3UL2A

Galactose-specific lectin from dolichos lablab in p6522 space group
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
252
structure length
248
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Legume lectin
total genus 54
structure length 248
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ul2A00
4LBMA 1S0BA 4Q27A 2NMOA 1JN2P 2GNBA 4GKYA 1UMZA 3V65A 4C1XA 1FATA 1WD4A 1W6OA 4ITCA 2W52A 1QOTA 5SV8A 2AENA 3RG0A 1N3PA 3HMYA 2OUJA 4XDQA 5E89A 2DTYA 2DVGA 1ONAA 1LHNA 1V6JA 2PHXA 3SISA 5GLUA 3PVNA 4WVWA 1DBNA 3IPVB 4P14A 4WZFA 4Q2FA 2E53A 4UW3A 2ZGMA 1LGBA 1UZYA 1HDKA 2W08A 3ZSKA 3VKNA 2H0BA 1BQPA 3IM0A 2YY1A 3TB0A 1AZDA 4FOYA 1HQWA 3W58A 3IN9A 2A5ZA 5KXEA 2A6YA 2R0FA 4FQ4A 1A78A 5EYYA 1W6OB 2D7FA 2DU1A 2UWAA 4PCRA 3NV4A 1LHUA 1NXD1 4Y20B 5GZFA 5H9PA 5FREA 1OFSA 1ULEA 2EALA 1HQLA 1DLLA 2ZMKA 2GNDA 2ZHKA 1Q8VA 3AYCA 4ATEA 2VY0A 1Q8QA 1QGLA 3M3CA 1AX2A 3OY8A 3USUA 1V6OA 4Y1YA 4XXPA 1LTEA 3DUIA 2ZGPA 5KXBA 1GBGA 1VALA 1QMJA 4XJZA 1HKDA 2ZBJA 5H9RA 3HN1A 2ERFA 1LU2A 1IOAA 1SBEA 1LU1A 1MS1A 1LULA 1QOSA 1X50A 1DQ6A 3RMYA 2VW0A 2UWCA 3T1MA 5GZDA 4XE9A 2DU0A 1V6NA 1MS3A 3AZZA 3N36A 2A3XA 3R4UA 4WVVA 1Z0HA 2P3KA 3VUOA 3OBTA 3ENRA 4XIKA 1SLTA 2ZMNA 3N7MA 3WHUA 3OY8B 2JECA 4LBJA 2D3SA 1ZM1A 5KXCA 3POYA 2EIGA 2EXIA 5GALA 4YFWA 1N3QA 2E7QA 1S0IA 2JKBA 4Q1RA 1RIRA 1ULGA 4AVTA 2GALA 1KQRA 1R1ZA 4M3CF 4DPNA 1WLDA 3V0AA 4NO4A 3APBA 3D5OA 4XMAA 1QDOA 3OYWB 1F9KA 2ZGRA 2YZ4A 4YW2A 1DQ5A 2JDZA 1W0OA 3SH3A 1MS5A 2A6ZA 4XMIA 4YG6A 3SH4A 3VKLA 2ZGLA 2VH9A 2OUHA 4XJAA 1IKPA 2GNMA 3T1LA 3WHTA 3ZXEA 5CA6A 3AZYA 1LOEA 2PHRA 2A3WA 1MVEA 2CWMA 2VUAA 3AP7A 4YM3A 1ZA4A 2UURA 1YYNA 5E88A 1DQ2A 1WUVA 3U4XA 2GNTA 4PQ9A 2EXKA 1EPWA 1GSLA 1WLWA 4LBLA 3O0XA 5DZEA 1PZ8A 2XB6C 2NZ9A 1Q8OA 3ATGA 3UL2A 3M1HA 1DQ0A 3ZVXA 1F31A 2GN7A 2D6LX 2VU9A 3WG2A 1AXKA 2PHWA 1C57A 1YXWA 3LCPA 4ATFA 2ES3A 3B3QE 4Y1VA 4R9BA 4TYSA 1MS8A 4XBQA 1V6LA 2DUOA 4XILA 3MW3A 3SNMA 2LTNA 2ZAAA 4GXLA 5H9SA 1CVNA 1WCSA 3M2MA 3V0BB 1S1AA 1QU0A 3A0KA 5F9TA 1LOAA 5IK4A 1OKQA 4WV8A 1W6QA 2AUYA 3IPVA 1VAVA 4BLJA 5EXOA 3ZPYA 1I3HA 1LENA 5JVVA 4HL0A 1MZ5A 3LSDA 3WOGA 4YFZA 1JW6A 5IUQA 3FFZA 1MS0A 3ZXFA 2CL2A 2PHTA 1Z78A 3WUDA 4YZ4A 1ULFA 1LHOA 5KXDA 1CPMA 1BJQA 2EAKA 2WLQA 2WNEA 4GWNA 3WNXA 1ENQA 2ZACA 2B7YA 1TEIA 4Q1PA 1S0CA 4DS0A 4Y1XA 5FRAA 1S0FA 3V0BA 1G9DA 4YGDA 5T5OA 4Q8LA 1CIWA 3USUB 4P9XA 3WG1A 3FBYA 5JMCA 4ISRA 2AGSA 1V00A 1C4RA 2YV8A 1WBLA 4FQZA 4XHBA 5F5QA 1AX1A 2ZGKA 3D4KA 3N7KA 4ASMB 1C1LA 4FPCA 2D6KA 2VW2A 3AZWA 1N1TA 1CPNA 1QF3A 4YW4A 2SLIA 1H9WA 4UW4A 4FPHA 1B09A 1GNHA 3C2UA 4M3CB 1SLIA 3FLPA 4C1WA 4FOVA 2ZGSA 1LGCA 1DQ4A 2ZA9A 4HANA 3PMEA 4JC1A 1KDKA 1LHWA 1O4ZA 2ZABA 4XTPA 4XYXA 3AJYA 3I4IA 2EF6A 4L8QA 1CJPA 1FNZA 2W68A 3RS6A 1SCRA 4U2AA 5DG1A 1JOJA 3ZYRA 2YROA 2ZMLA 2HYKA 1LEMA 3NV3A 3DGTA 1LECA 4FPLA 4M01A 5GLTA 3WV6A 4Q8KA 5JOYA 5CBLA 2ENRA 2R1DA 4CRQA 1G9AA 2WKKA 3ZSLA 4M3CA 3V0AB 2A70A 3HR9A 3IKWA 3AP6A 1CN1A 1G9BA 3QCWA 5JOXA 1G86A 4FP3A 3OYWA 5T50A 4XHXA 3WUCA 1G9CA 1IS6A 1WW4A 4SLIA 4YGEA 2GMEA 1U0AA 5DZFA 3ZXKA 3T2TA 4F83A 1JYIA 4XTMA 1A8DA 2PHUA 3L2YA 3ZSMA 1UAIA 3D6EA 4XJWA 1UPSA 2WSUA 2D43A 1WW7A 2P37A 1SBFA 5DUVA 2D6MA 4OZXA 3PVEA 3IMNA 3FLRA 2GMMA 2NN8A 1DZQA 3ILRA 5LK5A 1GZCA 5GZGA 1UX6A 1KITA 2DYCA 4Z8BA 1LOBA 3RSJA 1MR5A 3QLQA 1BZWA 4BPZA 2D3RA 4RL7A 4DFSA 2R1BA 4AGRA 1KDMA 4YZ3A 5GM0A 4YZ5A 3B01A 3UJOA 4DRRA 5T5PA 2A6XA 2R49A 1MS4A 4YZ1A 5DZGA 2ZHLA 3O0VA 2Q5TA 1SLCA 3PJQA 3AP4A 5HCBA 5GZCA 1LJ7A 3N3HA 1DYPA 2SBAA 3WDUA 3WG4A 4ZXKA 1N3OA 4CTEA 1VAMA 4RA0A 1JHNA 3AP9A 4AWDA 2RHPA 1FNYA 4LBOA 1GZ9A 1CQ9A 5IK5A 1DQ1A 2ARBA 4GA9A 1Q56A 2ZGQA 4Y26A 4CZSA 1LESA 1WW5A 2DUPA 2ZHNA 2V5YA 4P9YA 2ZGNA 3O5SA 5GLZA 4BM8A 2V73A 1GLHA 4FPKA 4XXAA 2UU8A 4XOGA 3UJQA 1AXZA 2P3JA 4BLIA 1QDCA 3ZXJA 1ENRA 1LODA 2A3YA 5JOWA 3AFKA 1D2SA 2ZHMA 1QNWA 5IT6A 2WT2A 3WDTA 2DV9A 4FPYA 2E6VA 3GNEA 5IK7A 1WW6A 3AX4A 1URXA 2AH2A 1YO8A 3O12A 2FMDA 2OVUA 1VLNA 2R16A 4BMBA 2D3PA 1JBCA 1ULCA 3N35A 3WDYA 1OQ1A 2VW1A 1GKBA 4FOQA 1UL9A 1FYUA 4XBLA 4BMEA 1DYKA 1H9PA 1SBDA 3LSEA 2XG3A 4FPOB 3WCRA 3WDVA 4ZKTB 3KM5A 3OJBA 2A71A 5T54A 3RRDA 1AXYA 1SLAA 2Z42A 1Y7BA 4YM1A 1KRIA 1MVQA 1RINA 3AZVA 3AZXA 3RMXA 4PBPA 4P9WA 2DWRA 5CAZA 3NWKA 2WSVA 5DG2A 1IS4A 1LOGA 1DHKB 1KJLA 2TEPA 2YMZA 1UZZA 1GYKA 3RQ0A 3WZ1A 4Q26A 4R9CA 4Y22B 4K1ZA 1V6MA 1YRZA 3ZXLA 4DQAA 1A3KA 4K20A 1SCSA 1SLLA 3FUQA 5DXDA 1J1TA 3GALA 4GALA 5T5JA 5GJ6A 1ULDA 4YW5A 1S0EA 2CYFA 1N1VA 1W6PB 3NV1A 5GLVA 1FAYA 1YIFA 1QKQA 4JCKA 4PF5A 4AGVA 1PZ7A 4YM0A 2DVDA 4R9AA 4XJ8A 2P3IA 4YGCA 2DURA 5DUUA 3ILFA 4W65A 4AGGA 2A6VA 3B9CA 4BOWA 1S0GA 2NMNA 3R05A 3V64A 2DTWA 3WG3A 2GDFA 1GV9A 4XBNA 2PELA 4M3CE 3UK9A 3N7JA 3Q9OA 4K21A 4PBOA 3WDXA 3B00A 4FP2A 1V6IA 3INAA 2A7AA 2P34A 1CR7A 2DVFA 2EXJA 3AYAA 4YGBA 2ARXA 3N7LA 4LBNA 1SFYA 1O4YA 4YG0A 1IS5A 1CONA 3WDWA 2JJ6A 1LEDA 2DUQA 5E8AA 4YM2A 1GICA 1S0JA 3AXEA 3M3OA 2R0HA 3FLTA 3KQRA 1WBFA 1SLBA 2ZZJA 3TAYA 4I30A 1FV2A 2BQPA 1LHVA 2NP0A 1N1SA 4NOTA 4YG3A 1BYHA 3WCSA 4ISQA 1IS3A 1AJOA 1I1EA 