3UL2A

Galactose-specific lectin from dolichos lablab in p6522 space group
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
252
structure length
248
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 54
structure length 248
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ul2A00
3V0BB 3WNXA 4Q8LA 2P3JA 1QNYA 5F5QA 2NP0A 4M3CE 3PVNA 1G9BA 1LECA 2JECA 2D3PA 1PZ7A 2W52A 4WV8A 5H9SA 2DV9A 3OJBA 1YO8A 3IMNA 1CONA 1ULFA 1JXNA 5T52A 4LBJA 3WCSA 2YMZA 3NV4A 2ZGNA 3IKWA 1GZWA 1MR5A 2EXJA 3SISA 5GZDA 5JLVA 1GZWB 4Q1RA 4BLJA 1MS1A 2ZKNA 2ZMKA 3IN9A 4P14A 4XXPA 3ZXLA 5JMCA 1QOTA 1QKQA 3AK0A 2R49A 1OQ1A 4YW5A 2A70A 1DQ2A 4XTPA 4CTEA 1LEDA 2EF6A 3WOGA 1DQ1A 1HLCA 2BQPA 3AJYA 5GLVA 1A78A 3I8TA 1LOBA 2ZGUA 1JW6A 1SLAA 1MS3A 1IOAA 2D6KA 2VU9A 4FPCA 1UX6A 1JN2P 1V6IA 1MACA 1W6PA 2DU0A 1FNYA 4FPEA 4H55A 1W6PB 4SLIA 3V65A 5HCBA 1OKQA 4FPOB 1FV3A 3B9CA 2EIGA 5GZGA 2AH2A 4FPKA 2CYFA 3USUA 2H0BA 2A75A 2WJSA 1W0PA 2GDFA 1V6OA 2CL2A 3USUB 5GM0A 4YM0A 1F9KA 3LSEA 1I3HA 2R0HA 3N7MA 4FQ4A 3NV2A 3WDWA 2D44A 3WDXA 1LOFA 2UWAA 4GALA 1AJOA 1QNWA 2DUQA 4U2AA 3SNMA 3AP5A 3MW4A 1UPSA 3BTAA 4F83A 1LESA 4FP2A 2JD4A 3LCPA 1Z78A 1C4RA 3ZSLA 2WLQA 5DG1A 4FOWA 2VW0A 4L8QA 1UL9A 3QCWA 5EYYA 3ZXEA 1CPMA 1Y7BA 4YGDA 1LHNA 1MS4A 5F9TA 3POYA 4XBQA 2JDZA 2NZ9A 3WHTA 1UKGA 2NN8A 1QDOA 5CB7A 2E53A 2LTNA 1SLTA 1N3OA 4LBOA 4YG6A 3OYWA 4DFSA 1LGBA 4RL7A 1SLCA 5T5JA 1N1VA 4YLZA 2W39A 1UZYA 1S0JA 1WW7A 2ZMNA 1PZ8A 1WW6A 4AWDA 2ZBJA 3D4KA 5GLWA 1AXYA 4FVVA 1BQPA 1BZWA 2ERFA 1SLIA 1LODA 2AUYA 5GJ6A 1A3KA 1V6LA 1FX5A 3VKOA 4XE9A 3AXDA 5IK8A 4XILA 1WUVA 1VALA 2OVUA 2NYYA 4P9WA 2AGSA 3GALA 2TEPA 4PBPA 1GNZA 1AJKA 3L2YA 1GZ9A 1UZZA 1YYNA 4AVSA 2WQZC 4CZSA 4XIOA 3OPZA 1W6QA 3CNAA 2P2KA 2CWMA 3OBTA 1DHKB 4OZXA 3RQ0A 4Q26A 1KQRA 1LHWA 3AFKA 4M01A 2EXIA 3M2MA 4NO4A 1WW5A 3ZXJA 4FPFA 1WBFA 4LBMA 3AYCA 1GLHA 3ZSMA 3D5OA 3ZXFA 3FBYA 4M3CF 2A3WA 1LOGA 4R9AA 5T54A 5DG2A 3ASIA 1LOAA 5JVVA 4YM1A 1SLBA 4YFWA 1DIWA 2DVAA 4Y1YA 5DUVA 4YW2A 1LOCA 2D6PA 2YV8A 2NM1A 1MS5A 4KBBA 4BPZA 1KJLA 3HR9A 1SFYA 4GXLA 3T2TA 1IS5A 3D6EA 3JU9A 4YGBA 4D69A 5EYXA 1SBEA 1IS3A 2A6ZA 3Q9OA 4XJWA 4FQZA 1N47A 4PBOA 2GNBA 1H30A 2GNTA 4K1ZA 1D2SA 2PHFA 2VH9A 5JOZA 4AVVA 2OUHA 5LK5A 2YXSA 1DYKA 4ISQA 1G86A 2KM2A 3AYEA 1KDKA 2DTWA 4Z8BA 1QU0A 3PMEA 1HQLA 4FPJA 2ZABA 4XMIA 3SH4A 1LGNA 4CRQA 2D6MA 2DVDA 4U36A 1X50A 2GN3A 2YZ4A 3APBA 3A4UA 2WT0A 1JBCA 1N1YA 1N3PA 1YI7A 4XJAA 2D6LX 1MVEA 2WKKA 4YG0A 4ATEA 4AVTA 2UU8A 4YM2A 2WT2A 1S1AA 3ZPYA 3ZYPA 4JCKA 1BKZA 1GV9A 2R1BA 2VW2A 3AZXA 5IT6A 3AZVA 2ZACA 5EWSA 4BLIA 1GSLA 3INAA 4Y1VA 3WZ1A 4C1WA 2XB6C 5IUQA 5JOWA 3UJOA 1H9WA 2EAKA 3WUCA 3O0WA 2GNMA 5HCAA 3M3CA 1LCLA 1CPNA 3W59A 1DLLA 2OW4A 3AJZA 3B69A 4XJUA 1V6NA 1APNA 1GYKA 2E6VA 1S0EA 4GKYA 1YXWA 1AX2A 3RSJA 3WLUA 5KXDA 1AX1A 1UAIA 2E51A 5DZEA 4Q8KA 5KXCA 2VXRA 2ZGTA 1SBDA 1LJ7A 2D43A 2GN7A 2RHPA 2ZGQA 1IKQA 3IPVA 4P9YA 1ONAA 2R0FA 4ZXKA 3VUOA 5E8AA 1LTEA 3VKMA 1AXKA 1LHOA 3IPVB 5CAZA 3AP7A 3FUOA 4WZFA 3SITA 1HQWA 1TEIA 1S0GA 4P9XA 3OY8A 5GALA 3FLPA 3POWA 1F31A 1W6NA 5T5PA 2GNDA 3FUQA 1O4YA 4GWNA 5T55A 3OY8B 2ARBA 1IS6A 3H0OA 1W6NB 4DS0A 2ZGPA 1RITA 4DQAA 1FAYA 2JJ6A 3RRDA 1LU1A 2ZGRA 1C1FA 1QF3A 1ULCA 3WG4A 2R1DA 1JUIA 4R9DA 2A3XA 2NMOA 4Q2FA 5CBLA 1S0DA 1FYUA 1DQ5A 2DUPA 4AYUA 1C1LA 2DVBA 3HN1A 2PHUA 4WVWA 1AXZA 4YZ3A 3MW2A 3OYWB 5IK7A 1V6JA 3GNEA 1GANA 1RIRA 1QGLA 2I2SA 3NV1A 2DYCA 3WDUA 5JOXA 2E7QA 5T50A 3UK9A 1WD3A 4ATFA 5JDBA 3ILRA 1O4ZA 5KXBA 4PF5A 3O5SA 4FOYA 3C2UA 1F5FA 5DUXA 5T5OA 1LOFC 2D6OX 2E7TA 3A0NA 5DZFA 1CR7A 1NLSA 3PVEA 4YM3A 1W6MA 2ZGMA 4WVVA 2ZMLA 4YGEA 1W6MB 4XJ8A 3N36A 1CVNA 2ZAAA 3NV3A 4FP3A 1BYHA 4HL0A 4UW3A 3WCRA 3WHUA 1W6QB 5GZFA 4BM8A 4UW5A 5AVAA 4BMBA 1OFSA 4M3CA 2AENA 4LBKA 1V6MA 2LALA 3WDTA 4BMEA 5GZCA 4XYXA 3V0AA 5H9PA 4M3CB 1BJQA 2P34A 3V0AB 1FNZA 3N7JA 5T5LA 1HKDA 1MS8A 1KDMA 3VKLA 3ILFA 5IK5A 2GALA 4Y22A 2ZGKA 1CESA 1WD4A 1PZ9A 1DZQA 3AXEA 1IKPA 1AX0A 1JYCA 4Y1XA 4Y22B 1G9CA 1YRZA 3WG1A 3M1HA 5BYNA 1QOSA 1VAVA 2JE9A 1MS0A 4Y24A 3M3OA 3AZYA 4XHXA 2GMPA 2YY1A 3KM5A 2G4IA 4UW6A 1LHUA 1WCSA 3RS6A 1J1TA 2C9AA 2W08A 2A5ZA 2D3RA 2VY0A 3LSDA 4GWMA 4YW3A 1Z0HA 3AZZA 4I30A 4BOWA 5IK4A 4AGVA 3B00A 4JRAA 2V5YA 4LBQA 4Y20A 4DRVA 1ENQA 1GICA 1KJRA 1UMZA 2A6WA 4PQ9A 1S0IA 4LBQB 1IS4A 4Y20B 1WW4A 3T1MA 4YZ5A 1C57A 4ISRA 4JC1A 4Y1ZA 4YW4A 1ENRA 1S0BA 1WLWA 3A0KA 3O0VA 4TYSA 4YG3A 1CIWA 2DTYA 5JOYA 2R16A 3AP6A 2PELA 2AR6A 2WSVA 2ZHLA 3V0BA 1AF9A 4DRRA 1ZA4A 3B3QE 3ENRA 1DQ6A 3R4SA 4ASMB 1LOEA 1G9FA 4W65A 3WG2A 4GKXA 1WLCA 1SLLA 3B01A 4XDQA 3R4UA 3AZWA 3N7KA 5GZEA 2UURA 2ZZJA 3QLQA 4TZDA 3UJQA 1DQ4A 4ITCA 2WT1A 3KQRA 4XMAA 1G9AA 3M3EA 2FMDA 4DPNA 3MW3A 3O0XA 3SH5A 1LHVA 3TAYA 1SCRA 4LBNA 1MZ5A 5GLUA 3UL2A 3WVJA 3WDVA 1LGCA 2CWSA 1Q8OA 3DGTA 4YW1A 2C5DA 2P3IA 4FOVA 2VW1A 1Q56A 5GLTA 2A6XA 1ULEA 2A3YA 3DUIA 5CA6A 1KRIA 4R9BA 2GMEA 1U0AA 4K20A 1EPWA 4HANA 1GNHA 1QOOA 3AX4A 2UWBA 3FLRA 2ZHNA 3MPPG 5CNAA 1SBFA 1H9PA 1G7YA 3IM0A 3SH3A 1DYPA 3I4IA 4PCRA 1LU2A 1ZM1A 5SV8A 4Q1PA 4YZ4A 2PHTA 