2JG8C

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 131
sequence length 131
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8C00
4QQOA 2O0OA 2QE3A 4OUMA 1ALYA 5KWRA 1I9RA 4J6GA 3QD6A 1TNFA 1S55A 3K51A 2QDNA 4N90A 2KA3A 5KC5A 1KXGA 4KGQA 2ZJCA 2X29A 1D0GA 3MI8A 2RJKA 2HEWF 4TSVA 1OQDA 3ALQA 2TNFA 1DG6A 1WCKA 4OUSA 2Q1MA 4HT1T 5KC6A 4QQHA 2Q8OA 4QQ2A 4QQPA 5CIRA 3TYJA 5L19A 2RE9A 4QQLA 1XU1A 4MXWA 2OIIA 4MXWB 2Z5WA 4E4SA 4D7YA 2HEVF 1D4VB 4DB5A 1JTZX 1U5XA 3AB0A 1JH5A 1IQAA 3TWIA 5L36A 1RJ8A 1XU2A 4GIQA 3URFA 4F3JA 1GR3A 1U5YA 3LKJA 1U5ZA 2WNVA 1TNRA 4MXVA 1D2QA 2WNVB 3WD5A 2R6QA 4OULA 1C3HA 1OQEA 3L9JT 1PK6A 2WNVC 1KD7A 3ME2A 1PK6B 4MSVA 4QPYA 2R30A 4NN0A 5BNQA 2E7AA 1PK6C 3B94A 2RJLA 1A8MA 2AZ5A 3B93A 3QBQA 2JG9A 3IT8A 4DOUA 2WNUA 2JG9B 3B9IA 3FC0A 1O91A 2WNUB 3K48A 1OSGA 2JG8A 4KGGA 2JG8B 2R32A 4G4FA 3V56A 2ZPXA 2HEYF 2JG9C 4TWTA 2WNUC 4EN0A 1C28A 2JG8C 5TSWA 5HBAA 4RSUA 4KG8A 1DU3D 2TUNA 1RJ7A 4G3YC 4E4DX
chains in the Genus database with same CATH superfamily
1LGNA 1RUD1 1ST8A 4QXHA 2YC4A 2O0OA 4GB31 1QQP1 2DYCA 2LS6A 5KWRA 2VCBA 2JIJA 4XIKA 3H1MA 3Q8CA 4YZ5A 4EWEA 1OLQA 4JDNA 3FE5A 5SV8A 4GWJA 2JB4A 1C1FA 5DZGA 1HJFA 1RINA 2ZTNA 1MS4A 2EIBA 4K8RB 4MZUA 4I3GA 4QDQA 5GKAC 1GWMA 3WNMA 2YFUA 4N53B 2D6KA 1OLME 1U12A 2OPKA 1JUIA 3ROUA 5AVAA 2PHDA 3AXDA 3UESA 2BJSA 5F2SA 3VBFA 3L2YA 5FZCA 3ZYGA 5JOWA 2WWJA 3U4XA 2QUOA 3T2TA 4KL1A 1Q3EA 2J1TA 4XCAA 4E2SA 5ACA2 2WFF3 3CNAA 3S57A 3N7LA 5DG2A 3OPZA 3BALA 4COYA 5C5TA 1K5MA 2QTWB 4GKYA 5FBJA 2UU8A 5GJ6A 2RDNA 3S7EA 2WSUA 3VDBA 4MUVA 4YM3A 4XXPA 4M4RA 4UFJA 4E8DA 1O4YA 4B7KA 3RZHA 2YROA 1WW6A 4UF0B 1RUJ2 4CDUA 5L19A 2OA2A 5I8TA 4LLFA 5JPNB 2PN5A 4XF4A 4FVVA 1KDMA 3VKOA 3KMHA 1Z7S3 3DYPA 1PIV3 3L2HA 4CUAA 2FMDA 4NAOA 1XRUA 3CQOA 1LESA 1WLTA 3PVNA 5KXCA 4QKDA 5EYYA 3IMMA 3GHMA 3UNPA 2YU2A 1BLZA 3DUIA 4BB3A 1QJU3 2WFPA 1K45A 2ZGLA 4Q0VA 3Q9OA 4XFGA 4FBFA 5AFEA 1IG3A 1VAMA 3OOXA 5FPXA 1ZRCA 1K42A 1RVF1 3VD7A 3BTZA 2VULA 1UX6A 4EN9B 1KQRA 4OVEA 4GIQA 1JYXA 1OOPC 5F5CA 1QJX2 1H8VA 4F3JA 3BIEA 3RZLA 3VBRC 5EWSA 2WA4A 2ET1A 4YVSC 1AX0A 4Q2FA 1OXCA 4I2OA 1GLHA 4GMP0 2PHWA 5JMOA 3OCPA 2RM23 1W9FA 4H14A 4BPZA 3SKJE 1PO13 4WBBA 5FAXA 4EE2A 2FMYA 3W21A 1V6MA 1O3SA 3HOBA 3KSCA 3M7AA 4I02A 3UGFA 4JZRA 5CFDA 2CGPA 3MPBA 1PK6C 2ARBA 4D6QA 1D2SA 2BGOA 2X09A 1H8TB 4BQWA 4A4AA 5KHJA 1J59A 1UD1A 3AKRA 5A7WA 4LA3A 3R6SA 3SH5A 3WQ1A 5FO7B 4AI0A 2OQ6A 1JOJA 4S2DA 1NOVA 1SLBA 4HSJA 2JG9A 2AEYA 2BOJA 3MFCA 4B7EA 3OGVA 1O91A 1RUE2 4DINB 1JMUB 3AP7A 1G9CA 2V4VA 2ZPXA 2D44A 1VBA2 2QQIA 2VBDA 1GKBA 1IZ3A 2E63A 2RDQA 1KS5A 1JYIA 1RC6A 1GICA 2BWAA 4BQ3A 1AR83 2PAKA 2Q5TA 4MV2A 1R081 1FOD1 1V0AA 1V6OA 3USUA 5D8AA 1OFNA 5DDJ2 5E88A 4DMIA 4JKKA 1W03A 3S0MA 3F2ZA 2BQPA 3UYJA 1FPN2 2HWB2 3I2GA 4FFFA 4CDQC 4X6RB 1PX3A 4QB1A 3ZKYA 4LT5A 1UU5A 4J1XA 3ILRA 1BBT1 5F6KA 2DCYA 2RMU2 4I01A 4UW6A 4FAGA 1D0HA 5JMCA 3OTFA 1GP4A 4KNCA 2WZR2 2VVEA 3R4UA 5LA1A 1ZZBA 1ENQA 3ILNA 3T0AA 4A45A 3LAGA 1MPXA 3POGA 4Q4V3 2WKKA 3VKLA 5FY8A 1R1A2 4GWIA 1OVPA 3EO6A 4Q27A 4XFHA 2ZGSA 3OUIA 2OX0A 2P3KA 2Q0AA 4UFIA 2K2SA 3PIGA 5ACA1 3VV1A 1IPKA 4PLOA 4W6YA 1QWRA 1ULGA 4CP9A 4HKWA 1PVC3 4N9HA 1BEV3 3J4UH 3MLKA 5K8SA 1MQTB 1QXPA 2Q8CA 4Z07A 3LEGA 4HMZA 1PHMA 1F31A 3WDXA 3ZOIA 5C5UA 3AXEA 3WDVA 4UYBA 5FZ6A 5HXVA 5JWPA 4PBOA 4HKLA 1IG0A 4JC1A 2HWF2 1W8WA 2ATFA 5LBEA 3RJRA 1LU2A 4FPCA 5K9YA 1EP0A 3Q8FA 2WIIB 1ULPA 4AFAA 2P6HA 3TEZA 4RGKA 3FBYA 3ZYFA 3ZO0B 1F9KA 1ODMA 3EMRA 2GNDA 4L92A 1DFQA 3MLJA 3CHXA 4AQSA 3O1OA 3LWCA 1UYXA 1DQ1A 2MEV3 2PMWB 3ZN6A 4CXWA 4FQZA 3JD73 3LB9A 5FK7A 3MUY1 2XPJA 2D6OX 1XOYA 5HXMA 4NHKA 4QU1A 2BGPA 3RRDA 3SQOA 3O1MA 4WVZA 5A7SA 1VIWB 2O8OA 1NQDA 3VD5A 3J8F2 1TME2 5F3GA 2IXJA 1JODA 1C8NA 4D8MA 1QJX1 5FLJA 3KT4A 3VD3A 1GR3A 1U5YA 3U4SA 2XLAA 4ZHNA 3H50A 1SPPB 1VB4A 4M00A 4NOTA 5FY7A 2WNVB 2OT7A 3P3PA 2DDUA 1YI7A 1OQEA 4R9CA 3AKPA 4BLJA 1YI9A 2GMPA 2W87A 2E6VA 2JB8A 3NMBA 4OZXA 4PQ9A 1W6OA 3MDPA 2HWE1 1LHVA 3FUOA 1RUG3 4EROA 1QNYA 1F4AA 4LTAA 5LK5A 1OLMA 4EYUA 1I5ZA 5BNQA 2VMGA 5FZ8A 2JDUA 2VZ3A 2CL2A 3RZKA 1H6YA 4Q4Y2 3T1MA 2FZ2A 1CR7A 3ZXGA 2VMHA 1ZZ8A 5FPVA 4BU2A 3RZMA 2VZTA 1NE4A 2WN2A 1LHOA 2WC2A 2MHFA 2VECA 5AC92 5IK7A 1ZBA1 1FT9A 4FTSA 3DGTA 2WS92 2E51A 2WNUC 2Y38A 1ND3A 3KCXA 1P8JA 1PM7A 4BK4A 1LEMA 1YIFA 4CDWB 1R092 1GMMA 1W8TA 2YYOA 4PT6A 1IGOA 4D3WA 1NCRB 2EVXA 3PNAA 1VP6A 4L9BA 4ZY9A 3UKTA 4YW7A 4AEDC 4AI8A 4OHYA 1WMDA 3RYRA 3GBWA 2QVSB 2GN7A 1SHWB 3LF7A 5DDJ1 4B4QA 4L0PA 4D94A 1CZVA 5L9BA 2VNVA 4RR3C 4TLGA 5FFOC 1FMD1 5GZDA 1M06G 3ES1A 1MS0A 3O1TA 4LLOA 4AVTA 1Q8OA 1AYN2 3ZYPA 1N1VA 3ENRA 4ASMB 2OZ6A 1RUD3 1UO9A 2AACA 2RMU1 3ZR5A 5IFPA 1QQP3 1W0PA 1OA3A 3AL6A 4BXFA 1NCQC 4AFDA 2AEZA 1RTVA 2WZR1 3MYXA 1W6MA 1UOBA 4CU8A 2Q4SA 3H7YA 5LK7B 3R0RA 4BQXA 5A3NA 2NP0A 3GJAA 2K0GA 4Y5Z0 4LE3A 1RUNA 4KU7A 1MZ5A 1JU4A 3BOPA 1LULA 1DLLA 2C0ZA 4IV3A 3RYKA 4AE2A 5LEJA 1YHFA 4PF5A 2Y8KA 4CCCA 2DBIA 4CVUA 1VJ2A 4CDQB 3POIA 4XIOA 4EZHA 4QQHA 4N9IA 3VBSA 3ZFEA 3NAPA 4ZXEA 