2JG8C

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
b'KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 131
sequence length 131
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8C00
4TWTA 3V56A 2JG9C 4KGQA 5KWRA 2JG8B 4DB5A 4G3YC 3LKJA 1U5YA 3TYJA 4D7YA 2OIIA 1C3HA 2R32A 4TSVA 5TSWA 2E7AA 2WNUA 2Z5WA 4OUSA 4QPYA 3IT8A 1TNRA 4QQ2A 4DOUA 1D2QA 1PK6A 4G4FA 3URFA 5BNQA 3ME2A 5KC6A 3WD5A 1RJ8A 3QD6A 4KGGA 1IQAA 2JG9A 4J6GA 4KG8A 1OSGA 5L36A 5KC5A 4MXWA 1OQEA 4MXVA 2HEVF 1S55A 4E4SA 2HEWF 4NN0A 1D4VB 2JG8C 3B94A 2AZ5A 5HBAA 4E4DX 1RJ7A 3B9IA 2WNVA 1I9RA 1JH5A 4HT1T 2TNFA 4QQPA 1ALYA 2WNUB 3K48A 4RSUA 2Q8OA 1JTZX 4EN0A 4GIQA 3B93A 4F3JA 1PK6B 2Q1MA 4QQOA 3FC0A 1KXGA 1A8MA 4QQHA 2RE9A 1DU3D 1U5ZA 3AB0A 1U5XA 4OULA 1PK6C 2JG9B 2RJLA 2JG8A 4N90A 1D0GA 4OUMA 4MXWB 2RJKA 1XU1A 2ZJCA 5CIRA 2KA3A 2ZPXA 2R6QA 2HEYF 2QE3A 3TWIA 4QQLA 1C28A 1GR3A 2WNVB 3QBQA 1TNFA 1WCKA 2WNUC 2O0OA 1DG6A 1OQDA 2R30A 2WNVC 2TUNA 1KD7A 3ALQA 3MI8A 1O91A 2X29A 5L19A 3K51A 3L9JT 1XU2A 4MSVA 2QDNA
chains in the Genus database with same CATH superfamily
3KV5A 1HJGA 3IIAA 5FREA 1CAUA 1OFNA 2BGCA 2JIJA 1EP0A 2LRPA 1LU1A 3V64A 5I91A 5A6YA 3OSDA 3WHTA 1HV0A 1AR83 2E26A 2VTFA 2OA2A 5L73A 4XZPA 5I0RA 3GZUC 1QXRA 3CJIC 3KF3A 4FOWA 5A80A 1D4M1 2CWSA 3E5QA 5A33A 5CAZA 3GXUA 1LOBA 2VD7A 4AOCA 1HRV1 4EWDA 5FIXA 3DCQA 1QHDA 2D6PA 3CL1A 3ME2A 4RQPC 4P02B 5EXOA 3NWKA 3AKRA 4HKLA 5HI0A 1ULCA 3RQ0A 4PBPA 4V1PA 4AL9A 4DUXA 2HBUA 2X09A 4K1ZA 4PDWB 2VW2A 4IV3A 2PFWA 2VW1A 1L3JA 1J3QA 1O8SA 5L9BA 1H4GA 3BPSA 3OYWB 1VB2A 4KG8A 1W9FA 1F4AA 3N9MA 4LK6A 3UV9A 4BOWA 1S2BA 5A6ZA 1VAVA 1R091 1V70A 1OQEA 2E31A 2VL4A 3ES1A 3N9PA 5FCCA 1S55A 1WCQA 1NKGA 3ZXKA 3E5XA 4LXLA 4ZY9A 5K8SA 1H2KA 4PBOA 4EN7B 3AP5A 4HLTA 5J36A 2VZSA 5G04L 1Q56A 4XAEA 2VMGA 3AM2A 3ZFEB 1V9U3 1WCUA 5HCFA 1QDCA 2ATFA 2OZ6A 3DV8A 4IEPA 5IFTA 2PHUA 2XJRA 4WVMB 2C9KA 4DXTA 1ZA7A 1DQ6A 1PGSA 4BM8A 5FY7A 1FNZA 5FZKA 2GC2A 3B02A 3GNEA 1FT9A 1HN1A 5GJ6A 3OJBA 4AQSA 1OVPA 2FZ2A 1PVXA 1XNAA 1A8MA 3AC0A 3OOXA 4XDPA 4XQDA 4URAA 1O3TA 3VLBB 2GNBA 2OUHA 4NRMA 4RGGA 5FMOL 2RS13 2W3JA 4XMIA 2Z69A 1UOGA 1RTVA 4MO3M 3BYWA 3LEIA 2AENA 2D93A 1RUH1 3PVEA 2WC2A 2E53A 3TEZA 5H9RA 3WW1A 3GJAA 4DUWA 5BNPB 1R1A2 2X5IB 3VBUA 2V5YA 1W2TA 1E5SA 4L8QA 4AQ2A 3D8CA 1GOFA 5EJZB 3P1IA 4AHXA 2A71A 3E1F1 3WV6A 1X9PA 5LK5A 2GZWA 2VMHA 4MGSA 1DLCA 4MV2A 1ZZ9A 1OUXA 1JZ5A 4XTMA 1GR3A 5C9AA 3OUJA 1NUKA 2RR11 5I8YA 4XMAA 2E33A 3RZLA 3T3YA 2WFPA 4KWJA 4OI4A 2VOWA 4BQYA 3KV9A 1DG6A 4N53B 4V2VA 1GP5A 2Z42A 5FRAA 2MEV2 5C4WC 4YZ2A 3I54A 2Q30A 4C0BA 2DU0A 3J8F2 2ZGTA 4XXAA 2HYXA 3DYPA 4AEDA 3F95A 3IDCB 1CZSA 2BU9A 5JWPA 2PHLA 2D7FA 1LRHA 4IERA 4A7ZA 5ACA2 2ZTNA 3B7MA 4OI2A 1W8HA 4B7KA 3V0BB 5JPNB 3FHIB 5KWRA 3PDQA 3T30A 3D5OA 1OD5A 4GMP3 4CDXA 3ZFFB 2ZHNA 5F5CA 4LA3A 3EJKA 2NMNA 2BBAA 2DUPA 4RS5C 5FP4A 2V73A 5A7NA 5FJHA 3WNKA 2OPKA 4PQ9A 4D94A 3I3DA 5FZMA 1JZ2A 1X8EA 2DCTA 4WM8A 3U10A 1W06A 4AHWA 1RUC2 3PVOA 4K7JA 2XQRA 3TOJA 2GMPA 2DCKA 1LKNA 1PGW1 2W52A 1PNFA 2V72A 4AWDA 4XDOA 5J3UA 4IEUA 5AC91 4XPVA 2RS31 2ARXA 5FY8A 1JYXA 3JD73 1DGRA 3GGLA 4EWEA 1EAH1 2VCCA 1NLQA 1V6IA 3INAA 4MADA 2GMMA 5A7SA 1GOGA 1RL3A 2Q8CA 1XBFA 4E4SA 5FZGA 3PUIA 3VBOA 2XJPA 1NCQB 3B5LB 3J4UH 5I8SA 3VKFC 4MGIE 1G9AA 4O65A 2X8KA 2P3IA 1UYXA 3JU9A 1JZ7A 3LF7A 4LO4B 4XCAA 5JOYA 4DEVA 4Y4RA 1JH5A 1N1TA 4XILA 3CO2A 1ALYA 3HBZA 3M3QA 3NJXA 4QDRA 3BTYA 2BWCA 2VNGA 1QOOA 3ACGA 3N3HA 3FHAA 3P3NA 4RSUA 3RG0A 5FDBA 3S57A 1EV12 2OQ7A 4K8RB 2OXBA 1XYPA 2TBVA 4ZONA 4PF5A 2ZACA 1JZ4A 3FC0A 4N43C 2V09A 5A3TA 4L9BA 5FZEA 3BKZA 1LESA 5FPVA 1CIWA 3DGTA 2W46A 2YU1A 3GCWA 3MIEA 5FY5A 2B39A 4CXXA 3VDDA 1DP0A 1DU3D 2RHPA 3VZMA 3WQ1A 3ENRA 2GU9A 1H6YA 5JXHA 1D4M3 1QJEA 3TEXA 1W3VA 2Q1ZB 1BLZA 1H8TB 4OHWA 1CJPA 1D0GA 4QX2A 4FFFA 1S4CA 4HETA 1KS5A 1HRV3 4WM7B 4XBLA 3SH3A 1ZRDA 4Y20B 3ZYJB 2ZEWA 4OCTA 3OBRA 4Y22A 2AEZA 2ZHMA 3PMSA 4RR3B 5DMYA 1LULA 3HQUA 4JC1A 4COVA 1VRBA 3IPVB 3R05A 5JVVA 3TRSB 1BYHA 1I5PA 5A7WA 2VXRA 1G8WA 2JE7A 2Q1FA 1A3KA 4H7LA 3ZXAC 2EXKA 1K5MC 1SPPA 3M1HA 4Y24A 4LUKA 4CEWA 2C5DA 1R093 4FO9A 3RJ2X 4GJZA 1OQDA 4UFHA 3S5AA 5FY1A 4HVQA 1UAIA 4KQ7A 1B09A 4OMDA 5DPNA 4J1WA 1HXS2 1OH3A 2BGOA 1SG3A 5JSPA 2ZAHA 3AP6A 3O1MA 4LBOA 3ZN6A 2FMDA 5LCWL 4P00B 3CLPA 4K8FA 5FZAA 1Z7S1 2W08A 3O5SA 5FLIA 5A1AA 5F1RA 2WQ8A 1O8PA 3V56A 5I0DA 4ISQA 4CDQB 4CU8A 5C8CB 2Y6GA 3LKJA 5JOWA 1BBT1 2QQWA 1G9CA 2D6OX 5GLVA 5T3NA 1OMIA 1CD3G 4ZU7A 1G7YA 2WWUA 3ITQA 4Q4Y2 4BLIA 1S0GA 2C1FA 2IXKA 4LQRA 1MS4A 1C3HA 1QMJA 1OVSA 3DPRB 3UGGA 4GJYA 4KL1A 4LHKA 4UBHA 3AKSA 2LM3A 1VB4A 3ZIWA 3UETA 1B35C 3FLPA 1YJKA 1RUH3 2YGLA 2D43A 3VUOA 1FOD2 1C1LA 2GN3A 2IXJA 3POYA 4JGZC 5F5IA 4CPBD 4GWNA 3DL3A 1SMVA 4AAPA 1R1A1 1XNCA 5L9RA 3W5NA 4LK7A 2ARCA 1S0JA 3NAPA 2DFBA 4COYA 4KU7A 4J6GA 2RVAA 1PO12 4BXSV 2ZOEB 2E9QA 2RR13 2DVFA 2WA3A 4MXWA 4QX3A 2YGMA 3FLRA 3T09A 2FCVA 1REFA 4OHZA 4Y26A 3LZZA 5I0UA 1UPSA 1CX4A 4S2DA 3P3PA 1RXGA 3HVDA 2MEV1 4OMCA 1LOFA 1GICA 3J8F1 2BPA2 4BXFA 5FLHA 5GALA 2XJVA 