A 4WV8A 4HL0A 5JSRA 2FDFA 1VMHA 5I8TA 1TQ5A 3GDBA 3UGHA 3R4UA 4HANA 1QH6A 3KVBA 5FP3A 4EYUA 4TYSA 1PVC2 1U0AA 4N43C 4V1PA 5LASA 1WMDA 4DINB 4DXSA 1YQCA 1C5HA 4FXKB 4FFIA 1HRV2 1QJX3 1SLAA 2I45A 4IGPA 5J36A 4YW4A 1PIV1 2JDNA 4N9HA 1H1IA 4XJAA 1VAKA 3NJVA 5ERLA 3UKVA 3MO4A 1N3PA 1OMIA 5BYNA 1CONA 2X10A 2L9LA 3B00A 5LA9A 4Q8LA 3UV9A 2J1RA 1LNSA 3NJXA 4IL7A 1UMZA 3O14A 1OA2A 3AMQA 4RR3B 1DZRA 1ZZ9A 5LZ6A 4CDWA 2RJKA 2WFF3 4I0WB 1OPOA 2ADDA 1JU4A 4ZPIA 4YVWA 1G9AA 3H8XA 1LEMA 2R042 1UX7A 1H4HA 1V9U2 5KXEA 1LOAA 1VMFA 4Y33A 1JZ6A 2BPA2 1OFNA 4IEPA 4FPYA 2SLIA 4JHTA 4Z92B 1XRUA 4XFIA 1DF0A 4PLOA 4AVVA 4LPLA 1XYNA 3M7AA 5H9PA 3AYDA 1SLLA 3D82A 1JZ3A 5F39A 2FZ1A 1W9TA 4P9LA 1CGPA 2GMEA 2EIEA 4XDQA 4CEYA 1LOFC 4KMQA 2V73A 5FRAA 4U36A 5KHKA 3KCYA 4OMCA 1LENA 5LY1A 1U5IA 5DN2A 3ABZA 4O7XA 1Q5OA 4Y4RA 4NMIA 1OC1A 2RR12 1MPXA 2P34A 1CD3G 2VW0A 5DABA 4CSWA 3O1PA 1Q3EA 1C1LA 4KU7A 1MZFA 2OZ6A 1DGLA 4NAMA 4UT5A 1S0FA 4C0HA 5CG8A 4XZPA 5FYTA 3O5SA 4EN6B 2EIDA 4Q4Y3 5LBEA 4AQSA 1PX3A 1WA4A 3AXDA 1CX1A 5T54A 2GMPA 3NV3A 1VBD3 3BIWE 1WKYA 2J1SA 4LA3A 1DZTA 4CPBA 1SBEA 3ZSJA 5C71A 1GFF2 2HWB2 2MEV3 4HSLA 5FY8A 4HMZA 2P4EA 4Y1VA 1R1A2 1PZ9A 1IQAA 2ZEWA 4NRMA 3U78A 1S2EA 2RS33 5C7GA 5HI0A 2GP5A 1OQEA 2DCTA 2GH2A 2EXKA 1ZBA3 1QNWA 4LBQB 4Q1RA 3NNLA 4FSJA 3P1IA 1KS4A 3PJQA 2GN3A 4LHKA 1HXS1 3MLLA 4CU8A 3UKNA 3J7NA 3POFA 4LIVA 2BFUL 1QY4A 3AXEA 1LB2A 1RUI3 4XEZA 2E51A 2JE7A 5EZWA 1UYPA 4XFBA 5LY2A 2RMU3 3ZIWA 1NZCA 4A45A 3RFRA 3VBFB 1D2SA 1U5ZA 3FZ3A 5FLIA 5EIYB 1DQ5A 4KNCA 1Y9GA 5E88A 3ATGA 1A8MA 1N1TA 2BNNA 3B9CA 2F17A 3MZHA 4YZ5A 1N1VA 1B09A 2Y26A 4QPWA 5IK8A 4GZ9A 3CDZB 4S2DA 2JKBA 3JXSA 2A3WA 3D5OA 3POEA 1Q8SA 4CDXC 5A3MA 5JPMB 3LB9A 2ADEA 5ABJC 4IEZA 3O1UA 4CYDA 1CX4A 1E57A 3UESA 2OX0A 1AYN2 1MZ5A 2PHXA 3I97A 3I3MA 3ZPOA 1F2NA 4HXCA 4CRQA 3S0MA 5A33B 1GWLA 3ZYBA 4NWVA 1PK6B 3VUOA 3GBFA 3SH3A 1JXNA 1TEIA 2VMEA 1X8EA 5A33A 3FHQA 1AL0G 3L2HA 4BB3A 2Q0AA 1L3JA 4LUKA 3ACGA 1ZZ7A 2E33A 1Z7S1 2B46X 1PVC3 5APAA 1OPMA 3EB7A 3B01A 3OF1A 3ASIA 4H3WA 5EYYA 3RMYA 2XKOA 5FQ0A 5IATA 2RVAA 3POBA 4M4RA 3WCRA 5SV8A 3ZFEC 3VBHB 4Q0SA 5F5QA 5F5IA 5DMYA 4E4DX 2BBAA 1F9KA 2JICA 3KLSA 2NM1A 3KMHA 4I09A 4D6QA 4EROA 3OPTA 2Q8DA 2WIIB 1E5IA 4NWWA 2HYKA 4Q0QA 4Q26A 3RVHA 5FZ4A 3FJSA 1GKBA 3LGRA 3ZYPA 2Z5WA 1NCRB 4IEOA 3K3NA 1BXHA 3C3VA 4XCBA 1QDOA 3GYDA 1DGWA 4R9DA 2EXJA 3ZFFB 3LZZA 1V6LA 3OSDA 4O9GA 1RUH1 3GALA 2HWD1 1VBB2 3BCWA 2JD9A 1LU1A 3PIJA 5CZKA 4JGZB 4DXZA 1JOPA 1H8TB 3ZFGA 4XXPA 1J83A 1WD3A 2PHDA 2BWAA 2G4IA 3LDBA 4PQ9A 4IUGA 4I0BA 5FZ0A 5GZCA 1JYXA 3MLKA 4V2WA 1MS9A 1I5ZA 2RM23 1K5MB 4NIIA 2AACA 2XVGA 3I3DA 4Q0UA 4AW7A 4Y1XA 2ZHKA 1PX4A 1SZBA 1OOPB 3O0WA 3ZSLA 3F95A 2JE8A 4CEWC 2E7TA 1AYM1 2GH8A 3USUB 1KITA 4ITCA 4ISQA 4B4PA 4NPRA 2ZGRA 3LDRA 3R05A 4XJWA 4CVUA 4HPKA 1YI7A 1VALA 1MEC3 5CKQA 3ILNA 3F2ZA 3HR9A 1PO21 4YGDA 5FUPA 5BNOA 3OD0A 3P3PA 1IPKA 1IS4A 1RINA 4Z2AA 2W47A 1JHNA 3TNPB 1W0PA 2E7QA 4IETA 1O8PA 5FXZA 4V2VA 3MICA 4ES8A 1S1AA 5FMOS 1REEA 1J1LA 4YGCA 3S5QA 2R063 1FX5A 3I59B 4OI4A 3KV5A 3SHRA 3T0DA 1OA3A 1KEXA 4XAEA 2Y34A 4CDXA 2VOKA 5KHHA 2DURA 1T2XA 1DYOA 2CAVA 3AFKA 5FZ9A 3TBDA 4CEWB 2P6HA 2R072 3OCPA 4HK9A 3T0AA 3ZYRA 2JG9B 2VM9A 5A1FA 4BXSV 4AG4A 4A3ZA 5FYUA 4XOGA 2JECA 1JOBA 2BBVA 2B9VA 3D8CA 2HWE3 2C9KA 1ODNA 1X50A 4OHXA 4A7KA 4DUVA 2RJ2A 1MZ6A 1RUD3 2ATFA 2YGLA 4LO5B 3SEEA 5KWRA 3DPRB 4AFMA 5IJRA 5AC92 2BGCA 1UZVA 5IFTA 4IE4A 2C26A 1NG0A 4RD7A 3OG2A 5F6LB 2ZX3A 5FZ1A 3SLIA 5F9TA 3HN1A 4XF1A 4NHMA 3WNNA 4MUVA 2OT7A 3EXUA 5C6CA 2QQUA 1O4YA 4L8QA 2Q8EA 3HVDA 4XTMA 4C1WA 1N47A 3ZFFA 1YQ5A 1ASJ3 1YC61 1HV0A 2P3YA 5JMOA 4XJ9A 2VVDA 3TEWA 1XXNA 1RUJ1 3GHMA 4MGSA 4N8MA 3DYPA 3POWA 4MGQA 5JIUA 3OTFA 4ORFA 3J9SA 3CF6E 4IV1B 4BMEA 1W05A 1GBGA 1AX1A 1WA6X 5HV0A 3EBRA 1M06G 3KF5A 1AL21 1OFSA 1ENSA 3GXUA 1NXD1 2VZQA 5DQ0A 4FPFA 3VZOA 4YZ2A 1B35C 2DV9A 2YBKA 4OI2A 3JCIA 2AH2A 4ZU7A 2WRAA 1VBA3 1LU2A 3L2YA 3AL5A 4D94A 3NNGA 4LHSA 4HKWA 4IEXA 1LJ7A 4AR2A 3AKSA 4TN7A 5FWEA 3ZSEA 2WYSA 2BQPA 4P00B 2Y6HA 1GYKA 1SLCA 4YZ3A 3KGZA 5IVJA 1YFYA 2RMU1 2WDBA 3N9OA 1BZWA 1JU3A 1R1ZA 1X7NA 2VMDA 2YC4A 3OPZA 4YLZA 4YYOA 3VBSC 1RXFA 4GB33 2YB7A 1BBT2 4LHLA 4QAWA 4ES9A 3OD4A 4QDQA 1WBLA 1CQ9A 1O6UA 5JOYA 1PVC1 2HBUA 3PVBB 4IXLA 4LUMA 4XILA 2Q1ZB 5GLUA 1JN2P 2C6SA 1TZOA 3BTZA 3AZZA 2VTFA 4Q5OA 1W9FA 5BNNC 2DTWA 5CYYA 3BTYA 1QJY2 4FT8A 3TB0A 3ZYGA 4URAA 5ANNA 1MQTA 2MEV1 4XUPA 2ZMNA 4FPCA 4A6SA 1GP5A 3TNQA 4NR1A 4HPKB 3CBNA 4WVWA 4DXTA 1AL22 1QIQA 1UY3A 1JYNA 3GZAA 3UT0A 1WMEA 1ONAA 2VZPA 2AEYA 3J7MA 2BFUS 4XC9A 4ZONA 2UY9A 1W6PA 3GBWA 1HN1A 2ARXA 4QQPA 2Q8CA 4FFGA 2N7GA 3ES1A 2RS12 3N9QA 5F3CA 3NRUA 1RVF3 2XWJB 3IAPA 2JWPA 2Y0OA 2X05A 2QUOA 3ZXKA 3P6BA 2R041 4WZCA 3VL9A 2ZKLA 1X9TA 3TEZA 3T2OA 3GM8A 4XCAA 1XNBA 3N36A 1H2NA 3FLTA 4R9CA 3PVOA 3RSJA 4OZOA 1CJPA 5JI7A 1PM7A 5D8AA 2PHLA 5K4LA 2D43A 4H7LA 3RI8A 1XNTA 4JGYA 4IV1A 1OSGA 3ON7A 4XBNA 1DU3D 3NAPC 4K9SA 1RUG2 4YZ4A 4CTEA 1TMF2 3B69A 4QGMA 1X82A 5E8AA 1S0DA 3ZM8A 3AFGA 1K5MA 1PM4A 2YU1A 4OZXA 2YZ4A 5FFOC 2D7FA 4JDNA 1Q56A 5FZKA 2ZGPA 3LFIA 4R52A 4YGBA 4K40A 3ME2A 3TOJA 2HWC3 2GC0A 3VN4A 2ZTNA 1JH5A 4Y24A 1RC6A 4RQPC 5CKMA 4BK5A 1C57A 3LCPA 4EN9B 4AI8A 3VD5A 5HPOA 2QNKA 3MFAA 3M70A 1NUKA 4OHVA 4QXCA 2NN8A 1UO9A 1UZZA 3VBOC 2BP6A 1GP4A 3FHIB 1JHJA 1AR83 2ZX2A 5I0TA 5KBFA 1ZRFA 3BGAA 4HONA 2WC2A 3WP4A 5FBZA 4URTA 3NAPB 5DG2A 2ZGUA 3AP9A 1NOVA 3E6BA 3HQRA 1GSLA 1I3HA 3GCXA 1Q8QA 2JIJA 3J7LA 5DDJ3 2H0VA 1GUIA 3D0JA 3O12A 1ZZBA 1RL3A 3WDVA 5GM0A 5HBAA 4YVWB 4LITA 1CAWA 1HKDA 2WO3A 3K48A 3V0AA 4NIGA 1JZ2A 2FCVA 1QOOA 1IGOA 2IXLA 2FD8A 5FPZA 3ZYIB 4E8CA 4DEQA 1DBNA 3FUOA 2XLFA 4QMAA 5FY4A 5I0UA 3MIDA 3I54A 3ZXFA 3B02A 1EUTA 4IV3A 1R093 4G3YC 5FO8B 1JS9A 1PK6A 5FZDA 1O4ZA 4EV0A 1W8ZA 2XJUA 4R4XA 3AJZA 5FYSA 5CKNA 5J3UA 2W87A 1O91A 2P3JA 4LMFA 2VXJA 2ZHNA 1DDLA 3DKWA 4MHUA 2E6VA 4QXBA 2AC1A 3RWNA 1XU1A 2BZDA 4LO8A 1H4GA 4XDPA 4ZU5A 4ZXEA 4A41A 3LOIA 2VAUA 4Q4W3 4BQ3A 3MDPA 3JU9A 2W5FA 3ITQA 4M3CB 4O9EA 5IYYA 4JGYB 4UOJA 3UL2A 3KZ4C 2VQTA 2RDSA 1LHOA 2QZ3A 1HB1A 2UWCA 5CEHA 4OHYA 1SACA 4M01A 4MGZE 3DXTA 1Z78A 1GNZA 2VMGA 1OD5A 1VBC1 3MIGA 2ZA9A 3WOGA 3Q8CA 2ET1A 2JJ6A 1FPN2 3AKQA 3MGUA 1Z7S2 5I8SA 3H8UA 3NNJA 1Z7S3 4EZHA 3K77A 4XXAA 2JB8A 3AMNA 3KB5A 5BXXA 2PA7A 5E1RA 3TWIA 2WT1A 4FO9A 1LOBA 3ACFA 4GH4A 3OY8A 1ZRRA 1PNFA 2ARAA 4GXLA 1IS3A 3HT2A 4WVMA 2D44A 5FZCA 5L7OB 4CDUB 2BERA 2TUNA 3AL6A 4EQVA 4H2AA 1CWPA 1RUJ3 1FOD2 3I2IA 5T5JA 3SH4A 4LBQD 3VGIA 3N7MA 2E26A 4XE9A 2G9ZA 4MGTA 2NP0A 1F35A 2VUAA 1GQPA 4M0HA 3I2HA 3MYXA 4COUA 3ZFEA 4MG2A 2RV9A 3IMMA 3A4UA 5D1IA 3S7IA 4B4RA 3VBHC 3H3LA 5LATA 2BVBA 1V00A 2F4LA 2QQNA 1ND2A 4X8NA 1KS5A 1DGRA 4WVMB 5JI9A 3SITA 3RG0A 2E32A 2ZHLA 2VUCA 4XZUG 3VZNA 1YJKA 2XL9A 3OGGA 5GJ6A 5DZGA 4L11A 5C9AC 1FMD3 1FPN1 5DUVA 2IXCA 4YM1A 2WLPA 1NCRC 5A70A 4KGQA 1LKNA 2ZKNA 1NLSA 2HWB1 1VBD2 4FOYA 4OCTA 4RR3A 4AZZA 2R32A 4A44A 3ZFFC 1CZVA 2WZ8A 1V9U3 1BVP1 1EPZA 3WNKA 4CXWA 3J26N 2FMYA 2WZR3 4ZS2A 4HK8A 5T52A 4F7ZA 4LO6B 3TN91 4PHZA 4BIOA 4Y22B 1F5JA 1GZTA 4BISA 4XUNA 3RMXA 2AZ5A 1X33A 4GQ7A 1DYKA 1W2TA 3I3BA 1YFXA 5FMOL 5JWPA 3G6JB 3O1SA 1OKOA 4IV3C 4JKKA 5FIXA 2V5DA 5JLVA 3SXWA 2HEWF 1W6PB 2ZZJA 5CG9A 3AX4A 3EYPA 1F4HA 2WNVC 4BE3A 4L92A 3R4SA 1DFQA 2CYFA 3OUHA 1VBE2 3AYEA 1RXGA 2A1XA 3H7JA 2DUOA 5FZEA 5C3QA 5DAWA 2VZTA 3QH7A 1ZM1A 1NCQA 4Z07A 1AR91 3CEWA 1PGW2 3UK9A 1VBA2 2VQAA 5JSOA 4E2GA 1JYTA 4C0BA 1W3VA 3GJBA 4IEQA 1RUG3 4L97A 3THCA 4IGQA 4TSVA 3ZX7A 5IVEA 1NE4A 4IE7A 4X6RB 1UZWA 2VOXA 4EZ4A 2WT0A 2W1SA 3GNEA 2ZGKA 4YW1A 5JR7B 5IK5A 2VMHA 3R0RA 1W90A 1I9RA 1QJEA 1REFA 3KT7A 3WP3A 4WVVA 3LDKA 5A7SA 3PL0A 4P02B 4BXFA 1YWKA 1JZ8A 5D8AB 