3SH4A 5FO8B 5JSOA 4DPNA 3ZPOA 1WW5A 2BNMA 2WFF2 4IV1C 2FDIA 4XFAA 3NJYA 5CB7A 4MXWA 3O1UA 4CU6A 2HWF1 4XUOA 1SBDA 3RJ2X 2KR2A 2VNGA 2PLV3 2QQWA 1YFYA 5KXBA 3GZEA 3N3HA 1GOGA 4CEWB 2CGNA 2Y6KA 4CCOA 5LA9A 4AQ6A 5DAPA 2ARCA 2B5HA 4DY3A 1SEFA 1Z7S2 2VNRA 1PIV2 2D43A 4FFGA 4IGPA 4KWJA 4OYUA 2A6WA 3ITQA 2LRPA 1ZA4A 1FI2A 3LIHA 4GKXA 4RA0A 5A6ZA 1W2AX 4AG4A 4IDZA 1ND2B 5FYCA 1GQHA 2ORZA 4KMQA 4BH9A 4XHBA 1QJU2 3N7JA 5IVJA 1RYYA 1JOPA 2WO1A 3KF3A 4GAZA 4PBPA 3IZOA 1RVF3 3IPVB 2ZGMA 5LW9A 4P9JA 3M3CA 2NN8A 3JU9A 1HJGA 4KBZA 2JEMA 4KG0A 3WXPA 4K1ZA 3B7MA 2DUOA 3OY8A 3WDYA 5CAZA 1JZ8A 3ZFFB 5FZ4A 1NXMA 4MSVA 2X5IC 3BB6A 4XFCA 4QPYA 4WVVA 4AVAA 3JXSA 1H30A 2R041 2VTFA 1LGBA 2ZABA 3KF5A 3ATGA 2E7AA 4I30A 4XEZA 4URAA 2RM22 3GHNA 3FWEA 3HT2A 3M4FA 1DHKB 4GH4B 2QQLA 2RS53 3NV3A 4N43C 1S0GA 5IK5A 1EYBA 1PO12 3OBRA 5F3CA 3I3MA 2FDHA 3MV11 4W50A 3BN6A 4UI9L 3KHCA 1UOFA 2IZWA 3WF4A 5K7PA 5AC91 1SLCA 3O5SA 3UT0A 1UYZA 3VKNA 5CFCB 4ZU5A 4L99A 4CDXC 3W5NA 1MVQA 3I3EA 3TN93 2G19A 1O8SA 5HV4A 1QF3A 2GAUA 3WF3A 1R091 3PHMA 1IS6A 4OI1A 2VQ0A 3MHZA 4B4RA 2GC2A 3PU8A 3WNXA 4LK6A 3PVBB 4O9EA 4OUMA 5DQ0A 3RYPA 1ALYA 1VLNA 3AZXA 4FTBA 3IDAA 2HWC1 3G6JB 2YPJA 4J6GA 5H9PA 1JXNA 1S1AA 1W8HA 4XDPA 3VBUB 5GLUA 1AR82 1R083 1U0AA 3ACHA 4YWAA 1AYN1 2V72A 3U11A 3ZXJA 4LBNA 1PGL2 5A3TA 4PDWA 1CAUA 2YZ4A 2W46A 2DTYA 1IPJA 1S0FA 4Q26A 3VZKA 5C6CA 3VBHC 3ABZA 1BBT3 1DQ4A 3QCWA 1X8MA 1XYNA 1UPIA 2BOIA 4ZXKA 2P17A 1Q8SA 1UU6A 2WQ4A 2IWGB 4BLIA 3FLRA 2DU0A 5FYTA 3T08A 3I59B 4HETA 3ZFGC 4AVCA 1OLRA 2GMEA 1CAXB 4RQPB 3H42B 3J7HA 3NV1A 2Q8OA 4QPIB 3DYMA 4Q4V2 1O3TA 2Y64A 4XJZA 2OPWA 4LHLA 4AK3A 1S2KA 4MH0E 4ZONA 4HVRA 1JW6A 1JU3A 3VZOA 3APBA 1UY2A 4LBJA 1LENA 2WFF1 2JD9A 1NYWA 4UXAA 3V64A 4IEVA 1PVC2 1BEV2 4LBMA 5HV0A 1GP6A 1LEDA 3WW3A 5JIUA 5FYHA 3M2MA 1W6PB 4HK8A 3SISA 4CXXA 5C4WC 4QX3A 1RB8G 2ZGUA 1SLLA 1NAEA 3KB5A 4XW3A 1LOCA 2XONA 1GFF2 4N8MA 4OQ9A 4YM0A 3LEKA 1S0BA 1Z7S1 1J58A 1Y3TA 4D6SA 5JZGA 3MIDA 3MIFA 2Y26A 2HBTA 2XUMA 1YQCA 3MO4A 4CCEA 2QBXA 1WA6X 4WM7B 2MEV2 3K75B 3BTYA 1QJU1 2NYYA 1QNWA 1R64A 3ASIA 3JD72 4BQ1A 4D0QA 1U5ZA 2WJSA 4F8AA 3ACFA 5A1AA 5CKMA 5J37A 3T2QA 4GA9A 4WM8C 2VTXJ 1NQJA 4NHXA 4J1WA 4META 3KLSA 2VOVA 1NLRA 2GC3A 2XMLA 2GH2A 2ZEYA 4LBKA 2XWJB 4HLTA 4QPGC 4QDRA 2RV9A 3KT1A 1HIXA 2QZ3A 3OUHA 2WT0A 1PZ7A 1X50A 1S0EA 1DYOA 1L7LA 5T5PA 2AZ5A 1TQ5A 5JXIA 1V00A 2Q8DA 1UY1A 2ZHKA 2WBKA 3VLBB 5FKCA 2WYFA 2ZEXA 2OZJA 2ZMKA 1PO11 4RS5C 4JTNA 2HWE3 1RUG2 2JG8A 4A3ZA 4G4FA 4DEQA 3MEPA 3E1F1 3NNJA 2YPDA 4HK9A 4CCLA 2E32A 2VW1A 3NNGA 4QHBA 1SLTA 1LOFA 1B35C 1GNYA 1HQWA 2O1QA 2ZGOA 4AVVA 1I6XA 1SBFA 2F4PA 3WLUA 5T52A 1RJ7A 1WUVA 5HI0A 4LUKA 4Y1VA 3S7IA 4E4DX 5IYYA 3DEMA 1ZBA3 4O7XA 5J96B 1TG7A 2W92A 4EN8B 5FREA 5C8CC 1O5LA 1GYKA 2D6PA 4JVAA 5BNOB 2KD7A 3WEZA 3WW1A 4OQ8A 1CQ9A 1HB4A 3KS7A 5E1RA 1UCXA 2DFBA 3ZXLA 1A78A 3OYWA 1WLWA 5IWFA 4LHSA 3HWJA 1L7RA 1L3JA 1LOAA 3N9NA 5JR7B 4XFBA 1CGPA 3EJKA 1KXGA 3JBG1 4I0BA 3FN9A 1JS9A 2GDFA 5FYMA 1XB9A 2UYAA 3C8XA 4IEYA 3RNSA 3BOWA 1FMD3 4YW5A 4N53C 1PGL1 5A3WA 3VDDA 2DVFA 4IGQA 2R0HA 1FV3A 3JQXA 4IEWA 2B39A 4TLFA 2BP6A 5FYBA 5BXXA 3ON7A 1SDWA 1VR3A 3ZXAC 4DXSA 5A32A 1ENRA 4XBQA 1RUD2 2ZXQA 4ASLA 1QQP2 2A3WA 1W8OA 3LE0A 5IUQA 4XJ8A 1S0DA 4K7JA 2XJPA 5ABJB 3PJQA 1CD3G 4L11A 5GM0A 5CKNA 2J1EA 1ACCA 1AX2A 2BUKA 1G9AA 1W9SA 3QLQA 4QQ2A 1OC1A 1C5HA 4CTEA 4DFSA 5IW0A 1XNTA 3DYOA 4Q4V1 3RFRA 1NX9A 1AL21 3CJIA 3V65A 4FP2A 2YXSA 4KWUA 3IDBB 1X82A 3K46A 1RHI3 2GZWA 3WX5A 3S6PA 5L7OB 2DVAA 2DF7A 1DQ6A 3WDUA 1KJRA 5LA0A 1D4VB 1BEV1 4FPFA 3U10A 5J1XA 3CJXA 2A7AA 1O4TA 1W90A 1WW7A 3THDA 3TNQA 4ATEA 2YC2A 3KV4A 2QKDA 4IEQA 2C9KA 3ECQA 5CU1A 2A75A 2WWUA 4A3XA 1E5RA 4PLNA 4ZKTB 2ZACA 5IVVA 4YVWA 2DFCA 3TWIA 4CPBA 2PLV2 5I0UA 2FDJA 3DPRA 3E5UA 2PHFA 3WV6A 5FYSA 1STMA 2A1XA 4IESA 5FXZA 1GQPA 2AH2A 2YU1A 1OURA 3PMSA 2HYXA 4P02B 2AC1A 2MEV1 3CU7A 1BZWA 2Z69A 4OZOA 4XE9A 3VBOB 2Y0OA 3JD71 4EV0A 3UKVA 1PX4A 5T5OA 3EXUA 3VD9A 1CJPA 3GNEA 2YC0A 5BUVA 1JYTA 1H1AA 2VGDA 3WG2A 4CU9A 4LITA 4UFLA 2A73B 1LNSA 5EIYB 1I1EA 4JGYA 3AJZA 1AR93 4XPVA 1W6NB 1VBE3 5LCWL 1CAWB 1ODNA 1V6KA 4LUMA 1W39A 5FTTC 1RVF2 4AZZA 2JDYA 2D5HA 5FZOB 2WN3A 1GWLA 4QXCA 1H8TC 5JOXA 1GNZA 3GM8A 5GALA 4MADA 1DIWA 2J42A 4MGQA 4OHZA 3WY6A 2R043 4S2FA 4BYYA 5IVBA 2YBKA 1RUG1 4UBHA 2ILMA 3K4ZA 5BNPA 4LK7A 4GWNA 2RS52 4JRAA 5IK4A 4CEYB 2ZAAA 1AUYA 3VL9A 4DNYA 3LEIA 3POJA 4XJAA 4MGYE 1GBGA 5JPMB 5LATA 2YBPA 2C9AA 2JICA 1UX7A 4JQTA 5A7NA 2FCVA 1NZIA 1UU4A 1JYVA 2D6NA 2VUCA 1S2EA 3FJSA 3TN92 4RFT0 1DGRN 2HLEA 5CZKA 2H0BA 2HH9A 5FPBA 2HJIA 2ID4A 3HBKA 4QX8A 2I07B 3V0BA 4XUPA 2KA3A 4NIAA 5BNNB 3MGUA 4C1WA 5LZ6A 2B46X 4KBBA 3RDIA 1AJOA 1B35B 1D0GA 1H2MA 5I93A 4NHLA 2HWC3 3CMGA 1SLAA 5LBCA 3WNKA 1OQDA 4COWA 3LGRA 4CYDA 3B3QE 5FP8A 2J1RA 4TZDA 3KGZA 1DG6A 3I7DA 3ES4A 3P3NA 3WZ1A 1R082 5FLHA 3FX3A 2GMMA 2VR4A 2XVLA 1W0NA 5A3OA 5C3PA 2R7EB 4LA2A 3K4DA 1XNBA 2BRTA 3ACGA 4YW2A 1Q8QA 3LPFA 2GNMA 4OHWA 3SCGA 1AF9A 3CZUA 5EQUA 5C8WA 4QHOA 1G6NA 3GJBA 