4COWA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with the t-antigen (galb1-3galnac)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
TEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
total genus 56
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cowA00
4CP1A 4GQ7A 4AHXA 4D3WA 4COZA 4COUA 2XJRA 4AHWA 2XJVA 4A3XA 2XJPA 4AI2A 4AI3A 5A3MA 4AFBA 4AHYA 4COWA 4AI1A 4LHLA 4COYA 4AFCA 2XJUA 4CP0A 2XJQA 4LHKA 4ASLA 4CP2A 5A3LA 4AF9A 4LHNA 2XJSA 4COVA 2XJTA 4AI0A 4AHZA 4AFAA
chains in the Genus database with same CATH superfamily
1BEV1 1FOD1 4R52A 1W8NA 2BWCA 1VBB3 4LO4B 1DGRN 5FY1A 3ZX7A 5FK7A 4WM8C 3VDDB 1KQRA 1GZWB 1CX1A 1YLLA 5KHGA 1SCSA 1W90A 2CNAA 5ABJB 3MW3A 2Q8EA 1ZZ9A 1SLCA 3A23A 2VVEA 2DFBA 5T5OA 4DRRA 2NPIA 1HQWA 1OUXA 1Q43A 2BFUS 2ORXA 2WAOA 4DXTA 2YV8A 1EAH3 3ZN6A 1X82A 5JIAA 4QX3A 4XCBA 3UYJA 1KD7A 4N53A 1CN1A 3TNPB 5IVEA 1H1AA 4AR2A 3WG2A 1SPPB 1W3XA 2V73A 1RUE3 1ODNA 1OURA 3WCSA 4GULA 4EN9B 5F9TA 3OGRA 4LO5B 4HANA 4LBLA 4PHZA 3B9IA 3D8CA 3K2OA 4C8DA 5KXBA 1S0IA 4LXLA 4Y5TA 1F15A 5FZAA 4BMBA 1S0DA 1JYNA 3K4DA 1NQJA 1XQNA 3KCYA 1NCQC 5DDJ2 5FY7A 4E4ZA 3IDCB 5K0UC 2VTXA 5CNAA 2L9LA 3TWIA 2YFZA 2DTWA 4DUXA 5JOXA 4WZCA 2BJSA 5BNNB 1HRV3 2CGPA 3ZOIA 4UOJA 1ALYA 3VDDC 3X29B 3JB8A 1T2XA 1RUJ1 2DVFA 1NAEA 2VXRA 2VZVA 3MHZA 2DCYA 4GA9A 2E9QA 1W0NA 4KWKA 2HWC1 2WYFA 2XJRA 2RM23 4FI9A 3ORJA 3S7EA 1PMHX 4JRLA 3ZFFA 5A3MA 3V0AB 2WN2A 2VZTA 3ZXDA 3CJIA 3MW4A 3IPVA 2JDPA 4OHWA 4OMDA 3THPA 3VB9A 4AEDA 3P3PA 4JTNA 2YB7A 2VZPA 3F95A 2RS13 3OG2A 3SISA 5C8CB 3DECA 2X8KA 4LE3A 4QPGA 5SV5A 4LA2A 2P6CA 2W1QA 1LEMA 1W6NB 3NQHA 1VMJA 1ASJ1 4L11A 4YM2A 3MIEA 3O1TA 3PL0A 4XABA 2OPKA 4IERA 3FLTA 5HCAA 5GZCA 1OPMA 4B29A 1UOFA 3AJZA 3QD6A 1G8WA 3GM8A 5ACA1 3NO8A 4I0WB 1G6NA 1V6OA 4H7MA 1OOPB 3GYDA 2YZ4A 3WHUA 1U5YA 1QNYA 3ZFGA 4CEWA 5F37A 1R093 3IWZA 1OC1A 2VZSA 3CU7A 5FKBA 4CUBA 4RQPC 2HBUA 1VMHA 1UXZA 4TLFA 1PK6C 2YMZA 2QQMA 3UT0A 4L99A 4N7UA 2Z79A 5JXGA 1WW4A 2A6VA 2YC0A 3MUZ1 4XF4A 1V6IA 5T5PA 5FZCA 5A3LA 4JGYB 1EUUA 1F2NA 2XXZA 4LLFA 4L97A 5JCTA 3OUJA 4LHNA 1REEA 5A7QA 4AFMA 3N9OA 1OFSA 2WO3A 5FLJA 1ZBE3 4AE2A 4LUKA 3VUOA 3J7MA 4CXYA 4A6OA 1LB2A 2JE9A 1MS4A 3VHPA 1XBFA 2FZ2A 1MQTC 4V2VA 3WNXA 1YJLA 5HV0A 3H8OA 2ET7A 4CEYC 1J3PA 1RHI2 3GZAA 1CJPA 2ZKNA 1XC6A 2VTFA 3AYAA 4FXKB 5KC6A 1N3OA 4QGNA 1G9FA 5J09A 2HWF1 5E89A 3LDRA 1V6KA 1YQCA 4AVTA 1GANA 3GBGA 4XBLA 1XXNA 2XL9A 1W8FA 5FYUA 2ZAAA 4HETA 2QQLA 3JCIA 3WT3A 3RWKX 1RUG1 5F3IA 3TEYA 3NNGA 1C1FA 4PCRA 4P08A 5A32B 4BQYA 4GMP3 1V0AA 3DN7A 4RYDA 1EAH1 1OOPC 5KBFA 3LA7A 5FWEA 3C7GA 3CHXA 3THDA 1RUH3 2YG0A 4E2GA 2GN7A 3AVRA 2VJXA 2VCAA 4LKEA 2VO5A 2RV9A 3LQCA 4GH4B 5FBJA 4A7KA 4EROA 4H7LA 4DEVA 2XJVA 1RUE1 1W9WA 5BNPA 4JX0A 4XVHA 4YLZA 4D69A 3ZYFA 3CLPA 3FX3A 4AHYA 3KLSA 1RUI2 1ULEA 2BBAA 3ZYGA 3T2TA 4M0NA 4DUVA 2N7GA 2WS93 4DNYA 5FR3A 1YHFA 3R05A 2Q5TA 4RA0A 1O3RA 1RUF1 2QQWA 4D7YA 1GSLA 3POWA 3VDCA 1PGW1 4GMP0 3VL8A 5AFEA 1JOJA 4AEKA 1ZZCA 1PO12 4MO3M 1MS5A 4GIQA 1YQ8A 4N43B 4CE8A 4CCOA 1QJX3 3ZDVA 2Q8CA 4PIZA 2LUWA 1CJDA 1NA1C 2UY8A 1ZBA3 4Y1VA 2RS31 4BJ0A 2VW1A 2P3KA 2FQPA 1LR5A 2ZTNA 4LO6B 4XFCA 4DXSA 4IE6A 2XKPA 1I3HA 2WFF2 2RMU2 1GP5A 3VV1A 3JD72 2B8MA 1UZZA 3ILFA 3M8LA 3OBRA 5FOJB 2C9AA 4EE2A 1PIV1 2PN5A 2R061 5FLHA 2RS11 4JGZA 1E57A 4HONA 1ONAA 1LGCA 4HLTA 2MEV1 2ARBA 1VB2A 2XJTA 3ZFFC 1W2OA 1W9YA 1BKZA 4LO8A 1ACCA 3V65A 1JUHA 1RJ8A 2WN3A 3CJIC 4XXPA 4E27A 4XFIA 2FDGA 4MXWB 1WZXA 1A78A 2K46A 5FXWA 4ZS2A 4GKXA 1V9U3 1J3RA 2LS6A 2Q1MA 3IB3A 3MUY1 4HPKA 2BW8A 2OA2A 5GLZA 5FZIA 1IKPA 4D94A 4MUVA 1LNSA 4AK3A 1I9RA 1OVPA 4MSVA 1HRI1 5CZKA 4MGKE 1U5ZA 1R091 1PO22 3EBRA 3LIGA 1UOBA 1SEFA 4HT1T 4WBBA 5G05L 4EYUA 5JSPA 2B39A 1UU6A 4YW5A 2Y64A 3KF5A 3C7OA 2GMPA 3CJXA 5LK7B 4KI5M 4FOWA 3ACHA 4IEPA 4LKFA 2VOVA 4LBKA 4NPLA 4HK8A 1K42A 4Q0VA 2Z2SB 1ZBE1 3LIHA 1KEXA 2HWD2 3OY8B 5GLVA 3VZMA 4LT5A 2ENRA 3HVDA 2RJKA 4K40A 3VKLA 4NMIA 1OF3A 1IS4A 4QB6A 4RHV1 3PIGA 2QQNA 1WA4A 5JOYA 5K9YA 5KC5A 3SMHA 1O91A 5DUWA 5AVAA 3LB9A 2WRAA 3AP5A 2ZHLA 2PQQA 4PJYA 3U75A 4EN6B 1Z7S3 2ZGMA 3DGTA 4CP9B 1S0GA 1CX4A 4I01A 2DU1A 5FIXA 4K21A 5A70A 5L73A 5FP8A 5F3EA 4AFAA 5JMCA 1O6UA 2AYHA 4KWJA 2ZX1A 4AWDA 1UCXA 5FYBA 5C3PA 1XNBA 4FPKA 1X7NA 1TMF3 1VBB2 4MLOA 4DEQA 4E4HA 4UW3A 1SMVA 1J1LA 3BTYA 3N9LA 4IGOA 5CADA 2VVFA 2AZ5A 5LA2A 4YVWB 5A6YA 1ZRDA 3FBMA 5FP9A 1H2LA 4TXWA 3WNPA 4IUGA 3ZXAC 1XYNA 3T2OA 3VBRA 2WS91 5IVVA 2RR11 1OI6A 4IEUA 1KJLA 4CUCA 5A6QA 5BNPC 3MFAA 2WQ4A 3P5BA 1SG3A 3LOBA 3T4VA 1QOTA 3CQOA 3RMXA 4Q1PA 5FZ3A 5A3OA 1RGSA 2TNFA 1GQHA 1HKDA 2WNVC 2SLIA 4WM7A 4BB3A 3WD5A 3UGGA 1VBD3 5I0TA 4M3CA 2VOKA 2ZS6B 3ST7A 5C3RA 4XHXA 5CFCC 3S30A 3KQ4B 1F5JA 2GU9A 2QQPA 4K1ZA 1BJQA 5C9AA 3WDUA 1L7QA 4XF3A 4QXCA 1QWRA 4IEXA 3K3NA 3SCFA 1CAUA 3HWJA 3UK9A 5BNQA 1X33A 3TNQA 2J42A 5C8WA 2A6ZA 3AB0A 4Y24A 1HRV2 1DGRA 1DCSA 2WJSA 3LEMA 1GLHA 3ZSEA 2MNGA 2WO7A 2BWAA 4U2AA 4A7ZA 5FZDA 4BDVB 2ZHKA 3A4UA 3S7IA 4CYDA 2P6HA 3ZN5A 3W20A 2JG9C 1VIWB 3KCXA 1V9U1 2E6VA 2QKDA 4FPJA 4BQ3A 4JC1A 3AFGA 