4COWA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with the t-antigen (galb1-3galnac)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
TEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 56
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cowA00
4CP1A 4LHLA 4ASLA 4COYA 2XJQA 4LHKA 4AHZA 4AF9A 5A3LA 4LHNA 4COUA 4AI2A 2XJVA 2XJRA 4AFAA 2XJSA 4AI0A 4COWA 4AHYA 2XJPA 4A3XA 4COZA 4AHXA 2XJUA 4AHWA 2XJTA 4GQ7A 4CP0A 4CP2A 5A3MA 4AI1A 4AFCA 4AI3A 4D3WA 4COVA 4AFBA
chains in the Genus database with same CATH superfamily
5FYHA 1YXWA 4HSLA 3T2OA 2VL4A 3VDDB 1W04A 2VY0A 3SMHA 1REEA 2ZJCA 4Q5OA 2W68A 1ZRDA 2CAVA 1OBNA 1W99A 4AWDA 1WA6X 4IESA 4B8EA 4N8MA 1EAH2 2QZ3A 4IV1B 4DIQA 4EN6B 4ZS2A 3AZZA 2BERA 4QQOA 4A3ZA 2HWB3 4IEYA 3C3VA 2XJPA 4LKSA 1X9PA 2VD7A 4ZHNA 3N7JA 2C6SA 3AKQA 3VZJA 5IAVA 5FP4A 5FUIA 1QU0A 3U11A 5BNOA 5IK4A 3AYAA 1ZRCA 4JRLA 5D8AA 3U07A 1JN2P 1XNAA 1JU4A 3O1VA 4JDOA 1H4HA 2EIGA 3I2GA 1PO21 3ITQA 3JB4C 4AGVA 1DGWA 4URAA 4QPGB 4AGGA 1COV2 2C1FA 3HWJA 4LK7A 1NCQA 4LHNA 3R6SA 4JAAA 4Q0UA 2DVBA 1V9U1 1MACA 4QD2A 2WZ8A 2BJSA 2RMU3 3SCFA 5A3TA 2RR13 4Q4V3 4M4RA 2WQZC 4Y22A 3BIWE 1A6CA 1G8WA 1W6MA 3U4SA 4CUGA 5IT6A 1YIPA 5DN2A 5BNQA 3POFA 1DHKB 3H3UA 1GMMA 2GNDA 5L73A 4RA0A 1JUIA 1UX7A 4RL7A 1N3PA 4GZ9A 2J1SA 3NW4A 2UYBA 1SBDA 4KWJA 3J4UH 1TG7A 2WYSA 1OFNA 5FLHA 2EXJA 4G9SB 1K5MA 1NQJA 4FPYA 2XJQA 2YBKA 3VKNA 5JSOA 1Q8SA 2WZEA 5FP9A 2D40A 2VNVA 5FDBA 4ONUA 3FHIB 1XPWA 2HKXA 2ERFA 1VBD2 2VNGA 2WWUA 1KS4A 2YZ4A 2VGDA 3HT2A 5FUNA 1S0CA 4E4DX 2YV8A 1C8M1 5E88A 4YVWB 4IV1A 3RI9A 2G1MA 1VBC2 3MV01 2EIEA 3VBSC 4R9DA 4H2AA 5FTTC 3AX4A 3WSOA 4XUOA 5C3RA 1OD5A 1WW7A 4TWTA 1K12A 2GC2A 2QCSB 2YMZA 4BXFA 2WNUB 1HB3A 2RJLA 5EHDA 5IK8A 1TMF1 2H6CA 3M8LA 1ZZ7A 3O14A 4MXWB 2D6NA 4XPVA 4DY3A 2XHNA 3OCPA 1LESA 1LHVA 1NKGA 1YYNA 4XFBA 2VTFA 4XUPA 2W9XA 3D6EA 3HBZA 4CDUB 4ASKA 3VD7A 4GWIA 1UKGA 3SISA 4W6WA 3SCGA 3T30A 1ZRIA 4ZZ5A 3JCIA 2R16A 1EY2A 4HMZA 2E63A 3ZSJA 3ZYRA 1YJLA 2G9FA 2HWE1 5A7WA 3I3MA 1W2OA 4NHMA 5LZ6A 3S7IA 5CFDA 4CDWB 2NZ9A 1LRHA 4HKLA 5IVBA 3VN4A 1W8OA 4Q0QA 1DCSA 4QGMA 3SKJE 1WD4A 1PO13 4LO4B 4N43B 5FV3A 2IZWA 5FMOS 5GLZA 1LGCA 3ZXAC 1CJPA 1QHDA 1URXA 3T09A 4MVTA 4CEYA 5FZDA 1DZQA 3WOGA 5JPNB 4Q26A 2E51A 3UL2A 3WD5A 1IS5A 3BALA 4JX0A 5FZ8A 3KCYA 4ZU4A 4DFSA 1LGNA 3WDYA 2AZ5A 2VCMA 3H7YA 5H9RA 3NKGA 1PZ7A 1H8VA 3THTA 1ZZ6A 1HRI2 3ZLIA 4ZS3A 1W28A 1LJ7A 3IZOA 2GALA 3MIFA 2Z2SB 5GALA 1V6MA 3P1IA 5IATA 1CIWA 1ZBE2 1AR72 2W47A 3K46A 5FYSA 5ISLA 3F2ZA 3WQ1A 5KXBA 2BBAA 4UW5A 3WCRA 2EAKA 5A80A 1AX2A 2B39A 2YC4A 1ZNPA 4R4XA 3J7HA 4E8DA 1GQGA 1TVGA 1ST8A 2R062 2VQTA 3I2JA 4LQRA 1JYTA 4XQWA 1FMD3 2WNUA 1J84A 2LUWA 1D0GA 2GU9A 4NR1A 1WMDA 3LD8A 3LFMA 3HQXA 1DLLA 4MXWA 2VULA 1PZ9A 1QJY1 2JEMA 3Q8FA 4AE2A 1WZXA 4CDUA 1JOPA 4LOSA 2ZHNA 4JQRA 2TBVA 5EXOA 4FTBA 2A3WA 3RZMA 2MEV1 5DAXA 1W0NA 4TLGA 3DYMA 4XVHA 4D3WA 1KJLA 5ERLA 2WS92 3KGZA 3BTXA 1XJAA 2D5FA 1SFYA 3PU3A 1BEV1 2PAEA 4KWUA 1US2A 2XLAA 2BRTA 1UOBA 4IE0A 4CDWA 3OGJA 1AL21 4RN5A 5KXDA 1REDA 1ULGA 2GH8A 5CISA 3KVBA 3VBRC 3VD4A 1PGSA 2WZR3 5LK7B 3ROUA 4BQ1A 3POSA 2OT7A 2W2IA 3Q8CA 5JSRA 1V6IA 2YPJA 4NIAA 4RGKA 3W58A 4CVUA 3BGAA 5FZEA 2W46A 5CBLA 4OLLA 1DGRN 3NMBA 4FQ4A 4WM8C 3C8XA 2DCZA 1YQ8A 5EYXA 2AH2A 2VMGA 3NQHA 5E1RA 1GYKA 1ZBA1 4IL7A 1R1A2 1EV12 1W8UA 1K42A 1XNBA 2BV4A 2D6OX 1W06A 2ZGMA 3UGGA 2WNVA 1ACCA 1HDKA 4FP2A 3U10A 1HB1A 4R4ZA 3FLRA 2UU8A 4WM7C 3T1MA 2VOTA 1R64A 2MHFA 5L7OC 1SLCA 3CHXA 3E5QA 1W6OB 1WW4A 3M7AA 4YGDA 5ANQA 4EZHA 1W03A 2GMPA 3R4SA 5FO7B 5A7SA 4QKFA 1A8MA 2JDPA 1Z7S3 2VUJA 3GBFA 4IGPA 3VL9A 1JYNA 3RJRA 4NUBA 2VUDA 2BQPA 3POEA 5FMOL 1TEIA 1ND2C 3WP5A 2ILMA 4HPKA 4EJRA 5JXJA 3KCXA 1OOPC 4TSVA 1S0EA 2C26A 3MF9A 4L97A 3ZXEA 4DEQA 1VBA2 3QOPA 4LLFA 3IM0A 1W3VA 2D6PA 1PO23 4QPIA 1ZRRA 3HQRA 1EUUA 1F4HA 1NA1A 4KQ7A 2K9ZA 3TN92 2LM3A 3WZ1A 3RZGA 1RUF1 4C8DA 2XWJB 1QJX2 1V9U3 3AMMA 3KV5A 4EN8B 1GZ9A 4M3CB 3LEGA 3O0VA 4CXYA 5A6QA 1OD3A 1G9AA 3M1HA 4OMDA 4E4SA 1W9FA 2WNOA 3I2HA 4LBQB 5FJKA 5F2SA 2I2SA 3CBNA 3HT1A 3GCXA 4NOTA 1AXYA 1LR5A 3MBWA 4MUVA 1H9PA 4LBOA 1W90A 1SBFA 2CL2A 2E32A 2HEWF 3DYPA 3FHAA 3PDQA 1A3KA 5FZIA 3ES1A 5C9AB 4COVA 5EWSA 1H30A 2VMIA 5JLVA 1OKQA 5LA0A 1WGPA 3U4XA 4I0BA 1I9RA 4XJ8A 1AJOA 3GF6A 2ZGPA 3AP4A 3IAPA 3MW2A 1O5UA 2P3KA 3H3LA 3O0WA 4LKDA 3WINE 3EHKA 4XOGA 1J1LA 1XC6A 4FFIA 2ZEYA 3AP7A 4NHYA 1GICA 1Z0HA 1WKYA 2C24A 4GH4B 1MEC1 1L3JA 1H1AA 1P8JA 2R043 2XKPA 3AL6A 1JODA 1UNBA 4JGZB 5D2AA 5C3SA 5J36A 2VZRA 1OURA 4QXCA 4ZXKA 1BLZA 1C8M3 2XR4A 2XQXA 2SBAA 3CO2A 2BUKA 3VBOB 4JKLA 5FOBB 1Q43A 2UY8A 3EO6A 4AVCA 3V0AA 5FZMA 1LU1A 4LBQD 3CL1A 5FYUA 1W6PB 3KV4A 4YG6A 2JDMA 4AK3A 3FLPA 1O4ZA 3S5AA 3HIFA 2EXKA 1GQHA 4KL1A 3VBFC 4HOOA 5HCHA 2WKKA 2DUQA 2A73B 3ZOIA 5FR3A 1GZCA 3AKRA 4XFAA 1ASJ2 3KF3A 3B3QE 3WP4A 4BHPA 2JB4A 4L0PA 4FOYA 4XABA 1RUH2 4XMIA 5FP3A 3S7EA 4LBMA 1FPN1 1NZIA 4M0NA 3VGIA 1B35B 2JWPA 4ARYA 2HWD2 2R073 1RMU1 1AR82 1HQNA 4R9CA 4QB2A 1U5YA 3ZKYA 3DCQA 1W05A 5KC5A 3RVHA 4HK9A 2HWE3 2W5FA 5FREA 4CDQB 