2JG8C

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C1q subcomponent subunit A
total genus 29
structure length 131
sequence length 131
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8C00
2OIIA 2JG9A 2TNFA 2RJLA 5TSWA 3ME2A 1WCKA 3AB0A 4EN0A 5HBAA 1PK6B 3LKJA 4F3JA 3QD6A 1KD7A 2TUNA 1OQEA 1D4VB 1DG6A 2JG8C 2WNUC 3K48A 3TWIA 1C3HA 1D2QA 5KC5A 2RE9A 3K51A 4G3YC 1PK6A 4E4SA 3QBQA 2WNVC 1O91A 3B9IA 1S55A 1D0GA 4QQOA 2ZJCA 1RJ8A 2QDNA 1A8MA 4KGGA 3URFA 4D7YA 4OUMA 2AZ5A 2RJKA 2R6QA 4KG8A 4KGQA 4OUSA 1JTZX 2Z5WA 3ALQA 4MXWB 3FC0A 4QQ2A 2HEWF 2QE3A 2R30A 1GR3A 5BNQA 2Q1MA 4MXVA 4TWTA 3MI8A 1C28A 5L36A 3L9JT 4N90A 1PK6C 4MXWA 4DOUA 1TNFA 3IT8A 1KXGA 2WNVA 4HT1T 4OULA 5KC6A 4QQHA 1DU3D 2JG9C 3WD5A 1OQDA 4RSUA 2WNVB 4TSVA 5CIRA 4NN0A 2O0OA 1U5XA 4QQPA 2R32A 5L19A 2E7AA 4GIQA 4J6GA 4E4DX 3TYJA 1ALYA 2JG8B 2WNUB 1U5ZA 1JH5A 1I9RA 1TNRA 4DB5A 2HEYF 1RJ7A 1XU2A 2JG8A 2WNUA 2JG9B 2X29A 4QQLA 3V56A 1IQAA 4G4FA 2HEVF 5KWRA 2ZPXA 1U5YA 4MSVA 1XU1A 2Q8OA 1OSGA 4QPYA 3B93A 2KA3A 3B94A
chains in the Genus database with same CATH superfamily
2X5IC 4QX1A 3RZJA 5GM0A 1QNYA 1WA6X 4QKDA 2UWAA 3B3QE 1RHI3 1YQ2A 3JBG2 4XPVA 3WDYA 1CD3G 1WCKA 5FXVA 2K2SA 4CDWB 1MS4A 5FO8B 1SG3A 1W3XA 1WCSA 4GXLA 4Y5SA 3GZEA 4Q8KA 3ZN5A 2BEOA 3VZNA 5FZCA 2UURA 1TME3 2EAAA 5DDJ3 4EJRA 3WOGA 4COVA 4K40A 4XFFA 2E6VA 4Y22B 4Q0VA 3I2HA 1CAUA 4FOVA 2JDNA 3CJIA 5K0UB 3SHRA 2WWSA 4QX0A 3SCHA 5C4WC 3WF2A 2RE9A 3K51A 5I0UA 2D6KA 1AYN3 1RUI2 1PM4A 1PK6A 3AC0A 2PHXA 3RZMA 4LQRA 4MGKE 2UYBA 1I5ZA 1S2EA 1W8NA 2J22A 3B00A 3OJBA 2WNVC 2VQ0A 5BNPA 1PMIA 4COWA 1HJFA 1JHNA 1VMFA 4CSWA 1POV1 3HN1A 3V64A 1I5PA 2JDAA 3E6DA 3ZSEA 1X9PA 1ZREA 4Q29A 3WW3A 4XDOA 1W05A 1VBE2 4XHXA 1W8ZA 4GB32 2Z5WA 1ZZ7A 4Y1VA 4U2AA 2FDJA 3DPRB 3RI9A 1XYPA 3ZXLA 1COV3 2VVEA 3FC0A 4OZXA 2YFZA 1O8SA 2VZRA 5FKCA 2VM9A 1D4M1 2WQ8A 1ENXA 5IVFA 2XVLA 2V5DA 3U14A 2GNDA 1HB2A 2DU0A 5ERLA 1WGPA 3O14A 2R7EB 5KHIA 1TNFA 1XB9A 2PELA 3DKWA 1QQP1 1W8OA 3IT8A 2VW2A 3INAA 1W8FA 4KH9A 3WW1A 2XG3A 1N3PA 4DINB 3C7EA 4M0HA 1YQCA 2NM1A 2A70A 4YW3A 2E33A 3LEGA 4JRLA 3CZUA 2WN3A 3WNPA 1UYYA 2DCYA 2R071 5B4XA 4DY5A 1DZRA 1RC6A 4WM8C 3QLQA 3GZTB 5EJ3A 3VKMA 5JZGA 2W91A 3VN4A 2D3SA 1DFQA 1YO8A 4AFBA 1YFXA 2ZGPA 4CU7A 3MIDA 2HWC3 2D5HA 1ZRRA 1ULOA 4EROA 4TSVA 3IB3A 3E97A 3CEWA 1ASJ3 2JXAA 4N53A 2XKPA 4YVWA 1DQ0A 1G9FA 2VZTA 4CUCA 3H8RA 4MHRA 4CEYC 5CG8A 3UKVA 3MIGA 2BERA 4XABA 4AF9A 2W2IA 1LGBA 2IXHA 3KCCA 5FY4A 4YVWB 4NPRA 1I9RA 3NAPA 2WYFA 1DGRN 5EJ1B 3E6BA 2VMHA 1UU5A 4IEXA 5LBCA 4YZ3A 2CAUA 2R061 3VDDB 5C7GA 1GZ9A 5FZ4A 4FPKA 2BFUL 4NIIA 1JW6A 1TZOA 2XJTA 3AL6A 4IUGA 4C0HA 5KXDA 5FXZA 2FDFA 3ZKYA 2JDKA 3MF6A 3HBZA 5FY8A 4JGYC 2ERFA 1R082 2W1WA 3KD4A 3ZSLA 4K21A 2QBXA 4M3CE 5JZGC 1VBD2 1IPKA 1ZZ6A 2EA7A 4W65A 4KBZA 1DZQA 2HLEA 4UBHA 4YW4A 1UN1A 2DVGA 4DO0A 2VUCA 5F32A 3JBG3 5JI9A 1A78A 5FZAA 2D97A 5IUQA 4YSFA 2VZ1A 4I3PA 1OA4A 5FPVA 3K4AA 4NWVA 2VZ3A 2WO7A 1CX1A 2KR2A 2IVJA 4QDRA 3OEBA 1UF2C 1VBD1 2EVXA 1W6NA 4IEWA 3AKQA 2BDRA 2DBNA 4W50A 2EXHA 3LCPA 1KDKA 3EO6A 3RVHA 2ZTNA 1YHFA 5L73A 4CDXB 4CDQB 1LOFC 2ES3A 2DTWA 1HLCA 1QDCA 1YRZA 1AX2A 5A33A 2VOXA 3PVNA 1G6NA 4B3NA 2VE1A 3WUDA 2E53A 2FMYA 1LOAA 1D0GA 2GDFA 4QXBA 3AP4A 1IS6A 4CUGA 5M0TA 3RYPA 4I0AA 3AKSA 4OHVA 2VW1A 5FQ0A 2CHHA 4GH4B 5FV3A 4CP0A 3GHMA 1NY71 3FBMA 3PVBB 3IDCB 4BIOA 3U11A 1BJQA 1H2MA 4IE4A 2GAUA 3JB4C 3AMNA 2JD9A 4N8MA 1JZ4A 1JU3A 2X05A 2P3IA 5F5AA 3AJZA 4OLLA 5CKQA 3SNMA 1UXZA 1WMDA 1LESA 5FZLA 4BPZA 4XDPA 3N9NA 2J1AA 4LO6B 4RQPA 4DUWA 2MPFA 5IVBA 1ENQA 2CV6A 3VHOA 2R072 3CKHA 3OCPA 4A3ZA 3FBYA 4W8JA 4BH9A 4AEKA 1JHJA 4BLIA 3UNPA 4Y3OA 1RUF1 3BPSA 4OQ8A 1IOAA 1JU4A 4XCBA 3MIEA 3CU7A 5A7OA 1QXRA 3K3NA 4IEZA 3K46A 1J58A 1UPIA 2RR12 4AXOA 4NR1A 3KS7A 4KG0A 1POV0 5A7WA 1PGL2 2W1QA 1MQTC 5F6KA 4MGIE 3O7OA 4BQ3A 5I0DA 4AYUA 4XEZA 3R6SA 3FE5A 2B39A 1HRI1 1UKRA 2D6MA 1MEC1 1QXJA 2VQUA 2DVFA 1WBLA 1XNAA 3VBFA 3THPA 4LXLA 3ZFGC 3ZSMA 3EQEA 3HD8B 2XPJA 1PX4A 4LKDA 5CNAA 4J6GA 1AXKA 2VY0A 4YM0A 1RUH3 4BMEA 4CXWA 2VW0A 4P5YA 2YC0A 3PJQA 4LLFA 2V72A 5FBJA 4CCJA 5A7PA 5C8CC 5GZDA 5A6XA 1PGSA 2JDUA 3UK9A 3I3DA 4LA2A 5FYIA 1GZWA 1QOSA 3I2GA 4G4FA 5FYZA 2O14A 4JGZC 4CCCA 1G9BA 4QXCA 4EN9B 2R49A 5B2GB 4YM3A 2RM22 4MSVA 1L7LA 5GLTA 3POYA 4AAPA 4CYDA 2UU8A 3HWJA 5A1LA 3WQ0A 2DURA 4I30A 4YZ5A 1AJOA 3OOXA 3PTYA 5FPUA 2PAEA 4CDUB 3AZXA 4XQWA 2WA4A 2IXCA 5H9RA 1ONAA 3N9OA 2BGPA 2TNFA 4WVMA 2C6SA 4AHXA 1BHGA 4CDQA 4CU6A 3TEXA 2IXIA 3AB0A 3WNMA 1AR72 2EICA 4LK7A 3O1RA 1MQTB 2JD4A 3Q8CA 5FZKA 4PF1A 1T6GC 4K7JA 2JE7A 2WWJA 4MGSA 3GYDA 2VUDA 3ZKUA 1O59A 3H7JA 1FOD1 3VBOA 4D0QA 5DUUA 1O3TA 2WT2A 4EN7B 1EV11 2FDIA 2WSVA 1GOHA 4C8DA 2IXKA 4S2FA 4PLNA 1HRV3 4XHBA 5FPLA 3K48A 4Q8LA 3VBOB 4N7IA 3BYWA 1ENSA 4FP2A 3MFAA 1QJX3 5FPXA 4P08A 3POSA 1W8HA 4R52A 2YHJA 3D4KA 2NZ9A 1HN1A 5FZGA 4Q0UA 1LHVA 4FPEA 2RS53 1UX7A 3RRDA 1CPNA 3KQ4B 5GZEA 5IWFA 3IKWA 2HWD3 3ZXEA 5A33B 1UQXA 1ZA7A 2JE8A 4PI2A 3N36A 2C1FA 3BODA 3VHRA 1HV0A 2DUOA 2QQJA 4QX2A 3ZSJA 4X8NA 4GMP0 3I2IA 