4K21A 3RMYA 4Y1UA 3AYDA 1FATA 1ENSA 1QDCA 4AGRA 5FREA 2EXKA 3R05A 1MZ6A 1LENA 1QMJA 3WG3A 3WV6A 1CN1A 2Q5TA 3JUUA 4C1XA 3N3HA 1HDKA 2PHRA 2XG3A 3FFZA 3N35A 3HMYA 5HCFA 1Q8PA 2D3SA 2EXHA 3TB0A 4R9CA 1JOJA 4BQ1A 2ZA9A 3PVOA 3OBRA 4XXAA 2WNEA 2SLIA 2DVFA 4AGGA 1I1EA 5L73A 2PHXA 4K1YA 4LBQD 1Q8VA 2FHRA 2V73A 4LBLA 5DUWA 1B09A 1VAMA 4M00A 3MEPA 1MS9A 4NOTA 5GLZA 1S0CA 2VUAA 1Q8SA 1SACA 2CTVA 3RMXA 3O12A 1GKBA 4XOGA 3T1LA 3ZXKA 2JKBA 3AP9A 3RG0A 4RA0A 2CNAA 5DZGA 3ZSKA 1JHNA 1N1TA 2HYKA 4IQPA 2AYHA 4XBLA 2A7AA 3WUDA 2ENRA 3BOPA 1CJPA 2ZHKA 2ZGOA 4GA9A 2YROA 3AP4A 3N7LA 2D6NA 2AREA 3ZYRA 2ZGLA 3PJQA 2PHWA 5EXOA 5H9RA 3V64A 2A6YA 2W68A 4XZPA 3BODA 1D0HA 1ULGA 2DVGA 2WSUA 1JYIA 4XTMA 2P37A 5DXDA 1DBNA 4FPHA 1V6KA 2DURA 2ARXA 1DFQA 3M3QA 4FOQA 3FLTA 1V00A 5DUUA 2Z42A 1W0OA 2P3KA 2EALA 2DWRA 2B7YA 1CQ9A 2CY6A 1VIWB 3VV1A 1DQ0A 1R1ZA 3ZVXA 1G9DA 1WLDA 4FPGA 3ILNA 2DU1A 1RINA 5FRAA 1ULDA 1YIFA 3ATGA 4UW4A 1N3QA 4XHBA 1UN1A 5H9QA 1LEMA 1LULA 2GMMA 3AYAA 1Q8QA 2UWCA 4XIKA 3U4XA 5E89A 5E88A 1GZCA 2ZGSA 1VLNA 1AVBA 1N1SA 1KITA 1GBGA 2A71A 1MVQA 3VKNA 3BIWE 2ZHMA 1W6OA 2DUOA 4Y26A 3VKFC 1G8WA 3NWKA 3W58A 1NXD1 3SLIA 4Q27A 3WDYA 2D7FA 4ZKTB 1FV2A 1W6OB 4XJZA 1URXA 4FPYA 4XBNA 3OGGA 3POSA 1XQNA 2ES3A 5KXEA 4FPLA 4YGCA 4XJ9A 2NMNA 2A6VA 2SBAA 1A8DA 1BXHA 4YZ2A 4YFZA 4YZ1A 1DGLA 1S0FA 4MYEA 1AZDA 2OUJA 2JE7A 1SCSA 1WBLA 3ZSJA
chains in the Genus database with same CATH superfamily
4LKFA 3WNXA 3V0BB 3BGAA 4P5HA 2ET7A 5IWFA 5B4XA 1XYPA 3JQXA 4GAZA 5D1IA 4AI2A 1XSRA 4M3CE 1WA4A 4L0PA 5FYCA 1VBB1 2JECA 1PZ7A 2J1TA 4Q4X1 2R041 2O8QA 3OJBA 1W28A 2ZPXA 1D4M3 1HIXA 1ULFA 1JXNA 3VZKA 4UF0B 4HLTA 1QJX3 3WF4A 3AFGA 2ZGNA 3IKWA 5IVYA 1GZWA 1MR5A 5FYTA 5GZDA 5A3LA 2MNGA 3VBHC 4AHZA 4CCNA 2FD8A 4GWIA 4Q1RA 2W1SA 4BLJA 4R8HA 3CDZB 4COWA 2EICA 3ALQA 1ZBA3 3I2DA 3VBRC 3LEIA 4YW5A 3ZKYA 1AL22 2J22A 3MV01 3OEBA 4MXWB 3WOGA 1DQ1A 2Q1ZB 3T30A 2BQPA 1YWKA 1HQNA 1S2BA 4XPVA 3K3OA 3UNPA 1W8ZA 1OUXA 2WYSA 2ZGUA 1JW6A 3NKGA 1MS3A 2D6KA 2VU9A 3NKTA 4MGQA 4FPCA 1GMMA 1RXGA 1JN2P 1V6IA 1MACA 1ASJ1 2DBNA 3GCWA 2DU0A 5F39A 4FPEA 1W6PB 1PVC2 3BPZA 3J26N 4LLOA 4M4RA 4RHV1 4SLIA 4ZONA 3V65A 4UBGA 3O1VA 1VR3A 4YYOA 5ACA1 4Q4Y1 1PX3A 4B7KA 1FV3A 4JDMA 2XVGA 2O8OA 1YQCA 2VOXA 1DDLA 2Q1FA 3DYPA 2LM3A 4JGYA 4JKKA 2ZEZA 1AR72 4X8NA 2WJSA 4BQ4A 1XJAA 2CL2A 3USUB 4BZ4A 1F9KA 1UQXA 2RR12 2B45X 2R0HA 2Z69A 1ND3A 3NV2A 3NSTA 3WDWA 3I2FA 2UWAA 2GU9A 3JXSA 5FKCA 1OF4A 1JZ8A 1QNWA 3FN9A 4LO4B 4MGKE 3SNMA 1AR93 3LKJA 1OFNA 1OC1A 2W1UA 5F3GA 2Q8EA 2C6SA 2Y6KA 4A6OA 4RR3C 1BVVA 1RUE1 1ZRRA 4KU7A 5EYYA 1UL9A 2TNFA 3SXWA 5FPXA 2XBO1 2Y8KA 3HNYM 3ES4A 2D5FA 2XL9A 1UU4A 4AFDA 3SHRA 1ZZ7A 1LHNA 4BJ0A 1PHMA 2RG4A 2EIBA 4D6SA 4AG4A 4BQWA 5A32A 2E53A 2JDKA 2LTNA 4LHSA 4QDQA 1R083 4CDXC 1CAWB 1WCKA 4UFHA 5J98B 2JDHA 2VCMA 4YLZA 1UZYA 4ZPIA 1WW7A 3S7IA 2ZBJA 4YVWA 2WS93 3ACIA 3RJRA 4LQRA 4L92A 1FX5A 3VD7A 3VKOA 4XE9A 2AEYA 2XJRA 4FFFA 5IK8A 4GB31 2OVUA 2VMCA 3AKSA 5FXXA 4XFIA 4JDOA 1X7NA 4GH4B 3LE0A 4IGPA 3I2GA 2NLRA 1FMD2 1YYNA 3WF2A 4HSLA 1UOBA 4UI9L 1SMVA 1VMFA 3O14A 3O1PA 3FL7A 2CWMA 2QDRA 4H3WA 1LHWA 2WABA 3AFKA 3CJIC 2XUMA 3H1MA 4A7ZA 2XDVA 2OIIA 3ZXJA 1RVF3 4JKMA 3VBSB 4XAAA 2GP3A 5L9BA 2ATFA 2D5HA 3ZSMA 4PI2A 5EQUA 1W99A 1Z7S1 2A3WA 2LRPA 2O14A 4JQTA 4OQ8A 2HJIA 4DXZA 3H7YA 5JVVA 1FI2A 1SLBA 2R072 2E9QA 5I91A 3A23A 1LOCA 4KBBA 1L7QA 2FMYA 2QQIA 3KHCA 1LAJA 4DXTA 2BGPA 1WMXA 1YQ2A 4GXLA 5CVRA 3T2TA 5L7OB 3J8F3 4YGBA 4IV1B 5LBCA 2QBXA 2A6ZA 5FZIA 1UY1A 3T0DA 2LUWA 1OXCA 3BCWA 3HEIA 2GNBA 1H30A 4K1ZA 4OVEA 4CP0A 4NHKA 3WSOA 4QPIB 1RHI1 2WFF3 5FWEA 5A7SA 4AVVA 1W04A 5CG9A 1D7PM 1DYKA 2XR4A 2XUEA 3MUY1 5F1RA 1KDKA 1R1A1 3Q8AA 4MVTA 4OUMA 1PNFA 5I0SA 3MI8A 4CCOA 3RPQA 5FPAA 5A7NA 1LGNA 2HWB2 4B4QA 4CRQA 2D6MA 2GN3A 3Q8BA 4XFAA 3A4UA 3U0ZA 1N1YA 1YI7A 3HAGA 4MGIE 1MVEA 4I3GA 3S0MA 1UXXX 4BQ2A 4D7SA 2BERA 3LFMA 2UU8A 4CUAA 3IMMA 3ZYPA 2J42A 5CYYA 1EV11 1BKZA 3NL1A 3V56A 1UIJA 2VW2A 5FPUA 5IT6A 1ZZ6A 1ZREA 1Q3EA 4YSFA 4P9IA 5AFEA 2ZACA 1YQ8A 3BVCA 1E5SA 3KV4A 2VQAA 3GGLA 3INAA 3K4DA 4AFBA 3WZ1A 2VO5A 4ARYA 2VBDA 2AEZA 4A45A 1W9TA 1UOJA 2XB6C 5A1FA 2WNUB 4LO7A 2W5FA 4DEVA 3MDPA 1CD3G 4RGKA 1IPSA 4CP9A 3LA3A 3ME2A 3WP5A 1UZ0A 3MF9A 2BBAA 2K46A 1BK0A 3W59A 3AKPA 1LKNA 3M4FA 2OW4A 4WZCA 5FPZA 1NOVA 5IVJA 5ABJB 3H9AA 1APNA 2XLAA 3KGLA 3Q8CA 1MEC1 1AX2A 3E97A 3LEMA 4NAMA 3ZMNA 1RUJ1 1W2AX 1QHDA 2ADDA 1RXFA 5KXCA 3NAPC 2D43A 3SMHA 4K7JA 1IKQA 4ZXKA 2R0FA 2WYFA 1JI6A 1NY72 1SHWB 2ZX1A 4QHZA 4QHOA 1OLMA 3VKMA 4R4ZA 1LHOA 3IPVB 2C4XA 3SEPA 1C8NA 4WZFA 3ZYFA 4NPRA 1DGWX 5GALA 3POWA 4JV4A 1F31A 4KGQA 5T5PA 3VZNA 4CPBD 2QQPA 2A1XA 4I0AA 4GWNA 3OY8B 1PVC3 1BK1A 3POBA 1X9PA 3N9QA 5DAPA 2Y6JA 5F32A 3D8CA 2JJ6A 3RRDA 3GYDA 1XNAA 2RMU2 1AHSA 1ULOA 4UFIA 3POEA 2KA3A 2FDIA 5CBLA 4D6QA 4B7EA 1RGSA 2LS6A 3ETPA 5G05L 4RS5C 3F95A 3MIHA 4AAXA 3I59A 4IV3B 1OI6A 3ZMOA 4A44A 1PO13 3MIEA 4Q0UA 5IK7A 3GNEA 3OGVA 3MIFA 1GANA 1RIRA 2I2SA 3WDUA 4AF9A 2XJQA 2RM23 1DGRN 3ILRA 4F7ZA 3H8OA 1W05A 4PF5A 4OCTA 1EAH3 5DUXA 5T5OA 