3UL2A

Galactose-specific lectin from dolichos lablab in p6522 space group
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
252
structure length
248
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
total genus 54
structure length 248
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ul2A00
3H0OA 4XJWA 4FPGA 1OQ1A 4YW4A 3TB0A 3O0WA 4R9CA 4WVWA 4Y24A 1C1FA 2LTNA 5IK8A 2CWSA 1G9BA 1G7YA 1V6IA 1W6MA 1GSLA 1BYHA 3B69A 3A0KA 2FMDA 5CNAA 4W65A 1FX5A 2WT2A 3M3QA 2VW2A 3V0BB 1HKDA 2H0BA 3ZXKA 1ENQA 2ZGTA 1DHKB 2A3YA 3AK0A 3PJQA 3ZXLA 5HCBA 1LECA 1PZ7A 3PVOA 3WV6A 2DVAA 1AZDA 1AXZA 1WBFA 2WQZC 4K1YA 4PBPA 1FATA 2EXIA 1S0FA 4XJZA 1MS9A 1DZQA 2A6XA 3UJQA 5T52A 2ZGRA 4WVVA 1YO8A 1JYCA 2EF6A 4Y22B 3WG1A 3W59A 1QOTA 1V6NA 2P3KA 3RS6A 4FPLA 2R0FA 1ENRA 1QKQA 1WLWA 4CZSA 1RINA 2GN7A 4ATFA 2R1BA 1LENA 3WG2A 2D44A 1CPMA 2ZKNA 4YFWA 1IS6A 1QMJA 1SBEA 1EPWA 2Q5TA 1WUVA 3INAA 4XHXA 1I1EA 4DS0A 3Q9OA 3M2MA 1V6KA 3L2YA 1Q8PA 1F5FA 1BJQA 1GNHA 1JBCA 2W68A 3WHUA 1LHVA 3AZWA 4LBKA 3ZXJA 4Q2FA 1O4ZA 3VKLA 5GZCA 4PCRA 4YM2A 3D6EA 5T5OA 1SLCA 5JVVA 4FPEA 1JXNA 3V0BA 4Y1XA 1D0HA 1CN1A 1O4YA 1G9AA 1WD4A 1W6QB 1YYNA 2A70A 1SLAA 1VLNA 1WW6A 3AP9A 2ZZJA 2A3WA 1HDKA 4FOQA 2DYCA 2YROA 3SH4A 3ZPYA 5DUXA 3B00A 1GKBA 2ZAAA 5GZDA 1QDCA 4R9DA 1N1VA 1SBFA 2W08A 4YW5A 4YM3A 2ARBA 1W6PA 4XJ9A 2GALA 4XTPA 2NMNA 3WUCA 3RQ0A 1N47A 4DFSA 1N1TA 1W6NA 5BYNA 5GZEA 1HQLA 3MW3A 4YZ2A 3M3CA 3PMEA 1X50A 2A7AA 3AXEA 4XMAA 2JE7A 1DIWA 3D5OA 2PHTA 3MPPG 3AJYA 2EXKA 5T55A 2ZGQA 3ZSJA 2WSUA 3LSEA 3ILNA 1LGCA 1PZ9A 1QNWA 2TEPA 2ZGNA 1HQWA 4ITCA 4KBBA 3BOPA 2VY0A 3AYAA 1ULCA 4BQ1A 2D6NA 3SH5A 5EWSA 4GKYA 1ULEA 2DVBA 3A4UA 4M3CF 1MVEA 4C1XA 3WCSA 1SCRA 1S0DA 4GXLA 5GLZA 1IS4A 1KDMA 2PHXA 2A3XA 4XJ8A 5E88A 5FREA 3VKNA 5KXDA 4YGCA 5JDBA 2XB6C 3IKWA 1URXA 5JOZA 1YXWA 4L8QA 1JYIA 3OBRA 1DQ6A 3AP5A 2UWCA 2GNDA 1ULFA 2GMMA 4XJAA 3ZSKA 3NV1A 1JUIA 2W52A 2WT1A 2R1DA 3O0VA 4LBJA 1UN1A 4GKXA 4H55A 1Q8SA 4YGDA 3RMXA 4BOWA 4YGBA 4BMEA 4YW2A 3SLIA 3AP4A 3VKMA 4YZ5A 3O0XA 5DZFA 4OZXA 2W39A 4U36A 3NV4A 1OKQA 1YI7A 2VW0A 4LBQA 4P9YA 5H9RA 1LOCA 2ZMLA 4JC1A 2UURA 3AJZA 3ILFA 1CONA 2ZMNA 3M1HA 4XXPA 2AYHA 1LOBA 4GALA 3ATGA 3UL2A 1GNZA 4YZ4A 2YXSA 3B3QE 1QOOA 3JUUA 3ZXFA 5KXEA 1ULGA 1Q56A 1C1LA 3DGTA 3D4KA 2YZ4A 1NLSA 1R1ZA 3WDTA 2ZHKA 4XBQA 1WBLA 4FPKA 3SNMA 3WDXA 1W0PA 4FVVA 2PHWA 2E51A 5H9SA 2DU1A 1DQ0A 2R49A 3V65A 1V6MA 3AXDA 4AVTA 2ZGUA 1Q8OA 2JE9A 2JDZA 3MEPA 4RA0A 1LULA 5T50A 2ERFA 5JMCA 2R16A 1S0CA 1DLLA 1GZWA 3WNXA 1DFQA 1DQ5A 1LU1A 2ZHMA 3AFKA 3W58A 1KRIA 3NV3A 1UPSA 1FYUA 2PHUA 3QCWA 4ASMB 3IPVB 1MS8A 4YM0A 1SLBA 1W6PB 3M3EA 3OBTA 1SFYA 2AREA 4YZ1A 4WV8A 5CBLA 1DYPA 2KM2A 1W6NB 2GN3A 4XXAA 4AGRA 1H30A 3T2TA 3V64A 1N1SA 2EXHA 4AVSA 3N36A 4BM8A 1SLIA 4D69A 4NOTA 5EYXA 2CYFA 4CRQA 1S0GA 4ZKTB 1LHOA 2D6MA 4XBLA 3ZYRA 2ZMKA 1QDOA 5DG2A 1Q8VA 1LEDA 4YGEA 5GLUA 4ISQA 1I3HA 2EIGA 4PBOA 4HL0A 3V0AB 1AXKA 5H9QA 3N7KA 5GLWA 4AVVA 3VUOA 4Y1VA 4YLZA 5DUWA 3OJBA 2GNBA 4P9WA 1XQNA 2D3SA 5DG1A 3KQRA 4Q8LA 4FPCA 2D43A 1GZCA 1V00A 5GZGA 1LCLA 5E89A 5IK4A 2A5ZA 4F83A 4XIKA 1VALA 2YV8A 1FV3A 1N3QA 1OFSA 1KDKA 1QOSA 1KITA 1YRZA 4P9XA 4JCKA 4Q1PA 5DUUA 3WDUA 1D2SA 3OGGA 3AP7A 3N7JA 2A75A 4MYEA 2WLQA 3IPVA 2ZGKA 5CB7A 2R0HA 2ZGPA 1IS5A 1MVQA 1S0EA 3OPZA 4DRRA 3OYWA 2DURA 1WW4A 3MW4A 1N3PA 2DV9A 4LBQB 1BQPA 2UU8A 4XJUA 1LJ7A 3AZXA 4BLIA 1GICA 1CESA 1W6OB 1MACA 1GANA 1V6LA 2SLIA 3AZZA 1DYKA 5HCFA 1SLLA 2B7YA 3QLQA 4LBOA 1MZ5A 4XTMA 2DWRA 1AJKA 3WG3A 3B01A 4FP2A 3NWKA 3WHTA 2C9AA 1Z0HA 3FUQA 3V0AA 3ZYPA 4CTEA 4BPZA 4Q8KA 4GWMA 2YMZA 3RRDA 4FPYA 4M01A 4DQAA 1J1TA 5DZGA 5JOWA 2D6LX 2LALA 4ISRA 5L73A 4FPFA 3N35A 3A0NA 4Z8BA 4XILA 3C2UA 3N7LA 1GZWB 2PHRA 3WG4A 1QNYA 2AR6A 2BQPA 1UKGA 1A8DA 3AX4A 1H9PA 4IQPA 1WLCA 4PQ9A 4TZDA 4FPHA 1U0AA 4FPOB 1V6OA 5LK5A 4R9AA 3ZSMA 2XG3A 3NV2A 4Q1RA 2E7TA 4LBNA 1G8WA 4UW4A 2WNEA 3USUB 1LESA 4XBNA 3ENRA 1DQ2A 2ENRA 4PF5A 3FBYA 2JKBA 1FAYA 3WDVA 1WLDA 2UWAA 3ZSLA 2ZGSA 3UK9A 1AX2A 4BMBA 2ZBJA 2EAKA 3HR9A 3RG0A 1UZYA 2OUHA 1MS4A 2YY1A 1W6OA 3WDYA 2NZ9A 1G9CA 3SISA 3R4UA 4AGGA 5IUQA 1CPNA 1DGLA 1BXHA 3AZYA 2WT0A 2NMOA 4XYXA 5EXOA 5KXCA 3FUOA 1DBNA 2CNAA 1G9DA 4C1WA 5IK7A 2JD4A 1ENSA 5DZEA 2DU0A 2CY6A 5DXDA 1MR5A 4P14A 3BODA 2NP0A 1TEIA 1PZ8A 1S0BA 3BIWE 5F5QA 5SV8A 4FOYA 3SH3A 2ZGMA 2DTWA 2ZACA 2ZA9A 3BTAA 5GJ6A 1A78A 3HMYA 1MS1A 3I4IA 2ARXA 1A3KA 1WD3A 5T54A 1AXYA 1APNA 4YG0A 2C5DA 1LHUA 4XIOA 4K20A 2DTYA 3AYEA 1IS3A 2A6WA 2P37A 1LGBA 4M3CB 1N3OA 4ATEA 2OW4A 1KJRA 3USUA 3OYWB 2ES3A 2FHRA 3TAYA 1RIRA 3WZ1A 2P3JA 1ZM1A 3CNAA 2NM1A 5E8AA 1KQRA 1SLTA 4YW1A 2A6VA 2GDFA 2GMEA 3AYDA 4JRAA 2D7FA 5JOYA 2P34A 3ASIA 3FLTA 2JJ6A 4RL7A 1WW7A 1MZ6A 3FLRA 1ULDA 2D6KA 2I2SA 2UWBA 3POSA 1Y7BA 1N1YA 4M00A 2E6VA 1AVBA 2Z42A 1C4RA 2AUYA 2EALA 3PVNA 4FQZA 1FNYA 4WZFA 4YM1A 5GALA 4AYUA 2E53A 2A71A 4AWDA 4BLJA 5IT6A 1FNZA 1CR7A 3HN1A 2ZHLA 1UAIA 2E7QA 1NXD1 3ZXEA 5CAZA 5T5JA 3O5SA 5EYYA 4DRVA 5KXBA 4HANA 1AX1A 1DQ4A 3APBA 3UJOA 2HYKA 2CTVA 4YG3A 5GM0A 3N3HA 4Y1ZA 4Y1YA 4Y26A 3M3OA 4U2AA 