3RWNA 3SEEA 4ES9A 1KGYA 2J1SA 1UKRA 4OFGA 4BE3A 1MQTC 1BBT2 4LULA 1LOEA 1DGRA 2WABA 3N9LA 1ULEA 4IEUA 2RE9A 1LRHA 3HEIA 4QQLA 4O9GA 1A6CA 4AW7A 4BZ4A 1NKGA 4HBNA 1DZTA 4UT5A 3W59A 4CCMA 5A70A 1N1YA 3G7DA 3SNMA 2IVIB 1UAIA 2VMDA 1C1LA 1KFUL 1WLDA 1KS4A 5DZFA 2YGLA 1KFXL 3WSOA 1EY2A 5H9QA 3ZSLA 1UKGA 4OMDA 3CIHA 5C3OA 1APNA 5BPXA 5IJRA 3BIWE 4IE5A 3THCA 4RN5A 2SBAA 2ZMLA 1UY3A 3WUCA 3FMGA 2VXJA 5FMBA 1OOPA 1XE0A 2PYTA 3ZIWA 3V0AB 1LECA 3I2FA 3VBRA 2L9LA 1LTEA 4YVSA 4XXAA 2PLV1 2O14A 1EV13 1XU2A 3GCXA 1VBC3 4RL7A 2Y60A 4W6WA 4YGBA 4A6OA 1VPHA 4C0HA 4QB6A 3POBA 4HN1A 2KXLA 3TNPB 3BU7A 1QOTA 3BPZA 1O6UA 4ATFA 2CDOA 1OHFA 4P9GA 3TB0A 3ZN5A 5DMYA 5G05L 3I2DA 1QJY1 1BCXA 1IS4A 3AKTA 3JZVA 1QOSA 1RUC1 4FPLA 4RFRB 3ZSMA 2R6QA 4PQQA 4M3CB 2D3PA 1PVXA 1PK6A 2WNVC 3AVRA 3OPTA 4YZ2A 2DUPA 3DKWA 4DUXA 1MS5A 3EHKA 3MUZ1 1DGWA 3OPWA 2P3YA 4NE9A 1JI6A 3DKQA 4QPWA 2YFZA 2A3YA 4SBVA 5A1FA 1YLLA 3ZSJA 4KGGA 4M4PA 4YFZA 3BKZA 4PJYA 5DZEA 2BTVC 3RMYA 2V09A 3NKTA 3AYDA 1FXZA 2XHNA 3OGGA 2RS51 4ES8A 2BWCA 3POFA 4JGZC 1W6QA 4V2VA 5FPLA 2HWE2 1G9FA 1KEXA 4CDWC 5IAXA 3U14A 1O5UA 2W94A 3A7QA 3GALA 4CDQA 3IB3A 1NCRC 3RZGA 5C9AB 2EAAA 1J3QA 4FCAA 4B8EA 4JRLA 2JE7A 2Z2SB 4XILA 1VRH1 1PGSA 5FPUA 4B3NA 4ZZ8A 4TTGA 3KT7A 1E5HA 4GJYA 1JYNA 3TN91 1BJQA 4XMIA 5DXDA 1HQLA 2QDNA 1ZBA2 5KC5A 4CDUC 1ZVFA 3QOPA 3W58A 2XLGA 4XZPA 2E7TA 4H7LA 5AFBA 5CEHA 1EAH3 1LR5A 4TSVA 4XUQA 3AFKA 4LBQA 3VHOA 3J9SA 4PI2A 1SQ4A 5EV7A 4C8DA 5CA6A 3JBG3 2PQSA 1A34A 4Y3OA 3T0DA 4MOAA 1WBFA 5A6QA 3UKNA 4D7TA 1VAVA 1Q43A 3GDBA 1VMFA 1NA1C 1FMD2 4OHVA 2ZOEB 4E2GA 3B9CA 3OJBA 4YLZA 2VE1A 1AVBA 3O0WA 1VMHA 3PUHA 1QKQA 1C8M1 3C7FA 3U37A 4LKFA 4QGNA 3H8OA 1OMIA 2WNEA 2CWMA 2ZKLA 2ES3A 2R16A 3H0OA 1IS5A 5FY0A 1QGLA 3ORJA 3QACA 1KJLA 4Z8BA 1LU1A 5IHRA 1GZWB 1ZBE1 2W1UA 5DAXA 3NWKA 1AL23 1UY0A 1S0JA 1PZ9A 4PIXA 4XJUA 4ISQA 4CEWC 1RIRA 1RHI2 2XH6A 2DURA 3MV01 1DZRA 3WNNA 4JKLA 2ET7A 4QX0A 1POV3 5T54A 4AFMA 2C4XA 5ERLA 3TAYA 4ONUA 2PFWA 3D0JA 1RJ8A 2ERFA 4Q1RA 3NVCA 1YWKA 3LDKA 4K40A 2ENRA 5FCCA 2XB6C 1O59A 1ND2C 3AFGA 2OVUA 2WT2A 5FJKA 3ELNA 3MW2A 3THPA 1X9TA 4YRDA 2GNBA 4DXTA 3SXWA 5FMOL 4EN6B 5DUXA 2W95A 2WRAA 1IPSA 3I8TA 1TZOA 1Y9GA 3POEA 4JX0A 4WVMA 5DG1A 3UGGA 5C3QA 2FDFA 5B2GB 2G1MA 2V5YA 3FHAA 2UY8A 1G8WA 2DU1A 3LOIA 3B94A 3ZFFC 1MS3A 1LGCA 1JZ7A 4GWMA 5LASA 4QB2A 2W1WA 1COV3 4JQRA 1GSLA 2XKPA 3IT8A 4GH4C 1WCUA 4XTMA 2WNUA 4DOUA 5GLTA 4DO0A 1AR92 1GNHA 1VBE2 4UAPA 5KHGA 1HB2A 2DCKA 2VZSA 4TWTA 2ZHMA 3INAA 5HBAA 4CZSA 5FZLA 1REFA 3PUIA 4AEDA 5CFCC 5C71A 3IAPA 4D6RA 5T50A 1ZYBA 2BEOA 5K0UB 4YGDA 4XQWA 1SFNA 2R042 2Y34A 3LEMA 3O7OA 3PVEA 4FPJA 4RR3A 2Z79A 3PLQA 3VHRA 1H6XA 3GBGA 3TOJA 4UW5A 3AKSA 1W3VA 3DXUA 3LFMA 1H9PA 1H1MA 2RDRA 3QH7A 3KCCA 3AP4A 2ZZQA 5LA2A 3PDQA 5EJZB 1UOGA 3K51A 2D40A 3RMXA 1NCQA 5A3PA 1CONA 3VDCA 3WP5A 1SDDB 3VBUC 2XQXA 2EF6A 5I91A 2RS33 2X29A 5FYYA 5FZ3A 1YO8A 3WNOA 1I5PA 1ZM1A 3ZM8A 3MI8A 3AMQA 4UW3A 4Y5TA 5SV5A 4JGZB 3N9PA 1POQA 1WCQA 3JCIA 4YM1A 3B02A 4FOQA 4FOYA 3VBFB 3PJYA 3ZR6A 2B42B 2B9VA 2QFEA 4I09A 4YZ1A 2CAVA 3WUDA 1J1LA 4YYOA 1UNBA 1J3RA 4AL9A 1K5MB 4JDMA 4XDQA 1RXFA 3SEPA 1LHUA 2HWC2 4RHV3 5M0TA 4IV1A 1CWPA 1G86A 1K12A 3GZUC 4HONA 2WLQA 4A7YA 1CAVB 4RQPC 4R9DA 1RITA 2D5FA 1Q5OA 3OF1A 4QPIC 1HW5A 4CDUB 2W52A 3POWA 1H2KA 5L9VA 3ZIXA 4COUA 4BWOA 5KXDA 2WAOA 2F6BA 2PHXA 3J7MA 1BHGA 3EB7A 3I2KA 1BMV2 2CWSA 2PHRA 2P3IA 2VCCA 2G9GA 4N7IA 5L9RA 4X8NA 5FY4A 1YQ6A 2R061 3K77A 3NJVA 2RJ2A 1QMJA 5L73A 1EPWA 1NA1B 3HR9A 1RHI1 1QEXA 2QJVA 4IXLA 4K3UA 1CIYA 1W8ZA 3K3OA 2CYFA 1CJDA 4CRQA 1LOGA 4DUVA 4TN7A 4IEZA 2OW4A 1JYCA 2VZ1A 2F17A 1W2UA 1O7FA 2QQKA 4R9AA 4PF1A 4OHXA 3N35A 3ZLIA 4ARYA 4WM7C 1AL0G 1Q8PA 4QU2A 2C26A 1F5FA 2XWBB 3EBRA 5F5AA 5JR2A 1D2QA 2X5IA 3ACIA 1EV12 5JIAA 3WF1A 1VBC2 2QQUA 2WLPA 4M01A 4Y1UA 5CVRA 5FYVA 3RQ0A 3TEWA 4LEJA 2WQ8A 2WNOA 1XPWA 2E33A 4P5HA 1ENSA 5LY1A 4IE7A 4N43A 2J7MA 2BVVA 5CFDB 1ZRRA 2VVDA 3HJRA 3VB9A 3ZYBA 4E27A 1QJY3 3E5QA 2G9FA 1KITA 1RUC3 5I8SA 5A7WB 3Q8AA 3O1RA 3NRUA 4Q0QA 5A3UA 2OQ7A 2WWSA 2D98A 1NY72 2JXAA 3LFIA 4LQRA 2JG9B 4CDXA 1ZZCA 2R32A 3PUAA 2Y6GA 4U36A 1FX5A 2VMEA 2HEYF 1AR91 4MX3A 2Z4FA 1VBE1 1Y7BA 3N9QA 3NJZA 3OD4A 4B4PA 3KQ4B 4NPLA 1UN1A 2IXIA 2VXRA 4Z2AA 2J1UA 2B9UA 5LEKA 4MHUA 2WAAA 3O1VA 4KWLA 2YB7A 5GLWA 3OBAA 4G3YC 4BMEA 2C6SA 1W0OA 2MNGA 3USUB 1U5IA 1AYM3 1AXZA 1W9TA 3MBWA 5D8AB 4BCUA 3BPSA 2JDKA 4WZFA 2SLIA 1DYPA 2ZX4A 1CZSA 2AGSA 1WCSA 3H8UA 4XJ9A 4AI2A 2KM2A 4BDVB 5JLVA 2RDSA 2WO3A 2XBO1 3PL0A 5FUIA 5A33A 3LZZA 3ZMNA 4E4ZA 5BNOC 1UXZA 4MLOA 4HXCA 4XQ4A 4XHXA 1AR63 1N3PA 3AZWA 2RVAA 4UFKA 4X8PA 5FYUA 1XSQA 3I2JA 1UPSA 1F4HA 1JHJA 1XJAA 2E9QA 4K9SA 2AYHA 2VPVA 3VBHA 4AF9A 1WW4A 1VRH3 1QH6A 5DABA 2RHPA 3OEAA 3IKWA 5JI7A 2TNFA 3KWVA 3ZX7A 1WCKA 3E6DA 4OUSA 4IGOA 2E7QA 4Y20A 3ZFGA 4LOTA 2W1QA 4Y1YA 4GD4A 1KDKA 2EXIA 2ZX0A 4XTPA 5LBFA 4G9SB 2K9ZA 2WZPP 3ZDVA 5FK8A 4CP9B 4AEJA 3S30A 1EAH2 3N7KA 3Q8EA 2P5BA 4HL0A 4FOVA 2QQNA 3BGAA 4QQPA 4XAAA 5H9SA 4K6BA 3U1XA 3E6BA 