2JG8C

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
total genus 29
structure length 131
sequence length 131
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8C00
2RJKA 2Q1MA 4D7YA 4OULA 3QD6A 2E7AA 5HBAA 1ALYA 2O0OA 3AB0A 3TWIA 4F3JA 3LKJA 2TNFA 1TNRA 2WNUC 4QQHA 4MSVA 4G3YC 4KGGA 3K51A 2QDNA 2WNUB 3QBQA 2WNUA 4HT1T 1A8MA 4MXWA 3B9IA 4RSUA 1GR3A 4TSVA 3WD5A 1KD7A 1OSGA 4G4FA 2WNVC 1DU3D 3URFA 4QQLA 1S55A 2JG8B 3TYJA 2WNVB 2ZJCA 3FC0A 1RJ7A 1OQDA 2WNVA 3ALQA 1U5ZA 2X29A 2R6QA 5KWRA 4N90A 2AZ5A 2QE3A 1D0GA 4KGQA 4MXVA 1RJ8A 3IT8A 4E4DX 3ME2A 2HEYF 4NN0A 3B93A 1U5YA 2JG8C 2ZPXA 1D4VB 2JG8A 2RE9A 4OUSA 1C28A 1D2QA 1OQEA 2RJLA 4QQPA 5TSWA 4E4SA 5KC5A 1PK6B 3L9JT 4KG8A 1XU2A 2Z5WA 2Q8OA 1DG6A 4OUMA 4QPYA 1C3HA 4EN0A 1TNFA 2TUNA 1JH5A 3V56A 1O91A 2R30A 2HEWF 3K48A 4DOUA 2OIIA 4QQ2A 5L36A 4TWTA 4QQOA 4DB5A 2R32A 1JTZX 4GIQA 1PK6C 1IQAA 2HEVF 4MXWB 5L19A 1KXGA 5KC6A 2JG9C 3MI8A 5BNQA 1PK6A 1WCKA 1XU1A 5CIRA 2JG9B 1I9RA 4J6GA 2KA3A 1U5XA 2JG9A 3B94A
chains in the Genus database with same CATH superfamily
4OZOA 4QGNA 3L2YA 1YWKA 4AHXA 4EWDA 1UOFA 5IT6A 1NCRA 5EZWA 3ZYFA 4HSLA 4UW4A 3QD6A 2JECA 2C9KA 3UGHA 4AE2A 1VBC1 3U1XA 5FZOB 1JOPA 1UU6A 5IAVA 3V0BA 1ODMA 1RUG1 2DCJA 2OKXA 4H2AA 1C1FA 3BU0A 5F7UA 3FMGA 4XIOA 1EP0A 3MIEA 1VE0A 4FXGB 2YFUA 5ISLA 3QBQA 3W5NA 1RUI2 3KV6A 4MXWA 2AEZA 4R9DA 5BY5A 2X53S 1O8SA 1SPPA 3E1F1 5LK5A 3ZXKA 1ASJ2 1OH3A 4CTEA 2VVEA 4Q5OA 4YW7A 5T54A 2R042 5JDBA 2P3IA 4AFMA 1BYHA 1S2BA 3H42B 2G1MA 4FQZA 2E32A 2X5IC 2JG8B 2XKPA 3NVCA 4PI0A 2JDPA 5AVPA 2I45A 4IUGA 4OYUA 5FV3A 4LHLA 4GA9A 4N43B 1Q5OA 5FPBA 2F4PA 2GNTA 2BTVC 2VXJA 1PO23 2YU1A 1O5LA 2IWGB 1VBD1 4L9BA 4JHZA 2A3XA 5LY2A 5FZOA 2BDRA 2WNOA 3WDYA 1GWLA 1GWMA 3MICA 3PU3A 4AFCA 2CYFA 2I2SA 5AFEA 5KWRA 2ARXA 2PXJA 2DWRA 3VV1A 5F8PA 2W47A 3OYWB 4QB2A 5FO8B 2RDNA 3MFAA 4Y3OA 3ZFFC 2RJ2A 5C7GA 1Z0HA 2VW2A 4CDQB 4NN0A 3HQUA 1YEWA 2YC4A 5IK7A 5LEJA 1VRBA 1TG7A 4A2UA 2PN5A 1DQ6A 1QGLA 5FZIA 4D6QA 2QFEA 5CU1A 3IZOA 4IGOA 4LJHA 2BBAA 2TBVA 2JG8A 4CCDA 5GZEA 1DYPA 4OUSA 1AYN1 2P1BA 4KU7A 1GQGA 3Q8FA 1MZ5A 1CONA 4CEWB 5FPUA 2VUAA 4N43A 4KNCA 1UXZA 3VD7A 2VVFA 1WMDA 2BRTA 2GC2A 3R05A 4GKYA 4W50A 4QPGA 4EWAA 2VBPA 1PK6B 2VBBA 4JV4A 3WINE 1GOFA 3WW1A 3OGGA 2AACA 5E89A 3E5UA 3DGTA 3NV3A 1VB2A 3VBHB 2YB7A 1VBA1 4UFLA 3FBYA 5J48A 3SEPA 3OYWA 3K4DA 1GP5A 3POJA 3POFA 3B5LB 3R6SA 4OI0A 1XE7A 1LGCA 3MUZ1 5APAA 4Y1YA 1R1A1 4FSJA 1BVP1 1OT5A 4QDSA 1US3A 3O0XA 4JHTA 1GFF2 5KHIA 4BM8A 3PUHA 5FUPA 3VUOA 1RMU2 1PVC2 2J1AA 3D4KA 1JXNA 5LEKA 2RR13 4O65A 5FMDA 4CEWA 1TMF1 2YPDA 1FV2A 3O12A 4CA9A 2UYBA 4DXSA 1YCIA 2JG9C 3AYEA 2PHWA 5FOJB 4MYEA 1PK6A 1ZRFA 3VZMA 3AX4A 5LA9A 1W8OA 1ULPA 3CHXA 1RUD3 3MBWA 2KA3A 5H9QA 4Y1XA 1NZCA 3KV9A 3VBHA 1H6XA 5A3NA 4UI9L 1V9U3 4FAGA 2RJKA 1ULGA 3JD71 3UKTA 1ND3C 2Q8EA 4HOOA 4HXCA 5LA2A 3WP5A 1OKQA 4PLMA 4O9EA 4GB31 2XPJA 5FYSA 3NKTA 1W0OA 4HVOA 2GMEA 2R0FA 2R072 4AAXA 1C5IA 2E63A 1VRH2 4AEKA 3ZM8A 1MQTC 2A6XA 4LUKA 2HKXA 4Q8LA 3PU8A 4FFFA 4D7TA 1YLLA 1FI2A 1VMJA 2Z4FA 3HN1A 3TOJA 3KT4A 4L8QA 3WNKA 3J8F2 1L3JA 2WC2A 2XWJB 1CAUB 4K20A 1YI9A 2XLAA 4V2WA 5BNOC 2VW0A 4Z07A 3LPGA 2NLRA 3IAQA 2FQPA 2RMU3 5C3PA 1X82A 1PGSA 1RUF1 2JXAA 3KQRA 4FPHA 1K42A 1LECA 4M3CE 1LESA 2X5IB 4BXSV 5FZ7A 2XUEA 1UXXX 4F7ZA 5FLHA 3E6BA 4HANA 1KDMA 4K40A 4BE3A 3E5QA 5J3UA 5KXCA 1C8M2 1NG0A 4Z2WA 4ZXEA 1AX1A 4YZ1A 3NSTA 1BJQA 1K12A 3AVSA 3M4FA 3RZGA 1ZZ7A 5A32B 3OGVA 5F3GA 1AXKA 3LOIA 4BU2A 3N7MA 4NO4A 2RM21 2WFF3 1RUOA 2R061 1FNZA 1QJU3 4AVBA 4Q4W2 4D6RA 1HIXA 3UYJA 1NLSA 1CAUA 3FLRA 1QNYA 4Q4V2 4Y26A 3C7HA 1R081 2A3YA 3GZTB 2ZHLA 1E5RA 4ONUA 4RR3C 3ZX7A 2PAEA 4INDA 1DGLA 1NE6A 1CN1A 4YARA 5KXBA 1RINA 5LZ6A 4BQ3A 2ENRA 3RS6A 1HJGA 1UZVA 2K9ZA 3AP7A 1FV3A 3NNGA 4LE3A 3M3OA 5EJ3A 5GJ6A 1TME3 3GJAA 2XHKA 1QJX2 1X36A 5DAWA 2BQPA 3OUIA 4FOQA 3MZHA 5DUWA 5KHKA 2WFPA 1PZ9A 3IDAA 4EROA 3RZJA 4HKWA 3WG2A 1ZZ6A 5B4XA 1UZZA 4KL1A 3ACLA 4XPVA 4DNYA 4JDOA 4CDXB 5A32A 5J7MA 4QX5A 4XZPA 1L7LA 2H0BA 5FZFA 1GZTA 5T52A 3NAPA 1VAKA 1GSLA 1RUH1 2VCMA 1CAWB 2WFF2 1M06G 4DUVA 2WKKA 4PBOA 2DDUA 3AJYA 4M0HA 1AR72 5FXZA 3PUAA 1TQ5A 1X7NA 4JGZB 3AK0A 2WWSA 2ZEXA 4JQRA 5LBCA 1W99A 1GMMA 1PO21 3RWKX 3FFQA 1AL21 3RZLA 1U5IA 4FTEA 2R49A 3DPRC 4JVAA 2K0GA 2WWJA 4O9GA 3HR9A 5F9TA 2XBO1 3HWJA 2JG9B 3IDCB 2PHXA 4BMBA 4HVQA 4LMFA 3FHQA 4LK7A 3MEPA 1RHI3 4BPZA 1GOHA 2ZS6B 3QACA 5DN2A 3RRDA 4CDXA 1OUXA 4D7YA 4Y20B 4YW3A 2OZ6A 5HCFA 5LBEA 4F3JA 5CKMA 2J1UA 1CAWA 1ND3B 2QQNA 1CIWA 2Y60A 4XETA 5DDJ2 1UYYA 1V6IA 4LBQB 1MS8A 1DZRA 5IHRA 2UYAA 2FMDA 4XW3A 4RD7A 2O8OA 4JGZA 1QU0A 2CY6A 3SISA 5E8AA 3HPNA 3H9AA 2E33A 4XF3A 1ONAA 3WX5A 3AZYA 2BW8A 4NRMA 1QF3A 1W2OA 3VZLA 1Z7S2 2FCUA 4E8DA 1F31A 1BEV3 3AXDA 4NHLA 2D98A 3LDBA 3ZMNA 4DY3A 5FMOL 3BKZA 5A1LA 2IZWA 3UT0A 3EO6A 1WCQA 1YQ5A 4MHRA 5JZGA 2R1DA 3WCSA 4BK5A 1ZREA 5T5JA 2ZX3A 1O7FA 2VQ0A 1K5MB 1MZEA 2RG4A 3ACFA 1JMUB 1BK1A 5A7WB 2EALA 1LODA 1JYWA 1TVGA 2VOXA 1NQJA 5D1IA 3AZVA 3U4XA 4K7JA 3NO8A 1RJ8A 4CZSA 3VHNA 1ND2C 4A42A 4CXXA 