4OUEA 2BUKA 4Q4X2 3HAGA 3UKNA 4A6OA 3ALQA 5J3UA 2HEWF 4EYUA 2QVSB 3U10A 3KF3A 1HQWA 3NNFA 2Q1MA 2LTNA 1HN0A 3T1LA 5C3RA 4UFJA 1ASJ1 4BQXA 4RR3B 3GJAA 1SLLA 4NMIA 4IEOA 2RDQA 1GQHA 4GA9A 4OHWA 5DG1A 5DAVA 3ROUA 5A6ZA 2WIIB 2V09A 2ZGKA 4Q0PA 1X33A 1GP6A 1O5UA 5JIAA 4CA9A 3J7LA 4I0BA 3SLIA 1C4RA 1G86A 1W2OA 2CAVA 1AL22 1H0BA 3WSOA 3OY8B 5GZCA 1SFNA 2H0BA 4Q27A 3I7DA 1U5IA 5HPOA 2J1SA 2W52A 3I97A 3VBUC 1UOBA 3OGSA 4QDSA 1N47A 3IMNA 4CCKA 1QQP3 5DAPA 2VZSA 3OB8A 4CPBA 1ULCA 5A32B 4DXZA 5IATA 2NPIA 1F31A 2RS12 2YMZA 3ZYJB 1JI6A 1DYOA 4DMIA 3KT4A 5FR3A 3RYKA 1CZVA 3ON7A 2F4LA 1ZBE3 2OQ7A 3BTYA 2P6HA 2NYYA 3OD0A 3KV4A 5FYUA 3RGBA 3WEZA 4ASLA 5IFTA 4Q4W1 3AYCA 1K45A 3WG2A 1P8JA 3HNMA 5FZOB 2VVFA 3M2MA 3AFKA 5F6LB 1W9FA 1XSQA 1CJDA 3FLRA 2VUJA 1E5IA 1HRI2 4ZS3A 5L7OB 1JXNA 4HKLA 5FO7B 4UW6A 5GLZA 1XE7A 2GU9A 2VQTA 1VBE1 2IFRA 1AR83 1NG0A 2Z2SB 1J84A 5KBFA 3WP3A 3AP9A 3R4SA 4UBGA 1W6OB 4IGPA 5D21A 1V6JA 4PCRA 4YLZA 5T5OA 1POQA 2HWC1 2VGDA 2XJSA 2GN7A 2WZEA 2WNEA 3DYPA 1FT9A 2VTXA 3Q8FA 5KHKA 3LQCA 3ZFFA 2JG9A 2JKBA 2RS11 2W95A 3BALA 1J3RA 4XF9A 2RJLA 3NJXA 3CJIB 5G04L 5K9YA 1UIJA 2XQRA 1SEFA 4EQVA 2WYSA 2C26A 4CE8A 4B1LA 1WW5A 2B9UA 3QD6A 4AVCA 2WS91 2GNMA 4RQPC 2XVGA 1YIPA 4LTAA 4Z1VA 2ARXA 3T3YA 2XONA 1VB4A 3P5BA 2BVVA 2VOWA 1C8M1 1BVVA 4TN7A 1XRUA 4HOOA 3LSEA 4ZXEA 1MR5A 5FY5A 5C5UA 1RINA 4Q26A 1ND3A 5CZKA 1DLLA 1W0NA 5FYMA 5JOZA 4RA0A 3ST7A 1C3HA 2A6WA 2ZGMA 1JMUB 1NCQB 1IS4A 4KWUA 4Q1RA 5FMBA 1DGRA 3DPRA 3MIBA 2BWAA 1QNWA 4M4PA 4CDWC 1UOFA 5K8SA 4FPJA 2OVUA 5GZGA 3B01A 4QQOA 2BGCA 1C8NA 1LGNA 4LO4B 4Q4X1 3LA3A 3VZLA 5JSRA 1WLDA 1RIRA 3AYAA 5JSOA 3H8XA 1ZBA3 4FAHA 1GBGA 4RR3A 4GKYA 2HWD2 1WCUA 1TE1B 4IEYA 3HNBM 5CFDA 5BNNB 1OH3A 2VUAA 5I0SA 5HCFA 4UFHA 5E16A 2HBUA 3TNQA 4PLOA 2XWJB 3CJIC 1HRI3 2CWMA 4AGVA 4MXVA 3ZYIB 2XJRA 5L36A 3THCA 5L9BA 4K3UA 3RJRA 4RS5C 5FK8A 5LW9A 1EV12 4O65A 3VBRC 2EIGA 3QACA 1IKPA 3H3UA 5F3GA 2X5IB 1FMD3 3A0KA 4L97A 3MDPA 2IZWA 4PIYA 2BBVA 1J1LA 3DPRC 1XNBA 1KFXL 2EALA 1TG7A 3J8F1 2NP0A 4LA3A 1UY2A 2FDGA 1CPMA 3ZLIA 4N43B 2DYCA 4DY3A 3VL8A 3W5MA 1G8WA 5T5LA 1XQNA 4DEQA 1F35A 1PMHX 5FYTA 1W9YA 2Y6JA 2WN2A 1SHWB 1NKGA 4P9WA 4RGAA 4GMP1 4OI2A 3E5XA 4ASKA 2G4IA 1H9PA 4XFBA 1VALA 5JWPA 3C7FA 5K0UC 3MIFA 2RM21 4Z2WA 4XMAA 4ZKTB 5JSPA 3ETPA 1U0AA 3ZVXA 2R0HA 3C8XA 3CBNA 1REFA 2JG8A 4LK6A 5JOYA 2JG9B 4XILA 2BBAA 3K4ZA 1RYYA 3LEMA 1R1A3 4YW7A 4BMBA 4EWAA 2VPVA 5F1RA 3T0BA 1IPJA 2RM23 2VJXA 2J42A 3IBMA 1VBB1 1U5YA 1W0OA 4XF1A 1RUG2 1F15A 5FTTC 3IN9A 2SLIA 2VG9A 3ELNA 2ID4A 1XU1A 2BRTA 4Y4RA 3VBRB 4NOTA 4YVWC 1X50A 1GP4A 4E2GA 4MZUA 1QKQA 1US3A 1Y7BA 4P9YA 1UYPA 3AVRA 2P3YA 3N9LA 4D7TA 3O1PA 3AZYA 3NKGA 5DDJ1 3ZN6A 2OX0A 4RD7A 3ACGA 4LBOA 1GV9A 1NCQA 3C2UA 1JYWA 5LRSA 3MIHA 2RV9A 2RR13 3M3QA 1HB4A 5A3OA 5LA0A 2C0ZA 3LSDA 1CAUB 1PO11 1RVF1 2BNNA 3WG3A 3V0AA 2Y0OA 3O1TA 5DDJ2 3GCWA 3O1SA 1NA1A 4GB31 1UU4A 2R16A 3OYWA 4HZFA 4WM8B 3EBRA 4EN8B 1XE8A 3ILNA 5FDBA 2JG8C 4K20A 4QU1A 2B45X 2ZEYA 4E2QA 4PF5A 5CFCA 5CKMA 1RUG1 3CF6E 4E4SA 3WY6A 1JOPA 3OGGA 2OS2A 4AGRA 2D3RA 3F2ZA 5H9PA 3ACLA 2ZMKA 1NCRB 2CDOA 2WINB 5A70A 4O7XA 4NHKA 4JQTA 1SQ4A 4INDA 4AFCA 3W5NA 1PIV2 4CEYB 2Y64A 1N1YA 2E31A 3JQWA 2OZ6A 2YC2A 1NT0A 2WQZC 3N9PA 1GZTA 4PBOA 2YU2A 4NRMA 4UXAA 4ASMB 5AVPA 3PMSA 4CDXC 3FZ3A 4LORA 4PDWC 5FZMA 4OHZA 3W20A 3WDTA 2VTXJ 1H8TB 5C9AC 1AR91 3S6PA 2CSGA 3S5QA 5LZ6A 1Z7S3 2VU9A 4HK9A 1NOVA 1B35C 2A3WA 4MXWB 5FAXA 3A0NA 4MX3A 5IK5A 2ADEA 3OUJA 3I8TA 5A7WB 3VD4A 4JKMA 4JGYB 3NVCA 1SLAA 1ST8A 2CGOA 5F2WA 1W9SA 2BV4A 5FMCA 5G05L 4D69A 3U4SA 1Q3EA 4FOQA 4AI9A 4P9GA 1KXGA 3LDKA 4GWJA 3KB5A 3NL1A 4QGNA 2N7GA 3HJRA 5DZEA 2WSUA 3I3BA 4SLIA 2ZZJA 2HWB3 2KM2A 4QQHA 2W94A 5FMOL 5J36A 3LB9A 5T54A 1GNYA 2RMU1 3POEA 3AXDA 4BISA 4FTSA 1VRH2 1AXYA 3H1YA 1JZ8A 5A3UA 3OTFA 1MVQA 3PVEA 3KV5A 3JUUA 4J25A 3V0BB 1VMHA 3QOPA 1UZZA 3CDZB 4ARXA 2X5IA 2D6NA 2GMMA 2YU1A 2E32A 1HQNA 4FPGA 5LWBA 2PN5A 1S4CA 1K12A 3P3NA 2XBO1 5FY7A 1T2XA 2RHPA 3ZM8A 1W28A 3O1VA 2D7FA 4QB1A 1HXS3 1LOGA 2HWD1 3VD9A 4DPNA 2ZABA 1OBNA 5GZFA 2D6PA 5J98B 1RJ7A 2QUOA 3RFRA 1XU2A 4OYUA 4B4PA 1IHMA 4FPLA 1G9DA 1BMV2 2E51A 5FZ8A 2YBSA 4ZZ8A 1ZA4A 2R062 3H3ZA 4JCKA 1MS8A 5DUVA 4EWDA 1ND2A 5EYXA 2ATFA 2H6BA 5HCBA 3FHQA 1H4GA 1V00A 2DCTA 2XJQA 4N7UA 4KQ7A 2ARBA 3DUIA 2P37A 5BYNA 2UYAA 3I3EA 2ZACA 5T52A 1GWKA 5KHJA 1V6IA 2ET1A 1O6UA 2HH9A 5IVJA 1C1FA 1GLHA 3NNJA 4BCUA 2GNBA 5HBAA 5LCWL 5J7MA 4BQYA 3WQ1A 3TN93 5CISA 3J26N 2K46A 4Y1ZA 5E89A 1NCRA 2PLV1 2XXZA 3KZ4C 4LNVA 2RS32 2X53S 4MHUA 5IT6A 3M7AA 3H50A 4CUAA 1GNHA 1W6QB 1CONA 1YCIA 2UWBA 3RWNA 2ZHMA 1QQP2 4IERA 3VBSA 4IQPA 4HN0A 1DGLA 1SDWA 4ES8A 1XYNA 1LENA 2VMGA 1D2QA 3O1UA 4CCMA 3JD73 2PTMA 4UF0A 4Y33A 5J1XA 1DQ6A 2HWF1 3J4UH 4W6WA 1NLSA 1NZIA 3B9IA 4P9IA 4NAMA 1O8PA 1S0IA 4IGOA 4OQ9A 3V0AB 4W6YA 5J37A 3MBWA 3O5SA 5FZ9A 4FPOB 2ZZQA 1GUIA 1OI6A 4J1WA 1OD5A 4YG3A 4KNCA 2OW4A 3DF0A 2GC1A 4UFKA 1S0BA 1AR82 1SCSA 2D98A 3CNAA 3KM5A 5IW0A 4LHKA 3VBUA 2EXIA 5C8CB 4XZUG 3VBOC 2XR4A 1JYCA 1FPN3 4ZU5A 4OI4A 2VH9A 1WD4A 