5A3LA 5ABJC 5C70A 1MEC1 2P37A 2NPIA 4ITCA 3JBG2 5GLVA 3UL2A 3RZJA 4ZPIA 1ASJ3 1QDOA 1HQNA 1PNFA 1Y4WA 2OIIA 4B29A 4GZ9A 4CP2A 2MPFA 2WO7A 4CUCA 2QZ2A 5C4WA 3S5QA 1BK0A 2C24A 5L7OC 3AMNA 5K4LA 1BMV1 1C8M3 4GMP1 5FOJB 1QJEA 4CCDA 1YC61 3AB0A 3K2OA 5JVVA 3ZN6B 3WG1A 2EIDA 1JH5A 3MIGA 4LIUA 4WVWA 3X29B 5FQ0A 1ZRFA 3HNYM 4C0BA 3IIAA 5A6XA 4LHNA 3KVBA 3BYWA 5FDBA 3LA2A 1ZBE3 4LE4A 1WD4A 1IQDC 1AL22 3GCWA 3I3QA 2GP3A 3J7NA 4NRQA 1K3IA 1RL3A 4WZCA 4DRVA 1V6LA 2HKXA 3MIBA 2AR6A 4WM8A 4P9WA 3WNLA 3LKJA 4Q4X1 2E31A 3VBOC 1Q56A 4QPGA 2CTVA 2VCMA 4ZU7A 5FWEA 1E5IA 2Y33A 5G04L 2VOWA 4V2WA 1EV11 4XUNA 1VBC1 3ETPA 3AVSA 5FY5A 5IVCA 3TBDA 3WQ7A 1W6OB 1XNAA 2TBVA 2WO2A 2R30A 3N36A 4HPKA 1ULDA 4IEOA 4JV4A 2JKBA 4ORFA 4Q8LA 5EHDA 4LKSA 3SHRA 1XNDA 2FBEA 4LKEA 5A3MA 4RS5A 2JE8A 3R4SA 4HANA 1SBEA 2LW8A 2QQJA 4NWVA 4XQDA 2ZBJA 1PO21 3AP5A 5F7UA 3K3NA 2C5DA 2ZEZA 1NY71 5JSPA 4YARA 1QJZA 3QH6A 5IVEA 2WZ8A 1Z0HA 4XETA 4Y26A 3DL3A 4LXLA 1MZ6A 2DVBA 2OYZA 5J7MA 4BQ5A 1ND3B 2VZQA 3FZ3A 1COV2 3ST7A 4L2NA 1M4WA 2VNOA 4FQ4A 5C8CA 2A6YA 4FPEA 5D21A 5I0RA 2JE9A 3LQCA 4CEYC 2ARXA 5BYNA 4K20A 5C3RA 4AAPA 4A7ZA 1XC6A 2ARAA 5FZGA 3MF6A 3UV9A 5A7PA 3NQHA 2VL4A 2WR9A 1CX4A 4F83A 2NMNA 2VQUA 4NMIA 3VZMA 4A2UA 5FBZA 2VMFA 3QD6A 1TNFA 1PMIA 5EP9A 2Y6JA 1UWWA 2YBSA 5BY5A 1HN1A 5B4XA 2VU9A 3FLTA 1VALA 4H3WA 1UMIA 2UWCA 4MGKE 4Q0PA 3ZPYA 4N53A 4MYEA 1W3XA 3JQWA 4N7UA 4PIZA 1N1TA 3SKVA 2W08A 5KC6A 2CV6A 5BNNC 3O14A 4MGTA 2X53S 4BM8A 4BOWA 1W6MB 1YQ5A 3HBZA 4U2AA 4YW4A 1UQXA 4AGRA 1RXGA 1W99A 2VCAA 5E16A 4HT1T 3RSJA 2IFRA 5JAXA 1VBD3 1HXS3 4AR2A 2RS32 3DV8A 3H9AA 4IV3B 3N7MA 3MW4A 4R4ZA 3D8CA 2E26A 4FXKB 3W20A 3M3IA 3OGJA 4XF3A 2DV9A 5KHKA 3LOBA 3OBTA 1ZZ9A 3VBSB 2DTWA 3CF6E 1EAH1 1WGPA 2EAKA 1H1IA 3IWZA 4UF0A 3ZFEB 4XF0A 4NIHA 1WD3A 1WMFA 3I54A 3OG2A 4CPBD 4UWDA 5FZMA 2XVKA 4E4SA 4MXWB 2Z5WA 1JUHA 3T1LA 4CUBA 2JDNA 2V5DA 1AXYA 3PMEA 4RHV2 1DP0A 1ONAA 2BW8A 1VBB3 3CL1A 2WQZC 3N9OA 4GQ7A 1YJLA 3M1HA 2OKXA 4E8CA 5HCFA 1UZYA 1YUDA 5FZ0A 1BYHA 5E6HA 2CGOA 4AVSA 4LIVA 1DGWX 2CDPA 4XBLA 1IQAA 5FZDA 4P00B 3ZYHA 2FCTA 1LCLA 4TYSA 4AHYA 1W04A 3M8LA 3ZXEA 4C91A 1HRV3 2BBVA 2Y6FA 3HNMA 5ANQA 4YZ3A 3WQ0A 3ZSEA 2W5FA 2X05A 2R063 1EUTA 3D4KA 1JZ6A 1G9DA 3WQBA 5J36A 1UXXX 2IXCA 2P4EA 4CP1A 2XQRA 3O1SA 2LUWA 1POV1 3IIIA 3WP6A 2B8MA 4FO9A 4LKDA 3NV2A 1GP5A 5LWBA 4XZUG 2VQAA 2LTNA 4DXZA 3ME2A 1DF0A 1OH3A 3OY8B 4L8QA 3E5XA 4JAAA 4XDOA 2K46A 3WF2A 1H8TA 1LHWA 5J09A 2ZEWA 4COZA 1ZA7A 2AENA 2NM1A 2BYVE 2FDGA 5A1LA 3RWKX 2ZGPA 3QBQA 2VBPA 3A0NA 1S0CA 4IE0A 2IUWA 4P9IA 2GN3A 5APAA 4OMCA 4FT8A 4HVOA 5H9RA 2GALA 3K48A 3NV4A 3J7LA 2BBAA 5CG8A 1UIKA 1D4M3 1RGSA 4Z92B 4BK5A 1JN2P 1NG0A 3AMMA 1XNKA 2ZS6B 5FRAA 1QJY2 1C28A 3H3ZA 3GBFA 3MIEA 1RUC2 3AMPA 2R0FA 4KH9A 4RSUA 5DUUA 4JHTA 1V6IA 1DU3D 1OF4A 1WWYA 1COV1 3PURA 1PNGA 4CCJA 1W05A 5LRSA 1US2A 4NJ4A 1OA2A 1JZ3A 1XXNA 3H8RA 5ISLA 2RR13 2EIEA 3H1WA 5C9AC 2R073 5T3NA 4QX5A 5F5IA 5FP4A 4M3CF 4QDSA 2LM3A 3OD0A 1A8DA 1BQPA 4N90A 5C33A 2IXHA 3E6CC 1AYM2 4LMFA 1NXD1 1JYWA 1VB2A 1CIWA 5JXGA 4PDWB 1CAUB 2XBO3 2CU5A 3M70A 3A4UA 4F7ZA 4H7MA 1AR62 2BZDA 3WR0A 2DVDA 1OKOA 3AZVA 4FXGB 1AR73 2DWRA 1LJ7A 1GZTA 3MW3A 1UYPA 4OLLA 2FCUA 2GC0A 3WHUA 5JDBA 4XABA 1YYNA 1IHMA 2RS31 1MQTA 1VRH2 4FFHA 4HG6B 1AHSA 1W9YA 3HPNA 5FZFA 4DS0A 1MS8A 5JOYA 5F3IA 4NPMA 5FWJA 1V6JA 2VZUA 2HYKA 1GU3A 4MGIE 4YSFA 2A6XA 5IATA 2JDZA 4ISRA 1NT0A 5IVYA 4QX1A 1W8UA 3ZXFA 5FOBB 2ETEA 4RHV1 3HN1A 5FZ1A 3PTRB 4BHPA 4LR4A 3TEYA 1F35A 1OFSA 3IAQA 5FMOS 1MEC3 1UZ0A 2O8QA 3LSEA 4XAEA 1W2TA 1W8FA 2F4LA 4MHRA 1ASJ2 2BV4A 4QM8A 2VOXA 2GSYA 4PIYA 4W4ZA 4BISA 2W68A 4MGZE 3ILFA 2PQQA 1MZFA 3C7HA 4ZZ5A 1LB2A 3OBZA 1CX1A 1T2XA 3NNLA 5FIXA 2EIGA 1QH7A 2XJQA 4DQAA 1SMVA 1C8M2 3MICA 1HB1A 1NZCA 1S4CA 4GMP3 5JZGB 5ANNA 2V4AA 3HD8B 3UGHA 1SPPA 1JZ2A 4YG0A 1PGW2 1B09A 2BPA2 2WNVA 5FYZA 4OI2A 1YXWA 4KU8A 2AREA 3RVHA 1UF2C 1ZBE2 1C3HA 2VZRA 2H6CA 2I45A 5CISA 3LPGA 2WUHA 3D0SA 2EICA 1GV9A 4P9LA 5A7QA 4Q4X3 3DN7A 3SMHA 3VZJA 3C2UA 4MO3M 4AYUA 1Y9MA 4YW6A 3SCHA 3ZKUA 3RG0A 3AL5A 1OPOA 1V70A 2W1SA 2YY1A 3VHNA 2VY0A 1US3A 3B9IA 1WCDJ 2JG8B 3BTAA 2VZOA 3PU3A 1F5JA 4IEXA 1WKYA 4XC9A 1QOOA 5FP9A 5FY9A 4I0WB 3T4HB 4EZ4A 4JGZA 5TSWA 4EN0A 1OQ1A 3NNFA 3P6BA 4H55A 4CDWA 4RGGA 1FATA 1SFYA 1WMXA 2CAUA 5T5JA 5FY1A 1PO23 4K8FA 5FZBA 1NCRA 2CSGA 5FP3A 4QHZA 3H8XA 1DQ5A 1YFWA 2NQYA 4YW3A 1BKZA 2IXLA 4AFCA 4LBQD 5K0UC 4BQ4A 5IAVA 1MS1A 1TEIA 2UURA 4AGVA 2NZ9A 1CAVA 3BU0A 2HWD3 1UIJA 3OYWB 3KZ4C 2XJRA 3D3AA 4R4XA 4GULA 2YV8A 4NPRA 2H0VA 4AI3A 1F2NA 3CEWA 4MG2A 4CCKA 4Y22B 1N3QA 5FR3A 1WLCA 1AYM1 3VZNA 3U0ZA 4XFIA 4FFIA 3VDDB 1GUIA 2BFUL 3ALQA 5E89A 4A44A 5A32B 2XUEA 3H7JA 2AUYA 1AR61 2NLRA 1NA1A 2WT1A 1AZDA 2Y0IA 2ZGRA 3AYAA 3VBFC 2Y6HA 5C3SA 4NAMA 2RG4A 4A7KA 1RUH3 4AVBA 4MVTA 1HRI3 1K5MC 2XOMA 3IBMA 3M3QA 2WDBA 2WZEA 5EYXA 2A71A 1OI6A 4Y33A 3LCPA 5CIRA 5A6YA 1OBNA 1NLQA 2VOTA 2YHJA 3CJIB 3IDCB 1VBD2 4ASKA 1HXS2 5JCTA 2DCZA 4DIQA 4QX2A 5HCAA 5JI9A 4CEWA 2R1BA 3LA3A 2D93A 1OH4A 1E57A 