4GQ7A 1V6OA 2RR11 4XILA 5FZ0A 3D6EA 4XZUG 2Y6GA 5FCCA 4XDPA 2J42A 1CJPA 3SITA 1S0FA 1UY4A 1QJY3 4CCEA 5GZGA 4ASMB 1H2NA 1AR63 1U5YA 5BNNB 3O1PA 2ZGOA 5A3WA 3PLQA 2P5BA 5K7PA 3GYDA 1RUD1 2WL1A 4YYOA 1V9U1 4XJWA 1BMV1 4PBPA 5K4LA 4BISA 3N7JA 4TXWA 1JZ3A 2RHPA 1FT9A 5IWFA 1K5MA 4LK6A 3BPSA 1IS6A 1BZWA 1WUVA 4HSJA 5A7WA 1IHMA 1R091 4KG8A 4NIHA 3BI3A 1O3SA 5A3TA 2W87A 2YMZA 4MVTA 1J59A 3FFZA 3KT1A 4RHV2 3QLQA 2KR2A 5HCHA 4QPIA 4AFBA 2HWE2 3ZSEA 3OEBA 4H55A 4XFAA 2ES3A 2W52A 3FLTA 1B35C 1IG3A 3DKQA 1PX3A 3JBG2 4QU2A 4A4AA 4D6SA 1EY2A 4BWOA 3WW3A 3NKGA 5BNNA 3FJSA 3PNAA 3NJVA 2WINB 2RMU1 4RQPC 1W8FA 1ZRRA 1S0CA 1RUJ2 2WR9A 4Q4X3 5C4WC 2YHJA 2DU0A 3CLPA 1W90A 4O61A 1OLRA 4FAHA 4NPMA 3FN9A 3NV4A 3WNLA 3JB8A 5IFTA 1W6QB 2VG9A 5FY9A 1DYOA 1LGNA 1HB2A 1YIPA 5FYCA 2DVBA 1S2KA 3SKVA 4MGSA 5K8SA 1RB8G 1UN1A 2Y38A 1NY72 1OD5A 3KHBA 3U14A 1W6OB 1HW5A 3B94A 4HG6B 4YNIA 1G9BA 4FT8A 2JIJA 4C0BA 2CHHA 1QJU1 1R64A 2KXLA 2W92A 3S30A 3OUJA 1AX2A 2JDAA 3E6DA 3FWEA 4YFZA 4XMAA 4JTOA 1XC6A 2DURA 2XMLA 4RL7A 2HWC3 2WT2A 1ODNA 1NA1C 3GM8A 1W39A 4GMP0 4QX1A 1W9YA 2WAOA 3ZSMA 1MVEA 5IVEA 4R8HA 1BHGA 2VZ3A 3OPWA 4YW1A 3GJBA 2QQUA 1ULFA 3ZPOA 1QH6A 2CAUA 2GSYA 2W0XA 4LITA 4HT1T 3ZR5A 5JCTA 3A7QA 4YM2A 1NUKA 1A8MA 1OURA 2WDBA 2HH9A 3AZXA 3B9IA 2Q1ZB 4Y5TA 3ZIWA 1W8ZA 4NAOA 3LEMA 1TME1 2CWSA 1IZ3A 5A6QA 3O5SA 1QXRA 3W58A 4LKEA 5I0RA 1CAXB 4DPNA 1H6YA 3VKMA 5KXDA 1DU3D 3T2PA 5FYYA 1H1AA 1L7QA 1UPIA 3TYJA 1W2UA 5AC92 2XUMA 2ZJCA 2NP0A 1SFPA 1LHNA 4YGBA 4WVVA 5FKBA 3VBFB 1JZ8A 2YY1A 5GZFA 1D2SA 2QQOA 2DBNA 4BIFA 3E5XA 1C5HA 2DFBA 1OLMA 4ARYA 4W8JA 1SMVA 2ORXA 1IPJA 2WS92 5FPLA 3RJRA 1S2EA 1DF0A 5GM0A 1RUNA 3ZN6A 2PLV3 3KVBA 3MV11 5JMOA 4GKXA 4K8RB 3B93A 4D94A 2WIIB 1RVF3 5KHGA 4E27A 1LR5A 2VY0A 1DZTA 4AQTA 1CAXA 4B3NA 4UFMA 4J25A 4AEMA 3ZFGC 1RHI1 1N3OA 3VB9A 5A70A 1WLCA 2WA4A 4JZRA 3WHUA 1CVNA 5IVBA 3VZOA 1UU5A 4TLGA 4EYUA 3RSJA 3GZEA 2JEMA 5JI9A 3VBFA 1VBB3 4COUA 5FZCA 4Q1PA 1WCSA 1RUE2 3QH6A 2ERFA 5FMOS 2ZBJA 2Y26A 3CKHA 2BVBA 3ZXGA 4XF4A 4YG6A 2OXBA 4QPYA 2IFWA 2PHTA 1H2KA 1G6NA 1JH5A 2XJRA 3W5MA 1O91A 1U12A 1VBE2 1UOGA 2Y6JA 5FMBA 1FATA 1GWKA 1XNKA 2G9FA 3N7LA 2Z79A 4TYSA 4EE2A 1QDOA 4X6RB 2W08A 3ZYRA 3I3QA 4CE8A 3O1VA 3VN4A 3R4SA 5F3IA 1BEV1 4YPJA 5BPXA 1EV11 4DRVA 5JWPA 4QQOA 3KMHA 2A6WA 3CO2A 4EZ4A 4E9KA 3H8RA 1RC6A 1I1EA 1AR82 4L99A 4JKKA 1Y9QA 4XFBA 5EV7A 5CNAA 2D93A 4PDWB 1XSQA 5CFDB 5C4WB 2B42B 4AXOA 4FPKA 2IXIA 4W6YA 5FOBB 2ZABA 5BNQA 1W9WA 1WCKA 2JICA 4E4ZA 1PGL1 3RWNA 2BGOA 1NCRC 2VZPA 1MZFA 4YSFA 3ZXFA 3CZUA 1W3XA 5JPNB 1RXFA 2RS12 2E6VA 1KITA 3IB3A 3WR0A 5JIUA 4URTA 5K0UB 1YUDA 5H9PA 5JOZA 5A1AA 1WLDA 1QJY1 4DIQA 4FTBA 3MLJA 4YZ3A 1AR61 2LROA 2PYTA 2ZGSA 1XNDA 2VTFA 2UWAA 3MPBA 3WV6A 1MEC2 2VNVA 3M7AA 5FPXA 4OHWA 1AX0A 2W46A 3VLBB 1HV0A 3MDPA 3UKVA 1PMHX 1F9KA 4B1MA 1LHOA 1X33A 1BBT3 1FOD3 4PDWA 4IEXA 5CFDA 2Z42A 4A6SA 4RSUA 1NE4A 1A34A 3RMXA 4UYBA 2VW1A 4NPLA 3R4DB 2B9UA 2BOJA 4TSVA 4XFGA 2GNMA 3WD5A 3RZKA 1QQP3 4B1LA 1HQNA 2HYKA 3I2HA 4XJAA 4ZONA 3K4AA 1GZ9A 4QQLA 2VMEA 5T3NA 2JDNA 3P3PA 5C3QA 3WG1A 1VBC2 1SLCA 2RS33 3AXEA 1CESA 2VTXA 3MF6A 3MLLA 5K0UA 1DDLA 4KH9A 3O1OA 4PJYA 1N1SA 2QDRA 2XKOA 4FPOB 1F15A 1EAH2 3NWKA 2AGSA 1KFUL 1D4M3 4Q4X1 2B46X 2VUDA 1LHVA 2W1WA 2CV6A 4KGQA 2DUPA 4NWWA 3ZPYA 3WUDA 3T1LA 2OYZA 2HEYF 4MZUA 4M3CF 2SBAA 4Y5SA 3SNMA 3I2GA 2ARAA 5FP3A 3EMRA 1BBT2 1SBEA 2JG8C 4P9LA 1QMJA 3RJ2X 3USUB 1JZ2A 3TEYA 1K5JA 3NV2A 4MGTA 3PIGA 4QU1A 4N43C 3OOXA 4IE7A 3WNMA 3BALA 4ASKA 4URAA 5FP4A 1COV1 4QPGC 2ZEWA 3DYPA 2DUOA 3WW2A 2GNDA 2P37A 4LEJA 3SCFA 5JI7A 1H9WA 2P4EA 5EJ1B 3TAYA 4YZ4A 1GQPA 3ZSLA 4DZGA 4YGDA 5HCBA 4AAPA 3THCA 2LM3A 1QHDA 2HWC1 1CJDA 4BK4A 4IEWA 4DMIA 4GALA 3LA3A 1YXWA 2RS32 4XOGA 4GH4A 1N1YA 1DG6A 4FTSA 3AM2A 2VBDA 3FHIB 1JUHA 3VGIA 4KWKA 5FO7B 5CA6A 1V6LA 2HWF3 4SBVA 5DAVA 1ZA4A 5F6KA 4I3GA 1FAYA 2CSGA 3AKQA 4KG0A 5FP7A 5HXVA 3WF3A 4CCJA 2WO3A 2WZ8A 3OCPA 4LKSA 2UWBA 2BERA 3AVRA 3USUA 3OPZA 4QM9A 4HN0A 4CEWC 3GBWA 1JTZX 1DCSA 5IJRA 3GZUC 1U0AA 4RFT0 1PK6C 1W3VA 5BUVA 1LOGA 2BP6A 5DAPA 1GP6A 2HEVF 4BIOA 4IE4A 1V0AA 2DF7A 3VBHC 3H8XA 4X6QB 2OPKA 3TNPB 5JAXA 1XNBA 3BYWA 1WD4A 4Q0SA 3TBDA 1STMA 4IGQA 3VDCA 1E5IA 1WA4A 3LIGA 2VQAA 2H6BA 3GF6A 3I3DA 3PUSA 4CU6A 3N35A 1IPKA 3M2MA 2CU5A 4NROA 2PLV1 5JUVA 3LDRA 2E7AA 3PTRB 4CUAA 4CP0A 1ALYA 3V0BB 1I3HA 1PIV2 3LA7A 4P08A 1YQ2A 1H1MA 1RVF1 4LTAA 4MO3M 1NLRA 2YZ4A 3HBKA 4ZS2A 1XNAA 1RUI3 3TN92 5LW9A 1A6CA 4AVAA 1OLME 4LULA 1HN0A 5A7NA 1ASJ3 1MS3A 1Y9GA 2PAKA 5JR2A 4BCUA 2R043 2Q4SA 2WNUA 3T1MA 2BNNA 2JX9A 4BLIA 5IYYA 3ASIA 3SCGA 5A3OA 1VBB1 3W59A 2VR4A 1JYIA 1HB1A 4XUNA 1DHKB 3KV4A 1GZCA 1HRI2 4B7KA 4MLOA 4XJ8A 4OZXA 1AF9A 3WW4A 3B00A 1RXGA 5C3RA 5LK7B 3OGSA 3RYKA 4GWMA 3BTAA 2GP5A 5FYHA 4AGRA 1Q8OA 3I2FA 2MHFA 3PTYA 5FZKA 3WF2A 4JKLA 4ES9A 1LOAA 2GH2A 5FZBA 3DUIA 4HETA 3VKLA 1D0GA 2F6BA 4K1ZA 1IG0A 4LBNA 1YHFA 1JYTA 1PVXA 2XJUA 3FL7A 2NYYA 1N3PA 2WUHA 3GHNA 2D5HA 4YW5A 5FZ8A 4BYYA 3VDBA 2XL7A 5DUUA 3N4MA 4FFGA 2ADEA 1JU4A 1W9TA 4CU8A 5EFUA 5AVAA 