3UL2A

Galactose-specific lectin from dolichos lablab in p6522 space group
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
252
structure length
248
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 54
structure length 248
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ul2A00
4AWDA 3USUA 5JOWA 1ZA4A 3AYCA 3ZXJA 1WW5A 2P3KA 5JLVA 2ZBJA 1QNWA 3A0KA 5DUUA 2R0FA 3UK9A 1VAMA 3VKOA 2G4IA 3LSEA 4BM8A 1LTEA 2ZGNA 4UW4A 4FPFA 3NWKA 2VUAA 3RS6A 4GA9A 4WVVA 1AX2A 2WSVA 2UWBA 2RHPA 4XJWA 2R1BA 3WDWA 3I8TA 1DQ2A 1W0OA 4C1WA 1Z78A 3AZZA 3WVJA 3HMYA 1GLHA 4P14A 2P2KA 4XILA 4L8QA 5GLVA 2ZHKA 1QOSA 5T5PA 1FAYA 2ZA9A 4LBQB 5GZDA 5BYNA 1V6NA 1EPWA 3AXEA 5FREA 3O0XA 1S0DA 2PHWA 3PJQA 1LHVA 1SCSA 2D6PA 3AP7A 1Q8VA 3USUB 1MS5A 2A3WA 5GZCA 1IS4A 3VKFC 1LESA 2WKKA 1G9FA 4XJUA 2R49A 4Y1VA 2CY6A 2W39A 1IS3A 3NV1A 2D6OX 1LULA 3SISA 4U36A 2DWRA 2D3RA 4YM0A 4FPOB 5L73A 2I2SA 2ZZJA 4F83A 3OY8A 2V73A 3C2UA 3NV3A 5CAZA 5GZGA 2ES3A 1D0HA 2W08A 2A6WA 2EF6A 1GANA 5DG1A 5DZGA 4XE9A 2NYYA 2ZAAA 3WG4A 1R1ZA 1F31A 2LALA 4Y20A 2DVFA 4ZXKA 1WW7A 4FPEA 1N1TA 3AZWA 2ZGOA 5DUVA 4DS0A 3B01A 1YRZA 1UZZA 1DYKA 2DVDA 4XJ9A 2GNTA 4FOWA 2EIGA 1IOAA 2E53A 2GN3A 4XZPA 4FP3A 1URXA 1W0PA 3N7JA 4R9CA 3FUOA 2D6KA 4YGDA 3WG1A 3OYWA 5F5QA 1LCLA 1SCRA 5E89A 5GLTA 1QOTA 1W6PA 3DUIA 1LJ7A 4JRAA 4BQ1A 1SACA 2DU0A 1S0CA 4FOQA 2DVBA 2DU1A 3U4XA 1C57A 1HQWA 1J1TA 2LTNA 3R4UA 4Q8KA 4M3CA 2GMEA 4YZ2A 3OY8B 4XTPA 2R16A 1W6NA 4DFSA 3FLTA 4YM2A 5GZFA 1IS6A 2A70A 4BLIA 3VKNA 2A6XA 2EXKA 3AK0A 1RITA 2E51A 3MW4A 4Y20B 3O0VA 1KJLA 4BPZA 2NMOA 3A0NA 5IK8A 1A78A 1WD4A 1Y7BA 1UZYA 2PHUA 2WNEA 3PMEA 2WLQA 4R9AA 3SH3A 4DQAA 2ARBA 3AZVA 1S0IA 3D6EA 3M2MA 2BQPA 2ZHLA 2W52A 3AYEA 5AVAA 2YROA 3AYAA 2VXRA 3I4IA 5IK4A 3PVOA 4Q8LA 1S0EA 3OYWB 3AP4A 3V65A 1UPSA 3ZXEA 1V6OA 2DVGA 1F9KA 5T5LA 1DQ1A 1DQ5A 2A6YA 3B00A 2YV8A 1H30A 2SLIA 1C4RA 1CESA 3O0WA 2NP0A 1X50A 2JE7A 3FBYA 4UW3A 4W65A 1YO8A 1CQ9A 2AH2A 2DTYA 1OQ1A 1IKQA 4Q1PA 1G9CA 3AJZA 1BYHA 3MPPG 2CL2A 5JOYA 4M3CB 5KXCA 2Z42A 4Y1UA 2VW2A 1WW4A 3WDVA 3M1HA 1W6NB 5JMCA 3N7LA 3V64A 3WDTA 1DIWA 5T50A 4YM1A 4YM3A 1LU1A 5IK5A 1PZ8A 3HN1A 4M00A 3ZVXA 2JDZA 2OVUA 3WG2A 1N1YA 5JOXA 1ULDA 4AGGA 1LOBA 3BOPA 5HCBA 1DLLA 2NM1A 5CB7A 2GNBA 3OBTA 2ZMLA 1SLAA 2VY0A 4H55A 1PZ9A 1NLSA 1S0JA 2R0HA 4GKXA 4R9BA 4XIOA 5GLWA 3ZXLA 5E88A 4C1XA 3AX4A 1WLWA 4LBKA 4ZKTB 2ZGTA 1DFQA 2UURA 3N7MA 4GWNA 4AYUA 2GDFA 4TYSA 1QGLA 1GBGA 1U0AA 3O5SA 4UW5A 5CA6A 2D43A 2Q5TA 2AUYA 4FPGA 5IUQA 3KQRA 1A3KA 1H9WA 1ENQA 1ENSA 1JUIA 5F9TA 5DZEA 1CR7A 1DYPA 4UW6A 4AVSA 1LU2A 2YY1A 2VU9A 4P9WA 1LGNA 2OUJA 3KM5A 1IS5A 3PVNA 2YXSA 3AFKA 4LBMA 3UJQA 1UKGA 3M3EA 2D3SA 1QF3A 3ZSLA 5CBLA 1AXYA 3B3QE 3ATGA 4JCKA 4XHXA 1LEDA 2DUPA 1F5FA 2W68A 4YW2A 3MEPA 4XMAA 4K1YA 2CYFA 1TEIA 1MZ5A 2A3XA 1SLTA 2ZABA 4LBQD 2UWCA 1WBFA 4ISRA 5T55A 3VKMA 3SH4A 2A75A 1YI7A 4FOYA 4AGRA 4DRRA 1AX1A 1CPMA 2R1DA 5GALA 1C1FA 3BIWE 1W6OA 2JKBA 1UX6A 4YG6A 4K20A 3ZSMA 3SLIA 5EYYA 3R4SA 4FP2A 1S0FA 3N7KA 4XBQA 1I1EA 1AXZA 3DGTA 2ZGMA 2WT2A 1CPNA 1B09A 1UL9A 2ARXA 1XQNA 4LBJA 4XMIA 4AVVA 4CTEA 3WV6A 1FNYA 1KJRA 2PHRA 1SLBA 2ZGQA 4M01A 3M3OA 1A8DA 4BLJA 4FOVA 3V0AA 2HYKA 3M3QA 4FPLA 4K21A 2NZ9A 1YIFA 2ERFA 4FVVA 4FPHA 2XB6C 1S0BA 1SBDA 4TZDA 3WDUA 1BQPA 1UAIA 2JECA 2VW0A 2GALA 5DUWA 4Y24A 3W58A 3VUOA 1JYIA 1CN1A 4Q27A 4YFZA 1SFYA 2GMPA 4YW4A 1QOOA 1FYUA 1SLIA 1YYNA 1W6OB 2A71A 1LOEA 2ZGUA 3LCPA 5FRAA 1AF9A 4XBNA 3RMXA 1N3QA 4AGVA 3JUUA 5DZFA 1G86A 1V6KA 2ZGPA 4YG0A 1OKQA 4P9XA 2CWSA 4IQPA 4PQ9A 4FPKA 1GICA 3FLRA 1LECA 1SLLA 5JOZA 2KM2A 3QCWA 4XYXA 2JE9A 2FMDA 4R9DA 1DBNA 3OJBA 1ONAA 1JHNA 5SV8A 1MS8A 3WDXA 3BODA 3ILRA 1HDKA 2VW1A 3HR9A 3O12A 1S1AA 1VIWB 1D2SA 2ZMKA 1SBEA 3POSA 2JJ6A 1JXNA 4FQ4A 4M3CE 1AJOA 3V0AB 4PF5A 2D6NA 3NV2A 1N1VA 1LHWA 1QU0A 1W6MA 1MS3A 1WLDA 2OW4A 3FLPA 2AYHA 3OPZA 1MS9A 2EAKA 4XOGA 4YZ1A 1G9DA 1W6QA 3WLUA 2H0BA 1LOAA 4XIKA 1V6JA 2FHRA 2NN8A 1LGCA 4XBLA 1AVBA 1WCSA 5H9PA 5T52A 3SH5A 2VH9A 4MYEA 3ILFA 3WG3A 3NV4A 4AVTA 1N1SA 5T5JA 4WVWA 2ZGSA 1LGBA 3M3CA 3ZPYA 2SBAA 2CTVA 2C5DA 5IT6A 3OBRA 3IMNA 1Z0HA 4D69A 2CWMA 2ENRA 2XG3A 1GNZA 4XXPA 1O4ZA 4XTMA 5CNAA 4FQZA 3AP9A 1FV3A 4LBNA 2GNMA 1AX0A 1ENRA 2WT1A 4YGBA 4Y22A 4KBBA 1QDOA 4YFWA 1WW6A 1Q56A 1WUVA 5GM0A 1AJKA 4YLZA 1V6MA 1JYCA 4ASMB 3UJOA 1BZWA 1W6MB 2DUOA 4XDQA 1UMZA 3AZXA 3OGGA 1BXHA 4BMEA 1V6IA 5JDBA 3RG0A 3JU9A 1W6QB 3WDYA 3WUCA 2WT0A 2C9AA 4P9YA 2CNAA 2V5YA 4XJ8A 1KRIA 1MVQA 3AJYA 1NXD1 3RMYA 3APBA 1GZWA 1APNA 2AR6A 2ZHMA 4YZ4A 2D3PA 1BKZA 2EXHA 3B9CA 5T54A 4HANA 1SBFA 2DVAA 1O4YA 3INAA 3VKLA 3RRDA 4M3CF 1FATA 2PHXA 4YGEA 5T5OA 1LODA 1ULEA 1MS1A 1Q8QA 2PHFA 3WCSA 2D6MA 2OUHA 1CONA 2P3IA 3N35A 1DQ0A 4YW5A 1WLCA 4PBOA 4XHBA 4LBLA 5EYXA 3TAYA 4XJZA 3TB0A 2UU8A 2EXJA 4Y22B 4DRVA 4YW3A 2ZKNA 1ZM1A 3D4KA 4GKYA 1MZ6A 4DPNA 3CNAA 1C1LA 1QNYA 3GALA 1N3PA 3WHUA 4CZSA 1V00A 2D44A 4WZFA 2ZHNA 2ZGLA 1N3OA 3POWA 3IM0A 1G9BA 4FPCA 2A3YA 1GZWB 5DXDA 1LOFA 1LHOA 2WSUA 2A6VA 2AREA 4BOWA 1GNHA 1LOGA 3ILNA 4I30A 3AP6A 1HQLA 4WV8A 4NOTA 1ULCA 