1JYCA 3WLUA 1FV3A 4M00A 5HCFA 1MS9A 5T52A 3OPZA 1MACA 1QOOA 4R9DA 4Y1ZA 2AYHA 4AVVA 2A6WA 4XIOA 2CWSA 5EYXA 1W6MA 1DIWA 2WJSA 3A4UA 4YZ2A 1GZWB 3R4SA 4Y24A 3JU9A 4GWMA 3BTAA 3VKFC 3AXDA 1AX0A 4AVSA 5CNAA 3ZSJA 2W39A 4U36A 3MW2A 5GLWA 1G8WA 3W59A 5L73A 2GMPA 1LGNA 2KM2A 2C5DA 1AF9A 1Q8PA 2D6OX 4LBQD 3VV1A 3ZYPA 2WQZC 1JXNA 1SACA 2UWBA 3AYDA 4FPEA 4AYUA 3VKMA 4FOWA 5GZEA 1W6NA 2I2SA 1GZWA 3AYEA 1IKQA 3BODA 4XZPA 1Q8SA 1LOFA 3MEPA 3MW4A 1BXHA 1W6QB 3OBRA 3M3EA 3O0WA 4LBQB 3POSA 1ENSA 1W0PA 3B69A 2ZKNA 3POWA 1H30A 4FVVA 4BQ1A 3MPPG 2E7TA 2NYYA 5H9QA 1AVBA 2WT0A 4DRVA 3BOPA 2DVBA 1APNA 1VIWB 3PVOA 4Y1UA 1RITA 2DVAA 2D6PA 4FPFA 1BKZA 2A75A 1N47A 1DFQA 1S0DA 2NM1A 1NLSA 1D0HA 1AJKA 1UN1A 1W6NB 5DUXA 2EXHA 1GNZA 1WLCA 4IQPA 1V6KA 2C9AA 2D44A 3WVJA 4TZDA 1MZ6A 5EWSA 1G9FA 3H0OA 3JUUA 4K1YA 4LBQA 4Y22A 1GANA 3AK0A 2ZGTA 1PZ9A 4FPJA 2D6NA 4H55A 2VXRA 5JOZA 1W6PA 1W6MB 2ZGOA 3OGGA 2GN3A 3BIWE 3I8TA 1LOFC 2CNAA 5JDBA 5CB7A 2YXSA 2AR6A 5AVAA 3SLIA 3A0NA 1C1FA 3NV2A 3SITA 4YLZA 1JUIA 2JE7A 2CTVA 4Y20A 1QNYA 2P2KA 3FUOA 2ZGUA 3ILNA 1XQNA 5T5LA 1G7YA 2G4IA 3ASIA 2JE9A 3AP5A 5HCAA 1CESA 4GKXA 4YW3A 5BYNA 4XJ9A 5JLVA 2LALA 3SH5A 1LOCA 4D69A 1N1YA 4MYEA 1F5FA 1HLCA 1WD3A 2JD4A 5IK8A 1FX5A 3AJZA 4UW5A 1YI7A 2WT1A 4XJUA 5T55A 4FPGA 1DGLA 2AREA 4LBKA 3M3QA 2E51A 5DUWA 4YW1A 1UKGA 2CY6A 4UW6A 1LCLA 2PHFA 4JRAA 2FHRA 2OW4A 3CNAA 3VKOA 4KBBA 1KJRA
chains in the Genus database with same CATH superfamily
4LBMA 1OA3A 1REFA 2NMOA 4HKOA 1RUC3 1T6GC 4WM8C 5BY5A 1ZBA1 1HQNA 2BVBA 2XJPA 2Z2SB 4GKYA 1UMZA 3V65A 4CCCA 4C1XA 2GC1A 2W52A 3I3MA 1JODA 1HRV1 1BVP1 1OPMA 2AENA 1CZVA 2VZSA 4PDWB 5FZOA 4NIDA 1AR73 3G6JB 2OUJA 1D4M2 4XDQA 2GAUA 2DTYA 5E89A 3SISA 3WF4A 1W8OA 5JWPA 2BFUS 3SMHA 5BUVA 4E27A 3PVNA 3IPVB 4IUGA 4P14A 2E53A 1ND2B 3H8OA 2XBO3 5C5TA 1UZYA 3EJKA 3VKNA 5FZ7A 1JUHA 1T2XA 2YY1A 4AQSA 1QWRA 3NNMA 3O1OA 1HQWA 2VTFA 3W58A 1OT5A 1OH4A 1V9U1 2A6YA 1ZRRA 5FPVA 4F7ZA 2ET7A 1LHUA 4Y20B 4XAEA 5H9PA 4RR3B 1W03A 2VUCA 2VO5A 3CBNA 3NQHA 2ZMKA 2H6CA 3CJXA 4NHMA 5C4WB 1PVC1 4ZHNA 4XEZA 4ATEA 1QGLA 3LEGA 3M3CA 1AX2A 2PA7A 3OY8A 4BQ4A 2PAMA 4IGQA 5F5IA 3BUCA 4Q4Y3 2XVGA 1C5HA 4Y4YA 2ZGPA 3AKRA 5KXBA 3L9JT 4OUEA 3WXPA 3E97A 3DKQA 1NLRA 1HKDA 1JYVA 5H9RA 5JPMB 1V70A 4QQHA 5LY1A 4Q4X2 5JSPA 2EIBA 3DPRA 3DPRC 4META 4QX8A 4BISA 4JKMA 3D8CA 1PMIA 2C4XA 4FFFA 4XE9A 4QXKA 4R4ZA 3MIEA 2VXJA 3U1XA 2A3XA 3SKVA 4AI2A 1QY4A 3VL9A 1Z0HA 2P3KA 1AYM1 1DG6A 4EYUA 3ENRA 5C5UA 3WHUA 3N7MA 2ZMNA 4RSUA 2WN3A 1J84A 3OBAA 4XABA 5IAXA 2WFPA 2ZJCA 4LBJA 3K4DA 2ILMA 5FZHA 2HWE3 1UZWA 2VNVA 2YFZA 3NO8A 1GOFA 5T3NA 4QX2A 1JYXA 1QJX3 4YFWA 1F35A 4XFFA 1GMMA 1KEXA 1N3QA 3RI9A 2XJQA 5FP3A 4AVTA 1R1ZA 1VBC1 4CPBD 2QQWA 1NQDA 3V0AA 3WNMA 4NIGA 4B7KA 5JXJA 1GR3A 2QBXA 3WNLA 5F37A 2ZGRA 1R1A1 1OF4A 3NKTA 1W0OA 3SH3A 1NCQC 3RZMA 3UV9A 3KF5A 3M4FA 2ZTNA 3WF1A 4BQ5A 2IUWA 4L2NA 1D4M1 3T1LA 1IKPA 3MFCA 3TN93 1HB1A 3WHTA 5CA6A 1CAXA 2ORZA 3GJBA 4P5YA 3AP7A 4HBNA 4KWJA 2VUAA 4COVA 1ZA4A 3Q8EA 5E88A 2WC2A 1DQ2A 1ZBE2 4AQTA 5FOJB 1EPWA 1GSLA 1OH3A 4QT6A 5JCTA 1I6XA 1IGOA 3GZEA 3PJYA 2W91A 4HT1T 5I0DA 4P9LA 3N9NA 1Q8OA 3UKNA 4DINB 4L9BA 5JSOA 1JS9A 3ZVXA 5LA0A 1UYZA 2GN7A 3MUY1 4UOJA 4GMP3 1H2MA 1NT0A 3WNNA 4AE2A 1IPJA 1C57A 3JB8A 3LCPA 2ES3A 4AF9A 5C8WA 4R9BA 3HWJA 1V6LA 4MGYE 3SNMA 3ZYHA 1AYM2 3HD8B 5KHJA 2VVFA 4GXLA 1YFYA 1H4HA 2I74A 5B2GB 4MZUA 2FCUA 2WFF2 3KHBA 5A1AA 5M0TA 3A0KA 1QU0A 3PUIA 5FK7A 4E9KA 2CGPA 2F6BA 2PLV3 3H9AA 5I0UA 1UMIA 3EQEA 5CFDB 1W6QA 4JAAA 2YYOA 4AR2A 4BLJA 1IZ3A 2HWB1 3ZPYA 3ZPOA 2W92A 4HL0A 3M8LA 4AEDC 4DO0A 4EROA 4OMDA 3VZOA 2JB8A 2WN2A 1MEC1 2RS32 4RGGA 5A6XA 1GP4A 4RN5A 3W5NA 3BOWA 4QKBA 1BVVA 2ZEXA 3QOPA 3RZZA 1J83A 1VB4A 1BJQA 3HNMA 3IDEA 1M4WA 1QXJA 1DGRA 2HWE2 1TEIA 2JE8A 2ZACA 4MVTA 3OOXA 4Q1PA 3VZMA 4QU1A 5FRAA 4YPJA 1O5LA 1R093 1G9DA 1LAJA 2RV9A 3LOBA 1VRH2 2W95A 2C0ZA 1CIWA 1F8VA 1CZSA 1FOD2 2MHFA 5JMCA 1RUE3 4KGGA 2AGSA 5LWBA 2J1UA 1WBLA 3KV5A 5F5QA 2WUHA 1RUF3 3LDBA 4Q4V3 4LK6A 1HX6A 5FK8A 5C3SA 3AZWA 1N1TA 1XYNA 1CPNA 1VBE2 2O1QA 1H6YA 1NLQA 4QPGB 4UW4A 3C2UA 1SLIA 3ACGA 4C1WA 1C28A 1OPOA 1DQ4A 2ZA9A 2Y6LA 2J7MA 4QKFA 3USSA 3LA2A 1POV1 4HETA 4JC1A 2K46A 5IFTA 1O4ZA 5C3QA 2ZABA 4XTPA 5LCWL 4QDQA 4QQOA 5I0RA 1A8MA 1UO9A 2VMEA 4L8QA 1FNZA 3RWNA 3ZM8A 2W68A 3AKTA 3BU7A 3NNJA 1JOJA 4QX5A 5BNPB 2HYKA 1LEMA 4QGNA 3DGTA 5JOYA 4QHOA 2XLGA 3WD5A 2ENRA 2BPA2 4Q0SA 3I54A 3ZOIA 5EJ1B 5A33A 1YFXA 2UYBA 5A3LA 1XU2A 3V0AB 1G9BA 4P9JA 1UU6A 1CN1A 1NKGA 1UOBA 5FY9A 1WLTA 3VBRC 4GH4C 4ES8A 1US3A 2CGOA 5A32A 4A7KA 4L99A 5JZGB 1RMU1 1U0AA 3H3ZA 4IEUA 5C70A 2XMLA 3ME2A 3HNYM 1UAIA 4DZGA 1UPSA 3LKJA 1XU1A 5FYBA 3TEXA 3POGA 1NE4A 1WW7A 3MIHA 1SBFA 3PU8A 2VPVA 5DUVA 1HW5A 2RS11 4DXTA 1BK1A 3KSCA 3IMNA 3FLRA 2QKDA 1D4M3 3CIHA 1DZQA 5GZGA 3S0MA 1PM7A 5LY2A 1AYN2 4Z8BA 1LRHA 1UD1A 4BPZA 1PX3A 2B9UA 3IWZA 5FZAA 5ACA1 4YZ3A 4YZ5A 4HMZA 4DY3A 1C3HA 2VCCA 4KL1A 3UJOA 1Y4WA 1YC61 4ZZ5A 5T5PA 1NQJA 3KWVA 5DZGA 2ZHLA 3O0VA 5FO9B 1SLCA 3GHNA 2RVAA 3PJQA 5IJRA 1C8M2 3WDUA 2SBAA 4QPGA 