1J3QA 3JB8A 4Y1YA 3A7QA 3BU7A 4GAZA 3ZPOA 3IPVA 4V2WA 1UYXA 1SFYA 2B7YA 1QWRA 2Y38A 4JDNA 2ZBJA 4XBLA 5CB7A 5E8AA 4BK4A 1AR61 4FFFA 1K3IA 3D82A 1JBCA 2WNVA 4FOYA 1Y9GA 4YZ4A 4CP9A 1ZZ9A 3DGTA 4FPFA 1HX6A 3TOJA 4UFLA 4LLOA 1PO13 1EAH2 1CGPA 3T0DA 2ZA9A 3WXPA 1H2NA 3FUQA 1DU3D 4H14A 5ISLA 1YC61 3MO4A 3WUCA 1SBFA 3AMMA 4MGYE 3CL1A 3HMYA 1OURA 1UNBA 3TEWA 1LNSA 2BYVE 5DQ0A 3T2TA 2O0OA 1OKQA 4DXTA 5FREA 2JECA 4SBVA 2ET7A 3LZZA 4IE5A 4HVQA 3QH6A 1W90A 3I3QA 1SLBA 1Q8SA 2TEPA 1VBB3 2W0XA 1VRH3 1W0PA 2WNUB 4QPIC 3WVJA 2ZAHA 3ZXJA 1JZ5A 3SISA 2R043 3WW4A 4L8QA 3OGJA 2E7QA 3SKVA 3T1MA 1H1AA 3SMHA 2WNUA 5FY9A 1GSLA 2Q5TA 4FBFA 3K4DA 4XC9A 4OZOA 4ZHNA 4HVOA 5JMCA 3POJA 4Q0SA 3WCRA 3BI3A 2FD8A 1F5JA 2MEV2 3LIHA 2WZ8A 2BW8A 4HK8A 1W6PB 3OGVA 4E4ZA 1LOFA 2AYHA 3GDBA 4Y5TA 4YRDA 3CHXA 1W2TA 1AR73 4KL1A 5L9RA 1QJX1 2E26A 3IAPA 1KJLA 4HKWA 1OSGA 3ZYGA 4OMDA 1YXWA 3NV2A 3LA7A 1H4HA 4PQ9A 4B29A 3C7HA 2G19A 3JZVA 2QQMA 1CR7A 2JIJA 3ZXAC 4PDWA 3ME2A 5LK5A 3MUZ1 3RYRA 4HFSA 4EN0A 1FOD3 1LHWA 1V0AA 2E63A 5A3MA 5AFBA 1Q5OA 2XL7A 3J8F3 4JHTA 3MV11 4LITA 4UF0B 2BGOA 2HWE3 5FP3A 4A6SA 5ACA2 1HQLA 2HWB1 1OKOA 5C3PA 3WCSA 1W8UA 5FUIA 1BVP1 5FP9A 2DF7A 5J48A 1IZ3A 2ZAAA 4V1PA 4FOWA 4NPLA 4JV4A 4LHSA 1D4VB 1PX3A 1QGLA 4JTNA 2R042 2FCTA 2WNUC 4FFGA 3GCXA 4QPIB 5CVRA 1VMJA 4ES9A 3VBUB 1JZ3A 1QJEA 4UYBA 3HT2A 5FPZA 1PNFA 4RS5A 3WF3A 4QDQA 1O91A 3I59A 4QKBA 1S55A 2XJVA 5FUNA 3W9AA 4AQ6A 4CEWC 2DU1A 4ZU7A 1GMMA 3MEPA 4YWAA 2PAMA 3VV1A 3DV8A 1VBA2 1QU0A 4QPGA 1FYUA 4CVUA 1PVC3 2ZGSA 3VBSB 1HKDA 2BOIA 2CU5A 2R6QA 3AVSA 4OUSA 1CAVB 4LIUA 3KQRA 5A7SA 2A6VA 2VCMA 3KV6A 3TRSB 3PJYA 3JD71 1DDLA 2A75A 4GJYA 3U1XA 2C24A 3ZXDA 4XQ4A 2JENA 2PHDA 5BNQA 4BOWA 1UWWA 5IVEA 3NQHA 3AX4A 3R4DB 4L11A 3CO2A 1PGL1 5D8AB 2BNOA 4LKEA 5D1IA 1IKQA 3S7EA 4QXKA 1ND2C 1C5HA 2RR11 5FZ7A 3RS6A 2OPWA 3TN91 4OULA 4BWOA 2B8MA 3O0WA 5C8CA 1WLTA 3AMHA 4UFMA 1V6LA 1BBT1 5EV7A 4DEVA 2LM3A 3K75B 2P2KA 2VMIA 4LUKA 3VZMA 1IG0A 1QJY2 1RUD1 4LBQD 3TEZA 1RUF2 2P3KA 5ANNA 5ABJC 3ZYPA 4CCDA 4NJ4A 3ZXFA 1XNDA 2WUHA 2ZMNA 1EAH3 1S0JA 1S2KA 2VBPA 2W87A 2WA3A 1OUSA 1RUNA 5A7QA 3VKOA 5AC91 3MPBA 4LOTA 3BTAA 4IEPA 5JLVA 3PUSA 2AEYA 4MADA 3TYJA 3NJVA 2WZR2 1W9TA 5EP9A 3VDAA 5A1FA 5IK8A 2ZX1A 3HQRA 1NCQC 2EIDA 3UKTA 3M3IA 1LGCA 1DBNA 5FRAA 4A45A 4YZ2A 3VBRA 4MGZE 2QKDA 5BY5A 1RGSA 5IAXA 4B7EA 1DCSA 1AZDA 1S2BA 3VKLA 1VBA1 1V6MA 3A22A 2QZ3A 2X29A 4MH0E 4D7SA 1PZ9A 2YYOA 1JS9A 2VNGA 3B7MA 3UJOA 3ZN6B 4JTOA 1NA1C 2I2SA 2OUHA 2WR9A 3D3AA 4CU8A 5JXHA 1I1EA 2R1BA 4Q4Y1 1LU2A 4FFHA 2JKXA 4XYXA 1O3QA 4PBPA 1LJ7A 2J1TA 2YG0A 1C1LA 3M70A 4Q4V1 5D8AC 4D8MA 2D3PA 1UXXX 4P9LA 3VBHC 2QTWB 3W58A 1BZWA 5LY1A 3B94A 5JXGA 1HRV1 4E4HA 4QAWA 2OKXA 1H6XA 1XNCA 5FKBA 2PMWB 4XIOA 1PGW2 3TAYA 2UWCA 2DVAA 4F3JA 3TEYA 2ADDA 4RS5B 4U36A 3VL9A 2PYTA 4CDXA 4Y5Z0 2A6YA 3PU3A 2ORXA 1RMU1 1URXA 1OHFA 1NQJA 1F2NA 5DZGA 4A44A 4D6SA 3QBQA 4N43C 4ZONA 4QT6A 1G9AA 3AK0A 3L2HA 1D0HA 2ZGNA 4IV1A 1JN2P 2MEV1 3CQOA 4IW3A 3ZYRA 1LEMA 1LHUA 3QCWA 4WVZA 3ETQA 1VBC1 2V73A 4IV1B 3D8CA 1VBA3 1W2AX 4M4RA 4OUMA 4CP2A 1WLWA 4QPWA 2WO2A 1Q8PA 5CBLA 1DGWX 2WNOA 5CFCB 1JTZX 2EAKA 3PUIA 5HXMA 4XMIA 1RUH1 1IQDC 2VTFA 1V9U2 1QJU2 4BJ0A 1F4HA 2VXJA 3KT7A 3V65A 4AFAA 1DYPA 1OA2A 2ZEWA 3KCXA 4C1WA 2K9ZA 4NHXA 5FP7A 2WZPP 2RMU3 4GULA 1ZZ8A 2YPJA 3KSCA 1O5LA 5LA9A 1PHMA 4XFAA 5E6HA 2QDRA 2LS6A 3FX3A 4AVSA 1JYNA 1FNYA 5HI0A 2PLV3 1VIWB 1O3SA 3T4VA 3O1MA 3OUHA 2XLGA 1H8TC 1RUE2 3D0JA 3IWZA 5SV5A 1FMD1 1UZ0A 5C9AB 3NRUA 3KLSA 2W9XA 1RHI2 2GP3A 1I3HA 5FLIA 3NKTA 5L9VA 4IDZA 4LUMA 4NVPA 4XUOA 4E8CA 1ZRFA 5JOWA 5IJRA 2Y34A 4HMZA 5FCCA 4LO8A 3OBAA 3EYPA 4GWNA 2QFEA 1F9KA 4XFCA 3VB9A 2XVKA 3U4XA 3I2FA 1QOOA 1FPN1 3N7LA 5FZBA 2B46X 3WDXA 3VD7A 1U12A 1STMA 2E7AA 2UY8A 3GM8A 1SMVA 2JG8B 1YJKA 4BB3A 2D43A 2YROA 5C3SA 1PZ8A 3AL5A 1ZRCA 2WQ4A 2YDEA 4DB5A 3LAGA 1XJAA 1QJU3 3BN6A 4PQQA 1COV2 2HEYF 2JDHA 2LW8A 3M8LA 2CGNA 1X7NA 3ATGA 2XWBB 4IV3B 4QQLA 3LGRA 4JKLA 1IG3A 1V70A 3V56A 2HEVF 1ZRIA 1UO9A 5JI7A 2QQIA 4BXSV 1FPN2 3NNGA 1ND3C 4O61A 4AL9A 4ATEA 1RUI1 5T5PA 4CEWA 4AK3A 4EE2A 4CUBA 3VGIA 4QPYA 2Y6HA 4C90A 2VNVA 4COZA 1GWLA 4KWLA 4E27A 2O8QA 3VDDA 3LWCA 1GWMA 5L7OA 1RUE1 1SPPA 5F3EA 2W92A 1AUYA 4FQZA 1BXHA 4M00A 4RFRB 5FOBB 4GD4A 4ARYA 3LKJA 1R64A 2JDPA 2PQSA 4XFIA 2TUNA 1BYHA 5CFDC 2NLRA 1EPZA 3BTZA 4LR4A 1TVGA 4FCAA 4LJHA 1EUTA 3ACFA 4UW4A 5A80A 2D44A 3RNSA 4LEJA 1CIYA 4DXRA 2WKKA 2RS13 4K9SA 3WNKA 1DG6A 3T2QA 3LDBA 4RN5A 2AR6A 3I59B 3HPNA 4BU2A 3RPQA 3SH5A 2VNOA 5BNOC 3FJSA 4ATFA 2GZWA 1ODNA 3IDEA 3NW4A 3UT0A 3HBKA 4QB6A 4L2NA 3WF1A 1AYM2 1LAJA 4BQ4A 2EF6A 2WFPA 1WD3A 3OSDA 5CU1A 1YI7A 3GNEA 1MVEA 2W08A 2LRPA 3BGAA 1A8MA 1ZBA1 5IHRA 1BMV1 3LFIA 4NIAA 3A21A 1ND3B 1PO22 4FI9A 4BLJA 1PMJX 3KT1A 1Y9QA 1BK1A 2NMOA 2Z69A 3BVCA 1OFSA 3MLKA 4HSLA 4CDQC 2HWF3 5HXVA 1KS5A 2XBO2 4I3GA 2NMNA 3A4UA 4LE3A 3ZYHA 1ULFA 4M3CB 5C3QA 1OLMA 4QU2A 4Y1XA 3MPPG 1Z7S2 4Y20A 2WAAA 3UV9A 1WCDJ 2GNTA 3MGUA 3LD8A 2BFUS 5LB6A 4NPMA 1XPWA 4N90A 1SLTA 4RHV2 4TLGA 3NO8A 1NE6A 4FAGA 