1ASJ1 2YUEA 4EQVA 2OVUA 3B00A 4N7IA 3GJBA 2WQ4A 2VZOA 3RJRA 3UT0A 2Z4FA 5H9PA 1RUE1 1IS3A 5FZBA 5ACA1 2ARAA 4AI8A 1JTZX 2GALA 4L11A 2XR4A 3VGIA 3LFIA 1O4TA 1RUD2 2R49A 3MIDA 5KHKA 1LB2A 1SLCA 3H9AA 3IB3A 5FPLA 1APNA 4GH4A 2OPWA 1WCDJ 1C4RA 2VTXJ 2XHNA 1CAXB 4A6OA 3H8OA 5FZ1A 4DO0A 1NZIA 4OI1A 3AYEA 4YW5A 1F35A 3QLQA 1PK6C 2IXIA 1OPMA 1LEDA 4QU2A 5ABJC 3HT2A 2JDAA 3NSTA 3OPWA 1UNBA 5BNOC 1NE6A 1GQPA 3LGRA 1RUC1 5CIRA 3LIHA 1UN1A 3X29B 1EYBA 3OEAA 3D6EA 3MV11 1JOJA 1CAVA 3BTXA 4QB1A 3R4SA 4I0WB 4UT5A 2C26A 5F8PA 2XJSA 5AC93 2RS33 2JICA 1L7QA 3PU3A 4LO7A 3WDUA 2F4PA 1MS9A 1PNGA 4Q0UA 2VZUA 3R4UA 4QPGB 4TLFA 1XE8A 1TNFA 4QHZA 1FATA 3FX3A 4TTGA 1LAJA 1O4ZA 1T6BX 2B46X 4NWVA 3ZLIA 3NRUA 2YDEA 3UGHA 1Z78A 1TMF2 4U36A 1QJX3 3RSJA 1C1FA 3OUIA 1QWRA 3DXTA 1KITA 1DIWA 2X29A 3WNPA 1MS8A 3K51A 1VBA2 2UYAA 2ZGPA 3H3LA 4B1LA 5FXWA 1HDKA 5SV5A 4C1WA 2JG9C 3WF3A 5T55A 1YI7A 3I2IA 4M0HA 5BXXA 3RZHA 4DB5A 4G3YC 2ZX2A 1EV11 1H2NA 3PNAA 5LRRA 2WO7A 4UW4A 2J1VA 4PJYA 2GMEA 1JXNA 1YQ8A 5CKMA 1KJLA 5IJRA 2NM1A 2XJQA 3NO8A 1XNTA 2K9ZA 4X6RB 4YVSC 5A32B 3AFGA 5J48A 4CDUB 2Y60A 4RHV2 1Q8SA 1QJY1 4QPYA 1ZBA2 4QXKA 5LBFA 3W20A 5FZ4A 3HN3A 5EQUA 2WJSA 4GZ9A 4Q0VA 3VBRB 2J7MA 5D8AC 2AH2A 4PIZA 3USUA 2Q4SA 4I3PA 1H9WA 2A6WA 4YM1A 3ASIA 2QQKA 2JDNA 4AAXA 1QJFA 2I74A 4HPKB 1RJ8A 2QJVA 4YVWC 4FQ4A 3RI8A 4A6SA 1JHJA 3CIHA 5LATA 4BQ3A 4KGGA 1RB8G 1W2UA 2BNOA 1ACCA 4OZXA 2D5FA 1VBC3 5IVVA 3POFA 4LBQA 4R52A 4XUQA 3C7FA 4C0HA 5KR7A 5LBEA 2ARBA 1XPWA 1R082 3ROUA 4HBNA 3RRDA 3AZZA 1UF2C 1ZREA 4H3WA 1GBGA 5FP3A 1CAUB 2X05A 3EBRA 4EN8B 2ET7A 2JG8C 4Q2FA 4R9DA 1RMU2 5A3PA 5IVJA 3WNNA 1PVC2 4Y1ZA 1ODNA 3H50A 3BCWA 4Z2AA 4HK8A 2FDHA 5K4LA 4KBBA 3HN1A 1CPMA 1HXS1 2LROA 5JPMB 3MZHA 1POQA 5IVFA 1W8NA 4Q0SA 1Z7S3 2HWB2 5IVYA 4A7YA 1AR93 1MS5A 4QX5A 5A33B 5M0TA 1J59A 5DZGA 1SZBA 5T54A 3ZFEC 1OUSA 4DRVA 4BYYA 1BBT3 2IC1A 4P5HA 3RNSA 3RWKX 3OBAA 1KDMA 4QQHA 5EYXA 5LRSA 3MEPA 2FCTA 2Z79A 1H9PA 4Q4Y1 4XJAA 4O61A 4CUAA 2NP0A 3NL1A 2YYOA 5FMOS 4IV3B 5LBCA 4BCUA 4LPLA 3U37A 3VB9A 4JDNA 3C8XA 2VG9A 4Y1YA 4A7KA 1H6XA 1N1VA 1EY2A 4YW2A 4O9EA 4JKMA 1W6MA 1GWLA 4CCEA 5JXJA 4JKLA 5C3OA 2QQIA 1FOD1 4QWNA 3WF1A 5JXIA 1R1A3 3FMGA 2TEPA 3SNMA 1A34A 3ZXGA 5FTTC 4M3CF 3VHNA 4DXZA 3M3EA 3FFQA 4GB32 1H0BA 1URXA 5J37A 2ORZA 5EWSA 5FO8B 5LW9A 2H6CA 2XHKA 5K0UA 1GZCA 3H1WA 4IETA 4CCDA 3MW4A 3BVCA 4LJHA 1L7LA 4CUGA 2E51A 3POBA 5JDBA 2AYHA 2ZMNA 5CFCC 2BBVA 4QDSA 4YWAA 3WX5A 3N7LA 3WZ1A 1US3A 4XUPA 1Q8VA 3VD3A 2MEV3 1UKGA 4KBZA 2WR9A 3WP5A 4OHYA 3J8F3 2TUNA 4IEOA 1DDLA 1HB1A 2BV4A 1ASJ3 3SITA 4N53C 4P9XA 3POWA 1UXXX 3F2ZA 3AVSA 1RUE3 3L2YA 2JE9A 3THPA 1UY4A 1UZ0A 3PTYA 1VIWB 3RYKA 3AP4A 4NHYA 4D7YA 3LPFA 3DEMA 4HVRA 3VBUB 2XH6A 4D6QA 4XF9A 3WQ0A 3ZDVA 3I49A 1F5FA 1ZA4A 4A3ZA 4CA9A 4UF0A 4AI0A 1Q5OA 5TSWA 2XB6C 2WNUA 3DKWA 3ZN5A 1YFXA 4ATFA 5J09A 1M06G 2B42B 5C9AB 1RITA 3O1TA 3A4UA 1K45A 4COWA 4DOUA 1F9KA 5AVAA 4UW6A 2ID4A 1RUC3 2J1TA 1W9SA 2ZKLA 1CVNA 5JR7B 3ELNA 3HOBA 1TME2 3ZKYA 4MLOA 5KXDA 4I0AA 1QU0A 2VMFA 3I7DA 4AEDB 2PHDA 3CNAA 4LBJA 5FZ8A 1W28A 1CWPA 2NN8A 4LMFA 2FHRA 2I07B 4EJRA 1J1TA 1WBFA 2R7EB 3AMQA 3ZFGA 5JZGC 4EZ4A 4IE0A 1UY2A 2YPDA 4NROA 4V2WA 3BTZA 1SEFA 2DBNA 3CJIA 1SFPA 5T5LA 4CDXB 4JQRA 4XFFA 4CU7A 2VMCA 1WLTA 3VBHB 1OA4A 1TMF1 2R041 1OLME 5HCAA 2NLRA 2VZPA 4RQPA 1NCQC 4GA9A 3CKHA 4MOAA 4AEJA 2FD8A 1W8UA 1JU4A 1GOHA 5GZFA 4WM8B 1U5IA 5FP8A 1J58A 2A1XA 3AZWA 3JZVA 3UL2A 1WMFA 5GZDA 1QIQA 4YGDA 2Q5TA 3E6DA 5KXCA 4LHNA 4TXWA 1EV13 4X8PA 3E6CC 4BWOA 3M7AA 4KWUA 1PGL2 4P9JA 5IFPA 3KVBA 1UMIA 4BQ1A 2VUCA 4FTEA 5FQ0A 4ARYA 4M4PA 2I45A 1OF3A 1UX7A 2WWSA 1JYIA 4K6BA 1QJY3 1XNKA 5JR2A 2RDSA 2IUWA 1ZBA1 2Y8KA 3AKTA 3AP7A 1RINA 1MEC3 1AL0G 3E5UA 1X8MA 2D5HA 2P5BA 5FZDA 4NO4A 2YMZA 1BQPA 2QCSB 1AF9A 2RDQA 3DF0A 3VBOB 5LBBA 1S0DA 1D2SA 1P8JA 1H8TC 2VW0A 3ZXLA 4ITCA 1ND3C 2QQPA 1RUI2 1FPN2 4QQLA 5FLJA 5F2SA 4IV1C 5C8WA 4QPWA 5ERLA 1VBB1 2LS6A 2WZR1 2KD7A 5FZ9A 5IK4A 5FWJA 1G9FA 4DXSA 1J84A 4XZUG 1R081 1VP6A 4I0BA 3MICA 4SLIA 4Q4X2 4CEYC 1UW8A 2ZZQA 1RMU1 3BIEA 2BFUL 3RZMA 4QXCA 1PVC1 4CRQA 5EHDA 2R0FA 2W5FA 1HXS3 5FZLA 5A70A 5CFDA 3VDDB 3ZXJA 4UWDA 1JUHA 2VZQA 1QQP2 1EPZA 2VCBA 2XBO2 3RI9A 3AZYA 4L99A 2D6NA 2HWB1 3WCRA 1IOAA 2FDFA 2A5ZA 1GYKA 5CBLA 5JSRA 4AGVA 5LWBA 2YFUA 3A0NA 1OLQA 3MF6A 5G05L 3O1PA 3IKWA 4FVVA 5FYCA 2P3JA 1AX0A 2DYCA 3ILNA 4Y22B 3QACA 2OW4A 3NKGA 2GNDA 2XXZA 3U07A 5C8CC 1W8FA 5CISA 4DZGA 5F2WA 5BNNA 1YQ5A 5C4WA 3AJZA 4QQ2A 4NIGA 2PYTA 5A7WB 4FTSA 3NMBA 4G4FA 2VZRA 4UYBA 5FP9A 2GC1A 3MGUA 3MIFA 4QGNA 1SPPB 5FYZA 5BNQA 5C3RA 4CEWB 5C71A 3PJQA 2VU9A 2HWE2 4DY5A 4Z2WA 4P14A 4BPZA 3WNXA 3JCIA 2A3YA 3UESA 4L2NA 2BGPA 3SQOA 4NPRA 1FOD3 5FWEA 1JOBA 1SBEA 1CR7A 1KQRA 1WLCA 2CNAA 1H2MA 2GP5A 3MLKA 1JN2P 2XVGA 1W6OA 4N8MA 1F5JA 3ZN6B 4BIOA 4NHKA 3WW2A 1KRIA 3FUOA 2IXHA 3EHKA 3PL0A 2C24A 4GB31 3M4FA 1NCRC 1OD3A 4L92A 5F32A 3MFAA 5CKQA 2VUJA 3EXUA 1FX5A 1VBD2 2JDHA 1FV3A 3NNGA 3QCWA 4NWWA 4C8DA 3WF4A 4F7ZA 2AZ5A 1S0EA 2D44A 3MPBA 4B3NA 4MZUA 1UOJA 2EIDA 4M3CA 4X6QB 