1TZOA 1WCUA 4QQHA 5FMBA 4A42A 3A0NA 5IFTA 3PVEA 1RUI1 5A3WA 1VAKA 4QPGA 4OZOA 1U12A 1EPZA 2ZAAA 1W6QB 3D0SA 5GZFA 3WF3A 1NZCA 1PMHX 4ARXA 2BBVA 2LALA 4BMEA 4LMFA 1SPPA 4XYXA 1D4M1 1CAXB 3O7OA 1VRH1 2P34A 4PHZA 5DPNA 2FDJA 2VQ0A 1OOPB 5T5LA 3VKLA 3ILFA 1UY4A 4AI9A 2B8MA 1PZ9A 1UMIA 2YDEA 3AXEA 5A80A 3ZFFC 2HWE2 1K3IA 2CAUA 5BNOA 3LAGA 1ZBA1 5BNQA 5FAXA 2IVJA 3T0AA 4TTGA 3MF6A 1EY2A 3VBHA 4UFLA 5IVCA 3KM5A 5K0UB 3WD5A 2G4IA 4K9SA 1LHUA 4QKDA 1J3RA 1XNTA 4BCUA 3B9IA 4DIQA 3VBRA 2VXJA 5JZGB 1OSGA 2C9AA 3KQ4B 5F2SA 2JDMA 4W6YA 1HX6A 4YW3A 1Z0HA 3QH7A 2OZ6A 1IQAA 3POGA 4AGVA 3WXPA 4CCDA 4Y20A 2FCVA 4I0WB 3T4HB 3MZHA 2PA7A 4XACA 4FSJA 4N43B 4YZ5A 1WW4A 1PO22 1C57A 4ISRA 2IC1A 1NLQA 4BISA 5CKQA 5JOYA 1EYBA 3AP6A 1VJ2A 1NA1C 5APAA 5FYYA 4JGZC 2IFWA 1UCXA 2F17A 3ZFEC 2BWAA 3RYKA 1ZA4A 3ENRA 4DUWA 1DQ6A 4OUSA 2RS32 4GKXA 1HRV2 1PIV3 3TEXA 3HOBA 4P5YA 3AZWA 3T0BA 4BK4A 3PTRB 4LITA 3T09A 2ZZJA 3QLQA 4AZZA 5KHIA 5FZLA 2Y38A 4OI2A 2Q8OA 4XMAA 2X10A 2FMDA 3VBUB 3IWZA 3O0XA 4RQPC 1LHVA 1IZ3A 4AI0A 1NLRA 4LK6A 3I3QA 4LBNA 2OQ6A 5GLUA 5BNNC 2C26A 4QXCA 4C91A 3WVJA 4WM7C 3BTXA 1STMA 2HEVF 1Q8OA 3GBWA 5FZ1A 2K9ZA 2OZJA 4K8RB 1AR61 2VW1A 3AM2A 5FYMA 2OT7A 4CEYB 2A3YA 4CEWC 1VBE3 5CA6A 1KRIA 1QWRA 2UY9A 4R9BA 4CUGA 2Y64A 1QOOA 1R081 2UWBA 3FLRA 2R062 3KB5A 4XF3A 1H9PA 4CDQC 1VP6A 1R64A 1LU2A 3EYPA 2QCSB 5CZKA 2B9UA 2QQVA 4Q1PA 4YZ4A 1RUC1 2IXHA 3LEGA 5ANNA 2HWC2 3RMYA 4Y1UA 4X8PA 1FATA 1ENSA 1CZVA 1NAEA 3BB6A 2EXKA 1VBB3 3R05A 5C71A 1C5HA 5B2GB 4MLOA 4Q4X3 2R043 4WM8C 1CAUA 2HWD2 2XG3A 5HCFA 3OBZA 3UETA 2VZUA 1C8M2 4BQ1A 2KXLA 2ZX0A 3PVOA 2X8KA 1F2NA 4QKFA 2BW8A 2LW8A 4AGGA 1Y9MA 1AUYA 5L73A 2PHXA 3U78A 1GP6A 1RVF1 1Q8VA 2JG9B 2V73A 4LBLA 3FHIB 5LRRA 4M00A 1XU1A 4E2QA 1S0CA 2IWGB 1Q5OA 1Q8SA 1GZTA 1SACA 1RL3A 2J1AA 2G19A 2JDUA 3GCXA 3CJIA 1XU2A 3T1LA 4EWEA 2I45A 3RG0A 1VE0A 4Q0PA 1ASJ3 2CNAA 1JHNA 2VTXJ 2HYKA 4IQPA 1ALYA 4RHV3 3KF5A 2AYHA 1BEV2 2A7AA 2VZ3A 2VQTA 3WUDA 2ENRA 4BIFA 2ZHKA 5ACA3 5FZAA 4Q4Y3 2PLV1 3VZOA 1YJKA 4IE7A 4GA9A 1QIQA 4ZY9A 1VBC3 2P1BA 3ZYRA 5FO7B 3PJQA 1O6UA 4PLNA 4AAPA 2Z4FA 2A6YA 2W68A 4AOCA 4A4AA 2CGPA 4KMQA 4LXLA 3BTYA 4BA6A 2ORZA 3Q8FA 5DXDA 1RUG1 4O9EA 1HJFA 2DURA 2ARXA 3NMBA 1AYN3 3M3QA 1NE4A 3PHMA 1TNRA 4KWJA 4GMP3 2EALA 5FK7A 1UOGA 3FFQA 1CQ9A 5FPBA 1ACCA 5CEHA 1DQ0A 2QUOA 4LLFA 1WLDA 4IW3A 5JIAA 4HVQA 1RINA 5FRAA 5CIRA 1ULDA 3ZN4A 2GP5A 2XBO3 4UW4A 5H9QA 5D2AA 3ZIWA 2GMMA 3WNPA 1OKOA 2GC2A 4BK5A 4D0QA 5E89A 1G6NA 2YFUA 3LWCA 1YQ5A 3CLPA 2XPJA 1VLNA 5EZWA 1KITA 3IZOA 1K5MC 4BH9A 3W58A 1NXD1 3DPRB 1FV2A 1W6OB 4XJZA 4EQVA 1RMU3 4CCEA 2FDHA 2ES3A 4AVBA 5KR7A 5D8AC 4GWJA 4FPLA 4YGCA 4CVUA 3TEYA 1ODMA 4XJ9A 2NMNA 2SBAA 3FMGA 1JZ6A 1BLZA 5DAWA 3BIEA 4OHXA 1OBNA 5CG8A 5LA2A 4PIXA 4NRPA 1AZDA 4CDWB 2JE7A 5CFCB 1SCSA 1WBLA 3AP5A 4QM8A 1PNGA 2Y26A 2YU2A 3FHQA 4INDA 4Q8LA 3ZFGB 3OEAA 3VHPA 2JKXA 1H6YA 3PVNA 1G9BA 1LECA 1YHFA 1H2NA 4LE3A 4E8DA 1PMJX 2QQWA 2QTWB 3HBZA 4QU1A 4WV8A 5H9SA 2DV9A 2HEYF 5FZCA 5I0RA 5K9YA 3NAPA 4LO8A 5FY8A 4D3WA 2VNOA 5AVPA 1J1LA 2PHLA 1PVC1 1XE8A 4CE8A 3CJXA 3C3VA 2TUNA 2R6QA 2YG0A 5A3PA 5G04L 1PO23 1PK6C 1WGPA 1GZWB 2ZMKA 4J1WA 4A7YA 1AR71 2VM9A 5C8CB 1DCSA 3UKVA 4COYA 1W2OA 3AK0A 1GWLA 2R49A 1A6CA 2VE1A 3WX5A 2OA2A 5A7WA 3AJYA 5C7GA 5C3PA 2YPDA 3AMPA 2Q30A 3I8TA 1LOBA 1XC6A 4Q29A 1RHI3 2D97A 5J1XA 4B8EA 2HYXA 2WO2A 3IAPA 4RS5A 1YI9A 4H55A 4S2HA 2P5BA 3BU0A 3B7MA 2RS12 5A3OA 1R1A3 2JENA 3BALA 4XC9A 4XUTA 5FZ7A 4YARA 1OQEA 5GZGA 2RVAA 4FPKA 5C4WC 2WAAA 3BU7A 4BYYA 3ZYBA 2BEOA 3ZXGA 3LF7A 2XJVA 4JGYB 2W0XA 1POV0 1FOD2 1S4CA 3LSEA 1I3HA 4YVSC 3MO4A 3N7MA 1ZRFA 4QHBA 2D44A 4LKEA 4QX0A 3LOIA 2FZ1A 1ND3B 1UIKA 1HN0A 3SEEA 1AJOA 2DUQA 4U2AA 3AL6A 5FZ4A 2RE9A 1VRBA 1UPSA 4F83A 2ETEA 3HD8B 2JD4A 5LB6A 3ES1A 4LOSA 5JWPA 1PGL2 1C4RA 2JG8C 2BV4A 2WUHA 2BTVC 2WLQA 1W03A 2VW0A 1SG3A 3ZXEA 1HW5A 5I8TA 2PAKA 5KHHA 5FZEA 1CPMA 4K8FA 3NW4A 1QH7A 1MS4A 2GC1A 2YC0A 3POYA 4XBQA 1E5IA 1WMFA 4ES9A 1FMD1 2JDZA 1TMF2 2NZ9A 4UFKA 3WHTA 3WP3A 4CCKA 4FTBA 2NN8A 5CB7A 1RUH2 5EIYB 1VBD3 4CYDA 3U11A 2WZEA 4ZU7A 5FBZA 4YG6A 3AB0A 1Y4WA 3OYWA 1LGBA 3RI9A 4DFSA 5CFDC 1DYOA 5J36A 1RUF2 2VZVA 2CGOA 1SLCA 5T5JA 3VZMA 2W39A 4Q0SA 4BIOA 1S0JA 1F15A 1WW6A 4AWDA 4QDRA 2Y6FA 1BQPA 4N7UA 1B35B 1BZWA 1SLIA 1LODA 2ERFA 2AUYA 2Z2SB 1A3KA 1V6LA 3A7QA 4MX3A 1Y43B 3LDBA 1D4VB 3ACHA 2R071 4H7MA 1RJ7A 4TSVA 4XILA 1VALA 3ITQA 1J3QA 1BEV3 2AGSA 2TEPA 1YFUA 2B4KA 3KCXA 2RDQA 4HVRA 3L2YA 1GZ9A 1UZZA 1JZ7A 2YU1A 4E2GA 4AVSA 1DLCA 3I3DA 4NPMA 2WDBA 4CZSA 1Y3TA 3CNAA 1V70A 3OPZA 4HFSA 1H4GA 4IXLA 4QGLA 3OBTA 4OZXA 5FMOL 3SCFA 3VGIA 5A1AA 2O1QA 4ZHNA 1UO9A 4NO4A 1MQTC 3CZJA 4JGZA 1ZZBA 5KC6A 3ZFEA 1XYNA 1YNAA 4LBMA 3AYCA 5FBJA 5CKMA 4AL9A 3RZJA 5J09A 4IE0A 5HXVA 4O7XA 2B46X 3D5OA 3H3ZA 1NXMA 3FBYA 2W1QA 1M06G 4EZHA 2ORXA 3OUIA 5DG2A 4CU9A 3K77A 2Y33A 4I0BA 5DUVA 2HWB1 1DIWA 5FY4A 5FZOA 4E2SA 4AXOA 1MS5A 4BPZA 5CADA 1V9U2 3POIA 1KJLA 3HR9A 3JBG2 4RQPA 4ASKA 3KSCA 3JU9A 5E6HA 1VBE1 3AMHA 4D69A 2WO1A 3EO6A 3ACFA 3EQEA 3GF6A 1JYVA 1IS3A 3Q9OA 