2VU9A 1CQ9A 2PHFA 1MS0A 2GNTA 2RHPA 3POYA 1AX0A 5T5PA 3RSJA 1HLCA 2WKKA 3IM0A 3OY8B 1F9KA 1GYKA 4R9BA 1LOGA 3B9CA 1LOFA 1LGNA 2NN8A 5AVAA 3RMYA 3R4SA 1WW5A 2ZGOA 3DUIA 4FP3A 1B09A 1VAMA 1LHNA 4M3CA 2VW1A 2SBAA 1UZZA 2VXRA 3AP6A 3PVEA 2P3IA 2DVFA 4FQ4A 1LHWA 4YZ3A 1SACA 2D6OX 1YIFA 3KM5A 2CWMA 2P2KA 3VKFC 1UX6A 3IMNA 4UW5A 3SITA 5F9TA 1GV9A 1LODA 1WCSA 5JOXA 4XZPA 1AJOA 2WSVA 4I30A 1CJPA 3VV1A 1AF9A 1UMZA 2AENA 1JW6A 1Z78A 1FV2A 4M3CE 3ILRA 1LOAA 4Y20B 4XDQA 2D3RA 3R05A 1BZWA 2AH2A 4K21A 4XE9A 2DUQA 3ZVXA 3POWA 1KJLA 1S1AA 4Y22A 3T1MA 3U4XA 4XHBA 5DUVA 1VAVA 1Q8QA 2G4IA 4Q27A 1IOAA 2VH9A 1S0JA 2EXJA 1LU2A 3GALA 3I8TA 3WOGA 3GNEA 2AGSA 1W0OA 3N7MA 4Y1UA 3T1LA 1QGLA 3OY8A 1MS5A 4GWNA 4FPJA 5FRAA 3WLUA 2CL2A 1QU0A 2GNMA 5GZFA 2D3PA 1IKPA 1F31A 3MW2A 4DPNA 1ZA4A 1DQ1A 2DUOA 4FOVA 4AGVA 1C57A 1LTEA 3WCRA 2A6ZA 2ZABA 4GA9A 3O12A 4YW3A 1W6MB 4LBQD 3AZVA 2WJSA 2V5YA 1S0IA 1CVNA 5T5LA 1VIWB 1UL9A 4YG6A 3AYCA 3IN9A 4UW3A 1IKQA 4YFZA 1SBDA 3FLPA 1V6JA 2DVDA 2V73A 1BKZA 1W6QA 2OUJA 5CA6A 4UW6A 2VUAA 4Q26A 4LBLA 3LSDA 2ZHNA 3WUDA 2A6YA 2PELA 3LCPA 1GLHA 3WDWA 5H9PA 1G86A 4SLIA 4Y20A 2ZGLA 1MS3A 2D6PA 4XOGA 5IK5A 4LBMA 1QF3A 4NO4A 4K1ZA 3WVJA 1LOEA 1GBGA 1LEMA 2DVGA 1GZ9A 1JHNA 2NYYA 5JLVA 3JU9A 1G9FA 2JECA 4XMIA 3FFZA 5GLVA 1LOFC 2OVUA 1RITA 2GMPA 1JOJA 1SCSA 3VKOA 5HCAA 1H9WA 2DUPA 4FOWA 1JN2P 4ZXKA 5GLTA 1ONAA 1CIWA 4TYSA
chains in the Genus database with same CATH superfamily
1W3XA 4AFBA 1ODNA 2VCAA 3FHQA 4Q4V3 1JUHA 3AFGA 1C1FA 3LFIA 2WZPP 4JQTA 3U4SA 5FPZA 4XAEA 1GSLA 4C90A 1NLQA 4DXSA 3AKTA 5J09A 1XNDA 2FMDA 4W8JA 2GSYA 2R062 4QX7A 3V0BB 2G19A 2VW2A 3K48A 1ENQA 2R7EB 5BPXA 1RHI3 4XUNA 2Y0IA 3ROUA 1O5UA 1HQNA 4EV0A 1UW8A 4CCDA 2VMHA 2WBKA 3OD4A 2YBPA 3IB3A 3ZXLA 4AG4A 4K1YA 4LHLA 2WIIB 1COV3 4QM9A 2XHNA 2ZEWA 3D0JA 3WQ1A 5A33A 4CDXA 1TE1B 2BUKA 4BXSV 1FMD3 1YO8A 4GAZA 4A2UA 5C8CA 1LB2A 4Z92B 4K3UA 4LUKA 2DF7A 2EVXA 1UX7A 2JG9B 1KGYA 2P3KA 5J98B 2E7AA 3RS6A 4QGMA 4CP9B 2BDRA 3DL3A 2XL7A 2R1BA 4QXHA 3S7EA 1CPMA 4ZPIA 2HWF1 1Y4WA 4YFWA 5C5UA 1T6BX 4HLTA 4DUVA 5CFDC 5FO8B 5HBAA 4FTSA 2Q5TA 4LXLA 1NE4A 2P17A 3INAA 1I1EA 5B4NA 1OUSA 4IV3C 1BVVA 3RJRA 3T0AA 3ZIWA 4GD4A 2EIBA 3IAPA 1RB8G 4IV3B 4N7IA 2V72A 2BNMA 1R093 2B5HA 2W68A 3ZMOA 1Y9MA 3ZN6A 3H3UA 4A45A 4E4DX 4A7KA 5BY5A 4GZ9A 4CPBD 1OF3A 4PDWC 1RL3A 3MBWA 3KHBA 3MIHA 1UY1A 1EY2A 3DV8A 1JXNA 4Y1XA 1O4YA 1CN1A 4BQ2A 1X8EA 1WD4A 1W6QB 3LIGA 1SLAA 1UZ0A 1CZSA 1YQCA 1NQJA 4Y5TA 5GKAC 1GOHA 2P4EA 2YROA 5JWPA 5DUXA 3S30A 2XONA 4YW5A 2ARBA 4WVMA 2HWB2 4YNIA 4YM3A 4QHZA 2LW8A 4DFSA 3VD9A 1N1TA 2ZX2A 1W6NA 5GZEA 1HQLA 1U12A 3Q8BA 2VMCA 1RTVA 2A7AA 5FZCA 1PMJX 4IV1C 3MPPG 3BTZA 3UKVA 4IV1B 1TME2 4O9GA 2ZGQA 1UY3A 5DABA 4RQPC 4M0HA 2FBEA 2VMEA 4RQPB 5G04L 1HQWA 1NCQB 4JHTA 1UNBA 3JB8A 5JMOA 4OI2A 4D3WA 3AYAA 3VHRA 1PVC2 5EWSA 5IVFA 3I3DA 5L9RA 1ZBE2 1ND3B 1XXNA 2BFUL 3A4UA 5LBFA 2Y34A 3VBOC 1HXS1 4CP0A 5KC5A 3UV9A 5EFUA 3VBOB 2C0ZA 4UOJA 2VBDA 4MADA 5FYIA 5FREA 5E88A 3VKNA 2B9UA 4UF0A 4YGCA 1X9PA 4SBVA 1C8NA 4DB5A 4PI2A 5CYYA 5K4LA 5JOZA 4E8DA 1OXCA 1JYIA 3TN91 4QHBA 3O1SA 3WQ7A 2JDMA 1ULFA 2GMMA 2YFZA 3OUIA 4XJAA 1H4HA 3O1OA 4LBJA 2Y6LA 5BNPA 2FCVA 4H55A 1Q8SA 5KHJA 1VB2A 1H8VA 3RMXA 3RYKA 1JOBA 5JPMB 1RUJ1 3C7FA 1CGPA 5JCTA 4JV4A 3NVCA 4GQ7A 4DXTA 4UWDA 5BNNC 3T0BA 1PO12 3RZMA 1OKQA 5H9RA 3U78A 1LNSA 4JC1A 1OPMA 2VUDA 3OGJA 2JDAA 1F5JA 3UL2A 2QUOA 4XFGA 5LY2A 4E4HA 2IXCA 2VMIA 1GMMA 4G4FA 1ULGA 2Q0AA 5J7MA 5LATA 4IEVA 1OVPA 3ZYJB 1JH5A 1NLSA 4OVEA 5FZ4A 4OUMA 4Q4V2 5CKQA 4Q0SA 3U10A 5TSWA 3JXSA 4GH4A 3KD4A 5FMOS 2XJTA 2R49A 3BGAA 3V65A 1V6MA 5FJHA 3AXDA 5FY0A 2YBSA 1J1LA 3VHOA 4BB3A 5BXXA 2XHKA 1DLLA 1GZWA 1RHI2 3WF1A 4HKLA 3C7HA 2I07B 1VAKA 4DO0A 5ABJA 3C7EA 2BOJA 3AFKA 5FZ3A 5A7PA 5LRSA 2W1UA 3IPVB 1WA4A 4WM8C 1COV2 3VN4A 1HB4A 4YM0A 4WM8B 1NLRA 4N43A 1W6PB 1W9YA 4HFSA 2VZSA 4XCAA 5FUPA 4AFMA 1CZTA 1DYPA 3M4FA 4XXAA 1YCIA 5JUVA 3CF6E 3W20A 2AZ5A 1RYYA 1HXS3 1SLIA 4D69A 4NOTA 1HIXA 1S0GA 2D5FA 1LHOA 2Y6GA 1W8NA 4MOAA 3RWNA 3SKVA 1QDOA 3H7YA 1LEDA 1SFPA 1I3HA 2EIGA 5A70A 1KS4A 1XU1A 2BJSA 2K9ZA 3LAGA 3OUJA 3TN93 1AXKA 1R092 2PAMA 1OMIA 2AACA 2E26A 3C3VA 3N7KA 3KV6A 4JTNA 4RGAA 1CAUA 4NRPA 5CKMA 5C6CA 5DUWA 1KXGA 3I2JA 3NAPC 1UCXA 1XQNA 3T2PA 5DG1A 1O8PA 3KQRA 1RUJ3 3NAPB 4D7YA 4QKDA 5GZGA 1VP6A 3Q8AA 4OUSA 5E89A 4COZA 4CDUC 4XIKA 1MEC2 1CAXB 4NJ4A 1P8JA 1QOSA 1W2AX 2MEV1 4CDUB 1WA6X 2HBTA 2VZRA 5DUUA 3OGGA 1GOFA 3DPRA 4EYUA 2RS11 5AC91 4OUEA 1DF0A 3Q8EA 3B93A 5JSRA 2X09A 1W8HA 3WNMA 2DCZA 3AKQA 3KMHA 3FL7A 1ZZ9A 3OYWA 3GHNA 2DURA 4HKOA 4DZGA 4AHZA 5HCHA 1ENXA 1WW4A 5FY9A 4LBQB 2D93A 4XJUA 1QHDA 4MSVA 4MGQA 5FQ0B 1VRH1 3MO4A 2SLIA 1RXFA 4GJZA 4QMAA 2HWC1 3QLQA 4LBOA 1DP0A 2WWSA 3AL5A 4XTMA 1AJKA 3GBFA 5A32A 3WW3A 2FQPA 3IDBB 3VD7A 4Q0QA 2VCMA 3V0AA 3F2ZA 2YMZA 3T30A 3RPQA 5A7NA 4OULA 1J1TA 1D4VB 1H8TB 2R30A 2UY9A 3I59A 1QJFA 3POGA 2D6LX 2LALA 4NPLA 5DZGA 2Q8DA 4MXVA 3THDA 4D6QA 4CU6A 5A3PA 4AF9A 2IFRA 1V9U1 3BOWA 3HVDA 5L7OA 4AVAA 2CAVA 2BWCA 2PHRA 3WW4A 3S57A 1O3RA 5JSOA 