5AFBA 2G9FA 4RL7A 4BA6A 1C8M2 1PO22 1TQ5A 1O59A 3C2UA 3NV2A 3Q8EA 2JE8A 4HT1T 4QQPA 1HRI3 3WT3A 1ZZ6A 3FLTA 4QDQA 4KWKA 1KEXA 4GIQA 4WVVA 4MGZE 4NMIA 4AEMA 2DVGA 1LODA 2X10A 1QJZA 2A7AA 3VBSA 2GC0A 5FPUA 5L7OC 2A3XA 2R0HA 3FUQA 1YHFA 3R0RA 3VZNA 1N47A 1I5ZA 1W0PA 5FOJB 1W04A 3NAPB 3VN4A 1KS4A 5FMBA 4LO5B 3VD5A 1DYPA 4Q26A 5CEHA 2BQPA 4QXBA 3SEPA 3D4KA 2VBDA 2ETEA 1MVEA 1YC61 4HMZA 4MXWB 4RFT0 3HAGA 1OQ1A 4R9BA 3NJZA 2OZJA 1ONAA 4INDA 4UI9L 1ODMA 1TVGA 5BYNA 4GAZA 5FJKA 4MHUA 2AR6A 4ZPIA 3ZXFA 4KG0A 1TME1 2WFF2 2WZPP 3WLUA 2JDZA 2G19A 3Q9OA 2IXLA 1O7FA 2UY9A 3ZXEA 3WUCA 1C5HA 3PUAA 3WVJA 3BB6A 1CQ9A 1ULPA 3OY8A 5F5QA 2ADDA 4LKDA 4N43A 1QF3A 4F8AA 2YBPA 3WDVA 4XURA 5LASA 3WUDA 4GXLA 2Q0AA 3U14A 4NJ4A 4ZS3A 4N7UA 4HKOA 3WG2A 2DV9A 2FDKA 4H55A 2QQNA 3I59A 4GH4B 5GZCA 1OOPC 4H7MA 1JW6A 5C3PA 1TMF3 3O0WA 4AQTA 4AE2A 2BTVC 3WNLA 2R043 4A41A 5J98B 1BHGA 1XU2A 2QZ3A 1NG0A 3KHBA 5LEKA 3JBG2 3BPZA 3OEBA 1VAMA 1OLRA 3OG2A 4OLLA 1K3IA 4NRQA 2ZMLA 3I2JA 1IPKA 4B4RA 1GZTA 1U5YA 2RM22 2WRAA 1ULDA 4PT6A 2DTYA 4CCMA 2XOMA 1CAVB 5JAXA 2PLV3 2VZVA 1K5MA 1PGL1 3ACIA 3HT1A 1EPWA 3S6PA 4JQTA 4ZKTB 2VXJA 3OUHA 4MX3A 1ZBA3 4MH0E 1AYM2 4HONA 4FT8A 1CPNA 3LPGA 5FYTA 4QKDA 1VBE1 2WN2A 1X50A 4XJ8A 1W9YA 2NPIA 5FXZA 2DCYA 4Y1XA 4NIIA 5HPOA 1UZWA 3VBRC 3VBFC 5FYBA 3ATGA 2R072 3GF6A 4GD4A 3UJOA 4AFAA 4CCOA 1RUI1 1FPN1 5DAQA 4FP2A 2VCAA 1VBB3 1NXD1 3MLJA 3T0BA 4KNCA 2WZR3 1XE7A 2D6MA 2ZA9A 3VD7A 4IQPA 4XOGA 1W03A 4E4ZA 3AMPA 1VLNA 4JTOA 1ZZBA 1S0BA 4HZFA 4C1XA 5C7GA 1PIV2 5HXMA 4E4DX 2HJIA 4J1XA 5DAXA 4P9IA 4Q4X1 4BU2A 2VTXA 3B9IA 1RMU3 3GYDA 1J1LA 4PQQA 1QKQA 4YM3A 1PVC3 2GNMA 1B35A 3KZ4C 4HKWA 1GV9A 2QQUA 1MQTC 4O9GA 4QX1A 3TN92 5JMCA 2DF7A 3BI3A 1UIKA 3AX4A 4EN6B 3FL7A 4B1MA 1QQP1 3I2GA 4COZA 2XBO1 2HWB3 3RVHA 5FZ7A 2ZX4A 3USUB 2WS93 3B69A 3QH6A 1J3PA 4E8DA 1FYUA 2CGOA 4E2SA 1SFNA 2ZGQA 3JUUA 2R1BA 1LNSA 3ZIXA 1QJU2 3MDPA 1VMJA 3ZOIA 4M3CE 5DN2A 3UKNA 3K46A 1LGBA 1PHMA 2BDRA 2PAKA 1RUJ2 4LBQB 1W2AX 4OFGA 4NAOA 4R9CA 4XJUA 2JDUA 4EE2A 3M2MA 2VOTA 3ZYHA 2WKKA 3ZXDA 4QPIC 3PTRB 2HWE1 2KA3A 2ZPXA 2YY1A 2QKDA 2UWCA 4ZU4A 1W8TA 4FP3A 5GZGA 1W05A 5EPAA 2W0XA 3KSCA 5FYHA 1ZYBA 2OT7A 3VZLA 1WUVA 3ZX7A 2VQTA 4C90A 3N4MA 5KHJA 3MBWA 1K42A 4URTA 2O0OA 1NX9A 2P3KA 2PHRA 4JDOA 5B2GB 2OS2A 4X8NA 4UOJA 4W6YA 4PHZA 3ETQA 2ES3A 4YLZA 3FE5A 1VBD1 3GCXA 5LK7B 5ABJA 3MW2A 4AVCA 4DUVA 1KGYA 3IAQA 4MGTA 1BZWA 5BNOA 3LA2A 4GKYA 3A7QA 2NYYA 4HSJA 4CP9B 1RUNA 1C8M1 1PO21 5CVRA 3D3AA 4PIYA 1XSQA 1XRUA 5HXVA 4CU6A 2QQLA 2XVKA 5FV3A 3HQXA 1G9DA 4K9SA 5T52A 1RVF2 1WLWA 2AREA 2G4IA 1W6MB 2PAEA 2ZMKA 2R16A 5FBZA 4CPBA 4JHZA 3THTA 4KU8A 1CIYA 2FZ1A 4Y3OA 3VL8A 1U12A 2YXSA 3H1MA 3THDA 1WKYA 2VNOA 3RZZA 1AR72 4I09A 5K0UB 2MPFA 2XL9A 5CG9A 1CJDA 4HFSA 2XVLA 1RUG2 4BH9A 1JHNA 4IEZA 1RXFA 4Y4YA 5KHIA 1JU3A 2PA7A 2ZX1A 3D0SA 4MUVA 1ENSA 3WP3A 5C9AC 1TME3 2PAMA 5FZFA 2K0GA 4AF9A 1UPIA 2JG9A 2WFF1 4P08A 2XJUA 2VNVA 1VAKA 2WYSA 5EYYA 2W1WA 3U11A 4A42A 1ENXA 4ZZ5A 2EVXA 1GNYA 1BEV2 4FAHA 4YW7A 3O1SA 4PLOA 4YVSA 1GZ9A 3MW3A 2ORXA 4JVAA 3SCHA 5A6XA 4Q1RA 3E97A 3N9OA 4YZ4A 4CXWA 5FYYA 5JIUA 1W8WA 2RMU2 1GQGA 3IMNA 2PMWB 1NZCA 5D8AA 5I93A 1G9BA 2A3WA 4UF0B 1OF4A 2WNOA 3SEEA 5DABA 4FXGB 3ZYGA 2WNUB 3MF9A 4CE8A 1BMV2 2B4KA 1COV2 2VMIA 1WMXA 3JBG1 1VE0A 4LBLA 4YVWA 2F6BA 1G6NA 4JV4A 4XIOA 4YW1A 3VBHC 1EUTA 3N9NA 2VZ1A 1IZ3A 2RM21 2CSGA 3PVNA 5FY0A 3ZDSA 2W92A 1C8NA 1QGLA 3KCYA 1GZWA 4IGQA 1CN1A 4MGQA 3OCPA 5A6QA 3NNLA 1NY72 4QX8A 3RZGA 1K12A 1ULGA 2JG8A 5FMDA 5HV4A 4ET7A 2Y6FA 3ZFGB 3MFCA 5F37A 3VKNA 3T0AA 5F7UA 1XJAA 1VBE3 4EWAA 3W59A 1MS0A 3CJIB 4MHRA 1YFUA 2V5DA 1ND2C 2CHHA 1SLAA 1WMDA 3I3BA 2CAUA 2R071 1NA1B 1REDA 3EQEA 4FPOB 4MGYE 3ZYRA 4BQWA 2LW8A 4RQPB 3WCSA 4CP0A 4HANA 1FXZA 1O5UA 2DWRA 4EROA 1DGWA 1BK1A 5A3WA 3LD8A 5LY1A 2W87A 2FBEA 2VOVA 3LAGA 2YG0A 2EIGA 4GQ7A 1IPSA 1PIV1 1PMHX 1RHI2 3ES4A 4Q4X3 2DCJA 4XF3A 4YGEA 1W2NA 5CYYA 3BUCA 1AZDA 4CYDA 2BFUS 4HSLA 2JDPA 2WO3A 1WWYA 3HWJA 5FQ0B 2GDFA 3KV6A 3TN91 2QDNA 5BUVA 2J1AA 4TWTA 1OI6A 1H1IA 4DIQA 2BJSA 4EYUA 2GC3A 1QQP3 2WO1A 2XBO3 1ZRFA 1GP4A 2VR4A 3DUIA 1PMJX 3MIGA 3VDDC 3NNJA 3T1LA 1EAH3 1NQJA 5JIAA 4FFHA 3EO6A 4P9YA 4ES8A 1JYNA 2QUOA 4MYEA 1I1EA 4E2GA 2MHFA 2MNGA 4K1YA 4QHBA 2E7AA 4OUSA 4IE7A 3IZOA 1QJU1 1V9U2 4JGYC 1DFQA 1K5JA 3A21A 4XFBA 5CFCA 1ZNPA 3ZYPA 5FO9B 3ILRA 2A6ZA 1RUJ1 3M8LA 2B9VA 2VO5A 2WT1A 3GALA 4QGMA 4XBNA 4YNIA 2VOKA 1W9WA 2HWE3 5HCHA 4M0NA 1IKPA 3EB7A 3IDAA 2VQUA 3IIIA 4AVTA 3BU0A 4AHYA 2K2SA 5A7QA 1QEXA 2ZABA 4Z07A 4F83A 2YBKA 5T5OA 5CFDB 4LT5A 1E57A 3Q8AA 4LLFA 2CU5A 5C33A 3AYDA 3BOWA 3POGA 4HVOA 2ZGUA 5FR3A 5IVBA 4NN0A 4UFJA 3ZSLA 4IDZA 1D4VB 2HLEA 5IHRA 3T4HB 1UO9A 1IS5A 4LE4A 3RMYA 3VDCA 1VBD3 3VKLA 5B4XA 4W50A 1YLLA 2WNVA 2EAAA 1DYOA 4Q0PA 4XF1A 4FBFA 1JZ3A 3EYPA 1YNAA 2VUAA 4JDMA 3OTFA 4JRLA 3RS6A 1QOSA 1UYPA 2J1SA 4FTBA 5FYUA 3CZJA 1C8M3 4XC9A 4ARXA 2ILMA 5BNNB 2WQZC 3VZOA 5C4WB 1YI9A 3UKVA 2HWD2 3H3UA 1QNYA 3OBZA 2IVIB 5FKCA 1KXGA 1SCRA 1HJFA 1VALA 4XVHA 3SH5A 1RVF1 2P4EA 1JYTA 2DU1A 