3AMPA 3CIHA 4MV2A 2X10A 1OD3A 2ZX2A 2VCBA 1CX4A 1W6MB 4B1MA 1AF9A 3UJQA 1OLME 1G7YA 1H8VA 2ZHKA 5FPAA 2QQUA 4WM7B 1RUC3 1YWKA 5BPXA 1QJY3 4FT8A 5JXIA 2AREA 1MS5A 1L7RA 3SH3A 3O12A 2VMCA 2XUMA 4AHZA 1CZTA 1ZVFA 3ZFEB 2HKXA 5BNOB 4BQ5A 2W5FA 4D3WA 3RMXA 3OY8A 3SH4A 4LIVA 1U5XA 4QQPA 3RDIA 4KU8A 1V6KA 1TEIA 2FMDA 2BNMA 4L99A 4XXPA 2DCZA 1GZCA 5EIYB 1WMEA 4YGCA 5DZFA 1JH5A 2CY6A 3VLBB 4R9DA 2VR4A 1WW6A 1LECA 1PVC1 4OHXA 1VR3A 4AW7A 4QM9A 5FLHA 3ZMOA 1HXS1 4NRPA 5FZ3A 4Q4W3 2WZR1 1PIV1 2PQQA 5FZ6A 1LEDA 1IQAA 1ZYBA 4YW1A 2ARAA 2DDUA 5LRRA 2XKOA 4M3CF 2ZPXA 2E7TA 4C0BA 3AFGA 1Q8OA 4GJZA 5EHDA 4IL7A 2EIBA 3U0ZA 3ZPYA 1S0GA 5FOJB 1OF3A 4AHYA 3M3OA 3O0XA 1OXCA 3WNOA 5C4WB 1W6OA 3LOIA 3UGHA 4WM7C 4D6RA 3I2JA 1GZWB 1BEV1 3R4UA 4JC1A 1BBT2 4K6BA 4QPIA 4BYYA 4E9KA 1DP0A 2GC0A 1AXZA 4P00B 2X8KA 4LMFA 1VB2A 3BIEA 3GJBA 1RUC1 2WDBA 4E8DA 3AYDA 1X82A 3TNPB 1S0DA 1AYN2 3DYOA 1XNKA 4DQAA 2YB7A 4AHWA 4OHYA 4XJAA 1OQEA 4AG4A 1UZWA 3APBA 5JIUA 1B35A 3Q8BA 4FSJA 3F95A 1QXPA 2WAOA 4A3XA 4CDUC 5FPBA 3TWIA 5F9TA 1A6CA 3JD72 4QD2A 2XLAA 1TME2 3RMYA 4CXXA 3ILFA 4CU9A 1FATA 1TMF2 4M01A 1VBB2 2WT0A 2VMFA 4AAXA 4DUVA 4YFZA 2XH6A 3IMMA 3ORJA 3FMGA 1H1MA 2QJVA 3POFA 5GKAC 4YGDA 4PJYA 2P6CA 4QHZA 4XVHA 5AFEA 5KHHA 4UW3A 4XJ8A 4MG2A 1E57A 2DCJA 2P4EA 1UAIA 2B4KA 1MACA 3PTRB 5APAA 2D5FA 1APNA 3D5OA 1A8DA 1ENRA 3PIGA 4KGQA 5DG2A 4Z2AA 1QJU1 3HVDA 1LKNA 1QIQA 4Z8BA 2Z42A 4YYOA 3S57A 2XBO3 3DCQA 1RUG3 2E9QA 3GZUC 1NYWA 3VZJA 3RQ0A 4BQ1A 3HIFA 4YM2A 1N1SA 1PO23 3WX5A 3PUHA 3MZHA 3PHMA 1DIWA 4PLMA 3SXWA 4DOUA 3ZFEA 2MNGA 5AVAA 4JVAA 3GXUA 4OCTA 2ZGTA 4H7LA 4RFT0 2ZEZA 4TXWA 3ZX7A 1CAVA 1UD1A 2QQNA 2YY1A 3ES1A 4JGZA 5ACA1 4XJZA 1OLRA 2YV8A 5SV8A 3O1OA 3N9MA 4A7YA 3WG4A 3H0OA 2PHWA 4MGQA 1RXGA 3ZXGA 2AGSA 1XSRA 1O7FA 4XTMA 1UY4A 3J7HA 4ZXKA 2F4PA 3SC7X 1R092 3WF4A 2VNRA 2DVDA 4RSUA 2Q30A 3IM0A 5D8AA 3K77A 4RR3C 4R8HA 4AEMA 2KD7A 4WZFA 1PO21 4DZGA 2DVBA 2ZGOA 4Q4Y3 4XTPA 2OYZA 1L3JA 2WFF2 4RGGA 5JZGB 2ZMLA 1ALYA 3AKPA 3KWVA 1ZZBA 4IXLA 1TNRA 5BV6A 1HRV2 1VE0A 3OPWA 1US2A 4HL0A 5LK7B 1SBDA 3WR0A 2YBKA 4ZS2A 2JX9A 1Q8VA 1QH7A 2G9FA 3FN9A 4CEWB 2DFBA 3LE0A 1OVSA 5FZHA 1YQ6A 4XBQA 5GJ6A 4BE3A 3VBSC 2ORZA 4DRVA 1RUJ2 2J1UA 3LEKA 1GU3A 1WCQA 3BOWA 5F5CA 2WLQA 2ZCWA 5I0RA 2BTVC 3B93A 1AL23 4Z92B 3FFZA 1QMJA 3K2OA 2PHRA 4F83A 1TME1 3N9QA 3KCYA 5HV4A 5I8SA 1LOEA 3DKQA 1H6YA 3NMBA 1VBD3 2VBBA 4A42A 4LT5A 2Q0AA 1L7QA 2WJSA 2RG4A 4QKNA 3IDBB 4XUNA 3ZFGA 1LOCA 1AX1A 3WQBA 2DCKA 4A2UA 1ZM1A 3KGZA 1AR62 4R9AA 2GH8A 2HWE1 3JQXA 5F7UA 1ZBE2 1UZYA 3FFQA 4B7KA 2Y60A 2Y0IA 2IXLA 5GLUA 4NUBA 3VBHB 2Q1FA 2QNKA 1D4M3 1PVXA 5GALA 1VAVA 4MUVA 1DLCA 1K42A 1WUVA 4CCLA 5J09A 2KXLA 1RUI3 2XDVA 4LHNA 4M0NA 3WDVA 3KMHA 1YLLA 1H30A 1AR81 3AZVA 3MW3A 1UYZA 2W3JA 1UZVA 3EJKA 5E88A 1GNZA 4YVSA 3N35A 4HG6B 1S0CA 1YFWA 2GMEA 3PNAA 4BIFA 2ZEXA 4O9EA 1R1A1 2GALA 4HXCA 1X9TA 2AZ5A 2RJKA 2A73B 2L9LA 5JPMB 2R063 2WFF3 2G9GA 4CXYA 5DMYA 1UL9A 4QPGB 4NIGA 2WBKA 1ZBE1 1YJLA 4L0PA 1EPWA 3U37A 3AYEA 1QOTA 4RYDA 3LOBA 4LBQA 5DAXA 1JOJA 1OFNA 5EXOA 3I2KA 4QXHA 3AXEA 2FHRA 4HBNA 4MXWA 4N43A 4XURA 4EZ4A 4GH4A 5FZFA 3BCWA 4LKSA 4AVBA 2I07B 4IV1C 5C5TA 5F3IA 4HETA 2YUEA 2PXJA 2O8OA 4JGYA 3ZO0B 3H7YA 4AVTA 4YW6A 5CFCC 1XOYA 1AVBA 3PVOA 1GOGA 2FQPA 3POBA 5FO9B 5GLWA 4QGMA 5HCAA 3VHPA 3ACHA 1XXNA 3THDA 1PNGA 3ZXKA 2ZX3A 3MHZA 4HANA 2BJSA 1CN1A 3AP5A 4LBNA 1RUH2 4GWMA 3I2OA 2YZ4A 3L2YA 4IV3A 5J96B 4JGZB 2VCAA 1XYOA 3GBGA 5F2SA 4LPLA 4R4XA 4X6RB 3FL7A 4XUQA 4AWDA 5I91A 4E4DX 2NN8A 1GP5A 3AP7A 5LBBA 3A23A 2AEZA 2WFF1 3J7MA 2DWRA 5FXXA 2LUWA 2A6XA 1K5JA 3S30A 3SCFA 1YYNA 2ZX4A 1OUXA 2W46A 4JKKA 1W2UA 1QJX2 1EYBA 4JDMA 4LBKA 3MW2A 3WG1A 1FXZA 5EJZB 1D7PM 3PUQA 1NAEA 1QH6A 5IVYA 3VBFB 1LR5A 4EN6B 3S0MA 4G9SB 5T50A 4IEVA 2VECA 1JOBA 2VZVA 4CZSA 3IZOA 1KS4A 3HQXA 2A3YA 2JDMA 3N3HA 5LATA 2Q8OA 4BK5A 1JYXA 2VVDA 1O4ZA 3ES4A 1HIXA 1WLCA 1H1IA 3J7NA 1UY0A 3KVAA 4OFGA 1FOD2 3DL3A 4FXKB 2QQPA 2HYKA 4JAAA 4Z07A 4JQRA 4IV3C 3ZFFB 3ZYFA 1PK6B 3CLPA 1KD7A 2JJ6A 2F17A 1KRIA 1FAYA 2J1EA 1EUUA 4WBBA 5FP4A 2XQXA 4UOJA 1OC1A 4Q4V2 4YARA 1CQ9A 2BWCA 4B4RA 1NUKA 2DV9A 2W1SA 4JHZA 4FQ4A 4JZRA 4BDVB 4NHYA 1AR92 3VDCA 1SLIA 3KVBA 3FLPA 2GMPA 4Y26A 1AJKA 3P6BA 3PIJA 5EZWA 5F37A 4QMAA 4IGQA 4H3WA 3T09A 3UGGA 4XJ9A 5FQ0B 4IESA 3VZOA 2P5BA 1Y43B 1GOFA 2HJIA 4Y20B 1W9WA 3C7OA 2PAKA 3B69A 1NLRA 1ODMA 5DXDA 4MOAA 4YGBA 5FYYA 3LPGA 3JXSA 2ARCA 5CKNA 2PHTA 4HONA 2LROA 1R1A2 1UMHA 2H0VA 1JYTA 4J1XA 1N1VA 2IUWA 3KF5A 1UOJA 1X36A 4AI2A 1AYN1 3BKZA 5BXXA 4QWNA 1OPMA 2V5YA 1UKGA 1VAKA 4MLOA 4N53C 2JDYA 4FFIA 1E5SA 4I0WB 4NO4A 1NZCA 4NRQA 3W21A 3LEIA 3MUY1 2ILMA 3EHKA 4NWWA 1NCRC 1EP0A 1C28A 2SBAA 2XJPA 4KMQA 3GBFA 1PK6C 1OVPA 1LTEA 1DQ1A 5FBZA 4O9GA 3JU9A 4CCOA 4WVVA 3WDUA 5IAVA 4HT1T 5JDBA 3NSTA 1Z78A 5DABA 1K5MB 4AQSA 2C4XA 4AI1A 2DFCA 4URAA 1HDKA 2HWE2 1X8MA 1AL0G 4K8FA 3NNMA 1RHI1 5CA6A 4EZHA 2VL4A 3PURA 1FV3A 4HSJA 3ZMNA 2GH2A 2RS31 5I8YA 5D2AA 5C71A 3CMGA 1OQ1A 2PLV2 3CJXA 3K3OA 1PM7A 4DNYA 3M3EA 2TBVA 4A7ZA 1UY3A 1VPHA 3WV6A 