3V0BA 4PBPA 1FNZA 4Y1XA 5HCAA 4RL7A 5GZEA 1S0GA 2AGSA 2WJSA 3ENRA 1LEMA 1DHKB 1MVEA 3B69A 2D7FA 2TEPA 3QLQA 1WBLA 4SLIA 1KDMA 2B7YA 2PELA 5E8AA 1OFSA 3Q9OA 4JC1A 5HCFA 3WZ1A 1VLNA 4Q26A 1DZQA 4YZ5A 1HLCA 3VV1A 5H9RA 3ZYPA 1ULFA 4U2AA 3ZYRA 5KXBA 1HKDA 4XJAA 2ZGRA 3ASIA 4NO4A 3POYA 3PVEA 4YW1A 3ZSJA 1QKQA 3UL2A 2NMNA 4Y1YA 4FPYA 3BTAA 1LHUA 3AZYA 4YZ3A 4Q1RA 1GSLA 1I3HA 3A4UA 3ZXKA 5IK7A 1JBCA 1Q8OA 1GKBA 3LSDA 2GNDA 4GXLA 5GLZA 3W59A 3ZSKA 2ZMNA 3RSJA 3AP5A 3D5OA 3N36A 1RINA 3FUQA 3R05A 3L2YA 3T1MA 4Z8BA 1MS0A 4OZXA 1Q8PA 2GMMA 5LK5A 3V0BB 1VALA 2EALA 2P34A 4BMBA 1GZ9A 1QMJA 3AXDA 2P37A 1VAVA 1LOCA 5EWSA 4YG3A 4CRQA 3WOGA 2P3JA 5H9SA 4PCRA 1MACA 3ZXFA 1WD3A 2EXIA 4YGCA 3WUDA 2E6VA 4ITCA 1DQ6A 2E7QA 2YMZA 1V6LA 1FV2A 5GLUA 1CIWA 4K1ZA 4Y26A 1PZ7A 1RIRA 2ZGKA 3MW2A 4FPJA 1G7YA 3RQ0A 2A5ZA 3SNMA 1MR5A 1UN1A 3AYDA 1LENA 1AZDA 3IN9A 2DURA 3IPVA 5H9QA 2DUQA 3WNXA 1GYKA 1KQRA 5DUXA 4ATEA 1DGLA 1H9PA 5GJ6A 1FX5A 2PHTA 1GV9A 1DQ4A 2A7AA 4ATFA 4GALA 2YZ4A 1MS4A 1LOFC 3WHTA 2DTWA 1LHNA 2ZACA 1G9AA 1G8WA 1W6PB 3MW3A 1CJPA 1GZCA 2DYCA 1N47A 1QDCA 2JD4A 5DG2A 1JN2P 2A6ZA 2E7TA 1SLCA 3T1LA 4XXAA 2UWAA 3N3HA 1Q8SA 3H0OA 2D6LX 3WCRA 3IKWA 3GNEA 1ULGA 4Q2FA 4ISQA 4Y1ZA 5JVVA 3SITA 1YXWA 2WQZC 1IKPA 4LBQA 5KXDA 1CVNA 2GN7A 4RA0A 2DV9A 1KITA 1BJQA 1KDKA 3FFZA 5EXOA 1JOJA 4HL0A 4LBOA 2AENA 1JW6A 4GWMA 3T2TA 5KXEA 1AXKA 3IPVB
chains in the Genus database with same CATH superfamily
4AFCA 2HBUA 1ZA4A 4E2QA 5JOWA 3ZXJA 5A33A 3H1YA 1AL23 2B8MA 3TEXA 1WW5A 1NCRB 1FT9A 5IT6A 1QNWA 3ZXGA 1SMVA 2F4PA 2R0FA 4KNCA 4NIAA 3H8XA 4MX3A 1VAMA 3VKOA 2ZEXA 5FTTC 5CISA 1JZ7A 1YUDA 4BM8A 4KG8A 4N7UA 5BY5A 3W5MA 2P4EA 4DUVA 2LM3A 3NAPB 5C8CC 4XETA 3WNPA 1AX2A 3TNQA 3HNBM 4RHV2 4P08A 5FY9A 1DQ2A 2R061 2PN5A 1DZTA 2IC1A 5CU1A 4C1WA 1Z78A 3AZZA 3WVJA 4WBBA 1JYTA 4N53B 1RUG3 3OUJA 4XILA 5F39A 2HWD2 3KCCA 4CDWB 2PAMA 5C71A 1LB2A 1QHDA 3PJQA 4MXWB 2BWAA 1Q8VA 3I97A 5CZKA 5A3OA 2A3WA 2DBNA 3IDBB 4Q5OA 1LESA 1DU3D 3N9QA 2AACA 1G9FA 5C3RA 4XABA 2VCAA 2R49A 2WQ8A 2YFUA 3LFIA 4XJUA 2OQ7A 5JXHA 4DMIA 2W87A 1NQJA 4N9HA 4U36A 3H8UA 3HD8B 1ZBE1 4F83A 4FPOB 2EVXA 2WN2A 2ZZJA 3D0SA 3PNAA 4LEJA 5C5TA 5CAZA 3NV3A 1HRI2 4FFGA 2ES3A 4MGZE 1D0HA 2YC2A 5I8SA 5GZGA 2EF6A 1GANA 4QPGA 1HN0A 4IE5A 1R1ZA 1F31A 4Y20A 1WW7A 4FPEA 1WWYA 2ZGOA 2EIEA 2C24A 1UZZA 4COWA 1NE6A 2ATFA 2DVDA 1L3JA 4XJ9A 4BYYA 1X7NA 2GNTA 4E4DX 3AKQA 1NA1A 4QQOA 1GMMA 3PU8A 3JXSA 1WGPA 3NSTA 1URXA 3GCWA 1HB3A 1W0PA 3PIGA 4BH9A 2R063 3MI8A 5KHGA 3RI8A 3S0MA 4QPIC 2JIJA 3AKTA 3OYWA 5CVRA 5E89A 4IEZA 2BP6A 2HWE2 4CUBA 2YG0A 2K9ZA 2WS91 3CQOA 1UWWA 2DU0A 2ILMA 4H7MA 1TQ5A 4W6WA 2DVBA 2DU1A 5BNNA 1C57A 4L92A 5LEJA 1NKGA 1HQWA 1UPIA 1W3VA 4Q8KA 2VOVA 4M3CA 4YZ2A 3OY8B 1RUI2 2WFPA 2R16A 4XDOA 1W6NA 1UMIA 4NPRA 3VZNA 1UIJA 3IMMA 5A3WA 4BIOA 1BBT1 1XC6A 5ACA1 1ZBE3 2YU2A 1PMJX 2RG4A 3LPFA 4BPZA 4AI3A 3A0NA 1A78A 1PGW1 1WD4A 1VRBA 3U37A 5F32A 1WKYA 2W3JA 4E2SA 4HG6B 1LAJA 1S0IA 4QHOA 2BQPA 2ZHLA 2W52A 5B4XA 5FZLA 4BB3A 2JDUA 1STMA 5JZGB 4IGOA 4Q8LA 4D3WA 4CXYA 1S0EA 4NIDA 3CF6E 2XKOA 4CP9A 4FT8A 2A6YA 3WW2A 2YV8A 2VZUA 1QJZA 1K5MB 3FBYA 1JI6A 2ORZA 1YO8A 3CBNA 1CQ9A 2AH2A 1IKQA 4Q1PA 3LEKA 5FCCA 3NJVA 4Q0VA 5D1IA 3VHPA 4Y1UA 4LIUA 5AFBA 5BNPC 3U75A 5KC5A 3WDVA 3SHRA 4Z82A 3UNPA 3MYXA 3V64A 3NW4A 3T30A 4K7JA 1POV3 4DY3A 4M00A 3KHBA 2JDZA 1NE4A 2WLPA 4QPIA 4XQ4A 1N1YA 3FMGA 4N43C 1H4GA 1PMIA 4IV3B 5JOXA 2J1RA 4AGGA 1LOBA 4UOJA 3BOPA 1RUC2 3KZ4C 2ZX4A 1SLAA 4ZY9A 1BBT3 2R0HA 1VMHA 5JIAA 4LPLA 5D8AA 4MGSA 3URFA 1CAWB 1CWPA 5E88A 5A7PA 1F15A 3BUCA 3KWVA 2ZGTA 5ABJA 2UURA 5FMDA 1QIQA 2XL7A 2QNKA 3WX5A 2FMYA 4UW5A 4XUNA 3ZYGA 2D43A 5CA6A 1H9WA 3P5BA 3WF0A 1JUIA 2XJTA 4OQ8A 2J1TA 2EA7A 4OULA 1LU2A 2V4VA 2YY1A 3RNSA 4D6SA 2RS31 3WEZA 3ZSEA 3PVNA 1C5HA 2RS11 4NHYA 4GIQA 2YXSA 1D4M2 3AFKA 5LW9A 2C4XA 1UKGA 1K5JA 3M3EA 4QDSA 4RHV3 5CBLA 1ZZBA 2KA3A 2VG9A 2GP3A 1ZNPA 4AG4A 1I6XA 2VQ0A 4K6BA 3AMMA 5FK8A 5TSWA 4Z1VA 1DGRN 2CYFA 4K1YA 4NAMA 1TEIA 3K3OA 5J3UA 2JENA 1K42A 3JD72 4BZ4A 4LK6A 1WBFA 4ISRA 4GMP0 4PIYA 3SH4A 4TN7A 1GOFA 4CDUC 3B7MA 4FOYA 1YI7A 3EJKA 4P9LA 4J1WA 2XOMA 2R1DA 2V09A 3E6DA 4D6RA 1UX6A 3ETQA 3VB9A 4YG6A 1RUI1 5LBFA 1GUIA 2W1WA 4YYOA 3WP6A 4S2DA 3E6BA 3VBOB 1PX4A 3R4SA 3U1XA 4ZU7A 5A32A 5DMYA 3DGTA 4ZONA 5CKNA 4LLFA 5J36A 4CP0A 2QKDA 1KS4A 4HN0A 5L9VA 3FZ3A 1UL9A 2ARXA 3IB3A 5F2SA 2RJLA 1HRI3 5I8YA 5ANNA 5FBZA 3WV6A 1T2XA 3HT2A 4XUQA 1F5JA 2WC2A 4JGZC 2WDBA 3W21A 3T08A 4AVCA 1WMEA 3M3QA 2D93A 5ERLA 4TLFA 1IGOA 1YIFA 3MLKA 3GJBA 5KHKA 5L9BA 4XFIA 2RS33 3BCWA 4F7ZA 1ZZCA 2RS13 1AR82 1BQPA 2OS2A 1IZ3A 2JECA 3VLBB 3ZFFC 4Y33A 1L7RA 4A3XA 5IFTA 4PT6A 4YFZA 1SFYA 1SLIA 1YYNA 2WNUB 5B2GB 2A71A 1WCQA 2ZGUA 1AR61 1AF9A 3CJIB 3CLPA 3JUUA 3S57A 4P9GA 1G86A 2Y38A 4OHXA 2RS51 1H8TC 1OKQA 4IQPA 1KXGA 3H1WA 4P9XA 5C6CA 5K0UB 2P17A 3FLRA 1OQDA 3WQ0A 4CCMA 3RDIA 5F3CA 3I3MA 2VOTA 4GD4A 1O8SA 2KM2A 3QCWA 4CEWB 2ZJCA 2RR11 2FMDA 1RUI3 1O3SA 3ACLA 1ONAA 5FZAA 1DGWX 4CCNA 5FZHA 4EN6B 1B35A 1EPZA 3NO8A 4CPBD 1HW5A 2YFZA 2JJ6A 2YC4A 