2I2SA 1MZ5A 3ACFA 4OQ9A 2SBAA 2NZ9A 3NQHA 4PDWC 4QHOA 1CESA 4Q29A 5JZGA 2XLAA 3QH7A 2BW8A 2VQAA 4AR2A 1W6OB 4N90A 1WD4A 4XF0A 4NHLA 1AR71 1LGCA 3KLSA 2EALA 5FKBA 2AC1A 3W21A 2PQSA 2VAUA 3RMXA 1UIJA 1RUG1 2OUJA 1NCQA 2ZXQA 2FMYA 1LJ7A 2QTWB 1VR3A 5F5AA 4YW4A 3H8RA 4G9SB 4JKKA 4M3CB 2DVBA 2WFF3 1PZ9A 4TN7A 5DZEA 2A70A 4LOTA 4Q5OA 4LLOA 1V6MA 1MZFA 3WF0A 4CDWA 4XYXA 4RA0A 1JI6A 2C4XA 4HL0A 1SCSA 2XGXA 2ZEYA 1XYNA 2JECA 1PX3A 4Z92B 2Q8EA 2WAAA 5A1LA 3VBSB 4YPJA 1YO8A 3U4XA 2RS52 1UOBA 1M4WA 2DVDA 2ADEA 2JX9A 1TG7A 2RMU1 3AXEA 4HG6B 4WZFA 4XIKA 5CB7A 1SDWA 5A3MA 5CKNA 5LA0A 1OA2A 2O8OA 2OQ6A 3JD72 1AHSA 4XCBA 4Z8BA 2DUQA 2LALA 3MIBA 5ANQA 1WLDA 3CHXA 1V6JA 2HKXA 4GH4C 1BMV1 2WL1A 1LOAA 4Y33A 3B9CA 1ND3A 4NE9A 3N7JA 3TYJA 4META 1BCXA 5BNPC 2X5IC 3K3OA 4IV1A 5LB6A 2OIIA 4A3XA 1PO11 2RM23 1O3SA 3HJRA 1NYWA 1VRH2 2WSVA 4BZ4A 4CCLA 3B01A 1IG3A 2PELA 4Y5SA 1YIPA 2XL7A 3AMNA 3GBFA 1UMZA 1V6LA 3OY8B 3WF2A 1NY71 4CEYA 2CAVA 4N43B 2D98A 3OBTA 3AP9A 3JQWA 3KD4A 5KC6A 4NR1A 4LBKA 5C5UA 3ZSKA 4XW3A 5ACA3 1DZTA 1DGLA 2JB8A 2VVDA 3AZXA 4LO8A 2WLQA 3FWEA 3I59B 4XDQA 4GALA 4W65A 4RN5A 1IQAA 1OSGA 4PF1A 4YG3A 5DUUA 2GH2A 2WZ8A 2WWJA 1RUD1 3RGBA 2VBBA 3SHRA 1C57A 2VZTA 1UXZA 3ZO0B 2PHTA 1YWKA 4P5YA 3K2OA 4OQ8A 3WOGA 3T2OA 2P37A 2E32A 2YZ4A 5F3IA 2E63A 3DXUA 1W6QA 4QT6A 3ZFFC 4BISA 1IG0A 1PIV3 1H4HA 5IUQA 1RHI1 1ULEA 2WZEA 2C9AA 3AL5A 2TNFA 1UKRA 3M3OA 3PLQA 1FI2A 4ORFA 1AJOA 4AI9A 4UW3A 1F4HA 4DNYA 3TN93 2JIGA 1LHNA 4XETA 3IDEA 3IWZA 3MIHA 3H42B 2G9GA 3GBGA 1LGNA 4NPMA 1GU3A 1O4YA 3WY6A 2JD9A 4D6SA 3ZSEA 1AUYA 4A2UA 4PCRA 1U5ZA 1NCRA 4AGRA 4RFRB 1XC6A 5DDJ2 3AMHA 4COUA 3J7LA 3TAYA 1QJU3 1GFF2 2AACA 3B3QE 5B4NA 2JEMA 3UYJA 4I2OA 3J7HA 1IHMA 1RUJ3 4ZS2A 2AUYA 2XONA 3T1MA 3SXWA 2ENRA 1VBA1 1W6PA 5DQ0A 1DZRA 4YFZA 1REEA 1BKZA 5AFEA 1SACA 3WP4A 4LTAA 4LULA 3OF1A 4Y5TA 1B35B 2A6VA 5FZ6A 2JJ6A 5EV7A 5IK7A 5KHHA 3ILFA 3WG4A 2ZX0A 3H0OA 5L7OA 4XFGA 2LUWA 1UQXA 2WA4A 3DN7A 3H3ZA 3ST7A 2R30A 1YQ2A 2EA7A 1E5HA 4P9WA 5E89A 4AYUA 4EN9B 4YM2A 1W3XA 4Q27A 2QQOA 4XABA 4RHV1 3Q8BA 3G6JB 1SLIA 2ZGKA 1QNWA 5JCTA 4MVTA 5KBFA 3V0AA 4B8EA 3ALQA 3WHUA 3IBMA 3ZMNA 1O91A 2UYBA 4DMIA 4CUBA 1I3HA 2Y6KA 3NVCA 2ZEXA 5E1RA 1UZZA 3KVAA 2E7TA 5JLVA 4OHXA 1FMD2 2HWD1 1WW6A 4AG4A 3IM0A 4WM7C 3PVBB 3ZKUA 3WEZA 2HWC2 1RVF3 3HD8B 2BNNA 4ZU5A 4RR3C 5FZOA 1ZBE2 2FDGA 5FPBA 4BQ5A 1CAWA 1HX6A 1D2QA 2VUDA 1UYZA 5ISLA 1SBDA 3USSA 3M3CA 3NKTA 4YRDA 1AR73 4UBGA 1OOPA 2WT2A 4IXLA 5FYIA 1TE1B 5FOBB 5IATA 2N7GA 1C5IA 4GWIA 1IQDC 5I0TA 1RUG3 1DLLA 4J25A 3QD6A 3K4DA 5AVPA 2ZEZA 3S5QA 4AVBA 2K46A 3ETPA 3OGRA 5ABJB 5K0UC 3BOPA 1E5IA 1UWWA 3CQOA 5T5PA 5BNOB 2QQVA 4KWLA 3KGLA 5JOXA 1DGRN 2QVSB 4FPFA 2XUEA 1BJQA 4W4ZA 4IEXA 4MXVA 2HEVF 4FPLA 4ATEA 4QU1A 3SKVA 4YW3A 5JOZA 3T08A 4IE6A 3MHZA 4E2QA 4Q4Y3 4CDQC 4UFIA 3K75B 1XXNA 3SKJE 1FNYA 2WDBA 3WQBA 1HIXA 2V4VA 1NAEA 1GQHA 4Y1VA 2WT0A 2FCUA 3VKMA 2W1UA 2RS51 1H30A 2J1RA 1UU5A 2XJTA 1Y9QA 3FFZA 4JZRA 3WINE 1X9TA 2RDNA 3RYRA 4U2AA 3DPRC 2ZS6B 1SDDB 4XBQA 1BXHA 5K9YA 2E6VA 4I02A 3JD71 3B93A 1CZTA 4F3JA 2D6KA 4FXKB 1JBCA 2Q1MA 2Y6LA 3VBFA 1Y3TA 4QQOA 4LUMA 2X53S 3LSDA 3AZVA 1O3QA 1D7PM 2WNEA 3JQXA 2RE9A 3M70A 4BIFA 3LEMA 4E9KA 3KQ4B 1PO13 4PI2A 5A1FA 2F17A 1QJX2 4RS5A 5H9QA 4CZSA 3O12A 1W8OA 2R062 4LIUA 1VRH1 1US2A 3AXDA 1MZ6A 2JG9B 4Y1UA 1OHFA 4XQ4A 3GBWA 3C7EA 3VHOA 1Y43B 5EZWA 1KJRA 4QX0A 3KM5A 1OT5A 2RJKA 4FCAA 1UL9A 5FXVA 2DUOA 3ECQA 1DQ5A 4YVSB 3SCFA 1MQTA 1LOGA 4UW5A 3WW4A 3AVRA 2W47A 4IEVA 1C28A 3PJYA 3ZFGC 1GP6A 1UMHA 2JDMA 4FAGA 5D8AB 4B4PA 1UZVA 1LU2A 4R8HA 1L7RA 1RUD3 3FBYA 1W39A 4AEKA 2IZWA 3LDKA 2Y64A 2QQMA 4YVWB 3CJXA 3AKQA 4Q4V2 3OGVA 5I8TA 3JXSA 1NA1C 4YZ3A 2P3YA 1STMA 1DZQA 4HOOA 1HKDA 4K3UA 4DQAA 3WDWA 2PXJA 4IL7A 2PHWA 1GSLA 1YIFA 5L19A 1RHI3 1ZX5A 2XKPA 4XQWA 1GZWB 1UOFA 4HN0A 4YG0A 3KF5A 5KXBA 2FQPA 4QPIA 1ULFA 1N3PA 1VBC2 4CP2A 1VPHA 4KGQA 4LBMA 2ZBJA 2EICA 4NOTA 2JG8B 3KCCA 5JSOA 2CY6A 5CG8A 2O14A 4QB6A 4GULA 5A3UA 2CGNA 3E6BA 3ZYBA 5JI9A 5F3CA 2DURA 5FZ0A 2D3PA 4N9HA 1WCSA 4R9AA 3WSOA 1TEIA 3I2OA 1DF0A 3MLLA 2O8QA 4FPHA 3PUSA 4P9LA 2Z5WA 4XUTA 1I6XA 1GANA 1SFYA 4LIVA 5DDJ1 1JMUB 2OYZA 3ZPYA 4AVAA 3U0ZA 3PMEA 3URFA 1XSRA 1GNZA 1Z7S2 4QPGC 4NIAA 2QDRA 4B4QA 1AR92 4Q1PA 5DUXA 2HWF2 5F39A 4BK5A 3GDBA 3I3QA 4JCKA 5ANNA 3WD5A 3ZYFA 2A73B 5FXXA 1BBT2 1POV0 5IVCA 2KM2A 4K40A 3M3IA 1VBA3 1WZXA 1AX1A 2JDYA 5L36A 1HLCA 4W6XA 1T2XA 4AFCA 1MR5A 1UZYA 1YXWA 2VQ0A 4IE5A 4IGOA 5DAPA 3P6BA 3NV3A 4FPGA 1X33A 5IW0A 4HK9A 4JRAA 3NV1A 5F9TA 1AL22 1LHOA 4IW3A 3POIA 2XPJA 1OXCA 2QFEA 3ON7A 1JUIA 1JYCA 4PLMA 5CFDC 3BIWE 1V6KA 2YFZA 2A6YA 4RHV3 1WA4A 1DHKB 2EIBA 4Q8KA 1H1AA 2VECA 4D3WA 3L2HA 3LEGA 2XG3A 3GHNA 4CDUC 3N7KA 4FPJA 1LHWA 1D0HA 4PI0A 2W39A 2VJXA 5EJ3A 5CFCB 4LHLA 3VKOA 2NMOA 2UY8A 4Q4W2 4AXOA 4D6RA 1XNBA 3APBA 4XUNA 1QOTA 2HWD3 3H8UA 1X36A 1Y9MA 1FMD1 4QAWA 2QQJA 4RYDA 2GSYA 2GN7A 3SLIA 5T50A 1F15A 3LSEA 5BNNC 1Y9GA 3CBNA 1ST8A 2HWC1 3RPQA 3T2TA 5KHGA 3RYPA 3VL9A 4FPKA 2W68A 4IEYA 1BVP1 1R083 4PLNA 1ASJ2 4BJ0A 1ZBE1 