3OEBA 3WG4A 5LASA 2JDKA 1NYWA 5EV7A 1ZZ7A 4GMP1 1W2UA 2YPDA 4OUMA 2BUKA 3LDRA 1VBD1 4OFGA 5LK7B 1GZ9A 1V0AA 3ZYIB 1R091 2VQ0A 3K4AA 1UY0A 2WIIB 3I59B 1WW5A 2TUNA 4NIAA 2V5YA 5GLZA 1O3RA 5J1XA 2V73A 4XXAA 4XOGA 3KF3A 4XURA 4I01A 4AI8A 1UNBA 3ZFGC 1AUYA 5FUPA 4HONA 5G05L 1PO22 3WQ0A 4BLIA 2PHDA 1ULOA 4LKSA 1MQTC 4INDA 3WDTA 5IK7A 1YO8A 2Y6HA 2VD7A 3O12A 2FMDA 4M0NA 2Y34A 5LRSA 4XCBA 2D3PA 2ZS6B 3WDYA 4AVBA 2OZ6A 2OIIA 2XG3A 4FPOB 1CWPA 1AR93 4LTAA 4BK5A 4Q4W1 5LRRA 1AXYA 4LR4A 4W50A 4OHWA 1X9PA 4XETA 5K0UC 4B3NA 1PMHX 1EAH3 4RFT0 2WO2A 3AZVA 3RMXA 2CAVA 3VZLA 4WM7A 4A6OA 5FY1A 3KV9A 3KMHA 1IS4A 5I93A 1VPHA 3C7EA 1UU4A 1UZZA 5C4WA 4K40A 1POV0 4RFRB 1V9U2 4PQQA 1KFUL 4R9CA 4KQ7A 3VBFA 4LHNA 5IHRA 4Y22B 4QPIA 4AL9A 1S2KA 4QWNA 3IT8A 1A3KA 5A3NA 1SLLA 2JG9C 3VHPA 3GALA 3CF6E 3H7JA 1R092 4GB31 1Z7S2 5FWEA 3S5QA 1N1VA 1W6PB 3I2GA 1RVF1 1OLQA 4JVAA 1FAYA 3I59A 3I2HA 2QZ2A 4JCKA 1X7NA 1ZBA3 4JHZA 4QGMA 3UNPA 1PZ7A 5F5AA 1W3VA 1FPN3 4QPWA 2FZ2A 5FXXA 2P3IA 2QQUA 2DURA 2ZEYA 5JR7B 2LS6A 4MOAA 4AVAA 3ILFA 1PHMA 1W9TA 4QX1A 1PVXA 4CDUB 4G9SB 4V2WA 5ANQA 1S0GA 2NMNA 3K51A 4NIHA 4E2SA 2CV6A 2GDFA 1IPSA 3NJXA 1TZOA 4LA3A 3U4SA 2PELA 1V9U3 4IEXA 4M3CE 1RUJ1 2VQTA 2WDBA 4RS5A 2HWF2 3H8XA 3KV6A 1EPZA 4YVSC 4XZUG 4MGSA 5L7OA 2ZX2A 4CU8A 1T6BX 1G6NA 1CONA 1UMHA 2VZ3A 4AI1A 1PO21 1O6UA 2JJ6A 4XF0A 5A7NA 1GU3A 3WP4A 1RUC1 5LW9A 4XQDA 2RR13 4AFAA 4COWA 1RYYA 3AXEA 3VBHC 3AC0A 3FLTA 3KGLA 3R0RA 4K3UA 2WWSA 1BCXA 3KV4A 4AFCA 2ZZJA 1O5UA 2XJRA 4O7XA 2Y33A 5FZEA 4XUQA 4RR3C 3KB5A 4P9GA 5FP7A 4QXCA 4PIYA 3I3BA 1BYHA 3WCSA 1IS3A 2WA4A 3U10A 1WCUA 1KD7A 3LWCA 4IV3B 2J1EA 2HWF3 2P3YA 2W0XA 2AYHA 4LO4B 3KD4A 3IDAA 4AI3A 2E63A 4YARA 3O1PA 1W6MA 1XPWA 1PNFA 2KA3A 2WJSA 3A4UA 1GZWB 4OI1A 3WF0A 3GF6A 4NHYA 5C9AA 1M06G 2ET1A 3WF3A 3VBSC 4GWMA 4O9GA 3VKFC 5EQUA 3GZAA 3ECQA 2B8MA 1F4AA 3X29B 3ZSJA 4U36A 2XQXA 3BVCA 3VD4A 4MXWB 1G8WA 2V5DA 1SEFA 3RNSA 3S6PA 2GMPA 4SBVA 5FLHA 4LUKA 3UKTA 2XOMA 4LBQD 3ZYPA 2WQZC 4FPEA 1JZ3A 3VD9A 4GH4A 3LEMA 4IERA 4MGTA 5JXHA 4YRDA 1UCXA 4KGQA 2BJSA 4B4RA 5K7PA 1AR71 5CKMA 2VCMA 1RXFA 4DB5A 5C3PA 4PI0A 3MW4A 5FYCA 1TVGA 5F3GA 3OBRA 1O3SA 3U0ZA 1QJZA 1JU4A 1W0PA 5L7OB 2VM9A 2VMFA 1R1A3 1L7LA 4E4ZA 4ASKA 5D8AC 1HRI3 1L3JA 3SXWA 1ULPA 2HEYF 4OQ8A 3ACLA 1X36A 4Q0VA 3NNGA 4LO5B 3BOPA 2DVBA 3GBFA 5IVJA 3K2OA 1AR82 2D6PA 4FPFA 4LPLA 1BKZA 2A75A 5L19A 1U5ZA 4QDSA 2BDRA 4HKLA 5FFOC 1Q43A 4OMCA 1VRH3 2Q8OA 2C9AA 2D44A 3WVJA 4ASLA 3MI8A 5J96B 1MZ6A 4NRPA 3H0OA 3JUUA 5C8CC 3AK0A 5A3OA 2ZGTA 1PZ9A 5J37A 4BQ2A 4TLFA 2HJIA 2OQ7A 2VE1A 1YEWA 4QQ2A 2F4PA 2VGDA 2X10A 2ZGOA 3VDAA 3T0BA 2K9ZA 1LOFC 2IXJA 3I8TA 1W2TA 2YXSA 2AR6A 2MEV3 3IAPA 4I0AA 2WAAA 3ZFGA 1R64A 2QE3A 4NMIA 4HVOA 1SQ4A 3FUOA 5FXWA 1ZZBA 1G7YA 2V4VA 4BU2A 3LA7A 5DABA 2RDNA 2WNUA 2VOWA 3JB4C 4GKXA 3ZKYA 5DDJ2 3P6BA 5BXXA 3MV11 2QQVA 5A6QA 5FOBB 3T0DA 4UI9L 3CLPA 3I49A 5C7GA 4MG2A 5FZ4A 1XNTA 1PVC3 5IK8A 1AR72 3NAPB 1FX5A 1K5MB 4IGPA 1VAKA 1L7QA 3ROUA 5A1FA 4FPGA 1DGLA 2AREA 5IVFA 3M3QA 4WZCA 3BTYA 5DUWA 5JXIA 4UW6A 1LCLA 2PHFA 4JRAA 2OW4A 1UY3A 3VKOA 5J7MA 4JTOA 4KBBA 3WW3A 1O8SA 4LHSA 1VBE1 4JZRA 5F3CA 3F2ZA 4QB6A 1CAUA 2XBO1 4CDQC 3MGUA 1GP5A 2XL9A 5SV8A 2WZR2 2PLV1 5A70A 1FOD3 2W47A 4ZS3A 4LO8A 3C7OA 2XUEA 4AXOA 1QQP2 3NVCA 4GWJA 2RMU2 3TEWA 1H8TC 1ONAA 1LHNA 1V6JA 2OZJA 4Q4X1 4X8PA 2HWF1 3VBFC 4WVWA 3TN92 5L9VA 1HJGA 4QHBA 1DBNA 1X8MA 3ZIXA 5FZ3A 4WZFA 3WQ7A 1XSQA 1FI2A 2JG9A 1UIJA 1VBB1 4UW3A 2ZGMA 1COV1 3D0SA 3POJA 1GWMA 3PUAA 1HDKA 2W08A 1A6CA 2GP3A 2RS13 1D0GA 1AZDA 4UXAA 3LFIA 4AEDA 4XFCA 3J26N 2A5ZA 4EN9B 2R0FA 5EYYA 4FQ4A 1W6OB 2OPKA 2DU1A 1DZRA 3ZFFA 3H1MA 1YCIA 2RDQA 3VB9A 1RUNA 5GZFA 2HWB2 5FREA 2LW8A 1CAXB 2P4EA 1JI6A 1HQLA 1BBT3 1DLLA 1RUD3 3VDBA 1Q8VA 3K46A 3W20A 2HKXA 3RJRA 3USUA 2WQ4A 1RUG1 2VNRA 1V6OA 4XXPA 1AYM3 3DUIA 3ZO0B 1GBGA 2Y26A 4R4XA 2VUDA 1QMJA 4XJZA 2ZBJA 2B42B 3HN1A 3WW1A 1E5IA 4EQVA 3RJ2X 4KWKA 1H2NA 5LB6A 4UF0A 1DLCA 1LULA 1QOSA 2YBSA 3RMYA 3ZR5A 3GHMA 1HRV3 5GZDA 4A44A 2WABA 2ZZQA 3AZZA 1YWKA 3N36A 1FMD2 1XYOA 2ZOEB 5I8SA 3KZ4C 3MPBA 1FT9A 3WQ1A 1QXRA 2DFCA 2BWCA 2D93A 1XXNA 1OOPB 1SLTA 2BVVA 2BGPA 3IAQA 3OY8B 2JECA 2JIJA 5DMYA 5KXCA 3SHRA 1QQP1 2OA2A 3AVSA 2XL7A 4OLLA 3FJSA 2EXIA 4FCAA 1X33A 4PI2A 1RC6A 5A3UA 3JQXA 3DYMA 2BERA 3VBSA 2EIEA 2R6QA 1QEXA 4HN1A 3V56A 5CFCA 1ULGA 2GALA 4P9IA 3K75B 4CUCA 1WLDA 1OUXA 1WCQA 3SEPA 2Z5WA 3APBA 5LZ6A 4XMAA 1BLZA 5JMOA 1QDOA 2EIDA 4YW2A 1DQ5A 4Q4W2 2JDZA 3MHZA 1MS5A 1RUI3 1NUKA 2A6ZA 4MX3A 5F6LB 4YG6A 3VKLA 4XJAA 1W39A 3ZXEA 2GNMA 3H3UA 3NRUA 4N43A 5FZ6A 1LR5A 5FDBA 3VL8A 3HQXA 4K8FA 4UFLA 5A7PA 4EJRA 2UURA 1YYNA 2VOKA 3MO4A 4E2GA 1WUVA 2GNTA 1DDLA 1RB8G 5DAXA 1MEC2 1WLWA 4JQTA 1ZBA2 4LBLA 5CADA 1JH5A 3C7HA 3M70A 2QDRA 4YWAA 3OGRA 5HV4A 5D1IA 5C3RA 3ATGA 2CSGA 3KS7A 3UL2A 1EUUA 4G4FA 3MDPA 3POEA 1PX4A 1F31A 4FTEA 3UGGA 5KWRA 2YBPA 5LA9A 1Y9MA 4YVWA 3WQBA 4ATFA 3B3QE 2QDNA 4Y1VA 2JDNA 1MS8A 2BNMA 4XILA 3R6SA 3MW3A 1YLLA 1JZ5A 2E31A 2ZAAA 4NWWA 4ZU4A 1YIPA 3VBUA 4M4PA 1AR92 2R30A 1JHJA 5I8YA 3W5MA 1KGYA 