3O0VA 2EIGA 2RM22 4QHZA 1SACA 5FP7A 1JZ4A 1JZ8A 3V0BA 5F3CA 5FPAA 3NNMA 3RS6A 4Y1UA 3H8RA 2JEMA 2ARXA 4MGTA 4Q4V1 3A7QA 1UPSA 3NNJA 1VMFA 5FUPA 1VALA 2BNNA 1AYM3 2CY6A 3ABZA 2E31A 1CD3G 4E9KA 1VBC1 5C7GA 4CDQB 2H6BA 1QF3A 1LGBA 2PLV1 3N35A 5FMDA 2J1VA 2VULA 3B02A 2NN8A 2AGSA 1KITA 3ZM8A 5FXVA 1IGOA 4OMCA 1MACA 3FHIB 3VZLA 5A3UA 2E51A 4LMFA 3B7MA 5F6LB 5FYVA 5A7OA 3T4HB 5IATA 5IHRA 4QHOA 1PGL1 3H8XA 2WNUB 4P02B 1RUD1 4ZU7A 3O1RA 3BI3A 3GXUA 4CP0A 3SXWA 5KXEA 1ULPA 2XPJA 4QPIA 2XBO3 3RJRA 1FNYA 2A3YA 2BGCA 1UYYA 2YPDA 2YXSA 3K46A 5JR7B 5CFDA 4Z07A 2KD7A 1XE7A 2XUEA 3WF2A 5EWSA 3C3VA 1K45A 5IFTA 1BQPA 4F83A 4YVSA 1XPWA 4XHBA 1W8TA 2NM1A 2Q8DA 2CAUA 3I3DA 3O14A 1ND3A 3ZXFA 1K5MC 1CZTA 1WUVA 1MS8A 2ZCWA 3IDBB 4XACA 5FZHA 5FZ8A 3ZSLA 3VBOA 1ZNPA 3M70A 4F3JA 1B35B 1HQNA 2GAUA 1UY3A 2W46A 4V2WA 3VKFC 1XNAA 1TMF1 3I3BA 4FPEA 2Y6FA 2AREA 4XILA 1AXKA 2LW8A 1YCIA 1UY0A 5EP9A 2VTXJ 1BLZA 4PI0A 3OYWA 3DPRB 1DQ5A 1DQ2A 1LU1A 1QKQA 1W8HA 4HKOA 4P9LA 4CCLA 2PELA 1GKBA 2EXKA 1NZCA 4Q4W2 1UN1A 2CV6A 3DXUA 5D8AA 5A3WA 1RUH2 3ZSMA 5LWBA 3WY6A 2VUJA 1RUC3 5IK4A 2XL7A 4B3NA 5DMYA 4YG0A 2VU9A 1MZ5A 2D3SA 3HN3A 2J1TA 5L9BA 4YG6A 1VBD1 3ZMOA 1LESA 3WX5A 3C8XA 3WP6A 4CDXB 2PTMA 1AL0G 4G4FA 2VCMA 3I2JA 3SKJE 4FAHA 1AR72 4KBBA 1H8TC 4ET7A 2G9GA 2XDVA 4QX5A 4MG2A 3GZEA 3JQXA 2R0FA 5B4NA 1VAKA 5CU1A 1RMU3 1VBA3 1YIPA 2KM2A 5B2GB 2O8QA 1UZ0A 1KS4A 2W91A 3GCXA 4BISA 4EWDA 2FCVA 4D6SA 4KU8A 3IKWA 2NMNA 1QJX2 5D21A 1N1SA 2UYAA 3NV4A 2J7MA 2RDRA 1BK1A 1TVGA 1US3A 1Y9QA 1WMEA 2BQPA 2IXIA 3ACFA 3U07A 4EWAA 5C33A 3BN6A 5A7SA 4XUPA 3VBUC 1MPXA 4QDRA 3U4XA 4AFCA 4P5HA 1W0PA 1COV1 5G04L 2OQ7A 3JBG2 3M3CA 3SQOA 5FAXA 3B93A 5T54A 4XTMA 4CDUC 1JMUB 2GH2A 1MS9A 1QDOA 3UKTA 1MZ6A 4LBOA 3WW1A 1D2SA 3SKVA 1DQ4A 1DZTA 2ZGOA 1QQP3 1AYM1 1QGLA 1NCRC 1UZYA 3NJYA 5CVRA 1GNYA 3KVBA 1GICA 4QXBA 4ZU5A 4EZ4A 1L7RA 3Q8FA 3NNFA 3DYMA 4FQ4A 4AL9A 2XONA 2ZHMA 3O1PA 4DZGA 2A1XA 3O1VA 3ETPA 3WG4A 4C90A 1ULFA 4LKDA 3GGLA 1ZM1A 5CKMA 1JYWA 1US2A 2X5IB 5CG8A 1XYOA 2A75A 4S2DA 1PMJX 1QHDA 4IXLA 2IXJA 2XBO1 1WLWA 3WOGA 3M1HA 1OQEA 1OT5A 4Q4Y3 1IS6A 3KB5A 1W6QB 3HN1A 2BZDA 1DYKA 5FY5A 4QGLA 4FTEA 3HEIA 1HB2A 4QPIC 3VD9A 1W6PB 2VUCA 4NPMA 1LHWA 1Y7BA 3PUIA 4OHVA 2PHWA 2YY1A 1AR82 3KV9A 4LK7A 1K3IA 4MH0E 4H14A 4JVAA 5IAXA 1WKYA 2TEPA 2OYZA 3VL9A 3O1MA 1HW5A 5C4WC 1HX6A 2DV9A 5CKNA 2UU8A 3T0DA 4EZHA 1QEXA 2CU5A 1ZREA 4OHXA 2HWE1 1YYNA 4XJUA 1GQGA 2W68A 4YZ3A 1HXS3 1OD3A 1OKQA 3WW4A 1Z7S2 3AYDA 3KV5A 1NOVA 3TB0A 3RZLA 3ASIA 4LTAA 3VD3A 5KWRA 1ZZ7A 3VBOC 5LB6A 4UF0A 2VECA 1GQPA 1OF4A 1MZEA 1E5IA 3WW3A 1F8VA 4CUGA 3I2FA 4GWJA 3WINE 1CAWB 1DLCA 4XZUG 2JX9A 5SV8A 1EV13 2A6YA 3ZIXA 5T50A 3HOBA 1AR63 1OLME 1RUC1 1OFNA 3HR9A 3QBQA 2ZKLA 4J1WA 4QAWA 5IUQA 4Z2WA 3H42B 4ZU4A 5T3NA 2R30A 3V56A 1QJU3 4MGSA 2GNBA 3GF6A 5CYYA 5ANNA 1Y9GA 4CDWB 1PVXA 2WT0A 1DF0A 5JI9A 2PMWB 1HJGA 2UWBA 1KRIA 2UWCA 3KS7A 3UGHA 1RUJ3 3VBFB 4QDQA 4MV2A 1VE0A 2O8OA 3WSOA 4WVVA 2GSYA 3BB6A 2HWC3 1JBCA 2H0VA 2OUJA 4RS5B 4YW2A 4CCJA 2ZX0A 2WLPA 4O61A 2IWGB 3H7YA 1RL3A 2XLAA 1GZWA 1UYPA 4DQAA 2JG8B 5FTTC 2QZ3A 5DZGA 2LALA 1MZFA 2DWRA 4L92A 1H4GA 2CTVA 5ABJA 2G19A 1JOPA 1HN1A 2G9FA 4RGKA 1EP0A 3HIFA 5EJZB 2VE1A 3K75B 4C91A 1D4M2 1LOCA 1N3QA 2R1DA 4WM8B 5IVBA 5JPMB 5I8TA 1ASJ3 1TME1 4YPJA 1SQ4A 1T6GC 1PMIA 2B5HA 5GLTA 4R9BA 2EXJA 3RZGA 1C57A 2D98A 2QDRA 3NW4A 4YW1A 4YM3A 1YI7A 4QB1A 4AGVA 1PNGA 5ACA3 5JWPA 5JDBA 2W9XA 2J1RA 3MO4A 3RVHA 5A3NA 2R042 2XHNA 3AC0A 3B3QE 3EJKA 2XB6C 5F39A 1F4AA 2B4KA 4XW3A 4ATFA 2XVLA 1GOHA 4HSLA 4UXAA 4XMIA 1UY2A 3U14A 2W2IA 4M0HA 3CDZB 1TZOA 3HMYA 5JAXA 2JB8A 1ND2C 4AVVA 4E2QA 5LRRA 1APNA 5LASA 4JRAA 4NVPA 3MIBA 4QX7A 4C1WA 5JVVA 1HN0A 1BMV2 1KFXL 4AGRA 2CHHA 1W0OA 2VQ0A 1M4WA 3AKTA 2Y6KA 4YFWA 1OPOA 3SCGA 2W1UA 1K5JA 5I0DA 3FUOA 1OVSA 1AZDA 1NCQB 4MGIE 5L9VA 4UW4A 5K0UB 1A6CA 4W6XA 2ZGSA 5LBBA 1JZ5A 4K8FA 1W8OA 4GD4A 4Q4Y1 1Q8SA 2GALA 4XBQA 4PIYA 4HOOA 1SFPA 2HWF3 2QZ2A 4NJ4A 3V0AA 2BP6A 5CB7A 1WW6A 5DZEA 4O9EA 3SH5A 2CDOA 4BCUA 3CZUA 2RS51 4ZY9A 4BOWA 2W87A 4LHLA 4YZ5A 4Y1ZA 3DYOA 1FPN3 1HV1A 4XIKA 1I5ZA 1NY71 1RUG3 4AQTA 5KHIA 2GC3A 3RWNA 1UMIA 1W6NA 4NR1A 3HT2A 3OBAA 4MXVA 4QQHA 2D97A 4L0PA 3VBSC 4CXXA 1DG6A 1CZVA 1H6YA 1RUNA 4XFBA 1QJY1 1HXS1 2WT2A 4UFLA 2WWSA 4META 1CWPA 4ZHNA 1NLQA 4H2AA 1PM7A 3I4IA 2V72A 4AG4A 5C6CA 2BNOA 2A70A 2EA7A 3OBZA 2OVUA 2VQAA 1SBDA 4GJZA 4DFSA 2PFWA 4J6GA 2W08A 3NV2A 2DCZA 3ZYBA 1Q8OA 3FFZA 1EV11 2VUAA 3WCRA 3WNLA 2CDPA 1RUF3 2VBPA 1AR61 4LHKA 3H9AA 4JGYA 4JZRA 3H1YA 4NUBA 1QJU1 4RQPB 3I8TA 4HMZA 3LZZA 1PK6B 1ZZ6A 4RR3C 5HXVA 4W65A 1C8M3 4XJZA 3P3NA 1PZ8A 3NVCA 5FPXA 1BK0A 2RS33 3PUAA 2YUEA 3BALA 2WSVA 2RE9A 2UWAA 1W6MB 2A5ZA 2V4AA 2Y6HA 3HNMA 3Q8CA 1MEC3 4BK4A 3QOPA 5JZGC 4Z2AA 3U0ZA 1PIV3 2R063 3HQRA 2W95A 3FE5A 1MQTB 1ULOA 1VRH3 4IGQA 4RFT0 1YEWA 3M3EA 1ULGA 4HG6B 2VNOA 4QU2A 5A7WB 3T0BA 1GP6A 4CEYB 3WEZA 5L7OA 2SBAA 5FZOA 4ASLA 3I3EA 2MEV3 3PJYA 3ZSKA 4IV3B 1OSGA 3DEMA 3TN92 4EN7B 5A32A 4ARXA 4GB33 4A2UA 4XEZA 1BYHA 3N9PA 4YWAA 3DYPA 3WF3A 2WZEA 4FPHA 