4M01A 2PHXA 3RDIA 3RZJA 1W6NA 3LDBA 2ET1A 3VDAA 3POJA 1RUE2 4D8MA 1RYYA 4K21A 2VOXA 2WN3A 2XUMA 1VMFA 2W91A 4NHXA 5C5TA 4AVVA 4AGGA 2YC4A 3MYXA 4JGZA 1HB4A 3MO4A 3OGGA 2G9ZA 5IVEA 1UYYA 3H1YA 4LHSA 2WNVB 3VBHA 2WSUA 3AJYA 3WR0A 2PQQA 4WZCA 5T5JA 3LA3A 3VZJA 4AFDA 3ZYIB 5IT6A 5DUVA 3WXPA 2J1EA 3PUHA 4B7EA 1LCLA 4YSFA 3I2FA 1SQ4A 3NW4A 3ZSMA 1IKQA 4KH9A 3WDTA 2D3SA 4Z1VA 4I30A 2AGSA 3I3MA 4CXYA 1AR62 1Q8OA 2RS53 2P6HA 5JZGB 4W6WA 1OKQA 4MSVA 4WVWA 4IV3C 3VBSC 2YROA 4L0PA 1AYN2 2XMLA 3OPZA 3D82A 1UU6A 1SLTA 3KQRA 1A6CA 1AJKA 1ND2A 5C3QA 4HXCA 2P1BA 3PUQA 3HR9A 4RGAA 2D3RA 3PURA 4QKNA 4GB33 3KMHA 3IMMA 1ENRA 2R32A 2RV9A 3NNFA 3GHMA 5FZCA 5A3OA 5FAXA 1KDKA 5A7OA 4D69A 4DXRA 1QJX1 2VULA 1VRH3 1TNRA 2JD4A 2Y6HA 2R061 4R4ZA 2W94A 1CONA 1PK6A 3LQCA 4OZOA 1UU4A 2C6SA 5FYVA 2G1MA 5IWFA 4CDWB 1LHVA 3LCPA 3K4ZA 1ZZ8A 2IWGB 4QMAA 3O14A 1LECA 1LENA 1YJLA 5C70A 2VVFA 4NIHA 5BPXA 1DQ4A 1POV1 1IS6A 1OFSA 1W0OA 1UY0A 5F3GA 1XQNA 1WW7A 4EV0A 1J3RA 1WBLA 3DYMA 4P9GA 3UK9A 1YYNA 3SH4A 4EZHA 1QJY2 1S2EA 4S2HA 3A23A 5JXGA 4XFCA 2BOIA 1X82A 1MEC2 1OURA 1N3QA 4KMQA 4TZDA 3HNBM 4DFSA 1ND3B 3BN6A 4JGYA 4Q4V1 1CX1A 4GKXA 1TZOA 4IV1B 2O1QA 3VBUC 5GZEA 5C3SA 3AYCA 2Q8DA 1DBNA 3WG1A 3Q8FA 2PHFA 1HV1A 1YQCA 4XACA 4LA2A 1VBC1 1RUF2 4CEYB 1SLLA 3RWNA 1HW5A 2OX0A 1FV2A 1QXJA 5DG2A 3HPNA 3FZ3A 4YGBA 3OD0A 3HBKA 3UKTA 2Y0OA 4UFLA 3KV4A 4CCJA 1O3RA 5FO7B 4FI9A 3BU7A 5E16A 4AEDC 1GLHA 3ORJA 3KWVA 4RD7A 2P6CA 2RJLA 2VNRA 5DDJ3 4DEQA 1LOCA 2A75A 2VZ3A 3I8TA 5A7PA 3ACLA 4LKFA 5FP7A 1AR91 5DAVA 3RFRA 1LTEA 2HWF1 2J42A 2QE3A 4XTPA 3OB8A 5FBJA 4CDXC 1W6QB 3FN9A 2W9XA 3K77A 5KXEA 2D40A 3MUY1 1DQ1A 1AXKA 1Q43A 4FQZA 4OHVA 2ZGRA 4R4XA 2HBTA 1OBNA 4JTNA 2V4AA 5LY2A 2B5HA 4WM8C 4YYOA 2BZDA 2D97A 1S2KA 3VZKA 5J7MA 1AL21 4PDWA 3I4IA 1WMEA 4LR4A 1KFUL 1N1YA 5SV8A 3DKQA 3OYWA 2KXLA 1GNHA 3T0DA 1KD7A 4S2GA 5HCBA 5IAVA 3MI8A 3UJQA 3L9JT 1NCRB 5K7PA 1AYM1 1H2LA 4AZZA 3ZN4A 3HEIA 5IAXA 4FPYA 1ZZ7A 4JAAA 2BNMA 1JZ8A 1T6GC 5FPZA 3POEA 1YFWA 3N9QA 2DBIA 1AR82 4XF4A 2VY0A 4Q4W1 2RG4A 3ZFEA 1FMD3 3KHCA 1RUI3 1FPN3 4NAMA 3VBOC 3IDBB 1Y4WA 2ZHKA 2QNKA 4WVMA 4XJWA 4Z82A 1W0NA 1W6PB 2BWAA 2HWC3 4LKSA 4XFAA 1U0AA 3TNPB 3ZSJA 3ZR5A 4WBBA 4M00A 1ZZCA 5EJ1B 3RZKA 1HRI2 2GH8A 4AW7A 3LDRA 1ZBE3 1LEMA 3R4DB 2FDJA 2XWBB 2UURA 2EIEA 4ZXEA 3FBMA 3OGJA 4D7SA 5L7OB 4UAPA 2YV8A 5IYYA 2QBXA 3LIGA 1W90A 1WGPA 4DS0A 5L9VA 1NT0A 2CV6A 2HYKA 3PHMA 4BLJA 1S1AA 3V0AB 2VH9A 4MGKE 1HQWA 3NV4A 4UFKA 5EP9A 5FY4A 5BNPA 1IS4A 2X5IA 1OPOA 4FPCA 4DPNA 2HEWF 4LE3A 4ASKA 4BHPA 1X7NA 5DZFA 3T2PA 3POSA 3I2HA 5BY5A 2WUHA 3VD9A 4NIDA 2JENA 3AYAA 1RJ7A 1OC1A 4DINB 1OKOA 2JB4A 4Q0QA 5DAWA 2D6LX 4AK3A 1G86A 3K3NA 2P17A 3R6SA 4ASLA 1AR61 3JB8A 5IK8A 1FAYA 5FZOB 4CP1A 2Q8OA 4D0QA 3N9LA 4YZ1A 4N53A 3H8XA 3JB4C 4BE3A 1CAWB 3TEWA 3KB5A 1CZVA 1SHWB 1YFYA 1AYN1 2W1SA 4QD2A 5DUWA 4IUGA 1ZM1A 3J7NA 2JDKA 2WBKA 3LE0A 4CEWC 1OOPB 4XFHA 4FOVA 4YG6A 2RS12 2YBSA 4KI5M 4YW6A 5FUIA 3WNOA 3O1VA 5FFOC 1JYVA 2YHJA 2J22A 5E88A 3VHPA 3AL6A 4QM8A 4OULA 5FPXA 3V0BA 1VMHA 2WABA 4BDVB 1NLRA 2ZZJA 3DYOA 1UCXA 2L9LA 4LNVA 3SCGA 2R042 3N35A 2R063 3LWCA 1V00A 4OUMA 4YARA 1KFXL 3G7DA 1YEWA 5LA1A 3AKPA 5FYSA 3ZFFA 3ZPOA 1XU1A 3K4AA 1V6NA 2IFWA 5FUPA 4FPEA 1SLBA 4W8JA 2VGDA 3GZEA 3KCXA 4S2FA 3WDXA 2R6QA 2RJ2A 5DXDA 1PO23 1A78A 3GZTB 2ZX3A 5JUVA 5JMOA 4BMEA 4A45A 1POV3 3C3VA 2PLV2 5GLZA 3KT7A 3QBQA 4M4RA 4AI3A 4YZ5A 5J1XA 3WQ7A 1N1SA 1WCKA 1J83A 5D1IA 2ZCWA 1R64A 4OI0A 3KT1A 4UFMA 2J1UA 2WIIB 2GAUA 3LA7A 5FZ3A 2YB7A 3VBFB 1MEC1 2BERA 5JI7A 5FK7A 5D2AA 2Y6JA 4Q4V3 2VE1A 1LHUA 4OVEA 5CNAA 1UX6A 1WD3A 1IPJA 3BODA 4L97A 1LR5A 5D21A 2BVBA 4GWMA 3D0JA 4RS5B 1OLMA 3NAPC 1W8ZA 5IK5A 4I01A 2GNTA 2CTVA 3WDYA 1XYOA 1VBB2 5CADA 3QOPA 1F31A 2WZR2 3O1RA 2IXCA 2EF6A 4LEJA 1O5LA 2BVVA 2UWBA 2PN5A 1DCSA 1RUF1 2VBPA 2Y0IA 3W58A 4CCNA 1MQTB 3LB9A 4TSVA 5HV0A 1S0FA 5LA2A 2WAOA 2VPVA 2R1DA 5GLWA 4Q8LA 1LOFC 3IAPA 4GWJA 1BEV1 3IT8A 2ZGNA 5CU1A 2EXHA 3O1OA 1W99A 3BALA 4D7TA 1XE0A 3CEWA 1MACA 3U1XA 3LOIA 2GP3A 2C0ZA 1V0AA 2ZGOA 2CYFA 1JZ6A 3CMGA 3O0XA 5A3NA 4QB2A 4WVZA 4K20A 2E7QA 2IVJA 1NE4A 1A8DA 2HWF3 2LTNA 1DYKA 2WS92 3PU8A 4IESA 4Y5Z0 4CTEA 5FK8A 3ACHA 3U75A 1ENQA 1R1ZA 2YPJA 2AEYA 3PIGA 1COV1 3JBG3 3J7MA 3S30A 1H8TA 2BOJA 5KC5A 1GWKA 4O7XA 1ZRRA 2VMEA 4WM7A 2P34A 3ZR6A 2BRTA 4QPIB 4Y20A 4CP9A 5DG1A 4ES9A 4XUOA 1MS1A 2Y34A 1MPXA 3O1UA 1WW4A 1S0CA 3ABZA 1Q3EA 4RR3A 1AL23 3NJVA 4QKFA 2H0BA 2DCZA 4LBQD 4TLGA 3IPVA 4XHXA 5GKAC 1E5RA 4A4AA 1ULOA 2CGPA 3PIJA 1NQDA 4YFWA 3BGAA 4XJZA 4JHTA 2B7YA 4IGPA 5FPAA 4LORA 3K48A 3HNYM 5CZKA 1AYM3 1MS3A 2JKBA 2UU8A 2WLPA 2ZGLA 4WV8A 2HH9A 4HN1A 4FSJA 4QKBA 4GMP0 3TNQA 5GLUA 4FOYA 4NPLA 2BP6A 3CZUA 4CCKA 1AR81 3KS7A 3FHQA 2H6BA 4Q4W3 2R073 1QDOA 3U4SA 1D4M2 3AB0A 3LFMA 3MV01 5F3EA 4PIXA 1QXPA 4B29A 1QY4A 1HRV2 4QGLA 4CDQA 3LOBA 5C8CA 2Y26A 2WINB 1AXYA 1GMMA 4C91A 1WA6X 1F8VA 2VCMA 4DRRA 2XWJB 1HRI1 2ZJCA 2EAKA 3V65A 3UGFA 2VM9A 1HB2A 1K5MB 3SC7X 1Y7BA 4H14A 2HEYF 3UNPA 3BTAA 3DPRA 3TWIA 2VC9A 3LEKA 5FMCA 1HB3A 2DFCA 