5IK4A 3ZYBA 1F4AA 4V1PA 2D3PA 3LIHA 3KCXA 4IE6A 1OA3A 1NAEA 2EVXA 2OT7A 4UBGA 4XTPA 3O14A 2B8MA 5GLUA 1KS4A 1GUIA 2QCSB 2W91A 5LY1A 2GMMA 2P6HA 3ON7A 2NMOA 3MHZA 3VZKA 4JGYB 4QPGB 4IGPA 3WLUA 1JW6A 2ZX4A 1XRUA 3SLIA 2BPA2 1PM7A 1XQNA 1XE8A 3C3VA 4GMP3 1OD3A 4PLNA 4QKNA 5EHDA 3NAPC 2RM22 4CRQA 5LRSA 1G8WA 3KM5A 1XSRA 2QQWA 1WGPA 3K48A 3PDQA 3HEIA 1PGW2 3OD0A 2E31A 1RMU3 1X50A 1HQWA 1PVC3 1ULOA 2X09A 4N9IA 5LWBA 4QQ2A 1QQP1 1VMFA 2XGXA 3VD4A 3ZIXA 5BNPB 5FJHA 4PF1A 1NXMA 3DEMA 2BGPA 4HONA 1F2NA 3P6BA 4BDVB 1GNYA 2P17A 3ACGA 2A6ZA 3K3NA 4JGYA 5JXGA 5FZMA 4FPFA 1EPZA 1W9FA 2Q5TA 5LBFA 3PHMA 4CDXC 3KSCA 3NW4A 2GDFA 5FZ9A 3UV9A 3P1IA 1D4M1 5D8AB 5EIYB 5LCWL 2MEV2 2OQ6A 1LULA 1MACA 2EXJA 2VMHA 2WABA 1S0BA 3VKOA 3NJXA 4QXKA 2DCYA 2R073 2WO1A 5I8SA 3VHRA 2JD9A 3WNXA 2NMNA 1VRH3 4OMDA 4C91A 4JGZC 5JMCA 3ILNA 4I01A 2A1XA 4YW6A 5KXEA 4A7YA 1HX6A 4LO8A 3IDEA 4MSVA 4OMCA 5A7OA 1JZ5A 1W28A 3J8F3 5BNPA 1W0NA 4IV3B 1O4ZA 3B7MA 4KU8A 4LLOA 4AVSA 4TTGA 2EA7A 1J84A 2JDUA 2XOMA 4ZU5A 5LBBA 2XBO2 5JZGC 1AXZA 1POV0 1KD7A 4LKFA 1YC61 2VGDA 3LF7A 5JXJA 3IWZA 3WT3A 5D8AA 4EQVA 4YM1A 1RL3A 1Q56A 2VECA 4ATFA 4LR4A 3U78A 2HWF1 4A44A 5CFCB 3H7YA 3FC0A 1WWYA 1C8M3 2DVDA 1FNYA 3J9SA 1CD3G 2P3JA 3POBA 5FFOC 3ZYGA 1W2NA 3BVCA 3S0MA 4XFCA 5E16A 5FBZA 5LA0A 2QQIA 1OHFA 3ETQA 3WQ1A 1U5ZA 1SFNA 1VR3A 2JDKA 5H9SA 2JB4A 3NNJA 3ZXJA 2FZ2A 3AKTA 4Q4W3 4E4DX 1JHJA 3WG4A 1FXZA 4EV0A 5F37A 1IKQA 2ZXQA 2BU9A 5FUIA 2JE9A 4FPYA 4IV3A 4Q4V3 5A80A 3AC0A 5FYMA 2LALA 3POGA 2UU8A 4XFFA 3S57A 2WYSA 3PL0A 4U2AA 3VDDB 1V6NA 1QXJA 5FTTC 3N3HA 4XC9A 3UJOA 4FCAA 1NZIA 3ZSKA 4LBQD 1XYPA 3MIBA 3CJIB 1J83A 1K5MC 1PZ7A 2VMIA 4E2GA 1PNGA 5J37A 5DG1A 3FHAA 1W04A 1I6XA 1QJX3 2VZOA 3BB6A 5CFCA 2HYXA 5JVVA 4QD2A 5M0TA 4YVWB 2OUJA 2YC2A 5KC5A 1GNZA 4AHYA 4QPIC 1JHNA 4CP9B 2JDYA 1RUI1 2WZR1 4BQYA 1WKYA 3ACIA 5JOWA 4U36A 1ASJ1 2VPVA 1LAJA 2R041 5BNNC 4B7EA 2HEWF 1W6NA 3D5OA 3HNYM 3NAPB 1YQ6A 5EPAA 1AR73 2TEPA 5EQUA 2QQLA 3LFMA 3GBFA 5I0SA 1OVPA 2ZGTA 3SQOA 1N1VA 1E5SA 1GU3A 4K21A 2R32A 4CDUB 4RFRB 5EXOA 1BMV2 2G19A 2ZKNA 3Q8EA 3CJIA 2ZGUA 2N7GA 4GZ9A 2BGCA 3HOBA 4ZKTB 3TNQA 1HV1A 2RS52 3MV01 3WQ0A 3POSA 2Q1FA 3ILRA 3Q8CA 4YVWA 4EN9B 5KC6A 3K3OA 2CL2A 1FPN2 1S0GA 3MI8A 4MADA 1JI6A 4R9BA 4FO9A 2BUKA 3SHRA 4A3ZA 4CP9A 4NHXA 4I0BA 3U4SA 4IL7A 4M4RA 4P5HA 2A70A 1SLTA 5JPMB 2C24A 4DS0A 1H4GA 4JDNA 5HXMA 3WNNA 5DDJ3 2Q1MA 4AHWA 4DEQA 2ZAHA 4UW5A 3WDUA 1H1IA 1EUTA 4OULA 5FYZA 3VBUB 1HXS3 4HKOA 5HBAA 4WV8A 2Y0IA 5CG9A 1DFQA 1SCSA 1X8MA 2EIGA 4QQHA 1G86A 2ZGNA 3J7NA 4RN5A 4CDUA 3SH4A 1Z7S3 1WBLA 3DYMA 4LO6B 3TRSB 1ENRA 3VZJA 4UWDA 3HIFA 3D0JA 2OS2A 3KVAA 5DQ0A 4WVWA 1VAVA 1QEXA 2Y8KA 1NCQB 3MW3A 5CB7A 1PO12 4GMP1 2HJIA 1QWRA 3H3UA 5FZLA 1D7PM 5JZGB 5L9RA 5D2AA 1S55A 3ZYPA 2A71A 2Q8DA 1AYM2 3ILFA 3VBOB 2HWB2 5CBLA 3NRUA 5DMYA 2Q8CA 4S2DA 4FOYA 1O4YA 5LRRA 3VBUA 3BTXA 1IOAA 1UW8A 2JDMA 1RMU1 1UIKA 1PVC1 1VJ2A 3O0WA 4Z92B 3OY8A 4Q29A 2VOVA 1BVVA 4MX3A 5JR7B 3EBRA 2Y6LA 1HXS2 3C8XA 1O59A 4N53B 3VD3A 4MXVA 4WZFA 2D6PA 2RDSA 3KV5A 1Y7BA 2W39A 3DYOA 4Q4Y3 1TZOA 3N9NA 2VUJA 4MG2A 3S5AA 5A3MA 1S0IA 1W05A 4OHYA 2JB8A 3IN9A 1CGPA 1NCQA 3HQXA 4S2FA 5F6LB 1QKQA 4XF0A 1H8TB 1ZVFA 2XONA 1KFXL 3MIDA 1AJOA 2DUQA 3VBFC 1MVQA 3APBA 1XOYA 2RE9A 1REEA 4IE0A 1IS5A 4UBHA 4A3XA 2EXHA 2R071 3VBOA 5CEHA 1ENQA 3O0VA 1VRH1 5K9YA 1OKOA 5TSWA 3VKNA 2A5ZA 2XJQA 4RHV3 4XE9A 1UZ0A 4MH0E 4KMQA 2HWE3 4FBFA 2ZCWA 4I0WB 3ZVXA 2VOTA 3PUQA 2Z5WA 1IGOA 1JN2P 3J8F1 2WN3A 4N53A 4OUMA 2WSVA 3JBG3 4QPIB 4EN0A 4UOJA 4W6WA 3WP4A 4CDWB 4YVSA 2ZZJA 1WW5A 1PMJX 3GXUA 1RUJ3 1WD3A 2QNKA 3H8UA 2P6CA 4Q4Y2 5L36A 2EAKA 2ZHMA 4QX0A 3W9AA 1H8TA 1BLZA 1VIWB 2YFZA 1J58A 2XWBB 3BTYA 2PQQA 4P00B 3V64A 1UYXA 4L11A 2OUHA 3WCRA 3T4HB 1C8M1 4FOVA 2R7EB 2VCCA 4MHUA 4LO5B 1UY0A 3RI9A 2OPWA 2BJSA 4M4PA 3RMYA 1GICA 5A6ZA 3I2DA 2L9LA 2WWUA 4Y1VA 4Q4W1 5IUQA 4YG3A 1HB3A 3A4UA 4Q4V1 3WQ7A 2ZAAA 2VMDA 2EXIA 4RGAA 3USSA 1H9PA 4LHNA 4QXCA 5CADA 4CDWA 1GP4A 3AL6A 1XXNA 2E7TA 5T5OA 2XJPA 4JDMA 3ZXAC 2D44A 1W2TA 3WUCA 1WZXA 1AVBA 3JXSA 3K46A 4FP2A 1J3QA 2AR6A 4ITCA 4K9SA 4PDWC 3PVNA 5CFDC 1WMFA 1X9TA 1N3QA 4IEYA 3UK9A 2Z69A 5DAQA 4P9JA 3T4VA 4ASLA 1QJX1 4FPJA 3AYAA 3R4UA 4Q8KA 3MIGA 4XVHA 2OVUA 1UCXA 2ID4A 3C2UA 2I74A 3LSDA 4OUEA 3WOGA 1SQ4A 5E6HA 5FY7A 3VBSB 5C5TA 4YGCA 2GC3A 5AC93 1RYYA 4HK8A 4CSWA 1Q43A 3JCIA 5K0UC 3C7GA 3R0RA 1QIQA 2WFF1 3LEKA 3HMYA 3O1MA 2JENA 1AR71 3BPZA 2WJSA 2WS93 2ZKLA 4YM3A 4RGKA 1CR7A 4Q0PA 3POEA 2VJXA 5F3CA 1OOPB 3I2KA 1CIYA 2HBTA 1GYKA 1V6MA 3F2ZA 4NJ4A 1M4WA 4PIYA 4QX3A 3M70A 2BVVA 5FPZA 2VOWA 1Q8VA 3ZN6B 1NLQA 2GU9A 4IV1B 2HWD2 2D6OX 2DVAA 1WLTA 4XFHA 1ZBE2 3OJBA 1DQ1A 4K1YA 4LHSA 1UX7A 3P3NA 3RDIA 3VBSA 4A7ZA 1BKZA 1W06A 3JUUA 1WW7A 4D3WA 5C71A 5LATA 4B4RA 4AYUA 1ZM1A 1HN1A 1RUE3 2VCBA 5DDJ1 5FY4A 3CF6E 1UNBA 3AMNA 4BQ5A 3A21A 3K2OA 3KZ4C 4GH4C 4UW6A 3NV1A 4HBNA 3EXUA 3NNMA 5FYUA 3CIHA 1OOPA 5I91A 5JXHA 1VBE3 1LKNA 2MNGA 2WQZC 3MFCA 1QOTA 2G9ZA 3ZN4A 1ZBA2 4QKBA 4CCNA 2FCTA 5C8CA 1Z7S1 5FYBA 1W8UA 5FBJA 1B09A 