1VAVA 3K48A 2BP6A 2Y38A 4G3YC 4URAA 1LENA 4TWTA 5JVVA 3WOGA 4ARYA 4LK7A 3FFZA 1MS0A 2OYZA 3ZXFA 2CL2A 1JZ8A 2XVLA 3TN91 1ULFA 3H50A 5IWFA 1VBA2 3O1UA 3BALA 4LKDA 1LHOA 1UU5A 1CPMA 4PT6A 1HN0A 2DCJA 2WNEA 2PYTA 1ENQA 4DS0A 1S0CA 1UOGA 4GB33 3OUIA 3MLJA 1DZTA 1ST8A 2Y6GA 4P08A 5I91A 4QKNA 3VHOA 5CG8A 3ZN4A 4XF1A 2PLV2 1TNRA 1STMA 4LO6B 4PHZA 4ZXEA 4H2AA 5FWJA 4RYDA 3WG1A 4NHLA 1UY1A 3FBYA 2J1TA 4ISRA 4E4HA 3P1IA 4DUWA 4HK8A 4KMQA 4XHBA 3E5QA 1RUG3 4FAHA 5BNOA 4ASMB 4FPCA 3C7GA 3OCPA 2D6KA 1QJEA 2VW2A 5EFUA 4A41A 3P3NA 2VVDA 3GYDA 4YW4A 3BI3A 2SLIA 3MLLA 2W46A 3E5UA 1B09A 1GNHA 5LA2A 1XNKA 1JMUB 3LIGA 5ABJA 4CDQA 4HANA 4OUSA 3VZKA 3TOJA 3U75A 3PMEA 3LOIA 4WM7C 1EYBA 5FBJA 5JZGC 1KDKA 1LHWA 2QQIA 3W9AA 5FMOS 2X5IC 4JX0A 5C4WC 2Y8KA 1W8TA 1CJPA 1PK6B 3OF1A 4IE7A 2RE9A 3CEWA 4U2AA 3ZYRA 1R1A2 2VZRA 4AEMA 1RUG2 4WVZA 3NV3A 5GLTA 3FL7A 4JTNA 4FO9A 1G9AA 1TQ5A 2I45A 3OGJA 2ZXQA 3LF7A 1RUH2 2IVIB 1H2KA 2A70A 3IKWA 4IL7A 3AP6A 4O61A 1PGL2 2H6BA 3QCWA 4FP3A 2Q8CA 3OYWA 5FP4A 3VHRA 3WUCA 1VBD2 3JXSA 4AFBA 4RQPC 4XVHA 5F8PA 2P6CA 1JYIA 4C90A 3AKSA 2VC9A 4N53A 3VBOB 4LT5A 2BWAA 3D6EA 5HXMA 2O0OA 1H1MA 4HXCA 4EWEA 2L9LA 3WEZA 3ETPA 4N7IA 2NN8A 3ILRA 4MHRA 2Y0OA 3ZLIA 1UPIA 2IXKA 4I0BA 2YHJA 2IVJA 2ZKLA 1KITA 1MR5A 3QLQA 3OGVA 2D3RA 1KDMA 5A7QA 1QJX2 2VMGA 1Z7S3 3ZFGB 3U07A 2A6XA 3MIDA 2R49A 4JGZA 1PMJX 4D7TA 5I8TA 5FMDA 1TMF2 2WZEA 3AP4A 5HCBA 1ZREA 4OULA 1LJ7A 5GZCA 1F5JA 4NHXA 3VD5A 4AAXA 5EIYB 3E6BA 4BHPA 3VBUC 4JRLA 2J42A 1VAMA 4CTEA 4I2OA 1OURA 3JQWA 4Z07A 5TSWA 1F4HA 1CIYA 3RZJA 4KBZA 4DEQA 4GA9A 1Q56A 2D40A 4LIVA 3A23A 1LESA 1RGSA 2ZHNA 3PL0A 4XF4A 4FPKA 2E26A 2LM3A 2QQNA 4A3ZA 4ARXA 2VUJA 1HXS1 1AXZA 2W2IA 1W9SA 1VRH1 5DAPA 4H7MA 1LODA 4BJ0A 1PGL1 5JOWA 2VBBA 2ZHMA 3ES1A 2VCBA 3I3QA 2P17A 4CUGA 4V1PA 1W04A 1EV13 4IXLA 2UY9A 2AH2A 5FXVA 1K5JA 4UFKA 4NRMA 1OQEA 2OVUA 4ORFA 2WRAA 3TNPB 5L36A 3ZXGA 1ULCA 3AVRA 1OI6A 1OQ1A 4E8DA 5CKNA 4BMEA 4DUXA 1DYKA 4ZONA 1H9PA 3GGLA 3O1VA 2B46X 1SBDA 2ZEWA 3WCRA 3LPFA 3D82A 3NW4A 5D2AA 3KM5A 3FFQA 4XCAA 4ZKTB 2CDPA 4YW6A 3LIHA 4IV1B 1SLAA 1SZBA 3B02A 5LEKA 1Y7BA 4YM1A 1WWYA 5FLIA 1MZFA 2BNNA 4FXKB 4P9WA 1VBB3 5I0TA 3NWKA 3PTRB 3S7IA 5CAZA 4QPYA 4Y5SA 5LA1A 4UFMA 2OQ6A 4RGAA 3HN3A 2FDJA 3RQ0A 4NAOA 1GYKA 1RHI3 3T4VA 2RJ2A 4K1ZA 2ZCWA 1V6MA 4XFAA 3ZXLA 3BU0A 4DQAA 2XPJA 1IG3A 1W2OA 4K20A 1O4TA 3FUQA 3EHKA 5DXDA 4GALA 2Q8DA 2O8OA 1ULDA 4N7UA 2CYFA 4Z82A 3U14A 4O65A 1QKQA 1ODNA 4AGVA 3EXUA 4N8MA 4UBHA 4IEZA 4XJ8A 3VZNA 5C6CA 5DUUA 2R041 4W65A 5FCCA 5BPXA 1PIV1 5IAVA 4BDVB 3R05A 3V64A 2VMDA 2WFF1 3QBQA 3N9MA 5CVRA 1BEV3 3WG3A 2XWJB 3A21A 1NCRB 2X05A 2R071 2WS92 4S2DA 3UK9A 1YI9A 3J8F2 3AMNA 3N7JA 3Q9OA 1PO12 1H8TB 4J25A 3B00A 4FP2A 4IV3A 4K21A 4XAAA 2EAAA 4CCOA 1CR7A 2DVFA 3MIGA 4CCLA 2JICA 4YGBA 3N7LA 1XNBA 3KVBA 2OX0A 1SFYA 3FZ3A 1AL22 1O4YA 2C6SA 3AMHA 1EY2A 4YG0A 2B9VA 5CISA 3O14A 3WDWA 2VAUA 4DMIA 1JZ6A 3T30A 5A7WA 3HVDA 4CSWA 1IQAA 1XC6A 3NJYA 1S0JA 1NA1A 3ACHA 2R0HA 5D21A 4TTGA 4COUA 1OD3A 1ZRIA 4UT5A 3T4HB 1YFUA 3TAYA 3WNKA 4I30A 5J48A 2BQPA 2YPJA 5ABJC 4CEYB 4KG8A 3T2QA 2B4KA 1AJOA 2XJUA 3I3EA 3VHNA 3VDCA 1FV3A 4M00A 5DPNA 1MS9A 5HCFA 3OPZA 2OS2A 4HPKA 1QOOA 3ZN6B 4QX0A 1UWWA 2LROA 4XIOA 4OQ9A 5FY4A 1DIWA 4JDMA 1Y9GA 2JG9B 4CXXA 1ND2A 4NVPA 3BTXA 3JU9A 4DIQA 4BQYA 2YG0A 1D7PM 3NJZA 4AVSA 5L7OC 4J1XA 4FFHA 4OHXA 3KGZA 2W39A 4I3PA 4PJYA 2ETEA 2JDUA 3LA3A 4D8MA 5GLWA 1AYN3 1I9RA 2JDMA 4ONUA 5L73A 1POV3 1RJ7A 5K9YA 1BEV1 4BCUA 2D6OX 1AF9A 1Q8PA 3RYKA 1ENXA 1WCDJ 4HLTA 1W8NA 2PAEA 1HXS2 1SACA 3ZN6A 5A3MA 4MHUA 2XKPA 3GDBA 1OFNA 5GZEA 2VMHA 5A3TA 5KHIA 1W6NA 5GKAC 5HCHA 5FZFA 1GQPA 1K5MC 1HJFA 1VMHA 4AHWA 1IKQA 3BODA 4XZPA 1JZ4A 1W6QB 3ACIA 3O0WA 3POSA 3PUQA 3B69A 2ZKNA 1JOBA 1H30A 4EN6B 2D5FA 5ACA2 2XJVA 2IXLA 1O3QA 3N9QA 3FE5A 2NYYA 2KD7A 3MV01 2WT0A 2O14A 3PVOA 1APNA 1VIWB 2GZWA 4Y1UA 4MGZE 4NPMA 3P3PA 5FZLA 1AR61 2RG4A 2RS12 3F95A 3GBWA 4QPGC 4WM7B 5A32B 1S0DA 3VN4A 2NM1A 3KQ4B 1D0HA 3CHXA 1GNZA 4IEOA 4IE4A 2FMYA 1V6KA 2Z79A 2RDSA 4Y33A 4MLOA 4K1YA 4LBQA 1UZ0A 1GANA 3ETQA 3MIFA 4FPJA 3H3LA 1PGW2 2D6NA 3WSOA 5JOZA 3IIAA 3OGGA 3S5AA 3KVAA 2VZVA 5JSRA 3H1YA 4EZHA 2JXAA 4PLNA 4QKDA 5JDBA 5CB7A 1CAWB 4AAPA 3SLIA 3SITA 2Q1FA 4A6SA 1SG3A 2CTVA 1WMEA 4Y20A 5CFCB 1DGWA 1QNYA 2P2KA 3HEIA 2G4IA 3S7EA 5AFBA 3AP5A 2JG8A 1CESA 4AFMA 4JGYC 1WMXA 4YW3A 4XJ9A 4N43B 5ISLA 5FPBA 4FFIA 2Y6KA 3CDZB 1LOCA 3HBZA 1VBB2 3SH5A 3RZHA 2XDVA 1F5FA 4MYEA 2JD4A 3AJZA 4V2VA 4NUBA 5FO8B 5FMBA 4CP1A 1JTZX 3UYJA 2ZX1A 1RUH3 3ES4A 5F2WA 2E32A 1S0BA 4A3XA 1W9FA 1AL21 4N9HA 4HSLA 2AEYA 3A7QA 5EZWA 2ADDA 4DXRA 2R061 3QH7A 1W05A 3RDIA 2GNBA 1W8WA 4CDUC 1FATA 1WD4A 2VTXJ 3AL5A 3IZOA 4QMAA 5A7SA 1IPKA 1N3PA 2AC1A 2VJXA 3E6DA 3HMYA 4B29A 4DUVA 1OLME 4URTA 1HN1A 3PTYA 4Q0QA 2PHXA 3RZGA 5BNNA 2PFWA 5GLUA 5FLJA 2FCTA 3GJAA 4FI9A 4Q4Y2 4Q2FA 4DOUA 5FQ0A 5J98B 1LGBA 1ND3B 2HWE1 3ZSKA 2H0BA 2XLFA 3IM0A 1YQ2A 3BB6A 1GWLA 2AZ5A 3U11A 4W6XA 5KXEA 1HRI1 1TME1 2C26A 1A78A 4DXSA 2D7FA 4Z1VA 3TNQA 2JIGA 4OI2A 2FBEA 3PLQA 4XFBA 2RM21 