2LALA 1FT9A 5HXMA 3KHCA 2O8QA 3CZUA 4QQ2A 1W6OB 1RUH3 3QD6A 5J37A 2HWD3 2WNVB 4QPIB 4YG6A 1QEXA 2Q4SA 4AI1A 2XWBB 1BKZA 4FOQA 2FDGA 2CTVA 1RB8G 3FX3A 2D6OX 2FQPA 4Y5SA 5FLHA 5A3WA 3V0BA 5I0SA 3CQOA 1BJQA 2XJSA 3ZR6A 3ZIXA 4M3CF 5EQUA 2XGXA 3CLPA 3S30A 1LHWA 3HD8B 1XQNA 1GOGA 2P5BA 1ZREA 1G8WA 1VAMA 2XVKA 3DEMA 1ZX5A 3P3NA 1UXXX 2R30A 4FOVA 5IVYA 4XBQA 4QKNA 3WQ0A 4LQRA 3V56A 2D6PA 4WVZA 2Z2SB 1OUSA 1TME1 4HVRA 4P5YA 1HW5A 5DPNA 1CPMA 4CCJA 1HX6A 3LSDA 4B8EA 1NQJA 1PZ8A 4IEVA 2CDOA 1GOFA 3JQWA 4WM7C 4YFZA 2ZGOA 4CPBD 2EVXA 2PAMA 4QM9A 3RZJA 4YNIA 3DXUA 1C8NA 3INAA 1C8M1 4JTOA 4IQPA 4FFHA 5F8PA 5CADA 3MIEA 1NA1B 5BNPB 3TEXA 3VBOB 3WY6A 5A7NA 4XF9A 2PMWB 1PVXA 2O0OA 1E5SA 1LRHA 1RUH2 2VECA 3Q8FA 4CEYC 1D4VB 4IV1C 4XFAA 4COVA 2FCUA 1S2BA 1S2KA 4RHV3 4QD2A 4CDQC 5BV6A 1LECA 1N3QA 3EQEA 4GB31 5FZIA 3C8XA 4LULA 1RGSA 2DWRA 2K9ZA 1D7PM 2QBXA 1BLZA 2VQ0A 2A73B 2YUEA 2ZCWA 5A80A 1MQTB 1CIYA 1J3RA 1ZA4A 3LPFA 4NROA 2JEMA 1DQ1A 2E9QA 2WO1A 5FMBA 5BNOC 1U5YA 4MHRA 1W28A 1X8MA 4LHNA 1KQRA 1OH3A 2JX9A 4K20A 3M3OA 2XL7A 4LKSA 4DIQA 1ODMA 1BK0A 4NRPA 4COWA 5LEKA 1AR63 2BV4A 2CAUA 4W4ZA 1G9FA 2JG9A 4A2UA 2P3IA 2A70A 2D5HA 3VBFC 3VBSB 4QPGA 1YLLA 2VBPA 3CJIB 5H9RA 4XBLA 4XQ4A 3URFA 1S55A 5FK8A 4AQ2A 4DXRA 2V5YA 1XYPA 1D4M3 2CWMA 2Q1MA 2DVGA 2VCMA 2Y64A 2VQUA 3C7OA 1HJFA 2XKPA 5IHRA 1C8M2 4DMIA 1BEV3 1GQHA 4HN1A 3IIAA 4PI2A 5D2AA 5LWBA 2FZ2A 2C24A 2C5DA 3WW1A 1O3RA 4Q4W2 1Q8VA 3T1LA 2VL4A 1LTEA 2BEOA 1S0BA 1VPHA 1XJAA 4WM8A 3E6CC 3J4UH 5F3GA 1NKGA 3WNPA 2VC9A 1XPWA 4RGKA 5FLJA 5GZDA 2VJXA 3RRDA 2JG8A 2VO5A 2RE9A 1QJU3 5IVVA 4HVOA 2QQLA 4DY5A 2QDNA 3JBG3 4PQQA 4QXKA 4XETA 3OGJA 2WZPP 5HCFA 2RS13 5JOXA 1BK1A 4MYEA 3ZOIA 1SQ4A 4KU8A 4L2NA 5CU1A 2OIIA 3T4VA 2WFPA 2VW2A 5AC91 2WSUA 2ZEYA 4K7JA 4L9BA 4LEJA 2RS32 2R49A 4A7YA 3OBRA 1WLWA 3MFCA 3J8F2 4CUAA 5GZGA 2W08A 2XJVA 3NKGA 4Q4V3 4QX3A 2Z69A 3LQCA 4RGGA 5FWJA 4HG6B 2WN2A 2R16A 1RHI2 1GZCA 3BODA 1DLCA 2W1QA 1W03A 2ERFA 5C3RA 2W1WA 1CAXB 4Q4Y2 2WS92 1RUJ2 3FE5A 4FCAA 1JYCA 1RTVA 4FPOB 4GKYA 5EJ1B 5FPAA 4BYYA 3V65A 2W0XA 4F8AA 3OBAA 1UD1A 2DBNA 3AP6A 4AK3A 1A34A 3JB4C 1PMIA 2O8OA 4PDWB 1UOBA 4JRAA 3T4HB 4YVSB 3T2TA 1H9WA 4XACA 2WINB 3ZSMA 1UOGA 5JZGA 2WAOA 2IZWA 1OOPC 3QBQA 3J7HA 3ZKYA 4BJ0A 5DG1A 2R073 3GCWA 3GZEA 5J09A 5BNNA 1S0JA 1NLQA 5LBFA 2Y6LA 2ZJCA 1GZWA 2VZ3A 5F3IA 4UI9L 3PUSA 4PBPA 1UY4A 2EIBA 3NNMA 1XOYA 1HQNA 3W59A 4DO0A 3VBOA 1OF3A 1CAXA 1QQP2 4A7ZA 4O61A 5JOZA 2VMIA 5EP9A 4ZU4A 4GAZA 1N1YA 5JZGC 2RMU2 5IW0A 1RIRA 1NCQC 2CL2A 2QQKA 4FXGB 3EHKA 3WG1A 2QQIA 2Z42A 2AYHA 4CU7A 3KD4A 3DPRA 3KCXA 1AR93 4CUGA 5K7PA 4HBNA 5L9VA 1PO11 4LTAA 4AVTA 1GP6A 3PMSA 4NHLA 1SG3A 1VLNA 2P6CA 1C1FA 2ZX4A 2A6XA 2DFCA 1H2LA 1PGL1 4QX1A 5C8CC 2DDUA 3RJ2X 1ND3C 1QJY1 2DF7A 3V0BB 4F3JA 1D0HA 4Q4X1 3VD9A 1R092 4P08A 2OQ6A 3ZYJB 4ASLA 1WZXA 2DCYA 1J58A 2QQMA 3OGVA 4AI9A 4BCUA 5DZEA 1ND2C 3MF9A 3OUJA 1K5JA 2WQ8A 5DUUA 3WG3A 5EHDA 3WW2A 1RHI3 1O5UA 1A3KA 1CJDA 1W2NA 1J1TA 2XHKA 2AUYA 4QT6A 4AYUA 2DVFA 1W8WA 3VLBB 5F1RA 3AMPA 1AR71 2O1QA 4GWMA 3VV1A 3WQBA 4CDWB 4BQ1A 3B3QE 4D69A 2WL1A 4RYDA 1SLBA 3FLRA 2SBAA 4DY3A 3GJAA 1AR81 1J59A 2JE9A 1QGLA 1ND2B 1YCIA 4P9GA 1M4WA 2GNMA 1H6XA 3AB0A 4QX7A 5FYBA 3E5UA 1NE6A 4BQ4A 5FOJB 4YG0A 3ZMNA 1BBT3 4MSVA 5FTTC 3RYRA 1EUUA 3RZLA 4RA0A 1QOTA 1W99A 1FOD1 4XF3A 5DDJ1 1RUG1 1FV3A 4OMDA 1OHFA 4J25A 5C3SA 3W5NA 3PU8A 1PGL2 2BDRA 3CKHA 3PUAA 1JYWA 1H2MA 3I2JA 4GH4C 1JOJA 4K3UA 4AEDA 1O8SA 1KJRA 3CNAA 3E5QA 2RS51 1SMVA 1POV3 3BU7A 5AVAA 1IHMA 4FPHA 4N53C 3NW4A 1UIJA 1AX2A 2OYZA 3CIHA 5FV3A 5J98B 3O1MA 4Q2FA 5IVBA 4M0NA 1QJZA 4GMP3 2PLV1 3ALQA 3H3ZA 5FYIA 5DAXA 5FQ0B 2WNOA 1XE0A 2A6YA 1AR72 2D6LX 2VZVA 1AUYA 3D0SA 3HOBA 4W6WA 4XAAA 3WG2A 5K0UC 3HQUA 1VBD1 4QB6A 3ZXEA 1REDA 3MUY1 4MGYE 3USSA 3WHUA 1V9U1 4YARA 1VE0A 2WKKA 3U75A 5GLWA 4N53B 1CAUB 1RUC2 3TYJA 1BHGA 2G1MA 5FZHA 5ABJA 2V09A 5KC6A 1J3QA 1SPPA 5J96B 1KJLA 4OLLA 4PLMA 4Q1PA 5A6YA 1G9BA 2XDVA 2EAAA 4SLIA 2I2SA 3AZYA 4OYUA 3THDA 1MS3A 2WNUB 3N7JA 2CDPA 3PTYA 4X6QB 5DDJ2 3WR0A 3OB8A 4BLJA 3RZHA 3I3EA 4LLFA 4DRRA 2YROA 2YBPA 1YQ6A 1SFPA 3T0BA 1OQDA 4OUSA 4OQ8A 3PVNA 2DU0A 1UAIA 3JQXA 3A0KA 3KQ4B 2X5IA 2RS53 3DUIA 3SKVA 4D0QA 2RS52 3I4IA 3N9LA 1W0OA 3GZTB 2YXSA 3QACA 4IEYA 2WLQA 2VXRA 1CAVA 4UWDA 3OGSA 1VBA1 4H7MA 1CAUA 1QNYA 2ORXA 2P3KA 3AM2A 5E89A 5SV5A 5A3NA 1H1AA 4D7YA 1K45A 3M3QA 3VB9A 3VKLA 3ZFEB 5L7OC 2XJQA 4Y3OA 3RZMA 1U5XA 4S2HA 4RN5A 4P5HA 1AYN3 4Y1ZA 1DHKB 1W8FA 2VE1A 1C4RA 2C4XA 5ACA3 1BCXA 3JB8A 4DUWA 3WD5A 3PMEA 4QGNA 1Y9MA 4FI9A 3FBYA 4K8RB 3O1VA 3FMGA 4BDVB 1ULCA 5EYXA 1RUC1 1AL23 1W2UA 4UFHA 4B4QA 1W6QA 4YM2A 4KWUA 3K75B 1VBC2 4HLTA 4KWLA 3PUIA 1A6CA 2QQVA 4XABA 4XMIA 4IERA 2ZGQA 1HXS2 4ATFA 4EWEA 4HSJA 2JDKA 5CB7A 2JG9C 4DUXA 1OLQA 4EN0A 2C0ZA 2VOTA 2YFZA 1IS5A 2B45X 3DL3A 4NHXA 5FZFA 3GGLA 1YIPA 5FY9A 4GWJA 2HKXA 4W8JA 3LPGA 5EV7A 2WABA 4JX0A 2XHNA 3KT4A 1BYHA 1UU6A 3UETA 4XFFA 5D8AC 2V4AA 2ZPXA 4LNVA 4P9WA 3IMNA 4W65A 1LAJA 3RQ0A 4BM8A 4ZY9A 4D6SA 5FK7A 4M3CA 5T5PA 3W20A 1W6NB 3I2KA 4QM8A 1UXZA 2XPJA 1Q8PA 3VD7A 5FP4A 4YZ1A 2FDKA 1GMMA 1AJOA 4JGYC 4PIYA 2Q1FA 3DN7A 2QFEA 1YFUA 2JG8C 3HNMA 4EN8B 4XMAA 2I07B 3TAYA 2JDMA 4AHXA 2KM2A 2JDZA 4HKOA 5FJHA 5FKBA 5T5LA 2QE3A 1KXGA 1J84A 1POV0 3MIHA 5EWSA 4DB5A 3FWEA 2HWC2 3IAQA 4XFCA 4XF0A 5BPXA 4YGEA 2PHFA 3S5AA 2DCKA 1PMJX 3JBG2 5CISA 3BU0A 5FZOA 4I3PA 4CP9B 1UY2A 4NIDA 4LE4A 3WUDA 1OVPA 3LFMA 3MW3A 1RUE1 3E97A 2RDRA 1TG7A 5AFBA 2CGNA 2EICA 4INDA 4RFRB 4YM0A 5A3LA 1EYBA 3NV1A 1JZ4A 3VBUA 3BPSA 2TNFA 5L19A 5FBJA 3NJYA 1CZTA 2RR13 3KT1A 3N7LA 3WNLA 2ZAHA 3PVEA 3Q9OA 4QWNA 3K4DA 5I0DA 5FZAA 5LBCA 4YW3A 2LS6A 1PO23 2BGOA 4I01A 4EJRA 2DYCA 4PIZA 4XDOA 3U37A 1H1MA 5IUQA 1UIKA 5JAXA 4MX3A 5CNAA 1GR3A 3ZPYA 3CHXA 2F4PA 2K46A 4NUBA 2LTNA 2GU9A 3VHNA 3ZLIA 1MVEA 2XG3A 4BIFA 5LA2A 3BVCA 5C4WB 1QHDA 1WD4A 4MO3M 1LGBA 1PGW1 4ET7A 2HWC1 4N90A 1LESA 3ZMOA 5T50A 4NHYA 3KHBA 1L7RA 3OEAA 3JBG1 4P14A 1PK6C 1EPWA 1SHWB 2B5HA 2XQXA 3OPWA 5A7WA 2EIGA 2KD7A 4J6GA 1RUE3 3AKPA 4YW2A 2WWJA 3U10A 1AYM2 5FZ7A 2R1BA 3VDDB 1OI6A 4LOTA 1FNZA 3LIHA 1QQP3 2RDNA 3O7OA 4QDRA 5FUNA 2R043 5FZ3A 5AC93 2HWF2 3NVCA 5FPBA 1NX9A 5FXWA 3T2QA 1OA4A 3J8F1 4YVSA 2WSVA 1FAYA 1XNKA 5G05L 4IV3B 1SBDA 5C4WA 5JR2A 1PO22 5C8CA 4PF5A 2OW4A 4I3GA 1ZBA2 2CY6A 1V6JA 1T6GC 4GD4A 2EALA 2XOMA 3AMHA 4JQTA 2W92A 2W9XA 4KG0A 2WS91 3SH5A 4AEDB 4CCKA 2VY0A 3B93A 4XYXA 3B94A 4E4HA 1MQTC 3WINE 5CAZA 1H8TC 2VZOA 4HOOA 4FTSA 4M4PA 1SCRA 2TEPA 1TME2 3POYA 4UBGA 1LCLA 5GZEA 2GC2A 2XBO1 2XQRA 4YFWA 2VTXJ 1BMV2 3VBRA 4YW7A 5HCHA 4SBVA 4AFCA 3POSA 4JCKA 4LO4B 4X8PA 4C90A 1PGSA 3WXPA 2RHPA 3NWKA 1EV12 3A22A 1US3A 1QQP1 5ISLA 2VULA 2IWGB 2BRTA 4IE0A 2YC0A 2CWSA 1Y4WA 2FCTA 4ARYA 1UU4A 4BQ5A 2HWF1 4Y1UA 1DQ0A 4AAPA 3ACLA 1KFUL 4U2AA 3UJQA 1NYWA 4TZDA 4QX5A 5A1AA 3BTXA 5D21A 4CUCA 4Z1VA 2KXLA 1RJ8A 2AENA 2QQOA 1UN1A 2AEZA 3BOPA 4YG3A 3AP5A 4NE9A 3WDWA 5C3OA 4JZRA 1AVBA 1PO13 4B7EA 3H0OA 4NVPA 5FOBB 2YYOA 1UY1A 4IESA 2YGMA 3E5XA 3L9JT 3VKFC 2YU2A 1W8UA 2ZGSA 2R1DA 4PIXA 1G9DA 1LOGA 2C9AA 5J48A 1YI9A 2VTXA 4AE2A 1RUI2 5A3PA 4LR4A 3ZN6A 1WMFA 4K1YA 3SKJE 4QQLA 1GWKA 1GOHA 2IXHA 4FAHA 3WZ1A 3WNMA 1KGYA 3I2GA 1MS5A 4I0AA 3GHNA 3OBTA 2DVAA 4OQ9A 1SFNA 4A3XA 4Q4V1 1COV2 1BMV1 4B1LA 1NA1C 5BNPC 1ZYBA 2YC2A 1RVF2 1FYUA 3DKQA 1OVSA 4UXAA 1FNYA 1EV11 2UY8A 1VRH3 1CIWA 2CSGA 4N9IA 4EWDA 5C8CB 1H2KA 1E5HA 1ZZ6A 4JC1A 3DCQA 4LBLA 3AMMA 3WF4A 4Z8BA 3SCFA 1VB2A 4AVCA 4AI2A 5H9QA 3RNSA 2QDRA 5DXDA 1XBFA 3HMYA 1G9CA 4AHYA 3HBZA 5JXIA 4YVSC 4LKDA 5A7QA 2J1UA 1H30A 2VZSA 1XU2A 4BWOA 5FZOB 3I2OA 2HWB3 1I5PA 2MEV2 4JKLA 1IG3A 1HV1A 1Y9QA 4NAOA 3VBRB 2LROA 4C91A 4W50A 2PHTA 1B35B 1AR62 3WF2A 2IXKA 3ORJA 1MEC1 4COYA 2GDFA 2QTWB 4IE6A 3C7EA 3Q8BA 1VRBA 1V6KA 5FZGA 4CDUC 4UFMA 1HLCA 2PLV2 3ST7A 2BGPA 2PLV3 2DCZA 2BW8A 3SCGA 5CIRA 4W6XA 3OOXA 5ANQA 1BEV2 5JOWA 3DF0A 5JPNB 5JMCA 1G6NA 1P8JA 4GWNA 3T2PA 1HIXA 2ILMA 3VBRC 4DS0A 3UKTA 5A6QA 1F8VA 1MACA 1NZIA 4ZHNA 3DPRC 3WF3A 3VL8A 5FZMA 3ZR5A 5JXHA 2B4KA 2JDPA 4Q4X3 1WLCA 1Y43B 5JDBA 2ZMLA 2XXZA 5DAPA 1LOCA 3AKRA 3VZLA 4HFSA 1XE7A 4DNYA 1UMHA 5C3PA 4ONUA 1COV3 5DAVA 3WW4A 5M0TA 4BH9A 1O7FA 1YIFA 2ES3A 1DG6A 1XYOA 2RM22 4CA9A 3USUA 4ZZ5A 2VW1A 1UKRA 2YV8A 1GANA 4FPEA 4XJZA 4AHZA 4YM3A 2WO2A 1H8VA 1ACCA 4P9YA 1ZRCA 4GIQA 4LKFA 2ENRA 2JDYA 4XVHA 2UWAA 3ENRA 1CR7A 4MH0E 1EAH1 2WWUA 2NMNA 4AEMA 4CDUA 3MIFA 3NNFA 1GZ9A 1MEC2 4MLOA 2RDQA 3K3OA 4TTGA 1XNAA 1Y7BA 2NYYA 1H9PA 2J42A 1KFXL 4S2GA 1W06A 2ZX0A 3RYPA