1QNYA 3GBGA 3AX4A 4H7LA 1UKGA 1ULPA 2EAAA 3BCWA 4KWJA 4PQ9A 3TWIA 4TZDA 2DCKA 2GAUA 4M4PA 4UFKA 2HWF2 5AVPA 2XGXA 4FPOB 5LK5A 1OPOA 3ZFFC 1RXGA 3ZFFB 4CDWC 3I2HA 2W46A 1LESA 4CDWB 1H2KA 2ENRA 3DEMA 4Q4X1 5FMOL 1ST8A 4QDSA 3WDVA 3ZSLA 1WLDA 3VBFC 2IC1A 2QVSB 2Y64A 2ZGSA 4NMIA 3UK9A 4CCKA 3VBFB 1ZZCA 2YY1A 2B42B 3VB9A 2NZ9A 1OLQA 2VVDA 3BU7A 5LB6A 1OA2A 3WR0A 3R4UA 5CZKA 1G9CA 4BQWA 3FFQA 2VTFA 2WT0A 2MEV3 1DBNA 2VR4A 3E5XA 2JD4A 3E5UA 4LHKA 4XF4A 1XE7A 2RS13 2DU0A 5AC93 5BNOA 4FI9A 5FZFA 3ZYBA 4OHZA 3BODA 2Z69A 4NHXA 5A3MA 3BIWE 5F5QA 5FR3A 2VVEA 4FOYA 1XRUA 4HPKB 4XQWA 2ZA9A 3BTAA 3SC7X 3HMYA 1WD3A 3VZLA 5B2GB 1UIJA 1AXYA 1APNA 1SDDB 2J42A 4JDMA 5J37A 1K5JA 1VRH3 2DTYA 4K20A 1IS3A 1SPPA 5C9AC 1EUTA 4GJYA 4QGLA 4Z2WA 5C9AB 1R64A 1JYTA 1NKGA 2WC2A 2VXJA 4K8FA 4NHYA 3TAYA 3BIEA 1ZM1A 2LRPA 3CNAA 5LW9A 1JU4A 2W95A 3ASIA 4LPLA 1CD3G 1NQDA 1HXS2 2VL4A 5JLVA 1N1YA 4M00A 5F5CA 3MIEA 3ST7A 5FYCA 2EALA 2YYOA 4FQZA 1FNYA 4LO7A 4XW3A 4AI2A 4EN6B 2JG8B 4AYUA 4CCJA 1V9U3 1W8FA 2JXAA 3MUZ1 3BALA 1NYWA 4MGYE 4R4XA 2QTWB 3UNPA 1CX1A 5LRRA 5KXBA 3IBMA 1OUXA 3LIHA 4GWIA 3TN92 1U5IA 1F4AA 2N7GA 3UJOA 4RS5A 2HYKA 3I7DA 3N3HA 4JKMA 4Y1ZA 1ND2C 4Y1YA 5F5IA 4OI1A 4QKFA 1G6NA 2VPVA 1ND2B 1D7PM 3GXUA 5IVJA 1OBNA 2VU9A 1CQ9A 2PHFA 4ZU4A 1RUJ2 4RD7A 2QQLA 4Q4X3 2RHPA 1TNRA 3RSJA 2DDUA 1B35A 4IL7A 1HLCA 3IM0A 1C8M1 4N7UA 4EWAA 3WQ0A 1LGNA 2NN8A 5AVAA 5I8TA 2ZGOA 4FP3A 5FK8A 1B09A 2DBIA 3RDIA 1VAMA 1OD3A 2D5HA 3HBZA 1CWPA 1OD5A 3N9QA 5F32A 5F6LB 2ZEZA 5ERLA 2PHDA 4FFIA 5I8YA 3VD5A 2QQNA 4A3ZA 4NIAA 5A6ZA 3HT2A 1UZZA 3PVEA 3EHKA 1LHWA 4YZ3A 1H6YA 3ZN5A 1SHWB 3WD5A 4IETA 4KWLA 3AMQA 1W99A 1UX6A 5F9TA 4P9IA 1GV9A 1LODA 5JOXA 3EXUA 4AQSA 1UOFA 1CJPA 3LA2A 4KNCA 4UFJA 4AI3A 1W2UA 1FV2A 1T2XA 3NJZA 1GFF2 2AEYA 2ZX3A 3DECA 3LF7A 4XDQA 4XF3A 1OQEA 2C1FA 5FZIA 3UYJA 5A6YA 2WNUA 1HB3A 4IERA 4J1XA 3ZVXA 3POWA 2BEOA 4JQRA 2F6BA 1S1AA 1WMEA 3DKWA 5DPNA 4YW7A 2RM21 3ABZA 1Q8QA 2G4IA 5G05L 4LKEA 1W8ZA 4XDPA 4CP9A 3ACHA 2O0OA 1VR3A 3N7MA 4GB31 4Y1UA 1QGLA 2CV6A 3OY8A 2WFF1 4GWNA 5FRAA 5CFDA 4IESA 2CL2A 2D3PA 4QDQA 5HXVA 1FI2A 2XUEA 4IV3A 1DGRN 5HV4A 4D0QA 2VZPA 4S2FA 4FOVA 4OLLA 4GMP1 3WW2A 3IT8A 4MO3M 2W2IA 5DAPA 1W6MB 1OF4A 5C3RA 1JZ2A 1BMV1 1J3PA 1O4TA 5T5LA 2YUEA 4EQVA 3H9AA 1RUD2 1UL9A 1VIWB 3I3QA 4PDWA 3IN9A 5EP9A 3HD8B 4YFZA 3FLPA 3CJXA 1W6QA 3JZVA 4XVHA 1GOGA 5A3UA 4MZUA 4Q26A 4XPVA 4KG0A 2BVBA 3LSDA 4YWAA 4I02A 1DGWA 5IATA 2WS91 3WDWA 3ZFEC 1GP6A 1C8M3 2BGPA 2MEV2 4Y20A 3ZFEB 2D6PA 4QQ2A 4URAA 5JXJA 2RS12 4K1ZA 5AC92 3IDCB 1GWKA 3OPTA 3E6DA 1LEMA 5C71A 2NYYA 1JHNA 1XSQA 2Q4SA 1OI6A 1PX3A 1US3A 3JU9A 4CEWC 4KGQA 2OXBA 2WZR1 4CEWB 2FDHA 4BE3A 2OVUA 2WWUA 1SCSA 4IV1A 2HWE3 5HCAA 4MX3A 2WZ8A 1JN2P 3BTXA 5A3WA 1VRH2 5A1AA 2HWB1 2W0XA 1ENSA 2WN2A 4RQPA 1CIWA 2HWC2 1JOPA 3L2HA 4W6YA 4YW4A 3O0WA 4KG8A 4WVWA 5CU1A 2YC4A 1CAWB 2PN5A 1V6IA 5CEHA 2IVIB 3QH7A 5JAXA 3HNBM 3FZ3A 5EQUA 1RC6A 1KEXA 2OT7A 3HNMA 4XFCA 4R8HA 2RM23 3IDAA 2AEZA 5I8SA 3JBG1 3PJQA 4D7SA 4Y33A 5LCWL 3P6BA 1X9TA 1V9U2 4ZU7A 1ZBE1 4RFT0 4GB33 2VNGA 2QFEA 2WFF3 1MQTC 1S0FA 3CIHA 3RZHA 1MS9A 3J8F1 1MQTB 1XYNA 2I74A 2ZGRA 2Q30A 2ZOEB 3KT4A 4L11A 3AMNA 3BPZA 5DDJ1 1JYCA 4M4RA 4Y22B 5LWBA 2A73B 2YHJA 4KMQA 3WG1A 3WY6A 4GMP3 2R0FA 4IEQA 3SEEA 5BNNA 2J1EA 2XBO2 2RJ2A 2WQ4A 2X10A 4NPMA 4NVPA 4K6BA 1ZX5A 2FZ1A 4Q4X2 1UMHA 2RS51 5D8AC 3O1VA 3GZTB 5JZGC 1EAH1 4N90A 3OEBA 2ETEA 4ES8A 2RDSA 1ZRCA 4DS0A 2XJPA 3H8RA 2H6CA 3M2MA 4JKKA 4LHNA 1Q5OA 1F5FA 1BJQA 2W47A 1GNHA 1JBCA 5I0UA 2WLPA 2WDBA 3AZWA 5DMYA 3ZXJA 3PLQA 3VKLA 4PCRA 5C4WA 2XOMA 5T5OA 1SLCA 5JVVA 4AEDA 2QDNA 4QB2A 5J1XA 1DZRA 1IHMA 1POV1 3K77A 4K9SA 1HN0A 4LO5B 1IPSA 4NAOA 3L9JT 1VLNA 4NROA 1WW6A 2DCTA 3AP9A 2VVFA 1R081 1HDKA 3CJIC 4FOQA 4GMP0 4JGYC 4XFHA 2DYCA 4JGYB 3MZHA 1RJ7A 2VJXA 3B00A 4L97A 2ZAAA 1ZREA 2GC0A 1I9RA 1QDCA 4R9DA 2UYAA 1N1VA 1SBFA 1UF2C 5LASA 1UYYA 2HWB3 4WM8A 4CU7A 2CDOA 1W6PA 2A1XA 3PJYA 2WRAA 2PLV2 4XJ9A 2B8MA 2JE8A 3H7JA 3PIGA 4A42A 5BYNA 4OFGA 2GC2A 2HBUA 1Y43B 2XL9A 1WZXA 3C7GA 3MV01 5F3EA 4XMAA 4XF1A 1BBT2 4WBBA 3ZPOA 2J7MA 1TME3 3K46A 3ZM8A 5T55A 1HRV1 4IEZA 5A7WA 3LSEA 4IEUA 1LRHA 2ILMA 5BNQA 2O14A 1MZEA 5CADA 1UZWA 2XQXA 3ALQA 2Y6JA 4BQ1A 1ZBE3 3T0DA 4GKYA 4QXBA 4C1XA 1IZ3A 4BIFA 1SCRA 2VE1A 1S0DA 1X82A 3J8F3 3I3EA 3PURA 5CFCA 4GXLA 4LNVA 5FAXA 1IS4A 5KXDA 2A3XA 3MIGA 3NAPA 1HRI1 2BTVC 2XLAA 3H8UA 2QQVA 3RFRA 2UYBA 1RUOA 1URXA 1CAXA 4CDUA 4FAGA 5LBBA 1DQ6A 3OB8A 2UWCA 1BVP1 1UU6A 2GNDA 3THTA 1A34A 1JZ4A 1OLMA 5FP7A 4XACA 2W52A 2R1DA 3O0VA 1EAH3 1C8M2 1JMUB 3VL8A 2CHHA 2W91A 3A21A 3SLIA 5DAVA 2BFUS 5FBZA 2W94A 1U5XA 3VKMA 4Z07A 2VUCA 1MEC1 5FOBB 2ZAHA 4LBQA 2GC1A 1UMIA 2UURA 3KB5A 4XURA 5FQ0A 1CONA 2JX9A 2OPWA 2AYHA 2ZX1A 3EQEA 4QU1A 3ZXGA 4B4QA 1GNZA 1OLME 3PIJA 2L9LA 1GR3A 3OPWA 4YZ4A 2G9FA 3J7HA 2VAUA 5KXEA 1W8OA 4AEMA 4LMFA 1R083 2WQ8A 4X8PA 3IZOA 2BGCA 4TSVA 1R1ZA 4OQ8A 1F8VA 5SV5A 3ELNA 4XBQA 3NO8A 4FPKA 3U1XA 4C0BA 5FPXA 4B8EA 4OHYA 4O9EA 4IEWA 2W1SA 2VMGA 4TLFA 1W05A 5FWEA 4B1MA 4HVQA 2JE9A 3MEPA 4XUPA 2TUNA 