4LBMA 4Q4V3 4NHMA 4WM7A 1MZEA 2W39A 2P3JA 2PA7A 4AEJA 1OA3A 3LF7A 3OBRA 4ORFA 2CWSA 2Y26A 4KWJA 1MPXA 3P3PA 1O4TA 4YG6A 5C6CA 1KFUL 5A32A 2B5HA 3OF1A 4F7ZA 1QJFA 1CJPA 5A1AA 5FZ1A 3SQOA 1V6OA 4N53B 5EPAA 3OBZA 3WF0A 3UESA 2R041 3ACIA 4GWIA 1IS5A 2IWGB 3NJZA 1DZTA 2MEV3 3WP5A 5I93A 5KXEA 1VBC2 5GLVA 4DUXA 5DN2A 4EWEA 3WLUA 1N3OA 3GGLA 1WMFA 2VCCA 1W6NB 2FCVA 1LODA 3NV3A 4GMP3 4Z82A 5I0TA 3NJYA 2HWB2 3E6CC 1B09A 5EYYA 1GFF2 2C5DA 3UETA 2XLFA 3N7KA 5TSWA 4KBBA 3GALA 4K1ZA 5CEHA 3VKNA 5F8PA 2ZHLA 5JAXA 1OT5A 2UY9A 4WVMB 1UW8A 3IAQA 2WABA 2EXKA 2I45A 3KGLA 2PHFA 5JR2A 4Q5OA 3U75A 3VZKA 2AENA 4XDQA 4C1XA 2XHNA 5C3OA 1S0EA 2V4VA 4C91A 1BCXA 3NNLA 5K7PA 3WDWA 5BUVA 2Q4SA 1PGW1 4AEDB 4DFSA 3VD3A 3N7JA 1ZBA2 2J7MA 3VD5A 3I54A 3BB6A 5LASA 1LOBA 3POIA 1F8VA 1J1TA 1AYM1 2CTVA 1YQ5A 2YGMA 1CAWB 5H9QA 2QQOA 2JB8A 3ZSKA 3C3VA 2WZR3 4HLTA 4B8EA 1M06G 3HEIA 2ZJCA 3WNLA 1RJ8A 4BXFA 3IPVB 3AJYA 3N7MA 1REEA 4HPKB 1GKBA 1Y4WA 4UWDA 4OI0A 4LULA 3RZKA 4Q4Y2 2XOMA 2VMEA 4KG8A 4WZCA 3AZWA 2QQKA 3GZAA 2FZ2A 2IFWA 4LBQB 2AH2A 3LPFA 3Q8AA 1Y3TA 1K5MA 1ACCA 2J1VA 4Y1UA 2VZOA 1JZ7A 4R9BA 2VZUA 4Q1PA 1HV1A 3AM2A 1MZ6A 1TMF1 3FWEA 2CGPA 5A6QA 4TWTA 3MI8A 4GB33 2RVAA 5FYHA 1JYIA 1OPOA 1ZX5A 3WHTA 4BHPA 5AC92 3NV1A 4YW2A 5KXBA 4QM8A 2B9VA 2RS33 1NE4A 2QCSB 4H55A 1REDA 4RL7A 3RWKX 3HQUA 3D6EA 3T08A 3UYJA 3WNNA 4COYA 5BNNA 3BOPA 3LA2A 1W03A 4I2OA 2EXJA 4R4ZA 5FY0A 4N9HA 4AI8A 3S7IA 4OMCA 1RUC2 4FXGB 3WP6A 2DBIA 4AEDC 1YUDA 2JG9C 1LULA 2HWC2 2G1MA 4XQDA 1BEV2 4IEQA 3GHNA 2Y33A 4QKFA 2YBPA 1OF4A 1NX9A 1PO12 2WNVB 4QHBA 1COV1 2D6OX 5FY1A 5F5IA 4AFDA 3CZJA 2R32A 3E5UA 3Q8EA 1GANA 1SCRA 3USUB 1NXMA 5L19A 1RB8G 1W6PA 1HW5A 3MICA 1DGWA 4UI9L 4BZ4A 5JPNB 3C7GA 2ENRA 1KEXA 2XJUA 4AOCA 4FTEA 1VAMA 3B9CA 1J83A 2P34A 4L9BA 5DPNA 1VBC3 3OGRA 4L92A 5E1RA 4GALA 4Q4W2 1SBEA 1A3KA 2LALA 4XXAA 4COUA 3RJ2X 2Y6GA 2ZGRA 1IPSA 5DUWA 5HV0A 1YFUA 2XL9A 2BOJA 4WV8A 5EWSA 5ANQA 3ZYBA 4AI3A 4LKFA 2Q1ZB 2JE9A 1W39A 3UGFA 5JR7B 1LU1A 3OYWB 1UY1A 4ZY9A 1YIFA 4AI0A 1RUD3 2I74A 4AZZA 1UCXA 5CYYA 5ABJA 4KU7A 4CRQA 1C8M3 4MYEA 2IC1A 1BBT3 5F39A 4D94A 5DUXA 1MS1A 1W06A 5EFUA 1LHNA 1MS3A 5BNPB 2A6ZA 2Q8DA 3E1F1 4JX0A 4OI1A 5LA1A 1MZFA 1RUE3 2NQYA 1Q43A 2WL1A 2D40A 3ENRA 3JBG1 5F5QA 3ZR6A 1H9WA 2PHUA 1JODA 1BEV3 2K0GA 4HPKA 3IIIA 4R9CA 2AUYA 3J8F2 4QX7A 4FP3A 1DQ4A 4YG0A 1OH4A 2OPKA 4PDWB 3RZGA 2WT1A 1ULEA 1F4AA 4ISRA 1OOPA 4RHV1 1DQ5A 3AKRA 1EY2A 3DEMA 3E5QA 1B35B 2CL2A 4IE6A 4X8PA 3WW2A 5H9SA 1JZ2A 4AE2A 4M3CA 3PLQA 4F8AA 1YFYA 3VDDC 5T3NA 2VXRA 4TLFA 3T30A 2OA2A 5A3WA 2BP6A 2PFWA 2JB4A 4WM8A 1FI2A 2VD7A 2FDHA 3RZLA 2C9KA 4LBLA 3B02A 1RMU2 3J9SA 3GF6A 4MGTA 1H2KA 4NIHA 5FXWA 5FZDA 3M3CA 2GC3A 3SITA 4XBNA 4PIZA 1VJ2A 3M4FA 1KQRA 5FMOS 4CCEA 3OPTA 2J1RA 1GR3A 2BZDA 3EMRA 4XUTA 1FX5A 4CEYA 4S2HA 3ZIXA 3WHUA 1R083 1GQPA 3HOBA 2ZS6B 5BNOA 4CCNA 4XUPA 5BNPC 1EV13 2WRAA 1A34A 1ZRDA 5JCTA 2C9AA 2FBEA 1O4YA 4DIQA 2BU9A 1E5RA 1M4WA 3SEEA 5ACA3 1RTVA 4S2GA 1WWYA 1RUF3 3WNXA 3RG0A 1DYKA 3NAPB 2GP5A 5I8TA 2D6LX 4YGEA 3DXTA 4GQ7A 1OQDA 2Z79A 1RUOA 5FZIA 1S1AA 3VKFC 4AQTA 4A41A 4NIDA 5CIRA 3W59A 1JUIA 4NE9A 2RJ2A 1UMZA 3HN3A 4X6QB 3MYXA 3ZOIA 1SDDB 1W6MA 2CNAA 3BPZA 4IETA 4K1YA 4XFHA 1QEXA 3USSA 1WKYA 4HVRA 1ND2B 2EIEA 5IVCA 4GKXA 1U5ZA 1AX0A 4GH4C 3ITQA 1RXFA 5FUPA 2WO1A 5FP8A 3WP4A 1F5FA 1W8WA 2Q8CA 4LO7A 4YZ1A 5JOXA 4JRAA 3LIGA 3H42B 1OLQA 5ABJB 3G7DA 3LDRA 2GSYA 1J3PA 5T55A 1CAXA 1N3QA 5KWRA 4DRRA 1RUD2 2B42B 4UW5A 3JCIA 4PT6A 1MEC2 5EQUA 4CDUA 2BVBA 2ZKLA 4XJUA 5A3NA 2GC2A 1KDMA 3PMEA 4FVVA 1CAXB 2G9ZA 4LO5B 4B4QA 1RVF2 4QPGC 3TB0A 3TN92 2VZQA 2ZX0A 1QJZA 3R05A 4CDWA 2OIIA 3IIAA 1JYVA 3H1MA 2XHKA 4CTEA 4LHLA 3SKJE 3BTXA 2DUQA 2XUEA 3T2PA 3NAPC 2RDRA 1X8EA 4XE9A 4URTA 5FYBA 1NA1B 2ZGLA 1SPPB 1FMD2 2VULA 2WS93 4PIXA 4P14A 4P9JA 5K4LA 1FNZA 3ASIA 5IYYA 5FWEA 1XC6A 3ZFGB 2YC4A 2Y6FA 1VLNA 5FK7A 5FZ0A 3WQ7A 2A5ZA 4YFWA 5LBFA 4TZDA 1N1TA 2O1QA 1AL21 2VAUA 4FTBA 1CAWA 4Q2FA 2XB6C 2XMLA 3T4HB 2OXBA 2WWUA 1S0FA 3NWKA 1RUJ1 4G3YC 5CADA 2DTYA 4V2VA 3RSJA 3I2DA 3MV01 4K8RB 1V6NA 3MLJA 2PHLA 3ZFFC 1WZXA 4ZPIA 4AEDA 4AQ2A 5LEJA 2A71A 4ITCA 1V9U1 2Q8EA 3T2OA 4IE7A 1SACA 2RS52 3IDAA 1RITA 1ULDA 2QDNA 3ABZA 4XIKA 1ASJ2 3OEAA 3HR9A 2CDPA 4D7YA 1W04A 1LCLA 2W68A 1GYKA 1QDOA 2V4AA 5LA2A 3THTA 5KR7A 1IS3A 3H9AA 1UPSA 3TBDA 5AC93 1V9U3 2VQAA 3VHNA 1GICA 2HBTA 1UOGA 4H2AA 3I4IA 1XNTA 4QQ2A 4XACA 2QE3A 4META 3VBFC 2VOKA 5FIXA 2QQLA 1XBFA 3ZIWA 1OMIA 4RGKA 2IVIB 2VMDA 3KV9A 4N9IA 1R091 1CVNA 5JUVA 3RZHA 4QB2A 2QQWA 2QZ2A 2JEMA 3AP6A 5FYVA 5FZEA 5A3LA 4AVVA 4QHOA 1YI9A 4KI5M 1MS9A 4XCAA 4XJWA 5FYSA 2RMU2 3ILRA 4PHZA 5HCHA 2F6BA 2JICA 1AR63 3KHBA 3OPZA 4P02B 1LB2A 1R093 2JDZA 5LBEA 1MZ5A 1ZZCA 5FJHA 1IGOA 2FCUA 3WD5A 3ZR5A 4AGGA 2HYXA 2A3XA 2YPDA 1R1ZA 1KITA 4TYSA 3USUA 4XZPA 1KGYA 2A1XA 4CP9B 2ZKNA 4GZ9A 4NN0A 4YW5A 5T5JA 1G9CA 5F3CA 3T0AA 1W99A 1Y9MA 2OUJA 3FHIB 1TMF3 3H3LA 3QH7A 4WVWA 1AR71 4GIQA 4BQ2A 2MHFA 4MO3M 4E2SA 1QF3A 4XETA 3WZ1A 5KHGA 3VDBA 3B5LB 3DN7A 4I01A 2W47A 3H8UA 4BQWA 1FV2A 1H2LA 