3FHIB 1U5XA 2I74A 4INDA 4UBGA 1DCSA 3KM5A 4GALA 3IDEA 2ZX2A 1OF3A 3BVCA 1ULCA 2B7YA 2X8KA 5F32A 2D3RA 1CPMA 1ASJ1 1RUI3 4HVQA 4YVWB 5KR7A 3MF9A 1NE6A 3UK9A 5C7GA 1BVVA 1VBB2 2JECA 3DPRB 4KI5M 1ND2A 2GH8A 2JX9A 1DZQA 3AZYA 2A70A 3H3LA 3LDRA 4JHZA 3VL8A 3BI3A 3URFA 1UZZA 2ZGQA 3CLPA 4IUGA 3AM2A 4RYDA 2DBNA 4LBOA 2VG9A 4Q0SA 1H9WA 4NIGA 5HCBA 4YGEA 3LSDA 1I3HA 2PA7A 2XJTA 3IPVA 4Q4W2 2Z42A 5FZAA 4AAXA 1HRV2 1PGW1 1L7QA 1GOHA 2NMOA 2LALA 2PHUA 4HOOA 1UZWA 4MGSA 4GJZA 3ZFFA 1IOAA 5FKBA 2J1AA 2R062 4FPHA 5GLZA 5FUPA 3RZZA 4JGYB 4COVA 2CNAA 4NN0A 3EYPA 2ZHNA 3KV5A 3BUCA 1Y43B 2V73A 3JUUA 3NJXA 4GH4A 3DXTA 1W2OA 3ZSKA 4OI4A 2GC1A 5CFDC 3B93A 4QKNA 3GYDA 5DUWA 5I0TA 2XG3A 2HBUA 3WINE 1K5JA 1HN0A 1S2BA 5CFCA 5CNAA 2JG9C 2JIGA 2ZGTA 2YUEA 4Y5SA 2P1BA 4ZS3A 3WOGA 4AHZA 1MZEA 5BNPB 1TMF3 2BDRA 1XQNA 5FZ7A 2XR4A 4P5YA 3C7GA 4IETA 3LIGA 2JWPA 2VD7A 1NLSA 3I4IA 3I2HA 1D7PM 4HKOA 4QQOA 1D4M2 2QE3A 4QX7A 5A7OA 3B00A 2R49A 3FHQA 3CKHA 4CP0A 4O61A 5D8AC 4AHXA 1RMU3 4JCKA 3VBUA 1J3PA 3BODA 1RUJ1 3ZXDA 3I49A 3H1YA 5FUNA 5T55A 4AHWA 4BJ0A 4E4HA 3V0BB 4QXBA 2VUAA 2ZJCA 3IM0A 1SCRA 4QGLA 3TRSB 3EQEA 5JXJA 1REDA 1E5SA 4TXWA 2BVBA 2RR12 4I0AA 2VZPA 5D1IA 3KHBA 3UETA 2R072 4Y1ZA 1DDLA 2VQTA 1NUKA 2H6BA 4Y24A 4PCRA 4QXKA 4S2GA 5EJ1B 2Q1MA 5J3UA 3E97A 1JBCA 4CCNA 3K4AA 4ZS2A 4P08A 3I59A 3VD4A 1CAXA 4RQPA 4W8JA 3RGBA 3AMHA 4QPIA 2ADEA 2XBO2 2CY6A 4S2HA 4KWKA 1Y9QA 1X36A 4XCBA 3TYJA 1C57A 5F6LB 3MFAA 1AR72 3A21A 2W3JA 1RUF3 4FPOB 5IVFA 1VBD1 1N3OA 1HXS1 5F9TA 3B5LB 2WINB 2FDKA 2ZAHA 1YIPA 4FP3A 2PAMA 2UYBA 3AYEA 1JTZX 1W6PA 2VOKA 4NO4A 1JZ4A 2JENA 1XE7A 4IERA 3C3VA 2W91A 1JHNA 3UJOA 1W9WA 3ZYIB 3KGLA 4AGGA 1V9U3 4Q0UA 1OOPB 4DUWA 5JUVA 1XBFA 2G9ZA 1POV0 3VBRB 4YVSB 4QMAA 1VBB1 2B4KA 3FUQA 4PLMA 1FV2A 1MEC2 4GXLA 4WM7A 3FLPA 4HZFA 4FOWA 1FNZA 5FZ9A 1HV1A 2ZCWA 1WA4A 1RUE1 1OKQA 2I2SA 1CESA 4UFMA 2QNKA 3GZAA 4NIIA 4Z2WA 2XL7A 2VO5A 4R9BA 1VBA1 4MXVA 4Q4W1 2RS13 3WCSA 1HRV1 4OCTA 4CSWA 4DZGA 1R1ZA 2VC9A 4Q1PA 5F2WA 5IT6A 3L9JT 4R8HA 1O8PA 1PK6B 2EXHA 1QDCA 3CO2A 5GZGA 4AQ2A 2XHKA 4YG3A 3LA7A 2JDAA 2ZGNA 5D2AA 4XACA 5HPOA 4HN0A 1VE0A 2VJXA 1FPN1 2HWB1 3GZTB 3THTA 2QQPA 5KXEA 1UY4A 3SLIA 3FC0A 3ZDSA 4Y4RA 3I3DA 5FMDA 3LDBA 5EFUA 3WF0A 1W28A 4GB33 4XF1A 3AK0A 4XF9A 4Q4X2 1QJFA 3NO8A 1LOBA 5F1RA 2XJSA 4JTOA 4K1YA 4YM2A 5BV6A 1UW8A 2ADDA 3A23A 4FTEA 1DQ2A 1UOJA 1ND3C 3VHPA 1UYYA 1W6QB 1R1A1 2PHTA 4XMAA 1REEA 5FO9B 4AWDA 3AZZA 4UW4A 4AFBA 3O1PA 4B1LA 5BNOA 5DAVA 3WVJA 1JZ5A 1D4M1 4ARXA 4P9YA 3WNPA 1J1TA 3HAGA 3POSA 4LJHA 1PO22 1S55A 3U78A 4M3CE 1IS3A 1OPMA 4CU7A 2BNNA 2YMZA 5JXHA 3WCRA 4C90A 4K21A 1SACA 3WDTA 4FPGA 3RI9A 2VM9A 2RJKA 4XURA 1V6NA 3NKGA 3AP6A 4Q29A 3HIFA 1C4RA 2HWD2 2VW0A 2RR11 4LBQB 4URTA 3FFQA 4FPKA 1CN1A 2P6CA 3HVDA 2R071 3OB8A 2A3XA 3POYA 4QWNA 4YG6A 1OUXA 1LKNA 3HMYA 5AVPA 3HT1A 3MZHA 1FNYA 4Y4YA 5CKQA 5ABJA 2VVFA 4AI9A 3BCWA 4XBNA 5EJ3A 1UMHA 2VH9A 4BIFA 1EUUA 1N47A 1X33A 4IV3C 1W06A 1YCIA 3M3OA 3A22A 3OEBA 4A42A 3RI8A 3GF6A 2OS2A 3D82A 3NSTA 3VZLA 3VBSC 3J8F1 1TME1 3ZFEC 5EZWA 4OUEA 3NAPC 1AJKA 2Q8EA 4E2QA 5L7OA 2ZHLA 1AR71 1RUH2 4D7YA 4QM9A 1HRI2 2XL9A 2FQPA 2A5ZA 2HEVF 1H0BA 4KQ7A 4DB5A 1O3QA 1HKDA 1DLCA 1VAKA 4QKFA 1S0IA 1HX6A 1XYOA 1YNAA 2DVGA 4UFHA 3T09A 1IKQA 1HLCA 5EXOA 3ZVXA 2QQVA 4EN7B 2VAUA 5F39A 4Q4Y1 1H2LA 2UY9A 4QAWA 4L97A 2JJ6A 4W65A 1JOBA 1N1SA 1MR5A 2VTXA 1X7NA 4FPYA 3ZXKA 3HQRA 1W8NA 3VBOA 4D7SA 1XNCA 1YQ8A 1RUI2 2WS91 1EPZA 4QKBA 4YZ4A 1WBLA 1TNRA 5JSRA 3O0VA 3WD5A 2GNTA 3T2PA 2PXJA 4WVMB 4NR1A 3OSDA 1OT5A 4NWWA 4AEKA 1W6NA 1YFXA 5EPAA 1G9BA 1CAWA 2XXZA 3H3UA 3ZN4A 4XYXA 1YJKA 2FZ1A 1LODA 5GZFA 2ORXA 5FZOA 2BGCA 3SH3A 2XKOA 2B45X 2Q1ZB 1SG3A 4LOSA 4YFWA 2R1DA 1X8EA 3ETQA 5FP7A 1FOD3 2FHRA 2A6ZA 4FI9A 2WNUB 4XJWA 5DUVA 4DXRA 4AI1A 5J98B 3V56A 1GQGA 1F15A 2OUJA 3P1IA 4IQPA 1Q8VA 3NNMA 4Q5OA 3KQRA 2D6LX 2WYSA 5KBFA 2DCTA 3CBNA 2D7FA 3PUSA 3RPQA 4AEDB 3WT3A 4CEYA 2XJUA 4AXOA 1H4GA 4FSJA 3P5BA 1T6GC 3FFZA 4D69A 4RR3B 1UMZA 3WG4A 2X10A 4WV8A 5GZEA 1Z78A 5I0SA 4Z1VA 2W39A 3S5AA 1CZTA 1TMF2 1O3RA 2PELA 3AKQA 1FYUA 4NIDA 2EALA 3DECA 5ACA3 1NCQB 4EWDA 5BNNA 2XJVA 4KGQA 2Q30A 2JDMA 4A6SA 1IKPA 1B35A 4BQ2A 1F8VA 1RMU2 2HEWF 1VRBA 4AEMA 4LPLA 3BTXA 4I3PA 4CE8A 5FZIA 3N4MA 3B01A 4PDWC 2HWD1 4JDOA 1RUJ3 1OA4A 2XVGA 4Z82A 3HQXA 1OD3A 5LY2A 1LAJA 1PIV1 1ZX5A 3AP9A 4NVPA 5FPZA 4IV1B 1H2NA 3JB4C 2IVJA 3U07A 3PVOA 1HB3A 2P3JA 3Q8BA 3ZMOA 1GZCA 1XE8A 3AYCA 2ZA9A 2A6VA 2QQOA 3J26N 3ZYJB 3HN3A 2WA3A 4M0NA 4XUTA 1C5IA 5CG9A 1ENXA 3A0KA 3MLLA 3MPPG 2D3SA 2D6MA 4Q8KA 4LNVA 4IEPA 1CVNA 2EXJA 5F37A 2GP5A 1MACA 3SITA 1RUH1 4LO4B 4NRMA 5F8PA 3I2OA 1HRI1 2UWAA 3FBMA 1GANA 4XVHA 1J84A 5E8AA 4W6XA 2IC1A 3GGLA 1QXRA 3AJYA 3KV6A 3N9MA 2ZX3A 3GXUA 3VN4A 1QJX3 4BMBA 1A3KA 1RUF2 3AC0A 4RGAA 1ZREA 1T6BX 2ZKNA 1OVSA 3KV9A 5CYYA 4HFSA 4LBLA 2RM21 3V0AA 1LHNA 5GZCA 1TE1B 2BERA 4LHKA 2ZX1A 4LO7A 1BXHA 5FMCA 4DRRA 3NAPB 3SCFA 4NHYA 4NRPA 5FXVA 5JZGC 3WG3A 4BA6A 3IMNA 3SC7X 1V9U2 2Y6LA 3PIJA 2GU9A 1RUI1 1ZZ7A 3C7OA 4LO8A 