1QJU2 5J09A 1OFSA 1ULEA 1H6XA 3AYCA 4IV3C 1L7RA 3VBFB 2WNOA 1Q8QA 1LKNA 1ZBE1 1IHMA 1OUSA 1CAVA 1S4CA 4B1LA 4BK4A 4H3WA 3CZUA 4Y1YA 2JWPA 3JZVA 4OHVA 2IWGB 5CFCC 1DP0A 2CGNA 2WFF3 2OKXA 4BXFA 3MUZ1 5A3PA 1SBEA 2IFRA 1MS1A 1NA1C 3MICA 3VBSB 1DQ6A 4Z92B 1FPN2 2VW0A 1BMV1 1W2NA 2CDOA 2UWCA 2HWC1 3I97A 2I07B 3M7AA 3T1MA 5BNOC 2DU0A 3CMGA 3VBOC 3R4UA 4D7SA 2FDFA 4EN7B 5CZKA 2G9ZA 1I5PA 1BEV2 1YHFA 1DGWX 2E33A 1ODMA 3QACA 2FZ1A 2J1RA 1YQ6A 4XIKA 2D3SA 1ZM1A 3POYA 3E1F1 4IEPA 1HB4A 5FKBA 3C3VA 1OD5A 4KG0A 4ZY9A 3RZLA 2FDGA 2EIGA 2HH9A 2JEMA 3SKJE 1OLMA 1B35B 5GALA 3SC7X 1QH6A 2Q1MA 3AKQA 4Y5TA 3OG2A 2NQYA 3THDA 3VDDC 1S0IA 2Q30A 4Q1RA 1RIRA 1JZ2A 2JD9A 4M3CF 1ZRFA 5FZIA 3OYWB 3LB9A 2YZ4A 4L92A 4MSVA 1XRUA 4NAMA 3WW4A 3ZFEB 2ADEA 4IDZA 4Y3OA 4DY5A 4XMIA 3SH4A 4OI0A 4Q5OA 3AMMA 4DEVA 1W3XA 2G1MA 4A2UA 2C24A 4B4QA 3JBG3 1SDWA 2ID4A 1LOEA 4KNCA 2A3WA 3BPSA 4P5HA 5A6ZA 5C8CA 1W8ZA 4KU8A 1FOD1 4KU7A 1JU3A 5FY0A 1PO23 1WGPA 3RWKX 1VBA1 3OB8A 3VZJA 1PZ8A 5FUNA 2NZ9A 4L97A 1YUDA 4CEWC 1W8FA 2V09A 3ZKUA 2A73B 4OYUA 2VU9A 2D6LX 3WG2A 5ABJB 1FPN1 1QJU1 1CZTA 4Q4W3 4XUNA 3EB7A 2BRTA 5LBFA 2BV4A 1CAUB 3B5LB 4CP2A 3O1MA 4XBQA 3J8F3 1VJ2A 1QIQA 2EVXA 3DYOA 2IZWA 2LTNA 1PIV2 4NE9A 4QM8A 5H9SA 3JD73 5JR2A 1CVNA 3M2MA 3V0BB 3HNBM 1GOHA 5F9TA 2D98A 3NNFA 4H7LA 4BXSV 1OKQA 4WBBA 2ZX3A 4XQWA 4ZU7A 2YC0A 3B93A 5IK4A 1OHFA 3J8F1 4KWLA 2AUYA 3IPVA 1VE0A 3SCFA 4QGLA 2Q0AA 1HRV2 1AR63 4IEWA 1RUE2 3ZDSA 3LSDA 4YFZA 1JW6A 2FDIA 2BOIA 5IFPA 2B45X 2PHTA 3POBA 2BW8A 2DCZA 2WWUA 3T3YA 5KR7A 4CEYA 3I2KA 2WLQA 3PURA 4FTSA 2KR2A 3WP3A 3K3NA 2B7YA 3IBMA 2YBKA 4BIOA 1PIV3 4CDQB 4CXWA 2XWBB 2Z4FA 1S0FA 3VD3A 3V0BA 5DAQA 3HPNA 4NWVA 3WINE 5T5OA 2GH2A 4Q8LA 1QJY2 1RUJ3 3USUB 5CEHA 4AQ6A 4CCDA 2BTVC 3UGFA 1V00A 1C4RA 1XE8A 2IFWA 1SHWB 2YV8A 4FQZA 1ZNPA 4IE6A 3ELNA 4IV1A 2WL1A 2ZGKA 3D4KA 2RS51 3AL6A 5J3UA 3ZXDA 3BN6A 4MXWA 5EHDA 3KCYA 3MYXA 3B7MA 4GD4A 4QHZA 2XBO2 4FPHA 5FZBA 3LQCA 5LATA 4M3CB 5F32A 3FLPA 4ZZ8A 1OVPA 3JBG2 4FOVA 4QQLA 5JXGA 4OZOA 1LGCA 4C8DA 4YVWB 1NOVA 4LQRA 2WNUB 4D7YA 4QQPA 2WYFA 3DKWA 4XYXA 3E5XA 1H2LA 2K2SA 2XH6A 4AHZA 2RR11 3LE0A 4K6BA 4XUPA 4TN7A 5D8AA 5IW0A 5F1RA 1FXZA 2BOJA 5FKCA 1H1IA 1XOYA 3RS6A 2ZMLA 5CIRA 3WNPA 4FPLA 5BNNC 3WV6A 5FZ9A 4M01A 4MXVA 4Q8KA 5CBLA 4CRQA 1VBE3 4AW7A 3OUHA 2WKKA 3ZSLA 2YU1A 4M3CA 2BU9A 5C71A 5EJZB 4N9IA 4CYDA 1G86A 4UFHA 4LOTA 4XHXA 3ZYJB 1G9CA 3JD72 1WW4A 4SLIA 2GMEA 3HOBA 4XTMA 4XJWA 4LE4A 2D43A 4COZA 2JKXA 2GC2A 1COV2 2D6MA 4OZXA 3WT3A 3PVEA 4CE8A 1GZCA 1S2EA 1POQA 3DCQA 3NAPC 1UX6A 4D3WA 2DYCA 5A7WB 3MFAA 3RSJA 1BZWA 4TSVA 2RS31 1ZZCA 4RL7A 2ZX0A 4J1WA 4AGRA 1VMFA 2AEZA 1K12A 3S57A 5F3IA 2FDHA 2Y6JA 5JPNB 1WCKA 4DRRA 3ORJA 4DNYA 1MS4A 3DEMA 4RQPB 3FC0A 1AR91 2Q5TA 2E9QA 3LGRA 4N90A 4N53B 2NLRA 3VBOA 1DYPA 4MGKE 3VBRA 3ZMOA 1XSRA 2VZUA 1QJY3 3MBWA 1N3OA 2VTXA 4LOSA 3GZTB 1H4GA 4W4ZA 1QJU3 2YGLA 2V72A 1SDDB 2QQKA 3KCCA 4D6SA 2ZX4A 4LBOA 2IXHA 1CQ9A 2MPFA 5DQ0A 1DQ1A 3I2DA 3I3DA 4KWUA 2DUPA 4P9YA 5FZMA 2G9GA 3G7DA 3D0JA 1PK6C 1GLHA 3HAGA 4IEYA 2UU8A 1UOJA 5F5CA 4GJYA 4ZU5A 1AR83 2FQPA 4LORA 1ACCA 2P3JA 5JIAA 3JBG1 3HT1A 4FT8A 2VOXA 1D4VB 2J1VA 3AFKA 5FPAA 4MUVA 1QNWA 5IT6A 2YC4A 4J6GA 2DV9A 4FPYA 2E6VA 1W28A 1YNAA 2WYSA 1O3TA 4AZZA 4XF9A 5C33A 1URXA 2PQQA 4CP9A 2VR4A 1F2NA 1U5IA 1VLNA 2R16A 5FY8A 4IW3A 1ASJ2 1JBCA 3FWEA 3N35A 3TRSB 2VW1A 2W1QA 1UL9A 4BB3A 4XBLA 3NJVA 2HWD3 4EE2A 1UXXX 4P00B 4F3JA 3URFA 1BHGA 3AM2A 3WDVA 3OJBA 2A71A 5FPZA 5CYYA 5BNOB 2Z42A 1LB2A 1OXCA 1KRIA 2BFUL 3U78A 2VVEA 4GJZA 3H7YA 4PLMA 2WO7A 4HVQA 3H42B 3MZHA 2HWB3 3CJIA 4JGYB 4PBPA 1KS5A 1UYYA 2DWRA 4XUOA 5DG2A 4ZS2A 2H0VA 2YC2A 1H0BA 3J9SA 3PDQA 1KJLA 2YMZA 4CDXB 2FCVA 3EMRA 1GOGA 2NPIA 2RJLA 2WNVB 1S2BA 1TME2 4Q26A 3TWIA 1RUH1 1HXS3 4RS5B 1SCSA 3LEIA 1ZA7A 1J1TA 2WWJA 5GJ6A 4YW5A 1S0EA 3NV1A 5GLVA 4NIIA 2WO1A 1YIFA 5FMCA 4Q4Y1 1QH7A 2R063 2TBVA 4Q4X3 5E16A 1TMF3 5JI7A 1UX7A 2DVDA 4R9AA 2RR12 1ZZ8A 4YGCA 2VOVA 4BIFA 4RD7A 1VBC3 5HPOA 1CX4A 3KT7A 4AGGA 2P1BA 1NCQB 4YYOA 2A6VA 3B9CA 4BOWA 1HRI2 2WZR1 2DTWA 2IXIA 1W9YA 5FYYA 1SPPB 4LLOA 5DN2A 2CU5A 1TME3 3HBKA 4CEYC 2ARAA 4PBOA 2B5HA 3PMSA 3WDXA 1V6IA 3INAA 2A7AA 2P34A 2Q1ZB 2EXJA 4LKEA 4XDPA 1BBT1 1B35A 1WZXA 1RMU2 1IS5A 1LEDA 4NROA 5IVBA 4M0HA 3OBZA 1Y3TA 1GICA 2X53S 1ZZ6A 5FJHA 3KQRA 1US2A 1SLBA 1OVSA 4XFIA 1XYPA 5L9RA 1FV2A 2RS33 5F39A 1LHVA 4JKLA 1N1SA 4NOTA 4YG3A 2HEWF 2VG9A 3P5BA 1I1EA 1JYCA 2MNGA 1ASJ1 5T52A 4GIQA 1E5RA 1HB2A 3RZKA 1KXGA 1MACA 4R9DA 4Y1ZA 5A80A 1JYTA 2A6WA 2J1SA 2RS53 2X5IA 4RHV1 4D94A 5K8SA 3UESA 2R7EB 1HV0A 2QUOA 4QB1A 2CWSA 5CU1A 3VDDA 2VZQA 4Q29A 4QPIB 2EICA 4YZ2A 3DXUA 3ON7A 3IMMA 1NA1B 3BTAA 3AXDA 4O9EA 1AX0A 3OTFA 5FZ8A 4UWDA 4Q4V2 3MW2A 1CGPA 4COYA 3TEYA 1LGNA 4F8AA 2KM2A 2HYXA 4I02A 2C5DA 5FZ0A 3VV1A 2UWBA 1NX9A 4CXYA 1NZIA 5AFEA 2GC0A 3VKMA 1XBFA 4HSJA 1NCRA 1YQ5A 3E6CC 3VBUB 5IATA 2BBAA 2I2SA 1K5MA 3HQRA 3S30A 2WLPA 1GZWA 4S2HA 1RVF2 5JI9A 4NHKA 2RJKA 3MEPA 2VMCA 1BXHA 1UYXA 3KT4A 4LBQB 2VULA 1J59A 4EN0A 5AC92 3H8UA 3C7FA 2BZDA 3I2OA 4LO7A 3AKPA 