3NL1A 2ERFA 4IEYA 2R16A 1S0CA 2RM22 1DFQA 1ZYBA 3J9SA 4NR1A 2J1AA 3SMHA 3WSOA 4P9JA 3PUSA 3W58A 1KRIA 1ZRFA 1HRV3 3MIDA 1STMA 4GB32 2ZKLA 2WFF2 1MS8A 2J22A 2XPJA 3QH6A 3GF6A 3ZFFA 3D0SA 2V4VA 3M3EA 4CDWA 1SFYA 2Z5WA 2JG9C 1GQHA 1HV0A 1POV0 1RJ8A 2C6SA 4I3GA 4QKBA 4WV8A 5FZ9A 5A3NA 5KC6A 2GN3A 3N9PA 2HKXA 3KCCA 3T2TA 2EXHA 4ASLA 4BM8A 1WMFA 2OS2A 3PTRB 3VBFA 1F15A 3PU3A 4XEZA 5LA0A 1UIKA 3MLLA 1DGRA 1BMV2 4O65A 3NSTA 4ZKTB 5FXZA 1HRI3 2ZMKA 1CX4A 1UOBA 2V5DA 5EJ1B 4YGEA 1HJGA 1NUKA 2XKOA 2X53S 3CLPA 4ISQA 3KQ4B 4AI1A 4HL0A 4QPIB 4RR3C 1U5ZA 4JVAA 3MLKA 4RR3B 3VUOA 2WO3A 3VZNA 1WCUA 4YLZA 2WS92 5FZ6A 1S4CA 3OJBA 2GNBA 2WAAA 4AK3A 1NOVA 3LDRA 5FY4A 2QJVA 4JGZB 2VO5A 4LKDA 3EB7A 4LK6A 1QQP1 1MEC3 5IFPA 3OOXA 2ADEA 2YV8A 1FV3A 1N3QA 1OFSA 2BBAA 4HBNA 1VB4A 3ZYGA 3K3OA 4Q1PA 3WDUA 5CVRA 2WZR2 4W4ZA 4NHMA 1IPKA 4HSJA 2OZJA 5C9AA 3CL1A 5FY7A 4LTAA 2ZGPA 3T2QA 5HV0A 5L9VA 3K2OA 3LOBA 4FTBA 2KA3A 5FYZA 3MLJA 1RUC1 2FDJA 3T09A 2ZJCA 1BHGA 1S2BA 3ZX7A 4IXLA 1N3PA 2DV9A 5FPBA 2UU8A 5FK7A 4CUGA 5HXMA 4JX0A 4XFBA 4BLIA 4K8RB 4V2WA 1GICA 4J1WA 1CESA 1W6OB 1MACA 1GANA 1V6LA 2YBKA 3FJSA 3ZIXA 4CDQC 5A1LA 4CCCA 5FZBA 1DYKA 5HCFA 5LA2A 4CDQB 2OQ6A 3PUHA 1NCQC 3O7OA 4IE6A 4FP2A 3R6SA 4LE3A 4V1PA 5KBFA 1L7RA 4H14A 3JBG2 2XKPA 1ZRRA 4Q8KA 4I2OA 1ND3C 4QXCA 1KS5A 5FZEA 2ZX4A 1H1IA 3TNPB 4M01A 4CSWA 2ZCWA 3VDAA 3J8F2 1ACCA 1ND2A 4ISRA 4AVCA 5L73A 1SG3A 4FPFA 3A0NA 3NMBA 5DDJ2 4Z8BA 4XILA 2FDIA 2RS31 4HETA 2JEMA 2BWAA 2UY8A 3N7LA 4QT6A 2VOVA 3WG4A 4MXWA 1A8DA 4YYOA 4C91A 5J96B 4FPHA 2HWF3 3VBUC 2YG0A 1ULOA 5A7QA 2RS52 3URFA 3VBUB 1H2NA 4IGPA 3KWVA 1EAH2 1WMDA 3AC0A 3BN6A 2VQ0A 3WP4A 5JXHA 2XWJB 1PGL1 3I3MA 1DQ2A 2QQMA 3ES4A 3PNAA 4E4ZA 2JKBA 4ZONA 4A7YA 1YJLA 3WT3A 4AXOA 1E57A 5F5AA 1JHJA 5A6XA 1UZYA 2O8OA 4YARA 3WDYA 3S6PA 3VZJA 4KL1A 1PK6C 3P1IA 1A8MA 3J4UH 1PK6B 1QQP3 1CPNA 3AZYA 1BXHA 3NQHA 4GULA 4L99A 5KXCA 4XYXA 2CNAA 5AFEA 4PJYA 1GWMA 4C1WA 5IK7A 1R082 1DU3D 3CZJA 3RI8A 1WCKA 5KHIA 4DMIA 5JI7A 4NAMA 5A3TA 1C28A 1ZA7A 2ZGMA 2DTWA 2ZACA 1QJX1 3A7QA 3Q8CA 4BIOA 1RUC3 4I01A 2ARXA 4ZY9A 4MUVA 5A1FA 4Y4YA 4MGZE 4PQQA 4XUQA 1DLCA 4H2AA 4YG0A 4MG2A 4BISA 1J3RA 1TMF1 2VMDA 1AR71 1XE8A 4M3CB 4MHRA 1HRV2 2B45X 2WNOA 4UFIA 4HT1T 4CPBA 1KD7A 3USUA 1PMHX 3WZ1A 4RGGA 1RIRA 3J7MA 4P02B 1HV1A 1SLTA 2A6VA 2GDFA 4JRAA 3DYOA 2D7FA 4YVSC 3GJBA 2JB8A 2P34A 3FLTA 4RL7A 3S0MA 3HBKA 1WW7A 1MZ6A 3FLRA 1QJU1 1EYBA 3POSA 4P00B 4YVSB 5M0TA 2E6VA 1AVBA 1C4RA 3PVNA 5I91A 1L7QA 1HRI2 3U11A 2RS33 5DAWA 3VBSC 3VHNA 1FNZA 5FO7B 4BLJA 2ZHLA 1AR61 1UAIA 3GZAA 3VBSB 4ET7A 4MGIE 4QPWA 1H0BA 2RG4A 1E5RA 2CGOA 4HANA 4ARXA 3ZFEA 1E5IA 4MV2A 4IE7A 5FZMA 2CTVA 1RUD1 4QDRA 2VZVA 1RUE1 5E1RA 5GM0A 3OBZA 1AR81 2ARAA 2XJQA 1YHFA 3AMPA 3WF2A 4I0BA 4WVZA 3ZO0B 3WNNA 4CEWA 3MI8A 3POYA 3V56A 1AX0A 4IUGA 1OH4A 4CEYB 3EMRA 2Y38A 1OA3A 1QIQA 1LOGA 3B9CA 5JXGA 2VZ1A 1J59A 2OIIA 3AKPA 1JZ6A 2PAKA 5FZ0A 3ZXAC 4CCEA 2RJLA 4OMDA 3SCFA 3EJKA 3UETA 2RDRA 2X05A 2VGDA 2P1BA 2SBAA 2VXRA 1CAWA 2P3IA 2DVFA 2KD7A 1M4WA 1SACA 4JDNA 3WXPA 4B7KA 4Q5OA 3ZLIA 3KVBA 2P2KA 3KCYA 3FWEA 4I30A 1IG3A 1QJX3 2WSVA 1AUYA 3CMGA 4ES9A 5T3NA 1DCSA 3VD3A 1OKOA 4QX3A 3LKJA 1JW6A 1Z78A 5FKCA 2FDFA 3ILRA 4OI0A 3PVBB 2D3RA 4XF0A 5FPVA 1MQTA 1TMF3 2R32A 3DN7A 3PHMA 4XE9A 3AKRA 1PVXA 1AR73 3WF0A 4F7ZA 1H8TC 4Y22A 3CBNA 3U4XA 3CO2A 1VPHA 4QQHA 1KFUL 5FBJA 3GALA 4E9KA 4OYUA 1JYXA 4A41A 3GNEA 4D8MA 1W0OA 4A44A 3T1LA 4Q29A 3WLUA 5D8AA 1J83A 1QJU3 1QU0A 3I49A 4UBGA 2J1UA 1IKPA 4LOTA 5JZGA 1VBE1 3J7LA 3SCGA 2GH2A 5FUNA 3C8XA 3K75B 4MVTA 4AGVA 1LTEA 2YU2A 2Q1FA 2A6ZA 3LQCA 4GA9A 2XBO1 4BQ4A 2R6QA 2F4PA 4RN5A 5IYYA 1PMIA 4LBQD 3AVRA 2V5YA 1S0IA 4FFFA 1RUD3 4EN9B 1RUE3 3O1TA 4LKSA 3JQWA 4YG6A 1AR83 2W9XA 3AYCA 4GIQA 5EHDA 1SBDA 1V6JA 2DVDA 3POFA 1BKZA 2W1WA 4B29A 1E5SA 5CA6A 4HVRA 4ORFA 1H6XA 5LY1A 1W9FA 2ZHNA 4QPGC 1QQP2 3CJIA 1XPWA 4QPGB 1W03A 4R52A 4DY5A 2Q1MA 5IK5A 2VTXA 3RYRA 4NO4A 2RDNA 1UXXX 3K4DA 2WR9A 1LOEA 3SKJE 2EICA 1GBGA 2GP5A 2VBPA 2DVGA 3QD6A 4LA2A 3ZR6A 1G9FA 2JECA 4ASKA 1SMVA 5IVBA 2QE3A 5J48A 1RUC2 1O59A 5GLVA 1CZVA 1VRBA 2OZ6A 1RITA 4PIXA 1H9WA 1SZBA 1WCDJ 5BUVA 5J36A 2ATFA 2QQPA 2PLV1 3CHXA 2HWC3 3F95A 5DAQA 5L19A 4BYYA 1OQ1A 5FP4A 3TB0A 3ZN6B 3MHZA 2OPKA 1ZRIA 4P9LA 4Q4Y1 1JODA 1YUDA 5FZLA 5IK8A 1G7YA 2LS6A 1BBT1 3BVCA 1YFWA 2VQTA 3B69A 3A0KA 1W2TA 4W65A 3LD8A 1FX5A 1ZZ7A 2WT2A 3KV9A 3M3QA 1HKDA 1NX9A 3M70A 5F2WA 5FXXA 1NA1C 2EA7A 4XFAA 1DHKB 3ZXKA 3U0ZA 5CIRA 2JG8C 1NA1B 1YEWA 2XJVA 5C3QA 1LECA 1YQ8A 1PZ7A 3PVOA 3WV6A 2WQZC 2RS32 4PBPA 1UWWA 4NRQA 3AM2A 3G6JB 1DZQA 2A6XA 4BH9A 5T52A 1VBE3 4Q0PA 4C0HA 1F4HA 4P5YA 1RUF1 2EF6A 3W59A 1QOTA 1DZTA 1V6NA 3IDEA 1ENRA 1WLWA 2XBO3 4CZSA 1U5YA 1L7LA 1LENA 2ZEXA 3W5MA 1PGL2 2ZKNA 5FWJA 1QXPA 3PDQA 3FHIB 1SBEA 3KCXA 2PHLA 2QKDA 3FX3A 4QX5A 2D97A 2P3YA 3HOBA 1REFA 1CJDA 4UYBA 1BEV2 3MIFA 3L2YA 5IVVA 4NIIA 3FMGA 4UFLA 3O14A 3WHUA 4BXFA 1LHVA 1VMHA 4LBKA 3AVSA 4Q2FA 4O61A 1O4ZA 4YM2A 1TG7A 3D6EA 4OHVA 1HJFA 1X8MA 4CXYA 4IEOA 1W9SA 2ARCA 3V0BA 2AC1A 1D0HA 1G9AA 2PQQA 