4M3CA 4NROA 2X5IB 4YPJA 1G7YA 4YGCA 1KD7A 1RUE3 4QGMA 3F95A 2WSVA 4N43B 3TEXA 3B69A 3M3EA 1A8MA 1VBA3 1ULOA 2EXKA 2ZZJA 4Q4W3 2RS12 4EWAA 1HV0A 1W2NA 4BQYA 5FZHA 4SLIA 2JDHA 3HNBM 5J48A 4QT6A 3KD4A 1UL9A 4Y22A 5HCHA 1AR81 1WZXA 4CDXB 5FYIA 1DQ0A 1O4ZA 4ET7A 5DDJ3 2XDVA 3C7EA 3ZYRA 2YDEA 2JG8C 2OXBA 1KRIA 1FPN3 2HWB3 4LORA 3WW2A 4B1MA 4KG8A 3AX4A 4OI0A 1QIQA 3D5OA 3USSA 3VKMA 2TUNA 1QU0A 2P2KA 5T5LA 2RMU3 1LOFC 4C1XA 3W5MA 1DYKA 2BFUS 4GB32 2IXKA 2W47A 1H4HA 2IFWA 3O0XA 4E9KA 4EJRA 5C9AA 2WZR3 5FXWA 5IK8A 1HDKA 1ULFA 1X9PA 2LROA 3I2IA 1ZRDA 1PMJX 2PHLA 1XYPA 1BVP1 1I9RA 2QDRA 4IE6A 3T4VA 1SZBA 1DBNA 1TMF1 2D97A 2PAEA 4V1PA 5A33B 5IFTA 4H2AA 1R1A3 3ACLA 4BIOA 2ZGKA 4RD7A 5A80A 1YEWA 5FPAA 2J22A 3T2OA 1URXA 1PVC1 2QCSB 1GWKA 5FLIA 3T3YA 3VBHB 4M0HA 5LB6A 3OGSA 3WDWA 3WW4A 1RMU1 1PZ8A 1XSRA 5F5QA 2C1FA 1SCSA 3D6EA 3ZFGB 3VDDC 4Y20B 1AX1A 2HWF3 5F3EA 3W9AA 4Y1XA 5FJHA 3VKFC 2J1VA 5DAWA 4DY5A 2XLFA 2OUHA 5I8YA 4J25A 2JDPA 2N7GA 2PTMA 2Q1FA 3VGIA 5FZEA 2P34A 3KCYA 3T30A 1BK1A 2JD4A 3DCQA 1AXKA 3KVAA 3U75A 4IW3A 1XU1A 3RS6A 5DAQA 4A41A 1MS9A 3I3BA 1VMJA 1YQ2A 3CJIC 4O65A 3O12A 1PM4A 2E53A 5C4WB 1SLIA 4XFFA 1GZWA 1GZ9A 3HQUA 1OUSA 2UWBA 3LD8A 2W2IA 2XGXA 1TME3 3J8F3 3PTYA 3PUQA 4FAHA 1DGLA 3CZJA 2WL1A 3IN9A 3OUJA 3CDZB 2YGMA 1RUF1 5FQ0B 3OGRA 5L36A 3I97A 1OD5A 1MVEA 2VUJA 2VBBA 4UOJA 5FXXA 3NL1A 4P9XA 1UZVA 2VUDA 3DF0A 4YVWC 4PHZA 4EQVA 2TEPA 3FL7A 4BXSV 2G4IA 3DPRC 4PI0A 5CBLA 1RUOA 3R05A 2ZMNA 4X6QB 4WM8B 4YW1A 4CUGA 4CA9A 1QY4A 3VDAA 2BNOA 2DUQA 4YNIA 1QHDA 5KHHA 1YRZA 2VMIA 2W9XA 4Q4Y3 5I0DA 1V9U1 3NW4A 4QPGB 4OULA 3R4DB 5DPNA 4QD2A 4AQTA 3MIHA 1WMEA 5AC93 1ZRIA 4JKMA 4IL7A 5LRRA 5KHIA 4LO6B 4ZU4A 2WS93 1ZNPA 4HPKB 4DEVA 3WP4A 2RJLA 4P14A 4AOCA 1QXJA 4JGYC 3WHTA 4IE4A 4XOGA 1PMHX 1J83A 4RS5B 1SFPA 4NUBA 1CPNA 1R093 2RS11 1FAYA 5DN2A 3UJQA 2JKXA 2VMCA 4HSLA 1OSGA 5FZKA 2CHHA 1TVGA 5JOZA 2FD8A 2YG0A 4NHMA 2VW2A 5CADA 1YFUA 1ZZ6A 2EA7A 5FV3A 3T0BA 4LO5B 5B4NA 3JB8A 5LBBA 4R52A 2BU9A 5K0UA 2DCJA 2VZVA 1FOD2 2W0XA 3WP3A 1AYN3 5BNPC 5C8CB 4CXYA 2QQMA 3VUOA 1GOFA
chains in the Genus database with same CATH topology
1LGNA 1RUD1 2O0OA 4GB31 1QQP1 2DYCA 5KWRA 4XIKA 3H1MA 4YZ5A 4EWEA 1OLQA 4JDNA 3FE5A 5SV8A 1C1FA 5DZGA 1RINA 2ZTNA 1MS4A 5GKAC 4MZUA 4I3GA 4N53B 2D6KA 1U12A 2OPKA 1JUIA 3ROUA 5AVAA 2PHDA 3AXDA 3U4XA 3VBFA 3L2YA 3ZYGA 5JOWA 2QUOA 3T2TA 4KL1A 1Q3EA 4E2SA 5ACA2 2WFF3 3CNAA 3N7LA 5DG2A 3OPZA 3BALA 4COYA 1K5MA 4GKYA 2UU8A 5GJ6A 3S7EA 2WSUA 4MUVA 4YM3A 4XXPA 1O4YA 4B7KA 2YROA 1WW6A 4CDUA 1RUJ2 5L19A 2OA2A 5I8TA 4LLFA 5JPNB 2PN5A 4XF4A 4FVVA 1KDMA 3VKOA 3KMHA 1Z7S3 3L2HA 1PIV3 2FMDA 1XRUA 1LESA 1WLTA 3PVNA 5KXCA 5EYYA 3GHMA 3DUIA 1QJU3 2WFPA 2ZGLA 4Q0VA 3Q9OA 4XFGA 4FBFA 5AFEA 1VAMA 5FPXA 1ZRCA 1RVF1 2VULA 1UX6A 4EN9B 1KQRA 4OVEA 4GIQA 1OOPC 1QJX2 1H8VA 4F3JA 3VBRC 5EWSA 2WA4A 2ET1A 4YVSC 1AX0A 4Q2FA 4I2OA 1GLHA 4GMP0 2PHWA 3OCPA 2RM23 4H14A 4BPZA 1PO13 4WBBA 5FAXA 2FMYA 1V6MA 1O3SA 3KSCA 3M7AA 4I02A 5CFDA 2CGPA 3MPBA 1PK6C 2ARBA 5KHJA 1D2SA 1J59A 1H8TB 1UD1A 3AKRA 4LA3A 3R6SA 3SH5A 3WQ1A 5FO7B 4AI0A 4S2DA 1JOJA 1NOVA 1SLBA 4HSJA 2JG9A 4B7EA 3MFCA 1O91A 1RUE2 4DINB 3AP7A 1G9CA 2ZPXA 2D44A 1VBA2 1GKBA 1IZ3A 2E63A 1KS5A 1JYIA 1RC6A 1GICA 2BWAA 1AR83 2PAKA 2Q5TA 4MV2A 1R081 1FOD1 1V6OA 3USUA 5D8AA 1OFNA 5DDJ2 5E88A 4DMIA 3S0MA 2BQPA 1FPN2 2HWB2 4CDQC 4X6RB 4LT5A 1UU5A 4J1XA 3ILRA 1BBT1 5F6KA 2DCYA 2RMU2 4I01A 4UW6A 4FAGA 1D0HA 5JMCA 3OTFA 4KNCA 2WZR2 2VVEA 3R4UA 1ZZBA 1ENQA 3ILNA 3LAGA 4Q4V3 2WKKA 3VKLA 1R1A2 3EO6A 4Q27A 4XFHA 2ZGSA 2P3KA 2Q0AA 2K2SA 5ACA1 3VV1A 1IPKA 4PLOA 4W6YA 1QWRA 1ULGA 4HKWA 1PVC3 4N9HA 1BEV3 3J4UH 3MLKA 5K8SA 1MQTB 1QXPA 4Z07A 4HMZA 1PHMA 1F31A 3WDXA 3AXEA 3WDVA 5HXVA 5JWPA 4PBOA 4HKLA 4JC1A 2HWF2 2ATFA 3RJRA 1LU2A 4FPCA 5K9YA 1EP0A 4AFAA 2WIIB 3FBYA 3ZO0B 1F9KA 2GNDA 4L92A 1DFQA 3MLJA 4AQSA 3LWCA 2MEV3 1DQ1A 3ZN6A 4FQZA 3JD73 3LB9A 2XPJA 2D6OX 4NHKA 3RRDA 4WVZA 1VIWB 2O8OA 1NQDA 3J8F2 1TME2 2IXJA 1C8NA 1QJX1 5FLJA 3KT4A 1GR3A 1U5YA 2XLAA 3H50A 1VB4A 4M00A 4NOTA 2WNVB 3P3PA 1YI7A 1OQEA 4R9CA 3AKPA 4BLJA 1YI9A 2GMPA 4OZXA 2E6VA 4PQ9A 1W6OA 3MDPA 2HWE1 1LHVA 3FUOA 1RUG3 4EROA 1QNYA 4LTAA 5LK5A 1I5ZA 5BNQA 2VMGA 2CL2A 4Q4Y2 3T1MA 2FZ2A 1CR7A 3ZXGA 2VMHA 1ZZ8A 1NE4A 1LHOA 2WC2A 2MHFA 2VECA 5AC92 5IK7A 1ZBA1 1FT9A 4FTSA 3DGTA 2WS92 2E51A 2WNUC 2Y38A 1ND3A 3KCXA 1PM7A 1LEMA 1YIFA 4CDWB 1R092 2YYOA 1IGOA 4D3WA 1NCRB 2EVXA 3PNAA 1VP6A 4L9BA 3UKTA 4AEDC 4AI8A 1ZREA 4OHYA 1WMDA 3RYRA 3GBWA 2QVSB 2GN7A 5DDJ1 4B4QA 4D94A 4RR3C 5FFOC 1FMD1 5GZDA 1M06G 3ES1A 1MS0A 4LLOA 4AVTA 1Q8OA 1AYN2 3ZYPA 1N1VA 3ENRA 4ASMB 2OZ6A 1RUD3 2RMU1 1QQP3 1W0PA 1OA3A 1NCQC 4AFDA 1RTVA 2WZR1 3MYXA 1W6MA 2Q4SA 3H7YA 5LK7B 3R0RA 2NP0A 2K0GA 4Y5Z0 4LE3A 1RUNA 4KU7A 1MZ5A 3BOPA 1LULA 1DLLA 2C0ZA 4IV3A 3RYKA 4AE2A 5LEJA 1YHFA 4PF5A 1VJ2A 4CDQB 4XIOA 4QQHA 4N9IA 3VBSA 3ZFEA 3NAPA 3SH4A 5FO8B 5JSOA 4DPNA 1WW5A 2BNMA 2WFF2 4IV1C 4XFAA 5CB7A 4MXWA 2HWF1 1SBDA 3RJ2X 2VNGA 2PLV3 1YFYA 3N3HA 4CEWB 2CGNA 4AQ6A 