1GWKA 4WM7A 4HMZA 4RFRB 5FFOC 1N47A 4FBFA 1W06A 2EIEA 1RUI3 2VJXA 4KNCA 5F5IA 1D2SA 2PHFA 4KWUA 4CEWA 5JOZA 2YFZA 3RNSA 2OUHA 1OLRA 5LK5A 3OUJA 2FZ2A 1W2TA 2E31A 2VL4A 4HG6B 4CDQA 4JX0A 3WT3A 4FPJA 1HQLA 1L3JA 1VRH3 1ZZCA 2YUEA 3I97A 3OF1A 2DVDA 5C9AC 1X50A 4LA2A 2YZ4A 3APBA 1W3VA 2WT0A 1N3PA 3K3NA 3WQBA 3GZEA 3LA2A 1NE6A 2EIDA 4ORFA 4WM8A 2D93A 4ATEA 3ORJA 5IAVA 4YM2A 1NCQB 1W8HA 1UWWA 2R1BA 4NVPA 5BNOC 3AZXA 3N4MA 1YFXA 1CZSA 4XQDA 4TWTA 3ZOIA 4PLMA 1W8UA 3ZO0B 1NY71 5FMOS 3KCCA 1QJFA 5EWSA 2CSGA 4Y1VA 1IPJA 1FPN3 4C1WA 2WNVC 4QX7A 5AFBA 3EBRA 1X8MA 4BE3A 1KS4A 1O8PA 5J7MA 1H9WA 1AR82 1ZNPA 1OD5A 3O0WA 5JPMB 5HCAA 4BDVB 4CP9B 4LIUA 4OI0A 4PDWC 5FZDA 1CPNA 1VBC1 2VUDA 2RMU1 3AJZA 1I9RA 1BCXA 2P6CA 3GJBA 4CP1A 3WLUA 1S0EA 4AEMA 1YXWA 4AEJA 5FO9B 1AX1A 1GOHA 2E51A 5DZEA 3HQUA 4Q8KA 3WNMA 4D8MA 2OKXA 2YBSA 1SBDA 2RHPA 4LA3A 4YW7A 1C5IA 2QZ3A 4PQQA 5FYUA 3VUOA 1AYN1 2X5IC 4D6RA 3ZM8A 5DMYA 4GMP1 3KT1A 2JIJA 1HQWA 1S0GA 3HT2A 4C0HA 3FLPA 2WN3A 3FUQA 4IL7A 2BPA2 2ARBA 1IS6A 2QJVA 4AEDC 2BWCA 3JB8A 2ZGPA 3JD72 4E4HA 1COV2 3CIHA 4DQAA 2R7EB 3D0JA 5LRSA 2P6HA 1C1FA 4LJHA 1TVGA 3MUZ1 4LULA 5HPOA 3WG4A 2R1DA 1JUIA 4R9DA 2NMOA 1AR63 3UGFA 4N53C 5LA1A 3POJA 1DQ5A 2DUPA 3E1F1 4QGMA 3WW2A 4AYUA 3ON7A 5LCWL 2IXLA 5A6XA 3G7DA 1AXZA 5HV4A 1CJDA 1RJ8A 3J9SA 1WMDA 4DY3A 1O5LA 5I0TA 4XUNA 1RYYA 3UESA 1RMU1 1RUC3 3I59B 1X36A 5ANQA 4IDZA 1I5ZA 3P6BA 1T2XA 3OOXA 4IEQA 1WD3A 3M8LA 1K5MA 1O59A 5F6LB 1AYM2 1R092 3GZAA 1ND2B 3WP6A 5KXBA 3H8XA 3O5SA 4BB3A 1CAVA 2JDPA 4KWLA 1RUNA 2HWE1 2RV9A 3ACLA 3UV9A 2WZR2 4B29A 4MSVA 2D6OX 2E7TA 5DZFA 1CR7A 2ADEA 5D8AA 2K0GA 1W6MA 2XGXA 2ZGMA 3J4UH 4I02A 4KI5M 4URTA 3OGJA 1TMF3 4IEOA 4WVVA 3VBFC 4NHMA 3H3UA 1US3A 3DV8A 3N36A 4FP3A 4BQXA 4QPGB 4HPKA 3VL8A 3AKTA 5FOJB 1NQDA 3PLQA 4UW5A 4YRDA 5C3SA 3HPNA 2LROA 3RZKA 3WNNA 4E4DX 1V6MA 3V0AA 3OG2A 1X82A 1SPPB 3R0RA 4Q4W2 1HKDA 2IUWA 3NNLA 4Y22A 2ZGKA 1CESA 2OQ7A 1WD4A 3B02A 1PO21 1DZQA 3BYWA 3JZVA 4AEKA 4MUVA 2VVDA 5JPNB 1RB8G 4BQ3A 1F4HA 4FTEA 5BYNA 2JE9A 1VAVA 2PLV3 1MS0A 4NJ4A 4CPBA 2RJ2A 3RYRA 4XHXA 1XE7A 4NRMA 2GMPA 3MBWA 1PK6A 4OQ9A 2RS31 2B5HA 1EUUA 3VBHB 5I0UA 2W91A 1ZRDA 3VD5A 2E26A 1J1TA 3OSDA 1IG0A 3WQ0A 4GWMA 3VBRB 4I30A 3VDAA 2PYTA 4IE5A 2RDSA 5IK4A 3RZLA 1UNBA 1RUG3 2UYBA 4DRVA 2MEV2 5LWBA 1ENQA 2IVIB 1ODNA 2W46A 1OA3A 1OPMA 2W9XA 1S0IA 3MFAA 3DECA 2CGNA 4Y20B 2E7AA 3DYOA 1W8NA 4N8MA 3ROUA 1O8SA 3T1MA 3ZSEA 1W0NA 1S0BA 3O0VA 1O91A 4TYSA 2DTYA 2UYAA 3NRUA 2R16A 2ZAHA 2AR6A 2MHFA 1RUD2 2VVEA 3JBG3 2IZWA 3V0BA 5LA0A 3P5BA 4IUGA 1YIPA 3IT8A 4XFBA 3W9AA 4MADA 4CCJA 3WR0A 4BXSV 5FYBA 1LOEA 4W65A 5LW9A 4NN0A 5C4WA 1SLLA 3C7GA 1QJEA 4PIYA 2R061 3R4UA 4IERA 5FCCA 5FTTC 3URFA 1JU3A 4DZGA 4YNIA 4EN8B 4YVSA 2HWC1 2WWSA 3B5LB 3CBNA 3KQRA 4NIDA 4IE4A 1BBT2 1OLQA 4W8JA 3M3EA 3IB3A 4FO9A 5A3MA 3IDEA 4O65A 5IW0A 1UZVA 3LDKA 3Q8EA 1ZBE2 2NPIA 1LGCA 2CWSA 3GDBA 4FFHA 2QQNA 4CXYA 3DEMA 2JG8A 4I09A 2P3IA 5FUPA 4RR3B 5LA9A 3PJYA 4IEZA 4YPJA 5HV0A 1QQP2 4AVCA 5FXVA 1VBD1 2OYZA 2XQXA 4IEUA 4FAGA 1GNHA 4L97A 2ZHNA 1WCQA 3LB9A 1HRI2 1OD3A 1G7YA 3BPSA 4BWOA 1TQ5A 3I4IA 4GULA 1AL23 4EN7B 2PHTA 2X05A 1QXRA 5A7PA 4DXRA 2FCUA 1GNYA 4PIZA 2D40A 4AGRA 1VBA2 2C24A 4XFFA 5CFDA 4CDUC 2Q0AA 2Q5TA 3LFIA 3JUUA 3N9NA 4CDXB 1HDKA 2PHRA 5AC92 5BNPC 5IHRA 1XRUA 3HMYA 1BEV1 2Y0IA 2D3SA 3TB0A 1A34A 1CAUB 4P08A 1CWPA 2F6BA 3QACA 1SQ4A 1UZWA 5FWJA 1IG3A 3OBRA 5KHKA 5DQ0A 1MZFA 3JCIA 4B1MA 1AR73 4K1YA 2WRAA 4Z2AA 2RR13 1B09A 4Y4RA 4XURA 3RGBA 3RZZA 4EV0A 4NOTA 4MGTA 2PMWB 2H0VA 2XJTA 3LIHA 1ZRIA 2CTVA 3U10A 1OH3A 2ZEYA 1MQTA 3LDRA 3O12A 4XOGA 2WWUA 1E57A 3CJIB 2PAMA 1GQPA 4N9IA 4I3PA 1OH4A 4CCLA 4O61A 1K5JA 1AL0G 2VBBA 3ZR6A 1CJPA 1QJY2 1U5IA 5A6QA 2ZGOA 3JD73 5FJHA 3S5AA 4CXWA 2CAVA 5F5CA 5LBEA 1HB4A 2PHDA 3I2KA 2QVSB 4LPLA 2HWF2 4ZS3A 5EXOA 5H9RA 3RI8A 4SBVA 4QQPA 3CL1A 4XZPA 1JYXA 1ULGA 2BNNA 3OPTA 5LY2A 3O1RA 3TOJA 1JYIA 2AC1A 1W90A 2OX0A 1OLME 1DBNA 2FCTA 4FPHA 1V6KA 4D7YA 5JUVA 4MO3M 3ZN5A 1SDWA 1RUE2 4KQ7A 3FLTA 4Q4V2 3TWIA 3IIAA 2XKOA 1W0OA 1XNBA 2DWRA 2XL7A 4QX5A 2C9KA 3OGRA 1JYTA 5C5TA 3HBKA 4FPGA 1AYM3 3H8UA 3RZMA 1W39A 3WNOA 3I2JA 1UN1A 5DDJ2 1LEMA 5K7PA 5JXIA 3UT0A 3ZDVA 1QY4A 5C9AA 4K6BA 4CU7A 1OVPA 4XIKA 1FMD3 1OMIA 5LK7B 3U4XA 2P17A 5E88A 1OURA 3U07A 4NHXA 1PGW1 3DYMA 1D0GA 1AVBA 3MIBA 5I8SA 2EVXA 1GBGA 1MVQA 2B9VA 4JQRA 3CQOA 3VKNA 5HCHA 1JMUB 1FPN1 1HB1A 1G8WA 1XPWA 3NWKA 4ZKTB 4Q0QA 4LOTA 4Q27A 1HV1A 1UU5A 2WIIB 2ZEWA 3MPBA 4FPYA 4V1PA 5FZ8A 3OGGA 4CA9A 2BJSA 1XQNA 2DBIA 4KGGA 1H8TC 3H50A 2E32A 4GB32 2B42B 4QWNA 3M3IA 2W2IA 4LHNA 5FYZA 5L7OA 1H2LA 2BOJA 2WNVA 3C7FA 3NJVA 2R073 4CUBA 1NX9A 4YZ1A 3POFA 1X8EA 4MV2A 3KWVA 2OUJA 3ZX7A 5F8PA 4PDWA 1QNYA 5F5QA 5JSOA 2A73B 3CHXA 2NP0A 4YW6A 3E6DA 1TG7A 2QQOA 4IE6A 3O1TA 1T6GC 2IXIA 5FLHA 1Z7S2 4B4RA 2D3PA 4LHKA 2W52A 2JD9A 5J3UA 1UKRA 3IMNA 1LB2A 4ZZ8A 5IVVA 2E33A 5T52A 4LBJA 2VMFA 5SV5A 3NAPB 1GOFA 2RS11 2X5IA 2YMZA 1PM4A 3NV4A 5LBBA 3PL0A 2EXJA 3KZ4C 4GQ7A 2HWB3 4Y4YA 4W4ZA 2WC2A 2ZKNA 1O3QA 4P14A 3ZXLA 4DINB 5JMCA 1H8VA 