5IVJA 2W94A 3B7MA 3KD4A 1AR93 5C5TA 4S2DA 1XE7A 2IC1A 3BB6A 4INDA 5ABJC 2P6CA 3WF0A 3H0OA 3ZFFC 1NOVA 4LULA 1NAEA 1OLME 3VBSA 4ORFA 4WZFA 3OPTA 3RMYA 1SCRA 3MUZ1 2XJSA 1NY72 5JOXA 2Q4SA 5CVRA 1D0HA 2OX0A 4N7IA 1UYPA 2P3JA 1NE6A 2CU5A 1TQ5A 5FY0A 5L36A 5G04L 3AKSA 5DPNA 3PIGA 4GH4A 2X5IB 1PM4A 2RJKA 4KBZA 4QB1A 1UWWA 3M3IA 3INAA 4JGZA 4CU9A 1CAWB 1EP0A 1GFF2 1LTEA 1H2KA 3PUIA 5A7OA 2V72A 4AFBA 5KR7A 2IFWA 3BCWA 2JJ6A 4M3CE 3GNEA 1R091 5CIRA 5FYMA 3NJXA 4CDXB 5I8YA 4PI2A 5HXMA 3AKPA 3K3NA 1UY4A 4EWDA 1EPWA 2VBPA 1RITA 4BE3A 1LHWA 4AI0A 4LO5B 2J42A 3DN7A 4MGIE 1W0PA 4Q2FA 5A33A 4JHZA 4MGZE 4Q1RA 1Q8PA 1QJY3 2V73A 1RIRA 3KT1A 3OGSA 4N53C 4RSUA 5A7NA 4CP0A 5FZHA 5K4LA 3VBHC 5CKQA 1AUYA 1ZREA 1RB8G 1B35A 2QBXA 3M3EA 3ZR5A 3OJBA 2YC0A 3IKWA 2MEV3 3B02A 3Q9OA 3TNPB 1CZSA 1FV3A 3MLKA 5LBBA 2VZ3A 3NV1A 3NSTA 5DUUA 2QQOA 1BEV3 4GKXA 3QD6A 3B94A 1VBD1 3DPRB 2B9UA 2QQWA 2GNMA 2NMOA 1UOGA 3SKVA 4O9GA 1OH3A 2XGXA 4MG2A 4XAAA 1M4WA 1NQDA 1VBC1 4NHKA 5F7UA 1JXNA 4LIVA 1WLWA 4M4PA 5FBJA 5SV8A 1JHJA 5IYYA 1MQTB 5GLUA 4O7XA 4TYSA 2B4KA 3PMEA 3FL7A 3UK9A 5C70A 1DFQA 3C7HA 3OD4A 4DUVA 3QACA 1PX4A 3AMQA 2WO3A 3FFZA 3TEXA 5C3QA 3B9IA 5BNNC 3AM2A 4IE4A 4ZZ8A 1ZBA3 4HFSA 3PLQA 4RR3C 4OYUA 2E6VA 3RZKA 3F95A 5FMCA 5I91A 2GZWA 2YDEA 4HVQA 1WCSA 4AEDA 3AVRA 3OEAA 3T1LA 3SEPA 2GP5A 3ST7A 2R49A 3QCWA 2JKXA 4XUTA 3A4UA 5FPXA 3I3DA 4AYUA 1YQ2A 4PQ9A 2DCYA 2IXKA 4CEWC 3BPZA 2WSVA 1PK6C 1W39A 3VHOA 1N1TA 1F31A 1YI7A 4ET7A 3VBRA 3NVCA 3OBZA 3JD72 5HV0A 3NV2A 2HH9A 3MIGA 1SLBA 1XE0A 2ZAAA 2W1SA 3EQEA 3LCPA 4XZUG 4FBFA 4I02A 4LBLA 2PN5A 4AG4A 5KHIA 3FUQA 3A0NA 3EMRA 2RS12 4WVWA 1RUF3 2HEYF 5F9TA 4JGYC 1HRI1 2JG8B 1H2NA 1RC6A 5IVFA 1WCDJ 2BBVA 1SMVA 1UZWA 1VIWB 3LZZA 1O4TA 4AOCA 1LGBA 4XMAA 1ZBE1 1AR71 1RUI2 4QKBA 3N9NA 2WN2A 3CF6E 3HAGA 4IGQA 1KXGA 1QWRA 4I01A 4L99A 3VDDC 4D6SA 1QKQA 3M3QA 5LBCA 3R05A 1UD1A 1PVC1 4MHRA 2R061 3ACIA 4ZONA 5FY5A 1MQTA 3CMGA 2BDRA 3GZAA 2E33A 4KMQA 4YW7A 4R9BA 2F4PA 3C7GA 1LHOA 2J1TA 2V5DA 1PGW2 3VD5A 2XONA 1R1ZA 5CEHA 4CCCA 4QU1A 3WLUA 2OUJA 3MLLA 4JQTA 5T5PA 2BP6A 4H55A 2BGPA 3LKJA 1MEC3 3T0BA 1IS3A 3MFAA 2PMWB 1NZCA 1YFWA 2EIBA 3HNMA 4HN0A 2Q1ZB 5DUXA 1JZ2A 3KF5A 1JHNA 1NLQA 4UF0B 3POWA 4QPGC 2WS91 3LF7A 5JUVA 3ETPA 1C8NA 3JXSA 2ORZA 5C8WA 1RUNA 3CEWA 4P00B 3LPGA 2DTWA 4I09A 1G86A 1FNYA 4XTPA 3L2HA 5FMDA 1FV2A 4OI1A 4JVAA 3VHNA 4HZFA 2P3YA 2ZX1A 1DIWA 3NNMA 3B93A 1JYWA 1JYCA 4XJZA 1C1FA 4Q29A 4K20A 2HWF2 5BY5A 2PHWA 4OUMA 4Q4Y2 5FY1A 1F5JA 4QHZA 2VM9A 1FPN3 3KT4A 3AB0A 2VNOA 2RM22 4A7ZA 3H1WA 2FCUA 2VMDA 4Q4X2 1RMU3 4QB6A 2W39A 2YBSA 2RDSA 2O0OA 3CLPA 5IW0A 3WVJA 1DG6A 2XPJA 3GHMA 3W5MA 3THPA 1JOBA 4FPFA 1AZDA 3VZNA 1AYM2 1QOSA 4ASLA 4Y5SA 5A7PA 4XTMA 3W21A 2AYHA 3CJIA 4MV2A 2ZGLA 4YVWC 4X8NA 3QH7A 5F5IA 4IXLA 4FPGA 2VE1A 4OQ8A 1S0GA 3RS6A 3C7FA 4ZY9A 5IHRA 1ALYA 1EUTA 1O8PA 4LBNA 4Y5TA 5TSWA 3AZYA 5FXXA 5EIYB 2JICA 1SZBA 5FYBA 5KHGA 5KC6A 5E6HA 4HPKB 1CAUB 1VBA1 4I0AA 4BLIA 4B7EA 1ENRA 1E5IA 4JHTA 2TNFA 4PIZA 3ZSLA 4IV3C 1QEXA 3WR0A 3R4DB 4DS0A 2WQ4A 1QJX1 5E8AA 2LROA 2GDFA 2Y33A 3M2MA 1QF3A 3MIBA 3LAGA 2XJVA 2BU9A 1GNZA 2GSYA 1AX1A 5LEJA 1KS5A 4MADA 4NPRA 4YRDA 5BNOB 2P4EA 3VDBA 2OYZA 2FHRA 4MZUA 4WVZA 2EF6A 5I0DA 4C90A 1ENQA 3ORJA 5D8AB 4N43C 4Q4W2 2DVDA 4ARXA 4NN0A 3H3ZA 1ULOA 1DU3D 4QGLA 3ZFFA 5EJZB 2ZMKA 3R0RA 4NMIA 3LDRA 3ME2A 4IQPA 5LASA 1O59A 2ID4A 3WUDA 4JTOA 1RYYA 3WXPA 4N90A 5C33A 4GIQA 5LCWL 1SFPA 5GLTA 4CCEA 4DEVA 4HONA 4M3CF 1G9BA 5K0UA 3H50A 5BPXA 4EYUA 1XRUA 4HL0A 4GA9A 1VBD3 3LEIA 3KLSA 4QX8A 4Y22B 4Y4YA 4AEMA 3RZHA 4XETA 1ULEA 2O1QA 2DBIA 1X8MA 3MZHA 4YW3A 3OF1A 2XHKA 5LK5A 5I0TA 5F3CA 1A8DA 4YG0A 1VBC3 3EB7A 3DL3A 2OPWA 1UY3A 3WV6A 3H9AA 3K3OA 4MH0E 4QXBA 4XURA 5FYVA 3ZXLA 2DURA 3ZR6A 4Z8BA 3ZMNA 5F5AA 2F6BA 2RDQA 2V09A 5LA2A 4Z1VA 5ANNA 1W2UA 3Q8BA 4PJYA 5IJRA 1W9SA 1K45A 2AENA 2W92A 2DFBA 2V4AA 4PDWA 4CP1A 4CEWA 5CG8A 1GU3A 2PXJA 2FDHA 4J1WA 3ZDVA 1OKOA 4DXZA 4P9GA 1HRV2 2Y0IA 1LOAA 2PHRA 5JXIA 2BNNA 1LENA 5LA9A 1OA3A 1NLSA 3ILNA 2RDRA 1LEMA 1YFYA 2YGLA 4KWKA 2HWD1 3K2OA 3J8F2 3BYWA 1AR81 4DXSA 3N9LA 4JKKA 3ZXKA 5JVVA 3JB8A 3T2TA 1H8TB 1UZVA 2J7MA 1V6KA 3KGLA 4E2QA 1Z7S1 3ILRA 2VG9A 4ZU7A 5AFEA 5JR2A 2VZVA 1MZ5A 1LU2A 1MS3A 3HJRA 3NAPA 3ZO0B 2P1BA 4CYDA 1MZ6A 3QLQA 5C6CA 4NIGA 5LW9A 1KFUL 2WRAA 4A4AA 4QX2A 2D43A 3H1MA 4L2NA 4LA3A 2WQ8A 3ZFGA 4D7TA 3D0SA 4GALA 2VPVA 2D6MA 1UCXA 1Y3TA 4AQSA 1Q5OA 2LS6A 5H9SA 2EVXA 4CCKA 2BOIA 1H9WA 1PM7A 4MLOA 2FDIA 4GMP1 2BVVA 2JDHA 1HRI3 1ZVFA 1H1IA 3C7EA 4XEZA 5BNNA 1Q8QA 3GBWA 4YZ5A 5A7WB 2I07B 2R30A 3MV11 1ZBE3 1AR73 2NMNA 3AL5A 1MS5A 2GMMA 1OUSA 4LE4A 4XJ9A 5EP9A 4FAHA 5CFDB 1RUD2 2Q5TA 1CD3G 1SPPB 1VB2A 2VU9A 3BODA 2H6BA 5FPAA 1MZFA 1EYBA 5FXVA 1J58A 3TNQA 2BFUL 2VOKA 3RGBA 4BK5A 1VJ2A 1LAJA 1MS9A 3N7LA 1PVC3 2R063 4Y26A 3Q8AA 2XVGA 2Z5WA 4CEYB 4CP9A 5AC92 5A7QA 1RUG2 1C57A 5LB6A 3LDBA 3BU0A 2ZGQA 1BHGA 1JW6A 5KHJA 2D6KA 3RRDA 3BN6A 3LA3A 3VZMA 1YFUA 1OPMA 4NO4A 3B69A 2R041 4DRVA 1T6BX 2CNAA 4XYXA 3LA7A 4NHLA 3GZTB 1DQ0A 1UW8A 4QDQA 3J7MA 5H9PA 3R4UA 3LOIA 1QQP2 4BZ4A 3ACGA 2WZPP 4PIYA 1UXZA 4XUNA 2W1WA 5GJ6A 3SH5A 2WS93 1H8TA 2CAUA 3Q8EA 2ZBJA 3ZIXA 3GZUC 1XU2A 3ABZA 3KS7A 2PHLA 3JUUA 4FOQA 4UFMA 5DG1A 5DUVA 2JDKA 2VQUA 4MGKE 1LHNA 1PGL1 2PYTA 1DP0A 1ZX5A 3DUIA 2C4XA 3T3YA 2JDNA 2BGCA 1WLDA 5C3OA 2ZEXA 1YHFA 5FOJB 1KDKA 1L7RA 3RPQA 2XWBB 1JTZX 4CRQA 1SLAA 2JG9C 2FMDA 1QDOA 2G9ZA 1ULCA 3DXTA 1V0AA 1WA4A 1QXJA 2WC2A 1G9CA 4PI0A 2Q8CA 1CJDA 2PQSA 4FI9A 2ZCWA 1FI2A 1S55A 4YW5A 2UURA 3ZXGA 2R071 4URTA 5GM0A 5A6YA 3NRUA 1LOFC 1UU6A 1F35A 1W8WA 4BPZA 5FBZA 2BVBA 4ZU5A 2YHJA 4MGTA 4FOWA 5FZ9A 5EV7A 3EJKA 1CONA 4YW4A 1GP5A 3G6JB 2ADDA 1AR91 4CE8A 1Q3EA 4L9BA 2ZXQA 5JMCA 3V0BA 1SPPA 3PL0A 3RZZA 1DGWX 3NO8A 3ZPYA 4LOTA 4NRQA 2VTXA 5FYIA 3MI8A 1GBGA 2DCJA 2DUOA 4M00A 5DUWA 2D3SA 3VBOC 4YGBA 2RE9A 4PBOA 4GKYA 5GZGA 3WDXA 2XBO1 4OHXA 1L7LA 1QIQA 1S0DA 2RS52 4XE9A 3E6BA 3AXDA 5F5QA 1XYPA 2SLIA 4GAZA 3BIEA 2ZX3A 5T50A 1UY0A 4UWDA 5AVPA 3JD71 3CNAA 4SBVA 1UAIA 4QM8A 3A7QA 4RS5B 1VBA3 2D7FA 3G7DA 3HQUA 1AL0G 4PCRA 4UAPA 3VZOA 3ZX7A 4OI2A 4KG8A 4CU7A 1GNYA 3AYDA 5FZAA 3IIIA 2WNVB 4QPYA 2PLV2 3WEZA 1PZ8A 3DV8A 1QH6A 2RS11 4QM9A 2HWC2 4H3WA 2XLGA 5JPMB 1N1VA 1HJGA 4LPLA 3VB9A 1QJX3 4R9AA 1V6NA 4Q8LA 2VW0A 3UYJA 5F6KA 3X29B 2F17A 4QGNA 1ND3B 1RUI1 2ZGKA 4AGRA 1IZ3A 4UFLA 2WINB 1C28A 2FDJA 1RUC2 1ZYBA 3MO4A 4FPCA 1WCQA 4LHSA 4CDQC 2BGOA 3ECQA 1IG0A 4AI8A 4BQWA 5A6XA 1VBB2 2XJTA 4K3UA 3OPZA 1LECA 2I74A 4CXWA 1QJZA 2DF7A 5C8CA 1AR62 1O4YA 1V6OA 2W91A 1CQ9A 4QPIB 4CCMA 4DNYA 5DAWA 1NA1B 5LATA 1PGW1 4EN9B 1BK0A 2WAAA 4OHWA 2X09A 2DDUA 3P3PA 1UY1A 2ZGRA 3IB3A 4K8RB 2VBDA 1CR7A 4PQQA 4Y4RA 5FK8A 5IUQA 3S57A 3ACFA 2HLEA 4MYEA 1L7QA 2QDNA 3OD0A 5EFUA 4E2SA 2X5IC 1XBFA 4HXCA 5J09A 4PLNA 1KEXA 3ZFEA 4WV8A 5T55A 4MO3M 4PLMA 4CDXC 1D2QA 4GJYA 4OQ9A 3SXWA 3UETA 5C4WC 2W08A 5C5UA 3WF4A 4BOWA 4NWWA 3OUHA 1ZM1A 2Y0OA 1Y9QA 2ZHKA 2YB7A 1TME2 3J26N 4K1YA 4RS5A 3RMXA 3TBDA 1H2MA 1C5IA 2UWAA 1XSRA 2HWF1 3FLTA 1RUH3 3ILFA 4Q4Y1 4E2GA 5BNPC 2P17A 4RQPA 1FXZA 2VMHA 1UF2C 4HKOA 4Y5Z0 4YVSC 1F5FA 3WW4A 1YCIA 4AL9A 4LT5A 1PIV2 2C5DA 1CX1A 4NPLA 4YM0A 3UJQA 4XFIA 4Q4X1 4R52A 2YFUA 2HWD3 3N9OA 3MW4A 4DINB 1AR83 5A6ZA 3V0AB 4OUEA 4D7SA 3WG2A 4META 1DQ5A 2WFPA 1ND3A 3E6DA 2MNGA 1S0BA 3DEMA 2R1BA 5FPZA 3RWKX 1K5JA 2VNRA 3IAQA 2JB8A 2VVEA 5DMYA 3DPRC 3DYOA 2XLFA 1PHMA 3JZVA 4Y1XA 4A42A 3CJXA 1AJKA 4H7MA 4I3PA 3AMPA 3S6PA 2CWSA 4KWLA 4CCOA 1ULPA 3GHNA 4IUGA 1SQ4A 1AXKA 2JX9A 1PO12 1W9YA 5FK7A 2D3PA 2A6WA 5T5LA 5I0RA 4AF9A 2G4IA 3T4HB 3ZYIB 2WLPA 2LALA 5IVVA 3ACLA 2VMFA 1MVEA 4OMCA 4AZZA 3E6CC 4D6QA 1YIFA 4GMP3 4N7UA 3GM8A 2CGPA 3HN1A 4ZKTB 3VD3A 2OS2A 2QTWB 2XUMA 3MW3A 4NHXA 5FY7A 3SCHA 2R6QA 4LE3A 3O1TA 4IEPA 2ARCA 3LA2A 4NIHA 2P2KA 4ASMB 5CFCC 5JZGC 3PTYA 3WW3A 1YEWA 2F4LA 2WWJA 1NCRC 1WBLA 3VUOA 1S0IA 2IXJA 1UMIA 2VECA 3CDZB 3VBSB 3J7LA 5FPBA 3I2DA 4KU7A 3U75A 2CDPA 3OYWB 1HXS2 2QQMA 3VBUC 1KITA 1G9FA 4UXAA 4AAPA 1SBEA 3KV6A 4Q1PA 5FKCA 4IEOA 5LBEA 2PA7A 2VTXJ 5JMOA 5KWRA 5FYCA 4FOVA 1W8TA 1O3QA 1ODMA 3WNXA 3I7DA 4OZOA 3DKQA 3WNPA 3W5NA 2DTYA 1ENSA 4NE9A 4BIFA 1ULDA 4UFHA 1YRZA 1TNRA 4H14A 3ZN5A 1YI9A 2JG8C 5FMBA 4Z2WA 1J3PA 3TRSB 2VZTA 5L19A 3MLJA 2VCAA 4AVSA 5FZ6A 3AVSA 2JIJA 1QH7A 5A33B 5T54A 1UMHA 4FPEA 4IE6A 2KD7A 3OPWA 4HETA 3RG0A 5T5OA 1Z78A 5F5CA 3J7NA 2CWMA 1SFNA 2ZOEB 4YGEA 1ZZCA 1XYNA 5LRSA 2VC9A 1VAVA 1OQEA 4AXOA 1YQ6A 2DCKA 3N36A 1LB2A 5HPOA 2Q30A 1I3HA 1Y9GA 1GSLA 1RVF2 2VMEA 4CXXA 4BA6A 2VXJA 4QX7A 1DQ4A 5ACA2 1HRV1 1NLRA 2O8OA 4I3GA 4WZCA 5JR7B 4BQXA 1QNWA 3U14A 4LKEA 4E4ZA 1EAH1 1UYXA 1XNDA 3VHRA 5JOWA 3JBG2 3D4KA 1HKDA 2X05A 3J8F1 3HNBM 4XF3A 3HNYM 1WCUA 2HJIA 1Q56A 3POGA 1WW6A 3WCSA 3WF3A 2XBO3 4YFZA 3SH4A 5HI0A 3WP6A 3OYWA 4P9YA 5A70A 5CA6A 4C0BA 1RUOA 2FMYA 2GN7A 4Q0PA 3S30A 1TZOA 3PNAA 1E5HA 3WHTA 4EZ4A 3JD73 4RHV2 4V2WA 2ZKNA 3ENRA 1FOD2 4FXKB 5DZFA 1COV1 2XDVA 1U12A 1YQ5A 3D8CA 5J48A 1JZ7A 2PHXA 1GLHA 2QNKA 2RS13 3VZLA 1SLTA 4NRMA 4AEDB 4YM3A 5APAA 2KA3A 1OUXA 2JIGA 2VOXA 1KRIA 4COUA 5L9RA 5C3PA 3MHZA 2DVFA 1VR3A 2LRPA 4R8HA 1RUI3 2FCVA 4OZXA 4B4PA 4EE2A 1D7PM 4XBNA 2A7AA 3PVOA 5A3PA 1VMFA 1DZTA 3ZVXA 4AVBA 3VBRB 3GJAA 2WA4A 2DV9A 4NVPA 3MGUA 5I8SA 4XDQA 1OT5A 4OHVA 2RS32 4XFGA 4AW7A 4W6XA 2PFWA 1RUG1 3FHQA 3JQWA 3OY8B 2JD9A 1QXRA 4J1XA 5FRAA 3N7KA 3LIGA 4CZSA 3AMNA 1D2SA 1RHI2 3E97A 1UYZA 3AP6A 2WBKA 3O1SA 4WM8B 2QQUA 4N9IA 4NPMA 5CAZA 4NIIA 3BTAA 1HW5A 3ZYPA 2A6XA 4EWAA 2ZZQA 4IEQA 2CTVA 4IDZA 3BKZA 3BI3A 1QXPA 4OHZA 4Z92B 1QOTA 3M3CA 1RUJ2 1QQP1 4XACA 3ES4A 2ZZJA 1JBCA 5FKBA 3SEEA 3ZYGA 4JZRA 3MYXA 4MSVA 5E89A 4BB3A 2CSGA 1H1MA 5FFOC 1NT0A 4WM7B 4BYYA 2GC1A 2CYFA 4PBPA 2OQ6A 3KHCA 1O3TA 4NIDA 1XU1A 1VMJA 2DCTA 2ZS6B 1W6QA 4A45A 4BIOA 4EWEA 1NX9A 4D94A 1HQWA 2VXRA 3S0MA 3UJOA 4B7KA 2A71A 2B5HA 4F83A 1VAKA 4ES9A 3ATGA 2A6VA 3LB9A 4FFHA 3ZSKA 5BNOC 1QJEA 5M0TA 1UX6A 3D0JA 3ZMOA 4K9SA 5LRRA 1TMF2 2HWF3 1UOFA 4Q4Y3 3SITA 4QT6A 4FO9A 5FO9B 2JE8A 2XJRA 3TOJA 2B7YA 1VRH2 3AZVA 4BQ5A 3ACHA 5J7MA 1WW5A 5SV5A 4Q4X3 2Y64A 2EA7A 4DO0A 2QQKA 5CYYA 3I54A 5DZEA 4DOUA 5A1FA 5L9VA 4FTEA 