2B5HA 4DY3A 1SEFA 1Z7S2 2VNRA 1PIV2 2D43A 4KWJA 2A6WA 1ZA4A 1FI2A 4GKXA 4RA0A 4AG4A 1ND2B 1GQHA 4BH9A 4XHBA 1QJU2 3N7JA 4PBPA 1RVF3 3IPVB 2ZGMA 4P9JA 3M3CA 2NN8A 3JU9A 2JEMA 4KG0A 3WXPA 4K1ZA 3B7MA 2DUOA 3OY8A 3WDYA 5CAZA 3ZFFB 1NXMA 4MSVA 2X5IC 3BB6A 4XFCA 4QPYA 4WVVA 4AVAA 1H30A 2R041 1LGBA 2ZABA 4XEZA 3ATGA 2E7AA 4I30A 2RM22 3GHNA 3FWEA 3HT2A 3M4FA 1DHKB 4GH4B 2RS53 3NV3A 4N43C 1S0GA 5IK5A 1EYBA 1PO12 3OBRA 2IZWA 5K7PA 5AC91 1SLCA 3O5SA 3VKNA 5CFCB 4ZU5A 4L99A 4CDXC 1MVQA 3TN93 1QF3A 2GAUA 1R091 3PHMA 1IS6A 4OI1A 2VQ0A 4B4RA 2GC2A 3WNXA 3PVBB 4O9EA 4OUMA 3RYPA 1ALYA 1VLNA 3AZXA 4FTBA 2HWC1 3G6JB 2YPJA 4J6GA 5H9PA 1JXNA 1S1AA 3VBUB 5GLUA 1AR82 1R083 1U0AA 1AYN1 3U11A 3ZXJA 4LBNA 1PGL2 4PDWA 1CAUA 2YZ4A 2DTYA 1IPJA 1S0FA 4Q26A 3VZKA 5C6CA 3VBHC 1BBT3 1DQ4A 3QCWA 1X8MA 1XYNA 1UPIA 4ZXKA 2P17A 1Q8SA 1UU6A 2WQ4A 2IWGB 4BLIA 3FLRA 2DU0A 4AVCA 3ZFGC 3I59B 4HETA 1OLRA 2GMEA 1CAXB 4RQPB 3NV1A 2Q8OA 4QPIB 4Q4V2 1O3TA 4XJZA 4LHLA 4AK3A 1S2KA 4MH0E 4HVRA 1JW6A 3VZOA 3APBA 4LBJA 1LENA 2WFF1 3V64A 1NYWA 4UXAA 4IEVA 1PVC2 1BEV2 4LBMA 1LEDA 3WW3A 5JIUA 3M2MA 1W6PB 4HK8A 3SISA 5C4WC 1RB8G 2ZGUA 1SLLA 3KB5A 4XW3A 1LOCA 1GFF2 4YM0A 1S0BA 1Z7S1 1J58A 1Y3TA 5JZGA 3MIDA 3MIFA 2Y26A 2XUMA 4WM7B 2MEV2 1QJU1 2NYYA 1QNWA 3ASIA 4BQ1A 3JD72 1U5ZA 2WJSA 4F8AA 5J37A 4GA9A 4WM8C 1NQJA 4J1WA 4META 3KLSA 2VOVA 1NLRA 2GC3A 2GH2A 4LBKA 2XWJB 4HLTA 4QPGC 3KT1A 1HIXA 2QZ3A 2WT0A 1PZ7A 1X50A 1S0EA 5T5PA 2AZ5A 1TQ5A 1V00A 2ZHKA 3VLBB 2OZJA 2ZMKA 1PO11 4RS5C 4JTNA 2HWE3 1RUG2 2JG8A 4G4FA 3MEPA 4HK9A 2VW1A 4QHBA 1SLTA 1LOFA 1B35C 1HQWA 2O1QA 2ZGOA 4AVVA 1I6XA 1SBFA 2F4PA 3WLUA 5T52A 1RJ7A 1WUVA 5HI0A 4LUKA 4Y1VA 3S7IA 4E4DX 1ZBA3 5J96B 4EN8B 5FREA 5C8CC 1O5LA 1GYKA 2D6PA 4JVAA 5BNOB 3WW1A 1CQ9A 3KS7A 5E1RA 1UCXA 2DFBA 3ZXLA 1A78A 3OYWA 1WLWA 3HWJA 1L3JA 1LOAA 5JR7B 1CGPA 4XFBA 3EJKA 1KXGA 3JBG1 4I0BA 2GDFA 2UYAA 4IEYA 3RNSA 3BOWA 1FMD3 4YW5A 4N53C 1PGL1 3VDDA 2DVFA 4TLFA 2R0HA 1FV3A 3JQXA 4IEWA 2B39A 5BXXA 3ZXAC 1SDWA 1VR3A 5A32A 1ENRA 4XBQA 1RUD2 4ASLA 1QQP2 2A3WA 5IUQA 4XJ8A 1S0DA 4K7JA 2XJPA 5ABJB 3PJQA 1CD3G 4L11A 5GM0A 1G9AA 1AX2A 2BUKA 3QLQA 4QQ2A 1C5HA 4CTEA 4DFSA 4Q4V1 1AL21 3CJIA 3V65A 4FP2A 2YXSA 3IDBB 1X82A 1RHI3 2GZWA 3WX5A 3S6PA 5L7OB 2DVAA 2DF7A 1DQ6A 3WDUA 1KJRA 1D4VB 1BEV1 4FPFA 3U10A 3CJXA 2A7AA 1O4TA 3TNQA 1WW7A 4ATEA 2QKDA 4IEQA 3ECQA 5CU1A 2A75A 4A3XA 4PLNA 4ZKTB 2ZACA 4YVWA 2DFCA 3TWIA 2PLV2 5I0UA 3DPRA 3E5UA 2PHFA 3WV6A 4IESA 2AH2A 3PMSA 2MEV1 3CU7A 1BZWA 2Z69A 4XE9A 3VBOB 2Y0OA 3JD71 4EV0A 3UKVA 5T5OA 3EXUA 1CJPA 3GNEA 2YC0A 5BUVA 1H1AA 2VGDA 3WG2A 2A73B 1I1EA 4JGYA 3AJZA 1AR93 4XPVA 1W6NB 1VBE3 1CAWB 1V6KA 4LUMA 1W39A 5FTTC 1RVF2 2D5HA 1H8TC 5JOXA 1GNZA 5GALA 1DIWA 4OHZA 3WY6A 2R043 4S2FA 4BYYA 4UBHA 1RUG1 2ILMA 5BNPA 4GWNA 2RS52 4JRAA 5IK4A 4CEYB 2ZAAA 1AUYA 3VL9A 4DNYA 4XJAA 4MGYE 1GBGA 5JPMB 2C9AA 2JICA 1UU4A 2D6NA 3FJSA 3TN92 4RFT0 1DGRN 2H0BA 2HJIA 2I07B 3V0BA 2KA3A 5BNNB 3MGUA 4C1WA 2B46X 4KBBA 3RDIA 1AJOA 1B35B 1D0GA 1H2MA 5I93A 4NHLA 2HWC3 4COWA 1SLAA 1OQDA 3LGRA 4CYDA 3B3QE 4TZDA 3KGZA 1DG6A 3I7DA 3ES4A 3P3NA 3WZ1A 1R082 5FLHA 3FX3A 2GMMA 5I8YA 2XVLA 4LA2A 4YW2A 1XNBA 1Q8QA 2GNMA 4OHWA 3SCGA 1AF9A 5C8WA 1G6NA 3RWNA 4ES9A 4OFGA 1UKRA 4BE3A 1MQTC 1BBT2 4LULA 1LOEA 1DGRA 1ULEA 4IEUA 2RE9A 1LRHA 4QQLA 4BZ4A 4O9GA 1A6CA 4AW7A 4HBNA 1DZTA 3W59A 1N1YA 3G7DA 3SNMA 1UAIA 1C1LA 1KFUL 1WLDA 1KS4A 3ZSLA 2YGLA 1KFXL 1EY2A 5H9QA 1UKGA 1APNA 5BPXA 3BIWE 2SBAA 2ZMLA 3WUCA 3FMGA 1OOPA 2PYTA 3ZIWA 3V0AB 1LECA 3VBRA 4YVSA 1LTEA 4XXAA 2PLV1 1EV13 1XU2A 4RL7A 1VBC3 4W6WA 4YGBA 4C0HA 4HN1A 3TNPB 2KXLA 3BU7A 1QOTA 3BPZA 4ATFA 4P9GA 1OHFA 3TB0A 3ZN5A 3I2DA 1QJY1 1BCXA 1IS4A 3AKTA 3JZVA 1QOSA 1RUC1 4FPLA 3ZSMA 2R6QA 4M3CB 2D3PA 1PVXA 1PK6A 2WNVC 4YZ2A 2DUPA 3DKWA 1MS5A 3EHKA 1DGWA 2A3YA 4SBVA 1YLLA 3ZSJA 4KGGA 4YFZA 4PJYA 5DZEA 2BTVC 3RMYA 2V09A 3NKTA 3AYDA 1FXZA 3OGGA 2RS51 4ES8A 2BWCA 4JGZC 1W6QA 2HWE2 1G9FA 4CDWC 1O5UA 4CDQA 3GALA 1NCRC 5C9AB 2EAAA 1J3QA 4FCAA 4B8EA 4JRLA 2JE7A 2Z2SB 4XILA 1VRH1 1PGSA 4B3NA 3KT7A 3TN91 1BJQA 4XMIA 5DXDA 1HQLA 2QDNA 1ZBA2 5KC5A 4CDUC 1ZVFA 3QOPA 3W58A 2XLGA 4XZPA 2E7TA 4H7LA 5AFBA 1EAH3 1LR5A 4TSVA 3AFKA 4LBQA 3VHOA 3J9SA 1SQ4A 5EV7A 5CA6A 3JBG3 1WBFA 3UKNA 4D7TA 1VAVA 1Q43A 1NA1C 1FMD2 4OHVA 2ZOEB 4E2GA 3B9CA 3OJBA 4YLZA 1AVBA 3O0WA 1QKQA 1C8M1 4QGNA 1OMIA 2WNEA 2CWMA 2ZKLA 2ES3A 2R16A 3H0OA 1IS5A 1QGLA 3QACA 1KJLA 4Z8BA 1LU1A 1GZWB 1ZBE1 3NWKA 1AL23 1S0JA 1PZ9A 4PIXA 4XJUA 4ISQA 4CEWC 1RIRA 1RHI2 2XH6A 2DURA 1DZRA 2ET7A 1POV3 5T54A 4AFMA 3TAYA 4ONUA 2PFWA 3D0JA 1RJ8A 2ERFA 4Q1RA 3NVCA 1YWKA 4K40A 2ENRA 5FCCA 2XB6C 1ND2C 3AFGA 2OVUA 2WT2A 3THPA 3ELNA 3MW2A 4YRDA 2GNBA 3SXWA 5FMOL 4EN6B 5DUXA 3I8TA 4WVMA 5DG1A 5B2GB 2V5YA 2UY8A 1G8WA 2DU1A 3LOIA 3B94A 3ZFFC 1MS3A 1LGCA 4GWMA 1COV3 4JQRA 1GSLA 2XKPA 3IT8A 4GH4C 4XTMA 4DOUA 2WNUA 5GLTA 1AR92 1GNHA 1VBE2 5KHGA 2DCKA 4TWTA 2ZHMA 3INAA 5HBAA 4CZSA 1REFA 4AEDA 5CFCC 5T50A 1ZYBA 2BEOA 5K0UB 4YGDA 4XQWA 1SFNA 2R042 3O7OA 3PVEA 