chains in the Genus database with same CATH topology
5F5CA 2Q8CA 5FZOA 5FYIA 5A3WA 5FXZA 4EZHA 4LIVA 5FPAA 3KV4A 5IWFA 2YU2A 3N9QA 4V2VA 5F3CA 4CCNA 5A3PA 5LY2A 2P5BA 5F37A 3KV5A 5IVYA 5A7WB 3UYJA 4QX8A 3PURA 3NJYA 5FBJA 5FZCA 5FYVA 3PTRB 5F3EA 2YBSA 5FZ9A 5FZHA 5FPUA 3AL6A 5FYHA 5K4LA 4CCJA 3AVRA 2XDVA 4QWNA 5A1FA 5FP3A 5FYCA 3KVBA 5FYYA 5FXVA 5FZAA 4EYUA 5FYUA 5F3IA 3DXUA 4CCMA 2OS2A 3PUSA 5E6HA 4XDOA 4IGPA 2YBPA 4DO0A 2W2IA 2YU1A 5A7NA 2OX0A 4NUBA 4GAZA 3ZPOA 5IW0A 3ZLIA 3LD8A 5F32A 5FZ1A 5FZKA 5IVFA 3N9LA 3KVAA 5FP7A 5IVBA 5FZIA 5F2WA 2OT7A 2Q8EA 4CUGA 5A3NA 5A80A 4QXHA 3OPWA 4Y3OA 5A7QA 5A7WA 3KV9A 2OQ7A 3PU3A 4QXCA 2WWJA 4LXLA 5F5AA 5FZ7A 5A7OA 5FZOB 5FY1A 4DIQA 5FUNA 5FY0A 5FZ3A 4C8DA 4HONA 2XUEA 5F5IA 5FPBA 5FZ8A 2OQ6A 5FPVA 5F2SA 4QU1A 5FXWA 4Y33A 4AI9A 5LW9A 4IGOA 4D6QA 3OPTA 2Q8DA 5FXXA 2YBKA 4BISA 1VRBA 2PXJA 5FZGA 3N9MA 3RVHA 4GD4A 3AL5A 5FZ4A 4LITA 5F39A 2YPDA 4CCKA 5ANQA 3K3NA 3PDQA 4TN7A 5FWEA 5FYZA 4D6RA 4CCLA 5FZFA 5LWBA 5FY7A 5FY9A 4E4HA 5FY5A 4BU2A 5LY1A 5FY4A 5IVJA 2VD7A 3N9OA 4HOOA 4Y4RA 5FZMA 4GJZA 5FZEA 5F3GA 4CSWA 5FJKA 4QX7A 4UF0B 5FYBA 4GJYA 2XXZA 5FZDA 5FZBA 5FP9A 5FP8A 5FYSA 3LDBA 4D6SA 5IVVA 5A3TA 5FZ0A 3N9NA 5FYTA 4V2WA 5FZLA 3PUQA 4IGQA 4QXBA 5IVEA 4LIUA 5FYMA 4EZ4A 4XDPA 5FZ6A 3AVSA 5FP4A 3PU8A 4ASKA 5ISLA 3PUAA 4URAA 2XMLA 2GP3A 5FY8A 5A7SA 3N9PA 4BXFA 5CEHA 4AAPA 5FJHA 3K2OA 2WWUA 3DXTA 3U78A 2GP5A 4CCOA 3KV6A 4UF0A 3K3OA 5IVCA 5FPLA 5KR7A 3U4SA 5FV3A 5FWJA 5FUPA 5A7PA 5A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5C A;  2Q8C A;  5FZO A;  5FYI A;  5A3W A;  5FXZ A;  4EZH A;  4LIV A;  5FPA A;  3KV4 A;  5IWF A;  2YU2 A;  3N9Q A;  4V2V A;  5F3C A;  4CCN A;  5A3P A;  5LY2 A;  2P5B A;  5F37 A;  3KV5 A;  5IVY A;  5A7W B;  3UYJ A;  4QX8 A;  3PUR A;  3NJY A;  5FBJ A;  5FZC A;  5FYV A;  3PTR B;  5F3E A;  2YBS A;  5FZ9 A;  5FZH A;  5FPU A;  3AL6 A;  5FYH A;  5K4L A;  4CCJ A;  3AVR A;  2XDV A;  4QWN A;  5A1F A;  5FP3 A;  5FYC A;  3KVB A;  5FYY A;  5FXV A;  5FZA A;  4EYU A;  5FYU A;  5F3I A;  3DXU A;  4CCM A;  2OS2 A;  3PUS A;  5E6H A;  4XDO A;  4IGP A;  2YBP A;  4DO0 A;  2W2I A;  2YU1 A;  5A7N A;  2OX0 A;  4NUB A;  4GAZ A;  3ZPO A;  5IW0 A;  3ZLI A;  3LD8 A;  5F32 A;  5FZ1 A;  5FZK A;  5IVF A;  3N9L A;  3KVA A;  5FP7 A;  5IVB A;  5FZI A;  5F2W A;  2OT7 A;  2Q8E A;  4CUG A;  5A3N A;  5A80 A;  4QXH A;  3OPW A;  4Y3O A;  5A7Q A;  5A7W A;  3KV9 A;  2OQ7 A;  3PU3 A;  4QXC A;  2WWJ A;  4LXL A;  5F5A A;  5FZ7 A;  5A7O A;  5FZO B;  5FY1 A;  4DIQ A;  5FUN A;  5FY0 A;  5FZ3 A;  4C8D A;  4HON A;  2XUE A;  5F5I A;  5FPB A;  5FZ8 A;  2OQ6 A;  5FPV A;  5F2S A;  4QU1 A;  5FXW A;  4Y33 A;  4AI9 A;  5LW9 A;  4IGO A;  4D6Q A;  3OPT A;  2Q8D A;  5FXX A;  2YBK A;  4BIS A;  1VRB A;  2PXJ A;  5FZG A;  3N9M A;  3RVH A;  4GD4 A;  3AL5 A;  5FZ4 A;  4LIT A;  5F39 A;  2YPD A;  4CCK A;  5ANQ A;  3K3N A;  3PDQ A;  4TN7 A;  5FWE A;  5FYZ A;  4D6R A;  4CCL A;  5FZF A;  5LWB A;  5FY7 A;  5FY9 A;  4E4H A;  5FY5 A;  4BU2 A;  5LY1 A;  5FY4 A;  5IVJ A;  2VD7 A;  3N9O A;  4HOO A;  4Y4R A;  5FZM A;  4GJZ A;  5FZE A;  5F3G A;  4CSW A;  5FJK A;  4QX7 A;  4UF0 B;  5FYB A;  4GJY A;  2XXZ A;  5FZD A;  5FZB A;  5FP9 A;  5FP8 A;  5FYS A;  3LDB A;  4D6S A;  5IVV A;  5A3T A;  5FZ0 A;  3N9N A;  5FYT A;  4V2W A;  5FZL A;  3PUQ A;  4IGQ A;  4QXB A;  5IVE A;  4LIU A;  5FYM A;  4EZ4 A;  4XDP A;  5FZ6 A;  3AVS A;  5FP4 A;  3PU8 A;  4ASK A;  5ISL A;  3PUA A;  4URA A;  2XML A;  2GP3 A;  5FY8 A;  5A7S A;  3N9P A;  4BXF A;  5CEH A;  4AAP A;  5FJH A;  3K2O A;  2WWU A;  3DXT A;  3U78 A;  2GP5 A;  4CCO A;  3KV6 A;  4UF0 A;  3K3O A;  5IVC A;  5FPL A;  5KR7 A;  3U4S A;  5FV3 A;  5FWJ A;  5FUP A;  5A7P A;  5A1L A; 
#chains in the Genus database with same CATH topology
 3B9I A;  5F5C A;  2B7Y A;  1UWW A;  3LEG A;  4FVV A;  3H3U A;  3KV4 A;  3IWZ A;  4IEW A;  1K42 A;  3IZO A;  2OVU A;  4YWA A;  3DGT A;  1RYY A;  2JEN A;  2E7A A;  3N7K A;  3HJR A;  3BB6 A;  3GBG A;  2B39 A;  1PNG A;  1O3S A;  3PLQ A;  1N3O A;  4JDO A;  4Q4X 2;  4YSF A;  1APN A;  4QX8 A;  4AGV A;  2GAL A;  4FBF A;  4MET A;  3S57 A;  4LK6 A;  3HPN A;  4R9B A;  3NMB A;  3PIG A;  2W39 A;  1G7Y A;  4FPJ A;  5E16 A;  5FYH A;  2TBV A;  5A3O A;  4JAA A;  4E4S A;  1J3P A;  3VBH A;  1RJ7 A;  1JUI A;  4CCM A;  4MAD A;  1UZ0 A;  2E63 A;  2WO7 A;  1ULD A;  1TNR A;  2P17 A;  2WJS A;  3GZU C;  3MBW A;  2PQS A;  5JSP A;  3I49 A;  2Y6K A;  4LOR A;  2BUK A;  4HZF A;  3J8F 3;  2J1E A;  1SLI A;  4R8H A;  4ZS3 A;  1SPP B;  5F32 A;  4BQX A;  1XNC A;  2GAU A;  1EAH 2;  4N7I A;  5GAL A;  4MXW A;  4RQP B;  5JVV A;  3MHZ A;  1QXP A;  5EPA A;  2PYT A;  4WM8 C;  1K5M C;  5GLT A;  5KHJ A;  1YUD A;  4AF9 A;  4L0P A;  2WA4 A;  4P9J A;  1FXZ A;  4FQZ A;  1LHN A;  1RIT A;  2MHF A;  2IVJ A;  2R06 1;  4FP2 A;  5FY1 A;  2OPW A;  4D8M A;  5I8Y A;  4GKX A;  3LF7 A;  4AQT A;  1MR5 A;  2BOI A;  2ZGN A;  2EXH A;  1I6X A;  4XUO A;  3ZXD A;  1OUR A;  2DVB A;  5GLV A;  3IKW A;  2WAA A;  4DFS A;  5DUX A;  1O59 A;  2WA3 A;  4Q8K A;  4AGR A;  2WNV A;  4N7U A;  2GMM A;  3MF6 A;  4UFK A;  4YVW C;  3MPP G;  1UYY A;  1A8D A;  1G86 A;  4QKD A;  2Y60 A;  5BNQ A;  5EXO A;  2IVI B;  4Y20 A;  3WVJ A;  3CMG A;  3S7E A;  1NLR A;  2H6C A;  4CP2 A;  4CDW C;  1YEW A;  2V72 A;  5IAV A;  1NQD A;  3PDQ A;  1AZD A;  4KG8 A;  1W39 A;  5FO9 B;  5FKC A;  3NKT A;  4UW4 A;  3N35 A;  4LBQ A;  2UUR A;  5C70 A;  1R1A 3;  3W9A A;  2W95 A;  1W6Q B;  2CNA A;  4P9I A;  4AFA A;  1TVG A;  3MI8 A;  1JZ5 A;  2A6V A;  2W52 A;  3VBF A;  3WDU A;  1YO8 A;  3FL7 A;  4GWI A;  1F5F A;  2Y38 A;  5C4W C;  1ENR A;  5A3U A;  1OLM E;  4AHW A;  3ZDS A;  3MLJ A;  3T3Y A;  4BK4 A;  5IT6 A;  3M3E A;  2F6B A;  3SMH A;  1S0I A;  2OUH A;  2ZEX A;  2ZXQ A;  2ZGL A;  3RI9 A;  1RUN A;  1VBE 3;  2VOW A;  4YRD A;  3E6D A;  1R64 A;  4ARX A;  2Q5T A;  1WCK A;  1LOD A;  2WZR 1;  4RSU A;  5H9S A;  3MPB A;  3TN9 3;  4ZKT B;  4KWJ A;  4D7S A;  1K3I A;  4QKF A;  2Z4F A;  4L99 A;  4MZU A;  4PDW A;  1GU3 A;  3ETP A;  2DBI A;  3ES4 A;  2BWC A;  2B9U A;  2JD4 A;  1YHF A;  2A6Z A;  2VNG A;  4MGK E;  4FP3 A;  5CFD C;  2WFF 1;  1KDM A;  1FMD 1;  1FPN 3;  5IWF A;  4GMP 0;  5EJZ B;  5LRS A;  1W04 A;  2D6N A;  1HDK A;  1JI6 A;  1W9S A;  2VCC A;  2VNR A;  2VOV A;  4XPV A;  3ZXG A;  5ACA 2;  1XND A;  4I30 A;  1ND3 A;  3WQ7 A;  3X29 B;  1TE1 B;  2YBS A;  4OHZ A;  2VUJ A;  3POJ A;  1IPJ A;  1QJU 1;  3WUC A;  1QF3 A;  5FYC A;  3IT8 A;  4GH4 B;  1XSR A;  3IB3 A;  3AYA A;  3WNX A;  2A5Z A;  1HRI 2;  1QJX 1;  4F83 A;  3VDD C;  4UW5 A;  2VZ1 A;  2BU9 A;  2EAK A;  4AI0 A;  2BNO A;  2IFR A;  3KF3 A;  1WCS A;  4JKM A;  4MXV A;  3FFQ A;  3I7D A;  3KVA A;  3ZXA C;  4CUB A;  4QPG B;  4NJ4 A;  1AR9 2;  1UPI A;  3HNY M;  5B4N A;  2XBO 2;  4YW6 A;  1ASJ 2;  3MIB A;  5K0U B;  2J1A A;  2Y6F A;  4K21 A;  4CXX A;  4C1X