4AFMA 1UY1A 1OA3A 4FOQA 2SLIA 4ZZ8A 1R092 2F4LA 5C6CA 2XLFA 2ZHLA 3KT4A 3OD4A 3U78A 3ZMOA 3A22A 1MVQA 1GWMA 2ZKNA 5A3LA 4E4HA 2YC2A 1PX4A 4FFGA 3WW3A 1LOEA 4UXAA 1DGWX 1NLSA 3OPTA 4CUCA 2BEOA 2WNVC 1YUDA 3CU7A 3IN9A 4XXPA 1W9TA 4YM0A 2Z2SB 5FUNA 4E27A 3OGSA 4E8CA 1GUIA 1V9U1 2A6XA 3C7GA 3H7JA 1RGSA 4ZXKA 3C7OA 1Q8PA 2B9UA 1JYWA 4H2AA 3J26N 1AR63 3SISA 2P2KA 2W1QA 2B8MA 3HMYA 3DECA 3TBDA 1W6NB 4CU9A 3N36A 1AYN3 5F6KA 3ZM8A 3Q8CA 5J96B 4SBVA 5FZHA 4CCCA 3HIFA 1JOPA 2JXAA 4FFIA 4IE4A 3S7IA 1AXZA 2RS11 2YC0A 3AFKA 2DVAA 4JGZB 5GLTA 3VHRA 4NRPA 4QM9A 4OUEA 1YRZA 1Q8QA 1RUH2 1RC6A 1SBFA 3S7EA 4XFIA 1O6UA 3I97A 4LITA 1NA1A 1PZ8A 1XNDA 3EMRA 4MG2A 1BK0A 4CSWA 5CA6A 1ZRCA 2Y38A 1CAXA 1V6OA 1AX2A 2ZGSA 2W95A 4NVPA 2ZGMA 1UY3A 1H1MA 4JX0A 4CVUA 3GZAA 3GM8A 5I0SA 3T4VA 4I3GA 1RUOA 2ERFA 1NXMA 2VVEA 2RR12 4ASMB 5LA9A 5APAA 3SMHA 2YU2A 2H0VA 4CDWC 3J9SA 2WO2A 1DQ2A 5GM0A 2QZ2A 1OH4A 1CGPA 2PLV1 3MPPG 2BYVE 3S0MA 4NHMA 3NNMA 1ZVFA 2XDVA 2OKXA 1HN0A 2PTMA 3VV1A 4BQXA 4AHZA 1N3OA 2JKXA 2W2IA 2CWMA 2CDOA 3B94A 1EUUA 3KGZA 4TYSA 5BV6A 1UD1A 5E8AA 5HBAA 1ND2B 1F2NA 1XOYA 2WYFA 3C7HA 2BUKA 1W2OA 4IEQA 4A44A 1HQNA 1VBE2 4LBNA 5EIYB 3NJYA 3H7YA 1I9RA 3HNMA 4QPGA 4XAAA 5F6LB 3I2KA 2NQYA 4LOSA 4DY3A 1WW5A 3I2DA 4EN0A 4BQ2A 5EFUA 4AFBA 2B45X 2JWPA 3WNMA 4GMP1 4N9IA 1PK6B 4ZHNA 3HQRA 1VJ2A 4BB3A 1HQLA 3WG3A 4XHBA 4ISRA 3AMMA 2XLGA 1RUF3 4RGKA 4YGCA 1PMIA 1ZRIA 3A0KA 4AI2A 4IEWA 4LKEA 2FDIA 2EXIA 2UWAA 1U5XA 2VMDA 5E6HA 1PZ7A 4QX7A 5H9SA 3T2QA 1JS9A 3O7OA 1H8VA 2DDUA 1S0IA 3CF6E 3TB0A 3ZVXA 1BEV3 2KR2A 4AI1A 3VD4A 5LEJA 2RDRA 3FJSA 5FY9A 3I3EA 3W5MA 1PGW2 3MUZ1 1YQ6A 4QXHA 4ONUA 2Y33A 4BQ4A 1JODA 5AC92 2RS32 2RMU3 1RIRA 2XQXA 5A32A 2XKOA 2EXJA 4CDUA 2CL2A 3WP6A 1PM4A 2WS91 1EAH2 4JGYB 3THCA 3VDBA 1IGOA 3P5BA 4AVSA 1XB9A 3VBRA 1COV3 4LO6B 2CDPA 5LZ6A 1AVBA 1GKBA 1Z0HA 3W9AA 1PM7A 1QH6A 2IFRA 3O0VA 3N7MA 2DTWA 2WNUC 4XEZA 1QH7A 5FYMA 4XE9A 4HPKA 1DQ0A 4XJ9A 4BMBA 1YCIA 3CDZB 4AQ6A 5FZIA 1MZEA 4OYUA 4NUBA 3AK0A 4BK4A 1NOVA 2ZAAA 3TEYA 1BVVA
chains in the Genus database with same CATH topology
5FREA 3IIAA 1CAUA 1OFNA 2BGCA 1EP0A 1LU1A 3V64A 5I91A 3WHTA 1HV0A 1AR83 2OA2A 5L73A 4XZPA 5I0RA 3GZUC 1QXRA 3CJIC 4FOWA 1D4M1 2CWSA 3E5QA 5A33A 5CAZA 1LOBA 4EWDA 1HRV1 1QHDA 2D6PA 3CL1A 3ME2A 4RQPC 5EXOA 3NWKA 3AKRA 4HKLA 5HI0A 1ULCA 3RQ0A 4PBPA 4V1PA 4K1ZA 4PDWB 2VW2A 4IV3A 2PFWA 2VW1A 1L3JA 1J3QA 1H4GA 3OYWB 4KG8A 1VB2A 3UV9A 4BOWA 1S2BA 1VAVA 1R091 1V70A 1OQEA 3ES1A 5FCCA 1S55A 3ZXKA 3E5XA 5K8SA 1H2KA 4PBOA 4EN7B 3AP5A 4HLTA 5J36A 1Q56A 2VMGA 3AM2A 3ZFEB 1V9U3 5HCFA 1QDCA 2ATFA 2OZ6A 3DV8A 4IEPA 2PHUA 2XJRA 4WVMB 1DQ6A 1PGSA 4BM8A 1FNZA 2GC2A 3B02A 3GNEA 1FT9A 5GJ6A 3OJBA 4AQSA 2FZ2A 1PVXA 1A8MA 1O3TA 4XQDA 3VLBB 2GNBA 2OUHA 4RGGA 5FMOL 2RS13 4XMIA 2Z69A 1RTVA 2AENA 2D93A 1RUH1 3PVEA 2WC2A 2E53A 5H9RA 3WW1A 5BNPB 1R1A2 2X5IB 3VBUA 2V5YA 4L8QA 4AQ2A 3D8CA 4AHXA 2A71A 3WV6A 5LK5A 2GZWA 2VMHA 4MV2A 1ZZ9A 4XTMA 1GR3A 5C9AA 2RR11 5I8YA 4XMAA 2WFPA 4KWJA 4OI4A 2VOWA 1DG6A 4N53B 5C4WC 2Z42A 5FRAA 2MEV2 4YZ2A 3I54A 2Q30A 4C0BA 2DU0A 3J8F2 2ZGTA 4XXAA 4AEDA 3IDCB 5JWPA 2PHLA 2D7FA 1LRHA 4IERA 4A7ZA 5ACA2 2ZTNA 3B7MA 4OI2A 4B7KA 3V0BB 5JPNB 3FHIB 5KWRA 3D5OA 1OD5A 4GMP3 4CDXA 3ZFFB 2ZHNA 4LA3A 3EJKA 2NMNA 4RS5C 2DUPA 2V73A 2OPKA 4PQ9A 4D94A 1X8EA 2DCTA 4WM8A 3U10A 4AHWA 1RUC2 3PVOA 4K7JA 3TOJA 2GMPA 2DCKA 1LKNA 1PGW1 2W52A 1PNFA 4AWDA 5J3UA 4IEUA 5AC91 4XPVA 2RS31 2ARXA 3JD73 1DGRA 4EWEA 1EAH1 1V6IA 3INAA 2GMMA 1RL3A 4E4SA 3VBOA 2XJPA 1NCQB 3B5LB 3J4UH 5I8SA 3VKFC 4MGIE 1G9AA 2X8KA 2P3IA 3JU9A 4LO4B 5JOYA 1JH5A 1N1TA 4XILA 3CO2A 1ALYA 3HBZA 3M3QA 2BWCA 2VNGA 1QOOA 3N3HA 3P3NA 4RSUA 3RG0A 5FDBA 1EV12 1XYPA 2TBVA 4PF5A 2ZACA 3FC0A 4N43C 2V09A 4L9BA 1LESA 1CIWA 3DGTA 3MIEA 2B39A 3VDDA 1DU3D 2RHPA 3VZMA 3ENRA 2GU9A 1D4M3 2Q1ZB 1H8TB 4OHWA 1CJPA 1D0GA 4HETA 1KS5A 1HRV3 4WM7B 4XBLA 3SH3A 1ZRDA 4Y20B 3ZYJB 3OBRA 4Y22A 2ZHMA 3PMSA 4RR3B 1LULA 4JC1A 4COVA 3IPVB 3R05A 5JVVA 3TRSB 1BYHA 2VXRA 1G8WA 2JE7A 1A3KA 4H7LA 3ZXAC 2EXKA 1K5MC 3M1HA 4Y24A 4LUKA 4CEWA 2C5DA 1R093 4FO9A 3RJ2X 1OQDA 4HVQA 1UAIA 4KQ7A 1B09A 4J1WA 1HXS2 5JSPA 2ZAHA 3AP6A 4LBOA 3ZN6A 2FMDA 3CLPA 4K8FA 1Z7S1 2W08A 3O5SA 5FLIA 5F1RA 3V56A 4ISQA 4CDQB 5C8CB 3LKJA 5JOWA 1BBT1 1G9CA 2D6OX 5GLVA 5T3NA 1OMIA 1CD3G 4ZU7A 1G7YA 4Q4Y2 4BLIA 1S0GA 2C1FA 2IXKA 1MS4A 1C3HA 1QMJA 3DPRB 4KL1A 4LHKA 4UBHA 3AKSA 2LM3A 1VB4A 3ZIWA 1B35C 3FLPA 1YJKA 1RUH3 2YGLA 2D43A 3VUOA 1FOD2 1C1LA 2GN3A 2IXJA 3POYA 4JGZC 4GWNA 3DL3A 1SMVA 1R1A1 1XNCA 1S0JA 3NAPA 2DFBA 4COYA 4KU7A 4J6GA 1PO12 2ZOEB 2E9QA 2RR13 2DVFA 2WA3A 4MXWA 2YGMA 3FLRA 1REFA 4OHZA 4Y26A 3LZZA 5I0UA 1UPSA 1CX4A 4S2DA 3P3PA 2MEV1 1LOFA 1GICA 3J8F1 2BPA2 5FLHA 5GALA 2XJVA 2YUEA 1ASJ1 2OVUA 3B00A 4N7IA 2WQ4A 3RJRA 5ACA1 5H9PA 1RUE1 1IS3A 4AI8A 1JTZX 2GALA 4L11A 3VGIA 1LB2A 1O4TA 1RUD2 2R49A 3MIDA 5KHKA 1SLCA 3H9AA 1APNA 4GH4A 1WCDJ 1C4RA 1CAXB 4OI1A 3AYEA 4YW5A 3QLQA 1PK6C 2IXIA 1OPMA 1LEDA 4QU2A 5ABJC 3HT2A 3NSTA 5BNOC 1NE6A 3LGRA 1RUC1 5CIRA 1UN1A 