4IW3A 1NCQC 3OBAA 4UT5A 1OF3A 5KHHA 1ZZ8A 5CKMA 3OUIA 5FQ0A 1AXZA 4O61A 5FZ7A 3FMGA 5F3EA 1MS4A 3MUY1 3MPBA 4JDNA 1C5HA 4XQDA 1YC61 3I8TA 2B8MA 2Z69A 3A21A 4LUMA 1F8VA 2ORXA 5FZ3A 2H0VA 4BJ0A 2VUCA 3OY8A 1GUIA 2O8QA 2RS51 1FT9A 3AYEA 3RZLA 4LO6B 5C4WA 2R1DA 4AFMA 4CCLA 4WM8A 2BWAA 4A6OA 2Y6LA 5FYTA 1K5MC 4P5HA 3WY6A 3OUJA 1PX3A 5FLJA 4YFWA 3PMSA 4AR2A 4LA2A 2ARAA 2PLV1 2WFF2 5C7GA 2XUEA 2HWC1 1POV1 3M4FA 3MDPA 3CJIB 1MS1A 4K7JA 4WM7A 1AYN2 1RXFA 1VE0A 1B09A 2EAAA 3POJA 4IV1C 5L7OA 4GWNA 4QKDA 4XDPA 2Q8OA 3HR9A 2IXHA 4GB32 2X53S 3A22A 5T52A 2VBBA 3SLIA 3QH6A 4AAXA 3CU7A 1WLCA 3IPVA 3PHMA 1RUC1 5FY8A 3ZM8A 4B4RA 4ITCA 1ND2A 3VBFB 4MXVA 1VBB1 3H7JA 1VPHA 3OB8A 1OOPA 1O5LA 1AR61 1SLIA 2WAOA 4BQ3A 3CKHA 4C1XA 1RJ8A 2EALA 3I4IA 4JRAA 1FYUA 1MZEA 1W2NA 5A3MA 5JDBA 5A3WA 3FBYA 5FZKA 5KXEA 3O1PA 1ODNA 3M3OA 1OSGA 2BYVE 2ZMNA 2E9QA 4DRRA 2WT0A 3IMMA 3I59A 1CPMA 2MEV2 2WL1A 2MPFA 2X8KA 1GOGA 1A34A 5FWEA 2DWRA 2J22A 5BXXA 4XJAA 3KVAA 4YZ4A 1GANA 4AQ2A 5F32A 2YC2A 4YZ3A 2KM2A 3D5OA 5CFDC 4V1PA 1AL22 4QQHA 3PIJA 3IDCB 2Q0AA 1CESA 4MOAA 5ABJB 1BKZA 1R082 3ZFFB 1W8ZA 2XVKA 1NUKA 4HK8A 3ZN4A 5DDJ2 5HV4A 4P9JA 4AHWA 4CEYC 4FXGB 4IE7A 4X8PA 4Y20A 1FNZA 1VB4A 5IVCA 1TME1 1R1A1 1EV11 3AJYA 3O1UA 3TEWA 5K0UB 3FE5A 1HRV3 1YLLA 1POV0 5GKAC 3AFKA 4W65A 1QJU2 1UU4A 1XB9A 2ATFA 3OSDA 1PIV1 2ADEA 4XFCA 4AVVA 1IKQA 1EAH3 5GZDA 3J8F3 5CG9A 1FATA 1IKPA 2CDOA 3W59A 2WSUA 1N1YA 1UPSA 1J3QA 1QDCA 1Y4WA 3DGTA 1KFXL 2UWCA 2P6HA 1ZA7A 2WNUC 1SG3A 4YPJA 3VBFA 2D44A 4CP2A 2FCTA 1DDLA 3AP5A 1W8FA 1VRBA 3K51A 3RNSA 4PDWB 3I2FA 4I30A 4KH9A 4X6QB 3H8XA 4OULA 1DLCA 4AFCA 4L11A 4N53B 3SNMA 1JS9A 1VP6A 2HBTA 3P6BA 3TN91 4BQYA 4CDUC 3BU7A 1COV3 4COYA 3N7MA 1US3A 2JDZA 5F1RA 4AHZA 4LORA 3EBRA 1E5SA 2FZ2A 3WF1A 2VOWA 4JDMA 1UKRA 5B4NA 2TUNA 4CCJA 2E31A 1DBNA 3OGRA 3FBMA 3NAPB 2ARBA 3LWCA 1YFXA 5CNAA 4C0HA 4Q0VA 2QFEA 4UFJA 5CU1A 4CDWC 3O1OA 4QU2A 1AX0A 1J59A 4GQ7A 1HIXA 1W9TA 5JIAA 3LPFA 1VBE2 4P08A 5ABJA 5DABA 1LOEA 4XQ4A 4Y33A 5DQ0A 3T4VA 3ALQA 3ZFGB 3ZN6A 2WDBA 5T3NA 1JZ8A 4B1LA 3ELNA 5AC93 4YZ2A 1RUG3 4QHOA 2VQAA 5A3OA 1PMJX 2GMEA 3RZJA 4QX0A 4MX3A 1OLQA 3CZJA 2Y6FA 2A70A 2ZGOA 3ZYFA 2P3IA 2W1UA 5IWFA 3ZYHA 5BNNB 4EROA 4KU8A 1JZ6A 1DF0A 2FZ1A 1VAMA 2D3RA 1IQDC 4QXKA 1QQP3 5J98B 5FZFA 4AVAA 1BMV2 2WNVC 1MEC2 4CU8A 2IWGB 1ENXA 4WVMA 2XKOA 3RYKA 1I5ZA 2NN8A 1LNSA 1D4M2 2W0XA 1BBT2 2K2SA 5A1LA 1IGOA 4XF0A 1I6XA 3UKNA 5F37A 2GC0A 3OG2A 1HB4A 1U5ZA 4CP9B 5CZKA 3I49A 4QHBA 3NV4A 1YJKA 2AEYA 3KWVA 4J6GA 1BCXA 3KHBA 4AVTA 2N7GA 1ASJ1 2NQYA 4D0QA 3RYRA 1PK6B 1IS4A 2WIIB 5FIXA 1RUH1 2D5HA 4FP3A 4CU6A 4N53A 3KSCA 1OA4A 4C91A 2WLQA 3VBHA 3RQ0A 3LDKA 1ULFA 3ZPOA 3LEMA 1CGPA 1JH5A 5I93A 5FP7A 1OXCA 4IEWA 5F2WA 1Q8OA 4GULA 4SLIA 2YUEA 1NA1C 3BOWA 3WG3A 1W2TA 1U0AA 1Y43B 1RL3A 1W3XA 1IOAA 2PQQA 4FCAA 2VO5A 5HCAA 3U78A 5GLWA 3E5XA 4WBBA 3GYDA 3ZSMA 3JBG1 2QKDA 1OQDA 2Y26A 4G3YC 1X7NA 4RFT0 4EN0A 1UOJA 5K7PA 4RFRB 3EXUA 5D21A 1A78A 4CPBA 1NY71 1X33A 2QUOA 3BPSA 4LUKA 3C2UA 2UWBA 2ZTNA 2ZX0A 5FXWA 5IK5A 2RS53 4PIXA 4XW3A 3VLBB 1GWMA 1C3HA 2GC3A 3MICA 4NAOA 5IFTA 4Q8KA 1NG0A 4AHYA 3LFIA 4Y1UA 3HMYA 1O91A 4RHV1 2Q8DA 4HKWA 2KXLA 2R0HA 1GKBA 1LEDA 3MFCA 1RUE2 1F2NA 1FOD1 4LITA 3UGHA 4RR3A 1ZZ9A 3LEKA 3V0BB 2PLV3 2BW8A 3ASIA 3DF0A 3HN3A 4D6RA 3ETQA 1UN1A 2ZMLA 2HWC3 1POV3 1WCKA 3LSDA 4QX1A 4S2HA 5JAXA 3I2OA 1IPSA 3WQ7A 4YGCA 1ZZBA 3ZYBA 3BTYA 4LO8A 2XG3A 1RINA 1YUDA 1SEFA 1UO9A 2Y60A 5HBAA 5IFPA 2E53A 1R092 2WT1A 2J1RA 2JE7A 1H0BA 2GN3A 2K46A 2X10A 1DGRA 1AHSA 2R32A 1U5IA 2WUHA 3B00A 4FPLA 1RUC3 4LKFA 1OVPA 3GBGA 1PK6A 4QPWA 5EJ3A 5CB7A 2IXIA 4XIOA 4LXLA 5AFBA 4Y3OA 1VBB3 1UMZA 2OVUA 2J1VA 4JKMA 1JYVA 2RS31 1AR63 1GQPA 1H4GA 4XF4A 2XXZA 5LY2A 3WNOA 3ZIWA 1D4VB 4XFHA 2Y8KA 3ZYJB 1RHI1 4HT1T 2JKBA 2NP0A 3H8UA 1SACA 4YW6A 2WABA 1JU3A 5A3NA 4JGYA 2RJ2A 4ATFA 1NYWA 2G19A 2QQJA 3KV9A 2B45X 4YYOA 5JSPA 4QMAA 2ZGSA 3WX5A 3AXEA 2CV6A 2ZKLA 1SHWB 5FO8B 1F15A 1RUJ1 3OBRA 2C0ZA 3VDDA 1S0FA 1E5RA 4KBBA 4QQ2A 1F4AA 5FPLA 5I0UA 3MPPG 2ZABA 4AQTA 3O1MA 1UXXX 2XQRA 4M01A 4XJUA 3B5LB 5JI7A 5C8CB 1Y9MA 2ETEA 5C9AC 4GMP0 2Y6HA 1W0OA 1BJQA 1PMIA 3TWIA 5DG2A 5FZ0A 1KJRA 3VDAA 4P5YA 1SLLA 4DY5A 2WA3A 5FZBA 5C71A 3ZKUA 4UW4A 1TME3 4D7YA 1JI6A 4QAWA 1R1A3 1EV13 1HV0A 3KQ4B 3UT0A 3PJYA 1AVBA 1S0JA 4IETA 4P9XA 4BXSV 1JZ4A 2PAMA 4FVVA 2A75A 4GH4C 1IG3A 5G05L 4JGZC 4Z07A 1GOHA 1VRH1 1PIV3 4IV3B 2DBNA 3BUCA 3ZFEB 1OLRA 4QPGA 4V2VA 1UIJA 2Y6JA 5JI9A 5GLVA 2W87A 5J1XA 3USSA 3JU9A 4HLTA 1JZ3A 2W1QA 2AREA 4LO7A 2HWB2 5IVYA 3ZDSA 1BVVA 1BK1A 5CKNA 4Y1VA 1REFA 3D3AA 3N9MA 1J3RA 3OOXA 4IEXA 4M0HA 4ZXEA 4BCUA 2Y6KA 5K9YA 2Z42A 5JXGA 3KT7A 3GDBA 4RQPB 3T08A 4OCTA 4B1MA 3TN93 3K48A 3WW2A 1CPNA 3SHRA 4A7KA 5GZCA 1AF9A 4CTEA 1B35C 3WP3A 1SDWA 1GWKA 1OMIA 2ZA9A 2VCCA 4YM1A 2OIIA 2ET7A 3EYPA 4ATEA 4CUBA 1J1TA 1HV1A 1OI6A 1BXHA 2AUYA 1QNYA 4JTNA 3PVNA 3VV1A 4NJ4A 4AI9A 2GP3A 2BEOA 2RMU2 2UY9A 2RR12 4H7LA 2A5ZA 2PTMA 2RVAA 2JE9A 2WFF1 4Q4V2 4QDSA 3VDCA 4KNCA 5DXDA 1ONAA 1AYN1 3O7OA 5EQUA 5DZGA 4ISRA 2OA2A 2DU0A 4YVWA 