A;  4N43 B;  2YDE A;  2OQ7 A;  2VMF A;  2D40 A;  3WDY A;  3IDE A;  4LXL A;  4PT6 A;  2XJT A;  4TLF A;  4AED C;  2K2S A;  3NV2 A;  1QXJ A;  4Z2W A;  1PIV 3;  3D6E A;  5L73 A;  4EN7 B;  4OI1 A;  1SLT A;  5G04 L;  5FZ8 A;  3U1X A;  2AGS A;  1OXC A;  3VKM A;  2HBT A;  3IBM A;  2CHH A;  2YFU A;  1EAH 3;  3WHT A;  2NPI A;  4XFH A;  4RL7 A;  3WNO A;  1CPN A;  1NAE A;  2R07 1;  3LAG A;  1QWR A;  5AFE A;  2D3S A;  4RR3 C;  3VDD A;  1JW6 A;  4KGG A;  1HXS 3;  5FMC A;  4FPK A;  1HRI 1;  1HRV 3;  1QJX 2;  1W8T A;  2PAK A;  3OBZ A;  4CCL A;  2QJV A;  2NLR A;  1NT0 A;  1RUI 1;  4QQO A;  3EJK A;  1C28 A;  2ZAA A;  4NRQ A;  3FN9 A;  2A3X A;  4AVA A;  3KM5 A;  5BY5 A;  3NJZ A;  5CBL A;  1UYX A;  1SEF A;  1UCX A;  3A21 A;  1YYN A;  3QLQ A;  4HVQ A;  4RHV 2;  2YG0 A;  5JZG B;  4GJY A;  1URX A;  2XUM A;  3RYK A;  5FP8 A;  1C3H A;  1IOA A;  4Q4V 2;  1ASJ 1;  2JDA A;  3IDB B;  5FZL A;  1XC6 A;  4G4F A;  3LSE A;  4JGZ C;  3KS7 A;  5C5U A;  3E1F 1;  4IEU A;  3HEI A;  5FYM A;  3WW3 A;  1EP0 A;  1H6Y A;  3H9A A;  3I2D A;  5FZ6 A;  4E9K A;  4DZG A;  2Y33 A;  4ZZ8 A;  2J22 A;  4PF1 A;  3DYO A;  1VMJ A;  4BHP A;  3WQ1 A;  3III A;  3PUH A;  1NY7 1;  3ETQ A;  2GP3 A;  3T09 A;  4B3N A;  1V0A A;  3WLU A;  1ULO A;  2ID4 A;  4CU6 A;  1ZBE 2;  4Y4Y A;  1VAV A;  1F15 A;  5KXC A;  1W9Y A;  3K2O A;  2D93 A;  1OUX A;  1WLT A;  1LR5 A;  3TRS B;  2VU9 A;  2WQ4 A;  1O3T A;  2VVE A;  2VBD A;  3WDX A;  3U4S A;  1HJG A;  1TNF A;  2A7A A;  4KWK A;  5A1L A;  2HWE 1;  2YMZ A;  1YRZ A;  1W8H A;  4QHO A;  1AX0 A;  3IN9 A;  1FV2 A;  1LGC A;  2ZMK A;  5TSW A;  4A6O A;  1OOP A;  4E2Q A;  2LRP A;  3VHP A;  4AAX A;  1RUD 2;  4CCN A;  3QOP A;  4FQ4 A;  4Z82 A;  2X29 A;  4Y5T A;  1SDD B;  3WF1 A;  3W5M A;  3A0N A;  3BTA A;  3CL1 A;  4R4Z A;  3RZK A;  1H8T A;  3ZFG B;  1ZNP A;  4JGZ A;  3AP4 A;  1BBT 1;  5CFC A;  4AVS A;  5IFP A;  1ZBA 1;  3H8O A;  2VUD A;  1WCU A;  5FYY A;  4IDZ A;  2HYX A;  1UOJ A;  2LW8 A;  2FDJ A;  1E5R A;  3ZN6 B;  2K0G A;  5E6H A;  1STM A;  1PZ7 A;  5A32 B;  1L7L A;  1SBF A;  2Z79 A;  2I74 A;  1W2O A;  2XB6 C;  4XJ8 A;  1QOS A;  3LKJ A;  4LT5 A;  5K0U A;  2YHJ A;  1UKG A;  2G19 A;  2XR4 A;  3HT1 A;  2YY1 A;  1NY7 2;  3WG4 A;  1QXR A;  3OUI A;  3POI A;  2B42 B;  2ZS6 B;  2JG8 B;  3AZW A;  5KHG A;  1ZBE 1;  3CU7 A;  2A6W A;  4E27 A;  5IVF A;  3VZJ A;  4OI0 A;  2GSY A;  5FP7 A;  2JDU A;  1JZ7 A;  3OYW A;  1T6B X;  5C8W A;  2W3J A;  4R9A A;  5KXB A;  1W6M B;  5B2G B;  2DU1 A;  2P2K A;  3LEM A;  3RS6 A;  3PNA A;  2D3P A;  2XJR A;  4FFF A;  1US2 A;  3ZSK A;  4QXH A;  1DQ2 A;  2HWE 2;  4CDQ B;  4CCD A;  3H8R A;  5HCB A;  2RM2 1;  1LHU A;  3W58 A;  4PCR A;  3PU3 A;  2XLG A;  3HQX A;  4NPM A;  3H1W A;  3H42 B;  5FUI A;  3ZN4 A;  1GLH A;  4XHX A;  4BMB A;  1AHS A;  4CDQ A;  4RS5 C;  4A4A A;  1LHV A;  2FHR A;  4NIA A;  1MZE A;  5A32 A;  3THT A;  5IK4 A;  4TWT A;  4CE8 A;  3C7H A;  4Y22 A;  3O1T A;  4QU1 A;  1IKP A;  3WP5 A;  3O1O A;  3JUU A;  4LBN A;  4QDS A;  3ZKU A;  1VP6 A;  1RMU 1;  3H7Y A;  3MUZ 1;  1RHI 1;  2PXJ A;  4UFL A;  3LE0 A;  4DOU A;  3N9M A;  2PHW A;  4XIK A;  3A23 A;  2PN5 A;  3K4Z A;  4P9X A;  4YW5 A;  4WM7 B;  3AP7 A;  2GC1 A;  2XJP A;  3ZXJ A;  1KRI A;  3KWV A;  3K51 A;  1JOD A;  4QPG C;  4AQ6 A;  4BOW A;  5FY7 A;  3NQH A;  2A75 A;  5K8S A;  5FY5 A;  2X09 A;  1PHM A;  4COZ A;  4KI5 M;  3BN6 A;  2B8M A;  4UFI A;  5JUV A;  3BOW A;  4LBO A;  4UF0 B;  1HQL A;  5C9A A;  5FZB A;  3SEP A;  2Y0I A;  3O0V A;  2ZBJ A;  3LA2 A;  4LBJ A;  3VDC A;  4TXW A;  5LB6 A;  1VR3 A;  2D5F A;  2A71 A;  3H50 A;  3PUQ A;  3SNM A;  3S6P A;  3DEC A;  1S4C A;  2WT2 A;  3KSC A;  2D6M A;  3LA7 A;  3AVS A;  1OBN A;  1C5I A;  1R08 1;  3H1Y A;  1MS4 A;  2JXA A;  2PHU A;  4XIO A;  3KGL A;  2FDI A;  2IXJ A;  4Y26 A;  4ASK A;  1CN1 A;  4PLN A;  2FBE A;  4N43 A;  3O1R A;  4RFT 0;  1WW7 A;  4KL1 A;  3ZYF A;  2ZAC A;  4QHZ A;  1UU5 A;  2EF6 A;  1K12 A;  5JXG A;  2Y6J A;  2IUW A;  1OLR A;  2D97 A;  3AZX A;  4LKE A;  1O5L A;  3D3A A;  4QPI A;  4LBM A;  2QQJ A;  5ABJ B;  3TEY A;  2WWS A;  4HKL A;  1MS1 A;  2HLE A;  2OKX A;  4CP0 A;  5IVC A;  1IQD C;  2CU5 A;  2PEL A;  1WCQ A;  2LM3 A;  3UGG A;  1RUF 1;  2PQQ A;  2C1F A;  1WW6 A;  1PO1 2;  1V70 A;  1VJ2 A;  3OY8 B;  4UAP A;  1Z0H A;  4AEK A;  2VMC A;  4ISR A;  4H55 A;  3BIE A;  2HEY F;  1HB2 A;  4AFD A;  3LEI A;  3MW4 A;  5I91 A;  3ZDV A;  1KDK A;  2Y6G A;  1UYZ A;  4MVT A;  4LE3 A;  4FPG A;  1DGR N;  1Q8O A;  5FPX A;  1WW5 A;  2JDH A;  3QH6 A;  4KBB A;  1SFY A;  4GAL A;  5L9B A;  5A7W B;  5I0R A;  3I8T A;  1R09 1;  1UMI A;  4QX0 A;  3M3I A;  2QQW A;  4NO4 A;  1GQG A;  4WBB A;  5F3E A;  4E2S A;  2RR1 1;  5FPU A;  4JV4 A;  1CAV B;  1DGW X;  2H0B A;  2VH9 A;  4OUM A;  3ZYH A;  2KR2 A;  2ZX1 A;  5BUV A;  4PDW C;  1MVQ A;  5IAX A;  3ECQ A;  1XSQ A;  5K9Y A;  1LUL A;  1LED A;  3FC0 A;  2ZGT A;  5C5T A;  5DZF A;  4JVA A;  1HN0 A;  1POQ A;  3I59 A;  4NPL A;  2OS2 A;  4BQ2 A;  5FCC A;  1GNH A;  1R08 3;  2E31 A;  1BEV 1;  3AYC A;  1R08 2;  3BKZ A;  3C2U A;  1ENQ A;  1LOE A;  1CAW B;  3VHO A;  2W2I A;  3VZK A;  1JTZ X;  4RGA A;  3WP6 A;  2DVD A;  1OKQ A;  1YXW A;  3N3H A;  1AR8 2;  2HH9 A;  1POV 1;  1VIW B;  1WCD J;  4NN0 A;  3VBU C;  1R1A 1;  2HJI A;  2WR9 A;  2YPJ A;  2ARE A;  3FLP A;  3T30 A;  3BAL A;  3U07 A;  1AXY A;  4N53 A;  1RUF 2;  3ZO0 B;  4AVB A;  4Q27 A;  5AVP A;  1OLM A;  1FOD 3;  1W0N A;  5A6Z A;  2NMO A;  3NST A;  4LA2 A;  4K8F A;  1GWM A;  2P1B A;  2DUP A;  2HEV F;  2JIG A;  5FY0 A;  2WBK A;  2ETE A;  2WZR 2;  4MXW B;  4RQP A;  3THP A;  4B7K A;  2QZ2 A;  1NXM A;  5FPV A;  5LK5 A;  1ND3 B;  2UU8 A;  1OD3 A;  4UBH A;  1UX6 A;  2G9G A;  5FDB A;  2X5I B;  2GNB A;  1V6I A;  3WCS A;  3LWC A;  5T3N A;  3VBU B;  5T5O A;  1C8M 3;  2R7E B;  1FMD 2;  2YPD A;  3B7M A;  3Q8E A;  4D6R A;  1HRI 3;  1HRV 1;  3MEP A;  3JD7 3;  3O0X A;  1XB9 A;  2E53 A;  4DPN A;  2G9F A;  2WN3 A;  5FMD A;  2R0F A;  4JRL A;  1AYN 1;  1AF9 A;  2Q30 A;  3NO8 A;  5ACA 1;  2QKD A;  5LK7 B;  4BZ4 A;  3EMR A;  2RJL A;  4J1X A;  4CP1 A;  4MV2 A;  4CCC A;  2X5I C;  1S0E A;  5JXJ A;  5IK7 A;  4KH9 A;  2PHR A;  4LBK A;  1VBC 3;  1NCQ B;  2W46 A;  1QJU 2;  4IE5 A;  1JMU B;  1JUH A;  1ULG A;  1W2A X;  3ACI A;  4QHB A;  4BPZ A;  1QU0 A;  2ZEZ A;  3WSO A;  2IXI A;  2DCJ A;  3G7D A;  2D98 A;  2W91 A;  2Y8K A;  1DLL A;  5L9R A;  3RPQ A;  5HXV A;  4JTN A;  3MW2 A;  4LIU A;  2VZR A;  2GC3 A;  2GZW A;  3APB A;  3AC0 A;  4Y1Y A;  5LEJ A;  4QU2 A;  1JYI A;  3UJO A;  1LOF A;  1QKQ A;  4AXO A;  4XTP A;  4QB2 A;  4EWA A;  5B4X A;  1CZS A;  3WT3 A;  4HT1 T;  4XFG A;  3ACH A;  3V64 A;  1Q43 A;  4XUQ A;  3W21 A;  1KD7 A;  5F6K A;  4W6Y A;  3TN9 2;  1RMU 3;  2PTM A;  3FBM A;  5KC5 A;  5FPL A;  5KR7 A;  4UW3 A;  4ZXK A;  4OHW A;  3NAP A;  1O3Q A;  1ZA7 A;  2QCS B;  1UOF A;  1YNA A;  4BQY A;  5LA1 A;  1ULE A;  2DFB A;  3V0A B;  2NZ9 A;  3T1M A;  3PHM A;  2DUQ A;  2R06 2;  2BOJ A;  4OUE A;  4M00 A;  1YQ2 A;  2RG4 A;  3ILR A;  4K1Z A;  2FMD A;  4WM7 A;  3DV8 A;  2EXI A;  3IM0 A;  4Q0V A;  4WZF A;  4BLI A;  1BQP A;  1VBE 1;  4CXY A;  3PUR A;  2A3Y A;  1VBB 1;  1EY2 A;  5DUW A;  1V6N A;  2WNU C;  3KCC A;  3LOB A;  3LEK A;  4D3W A;  2IFW A;  4CU9 A;  3D4K A;  4QKB A;  3ZXL A;  5FXV A;  1ALY A;  1UZY A;  4XQD A;  4DEV A;  3IDA A;  1IPS A;  2J7M A;  3ROU A;  4CEY B;  4BA6 A;  4XF4 A;  1TMF 3;  3WF0 A;  2D6K A;  3BPZ A;  3HIF A;  4CP9 A;  3VD3 A;  1U12 A;  1XE8 A;  2IC1 A;  1IG0 A;  5EJ3 A;  5GLZ A;  5J1X A;  3LD8 A;  1ZBE 3;  2GNT A;  1QJF A;  1WW4 A;  3I2F A;  3SIS A;  1QH7 A;  3SQO A;  1IZ3 A;  1WWY A;  2OZJ A;  1AXZ A;  3LIG A;  4YPJ A;  4I2O A;  1DIW A;  1OF4 A;  1GIC A;  2GN7 A;  2ORZ A;  3N4M A;  3KV9 A;  5LRR A;  2VNO A;  5F5A A;  1UY0 A;  3OEB A;  5CFD A;  4BQW A;  1GZW B;  2P37 A;  3HWJ A;  1OT5 A;  2WYF A;  3VD4 A;  4K6B A;  3FFZ A;  4JHZ A;  5F7U A;  2WNU A;  2XUE A;  3WEZ A;  3R6S A;  4AEJ A;  1F31 A;  3U4X A;  1DQ4 A;  3PJY A;  5L7O A;  5I93 A;  5LW9 A;  3OYW B;  1YFW A;  3U11 A;  4ATE A;  1MS8 A;  5FXX A;  1I1E A;  2WUH A;  3I3Q A;  4RS5 A;  5HV4 A;  3IPV A;  4XUR A;  2ZHM A;  1RUF 3;  3KQR A;  4AFB A;  2ZZQ A;  1Y3T A;  2WFF 2;  4PBO A;  2VG9 A;  5CA6 A;  2VBB A;  1AYM 3;  3JD7 2;  4JQR A;  1JYV A;  3VDB A;  1SDW A;  1RUE 2;  2J1V A;  5FYZ A;  5FRE A;  5CVR A;  1VB4 A;  1VRH 1;  2W1U A;  2PAE A;  1L7Q A;  4NIH A;  2BNM A;  2V4V A;  4BU2 A;  3HAG A;  2Q8O A;  4PI0 A;  2XON A;  3UNP A;  3VHR A;  3LA3 A;  3R4D B;  2BJS A;  5FJK A;  4FTE A;  4GB3 2;  2J1T A;  1N1S A;  5FP9 A;  5KXD A;  1ZVF A;  4CDX B;  2ARC A;  5A3T A;  5FO7 B;  5A6X A;  3N9N A;  1UW8 A;  3AKT A;  1YQ8 A;  3MV0 1;  3VDA A;  2XVL A;  1A78 A;  1QJY 3;  3ELN A;  4B29 A;  2BVV A;  5BNN B;  4AWD A;  4JDM A;  1V6M A;  1ZZ8 A;  3VKO A;  2XH6 A;  3VKN A;  2FDH A;  3QCW A;  4UF0 A;  3BYW A;  2WNE A;  3ZFG C;  5C9A B;  4KBZ A;  2BYV E;  4J1W A;  4PJY A;  3C7G A;  4OVE A;  5A7P A;  2ZGM A;  4MGI E;  2WS9 3;  4CZS A;  2XBO 3;  4QPY A;  1S0G A;  1CVN A;  2MPF A;  3JD7 1;  4QPI C;  4IW3 A;  3AK0 A;  5HCA A;  4M3C E;  4S2F A;  1S0C A;  2OA2 A;  1UNB A;  1VRH 2;  1DYP A;  1FAT A;  4Q4W 1;  5LBB A;  1MS0 A;  1UF2 C;  1YJL A;  2ARB A;  1GV9 A;  2UWB A;  2HWD 2;  1IKQ A;  4UW6 A;  4DQA A;  1GNY A;  3PTR B;  1W6O A;  1UPS A;  2ET7 A;  3CZJ A;  1RUC 3;  5FYV A;  1CES A;  3AVR A;  1RMU 2;  3P5B A;  2VCB A;  4WM8 B;  2CGO A;  4OUL A;  1JBC A;  3RZZ A;  1D2Q A;  1O4T A;  3FUQ A;  3FHA A;  3T08 A;  4AOC A;  3OJB A;  2R6Q A;  2VGD A;  4XW3 A;  3RJR A;  1H0B A;  2JKX A;  2KA3 A;  2JB4 A;  4RS5 B;  2VR4 A;  3BUC A;  2HWF 3;  1SCS A;  2ZAB A;  1AXK A;  4XHB A;  1OQ1 A;  1WGP A;  2BTV C;  2OXB A;  2RS3 1;  4AI3 A;  5CFC B;  1AJK A;  4DRV A;  4E8D A;  4RHV 1;  3VZM A;  5C33 A;  1PMH X;  1WLD A;  3POG A;  5F2W A;  5L36 A;  3M2M A;  4H14 A;  4UYB A;  3H1M A;  3MV1 1;  2UYA A;  5LA0 A;  3JZV A;  3NL1 A;  4XUT A;  4ASM B;  4E4Z A;  4AL9 A;  4GMP 1;  4G9S B;  3ZVX A;  1ULP A;  4HET A;  2UYB A;  4Y5Z 0;  4Q4Y 1;  5GZF A;  3DYM A;  1UL9 A;  4UFJ A;  5CFD B;  3RDI A;  1W8O A;  2RS1 1;  4LK7 A;  4XQW A;  5A7O A;  1W8N A;  2VVF A;  4AGG A;  1V6O A;  4XJU A;  3IPV B;  4FOW A;  3Q8A A;  2W68 A;  3WV6 A;  4C8D A;  5BNO B;  4LLO A;  4O65 A;  1DP0 A;  3A7Q A;  2QQP A;  1W6M A;  5F2S A;  3RGB A;  4IGO A;  5JCT A;  4OFG A;  2MNG A;  1HB4 A;  1WMX A;  2DTY A;  4Q29 A;  4QQH A;  1D4M 1;  3OGR A;  2CGP A;  5CFC C;  5J7M A;  3U0Z A;  4CCE A;  4GUL A;  3CJI C;  3B5L B;  1DCS A;  2AR6 A;  4LJH A;  1TMF 1;  1NA1 A;  3RWK X;  2XLA A;  5BNP A;  1ST8 A;  3UGF A;  1RUD 1;  1WUV A;  1QDC A;  5FAX A;  1BVV A;  3RZG A;  2VD7 A;  1UQX A;  4LO7 A;  3HBK A;  5T55 A;  4MOA A;  4FAG A;  3M4F A;  4GJZ A;  4CEW A;  3C7F A;  1HQW A;  3AJY A;  2CV6 A;  3AZV A;  1B35 A;  2R0H A;  4B1M A;  2OPK A;  4D7T A;  1COV 1;  2NQY A;  4QB1 A;  1ZZC A;  2D3R A;  3ZN5 A;  3EO6 A;  1RVF 1;  4FTB A;  2X8K A;  2ZOE B;  1LGN A;  3CJX A;  1PIV 2;  1QMJ A;  3SC7 X;  3NV4 A;  3M1H A;  2H6B A;  2GND A;  5FR3 A;  3BI3 A;  1EV1 3;  1NCR A;  5EFU A;  2XML A;  1ZRD A;  2VCA A;  4QGL A;  1VBB 3;  3N9P A;  2VZU A;  1F4A A;  1X36 A;  1ZRI A;  1DQ6 A;  3VBS A;  4CCO A;  4I02 A;  3GF6 A;  1WBF A;  3KV6 A;  2VNV A;  2O14 A;  1HB3 A;  4KQ7 A;  4QX2 A;  3HN3 A;  3CJI A;  5DAQ A;  1DZQ A;  1OH4 A;  4GA9 A;  4A42 A;  5KHI A;  5LCW L;  1ULF A;  1D0G A;  1D4M 2;  1ENX A;  2WZE A;  2QVS B;  1X9P A;  4NOT A;  2W94 A;  1AR7 3;  2EA7 A;  3M8L A;  4NHK A;  4LOS A;  1W6N A;  3U14 A;  4FPL A;  4TLG A;  3IDC B;  3M3C A;  5JIA A;  2X53 S;  1W3X A;  3K4A A;  5GKA C;  5F37 A;  3UYJ A;  3SCH A;  1IS6 A;  2LUW A;  2PFW A;  3ILF A;  4Y20 B;  3WDT A;  2VPV A;  3K46 A;  1AR6 1;  3CO2 A;  1W9W A;  2OUJ A;  3HNB M;  4HN0 A;  1FI2 A;  1TME 3;  2WQZ C;  3WX5 A;  4Q0P A;  1RUO A;  4EE2 A;  4WV8 A;  4HL0 A;  5JSR A;  2FDF A;  1VMH A;  5I8T A;  1TQ5 A;  3GDB A;  3UGH A;  3R4U A;  4HAN A;  1QH6 A;  3KVB A;  5FP3 A;  4EYU A;  4TYS A;  1PVC 2;  1U0A A;  4N43 C;  4V1P A;  5LAS A;  1WMD A;  4DIN B;  4DXS A;  1YQC A;  1C5H A;  4FXK B;  4FFI A;  1HRV 2;  1QJX 3;  1SLA A;  2I45 A;  4IGP A;  5J36 A;  4YW4 A;  1PIV 1;  2JDN A;  4N9H A;  1H1I A;  4XJA A;  1VAK A;  3NJV A;  5ERL A;  3UKV A;  3MO4 A;  1N3P A;  1OMI A;  5BYN A;  1CON A;  2X10 A;  2L9L A;  3B00 A;  5LA9 A;  4Q8L A;  3UV9 A;  2J1R A;  1LNS A;  3NJX A;  4IL7 A;  1UMZ A;  3O14 A;  1OA2 A;  3AMQ A;  4RR3 B;  1DZR A;  1ZZ9 A;  5LZ6 A;  4CDW A;  2RJK A;  2WFF 3;  4I0W B;  1OPO A;  2ADD A;  1JU4 A;  4ZPI A;  4YVW A;  1G9A A;  3H8X A;  1LEM A;  2R04 2;  1UX7 A;  1H4H A;  1V9U 2;  5KXE A;  1LOA A;  1VMF A;  4Y33 A;  1JZ6 A;  2BPA 2;  1OFN A;  4IEP A;  4FPY A;  2SLI A;  4JHT A;  4Z92 B;  1XRU A;  4XFI A;  1DF0 A;  4PLO A;  4AVV A;  4LPL A;  1XYN A;  3M7A A;  5H9P A;  3AYD A;  1SLL A;  3D82 A;  1JZ3 A;  5F39 A;  2FZ1 A;  1W9T A;  4P9L A;  1CGP A;  2GME A;  2EIE A;  4XDQ A;  4CEY A;  1LOF C;  4KMQ A;  2V73 A;  5FRA A;  4U36 A;  5KHK A;  3KCY A;  4OMC A;  1LEN A;  5LY1 A;  1U5I A;  5DN2 A;  3ABZ A;  4O7X A;  1Q5O A;  4Y4R A;  4NMI A;  1OC1 A;  2RR1 2;  1MPX A;  2P34 A;  1CD3 G;  2VW0 A;  5DAB A;  4CSW A;  3O1P A;  1Q3E A;  1C1L A;  4KU7 A;  1MZF A;  2OZ6 A;  1DGL A;  4NAM A;  4UT5 A;  1S0F A;  4C0H A;  5CG8 A;  4XZP A;  5FYT A;  3O5S A;  4EN6 B;  2EID A;  4Q4Y 3;  5LBE A;  4AQS A;  1PX3 A;  1WA4 A;  3AXD A;  1CX1 A;  5T54 A;  2GMP A;  3NV3 A;  1VBD 3;  3BIW E;  1WKY A;  2J1S A;  4LA3 A;  1DZT A;  4CPB A;  1SBE A;  3ZSJ A;  5C71 A;  1GFF 2;  2HWB 2;  2MEV 3;  4HSL A;  5FY8 A;  4HMZ A;  2P4E A;  4Y1V A;  1R1A 2;  1PZ9 A;  1IQA A;  2ZEW A;  4NRM A;  3U78 A;  1S2E A;  2RS3 3;  5C7G A;  5HI0 A;  2GP5 A;  1OQE A;  2DCT A;  2GH2 A;  2EXK A;  1ZBA 3;  1QNW A;  4LBQ B;  4Q1R A;  3NNL A;  4FSJ A;  3P1I A;  1KS4 A;  3PJQ A;  2GN3 A;  4LHK A;  1HXS 1;  3MLL A;  4CU8 A;  3UKN A;  3J7N A;  3POF A;  4LIV A;  2BFU L;  1QY4 A;  3AXE A;  1LB2 A;  1RUI 3;  4XEZ A;  2E51 A;  2JE7 A;  5EZW A;  1UYP A;  4XFB A;  5LY2 A;  2RMU 3;  3ZIW A;  1NZC A;  4A45 A;  3RFR A;  3VBF B;  1D2S A;  1U5Z A;  3FZ3 A;  5FLI A;  5EIY B;  1DQ5 A;  4KNC A;  1Y9G A;  5E88 A;  3ATG A;  1A8M A;  1N1T A;  2BNN A;  3B9C A;  2F17 A;  3MZH A;  4YZ5 A;  1N1V A;  1B09 A;  2Y26 A;  4QPW A;  5IK8 A;  4GZ9 A;  3CDZ B;  4S2D A;  2JKB A;  3JXS A;  2A3W A;  3D5O A;  3POE A;  1Q8S A;  4CDX C;  5A3M A;  5JPM B;  3LB9 A;  2ADE A;  5ABJ C;  4IEZ A;  3O1U A;  4CYD A;  1CX4 A;  1E57 A;  3UES A;  2OX0 A;  1AYN 2;  1MZ5 A;  2PHX A;  3I97 A;  3I3M A;  3ZPO A;  1F2N A;  4HXC A;  4CRQ A;  3S0M A;  5A33 B;  1GWL A;  3ZYB A;  4NWV A;  1PK6 B;  3VUO A;  3GBF A;  3SH3 A;  1JXN A;  1TEI A;  2VME A;  1X8E A;  5A33 A;  3FHQ A;  1AL0 G;  3L2H A;  4BB3 A;  2Q0A A;  1L3J A;  4LUK A;  3ACG A;  1ZZ7 A;  2E33 A;  1Z7S 1;  2B46 X;  1PVC 3;  5APA A;  1OPM A;  3EB7 A;  3B01 A;  3OF1 A;  3ASI A;  4H3W A;  5EYY A;  3RMY A;  2XKO A;  5FQ0 A;  5IAT A;  2RVA A;  3POB A;  4M4R A;  3WCR A;  5SV8 A;  3ZFE C;  3VBH B;  4Q0S A;  5F5Q A;  5F5I A;  5DMY A;  4E4D X;  2BBA A;  1F9K A;  2JIC A;  3KLS A;  2NM1 A;  3KMH A;  4I09 A;  4D6Q A;  4ERO A;  3OPT A;  2Q8D A;  2WII B;  1E5I A;  4NWW A;  2HYK A;  4Q0Q A;  4Q26 A;  3RVH A;  5FZ4 A;  3FJS A;  1GKB A;  3LGR A;  3ZYP A;  2Z5W A;  1NCR B;  4IEO A;  