2JWPA 3UL2A 1RMU2 1VBA2 2VZRA 2WZR1 4GH4A 4QT6A 2BUKA 2XHKA 4XJAA 2D40A 3KGLA 2Q8OA 4CVUA 1DFQA 4XXAA 1HRI3 2ZEXA 4K3UA 2VD7A 2W1SA 2WA3A 1ENXA 3FHQA 3GCWA 4S2FA 3A22A 4XJ9A 4BHPA 4ZPIA 2D93A 2DCTA 3OEAA 3FFQA 2ZGLA 4M4PA 4YW4A 1YRZA 4D0QA 1ENQA 2IC1A 1OA4A 4L9BA 4BLIA 1GWKA 3DL3A 2D5FA 4N9IA 1UF2C 4CUAA 1S0EA 1OXCA 4N43A 4R9AA 2EAAA 3AMMA 1TG7A 2LM3A 3ROUA 1AL23 3KM5A 1UYZA 5DG2A 1H1MA 1UNBA 2BYVE 2DVGA 1QQP2 1GYKA 2R0HA 1D0GA 2YGLA 2VZQA 4R4ZA 3KWVA 4RHV3 2W5FA 1X9PA 4AVCA 1QH6A 4WVZA 5I93A 3W5MA 3ZIWA 2VXJA 3FC0A 4IV3C 2VZOA 2HWB2 3E6BA 1NA1B 3KT1A 2GC0A 4NIGA 2VZUA 3D0JA 5K7PA 2IFWA 4DY5A 2OPWA 4ZS3A 5A7NA 2ARAA 3E1F1 1FPN1 1WCDJ 3AP7A 1UIKA 3MV11 5BPXA 2BGPA 2WWJA 3SNMA 3DF0A 5C3QA 5FMOL 3AX4A 4NHKA 4AXOA 4F8AA 1VBE3 4MXWA 1S55A 2Z4FA 5F5IA 1SHWB 1BEV2 1FOD2 1JOBA 3ZDSA 4GQ7A 4SBVA 5HBAA 3PVEA 1S0JA 1AR91 4XETA 4P00B 3ZFFB 1W8UA 2QJVA 1WWYA 1CAXB 3CJIB 3IPVB 1CPNA 1LOAA 1QDCA 2VVDA 5F2WA 3ILNA 3ZMNA 3ALQA 3IAPA 2UYBA 4CCKA 2E7AA 4DMIA 3JU9A 4N53C 5LY2A 3CIHA 2JIGA 2ADDA 2WO1A 4S2HA 5DAXA 4QX8A 2JECA 2QDNA 4GXLA 2RR13 4OZOA 3IBMA 4Y20A 2F4PA 5FV3A 4IEZA 1DDLA 5EQUA 2K9ZA 4XUQA 1F35A 4XOGA 4LQRA 5JMOA 1IKQA 5EJ1B 2PA7A 4XDOA 5BNOA 1SLAA 1XNTA 2DUPA 3D6EA 3NAPA 4WVMB 1C8M1 1CESA 1E5RA 1C5IA 5FZFA 5IK5A 2Y34A 2A73B 3OY8A 5A3TA 2VMIA 3TEWA 2WBKA 4NIHA 3VD5A 2TUNA 1C5HA 3PVOA 3Q8BA 2QE3A 1IOAA 1NLSA 4O65A 5LZ6A 4DUWA 4JKLA 3K3OA 1MEC1 3N7KA 4IE4A 5HI0A 3O1OA 1QIQA 4CP9A 1VRH1 1U5IA 1EY2A 2FMYA 2BOJA 2TBVA 5E8AA 1AJOA 2PHFA 2Q1ZB 2IZWA 3ZYRA 1JZ2A 3GJBA 5FUIA 2PAKA 1LTEA 3LSEA 3PUSA 4GB31 2Y60A 1UWWA 1RUJ2 4Y4YA 4AEDC 3WZ1A 4B1MA 4FSJA 1QMJA 1UZWA 4YW6A 4X6QB 3ILRA 2HWC2 1DQ0A 1GOGA 4QPGC 1FMD1 2VPVA 4OYUA 3AYCA 4BIOA 1UW8A 1BCXA 1IZ3A 2Y0IA 4BXFA 2GN3A 4Q4V3 2G1MA 3M7AA 5DZFA 1U5XA 3I7DA 4YVWA 5F2SA 2WNOA 3A21A 3R0RA 4LOSA 3RZHA 1DZQA 1A3KA 3LDKA 5AFBA 4CZSA 5FZEA 1VBC3 1CIWA 2XJSA 3NJVA 3H50A 1ASJ2 3VGIA 4CEWC 3ZFGC 4PF1A 2D6KA 4KBZA 2PLV3 2W92A 3LFMA 1GNHA 4KWLA 5FYIA 1E5HA 3K77A 1I6XA 4MHRA 5FFOC 5A1LA 5FUNA 3VKNA 1C1LA 2ZGRA 1DYPA 1SBFA 1GU3A 1NXD1 2WAAA 3AXEA 3J26N 4G9SB 1F31A 4ONUA 4CCMA 2WNEA 5ACA2 1CONA 3SITA 5DPNA 2D6OX 2ERFA 1AL21 4I0BA 4LEJA 4PT6A 2QQJA 2XJPA 1RVF1 3MIDA 5BNPB 3UGFA 2PHXA 1D4VB 1RUD3 5FO7B 2VMGA 5T52A 1JH5A 3VD4A 3VBHA 2WDBA 1VB4A 4E8CA 1VAVA 1TE1B 4KNCA 3QACA 4FCAA 2WNVB 1SFYA 2HEWF 5JSRA 1DYOA 5EV7A 3RRDA 2Q30A 1QOOA 2WLQA 2MHFA 3POJA 5CFCB 4YGDA 1OMIA 4XQWA 4HL0A 1UOGA 3AZYA 5C3OA 2W0XA 3ZLIA 4V1PA 1W3VA 2ATFA 3RZMA 3NNLA 4LNVA 4D3WA 4EN8B 3V64A 1GZ9A 1VBE1 4W8JA 1H4HA 3M2MA 4JKKA 4P14A 4DXZA 2C4XA 4AAPA 3T08A 2H6CA 3VZOA 1AYN1 1O4TA 3CMGA 4QDSA 3LGRA 3ZXEA 3IIAA 3K4ZA 4LJHA 4Y1YA 5J1XA 3AKSA 2HWF2 2XQRA 3BCWA 5CG9A 4LBNA 4QXKA 4HN0A 1V00A 2VUDA 4YM0A 1Z0HA 1OLRA 4I0AA 4OHZA 5LY1A 4BA6A 2JG9B 4BMEA 1WMXA 3QLQA 4JGZB 2E7TA 5JR2A 1STMA 3POSA 3VN4A 1RUG2 2VMFA 2VCCA 1UX7A 2ZEZA 1RTVA 2D7FA 3U11A 3RZKA 1EAH2 2PHLA 1F4HA 4Q0QA 5F6KA 4HPKB 1ZRCA 1QJFA 1AF9A 2RJLA 3M3IA 2CL2A 3KV6A 2YC2A 3T2QA 2ZX2A 1E5SA 3AZVA 3WV6A 2F4LA 4IESA 4AHWA 2ZJCA 1RUE2 1CGPA 4BK5A 2DBIA 3AMHA 4SLIA 2XQXA 3OD4A 1REFA 2WNUA 2O1QA 2VH9A 2Y8KA 1IG3A 3ME2A 4COYA 5F5AA 1LOBA 4DRVA 4HVOA 4D7TA 4L2NA 2QCSB 5HCFA 3VHOA 2FD8A 2EIDA 3CZJA 1RUF2 1WLDA 1PGW2 3J8F1 3ZXGA 4OVEA 3KZ4C 1LOFA 2IVJA 2ZX3A 4LR4A 4AEMA 1CR7A 4CTEA 3E5XA 4LBJA 4LOTA 2VCBA 4RD7A 5LEJA 1XE8A 5JPNB 1L3JA 3UETA 4IW3A 1AX1A 2RVAA 2RS32 1HB4A 5I91A 4QQOA 1J1TA 2HLEA 4B7EA 2H0BA 4JGZC 1B35A 3KMHA 4AZZA 4OCTA 4D7SA 1COV3 1CVNA 2WSUA 3C7HA 3IMMA 3PIJA 1YI9A 4ISQA 4EN0A 4YZ1A 1PIV2 3ZSJA 2JD9A 2R062 3ZXLA 4A44A 1K5MB 3ACLA 3FHAA 1W04A 4AF9A 1D7PM 1FX5A 2RS12 3RGBA 4NIAA 3DPRA 1JYCA 1V6NA 4JDNA 1S2BA 2MEV2 3DXTA 4CRQA 1O3QA 4WZFA 5LBFA 2E33A 2JDHA 3OF1A 2NYYA 1N1VA 4ZKTB 3QCWA 4LIUA 1Q5OA 1QOSA 3D5OA 2WZPP 4FPCA 2HH9A 3GZTB 1IQDC 1R1ZA 3OEBA 1K12A 1MVEA 3WDVA 5FOBB 4Y4RA 2DURA 4DOUA 4ORFA 2FZ1A 2YYOA 5A33B 4UW6A 5FDBA 5L9RA 3ZYHA 1HRI2 3BIEA 3T3YA 4JCKA 2VOWA 2VQTA 1R092 4AYUA 4XDPA 4ZZ5A 2A6XA 4IV1A 1PZ7A 3BU0A 2NQYA 2VW0A 4DY3A 2P4EA 3TEZA 2R073 3U37A 2CWMA 2VBDA 3RYKA 4Y22B 1JW6A 5J3UA 2B9UA 3I97A 3MPBA 4CSWA 1J59A 1Q56A 3WNKA 1R1A1 1J84A 4KGQA 5CA6A 2RHPA 2LROA 1H8TB 2IUWA 1ZBE2 5EYYA 3HQUA 3D82A 2E63A 5E16A 3CF6E 1O59A 4RSUA 4QKFA 1S2KA 1ST8A 4RHV2 3RNSA 4Y33A 5BUVA 3NWKA 2CGOA 5FPVA 3WQ1A 2C0ZA 1SDDB 3KGZA 2XJQA 5IVCA 2HWE3 4LHSA 4EWEA 2Z69A 3PVNA 2XG3A 3UV9A 4YFZA 5FXXA 3RZZA 1XJAA 3LPGA 3LSDA 3AP9A 4TLGA 4BH9A 3VBUB 5FYTA 1ZRIA 2W3JA 3I59B 4NRPA 2W94A 4X8PA 3WR0A 4FTBA 4TYSA 5A1AA 1OA2A 5L19A 3NJXA 4YGEA 3VDAA 4AHXA 2JDZA 1O8PA 4CDUB 5IYYA 2J1EA 2OZJA 3AKPA 4COZA 2B45X 2QNKA 2JE8A 3LD8A 5I0SA 3ZYPA 4NIDA 1JYIA 5DDJ3 1XYPA 3N7JA 4KQ7A 4PDWA 4X8NA 4XURA 2GZWA 1NCRB 3BYWA 3JB4C 4IGPA 4XBNA 3VBRC 2UURA 4IEVA 4OI0A 5FYHA 1AHSA 4MGQA 4DPNA 5LEKA 3THTA 3OGJA 2FDFA 2A6WA 1GWMA 4KG8A 1W99A 2VZ3A 4IETA 1IG0A 2WS92 2RR12 4YGCA 2YBPA 4FPOB 4M00A 4WM7C 1V6LA 1VLNA 3KSCA 1GMMA 3LFIA 2VR4A 4HBNA 1W6QA 1D2QA 1YFUA 4Y26A 4IEWA 1DLLA 1BXHA 3POGA 1S0CA 4FPYA 