5ACA2 1LENA 4X8PA 4IV1A 3T30A 2OIIA 1S1AA 4B8EA 1AR83 3S7EA 2VZSA 3OPTA 3WP3A 4NMIA 4UXAA 2D6KA 1UY3A 1A78A 1POV3 1XYNA 5CG8A 5L7OB 2VC9A 1CX4A 1LOFA 3K4ZA 4QM8A 4BJ0A 2YC0A 4XCAA 1FMD2 5FP8A 1SBFA 1YO8A 2D40A 1BXHA 4ORFA 3V0AB 1OUSA 3E6CC 5E1RA 3CL1A 3W21A 4QGLA 4JTNA 3WY6A 4CEYB 1KJLA 2RS13 4UFHA 3GBGA 2JDZA 2VXRA 2Y6HA 1QJZA 3ZLIA 5HCAA 1K45A 3PJYA 1SLAA 4OHVA 5CIRA 4O7XA 4OVEA 1ZZ9A 2BZDA 2VQUA 4PI2A 5IK5A 1CZSA 2PHLA 2KD7A 3OEAA 3LQCA 3B3QE 1MEC3 3LE0A 2ZGLA 2WZPP 4DY5A 1VLNA 3KCYA 2B4KA 4TLFA 4XDQA 2ARCA 2GMPA 4KBBA 5FZ3A 3GCWA 2WNUC 5FK8A 4QHZA 3OBTA 3LCPA 2E51A 5L7OA 4KGGA 1UZYA 4YFWA 2ZTNA 1RUC2 3OD4A 4CCLA 1HDKA 4XIKA 4XYXA 5FYTA 4AI3A 5JIAA 4OQ8A 1LNSA 2P3YA 5ERLA 3V0AA 3RVHA 1W8NA 5J1XA 5F5AA 3UKNA 3V65A 4COYA 5ABJB 1QY4A 1XNTA 2WQ8A 4RHV1 2YROA 3H1MA 4CEYA 2HWE1 1REFA 4J1WA 2FDGA 3ZOIA 3EQEA 3ES1A 4P14A 1VBC3 1E5HA 2JD4A 4FPEA 3WF4A 4G4FA 1Q8QA 2IXLA 4XQWA 3JBG1 5KHHA 3ZFEA 4DUWA 2XLFA 3H3ZA 3RZZA 1RJ7A 1EAH3 3JQXA 4QT6A 4ATEA 1WMEA 1RUJ1 2FBEA 1WBFA 1CAVB 1HRV2 2WNVA 3MYXA 4XAAA 4Y1ZA 3GCXA 3WNPA 2CWMA 2VMCA 2ET1A 4XXAA 1AR92 1UZWA 2ZX1A 4XJ9A 1Y9MA 1T6BX 3IBMA 2W9XA 1ST8A 4XQ4A 4ZS3A 2O1QA 2IXCA 4GULA 4N7IA 3MGUA 4WM8B 3VDDA 4LPLA 3DV8A 2BBVA 5G04L 4XBQA 4NRQA 4QDRA 1G9AA 5A7SA 1NY71 2UY8A 2WQ4A 2CDPA 5ABJA 4NIIA 1W6PB 4LBKA 4QWNA 4AI0A 3LEIA 1KEXA 1DGRA 4MGQA 2K2SA 3NNFA 3SH3A 4JX0A 1ZRIA 1S4CA 5L73A 3I2IA 1D2QA 1RUG2 2A3WA 5F5QA 3ROUA 4A6OA 2RJLA 1CAVA 1UD1A 3FE5A 3ES4A 1WCUA 5IATA 1ZRDA 4GH4B 4Q1RA 4OHXA 3IIAA 3ZKYA 1XU2A 1OVSA 5FAXA 5FYIA 2VAUA 2XDVA 3F95A 2MPFA 1NKGA 4C90A 3VD5A 2ZGKA 3CEWA 1C57A 4WM8A 4KQ7A 5FY8A 5BV6A 4E4HA 5G05L 4CUGA 3UNPA 5JXIA 4FPGA 1MS0A 3KQ4B 4CPBA 1IQDC 3THDA 3A0KA 5AC91 4OHZA 1W6PA 2E26A 2W3JA 4IEVA 2DCKA 3ZMOA 1MS4A 3SEEA 5J09A 4JGYC 5T50A 3DN7A 1RTVA 2WZEA 4OI1A 1VBD2 2OA2A 3OBZA 2WS91 1DLLA 4AFDA 4AEDA 2QJVA 4IERA 5J36A 3N9OA 1XE0A 2GN3A 3HNMA 1XB9A 1W8TA 3CJXA 1LTEA 1XU1A 2R0HA 3J4UH 4XFIA 5A33B 1W03A 2Q0AA 1PIV3 3G7DA 4LKDA 4Y4RA 2OX0A 3OF1A 2ZEYA 4LIVA 5EJZB 3NQHA 1APNA 5F2SA 4HLTA 4PLOA 4NR1A 3TN93 2O14A 1DZQA 3BU7A 4XJZA 3WSOA 2YBSA 4AEJA 1QJFA 3CBNA 5BNPC 3AKPA 3TWIA 1G9DA 3LKJA 5C9AB 3C7EA 1W2AX 1EPWA 2Y34A 1TNRA 3AMHA 1AYN2 1YJLA 3ATGA 4NAMA 2EIBA 4XABA 2HBUA 4AVTA 4C1XA 5FXXA 1RUE1 2ILMA 2WNUB 2H0VA 2D3SA 1HRI3 2QQPA 5FYVA 2X10A 1F5FA 5D8AC 2QVSB 3T08A 2J22A 1J1TA 1MS5A 1AZDA 2PHDA 1VBE1 2QBXA 1YJKA 2YBPA 4GWNA 1VBA2 1HKDA 1OSGA 2WO7A 4LQRA 3DXTA 1CPMA 1K3IA 1N47A 2GC1A 3OBRA 2FDJA 4NHYA 5A33A 3MW2A 1NXD1 1MS9A 2C4XA 4DXZA 4TN7A 1LCLA 4QMAA 3IDBB 4IEPA 3A23A 1UY1A 2RVAA 1OXCA 1R1A2 2D5FA 1AR81 1I5ZA 4C8DA 3DCQA 2UURA 1SFYA 2PHRA 3LGRA 4IV3C 2D3RA 5C9AA 1POV1 3G6JB 2DTWA 3TEWA 1OBNA 3I2JA 2C1FA 4IEZA 1F4HA 3BOPA 5DAXA 2FCVA 5F3EA 1DQ0A 3DF0A 1TMF2 3MIHA 4KI5M 3BN6A 4GWIA 5FPVA 2ZOEB 2XHNA 1CZVA 3T2TA 1R1ZA 1YFYA 1RUF3 3MPPG 4DINB 2OZJA 2RS11 2DVGA 1S0JA 1JYXA 1HJFA 4YW2A 3LOBA 3RZMA 5CFCC 2GC0A 5JSRA 3JD72 2ORZA 2V4AA 1PM4A 2C9AA 1D4VB 1UQXA 2W5FA 4P02B 2GNBA 2CNAA 1JS9A 4NHKA 2YG0A 5DZEA 4NIDA 4GB32 3ZYHA 1OQEA 2GP3A 1LJ7A 1V70A 1OH4A 2RM23 4ISRA 4ES8A 2ZMKA 4E4SA 3I49A 4W4ZA 5IVYA 1O6UA 5JOXA 4ISQA 4Y22A 4LO4B 1O5UA 1W8HA 2JJ6A 2PTMA 4LHKA 3QCWA 5GLZA 5GKAC 1KQRA 2C26A 2XH6A 3AL5A 4H7LA 3KGLA 1C4RA 3OGRA 4F8AA 3UESA 5FY1A 2WNEA 3THPA 3CJIC 2XR4A 2WLQA 4L2NA 3ETPA 1RIRA 3INAA 1POQA 2ET7A 1RUF2 2QQJA 4KBZA 4PHZA 5EYXA 5GLVA 2NN8A 2RDRA 4LOTA 5FZEA 1W6MB 4FP3A 5A7QA 5FZAA 3BCWA 3ST7A 2XLGA 4YVWC 1J1LA 2DTYA 3S7IA 3ZO0B 3AFGA 1IS4A 1QXPA 1EAH1 4ET7A 4KWJA 4FFIA 2AH2A 5HPOA 3H7JA 2MEV3 2WZR2 2UY9A 1YQ8A 2ZMNA 3WZ1A 2GZWA 3LA2A 1XBFA 2ETEA 2P3KA 3GHMA 4OI4A 1RUH3 1JYVA 2FHRA 2CGPA 3HQRA 2R062 2VNRA 3I7DA 4MGKE 1BBT1 1FOD1 3WHTA 4AQSA 5IVVA 2XVKA 1UMIA 3LSEA 3T3YA 3X29B 1YFWA 5C3SA 3DXUA 3AFKA 4CDUC 1R082 2WN2A 5A6XA 3KD4A 3RGBA 3AB0A 1AL23 1SLIA 1LGBA 4Z8BA 4ZZ8A 4A45A 4JRLA 4XF9A 3C7OA 1W6MA 1YRZA 2D97A 4TZDA 3H0OA 1CPNA 5FZHA 2XBO3 3AMPA 1H8VA 1GLHA 2RS31 4WM7B 3AYDA 3LEGA 1ACCA 3JU9A 1OI6A 4NWVA 2FD8A 1OPMA 3B01A 3T0DA 2QQKA 1GR3A 1GV9A 4QPWA 2VOKA 4HN1A 4AZZA 1GNHA 2YUEA 2ZACA 2AYHA 3N9PA 2XB6C 5IVJA 3LAGA 3H8OA 3I59B 2H6CA 1LOCA 3VBUC 3N9LA 2EIDA 1X9PA 4AL9A 1HQLA 5FPAA 1P8JA 2C6SA 5GZCA 4AI8A 1RUH2 1BK0A 1URXA 2YBKA 2ZZQA 2DVFA 1LHWA 2W1QA 2NZ9A 4FPLA 4CU9A 2EXKA 4YLZA 4PT6A 5FXVA 4HZFA 1ZZ8A 3ALQA 3HJRA 5T5PA 4XBLA 1W0PA 2E9QA 3HAGA 4CXYA 1PO22 1OF3A 1AL22 3IIIA 3M3CA 4RS5B 4XXPA 4A41A 5C8WA 1NCQC 1XPWA 4WM7A 3D8CA 4BHPA 4NIGA 1V6JA 5FZ6A 2ZEZA 3NJYA 3U10A 4CUBA 3Q8AA 4W6XA 1QOSA 2DBIA 3M3EA 2VZTA 3LWCA 3POWA 4I09A 4CDQA 5FLJA 4UF0B 1YFXA 2A75A 4CYDA 3J7HA 1UAIA 5T5LA 3VBOC 1LU1A 2VH9A 3ZYJB 3I59A 3H1WA 2ZPXA 1PIV1 5LB6A 4MOAA 4XEZA 4R9AA 1C8NA 4S2HA 4BMEA 5DG2A 3TN91 4Q0VA 4WVZA 1ENXA 4N53C 3DECA 3VZNA 3D0SA 1WA6X 1KJRA 4YVSC 1SLLA 2DV9A 4NOTA 2JE8A 2WAAA 2KM2A 4CCKA 4COZA 1ZYBA 1W6NB 1HRI1 4RS5A 2K46A 4ZXKA 3VBRB 2PELA 3WDVA 4F83A 1H30A 1H8TC 3OG2A 2NM1A 4NRPA 4YGEA 1VAMA 1J3RA 2XL9A 4EN6B 4QHOA 3O1TA 4IQPA 2HLEA 2J1SA 4UF0A 4C1WA 