3K3N A;  1BXH A;  3C3V A;  4XCB A;  1QDO A;  3GYD A;  1DGW A;  4R9D A;  2EXJ A;  3ZFF B;  3LZZ A;  1V6L A;  3OSD A;  4O9G A;  1RUH 1;  3GAL A;  2HWD 1;  1VBB 2;  3BCW A;  2JD9 A;  1LU1 A;  3PIJ A;  5CZK A;  4JGZ B;  4DXZ A;  1JOP A;  1H8T B;  3ZFG A;  4XXP A;  1J83 A;  1WD3 A;  2PHD A;  2BWA A;  2G4I A;  3LDB A;  4PQ9 A;  4IUG A;  4I0B A;  5FZ0 A;  5GZC A;  1JYX A;  3MLK A;  4V2W A;  1MS9 A;  1I5Z A;  2RM2 3;  1K5M B;  4NII A;  2AAC A;  2XVG A;  3I3D A;  4Q0U A;  4AW7 A;  4Y1X A;  2ZHK A;  1PX4 A;  1SZB A;  1OOP B;  3O0W A;  3ZSL A;  3F95 A;  2JE8 A;  4CEW C;  2E7T A;  1AYM 1;  2GH8 A;  3USU B;  1KIT A;  4ITC A;  4ISQ A;  4B4P A;  4NPR A;  2ZGR A;  3LDR A;  3R05 A;  4XJW A;  4CVU A;  4HPK A;  1YI7 A;  1VAL A;  1MEC 3;  5CKQ A;  3ILN A;  3F2Z A;  3HR9 A;  1PO2 1;  4YGD A;  5FUP A;  5BNO A;  3OD0 A;  3P3P A;  1IPK A;  1IS4 A;  1RIN A;  4Z2A A;  2W47 A;  1JHN A;  3TNP B;  1W0P A;  2E7Q A;  4IET A;  1O8P A;  5FXZ A;  4V2V A;  3MIC A;  4ES8 A;  1S1A A;  5FMO S;  1REE A;  1J1L A;  4YGC A;  3S5Q A;  2R06 3;  1FX5 A;  3I59 B;  4OI4 A;  3KV5 A;  3SHR A;  3T0D A;  1OA3 A;  1KEX A;  4XAE A;  2Y34 A;  4CDX A;  2VOK A;  5KHH A;  2DUR A;  1T2X A;  1DYO A;  2CAV A;  3AFK A;  5FZ9 A;  3TBD A;  4CEW B;  2P6H A;  2R07 2;  3OCP A;  4HK9 A;  3T0A A;  3ZYR A;  2JG9 B;  2VM9 A;  5A1F A;  4BXS V;  4AG4 A;  4A3Z A;  5FYU A;  4XOG A;  2JEC A;  1JOB A;  2BBV A;  2B9V A;  3D8C A;  2HWE 3;  2C9K A;  1ODN A;  1X50 A;  4OHX A;  4A7K A;  4DUV A;  2RJ2 A;  1MZ6 A;  1RUD 3;  2ATF A;  2YGL A;  4LO5 B;  3SEE A;  5KWR A;  3DPR B;  4AFM A;  5IJR A;  5AC9 2;  2BGC A;  1UZV A;  5IFT A;  4IE4 A;  2C26 A;  1NG0 A;  4RD7 A;  3OG2 A;  5F6L B;  2ZX3 A;  5FZ1 A;  3SLI A;  5F9T A;  3HN1 A;  4XF1 A;  4NHM A;  3WNN A;  4MUV A;  2OT7 A;  3EXU A;  5C6C A;  2QQU A;  1O4Y A;  4L8Q A;  2Q8E A;  3HVD A;  4XTM A;  4C1W A;  1N47 A;  3ZFF A;  1YQ5 A;  1ASJ 3;  1YC6 1;  1HV0 A;  2P3Y A;  5JMO A;  4XJ9 A;  2VVD A;  3TEW A;  1XXN A;  1RUJ 1;  3GHM A;  4MGS A;  4N8M A;  3DYP A;  3POW A;  4MGQ A;  5JIU A;  3OTF A;  4ORF A;  3J9S A;  3CF6 E;  4IV1 B;  4BME A;  1W05 A;  1GBG A;  1AX1 A;  1WA6 X;  5HV0 A;  3EBR A;  1M06 G;  3KF5 A;  1AL2 1;  1OFS A;  1ENS A;  3GXU A;  1NXD 1;  2VZQ A;  5DQ0 A;  4FPF A;  3VZO A;  4YZ2 A;  1B35 C;  2DV9 A;  2YBK A;  4OI2 A;  3JCI A;  2AH2 A;  4ZU7 A;  2WRA A;  1VBA 3;  1LU2 A;  3L2Y A;  3AL5 A;  4D94 A;  3NNG A;  4LHS A;  4HKW A;  4IEX A;  1LJ7 A;  4AR2 A;  3AKS A;  4TN7 A;  5FWE A;  3ZSE A;  2WYS A;  2BQP A;  4P00 B;  2Y6H A;  1GYK A;  1SLC A;  4YZ3 A;  3KGZ A;  5IVJ A;  1YFY A;  2RMU 1;  2WDB A;  3N9O A;  1BZW A;  1JU3 A;  1R1Z A;  1X7N A;  2VMD A;  2YC4 A;  3OPZ A;  4YLZ A;  4YYO A;  3VBS C;  1RXF A;  4GB3 3;  2YB7 A;  1BBT 2;  4LHL A;  4QAW A;  4ES9 A;  3OD4 A;  4QDQ A;  1WBL A;  1CQ9 A;  1O6U A;  5JOY A;  1PVC 1;  2HBU A;  3PVB B;  4IXL A;  4LUM A;  4XIL A;  2Q1Z B;  5GLU A;  1JN2 P;  2C6S A;  1TZO A;  3BTZ A;  3AZZ A;  2VTF A;  4Q5O A;  1W9F A;  5BNN C;  2DTW A;  5CYY A;  3BTY A;  1QJY 2;  4FT8 A;  3TB0 A;  3ZYG A;  4URA A;  5ANN A;  1MQT A;  2MEV 1;  4XUP A;  2ZMN A;  4FPC A;  4A6S A;  1GP5 A;  3TNQ A;  4NR1 A;  4HPK B;  3CBN A;  4WVW A;  4DXT A;  1AL2 2;  1QIQ A;  1UY3 A;  1JYN A;  3GZA A;  3UT0 A;  1WME A;  1ONA A;  2VZP A;  2AEY A;  3J7M A;  2BFU S;  4XC9 A;  4ZON A;  2UY9 A;  1W6P A;  3GBW A;  1HN1 A;  2ARX A;  4QQP A;  2Q8C A;  4FFG A;  2N7G A;  3ES1 A;  2RS1 2;  3N9Q A;  5F3C A;  3NRU A;  1RVF 3;  2XWJ B;  3IAP A;  2JWP A;  2Y0O A;  2X05 A;  2QUO A;  3ZXK A;  3P6B A;  2R04 1;  4WZC A;  3VL9 A;  2ZKL A;  1X9T A;  3TEZ A;  3T2O A;  3GM8 A;  4XCA A;  1XNB A;  3N36 A;  1H2N A;  3FLT A;  4R9C A;  3PVO A;  3RSJ A;  4OZO A;  1CJP A;  5JI7 A;  1PM7 A;  5D8A A;  2PHL A;  5K4L A;  2D43 A;  4H7L A;  3RI8 A;  1XNT A;  4JGY A;  4IV1 A;  1OSG A;  3ON7 A;  4XBN A;  1DU3 D;  3NAP C;  4K9S A;  1RUG 2;  4YZ4 A;  4CTE A;  1TMF 2;  3B69 A;  4QGM A;  1X82 A;  5E8A A;  1S0D A;  3ZM8 A;  3AFG A;  1K5M A;  1PM4 A;  2YU1 A;  4OZX A;  2YZ4 A;  5FFO C;  2D7F A;  4JDN A;  1Q56 A;  5FZK A;  2ZGP A;  3LFI A;  4R52 A;  4YGB A;  4K40 A;  3ME2 A;  3TOJ A;  2HWC 3;  2GC0 A;  3VN4 A;  2ZTN A;  1JH5 A;  4Y24 A;  1RC6 A;  4RQP C;  5CKM A;  4BK5 A;  1C57 A;  3LCP A;  4EN9 B;  4AI8 A;  3VD5 A;  5HPO A;  2QNK A;  3MFA A;  3M70 A;  1NUK A;  4OHV A;  4QXC A;  2NN8 A;  1UO9 A;  1UZZ A;  3VBO C;  2BP6 A;  1GP4 A;  3FHI B;  1JHJ A;  1AR8 3;  2ZX2 A;  5I0T A;  5KBF A;  1ZRF A;  3BGA A;  4HON A;  2WC2 A;  3WP4 A;  5FBZ A;  4URT A;  3NAP B;  5DG2 A;  2ZGU A;  3AP9 A;  1NOV A;  3E6B A;  3HQR A;  1GSL A;  1I3H A;  3GCX A;  1Q8Q A;  2JIJ A;  3J7L A;  5DDJ 3;  2H0V A;  1GUI A;  3D0J A;  3O12 A;  1ZZB A;  1RL3 A;  3WDV A;  5GM0 A;  5HBA A;  4YVW B;  4LIT A;  1CAW A;  1HKD A;  2WO3 A;  3K48 A;  3V0A A;  4NIG A;  1JZ2 A;  2FCV A;  1QOO A;  1IGO A;  2IXL A;  2FD8 A;  5FPZ A;  3ZYI B;  4E8C A;  4DEQ A;  1DBN A;  3FUO A;  2XLF A;  4QMA A;  5FY4 A;  5I0U A;  3MID A;  3I54 A;  3ZXF A;  3B02 A;  1EUT A;  4IV3 A;  1R09 3;  4G3Y C;  5FO8 B;  1JS9 A;  1PK6 A;  5FZD A;  1O4Z A;  4EV0 A;  1W8Z A;  2XJU A;  4R4X A;  3AJZ A;  5FYS A;  5CKN A;  5J3U A;  2W87 A;  1O91 A;  2P3J A;  4LMF A;  2VXJ A;  2ZHN A;  1DDL A;  3DKW A;  4MHU A;  2E6V A;  4QXB A;  2AC1 A;  3RWN A;  1XU1 A;  2BZD A;  4LO8 A;  1H4G A;  4XDP A;  4ZU5 A;  4ZXE A;  4A41 A;  3LOI A;  2VAU A;  4Q4W 3;  4BQ3 A;  3MDP A;  3JU9 A;  2W5F A;  3ITQ A;  4M3C B;  4O9E A;  5IYY A;  4JGY B;  4UOJ A;  3UL2 A;  3KZ4 C;  2VQT A;  2RDS A;  1LHO A;  2QZ3 A;  1HB1 A;  2UWC A;  5CEH A;  4OHY A;  1SAC A;  4M01 A;  4MGZ E;  3DXT A;  1Z78 A;  1GNZ A;  2VMG A;  1OD5 A;  1VBC 1;  3MIG A;  2ZA9 A;  3WOG A;  3Q8C A;  2ET1 A;  2JJ6 A;  1FPN 2;  3AKQ A;  3MGU A;  1Z7S 2;  5I8S A;  3H8U A;  3NNJ A;  1Z7S 3;  4EZH A;  3K77 A;  4XXA A;  2JB8 A;  3AMN A;  3KB5 A;  5BXX A;  2PA7 A;  5E1R A;  3TWI A;  2WT1 A;  4FO9 A;  1LOB A;  3ACF A;  4GH4 A;  3OY8 A;  1ZRR A;  1PNF A;  2ARA A;  4GXL A;  1IS3 A;  3HT2 A;  4WVM A;  2D44 A;  5FZC A;  5L7O B;  4CDU B;  2BER A;  2TUN A;  3AL6 A;  4EQV A;  4H2A A;  1CWP A;  1RUJ 3;  1FOD 2;  3I2I A;  5T5J A;  3SH4 A;  4LBQ D;  3VGI A;  3N7M A;  2E26 A;  4XE9 A;  2G9Z A;  4MGT A;  2NP0 A;  1F35 A;  2VUA A;  1GQP A;  4M0H A;  3I2H A;  3MYX A;  4COU A;  3ZFE A;  4MG2 A;  2RV9 A;  3IMM A;  3A4U A;  5D1I A;  3S7I A;  4B4R A;  3VBH C;  3H3L A;  5LAT A;  2BVB A;  1V00 A;  2F4L A;  2QQN A;  1ND2 A;  4X8N A;  1KS5 A;  1DGR A;  4WVM B;  5JI9 A;  3SIT A;  3RG0 A;  2E32 A;  2ZHL A;  2VUC A;  4XZU G;  3VZN A;  1YJK A;  2XL9 A;  3OGG A;  5GJ6 A;  5DZG A;  4L11 A;  5C9A C;  1FMD 3;  1FPN 1;  5DUV A;  2IXC A;  4YM1 A;  2WLP A;  1NCR C;  5A70 A;  4KGQ A;  1LKN A;  2ZKN A;  1NLS A;  2HWB 1;  1VBD 2;  4FOY A;  4OCT A;  4RR3 A;  4AZZ A;  2R32 A;  4A44 A;  3ZFF C;  1CZV A;  2WZ8 A;  1V9U 3;  1BVP 1;  1EPZ A;  3WNK A;  4CXW A;  3J26 N;  2FMY A;  2WZR 3;  4ZS2 A;  4HK8 A;  5T52 A;  4F7Z A;  4LO6 B;  3TN9 1;  4PHZ A;  4BIO A;  4Y22 B;  1F5J A;  1GZT A;  4BIS A;  4XUN A;  3RMX A;  2AZ5 A;  1X33 A;  4GQ7 A;  1DYK A;  1W2T A;  3I3B A;  1YFX A;  5FMO L;  5JWP A;  3G6J B;  3O1S A;  1OKO A;  4IV3 C;  4JKK A;  5FIX A;  2V5D A;  5JLV A;  3SXW A;  2HEW F;  1W6P B;  2ZZJ A;  5CG9 A;  3AX4 A;  3EYP A;  1F4H A;  2WNV C;  4BE3 A;  4L92 A;  3R4S A;  1DFQ A;  2CYF A;  3OUH A;  1VBE 2;  3AYE A;  1RXG A;  2A1X A;  3H7J A;  2DUO A;  5FZE A;  5C3Q A;  5DAW A;  2VZT A;  3QH7 A;  1ZM1 A;  1NCQ A;  4Z07 A;  1AR9 1;  3CEW A;  1PGW 2;  3UK9 A;  1VBA 2;  2VQA A;  5JSO A;  4E2G A;  1JYT A;  4C0B A;  1W3V A;  3GJB A;  4IEQ A;  