4JHZA 1R081 5FPUA 1W6PA 3SEEA 3OOXA 5C9AC 2W47A 1Q8QA 4HKWA 4ASMB 2X05A 4AVAA 4XC9A 1ZBA2 3MF9A 3POIA 3W58A 1PVC1 2HKXA 4FOVA 3WVJA 1JXNA 2JE7A 3DV8A 2EVXA 1LOFC 2EIBA 1BBT1 4E4DX 1TME3 4QPIB 4A42A 1H1IA 2D44A 4CP2A 1A8MA 1PX4A 2GMEA 2VOXA 5IK7A 4FOQA 4XUTA 4MHUA 2WR9A 3CEWA 2LTNA 2QQKA 2Z42A 5ERLA 2BFUL 3R4UA 2CGNA 2C24A 3H3ZA 3T1LA 5C4WB 3WLUA 3PHMA 1N1TA 2VNGA 1KJRA 4BQXA 2VMCA 1CAWA 1XSRA 4OFGA 1ODMA 5FZGA 2OXBA 5CISA 3ES4A 3I2HA 4XF0A 5LK5A 2BOIA 2JDNA 2KXLA 3LEGA 1V9U2 3VBOB 3ZPYA 3H7JA 4Q0PA 5DN2A 4YZ2A 5AC91 3BOWA 4Y1XA 2ZZQA 3OPTA 3S0MA 4Y3OA 3I2OA 3A0NA 5FYSA 3U78A 5EJ3A 1QJZA 1QH7A 2VW2A 2EAKA 3ZKYA 4CDWA 2WA4A 4Q4V2 5FRAA 3N3HA 3EHKA 3K51A 2F6BA 3KQRA 5H9QA 4Z1VA 4RGGA 1LHNA 5JXHA 5H9RA 4Q4X1 4OQ9A 3VBFA 3AKQA 1XU1A 4YW7A 2ID4A 5J37A 2R071 1VBC2 3K48A 1RHI3 3GHMA 1QXRA 1WLTA 2X53S 1G9BA 5HPOA 2PLV2 4XCAA 2JB4A 5F32A 2PHDA 4IV1C 3WUCA 2RS53 1XOYA 2JG8A 1O3TA 4QX1A 4R4XA 3E5QA 2GC1A 4O7XA 1GZCA 4OQ8A 2FMDA 4UFMA 4MX3A 4UT5A 1PGL2 5CFDC 2RDQA 4HSJA 4AI1A 2WWUA 4QQPA 3ZFEA 4LUMA 4BWOA 2QTWB 1FXZA 4GWNA 1G9AA 4WM8A 3OB8A 5APAA 1MS3A 4FPLA 4YVSC 2ZMKA 3W5NA 1WA6X 2C5DA 2E7QA 1QJY3 5E1RA 1M06G 4QXHA 5GLWA 4NWVA 3R6SA 1S0FA 2PHTA 2Y6JA 1YQ6A 4DS0A 1ND3C 1UAIA 3B00A 4CCCA 3S57A 5JUVA 1XNKA 1KS5A 2VMEA 3LDBA 4UBGA 3HQXA 4PLMA 4QB2A 5C71A 1RUI3 3PNAA 4JKMA 4BPZA 1W6OB 2AEYA 2JDAA 2QBXA 5FYZA 4CU9A 4N90A 4A6SA 1W8WA 5FPBA 1BVP1 1YJKA 3OBTA 4ASKA 4QX2A 4QMAA 3FLPA 5J48A 3WDTA 5DDJ1 2CAVA 1CAVA 1TMF2 4KL1A 5KXDA 2P3JA 3KVAA 4XJWA 1GNZA 2OZ6A 3E97A 2GC2A 3HAGA 2OUHA 2ZGTA 3OGSA 5D8AC 1NX9A 2A3WA 1ND2B 1WBLA 5J7MA 3MIFA 4RFRB 1NCQA 2W39A 3MI8A 5DAPA 5H9PA 3RJ2X 5K0UA 2D3PA 5DUXA 1WD3A 3KHBA 4PDWC 2BBVA 3IAQA 1V70A 1GBGA 3NSTA 4KH9A 3OPZA 4Q27A 1LHUA 1Y9MA 4QGMA 2WFF3 4J1XA 2RMU3 4B8EA 1JU4A 2OQ6A 3FMGA 4LITA 4PQ9A 4LBQB 1POV3 4QPYA 4ZONA 4NAOA 1HB3A 1OLMA 2XWBB 3VDDA 1RIRA 4YW3A 4DXRA 3U1XA 5LRSA 5LBEA 5IAVA 3INAA 3CKHA 2RDNA 3HD8B 1DU3D 4W4ZA 1H9PA 1VBD2 2WZ8A 3U4SA 3O7OA 3AK0A 3JUUA 4KU7A 4IE7A 3U10A 5IT6A 1EPZA 5FYYA 3WF1A 4H3WA 1JYVA 5FZBA 1UIJA 4OI4A 4QQLA 4LBMA 4JDMA 4DIQA 3WNOA 4Q26A 5ANQA 2WZR3 1I5PA 3W9AA 1ENRA 3B94A 1AX2A 1SPPA 2ZACA 4RN5A 3WHTA 5M0TA 2GNMA 1H2MA 1LECA 1UY4A 1POV0 2ZGKA 3OTFA 4NHXA 3VBSB 5KHJA 1WCSA 1QJEA 1IHMA 1UPIA 4BXSV 4AQSA 3BVCA 2KA3A 3EQEA 3P6BA 2Y0OA 5FZ0A 4BE3A 1W05A 2Y33A 1UMZA 3POEA 1S1AA 4URAA 1COV2 1YIFA 2P17A 5GALA 3NV1A 4OUMA 1AJKA 1SLTA 1YWKA 3MLKA 4HZFA 4RQPA 2PAMA 5BNNA 5BY5A 2YFUA 3NMBA 5K4LA 4K6BA 1W9FA 4JQRA 4AI0A 4PBOA 4AHZA 3MDPA 3O0XA 2HWD3 5FYMA 3VHRA 3ZPOA 4AI8A 1GWLA 3NV3A 1JU3A 1AYM2 2HBTA 4A3ZA 3OD0A 1RHI1 1SLLA 1W6MA 2JDYA 1Z78A 2ZEYA 4JAAA 4RR3B 4B1LA 1B09A 3J4UH 2JDKA 3NRUA 2BPA2 2PQSA 3AMQA 3APBA 4A4AA 1OD5A 3TBDA 4I3GA 1MQTA 5EFUA 5C8CA 4IEQA 4ARYA 1ULCA 4YYOA 1HB1A 4CEYA 1H8VA 1MS0A 5FZKA 2CWSA 1Q8VA 4O9GA 2XLFA 5JZGB 5A6XA 1BVVA 3RPQA 4BQ4A 3WDYA 3WXPA 2P3YA 1JZ7A 2XBO2 3I2DA 5AVPA 3IM0A 1X9TA 2B42B 3L9JT 5GJ6A 2XVGA 2ZGNA 5LA9A 1JS9A 3Q8AA 4M4RA 2XLGA 2G9ZA 5LBCA 1AR93 5EIYB 2F17A 4GZ9A 4P9YA 2XKOA 4PIXA 4Q0UA 1WCUA 4S2GA 3ZFEC 3IDAA 3WNMA 2DF7A 2VQUA 3IN9A 1JODA 1OOPA 5D2AA 4KWUA 5DAQA 1RUI1 1SCRA 5GZFA 3B9CA 3UESA 1SBEA 3C7FA 3AKRA 2W1WA 4QM8A 5BYNA 2ZX4A 1LEDA 4CU8A 1VRBA 3FZ3A 3IDEA 3KT4A 5FQ0B 3H1WA 2ES3A 4Z8BA 2HWE2 5KXCA 4FTSA 4CCDA 2AEZA 1PO11 4BM8A 3PMEA 1N3PA 1YFYA 3USUB 4A7YA 3ZKUA 3SLIA 5IVYA 2D43A 1ZZBA 3WQ0A 1PM4A 2Z5WA 5CIRA 4PLOA 3GBWA 5DUUA 2WFF1 3RMYA 2RMU1 3JD71 4AOCA 1POV1 2YHJA 2EF6A 1WMFA 1NA1A 1RUC2 2ZAHA 4NHMA 4XYXA 3ZR5A 3NKGA 3RI9A 2WO2A 3EB7A 3MV01 4FP2A 3J7HA 1EUTA 5CBLA 1ZRFA 3BGAA 4FBFA 2VM9A 3KT7A 3PU8A 2NMOA 3WF4A 4W50A 5IVFA 5HXMA 4FFHA 1OUSA 1XNCA 2DFCA 3D0SA 3RZJA 2AR6A 4XQDA 1CZSA 5ABJC 1KGYA 2NP0A 4CCEA 1OA3A 3MEPA 1FMD3 2J1AA 5EPAA 3HPNA 3ON7A 3ZO0B 1CAXA 3T09A 3MPPG 2I74A 2Q4SA 1RYYA 3J7LA 5C5UA 3MBWA 1NG0A 4NOTA 1P8JA 4K20A 3UJOA 3C2UA 4OLLA 1PO21 2DVBA 3CL1A 4FP3A 1WBFA 1RITA 1TME2 3H8UA 3ZN6B 5FBZA 3MZHA 3BPSA 5FZ1A 5FJHA 4N53B 5DAWA 3FWEA 3H3UA 1C3HA 3P1IA 3S6PA 3HBKA 1AUYA 2OW4A 3VKOA 4WVMA 1KDMA 1AVBA 2K0GA 2YDEA 1RVF3 2HWD1 3RI8A 2CSGA 4YGBA 4L8QA 2W52A 3GZUC 1U12A 4XUNA 1OLQA 2D6PA 3PURA 4MZUA 1W2TA 1URXA 4JTOA 2B46X 3ELNA 5FP4A 5BNNC 4RL7A 2YPJA 2BERA 1LHVA 1GUIA 1RJ7A 2UY9A 1IQAA 2XUMA 3WDWA 4XPVA 4K9SA 4KMQA 4HK9A 4TZDA 2FDKA 2ZHNA 5L36A 5FZ4A 5F3GA 1MR5A 3WQBA 5IK8A 4HXCA 3I3MA 1YQ2A 2HEVF 2GH8A 3AL6A 3ZR6A 5C8CC 1LULA 1AYN3 3WQ7A 1AX0A 4Q4Y2 3VZJA 3URFA 4NRMA 2DVDA 2BRTA 4CA9A 1VBB1 2I45A 2JENA 5JI7A 5IFPA 3POYA 5FKCA 4AEDB 4IE5A 4AVBA 4D6RA 4UBHA 2RS52 5GZEA 2Y6GA 1JYTA 3IZOA 4XF9A 2A3XA 5L7OB 1X36A 1JTZX 5FZOB 1NY72 2P3IA 1JUIA 1NYWA 2IFRA 2Y26A 4QPGB 1G9CA 4NRQA 1ZRRA 4R8HA 1OQDA 1X8EA 3KF3A 3R4SA 4Q4W3 4NWWA 1PGSA 1UL9A 5FJKA 3MYXA 1QJY2 1RB8G 1HXS2 4CXWA 4Q5OA 4MGYE 1G9DA 4G3YC 4B7KA 3N7LA 4NPRA 2Q1FA 5J98B 4CEWB 3ZFGB 5K8SA 3T30A 4AFBA 3ITQA 4JGYC 4UFKA 2IXCA 2VOTA 1WCQA 2C26A 4TSVA 1V6JA 2B9VA 4C1XA 3M3QA 2PAEA 4XQ4A 1JZ6A 1PZ9A 2HJIA 1FT9A 1AR73 4U36A 1ZA4A 2WNVA 3UKNA 4HVRA 1EV12 2AENA 