1POV3 4ET7A 2BQPA 1OOPC 4QX5A 4CPBD 1BKZA 2ETEA 4NAOA 4I02A 4ISQA 2RS51 2X09A 1PZ7A 4AFMA 4P5HA 1RL3A 1DQ2A 1MQTA 4YM1A 1LRHA 3POWA 2P1BA 1C8M2 1MEC3 3FUOA 4DXSA 1EAH1 1CESA 2VC9A 2Z4FA 1QY4A 3OG2A 2WS92 4A4AA 2KA3A 2FZ1A 2IXJA 1NQDA 3WINE 2Y6LA 2OZJA 1SLCA 3OUIA 4S2DA 1HJGA 4YVSC 5K0UA 2VO5A 4YPJA 4HN1A 2A7AA 1UIKA 4HKOA 3U78A 3H8OA 1JUHA 1QJY1 1RVF3 2VZPA 4W4ZA 4ZU4A 1MS0A 2Y6KA 1W6QA 2R073 3I49A 4LBJA 3EXUA 2JWPA 4ONUA 3RZZA 4NHLA 4OVEA 5C8WA 2DUPA 3BIWE 4XF4A 4XOGA 1K5MC 1O3RA 2JIGA 3FLTA 1D4M2 1C57A 2Y8KA 3H1WA 4A7KA 5A7NA 2AC1A 2XGXA 2FDKA 3N4MA 2CYFA 1WA4A 2VOVA 3MLLA 5FJKA 3OBTA 5KC5A 4PI0A 3KHCA 3EB7A 1J59A 1AR93 4YNIA 1H8TA 2YXSA 1OOPB 1ULPA 2WO3A 2HWF2 1Z0HA 2ZHNA 1E5HA 3D0SA 4FPHA 5B4NA 3S5AA 5CFDB 5IVVA 3MW4A 3Q9OA 1HXS2 3VBHA 4Y22A 3BUCA 4I09A 4KGGA 1PIV3 1ULGA 4Y4YA 4KWKA 3URFA 5KXCA 2VOTA 3LFMA 1PVC2 4FPYA 3PDQA 1UX6A 3PL0A 2W1UA 2D93A 3ZDSA 5FWJA 1T6BX 1DF0A 1KJRA 3OD4A 2RDNA 1AYM3 3AMQA 2RDSA 2WLPA 4Q4X3 5C70A 1I6XA 5A6YA 3I3MA 4CP1A 1RUJ3 4FPCA 5JXJA 2OQ6A 5JVVA 2R30A 1NY72 4YVSB 3POGA 3PUAA 3ZN4A 4EV0A 1UU6A 5DAWA 1SZBA 3DYMA 1W3VA 3DECA 4RHV3 5LEKA 5FLJA 1AHSA 3L9JT 4QGLA 3X29B 2WC2A 1CIWA 4XF3A 4TTGA 4BA6A 2OT7A 5CAZA 4RQPB 1Q8QA 3R0RA 5FFOC 2YGLA 3V0BA 1VP6A 1GQGA 1WW7A 1WMXA 2ZXQA 2H6CA 5A3PA 1Q56A 2VBDA 5LY2A 4D6QA 5C33A 3VUOA 1DHKB 2P17A 5JMOA 3FHAA 2ZOEB 5KC6A 1D2SA 1WW4A 4W6XA 1R081 1HB3A 1W8TA 1C5IA 2R1DA 5DAQA 5L7OC 2BPA2 4DS0A 5C9AA 1NLQA 1SFPA 5FMDA 4AR2A 4AVAA 4UFIA 5A3TA 4BM8A 1JZ6A 1NXD1 4XF0A 3ZDVA 1LHOA 1UMIA 1Z7S1 3AZZA 3MFCA 3NV4A 4XAEA 4Y24A 2GN3A 4ZZ5A 4LOSA 4UT5A 4H7MA 4JDOA 1VBE3 3SCGA 3SEPA 3BU0A 1QHDA 4NROA 4XFGA 5IK4A 5BNNC 3GBWA 1HB1A 3M1HA 4XW3A 3AKTA 4IE0A 1BLZA 1YNAA 2YFUA 3ECQA 3PU8A 1WBFA 5C4WA 4FO9A 3O0VA 3U07A 4UAPA 3ZFEC 5IK7A 1YEWA 2ZGQA 2QQVA 1VRH1 1VRBA 2AACA 3G6JB 3MF9A 3HNYM 3UL2A 3HT1A 1W2NA 3P1IA 2ZGUA 1CWPA 5CG9A 4LE4A 4QX3A 1BK0A 3WT3A 5IFPA 4Q0QA 1BQPA 1CZSA 2R0FA 4IEUA 4P9XA 1YQ8A 5FYCA 1TQ5A 4MVTA 4XAAA 1ZNPA 4QX8A 5FZOA 3RI8A 1RMU3 1XE0A 3DXUA
chains in the Genus database with same CATH topology
2X5IC 5GM0A 1QNYA 2UWAA 3B3QE 1RHI3 3JBG2 4XPVA 3WDYA 1CD3G 1WCKA 2K2SA 4CDWB 1MS4A 5FO8B 1WCSA 4GXLA 4Q8KA 3ZN5A 2BEOA 3VZNA 2UURA 1TME3 2EAAA 5DDJ3 4EJRA 3WOGA 4COVA 4K40A 4XFFA 2E6VA 4Y22B 4Q0VA 1CAUA 4FOVA 3CJIA 5K0UB 3SHRA 2WWSA 3SCHA 5C4WC 2RE9A 3K51A 5I0UA 2D6KA 1AYN3 1RUI2 1PK6A 2PHXA 4MGKE 2UYBA 1I5ZA 5BNPA 3B00A 3OJBA 2WNVC 2VQ0A 1PMIA 4COWA 1JHNA 1POV1 3HN1A 3V64A 3ZSEA 3E6DA 1ZREA 4Q29A 3WW3A 1VBE2 4XHXA 4GB32 2Z5WA 1ZZ7A 4Y1VA 4U2AA 3DPRB 3RI9A 1XYPA 3ZXLA 1COV3 2VVEA 3FC0A 4OZXA 1D4M1 1ENXA 2XVLA 2GNDA 2DU0A 1WGPA 3O14A 1TNFA 2PELA 3DKWA 3IT8A 1QQP1 2VW2A 3INAA 4KH9A 3WW1A 2XG3A 1N3PA 4DINB 4M0HA 4YW3A 2NM1A 2A70A 4JRLA 2DCYA 2R071 4DY5A 1DZRA 1RC6A 4WM8C 3QLQA 3GZTB 5EJ3A 3VKMA 5JZGA 3VN4A 2D3SA 1DFQA 1YO8A 4AFBA 1YFXA 2ZGPA 3MIDA 2HWC3 2D5HA 1ZRRA 4EROA 4TSVA 3E97A 3CEWA 1ASJ3 2JXAA 4N53A 2XKPA 4YVWA 1DQ0A 1G9FA 4CEYC 5CG8A 3UKVA 3MIGA 4AF9A 3KCCA 1LGBA 2IXHA 4YVWB 4NPRA 1I9RA 3NAPA 1DGRN 3E6BA 2VMHA 1UU5A 4IEXA 4YZ3A 2CAUA 2R061 3VDDB 1GZ9A 4FPKA 2BFUL 1JW6A 2XJTA 5KXDA 4C0HA 3MF6A 3HBZA 4JGYC 2ERFA 3KD4A 3ZSLA 4K21A 4M3CE 5JZGC 1VBD2 1IPKA 1ZZ6A 2EA7A 4W65A 1DZQA 4UBHA 4YW4A 1UN1A 2DVGA 3JBG3 5JI9A 1A78A 2D97A 5IUQA 4YSFA 4I3PA 1OA4A 4NWVA 1UF2C 1VBD1 2EVXA 1W6NA 4IEWA 3AKQA 2EXHA 3LCPA 1KDKA 3EO6A 2ZTNA 1YHFA 5L73A 4CDXB 4CDQB 1LOFC 2ES3A 2DTWA 1HLCA 1QDCA 1YRZA 1AX2A 5A33A 2VOXA 3PVNA 1G6NA 4B3NA 3WUDA 2E53A 2FMYA 1LOAA 1D0GA 2GDFA 3AP4A 1IS6A 3RYPA 4I0AA 3AKSA 4OHVA 2VW1A 5FQ0A 4GH4B 4CP0A 3GHMA 1NY71 3FBMA 3PVBB 3IDCB 4BIOA 3U11A 1BJQA 1H2MA 2GAUA 3JB4C 3AMNA 2P3IA 3AJZA 4OLLA 3SNMA 1WMDA 1LESA 4BPZA 4RQPA 4LO6B 2MPFA 1ENQA 2CV6A 3VHOA 2R072 4BH9A 3OCPA 4BLIA 3FBYA 4AEKA 1RUF1 1IOAA 3MIEA 3CU7A 1QXRA 4IEZA 1J58A 1UPIA 2RR12 4AXOA 4NR1A 3KS7A 4KG0A 1POV0 1PGL2 5F6KA 1MQTC 4MGIE 3O7OA 4AYUA 4XEZA 3R6SA 3FE5A 2B39A 1HRI1 1UKRA 2D6MA 1MEC1 1QXJA 2DVFA 1WBLA 3VBFA 3THPA 3ZFGC 3ZSMA 3EQEA 3HD8B 2XPJA 5CNAA 4J6GA 1AXKA 2VY0A 4YM0A 1RUH3 4BMEA 2VW0A 2YC0A 3PJQA 4LLFA 5C8CC 5GZDA 1PGSA 3UK9A 4LA2A 1GZWA 1QOSA 4G4FA 4JGZC 1G9BA 4EN9B 2R49A 5B2GB 4YM3A 2RM22 4MSVA 5GLTA 3POYA 4CYDA 2UU8A 3HWJA 3WQ0A 2DURA 4I30A 4YZ5A 1AJOA 3PTYA 2PAEA 4CDUB 3AZXA 4XQWA 2WA4A 2IXCA 5H9RA 1ONAA 4WVMA 2TNFA 4AHXA 4CDQA 2IXIA 3AB0A 1AR72 1MQTB 2JD4A 1T6GC 4K7JA 2JE7A 3GYDA 3H7JA 1FOD1 3VBOA 5DUUA 1O3TA 2WT2A 4EN7B 1EV11 2WSVA 2IXKA 4S2FA 4PLNA 1HRV3 4XHBA 3K48A 4Q8LA 3VBOB 4N7IA 1ENSA 4FP2A 3MFAA 1QJX3 5FPXA 3POSA 4R52A 2YHJA 3D4KA 2NZ9A 4Q0UA 1LHVA 4FPEA 2RS53 3RRDA 1CPNA 5GZEA 3IKWA 2HWD3 3ZXEA 5A33B 3N36A 2C1FA 3BODA 3VHRA 1HV0A 2DUOA 3ZSJA 4X8NA 4GMP0 2BUKA 4Q4X2 3HAGA 3UKNA 3ALQA 5J3UA 2HEWF 2QVSB 3U10A 1HQWA 2Q1MA 2LTNA 3T1LA 1ASJ1 4RR3B 1SLLA 4IEOA 4OHWA 1GQHA 4GA9A 5DG1A 3ROUA 2WIIB 2V09A 2ZGKA 4Q0PA 1X33A 1O5UA 5JIAA 4I0BA 3SLIA 1C4RA 1G86A 2CAVA 1AL22 1H0BA 3OY8B 5GZCA 1SFNA 2H0BA 4Q27A 3I7DA 1U5IA 2W52A 3VBUC 1N47A 3IMNA 1QQP3 1ULCA 