1RUG 3;  4L97 A;  3THC A;  4IGQ A;  4TSV A;  3ZX7 A;  5IVE A;  1NE4 A;  4IE7 A;  4X6R B;  1UZW A;  2VOX A;  4EZ4 A;  2WT0 A;  2W1S A;  3GNE A;  2ZGK A;  4YW1 A;  5JR7 B;  5IK5 A;  2VMH A;  3R0R A;  1W90 A;  1I9R A;  1QJE A;  1REF A;  3KT7 A;  3WP3 A;  4WVV A;  3LDK A;  5A7S A;  3PL0 A;  4P02 B;  4BXF A;  1YWK A;  1JZ8 A;  5D8A B;  2LAL A;  1FT9 A;  5HXM A;  3KHC A;  2O8Q A;  3CZU A;  4QQ2 A;  1W6O B;  1RUH 3;  3QD6 A;  5J37 A;  2HWD 3;  2WNV B;  4QPI B;  4YG6 A;  1QEX A;  2Q4S A;  4AI1 A;  2XWB B;  1BKZ A;  4FOQ A;  2FDG A;  2CTV A;  1RB8 G;  3FX3 A;  2D6O X;  2FQP A;  4Y5S A;  5FLH A;  5A3W A;  3V0B A;  5I0S A;  3CQO A;  1BJQ A;  2XJS A;  3ZR6 A;  3ZIX A;  4M3C F;  5EQU A;  2XGX A;  3CLP A;  3S30 A;  1LHW A;  3HD8 B;  1XQN A;  1GOG A;  2P5B A;  1ZRE A;  1G8W A;  1VAM A;  2XVK A;  3DEM A;  1ZX5 A;  3P3N A;  1UXX X;  2R30 A;  4FOV A;  5IVY A;  4XBQ A;  4QKN A;  3WQ0 A;  4LQR A;  3V56 A;  2D6P A;  4WVZ A;  2Z2S B;  1OUS A;  1TME 1;  4HVR A;  4P5Y A;  1HW5 A;  5DPN A;  1CPM A;  4CCJ A;  1HX6 A;  3LSD A;  4B8E A;  1NQJ A;  1PZ8 A;  4IEV A;  2CDO A;  1GOF A;  3JQW A;  4WM7 C;  4YFZ A;  2ZGO A;  4CPB D;  2EVX A;  2PAM A;  4QM9 A;  3RZJ A;  4YNI A;  3DXU A;  1C8N A;  3INA A;  1C8M 1;  4JTO A;  4IQP A;  4FFH A;  5F8P A;  5CAD A;  3MIE A;  1NA1 B;  5BNP B;  3TEX A;  3VBO B;  3WY6 A;  5A7N A;  4XF9 A;  2PMW B;  1PVX A;  2O0O A;  1E5S A;  1LRH A;  1RUH 2;  2VEC A;  3Q8F A;  4CEY C;  1D4V B;  4IV1 C;  4XFA A;  4COV A;  2FCU A;  1S2B A;  1S2K A;  4RHV 3;  4QD2 A;  4CDQ C;  5BV6 A;  1LEC A;  1N3Q A;  3EQE A;  4GB3 1;  5FZI A;  3C8X A;  4LUL A;  1RGS A;  2DWR A;  2K9Z A;  1D7P M;  2QBX A;  1BLZ A;  2VQ0 A;  2A73 B;  2YUE A;  2ZCW A;  5A80 A;  1MQT B;  1CIY A;  1J3R A;  1ZA4 A;  3LPF A;  4NRO A;  2JEM A;  1DQ1 A;  2E9Q A;  2WO1 A;  5FMB A;  5BNO C;  1U5Y A;  4MHR A;  1W28 A;  1X8M A;  4LHN A;  1KQR A;  1OH3 A;  2JX9 A;  4K20 A;  3M3O A;  2XL7 A;  4LKS A;  4DIQ A;  1ODM A;  1BK0 A;  4NRP A;  4COW A;  5LEK A;  1AR6 3;  2BV4 A;  2CAU A;  4W4Z A;  1G9F A;  2JG9 A;  4A2U A;  2P3I A;  2A70 A;  2D5H A;  3VBF C;  3VBS B;  4QPG A;  1YLL A;  2VBP A;  3CJI B;  5H9R A;  4XBL A;  4XQ4 A;  3URF A;  1S55 A;  5FK8 A;  4AQ2 A;  4DXR A;  2V5Y A;  1XYP A;  1D4M 3;  2CWM A;  2Q1M A;  2DVG A;  2VCM A;  2Y64 A;  2VQU A;  3C7O A;  1HJF A;  2XKP A;  5IHR A;  1C8M 2;  4DMI A;  1BEV 3;  1GQH A;  4HN1 A;  3IIA A;  4PI2 A;  5D2A A;  5LWB A;  2FZ2 A;  2C24 A;  2C5D A;  3WW1 A;  1O3R A;  4Q4W 2;  1Q8V A;  3T1L A;  2VL4 A;  1LTE A;  2BEO A;  1S0B A;  1VPH A;  1XJA A;  4WM8 A;  3E6C C;  3J4U H;  5F3G A;  1NKG A;  3WNP A;  2VC9 A;  1XPW A;  4RGK A;  5FLJ A;  5GZD A;  2VJX A;  3RRD A;  2JG8 A;  2VO5 A;  2RE9 A;  1QJU 3;  5IVV A;  4HVO A;  2QQL A;  4DY5 A;  2QDN A;  3JBG 3;  4PQQ A;  4QXK A;  4XET A;  3OGJ A;  2WZP P;  5HCF A;  2RS1 3;  5JOX A;  1BK1 A;  4MYE A;  3ZOI A;  1SQ4 A;  4KU8 A;  4L2N A;  5CU1 A;  2OII A;  3T4V A;  2WFP A;  2VW2 A;  5AC9 1;  2WSU A;  2ZEY A;  4K7J A;  4L9B A;  4LEJ A;  2RS3 2;  2R49 A;  4A7Y A;  3OBR A;  1WLW A;  3MFC A;  3J8F 2;  4CUA A;  5GZG A;  2W08 A;  2XJV A;  3NKG A;  4Q4V 3;  4QX3 A;  2Z69 A;  3LQC A;  4RGG A;  5FWJ A;  4HG6 B;  2WN2 A;  2R16 A;  1RHI 2;  1GZC A;  3BOD A;  1DLC A;  2W1Q A;  1W03 A;  2ERF A;  5C3R A;  2W1W A;  1CAX B;  4Q4Y 2;  2WS9 2;  1RUJ 2;  3FE5 A;  4FCA A;  1JYC A;  1RTV A;  4FPO B;  4GKY A;  5EJ1 B;  5FPA A;  4BYY A;  3V65 A;  2W0X A;  4F8A A;  3OBA A;  1UD1 A;  2DBN A;  3AP6 A;  4AK3 A;  1A34 A;  3JB4 C;  1PMI A;  2O8O A;  4PDW B;  1UOB A;  4JRA A;  3T4H B;  4YVS B;  3T2T A;  1H9W A;  4XAC A;  2WIN B;  3ZSM A;  1UOG A;  5JZG A;  2WAO A;  2IZW A;  1OOP C;  3QBQ A;  3J7H A;  3ZKY A;  4BJ0 A;  5DG1 A;  2R07 3;  3GCW A;  3GZE A;  5J09 A;  5BNN A;  1S0J A;  1NLQ A;  5LBF A;  2Y6L A;  2ZJC A;  1GZW A;  2VZ3 A;  5F3I A;  4UI9 L;  3PUS A;  4PBP A;  1UY4 A;  2EIB A;  3NNM A;  1XOY A;  1HQN A;  3W59 A;  4DO0 A;  3VBO A;  1OF3 A;  1CAX A;  1QQP 2;  4A7Z A;  4O61 A;  5JOZ A;  2VMI A;  5EP9 A;  4ZU4 A;  4GAZ A;  1N1Y A;  5JZG C;  2RMU 2;  5IW0 A;  1RIR A;  1NCQ C;  2CL2 A;  2QQK A;  4FXG B;  3EHK A;  3WG1 A;  2QQI A;  2Z42 A;  2AYH A;  4CU7 A;  3KD4 A;  3DPR A;  3KCX A;  1AR9 3;  4CUG A;  5K7P A;  4HBN A;  5L9V A;  1PO1 1;  4LTA A;  4AVT A;  1GP6 A;  3PMS A;  4NHL A;  1SG3 A;  1VLN A;  2P6C A;  1C1F A;  2ZX4 A;  2A6X A;  2DFC A;  1H2L A;  1PGL 1;  4QX1 A;  5C8C C;  2DDU A;  3RJ2 X;  1ND3 C;  1QJY 1;  2DF7 A;  3V0B B;  4F3J A;  1D0H A;  4Q4X 1;  3VD9 A;  1R09 2;  4P08 A;  2OQ6 A;  3ZYJ B;  4ASL A;  1WZX A;  2DCY A;  1J58 A;  2QQM A;  3OGV A;  4AI9 A;  4BCU A;  5DZE A;  1ND2 C;  3MF9 A;  3OUJ A;  1K5J A;  2WQ8 A;  5DUU A;  3WG3 A;  5EHD A;  3WW2 A;  1RHI 3;  1O5U A;  1A3K A;  1CJD A;  1W2N A;  1J1T A;  2XHK A;  2AUY A;  4QT6 A;  4AYU A;  2DVF A;  1W8W A;  3VLB B;  5F1R A;  3AMP A;  1AR7 1;  2O1Q A;  4GWM A;  3VV1 A;  3WQB A;  4CDW B;  4BQ1 A;  3B3Q E;  4D69 A;  2WL1 A;  4RYD A;  1SLB A;  3FLR A;  2SBA A;  4DY3 A;  3GJA A;  1AR8 1;  1J59 A;  2JE9 A;  1QGL A;  1ND2 B;  1YCI A;  4P9G A;  1M4W A;  2GNM A;  1H6X A;  3AB0 A;  4QX7 A;  5FYB A;  3E5U A;  1NE6 A;  4BQ4 A;  5FOJ B;  4YG0 A;  3ZMN A;  1BBT 3;  4MSV A;  5FTT C;  3RYR A;  1EUU A;  3RZL A;  4RA0 A;  1QOT A;  1W99 A;  1FOD 1;  4XF3 A;  5DDJ 1;  1RUG 1;  1FV3 A;  4OMD A;  1OHF A;  4J25 A;  5C3S A;  3W5N A;  3PU8 A;  1PGL 2;  2BDR A;  3CKH A;  3PUA A;  1JYW A;  1H2M A;  3I2J A;  4GH4 C;  1JOJ A;  4K3U A;  4AED A;  1O8S A;  1KJR A;  3CNA A;  3E5Q A;  2RS5 1;  1SMV A;  1POV 3;  3BU7 A;  5AVA A;  1IHM A;  4FPH A;  4N53 C;  3NW4 A;  1UIJ A;  1AX2 A;  2OYZ A;  3CIH A;  5FV3 A;  5J98 B;  3O1M A;  4Q2F A;  5IVB A;  4M0N A;  1QJZ A;  4GMP 3;  2PLV 1;  3ALQ A;  3H3Z A;  5FYI A;  5DAX A;  5FQ0 B;  2WNO A;  1XE0 A;  2A6Y A;  1AR7 2;  2D6L X;  2VZV A;  1AUY A;  3D0S A;  3HOB A;  4W6W A;  4XAA A;  3WG2 A;  5K0U C;  3HQU A;  1VBD 1;  4QB6 A;  3ZXE A;  1RED A;  3MUY 1;  4MGY E;  3USS A;  3WHU A;  1V9U 1;  4YAR A;  1VE0 A;  2WKK A;  3U75 A;  5GLW A;  4N53 B;  1CAU B;  1RUC 2;  3TYJ A;  1BHG A;  2G1M A;  5FZH A;  5ABJ A;  2V09 A;  5KC6 A;  1J3Q A;  1SPP A;  5J96 B;  1KJL A;  4OLL A;  4PLM A;  4Q1P A;  5A6Y A;  1G9B A;  2XDV A;  2EAA A;  4SLI A;  2I2S A;  3AZY A;  4OYU A;  3THD A;  1MS3 A;  2WNU B;  3N7J A;  2CDP A;  3PTY A;  4X6Q B;  5DDJ 2;  3WR0 A;  3OB8 A;  4BLJ A;  3RZH A;  3I3E A;  4LLF A;  4DRR A;  2YRO A;  2YBP A;  1YQ6 A;  1SFP A;  3T0B A;  1OQD A;  4OUS A;  4OQ8 A;  3PVN A;  2DU0 A;  1UAI A;  3JQX A;  3A0K A;  3KQ4 B;  2X5I A;  2RS5 3;  3DUI A;  3SKV A;  4D0Q A;  2RS5 2;  3I4I A;  3N9L A;  1W0O A;  3GZT B;  2YXS A;  3QAC A;  4IEY A;  2WLQ A;  2VXR A;  1CAV A;  4UWD A;  3OGS A;  1VBA 1;  4H7M A;  1CAU A;  1QNY A;  2ORX A;  2P3K A;  3AM2 A;  5E89 A;  5SV5 A;  5A3N A;  1H1A A;  4D7Y A;  1K45 A;  3M3Q A;  3VB9 A;  3VKL A;  3ZFE B;  5L7O C;  2XJQ A;  4Y3O A;  3RZM A;  1U5X A;  4S2H A;  4RN5 A;  4P5H A;  1AYN 3;  4Y1Z A;  1DHK B;  1W8F A;  2VE1 A;  1C4R A;  2C4X A;  5ACA 3;  1BCX A;  3JB8 A;  4DUW A;  3WD5 A;  3PME A;  4QGN A;  1Y9M A;  4FI9 A;  3FBY A;  4K8R B;  3O1V A;  3FMG A;  4BDV B;  1ULC A;  5EYX A;  1RUC 1;  1AL2 3;  1W2U A;  4UFH A;  4B4Q A;  1W6Q A;  4YM2 A;  4KWU A;  3K75 B;  1VBC 2;  4HLT A;  4KWL A;  3PUI A;  1A6C A;  2QQV A;  4XAB A;  4XMI A;  4IER A;  2ZGQ A;  1HXS 2;  4ATF A;  4EWE A;  4HSJ A;  2JDK A;  5CB7 A;  2JG9 C;  4DUX A;  1OLQ A;  4EN0 A;  2C0Z A;  2VOT A;  2YFZ A;  1IS5 A;  2B45 X;  3DL3 A;  4NHX A;  5FZF A;  3GGL A;  1YIP A;  5FY9 A;  4GWJ A;  2HKX A;  4W8J A;  3LPG A;  5EV7 A;  2WAB A;  4JX0 A;  2XHN