3N9NA 1ENSA 3MIGA 1YNAA 2BGOA 2JXAA 4I09A 1YXWA 4FFGA 1AR62 1UYXA 1A8DA 1DQ6A 1OH3A 1GOFA 3J8F3 4XIOA 5FMCA 5CFCA 2DCJA 1QJU2 3RFRA 2EICA 3AVSA 5FZ7A 3VD7A 1HRV1 4XFAA 1CIYA 5IVJA 3POBA 1LAJA 2AACA 1LODA 3LCPA 3WG3A 2AUYA 5FZ6A 2BEOA 4BQWA 1SLIA 5IJRA 5L7OC 1PHMA 2XWJB 4BZ4A 3VLBB 2RM21 3JBG3 5FP3A 5J36A 5LW9A 2G4IA 4X6RB 3PJQA 3KD4A 4BYYA 3AZWA 2J1UA 5EZWA 2JG9A 1OH4A 2JJ6A 4YNIA 4A41A 1NLRA 4F7ZA 3DKWA 1GP4A 4XTPA 1O7FA 4GH4C 3NJZA 4UFIA 1U0AA 4TWTA 1W39A 4MOAA 4NIIA 4OI2A 1DGWX 1DHKB 4W6YA 2PYTA 4OHYA 1TNRA 5D1IA 5T5JA 4P9GA 3MW2A 4CP1A 2A7AA 3RQ0A 1H2NA 2WZR2 2ZABA 4ZXKA 1OKOA 1W9TA 5GLUA 4AI2A 3I49A 4HFSA 4LULA 3FL7A 5T55A 3IMNA 2MPFA 3DUIA 4FAGA 2DCKA 1BZWA 2YBSA 5DUVA 2QFEA 5IWFA 3AZZA 5F1RA 1QU0A 2ZBJA 1XNDA 3BODA 4N7IA 2VC9A 4QM9A 1VAMA 1Y3TA 1QXPA 2PHUA 3MGUA 1RC6A 3PUHA 4FPGA 4N43C 2R7EB 4QX0A 4Y20B 2VMDA 3T0AA 5LA1A 3GJAA 4FT8A 2GP5A 3PVBB 4NE9A 1HQLA 1R1A3 5BNOB 1JYXA 2R32A 2WQZC 3NAPB 2XMLA 3O0WA 1OQ1A 5FREA 2VL4A 3N9QA 3PLQA 4ZXEA 5CAZA 1AR83 2CYFA 4HN1A 4IE0A 2P34A 1UQXA 2DVAA 4XJ8A 3PMSA 1JZ3A 4YZ4A 3I2IA 1YO8A 2JDUA 3M3OA 4I30A 3SC7X 2QQOA 1H0BA 1JI6A 3IT8A 1TEIA 4D8MA 5EHDA 3OUIA 4NAMA 1HV0A 2OX0A 3SH3A 2OT7A 3TYJA 2I07B 2Y38A 5JLVA 1K5MA 4FPFA 1T6BX 3GHNA 3H0OA 1DIWA 3M4FA 1ZVFA 3Q9OA 1FPN2 1ULDA 3THCA 4M3CF 4XAAA 3GALA 5BV6A 2J22A 3QH7A 5FXZA 5J96B 5EXOA 2WYSA 4CCNA 4GMP1 3PUQA 4ITCA 4CDQA 4Q4W1 3HBZA 2GNTA 1W2UA 4P9XA 1Y4WA 3MFCA 5HV4A 1RUH1 2DTYA 4XFHA 2BVBA 1AR92 3NL1A 3TRSB 3W21A 1UMHA 4UW5A 1UZVA 4UWDA 4TTGA 3FUQA 2PHRA 5B4XA 2OKXA 4COWA 4OUEA 5A33A 5LATA 4M3CE 2YGMA 2BU9A 4QU1A 2E53A 3OGGA 4ES8A 3DCQA 2QUOA 5BNOC 2YU1A 2ILMA 3NAPC 1AR71 1FAYA 4HKLA 1V6MA 2WQ8A 4OULA 5F7UA 4Y22A 4UYBA 3LKJA 3PDQA 3MIHA 4UFJA 2EXIA 2C1FA 4B4QA 1SLBA 1X8MA 1UX6A 1R083 3BIWE 1TQ5A 1H8TA 1C8M2 1O5LA 5DABA 1LJ7A 1QJX1 3USSA 5E88A 4AI9A 2VNRA 2DYCA 4QHBA 1AXYA 3HT1A 1VR3A 2ADEA 1PVC3 1ZBA1 2GP3A 3BOPA 1D4M3 1GR3A 1R64A 1BBT3 1XU2A 2ETEA 2X10A 3VBHB 3OJBA 2GNDA 3ZXJA 2JIJA 2EIEA 1MEC2 2RG4A 2FDJA 1WW7A 3AMPA 2OIIA 3JBG1 3UKVA 5I8YA 5FMOS 4GAZA 1VRH2 3AMNA 2C6SA 1ZZ8A 3S5QA 4HVQA 3VBUA 3C7EA 3RYPA 3WUDA 3GNEA 2V09A 5I8SA 3MICA 3I59A 2R043 1PX3A 1X50A 2EALA 4OI1A 5ISLA 4GB32 3HJRA 5GKAC 4BIFA 4CDUA 3CNAA 2NLRA 3BTZA 2JD4A 5AC93 2V5DA 4YVWC 1J58A 3ECQA 4H55A 5FLIA 3I54A 3EMRA 4B4RA 4E4SA 1FMD2 1IPSA 3BUCA 2WFPA 3AM2A 2WUHA 1NCRA 5FY0A 2QQVA 5T5LA 5A3PA 4NN0A 1NE6A 4Q2FA 3JZVA 2RDSA 3EYPA 4W6WA 4AQ2A 4CDXA 4Q1RA 4AEJA 4Q4X3 2XGXA 1LCLA 1O4YA 3VBRB 2P1BA 4P5YA 5I0RA 1H9WA 1NQDA 3LF7A 1RXFA 4LE4A 4P9WA 5FZ9A 4QPWA 5DG1A 3FBYA 3POFA 1GFF2 5E6HA 1NZIA 1YUDA 1S2EA 3VBHC 4C0BA 5C5TA 2K2SA 5FWJA 2WKKA 2HYXA 2V5YA 4MGZE 1AL22 3BPZA 1WMDA 2O0OA 1FNZA 3MLJA 1RVF2 4WM7B 4YRDA 5GM0A 2YU2A 4M3CB 3LA3A 1H6XA 4BQ2A 2ZGUA 1AR81 5A6ZA 1GV9A 2O14A 1SZBA 3AP6A 5FPZA 4Q8KA 3L2YA 2P37A 5C9AB 2BTVC 1S0BA 3AXDA 1UO9A 2I2SA 1CAUB 1Z7S1 4LORA 2ZMLA 5FO8B 4BQ1A 4IDZA 1KFUL 5C4WA 4LBQD 4CPBD 4DO0A 2E32A 2R49A 1H30A 4FFIA 2C9KA 4IQPA 4NO4A 4XFGA 5DQ0A 4I2OA 4UFHA 2XVKA 1VBE2 4AVSA 2BVVA 1C8NA 4GJYA 4D6QA 1UKGA 2YBKA 3ZYIB 3RG0A 2FHRA 1AYN2 5BXXA 1O5UA 4Y5Z0 1GZTA 1LGNA 1W8ZA 2QQIA 3V0BB 3WG1A 4LO7A 2D5HA 4CDQC 3UJQA 2ZEWA 4CU7A 5FO9B 2X5IA 1N1YA 3BU7A 5F5QA 3VHNA 3ZYJB 4DB5A 5LCWL 3KHCA 3WDXA 3N36A 3SEPA 2ZZJA 2E26A 3B5LB 2FCUA 2WT1A 3WW2A 4YG3A 2AC1A 4P9IA 4GWMA 4N9HA 3T2PA 1HLCA 2DBNA 4A45A 3Q8EA 1UY1A 3MLLA 1W06A 2D6NA 2WNUC 2WC2A 5I0UA 3LA2A 1DZRA 3LWCA 4EQVA 4NHLA 2WABA 4A3XA 1O4ZA 4EV0A 2Y6LA 1WGPA 3J7NA 3K4AA 5H9SA 3I2GA 3RSJA 2EXHA 5F5CA 2VBBA 4JHTA 5FYCA 1EYBA 1D4M1 1VP6A 1C4RA 1NT0A 3F2ZA 4IV1B 4Y5SA 2D3RA 1XB9A 3TN93 1EPWA 1YFXA 5KR7A 1C28A 2LRPA 4FFFA 2WL1A 3LE0A 1J83A 2D6LX 2QQUA 3B01A 5CFDB 1RUOA 3H3LA 4FXGB 1MS1A 3J8F2 4Q29A 2DDUA 3AJYA 2B7YA 3JXSA 1QY4A 2BV4A 1HDKA 4YVSB 1F9KA 1B35C 4QD2A 3VDBA 1UXXX 5A80A 2R041 3ZN4A 3H1MA 2IXKA 2IVIB 1W6OA 4CU6A 5GZDA 4KGGA 1WW5A 4TN7A 1ND3B 5JIUA 1I1EA 5JOWA 3LOIA 5TSWA 5A1FA 4QKNA 4QKBA 4AW7A 3DPRC 4GKYA 4I02A 3R4DB 2FDIA 2ET1A 4J25A 2FCTA 5FCCA 1UU5A 2XOMA 3LAGA 4XDQA 4Z82A 1REDA 5HCBA 1NXMA 2AH2A 2JKXA 4BQ5A 1BMV1 1O8SA 3GDBA 1NKGA 4LLOA 4YM1A 4PBPA 5C70A 1TNFA 1S4CA 1ND2A 3OCPA 3OSDA 1Q8PA 3OYWB 4COVA 1HIXA 1UD1A 3O1UA 5KHHA 4QQ2A 2BDRA 1MVQA 4WVWA 4K8RB 3AFKA 2ZXQA 3LEIA 1CPMA 3AP4A 3AZXA 3VZKA 1W03A 5JSOA 3FN9A 2KR2A 5D8AB 4K7JA 4RS5A 4RGAA 5FZLA 4LBQA 4CDXC 4CPBA 2HWB3 3SHRA 5HCHA 4ISRA 1DQ1A 2A71A 4PDWB 1RXGA 2XH6A 4E2SA 2P2KA 3SH4A 3CO2A 1YQ5A 3UNPA 3BKZA 1PNFA 4R9CA 1LU2A 1A34A 3BTXA 1RUD2 4P9JA 3VZNA 3O12A 4QKDA 2DUOA 2GDFA 1FV2A 4E8DA 3S5AA 1XSQA 1HJFA 2ZGQA 3GBFA 4FOYA 4OUSA 4Z92B 1W28A 4QWNA 1KXGA 4UI9L 1BEV3 1FOD3 3T1MA 3EO6A 1DGWA 4JV4A 5FY8A 1CQ9A 3ZVXA 1ZYBA 4XZPA 2DUQA 3I2KA 3WF0A 2X09A 5EYXA 1R1A2 1RINA 3D3AA 2X29A 2JDMA 2ZGPA 2WINB 4ZZ8A 3VBSA 1FI2A 4XUOA 4MYEA 3TAYA 3AYEA 4AI3A 1FATA 5C3SA 2R6QA 2JKBA 1IS3A 1JN2P 5FY9A 1LENA 1ZX5A 2IXLA 4BU2A 1FYUA 5IW0A 1W9SA 3LPFA 4Q8LA 1VJ2A 5CKQA 5GZGA 3FJSA 4AAXA 2XJUA 4XE9A 2VGDA 2FBEA 1BHGA 3IIIA 3JQWA 2WIIB 3HNBM 5FMBA 