2IC1A 4YZ2A 2RS53 4IEUA 4ZY9A 1VB4A 4M01A 4FOWA 5CISA 4WBBA 1R093 2XVGA 3GNEA 4IW3A 4Z2AA 3KHCA 4GD4A 1FPN3 1UU4A 4Q2FA 4PQQA 4I02A 3I2OA 1SEFA 3LFIA 3N7KA 3IAPA 4P5YA 2Q30A 5EP9A 5FKCA 3BODA 4COVA 3VDAA 3KLSA 4R52A 3RYPA 2LTNA 1DP0A 1QDCA 4P9IA 4Y33A 4AW7A 3OUHA 4DO0A 2V72A 4CDWC 2RR12 1Z78A 2W1SA 3HVDA 1G9FA 4QXBA 3N9QA 3SCHA 3VBRA 1HLCA 4AQ2A 1TEIA 2ZHNA 1VPHA 2IXKA 4EJRA 1JZ6A 2WLPA 4GAZA 4Y1UA 1RUD2 4EN8B 2O0OA 3EB7A 2BEOA 1BCXA 1DLCA 1V9U2 4UFIA 1O4TA 4HL0A 2GAUA 5FR3A 2IXHA 2JIGA 3OBAA 3K51A 2QDNA 4UW3A 3I8TA 2ZA9A 4XMIA 3UGFA 4I2OA 1PO13 1AXYA 3PUIA 2DYCA 3GALA 3EYPA 4B4QA 1R092 1V00A 3I3EA 2VMGA 4XUPA 2JDHA 3QH7A 4LOSA 3ZN5A 5FDBA 1AYM3 5A3LA 1H2MA 1WLWA 1OF4A 2WT1A 3ZFFB 2VMFA 2HWB3 4QKFA 4DRRA 1PGW1 2BV4A 2EF6A 4CCOA 1BQPA 1OMIA 3HT1A 1US2A 4OI2A 5GZDA 3U11A 2X05A 3NNLA 4MGYE 4Q0UA 2G9GA 3TEZA 1OLQA 5I93A 3PJQA 3LDKA 2EAAA 2I07B 3OSDA 4PCRA 1AUYA 4XJUA 3HD8B 3OY8B 4QKDA 1IKPA 4AQ6A 2RMU2 2X5IA 2ARBA 3K77A 4CVUA 4PIZA 2NPIA 3WQBA 4NVPA 2V4VA 4LUMA 2C5DA 3KF3A 1KGYA 3VKFC 1NT0A 2WT0A 4OLLA 1LEMA 5I0UA 4QGMA 2R6QA 1F5JA 3QOPA 4YWAA 4CP1A 5A3UA 1AHSA 1Y3TA 1F35A 3VBSC 1N1TA 2Y33A 3HBZA 5C33A 4S2GA 3P5BA 4PF5A 1O8PA 1NQDA 2MEV1 5F2WA 1WMXA 3KCCA 3O7OA 5JSPA 3WXPA 2YU2A 3ZFFA 5CKNA 3RG0A 4D7SA 1VMHA 1DGWA 1JODA 3BIWE 5F39A 1QJU2 1ULDA 3K75B 1OOPC 4D8MA 3S6PA 2D7FA 5CYYA 2VZUA 3GGLA 3CQOA 3WDTA 4I30A 4AGVA 5C8CC 1A3KA 1F8VA 2IVIB 2ZMLA 2VZ1A 2VVDA 2QUOA 3L9JT 4IV1C 4HVRA 4NE9A 1RITA 4BH9A 4X8NA 4LLFA 5JOYA 5T55A 4AHZA 1LU2A 3THTA 4V2VA 2OW4A 1UOBA 4YVSB 1TNFA 2TUNA 2EICA 3H1YA 3LPFA 5DZFA 1TME2 4HMZA 5KR7A 1PX4A 1LOFC 1SACA 5DUXA 2GALA 4E2QA 1LEDA 3M3QA 5FRAA 3U37A 4BQ2A 2VE1A 2RV9A 4JC1A 1SCRA 4ZZ5A 5IVFA 1UMZA 2JKXA 3RZHA 1H0BA 5DZGA 2PQSA 1Y4WA 3MIFA 5GLTA 1FX5A 3RFRA 4ARXA 2A6YA 4P9YA 3KF5A 4H3WA 5FZGA 4YZ5A 4FPCA 4Q27A 3CDZB 3PURA 4UFKA 5L9BA 4BQWA 4LORA 4E8CA 1MQTB 1WCDJ 1XYOA 2DU1A 3FX3A 5FWJA 3POIA 5JSOA 1LOBA 1REDA 2VO5A 2DCZA 2QZ2A 1WW6A 2Y6FA 1EV13 4EZHA 1CX1A 2JG9A 2B5HA 1JUIA 5F32A 3ELNA 5BNOB 3H3LA 5BYNA 5HV4A 2QKDA 1PHMA 3M8LA 2D6MA 5L7OC 3GDBA 2B7YA 5FWEA 3MLKA 4Y20A 1RHI2 3KWVA 2XG3A 2TNFA 3OB8A 5F5IA 4IEOA 3T09A 4BB3A 3B9CA 4R4ZA 4QB1A 5FP9A 3HT2A 1ND3A 5FLIA 3ITQA 1MR5A 5ANQA 4CEYC 1ZA7A 3T2OA 1LOEA 4META 4XBNA 4CXWA 4LBQA 3SXWA 1L7RA 2BOIA 2LS6A 4CU7A 3POYA 2DCTA 3AZZA 4ZPIA 3ZFEC 1DQ4A 5I0TA 2D6NA 5FZ1A 3IM0A 3PIJA 1MQTA 1MZ6A 3M3IA 3T2QA 1H4HA 2R1BA 2VD7A 1YNAA 1YIFA 2WNVC 3ORJA 4EN7B 2Y6KA 4AI9A 4B29A 3OTFA 4NIAA 4QXHA 5BNOA 3CMGA 2WRAA 1OQDA 2A7AA 2VCAA 1BEV2 5FZ4A 1EV12 4RR3B 4A7KA 3FUOA 3PMEA 2E7QA 3DKWA 3VDDC 2XJSA 3CU7A 2HWD3 2RS51 1ZBE3 2X29A 1GKBA 5FZDA 5ABJC 1CWPA 1FPN1 1OA4A 2VL4A 1QH7A 3WF1A 3ME2A 4FVVA 4LIUA 4NPRA 3GZAA 1PGL2 2AC1A 4Q0QA 1VP6A 4KWLA 1E57A 4XTMA 2YPJA 5LA1A 1UYPA 1A8DA 2Y0OA 4XUQA 4ZU7A 1XJAA 4XDOA 2ADDA 4FFHA 5SV5A 1FYUA 3IMNA 4P9XA 1UKGA 1NX9A 1QJY2 4AR2A 2NQYA 4OFGA 2ZHKA 1AR62 2C0ZA 2SLIA 2V09A 4PIXA 3RI8A 1LB2A 1ZBA3 1O3RA 3O1RA 1UWWA 2ZGMA 4XACA 4XF1A 2YYOA 4RR3A 4UT5A 3CZJA 3WEZA 5ACA3 3I4IA 2W2IA 1T2XA 4WM8C 1MS1A 3SC7X 1QNWA 2P34A 2Q8OA 5C8CB 5B2GB 3UGGA 1KS5A 2CDOA 4LA2A 4BLJA 4BQXA 1OQ1A 3DPRB 1PO11 1SLBA 1OC1A 1UF2C 1SZBA 4IDZA 1PMIA 4XHBA 4YM0A 3BTZA 4Z1VA 1O3QA 1COV3 1CQ9A 1ENSA 4LO7A 3Q9OA 3T0AA 4LE4A 1FMD3 1GZWB 1AYM1 1ULCA 4XUOA 5D21A 2ZGRA 2HWB1 4AF9A 5F5CA 2UWCA 3KGZA 4TWTA 3PVBB 3KT7A 4DB5A 1UPSA 4AEDC 2VZVA 1HB4A 2WYFA 4WZCA 3IMMA 5FJKA 1HXS1 1OFSA 4N7UA 4J1XA 3BOWA 4CPBD 5C6CA 3PVEA 3HNBM 5J96B 2AEYA 4MGZE 4Q26A 4CCCA 1KXGA 4SLIA 4Q4X2 4COWA 3TB0A 2D43A 1JYCA 5E88A 1RGSA 1H2LA 2V73A 4LA3A 1W6QA 4OCTA 1JZ7A 1CZTA 1DBNA 1I9RA 4AK3A 3PMSA 5IFPA 1ZX5A 3BIEA 4GXLA 3U07A 2Y64A 3DPRA 2ZGPA 4UFJA 4MV2A 5A1FA 5F1RA 1W6OA 2LUWA 1RUC3 5GLWA 1IS3A 4XAEA 1GZWA 3RQ0A 3RNSA 3AYCA 1COV2 1Q8PA 3LD8A 1UMHA 4LBOA 4JAAA 3J26N 2F17A 1T6GC 3VHOA 5H9RA 5EWSA 3BUCA 2VM9A 4IETA 4XCBA 5EYYA 5I0DA 4WVMB 4HKLA 4W65A 4EWEA 1LRHA 2D6LX 4Y24A 2HWC2 4MGIE 3UJQA 4QAWA 4DXRA 4P9WA 3ZYIB 5KHJA 4IEQA 1ND2B 3FZ3A 4FQ4A 1OFNA 3H50A 5DUVA 3ZFEB 3AP5A 2AENA 2BYVE 1JBCA 4RGGA 1Q8SA 3VL8A 1HRV3 1KRIA 1S0DA 2BWAA 1EYBA 4ZU4A 1SBDA 4Q4Y1 3J7LA 1TE1B 2ZX2A 3M1HA 5BXXA 3CNAA 4B4PA 1AR93 5C9AC 2WNVB 2FDIA 5CVRA 4YG0A 3ZSJA 5IVCA 4LNVA 2BFUL 2B9VA 2V5YA 3UL2A 4K8FA 1UYZA 1X8EA 2IUWA 2QQVA 2VZRA 3VL9A 2PFWA 3SKJE 1J3PA 4BA6A 1UY2A 2W1UA 4DEVA 3AKRA 3RPQA 4N90A 2IXJA 1ZZBA 2O8QA 3IKWA 3MO4A 3ACHA 3Q8BA 5GALA 3A22A 3ZXLA 4WVMA 3SH5A 4BZ4A 2CGNA 1SHWB 4LT5A 4HK9A 4QB6A 3BGAA 3WP6A 3A0NA 4MUVA 4JCKA 4I3PA 3LZZA 3ZXDA 2VZQA 1VALA 1ND2A 2G4IA 4K3UA 3WG3A 3NJZA 3MF9A 1EUUA 1RUG3 1B35B 2IFRA 2B45X 4IE5A 4JKMA 4YRDA 2PLV2 1JOBA 1LHUA 3AZWA 3I97A 2CTVA 4AVCA 2ZGQA 2A73B 3OGJA 1RVF2 5FXWA 3UETA 3AP9A 1OPOA 2JE7A 2PHUA 4H14A 4HPKB 4RQPB 3W20A 3ZDSA 1ZNPA 2WO2A 2B39A 2Z2SB 2JWPA 4QHBA 3ENRA 3ZXEA 5ANNA 4DUXA 1GOGA 1YFUA 4GWJA 4KWUA 1DQ2A 3AP6A 3ABZA 1GBGA 2XVLA 1SG3A 1PZ8A 3L2HA 4E2SA 4FI9A 4M00A 1YQCA 3AKSA 1ZZCA 1VBB2 4XURA 5FREA 2ATFA 5J98B 2R16A 3WVJA 3O1UA 5A3PA 2CAVA 4GJZA 