4O65A 1UZZA 1T6GC 2BOJA 4GB31 3WDUA 3C7OA 4IEVA 3POIA 3THDA 5HCFA 1O7FA 1PVC2 3UV9A 4OHYA 3AKTA 1XYOA 4RGGA 4Z2AA 1HXS3 1QMJA 3LQCA 4BM8A 2BPA2 3SQOA 5B2GB 5KHKA 5JXHA 2YU1A 5DAPA 1CAVB 1S2BA 1XE8A 4XIKA 4COWA 5KXCA 2VOVA 2GAUA 3GXUA 4Q0SA 1M06G 5KBFA 1BZWA 4A3XA 2V4VA 2J1AA 2XVLA 4IV3A 3O0XA 1E57A 2YYOA 3GALA 3HPNA 3H8OA 2XJUA 4UBGA 2IXCA 2E7AA 3N9PA 4GJZA 2FDKA 3J9SA 3VD9A 2UYAA 3BOPA 4AEDC 4LIUA 5FP8A 1GZTA 2WYFA 3IDEA 3N4MA 3AZXA 3WNNA 4MHUA 3VHPA 1NXD1 1QY4A 1CAXB 4BDVB 1XOYA 4PF1A 4IERA 2JDUA 2NYYA 1CIYA 2YY1A 2VW1A 1ASJ3 3FN9A 1X36A 2VZSA 4FPHA 5FZGA 3NKTA 5H9QA 4P02B 1H6YA 1OFSA 3PUQA 2OW4A 2IXLA 2YBPA 4LHKA 4K1ZA 1R081 4N43A 3S5QA 3T2QA 3RDIA 3CQOA 5DDJ1 2RM21 4XJWA 3WNKA 4BWOA 2A6ZA 2CGNA 1OH4A 2VW2A 1RVF3 4JV4A 5F39A 5ACA3 2A6YA 4UYBA 3FFQA 1QJU1 1AYM1 4N9HA 1GP4A 3IDAA 2ARXA 5LEKA 2ES3A 2D93A 2K0GA 3JBG3 5A32B 2DVAA 4CCDA 2YU2A 1OVSA 1DQ1A 4LMFA 4DZGA 1O3RA 2Q1MA 1H2LA 1JOJA 4BK4A 5LA1A 4BISA 3PVEA 3VKLA 4AI2A 1UZYA 2L9LA 4XXAA 1MQTC 4XILA 5FXZA 3AP9A 4AFDA 3WQBA 2AEZA 2WNEA 2OPKA 3U37A 1C4RA 1VLNA 5BUVA 1IQAA 1OHFA 4Z82A 1LOCA 5FYZA 5F3IA 2OUHA 4RHV3 3GGLA 1CAVA 3PVBB 4OFGA 1UYYA 3IMNA 1WMXA 3O12A 1FOD3 2B42B 2NLRA 3LGRA 4XBLA 4PT6A 2ZACA 2ZEWA 4YM2A 1X82A 3CIHA 4LHLA 4C1WA 4DXRA 5D1IA 4K8FA 3HOBA 2B46X 3IT8A 2OQ7A 2QE3A 2ZHLA 3V65A 3VKOA 1CAXA 3RWNA 4DUWA 2QQPA 2E7TA 4FT8A 1FMD2 3FC0A 1XSQA 5FZ4A 3AMHA 4S2GA 3WG4A 2PHDA 4Q4W1 1VBE1 2ZX4A 1IS6A 1OF4A 4ZPIA 4A44A 4P9LA 2NM1A 4XFFA 4XHBA 2NPIA 2QQVA 2JG9B 2RS33 4QDRA 1WD3A 4IEZA 3U1XA 2VR4A 2Y34A 4Y1ZA 3FUOA 3TEYA 2EXIA 1IPKA 4F3JA 4Y24A 4YG3A 1N3OA 4QWNA 4CCNA 1RHI3 4XUQA 4TTGA 2VJXA 2JENA 1CN1A 4YARA 3RYPA 1APNA 4XAEA 1W2AX 1UQXA 4XCBA 1HB2A 5B4XA 4TN7A 5I8TA 2OKXA 5A3LA 1RUJ3 2FDFA 1BMV1 1HLCA 1WBFA 1S2EA 5A32A 2XL9A 4UW6A 1J83A 4GWJA 1MPXA 1D4M1 1RXGA 1BBT1 2OXBA 3CJIC 3JQXA 2RV9A 3QBQA 1XQNA 2ET1A 2WZR2 4S2FA 1VMHA 4ISQA 4L92A 1W6OA 2VMCA 4AHXA 3K4DA 2AR6A 2YFZA 1W8HA 1S4CA 2WN3A 3E5UA 3I3EA 3PUHA 3W9AA 3WHUA 5I0SA 4UFKA 1OLMA 1UU5A 1KDMA 3LSEA 2Z79A 1OA2A 1DZRA 1TMF3 2AGSA 5FZ1A 5GZFA 5A3UA 3PU8A 4KGGA 1O8SA 2HBUA 2RDNA 3NJYA 5F3GA 2VH9A 2V5YA 1ZRFA 5HCBA 4A6SA 5HXVA 1VRH3 4NAMA 3UKTA 4IEUA 4U36A 3THCA 3O1RA 2DUPA 3RI8A 2QQLA 4HG6B 4DQAA 4KI5M 2X29A 1GNHA 1CZVA 3AC0A 3KCCA 2BNMA 1STMA 1W6QB 5FPVA 2LTNA 4M3CA 2VAUA 3BVCA 1S1AA 1HN0A 3WT3A 4X6RB 2E26A 1Z7S2 3PUAA 2OZJA 2TEPA 1XNKA 4LBQA 1V00A 1NE4A 1MS8A 3I2IA 3HD8B 3ZSEA 2JG9A 2QQIA 1CX4A 1XXNA 1W9WA 4FPOB 2ZGTA 2I45A 5EZWA 2WO1A 3TB0A 5C9AA 4G4FA 5A1AA 1NXMA 2YPDA 4BMBA 2CY6A 1PO22 1YNAA 1LOFA 3KMHA 3NNJA 4FFGA 4HANA 2YGMA 2OZ6A 5JCTA 3I97A 1O6UA 4UI9L 2AC1A 3K77A 5IVEA 1UL9A 3U0ZA 1RUE1 2J1EA 4HBNA 1V9U2 3L2YA 5FQ0B 3VL8A 4F8AA 1RUD1 2QVSB 2Y6GA 2PELA 4LJHA 4AEKA 4YZ1A 2GNTA 5K0UC 3H42B 4LBJA 2WFF3 3APBA 3WDVA 4LR4A 3WDTA 3WNLA 2CGOA 4E4HA 4EV0A 4JC1A 1AYN3 2VUAA 3GZEA 3NJVA 3POYA 3MIDA 1G6NA 3PJQA 3VBOA 5BV6A 5JOZA 3OEBA 4FPKA 5AC91 1BVP1 1KGYA 1YO8A 2QQNA 3DXUA 2ENRA 4GB33 3VKMA 4EN7B 4K40A 4D69A 1W6PA 3I3QA 2VZ1A 5DAVA 4RD7A 3TEZA 5C4WB 3DKWA 4HSJA 2FD8A 4GD4A 2WO7A 1KD7A 3A23A 5JWPA 1GWLA 1CVNA 4LBKA 2ZGUA 4HVOA 3URFA 4CSWA 4DB5A 3HBKA 4AFAA 2QZ2A 4PDWC 2VZPA 4NRPA 1N3QA 3NNLA 1QOOA 3LE0A 5FUPA 5BNPB 5J96B 2VZUA 3H8RA 3IN9A 3SH3A 5FJHA 2JXAA 2R042 4YVSB 2JDAA 3TAYA 4BQ4A 4DUXA 1Y7BA 3CZUA 1RTVA 1QJFA 3A0KA 1DYPA 2GH2A 1LKNA 5L7OB 1C8M2 4OUSA 1W8NA 3IBMA 4W6YA 2WWSA 3FX3A 3FZ3A 3WUCA 3ON7A 3KM5A 3IPVB 3W20A 2C9AA 5EPAA 1GV9A 1ND2B 2KR2A 3HEIA 3NAPC 4CDQA 5FZLA 3MIHA 1AL23 1W6NB 1PGL2 1O3SA 3OGVA 1OOPB 1G7YA 5D8AC 1R083 2R7EB 3K75B 2ZPXA 1V6JA 4W50A 4MGQA 3PTRB 1YQCA 5K8SA 4DPNA 3BTZA 2QJVA 1SCSA 1MR5A 5DDJ3 3ZFGC 2DFCA 2RM23 3GJBA 4TXWA 1GR3A 2DYCA 2WR9A 4QKNA 2A3YA 2Z4FA 4A7YA 3P3NA 5GZEA 4WVVA 5FZCA 4GXLA 3I59B 3MIEA 4E8CA 4TZDA 2R072 2ZGNA 2BTVC 1MVQA 4CUCA 1DYOA 1QJU3 1AYM3 1U5XA 2X5IA 4XZPA 1LULA 1PNFA 2FDGA 2HWE2 5FZOB 1CAWA 3T0AA 2YROA 3E1F1 1AR92 3HVDA 4XDOA 5CFCB 4U2AA 5JZGB 2JD4A 2DVGA 3AK0A 5CADA 1NCRB 1X9TA 4CDXA 3AZWA 1MS0A 2EICA 4YNIA 2HWB1 1QGLA 2VVFA 4OI4A 3ZXDA 3POBA 3NL1A 2YXSA 3K4AA 4RYDA 4EQVA 1UZ0A 1JMUB 4Y20B 3ZXFA 3K4ZA 3UNPA 2XBO2 1SDDB 1DYKA 2WT2A 1RJ7A 2ZHMA 3OTFA 4O9EA 3VBUB 1JYIA 4B3NA 5BNPA 2ZX2A 1UY2A 1YWKA 4YVSA 2EIDA 1LOBA 2XOMA 2A1XA 2YG0A 5J37A 4FFFA 1UPIA 1V6LA 4OVEA 5EYYA 2RHPA 3I3BA 3TYJA 1H8TC 2R0FA 3KQRA 2HYKA 1POQA 3KB5A 2XL7A 4I2OA 3NJZA 2RMU1 3NNGA 2B9VA 1HJFA 1S2KA 2J1UA 2RR11 4FPJA 4L8QA 4Q4V1 4W4ZA 3LOBA 5FCCA 4A2UA 3DPRA 1W6NA 3VZKA 3WG1A 1H6XA 3N3HA 2BWCA 3AFGA 5T5JA 3M70A 1VBE3 4Q4W3 2EXHA 5DAQA 2IVJA 4W8JA 1DQ6A 3AYCA 1F9KA 1QJY2 3T2PA 3ZXJA 4XF9A 5IAXA 3WF2A 4YSFA 4D8MA 1BYHA 4I0WB 1RGSA 5LY1A 2PAKA 1DQ2A 1GZWB 3UESA 2D6LX 4E27A 5FAXA 1PNGA 2C9KA 4UOJA 4FAGA 5L9BA 2Q8EA 2VQ0A 5JOYA 2GNBA 1I1EA 1BEV2 4FTSA 5FZOA 1CZTA 4YW2A 1N1SA 2G9GA 5CFCA 1GOFA 2VVDA 2ZEZA 4UBHA 4LLOA 5JZGA 4PHZA 1NCRA 1D4M3 2LW8A 1BBT3 4YLZA 1WLTA 3WNMA 2Q1FA 3ZN6B 4DMIA 3I2KA 2BNOA 1IHMA 4CUAA 4NROA 1ZA4A 4AI1A 1I5PA 4LTAA 3WDWA 5JIUA 4XC9A 5FY4A 1TNFA 3DECA 