3IDAA 1RUD3 4AEDA 1OQ1A 4KU8A 1DQ2A 2XHKA 1YUDA 5F3EA 2EF6A 4MH0E 1REFA 4F3JA 1NKGA 5FZFA 1HLCA 1UU6A 2W92A 5JI9A 2DFBA 5GLVA 3ZR5A 1OPOA 3IIIA 3AMQA 2VVFA 5A7WB 1HB2A 2WZ8A 5DAQA 1IOAA 2G1MA 4N53A 2N7GA 1UX6A 3AVRA 1FNYA 5FZ6A 4A41A 1BBT3 1PGL1 3TYJA 5IVEA 2I74A 3MICA 5LEKA 3PDQA 4RS5B 1QJU2 3I3EA 4HOOA 5A7QA 3O1OA 1J59A 3B9CA 1CZTA 3AVSA 2AH2A 5LASA 1ZBE3 2CYFA 3VZJA 1JHJA 1GUIA 1POQA 1ZZ9A 2VZRA 4KBZA 1W0PA 2GDFA 1TMF1 4AK3A 1EV12 2ID4A 3HNMA 1QQP3 5FMDA 1BHGA 2VOTA 4FQ4A 4L9BA 3WDXA 4DEQA 2ARCA 4B4PA 1WWYA 4GALA 1YEWA 1HRI3 4AQTA 3RVHA 3VBFA 2V09A 5FP3A 3MW4A 1ZYBA 3K4AA 5FYVA 3BTAA 5FDBA 1LESA 2NQYA 3UGHA 4DNYA 4XDPA 4IEWA 4AFMA 1NCRC 3THPA 3ZSLA 4AQ2A 2VMDA 3A21A 3TRSB 4AW7A 3KGZA 3SKVA 5E1RA 4COZA 1O4TA 1PGSA 4EE2A 4YGDA 3ZPOA 5F9TA 4OHWA 4P9JA 1HXS2 4E4ZA 1MEC2 3LIGA 2BNOA 1QDOA 2KR2A 2RMU3 4MZUA 2MPFA 1SLTA 1N3OA 3ZFFB 4H2AA 3NVCA 4IV3A 4NWWA 1EUTA 2XQRA 3J7LA 3DKQA 1N1VA 4NHLA 4XQWA 2ZMNA 3GZUC 1U5ZA 3ZXDA 3HWJA 3D4KA 3LD8A 5GLWA 1AXYA 2I07B 1UYYA 4Y33A 1VB4A 2BGOA 4RN5A 4DUVA 5C33A 3ZIXA 1FT9A 3VDDC 4RSUA 1K45A 4P9WA 3JBG1 2XVKA 3GALA 4PBPA 1GNZA 1AJKA 4MGZE 3KHBA 1POV3 4LE4A 4XIOA 4ES8A 4META 1W6QA 5A1LA 3VD9A 1OA4A 3VHRA 1ST8A 1KQRA 1XNCA 2HWF3 4M01A 4UAPA 2EXIA 3M2MA 1S2EA 4COUA 3RZHA 4FPFA 5LBFA 4BXFA 1WBFA 1NA1B 5I0DA 5KWRA 3E6CC 4JGZB 2XXZA 3N9PA 1OOPA 3ZFEB 5FPLA 4JTNA 3ZXFA 3HN3A 1WLTA 4R9AA 1LOGA 5T54A 4HK8A 2XLGA 4ONUA 4Q4V3 1LOAA 3H3LA 3QBQA 2J1UA 3VB9A 4LKSA 5FZOB 4FCAA 3PIJA 4TXWA 4XAEA 5A3UA 3D6EA 4HKWA 1UYZA 4RQPB 3ACGA 2HWE3 4QQOA 3L2HA 1J58A 5EYXA 1VMHA 1SBEA 2VZSA 3QOPA 1K12A 5DDJ3 3O1MA 4FFGA 4FQZA 4XJWA 5BNNB 4PBOA 2W87A 2VULA 2WLPA 2VPVA 1OT5A 1S55A 4WM7B 3T4VA 2GNTA 1AL21 5FOBB 2VH9A 3W5MA 4GD4A 2JICA 4X6RB 1D4M2 3PURA 5JI7A 4CEWB 4DMIA 2YXSA 2XVLA 1SZBA 4HT1T 1QJX2 3AYEA 1JU4A 4AI1A 4E27A 4ZU4A 1IQDC 4LEJA 4XVHA 2DCZA 3THCA 1QU0A 3PMEA 4A3ZA 4XMIA 3KLSA 4CDQB 3SH4A 2JXAA 3UKTA 5L36A 3AC0A 5FY5A 1AR81 4XFCA 3WQ1A 4S2DA 2WKKA 4CDUA 4YG0A 3IDCB 4WM8B 5BNPA 2WT2A 2YPJA 2RR11 1JYNA 3R4DB 4HKLA 4QKNA 4PJYA 4RGAA 2RS33 2BFUL 3AZVA 1HRV3 2VOVA 3W5NA 3VBOC 2FBEA 4BLIA 1GSLA 3NO8A 5F3CA 5M0TA 5LY1A 3GM8A 5JOWA 4CCCA 3HQXA 3NQHA 4JVAA 2OS2A 3ECQA 3WUCA 1P8JA 2GNMA 3BOWA 3JD71 3LZZA 1U5YA 3ZXAC 1COV1 1UD1A 1F8VA 3WW3A 4LKDA 3P3NA 3B69A 5FZ3A 1V6NA 1GYKA 2E6VA 2VNVA 4GKYA 1GOGA 3RSJA 3T2PA 1CX1A 4XABA 1W2UA 5FP4A 3WP4A 1AR92 2O0OA 2ZGTA 1LJ7A 5IVFA 2ZGQA 1I6XA 4P9YA 2ZX2A 2R063 5DAVA 3T3YA 5E16A 4AI3A 1AXKA 2BOIA 4GJZA 1JH5A 2CU5A 3FUOA 2H6BA 4AI8A 2Q8DA 2HWC3 4XUPA 4Z07A 1W6NA 1ENXA 2VNGA 4QKBA 1O4YA 3PUSA 5JR7B 5DN2A 1AYM1 1R091 3H0OA 5T55A 4FAHA 3KMHA 1S2KA 3OGSA 1QJU3 1RITA 4XF4A 1Y9GA 2CV6A 2HWD3 2WFPA 2ZGRA 4J1XA 1QXPA 2WZR1 2EA7A 1QF3A 2BUKA 1C8M3 2YBPA 3T2QA 4JAAA 4WVZA 2A3XA 2JX9A 3MIDA 4Q2FA 1FYUA 3KCYA 2DCKA 1C1LA 2DVBA 3K75B 5A32B 2PHUA 3CKHA 1MZEA 3VD4A 2G9ZA 4D94A 1D2QA 1KEXA 4YZ3A 2WS92 5FLJA 3MW2A 2PFWA 4OMCA 4TLFA 4CU8A 4M4PA 2BZDA 4UWDA 1QGLA 2QE3A 1JOPA 4NHYA 2BFUS 2E7QA 5JOXA 4ATFA 2VTFA 5J37A 3PIGA 4EJRA 1K5MB 3C2UA 2JDAA 2VOWA 2Y60A 4N7IA 1RC6A 2ZCWA 1KFXL 4GIQA 1UY2A 2WNOA 1LOFC 4IGOA 4FFIA 1CAVB 3PU8A 3N9OA 1WMEA 1H8TA 2WR9A 3WNKA 3HNBM 3TNPB 2TBVA 3WEZA 2W47A 2JB4A 1DF0A 1W6MB 4XJ8A 5D8AB 1CVNA 4HL0A 3WCRA 2Y34A 1HJGA 5AVAA 4HPKB 4BMBA 1OFSA 4M3CA 4LBKA 5F6KA 5JR2A 3V0AB 4XQ4A 2MEV1 4FXGB 1W8OA 4OFGA 1MS8A 4HBNA 5EP9A 4QX8A 2GALA 1KD7A 2J1RA 3PVBB 1ULPA 3AKRA 3J8F2 1IKPA 1AX0A 3L9JT 4Y22B 1G9CA 1YLLA 3WG1A 4EZ4A 3PNAA 1RUD1 3M1HA 1QOSA 3NJYA 4QB1A 3M3OA 4TN7A 3AZYA 1XNKA 2YY1A 2HKXA 2WFF2 2WN2A 4CUCA 5HXMA 2VCCA 4ASLA 2XOMA 1WCSA 1PK6B 3NJZA 3RS6A 2QQKA 1H4HA 4PT6A 4KWKA 3QH6A 1OQDA 2W08A 2D3RA 2VY0A 5DABA 4FTSA 2ILMA 3FE5A 3BUCA 4GH4C 4WVMA 1BBT1 2QZ2A 3B00A 4JRAA 2V5YA 4LBQA 4NWVA 4JZRA 1UMZA 2A6WA 4PQ9A 4MG2A 1UYPA 1IS4A 4QXBA 5A3TA 3C8XA 1TME2 4JC1A 4W6XA 4ZS2A 4YW4A 4LO5B 1ENRA 1ZBE1 2Y6HA 3A0KA 3R6SA 1V0AA 1E5HA 2WSVA 3VBSC 3ZN6A 4OHVA 2ZHLA 2W3JA 4OUEA 1AF9A 4FXKB 1QQP1 5A3NA 4DRRA 4X6QB 2YB7A 4ASMB 1G9FA 2IXJA 5EPAA 1WLCA 3B01A 3OPWA 3UYJA 3JB4C 1HRI1 3A22A 5C4WB 3N7KA 5GZEA 2PAEA 1NZIA 4J25A 3VDCA 2RJKA 2BDRA 2WL1A 3U4SA 5KBFA 3UJQA 1DQ4A 4ITCA 5FYHA 2WT1A 3SC7X 5L7OC 1VBA1 3MW3A 4YVSB 5FP7A 3TAYA 4IV1C 1MZ5A 1UXZA 1JZ5A 3UL2A 3PUAA 5AC91 2ZZQA 4QD2A 3EJKA 5C8CA 3CEWA 3MV11 4XFHA 1NCRA 2C5DA 3KV9A 1IPKA 4FOVA 4QPIC 2GC0A 2A6XA 2JG8B 1ULEA 4LORA 4XETA 3S5QA 1U0AA 1EPWA 2C1FA 3C7OA 3N9MA 4HANA 3HIFA 3AX4A 5BUVA 5BXXA 3E6BA 4A7KA 3MPPG 5CNAA 3TN92 5CU1A 3SH3A 5A6YA 1DYPA 4PCRA 1ZM1A 5SV8A 5F5AA 4UYBA 4P9GA 5JZGA 1C28A 4K21A 4UT5A 3P3PA 1QDCA 1Y9QA 2XWBB 4C8DA 4KH9A 4DXSA 4GZ9A 5L19A 1MZ6A 1SFNA 4JDNA 4W50A 2J1SA 4Y3OA 5I8YA 3WV6A 1CN1A 3PUQA 3E5XA 4C1XA 4QMAA 1GFF2 3ST7A 2VZTA 5CFDB 3N35A 3M7AA 3OD4A 3THTA 2RS13 2L9LA 1YCIA 2EXHA 5FQ0A 2RS52 5FZGA 1QJY1 5JAXA 2ZA9A 1POV1 3UKNA 4PI0A 2G9FA 4XF0A 4LUKA 4XXAA 2Q1MA 3MIGA 3VDDA 2DVFA 1I1EA 4E4SA 1W9YA 2HWF1 4YM3A 2GZWA 5BPXA 2WNUC 1SEFA 2V72A 1FOD3 1SDDB 2FHRA 2VNRA 4LBQD 5DUWA 1PO12 1F4AA 5C3RA 3MEPA 1MS9A 