5A7OA 1W2AX 4AEMA 1TNRA 1POV0 1YQ6A 2D6NA 4PF5A 5FYVA 1TME1 4CCLA 3K51A 2OZJA 1LHWA 1QU0A 2XH6A 2BTVC 1SG3A 2XBO2 5IVYA 1WLDA 3SCFA 2OW4A 3FLPA 4IDZA 3IBMA 2X29A 4XOGA 3PDQA 1OH3A 1OVPA 1XU1A 2NQYA 4NPMA 3WLUA 2PAEA 1LOAA 2WR9A 5H9PA 2W91A 5T52A 3SH5A 1JTZX 2JE8A 3S7EA 4FSJA 2KD7A 1HIXA 1OOPC 5BNOB 2Y6HA 2R072 2IVJA 4A3ZA 1GWKA 1BMV1 4Z2WA 3M3CA 4XFAA 2CTVA 1O59A 4K3UA 3OBRA 3IMNA 4D69A 5LWBA 5HV0A 2CWMA 1R082 2BBVA 1EAH2 2XG3A 1NOVA 1AR63 3FBMA 2A1XA 2CU5A 4CCDA 2WYFA 2XVKA 5CNAA 1QH6A 4JGYC 1MQTB 2RS53 3PUAA 5LEKA 2CDOA 3KCXA 1ZVFA 3AP9A 3MIBA 3PUSA 4DXSA 1M4WA 5FWEA 4CU8A 4LBNA 4ARYA 2WUHA 1ENRA 5IAVA 1QDOA 4YFWA 2VL4A 1Q56A 4URTA 1O3RA 3ACHA 5A80A 2XL9A 4ASKA 1JYCA 4ASMB 4W8JA 3UJOA 4XDQA 2C0ZA 1UMZA 1W2OA 2R6QA 3JCIA 3VD7A 1FOD1 4JQRA 3RG0A 2Z69A 3WDYA 4L9BA 1PVC2 3BN6A 2WYSA 3NKGA 4UFKA 1TME3 2VUCA 5FP4A 5A70A 2B39A 4Q4X2 3ZFEB 5IVVA 1AR62 4CXWA 1QXJA 1RB8G 3C7HA 4DINB 2P1BA 1EUTA 1XPWA 4CCKA 3RMYA 2WZR2 2ZHMA 5T54A 3WNOA 5KXEA 4HOOA 1WA4A 2EXHA 3RZZA 3M7AA 2RJKA 3LA7A 2DVAA 1O4YA 3T3YA 3ZKUA 1XE0A 2PHXA 2QTWB 4CEWC 4FTEA 3VBRC 4LHSA 3J4UH 1D4M3 3DPRB 2XVGA 2P3IA 5DAVA 2VR4A 1XYPA 4BQWA 3KT1A 3KQ4B 4KWUA 3DF0A 4GJYA 2X09A 1S2BA 4LBLA 3VGIA 4A2UA 4W4ZA 5HBAA 5I0RA 5JWPA 1O7FA 4BXSV 2EXJA 2XKPA 4DRVA 3MF6A 1EV12 3JD73 2E7AA 3D4KA 3K48A 1GR3A 3WF4A 2WRAA 4GKYA 3MIDA 1O4TA 1X9PA 5DN2A 3QH7A 5C5UA 2HBTA 4ZZ5A 1SHWB 1QNYA 3IAQA 1HQNA 3ZIWA 1SQ4A 1N3PA 1C3HA 2X5IC 4CEYB 3PMSA 1V00A 1W9WA 1F8VA 5BPXA 3RJRA 2X53S 4E8CA 2DCJA 1FOD3 4RS5B 2WWUA 4IEYA 2WSUA 5F5IA 2AEZA 2A6VA 4OHVA 1RUJ2 4GH4A 1QJY2 2XBO1 1UOGA 2JDNA 4I30A 4O9EA 5ANQA 4COUA 5JSOA 4B29A 1ULCA 3V0BA 3P3PA 4PBPA 3KF3A 4A6SA 3X29B 4MH0E 3E6CC 3MFCA 4RL7A 5FZ7A 1UY1A 2LS6A 2Y6JA 1UXXX 2TEPA 3QLQA 2WIIB 2B7YA 3P6BA 2LROA 4OHYA 2OXBA 2IUWA 1YCIA 4XFBA 4AEDC 5IVEA 2B5HA 1ULFA 2BV4A 4JX0A 4U2AA 2LW8A 3JBG2 1ND2B 4X8NA 2BEOA 3WQ1A 5KXBA 2QQVA 1HKDA 2C9KA 2ZGRA 4NO4A 4XJAA 4QX0A 1TMF1 3PVEA 2MEV1 3ZSJA 1QKQA 1XYNA 5JPMB 2NMNA 4BQ4A 2QFEA 2ZAHA 4YZ3A 1UOJA 4FXGB 5LY2A 3ZXKA 4HPKA 1W8FA 4YW7A 3OGJA 1VBB2 5L9RA 2FZ1A 4JDNA 2GNDA 2QVSB 2RV9A 3KSCA 3ZYIB 3TN92 5E6HA 3ZSKA 3LEIA 5FZDA 4IE4A 1W8TA 3D5OA 3N36A 4F3JA 2GU9A 3L2YA 4ARXA 5LY1A 4OZXA 1NCQC 2PQSA 5L7OB 1GZ9A 1PVC1 2FQPA 1IQDC 2VZSA 5DAXA 1LOCA 3I2OA 4Q4X1 2X5IA 4CRQA 2XBO3 3H9AA 3OGSA 2R32A 3WUDA 2HWC2 2IXLA 2YB7A 2G9ZA 1DQ6A 2E7QA 4QU2A 3ZR6A 2D5HA 1ALYA 1CIWA 4I02A 5AC92 2R073 5IATA 1GP6A 1RIRA 4QPYA 3SNMA 1MR5A 4QQPA 3OBAA 4KWLA 1GNYA 1VRH2 2BPA2 4CDQB 1NCRA 1EV11 3RFRA 1UX7A 3WW3A 4KG0A 1DQ4A 3WW4A 1TMF3 4EN7B 2UYAA 2IXKA 4A41A 4PI0A 1G9AA 1W6PB 1IHMA 3MLJA 3MW3A 3WY6A 4AEDA 1OI6A 1QDCA 2JD4A 3AL5A 1DGRA 3J8F2 4GJZA 4QGLA 1JN2P 4AVAA 3NAPA 1U12A 1RMU1 1Z7S2 2E7TA 3T1LA 3N3HA 3VZJA 2HYXA 5I8TA 2Z2SB 3H0OA 2IXJA 3A22A 3FHQA 3WCRA 1NG0A 1JYXA 4QX7A 1RUD1 1PVC3 4IV1B 4N53A 4A42A 1AR91 1ULPA 1ZX5A 2DCKA 2XJPA 4Q4X3 5KXDA 4CDWA 4LJHA 5DABA 1BJQA 2VBPA 3N4MA 3OSDA 1ULOA 5FXVA 2WZR3 3LA2A 3AMHA 3AC0A 2XMLA 2AENA 4GWMA 4LBOA 4OVEA 1Q3EA 3IPVB 2Y6KA 4MXWA 3P1IA 1AL22 4HSJA 3AYCA 3ZFGC 5IW0A 1VB2A 2P3KA 2ZBJA 3BGAA 4CCCA 1W05A 1RUE1 2WNVC 3MLLA 4BQXA 1UY0A 3OEAA 4B7KA 3GF6A 4NRPA 5FLHA 3EYPA 1YJKA 2RMU1 1EV13 3NRUA 3OCPA 1PGL2 3VBSC 2VJXA 3HQXA 4RFT0 2RHPA 1UF2C 4XJWA 3S5QA 3HEIA 2WINB 3OGVA 1RUG2 2ET1A 5EIYB 3VBHC 4P14A 2DBIA 3TEYA 1RMU3 2ZHKA 4PLMA 1E57A 1E5IA 4LBQB 2W1QA 3MUZ1 3K4ZA 3LDRA 3H42B 1X33A 1F4AA 3AXEA 5FREA 4BXFA 1RUD3 4OFGA 4R52A 5FZKA 4E4SA 1AR93 1E5RA 1LHVA 1SCSA 2FCUA 2WNOA 3L2HA 4K8RB 1RUJ3 4LXLA 5FMOS 5FZBA 3USUB 3K4DA 1XRUA 3HVDA 3NMBA 4AE2A 2WKKA 1UW8A 2JB4A 4OI2A 2CY6A 4Y1VA 1BEV1 2D6OX 1LULA 1GOGA 3J26N 3AKSA 1YEWA 2DWRA 4YM0A 1W39A 1DF0A 4RGAA 1BK1A 4OZOA 4XAAA 3OY8A 3C2UA 1YHFA 2JKXA 3VBUB 1UZ0A 2A6WA 2QDNA 1WZXA 3ZIXA 5DZGA 5FK7A 3WG4A 3ME2A 4ZXKA 5CG8A 1RUE3 1OLQA 3AZWA 3IAPA 4DS0A 3JBG3 3NNJA 3B01A 3I54A 1PIV1 2Q8CA 3ZFGA 2UY9A 3AVRA 4HT1T 3ROUA 3E1F1 5JIUA 1IOAA 2Q0AA 1QJU2 2JG8C 5F3GA 2R062 3GGLA 4FP3A 5JZGA 2XJRA 1SEFA 3N7JA 5C8WA 5LRRA 3Q8EA 2OIIA 3GZAA 4P9JA 3WG1A 1YI9A 1LCLA 1IQAA 2FZ2A 1RL3A 3TN93 4BDVB 4R4XA 4O61A 3IIAA 5EJZB 5FWJA 3DYMA 1K5MA 1S0CA 4SBVA 3HT1A 4FFHA 1ZZ6A 3H7YA 1V70A 2LTNA 2GMEA 4YARA 3VDBA 3GBWA 4XTPA 4IL7A 4UBHA 5HXVA 1JZ3A 3ELNA 1ZBE2 2FDJA 1BEV3 2VAUA 4P9IA 2E51A 2HWC3 1S2EA 2L9LA 3Q8FA 4XURA 4AXOA 5JI9A 4IV3A 2NMOA 3RPQA 3SCHA 5IK8A 1H6YA 5F37A 4R9AA 1RJ8A 1Y7BA 3A21A 3K3NA 4DQAA 1DYOA 1VBA1 3M2MA 5AVAA 2XJQA 1CAWA 3I2JA 4E2GA 5IK4A 2VGDA 3I4IA 1O3QA 5IVJA 3M3IA 4PDWB 4JKMA 4MLOA 4OI0A 1RHI1 3ZXEA 1V6OA 2DVGA 2JDYA 4UXAA 4ZS3A 2OKXA 1F9KA 2LUWA 1DQ5A 4DEQA 1H30A 4MV2A 1C4RA 1CESA 5FXZA 2NP0A 4W65A 3TBDA 2ZKLA 2Q4SA 5A3MA 1U5YA 2FCTA 2DTYA 1OQ1A 1G9CA 1Z7S3 4P5HA 4OYUA 3MPPG 2CL2A 2WS92 3C7OA 1HRV1 4BU2A 3O1PA 1HJFA 2VW2A 5FP7A 5JMCA 4AL9A 4XFFA 1VE0A 1FPN1 1RUH2 2WO7A 3N7LA 5T50A 4YM1A 3WINE 4YM3A 4S2GA 1LU1A 2WA3A 2IZWA 3SQOA 5IK5A 1PZ8A 3HN1A 3ZVXA 4QPGC 2OVUA 4YVSB 3EO6A 5KHIA 1XXNA 5HCBA 1BBT2 2NM1A 5ACA2 2ZMLA 2VY0A 4H55A 4GKXA 2YU1A 4QXKA 4XIOA 