A;  3KT4 A;  1BYH A;  1UU6 A;  3UET A;  4XFF A;  5D8A C;  2V4A A;  2ZPX A;  4LNV A;  4P9W A;  3IMN A;  4W65 A;  1LAJ A;  3RQ0 A;  4BM8 A;  4ZY9 A;  4D6S A;  5FK7 A;  4M3C A;  5T5P A;  3W20 A;  1W6N B;  3I2K A;  4QM8 A;  1UXZ A;  2XPJ A;  1Q8P A;  3VD7 A;  5FP4 A;  4YZ1 A;  2FDK A;  1GMM A;  1AJO A;  4JGY C;  4PIY A;  2Q1F A;  3DN7 A;  2QFE A;  1YFU A;  2JG8 C;  3HNM A;  4EN8 B;  4XMA A;  2I07 B;  3TAY A;  2JDM A;  4AHX A;  2KM2 A;  2JDZ A;  4HKO A;  5FJH A;  5FKB A;  5T5L A;  2QE3 A;  1KXG A;  1J84 A;  1POV 0;  3MIH A;  5EWS A;  4DB5 A;  3FWE A;  2HWC 2;  3IAQ A;  4XFC A;  4XF0 A;  5BPX A;  4YGE A;  2PHF A;  3S5A A;  2DCK A;  1PMJ X;  3JBG 2;  5CIS A;  3BU0 A;  5FZO A;  4I3P A;  4CP9 B;  1UY2 A;  4NID A;  4LE4 A;  3WUD A;  1OVP A;  3LFM A;  3MW3 A;  1RUE 1;  3E97 A;  2RDR A;  1TG7 A;  5AFB A;  2CGN A;  2EIC A;  4IND A;  4RFR B;  4YM0 A;  5A3L A;  1EYB A;  3NV1 A;  1JZ4 A;  3VBU A;  3BPS A;  2TNF A;  5L19 A;  5FBJ A;  3NJY A;  1CZT A;  2RR1 3;  3KT1 A;  3N7L A;  3WNL A;  2ZAH A;  3PVE A;  3Q9O A;  4QWN A;  3K4D A;  5I0D A;  5FZA A;  5LBC A;  4YW3 A;  2LS6 A;  1PO2 3;  2BGO A;  4I01 A;  4EJR A;  2DYC A;  4PIZ A;  4XDO A;  3U37 A;  1H1M A;  5IUQ A;  1UIK A;  5JAX A;  4MX3 A;  5CNA A;  1GR3 A;  3ZPY A;  3CHX A;  2F4P A;  2K46 A;  4NUB A;  2LTN A;  2GU9 A;  3VHN A;  3ZLI A;  1MVE A;  2XG3 A;  4BIF A;  5LA2 A;  3BVC A;  5C4W B;  1QHD A;  1WD4 A;  4MO3 M;  1LGB A;  1PGW 1;  4ET7 A;  2HWC 1;  4N90 A;  1LES A;  3ZMO A;  5T50 A;  4NHY A;  3KHB A;  1L7R A;  3OEA A;  3JBG 1;  4P14 A;  1PK6 C;  1EPW A;  1SHW B;  2B5H A;  2XQX A;  3OPW A;  5A7W A;  2EIG A;  2KD7 A;  4J6G A;  1RUE 3;  3AKP A;  4YW2 A;  2WWJ A;  3U10 A;  1AYM 2;  5FZ7 A;  2R1B A;  3VDD B;  1OI6 A;  4LOT A;  1FNZ A;  3LIH A;  1QQP 3;  2RDN A;  3O7O A;  4QDR A;  5FUN A;  2R04 3;  5FZ3 A;  5AC9 3;  2HWF 2;  3NVC A;  5FPB A;  1NX9 A;  5FXW A;  3T2Q A;  1OA4 A;  3J8F 1;  4YVS A;  2WSV A;  1FAY A;  1XNK A;  5G05 L;  4IV3 B;  1SBD A;  5C4W A;  5JR2 A;  1PO2 2;  5C8C A;  4PF5 A;  2OW4 A;  4I3G A;  1ZBA 2;  2CY6 A;  1V6J A;  1T6G C;  4GD4 A;  2EAL A;  2XOM A;  3AMH A;  4JQT A;  2W92 A;  2W9X A;  4KG0 A;  2WS9 1;  3SH5 A;  4AED B;  4CCK A;  2VY0 A;  3B93 A;  4XYX A;  3B94 A;  4E4H A;  1MQT C;  3WIN E;  5CAZ A;  1H8T C;  2VZO A;  4HOO A;  4FTS A;  4M4P A;  1SCR A;  2TEP A;  1TME 2;  3POY A;  4UBG A;  1LCL A;  5GZE A;  2GC2 A;  2XBO 1;  2XQR A;  4YFW A;  2VTX J;  1BMV 2;  3VBR A;  4YW7 A;  5HCH A;  4SBV A;  4AFC A;  3POS A;  4JCK A;  4LO4 B;  4X8P A;  4C90 A;  1PGS A;  3WXP A;  2RHP A;  3NWK A;  1EV1 2;  3A22 A;  1US3 A;  1QQP 1;  5ISL A;  2VUL A;  2IWG B;  2BRT A;  4IE0 A;  2YC0 A;  2CWS A;  1Y4W A;  2FCT A;  4ARY A;  1UU4 A;  4BQ5 A;  2HWF 1;  4Y1U A;  1DQ0 A;  4AAP A;  3ACL A;  1KFU L;  4U2A A;  3UJQ A;  1NYW A;  4TZD A;  4QX5 A;  5A1A A;  3BTX A;  5D21 A;  4CUC A;  4Z1V A;  2KXL A;  1RJ8 A;  2AEN A;  2QQO A;  1UN1 A;  2AEZ A;  3BOP A;  4YG3 A;  3AP5 A;  4NE9 A;  3WDW A;  5C3O A;  4JZR A;  1AVB A;  1PO1 3;  4B7E A;  3H0O A;  4NVP A;  5FOB B;  2YYO A;  1UY1 A;  4IES A;  2YGM A;  3E5X A;  3L9J T;  3VKF C;  2YU2 A;  1W8U A;  2ZGS A;  2R1D A;  4PIX A;  1G9D A;  1LOG A;  2C9A A;  5J48 A;  1YI9 A;  2VTX A;  4AE2 A;  1RUI 2;  5A3P A;  4LR4 A;  3ZN6 A;  1WMF A;  4K1Y A;  3SKJ E;  4QQL A;  1GWK A;  1GOH A;  2IXH A;  4FAH A;  3WZ1 A;  3WNM A;  1KGY A;  3I2G A;  1MS5 A;  4I0A A;  3GHN A;  3OBT A;  2DVA A;  4OQ9 A;  1SFN A;  4A3X A;  4Q4V 1;  1COV 2;  1BMV 1;  4B1L A;  1NA1 C;  5BNP C;  1ZYB A;  2YC2 A;  1RVF 2;  1FYU A;  3DKQ A;  1OVS A;  4UXA A;  1FNY A;  1EV1 1;  2UY8 A;  1VRH 3;  1CIW A;  2CSG A;  4N9I A;  4EWD A;  5C8C B;  1H2K A;  1E5H A;  1ZZ6 A;  4JC1 A;  3DCQ A;  4LBL A;  3AMM A;  3WF4 A;  4Z8B A;  3SCF A;  1VB2 A;  4AVC A;  4AI2 A;  5H9Q A;  3RNS A;  2QDR A;  5DXD A;  1XBF A;  3HMY A;  1G9C A;  4AHY A;  3HBZ A;  5JXI A;  4YVS C;  4LKD A;  5A7Q A;  2J1U A;  1H30 A;  2VZS A;  1XU2 A;  4BWO A;  5FZO B;  3I2O A;  2HWB 3;  1I5P A;  2MEV 2;  4JKL A;  1IG3 A;  1HV1 A;  1Y9Q A;  4NAO A;  3VBR B;  2LRO A;  4C91 A;  4W50 A;  2PHT A;  1B35 B;  1AR6 2;  3WF2 A;  2IXK A;  3ORJ A;  1MEC 1;  4COY A;  2GDF A;  2QTW B;  4IE6 A;  3C7E A;  3Q8B A;  1VRB A;  1V6K A;  5FZG A;  4CDU C;  4UFM A;  1HLC A;  2PLV 2;  3ST7 A;  2BGP A;  2PLV 3;  2DCZ A;  2BW8 A;  3SCG A;  5CIR A;  4W6X A;  3OOX A;  5ANQ A;  1BEV 2;  5JOW A;  3DF0 A;  5JPN B;  5JMC A;  1G6N A;  1P8J A;  4GWN A;  3T2P A;  1HIX A;  2ILM A;  3VBR C;  4DS0 A;  3UKT A;  5A6Q A;  1F8V A;  1MAC A;  1NZI A;  4ZHN A;  3DPR C;  3WF3 A;  3VL8 A;  5FZM A;  3ZR5 A;  5JXH A;  2B4K A;  2JDP A;  4Q4X 3;  1WLC A;  1Y43 B;  5JDB A;  2ZML A;  2XXZ A;  5DAP A;  1LOC A;  3AKR A;  3VZL A;  4HFS A;  1XE7 A;  4DNY A;  1UMH A;  5C3P A;  4ONU A;  1COV 3;  5DAV A;  3WW4 A;  5M0T A;  4BH9 A;  1O7F A;  1YIF A;  2ES3 A;  1DG6 A;  1XYO A;  2RM2 2;  4CA9 A;  3USU A;  4ZZ5 A;  2VW1 A;  1UKR A;  2YV8 A;  1GAN A;  4FPE A;  4XJZ A;  4AHZ A;  4YM3 A;  2WO2 A;  1H8V A;  1ACC A;  4P9Y A;  1ZRC A;  4GIQ A;  4LKF A;  2ENR A;  2JDY A;  4XVH A;  2UWA A;  3ENR A;  1CR7 A;  4MH0 E;  1EAH 1;  2WWU A;  2NMN A;  4AEM A;  4CDU A;  3MIF A;  3NNF A;  1GZ9 A;  1MEC 2;  4MLO A;  2RDQ A;  3K3O A;  4TTG A;  1XNA A;  1Y7B A;  2NYY A;  1H9P A;  2J42 A;  1KFX L;  4S2G A;  1W06 A;  2ZX0 A;  3RYP A; 
#chains in the Genus database with same CATH homology
 5F5C A;  2Q8C A;  5FZO A;  5FYI A;  5A3W A;  5FXZ A;  4EZH A;  4LIV A;  5FPA A;  3KV4 A;  5IWF A;  2YU2 A;  3N9Q A;  4V2V A;  5F3C A;  4CCN A;  5A3P A;  5LY2 A;  2P5B A;  5F37 A;  3KV5 A;  5IVY A;  5A7W B;  3UYJ A;  4QX8 A;  3PUR A;  3NJY A;  5FBJ A;  5FZC A;  5FYV A;  3PTR B;  5F3E A;  2YBS A;  5FZ9 A;  5FZH A;  5FPU A;  3AL6 A;  5FYH A;  5K4L A;  4CCJ A;  3AVR A;  2XDV A;  4QWN A;  5A1F A;  5FP3 A;  5FYC A;  3KVB A;  5FYY A;  5FXV A;  5FZA A;  4EYU A;  5FYU A;  5F3I A;  3DXU A;  4CCM A;  2OS2 A;  3PUS A;  5E6H A;  4XDO A;  4IGP A;  2YBP A;  4DO0 A;  2W2I A;  2YU1 A;  5A7N A;  2OX0 A;  4NUB A;  4GAZ A;  3ZPO A;  5IW0 A;  3ZLI A;  3LD8 A;  5F32 A;  5FZ1 A;  5FZK A;  5IVF A;  3N9L A;  3KVA A;  5FP7 A;  5IVB A;  5FZI A;  5F2W A;  2OT7 A;  2Q8E A;  4CUG A;  5A3N A;  5A80 A;  4QXH A;  3OPW A;  4Y3O A;  5A7Q A;  5A7W A;  3KV9 A;  2OQ7 A;  3PU3 A;  4QXC A;  2WWJ A;  4LXL A;  5F5A A;  5FZ7 A;  5A7O A;  5FZO B;  5FY1 A;  4DIQ A;  5FUN A;  5FY0 A;  5FZ3 A;  4C8D A;  4HON A;  2XUE A;  5F5I A;  5FPB A;  5FZ8 A;  2OQ6 A;  5FPV A;  5F2S A;  4QU1 A;  5FXW A;  4Y33 A;  4AI9 A;  5LW9 A;  4IGO A;  4D6Q A;  3OPT A;  2Q8D A;  5FXX A;  2YBK A;  4BIS A;  1VRB A;  2PXJ A;  5FZG A;  3N9M A;  3RVH A;  4GD4 A;  3AL5 A;  5FZ4 A;  4LIT A;  5F39 A;  2YPD A;  4CCK A;  5ANQ A;  3K3N A;  3PDQ A;  4TN7 A;  5FWE A;  5FYZ A;  4D6R A;  4CCL A;  5FZF A;  5LWB A;  5FY7 A;  5FY9 A;  4E4H A;  5FY5 A;  4BU2 A;  5LY1 A;  5FY4 A;  5IVJ A;  2VD7 A;  3N9O A;  4HOO A;  4Y4R A;  5FZM A;  4GJZ A;  5FZE A;  5F3G A;  4CSW A;  5FJK A;  4QX7 A;  4UF0 B;  5FYB A;  4GJY A;  2XXZ A;  5FZD A;  5FZB A;  5FP9 A;  5FP8 A;  5FYS A;  3LDB A;  4D6S A;  5IVV A;  5A3T A;  5FZ0 A;  3N9N A;  5FYT A;  4V2W A;  5FZL A;  3PUQ A;  4IGQ A;  4QXB A;  5IVE A;  4LIU A;  5FYM A;  4EZ4 A;  4XDP A;  5FZ6 A;  3AVS A;  5FP4 A;  3PU8 A;  4ASK A;  5ISL A;  3PUA A;  4URA A;  2XML A;  2GP3 A;  5FY8 A;  5A7S A;  3N9P A;  4BXF A;  5CEH A;  4AAP A;  5FJH A;  3K2O A;  2WWU A;  3DXT A;  3U78 A;  2GP5 A;  4CCO A;  3KV6 A;  4UF0 A;  3K3O A;  5IVC A;  5FPL A;  5KR7 A;  3U4S A;  5FV3 A;  5FWJ A;  5FUP A;  5A7P A;  5A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...