3X29B 1EYBA 3D6EA 1JOJA 1CAVA 3R4SA 4I0WB 2XJSA 5AC93 2RS33 2JICA 4LO7A 3WDUA 2F4PA 1MS9A 1PNGA 4Q0UA 3R4UA 4TLFA 4QPGB 1XE8A 1TNFA 1FATA 3FX3A 1O4ZA 2B46X 4NWVA 2YDEA 1Z78A 1TMF2 4U36A 1QJX3 3RSJA 1C1FA 1QWRA 1KITA 1DIWA 2X29A 1MS8A 3K51A 1VBA2 2UYAA 2ZGPA 1HDKA 5SV5A 4C1WA 2JG9C 5T55A 1YI7A 4M0HA 5BXXA 4DB5A 4G3YC 2ZX2A 1EV11 1H2NA 3PNAA 5LRRA 4UW4A 4PJYA 2GMEA 1JXNA 1KJLA 5A32B 2NM1A 2XJQA 3NO8A 2K9ZA 4YVSC 4X6RB 3AFGA 5J48A 4CDUB 4RHV2 1Q8SA 1QJY1 4QPYA 1ZBA2 4QXKA 2WJSA 3VBRB 4Q0VA 5D8AC 2AH2A 4PIZA 3USUA 2Q4SA 4I3PA 1H9WA 2A6WA 4YM1A 3ASIA 2I74A 4HPKB 1RJ8A 2QJVA 4YVWC 4FQ4A 3RI8A 4KGGA 1RB8G 1W2UA 2BNOA 4OZXA 2D5FA 1VBC3 4LBQA 4R52A 4C0HA 2ARBA 1R082 3ROUA 4HBNA 3RRDA 3AZZA 1UF2C 1ZREA 4H3WA 1GBGA 1CAUB 3EBRA 4EN8B 2ET7A 2JG8C 4Q2FA 4R9DA 1RMU2 1PVC2 4Y1ZA 3H50A 3BCWA 4HK8A 4KBBA 3HN1A 1CPMA 1HXS1 5JPMB 3MZHA 4Q0SA 1Z7S3 2HWB2 4A7YA 1AR93 1MS5A 4QX5A 5A33B 1J59A 5DZGA 5T54A 3ZFEC 4DRVA 4BYYA 1BBT3 2IC1A 4P5HA 3RNSA 5LRSA 1KDMA 4QQHA 5EYXA 3MEPA 2Z79A 1H9PA 4Q4Y1 4XJAA 2NP0A 3NL1A 2YYOA 5FMOS 4IV3B 4BCUA 4JDNA 2VG9A 4Y1YA 4A7KA 1N1VA 1EY2A 4YW2A 4O9EA 1W6MA 1FOD1 1R1A3 3FMGA 2TEPA 3SNMA 3ZXGA 5FTTC 4M3CF 3VHNA 4DXZA 3M3EA 3FFQA 4GB32 1H0BA 1URXA 5J37A 5EWSA 5FO8B 2H6CA 2XHKA 5K0UA 1GZCA 3H1WA 4IETA 3MW4A 2E51A 5JDBA 2AYHA 2ZMNA 5CFCC 2BBVA 3WX5A 3N7LA 3WZ1A 1Q8VA 2MEV3 1UKGA 3WP5A 4OHYA 3J8F3 2TUNA 4IEOA 1DDLA 3SITA 1ASJ3 4N53C 4P9XA 3POWA 1RUE3 3L2YA 2JE9A 3THPA 3PTYA 1VIWB 3RYKA 3AP4A 4D7YA 3VBUB 4HVRA 5CG8A 2XH6A 4XF9A 3WQ0A 1F5FA 1ZA4A 4AI0A 1Q5OA 5TSWA 2XB6C 2WNUA 3DKWA 3ZN5A 1YFXA 4ATFA 5J09A 1M06G 2B42B 5C9AB 1RITA 3A4UA 4COWA 4DOUA 1F9KA 5AVAA 4UW6A 1RUC3 2ZKLA 1CVNA 5JR7B 3ELNA 1TME2 4MLOA 5KXDA 4I0AA 1QU0A 3I7DA 4AEDB 2PHDA 3CNAA 4LBJA 2NN8A 2FHRA 2I07B 4EJRA 1J1TA 1WBFA 3AMQA 3ZFGA 5JZGC 1SEFA 3CJIA 5T5LA 4CDXB 4JQRA 4XFFA 1WLTA 3VBHB 1OA4A 1TMF1 2R041 5HCAA 2NLRA 4RQPA 1NCQC 4GA9A 4AEJA 5GZFA 4WM8B 1U5IA 1J58A 3AZWA 3JZVA 3UL2A 1WMFA 5GZDA 4YGDA 2Q5TA 3E6DA 5KXCA 4LHNA 1EV13 4X8PA 3E6CC 4BWOA 3M7AA 1PGL2 4P9JA 4BQ1A 4FTEA 5FQ0A 2I45A 1JYIA 2WWSA 4K6BA 1QJY3 1XNKA 1ZBA1 3AKTA 3AP7A 1RINA 1MEC3 1AL0G 3E5UA 1X8MA 2D5HA 4NO4A 2YMZA 1BQPA 2QCSB 1AF9A 3DF0A 3VBOB 1S0DA 1D2SA 1H8TC 2VW0A 3ZXLA 4ITCA 1ND3C 2QQPA 1RUI2 1FPN2 4QQLA 5FLJA 4IV1C 5C8WA 1VBB1 2WZR1 5IK4A 1G9FA 1R081 1VP6A 4I0BA 3MICA 4SLIA 4Q4X2 4CEYC 1UW8A 2ZZQA 1RMU1 2BFUL 1PVC1 4CRQA 2R0FA 1HXS3 5CFDA 3VDDB 3ZXJA 1JUHA 1QQP2 1EPZA 2XBO2 3RI9A 3AZYA 4L99A 2D6NA 2HWB1 3WCRA 1IOAA 2A5ZA 1GYKA 5CBLA 5JSRA 4AGVA 3A0NA 1OLQA 3MF6A 3IKWA 4FVVA 2P3JA 1AX0A 2DYCA 3ILNA 4Y22B 3QACA 2OW4A 3NKGA 2GNDA 5C8CC 3U07A 4DZGA 5BNNA 5C4WA 3AJZA 4QQ2A 2PYTA 4FTSA 4G4FA 5BNQA 2GC1A 3MGUA 3MIFA 4QGNA 4CEWB 3PJQA 2VU9A 2HWE2 4DY5A 4Z2WA 4P14A 4BPZA 3WNXA 3JCIA 2A3YA 4L2NA 4NPRA 1FOD3 1SBEA 1CR7A 1KQRA 1WLCA 2CNAA 1H2MA 3MLKA 1JN2P 2XVGA 1W6OA 3ZN6B 1F5JA 1KRIA 4BIOA 4NHKA 3WW2A 3FUOA 2IXHA 3EHKA 4GB31 3M4FA 1NCRC 4L92A 3MFAA 2VUJA 3EXUA 1FX5A 1VBD2 4NWWA 1FV3A 3QCWA 4F7ZA 2AZ5A 1S0EA 2D44A 3MPBA 4B3NA 4MZUA 4M3CA 4X6QB 5AFBA 2G9FA 4RL7A 4BA6A 1C8M2 1PO22 1TQ5A 3C2UA 3NV2A 4HT1T 4QQPA 3WT3A 1HRI3 1ZZ6A 3FLTA 4KWKA 4GIQA 4WVVA 4MGZE 4AEMA 2DVGA 1LODA 1QJZA 2A7AA 3VBSA 2GC0A 5L7OC 2A3XA 2R0HA 3FUQA 1YHFA 3R0RA 3VZNA 1N47A 1I5ZA 1W0PA 5FOJB 3NAPB 3VN4A 1KS4A 4LO5B 1DYPA 4Q26A 2BQPA 3D4KA 4HMZA 2ETEA 1MVEA 4RFT0 4MXWB 3HAGA 1OQ1A 4R9BA 3NJZA 2OZJA 1ONAA 4INDA 5BYNA 2AR6A 3ZXFA 4KG0A 1TME1 2WFF2 2WZPP 3WLUA 2JDZA 3Q9OA 2IXLA 1O7FA 2UY9A 3ZXEA 3WUCA 1C5HA 3WVJA 3BB6A 1CQ9A 3OY8A 5F5QA 4N43A 1QF3A 4F8AA 3WDVA 3WUDA 4GXLA 2Q0AA 3WG2A 4N7UA 4HKOA 2DV9A 4H55A 3I59A 4GH4B 5GZCA 1OOPC 4H7MA 1JW6A 1TMF3 3O0WA 4AQTA 4AE2A 2BTVC 2R043 5J98B 1XU2A 2QZ3A 1NG0A 5LEKA 3JBG2 3BPZA 1VAMA 1OLRA 4OLLA 2ZMLA 1IPKA 4B4RA 1U5YA 2RM22 1ULDA 2DTYA 1CAVB 5JAXA 2PLV3 1PGL1 1K5MA 3HT1A 1EPWA 3S6PA 4ZKTB 4MX3A 1ZBA3 4MH0E 1AYM2 4FT8A 1CPNA 1VBE1 1X50A 4XJ8A 2NPIA 2DCYA 4Y1XA 3VBRC 3VBFC 3ATGA 2R072 3GF6A 3UJOA 4AFAA 1RUI1 1FPN1 4FP2A 1VBB3 1NXD1 3MLJA 4KNCA 2WZR3 1XE7A 2D6MA 2ZA9A 4IQPA 4XOGA 4E4ZA 3AMPA 1VLNA 4JTOA 1ZZBA 1S0BA 4HZFA 4C1XA 1PIV2 4E4DX 2HJIA 4J1XA 4P9IA 4Q4X1 3B9IA 1RMU3 3GYDA 1J1LA 1QKQA 4YM3A 1PVC3 2GNMA 1B35A 3KZ4C 4HKWA 1GV9A 4O9GA 1MQTC 3TN92 5JMCA 2DF7A 1UIKA 3AX4A 4EN6B 1QQP1 4COZA 2XBO1 2HWB3 2ZX4A 3USUB 2WS93 3B69A 3QH6A 1J3PA 1FYUA 2CGOA 4E2SA 1SFNA 2ZGQA 3JUUA 2R1BA 3ZIXA 1QJU2 3MDPA 4M3CE 3UKNA 1LGBA 1PHMA 2PAKA 4LBQB 1RUJ2 4OFGA 4XJUA 4R9CA 3M2MA 2WKKA 3ZXDA 4QPIC 2HWE1 2KA3A 2ZPXA 2YY1A 2QKDA 2UWCA 4ZU4A 4FP3A 5GZGA 2W0XA 3KSCA 1ZYBA 3VZLA 1WUVA 3ZX7A 4C90A 3N4MA 5KHJA 4URTA 2O0OA 2P3KA 2PHRA 4JDOA 5B2GB 4X8NA 4W6YA 3ETQA 2ES3A 4YLZA 3FE5A 1VBD1 5LK7B 5ABJA 3MW2A 4AVCA 1BZWA 5BNOA 3LA2A 4GKYA 2NYYA 4HSJA 1RUNA 1C8M1 1PO21 5CVRA 4PIYA 1XRUA 5HXVA 2XVKA 3HQXA 1G9DA 4K9SA 5T52A 1RVF2 1WLWA 2AREA 2G4IA 1W6MB 2PAEA 2ZMKA 2R16A 5FBZA 3THTA 4KU8A 2FZ1A 3VL8A 1U12A 2YXSA 3H1MA 2VNOA 3RZZA 1AR72 4I09A 5K0UB 2MPFA 2XL9A 5CG9A 1CJDA 4HFSA 2XVLA 1RUG2 4BH9A 1JHNA 