2XLGA 4AQSA 2JG9B 1S4CA 1NA1C 1PGW2 3PJYA 1PK6B 3VBOA 4LMFA 4EYUA 1DFQA 2JDKA 4AYUA 4KMQA 2GDFA 1ZBA1 5FBJA 3MPBA 1QGLA 1IG3A 1U0AA 2OQ6A 3O5SA 4IE6A 4FPGA 3HN3A 4B4RA 3F2ZA 2Q30A 1MEC1 4EN8B 2J1SA 1ZA7A 4PIXA 4A44A 2HWB1 2HEVF 4FFFA 4UW6A 4WZCA 4P9WA 4Y4RA 5FYUA 3H8OA 3KM5A 3U07A 1IS5A 1RHI3 2EIBA 5A6XA 1QJU1 5BNNC 1AR71 2RE9A 5FY0A 1RVF1 2J1UA 2JIGA 3RVHA 1PGSA 1PNGA 2OA2A 2DUPA 3MEPA 2VZPA 4XMAA 4IEVA 1FMD1 1SPPB 3ORJA 1WCDJ 1VB4A 3ZLIA 1HRV3 4L0PA 1XYOA 4QWNA 2ZS6B 2VC9A 4XC9A 3ZYBA 2B46X 1FPN3 2VMEA 3NKTA 4AGRA 4DRRA 4JHZA 5GALA 2WNUA 5FZEA 3CJIA 1XNBA 2Y6LA 4QDRA 5FZFA 1PHMA 3I2FA 2BJSA 5K0UA 3SLIA 4Z2AA 1JUHA 4KI5M 1S0FA 4WM7B 1CZVA 1RGSA 4AI9A 2XUMA 3FHAA 4QT6A 5EP9A 2GC0A 1B09A 3UKTA 4LHLA 5C3SA 3S6PA 4XAEA 1YFWA 2JD9A 4XMIA 4AVVA 1ZREA 3K46A 2BGOA 3ZOIA 3R4DB 4LKSA 5BNQA 1ZBA3 1KJRA 1SDWA 4IW3A 2Q1MA 1A8DA 1OPMA 4RN5A 5BV6A 2CGNA 3MV11 2BUKA 5I93A 3OF1A 2NZ9A 1QJFA 2ERFA 2GC3A 2RS32 4PJYA 2XB6C 1S55A 2HWB3 2RS12 3W20A 3BALA 1J58A 4KH9A 4OMCA 4QQ2A 1GQHA 1SBDA 4TZDA 1QJU3 1UAIA 2GALA 1RVF3 1YFYA 1REFA 4QKDA 4JZRA 4EV0A 1V9U1 3N9PA 1F4HA 4GULA 2XJSA 5I0UA 1OUSA 1PO11 1QOOA 5BNOA 1LOEA 2Y0OA 1CAXB 2VZVA 3I2KA 3POGA 2BFUL 4AGVA 3FHIB 4NAOA 2BOIA 5DZFA 2W5FA 3B93A 1BLZA 4HN1A 4YG0A 5D8AC 4JTNA 5FY4A 4DXRA 5FXXA 5A1AA 1RUH1 5E16A 4FPKA 4ZPIA 3VBFB 5A1LA 4LQRA 4HKOA 5JOZA 5ABJC 4XYXA 4QKFA 2JE9A 2BGPA 4QHBA 1PO21 1DBNA 1MQTA 2PA7A 1AHSA 2IWGB 2VBBA 4NIGA 1HDKA 1KD7A 1C28A 3QACA 4M3CE 4EN9B 1JXNA 2WO1A 4FQ4A 3PHMA 4LNVA 4JQTA 4XF3A 5G04L 4A45A 3LA3A 4QXBA 3WR0A 4H3WA 1FI2A 1XE8A 2B9UA 3UGHA 2FBEA 3S7IA 4ZU4A 1REDA 4AHYA 1MS9A 4YZ1A 3BI3A 1COV1 4WVMB 1HXS1 4YVWB 1GZTA 2H0BA 1W8HA 1PM4A 3CIHA 4XBLA 5DQ0A 5IWFA 1W8OA 3SC7X 1WCSA 4M4RA 3LKJA 3SCGA 3ZFEA 4NVPA 5FO7B 1RXGA 3NV4A 4DEVA 3KD4A 4HLTA 5FYMA 3PVBB 2OX0A 2XHKA 2ZEWA 4IGPA 4META 5FY5A 2X05A 3IWZA 5LBCA 4QXHA 3KB5A 4WVWA 1TE1B 2SBAA 3ZX7A 2QBXA 2QZ3A 5BXXA 5F6KA 4DXTA 1PO13 5C9AC 3T2PA 1GNZA 5C3QA 2RS52 2WS93 1O4ZA 3DPRA 2WZPP 2Q8EA 2VVDA 4E8DA 1ZZ9A 4FQZA 4MZUA 5FZ1A 4Y5Z0 3EB7A 1RUH3 1AYM1 1FV3A 2RR12 2W9XA 3EHKA 4IEXA 3J7LA 4FAGA 1PO23 2F6BA 5CFCB 5IVCA 2CDPA 5EJ3A 5IVBA 5ACA3 1YQ2A 2VM9A 4NHXA 1W0NA 1IPKA 2Z5WA 4RGKA 1BXHA 5JDBA 2XLFA 4QKBA 3JU9A 1TME2 1W6QB 1UYZA 4OUMA 4CEYA 2C9AA 1XB9A 1NUKA 2BW8A 4RR3B 2BGCA 1PMHX 2IVIB 3LAGA 1GFF2 4RS5A 5HCAA 1COV3 2ARCA 2D3PA 1HXS3 4HANA 3GJAA 2XWBB 3AKPA 2W46A 1FATA 1EP0A 2VOKA 1ULEA 4HVRA 4V2WA 1HV0A 1MS1A 1DGWA 1BMV2 1Q8QA 1W9TA 1W8NA 2CAVA 3RWNA 2E32A 3VD5A 5C4WA 1IG0A 1AUYA 5EYXA 2W1UA 2Y34A 5J98B 3UETA 4Y22B 1A6CA 2K2SA 4LTAA 4YW3A 1B35C 2X10A 4P5YA 1J59A 2ZX3A 1MZ6A 4DPNA 3D3AA 3WP4A 1AYM3 2CHHA 4CU6A 3O1UA 4HKLA 3BU0A 1ND2A 4MO3M 3HBKA 3ALQA 1C1LA 4CE8A 4EZHA 5C9AA 3GALA 4CUCA 2GC2A 3WHUA 5K4LA 3LFMA 3MHZA 4QX1A 2X8KA 3DKQA 4IESA 1FOD2 4HKWA 4KBZA 3SMHA 5A3LA 3POWA 3IM0A 5LBBA 1QEXA 4L99A 5FUIA 5JXGA 1YQ5A 2DDUA 2PLV1 1YNAA 1O8PA 4H2AA 1H1MA 2Q8OA 4UFMA 4C8DA 4DB5A 3WNMA 4MG2A 5FY7A 3GCXA 5L7OA 4BA6A 3MICA 3AMNA 3HQUA 2AGSA 4AEKA 4DXZA 1LEMA 5CFDB 3BTYA 4Y5TA 1MVEA 2QQIA 1XNKA 4WM8B 5FYTA 1JYWA 3NNMA 1KDMA 5FYZA 4CDXB 1JZ6A 3ZPOA 1WMFA 2ADEA 3A7QA 3CL1A 3KV9A 4JRLA 5HCFA 1VLNA 2AC1A 4ZHNA 3ZYPA 2YPJA 3KVBA 5LATA 5LASA 5LA2A 2ZOEB 2FCVA 1VR3A 2OPKA 3POYA 2XPJA 3UL2A 1XE7A 4UI9L 4FPYA 3BTZA 3AZYA 4Q1RA 1GSLA 2XDVA 2VE1A 3A4UA 4I3GA 4CDQA 2CV6A 2FDGA 1NLRA 5IK7A 2V72A 4OQ9A 1GKBA 5FR3A 4W50A 4GXLA 1CAUB 5CIRA 1SDDB 4CU9A 3POJA 5FPAA 2ZMNA 3T1MA 3R05A 4Z8BA 4I2OA 1JZ5A 3OD0A 2PQQA 3J7NA 2WA4A 2HH9A 1Q8PA 2GMMA 1NXMA 4BQ2A 1ND3B 1RUF1 5LB6A 4DUXA 3BIEA 5DDJ1 3N9MA 3AXDA 2P37A 1DCSA 2MNGA 3VN4A 3WOGA 1MACA 3B94A 4RQPB 3ZXFA 4YGCA 1XJAA 4IV1A 4LHNA 2E6VA 4CCJA 5CEHA 3O1MA 3CHXA 3RJ2X 4Q4W1 4Y26A 1PZ7A 3FJSA 1JH5A 1G7YA 3QBQA 1W8ZA 5JPNB 5FJKA 2PXJA 1UN1A 4COVA 1VAKA 3W5NA 2XONA 3IPVA 4ES8A 3WNXA 2QQPA 5DUXA 4ATEA 4AHZA 1TMF2 1IPJA 2MEV2 1FX5A 2PHTA 1GV9A 4J6GA 4V1PA 3C7FA 4ATFA 4EWAA 2IXIA 2YZ4A 1MS4A 3VDDC 2VO5A 3WHTA 2RR13 1CJPA 1GZCA 5FYIA 5C8CB 4GH4C 1N47A 3O1RA 4MHUA 4AF9A 5DG2A 1HJGA 5A6ZA 3HBZA 2HJIA 2A6ZA 2BNNA 3O7OA 1RUOA 4JTOA 3LIGA 3IKWA 2WN3A 4V2VA 1U5XA 3GNEA 3T2QA 3OPWA 1RUF3 4JAAA 1OH4A 1TG7A 4Q2FA 3ZDVA 1T6BX 4ISQA 1Q43A 5JVVA 2H6BA 2XUEA 3SITA 3KT4A 2WQZC 4LBQA 3SKJE 1KITA 2D40A 3VZKA 1KDKA 3FFZA 3LPGA 5A7SA 2K46A 4NPLA 2YHJA 2NPIA 1ZRCA 1AXKA 1XNAA 2VXJA 2QCSB 3USUA 1UZVA 2JX9A 3ZM8A 4KWKA 4M4PA 3RYPA 2B45X 4NWVA 4HK8A 3VD3A 1VBD1 3BU7A 2DFCA 5JLVA 5IJRA 5DUUA 4QQLA 2VOWA 2G4IA 3LSEA 3H50A 2PYTA 3I49A 4QX5A 4UW4A 4FPFA 3VBUA 1I9RA 3RS6A 2P3YA 4GA9A 1BCXA 4LR4A 3PTYA 4WVVA 2XXZA 3RZMA 1CX4A 1CD3G 1SFNA 1JODA 1NQDA 1RMU2 4N8MA 2Z4FA 3ES1A 5GLVA 2BYVE 1UCXA 1QOSA 2G9GA 4UFLA 1FAYA 3D82A 5BYNA 4QPIB 3VDDA 1RUD2 2E63A 4KL1A 3W9AA 4AOCA 1AR92 2JDHA 3O0XA 3MIHA 3VZOA 3AKRA 2FDFA 3AP7A 4FI9A 1W04A 4BK4A 5GZCA 1IS4A 3KF5A 3JB4C 5GKAC 2D97A 3LQCA 4LKDA 3WF3A 2W39A 1IS3A 3ZN5A 5DPNA 1NCRC 1YFXA 2V73A 4W6YA 1VPHA 2J1EA 2W08A 3TYJA 4R8HA 5DG1A 1X8MA 1RUE2 2RDRA 3GYDA 2NYYA 3FC0A 3K4AA 4XE9A 2QQMA 2DVFA 