3WDXA 4AWDA 4IESA 1VBD3 3SMHA 2BWCA 2OQ7A 4PQ9A 3ZKUA 4BQ4A 2VNGA 3J7MA 3JZVA 5IK8A 4CP2A 1UKRA 1B35A 2XJTA 1GANA 1DQ5A 2WBKA 5CZKA 4GIQA 5DXDA 4QX8A 3U75A 5C70A 1O3TA 1NA1B 1QJEA 4AEDB 2FDKA 2PMWB 2J1RA 4D69A 4YW4A 1ULEA 1UL9A 4HPKA 4M0NA 4RQPA 2WA3A 2W68A 5C4WA 4XUTA 2HWD1 2QTWB 5FK7A 5LASA 1ZBE1 5CKQA 2PA7A 5A6YA 4Z82A 3VHPA 1JZ4A 4DQAA 1YYNA 2RDQA 2WSUA 4XHXA 4QX2A 2IVJA 2FMYA 4GJYA 2X8KA 2GN7A 1W9SA 4AGGA 1AYN3 3KS7A 3WDWA 3VD9A 5IAXA 3E97A 1KDKA 5CAZA 2FDHA 4L0PA 4C0HA 2QZ3A 2W94A 1PNFA 1V6KA 3PVOA 3FUQA 4LBLA 3IPVB 5I8YA 5HI0A 4G3YC 1Y43B 4JQTA 3ZR6A 2E53A 5DABA 1W8WA 3I3BA 1VBA3 2QQMA 5C5UA 1NA1A 1ZBA1 4AOCA 4RYDA 3WF0A 4R4XA 3JB4C 1GQHA 5AFBA 5ACA1 3EHKA 3FLPA 3B02A 3AJZA 5HV0A 2BNMA 3WNOA 3D3AA 5SV8A 1FOD2 1R1A3 2W95A 1AL0G 3NL1A 5IW0A 4M3CB 3URFA 2VQTA 3B69A 4QX7A 5I8TA 3AP4A 4I0AA 4Y5Z0 2V5DA 1QQP2 2CGOA 3N9MA 1FMD1 3ZFGB 1TMF3 3ECQA 1JU3A 3D82A 5FIXA 3U0ZA 4LBMA 4WM7C 4AI1A 2XJVA 1QOOA 3IPVA 3NMBA 4HFSA 2AZ5A 1DYKA 2LW8A 2QE3A 3MW4A 4P9GA 3IT8A 4FXKB 5FUNA 2BNOA 4CDQC 2VUCA 3AMQA 1UOJA 1MPXA 2F4LA 5JLVA 5A7PA 3AMMA 3I54A 2VULA 2J1VA 5FO9B 3JD73 1D4M2 2YXSA 3TEXA 4N8MA 4AG4A 4BXFA 5B4NA 2ZX0A 2LRPA 1S0EA 4RA0A 5FY0A 2AREA 3JQWA 3KB5A 4GB33 1JOJA 4XQDA 3RYRA 4DXTA 4IXLA 4AI2A 2YV8A 5KBFA 4M3CA 2YGMA 4NHMA 1G7YA 4NUBA 4D0QA 2P2KA 4N9HA 4AFAA 2PHFA 3N36A 1C28A 4R9CA 1RUC1 1NYWA 4L97A 1JYNA 4QQPA 2XXZA 3ZFGA 1SDDB 4Y22B 4BOWA 3HN3A 1WW4A 2EIEA 4H7MA 1C1LA 2DFCA 4K6BA 4RS5C 4DFSA 5C3OA 3FBMA 4LBJA 1ZRCA 2VNOA 4QDQA 2GH8A 4CUCA 5FQ0B 4G9SB 1C3HA 1DGWX 2J1TA 3ZDVA 3V56A 2BFUS 2R30A 1NCRB 5L9VA 2XQRA 3T0BA 4DOUA 2FDFA 4JRAA 2FZ1A 1DGRN 2XQXA 2AUYA 1I5PA 3C7FA 2HWF2 2JKBA 2YDEA 4AVVA 1HRV1 1XNCA 4ZHNA 4CCMA 2WZR3 1MEC1 2A6VA 4LXLA 4BQ1A 1AR91 5FMCA 1NOVA 1IPSA 1D0HA 3LB9A 1AJKA 2VU9A 4L92A 1IQAA 1YI7A 2R063 1UO9A 1OA2A 2J1EA 2YGLA 3DL3A 4MXWB 5L19A 1SPPB 4UAPA 3MUY1 1DIWA 3O1SA 2VTXJ 3I3MA 1G9CA 4Y4YA 3S5QA 1UIJA 3VBRC 2PAMA 3EJKA 5DPNA 1SDWA 4OQ9A 1R083 4J6GA 2J7MA 1UX6A 1Q3EA 5FY5A 1U5XA 5FQ0A
chains in the Genus database with same CATH topology
4QGNA 3L2YA 1YWKA 4AHXA 4EWDA 5IT6A 1NCRA 5EZWA 4HSLA 4UW4A 3QD6A 2JECA 4AE2A 1VBC1 1UU6A 3V0BA 1RUG1 2DCJA 1C1FA 3FMGA 4XIOA 1EP0A 3MIEA 4FXGB 3QBQA 1RUI2 4MXWA 4R9DA 5BY5A 2X53S 5LK5A 3ZXKA 1ASJ2 4CTEA 2VVEA 5T54A 5JDBA 2R042 2P3IA 4AFMA 1BYHA 1S2BA 4FQZA 2X5IC 2JG8B 2XKPA 3NVCA 5AVPA 2I45A 4LHLA 4GA9A 4N43B 1Q5OA 2F4PA 2GNTA 2BTVC 1PO23 1O5LA 2IWGB 1VBD1 4L9BA 2A3XA 3WDYA 3MICA 4AFCA 2CYFA 2I2SA 5AFEA 5KWRA 2ARXA 2DWRA 3VV1A 3OYWB 5FO8B 3MFAA 3ZFFC 1Z0HA 2VW2A 4CDQB 4NN0A 5IK7A 5LEJA 4A2UA 2PN5A 1DQ6A 1QGLA 2QFEA 5CU1A 2TBVA 2JG8A 5GZEA 1DYPA 4OUSA 1AYN1 4KU7A 1GQGA 1MZ5A 1CONA 4CEWB 2VUAA 4N43A 4KNCA 2VVFA 1WMDA 2GC2A 3R05A 4GKYA 4QPGA 4EWAA 1PK6B 3WINE 4JV4A 3WW1A 3OGGA 5E89A 3E5UA 3DGTA 3NV3A 1VB2A 3VBHB 1VBA1 3FBYA 5J48A 3OYWA 4OI0A 3B5LB 3R6SA 1XE7A 1LGCA 4Y1YA 1R1A1 4FSJA 1BVP1 3O0XA 5KHIA 1GFF2 4BM8A 3VUOA 1RMU2 1PVC2 3D4KA 1JXNA 5LEKA 2RR13 4CEWA 1TMF1 1FV2A 3O12A 2UYBA 1YCIA 2JG9C 3AYEA 2PHWA 5FOJB 4MYEA 1PK6A 1ZRFA 3VZMA 3AX4A 1RUD3 5H9QA 2KA3A 3VBHA 4Y1XA 1NZCA 1V9U3 4FAGA 2RJKA 1ULGA 3JD71 3UKTA 1ND3C 3WP5A 1OKQA 4PLMA 4O9EA 4GB31 2XPJA 3NKTA 1W0OA 4HVOA 2GMEA 2R0FA 2R072 1C5IA 2E63A 1VRH2 4AEKA 1MQTC 2A6XA 4LUKA 2HKXA 4Q8LA 4D7TA 1YLLA 1FI2A 3HN1A 3TOJA 3KT4A 4L8QA 3J8F2 1L3JA 2WC2A 2XWJB 1CAUB 4K20A 1YI9A 2XLAA 5BNOC 2VW0A 4Z07A 2NLRA 2FQPA 2RMU3 1X82A 1PGSA 1RUF1 2JXAA 3KQRA 4FPHA 1LECA 4M3CE 1LESA 2X5IB 4F7ZA 5FLHA 3E6BA 4HANA 1KDMA 4K40A 4BE3A 3E5QA 5J3UA 5KXCA 1C8M2 1NG0A 4Z2WA 4YZ1A 1AX1A 3NSTA 1BJQA 3M4FA 1ZZ7A 5A32B 1AXKA 3LOIA 3N7MA 4NO4A 2RM21 2WFF3 1RUOA 2R061 1FNZA 1QJU3 4AVBA 4Q4W2 1HIXA 1NLSA 1CAUA 3FLRA 1QNYA 4Q4V2 4Y26A 1R081 2A3YA 3GZTB 2ZHLA 4ONUA 4RR3C 3ZX7A 2PAEA 4INDA 1DGLA 1NE6A 1CN1A 4YARA 5KXBA 1RINA 2ENRA 3RS6A 2K9ZA 3AP7A 5EJ3A 1FV3A 4LE3A 3M3OA 5GJ6A 1TME3 2XHKA 1QJX2 1X36A 2BQPA 4FOQA 3MZHA 5DUWA 5KHKA 2WFPA 1PZ9A 4EROA 4HKWA 3WG2A 1ZZ6A 5J7MA 1UZZA 4KL1A 3ACLA 4XPVA 4DNYA 4JDOA 4CDXB 5A32A 4QX5A 4XZPA 5T52A 2H0BA 3NAPA 1VAKA 1GSLA 1RUH1 1CAWB 2WFF2 1M06G 2WKKA 4PBOA 3AJYA 4M0HA 1AR72 1TQ5A 1X7NA 4JGZB 3AK0A 2WWSA 4JQRA 1PO21 3FFQA 1AL21 1U5IA 4FTEA 2R49A 3DPRC 4JVAA 2K0GA 4O9GA 3HR9A 5F9TA 2XBO1 3HWJA 2JG9B 3IDCB 2PHXA 4BMBA 4HVQA 3MEPA 1RHI3 4BPZA 2ZS6B 3QACA 3RRDA 4CDXA 4D7YA 4Y20B 4YW3A 2OZ6A 5HCFA 4F3JA 1CAWA 1ND3B 4XETA 1CIWA 5DDJ2 1V6IA 4LBQB 1MS8A 1DZRA 2UYAA 2FMDA 4XW3A 4RD7A 2O8OA 4JGZA 1QU0A 2CY6A 3SISA 5E8AA 3H9AA 4XF3A 1ONAA 3WX5A 3AZYA 2BW8A 1QF3A 3VZLA 1Z7S2 1F31A 1BEV3 3AXDA 4NHLA 2D98A 3ZMNA 4DY3A 5FMOL 2IZWA 3EO6A 5JZGA 2R1DA 3WCSA 1ZREA 5T5JA 2ZX3A 1O7FA 2VQ0A 1K5MB 1MZEA 1BK1A 2EALA 1LODA 2VOXA 1NQJA 5D1IA 3AZVA 3U4XA 4K7JA 3NO8A 1RJ8A 4CZSA 3VHNA 1ND2C 4GQ7A 1V6OA 2RR11 4XILA 3D6EA 5FCCA 1CJPA 3SITA 1S0FA 1QJY3 5GZGA 4ASMB 1H2NA 1AR63 1U5YA 5BNNB 2ZGOA 3PLQA 5K7PA 3GYDA 1RUD1 2WL1A 4YYOA 1V9U1 4XJWA 1BMV1 4PBPA 3N7JA 2RHPA 1FT9A 1K5MA 1IS6A 1BZWA 1WUVA 4HSJA 1IHMA 1R091 4KG8A 1O3SA 