4IEZA 5KHIA 4Y4YA 3D0SA 2PA7A 2ZX1A 4MUVA 3WP3A 1ENSA 5C9AC 1TME3 2PAMA 2K0GA 4AF9A 1UPIA 2JG9A 2WFF1 2XJUA 1VAKA 5EYYA 3U11A 1ENXA 2EVXA 1BEV2 4FAHA 4PLOA 4YVSA 1GZ9A 3MW3A 3SCHA 4JVAA 4Q1RA 3E97A 4YZ4A 5JIUA 2RMU2 1GQGA 3IMNA 1NZCA 5D8AA 5I93A 1G9BA 2A3WA 4FXGB 3ZYGA 2WNUB 3MF9A 1BMV2 1COV2 2VMIA 3JBG1 4YVWA 4LBLA 3VBHC 2F6BA 1G6NA 4JV4A 4XIOA 4YW1A 1IZ3A 2RM21 3PVNA 3ZDSA 1C8NA 1QGLA 3KCYA 1GZWA 1CN1A 3OCPA 1NY72 1ULGA 2JG8A 3ZFGB 3MFCA 3VKNA 1VBE3 4EWAA 3W59A 1MS0A 3CJIB 1YFUA 1ND2C 1SLAA 1WMDA 2CAUA 2R071 1NA1B 1REDA 3EQEA 4FPOB 4MGYE 3ZYRA 4RQPB 3WCSA 4CP0A 4HANA 1FXZA 1O5UA 2DWRA 4EROA 1DGWA 1BK1A 2FBEA 2VOVA 3LAGA 2EIGA 4GQ7A 4YGEA 1PIV1 1RHI2 3ES4A 4Q4X3 2DCJA 4XF3A 1AZDA 4CYDA 2BFUS 4HSLA 3HWJA 5FQ0B 2GDFA 3TN91 2QDNA 5BUVA 4TWTA 1OI6A 1H1IA 2GC3A 1QQP3 2XBO3 1ZRFA 3DUIA 3MIGA 3VDDC 3T1LA 1EAH3 1NQJA 5JIAA 4P9YA 3EO6A 4ES8A 1I1EA 2QUOA 4MYEA 4E2GA 2MHFA 2MNGA 4K1YA 4QHBA 2E7AA 4OUSA 1QJU1 1V9U2 4JGYC 1DFQA 4XFBA 5CFCA 1ZNPA 3ZYPA 5FO9B 3ILRA 2A6ZA 1RUJ1 3M8LA 4QGMA 3GALA 2WT1A 4XBNA 4YNIA 2VOKA 2HWE3 4M0NA 1IKPA 4AVTA 4AHYA 2K2SA 2ZABA 4Z07A 4F83A 5T5OA 5CFDB 4LT5A 1E57A 4LLFA 5C33A 3AYDA 3BOWA 4HVOA 2ZGUA 4NN0A 3ZSLA 1D4VB 1IS5A 4LE4A 3RMYA 1VBD3 3VKLA 1YLLA 2WNVA 2EAAA 4Q0PA 4FBFA 4XF1A 1YNAA 2VUAA 4JDMA 3OTFA 4JRLA 3RS6A 1QOSA 4FTBA 1C8M3 2ILMA 5BNNB 2WQZC 3VZOA 5C4WB 1YI9A 3UKVA 2HWD2 3H3UA 1QNYA 1KXGA 1SCRA 1VALA 3SH5A 1RVF1 2DU1A 2I2SA 1MZ5A 5JZGA 2SBAA 2NZ9A 4PDWC 1CESA 4Q29A 2XLAA 3QH7A 2BW8A 2VQAA 1W6OB 4N90A 1WD4A 4XF0A 4NHLA 1AR71 1LGCA 3KLSA 2EALA 3RMXA 1UIJA 1RUG1 2OUJA 1NCQA 2FMYA 1LJ7A 1VR3A 4YW4A 4G9SB 4M3CB 2DVBA 2WFF3 1PZ9A 5DZEA 2A70A 4LLOA 1V6MA 1MZFA 4CDWA 4XYXA 4RA0A 4HL0A 1SCSA 2XGXA 1XYNA 2JECA 4Z92B 3VBSB 1YO8A 3U4XA 2RS52 1M4WA 2DVDA 2JX9A 3AXEA 2RMU1 4WZFA 5A3MA 4XIKA 5CB7A 1SDWA 1OA2A 2O8OA 3JD72 1AHSA 4Z8BA 2DUQA 2LALA 3MIBA 1WLDA 1V6JA 2HKXA 4GH4C 1BMV1 2WL1A 1LOAA 3B9CA 1ND3A 3N7JA 3TYJA 4META 1BCXA 5BNPC 2X5IC 4IV1A 2OIIA 4A3XA 1PO11 2RM23 1O3SA 1NYWA 1VRH2 2WSVA 4BZ4A 3B01A 2PELA 1YIPA 2XL7A 3AMNA 3GBFA 1UMZA 1V6LA 3OY8B 1NY71 4CEYA 2CAVA 4N43B 2D98A 3OBTA 3AP9A 3JQWA 3KD4A 5KC6A 4NR1A 4LBKA 3ZSKA 4XW3A 5ACA3 1DZTA 1DGLA 4XDQA 2VVDA 3AZXA 4LO8A 2WLQA 3FWEA 3I59B 4GALA 4W65A 1IQAA 1OSGA 4YG3A 5DUUA 2GH2A 1RUD1 3SHRA 1C57A 3ZO0B 2PHTA 1YWKA 3WOGA 2P37A 2YZ4A 2E63A 4QT6A 1W6QA 3ZFFC 1PIV3 1H4HA 5IUQA 1RHI1 1ULEA 2C9AA 2TNFA 1UKRA 3M3OA 3PLQA 1FI2A 4ORFA 1AJOA 4UW3A 4DNYA 3TN93 1LHNA 4XETA 3IDEA 3IWZA 3MIHA 2G9GA 3GBGA 1LGNA 1O4YA 3WY6A 3ZSEA 1AUYA 4A2UA 4PCRA 1U5ZA 1NCRA 4AGRA 5DDJ2 3AMHA 4COUA 3TAYA 1QJU3 1GFF2 3B3QE 2JEMA 4I2OA 1IHMA 1RUJ3 2AUYA 3T1MA 3SXWA 2ENRA 1VBA1 1W6PA 1DZRA 4YFZA 1REEA 1BKZA 5AFEA 1SACA 3WP4A 4LTAA 4LULA 3OF1A 1B35B 2A6VA 2JJ6A 5EV7A 5IK7A 5KHHA 3ILFA 3WG4A 2ZX0A 3H0OA 5L7OA 4XFGA 2LUWA 2WA4A 3DN7A 3H3ZA 3ST7A 2R30A 4EN9B 2EA7A 4P9WA 5E89A 4AYUA 4YM2A 4Q27A 4RHV1 3G6JB 1SLIA 2ZGKA 1QNWA 5JCTA 4MVTA 5KBFA 3V0AA 4B8EA 3ALQA 3WHUA 3IBMA 3ZMNA 1O91A 2UYBA 4DMIA 1I3HA 3NVCA 5E1RA 1UZZA 2E7TA 5JLVA 4OHXA 1FMD2 2HWD1 1WW6A 4AG4A 3IM0A 4WM7C 3PVBB 2HWC2 1RVF3 3HD8B 2BNNA 4ZU5A 4RR3C 1ZBE2 1CAWA 1HX6A 1D2QA 1SBDA 3USSA 3M3CA 3NKTA 4YRDA 1AR73 4UBGA 1OOPA 2WT2A 4IXLA 1TE1B 5FOBB 2N7GA 1C5IA 5I0TA 1RUG3 1DLLA 3QD6A 5AVPA 4AVBA 5K0UC 5ABJB 3BOPA 5T5PA 5BNOB 4KWLA 3KGLA 5JOXA 1DGRN 2QVSB 4FPFA 1BJQA 4IEXA 4MXVA 2HEVF 4FPLA 4ATEA 4YW3A 5JOZA 4E2QA 4Q4Y3 4CDQC 1XXNA 1FNYA 1HIXA 1GQHA 4Y1VA 2WT0A 3VKMA 2RS51 1H30A 1UU5A 2XJTA 1Y9QA 3FFZA 3WINE 3RYRA 4U2AA 3DPRC 2ZS6B 4XBQA 1BXHA 5K9YA 2E6VA 4I02A 3JD71 3B93A 4F3JA 2D6KA 4FXKB 1JBCA 2Q1MA 3VBFA 1Y3TA 4QQOA 4LUMA 2X53S 3LSDA 3AZVA 1O3QA 2WNEA 3JQXA 2RE9A 3M70A 4BIFA 4E9KA 1PO13 1QJX2 4RS5A 5H9QA 4CZSA 3O12A 2R062 1VRH1 3AXDA 1MZ6A 2JG9B 4Y1UA 1OHFA 4XQ4A 3GBWA 3VHOA 1Y43B 5EZWA 1KJRA 3KM5A 2RJKA 4FCAA 1UL9A 2DUOA 3ECQA 1DQ5A 4YVSB 3SCFA 1MQTA 1LOGA 4UW5A 3WW4A 4IEVA 1C28A 3PJYA 3ZFGC 4FAGA 5D8AB 4B4PA 4R8HA 1LU2A 1RUD3 3FBYA 1W39A 4AEKA 2IZWA 4YVWB 3CJXA 3AKQA 4Q4V2 5I8TA 1NA1C 4YZ3A 1DZQA 4K3UA 1HKDA 4DQAA 3WDWA 4IL7A 2PHWA 1GSLA 1YIFA 5L19A 1RHI3 1ZX5A 2XKPA 4XQWA 1GZWB 4YG0A 4HN0A 5KXBA 2FQPA 4QPIA 1ULFA 1N3PA 1VBC2 4CP2A 4KGQA 4LBMA 2ZBJA 4NOTA 5JSOA 2JG8B 3KCCA 2CY6A 4GULA 2CGNA 3E6BA 5JI9A 2DURA 2D3PA 4N9HA 1WCSA 4R9AA 1TEIA 1DF0A 3MLLA 2O8QA 4FPHA 4P9LA 2Z5WA 1I6XA 1GANA 1SFYA 3ZPYA 5DDJ1 2OYZA 4AVAA 3U0ZA 3PMEA 3URFA 1GNZA 1Z7S2 4QPGC 2QDRA 4B4QA 1AR92 4Q1PA 5DUXA 2HWF2 3WD5A 4JCKA 2A73B 1BBT2 1POV0 2KM2A 4K40A 3M3IA 1VBA3 1AX1A 5L36A 1HLCA 4W6XA 4AFCA 1MR5A 1UZYA 1YXWA 2VQ0A 3NV3A 4FPGA 1X33A 4HK9A 4JRAA 3NV1A 5F9TA 1AL22 1LHOA 2XPJA 2QFEA 4PLMA 1JUIA 1JYCA 5CFDC 3BIWE 1V6KA 4RHV3 2A6YA 1WA4A 1DHKB 4Q8KA 1H1AA 2VECA 4D3WA 3L2HA 2XG3A 3GHNA 4CDUC 3N7KA 4FPJA 1LHWA 1D0HA 2W39A 5EJ3A 5CFCB 4LHLA 3VKOA 2NMOA 2UY8A 4Q4W2 4AXOA 1XNBA 3APBA 1QOTA 2HWD3 3H8UA 1X36A 1FMD1 2GSYA 2GN7A 3SLIA 5T50A 3LSEA 5BNNC 2HWC1 3RPQA 3T2TA 5KHGA 3RYPA 3VL9A 4FPKA 2W68A 4IEYA 1BVP1 1R083 4PLNA 1ASJ2 1ZBE1 4M01A