3MLKA 4IEYA 4XCBA 5FP8A 5GLZA 1GQHA 2GH2A 3KVAA 4RGGA 5CISA 3DL3A 2VR4A 4IEPA 2RM22 4AHXA 3I49A 4Q4V1 3RMXA 1JZ2A 3I54A 4HVOA 4XCAA 3ZXKA 4GJYA 2JKBA 1EP0A 3AP9A 5ABJC 2Y6LA 1EAH2 1MQTB 4XZUG 4AE2A 2K2SA 4OHYA 3F2ZA 3THDA 4XBLA 2AACA 2P3YA 2OPKA 5IAXA 2QFEA 4DOUA 3N7LA 5DDJ1 1BMV2 1H2KA 2AREA 4AHWA 2ZGLA 1KS5A 2PHWA 4QQLA 3U14A 5A6ZA 1I5PA 3DXTA 3J7HA 4COVA 4IESA 3BODA 1D0HA 3HT1A 2V4VA 2DVGA 2WSUA 1RUH3 2P37A 3PU3A 1GR3A 3VHNA 4G3YC 4IGQA 2EAAA 3C7HA 1B35A 1DFQA 2XHNA 1V00A 1RUF3 2XLFA 4QAWA 5A7OA 3T2OA 2P3KA 5K8SA 1L7RA 2CY6A 1YQ6A 2Q8CA 2XJPA 3TEZA 2G9GA 3VV1A 4CU6A 1R1ZA 2JDNA 1JYWA 5FZ0A 5A33A 5FV3A 3I2HA 1YIFA 2VZQA 1JZ4A 4IV3C 2QQLA 4OI4A 5FPVA 2ARAA 4HN0A 2V4AA 1Q8QA 4LT5A 1UPIA 3FJSA 2VC9A 2WO7A 1UX7A 2DCYA 2PQQA 4NROA 3RYPA 4A6SA 5C9AB 3D3AA 1HRV1 2FDKA 1NYWA 4EN9B 1UOFA 2A71A 3H1WA 4CXXA 5KC5A 1O3RA 2ZHMA 1YJLA 4Y26A 3FZ3A 1W9WA 1GP5A 5BNOB 5C70A 1DGRA 5KXEA 4UOJA 1K42A 4NR1A 4Z82A 1H1MA 3AL5A 3VBOA 2PQSA 3SQOA 2VUCA 2XMLA 4URAA 5KHGA 1RUOA 2A6VA 1A8DA 1BXHA 5FY9A 5FY1A 4YZ2A 1QH6A 3MLJA 2WNVB 1DGLA 1S0FA 1V9U3 4MYEA 3OB8A 1FXZA 1PIV2 4RYDA 4PLOA 3WDTA 3K48A 3ZSJA 5I93A 1W8TA 1OOPC 1JS9A 2P3JA 3FHAA 2JWPA 1UW8A 4PDWB 1L7LA 3VL9A 1C3HA 3I2IA 5DAXA 1W8FA 1QJZA 2GC3A 4UF0A 5F2WA 1YO8A 4V2WA 4OMDA 4JHZA 3HJRA 1CONA 2XH6A 4R4XA 3WCSA 3LPFA 3SKJE 1QJU1 1ZVFA 1ZZ8A 5K0UC 3B94A 1NG0A 5T3NA 2X5IB 4UXAA 3SISA 2HWD1 1TME3 1VBE2 5JLVA 2FDFA 1MS1A 1NCQA 3IN9A 4QX3A 1A8MA 1C8M1 4XXPA 5JZGC 5LZ6A 2YC2A 4JKLA 1QOTA 1QKQA 3ETQA 4MXWA 3ZLIA 2A70A 4XTPA 4Y5Z0 4CTEA 1LEDA 4NUBA 2HLEA 4AEDB 3PUHA 4N43C 5KHJA 1A78A 4FT8A 2R32A 3EMRA 1VBB2 1SLAA 4EN6B 4HONA 4Q4X2 2R042 2QQUA 1W6PA 1XNDA 4N53B 4OHZA 3E5QA 5FY0A 1T6BX 3RJ2X 4L99A 4HK9A 1W9FA 3GBFA 3MHZA 1VMJA 4LTAA 5HCBA 2CHHA 1OKQA 1UY3A 4FPOB 4V2VA 4DY5A 2EIGA 5BY5A 4NAOA 3NNMA 5JSRA 4Y5TA 3USUA 1AR83 2H0BA 2A75A 2OPWA 1MPXA 1HXS1 2VOKA 4BQ5A 1V6OA 5GM0A 4YM0A 1H0BA 2Y0OA 1GQGA 3VBUC 4N9HA 1LOFA 4G9SB 4K40A 3TN93 2CDOA 3VLBB 1KGYA 1ASJ2 4JHTA 4HN1A 4FP2A 3SCHA 3VBFB 5C3QA 3LCPA 1Z78A 4RHV2 4CEYC 3BKZA 2IFRA 2J1EA 3GXUA 5DG1A 4FOWA 5ACA2 4L8QA 4Q4Y2 1J84A 3QCWA 1CGPA 4NIIA 4AQSA 1KFUL 1VBC2 1Y7BA 1JUHA 2RS53 4S2GA 3PTYA 1PVXA 5IJRA 1COV3 1UKGA 1UYXA 1O3TA 4IETA 4UBHA 2OXBA 1ZX5A 2WZPP 4QDSA 3RWKX 4AHYA 4LBOA 1CAWA 1JTZX 1AYN2 2QQJA 4E8CA 1GP4A 4RL7A 4F8AA 4IEXA 1XYOA 1PZ8A 1BVP1 1HN1A 3AKQA 1ND2A 3MLLA 2GH8A 4FVVA 2HH9A 3BI3A 5GJ6A 4NIGA 3K2OA 3DF0A 4NE9A 1XOYA 3SCGA 5F37A 2XBO2 3AXDA 2H6CA 3DKWA 4GH4A 2XKPA 4QPYA 4OI1A 1WUVA 2NYYA 1YFWA 2JG9C 3KF3A 1R093 2VCAA 4HETA 4HZFA 3DCQA 3W21A 2BYVE 5JXJA 2CDPA 2WBKA 5J48A 2WQZC 1XE0A 1W2NA 4MHRA 2WZR3 1JZ3A 2V5DA 2P2KA 1DHKB 3RQ0A 2RDNA 2DCJA 4Q26A 2PTMA 3NJXA 3K51A 3VBSA 1WW5A 1IHMA 4JRLA 2VCBA 4OYUA 1GLHA 1RMU2 3MGUA 3CU7A 4M3CF 1QJX1 2C0ZA 3OUHA 4B1LA 4NMIA 3ASIA 2JE8A 2RJLA 2YGMA 4XDOA 2WQ4A 4DB5A 2HBTA 2E63A 4YM1A 4YFWA 2DVAA 4Y1YA 4YW2A 3ZYGA 2D6PA 2JEMA 2YV8A 2NM1A 3N9LA 4Q4W3 3S30A 4D7TA 3DXUA 5EFUA 1SFYA 3WNLA 5FR3A 3WF0A 2BVBA 5FO8B 4IV1A 1IS5A 1W9SA 4N90A 4KL1A 2W94A 5A70A 3AMNA 5FK8A 2VMEA 4QPIA 2GSYA 4LNVA 2VZPA 4J6GA 5HI0A 5K4LA 5FUNA 2PXJA 1F35A 5FYSA 2YGLA 4ISQA 1G86A 2KM2A 1LRHA 1CIYA 3DN7A 5FIXA 2WAOA 2DTWA 4Z8BA 2ZABA 1SFPA 2X09A 4DUXA 2MEV3 4U36A 4XJAA 1JBCA 2D6LX 1DU3D 3BN6A 4QB6A 2QKDA 4UFJA 1UY0A 4R52A 4AVTA 2KD7A 4CDUB 1S1AA 5LATA 4CSWA 3ZPYA 3DPRC 1U5XA 4JCKA 4KG0A 5BNPB 1FOD1 1GV9A 2VZOA 5C6CA 4A3XA 4QPWA 1H1IA 1AR91 1RHI2 2XWJB 2JDYA 3OTFA 3QD6A 4AVAA 4EWAA 2VAUA 5FUIA 3B93A 1HV0A 2WNUA 3TBDA 5EHDA 1R1A2 2VGDA 2W95A 4Z1VA 1GWMA 4AFCA 5IUQA 4CDWC 2VZ1A 5CFCC 1F5JA 3UJOA 3RWNA 3IBMA 2EAKA 2XJUA 3ZFGC 3UGGA 4RR3A 3WF1A 4LO6B 3M3CA 1LCLA 3C7EA 4EROA 5L9RA 2YC4A 5ABJA 5FP9A 1DLLA 5F3IA 4KG8A 2VBPA 4XJUA 4AR2A 1UAIA 4O9GA 1RUH1 2VXRA 2DDUA 4H14A 2GN7A 1NT0A 2UY8A 4H7LA 3RDIA 3GZTB 4BQYA 3IPVA 5C8WA 1ONAA 2WA3A 3CZUA 5JIUA 1ZRCA 5E8AA 3VHOA 1LTEA 2WS91 1RUF1 5CAZA 5IATA 3ZDSA 3AP7A 4B3NA 1UF2C 3SITA 2D98A 4CDXA 1OVSA 1TEIA 4QX2A 3OBAA 3OY8A 4P9XA 5C8CC 5F7UA 4QQ2A 3I2OA 1VBA3 2GNDA 2J1VA 5CKNA 1DP0A 4YWAA 1W6NB 5EJ3A 4DS0A 3H1YA 4L2NA 1KXGA 1FAYA 5AC93 1LU1A 4MXVA 3GBGA 2ZX4A 1VBD2 2Y6GA 1ULCA 4M0NA 3X29B 2AZ5A 4YVWB 1RUJ2 1S0DA 3I7DA 4XW3A 4Y5SA 3HN1A 2ZOEB 4WVWA 4LHLA 3KV5A 4HKOA 5J96B 1H1AA 3K4ZA 2J7MA 4Q5OA 2VECA 3OYWB 5GKAC 1W8WA 1V6JA 1O3SA 4ZXEA 2QDNA 1VB2A 5C3OA 1OUSA 2ZKLA 3NV1A 3S7EA 2DYCA 4M0HA 4JGYC 5T50A 3UK9A 4EYUA 5JDBA 2WQ8A 1O4ZA 1M4WA 3CO2A 3P1IA 5FJKA 4FOYA 1F5FA 3WQ7A 3J8F1 4MHUA 3OCPA 1ND3C 4E9KA 1V9U1 3O1SA 1NLSA 1QJY3 2VD7A 1DG6A 3MYXA 4IEVA 1H8TB 2FQPA 2X53S 2ZMLA 4K3UA 4MGSA 4RD7A 2VG9A 4YGEA 1TE1B 2BGCA 4LIVA 2WFF1 3NV3A 3WHUA 5KXDA 1BYHA 4UW3A 1PMIA 4OULA 4BM8A 3CMGA 4JTOA 4QGNA 1CAXA 1DZTA 1WA6X 2AENA 5GZCA 2VMIA 4HXCA 3KD4A 4M3CB 5H9PA 2YYOA 1BJQA 2ZX3A 3S6PA 2F4PA 1FNZA 3N7JA 1KDMA 1RUE3 5IK5A 3WY6A 5B4NA 3EHKA 4UFMA 5HBAA 1QEXA 5IVBA 1TME1 4Y1XA 1JYCA 3AMMA 1DGWA 1YRZA 2RDRA 5C5UA 1X33A 3VDBA 4LUMA 2DF7A 3ZYJB 4A2UA 1RUI2 3U75A 5K0UA 5JMOA 4Y24A 5FYIA 4UW6A 5FKBA 1B35C 4I01A 