1YYNA 3DXTA 2A70A 1RUH1 2RJKA 2ZZJA 1QJX2 4DNYA 1S55A 2E32A 3GCXA 3HIFA 2NLRA 1XOYA 4LQRA 3E6CC 4LULA 4AW7A 3HN3A 1GKBA 3D82A 3H42B 5K7PA 2W08A 4KGGA 2PLV3 4OHWA 1TMF2 3RZLA 2GALA 4P5HA 2NMNA 3WUCA 1AR72 1N47A 1W8WA 4HG6B 4ZU5A 3RQ0A 2X5IC 2HH9A 4FFGA 2JG9A 3HT1A 2X5IB 4Q4Y3 4HN0A 4QQLA 1BBT3 1DIWA 1NZCA 2JKXA 2PAEA 2PHTA 4XDOA 4XQ4A 5FY1A 4NRMA 1UD1A 3JCIA 1QXJA 3JQXA 5EZWA 2WSUA 5CBLA 2CU5A 2IFWA 5F3GA 2OYZA 1JYWA 2YDEA 1QJU2 4ONUA 4WZCA 3IWZA 4KBBA 4NPRA 1VE0A 4XC9A 3BOPA 2W5FA 4COUA 1ULCA 1DG6A 4RR3A 3SH5A 1VBC1 3J7NA 1ULEA 2DVBA 5JIUA 2WO1A 4YVWC 1MVEA 1AR62 1SFNA 4YVWB 3O1PA 4KQ7A 4RSUA 5GLZA 4BHPA 1W39A 1RUF3 1RUE2 1WWYA 1CAVB 5JDBA 1AR82 2Y6FA 3LGRA 3WF3A 1K5MC 1PIV1 1YXWA 4UFHA 2R041 1K5MB 2F4LA 1UU4A 4PIYA 5FZKA 3RZJA 2FMYA 2BU9A 5FPUA 1JUIA 4LJHA 1JTZX 2E31A 3LB9A 1UN1A 3SEPA 2WNVC 4GKXA 4LLOA 2VOWA 1RGSA 4YGDA 3UGHA 4BOWA 4N43B 2BVVA 2WNVB 4YGBA 4YW2A 4BMEA 2V4AA 3AP4A 1ALYA 4YZ5A 5LZ6A 4CUAA 1OQDA 3KSCA 2OQ7A 4OZXA 2W39A 1HB1A 4KWUA 4U36A 4K7JA 1YI7A 5FZGA 2DFBA 1LOCA 2TBVA 1OVSA 2ZMLA 5IVYA 1OH3A 3AJZA 3ILFA 2ZMNA 3M1HA 1LOBA 3ETPA 3R4DB 3LPFA 2VECA 4CDQA 2YXSA 3B3QE 1QOOA 3ZMNA 4BQ5A 3MV11 1GP4A 1RUH3 1J58A 3H3LA 1IQAA 1EV11 1NCQA 3JUUA 1Q56A 4QXKA 5C7GA 2WUHA 5FYMA 1C1LA 4LO6B 4Q0VA 3D4KA 1UY4A 2R071 1VBB1 2DBNA 2YZ4A 3T4VA 3LA7A 4AOCA 1GUIA 4AQTA 5FYVA 5ACA1 1ND3A 1WBLA 3HQUA 1Q3EA 2VCCA 1MZFA 1W0PA 3B9IA 2PHWA 4FVVA 5EJZB 4E2GA 3VBOA 4TWTA 5H9SA 2DU1A 1DQ0A 2X8KA 5FZ8A 1UQXA 5F3CA 2ZGUA 2NQYA 4RA0A 2JDZA 3GGLA 5JMCA 2BGOA 2BOIA 3UESA 4XFFA 4I0AA 5JXIA 1DQ5A 1OC1A 1LU1A 3HEIA 2ZHMA 3DPRB 5FCCA 3ZYFA 3NV3A 1UPSA 2PHUA 3QCWA 3VBHC 4ASMB 3B94A 3VBUA 4BDVB 3VBHB 3ZN4A 4CCMA 2Y33A 1JI6A 1SLBA 1PGSA 3CDZB 1VBE2 2VC9A 3W9AA 3ZR5A 2AREA 4YZ1A 1K45A 5LBEA 3W5NA 1VBC3 3LPGA 1H30A 3V64A 4AGRA 2QQIA 3THPA 4AI0A 4AVSA 4CCOA 1ZBA1 5EYXA 4LR4A 5A3LA 2Q8OA 4CRQA 4LT5A 1V70A 1TVGA 2D6MA 1YWKA 4LEJA 3ZYRA 3NJXA 4BQYA 3HWJA 5DG2A 1Q8VA 4NWWA 5FDBA 1PK6A 1HN1A 4AI8A 5A32B 1IPJA 2ZZQA 4PHZA 1HB2A 4PBOA 3DYMA 4QHOA 3V0AB 2R043 5A7SA 1PM7A 3I54A 2ET1A 1X33A 2XDVA 5GLWA 1ZRDA 1D4M2 1D0GA 2J1RA 2WS93 4W50A 4A7ZA 1WGPA 4URTA 3FC0A 3JD71 4JZRA 2W3JA 1W2NA 4P9WA 2D3SA 4Q8LA 4FPCA 2D43A 1V00A 2VZQA 5FYBA 4QKNA 1WCQA 2VULA 4P9XA 1KDKA 3MPBA 3LEGA 4N8MA 3WNLA 3AMMA 4JCKA 4ZS2A 2WZR3 3WP5A 5IAXA 1D2SA 5LBCA 3O1RA 4E27A 1UYZA 4LLFA 4MYEA 2B4KA 5JI9A 3IPVA 2R0HA 2VBBA 3CU7A 3TYJA 1MVQA 1S0EA 4DRRA 1EV13 3I2DA 2OKXA 1US2A 2BP6A 3GBWA 5D21A 3PMSA 2BBVA 2R073 3K51A 1VBB3 3LOIA 1C3HA 5IWFA 2YPDA 3MW4A 3POBA 5C5TA 5ACA3 5FZOB 4Q4Y2 5CKNA 3UGFA 3TEZA 3KZ4C 2C24A 3AZZA 5J3UA 4YW6A 5FPAA 3POIA 1SLLA 4YRDA 2P5BA 1NT0A 1VMFA 1MZ5A 3WW1A 4AL9A 4CVUA 2DWRA 3WG3A 1JZ8A 3SQOA 2HWD1 3NWKA 2Z79A 3MUY1 3JBG3 4H3WA 3VBSA 3FUQA 4AHWA 5C3OA 4QM8A 3I2GA 3T4HB 3ZYPA 2VNRA 4JKLA 4BPZA 4CTEA 2VZ3A 4GWMA 2QQJA 2JDNA 5FIXA 5BNOB 3SXWA 4CYDA 3K4AA 4FPYA 4DQAA 4NWVA 1GQPA 4IE0A 4FCAA 4DXRA 1PO21 2QQKA 4S2HA 5LA1A 5DDJ3 2WAOA 2IUWA 3RZZA 3N35A 3IIIA 1RUF2 3ES1A 5FYYA 3C2UA 2PMWB 5CISA 4IQPA 5FY8A 1ZBA3 2VD7A 2XJUA 4WM7C 1NG0A 1U0AA 1EPZA 2RS53 2JDPA 3VDCA 4WM7B 3N9LA 2ZS6B 3UKTA 1OHFA 3ACFA 1GWLA 1UY0A 3FHAA 1JS9A 1ZZBA 3NV2A 4Q1RA 3IAQA 3LZZA 4LBNA 4UW4A 2NPIA 1PHMA 2WNEA 3KT7A 5EV7A 4XBNA 3N9MA 2KXLA 1Y9QA 5F39A 3OBAA 4PF5A 3FBYA 5FP9A 1FAYA 3VZOA 3WNPA 1AX2A 4PF1A 4BMBA 4CP2A 3RG0A 1HW5A 2O8QA 3JD73 2OUHA 4BZ4A 1MS4A 3ETQA 5JIAA 3NRUA 4Y4RA 2JIGA 4AGGA 1POV3 3DYPA 5EXOA 1RUH2 1G9DA 2HEYF 4XUTA 2WINB 5DZEA 1S2KA 2XUMA 4PT6A 2RR11 1PNGA 1RVF1 1ZZ6A 3O1MA 2NP0A 4LKFA 1PZ8A 1S0BA 4TTGA 1H8TA 5SV8A 2WO7A 3MFCA 5LEKA 3POEA 5F37A 4KU8A 3H8XA 1A78A 1MS1A 4Y5Z0 3ZSEA 2B39A 5T54A 1DYOA 3NNLA 4N9IA 2Q1ZB 3GYDA 1JZ5A 4E4SA 1LHUA 1POQA 3AYEA 3K4ZA 2YC0A 4QQPA 1C5IA 1ODMA 1UY2A 4OCTA 4EZHA 2C4XA 2OW4A 1REDA 4UBHA 3ME2A 2HWD3 4OMCA 5D2AA 4G3YC 3HQXA 1KQRA 4I09A 4KH9A 2GMEA 1DDLA 3AYDA 3KV4A 1K42A 1VBC2 2VZOA 4CCNA 5IHRA 2JJ6A 4J6GA 4DEQA 2ZTNA 2D6KA 2I2SA 2Z42A 3LA3A 1PO23 4L0PA 2AUYA 3A22A 4WZFA 4YM1A 5KHKA 2GZWA 2E53A 2A71A 5IT6A 4QPIC 1CR7A 1QJEA 1RUG1 3BB6A 3P3PA 2Q8CA 3VBRC 4XFIA 2E7QA 2VG9A 2K2SA 3VBRB 1PIV2 1O6UA 4QPGA 3VDBA 2WNUC 5CG9A 2GH8A 2R042 1M06G 1DQ4A 3APBA 2WNUB 1OOPC 4YPJA 4A3XA 4YG3A 2PFWA 4AQ6A 1OOPB 3M3OA 4JGZC 4OZOA 4U2AA 2JDYA 5FZHA 5FO9B 2J1VA 1QWRA 3MIBA 4HPKA 5E16A 3RVHA 2HEVF 4HMZA 3VLBB 4N53C 3AL6A 4LIVA 4EJRA 1UOJA 3OY8B 1VBA1 4N53B 1GYKA 4KBZA 5A6QA 5CFDB 1XNTA 3RMYA 3R4SA 5C8WA 1NY71 5HPOA 3DUIA 3ORJA 3PUIA 4FBFA 5B4XA 2PYTA 2XQRA 3LEIA 3HAGA 4BJ0A 5L9BA 4AQ2A 1VMJA 3ACGA 1AR91 1EV12 3AP6A 3B5LB 2J1SA 2XH6A 1Q43A 2D6OX 2YU1A 5C3PA 2R072 1VBB2 4PDWB 1FPN1 4CA9A 2RR13 1RVF3 4PIZA 2C9KA 5ACA2 5F2SA 3VKFC 1H1AA 3FE5A 3IMNA 3SITA 2O1QA 1AJOA 1NA1A 2PA7A 3KT1A 2Y6HA 5APAA 1NZIA 5D1IA 3VDDC 2JG8A 1AYM1 3VDDB 3VV1A 1AF9A 1NCRC 3KF3A 2AENA 3ON7A 4L9BA 4MHUA 3IIAA 2ZXQA 1EP0A 1QY4A 1NCRB 2JDHA 4Y20B 4R4ZA 5FZ1A 3RI9A 2WWJA 3IMMA 1BZWA 2AH2A 2VOXA 4CXXA 5C70A 3TEWA 3Q8FA 4D6RA 2XVGA 3SHRA 4AVBA 3HQRA 4GWJA 5DUVA 2XVLA 4Q27A 1IOAA 2BERA 1S0JA 