4UF0B 5L9BA 3MPPG 1SFPA 3OD4A 5FO7B 2X8KA 4PLOA 5H9QA 1AVBA 2MEV2 5BV6A 4XACA 2DVAA 5FIXA 2YFUA 4M4RA 1E5HA 4C0HA 4PDWA 5FZOB 4PDWC 1OOPA 3I2JA 1UN1A 1W6NB 2XR4A 5A7OA 4K8RB 1HV1A 2EXHA 3LAGA 4LE3A 5DUXA 4CA9A 2E7AA 4N43C 3ZYBA 4TZDA 2GSYA 2W94A 1G9FA 4XFHA 4Y22A 1H8VA 2UYAA 3BGAA 2DCTA 4FFGA 4NN0A 2X5IB 3O1TA 4H55A 2KXLA 3UGHA 1W6PA 1W6MB 2QQMA 3IDCB 5FYUA 1YQCA 2VL4A 5FBZA 3BIWE 4AEKA 5C9AB 4WM8A 2CNAA 2P6HA 4B4PA 2X29A 5AVAA 3ZYGA 1C1FA 4FBFA 3NV2A 4YLZA 1JUIA 3Q8CA 4HK9A 1X8EA 3SCGA 4Q4V1 4JGZB 3AB0A 5FYZA 2ZGUA 4CDUA 5KBFA 1XQNA 5T5LA 1QHDA 3CQOA 5FR3A 2JE9A 2RS52 1AHSA 1PM4A 5FPXA 1FMD1 2Q4SA 3GCXA 2LALA 3J4UH 2YU2A 3SQOA 3CO2A 3VD7A 4LXLA 4E4DX 1D2QA 5FPUA 4MH0E 2UY8A 1N1YA 1AR62 2G19A 1UYPA 4GAZA 2VZOA 3OPWA 1YFWA 4UW5A 1YI7A 1OBNA 1YQ8A 2DFBA 5FXZA 5T55A 1E5SA 1R081 2JDAA 1TE1B 1CAWA 2DDUA 2E51A 4GQ7A 5DAWA 4BA6A 1UKGA 3DECA 1YJKA 4AQ2A 4HZFA 1W06A 1PGW1 2QFEA 4N53C 4Q27A 5FMOL 1JN2P 3SEEA 5FPLA 4OHYA 1W6OA 4ITCA 2VZ1A 1QOTA 4H14A 4L11A 3RG0A 4CDWA 4CDWC 2QQLA 3GM8A 2DVGA 4LNVA 4XQ4A 1ASJ3 2QQPA 1BMV2 3FMGA 1O7FA 5A1LA 5FYVA 1VRBA 3J7NA 3N4MA 1ZBE3 3D3AA 4LEJA 3OPTA 4RGKA 1BQPA 4UBGA 1MQTB 5F2SA 3TB0A 4FOYA 4WM8B 1RUC2 1NY72 3IN9A 5IVVA 4A45A 4QD2A 3DPRB 2UWAA 1OLRA 4PCRA 3NV4A 3ST7A 1NXD1 2C9KA 1J3PA 4XC9A 1RUE1 3UETA 2ARCA 2DBNA 2EALA 2PAKA 4CDXA 4C91A 4WVMB 4GMP0 5A3WA 5DDJ1 3OD0A 2GNDA 2ZHKA 2VY0A 2DF7A 3A22A 2PXJA 2JDPA 4CCEA 3T0AA 1LTEA 1ND2C 4I09A 4A4AA 4E4SA 1OA4A 1VALA 3LEKA 2Z69A 4MO3M 1KFXL 2ZAHA 2ERFA 5K0UB 1LU2A 3HQUA 1IOAA 1LU1A 1X50A 3HIFA 4I0WB 2QJVA 3ZSEA 3FHQA 4IESA 4IV1C 3AMQA 3PU3A 4XDOA 3AMPA 1V6NA 1MS3A 4MV2A 3THPA 2YGMA 3IB3A 4WVVA 4QB2A 3T2OA 3ZFFC 4BWOA 3TBDA 3ZIWA 1GQHA 3CU7A 4LIUA 2X09A 3OBTA 5FJKA 3VUOA 4B1MA 1K42A 1SMVA 4FSJA 5EP9A 4NRQA 4FTBA 3BCWA 1CAVB 3K77A 5IVCA 4W6YA 1UY4A 4HFSA 1OA2A 5FTTC 4CU9A 4K7JA 4A42A 3T2PA 4BQ3A 3H1WA 3HT2A 1K3IA 2JX9A 1RXGA 3QD6A 1W90A 1RMU3 4HOOA 4LMFA 2E7QA 2JKBA 4MGIE 1KQRA 1C8M3 2HWC3 5EJ3A 2R043 1NE6A 4K9SA 1EAH2 4DPNA 1ND3C 2XHNA 1ND3A 4NO4A 3DF0A 3J7HA 2XGXA 3D5OA 2V4AA 1F9KA 1W8UA 4X6RB 4Y5Z0 5FZCA 2BNOA 3WW2A 4IEVA 2VBDA 1Y43B 5APAA 2ZGLA 3RFRA 2VH9A 2OUHA 3GXUA 4RR3A 4CCKA 1WKYA 1NCRC 3AZYA 3FHIB 4JQRA 4YVSB 2PHRA 2CWMA 1MVEA 3LD8A 3M3IA 4CVUA 4YM3A 2JB4A 4IETA 3ZMNA 3ACFA 3H8RA 1UKRA 4IGOA 3U4XA 4PQ9A 2EXKA 3T08A 3VDDB 5AVPA 4OVEA 2R062 5DZEA 3O0XA 1DF0A 1LNSA 3PUSA 4NPRA 3ALQA 1OF3A 2XB6C 1OSGA 3OEAA 1IQDC 4UFJA 5ANNA 5FYSA 4X6QB 3SCHA 2CAUA 3M1HA 2XJTA 1DQ0A 4QXBA 2PTMA 1BK0A 3JCIA 5FZGA 3LDKA 5K0UA 4CP0A 1AXKA 3FN9A 1ZX5A 2W5FA 3CL1A 2PHWA 4IEQA 1YXWA 4TLGA 3ZFEC 2WNUC 1SPPA 1W8HA 1VBA3 2VMIA 4TYSA 2WS93 2XUMA 4B8EA 2DUOA 5HV0A 4ES9A 4YVSA 2VZPA 4XPVA 1CD3G 1OQDA 2PQSA 1WMFA 4OI4A 4FAGA 1VBD3 5JAXA 1WCSA 4QPIC 2XKOA 1S1AA 2VBPA 5DDJ3 1LOAA 2OT7A 5BNPC 2WR9A 3GBGA 1AL0G 3GCWA 3NL1A 4WV8A 4A7YA 1RUJ2 4GZ9A 4BQWA 5LBCA 4YSFA 2BBVA 2IXCA 3EO6A 5FYIA 5EXOA 1I3HA 1QXPA 1MZ5A 3PIGA 5AC93 5E6HA 2WA3A 1R082 1RUF2 5IUQA 1OC1A 5F7UA 1Z78A 5I0SA 1VR3A 1RHI1 4YZ4A 3WUDA 4LA2A 5JZGA 4AFDA 2VZTA 2QZ3A 5KXDA 2EAKA 3WNXA 4GWNA 2JG8C 3RVHA 4S2GA 3MF6A 3DYPA 4Y1XA 1KS4A 4X8NA 4HPKB 4MGQA 4YVWC 1JYNA 5LEJA 2JDYA 4RS5C 4YGDA 2VNOA 1UZVA 1P8JA 3EYPA 1DYOA 1WMDA 4P9XA 1GZTA 5IYYA 3B9IA 2RMU1 5D8AB 4XW3A 3O7OA 4RHV2 1AX1A 1J3RA 3B94A 4LULA 3N7KA 1C1LA 2YUEA 4CUAA 3VBHA 2O8QA 3NKGA 3W21A 1QF3A 5HXVA 5HI0A 1DGRN 1GNYA 1H9WA 4JDNA 3I2IA 3ZDVA 2WS91 2ZGSA 5FY7A 4AI9A 2OPWA 4E2QA 3BTZA 4GH4B 4HKWA 3CJIC 3ZYFA 4ET7A 4XFGA 3AJYA 3I4IA 3IDBB 2D97A 5F6KA 4HG6B 2EF6A 2IC1A 2YDEA 1COV3 1I5ZA 2VQAA 3NAPA 4QX3A 3THTA 3KHCA 1UOFA 3Q8FA 1SCRA 5DG1A 5C9AC 2YROA 1J3QA 5CFDA 1LECA 3VBHB 3RPQA 4JDOA 3PHMA 1PNGA 2R1DA 4CCNA 2R072 4EWAA 1MZEA 1S55A 1C5IA 4JGZC 4AHYA 5KHKA 2CHHA 2GC3A 2FDKA 3HR9A 1Q5OA 5JOXA 2J1AA 3DV8A 4QDRA 5T50A 2PHLA 1IS6A 4YGEA 3WR0A 3ZXKA 5DZFA 1RJ8A 1E57A 3T2TA 4F83A 3N9LA 3ZSMA 1A8DA 2PHUA 2ZPXA 3L2YA 3KCXA 2WSUA 5KC5A 3GZUC 3RI8A 1CX1A 2P37A 3FX3A 4EV0A 4CU6A 4Y4RA 3I2FA 5BNQA 5FYMA 2DCYA 1OMIA 2GMMA 5G04L 5LK5A 2QVSB 1U5XA 1R083 3ZR6A 4D0QA 5BNNB 1Y9QA 2HWD1 1B35C 4E8CA 1LOBA 3TYJA 3TEZA 3POIA 3N9OA 4DFSA 2R1BA 1O59A 2RM22 2ATFA 1VP6A 4R52A 5GM0A 3B01A 4C0BA 3ZXAC 4YZ1A 3T09A 3VGIA 4B7EA 4AI0A 4YNIA 3N3HA 2R042 5FYHA 4S2FA 2WNVA 4ZXKA 2WNVC 4XUTA 1ZRDA 4R8HA 1ZVFA 2HBUA 1IG0A 2DBIA 1JHNA 4RA0A 4W6WA 3AP9A 3MIBA 3J7MA 4AWDA 4QAWA 2RHPA 1RUD2 3JD71 1FNYA 4CP9B 1REEA 4UFIA 4AOCA 4EN8B 1H1AA 5ACA3 2ARBA 4Y26A 5IK5A 2ZGQA 3O1RA 4CZSA 4BM8A 2ZGNA 3O5SA 1PO13 4IE5A 5SV5A 2R32A 3OUJA 3Q8AA 1XE7A 4NJ4A 3UJQA 2HBTA 1DCSA 4AVCA 2Y6FA 3KT1A 5KHGA 3FBMA 1QDCA 3ZXJA 2GP5A 1ENRA 4L0PA 5CKQA 4CCJA 2A3YA 1QJY1 1D2SA 2XHKA 1F15A 4AK3A 2WT2A 2WZR3 3OSDA 3GNEA 3N9PA 2PN5A 4NR1A 1H8TA 1DU3D 1WW6A 1X9TA 3AX4A 5IVEA 2FD8A 2W1SA 1EUTA 1QQP3 4UYBA 2AACA 2VECA 1JOPA 1RHI2 4BMBA 1C8M1 3Q8BA 5ERLA 1GKBA 2EA7A 4FOQA 1FYUA 1HIXA 2R073 2HLEA 1SFNA 1UQXA 2YB7A 3LSEA 4LITA 1W2AX 2B39A 1TG7A 1NXMA 2LUWA 2P5BA 4ZPIA 1UIKA 5T54A 3RRDA 2J22A 4CCMA 4CEWA 2XONA 4UAPA 1ALYA 2W87A 