2YMZA 4MVTA 1J59A 3FFZA 3KT1A 4RHV2 3QLQA 4QPIA 4AFBA 2HWE2 3ZSEA 4H55A 4XFAA 2ES3A 2W52A 3FLTA 1B35C 4QU2A 3JBG2 1EY2A 4BWOA 3WW3A 3NKGA 5BNNA 3FJSA 3PNAA 2WINB 2RMU1 4RQPC 1ZRRA 1S0CA 1RUJ2 4Q4X3 5C4WC 2YHJA 2DU0A 3CLPA 1OLRA 4FAHA 3NV4A 3JB8A 1W6QB 2VG9A 1LGNA 1YIPA 2DVBA 1S2KA 5K8SA 1RB8G 1UN1A 2Y38A 1NY72 1OD5A 1W6OB 1HW5A 3B94A 4YNIA 1G9BA 4FT8A 4C0BA 1QJU1 2KXLA 3S30A 1AX2A 3E6DA 3FWEA 4YFZA 4XMAA 4JTOA 4RL7A 2DURA 2HWC3 2WT2A 1NA1C 1W39A 4GMP0 3ZSMA 1MVEA 4R8HA 4YW1A 1ULFA 1QH6A 2CAUA 2GSYA 2W0XA 4HT1T 5JCTA 5FLJA 4YM2A 3SCHA 1A8MA 3AZXA 3B9IA 2Q1ZB 3ZIWA 1TME1 2CWSA 1IZ3A 3O5SA 1QXRA 3W58A 5I0RA 1CAXB 4DPNA 5KXDA 3VKMA 1DU3D 1H1AA 1UPIA 3TYJA 1W2UA 5AC92 2XUMA 2ZJCA 2NP0A 1LHNA 4YGBA 4WVVA 3VBFB 2YY1A 5GZFA 1D2SA 4BIFA 3E5XA 1C5HA 2DFBA 1SMVA 1IPJA 2WS92 3RJRA 1DF0A 5GM0A 1RUNA 3ZN6A 2PLV3 4GKXA 3B93A 4D94A 2WIIB 1RVF3 5KHGA 4E27A 1LR5A 2VY0A 1DZTA 4AQTA 1CAXA 4B3NA 4AEMA 3ZFGC 1RHI1 1N3OA 1WLCA 2WA4A 3WHUA 1CVNA 3VZOA 1UU5A 3RSJA 2JEMA 5JI9A 3VBFA 1VBB3 4COUA 4Q1PA 1WCSA 1RUE2 3QH6A 2ERFA 5FMOS 2ZBJA 2Y26A 2BVBA 3ZXGA 4XF4A 4YG6A 4QPYA 2IFWA 2PHTA 1H2KA 1G6NA 1JH5A 2XJRA 1O91A 1U12A 1VBE2 1FATA 1XNKA 2G9FA 3N7LA 2Z79A 4TYSA 1QDOA 4X6RB 2W08A 3ZYRA 3VN4A 3R4SA 1BEV1 5JWPA 5BPXA 1EV11 4DRVA 4QQOA 3KMHA 2A6WA 3CO2A 4E9KA 1RC6A 1I1EA 1AR82 4L99A 1Y9QA 4XFBA 5EV7A 5CNAA 2D93A 4PDWB 5CFDB 5C4WB 2B42B 4AXOA 4FPKA 2IXIA 4W6YA 5FOBB 2ZABA 5BNQA 1PGL1 1WCKA 2JICA 4E4ZA 3RWNA 1NCRC 1MZFA 4YSFA 3ZXFA 5JPNB 2RS12 2E6VA 1KITA 3WR0A 5JIUA 4URTA 5K0UB 1YUDA 5H9PA 5JOZA 1WLDA 1QJY1 4FTBA 3MLJA 4YZ3A 1AR61 2PYTA 2ZGSA 1XNDA 2UWAA 3MPBA 3WV6A 1MEC2 3M7AA 5FPXA 4OHWA 1AX0A 3VLBB 1HV0A 3MDPA 3UKVA 1F9KA 1LHOA 1X33A 1BBT3 1FOD3 4PDWA 4IEXA 5CFDA 2Z42A 4RSUA 1NE4A 3RMXA 2VW1A 3R4DB 2B9UA 4TSVA 4XFGA 3WD5A 2GNMA 1QQP3 1HQNA 2HYKA 4XJAA 1GZ9A 4QQLA 5T3NA 3P3PA 3WG1A 1VBC2 1SLCA 2RS33 3AXEA 1CESA 3MLLA 3MF6A 5K0UA 1DDLA 4KH9A 4PJYA 1N1SA 2QDRA 2XKOA 4FPOB 1EAH2 3NWKA 2AGSA 1KFUL 1D4M3 4Q4X1 2B46X 4KGQA 1LHVA 4NWWA 2CV6A 2DUPA 3ZPYA 3WUDA 3T1LA 2OYZA 2HEYF 4MZUA 4M3CF 2SBAA 3SNMA 1BBT2 1SBEA 2JG8C 4P9LA 1QMJA 3RJ2X 3USUB 3NV2A 4N43C 3BALA 1COV1 4QPGC 2DUOA 3WW2A 2GNDA 2P37A 4LEJA 3SCFA 5JI7A 1H9WA 3TAYA 4YZ4A 3ZSLA 4DZGA 4YGDA 5HCBA 2LM3A 1QHDA 2HWC1 1CJDA 4DMIA 4IEWA 4GALA 3LA3A 1YXWA 2RS32 4XOGA 4GH4A 1N1YA 1DG6A 4FTSA 3AM2A 3FHIB 1JUHA 3VGIA 4KWKA 5FO7B 5CA6A 1V6LA 2HWF3 4SBVA 1ZA4A 5F6KA 4I3GA 1FAYA 4KG0A 3AKQA 5HXVA 3OCPA 2UWBA 3USUA 3OPZA 4QM9A 4HN0A 4CEWC 3GBWA 1JTZX 3GZUC 1U0AA 4RFT0 1PK6C 5BUVA 1LOGA 2HEVF 4BIOA 2DF7A 3VBHC 4X6QB 2OPKA 3TNPB 5JAXA 1XNBA 4Q0SA 1WD4A 3TBDA 1WA4A 2VQAA 2H6BA 3GF6A 3N35A 1IPKA 3M2MA 2PLV1 2E7AA 4CP0A 1ALYA 3V0BB 1I3HA 1PIV2 3LA7A 1H1MA 1RVF1 4LTAA 1NLRA 2YZ4A 1RUI3 3TN92 1A6CA 4AVAA 4LULA 1ASJ3 1MS3A 2PAKA 4BCUA 2R043 2Q4SA 2WNUA 3T1MA 2BNNA 2JX9A 4BLIA 3ASIA 3SCGA 1VBB1 3W59A 1JYIA 1DHKB 4B7KA 1GZCA 1HRI2 4MLOA 4XJ8A 4OZXA 1AF9A 3WW4A 3B00A 5LK7B 3RYKA 4GWMA 3BTAA 4AGRA 1Q8OA 2MHFA 3PTYA 4ES9A 1LOAA 2GH2A 3DUIA 4HETA 3VKLA 1D0GA 2F6BA 4K1ZA 4LBNA 1YHFA 1PVXA 2XJUA 4YW5A 2NYYA 1N3PA 4BYYA 3GHNA 2D5HA 2XL7A 5DUUA 3N4MA 5EFUA 5AVAA 5IK4A 4V1PA 2D3PA 3KCXA 1OA3A 2EVXA 4UBGA 4XTPA 3O14A 2B8MA 5GLUA 1KS4A 2QCSB 2GMMA 3VZKA 2NMOA 4JGYB 4QPGB 3WLUA 1JW6A 2ZX4A 1XRUA 3SLIA 2BPA2 1PM7A 1XQNA 1XE8A 3C3VA 4GMP3 4PLNA 3NAPC 2RM22 4CRQA 5LRSA 1G8WA 3KM5A 1WGPA 3K48A 1PGW2 3OD0A 1RMU3 1X50A 1HQWA 1PVC3 4N9IA 4QQ2A 1QQP1 2XGXA 3ZIXA 5BNPB 1NXMA 1F2NA 2P17A 2A6ZA 4JGYA 4FPFA 1EPZA 2Q5TA 3PHMA 4CDXC 3KSCA 3NW4A 2GDFA 3UV9A 1D4M1 5D8AB 2MEV2 1LULA 1MACA 2EXJA 2VMHA 1S0BA 3VKOA 5I8SA 4QXKA 2DCYA 2R073 3WNXA 3VHRA 2NMNA 1VRH3 4C91A 4JGZC 5JMCA 3ILNA 4I01A 5KXEA 4A7YA 1HX6A 4LO8A 3IDEA 4MSVA 3J8F3 5BNPA 4IV3B 1O4ZA 3B7MA 4KU8A 4LLOA 4AVSA 2EA7A 4ZU5A 2XBO2 5JZGC 1AXZA 1POV0 1KD7A 2VGDA 3IWZA 3WT3A 5D8AA 4YM1A 1RL3A 1Q56A 2VECA 4ATFA 4LR4A 2HWF1 5CFCB 3H7YA 3FC0A 2DVDA 1C8M3 1FNYA 3J9SA 1CD3G 2P3JA 5FFOC 3ZYGA 3S0MA 4XFCA 5E16A 5FBZA 3ETQA 1OHFA 3WQ1A 1U5ZA 1SFNA 1VR3A 3ZXJA 5H9SA 2FZ2A 3AKTA 4Q4W3 4E4DX 3WG4A 1FXZA 4EV0A 1IKQA 2JE9A 4FPYA 4IV3A 4Q4V3 2LALA 2UU8A 4XFFA 4U2AA 1V6NA 1QXJA 5FTTC 3N3HA 3UJOA 4FCAA 3ZSKA 4LBQD 1XYPA 3MIBA 3CJIB 2VMIA 1K5MC 1PZ7A 4E2GA 1PNGA 5J37A 5DG1A 1I6XA 1QJX3 3BB6A 5CFCA 5JVVA 4QD2A 4YVWB 2OUJA 5KC5A 1GNZA 4AHYA 4QPIC 1JHNA 2WZR1 1RUI1 5JOWA 4U36A 1ASJ1 2VPVA 2R041 5BNNC 4B7EA 2HEWF 1W6NA 3D5OA 3NAPB 1AR73 2TEPA 3GBFA 5I0SA 2ZGTA 1N1VA 4K21A 2R32A 4CDUB 5EXOA 1BMV2 2ZKNA 3CJIA 2ZGUA 2N7GA 2BGCA 4ZKTB 3TNQA 1HV1A 2RS52 3WQ0A 3POSA 3ILRA 4EN9B 4YVWA 5KC6A 2CL2A 1FPN2 1S0GA 3MI8A 3SHRA 4R9BA 4FO9A 2BUKA 4I0BA 4IL7A 4P5HA 2A70A 1SLTA 5JPMB 4DS0A 1H4GA 4JDNA 5DDJ3 2Q1MA 4AHWA 2ZAHA 4UW5A 3WDUA 1H1IA 4OULA 3VBUB 1HXS3 4HKOA 5HBAA 4WV8A 2Y0IA 5CG9A 1DFQA 1SCSA 1X8MA 2EIGA 4QQHA 1G86A 2ZGNA 4CDUA 3SH4A 1Z7S3 1WBLA 4LO6B 3TRSB 1ENRA 3VZJA 3HIFA 3D0JA 4WVWA 1VAVA 1NCQB 3MW3A 5CB7A 1PO12 4GMP1 2HJIA 1QWRA 3H3UA 5JZGB 1S55A 3ZYPA 2A71A 1AYM2 3ILFA 3VBOB 2HWB2 5CBLA 