4UT5A 2ZPXA 5FZOA 5FPVA 3DN7A 4XCBA 5DUVA 4E9KA 3NAPC 3Q8BA 1JZ4A 2RMU2 5FYCA 2W92A 3AFGA 3RGBA 5HCHA 1DYKA 1J84A 5I0DA 2EIGA 4XACA 2E53A 1UU5A 5I0SA 1ZRRA 4N53C 2WAOA 3I59B 4PDWA 1HX6A 4R9CA 2D6KA 3HPNA 4CDWC 2J1AA 1SCRA 1E5SA 4NIHA 1QOTA 4XUPA 1QJX1 3DUIA 4LO6B 1PX3A 4JRAA 2HEWF 5EHDA 5FKCA 4MUVA 4FOQA 3E5QA 4MOAA 3U4XA 3WNLA 5FZMA 5BNPB 2DCZA 3CMGA 1UU4A 1SFPA 2Y6FA 5C70A 2JXAA 2B42B 4CCOA 4DFSA 1BEV2 1Y3TA 3THTA 3VZMA 3QH6A 5GZFA 1IS6A 2A70A 1J3RA 4IERA 5CKQA 3VKNA 4BLIA 4N43B 2EXKA 3AK0A 5HV4A 2JICA 4HETA 1BK0A 1L7QA 4FO9A 4OUSA 3WF1A 1JOBA 1KJLA 4YVSA 2VMCA 4QGNA 3WF2A 1X8EA 1UZYA 2PHDA 3PMEA 4KU7A 1UU6A 3TWIA 3SH3A 1K12A 3VZLA 5I91A 4HFSA 3ZN6B 1OD3A 2YROA 2WWSA 2VXRA 3AYAA 3B5LB 1H4HA 1PIV2 1PK6A 4GB31 3PUQA 2BBAA 2MEV3 3POIA 5CYYA 3AP4A 2W47A 1UPSA 1VBE1 4L11A 3RI9A 2R30A 1DQ1A 5T5LA 3B00A 3ZYHA 4UYBA 2JE7A 4UW3A 5A7QA 1Y9QA 4Q4V1 4A7ZA 3PU3A 4TTGA 4IEUA 4PIZA 4A6OA 1UXZA 4E4ZA 1XNTA 4OUEA 2EICA 3PURA 2JDPA 3CJXA 4OI1A 3WDTA 4L2NA 3FFQA 5KWRA 1ZYBA 1SPPA 3WG2A 2YPDA 4LO4B 4OHZA 4CDUB 1POQA 1EUUA 2J1VA 5FZ4A 4JV4A 1KEXA 5CB7A 5JAXA 2GNBA 1Y43B 1RTVA 4R9BA 5F1RA 5LK7B 4J25A 2RM21 5GLWA 3WQBA 2J42A 3MIFA 3ZXLA 3E5UA 3AX4A 1YIPA 2BOJA 3F95A 1WMDA 4ZKTB 5F3IA 1NLQA 1VBA2 3N7MA 4GWNA 4WM7A 3THPA 5JZGC 3RYRA 2CAUA 2E33A 1XU2A 4C0BA 3H8RA 1DDLA 5A3UA 3KQRA 1A3KA 1K3IA 2VTXJ 1ENSA 1CZSA 4MSVA 5F9TA 1DLCA 4GB33 1DYPA 1RHI2 1WA6X 4AVSA 2QJVA 4JGZB 2VU9A 3K75B 5FZ8A 1LGNA 1ASJ1 2OUJA 4NWWA 2WABA 1K5MC 1UIKA 1ZZ7A 3GDBA 4ORFA 2Y6GA 3C7GA 4K9SA 4CU7A 1H2MA 1OA4A 1QF3A 1W3XA 2PTMA 2YBSA 4PLNA 3ZSLA 4XFHA 3ATGA 4EWEA 1LEDA 4YW2A 2GSYA 3ZFFB 1HRV2 1Y9GA 1ZZ8A 2HWF1 1SLTA 1FPN2 2ZABA 5FZGA 3S30A 3M4FA 4YNIA 1PVXA 3LOIA 5T55A 1W2UA 4KU8A 3IT8A 4IV3C 2GZWA 2ZEZA 4KWJA 5F2WA 5KHHA 1AX1A 1CPMA 3WT3A 1C1FA 2ET7A 2I45A 3BIWE 1H8TB 2BDRA 3RWKX 1CAXA 5FMCA 1H1IA 4K20A 3R6SA 2CGPA 3T2OA 5J37A 2W0XA 5EYYA 4FP2A 3ZDSA 4DNYA 3VBFA 1ACCA 3V56A 4XBQA 2JDMA 1AXZA 1I1EA 2FD8A 3BKZA 2ZGMA 1JU3A 2QQUA 2WT2A 1CPNA 4COYA 2RM23 3I7DA 5FXWA 4M0HA 3H1MA 4G9SB 1XQNA 1AYN1 3ST7A 1ZBA2 4CTEA 3AVSA 2V4AA 4I0WB 2PHRA 2JEMA 2ZGQA 4M01A 3M3OA 1MEC2 4MXVA 5FZ9A 4FOVA 4AR2A 4BLJA 2HYKA 2BNMA 2HWB2 4FPLA 4I3PA 1H0BA 1OUXA 2RMU3 4K21A 3RZLA 4FPHA 2KXLA 4FVVA 4Q0SA 2DCYA 3VD4A 5LA9A 3GZEA 1ASJ3 1AR72 1H2KA 1RVF2 3WDUA 4XDPA 4S2HA 4WVMA 5DUWA 2AZ5A 4Y24A 1OOPB 1T6GC 4YVWA 1CN1A 1NYWA 4AVBA 3LZZA 3VUOA 3MZHA 4UF0B 1CZTA 1TZOA 1FMD2 2Q1ZB 4B7EA 2GMPA 4YW4A 4H7LA 4BJ0A 2QUOA 1W8UA 3TEZA 1W6OB 3LCPA 5EPAA 5FRAA 2AEYA 4AAPA 5CADA 2HWF3 3RZJA 2VD7A 3RMXA 1XOYA 3KT7A 2E31A 4IETA 2ZGPA 1V6KA 2CWSA 2ZTNA 3GHMA 1LECA 4NHLA 3VBOC 3K2OA 4JGYB 5LBEA 1GOHA 4XF0A 4BK5A 1S2KA 3ACFA 2VQUA 4L97A 3OJBA 2O8OA 4R9DA 1ODMA 4FBFA 4B3NA 1JHNA 1MS8A 5F3EA 3BODA 2KR2A 2FDIA 2VW1A 2YDEA 3EBRA 3HR9A 5EZWA 5JMOA 3O12A 1VIWB 2ZMKA 4LOSA 4YSFA 3V0AB 3KHCA 4BWOA 2GC1A 5EFUA 1AJOA 2BERA 4GAZA 4Q4Y1 2VQTA 5CFCA 3NV2A 1N1VA 1WCUA 3ITQA 3T0AA 3PL0A 5IVFA 3OB8A 1MS3A 1YQ8A 4PLOA 5FQ0B 1ODNA 2AYHA 3DECA 3OPZA 3OGRA 4G3YC 4AFAA 4EZ4A 1W6QA 3MV01 4X8PA 1PIV3 4C0HA 4XIKA 1V6JA 1OSGA 2FHRA 2NN8A 2W1SA 1AVBA 5JR7B 3WNNA 4CXXA 4C90A 3O1SA 3POBA 4RR3A 1GQGA 1QWRA 3WG3A 4AVTA 2W95A 1PM7A 2ID4A 4N90A 2LRPA 3J7MA 1D2QA 1V9U2 4B8EA 2WNUC 1LGBA 2ZGSA 3GBFA 4QKNA 5FPZA 3VBRB 4B1MA 1J1LA 1PO12 3CJIC 4LO8A 5F8PA 2BRTA 1W06A 5L19A 1SZBA 4FCAA 4GZ9A 2ENRA 5JSRA 4XF1A 5K0UC 1RUNA 3N9LA 1LNSA 4HPKB 4Y3OA 2WO2A 4FTBA 2B9VA 2VMDA 3ZYFA 1FXZA 4B4QA 2GNMA 1OLMA 1PO22 4RYDA 3OG2A 2Y26A 4Y22A 2XJUA 5FYBA 4KBBA 3VDAA 1WW6A 1TNFA 1WUVA 2ORXA 1V6MA 3T4HB 5FIXA 3CZUA 2YBPA 1W6MB 1R1A1 3AZXA 3L9JT 2XGXA 3U0ZA 2X5IB 4BMEA 3IZOA 4K8FA 2VMFA 1JZ8A 2Q1FA 4EN0A 4QD2A 1OA3A 1NY71 1OLME 2WBKA 3FX3A 3WUCA 2WT0A 1A34A 4UBGA 2CNAA 2P5BA 1C5IA 4EROA 4XJ8A 1VBA3 3LGRA 1KRIA 1X82A 1NXD1 1DZRA 1COV2 1HXS2 1LKNA 3APBA 4LIVA 4YZ4A 1APNA 2AR6A 5A3TA 5BNOC 3E97A 1BKZA 4X6RB 1PNFA 4D8MA 1SBFA 2DCTA 3VKLA 3MUY1 1KGYA 3N9NA 3NL1A 3UYJA 1LODA 2ETEA 2VTXA 1R091 2D98A 3Q8AA 5JUVA 2D6MA 2ARAA 3C8XA 1CONA 3WQ7A 4KQ7A 3UESA 4YW5A 4YPJA 2R041 5FYHA 1WLCA 4PBOA 5CFDA 1IPSA 1MQTC 2BVVA 4WM8A 2GH2A 3ACIA 4LHKA 4QB1A 3SKVA 3TB0A 3LF7A 3MFAA 3LIHA 4AEDB 4CDXA 1GQPA 2ZKNA 5A3NA 3U4SA 3LEGA 1AYM2 4A7YA 2BWCA 2YGMA 3WSOA 1GP4A 4GMP1 5A7NA 3WD5A 4AHXA 3PUIA 3CNAA 5FP8A 2ZEYA 4HVOA 3VDCA 5J1XA 2GAUA 4CZSA 5FPXA 3U78A 2D44A 3BPZA 2OZ6A 4WZFA 4YWAA 4LITA 1R1A3 4MVTA 2ZGLA 4EJRA 1U5ZA 3ZFEC 1OKOA 4FPCA 2A3YA 1GZWB 4IGQA 5DXDA 1LOFA 2MPFA 3HIFA 5F5AA 1LHOA 4JDMA 1CAUA 2AREA 1NCQB 5DAWA 1GNHA 1LOGA 3ILNA 1HQLA 1MEC3 4PQQA 4NOTA 4QPWA 1FNZA 1ND3A 3BPSA 1ENXA 1MPXA 3VHOA 1S0GA 3DPRC 3ENRA 2VNGA 4ZU5A 4BE3A 2CSGA 3B69A 1Y4WA 2D7FA 3UKNA 1AR73 1R093 1WBLA 4RQPA 2D5FA 4E27A 3PLQA 4JKKA 2PELA 3KV5A 1OFSA 2R043 4JC1A 4Q26A 1DZQA 1LRHA 3DYPA 1HLCA 1FMD3 3VV1A 2YC0A 5JI7A 3O1OA 3ZYRA 3JB8A 1E5HA 3HAGA 4QM9A 3THCA 1OVSA 2QQKA 2QE3A 3U11A 5FJHA 2BZDA 4CEYC 4GMP3 4W6XA 1W9SA 3ZYJB 1Q8OA 2N7GA 2QDRA 3LSDA 3W59A 3VHNA 4RS5C 5K7PA 1UOBA 3BVCA 3FUQA 2RDNA 3LE0A 2XR4A 5C8CA 