1J58A 2F17A 1MVQA 1RINA 3AZXA 5HBAA 1RUF1 3ABZA 1NAEA 2VQUA 2WSVA 1PGSA 5C3OA 1EV12 4IE0A 1XNAA 1LOGA 1BBT2 3ZFEA 1DHKB 1RUI2 2TEPA 1RL3A 2QCSB 2Y60A 3I7DA 5LBEA 1XE0A 3BIEA 2RDRA 3WZ1A 1A34A 3WY6A 2VOTA 2MEV1 3LZZA 4I3GA 5FY5A 1YRZA 4AHXA 1AR81 1RUD1 2HWD2 5T5JA 1NG0A 3ZN5A 2QNKA 2WINB 1WA6X 2F4LA 2XJSA 3LFMA 3NMBA 3PVBB 2GU9A 1JYWA 2Y64A 1QJX1 3POFA 4PF5A 3WF2A 5BNPA 5K4LA 5F3EA 3EBRA 4YM0A 4QM9A 1JZ7A 3PNAA 1C8NA 5IVYA 4HN0A 1GP6A 5B4XA 4OCTA 4BZ4A 1FMD3 2W3JA 2WBKA 1NY71 2TNFA 4YW7A 4CDXC 4MADA 3QH6A 4D6RA 4CU7A 1RTVA 2RMU3 3MF9A 3MLKA 1GV9A 4XBNA 4XF3A 2WQ8A 5CG9A 1AYN1 1EP0A 5FUIA 5FAXA 4HVRA 4CPBA 2JDHA 3AYAA 1UW8A 1XNCA 5KHHA 1W0NA 2ARXA 2A1XA 4LBNA 3O1SA 2DCKA 3ZX7A 1GUIA 4LHKA 3KLSA 3PIJA 5FYTA 3K4ZA 4KI5M 1UF2C 2DUQA 5E8AA 3VLBB 4DXZA 4TXWA 4YM2A 2QQOA 1O91A 1MPXA 5FV3A 4GWIA 4FXGB 2XXZA 3M3OA 3BKZA 5JIUA 1Z7S1 1WBFA 3CZJA 1RUOA 2GH8A 4CEWB 1WA4A 5DAVA 4RQPA 2NP0A 3C8XA 4ISQA 4CUBA 2JENA 3WLUA 3WP6A 5FZ1A 2W1WA 4EZ4A 5C8CB 4NPLA 2WZPP 3DN7A 4AVVA 3THCA 1TMF1 3WNOA 5EYXA 1HB3A 1ZYBA 1UXZA 1RVF3 2XQRA 1U12A 1GFF2 3ITQA 3R4SA 4Y24A 5CFDC 3R4DB 2VNGA 4LHLA 4D6QA 1ZRCA 4LUMA 1W9WA 4P02B 4RHV3 1MQTA 5CNAA 3PUHA 5KC6A 4AEDB 2W1UA 2WZ8A 3RYPA 3W59A 3BPZA 4LKFA 5FP8A 2JG8B 3ZFFB 2RM23 2VCAA 2XVKA 5A6YA 1OOPC 2PMWB 1NCQA 2BYVE 4EWDA 4W8JA 1JXNA 4WVMA 3AYDA 4AYUA 1CJDA 2Q8EA 4FOWA 3NNLA 5J36A 1XJAA 1REDA 3AYEA 3DXTA 1ZZ9A 1Q8SA 1LOFA 2HWC2 1PK6A 3M3EA 1ENSA 2QQJA 4JV4A 3POWA 1VBC2 2BEOA 2G9FA 2K0GA 4FVVA 1GWKA 3LPGA 4BQ1A 2E7TA 1VB2A 2WAOA 5E1RA 3WP5A 4DRVA 1TNFA 5FZDA 1RITA 3FHAA 3RYRA 1N47A 3CJIB 1UY2A 1DFQA 4GB32 1W99A 3L2HA 4JGYA 1PO11 4QXHA 1NLSA 3J7LA 4PF1A 4QX7A 4BH9A 1AJKA 4BQXA 1AL23 1XNDA 1WLCA 2ZEZA 4IQPA 1MEC3 4BE3A 4JKKA 4PIXA 3DL3A 4OHZA 4AEJA 3AFGA 3K3OA 4JHTA 3HJRA 5EWSA 3WX5A 2OXBA 5FP9A 1U5YA 2WO3A 2N7GA 1PVC2 3NSTA 4LJHA 5FQ0B 1EV11 2BGCA 2ORXA 2W9XA 1Q3EA 3RGBA 2VXRA 4A7ZA 3BYWA 1NZCA 1RUI1 2GN3A 2HEVF 4PIZA 4GULA 3A0NA 4Z2WA 2JE7A 5JUVA 3OGSA 5LBBA 4BYYA 4Z2AA 5AC91 5B4NA 3ILNA 1J1LA 5EPAA 1K45A 3UT0A 1X82A 3ASIA 1OKOA 5HCAA 1QJFA 3VBRB 1VMJA 5FZKA 5BYNA 4Q0PA 5JLVA 1EAH1 4LLFA 1O8PA 2BGOA 1GQGA 3IIIA 4Q0UA 4D69A 2Y0IA 1HLCA 2LRPA 1WD3A 4CDWB 4KH9A 2D5HA 2C1FA 5A33B 2WT1A 4QU2A 4AG4A 4XJUA 1YJLA 4LBKA 3CKHA 1XB9A 4YW1A 2CY6A 3U37A 2FHRA 2QTWB 3CNAA 3UKVA 2XLAA 1KJRA
chains in the Genus database with same CATH topology
4LBMA 1OA3A 1REFA 2NMOA 4HKOA 1RUC3 1T6GC 4WM8C 5BY5A 1ZBA1 1HQNA 2BVBA 2XJPA 2Z2SB 4GKYA 1UMZA 3V65A 4C1XA 2GC1A 2W52A 1HRV1 1BVP1 1OPMA 2AENA 4PDWB 1AR73 3G6JB 2OUJA 1D4M2 4XDQA 2GAUA 2DTYA 5E89A 3SISA 5JWPA 2BFUS 3SMHA 5BUVA 4E27A 3PVNA 3IPVB 4P14A 2E53A 1ND2B 2XBO3 1UZYA 3EJKA 3VKNA 1JUHA 2YY1A 4AQSA 1QWRA 1HQWA 3W58A 4F7ZA 2A6YA 1V9U1 1ZRRA 2ET7A 1LHUA 4Y20B 5H9PA 4RR3B 2ZMKA 2H6CA 3CJXA 4NHMA 5C4WB 1PVC1 4XEZA 4ATEA 1QGLA 3M3CA 1AX2A 2PA7A 3OY8A 2PAMA 4Q4Y3 2XVGA 1C5HA 4Y4YA 2ZGPA 3AKRA 5KXBA 3L9JT 3WXPA 3E97A 1NLRA 1HKDA 5H9RA 5JPMB 1V70A 4QQHA 4Q4X2 5JSPA 3DPRA 3DPRC 4META 3D8CA 1PMIA 4XE9A 4QXKA 4R4ZA 3MIEA 2A3XA 4AI2A 1QY4A 3VL9A 1Z0HA 2P3KA 1AYM1 1DG6A 3ENRA 3WHUA 3N7MA 2ZMNA 4RSUA 2WFPA 2ZJCA 4LBJA 2ILMA 2HWE3 5T3NA 3NO8A 1QJX3 4YFWA 4XFFA 3RI9A 1N3QA 2XJQA 4AVTA 1R1ZA 1VBC1 3V0AA 1NQDA 4B7KA 1GR3A 2ZGRA 1R1A1 3NKTA 1W0OA 3SH3A 1NCQC 3UV9A 3M4FA 2ZTNA 4L2NA 1D4M1 3T1LA 1IKPA 3MFCA 3TN93 3WHTA 5CA6A 1CAXA 4COVA 3AP7A 4HBNA 4KWJA 2VUAA 1ZA4A 5E88A 2WC2A 1DQ2A 1ZBE2 4AQTA 5FOJB 1EPWA 1GSLA 5JCTA 4QT6A 1I6XA 1IGOA 3PJYA 4HT1T 4P9LA 1Q8OA 3UKNA 4DINB 4L9BA 5JSOA 3ZVXA 2GN7A 4GMP3 1H2MA 4AE2A 1IPJA 1C57A 3JB8A 3LCPA 2ES3A 4AF9A 5C8WA 4R9BA 3HWJA 1V6LA 4MGYE 3SNMA 1AYM2 3HD8B 5KHJA 2VVFA 4GXLA 1YFYA 1H4HA 2I74A 5B2GB 4MZUA 2WFF2 3A0KA 1QU0A 4E9KA 2CGPA 2F6BA 2PLV3 3H9AA 5I0UA 3EQEA 5CFDB 1W6QA 4JAAA 2YYOA 4BLJA 1IZ3A 2HWB1 3ZPYA 4AEDC 4HL0A 4EROA 3M8LA 3VZOA 1MEC1 2RS32 4RGGA 3BOWA 1BVVA 3QOPA 3RZZA 1VB4A 1BJQA 3IDEA 1M4WA 1QXJA 1DGRA 2HWE2 1TEIA 2ZACA 4MVTA 4Q1PA 3VZMA 5FRAA 1O5LA 1R093 1G9DA 3LOBA 1VRH2 2C0ZA 1CIWA 1F8VA 1FOD2 2MHFA 5JMCA 1RUE3 4KGGA 2AGSA 1WBLA 5F5QA 1RUF3 4Q4V3 1HX6A 3AZWA 1N1TA 1XYNA 1CPNA 1VBE2 2O1QA 4QPGB 4UW4A 3C2UA 1SLIA 4C1WA 1C28A 1OPOA 1DQ4A 2ZA9A 3USSA 3LA2A 1POV1 4HETA 4JC1A 1O4ZA 2ZABA 4XTPA 4QQOA 5I0RA 1A8MA 4L8QA 3RWNA 1FNZA 2W68A 3AKTA 3BU7A 1JOJA 4QX5A 5BNPB 2HYKA 1LEMA 4QGNA 3DGTA 5JOYA 2XLGA 3WD5A 2ENRA 2BPA2 4Q0SA 3I54A 5A33A 1YFXA 2UYBA 5A3LA 1XU2A 3V0AB 1G9BA 4P9JA 1UU6A 1CN1A 1WLTA 3VBRC 4GH4C 4ES8A 2CGOA 5A32A 4A7KA 4L99A 5JZGB 1RMU1 1U0AA 3H3ZA 4IEUA 3ME2A 1UAIA 4DZGA 1UPSA 3LKJA 1XU1A 1NE4A 1WW7A 3MIHA 1SBFA 2VPVA 5DUVA 1HW5A 2RS11 1BK1A 3KSCA 3IMNA 3FLRA 2QKDA 1D4M3 1DZQA 5GZGA 3S0MA 1PM7A 1AYN2 4Z8BA 1LRHA 1UD1A 4BPZA 2B9UA 3IWZA 5ACA1 4YZ3A 4YZ5A 4HMZA 4DY3A 1C3HA 4KL1A 3UJOA 5T5PA 1NQJA 5DZGA 2ZHLA 3O0VA 5FO9B 1SLCA 3GHNA 3PJQA 1C8M2 3WDUA 2SBAA 4QPGA 3WG4A 1NYWA 5EV7A 1ZZ7A 4GMP1 1W2UA 4OUMA 2BUKA 4OFGA 1VBD1 5LK7B 1GZ9A 3ZYIB 1R091 2VQ0A 3I59B 2WIIB 1O3RA 1WW5A 2TUNA 2V5YA 5GLZA 2V73A 4XXAA 4XOGA 4I01A 4AI8A 3ZFGC 1AUYA 