5A32B 4DXZA 2NPIA 1F31A 2RS12 2YMZA 3ZYJB 4DMIA 3KT4A 3RYKA 1ZBE3 2NYYA 3OD0A 4ASLA 4Q4W1 3AYCA 3WG2A 2VVFA 3M2MA 3AFKA 5F6LB 1CJDA 3FLRA 2VUJA 1HRI2 5L7OB 1JXNA 4HKLA 5FO7B 4UW6A 5GLZA 1XE7A 2GU9A 1VBE1 2IFRA 1AR83 1NG0A 2Z2SB 5KBFA 3WP3A 3AP9A 3R4SA 4UBGA 1W6OB 1V6JA 4PCRA 4YLZA 5T5OA 2HWC1 2VGDA 2XJSA 2GN7A 2WNEA 1FT9A 5KHKA 3ZFFA 2JG9A 2JKBA 2RS11 3BALA 1J3RA 4XF9A 2RJLA 3CJIB 5K9YA 1UIJA 1SEFA 1WW5A 2B9UA 3QD6A 4AVCA 2WS91 2GNMA 4RQPC 2XVGA 1YIPA 4LTAA 4Z1VA 2ARXA 1VB4A 2BVVA 2VOWA 1C8M1 1BVVA 1XRUA 3LSEA 1MR5A 1RINA 4Q26A 1ND3A 1DLLA 5JOZA 4RA0A 3ST7A 1C3HA 2A6WA 2ZGMA 1NCQB 1IS4A 4Q1RA 1DGRA 3DPRA 3MIBA 2BWAA 1QNWA 4CDWC 5K8SA 4FPJA 2OVUA 5GZGA 3B01A 4QQOA 2BGCA 1C8NA 1LGNA 4LO4B 4Q4X1 3LA3A 3VZLA 5JSRA 1WLDA 1RIRA 3AYAA 5JSOA 1ZBA3 4FAHA 1GBGA 4RR3A 4GKYA 2HWD2 5CFDA 1TE1B 4IEYA 5BNNB 2VUAA 5I0SA 5HCFA 5E16A 3TNQA 4PLOA 2XWJB 3CJIC 1HRI3 2CWMA 4AGVA 4MXVA 3ZYIB 2XJRA 5L36A 3RJRA 4K3UA 4RS5C 1EV12 3VBRC 2EIGA 3QACA 1IKPA 3H3UA 2X5IB 1FMD3 3A0KA 4L97A 3MDPA 2IZWA 4PIYA 2BBVA 1J1LA 3DPRC 1XNBA 1KFXL 2EALA 3J8F1 2NP0A 4LA3A 1CPMA 4N43B 2DYCA 4DY3A 3VL8A 1G8WA 5T5LA 1XQNA 4P9WA 4RGAA 4GMP1 4OI2A 3E5XA 2G4IA 1H9PA 4XFBA 1VALA 5JWPA 5K0UC 3MIFA 2RM21 4Z2WA 4XMAA 4ZKTB 5JSPA 1U0AA 3ZVXA 2R0HA 1REFA 2JG8A 5JOYA 2JG9B 4XILA 1R1A3 4BMBA 4EWAA 2VPVA 5F1RA 1IPJA 2RM23 3IBMA 4XF1A 1VBB1 1U5YA 1W0OA 1RUG2 5FTTC 3IN9A 2SLIA 2VG9A 3ELNA 1XU1A 3VBRB 4NOTA 4YVWC 1X50A 4E2GA 4MZUA 1QKQA 1Y7BA 4P9YA 4D7TA 3AZYA 3NKGA 5DDJ1 3ZN6A 4RD7A 4LBOA 1GV9A 1NCQA 3C2UA 5LRSA 3MIHA 3M3QA 2RR13 2C0ZA 3LSDA 1CAUB 1PO11 1RVF1 2BNNA 3WG3A 3V0AA 2Y0OA 5DDJ2 1NA1A 4GB31 1UU4A 2R16A 3OYWA 4HZFA 4WM8B 3EBRA 4EN8B 1XE8A 3ILNA 5FDBA 2JG8C 4K20A 2B45X 4E2QA 4PF5A 5CFCA 1RUG1 3CF6E 4E4SA 3WY6A 3OGGA 4AGRA 2D3RA 5H9PA 3ACLA 2ZMKA 1NCRB 2WINB 4NHKA 1SQ4A 4INDA 4AFCA 1PIV2 4CEYB 1N1YA 3JQWA 2OZ6A 2WQZC 4PBOA 4UXAA 4ASMB 5AVPA 3PMSA 4CDXC 3FZ3A 4PDWC 4OHZA 3WDTA 1H8TB 5C9AC 1AR91 3S6PA 1Z7S3 2VU9A 4HK9A 1NOVA 1B35C 2A3WA 4MXWB 5FAXA 3A0NA 4MX3A 5IK5A 3I8TA 4JGYB 3NVCA 1SLAA 2CGOA 4D69A 1Q3EA 4FOQA 4P9GA 1KXGA 3KB5A 3NL1A 4QGNA 2N7GA 5DZEA 2WSUA 4SLIA 2ZZJA 2HWB3 2KM2A 4QQHA 5J36A 5FMOL 3LB9A 5T54A 2RMU1 3AXDA 4FTSA 1VRH2 1AXYA 3H1YA 3OTFA 1MVQA 3PVEA 3JUUA 3V0BB 3QOPA 1UZZA 2X5IA 2D6NA 2GMMA 1HQNA 4FPGA 2PN5A 3P3NA 2XBO1 2RHPA 2D7FA 1HXS3 1LOGA 2HWD1 4DPNA 2ZABA 5J98B 5GZFA 2D6PA 4B4PA 1RJ7A 2QUOA 1XU2A 1IHMA 4FPLA 1G9DA 1BMV2 2E51A 1ZA4A 2R062 3H3ZA 4JCKA 1MS8A 5DUVA 4EWDA 1ND2A 5EYXA 2ATFA 2H6BA 5HCBA 1H4GA 1V00A 2DCTA 2XJQA 4N7UA 4KQ7A 2ARBA 3DUIA 2P37A 5BYNA 2UYAA 2ZACA 5T52A 5KHJA 1V6IA 2ET1A 1C1FA 1GLHA 4BCUA 5HBAA 2GNBA 5J7MA 3WQ1A 3TN93 3J26N 4Y1ZA 5E89A 1NCRA 2PLV1 3KZ4C 4LNVA 2RS32 2X53S 5IT6A 3M7AA 3H50A 1GNHA 1W6QB 1CONA 1YCIA 2UWBA 3RWNA 2ZHMA 1QQP2 4IERA 3VBSA 4IQPA 4HN0A 1DGLA 1SDWA 4ES8A 1XYNA 1LENA 2VMGA 1D2QA 3JD73 2PTMA 1DQ6A 2HWF1 3J4UH 4W6WA 1NLSA 3B9IA 4P9IA 1S0IA 3V0AB 4W6YA 5J37A 3O5SA 4FPOB 2ZZQA 1OI6A 4J1WA 1OD5A 4YG3A 4KNCA 2OW4A 3DF0A 2GC1A 1S0BA 1AR82 1SCSA 2D98A 3CNAA 3KM5A 3VBUA 4LHKA 2EXIA 5C8CB 3VBOC 1JYCA 1FPN3 4ZU5A 4OI4A 2VH9A 1WD4A 1J3QA 3JB8A 4Y1YA 3BU7A 3IPVA 1SFYA 2B7YA 1QWRA 2Y38A 4JDNA 2ZBJA 4XBLA 5CB7A 5E8AA 1AR61 3D82A 1JBCA 2WNVA 4FOYA 4YZ4A 1ZZ9A 3DGTA 4FPFA 1HX6A 3TOJA 4LLOA 1PO13 1EAH2 1CGPA 2ZA9A 3WXPA 1H2NA 3FUQA 1DU3D 4H14A 3WUCA 1SBFA 3AMMA 4MGYE 3CL1A 3HMYA 2BYVE 3T2TA 2O0OA 1OKQA 5FREA 2JECA 4SBVA 2ET7A 3LZZA 4HVQA 3QH6A 1SLBA 1Q8SA 2TEPA 1VBB3 2W0XA 1VRH3 1W0PA 2WNUB 4QPIC 3WVJA 2ZAHA 3ZXJA 3SISA 2R043 3WW4A 4L8QA 3OGJA 2E7QA 3T1MA 1H1AA 3SMHA 2WNUA 1GSLA 2Q5TA 4FBFA 4HVOA 5JMCA 4Q0SA 3WCRA 1F5JA 2MEV2 2BW8A 4HK8A 1W6PB 4E4ZA 1LOFA 2AYHA 4YRDA 1AR73 4KL1A 1QJX1 1KJLA 4HKWA 1OSGA 3ZYGA 1YXWA 3NV2A 3LA7A 1H4HA 4PQ9A 4B29A 3JZVA 3ZXAC 1CR7A 4PDWA 3ME2A 5LK5A 3RYRA 4HFSA 4EN0A 1FOD3 1LHWA 2E63A 5A3MA 5AFBA 1Q5OA 2XL7A 3J8F3 5KHIA 5HI0A 2HWE3 5ACA2 1HQLA 2HWB1 3WCSA 1BVP1 2DF7A 5J48A 1IZ3A 2ZAAA 4V1PA 4FOWA 4JV4A 1D4VB 1QGLA 4JTNA 2R042 2WNUC 4QPIB 5CVRA 4ES9A 3VBUB 5FPZA 3HT2A 1PNFA 4RS5A 1O91A 3I59A 1S55A 2XJVA 3W9AA 4AQ6A 4CEWC 2DU1A 4ZU7A 3MEPA 2PAMA 3VV1A 3DV8A 1VBA2 1QU0A 4QPGA 1FYUA 1PVC3 2ZGSA 3VBSB 1HKDA 2R6QA 4OUSA 1CAVB 3KQRA 2A6VA 3TRSB 3PJYA 3JD71 1DDLA 2A75A 3ZXDA 4XQ4A 2JENA 2PHDA 5BNQA 4BOWA 3AX4A 3R4DB 4L11A 3CO2A 1PGL1 5D8AB 2BNOA 5D1IA 1IKQA 3S7EA 4QXKA 1ND2C 1C5HA 2RR11 3RS6A 3TN91 4BWOA 5C8CA 4OULA 5I0RA 2B8MA 3O0WA 1WLTA 3AMHA 1V6LA 1BBT1 5EV7A 2LM3A 2P2KA 2VMIA 4LUKA 3VZMA 1QJY2 1RUD1 4LBQD 1RUF2 2P3KA 5ABJC 3ZYPA 3ZXFA 1XNDA 2ZMNA 1EAH3 1S0JA 1S2KA 2WA3A 1RUNA 3VKOA 5AC91 3MPBA 3BTAA 4IEPA 5JLVA 3TYJA 5IK8A 2WZR2 2ZX1A 1NCQC 3UKTA 3M3IA 1LGCA 1DBNA 5FRAA 4YZ2A 5BY5A 3VBRA 4MGZE 2QKDA 1RGSA 4B7EA 1AZDA 1S2BA 3VKLA 1VBA1 1V6MA 2QZ3A 2X29A 4MH0E 4D7SA 1PZ9A 2YYOA 2VNGA 3B7MA 3UJOA 3ZN6B 4JTOA 1NA1C 2I2SA 2OUHA 1I1EA 2R1BA 4Q4Y1 1LU2A 4XYXA 1O3QA 4PBPA 1LJ7A 4Q4V1 1C1LA 3M70A 5D8AC 2D3PA 4P9LA 3VBHC 3W58A 1BZWA 3B94A 1HRV1 1XNCA 4XIOA 1PGW2 3TAYA 2UWCA 2DVAA 4F3JA 4RS5B 