1C1LA 5E16A 2E7QA 3VBUA 2PHUA 5FLIA 2PHFA 4LK6A 1OC1A 2CHHA 4BMEA 1Q8VA 4FQZA 5AVAA 2WO2A 4Y1YA 1ZBA2 4QQPA 4P9IA 4AEJA 5F8PA 2IVIB 2RG4A 1N47A 4B4QA 1TE1B 3N35A 4B29A 4WVMB 2P34A 3IDBB 4BLJA 4PLOA 3GCWA 3USUB 4Q27A 2JG8A 2JECA 3V64A 5FPUA 1JYXA 4P14A 4XBQA 4J25A 2W52A 3WW1A 4P9WA 5J3UA 3LIHA 4XHXA 3AJZA 2A3XA 4UFIA 2VZOA 1CWPA 1DGLA 1HX6A 1PO11 5FYYA 3B9CA 4K6BA 5LBFA 2Y38A 2ZAHA 1V70A 3VBHB 1OPOA 4XF1A 5C8CC 3O5SA 4AQ6A 4XCAA 4LNVA 4XXPA 1GZWA 3OGGA 4MGYE 5LWBA 3N9QA 4JCKA 2XH6A 4LEJA 1RUF2 4YWAA 3KZ4C 2FBEA 3PUSA 1RUE3 4KGQA 2HYXA 4COZA 1RUD3 3WQ0A 2FQPA 3L9JT 3UKVA 3RJ2X 4MGSA 1LHUA 2W95A 4UF0A 3ZFEC 5EJ1B 3D82A 3H1YA 4IGOA 5FWJA 1R093 2WJSA 2IFRA 3NWKA 1FMD1 2HEVF 4BQ2A 2BFUS 1HXS1 1PVXA 1WMEA 3MF6A 1LODA 1WWYA 2DU1A 4OI0A 3P5BA 4FSJA 4HVRA 4GWMA 3FJSA 3T0DA 1JZ5A 4KG0A 1X8EA 4RS5C 1X50A 2XB6C 4UW3A 2XMLA 1EPZA 1HQLA 1PMHX 4RR3B 1G9DA 2JDYA 4RQPC 1LCLA 3NV3A 3UGFA 4QQLA 5IK7A 1FX5A 1UIKA 2VCBA 4PF5A 4A41A 3MEPA 3USUA 4AI3A 2D98A 4YW1A 2P37A 1T2XA 1BQPA 2P5BA 3PURA 4ES8A 4QX5A 1NCQB 2PHTA 4QX3A 4HN1A 1ND3C 3V56A 2D97A 3B01A 5BYNA 4CEWB 4CPBD 3IIAA 4K21A 3FWEA 4BH9A 5FY9A 1IPJA 1GP6A 1W6MB 2O14A 3NNFA 3OBTA 3RSJA 1VALA 2VZQA 2WZR1 4E9KA 4NWVA 2W3JA 4CA9A 2H0BA 1XNTA 4TLFA 2QDRA 4F7ZA 4RGAA 3RFRA 1FAYA 1LOGA 1XNCA 2AACA 1KQRA 4QPIC 3SC7X 3VKFC 2IUWA 4BU2A 1HN1A 4IE5A 1RVF1 1K3IA 1WMFA 3IWZA 1FPN2 2BZDA 1WUVA 5ACA1 4JGYB 4DXTA 4QXHA 1K5MB 1OQ1A 1RMU2 5F6LB 1JUHA 1CAUA
chains in the Genus database with same CATH topology
1YXWA 4HSLA 3VDDB 2VY0A 3SMHA 1REEA 2ZJCA 1ZRDA 2W68A 2CAVA 4AWDA 4B8EA 4IESA 1EAH2 2QZ3A 4IV1B 4EN6B 3AZZA 4QQOA 2HWB3 4IEYA 3C3VA 2XJPA 3N7JA 3AKQA 3VZJA 1QU0A 3U11A 5BNOA 5IK4A 3AYAA 1ZRCA 4JRLA 5D8AA 3U07A 1JN2P 4JDOA 1H4HA 2EIGA 1PO21 3JB4C 4AGVA 1DGWA 4QPGB 4AGGA 1COV2 2C1FA 3HWJA 1NCQA 4LHNA 3R6SA 4JAAA 4Q0UA 2DVBA 1V9U1 1MACA 4QD2A 2RMU3 3SCFA 2RR13 4Q4V3 2WQZC 4Y22A 3BIWE 1A6CA 1G8WA 1W6MA 5IT6A 1YIPA 5BNQA 1DHKB 3H3UA 2GNDA 5L73A 4RA0A 1JUIA 4RL7A 1N3PA 3NW4A 2UYBA 1SBDA 4KWJA 3J4UH 1OFNA 5FLHA 2EXJA 4G9SB 1K5MA 1NQJA 4FPYA 2XJQA 3VKNA 5JSOA 1Q8SA 2D40A 5FDBA 4ONUA 3FHIB 2HKXA 2ERFA 1VBD2 2VNGA 1KS4A 2YZ4A 2VGDA 3HT2A 1S0CA 4E4DX 2YV8A 1C8M1 5E88A 4YVWB 4IV1A 3RI9A 1VBC2 3VBSC 4R9DA 5FTTC 3AX4A 1OD5A 1WW7A 4TWTA 2YMZA 2GC2A 2QCSB 2WNUB 2RJLA 5IK8A 1TMF1 2H6CA 3M8LA 1ZZ7A 3O14A 4MXWB 2D6NA 4XPVA 4DY3A 3OCPA 1LESA 1LHVA 4XFBA 1YYNA 4CDUB 3D6EA 3HBZA 1UKGA 4W6WA 3SCGA 3JCIA 2R16A 1EY2A 4HMZA 2E63A 3ZSJA 3ZYRA 1YJLA 2G9FA 2HWE1 4NHMA 3S7IA 5CFDA 4CDWB 2NZ9A 1LRHA 4HKLA 3VN4A 4Q0QA 4QGMA 1WD4A 1PO13 4LO4B 4N43B 2IZWA 5FMOS 5GLZA 1LGCA 3ZXAC 1CJPA 1QHDA 1URXA 4MVTA 4CEYA 1DZQA 3WOGA 5JPNB 4Q26A 2E51A 3UL2A 3WD5A 1IS5A 3BALA 4DFSA 3KCYA 4ZU4A 1LGNA 3WDYA 2AZ5A 3H7YA 5H9RA 3NKGA 1PZ7A 1H8VA 3THTA 1ZZ6A 1HRI2 1LJ7A 2GALA 3MIFA 2Z2SB 5GALA 1V6MA 1CIWA 1ZBE2 1AR72 3WQ1A 5KXBA 4UW5A 3WCRA 2EAKA 1AX2A 2B39A 1ZNPA 4R4XA 1GQGA 2R062 4XQWA 1FMD3 2WNUA 2LUWA 1D0GA 2GU9A 4NR1A 1WMDA 3HQXA 1DLLA 4MXWA 2VULA 1PZ9A 1QJY1 2JEMA 4AE2A 4CDUA 2ZHNA 4JQRA 2TBVA 5EXOA 4FTBA 2A3WA 2MEV1 4D3WA 1KJLA 2WS92 3KGZA 2D5FA 1SFYA 1BEV1 2PAEA 2XLAA 4CDWA 3OGJA 1AL21 5KXDA 1REDA 1ULGA 2GH8A 3VBRC 1PGSA 2WZR3 5LK7B 3ROUA 4BQ1A 3POSA 5JSRA 1V6IA 2YPJA 3W58A 5CBLA 4OLLA 1DGRN 4FQ4A 4WM8C 2DCZA 5EYXA 2AH2A 2VMGA 5E1RA 1GYKA 1ZBA1 4IL7A 1R1A2 1EV12 1XNBA 2D6OX 2ZGMA 2WNVA 1HDKA 4FP2A 3U10A 4R4ZA 3FLRA 2UU8A 4WM7C 3T1MA 2MHFA 5L7OC 1SLCA 3E5QA 1W6OB 1WW4A 3M7AA 4YGDA 2GMPA 3R4SA 5FO7B 1A8MA 2VUJA 1Z7S3 3GBFA 3VL9A 3RJRA 2BQPA 5FMOL 1TEIA 1ND2C 3WP5A 2ILMA 4HPKA 4EJRA 3KCXA 1OOPC 4TSVA 1S0EA 3MF9A 4L97A 3ZXEA 1VBA2 3QOPA 4LLFA 3IM0A 2D6PA 1PO23 4QPIA 1ZRRA 4KQ7A 1NA1A 3TN92 2K9ZA 3WZ1A 2LM3A 1RUF1 2XWJB 1QJX2 1V9U3 3AMMA 4EN8B 1GZ9A 4M3CB 3O0VA 1G9AA 3M1HA 4E4SA 4LBQB 2I2SA 4NOTA 3HT1A 1AXYA 1LR5A 4MUVA 1H9PA 4LBOA 1SBFA 2CL2A 2HEWF 1A3KA 3ES1A 5C9AB 4COVA 5EWSA 1H30A 2VMIA 5JLVA 1OKQA 1WGPA 3U4XA 4I0BA 1I9RA 4XJ8A 1AJOA 3GF6A 2ZGPA 3AP4A 3MW2A 1O5UA 2P3KA 3O0WA 3WINE 3EHKA 4XOGA 1J1LA 3AP7A 1GICA 1Z0HA 4GH4B 1MEC1 1L3JA 1H1AA 2R043 2XKPA 4JGZB 5J36A 4ZXKA 1C8M3 2SBAA 3CO2A 2BUKA 3VBOB 5FOBB 1Q43A 2UY8A 3EO6A 4AVCA 3V0AA 1LU1A 4LBQD 3CL1A 1W6PB 4YG6A 4AK3A 3FLPA 1O4ZA 3HIFA 2EXKA 1GQHA 4KL1A 3VBFC 2WKKA 2DUQA 2A73B 1GZCA 3AKRA 4XFAA 1ASJ2 4BHPA 3B3QE 3WP4A 4FOYA 1RUH2 4XMIA 3S7EA 4LBMA 1FPN1 4M0NA 3VGIA 1B35B 2HWD2 2R073 1RMU1 1AR82 1HQNA 4R9CA 1U5YA 5KC5A 4HK9A 2HWE3 5FREA 4CDQB 3B7MA 3KD4A 1AR93 4S2DA 1XE7A 2IC1A 3BB6A 4INDA 5ABJC 3H0OA 3ZFFC 1NOVA 4LULA 3VBSA 4ORFA 4WZFA 3RMYA 1SCRA 5JOXA 2XJSA 1NY72 2Q4SA 5CVRA 1D0HA 4N7IA 2P3JA 1NE6A 5L36A 1TQ5A 3AKSA 4GH4A 2X5IB 2RJKA 3M3IA 3INAA 4JGZA 1CAWB 1EP0A 1GFF2 1LTEA 1H2KA 4AFBA 2IFWA 3BCWA 2JJ6A 4M3CE 3GNEA 1R091 5CIRA 4CDXB 5I8YA 3AKPA 4EWDA 1EPWA 1RITA 4BE3A 1LHWA 4AI0A 4LO5B 3DN7A 4MGIE 1W0PA 4Q2FA 5A33A 4MGZE 4Q1RA 1Q8PA 1QJY3 2V73A 1RIRA 3KT1A 4N53C 4RSUA 4CP0A 3VBHC 1AUYA 1ZREA 1RB8G 1B35A 3M3EA 3OJBA 2YC0A 3IKWA 2MEV3 3B02A 3Q9OA 3TNPB 3MLKA 1FV3A 3NV1A 3NSTA 5DUUA 