3H3UA 2PLV2 5LK5A 3KMHA 3NJXA 4BMBA 5A6QA 2FDKA 2G9FA 1POV1 4YG3A 5FP9A 4IXLA 4BISA 2O0OA 5A7WB 1QXRA 5C4WC 4FXKB 1WD3A 3I2DA 3LDBA 1YC61 2EXIA 3NVCA 1DP0A 4F8AA 2P6CA 2YMZA 3M70A 3NQHA 4HXCA 4QM8A 5GLUA 4FTSA 3VBUC 4ZS2A 1CJDA 2ZZQA 1V9U3 3RQ0A 1ND2C 4ZXEA 3HNYM 1AZDA 3HQRA 2DURA 4HZFA 3ZFGB 3IIIA 1JS9A 5AVPA 5FZ0A 4NHMA 1DGLA 1H9PA 1W90A 2WNVB 1CAVB 1UY2A 3I3BA 5FY8A 3D0JA 4AK3A 1C8NA 2DTWA 2ZACA 1G8WA 2JB8A 3GZTB 4XF4A 3VBSB 2DYCA 4RHV1 5FLIA 4JHTA 4XXAA 1JOPA 2ZX2A 5L7OC 1Q8SA 2HWD1 1UYYA 1RUF2 5J48A 3AB0A 4JVAA 5E1RA 3VBHB 4CSWA 5DDJ2 5FAXA 2G1MA 3PIJA 2QQLA 1YXWA 2ZX1A 3O1VA 1IKPA 4CVUA 3DL3A 2GN7A 4UWDA 4RA0A 2Y0IA 4XEZA 1H2LA 4Y5SA 5EXOA 4MGQA 2WL1A 1JOJA 4HL0A 5FMOL 1JW6A 2XHNA 1OPOA 1US2A 1NT0A 1HB1A 2O14A 4QAWA 4Q4W2 5CKMA 3VHRA 4AWDA 4ZZ8A 2WZEA 5L36A 3SEPA 4CA9A 4LA2A 4LA3A 4MHRA 1HRI1 1OMIA 2ADDA 2IXHA 3A0KA 1UYPA 3UK9A 4CDQC 4LORA 4NHKA 2GP5A 1LTEA 2ZGNA 1LR5A 1NZIA 2P6HA 3NWKA 2VUJA 2VUAA 3HNMA 3KCYA 4INDA 5J7MA 4LO7A 3VD9A 1H6XA 2WSVA 2XLAA 1X9TA 2UWBA 4IE7A 3OD4A 4LT5A 2R1BA 2QQWA 4P00B 3I8TA 5T3NA 3WDWA 3VL8A 4EE2A 1W0OA 2JG8B 3HMYA 1GLHA 2IFWA 2H6CA 1W28A 2P2KA 2TNFA 4L8QA 5T5PA 2VMIA 5AFEA 3NNLA 2ZA9A 5GZDA 3KVAA 4B4PA 5FO9B 3A23A 1UYXA 2WQ4A 2HWD3 3OUIA 2HWE1 3I59A 4IV1C 4NRQA 5FZCA 1V6NA 5FO8B 1EPWA 4LLOA 1VP6A 3ZN4A 3OOXA 1S0DA 2PHWA 5IAXA 3O14A 2D6PA 1MS5A 4QMAA 5A33B 1BVP1 1REEA 3VKFC 1RJ7A 2UY8A 4R4ZA 3UT0A 3MIGA 1Y9MA 3NV1A 2VMHA 1RYYA 3SISA 5BNPA 5FLJA 2IFRA 5L73A 2D3RA 3BYWA 3I2GA 3I3EA 2I2SA 2WZ8A 4LUMA 1W9FA 3TRSB 3KV4A 1VBD2 3GBGA 4J1XA 1XNCA 4CUGA 1F35A 4NE9A 4S2FA 4QXCA 1V0AA 2VZQA 2V5DA 2VCCA 2ZAAA 4N43A 4WVZA 2LALA 4CPBA 3G6JB 3OPTA 1N1TA 4OLLA 5JXIA 1Q5OA 2QQJA 4MGIE 4DY5A 1JYNA 4B1LA 1YRZA 4RSUA 5IHRA 1J3PA 5F5CA 4FOWA 1JU4A 3NNGA 4BQYA 3ZN6A 5LA1A 2GN3A 4XZPA 1O5LA 3UGGA 2VZOA 1L7LA 4AW7A 5FV3A 3FUOA 4JKLA 3LOBA 4YGDA 3JQWA 5F5QA 4PHZA 3T4VA 2VCBA 5GLTA 1W6PA 3CKHA 3KGZA 1LJ7A 4HVQA 2HWE3 3NJYA 4BQ1A 1SACA 2PLV3 3MIEA 2VUDA 2QQNA 2R7EB 3I2HA 2VVEA 4O7XA 5DAQA 4IEPA 3HOBA 1J1TA 1W8WA 3R4UA 4IE0A 4OCTA 4UFJA 2O1QA 1BHGA 4N7IA 3TEWA 3FLTA 4YM2A 5ISLA 5DAPA 3LB9A 4QPGB 4HK9A 3LEMA 4FAHA 1I5PA 5KHJA 3NJZA 2PHLA 1QQP2 1UZWA 2A6XA 1RITA 3MW4A 4Y20B 1RUC1 2VOXA 3O0VA 4GWIA 4UFIA 5FKBA 2DFBA 1UY3A 2EIDA 4CDUA 4LOTA 5HI0A 2VQAA 1OF4A 2IXCA 3GXUA 3MF9A 1OLRA 5C33A 2WNEA 2PHUA 2MHFA 2WLQA 2XJVA 3DXTA 4NRMA 1NA1B 2ARBA 1XSRA 3AZVA 3D6EA 4QHZA 3AYEA 5C3PA 3PVOA 1RC6A 4BQ3A 4A4AA 3OYWB 3V65A 2Y8KA 3VL9A 3E5XA 4NROA 4Q0QA 1CIYA 1OFNA 3RZKA 3ES4A 3OUHA 2SLIA 3ZXDA 4CUAA 4OI4A 1D4M1 1JHJA 3O0WA 1BVVA 1GP5A 1X50A 1YLLA 2XWJB 5A6YA 4XPVA 4I0BA 5BNNB 4JGZA 1QJX2 1JZ2A 3CDZB 4LE4A 3H3ZA 3AJZA 1BYHA 3ON7A 5JOYA 5KXCA 2VNRA 4M3CB 2Z42A 3DV8A 5M0TA 1WW4A 3M1HA 1W6NB 1EYBA 1ST8A 3GZUC 1HN1A 5DDJ3 3JD71 1DIWA 4DIQA 5FOJB 3ZFFA 5CG9A 3KS7A 5A3PA 1C8M2 3WNKA 1OC1A 1ULDA 4K40A 1VBC2 3K77A 3ETPA 4Q0UA 3EMRA 1DLLA 2QQOA 4IEQA 2TUNA 1MZFA 3ZR5A 5K9YA 1X36A 3OBTA 4QQHA 5K8SA 1JMUB 1R64A 1PZ9A 1NLSA 1S0JA 1QH7A 1RUC3 4Y4YA 1H8TA 3ZMNA 4Q4W3 3GHNA 5G05L 1W99A 1HB4A 3EQEA 4NMIA 1WLWA 4C1XA 4BQ5A 5FMBA 3DCQA 4LBKA 4DOUA 2J22A 2Y33A 4TYSA 4PDWC 4CP9B 3S5AA 1GBGA 2Q5TA 5IUQA 2AUYA 4HMZA 4GB32 5LA0A 1ENQA 4CYDA 1CX1A 5DZEA 3FWEA 1CR7A 1VBE2 3CO2A 1K45A 5F7UA 3DXUA 3Q8CA 5FPBA 5JSPA 4LBMA 3UJQA 2D3SA 1AR81 1TVGA 4GQ7A 3T0BA 4Q4V2 1AXYA 3B3QE 4JCKA 4XHXA 1YQCA 1OD5A 1OURA 4LULA 1F5FA 2W68A 4AI8A 1ZRIA 4Q29A 1MZEA 1MZ5A 2A3XA 3BOWA 4N9IA 1U5IA 4ET7A 5LZ6A 2RDSA 4LBQD 2UWCA 1OOPA 1HB2A 3C3VA 5APAA 5SV5A 3VKMA 5D2AA 1A8MA 4YVSC 4QB6A 4UF0A 4CP1A 2A75A 5JCTA 2J7MA 4HONA 4AQTA 3THDA 1W6OA 2HKXA 2JKBA 5D8AB 5JXJA 2E9QA 5J09A 3ZSMA 3AMQA 2VECA 5ABJB 4PF1A 2JG9C 3N7KA 3I3QA 1W03A 4XVHA 3ZO0B 1QQP1 1PK6C 1W2TA 2RM22 4AHWA 4YW6A 4AI1A 4JGYA 1NZCA 3UGFA 4LKEA 5JR2A 1H1AA 5FYSA 1VBD3 4D0QA 3WXPA 4FFIA 4QX2A 4LBJA 2RJ2A 5FUNA 2JDAA 1FNYA 3DYOA 3H7JA 3CEWA 4NUBA 1KS5A 4DUWA 3FE5A 1SLBA 1HV1A 3V0AA 2VZ1A 4O65A 3KV6A 2WFF2 1ASJ2 2EAAA 3ACGA 1S0BA 3OTFA 4PI2A 5C4WB 5FOBB 5FQ0A 1AL0G 4QGMA 3BTXA 2NLRA 2R071 2VW0A 1AR83 3W58A 1JYIA 4Q27A 2BNOA 4NN0A 5IFPA 3HJRA 4XFGA 2HWF2 1FYUA 1O91A 1ZRFA 4CCEA 3POFA 1R081 4XBNA 1KFXL 1EAH1 1N3QA 2WO3A 4CEWA 2Y64A 3KLSA 5C9AB 3VBRA 4PQ9A 1UD1A 5A32B 4AFMA 3MBWA 2ZXQA 1GICA 3LWCA 1J3QA 4BHPA 1SLLA 1C8M1 3I2IA 4WM7C 4AFBA 1VBC1 5SV8A 2DF7A 3WDXA 3ILRA 1QQP3 4QU1A 1ZRDA 3JZVA 1S1AA 5F6LB 1D2SA 1NX9A 3AMPA 1AYN2 1SBEA 3B9IA 3JQXA 3POSA 4D7YA 1OT5A 3EXUA 1W6MA 4IEWA 5IYYA 4TXWA 2JG9A 2EAKA 3ABZA 1G9DA 4BCUA 4QX3A 2WZR1 5FDBA 3TAYA 1LGCA 5FFOC 2VPVA 2O8QA 1UOFA 2VH9A 4MYEA 3ILFA 1H8VA 2TBVA 4XF9A 1N1SA 5T5JA 2W2IA 3ZPYA 4NJ4A 1XSQA 2C5DA 4A7KA 4NIIA 1Z0HA 2PAKA 2BFUS 1QJX3 3VBFC 2VBDA 1R083 4XXPA 1EAH3 3IDCB 4XTMA 3PTRB 2W94A 4AEJA 2XVLA 4P02B 4QDQA 4XZUG 2Y60A 4D7SA 1VJ2A 2A73B 4AQ2A 1B35B 3KGLA 4GWJA 2XQXA 1AX0A 4RD7A 5A1FA 2WT1A 4YGBA 1C8M3 5GM0A 3RYKA 3GM8A 4HBNA 1AJKA 4YLZA 1VBC3 3P3NA 4COZA 1BZWA 2DUOA 1G6NA 4ONUA 3G7DA 3LDKA 3OGGA 4I09A 4Q4Y2 2Z79A 2G19A 1V6IA 5C7GA 2YGLA 1VMFA 4EQVA 4P9YA 