1NQJA 4YVWC 3IAQA 1IGOA 5JXGA 3ZYIB 4QX1A 3ELNA 3WINE 5JSPA 1VPHA 2A5ZA 3LSDA 4BOWA 4P00B 3AZZA 3EXUA 1VRH2 1YFYA 4N43A 3PMSA 4WVMB 1GICA 1KJRA 2VMGA 4OLLA 4LBQB 3E5UA 4Q0VA 3KS7A 4Y1ZA 3KT4A 1HB3A 1LNSA 4CP2A 1WLWA 4NPLA 4YG3A 1CIWA 4XFGA 5IFPA 4GB33 1ZBA2 2PELA 2GAUA 4QXHA 4AFAA 3BTZA 4HSJA 3ZN6B 3ABZA 5JCTA 3B3QE 1OHFA 2JIGA 1OF3A 3R4SA 4QXKA 3WG2A 1CX4A 1J83A 2WO3A 1PGW2 4XDQA 1OA2A 3KVBA 2B39A 3TN91 5LEJA 2DFCA 3HVDA 2UURA 4EN0A 1FPN2 2ET1A 5ISLA 4I2OA 3T08A 4TZDA 2BU9A 3VBUA 2P4EA 3FX3A 1G9AA 3JQWA 4DPNA 3OD0A 1Z7S3 2BP6A 3SH5A 2ZS6B 3USSA 1H6XA 1SCRA 5EJZB 4P9LA 3WDVA 2XONA 4QB2A 4ZU5A 3DGTA 4CCMA 4YW1A 4CEYA 2RS51 1WCDJ 4PF1A 5GLTA 1Q56A 1LR5A 5EJ1B 1NCRB 3DUIA 3J7NA 2GMEA 4K20A 3EB7A 3KV6A 4XF1A 3NNGA 1SBFA 2VQUA 1O5UA 5TSWA 2YBKA 3IM0A 4L11A 1PO11 4C90A 2VUJA 3LQCA 3D82A 3AYDA 4EWDA 2R30A 5FREA 2RM21 3TEWA 4XF9A 2IXKA 4XEZA 1GU3A 1LENA 1QMJA 5FZHA 3FWEA 1QXJA 3LPGA 3WG3A 1NCQC 3NNFA 1DZRA 1EAH1 3N3HA 4GMP0 3RFRA 3GHNA 1REEA 2WA4A 3FFZA 5EV7A 5FY7A 1Q8PA 4LR4A 3PUIA 2ZXQA 1JOJA 4R9CA 1XB9A 4ZZ5A 5FZKA 1AR62 3GHMA 5FQ0B 1UMHA 2ZTNA 4AQ6A 5IYYA 1W3XA 2F4LA 4QU2A 2WNEA 2SLIA 3H7JA 1BMV1 4MGYE 4BU2A 2ZJCA 2IXCA 2JG9A 1R082 2BNMA 4FI9A 3VDDB 3NNJA 1EV13 1REDA 2Z79A 3LA7A 1VAMA 2QNKA 4BHPA 1RUC2 1RTVA 2VUAA 5FLIA 4P02B 5FMCA 3MFCA 4W6WA 5FZMA 3IDBB 2PN5A 3U1XA 4MOAA 1GKBA 1XSQA 3FBMA 2WINB 4RFT0 4RA0A 5DZGA 3ZSKA 1N1TA 4Q4W1 1X9TA 2VMHA 4LK7A 5D21A 5FXWA 4Z2WA 5JXHA 4NIHA 1YC61 3BOPA 3H8RA 2YROA 3AP4A 3TNQA 2D6NA 3ZFFA 4DO0A 1NUKA 2X29A 5BV6A 2XJSA 3LGRA 4G4FA 1HXS3 3CF6E 3V64A 3VZLA 1MEC3 3J7MA 3I3MA 1RVF2 2HBUA 4QM9A 1RUJ3 4XUOA 2BVVA 4XTMA 1Q43A 1JODA 2FDGA 3HQRA 1XBFA 2W1WA 4FOQA 5DUUA 3FC0A 4WBBA 2Z42A 1WZXA 2Q4SA 1WKYA 2B7YA 3K46A 4TLGA 1VIWB 3ZKUA 3KT7A 3ZVXA 2DCTA 3WW4A 1G9DA 1JOBA 3ILNA 2DU1A 4C0BA 2PLV2 1O7FA 4QT6A 3VD3A 3U37A 3ATGA 5A33B 1N3QA 4XHBA 1LULA 3AYAA 1PIV1 2UWCA 1NA1A 4S2FA 5L9VA 1GZCA 3WW1A 1H2MA 5FXZA 2WWJA 4NRQA 2ZGSA 2HEWF 1ND2C 2YHJA 1N1SA 3LEKA 2BRTA 1RUG2 2Z5WA 3DPRA 3W20A 3BIWE 1W6OA 2DUOA 3VKFC 3LOBA 2JB8A 3O1UA 3SLIA 3WDYA 2D7FA 3S57A 2VTXA 1URXA 1E5RA 3POSA 4XBNA 5FZ9A 3GJAA 1XXNA 3H42B 1TNFA 1PM7A 5FZBA 3ZYHA 4QPGC 1PX4A 5ERLA 3VBOB 2QQMA 4Z92B 3RZGA 3VN4A 4YFZA 3M70A 5BNNA 3G6JB 4CDWA 4XUQA 5CFCA 4NIAA 2ZEXA 1US2A 3ZFGA 1J3PA 3I3BA 1ZA7A 4ET7A
chains in the Genus database with same CATH topology
3V0BB 3WNXA 4P5HA 2ET7A 1XYPA 3JQXA 5D1IA 4AI2A 4M3CE 1WA4A 1VBB1 2JECA 1PZ7A 4Q4X1 2R041 2O8QA 3OJBA 2ZPXA 1D4M3 1HIXA 1ULFA 1JXNA 3VZKA 4HLTA 1QJX3 3AFGA 2ZGNA 3IKWA 1GZWA 1MR5A 5GZDA 5A3LA 2MNGA 3VBHC 4AHZA 4Q1RA 4BLJA 4COWA 4R8HA 3ALQA 1ZBA3 3I2DA 3VBRC 4YW5A 1AL22 3WOGA 4MXWB 1DQ1A 2Q1ZB 2BQPA 1YWKA 1HQNA 1S2BA 4XPVA 2ZGUA 1JW6A 3NKGA 1MS3A 2D6KA 2VU9A 3NKTA 4FPCA 1V6IA 1JN2P 1MACA 1ASJ1 2DU0A 4FPEA 1W6PB 1PVC2 3BPZA 3J26N 4LLOA 4RHV1 4SLIA 3V65A 4UBGA 1VR3A 4YYOA 5ACA1 4Q4Y1 4B7KA 1FV3A 4JDMA 2XVGA 2O8OA 2VOXA 1DDLA 2LM3A 4JGYA 1AR72 4X8NA 2WJSA 2CL2A 3USUB 4BZ4A 1F9KA 2RR12 2B45X 2R0HA 2Z69A 1ND3A 3NV2A 3NSTA 3WDWA 2UWAA 2GU9A 1QNWA 4LO4B 4MGKE 3SNMA 1AR93 3LKJA 1OFNA 4RR3C 1BVVA 1RUE1 1ZRRA 4KU7A 5EYYA 1UL9A 2TNFA 3SXWA 5FPXA 2XBO1 3ES4A 2D5FA 2XL9A 1UU4A 4AFDA 3SHRA 1ZZ7A 1LHNA 1PHMA 4AG4A 5A32A 2E53A 2LTNA 1R083 4CDXC 1CAWB 1WCKA 5J98B 4YLZA 1UZYA 1WW7A 3S7IA 2ZBJA 4YVWA 2WS93 3RJRA 4L92A 1FX5A 3VKOA 4XE9A 2XJRA 5IK8A 4GB31 2OVUA 3AKSA 4XFIA 4JDOA 1X7NA 4GH4B 2NLRA 1FMD2 1YYNA 4HSLA 1SMVA 3O14A 2CWMA 2QDRA 4H3WA 1LHWA 3AFKA 3CJIC 2XUMA 3H1MA 4A7ZA 2OIIA 3ZXJA 1RVF3 3VBSB 2ATFA 2D5HA 3ZSMA 1Z7S1 2A3WA 2HJIA 4DXZA 3H7YA 5JVVA 1FI2A 1SLBA 2R072 2E9QA 5I91A 1LOCA 4KBBA 2FMYA 5CVRA 4GXLA 3T2TA 5L7OB 3J8F3 4YGBA 4IV1B 2A6ZA 2LUWA 3BCWA 2GNBA 1H30A 4K1ZA 4OVEA 4CP0A 4NHKA 4QPIB 1RHI1 2WFF3 4AVVA 5CG9A 1DYKA 5F1RA 1KDKA 1R1A1 4MVTA 4OUMA 5I0SA 1PNFA 3MI8A 3RPQA 4B4QA 1LGNA 2HWB2 4CRQA 2D6MA 2GN3A 4XFAA 3U0ZA 3A4UA 1N1YA 1YI7A 3HAGA 4MGIE 1MVEA 4I3GA 3S0MA 4D7SA 2UU8A 3ZYPA 1EV11 1BKZA 3NL1A 3V56A 1UIJA 2VW2A 5IT6A 1ZZ6A 1ZREA 1Q3EA 4YSFA 4P9IA 5AFEA 2ZACA 2VQAA 3INAA 4AFBA 3WZ1A 2XB6C 2WNUB 4LO7A 3MDPA 1CD3G 3LA3A 3ME2A 3WP5A 3MF9A 3W59A 3AKPA 1LKNA 3M4FA 2OW4A 4WZCA 5FPZA 1NOVA 5ABJB 3H9AA 1APNA 2XLAA 3KGLA 1MEC1 1AX2A 3E97A 3ZMNA 1RUJ1 1QHDA 5KXCA 3NAPC 2D43A 3SMHA 1IKQA 4ZXKA 2R0FA 1NY72 2ZX1A 3VKMA 4R4ZA 1LHOA 3IPVB 1C8NA 4WZFA 4NPRA 1DGWX 5GALA 3POWA 4JV4A 1F31A 4KGQA 5T5PA 3VZNA 2QQPA 4I0AA 4GWNA 3OY8B 1PVC3 1BK1A 3D8CA 2JJ6A 3RRDA 3GYDA 2RMU2 1AHSA 2KA3A 5CBLA 4B7EA 1RGSA 4RS5C 3MIHA 3I59A 4IV3B 1OI6A 3ZMOA 1PO13 3MIEA 4Q0UA 5IK7A 3GNEA 3MIFA 1GANA 1RIRA 2I2SA 3WDUA 4AF9A 2XJQA 2RM23 1DGRN 3ILRA 4F7ZA 4PF5A 1EAH3 5DUXA 5T5OA 4QQHA 3A0NA 3PVEA 1RUI1 1VAKA 4QPGA 1U12A 1EPZA 2ZAAA 1W6QB 3D0SA 5GZFA 1NZCA 2BBVA 2LALA 4BMEA 4XYXA 1D4M1 1CAXB 3O7OA 1VRH1 2P34A 2VQ0A 1OOPB 5T5LA 3VKLA 3ILFA 2B8MA 1PZ9A 2YDEA 3ZFFC 3AXEA 2HWE2 2CAUA 3LAGA 1ZBA1 5BNQA 5FAXA 3MF6A 1EY2A 3VBHA 3KM5A 5K0UB 3WD5A 2G4IA 4K9SA 1LHUA 4BCUA 1J3RA 3B9IA 3VBRA 5JZGB 1OSGA 2C9AA 4W6YA 1HX6A 4YW3A 1Z0HA 