4GKXA 1BEV3 3QD6A 3B94A 1VBD1 3DPRB 2B9UA 2GNMA 2NMOA 4O9GA 2XGXA 1M4WA 1NQDA 1VBC1 4NHKA 1JXNA 1WLWA 5SV8A 1MQTB 5GLUA 4TYSA 3PMEA 3UK9A 1DFQA 3OD4A 3QACA 3AMQA 3FFZA 3B9IA 5BNNC 3AM2A 1ZBA3 4HFSA 3PLQA 4RR3C 2E6VA 5I91A 2GZWA 2YDEA 4HVQA 1WCSA 4AEDA 3T1LA 3ST7A 2R49A 3QCWA 3A4UA 5FPXA 4AYUA 4PQ9A 2DCYA 2IXKA 4CEWC 3BPZA 2WSVA 1PK6C 1W39A 3VHOA 1N1TA 1F31A 1YI7A 3VBRA 3NVCA 3JD72 3NV2A 3MIGA 1SLBA 2ZAAA 3EQEA 4FBFA 3LCPA 4I02A 4LBLA 2PN5A 4AG4A 5KHIA 3FUQA 3A0NA 2RS12 4WVWA 1RUF3 2HEYF 5F9TA 4JGYC 1HRI1 2JG8B 1H2NA 1RC6A 1WCDJ 2BBVA 1SMVA 1VIWB 3LZZA 1O4TA 1LGBA 4XMAA 1ZBE1 1AR71 1RUI2 3CF6E 3HAGA 3VDDC 1KXGA 1QWRA 4I01A 4L99A 1QKQA 3M3QA 3R05A 1UD1A 1PVC1 2R061 1MQTA 3GZAA 4R9BA 2F4PA 1LHOA 1PGW2 1R1ZA 3WLUA 2OUJA 3MLLA 5T5PA 4H55A 3LKJA 1MEC3 1IS3A 3MFAA 1NZCA 1YFWA 4HN0A 5DUXA 2Q1ZB 1JHNA 3POWA 4QPGC 2WS91 1C8NA 5C8WA 1RUNA 3CEWA 2DTWA 4I09A 1G86A 1FNYA 4XTPA 3L2HA 4OI1A 1FV2A 4JVAA 3VHNA 4HZFA 2ZX1A 1DIWA 3B93A 1JYCA 4XJZA 1C1FA 4Q29A 4K20A 2HWF2 2PHWA 4OUMA 4Q4Y2 1F5JA 1FPN3 3KT4A 3AB0A 2VNOA 2RM22 4A7ZA 3H1WA 4Q4X2 1RMU3 2W39A 2O0OA 3CLPA 3WVJA 1DG6A 2XPJA 3GHMA 3THPA 4FPFA 1AZDA 3VZNA 1AYM2 1QOSA 4ASLA 4XTMA 2AYHA 3CJIA 4MV2A 2ZGLA 4YVWC 4X8NA 3QH7A 4IXLA 4FPGA 1S0GA 3RS6A 1ALYA 4LBNA 5TSWA 3AZYA 2JICA 5KHGA 5KC6A 4HPKB 1CAUB 1VBA1 4I0AA 4BLIA 4B7EA 1ENRA 2TNFA 4PIZA 3ZSLA 4IV3C 3WR0A 3R4DB 4DS0A 2WQ4A 1QJX1 5E8AA 2GDFA 3M2MA 1QF3A 3MIBA 3LAGA 2XJVA 1GNZA 2GSYA 1AX1A 5LEJA 1KS5A 4NPRA 4YRDA 5BNOB 2OYZA 2FHRA 4MZUA 4WVZA 2EF6A 4C90A 1ENQA 5D8AB 4N43C 4Q4W2 2DVDA 4NN0A 3H3ZA 4QGLA 1DU3D 3ZFFA 2ZMKA 3R0RA 3ME2A 4IQPA 3WUDA 4JTOA 3WXPA 4N90A 5C33A 4GIQA 5GLTA 4M3CF 1G9BA 5K0UA 3H50A 5BPXA 1XRUA 4HL0A 4GA9A 1VBD3 3KLSA 4Y22B 4Y4YA 4AEMA 4XETA 1ULEA 2O1QA 3MZHA 1X8MA 4YW3A 3OF1A 2XHKA 5LK5A 5I0TA 1A8DA 4YG0A 1VBC3 3DL3A 3WV6A 3H9AA 4MH0E 3ZXLA 2DURA 4Z8BA 3ZMNA 2F6BA 2V09A 4Z1VA 1W2UA 4PJYA 2AENA 2DFBA 4CP1A 4PDWA 5CG8A 4J1WA 4DXZA 4P9GA 1HRV2 2Y0IA 1LOAA 2PHRA 2BNNA 1LENA 1OA3A 1NLSA 3ILNA 1LEMA 1YFYA 2YGLA 4KWKA 2HWD1 3J8F2 1AR81 3ZXKA 5JVVA 3JB8A 3T2TA 1H8TB 1V6KA 3KGLA 4E2QA 1Z7S1 3ILRA 2VG9A 4ZU7A 5AFEA 1MZ5A 1LU2A 1MS3A 3NAPA 3ZO0B 4CYDA 1MZ6A 3QLQA 5C6CA 1KFUL 2D43A 3H1MA 4L2NA 4LA3A 3ZFGA 4D7TA 3D0SA 4GALA 2VPVA 2D6MA 1UCXA 1Y3TA 4AQSA 1Q5OA 5H9SA 2EVXA 1H9WA 1PM7A 4MLOA 4GMP1 2BVVA 1HRI3 1ZVFA 1H1IA 4XEZA 5BNNA 1Q8QA 3GBWA 4YZ5A 2I07B 2R30A 1ZBE3 1AR73 2NMNA 4XJ9A 1MS5A 2GMMA 4LE4A 4FAHA 5CFDB 1RUD2 2Q5TA 1CD3G 1VB2A 3BODA 2VU9A 3TNQA 2H6BA 1MZFA 1EYBA 1J58A 2BFUL 2VOKA 1VJ2A 1MS9A 3N7LA 1PVC3 2R063 4Y26A 2XVGA 2Z5WA 4CEYB 5AC92 1RUG2 1C57A 2ZGQA 1JW6A 5KHJA 2D6KA 3RRDA 3LA3A 3VZMA 1YFUA 1OPMA 4NO4A 3B69A 2R041 4DRVA 2CNAA 4XYXA 3LA7A 4NHLA 3GZTB 1DQ0A 1UW8A 5H9PA 3R4UA 3LOIA 1QQP2 4BZ4A 2WZPP 4PIYA 5GJ6A 3SH5A 2WS93 1H8TA 2CAUA 5JAXA 2ZBJA 3ZIXA 3GZUC 1XU2A 3KS7A 4FOQA 2PHLA 3JUUA 5DG1A 5DUVA 4MGKE 1LHNA 1PGL1 2PYTA 1ZX5A 3DUIA 2BGCA 1WLDA 1YHFA 5FOJB 1KDKA 3RPQA 2XWBB 1JTZX 4CRQA 1SLAA 2JG9C 2FMDA 1QDOA 1ULCA 1WA4A 1QXJA 2WC2A 1G9CA 1CJDA 2ZCWA 1FI2A 1S55A 4YW5A 2UURA 3ZXGA 2R071 4URTA 5GM0A 1LOFC 1UU6A 4BPZA 5FBZA 2BVBA 4ZU5A 2YHJA 4FOWA 5EV7A 3EJKA 1CONA 4YW4A 3G6JB 1AR91 1Q3EA 4L9BA 5JMCA 3V0BA 3RZZA 1DGWX 3NO8A 3ZPYA 3MI8A 1GBGA 2DCJA 2DUOA 4M00A 5DUWA 2D3SA 3VBOC 4YGBA 2RE9A 4PBOA 4GKYA 5GZGA 3WDXA 2XBO1 4OHXA 2RS52 1S0DA 4XE9A 3E6BA 3AXDA 5F5QA 1XYPA 2SLIA 2ZX3A 5T50A 5AVPA 3JD71 3CNAA 4SBVA 1UAIA 4QM8A 4RS5B 1VBA3 2D7FA 3G7DA 4PCRA 1AL0G 3ZX7A 3VZOA 4OI2A 4KG8A 3AYDA 4QPYA 2WNVB 2PLV2 1PZ8A 3DV8A 1QH6A 2RS11 4QM9A 2HWC2 4H3WA 2XLGA 5JPMB 1N1VA 1QJX3 4R9AA 1V6NA 4Q8LA 2VW0A 5F6KA 3X29B 4QGNA 1ND3B 1RUI1 2ZGKA 4AGRA 1IZ3A 2WINB 1C28A 1RUC2 1ZYBA 4CDQC 4FPCA 3ECQA 4AI8A 1VBB2 2XJTA 4K3UA 3OPZA 1LECA 2I74A 1QJZA 2DF7A 5C8CA 1AR62 1O4YA 1V6OA 1CQ9A 4QPIB 4DNYA 1NA1B 4EN9B 1PGW1 4OHWA 3P3PA 2ZGRA 1CR7A 5IUQA 4MYEA 5EFUA 2QDNA 3OD0A 4E2SA 2X5IC 5J09A 4PLNA 3ZFEA 4WV8A 5T55A 4PLMA 4CDXC 1D2QA 3SXWA 5C4WC 2W08A 4BOWA 4NWWA 1ZM1A 2Y0OA 1Y9QA 2ZHKA 3J26N 1TME2 4K1YA 4RS5A 3RMXA 3TBDA 1H2MA 1C5IA 2UWAA 2HWF1 3FLTA 3ILFA 1RUH3 4Q4Y1 4E2GA 5BNPC 2P17A 4RQPA 1FXZA 2VMHA 1UF2C 4HKOA 4Y5Z0 4YVSC 1F5FA 3WW4A 1YCIA 4LT5A 1PIV2 2C5DA 4YM0A 3UJQA 4XFIA 4Q4X1 4R52A 2HWD3 3MW4A 4DINB 1AR83 3V0AB 4D7SA 3WG2A 4META 1DQ5A 2WFPA 1ND3A 3E6DA 2MNGA 1S0BA 2R1BA 5FPZA 2VNRA 2VVEA 3DPRC 2XLFA 1PHMA 3JZVA 4Y1XA 3CJXA 1AJKA 4H7MA 4I3PA 3AMPA 3S6PA 2CWSA 4KWLA 3GHNA 1SQ4A 1AXKA 2JX9A 1PO12 5I0RA 2D3PA 2A6WA 5T5LA 4AF9A 2G4IA 3ZYIB 2WLPA 2LALA 3ACLA 1MVEA 3E6CC 1YIFA 4GMP3 4N7UA 2CGPA 3HN1A 4ZKTB 2XUMA 3MW3A 3SCHA 2R6QA 4LE3A 4IEPA 3LA2A 2P2KA 4ASMB 5CFCC 5JZGC 3PTYA 3WW3A 1NCRC 1WBLA 3VUOA 1S0IA 2IXJA 3VBSB 2VECA 3I2DA 4KU7A 3OYWB 1HXS2 3VBUC 1KITA 1G9FA 4UXAA 1SBEA 4Q1PA 4IEOA 2PA7A 5KWRA 4FOVA 1O3QA 3WNXA 3I7DA 2DTYA 1ENSA 4BIFA 1ULDA 1YRZA 1TNRA 4H14A 3ZN5A 1YI9A 2JG8C 4Z2WA 1J3PA 3TRSB 5L19A 3MLJA 4AVSA 1QH7A 5A33B 5T54A 4FPEA 4HETA 3RG0A 5T5OA 1Z78A 2CWMA 1SFNA 2ZOEB 4YGEA 1ZZCA 1XYNA 5LRSA 1VAVA 1OQEA 4AXOA 