4U36A 3VL9A 2PYTA 4CDXA 4Y5Z0 2A6YA 1RMU1 1URXA 1OHFA 1NQJA 1F2NA 5DZGA 3QBQA 4N43C 4QT6A 1G9AA 3AK0A 3L2HA 1D0HA 2ZGNA 4IV1A 1JN2P 2MEV1 3ZYRA 1LEMA 1LHUA 3QCWA 4WVZA 3ETQA 1VBC1 2V73A 4IV1B 3D8CA 1VBA3 4OUMA 4CP2A 1WLWA 1Q8PA 5CBLA 1DGWX 5CFCB 1JTZX 2EAKA 4XMIA 1RUH1 1V9U2 1QJU2 3V65A 3KT7A 4AFAA 1DYPA 1OA2A 3KCXA 4C1WA 2K9ZA 2WZPP 2RMU3 4GULA 1ZZ8A 2YPJA 3KSCA 1O5LA 1PHMA 4XFAA 2QDRA 3FX3A 4AVSA 1FNYA 2PLV3 1VIWB 1O3SA 2XLGA 1H8TC 1RUE2 3D0JA 3IWZA 5SV5A 1FMD1 5C9AB 3KLSA 1RHI2 1I3HA 5FLIA 3NKTA 4LUMA 4NVPA 1ZRFA 5JOWA 4HMZA 5FCCA 4LO8A 4GWNA 4XFCA 2QFEA 1F9KA 3U4XA 2XVKA 1QOOA 1FPN1 3N7LA 2B46X 3WDXA 1U12A 2E7AA 2UY8A 1SMVA 2JG8B 1YJKA 2D43A 2YROA 1PZ8A 1ZRCA 2WQ4A 2YDEA 4DB5A 3LAGA 1QJU3 1COV2 2HEYF 3M8LA 2CGNA 1X7NA 3ATGA 2XWBB 4IV3B 4QQLA 3LGRA 1V70A 3V56A 2HEVF 5JI7A 1FPN2 1ND3C 4ATEA 1RUI1 5T5PA 4CEWA 4AK3A 3VGIA 4QPYA 4C90A 4COZA 4KWLA 4E27A 2O8QA 3VDDA 3LWCA 5L7OA 1RUE1 1AUYA 4FQZA 1BXHA 4M00A 5FOBB 3LKJA 4XFIA 2TUNA 1BYHA 5CFDC 2NLRA 1EPZA 4LR4A 4FCAA 4UW4A 2D44A 3RNSA 4LEJA 2WKKA 2RS13 4K9SA 1DG6A 2AR6A 3I59B 3RPQA 3SH5A 2VNOA 5BNOC 3FJSA 4ATFA 2GZWA 3IDEA 3NW4A 4L2NA 1AYM2 2EF6A 2WFPA 1WD3A 5CU1A 1YI7A 3GNEA 1MVEA 2W08A 1A8MA 1ZBA1 1BMV1 1ND3B 1PO22 4BLJA 3KT1A 1Y9QA 1BK1A 2NMOA 2Z69A 3MLKA 1OFSA 4HSLA 4CDQC 2HWF3 5HXVA 1KS5A 2XBO2 4I3GA 2NMNA 3A4UA 4LE3A 1ULFA 4M3CB 4QU2A 4Y1XA 3MPPG 1Z7S2 4Y20A 3UV9A 1WCDJ 2GNTA 3MGUA 2BFUS 4N90A 1SLTA 4RHV2 3NO8A 1NE6A 4FAGA 3AMPA 4MV2A 2ZX2A 1CX4A 1W6MB 1AF9A 3UJQA 1G7YA 1H8VA 2ZHKA 4WM7B 1RUC3 1YWKA 5BPXA 1QJY3 4FT8A 2AREA 1MS5A 3SH3A 3O12A 2XUMA 4AHZA 3ZFEB 1ZVFA 2HKXA 5BNOB 4D3WA 3RMXA 3OY8A 3SH4A 1U5XA 4QQPA 3RDIA 4KU8A 1V6KA 1TEIA 2FMDA 2BNMA 4L99A 4XXPA 2DCZA 1GZCA 1WMEA 4YGCA 5DZFA 1JH5A 2CY6A 3VLBB 4R9DA 1WW6A 1LECA 1PVC1 4OHXA 1VR3A 4AW7A 4QM9A 5FLHA 3ZMOA 1HXS1 4Q4W3 2WZR1 1PIV1 2PQQA 1LEDA 1IQAA 1ZYBA 4YW1A 5LRRA 2XKOA 4M3CF 2ZPXA 2E7TA 4C0BA 3AFGA 1Q8OA 4IL7A 3U0ZA 3ZPYA 1S0GA 5FOJB 4AHYA 3M3OA 3O0XA 5C4WB 1W6OA 3LOIA 4WM7C 4E9KA 1GZWB 1BEV1 3R4UA 4JC1A 1BBT2 4K6BA 4QPIA 4BYYA 2GC0A 1AXZA 2X8KA 1VB2A 1RUC1 3AYDA 1X82A 3TNPB 1S0DA 1AYN2 4DQAA 1XNKA 4AHWA 4OHYA 4XJAA 1OQEA 4AG4A 3APBA 5JIUA 1B35A 4FSJA 1QXPA 4A3XA 4CDUC 3TWIA 5F9TA 1A6CA 3JD72 4QD2A 2XLAA 1TME2 3RMYA 3ILFA 1FATA 1TMF2 4M01A 1VBB2 2WT0A 4YFZA 2XH6A 3FMGA 1H1MA 2QJVA 5GKAC 5AFEA 4YGDA 4PJYA 5KHHA 4UW3A 4XJ8A 1E57A 2DCJA 1UAIA 1MACA 2D5FA 1APNA 3D5OA 1A8DA 1ENRA 4KGQA 5DG2A 4Z8BA 1QJU1 1LKNA 2Z42A 4YYOA 2XBO3 1RUG3 2E9QA 3GZUC 1NYWA 3VZJA 3RQ0A 4BQ1A 3HIFA 4YM2A 1N1SA 1PO23 3WX5A 3MZHA 3PHMA 1DIWA 4PLMA 3SXWA 4DOUA 3ZFEA 2MNGA 5AVAA 4JVAA 2ZGTA 4H7LA 4RFT0 3ZX7A 1CAVA 1UD1A 2YY1A 4JGZA 3ES1A 5ACA1 4XJZA 1OLRA 2YV8A 5SV8A 4A7YA 3WG4A 3H0OA 2PHWA 3ZXGA 2AGSA 1O7FA 4XTMA 4ZXKA 2F4PA 1R092 2VNRA 2DVDA 4RSUA 2Q30A 3IM0A 5D8AA 4RR3C 4R8HA 4AEMA 4WZFA 1PO21 4DZGA 2DVBA 2ZGOA 4Q4Y3 4XTPA 2OYZA 1L3JA 2WFF2 4RGGA 5JZGB 2ZMLA 1ALYA 3AKPA 1ZZBA 4IXLA 1TNRA 5BV6A 1HRV2 5LK7B 4HL0A 1SBDA 3WR0A 2JX9A 1Q8VA 1QH7A 2G9FA 4CEWB 2DFBA 4XBQA 5GJ6A 4BE3A 3VBSC 4DRVA 1RUJ2 3BOWA 2WLQA 2ZCWA 3B93A 2BTVC 1AL23 4Z92B 3FFZA 1QMJA 2PHRA 4F83A 1TME1 3KCYA 5I8SA 1LOEA 1VBD3 4LT5A 2Q0AA 2WJSA 3ZFGA 3IDBB 1LOCA 1AX1A 4A2UA 2DCKA 1ZM1A 3KGZA 1AR62 4R9AA 2GH8A 2HWE1 3JQXA 1ZBE2 1UZYA 3FFQA 4B7KA 2Y0IA 2IXLA 5GLUA 3VBHB 2QNKA 1D4M3 1PVXA 5GALA 1VAVA 4MUVA 1WUVA 5J09A 2KXLA 1RUI3 4LHNA 4M0NA 3WDVA 3KMHA 1YLLA 1H30A 1AR81 3AZVA 3MW3A 3EJKA 5E88A 1GNZA 4YVSA 3N35A 1S0CA 1YFWA 2GMEA 3PNAA 4BIFA 4O9EA 1R1A1 2GALA 2AZ5A 2RJKA 2A73B 5JPMB 2R063 2WFF3 2G9GA 1UL9A 4QPGB 1ZBE1 1YJLA 1EPWA 3AYEA 1QOTA 3LOBA 4LBQA 1JOJA 1OFNA 5EXOA 3AXEA 2FHRA 4HBNA 4MXWA 4N43A 4GH4A 3BCWA 4AVBA 2I07B 4IV1C 4HETA 2YUEA 4AVTA 2O8OA 4JGYA 3ZO0B 3H7YA 5CFCC 1AVBA 3PVOA 2FQPA 5FO9B 5GLWA 4QGMA 5HCAA 3VHPA 1XXNA 1PNGA 3ZXKA 2ZX3A 4HANA 1CN1A 3AP5A 4LBNA 1RUH2 4GWMA 2YZ4A 3L2YA 4IV3A 5J96B 4JGZB 3GBGA 1XYOA 4R4XA 4X6RB 4AWDA 5I91A 4E4DX 2NN8A 3AP7A 2WFF1 2DWRA 2LUWA 2A6XA 3S30A 3SCFA 1YYNA 2ZX4A 1W2UA 1QJX2 1EYBA 4JDMA 4LBKA 3MW2A 3WG1A 1FXZA 3VBFB 3S0MA 1QH6A 4EN6B 1LR5A 4G9SB 5T50A 4IEVA 2VECA 4CZSA 1KS4A 3HQXA 2A3YA 3N3HA 2Q8OA 2VVDA 1O4ZA 3ES4A 1HIXA 1WLCA 1H1IA 4OFGA 1FOD2 3DL3A 4FXKB 2QQPA 2HYKA 4JAAA 4Z07A 4JQRA 4IV3C 3ZFFB 1PK6B 3CLPA 1KD7A 2JJ6A 1KRIA 1FAYA 4WBBA 4Q4V2 4YARA 1CQ9A 2BWCA 4B4RA 2DV9A 4FQ4A 1AR92 1SLIA 3FLPA 2GMPA 4Y26A 1AJKA 5EZWA 4QMAA 4H3WA 4XJ9A 5FQ0B 4IESA 3VZOA 1Y43B 2HJIA 4Y20B 2PAKA 3B69A 1NLRA 5DXDA 4YGBA 2PHTA 1R1A2 2H0VA 4J1XA 1N1VA 1X36A 4AI2A 1AYN1 5BXXA 1OPMA 2V5YA 1UKGA 1VAKA 4MLOA 4N53C 4NO4A 4I0WB 1NZCA 2ILMA 3EHKA 4NWWA 1NCRC 1EP0A 1C28A 2SBAA 2XJPA 3GBFA 1PK6C 1LTEA 1DQ1A 5FBZA 4O9GA 3JU9A 4WVVA 3WDUA 4HT1T 5JDBA 3NSTA 1Z78A 1K5MB 4AQSA 4AI1A 2DFCA 1HDKA 2HWE2 1X8MA 1AL0G 4K8FA 1RHI1 5CA6A 1FV3A 4HSJA 3ZMNA 2GH2A 2RS31 5I8YA 1OQ1A 2PLV2 3CJXA 1PM7A 4DNYA 3M3EA 2TBVA 4A7ZA 3WV6A 4LBMA 4Q4V3 4NHMA 4WM7A 1MZEA 2W39A 2P3JA 2PA7A 4AEJA 1OA3A 3OBRA 4ORFA 2CWSA 2Y26A 4KWJA 3P3PA 1O4TA 4YG6A 5C6CA 1KFUL