3QH7A 2OZ6A 1IQAA 4AGVA 3WXPA 4Y20A 4I0WB 3MZHA 2PA7A 4FSJA 4N43B 4YZ5A 1WW4A 1PO22 1C57A 4ISRA 2IC1A 5JOYA 1EYBA 3AP6A 1VJ2A 1NA1C 4JGZC 2IFWA 1UCXA 3ZFEC 2BWAA 3RYKA 1ZA4A 3ENRA 1DQ6A 4OUSA 2RS32 4GKXA 1HRV2 1PIV3 3AZWA 2ZZJA 3QLQA 5KHIA 2Q8OA 2Y38A 4OI2A 4XMAA 2FMDA 3VBUB 3IWZA 3O0XA 4RQPC 1LHVA 1IZ3A 4AI0A 1NLRA 4LBNA 5GLUA 5BNNC 4C91A 3WVJA 4WM7C 2HEVF 1Q8OA 3GBWA 2K9ZA 2OZJA 1AR61 2VW1A 3AM2A 4CEYB 2A3YA 4CEWC 1VBE3 5CA6A 1KRIA 1QWRA 2UY9A 4R9BA 1QOOA 1R081 2UWBA 3FLRA 2R062 3KB5A 4XF3A 1H9PA 4CDQC 1VP6A 1LU2A 2QCSB 2B9UA 4Q1PA 4YZ4A 1RUC1 2IXHA 2HWC2 3RMYA 4Y1UA 4X8PA 1FATA 1ENSA 3BB6A 2EXKA 1VBB3 3R05A 1C5HA 5B2GB 4MLOA 4Q4X3 2R043 4WM8C 1CAUA 2HWD2 2XG3A 5HCFA 1C8M2 4BQ1A 2KXLA 2ZX0A 3PVOA 2X8KA 1F2NA 2BW8A 4AGGA 1AUYA 5L73A 2PHXA 1RVF1 1Q8VA 2JG9B 2V73A 4LBLA 3FHIB 5LRRA 4M00A 1XU1A 4E2QA 1S0CA 2IWGB 1Q5OA 1Q8SA 1SACA 1RL3A 3CJIA 1XU2A 3T1LA 4EWEA 2I45A 3RG0A 4Q0PA 1ASJ3 2CNAA 1JHNA 2HYKA 4IQPA 1ALYA 4RHV3 2AYHA 1BEV2 2A7AA 3WUDA 4BIFA 2ENRA 2ZHKA 5ACA3 4Q4Y3 2PLV1 3VZOA 1YJKA 4GA9A 1VBC3 3ZYRA 5FO7B 3PJQA 4PLNA 2A6YA 2W68A 2CGPA 4BA6A 5DXDA 1RUG1 4O9EA 2DURA 2ARXA 1AYN3 3M3QA 1NE4A 3PHMA 1TNRA 4KWJA 4GMP3 2EALA 3FFQA 1CQ9A 1DQ0A 2QUOA 4LLFA 1WLDA 5JIAA 4HVQA 1RINA 5FRAA 5CIRA 1ULDA 3ZN4A 2XBO3 4UW4A 5H9QA 3ZIWA 2GMMA 2GC2A 5E89A 1G6NA 3LWCA 3CLPA 2XPJA 1VLNA 5EZWA 1KITA 4BH9A 1K5MC 3W58A 1NXD1 3DPRB 1FV2A 1W6OB 4XJZA 1RMU3 2ES3A 4AVBA 5D8AC 4FPLA 4YGCA 4XJ9A 2NMNA 2SBAA 3FMGA 4OHXA 5CG8A 4PIXA 1AZDA 4CDWB 2JE7A 5CFCB 1SCSA 1WBLA 3AP5A 4QM8A 1PNGA 2Y26A 4INDA 4Q8LA 3ZFGB 3VHPA 3PVNA 1G9BA 1LECA 1YHFA 1H2NA 4LE3A 3HBZA 4WV8A 5H9SA 2DV9A 2HEYF 5I0RA 5K9YA 3NAPA 4LO8A 4D3WA 2VNOA 5AVPA 1J1LA 2PHLA 1PVC1 1XE8A 3CJXA 3C3VA 2TUNA 2R6QA 1PO23 1PK6C 1WGPA 1GZWB 2ZMKA 4J1WA 4A7YA 1AR71 5C8CB 4COYA 3UKVA 3AK0A 2R49A 1A6CA 3WX5A 2OA2A 3AJYA 3AMPA 2Q30A 3I8TA 1LOBA 4Q29A 1RHI3 2D97A 4B8EA 4RS5A 1YI9A 4H55A 4S2HA 3B7MA 2RS12 1R1A3 2JENA 3BALA 4YARA 5GZGA 1OQEA 4FPKA 5C4WC 3BU7A 4BYYA 3ZXGA 2BEOA 2XJVA 4JGYB 2W0XA 1POV0 1FOD2 3LSEA 1I3HA 4YVSC 1ZRFA 3N7MA 4QHBA 2D44A 3LOIA 2FZ1A 1ND3B 1UIKA 1AJOA 2DUQA 4U2AA 2RE9A 1UPSA 4F83A 2ETEA 3HD8B 2JD4A 3ES1A 1PGL2 5JWPA 1C4RA 2JG8C 2BTVC 2WLQA 2VW0A 3ZXEA 5I8TA 1HW5A 2PAKA 5KHHA 1CPMA 4K8FA 3NW4A 1QH7A 1MS4A 2GC1A 2YC0A 3POYA 4XBQA 1WMFA 4ES9A 1FMD1 2JDZA 1TMF2 2NZ9A 3WHTA 4FTBA 3WP3A 2NN8A 5CB7A 1RUH2 1VBD3 4CYDA 3U11A 4ZU7A 5FBZA 4YG6A 3AB0A 3OYWA 4DFSA 1LGBA 3RI9A 5CFDC 5J36A 1RUF2 2CGOA 1SLCA 5T5JA 3VZMA 2W39A 4Q0SA 4BIOA 1S0JA 1WW6A 4AWDA 1BQPA 4N7UA 1B35B 1BZWA 1SLIA 1LODA 2ERFA 2AUYA 2Z2SB 1A3KA 1V6LA 4MX3A 4YVWB 1Y43B 1D4VB 2R071 4H7MA 1RJ7A 4TSVA 4XILA 1VALA 1J3QA 1BEV3 2AGSA 2TEPA 1YFUA 3KCXA 4HVRA 3L2YA 1GZ9A 1UZZA 4E2GA 4AVSA 4CZSA 1Y3TA 3CNAA 1V70A 3OPZA 4HFSA 1H4GA 4IXLA 4QGLA 3OBTA 4OZXA 5FMOL 3SCFA 3VGIA 2O1QA 4NO4A 1MQTC 4JGZA 1ZZBA 5KC6A 3ZFEA 1XYNA 1YNAA 4LBMA 3AYCA 5J09A 5HXVA 2B46X 3D5OA 3H3ZA 1NXMA 3FBYA 1M06G 5DG2A 4I0BA 5DUVA 2HWB1 1DIWA 4E2SA 4AXOA 1MS5A 4BPZA 5CADA 1V9U2 1KJLA 3HR9A 3JBG2 4RQPA 3KSCA 3JU9A 1VBE1 3AMHA 4D69A 3EO6A 3EQEA 3GF6A 1IS3A 3Q9OA 4WM7A 4HMZA 5FFOC 1N47A 4FBFA 4KNCA 1RUI3 1D2SA 2PHFA 4CEWA 5JOZA 3RNSA 2OUHA 1OLRA 5LK5A 2FZ2A 4CDQA 3WT3A 4FPJA 1HQLA 1L3JA 1VRH3 1ZZCA 2YUEA 3OF1A 2DVDA 5C9AC 1X50A 4LA2A 2YZ4A 3APBA 2WT0A 1N3PA 3LA2A 1NE6A 4ORFA 4WM8A 2D93A 4ATEA 4YM2A 1NCQB 2R1BA 4NVPA 5BNOC 3AZXA 3N4MA 1YFXA 4XQDA 4TWTA 4PLMA 3ZO0B 1NY71 5FMOS 3KCCA 5EWSA 4Y1VA 1IPJA 1FPN3 4C1WA 2WNVC 5AFBA 3EBRA 1X8MA 4BE3A 1KS4A 5J7MA 1H9WA 1AR82 1ZNPA 1OD5A 3O0WA 5JPMB 5HCAA 4OI0A 4PDWC 1CPNA 1VBC1 2RMU1 3AJZA 1I9RA 1BCXA 4CP1A 3WLUA 1S0EA 4AEMA 1YXWA 4AEJA 5FO9B 1AX1A 4Q8KA 2E51A 5DZEA 1SBDA 2RHPA 4LA3A 1C5IA 2QZ3A 3VUOA 1AYN1 2X5IC 4GMP1 3KT1A 1HQWA 1S0GA 3HT2A 4C0HA 3FLPA 3FUQA 4IL7A 2BPA2 2ARBA 1IS6A 2QJVA 4AEDC 2BWCA 3JB8A 2ZGPA 3JD72 1COV2 4DQAA 3D0JA 5LRSA 1C1FA 4LULA 3WG4A 2R1DA 1JUIA 4R9DA 2NMOA 1AR63 4N53C 1DQ5A 2DUPA 4QGMA 3WW2A 4AYUA 2IXLA 3G7DA 1AXZA 1CJDA 1RJ8A 3J9SA 1WMDA 4DY3A 1O5LA 5I0TA 1RMU1 1RUC3 3I59B 1X36A 1I5ZA 4IEQA 1WD3A 3M8LA 1K5MA 5F6LB 1AYM2 1R092 3GZAA 1ND2B 3WP6A 5KXBA 3O5SA 1CAVA 4KWLA 1RUNA 2HWE1 3ACLA 3UV9A 2WZR2 4B29A 4MSVA 2D6OX 2E7TA 5DZFA 1CR7A 4YM3A 5D8AA 2K0GA 1W6MA 2XGXA 2ZGMA 3J4UH 4I02A 4URTA 4WVVA 3OGJA 1TMF3 4IEOA 3VBFC 4NHMA 3H3UA 3DV8A 3N36A 4FP3A 4QPGB 4HPKA 3VL8A 3AKTA 5FOJB 1NQDA 3PLQA 4UW5A 4YRDA 4E4DX 1V6MA 3V0AA 1X82A 3R0RA 4Q4W2 1HKDA 4Y22A 2ZGKA 1CESA 1WD4A 3B02A 1PO21 1DZQA 4AEKA 3JZVA 5JPNB 4MUVA 2VVDA 1RB8G 4FTEA 5BYNA 2JE9A 1VAVA 2PLV3 1MS0A 3RYRA 4XHXA 1XE7A 2GMPA 1PK6A 2RS31 2B5HA 3VBHB 5I0UA 1ZRDA 1J1TA 3WQ0A 4GWMA 3VBRB 4I30A 2PYTA 5IK4A 1RUG3 2UYBA 4DRVA 2MEV2 1ENQA 4K7JA 1OA3A 1OPMA 1S0IA 3MFAA 4Y20B 2CGNA 2E7AA 3T1MA 3ZSEA 3ROUA 1S0BA 3O0VA 1O91A 4TYSA 2DTYA 2UYAA 2R16A 2ZAHA 2AR6A 2MHFA 1RUD2 2VVEA 3JBG3 2IZWA 3V0BA 4XFBA 1YIPA 3IT8A 3W9AA 3WR0A 1LOEA 4W65A 4NN0A 5C4WA 1SLLA 4PIYA 2R061 3R4UA 4IERA 5FCCA 5FTTC 3URFA 4DZGA 4YNIA 4EN8B 4YVSA 2HWC1 2WWSA 3B5LB 3KQRA 1BBT2