2VH9A 1UU5A 2EXJA 1YQ2A 5FYTA 4MGKE 2AGSA 4MLOA 4CP1A 1MS5A 2QNKA 2GNMA 5GZFA 1ZBA2 3VHPA 1DGWX 1DQ1A 2J1TA 5IJRA 5HI0A 2DUOA 4QWNA 2BNNA 1RUG3 3ZXDA 1FOD1 2E9QA 1OURA 3O12A 4HONA 1YQ6A 5F3IA 3HNYM 3AZVA 4LHSA 1GNYA 1OA4A 4AZZA 5CAZA 1VBD1 4RHV1 2E33A 3N9OA 4Q4W1 3LEMA 3KS7A 1YIPA 3NNFA 1IKQA 4F3JA 3JD72 1BEV1 2CAUA 1UZVA 3EYPA 2FCUA 2OUJA 5CG8A 4LBLA 3ZDSA 4D6SA 1V0AA 3WUDA 4XQDA 2A6YA 2PELA 4EN0A 3LCPA 4S2GA 1GLHA 4RFRB 4AI9A 1VBA3 1XC6A 4MGTA 4SLIA 2ZGLA 1MS3A 4XOGA 1ASJ1 4LBMA 2IXLA 2FDKA 2VTXJ 5F7UA 3WVJA 1Z7S1 4AFDA 3WF4A 3PUAA 3ZYHA 5BNNB 2X5IA 1AR93 1KFXL 1NE6A 1QXRA 4LITA 3WHTA 5I93A 3MF6A 1XU2A 2VQAA 1LOFC 1R1A2 1FPN3 4LO8A 3VKOA 2DUPA 4FOWA 5FUIA 4QB6A 4ZXKA 4EWDA 1ONAA 2ZX0A 3EBRA 4IGOA 5FFOC 2B9VA 3H0OA 4XJWA 4FPGA 1AYM3 5JSPA 5KHGA 3JB4C 4HKWA 4R9CA 5FJKA 4Y24A 5C4WC 3H8OA 5FP3A 2LTNA 2HWD2 2CWSA 4AEDC 1G9BA 1W6MA 5C4WB 4B7EA 1AHSA 1BYHA 4YVWA 4AEDB 5CNAA 4QAWA 3UKNA 1S2EA 4EROA 1SQ4A 2CSGA 2YC2A 4CE8A 4BWOA 2H0BA 1CAVA 2WYFA 1UYXA 2ZGTA 2A3YA 3E97A 4F8AA 4D94A 5I0DA 5K9YA 3AK0A 1PO22 4AFAA 4Z82A 1K5MA 2DVAA 1AZDA 1AXZA 1WBFA 4LIUA 3CEWA 2HJIA 2P6CA 3KLSA 5FMBA 1GU3A 1FATA 1UPIA 2EXIA 4XJZA 3WX5A 2WFPA 2JIJA 3UJQA 4BQXA 2WNVA 3S5QA 4WVVA 1AL21 1JU3A 3QBQA 5FMDA 2QCSB 1FMD2 3ITQA 4RGKA 4OHXA 1YFUA 2RE9A 2XVKA 1FOD3 4E2SA 4FPLA 2FZ2A 1QKQA 3J26N 1RINA 2GN7A 3ZFGC 4ATFA 3RZGA 3WG2A 5FLJA 3WP3A 4CEYC 2D44A 3ZFGB 4KU7A 3BPSA 4DINB 1IS6A 1QMJA 1VBD3 3OGSA 4RHV3 1EPWA 4Q4W3 5FTTC 2IXIA 1WUVA 3M3IA 4S2DA 4XHXA 5A7WB 2JDUA 4HVOA 1XYPA 1BEV3 4ZHNA 3Q9OA 1GZTA 4QX2A 1V6KA 1Q8PA 4XETA 2ID4A 1QEXA 4D7TA 4FAHA 1UKRA 4B4RA 5CFCC 1JZ7A 4NIDA 5GZCA 3E1F1 5CFCB 3LFMA 3ACIA 1ASJ3 2VM9A 1X36A 4LO4B 4AEJA 1PNFA 4FPEA 1XB9A 1Z7S3 1RVF2 2RR12 5ANQA 2CDPA 3DF0A 3OSDA 1ZNPA 2IZWA 2PTMA 5IFTA 3E5QA 2A3WA 2ZPXA 4LA3A 3ACLA 3I97A 3SH4A 1AL0G 3ZPYA 2CGNA 5FZAA 4DUXA 2FDGA 4MH0E 4XAAA 4K40A 5GZDA 3VBHA 3NNMA 3FBMA 1SDWA 4TLGA 5KWRA 2QZ3A 4XCBA 4XTPA 5AFBA 2CGPA 3KGLA 5F6KA 4ZXEA 3TBDA 3MW3A 4IE5A 3M3CA 4YZ2A 1W28A 3PMEA 1X50A 3ZDVA 3AXEA 3RGBA 4BK5A 4EWEA 2JE7A 3NNGA 2DCJA 3D5OA 5K0UC 1XSRA 3AJYA 2EXKA 3OGVA 5K0UB 3ZSJA 4QB1A 3ILNA 4CXWA 1LGCA 1PZ9A 1QNWA 2TEPA 2ZGNA 3D8CA 3HJRA 2W87A 4ITCA 1NXMA 2VY0A 2D6NA 1C5HA 1AR63 1RUG2 2KR2A 4IGQA 1WKYA 1OSGA 3C7OA 1A6CA 4M3CF 2VZUA 3X29B 2K0GA 3U37A 3WCSA 2XLFA 1LR5A 4QX8A 4AFCA 4CUBA 3KHCA 1AL23 1KDMA 2PHXA 4XJ8A 2WA3A 5FLHA 1BK0A 4UFMA 3RYPA 2TNFA 2XB6C 3IKWA 3POJA 4BCUA 4L8QA 3OBRA 2RV9A 3OEAA 3AP5A 2ZEYA 1D4M1 2BW8A 3ZKUA 3ZSKA 4JGYA 3NV1A 2C26A 2LM3A 4CDXC 1O7FA 3EO6A 2WT1A 1T6GC 4YSFA 4CDXB 2OA2A 5A33B 1VBA2 4NE9A 4L92A 3TNQA 4DUWA 4JHZA 5C8CC 2VUJA 3LE0A 5C8CB 1NY72 1WMXA 3THCA 1QJY1 4NIHA 3O0XA 4P08A 2Y8KA 5DZFA 2JICA 3NV4A 2YGLA 3S7IA 4HOOA 4QGNA 2I45A 2RVAA 2VW0A 4P9YA 5HCBA 2G9ZA 5FZOA 1AR92 1L3JA 4LE4A 3RZKA 4J25A 4XXPA 2MHFA 5FOJB 1RMU1 4GALA 3ATGA 3MDPA 1FPN2 4COWA 5ISLA 1YC61 3I2IA 3MGUA 4HK8A 1BCXA 4OI4A 3ZXFA 4FFHA 5A80A 4B3NA 3TEXA 5JR2A 3DGTA 3SCHA 2WO2A 1AYM2 4O7XA 4I0WB 2QQWA 1W06A 2D40A 3WDTA 4V2VA 2ZHKA 3SNMA 2BPA2 2VQUA 2FCTA 3WDXA 2GC3A 3TRSB 3P3NA 2K46A 2E51A 2LROA 1OFNA 3ZYIB 4M0NA 4CU9A 2XJSA 4AVTA 5T50A 1Q8OA 5IW0A 4A6OA 1LULA 4C8DA 1K3IA 5FKBA 2EIDA 1YJKA 3WNXA 2PQSA 3DKQA 4QU2A 5L36A 1FYUA 3ZKYA 5KHHA 3USSA 4WM7A 2QBXA 3QACA 3PUQA 2RMU1 5FP8A 1XBFA 1QJZA 4W6WA 2ET7A 4WVMB 3OBTA 1FT9A 3M8LA 2KM2A 1W6NB 4PLMA 1O3TA 1FOD2 1N1SA 2QQUA 5LA9A 3N36A 2WL1A 3VD4A 3NJVA 3OF1A 5A3OA 5EIYB 2CYFA 3U14A 1W04A 1VBD2 1ZVFA 4RHV2 4XBLA 4CU8A 3MICA 1XNKA 4HK9A 4Q4W2 5FMCA 1UYPA 2Y26A 1H4GA 5GLUA 3WEZA 1IGOA 5I0RA 5I0TA 2BRTA 5BV6A 2XXZA 3LDKA 2Y60A 3E6BA 3NW4A 5EJ3A 1D4M3 2VOTA 5H9QA 3WINE 4AVVA 4Y1VA 4XUOA 3GM8A 1OLRA 3RWKX 3MFAA 3I2OA 3NNJA 4PI0A 2HEWF 1O5LA 1CIYA 1F35A 1ASJ2 1W0NA 4Y5SA 4UF0B 1QJY3 1GZCA 5C3SA 1O8SA 1AYN1 1H2LA 1GQGA 1LCLA 1SEFA 4META 3VGIA 1Z7S2 2A5ZA 4F83A 5IK4A 5IVCA 1QH7A 1VALA 3MF9A 1YRZA 2B46X 4MXWB 1KITA 3OG2A 3BTYA 3WQBA 3OTFA 3AP7A 5BNPC 2HYXA 1VJ2A 3N7JA 1RMU3 2A75A 4AE2A 1BLZA 5BNPB 4H7MA 1PGW1 4XABA 2WLQA 2ZGKA 2MNGA 1W90A 5CB7A 1IS5A 3OPZA 1ZZ8A 1RUI1 3I3BA 3CKHA 4UI9L 3WNKA 2P6HA 3BYWA 3ECQA 5FV3A 4G9SB 1BQPA 2E63A 2HWE1 1LJ7A 3AZXA 4BU2A 2Z2SB 3QOPA 1D2QA 1Y9GA 2B7YA 2W92A 3AKSA 5JR7B 2XWBB 2XJRA 1IG0A 3M7AA 3B01A 1O3SA 4EZ4A 2G1MA 2Z4FA 4QX0A 1XNAA 2C9AA 4QPIA 1Z0HA 4QX1A 3VBRA 4L2NA 2R061 3CZUA 2H0VA 4GH4C 3RRDA 3KF5A 4GH4B 5EPAA 1OOPA 4DOUA 5JPNB 4Q0UA 4PLOA 2RMU3 5JOWA 2RDQA 3GJAA 4IEPA 1AL22 4JGZA 4E2QA 4AEKA 3B02A 5ABJC 2XR4A 1W8UA 1GZWB 4IE4A 2DCYA 5ABJB 4IEXA 1H1MA 2AR6A 2BQPA 4HSLA 4N53A 1H9PA 1JYNA 1WLCA 2GP3A 3H3ZA 5LEJA 2X29A 1W9WA 4COYA 3KV5A 1V6OA 4JDOA 2JWPA 3WNOA 4R9AA 4N43C 3ZSMA 2XG3A 3P5BA 4HN1A 2E7TA 1G8WA 3USUB 1TZOA 4FSJA 1TNFA 1WLTA 2YPJA 3ENRA 5FY5A 2D98A 4NUBA 4AHYA 2WZEA 2UWAA 2WABA 2ZBJA 4A4AA 1O91A 2BYVE 2EAKA 2VNVA 3HR9A 4Z2AA 4NHLA 2ORZA 3BUCA 3S5AA 1W6OA 1EUUA 1W9TA 2VZTA 3LWCA 4AR2A 5C33A 1NAEA 1W8TA 3SISA 5FYUA 5IUQA 1AYN3 1I6XA 3DCQA 1DGLA 3VDDA 4X8NA 3WP6A 2NMOA 3H1MA 3NJYA 3FUOA 1NCRA 4FXGB 3FN9A 