2DCKA 3N36A 1LB2A 2Q30A 1I3HA 1GSLA 1RVF2 4BA6A 1DQ4A 5ACA2 1HRV1 1NLRA 2O8OA 4I3GA 4WZCA 5JR7B 1QNWA 4E4ZA 5JOWA 1EAH1 1XNDA 3VHRA 3JBG2 3D4KA 1HKDA 3J8F1 4XF3A 2HJIA 1Q56A 1WW6A 3WCSA 2XBO3 4YFZA 3SH4A 5HI0A 3WP6A 3OYWA 4P9YA 1RUOA 5CA6A 4C0BA 2FMYA 2GN7A 4Q0PA 3S30A 3WHTA 3PNAA 3JD73 4RHV2 2ZKNA 3ENRA 1FOD2 4FXKB 5DZFA 1COV1 5J48A 1U12A 3D8CA 2PHXA 1GLHA 2QNKA 2RS13 3VZLA 1SLTA 4AEDB 4YM3A 2KA3A 2VOXA 1KRIA 4COUA 2DVFA 1VR3A 4R8HA 1RUI3 4B4PA 4OZXA 4XBNA 2A7AA 3PVOA 1DZTA 3ZVXA 4AVBA 3VBRB 2WA4A 2DV9A 4NVPA 3MGUA 5I8SA 4XDQA 4OHVA 2RS32 4XFGA 4AW7A 4W6XA 2PFWA 1RUG1 3JQWA 3OY8B 4J1XA 5FRAA 1QXRA 4CZSA 3N7KA 3AMNA 1D2SA 1RHI2 3E97A 3AP6A 4WM8B 4N9IA 5CAZA 3BTAA 1HW5A 3ZYPA 2A6XA 4EWAA 2ZZQA 4IEQA 2CTVA 1QXPA 4OHZA 4Z92B 1QOTA 3M3CA 1RUJ2 1QQP1 3ES4A 2ZZJA 1JBCA 3ZYGA 3MYXA 4MSVA 5E89A 1H1MA 5FFOC 4WM7B 4BYYA 2GC1A 2CYFA 4PBPA 1O3TA 1XU1A 2DCTA 4BIOA 2ZS6B 1W6QA 4EWEA 4D94A 1HQWA 2VXRA 3S0MA 3UJOA 4B7KA 2A71A 2B5HA 4F83A 1VAKA 4ES9A 3ATGA 2A6VA 3LB9A 3ZSKA 5BNOC 1UX6A 3D0JA 3ZMOA 4K9SA 5LRRA 1TMF2 2HWF3 4Q4Y3 3SITA 4QT6A 4FO9A 5FO9B 2XJRA 3TOJA 2B7YA 1VRH2 3AZVA 5J7MA 1WW5A 5SV5A 4Q4X3 2EA7A 3I54A 5DZEA 4DOUA 4FTEA 1NCQC 5KHHA 1ZZ8A 5FQ0A 1AXZA 3FMGA 1MS4A 3MPBA 4JDNA 1C5HA 4XQDA 3I8TA 2B8MA 2Z69A 4LUMA 1F8VA 2H0VA 3OY8A 2O8QA 2RS51 1FT9A 3AYEA 4LO6B 5C4WA 2R1DA 4AFMA 4WM8A 2BWAA 1K5MC 4P5HA 3WY6A 5FLJA 4YFWA 3PMSA 4LA2A 2PLV1 2WFF2 2HWC1 1POV1 3M4FA 3MDPA 3CJIB 1MS1A 4K7JA 4WM7A 1AYN2 1B09A 2EAAA 4IV1C 5L7OA 4GWNA 2Q8OA 3HR9A 2IXHA 4GB32 2X53S 5T52A 3SLIA 3QH6A 3CU7A 1WLCA 3IPVA 3PHMA 1RUC1 4B4RA 4ITCA 1ND2A 3VBFB 4MXVA 1VBB1 3H7JA 1OOPA 1O5LA 1AR61 1SLIA 4C1XA 1RJ8A 2EALA 3I4IA 4JRAA 1FYUA 1MZEA 5A3MA 5JDBA 3FBYA 5KXEA 3M3OA 1OSGA 2BYVE 2ZMNA 2E9QA 4DRRA 2WT0A 3I59A 1CPMA 2MEV2 2WL1A 2MPFA 2X8KA 2DWRA 5BXXA 4XJAA 4YZ4A 1GANA 4AQ2A 4YZ3A 2KM2A 3D5OA 5CFDC 4V1PA 1AL22 4QQHA 3IDCB 2Q0AA 1CESA 5ABJB 1BKZA 1R082 3ZFFB 2XVKA 4HK8A 3ZN4A 5DDJ2 4P9JA 4AHWA 4CEYC 4FXGB 4X8PA 4Y20A 1FNZA 1VB4A 1TME1 1R1A1 1EV11 3AJYA 5K0UB 3FE5A 1HRV3 1YLLA 1POV0 5GKAC 3AFKA 4W65A 1QJU2 1UU4A 4XFCA 2ATFA 4AVVA 1PIV1 1IKQA 1EAH3 5GZDA 3J8F3 5CG9A 1FATA 1IKPA 3W59A 2WSUA 1N1YA 1UPSA 1J3QA 1QDCA 3DGTA 1KFXL 2UWCA 2WNUC 3VBFA 2D44A 4CP2A 1DDLA 3AP5A 3K51A 3RNSA 4PDWB 4I30A 4KH9A 4X6QB 4OULA 4AFCA 4L11A 4N53B 3SNMA 1VP6A 4CDUC 3TN91 3BU7A 1COV3 4COYA 3N7MA 5F1RA 2JDZA 4AHZA 3EBRA 2FZ2A 2VOWA 4JDMA 1UKRA 2TUNA 1DBNA 3FBMA 3NAPB 2ARBA 3LWCA 1YFXA 5CNAA 4C0HA 4Q0VA 2QFEA 4CDWC 5CU1A 1J59A 4QU2A 1AX0A 4GQ7A 1HIXA 5ABJA 5JIAA 1VBE2 1LOEA 4XQ4A 3ZFGB 3ALQA 3ZN6A 5T3NA 3ELNA 5AC93 4YZ2A 1RUG3 2VQAA 2GMEA 4MX3A 1OLQA 2A70A 2ZGOA 2P3IA 5BNNB 4EROA 4KU8A 1DF0A 2FZ1A 1VAMA 2D3RA 4QXKA 1QQP3 5J98B 1BMV2 4AVAA 2WNVC 1MEC2 2IWGB 1ENXA 4WVMA 2XKOA 3RYKA 1I5ZA 2W0XA 2NN8A 1D4M2 3SISA 1BBT2 2K2SA 1IGOA 4XF0A 1I6XA 3UKNA 2GC0A 1U5ZA 4QHBA 3NV4A 1YJKA 4J6GA 1BCXA 4AVTA 2N7GA 1ASJ1 2NQYA 3RYRA 1PK6B 1IS4A 2WIIB 1RUH1 2D5HA 4FP3A 4N53A 3KSCA 1OA4A 4C91A 2WLQA 3VBHA 3RQ0A 1ULFA 1CGPA 1JH5A 4IEWA 1Q8OA 4GULA 4SLIA 2YUEA 1NA1C 3BOWA 3WG3A 1U0AA 1Y43B 1RL3A 2PQQA 1IOAA 4FCAA 5HCAA 5GLWA 3E5XA 4WBBA 3GYDA 3ZSMA 3JBG1 2QKDA 1OQDA 2Y26A 4G3YC 1X7NA 4RFT0 4EN0A 5K7PA 3EXUA 1A78A 1NY71 1X33A 2QUOA 4LUKA 3C2UA 2UWBA 2ZTNA 2ZX0A 5IK5A 2RS53 4PIXA 4XW3A 3VLBB 2GC3A 1C3HA 3MICA 4Q8KA 1NG0A 4AHYA 4Y1UA 3HMYA 1O91A 4RHV1 4HKWA 2KXLA 2R0HA 1GKBA 1LEDA 3MFCA 1RUE2 1F2NA 1FOD1 4RR3A 1ZZ9A 3V0BB 2PLV3 2BW8A 3ASIA 3DF0A 3ETQA 1UN1A 2ZMLA 2HWC3 1POV3 1WCKA 3LSDA 4S2HA 3WQ7A 4YGCA 1ZZBA 4LO8A 2XG3A 1RINA 1YUDA 1SEFA 5HBAA 2E53A 1R092 2WT1A 2JE7A 1H0BA 2GN3A 3B00A 1DGRA 1AHSA 2R32A 1U5IA 4CEWA 4FPLA 1RUC3 3GBGA 1PK6A 5EJ3A 5CB7A 2IXIA 4XIOA 5AFBA 1VBB3 1UMZA 2OVUA 2RS31 1AR63 1H4GA 4XF4A 3ZIWA 1D4VB 4XFHA 3ZYJB 1RHI1 4HT1T 2JKBA 2NP0A 3H8UA 1SACA 4JGYA 4ATFA 1NYWA 5JSPA 4YYOA 2B45X 4QMAA 2ZGSA 3WX5A 3AXEA 2CV6A 2ZKLA 5FO8B 1RUJ1 3OBRA 2C0ZA 3VDDA 1S0FA 4KBBA 4QQ2A 5I0UA 3MPPG 2ZABA 4AQTA 4M01A 4XJUA 5JI7A 3B5LB 5C8CB 5C9AC 2ETEA 4GMP0 1W0OA 1BJQA 1PMIA 3TWIA 5DG2A 1KJRA 4DY5A 1SLLA 2WA3A 4UW4A 1TME3 4D7YA 1R1A3 1EV13 1HV0A 3PJYA 1AVBA 1S0JA 4IETA 4P9XA 2PAMA 4FVVA 2A75A 4GH4C 4JGZC 4Z07A 1VRH1 1PIV3 4IV3B 3ZFEB 1OLRA 4QPGA 1UIJA 5JI9A 5GLVA 3USSA 3JU9A 4HLTA 2AREA 4LO7A 2HWB2 3ZDSA 1BVVA 1BK1A 4Y1VA 1REFA 1J3RA 4IEXA 4M0HA 4BCUA 5K9YA 2Z42A 3KT7A 4RQPB 3TN93 3K48A 3WW2A 1CPNA 3SHRA 4A7KA 5GZCA 1AF9A 4CTEA 1B35C 3WP3A 1SDWA 1OMIA 2ZA9A 4YM1A 2OIIA 2ET7A 4ATEA 1J1TA 1HV1A 1OI6A 1BXHA 2AUYA 1QNYA 4JTNA 3PVNA 3VV1A 2RMU2 2BEOA 2UY9A 4H7LA 2RR12 4Q4V2 2A5ZA 2PTMA 2WFF1 2JE9A 4KNCA 5DXDA 1ONAA 1AYN1 3O7OA 5DZGA 4ISRA 2OA2A 2DU0A 4YVWA 1UZZA 1T6GC 4GB31 3WDUA 4IEVA 5HCFA 1O7FA 1PVC2 3UV9A 4OHYA 3AKTA 1XYOA 4RGGA 1HXS3 1QMJA 4BM8A 2BPA2 5B2GB 5KHKA 1CAVB 1S2BA 1XE8A 4XIKA 4COWA 5KXCA 2VOVA 2GAUA 4Q0SA 1M06G 5KBFA 1BZWA 4A3XA 2XVLA 4IV3A 3O0XA 1E57A 2YYOA 3GALA 2XJUA 4UBGA 2IXCA 2E7AA 3J9SA 2UYAA 3BOPA 4AEDC 3N4MA 3IDEA 3AZXA 3VHPA 1NXD1 1QY4A 1CAXB 4IERA 2NYYA 2YY1A 2VW1A 1ASJ3 4FPHA