4MVTA 3WNNA 1WCKA 1DP0A 1NE4A 1PO13 2ARCA 2PXJA 3QH6A 5A7PA 4ATEA 4FO9A 3G6JB 3ENRA 5CEHA 4LA3A 1UOJA 4LPLA 4XFFA 2FDHA 3E5UA 3NKTA 1LHOA 3ACGA 4FQZA 5JOZA 4N8MA 2ZPXA 4INDA 2VY0A 2JICA 1F5FA 1QXJA 2GMMA 4PLNA 3TEXA 1LKNA 1OBNA 3OPWA 5LA0A 2NZ9A 4NROA 1W2NA 4RR3A 5FPLA 1AXZA 3JD73 2X5IC 1G7YA 3EXUA 1O3SA 3WP5A 4GWIA 1FV3A 5F8PA 3AL5A 4LK6A 1G86A 4B4PA 4YSFA 1SFNA 1SDWA 4DINB 1OHFA 3OGVA 4PI2A 4URTA 1W2AX 1KDKA 3PTYA 3L2HA 1XE0A 1D0HA 4M01A 1IS5A 2ORZA 1IPJA 2VAUA 4KG0A 5JZGA 4JDOA 3PTRB 3TN91 4K1YA 3N7MA 3OUHA 3W59A 4NHYA 2J1SA 3B69A 3BTAA 1LOEA 1WD4A 2ZA9A 2VNVA 4XF1A 1DBNA 3LEKA 5DAVA 3RYRA 1ZA7A 1RMU1 3CBNA 1VBA1 2IXHA 3MF6A 4XMAA 3ZXKA 3J9SA 4AGGA 4FVVA 3WP4A 1LOGA 1DGLA 2RJ2A 3RDIA 5JXJA 1R082 3N4MA 3E6CC 1YC61 2P5BA 4EJRA 4IEYA 3TOJA 1IPKA 1PO23 4PQQA 1XRUA 4UAPA 2XR4A 4IL7A 1PVC2 3PU3A 3ZFEB 2YC4A 4MADA 1JHNA 5DXDA 1BBT2 3DKQA 3KCCA 3SCHA 1WLCA 3O5SA 2QVSB 5FQ0A 3ACIA 1JHJA 4YARA 3ETQA 4LKSA 1PK6A 5KHKA 4AQ6A 5JXIA 3VKMA 1LRHA 1H2KA 3KV4A 1J3QA 3D4KA 3USUA 2HEYF 2OS2A 4UF0B 1UKRA 2VG9A 2VZ1A 4JQTA 2YROA 1QQP1 4I3PA 4AFDA 4C0HA 4COUA 5FZMA 1N47A 1UU4A 2R1BA 4PF5A 1Y43B 2D6MA 1YFWA 5FY4A 4CDWC 4OZXA 3G7DA 1NUKA 3I3QA 3HNYM 4WV8A 2HYKA 2VMHA 5AC92 4R9DA 2HWB1 1POQA 1CAVB 4IEOA 4LIVA 4XAEA 2R16A 3VBFC 1VPHA 2ZOEB 3FLRA 5A7WA 3WP3A 2Q0AA 2ZMNA 2BNMA 1QNWA 2DU0A 4BLJA 3E6DA 3ATGA 3ES1A 4IV3A 4RS5C 3A0KA 2V4VA 1L7LA 3N9MA 4GALA 4Q0SA 4Q4X2 5FK8A 4ES9A 2JG8C 3O1SA 1Q3EA 2R072
chains in the Genus database with same CATH topology
1BEV1 1FOD1 4R52A 2BWCA 4LO4B 1VBB3 1DGRN 3ZX7A 4WM8C 3VDDB 1KQRA 1GZWB 1YLLA 5KHGA 1SCSA 2CNAA 5ABJB 3MW3A 1ZZ9A 1SLCA 5T5OA 2VVEA 2DFBA 4DRRA 2NPIA 1HQWA 1Q43A 2BFUS 2YV8A 1EAH3 3ZN6A 1X82A 5JIAA 1KD7A 4N53A 1CN1A 3TNPB 1H1AA 3WG2A 2V73A 1RUE3 3WCSA 4GULA 4EN9B 5F9TA 4LO5B 4HANA 4LBLA 3B9IA 3D8CA 5KXBA 1S0IA 4BMBA 1S0DA 1NQJA 1XQNA 3KCYA 1NCQC 5DDJ2 4E4ZA 3IDCB 5K0UC 5CNAA 3TWIA 2DTWA 5JOXA 4WZCA 5BNNB 1HRV3 2CGPA 1ALYA 3VDDC 3X29B 3JB8A 2DVFA 1RUJ1 2VXRA 2DCYA 4GA9A 2E9QA 4KWKA 2HWC1 2XJRA 2RM23 3S7EA 3ZFFA 4JRLA 5A3MA 3V0AB 3ZXDA 3CJIA 3MW4A 3IPVA 4OHWA 3THPA 4AEDA 3P3PA 4JTNA 3SISA 5C8CB 2RS13 2X8KA 4LE3A 4QPGA 5SV5A 4LA2A 1LEMA 1W6NB 1ASJ1 4L11A 4YM2A 3MIEA 2OPKA 4IERA 3FLTA 5HCAA 5GZCA 1OPMA 4B29A 3AJZA 3QD6A 1G8WA 5ACA1 3NO8A 4I0WB 1G6NA 1V6OA 4H7MA 1OOPB 3GYDA 2YZ4A 3WHUA 1U5YA 1QNYA 3ZFGA 4CEWA 1R093 3IWZA 3CU7A 4RQPC 4TLFA 1PK6C 2YMZA 4L99A 4N7UA 2Z79A 1WW4A 2A6VA 2YC0A 4XF4A 5T5PA 1V6IA 5A3LA 4JGYB 1F2NA 4LLFA 4L97A 5JCTA 4LHNA 1REEA 4AFMA 1OFSA 5FLJA 4AE2A 1ZBE3 3VUOA 4LUKA 1LB2A 2JE9A 1MS4A 3VHPA 2FZ2A 1MQTC 3WNXA 1YJLA 2ET7A 4CEYC 1J3PA 1RHI2 3GZAA 1CJPA 2ZKNA 4FXKB 3AYAA 5KC6A 1N3OA 4QGNA 1G9FA 5J09A 2HWF1 5E89A 1V6KA 4AVTA 1GANA 3GBGA 4XBLA 1XXNA 2XL9A 2ZAAA 4HETA 3JCIA 3WT3A 1RUG1 1C1FA 4PCRA 5A32B 4GMP3 3DN7A 1EAH1 1OOPC 5KBFA 3LA7A 4E2GA 1RUH3 2GN7A 4GH4B 4A7KA 4EROA 4H7LA 2XJVA 1RUE1 5BNPA 4YLZA 4D69A 3CLPA 3FX3A 4AHYA 3KLSA 1RUI2 1ULEA 3ZYGA 3T2TA 4M0NA 2N7GA 2WS93 4DNYA 1YHFA 3R05A 2Q5TA 4RA0A 1O3RA 1RUF1 4D7YA 1GSLA 3POWA 1PGW1 4GMP0 3VL8A 5AFEA 1JOJA 4AEKA 1ZZCA 1PO12 1MS5A 4GIQA 4N43B 1QJX3 4PIZA 2LUWA 1CJDA 1NA1C 2UY8A 1ZBA3 4Y1VA 2RS31 2VW1A 2P3KA 2FQPA 1LR5A 2ZTNA 4LO6B 4XFCA 2XKPA 1I3HA 2WFF2 2RMU2 3VV1A 3JD72 2B8MA 1UZZA 3ILFA 3M8LA 3OBRA 5FOJB 2C9AA 1PIV1 2PN5A 2R061 5FLHA 2RS11 4JGZA 1E57A 1ONAA 1LGCA 4HLTA 2MEV1 2ARBA 1VB2A 2XJTA 3ZFFC 1BKZA 4LO8A 3V65A 1JUHA 1RJ8A 3CJIC 4XXPA 4E27A 4XFIA 4MXWB 1A78A 4GKXA 1V9U3 1J3RA 2Q1MA 4HPKA 2BW8A 2OA2A 5GLZA 1IKPA 4D94A 4MUVA 4AK3A 1I9RA 4MSVA 1HRI1 4MGKE 1U5ZA 1R091 1PO22 3EBRA 4WBBA 5JSPA 1SEFA 4HT1T 2B39A 1UU6A 4YW5A 2GMPA 3CJXA 5LK7B 4FOWA 4IEPA 2VOVA 4LBKA 4HK8A 4Q0VA 2Z2SB 1ZBE1 2HWD2 3OY8B 5GLVA 3VZMA 4LT5A 2ENRA 4K40A 2RJKA 3VKLA 1IS4A 4RHV1 5JOYA 5K9YA 1WA4A 5KC5A 3SMHA 1O91A 5DUWA 5AVAA 3LB9A 3AP5A 2ZHLA 2PQQA 4PJYA 4EN6B 1Z7S3 2ZGMA 3DGTA 1S0GA 1CX4A 4I01A 2DU1A 4K21A 5L73A 4AFAA 5JMCA 2AYHA 4KWJA 2ZX1A 4AWDA 1UCXA 1XNBA 4FPKA 1X7NA 1TMF3 1VBB2 4MLOA 4UW3A 1SMVA 1J1LA 5CADA 2VVFA 2AZ5A 4YVWB 1ZRDA 3FBMA 3ZXAC 1H2LA 1XYNA 3VBRA 2WS91 2RR11 1OI6A 4IEUA 1KJLA 5BNPC 3MFAA 2WQ4A 3LOBA 1QOTA 3RMXA 4Q1PA 1RGSA 2TNFA 1GQHA 1HKDA 2WNVC 2SLIA 4WM7A 3WD5A 1VBD3 5I0TA 4M3CA 2VOKA 2ZS6B 3ST7A 4XHXA 5CFCC 3S30A 1F5JA 2GU9A 2QQPA 4K1ZA 1BJQA 5C9AA 3WDUA 4XF3A 1QWRA 4IEXA 3SCFA 1CAUA 3HWJA 3UK9A 5BNQA 1X33A 3TNQA 5C8WA 2A6ZA 3AB0A 4Y24A 1HRV2 1DGRA 2WJSA 1GLHA 3ZSEA 2MNGA 4U2AA 2BWAA 4A7ZA 2ZHKA 3A4UA 3S7IA 4CYDA 3ZN5A 2JG9C 1VIWB 3KCXA 1V9U1 2E6VA 2QKDA 4FPJA 4JC1A 3AFGA 3O0VA 2EIGA 2RM22 1SACA 3V0BA 3RS6A 4Y1UA 2JEMA 2ARXA 4Q4V1 1UPSA 1VALA 2BNNA 1AYM3 2CY6A 1CD3G 4E9KA 1VBC1 4CDQB 2H6BA 1QF3A 1LGBA 2PLV1 3N35A 2VULA 3B02A 2NN8A 2AGSA 1KITA 1IGOA 1MACA 3FHIB 3VZLA 2E51A 3B7MA 5F6LB 1PGL1 2WNUB 1RUD1 4ZU7A 4CP0A 3SXWA 5KXEA 2XPJA 4QPIA 2XBO3 3RJRA 1FNYA 2A3YA 2BGCA 2YXSA 5JR7B 5CFDA 4Z07A 1XE7A 5EWSA 3C3VA 1BQPA 4F83A 4YVSA 4XHBA 2NM1A 2CAUA 3O14A 1ND3A 3ZXFA 1K5MC 1WUVA 3ZSLA 1MS8A 2ZCWA 3IDBB 4F3JA 3VBOA 1ZNPA 