4S2DA 4FOYA 1O4YA 5LRRA 3VBUA 1IOAA 1UW8A 3O0WA 1RMU1 1UIKA 1PVC1 1VJ2A 4Z92B 3OY8A 4Q29A 2VOVA 1BVVA 4MX3A 5JR7B 3EBRA 1HXS2 4N53B 4MXVA 4WZFA 2D6PA 1Y7BA 2W39A 4Q4Y3 2VUJA 5A3MA 1S0IA 4OHYA 3IN9A 1CGPA 1NCQA 3HQXA 4S2FA 5F6LB 1QKQA 4XF0A 1H8TB 1ZVFA 1KFXL 3MIDA 1AJOA 2DUQA 3VBFC 1MVQA 3APBA 2RE9A 1REEA 1IS5A 4UBHA 4A3XA 2EXHA 2R071 3VBOA 1ENQA 3O0VA 1VRH1 5K9YA 5TSWA 3VKNA 2A5ZA 2XJQA 4RHV3 4XE9A 4MH0E 2HWE3 4FBFA 2ZCWA 4I0WB 3ZVXA 2Z5WA 1IGOA 1JN2P 3J8F1 4N53A 4OUMA 2WSVA 3JBG3 4QPIB 4EN0A 4W6WA 3WP4A 4CDWB 4YVSA 2ZZJA 1WW5A 1RUJ3 1WD3A 2QNKA 3H8UA 4Q4Y2 5L36A 2EAKA 2ZHMA 3W9AA 1H8TA 1VIWB 1J58A 2XWBB 2PQQA 3V64A 4L11A 2OUHA 3WCRA 1C8M1 4FOVA 4LO5B 3RI9A 3RMYA 1GICA 3I2DA 4Y1VA 4Q4W1 5IUQA 4YG3A 3A4UA 4Q4V1 3WQ7A 2ZAAA 4RGAA 2EXIA 3USSA 1H9PA 4LHNA 5CADA 4CDWA 1XXNA 2E7TA 5T5OA 2XJPA 4JDMA 3ZXAC 2D44A 3WUCA 4FP2A 1AVBA 4ITCA 1J3QA 2AR6A 4K9SA 4PDWC 3PVNA 5CFDC 1WMFA 3UK9A 1N3QA 4IEYA 2Z69A 4ASLA 4P9JA 1QJX1 4FPJA 3AYAA 3R4UA 4Q8KA 3MIGA 2OVUA 1UCXA 3C2UA 2I74A 3LSDA 3WOGA 1SQ4A 3VBSB 4YGCA 2GC3A 5AC93 4HK8A 1Q43A 3JCIA 5K0UC 3R0RA 2WFF1 3HMYA 2JENA 1AR71 3BPZA 2WJSA 2WS93 2ZKLA 4YM3A 1CR7A 4Q0PA 1OOPB 1GYKA 1V6MA 1M4WA 4PIYA 3M70A 2BVVA 5FPZA 2VOWA 1Q8VA 3ZN6B 2GU9A 4IV1B 2HWD2 2D6OX 2DVAA 1WLTA 4XFHA 1ZBE2 3OJBA 1DQ1A 4K1YA 3P3NA 3RDIA 3VBSA 4A7ZA 1BKZA 3JUUA 1WW7A 4D3WA 4B4RA 4AYUA 1ZM1A 1RUE3 5DDJ1 3CF6E 3AMNA 4GH4C 3KZ4C 4UW6A 3NV1A 4HBNA 3EXUA 5I91A 1OOPA 1VBE3 1LKNA 2MNGA 2WQZC 3MFCA 1QOTA 3ZN4A 1ZBA2 5C8CA 1Z7S1 5ACA2 1B09A 1LENA 4X8PA 4IV1A 2OIIA 1S1AA 4B8EA 1AR83 3S7EA 3WP3A 4UXAA 2D6KA 1A78A 1POV3 1XYNA 5CG8A 5L7OB 1CX4A 1LOFA 4QM8A 2YC0A 1FMD2 1SBFA 1YO8A 2D40A 1BXHA 4ORFA 3V0AB 3E6CC 5E1RA 3CL1A 4QGLA 4JTNA 3WY6A 4CEYB 1KJLA 2RS13 3GBGA 2JDZA 2VXRA 1QJZA 5HCAA 3PJYA 1SLAA 4OHVA 5CIRA 4OVEA 1ZZ9A 5IK5A 2PHLA 3B3QE 1MEC3 4DY5A 2ZGLA 2WZPP 1VLNA 3KCYA 4TLFA 4XDQA 2GMPA 4KBBA 2WNUC 3OBTA 3LCPA 2E51A 5L7OA 4KGGA 1UZYA 4YFWA 2ZTNA 1RUC2 3OD4A 1HDKA 4XIKA 4XYXA 4AI3A 5JIAA 3V0AA 3UKNA 3V65A 4COYA 5ABJB 1QY4A 4RHV1 4CEYA 2YROA 3H1MA 2HWE1 1REFA 4J1WA 3EQEA 3ES1A 4P14A 1VBC3 2JD4A 4FPEA 4G4FA 1Q8QA 2IXLA 4XQWA 3JBG1 5KHHA 3ZFEA 2XLFA 3H3ZA 3RZZA 1RJ7A 1EAH3 3JQXA 4QT6A 4ATEA 1WMEA 1RUJ1 2FBEA 1WBFA 1CAVB 1HRV2 2WNVA 3MYXA 4Y1ZA 2CWMA 2ET1A 4XXAA 1AR92 4XJ9A 2ZX1A 3IBMA 4XQ4A 2O1QA 2IXCA 4GULA 4N7IA 3MGUA 4WM8B 3VDDA 3DV8A 2BBVA 4XBQA 1G9AA 1NY71 2UY8A 2WQ4A 5ABJA 1W6PB 4LBKA 4AI0A 1DGRA 2K2SA 3SH3A 5L73A 1D2QA 1RUG2 2A3WA 5F5QA 3ROUA 2RJLA 1CAVA 1UD1A 3FE5A 3ES4A 1ZRDA 4GH4B 4Q1RA 4OHXA 3IIAA 1XU2A 5FAXA 2MPFA 4C90A 2ZGKA 3CEWA 1C57A 4WM8A 4KQ7A 5BV6A 4FPGA 1MS0A 3A0KA 5AC91 4OHZA 1W6PA 4IEVA 2DCKA 3ZMOA 1MS4A 5J09A 4JGYC 5T50A 3DN7A 1RTVA 4OI1A 1VBD2 2OA2A 2WS91 1DLLA 4AFDA 4AEDA 2QJVA 4IERA 5J36A 2GN3A 3CJXA 1LTEA 1XU1A 2R0HA 3J4UH 4XFIA 5A33B 2Q0AA 1PIV3 3G7DA 3OF1A 1APNA 4HLTA 4PLOA 4NR1A 3TN93 1DZQA 3BU7A 4XJZA 4AEJA 5BNPC 1G9DA 3AKPA 3TWIA 3LKJA 5C9AB 1EPWA 1TNRA 3AMHA 1AYN2 1YJLA 3ATGA 4AVTA 4C1XA 1RUE1 2ILMA 2WNUB 2H0VA 2D3SA 1HRI3 2QQPA 1F5FA 5D8AC 2QVSB 1J1TA 1MS5A 1AZDA 2PHDA 1VBE1 1YJKA 4GWNA 1VBA2 1HKDA 1OSGA 1CPMA 1N47A 2GC1A 3OBRA 5A33A 3MW2A 1NXD1 1MS9A 4DXZA 1LCLA 4QMAA 3IDBB 4IEPA 1R1A2 2D5FA 1AR81 1I5ZA 2UURA 1SFYA 2PHRA 3LGRA 4IV3C 2D3RA 5C9AA 1POV1 3G6JB 2DTWA 2C1FA 4IEZA 3BOPA 1DQ0A 3DF0A 1TMF2 3MIHA 2ZOEB 3T2TA 1R1ZA 1YFYA 1RUF3 3MPPG 4DINB 2OZJA 2RS11 2DVGA 1S0JA 4YW2A 3LOBA 5CFCC 2GC0A 5JSRA 3JD72 2C9AA 1D4VB 2GNBA 2CNAA 4NHKA 5DZEA 4GB32 1OQEA 1LJ7A 1V70A 2RM23 4ISRA 4ES8A 2ZMKA 4E4SA 5JOXA 4ISQA 4Y22A 4LO4B 1O5UA 2JJ6A 2PTMA 4LHKA 5GLZA 3QCWA 5GKAC 1KQRA 2XH6A 4H7LA 3KGLA 1C4RA 4F8AA 2WNEA 3THPA 3CJIC 2WLQA 4L2NA 3INAA 1RIRA 2ET7A 1RUF2 5EYXA 5GLVA 2NN8A 1W6MB 4FP3A 3BCWA 3ST7A 2XLGA 4YVWC 1J1LA 2DTYA 3S7IA 3ZO0B 3AFGA 1IS4A 1QXPA 1EAH1 4KWJA 2AH2A 3H7JA 2MEV3 2WZR2 2UY9A 2ZMNA 3WZ1A 2GZWA 3LA2A 2ETEA 2P3KA 3GHMA 4OI4A 1RUH3 2FHRA 2CGPA 4MGKE 2R062 2VNRA 3I7DA 3WHTA 1BBT1 1FOD1 4AQSA 2XVKA 3LSEA 3X29B 1YFWA 3AFKA 4CDUC 1R082 3KD4A 3AB0A 1AL23 1SLIA 1LGBA 4Z8BA 4JRLA 4XF9A 1W6MA 1YRZA 2D97A 4TZDA 3H0OA 1CPNA 2XBO3 3AMPA 1H8VA 1GLHA 2RS31 4WM7B 3AYDA 3JU9A 1OI6A 4NWVA 1OPMA 3B01A 1GR3A 1GV9A 2VOKA 4HN1A 1GNHA 2YUEA 2ZACA 2AYHA 2XB6C 3LAGA 3I59B 2H6CA 1LOCA 3VBUC 1HQLA 5GZCA 4AI8A 1RUH2 1URXA 2ZZQA 2DVFA 1LHWA 2NZ9A 4FPLA 2EXKA 4YLZA 4HZFA 1ZZ8A 3ALQA 5T5PA 4XBLA 1W0PA 2E9QA 3HAGA 1PO22 1AL22 3M3CA 4RS5B 4XXPA 5C8WA 1NCQC 4WM7A 3D8CA 4BHPA 1V6JA 3U10A 4W6XA 1QOSA 3M3EA 3POWA 4CDQA 3LWCA 4I09A 4CYDA 1YFXA 2A75A 1UAIA 5T5LA 3VBOC 1LU1A 2VH9A 3ZYJB 3I59A 3H1WA 2ZPXA 1PIV1 4XEZA 4R9AA 1C8NA 4S2HA 4BMEA 5DG2A 3TN91 4Q0VA 4WVZA 1ENXA 4N53C 3VZNA 3D0SA 1KJRA 4YVSC 1SLLA 2DV9A 4NOTA 2KM2A 4COZA 1ZYBA 1W6NB 1HRI1 4RS5A 4F83A 4ZXKA 3VBRB 2PELA 3WDVA 1H30A 1H8TC 2NM1A 4YGEA 1VAMA 1J3RA 2XL9A 4EN6B 4IQPA 4C1WA 2IC1A 4YZ2A 2RS53 4IEUA 1VB4A 4M01A 4FOWA 4WBBA 1R093 2XVGA 3GNEA 1FPN3 1UU4A 4Q2FA 4I02A 1SEFA 3N7KA 2Q30A 3BODA 4COVA 3KLSA 4R52A 3RYPA 2LTNA 4P9IA 1QDCA 4AW7A 4CDWC