1WCKA 2V5YA 4XUTA 1MVQA 3AJYA 2VMGA 4YVWC 4DZGA 4URAA 2OYZA 2VVFA 3R0RA 1RUJ1 1QJY1 3B02A 1GZWA 5FZ3A 5LRSA 3AM2A 3B9CA 4YRDA 4AFDA 2WFF1 4I0AA 4AZZA 3INAA 1EY2A 1VBE3 5FY1A 3RRDA 2VTFA 1D4VB 4M3CF 3SXWA 1NCQA 1QXPA 4LK7A 4YGEA 5T5OA 4KGQA 3H3LA 2PHFA 4QX8A 3WCSA 5J96B 2OUHA 2VZ3A 3N35A 3LD8A 3WW1A 2YYOA 3CZJA 1DQ0A 3C7EA 2RDQA 4Q4V3 1M06G 4XHBA 1D0GA 2VCMA 5C3OA 5I0TA 3D8CA 4XJZA 4OHWA 2UU8A 2WAAA 5FZ6A 3TNPB 4AAXA 4TWTA 3JBG1 1VMJA 5B4NA 2VULA 3N9OA 1ZM1A 2HEYF 3T09A 4DO0A 2ZCWA 5CFCC 2K0GA 3BB6A 5EV7A 1UMHA 3RZGA 4G4FA 3U14A 3DEMA 3FN9A 3T0DA 1NAEA 1R1A2 4XQWA 1VBB1 5D21A 1J83A 2ZHNA 4I01A 1OHFA 1I5ZA 3DKWA 4LUKA 1N3OA 3TN91 1G9BA 1NY72 1JYVA 3QD6A 4XW3A 4H14A 4RR3C 3WP5A 3RZHA 4IEOA 1XNDA 3OEBA 4BOWA 1O5UA 3IDAA 4C91A 1OF3A 3AP6A 4LE3A 1QJY3 4WV8A 1P8JA 4Y1XA 3UV9A 3MO4A 1RXFA 5GZEA 2WFF3 2WJSA 4XCAA 1DHKB 1R092 2HWC1 4M0NA 1OA2A 2BU9A 1DG6A 5A7WA 1WLTA 1GU3A 4AQ6A 1W9YA 4SLIA 3IDEA 2R042 5AC91 4ES9A 4TSVA 5E8AA 4MGTA 2VNVA 1OXCA 3Q9OA 2Q8DA 3WZ1A 4YZ5A 1UNBA 1QJEA 5H9RA 4RGGA 2H0VA 2ZX0A 4EWDA 1VRH1 4AI0A 1UO9A 5KC6A 3ASIA 1WMXA 4D6QA 3O1TA 5KBFA 4XQDA 4YW1A 4MADA 3ZXAC 2I74A 3UKVA 4Y1YA 1F2NA 1LHUA 2UYBA 3BTAA 4KGGA 3U10A 5FUPA 4D7TA 1I3HA 1UY4A 1US3A 1CGPA 1JBCA 3VDDB 1UKRA 2WNVA 5EJ1B 4OMDA 4E4HA 1CAVA 3J7HA 3J8F1 5GLZA 1VBB3 4HSLA 4GH4B 1Z7S1 3NNFA 3AP5A 3RSJA 3TOJA 1RINA 1YWKA 1MS0A 3VBSA 2F4LA 5LCWL 2E26A 2YUEA 1AYN3 3V0BB 1VALA 2EALA 2P34A 3USSA 1D7PM 1QMJA 4BIFA 4Z92B 1VAVA 3M8LA 4MGYE 5EWSA 4UAPA 2PFWA 5HPOA 1H2NA 2P3JA 1YJLA 2C1FA 2BVBA 4LKFA 4PCRA 5H9SA 3VBHA 5CFDC 1OBNA 4WM8C 3QOPA 2CGOA 3CU7A 4ITCA 4CDXC 2XQRA 2FDHA 1V6LA 1FV2A 2JWPA 5FZOB 1QY4A 4K1ZA 4CP2A 5KR7A 1AL21 2ZGKA 3MW2A 4FPJA 5AC93 1O6UA 2HLEA 2A5ZA 2VZTA 3WP3A 3IN9A 3AYDA 1LENA 4LO5B 2I07B 2PMWB 4O9GA 2RVAA 5H9QA 2DUQA 1GYKA 1KQRA 4IUGA 4UFHA 4Q0PA 4X6QB 2VNOA 5BUVA 5FP3A 3I3DA 2VZRA 2OT7A 5GJ6A 1UQXA 1VRH3 1YFUA 2A7AA 4GALA 3MDPA 5FPUA 4JDOA 4MGKE 1GWLA 1LOFC 3POEA 4ASLA 1PGL1 1LHNA 3OBZA 2GH8A 2WWJA 3HWJA 3MGUA 4TLGA 3AL6A 2QZ2A 1OQEA 5FPLA 5FYYA 1RUG1 5FZIA 3J8F3 1SLCA 1XBFA 1ND3C 4XFCA 2UWAA 3SEEA 4NR1A 2F17A 1KFUL 2D6LX 3FL7A 1W2NA 3ZMOA 4Q4Y3 1ULGA 2JG8A 4Y1ZA 4RQPC 1GWMA 2C6SA 4QB2A 4AI2A 4D94A 4XUOA 1O3TA 1CVNA 3J9SA 2DV9A 5EQUA 5HXMA 3ZKYA 2B4KA 2OPWA 2YBKA 3PUHA 4Z07A 3T2TA 2C26A 4RFRB 3ECQA
chains in the Genus database with same CATH topology
4AFCA 4E2QA 1ZA4A 5JOWA 3ZXJA 5A33A 3H1YA 1AL23 2B8MA 1WW5A 1NCRB 1FT9A 1QNWA 3ZXGA 1SMVA 2F4PA 2R0FA 4KNCA 4MX3A 1VAMA 3VKOA 5FTTC 1YUDA 4BM8A 4KG8A 4N7UA 5BY5A 2LM3A 3NAPB 5C8CC 4XETA 1AX2A 3TNQA 4RHV2 1DQ2A 2R061 2PN5A 1DZTA 2IC1A 5CU1A 4C1WA 1Z78A 3AZZA 3WVJA 4WBBA 4N53B 1RUG3 4XILA 2HWD2 3KCCA 4CDWB 2PAMA 1LB2A 1QHDA 3PJQA 4MXWB 2BWAA 1Q8VA 2A3WA 3IDBB 1LESA 1DU3D 1G9FA 4XJUA 2R49A 4DMIA 1NQJA 4N9HA 4U36A 3H8UA 3HD8B 1ZBE1 4F83A 4FPOB 2EVXA 2ZZJA 3D0SA 3PNAA 4LEJA 5CAZA 3NV3A 1HRI2 5I8SA 2ES3A 4MGZE 1D0HA 5GZGA 2EF6A 1GANA 4QPGA 1R1ZA 1F31A 4Y20A 1WW7A 4FPEA 2ZGOA 1UZZA 4COWA 1NE6A 2ATFA 2DVDA 1L3JA 4XJ9A 4BYYA 1X7NA 2GNTA 4E4DX 3AKQA 1NA1A 4QQOA 1WGPA 3NSTA 1URXA 1W0PA 4BH9A 2R063 3MI8A 5KHGA 3RI8A 3S0MA 4QPIC 3AKTA 3OYWA 5CVRA 5E89A 4IEZA 2HWE2 2K9ZA 2WS91 2DU0A 2ILMA 4H7MA 1TQ5A 4W6WA 2DVBA 2DU1A 5BNNA 1C57A 4L92A 5LEJA 1HQWA 1UPIA 4Q8KA 2VOVA 4M3CA 4YZ2A 3OY8B 1RUI2 2WFPA 2R16A 1W6NA 4NPRA 3VZNA 1UIJA 4BIOA 1BBT1 5ACA1 1ZBE3 4BPZA 4AI3A 3A0NA 1A78A 1PGW1 1WD4A 4E2SA 1S0IA 2BQPA 2ZHLA 2W52A 5JZGB 4Q8LA 4D3WA 1S0EA 3CF6E 2XKOA 4FT8A 2A6YA 3WW2A 2YV8A 1QJZA 1K5MB 3FBYA 1YO8A 1CQ9A 2AH2A 1IKQA 4Q1PA 5FCCA 4Q0VA 5D1IA 5AFBA 3VHPA 4Y1UA 5KC5A 1AR62 5BNPC 3WDVA 3SHRA 4Z82A 3MYXA 3V64A 3NW4A 4K7JA 1POV3 4DY3A 4M00A 2JDZA 1NE4A 2WLPA 4QPIA 4XQ4A 1N1YA 3FMGA 4N43C 1H4GA 1PMIA 4IV3B 5JOXA 4AGGA 1LOBA 3BOPA 1RUC2 3KZ4C 2ZX4A 1SLAA 1BBT3 2R0HA 5JIAA 5D8AA 3URFA 1CAWB 5E88A 2ZGTA 5ABJA 2UURA 2XL7A 2QNKA 3WX5A 2FMYA 4UW5A 5CA6A 3ZYGA 2D43A 1H9WA 1JUIA 2XJTA 2EA7A 4OULA 1LU2A 2YY1A 3RNSA 2RS31 3ZSEA 3PVNA 1C5HA 2RS11 4GIQA 2YXSA 1D4M2 3AFKA 1UKGA 3M3EA 4RHV3 5CBLA 1ZZBA 2KA3A 2VG9A 1ZNPA 4AG4A 1I6XA 2VQ0A 4K6BA 3AMMA 5TSWA 4Z1VA 1DGRN 2CYFA 4K1YA 5J3UA 1TEIA 2JENA 3JD72 4BZ4A 1WBFA 4ISRA 4GMP0 4PIYA 3SH4A 4CDUC 3B7MA 4FOYA 1YI7A 3EJKA 4P9LA 4J1WA 2R1DA 2V09A 3E6DA 1UX6A 3ETQA 4YG6A 1RUI1 4YYOA 3WP6A 4S2DA 3E6BA 3VBOB 5A32A 3R4SA 4ZU7A 3DGTA 4LLFA 5J36A 4CP0A 2QKDA 1KS4A 4HN0A 3FZ3A 1UL9A 2ARXA 2RJLA 1HRI3 5I8YA 5FBZA 3WV6A 3HT2A 2WC2A 1F5JA 4JGZC 4AVCA 1WMEA 3M3QA 2D93A 4TLFA 1IGOA 1YIFA 3MLKA 5KHKA 4XFIA 2RS33 3BCWA 4F7ZA 1ZZCA 2RS13 1AR82 1BQPA 1IZ3A 2JECA 3VLBB 3ZFFC 4A3XA 4YFZA 1SFYA 1SLIA 1YYNA 2WNUB 5B2GB 2A71A 2ZGUA 1AR61 1AF9A 3CJIB 3CLPA 3JUUA 4P9GA 1G86A 2Y38A 4OHXA 2RS51 1H8TC 1OKQA 4IQPA 1KXGA 3H1WA 4P9XA 5C6CA 5K0UB 2P17A 3FLRA 1OQDA 3WQ0A 3RDIA 2KM2A 3QCWA 2ZJCA 2RR11 2FMDA 1RUI3 1O3SA 3ACLA 1ONAA 1DGWX 4EN6B 1B35A 1EPZA 3NO8A 1HW5A 4AEMA 2JJ6A 1TNRA 1POV0 2D6NA 4PF5A 1TME1 3K51A 2OZJA 1LHWA 1QU0A 2XH6A 2BTVC 2XBO2 3SCFA 1WLDA 2OW4A 3FLPA 3IBMA 2X29A 4XOGA 4C0BA 1XU1A 