3M70A 1B35B 1HQNA 2GAUA 3VKFC 4FPEA 1TMF1 2AREA 4XILA 1AXKA 1YCIA 3OYWA 3DPRB 1DQ5A 1DQ2A 1LU1A 1QKQA 4HKOA 4P9LA 2PELA 1GKBA 2EXKA 1NZCA 4Q4W2 1UN1A 2CV6A 5D8AA 3ZSMA 1RUH2 3WY6A 2VUJA 1RUC3 5IK4A 2XL7A 4B3NA 4YG0A 2VU9A 1MZ5A 2D3SA 4YG6A 1VBD1 3ZMOA 1LESA 3WP6A 4CDXB 2PTMA 1AL0G 4G4FA 4FAHA 1AR72 4KBBA 1H8TC 2G9GA 4QX5A 3JQXA 2R0FA 1VAKA 5CU1A 1RMU3 1VBA3 1YIPA 2KM2A 5B2GB 2O8QA 1KS4A 4EWDA 4KU8A 3IKWA 2NMNA 1QJX2 1N1SA 2UYAA 3NV4A 1BK1A 1Y9QA 2BQPA 2IXIA 1WMEA 5C33A 4EWAA 3U07A 3VBUC 3U4XA 4AFCA 4P5HA 1W0PA 1COV1 3JBG2 3M3CA 5FAXA 3B93A 5T54A 4XTMA 4CDUC 2GH2A 1MS9A 1QDOA 3UKTA 1MZ6A 4LBOA 3WW1A 1D2SA 1DQ4A 1DZTA 2ZGOA 1QQP3 1AYM1 1QGLA 1NCRC 1UZYA 5CVRA 1GICA 4ZU5A 4FQ4A 2ZHMA 4DZGA 3WG4A 4C90A 1ULFA 1ZM1A 2X5IB 5CG8A 1XYOA 2A75A 4S2DA 1QHDA 4IXLA 2IXJA 2XBO1 1WLWA 3WOGA 3M1HA 1OQEA 4Q4Y3 1IS6A 3KB5A 1W6QB 3HN1A 1DYKA 4QGLA 4FTEA 4QPIC 1W6PB 1LHWA 1Y7BA 4OHVA 2PHWA 2YY1A 1AR82 4MH0E 4H14A 4JVAA 2TEPA 2OYZA 3VL9A 1HW5A 5C4WC 1HX6A 2DV9A 2UU8A 1ZREA 4OHXA 2HWE1 1YYNA 4XJUA 1GQGA 2W68A 4YZ3A 1HXS3 1OKQA 3WW4A 1Z7S2 3AYDA 1NOVA 3TB0A 3ASIA 4LTAA 5KWRA 1ZZ7A 3VBOC 2VECA 1MZEA 3WW3A 1F8VA 3WINE 1CAWB 2JX9A 5SV8A 1EV13 2A6YA 3ZIXA 5T50A 3HR9A 1AR63 1RUC1 3QBQA 1OFNA 4J1WA 4Z2WA 2ZKLA 5IUQA 4ZU4A 5T3NA 2R30A 3V56A 1QJU3 2GNBA 3GF6A 4CDWB 1PVXA 2WT0A 1DF0A 5JI9A 2UWBA 1KRIA 2UWCA 3KS7A 1RUJ3 3VBFB 4MV2A 2O8OA 4WVVA 2GSYA 3BB6A 2HWC3 1JBCA 2H0VA 2OUJA 4RS5B 4YW2A 2ZX0A 2WLPA 2IWGB 3H7YA 1RL3A 2XLAA 1GZWA 4DQAA 2JG8B 5FTTC 2QZ3A 5DZGA 2LALA 1MZFA 2DWRA 4L92A 1H4GA 2CTVA 5ABJA 2G9FA 1EP0A 3HIFA 4C91A 1D4M2 1LOCA 1N3QA 2R1DA 4WM8B 5JPMB 5I8TA 1ASJ3 1TME1 1SQ4A 1T6GC 1PMIA 2B5HA 5GLTA 4R9BA 2EXJA 1C57A 2D98A 2QDRA 3NW4A 4YW1A 4YM3A 1YI7A 4AGVA 1PNGA 5ACA3 5JWPA 5JDBA 2R042 3EJKA 3B3QE 2XB6C 4XW3A 4ATFA 2XVLA 4HSLA 4UXAA 4XMIA 4M0HA 3HMYA 5JAXA 1ND2C 4AVVA 4E2QA 5LRRA 1APNA 4JRAA 4NVPA 3MIBA 4C1WA 5JVVA 1BMV2 1KFXL 4AGRA 1W0OA 2VQ0A 1M4WA 3AKTA 4YFWA 1OPOA 3SCGA 3FUOA 1AZDA 1NCQB 4MGIE 4UW4A 5K0UB 1A6CA 4W6XA 2ZGSA 4K8FA 4Q4Y1 4XBQA 1Q8SA 2GALA 4PIYA 2HWF3 2QZ2A 3V0AA 5CB7A 1WW6A 5DZEA 4O9EA 3SH5A 4BCUA 2RS51 4BOWA 4LHLA 4YZ5A 4Y1ZA 1FPN3 1HV1A 4XIKA 1I5ZA 1NY71 1RUG3 4AQTA 5KHIA 2GC3A 3RWNA 1W6NA 4NR1A 3HT2A 4MXVA 4QQHA 2D97A 3VBSC 1DG6A 1RUNA 4XFBA 1QJY1 1HXS1 2WT2A 2WWSA 4META 1PM7A 3I4IA 4AG4A 5C6CA 2BNOA 2A70A 2EA7A 2OVUA 2VQAA 1SBDA 4DFSA 2PFWA 4J6GA 2W08A 3NV2A 2DCZA 1Q8OA 3FFZA 1EV11 2VUAA 3WCRA 1RUF3 1AR61 4LHKA 3H9AA 4JGYA 3H1YA 1QJU1 4RQPB 3I8TA 4HMZA 3LZZA 1PK6B 1ZZ6A 4RR3C 5HXVA 4W65A 1C8M3 4XJZA 3P3NA 1PZ8A 3NVCA 5FPXA 2RS33 2YUEA 3BALA 2WSVA 2RE9A 2UWAA 1W6MB 2A5ZA 1MEC3 3QOPA 5JZGC 3U0ZA 1PIV3 2R063 3FE5A 1MQTB 1VRH3 4RFT0 3M3EA 1ULGA 4QU2A 2VNOA 4CEYB 5L7OA 2SBAA 4ASLA 2MEV3 3PJYA 3ZSKA 4IV3B 1OSGA 3TN92 4EN7B 5A32A 4GB33 4A2UA 4XEZA 1BYHA 4FPHA 3UL2A 1RMU2 1VBA2 2WZR1 4GH4A 4QT6A 2BUKA 2XHKA 4XJAA 2D40A 3KGLA 2Q8OA 1DFQA 4XXAA 1HRI3 4K3UA 2WA3A 1ENXA 4S2FA 4XJ9A 4BHPA 2D93A 2DCTA 3FFQA 2ZGLA 4YW4A 1YRZA 1ENQA 2IC1A 1OA4A 4L9BA 3DL3A 2D5FA 4N9IA 1UF2C 1S0EA 4N43A 4R9AA 2EAAA 3AMMA 2LM3A 3ROUA 1AL23 3KM5A 5DG2A 1H1MA 2BYVE 2DVGA 1QQP2 1GYKA 2R0HA 1D0GA 2YGLA 4R4ZA 4RHV3 4AVCA 1QH6A 4WVZA 5I93A 3ZIWA 3FC0A 4IV3C 2HWB2 3E6BA 1NA1B 3KT1A 2GC0A 3D0JA 5K7PA 2IFWA 4DY5A 1FPN1 1WCDJ 3AP7A 1UIKA 5BPXA 3SNMA 3DF0A 5FMOL 3AX4A 4NHKA 4AXOA 4F8AA 1VBE3 4MXWA 1S55A 3ZDSA 1BEV2 1FOD2 4GQ7A 4SBVA 5HBAA 3PVEA 1S0JA 1AR91 4XETA 3ZFFB 2QJVA 1CAXB 3CJIB 3IPVB 1CPNA 1LOAA 1QDCA 2VVDA 3ZMNA 3ILNA 3ALQA 2UYBA 2E7AA 4DMIA 3JU9A 4N53C 4S2HA 2JECA 2QDNA 4GXLA 2RR13 3IBMA 4Y20A 2F4PA 4IEZA 1DDLA 2K9ZA 4XOGA 1IKQA 2PA7A 5BNOA 1SLAA 2DUPA 3D6EA 3NAPA 4WVMB 1C8M1 1CESA 5IK5A 1C5IA 2A73B 3OY8A 2VMIA 2TUNA 1C5HA 3PVOA 2QE3A 1IOAA 1NLSA 1MEC1 3N7KA 5HI0A 1VRH1 1U5IA 1EY2A 2FMYA 2TBVA 5E8AA 1AJOA 2PHFA 2Q1ZB 2IZWA 3ZYRA 2PAKA 1LTEA 3LSEA 4BLIA 4GB31 4AEDC 1RUJ2 4Y4YA 4FSJA 3WZ1A 1QMJA 4X6QB 3ILRA 2HWC2 1DQ0A 4QPGC 1FMD1 2VPVA 4BIOA 3AYCA 1UW8A 1BCXA 1IZ3A 2Y0IA 2GN3A 4Q4V3 3M7AA 5DZFA 1U5XA 3I7DA 4YVWA 3R0RA 1DZQA 1A3KA 5AFBA 4CZSA 1VBC3 1CIWA 2XJSA 3H50A 1ASJ2 3VGIA 4CEWC 3ZFGC 2D6KA 2PLV3 1GNHA 4KWLA 1I6XA 5FFOC 3VKNA 1C1LA 2ZGRA 1DYPA 1SBFA 1NXD1 4G9SB 4ONUA 3AXEA 3J26N 1F31A 2WNEA 5ACA2 1CONA 3SITA 2D6OX 2ERFA 1AL21 4I0BA 4LEJA 5BNPB 2XJPA 1RVF1 3MIDA 2PHXA 1D4VB 1RUD3 5FO7B 2VMGA 5T52A 1JH5A 3VBHA 1VB4A 1VAVA 1TE1B 4KNCA 3QACA 4FCAA 2WNVB 1SFYA 2HEWF 5JSRA 5EV7A 3RRDA 2Q30A 1QOOA 2WLQA 2MHFA 5CFCB 4YGDA 1OMIA 4XQWA 4HL0A 3AZYA 2W0XA 4V1PA 2ATFA 4LNVA 4D3WA 4EN8B 3V64A 1GZ9A 1VBE1 1H4HA 3M2MA 4P14A 4DXZA 3VZOA 2H6CA 1AYN1 1O4TA 3ZXEA 3LGRA 3IIAA 4Y1YA 3AKSA 2HWF2 3BCWA 5CG9A 4LBNA 4QXKA 4HN0A 1V00A 4YM0A 1Z0HA 1OLRA 4I0AA 4OHZA 4BA6A 2JG9B 4BMEA 3QLQA 4JGZB 2E7TA 3POSA 3VN4A 1RUG2 1RTVA 2D7FA 3U11A 1EAH2 2PHLA 4Q0QA 5F6KA 4HPKB 1ZRCA 1AF9A 2RJLA 3M3IA 2CL2A 2ZX2A 3AZVA 3WV6A 4IESA 4AHWA 2ZJCA 1RUE2 1CGPA 3AMHA 4SLIA 3OD4A 1REFA 2WNUA 2O1QA 2VH9A 3ME2A 4COYA 1LOBA 4DRVA 4HVOA 4D7TA 4L2NA 2QCSB 5HCFA 3VHOA 1RUF2 1WLDA 1PGW2 