1PO22 3WQ0A 4BLIA 2PHDA 1MQTC 4INDA 3WDTA 5IK7A 1YO8A 4M0NA 3O12A 2FMDA 5LRSA 2D3PA 2ZS6B 3WDYA 4AVBA 2OZ6A 2OIIA 2XG3A 4FPOB 1AR93 4LTAA 4Q4W1 5LRRA 1AXYA 4LR4A 4OHWA 4XETA 5K0UC 4B3NA 4RFT0 1EAH3 3AZVA 3RMXA 2CAVA 3VZLA 4WM7A 3KMHA 1IS4A 5I93A 1UU4A 1UZZA 5C4WA 4K40A 1POV0 3VBFA 1V9U2 1KFUL 4R9CA 4KQ7A 4LHNA 4Y22B 4QPIA 1S2KA 3IT8A 1A3KA 1SLLA 2JG9C 3VHPA 3GALA 3CF6E 3H7JA 1R092 4GB31 1Z7S2 1N1VA 1W6PB 1RVF1 1OLQA 4JVAA 1FAYA 3I59A 4QGMA 2QZ2A 4JCKA 1X7NA 1ZBA3 1PZ7A 1FPN3 2FZ2A 2P3IA 2DURA 5JR7B 4AVAA 3ILFA 1PHMA 1PVXA 4CDUB 4G9SB 1S0GA 2NMNA 3K51A 4E2SA 2CV6A 2GDFA 4LA3A 2PELA 1V9U3 4IEXA 4M3CE 1RUJ1 4RS5A 2HWF2 1EPZA 4YVSC 5L7OA 2ZX2A 1G6NA 1CONA 4AI1A 1PO21 2JJ6A 4XF0A 3WP4A 1RUC1 4XQDA 2RR13 4AFAA 4COWA 3AXEA 3VBHC 3FLTA 3KGLA 3R0RA 4K3UA 2WWSA 1BCXA 4AFCA 2ZZJA 1O5UA 2XJRA 4RR3C 3KB5A 4P9GA 4PIYA 1BYHA 3WCSA 1IS3A 2WA4A 3U10A 1KD7A 3LWCA 4IV3B 2HWF3 2W0XA 2AYHA 4LO4B 3KD4A 4AI3A 2E63A 4YARA 1W6MA 1PNFA 2KA3A 2WJSA 3A4UA 1GZWB 4OI1A 5C9AA 3GF6A 1M06G 2ET1A 3VBSC 4GWMA 4O9GA 3VKFC 3GZAA 3ECQA 2B8MA 3X29B 3ZSJA 4U36A 4MXWB 1G8WA 3RNSA 1SEFA 3S6PA 2GMPA 4SBVA 5FLHA 4LUKA 3UKTA 4LBQD 3ZYPA 2WQZC 4FPEA 4GH4A 4IERA 4YRDA 1UCXA 4KGQA 4B4RA 5K7PA 1AR71 4DB5A 3MW4A 1O3SA 3OBRA 3U0ZA 1QJZA 1W0PA 5L7OB 1R1A3 4E4ZA 5D8AC 1HRI3 1L3JA 3SXWA 2HEYF 3ACLA 1X36A 4Q0VA 4LO5B 3BOPA 2DVBA 3GBFA 4FPFA 1AR82 2D6PA 1BKZA 2A75A 5L19A 1U5ZA 4HKLA 5FFOC 1Q43A 1VRH3 2Q8OA 2C9AA 2D44A 3WVJA 4ASLA 3MI8A 5J96B 1MZ6A 3H0OA 3JUUA 5C8CC 3AK0A 2ZGTA 1PZ9A 5J37A 4TLFA 2HJIA 4QQ2A 2F4PA 2VGDA 2ZGOA 2K9ZA 1LOFC 2IXJA 3I8TA 2YXSA 2AR6A 2MEV3 4I0AA 3ZFGA 2QE3A 4HVOA 1SQ4A 3FUOA 1ZZBA 1G7YA 3LA7A 2WNUA 2VOWA 3JB4C 4GKXA 5DDJ2 5BXXA 5FOBB 3CLPA 1PVC3 5IK8A 1AR72 3NAPB 1FX5A 1K5MB 3ROUA 1VAKA 4FPGA 1DGLA 2AREA 3M3QA 4WZCA 5DUWA 4UW6A 1LCLA 2PHFA 4JRAA 2OW4A 3VKOA 5J7MA 4JTOA 4KBBA 3WW3A 1VBE1 1CAUA 2XBO1 4CDQC 3MGUA 2XL9A 5SV8A 2WZR2 2PLV1 1FOD3 4LO8A 4AXOA 1QQP2 3NVCA 2RMU2 1H8TC 1ONAA 1LHNA 1V6JA 2OZJA 4Q4X1 4X8PA 2HWF1 3VBFC 4WVWA 3TN92 4QHBA 1DBNA 1X8MA 3ZIXA 4WZFA 3WQ7A 2JG9A 1FI2A 4UW3A 1UIJA 1VBB1 2ZGMA 1COV1 3D0SA 1HDKA 2W08A 1A6CA 2RS13 1D0GA 1AZDA 4UXAA 4AEDA 4XFCA 3J26N 2A5ZA 4EN9B 2R0FA 5EYYA 4FQ4A 1W6OB 2OPKA 2DU1A 1DZRA 3ZFFA 3H1MA 1YCIA 1RUNA 5GZFA 2HWB2 5FREA 1CAXB 1HQLA 1BBT3 1DLLA 1RUD3 1Q8VA 2HKXA 3RJRA 3USUA 2WQ4A 1RUG1 2VNRA 1V6OA 4XXPA 1AYM3 3DUIA 3ZO0B 1GBGA 2Y26A 4R4XA 1QMJA 4XJZA 2ZBJA 2B42B 3HN1A 3WW1A 3RJ2X 4KWKA 1H2NA 1LULA 1QOSA 3RMYA 3GHMA 1HRV3 5GZDA 2ZZQA 3AZZA 1YWKA 3N36A 1FMD2 1XYOA 2ZOEB 5I8SA 3KZ4C 3MPBA 1FT9A 3WQ1A 1QXRA 2DFCA 2BWCA 2D93A 1XXNA 1OOPB 1SLTA 2BVVA 3OY8B 2JECA 5KXCA 3SHRA 1QQP1 2OA2A 4OLLA 2XL7A 3FJSA 2EXIA 4FCAA 1X33A 1RC6A 3JQXA 3VBSA 2R6QA 3V56A 4HN1A 5CFCA 1ULGA 2GALA 4P9IA 1WLDA 2Z5WA 3APBA 4XMAA 1QDOA 4YW2A 1DQ5A 4Q4W2 2JDZA 1MS5A 1RUI3 2A6ZA 4MX3A 5F6LB 4YG6A 3VKLA 4XJAA 1W39A 3ZXEA 2GNMA 3H3UA 4N43A 1LR5A 5FDBA 3VL8A 3HQXA 4K8FA 4EJRA 2UURA 1YYNA 2VOKA 4E2GA 1WUVA 2GNTA 1DDLA 1RB8G 1MEC2 1WLWA 1ZBA2 4LBLA 5CADA 1JH5A 3M70A 2QDRA 5D1IA 3ATGA 3KS7A 3UL2A 4G4FA 3MDPA 1F31A 4FTEA 5KWRA 4YVWA 4ATFA 3B3QE 2QDNA 4Y1VA 1MS8A 2BNMA 4XILA 3R6SA 3MW3A 1YLLA 2ZAAA 4NWWA 4ZU4A 1YIPA 3VBUA 1AR92 2R30A 5I8YA 1VAVA 3K48A 2Y38A 4G3YC 1LENA 4TWTA 5JVVA 3WOGA 3FFZA 1MS0A 2OYZA 3ZXFA 2CL2A 2XVLA 3TN91 1ULFA 3H50A 1VBA2 3BALA 1LHOA 1UU5A 1CPMA 2DCJA 2WNEA 2PYTA 1ENQA 4DS0A 1S0CA 4GB33 3MLJA 1DZTA 5I91A 3VHOA 5CG8A 3ZN4A 4XF1A 2PLV2 1TNRA 4LO6B 3WG1A 4NHLA 3FBYA 4ISRA 4HK8A 4XHBA 3E5QA 1RUG3 4FAHA 5BNOA 4ASMB 4FPCA 3OCPA 2D6KA 2VW2A 5EFUA 3P3NA 2VVDA 3GYDA 4YW4A 2SLIA 3MLLA 3E5UA 1B09A 1GNHA 1XNKA 5ABJA 4CDQA 4HANA 4OUSA 3VZKA 3TOJA 3PMEA 3LOIA 4WM7C 1EYBA 5JZGC 1KDKA 1LHWA 3W9AA 5FMOS 2X5IC 5C4WC 1CJPA 1PK6B 3OF1A 2RE9A 3CEWA 4U2AA 3ZYRA 1R1A2 4AEMA 1RUG2 4WVZA 3NV3A 5GLTA 4JTNA 4FO9A 1G9AA 1TQ5A 2I45A 3OGJA 1RUH2 1H2KA 2A70A 3IKWA 4IL7A 3AP6A 1PGL2 2H6BA 3QCWA 4FP3A 3OYWA 3VHRA 3WUCA 1VBD2 4AFBA 4RQPC 1JYIA 4C90A 3AKSA 4N53A 3VBOB 4LT5A 2BWAA 3D6EA 2O0OA 1H1MA 4EWEA 4N7IA 2NN8A 3ILRA 2Y0OA 1UPIA 2IXKA 4I0BA 2YHJA 2ZKLA 1KITA 1MR5A 3QLQA 2D3RA 1KDMA 1QJX2 2VMGA 1Z7S3 3ZFGB 3U07A 2A6XA 3MIDA 2R49A 4JGZA 4D7TA 5I8TA 1TMF2 3AP4A 5HCBA 1ZREA 4OULA 1LJ7A 5GZCA 1F5JA 3E6BA 4BHPA 3VBUC 4JRLA 4CTEA 1VAMA 4I2OA 3JQWA 4Z07A 5TSWA 4GA9A 1Q56A 2D40A 1LESA 1RGSA 2ZHNA 4XF4A 4FPKA 2LM3A 2VUJA 1HXS1 1AXZA 1VRH1 4H7MA 1LODA 1PGL1 5JOWA 2ZHMA 3ES1A 2P17A 4V1PA 1EV13 4IXLA 2UY9A 2AH2A 1OQEA 2OVUA 4ORFA 3TNPB 5L36A 3ZXGA 1ULCA 1OI6A 1OQ1A 4BMEA 1DYKA 1H9PA 2B46X 1SBDA 3WCRA 3D82A 3NW4A 4ZKTB 3KM5A 3FFQA 4IV1B 1SLAA 3B02A 5LEKA 1Y7BA 4YM1A 5FLIA 1MZFA 2BNNA 4FXKB 4P9WA 1VBB3 5I0TA 3NWKA 3S7IA 5CAZA 4QPYA 4RGAA 3RQ0A 1GYKA 1RHI3 4K1ZA 2ZCWA 1V6MA 4XFAA 3ZXLA 4DQAA 2XPJA 4K20A 1O4TA 3FUQA 3EHKA 5DXDA 4GALA 2O8OA 1ULDA 4N7UA 2CYFA 4Z82A 1QKQA 4AGVA 3EXUA 4UBHA 4IEZA 4XJ8A 3VZNA 5C6CA 5DUUA 2R041 4W65A 5FCCA 5BPXA 1PIV1 3R05A 3V64A 3QBQA 2WFF1 5CVRA 1BEV3 3WG3A 2XWJB 1NCRB 2R071 2WS92 4S2DA 3UK9A 1YI9A 3J8F2 3AMNA 3N7JA 3Q9OA 1PO1