3N9NA 4AAXA 1PM4A 1CAUB 4RYDA 2CY6A 4AHXA 3I2KA 4DEVA 5DXDA 1GP5A 1MR5A 4P14A 5IAVA 4JRLA 1TEIA 3LDBA 2PXJA 2QQOA 3SH3A 1XJAA 5GJ6A 1RUI3 4P9GA 3I4IA 1A3KA 1H2MA 2VCBA 4JAAA 2YB7A 3DPRC 4I3PA 4LUMA 2C5DA 3RJ2X 4XIOA 5LK7B 4MGSA 1YQ5A 2A6WA 2P37A 1LGBA 3BU0A 4KWKA 4QPYA 5A7OA 1N3OA 3AB0A 4ATEA 2WYSA 4BA6A 1KJRA 2ADDA 3MYXA 2VMFA 3A23A 4XZUG 3OYWB 2ES3A 2FHRA 3CQOA 4JTOA 2P3JA 4LOSA 5E8AA 2NM1A 4YW1A 3GDBA 2R063 1TME1 4DIQA 5JOYA 4PLNA 2V09A 1XNCA 2DFCA 5IVEA 1ULDA 5DN2A 4A6SA 2UWBA 1QH6A 1Y7BA 4X6QB 1W2OA 5I0SA 3UT0A 4QQOA 3PL0A 5GALA 3W21A 3ZOIA 1PVC1 1XYOA 4HXCA 4AWDA 4NIGA 3VL9A 3HN1A 1PIV3 1K12A 4TXWA 1NXD1 3ZXEA 4BK4A 3VZMA 2IXJA 3O5SA 5EYYA 5DAXA 3NKTA 5T5JA 4DRVA 5K8SA 2JDKA 1AX1A 3VZKA 2VNOA 4EE2A 4TN7A 1BK1A 1REEA 4FO9A 3I2FA 3OGRA 2ORXA 4IDZA 4OQ9A 3I59B 4Y26A 2JENA 5L7OC 2IVJA 1UOGA 3RNSA 5L7OB 3BKZA 5FZ7A 1MS0A 1QJY2 2GNTA 4B1LA 4CUCA 5T5PA 2WKKA 4R9BA 1F9KA 4KI5M 5D8AB 2QDRA 5FXWA 1LOFA 5JZGB 1FXZA 1WW5A 3G7DA 1LHNA 1RMU2 1UO9A 4M3CA 4B4PA 1IQDC 2VW1A 5KR7A 1PO11 4NN0A 4FQ4A 5FZDA 4COVA 3N4MA 1R1A1 4HZFA 2LUWA 1YIFA 5FPLA 3KM5A 3H1YA 3TEYA 5DQ0A 2CWMA 4XF9A 4YVSA 4UW5A 1Y3TA 3OD0A 1WCSA 1F2NA 2Y0OA 4XZPA 3U75A 5FYSA 3PTYA 4LORA 1UMZA 3CJIB 4Q4V1 4M3CE 4DXZA 2OX0A 1LOAA 1OT5A 2FD8A 2VOKA 3K3NA 2IXKA 1XE0A 3B7MA 5BNOC 4BQ3A 2HLEA 3R05A 5F8PA 4IW3A 4EN8B 4Z1VA 4K21A 4W6XA 2DUQA 1PX4A 3OCPA 1KJLA 2YGMA 3T1MA 1YLLA 1RHI1 1X7NA 4XHBA 1VAVA 2RMU2 3D3AA 4AAPA 1MPXA 1LU2A 3WOGA 3I8TA 4UXAA 1YI9A 2WN3A 5ANNA 3ZFGA 4CEYA 1LAJA 3T3YA 1LKNA 3BI3A 1COV1 2Y6KA 2BZDA 4FPJA 3GZUC 3PU8A 4N9HA 5E6HA 2F17A 3MW2A 1F31A 1SPPB 4UAPA 5FYHA 1ZA4A 2QZ2A 4DPNA 5FLIA 1FMD1 1HX6A 1YFXA 2G9GA 1PVC3 3O1UA 4QD2A 3TOJA 2JD9A 1C57A 3KGZA 3WCRA 2ZABA 3AMHA 2YFUA 3OUHA 4YW3A 1JZ3A 2XMLA 2Q8EA 1TQ5A 4Y3OA 3UGGA 2WJSA 1I5ZA 2EIEA 1CVNA 1YNAA 2W1QA 3H50A 4ARYA 4CCLA 2H6BA 4UW3A 4X6RB 4FTEA 4UT5A 2V73A 3H1WA 4INDA 4DY3A 1R091 1UXZA 1XNBA 2VUAA 4UW6A 4ZS3A 1AYN2 3T2OA 1E5HA 4ZZ5A 1I5PA 2IWGB 2MPFA 2WA4A 2GU9A 1YFYA 3T08A 1JYVA 3DXUA 3NKGA 3KVAA 4RS5C 1G86A 5H9PA 1RUNA 3U07A 4RS5B 1O3QA 1W3VA 1QF3A 2XLGA 2JB4A 3GCWA 1PGW2 1PO13 1GZ9A 2BNOA 4FXKB 3R0RA 4ZZ8A 4NHKA 3GHMA 1B35C 4XMIA 1RUI2 3FFZA 1R1A3 1B35B 1J84A 4EN7B 1J3QA 3LEKA 2GMPA 1JOJA 3HPNA 4LK7A 5F1RA 5K0UA 2HWE2 2BV4A 2IXHA 4E8CA 5GLTA 3GZEA 4TYSA 5FXVA 4FT8A
chains in the Genus database with same CATH topology
4AFBA 4Q4V3 1JUHA 3AFGA 1C1FA 2WZPP 5FPZA 1GSLA 4C90A 5J09A 3AKTA 1XNDA 2FMDA 2GSYA 2R062 3V0BB 3K48A 2VW2A 1ENQA 5BPXA 1RHI3 2Y0IA 3ROUA 1O5UA 1HQNA 4EV0A 1UW8A 2VMHA 3OD4A 3ZXLA 4AG4A 4K1YA 4LHLA 2WIIB 1COV3 4QM9A 3D0JA 3WQ1A 4CDXA 5A33A 1TE1B 2BUKA 1FMD3 1YO8A 4A2UA 5C8CA 1LB2A 4Z92B 4K3UA 4LUKA 2DF7A 2EVXA 2P3KA 2JG9B 5J98B 3RS6A 2E7AA 4QGMA 3DL3A 2XL7A 2R1BA 3S7EA 1CPMA 2HWF1 4YFWA 4HLTA 5CFDC 5FO8B 4FTSA 5HBAA 2Q5TA 1NE4A 2P17A 3INAA 1I1EA 4IV3C 1BVVA 3RJRA 3ZIWA 1RB8G 4IV3B 4N7IA 2BNMA 1R093 2B5HA 2W68A 3ZMOA 3ZN6A 3H3UA 4E4DX 4A7KA 5BY5A 4PDWC 1RL3A 3MIHA 1EY2A 3DV8A 1JXNA 4Y1XA 1O4YA 1CN1A 1X8EA 1WD4A 1W6QB 1SLAA 1NQJA 5GKAC 2YROA 5JWPA 5DUXA 3S30A 4YW5A 4YM3A 2ARBA 4WVMA 2HWB2 4YNIA 4DFSA 1N1TA 2ZX2A 1W6NA 5GZEA 1HQLA 1U12A 1RTVA 2A7AA 4IV1C 3MPPG 3UKVA 4IV1B 1TME2 4O9GA 2ZGQA 4RQPC 4M0HA 2FBEA 4RQPB 1HQWA 1NCQB 3JB8A 4OI2A 4D3WA 3AYAA 3VHRA 1PVC2 5EWSA 1ZBE2 1ND3B 1XXNA 2BFUL 3A4UA 3VBOC 4CP0A 5KC5A 1HXS1 3UV9A 5EFUA 3VBOB 2C0ZA 3VKNA 5FREA 5E88A 2B9UA 4YGCA 4SBVA 1C8NA 4DB5A 5JOZA 1JYIA 3TN91 4QHBA 3WQ7A 1ULFA 2GMMA 4XJAA 1H4HA 4LBJA 5BNPA 4H55A 1Q8SA 5KHJA 1VB2A 1H8VA 3RMXA 3RYKA 5JPMB 1RUJ1 1CGPA 5JCTA 4JV4A 3NVCA 4GQ7A 5BNNC 1PO12 1OKQA 5H9RA 4JC1A 1OPMA 3OGJA 1F5JA 3UL2A 2QUOA 4XFGA 2IXCA 2VMIA 4G4FA 1ULGA 2Q0AA 5J7MA 4IEVA 3ZYJB 1JH5A 1NLSA 4OVEA 4OUMA 4Q4V2 3U10A 4Q0SA 5TSWA 4GH4A 3KD4A 5FMOS 2XJTA 2R49A 3V65A 1V6MA 3AXDA 1J1LA 3VHOA 5BXXA 2XHKA 1DLLA 1GZWA 1RHI2 4HKLA 5ABJA 2I07B 1VAKA 3AFKA 5LRSA 3IPVB 1WA4A 4WM8C 1COV2 3VN4A 4YM0A 4WM8B 1NLRA 4N43A 1W6PB 4HFSA 4AFMA 1DYPA 3M4FA 4XXAA 1YCIA 3CF6E 2AZ5A 1HXS3 1SLIA 4D69A 4NOTA 1HIXA 1S0GA 2D5FA 1LHOA 3RWNA 1QDOA 3H7YA 1LEDA 1I3HA 2EIGA 1KS4A 1XU1A 2K9ZA 3LAGA 3TN93 1AXKA 1R092 2PAMA 1OMIA 4JTNA 3N7KA 3C3VA 4RGAA 1CAUA 5C6CA 5DUWA 1KXGA 3NAPC 1UCXA 1XQNA 5DG1A 3KQRA 1RUJ3 3NAPB 4D7YA 5GZGA 1VP6A 4OUSA 5E89A 4COZA 4CDUC 4XIKA 1MEC2 1CAXB 4CDUB 1QOSA 2MEV1 5DUUA 3OGGA 3DPRA 2RS11 5AC91 1DF0A 3B93A 5JSRA 2DCZA 3AKQA 3KMHA 1ZZ9A 3OYWA 3GHNA 2DURA 4HKOA 4DZGA 4AHZA 1ENXA 1WW4A 4LBQB 2D93A 4XJUA 1QHDA 4MSVA 5FQ0B 1VRH1 2SLIA 4QMAA 2HWC1 3QLQA 4LBOA 2WWSA 4XTMA 1AJKA 3GBFA 5A32A 3WW3A 2FQPA 3IDBB 4Q0QA 3V0AA 2YMZA 3RPQA 4OULA 1J1TA 1D4VB 1H8TB 2R30A 2UY9A 3I59A 5DZGA 2D6LX 2LALA 4MXVA 4AF9A 2IFRA 1V9U1 3BOWA 5L7OA 4AVAA 2CAVA 2BWCA 2PHRA 3WW4A 1O3RA 5JSOA 1QNYA 3GBGA 3AX4A 4H7LA 1UKGA 2EAAA 3BCWA 4KWJA 4PQ9A 3TWIA 4TZDA 2DCKA 2GAUA 2HWF2 5AVPA 2XGXA 4FPOB 5LK5A 1OPOA 3ZFFC 3ZFFB 4CDWC 1LESA 4CDWB 1H2KA 2ENRA 4Q4X1 5FMOL 3WDVA 3ZSLA 1WLDA 3VBFC 2IC1A 2QVSB 2ZGSA 3UK9A 3VBFB 1ZZCA 2YY1A 2B42B 2NZ9A 1OLQA 2VVDA 3BU7A 