3J8F1 3ZXGA 4OVEA 3KZ4C 1LOFA 2ZX3A 4LR4A 4AEMA 1CR7A 4CTEA 3E5XA 4LBJA 4RD7A 5LEJA 1XE8A 5JPNB 1L3JA 1AX1A 2RS32 5I91A 4QQOA 1J1TA 4B7EA 2H0BA 4JGZC 1B35A 3KMHA 4D7SA 1COV3 1CVNA 2WSUA 4EN0A 1YI9A 4ISQA 1PIV2 3ZSJA 3ZXLA 2R062 1K5MB 3ACLA 4AF9A 1FX5A 2RS12 3DPRA 1JYCA 1V6NA 4JDNA 1S2BA 2MEV2 4CRQA 1O3QA 4WZFA 3OF1A 2NYYA 1N1VA 4ZKTB 3QCWA 2WZPP 1Q5OA 1QOSA 3D5OA 4FPCA 3GZTB 1R1ZA 1MVEA 3WDVA 5FOBB 2DURA 4DOUA 4ORFA 2FZ1A 2YYOA 5A33B 4UW6A 5FDBA 1HRI2 4JCKA 2VOWA 4AYUA 1R092 2A6XA 4IV1A 1PZ7A 2NQYA 2VW0A 4DY3A 2R073 2CWMA 3RYKA 4Y22B 1JW6A 5J3UA 2B9UA 3MPBA 1J59A 1Q56A 1R1A1 4KGQA 5CA6A 2RHPA 5EYYA 1H8TB 1ZBE2 3D82A 2E63A 5E16A 3CF6E 4RSUA 1S2KA 4RHV2 3RNSA 5BUVA 3NWKA 2CGOA 3WQ1A 2C0ZA 3KGZA 2XJQA 2HWE3 4EWEA 2Z69A 3PVNA 2XG3A 3UV9A 4YFZA 3RZZA 3LSDA 3AP9A 4BH9A 3VBUB 4X8PA 3WR0A 3I59B 4FTBA 4TYSA 1OA2A 5L19A 4YGEA 4AHXA 2JDZA 4CDUB 2OZJA 3AKPA 4COZA 2B45X 2QNKA 5I0SA 3ZYPA 1JYIA 5DDJ3 1XYPA 3N7JA 4KQ7A 4PDWA 4X8NA 2GZWA 1NCRB 3JB4C 4XBNA 3VBRC 2UURA 4IEVA 4OI0A 1AHSA 4DPNA 5LEKA 3THTA 3OGJA 2A6WA 4KG8A 4IETA 2WS92 2RR12 4YGCA 4FPOB 4M00A 4WM7C 1V6LA 1VLNA 3KSCA 4HBNA 1W6QA 1D2QA 1YFUA 4Y26A 4IEWA 1DLLA 1BXHA 4FPYA 1S0CA 1R081 1W6PA 5C9AC 1Q8QA 4HKWA 4ASMB 4AVAA 1ZBA2 3MF9A 3W58A 1PVC1 2HKXA 4FOVA 3WVJA 1JXNA 2JE7A 3DV8A 2EVXA 1LOFC 4E4DX 1BBT1 1TME3 4QPIB 1H1IA 2D44A 4CP2A 1A8MA 2GMEA 2VOXA 5IK7A 4FOQA 3CEWA 2LTNA 2Z42A 2BFUL 3R4UA 2CGNA 3H3ZA 3T1LA 5C4WB 3WLUA 3PHMA 1N1TA 2VNGA 1KJRA 1CAWA 4OFGA 3ES4A 4XF0A 5LK5A 2KXLA 3VBOB 1V9U2 3ZPYA 3H7JA 4Q0PA 4YZ2A 5AC91 3BOWA 4Y1XA 2ZZQA 3S0MA 3A0NA 5EJ3A 1QJZA 1QH7A 2VW2A 2EAKA 4CDWA 2WA4A 4Q4V2 5FRAA 3N3HA 3EHKA 3K51A 2F6BA 3KQRA 5H9QA 4Z1VA 4RGGA 1LHNA 5H9RA 4Q4X1 3VBFA 3AKQA 1XU1A 5J37A 2R071 1VBC2 3K48A 1RHI3 3GHMA 1QXRA 1WLTA 2X53S 1G9BA 2PLV2 2PHDA 4IV1C 3WUCA 2RS53 2JG8A 1O3TA 4R4XA 3E5QA 2GC1A 1GZCA 2FMDA 4MX3A 1PGL2 5CFDC 4HSJA 4AI1A 3ZFEA 4QQPA 4BWOA 4LUMA 1FXZA 4GWNA 1G9AA 4WM8A 1MS3A 4FPLA 4YVSC 2ZMKA 2C5DA 2E7QA 1QJY3 5E1RA 1M06G 5GLWA 4NWVA 3R6SA 1S0FA 2PHTA 4DS0A 1ND3C 1UAIA 3B00A 1XNKA 1KS5A 4UBGA 3HQXA 4PLMA 1RUI3 3PNAA 4BPZA 1W6OB 4N90A 1BVP1 1YJKA 3OBTA 4QMAA 3FLPA 5J48A 3WDTA 5DDJ1 2CAVA 1CAVA 1TMF2 4KL1A 5KXDA 2P3JA 4XJWA 1GNZA 2OZ6A 3E97A 2GC2A 3HAGA 2OUHA 2ZGTA 5D8AC 2A3WA 1ND2B 1WBLA 5J7MA 3MIFA 1NCQA 2W39A 3MI8A 5H9PA 3RJ2X 5K0UA 2D3PA 5DUXA 1WD3A 4PDWC 2BBVA 1V70A 1GBGA 3NSTA 4KH9A 3OPZA 4Q27A 1LHUA 4QGMA 2WFF3 4J1XA 2RMU3 4B8EA 3FMGA 4PQ9A 4LBQB 1POV3 4QPYA 2XWBB 3VDDA 1RIRA 4YW3A 5LRSA 3INAA 3HD8B 1DU3D 1H9PA 1VBD2 3O7OA 3AK0A 3JUUA 4KU7A 3U10A 5IT6A 1EPZA 4H3WA 1UIJA 4OI4A 4QQLA 4LBMA 4JDMA 4Q26A 2WZR3 3W9AA 1ENRA 3B94A 1AX2A 3WHTA 2ZACA 2GNMA 1H2MA 1LECA 2ZGKA 1POV0 3OTFA 3VBSB 5KHJA 1WCSA 1IHMA 1UPIA 4AQSA 2KA3A 3EQEA 2Y0OA 4BE3A 1UMZA 1S1AA 1COV2 1YIFA 2P17A 5GALA 3NV1A 4OUMA 1AJKA 1SLTA 1YWKA 3MLKA 4HZFA 4RQPA 2PAMA 5BNNA 5BY5A 4K6BA 4AI0A 4JQRA 4PBOA 4AHZA 3MDPA 3O0XA 2HWD3 3VHRA 4AI8A 3NV3A 1AYM2 3OD0A 1RHI1 1SLLA 1W6MA 4RR3B 1Z78A 4JAAA 2BPA2 1B09A 3J4UH 3AMQA 3APBA 1OD5A 3TBDA 4I3GA 1MQTA 5EFUA 5C8CA 4IEQA 1ULCA 4YYOA 4CEYA 1H8VA 1MS0A 2CWSA 1Q8VA 4O9GA 2XLFA 5JZGB 1BVVA 3RPQA 3WDYA 3WXPA 2XBO2 3I2DA 5AVPA 3IM0A 5GJ6A 2B42B 3L9JT 2XVGA 2ZGNA 2XLGA 1AR93 4P9YA 4PIXA 3ZFEC 2XKOA 4Q0UA 4S2GA 2DF7A 3IN9A 1OOPA 1RUI1 1SCRA 5GZFA 3B9CA 1SBEA 3AKRA 4QM8A 5BYNA 2ZX4A 1LEDA 3FZ3A 3IDEA 3KT4A 5FQ0B 3H1WA 2ES3A 4Z8BA 2HWE2 5KXCA 4FTSA 1PO11 4BM8A 3PMEA 1N3PA 1YFYA 3USUB 4A7YA 3SLIA 2D43A 1ZZBA 3WQ0A 5CIRA 2Z5WA 4PLOA 3GBWA 5DUUA 2WFF1 3RMYA 2RMU1 3JD71 2YHJA 1POV1 2EF6A 1WMFA 1NA1A 1RUC2 2ZAHA 4NHMA 4XYXA 3NKGA 3RI9A 4FP2A 5CBLA 1ZRFA 4FBFA 3KT7A 2NMOA 3D0SA 1XNCA 2DFCA 2AR6A 4XQDA 5ABJC 2NP0A 1OA3A 3MEPA 1FMD3 3ZO0B 1CAXA 3MPPG 2I74A 2Q4SA 4NOTA 1NG0A 4K20A 3UJOA 3C2UA 4OLLA 1PO21 2DVBA 3CL1A 4FP3A 1WBFA 1RITA 1TME2 3H8UA 3ZN6B 5FBZA 3MZHA 4N53B 3FWEA 3H3UA 1C3HA 3S6PA 1AUYA 2OW4A 3VKOA 4WVMA 1KDMA 1AVBA 2K0GA 2YDEA 1RVF3 2HWD1 3RI8A 4YGBA 4L8QA 2W52A 3GZUC 1U12A 1OLQA 2D6PA 4MZUA 4JTOA 1URXA 2B46X 3ELNA 5BNNC 4RL7A 2YPJA 1LHVA 1RJ7A 2UY9A 3WDWA 1IQAA 2XUMA 4XPVA 4K9SA 4HK9A 4TZDA 2ZHNA 5L36A 1MR5A 5IK8A 2HEVF 2GH8A 5C8CC 1LULA 1AYN3 3WQ7A 1AX0A 4Q4Y2 3VZJA 3URFA 2DVDA 1VBB1 2I45A 2JENA 5JI7A 3POYA 4AEDB 4AVBA 4UBHA 2RS52 5GZEA 4XF9A 5L7OB 2A3XA 1X36A 1JTZX 1NY72 2P3IA 1JUIA 1NYWA 2IFRA 2Y26A 4QPGB 1G9CA 1ZRRA 4R8HA 1OQDA 1X8EA 3R4SA 4Q4W3 4NWWA 1PGSA 1UL9A 3MYXA 1QJY2 1RB8G 1HXS2 4MGYE 1G9DA 4G3YC 4B7KA 3N7LA 4NPRA 5J98B 4CEWB 3ZFGB 5K8SA 4AFBA 4JGYC 2IXCA 4TSVA 4C1XA 1V6JA 3M3QA 2PAEA 4XQ4A 1PZ9A 2HJIA 1FT9A 1AR73 4U36A 1ZA4A 2WNVA 3UKNA 4HVRA 1EV12 2AENA 4I09A 1ENSA 3MIGA 1YNAA 2JXAA 1YXWA 1AR62 1A8DA 1DQ6A 3J8F3 4XIOA 5CFCA 2DCJA 1QJU2 1HRV1 4XFAA 3WG3A 1LODA 3LCPA 2AUYA 2BEOA 1SLIA 5L7OC 1PHMA 2XWJB 4BZ4A 3VLBB 2RM21 3JBG3 5J36A 2G4IA 4X6RB 3PJQA 3KD4A 4BYYA 3AZWA 5EZWA 2JG9A 2JJ6A 4YNIA 1NLRA 4F7ZA 3DKWA 4XTPA 1O7FA 4GH4C 3NJZA 1U0AA 4TWTA 1W39A 4OI2A 1DGWX 1DHKB 4W6YA 2PYTA 4OHYA 1TNRA 5D1IA 5T5JA 4P9GA 3MW2A 4CP1A 2A7AA 3RQ0A