2NQYA 3WLUA 2PAEA 1LOAA 5H9PA 5T52A 3SH5A 4FSJA 1JTZX 3S7EA 1HIXA 1OOPC 5BNOB 2R072 1BMV1 4Z2WA 3M3CA 4XFAA 2CTVA 4K3UA 3OBRA 3IMNA 4D69A 2CWMA 1R082 2BBVA 1EAH2 2XG3A 1NOVA 1AR63 3FBMA 2XVKA 5CNAA 1QH6A 4JGYC 1MQTB 2RS53 5LEKA 3KCXA 1ZVFA 3AP9A 3MIBA 1M4WA 4LBNA 1ENRA 1QDOA 4YFWA 1O3RA 1Q56A 4URTA 2XL9A 1JYCA 4ASMB 3UJOA 4XDQA 2C0ZA 1UMZA 2R6QA 3JCIA 1FOD1 4JQRA 3RG0A 2Z69A 3WDYA 4L9BA 1PVC2 3NKGA 1TME3 2B39A 4Q4X2 3ZFEB 1RB8G 1QXJA 4DINB 3RMYA 2WZR2 2ZHMA 5T54A 5KXEA 1WA4A 2EXHA 3RZZA 3M7AA 2RJKA 3LA7A 2DVAA 1O4YA 2PHXA 4CEWC 4FTEA 3VBRC 3J4UH 1D4M3 3DPRB 2XVGA 2P3IA 1XYPA 3KT1A 3VGIA 3DF0A 5I0RA 4LBLA 1S2BA 4A2UA 5HBAA 5JWPA 1O7FA 2EXJA 2XKPA 4DRVA 3MF6A 1EV12 3JD73 2E7AA 3D4KA 3K48A 1GR3A 4GKYA 3MIDA 1O4TA 3QH7A 1QNYA 1HQNA 3ZIWA 1SQ4A 1N3PA 1C3HA 2X5IC 4CEYB 3PMSA 1V00A 1F8VA 5BPXA 3RJRA 2X53S 2DCJA 1FOD3 4RS5B 4IEYA 2WSUA 2A6VA 4OHVA 1RUJ2 4GH4A 1QJY2 2XBO1 4I30A 4O9EA 4COUA 5JSOA 4B29A 1ULCA 3V0BA 3P3PA 4PBPA 3X29B 4MH0E 3E6CC 3MFCA 4RL7A 2TEPA 3QLQA 2WIIB 2B7YA 4OHYA 1YCIA 4XFBA 4AEDC 2B5HA 1ULFA 4U2AA 3JBG2 1ND2B 4X8NA 2BEOA 3WQ1A 5KXBA 1HKDA 4XJAA 2ZGRA 4NO4A 1TMF1 3PVEA 2MEV1 3ZSJA 1QKQA 1XYNA 5JPMB 2NMNA 2QFEA 2ZAHA 4YZ3A 4FXGB 3ZXKA 4HPKA 3OGJA 1VBB2 2FZ1A 4JDNA 2GNDA 2QVSB 3KSCA 3ZYIB 3TN92 3ZSKA 4F3JA 3N36A 3D5OA 2GU9A 3L2YA 4OZXA 1NCQC 5L7OB 1GZ9A 1PVC1 2FQPA 1LOCA 4Q4X1 2X5IA 4CRQA 2XBO3 3H9AA 2R32A 3WUDA 2HWC2 2IXLA 1DQ6A 2E7QA 4QU2A 2D5HA 1ALYA 1CIWA 4I02A 5AC92 2R073 1RIRA 4QPYA 3SNMA 1MR5A 4QQPA 4KWLA 1VRH2 2BPA2 4CDQB 1NCRA 1EV11 3WW3A 4KG0A 1DQ4A 3WW4A 1TMF3 4EN7B 2UYAA 2IXKA 1G9AA 1W6PB 1IHMA 3MLJA 3MW3A 3WY6A 4AEDA 1OI6A 1QDCA 2JD4A 3J8F2 1DGRA 4QGLA 1JN2P 4AVAA 3NAPA 1U12A 1RMU1 1Z7S2 2E7TA 3T1LA 3N3HA 3VZJA 5I8TA 2Z2SB 3H0OA 2IXJA 3WCRA 1NG0A 1RUD1 1PVC3 4IV1B 4N53A 1AR91 1ZX5A 2DCKA 2XJPA 4Q4X3 5KXDA 4CDWA 1BJQA 3N4MA 2WZR3 3LA2A 3AMHA 4LBOA 4OVEA 2AENA 4GWMA 1Q3EA 3IPVB 4MXWA 1AL22 4HSJA 3AYCA 3ZFGC 1VB2A 2P3KA 2ZBJA 1RUE1 2WNVC 3MLLA 4B7KA 3GF6A 5FLHA 1YJKA 2RMU1 1EV13 3OCPA 1PGL2 3VBSC 3HQXA 4RFT0 2RHPA 1UF2C 4XJWA 2WINB 1RUG2 2ET1A 3VBHC 4P14A 1RMU3 2ZHKA 4PLMA 1E57A 4LBQB 1X33A 3AXEA 5FREA 1RUD3 4OFGA 4R52A 4E4SA 1AR93 1LHVA 1SCSA 3L2HA 3USUB 1RUJ3 5FMOS 4AE2A 1XRUA 2WKKA 1UW8A 4OI2A 4Y1VA 2CY6A 1BEV1 2D6OX 1LULA 3J26N 3AKSA 2DWRA 4YM0A 1W39A 1DF0A 4RGAA 1BK1A 3OY8A 3C2UA 1YHFA 3VBUB 2A6WA 2QDNA 3ZIXA 5DZGA 3WG4A 3ME2A 4ZXKA 5CG8A 1RUE3 1OLQA 3AZWA 4DS0A 3JBG3 3B01A 3I54A 1PIV1 3ZFGA 2UY9A 4HT1T 3ROUA 5JIUA 1IOAA 2Q0AA 1QJU2 2JG8C 2R062 4FP3A 5JZGA 2XJRA 1SEFA 3N7JA 5C8WA 5LRRA 2OIIA 3GZAA 4P9JA 3WG1A 1YI9A 1LCLA 1IQAA 2FZ2A 1RL3A 3TN93 4R4XA 3IIAA 1K5MA 1S0CA 4SBVA 3HT1A 1ZZ6A 3H7YA 1V70A 2LTNA 2GMEA 4YARA 3GBWA 4XTPA 4IL7A 4UBHA 5HXVA 3ELNA 1ZBE2 1BEV3 4P9IA 2E51A 2HWC3 4AXOA 5JI9A 4IV3A 2NMOA 3RPQA 3SCHA 5IK8A 4R9AA 1RJ8A 1Y7BA 4DQAA 1VBA1 3M2MA 5AVAA 2XJQA 1CAWA 4E2GA 5IK4A 2VGDA 3I4IA 1O3QA 3M3IA 4PDWB 4MLOA 4OI0A 1RHI1 3ZXEA 1V6OA 2DVGA 4UXAA 1F9KA 2LUWA 1DQ5A 1H30A 4MV2A 1C4RA 1CESA 2NP0A 4W65A 3TBDA 2ZKLA 2Q4SA 5A3MA 1U5YA 2DTYA 1OQ1A 1G9CA 1Z7S3 4P5HA 3MPPG 2CL2A 2WS92 1HRV1 2VW2A 5JMCA 4XFFA 1FPN1 1RUH2 3N7LA 5T50A 3WINE 4YM1A 4YM3A 4S2GA 1LU1A 2WA3A 2IZWA 5IK5A 1PZ8A 3HN1A 3ZVXA 4QPGC 2OVUA 4YVSB 3EO6A 5KHIA 1XXNA 5HCBA 1BBT2 2NM1A 5ACA2 2ZMLA 2VY0A 4H55A 4GKXA 4QXKA 4XIOA 2XLGA 4AQSA 2JG9B 1NA1C 1PGW2 3PJYA 1PK6B 3VBOA 1DFQA 4AYUA 2GDFA 1ZBA1 3MPBA 1QGLA 1U0AA 3O5SA 4FPGA 4B4RA 2Q30A 1MEC1 4EN8B 4PIXA 2HWB1 2HEVF 4UW6A 4WZCA 4P9WA 3KM5A 3U07A 1IS5A 1RHI3 1QJU1 5BNNC 1AR71 2RE9A 1RVF1 1PGSA 1PNGA 2OA2A 2DUPA 3MEPA 4XMAA 4IEVA 1FMD1 1WCDJ 1VB4A 1HRV3 1XYOA 2ZS6B 2B46X 1FPN3 3NKTA 4AGRA 4DRRA 5GALA 2WNUA 3CJIA 1XNBA 1PHMA 5K0UA 3SLIA 1JUHA 1S0FA 4WM7B 1RGSA 2XUMA 4QT6A 2GC0A 1B09A 3UKTA 4LHLA 3S6PA 1YFWA 4XMIA 4AVVA 1ZREA 3R4DB 5BNQA 1ZBA3 1KJRA 1SDWA 2Q1MA 1A8DA 1OPMA 5BV6A 2CGNA 2BUKA 5I93A 3OF1A 2NZ9A 2ERFA 2GC3A 2RS32 4PJYA 2XB6C 1S55A 2HWB3 2RS12 3BALA 1J58A 4KH9A 4QQ2A 1GQHA 1SBDA 4TZDA 1QJU3 1UAIA 2GALA 1RVF3 1YFYA 1REFA 4EV0A 1V9U1 4GULA 2XJSA 5I0UA 1QOOA 1PO11 5BNOA 1LOEA 2Y0OA 1CAXB 2BFUL 4AGVA 3FHIB 5DZFA 3B93A 4HN1A 4YG0A 5D8AC 4JTNA 1RUH1 5E16A 4FPKA 3VBFB 4HKOA 5JOZA 5ABJC 4XYXA 2JE9A 4QHBA 1PO21 1DBNA 1MQTA 2PA7A 1AHSA 2IWGB 1HDKA 1KD7A 1C28A 3QACA 4M3CE 4EN9B 1JXNA 4FQ4A 3PHMA 4LNVA 4XF3A 3LA3A 3WR0A 4H3WA 1FI2A 1XE8A 2B9UA 2FBEA 3S7IA 4ZU4A 1REDA 4AHYA 1MS9A 4YZ1A 1COV1 4WVMB 1HXS1 4YVWB 2H0BA 4XBLA 1WCSA 3LKJA 3SCGA 3ZFEA 4NVPA 5FO7B 3NV4A 3KD4A 4HLTA 3PVBB 2XHKA 4META 3IWZA 4WVWA 3KB5A 1TE1B 2SBAA 3ZX7A 2QZ3A 5BXXA 5F6KA 1PO13 5C9AC 1GNZA 2RS52 2WS93 1O4ZA 3DPRA 2WZPP 2VVDA 1ZZ9A 4FQZA 4MZUA 4Y5Z0 1RUH3 1AYM1 1FV3A 2RR12 3EHKA 4IEXA 4FAGA 1PO23 2F6BA 5CFCB 5EJ3A 5ACA3 1IPKA 2Z5WA 1BXHA 5JDBA 2XLFA 3JU9A 1TME2 1W6QB 4OUMA 4CEYA 2C9AA 2BW8A 4RR3B 2BGCA 3LAGA 1GFF2 4RS5A 5HCAA 1COV3 2D3PA 1HXS3 4HANA 2XWBB 3AKPA 1FATA 1EP0A 2VOKA 1ULEA 4HVRA 1HV0A 1MS1A 1DGWA 1BMV2 1Q8QA 2CAVA 3RWNA 5C4WA 1AUYA 5EYXA 5J98B 4Y22B 1A6CA 2K2SA 4LTAA 4YW3A 1B35C 1J59A