1OA2A 3WR0A 3R4UA 1G9CA 3FFQA 2WT0A 2MEV3 1DBNA 3E5XA 2JD4A 3E5UA 4LHKA 4XF4A 1XE7A 2RS13 2DU0A 5AC93 5BNOA 4OHZA 3BODA 2Z69A 5A3MA 3BIWE 5F5QA 2VVEA 4FOYA 1XRUA 4HPKB 4XQWA 2ZA9A 3BTAA 3HMYA 1WD3A 3VZLA 5B2GB 1UIJA 1AXYA 1APNA 4JDMA 4K20A 1VRH3 2DTYA 1IS3A 5C9AC 4QGLA 4Z2WA 5C9AB 2WC2A 4K8FA 3TAYA 1ZM1A 3CNAA 3ASIA 1CD3G 1NQDA 1HXS2 5JLVA 1N1YA 4M00A 3MIEA 3ST7A 2EALA 2YYOA 4FQZA 1FNYA 4LO7A 4XW3A 4AI2A 4EN6B 2JG8B 4AYUA 1V9U3 2JXAA 3BALA 1NYWA 4MGYE 4R4XA 5LRRA 5KXBA 3IBMA 3UJOA 3TN92 1U5IA 2N7GA 4RS5A 2HYKA 3I7DA 3N3HA 4Y1ZA 1ND2C 4Y1YA 4OI1A 1G6NA 2VPVA 1ND2B 2VU9A 1CQ9A 2PHFA 4ZU4A 1RUJ2 4RD7A 4Q4X3 2RHPA 1TNRA 3RSJA 1B35A 4IL7A 1HLCA 3IM0A 1C8M1 4N7UA 4EWAA 3WQ0A 1LGNA 2NN8A 5AVAA 5I8TA 2ZGOA 4FP3A 3RDIA 1B09A 1VAMA 2D5HA 3HBZA 1OD5A 5F6LB 2PHDA 5I8YA 3HT2A 1UZZA 3PVEA 3EHKA 1LHWA 4YZ3A 3ZN5A 3WD5A 4IETA 4KWLA 3AMQA 1UX6A 5F9TA 4P9IA 1GV9A 1LODA 5JOXA 3EXUA 4AQSA 1CJPA 3LA2A 4KNCA 4AI3A 1W2UA 1FV2A 3NJZA 1GFF2 2ZX3A 4XDQA 4XF3A 1OQEA 2C1FA 2WNUA 4IERA 4J1XA 3ZVXA 3POWA 2BEOA 4JQRA 2F6BA 1S1AA 1WMEA 3DKWA 2RM21 1Q8QA 2G4IA 2O0OA 1VR3A 3N7MA 4GB31 4Y1UA 1QGLA 2CV6A 3OY8A 2WFF1 4GWNA 5FRAA 5CFDA 4IESA 2CL2A 2D3PA 5HXVA 1FI2A 4IV3A 1DGRN 4S2FA 4FOVA 4OLLA 4GMP1 3WW2A 3IT8A 1W6MB 1BMV1 1J3PA 1O4TA 5T5LA 2YUEA 3H9AA 1RUD2 1UL9A 1VIWB 4PDWA 3IN9A 4YFZA 3HD8B 3FLPA 3CJXA 1W6QA 3JZVA 4MZUA 4Q26A 4XPVA 4KG0A 2BVBA 3LSDA 4I02A 1DGWA 2WS91 3WDWA 3ZFEC 1C8M3 2MEV2 4Y20A 3ZFEB 2D6PA 4QQ2A 2RS12 4K1ZA 5AC92 3IDCB 3E6DA 1LEMA 2NYYA 1JHNA 2Q4SA 1OI6A 4CEWC 3JU9A 4KGQA 2WZR1 4CEWB 4BE3A 2OVUA 1SCSA 4IV1A 2HWE3 5HCAA 4MX3A 1JN2P 1VRH2 2HWB1 2W0XA 1ENSA 4RQPA 1CIWA 2HWC2 3L2HA 4W6YA 4YW4A 3O0WA 4KG8A 4WVWA 5CU1A 1CAWB 2PN5A 1V6IA 3QH7A 5JAXA 3FZ3A 1RC6A 4XFCA 4R8HA 2RM23 5I8SA 3JBG1 3PJQA 4D7SA 1V9U2 4ZU7A 1ZBE1 4RFT0 4GB33 2VNGA 2QFEA 2WFF3 1MQTC 1S0FA 1MS9A 3J8F1 1MQTB 1XYNA 2I74A 2ZGRA 2Q30A 2ZOEB 3KT4A 4L11A 3AMNA 3BPZA 5DDJ1 1JYCA 4Y22B 2A73B 2YHJA 3WG1A 3WY6A 4GMP3 2R0FA 4IEQA 5BNNA 2XBO2 2WQ4A 4NVPA 4K6BA 1ZX5A 2FZ1A 4Q4X2 2RS51 5D8AC 3GZTB 5JZGC 1EAH1 4N90A 2ETEA 4ES8A 1ZRCA 4DS0A 2XJPA 2H6CA 3M2MA 4LHNA 1Q5OA 1F5FA 1BJQA 1GNHA 1JBCA 5I0UA 2WLPA 3AZWA 3ZXJA 3PLQA 3VKLA 4PCRA 5C4WA 5T5OA 1SLCA 5JVVA 4AEDA 2QDNA 1DZRA 1IHMA 1POV1 4K9SA 4LO5B 3L9JT 1VLNA 1WW6A 2DCTA 3AP9A 2VVFA 1R081 1HDKA 3CJIC 4FOQA 4GMP0 4JGYC 4XFHA 2DYCA 4JGYB 3MZHA 1RJ7A 3B00A 4L97A 2ZAAA 1ZREA 2GC0A 1I9RA 1QDCA 4R9DA 2UYAA 1N1VA 1SBFA 1UF2C 2HWB3 4WM8A 1W6PA 4XJ9A 3PJYA 2PLV2 2B8MA 3H7JA 5BYNA 4OFGA 2GC2A 1Y43B 2XL9A 4XMAA 4XF1A 1BBT2 4WBBA 1TME3 5T55A 1HRV1 4IEZA 3LSEA 4IEUA 1LRHA 2ILMA 1MZEA 5CADA 3ALQA 4BQ1A 1ZBE3 4GKYA 4C1XA 1IZ3A 4BIFA 1SCRA 3J8F3 1S0DA 1X82A 5CFCA 4GXLA 4LNVA 5FAXA 1IS4A 5KXDA 2A3XA 3MIGA 3NAPA 1HRI1 2BTVC 2XLAA 3H8UA 1RUOA 2UYBA 1URXA 1CAXA 4CDUA 4FAGA 1DQ6A 2UWCA 1BVP1 1UU6A 2GNDA 3THTA 2W52A 2R1DA 3O0VA 1EAH3 1C8M2 3VL8A 3SLIA 2BFUS 5FBZA 3VKMA 1U5XA 4Z07A 1MEC1 5FOBB 2ZAHA 4LBQA 2GC1A 3KB5A 2UURA 5FQ0A 1CONA 2JX9A 2ZX1A 2AYHA 3ZXGA 3EQEA 4B4QA 1GNZA 4YZ4A 1GR3A 2G9FA 5KXEA 4AEMA 1R083 4X8PA 2BGCA 4TSVA 1R1ZA 1F8VA 5SV5A 3ELNA 4XBQA 3NO8A 4FPKA 4C0BA 5FPXA 4B8EA 4OHYA 4O9EA 4IEWA 4TLFA 2VMGA 4HVQA 2JE9A 3MEPA 2TUNA 3NL1A 2ERFA 4IEYA 2R16A 1S0CA 2RM22 1DFQA 1ZYBA 3J9SA 4NR1A 3SMHA 4P9JA 3W58A 1KRIA 1ZRFA 1HRV3 3MIDA 4GB32 2ZKLA 2WFF2 1MS8A 2XPJA 3QH6A 3GF6A 3ZFFA 3D0SA 3M3EA 4CDWA 1SFYA 2Z5WA 2JG9C 1GQHA 1HV0A 1POV0 1RJ8A 4I3GA 4WV8A 5CBLA 5KC6A 2GN3A 2HKXA 3KCCA 3T2TA 2EXHA 4ASLA 4BM8A 1WMFA 3VBFA 4XEZA 1UIKA 3MLLA 1DGRA 1BMV2 3NSTA 4ZKTB 1HRI3 2ZMKA 1CX4A 4YGEA 2XKOA 2X53S 3CLPA 4ISQA 4AI1A 4HL0A 4QPIB 4RR3C 1U5ZA 4JVAA 3MLKA 4RR3B 3VUOA 3VZNA 4YLZA 2WS92 3OJBA 2GNBA 4AK3A 1NOVA 2QJVA 4JGZB 1QQP1 1MEC3 2YV8A 1FV3A 1N3QA 1OFSA 4HBNA 1VB4A 3ZYGA 4Q1PA 3WDUA 5CVRA 2WZR2 4NHMA 1IPKA 4HSJA 2OZJA 5C9AA 3CL1A 4LTAA 2ZGPA 3LOBA 4FTBA 2KA3A 3MLJA 1RUC1 2ZJCA 1S2BA 3ZX7A 4IXLA 1N3PA 2DV9A 2UU8A 4XFBA 4BLIA 1GICA 4J1WA 1CESA 1W6OB 1MACA 1GANA 1V6LA 3FJSA 3ZIXA 4CDQC 1DYKA 5HCFA 4CDQB 1NCQC 3O7OA 4FP2A 3R6SA 4LE3A 4V1PA 5KBFA 4H14A 3JBG2 2XKPA 1ZRRA 4Q8KA 4I2OA 1ND3C 1KS5A 2ZX4A 1H1IA 3TNPB 4M01A 2ZCWA 3J8F2 1ND2A 4ISRA 4AVCA 5L73A 4FPFA 3A0NA 5DDJ2 4Z8BA 4XILA 2RS31 4HETA 2JEMA 2BWAA 2UY8A 3N7LA 4QT6A 2VOVA 3WG4A 4MXWA 1A8DA 4YYOA 4C91A 5J96B 4FPHA 2HWF3 3VBUC 2RS52 3URFA 3VBUB 1H2NA 1EAH2 1WMDA 2VQ0A 3WP4A 2XWJB 1PGL1 1DQ2A 3ES4A 3PNAA 4E4ZA 2JKBA 4A7YA 1YJLA 3WT3A 4AXOA 1E57A 1UZYA 2O8OA 4YARA 3WDYA 3S6PA 3VZJA 4KL1A 1PK6C 1A8MA 3J4UH 1PK6B 1QQP3 1CPNA 3AZYA 1BXHA 4L99A 4GULA 5KXCA 4XYXA 2CNAA 5AFEA 4PJYA 4C1WA 5IK7A 1R082 1DU3D 3RI8A 1WCKA 5KHIA 4DMIA 5JI7A 1C28A 2ZGMA 2DTWA 2ZACA 1QJX1 4BIOA 1RUC3 4I01A 2ARXA 4MUVA 4Y4YA 4MGZE 4YG0A 1J3RA 1TMF1 1AR71 1XE8A 4M3CB 1HRV2 2B45X 4HT1T 1KD7A 3USUA 3WZ1A 4RGGA 1RIRA 1HV1A 1SLTA 2A6VA 2GDFA 4JRAA 2D7FA 4YVSC 2P34A 3FLTA 4RL7A 3S0MA 1WW7A 1MZ6A 3FLRA 1QJU1 1EYBA 3POSA 4YVSB 2E6VA 1AVBA 1C4RA 3PVNA 5I91A 1HRI2 3U11A 2RS33 3VBSC 3VHNA 4BLJA 1FNZA 5FO7B 2ZHLA 1AR61 1UAIA 3GZAA 3VBSB