4FPJA 4RR3A 2Z79A 3PLQA 3VHRA 3GBGA 3TOJA 4UW5A 3AKSA 1H9PA 1H1MA 3QH7A 3KCCA 3AP4A 2ZZQA 3K51A 2D40A 3RMXA 1NCQA 1CONA 3WP5A 3VBUC 2EF6A 5I91A 2RS33 2X29A 1YO8A 1ZM1A 3MI8A 3AMQA 4UW3A 5SV5A 4JGZB 3JCIA 4YM1A 3B02A 4FOQA 4FOYA 3VBFB 3PJYA 2B42B 4YZ1A 2QFEA 4I09A 2CAVA 3WUDA 1J1LA 4YYOA 1J3RA 1K5MB 4JDMA 4XDQA 1LHUA 2HWC2 4RHV3 4IV1A 1G86A 3GZUC 4A7YA 2WLQA 1CAVB 4RQPC 4R9DA 1RITA 2D5FA 1Q5OA 3OF1A 4QPIC 1HW5A 4CDUB 2W52A 3POWA 1H2KA 3ZIXA 4COUA 4BWOA 5KXDA 2F6BA 2PHXA 1BMV2 2CWSA 2PHRA 2P3IA 2G9GA 4N7IA 4X8NA 2R061 1QMJA 5L73A 1EPWA 1NA1B 3HR9A 1RHI1 2QJVA 4IXLA 4K3UA 4CRQA 2CYFA 1CJDA 1LOGA 4IEZA 2OW4A 1JYCA 1W2UA 1O7FA 4R9AA 4OHXA 3N35A 4WM7C 1AL0G 1Q8PA 4QU2A 3EBRA 1F5FA 2XWBB 1D2QA 2X5IA 1EV12 5JIAA 1VBC2 2WLPA 4M01A 4Y1UA 5CVRA 3RQ0A 4LEJA 4P5HA 1ENSA 4N43A 2BVVA 5CFDB 1ZRRA 2VVDA 4E27A 1QJY3 3E5QA 2G9FA 1KITA 1RUC3 5I8SA 4Q0QA 2WWSA 2D98A 1NY72 2JXAA 2JG9B 4CDXA 1ZZCA 2R32A 4U36A 1FX5A 2HEYF 1AR91 4MX3A 1VBE1 1Y7BA 3OD4A 3NJZA 4B4PA 1UN1A 2IXIA 2VXRA 2B9UA 5LEKA 4KWLA 5GLWA 4G3YC 4BMEA 1W0OA 2MNGA 3USUB 1U5IA 1AYM3 1AXZA 5D8AB 4BCUA 4WZFA 2SLIA 1DYPA 2ZX4A 2AGSA 3H8UA 1WCSA 4AI2A 4XJ9A 5JLVA 2KM2A 2XBO1 5BNOC 5A33A 3LZZA 3ZMNA 4E4ZA 4MLOA 4XQ4A 4XHXA 1AR63 1N3PA 3AZWA 4X8PA 1UPSA 2E9QA 4K9SA 2AYHA 2VPVA 3VBHA 4AF9A 1WW4A 1VRH3 1QH6A 2RHPA 3IKWA 5JI7A 2TNFA 3ZX7A 1WCKA 3E6DA 4OUSA 3ZFGA 2E7QA 4Y20A 4Y1YA 1KDKA 2EXIA 2ZX0A 4XTPA 2WZPP 4G9SB 2K9ZA 4AEJA 3S30A 1EAH2 3N7KA 4HL0A 4FOVA 5A3LA 4QQPA 5H9SA 5ABJC 4K6BA 3E6BA 1MEC1 2P37A 2NPIA 4ITCA 3JBG2 5GLVA 3UL2A 4B29A 1ASJ3 1QDOA 1HQNA 1PNFA 2OIIA 4CP2A 2MPFA 2QZ2A 5C4WA 5L7OC 3AMNA 1BMV1 1C8M3 4GMP1 5FOJB 3AB0A 5JVVA 3ZN6B 3WG1A 3MIGA 1JH5A 4WVWA 5FQ0A 1ZRFA 3X29B 4C0BA 3IIAA 4LHNA 5FDBA 3LA2A 1ZBE3 4LE4A 1WD4A 1AL22 4WZCA 1RL3A 4DRVA 1V6LA 2HKXA 3MIBA 2AR6A 4WM8A 4P9WA 3LKJA 4Q4X1 3VBOC 1Q56A 4QPGA 2CTVA 4ZU7A 2VOWA 1EV11 1VBC1 3TBDA 3WQ7A 1W6OB 2TBVA 3N36A 2R30A 4HPKA 1ULDA 4IEOA 4JV4A 2JKBA 4ORFA 4Q8LA 3SHRA 1XNDA 2FBEA 5A3MA 4RS5A 3R4SA 4HANA 1SBEA 4NWVA 4XQDA 2ZBJA 1PO21 3AP5A 2C5DA 1NY71 5JSPA 4YARA 1QJZA 3QH6A 1Z0HA 4XETA 4Y26A 3DL3A 1MZ6A 2DVBA 2OYZA 5J7MA 1ND3B 3FZ3A 1COV2 3ST7A 4L2NA 1M4WA 2VNOA 4FQ4A 5C8CA 2A6YA 4FPEA 5I0RA 2JE9A 4CEYC 2ARXA 5BYNA 4K20A 4A7ZA 3MF6A 3UV9A 1CX4A 4F83A 2NMNA 3VZMA 4A2UA 5FBZA 3QD6A 1TNFA 1PMIA 5BY5A 2VU9A 3FLTA 1VALA 4H3WA 2UWCA 4MGKE 4Q0PA 3ZPYA 4N53A 4MYEA 3JQWA 4N7UA 4PIZA 1N1TA 2W08A 2CV6A 5BNNC 3O14A 2X53S 4BM8A 4BOWA 1W6MB 3HBZA 4U2AA 4YW4A 4AGRA 5E16A 4HT1T 3RSJA 2IFRA 5JAXA 1VBD3 1HXS3 2RS32 3DV8A 3H9AA 4IV3B 3N7MA 3MW4A 4R4ZA 3D8CA 5T55A 4FXKB 5KC6A 3M3IA 3OGJA 4XF3A 2DV9A 5KHKA 3LOBA 3OBTA 1ZZ9A 3VBSB 2DTWA 3CF6E 1EAH1 1WGPA 2EAKA 1H1IA 3IWZA 3ZFEB 4XF0A 1WD3A 1WMFA 3I54A 2XVKA 4E4SA 4MXWB 2Z5WA 1JUHA 3T1LA 1AXYA 3PMEA 4RHV2 1ONAA 3CL1A 1VBB3 2BW8A 2WQZC 4GQ7A 1YJLA 3M1HA 5HCFA 1UZYA 1YUDA 1BYHA 2CGOA 4AVSA 1DGWX 4XBLA 1IQAA 1LCLA 4TYSA 4AHYA 3M8LA 3ZXEA 4C91A 1HRV3 2BBVA 4YZ3A 3WQ0A 3ZSEA 2R063 3D4KA 1G9DA 5J36A 2IXCA 4CP1A 2LUWA 1POV1 3WP6A 2B8MA 4FO9A 3NV2A 2VQAA 2LTNA 4DXZA 3ME2A 1DF0A 3OY8B 4L8QA 3E5XA 4JAAA 1H8TA 1LHWA 5J09A 4COZA 2AENA 2NM1A 2BYVE 2ZGPA 3QBQA 3A0NA 1S0CA 4P9IA 2GN3A 4FT8A 4HVOA 5H9RA 2GALA 3K48A 3NV4A 5CG8A 1UIKA 1D4M3 1RGSA 4Z92B 1JN2P 1NG0A 3AMMA 1XNKA 2ZS6B 5FRAA 1QJY2 1C28A 3H3ZA 3GBFA 3MIEA 1RUC2 3AMPA 2R0FA 4KH9A 4RSUA 5DUUA 1V6IA 1DU3D 1COV1 1PNGA 5LRSA 1OA2A 1XXNA 2RR13 3H1WA 5C9AC 2R073 5T3NA 4QX5A 4M3CF 2LM3A 3OD0A 1A8DA 1BQPA 4N90A 5C33A 2IXHA 3E6CC 1AYM2 1NXD1 1VB2A 1CIWA 4PDWB 1CAUB 2XBO3 3M70A 3A4UA 4F7ZA 4H7MA 1AR62 3WR0A 2DVDA 3AZVA 4FXGB 1AR73 2DWRA 1LJ7A 5JDBA 3MW3A 4OLLA 3WHUA 2GC0A 1YYNA 1IHMA 2RS31 1MQTA 1VRH2 1AHSA 4DS0A 1MS8A 5JOYA 1V6JA 2HYKA 4MGIE 4YSFA 2A6XA 2JDZA 4ISRA 3ZXFA 5FOBB 2ETEA 4RHV1 3HN1A 4BHPA 4LR4A 1OFSA 5FMOS 1MEC3 3LSEA 2O8QA 3VHNA 1ASJ2 4QM8A 2VOXA 2GSYA 4PIYA 2W68A 4MGZE 3ILFA 2PQQA 1MZFA 1LB2A 2EIGA 1QH7A 2XJQA 4DQAA 1SMVA 1C8M2 3MICA 4GMP3 1NZCA 5JZGB 3HD8B 4YG0A 1PGW2 1B09A 2BPA2 2WNVA 4OI2A 1YXWA 4KU8A 2AREA 1UF2C 1ZBE2 1C3HA 2H6CA 2I45A 3D0SA 1GV9A 4P9LA 4Q4X3 3DN7A 3SMHA 3VZJA 3C2UA 4AYUA 3SCHA 3RG0A 1OPOA 1V70A 2YY1A 2VY0A 3B9IA 1WCDJ 2JG8B 3BTAA 1F5JA 4IEXA 1QOOA 4I0WB 4JGZA 5TSWA 4EN0A 1OQ1A 4H55A 4CDWA 4RGGA 1FATA 1SFYA 2CAUA 5T5JA 1PO23 4K8FA 1NCRA 1DQ5A 1YFWA 2NQYA 4YW3A 1BKZA 2IXLA 4AFCA 4LBQD 5K0UC 1MS1A 1TEIA 2UURA 4AGVA 2NZ9A 1CAVA 2HWD3 1UIJA 3OYWB 3KZ4C 2XJRA 4R4XA 4GULA 2YV8A 4NPRA 2H0VA 4AI3A 1F2NA 3CEWA 4Y22B 1N3QA 1WLCA 1AYM1 3VZNA 3U0ZA 4XFIA 3VDDB 2BFUL 3ALQA 5E89A 5A32B 3H7JA 2AUYA 1AR61 2WT1A 2Y0IA 1NA1A 1AZDA 2NLRA 2ZGRA 3AYAA 3VBFC 4A7KA 1RUH3 4AVBA 4MVTA 1HRI3 1K5MC 3M3QA 3IBMA 5EYXA 2A71A 1OI6A 3LCPA 5CIRA 2YHJA 3CJIB 3IDCB 1VBD2 1HXS2 5JCTA 2DCZA 5HCAA 5JI9A 4CEWA 2R1BA 3LA3A 2D93A 1E57A 3FHIB 1U5XA 2I74A 4INDA 4UBGA 3KM5A 4GALA 3IDEA 2ZX2A 1ULCA 2B7YA 2X8KA 2D3RA 1CPMA 1ASJ1 1RUI3 4HVQA 4YVWB 3MF9A 1NE6A 3UK9A 1BVVA 1VBB2 2JECA 3DPRB 1ND2A 2GH8A 2JX9A 1DZQA 3AZYA 2A70A 3VL8A 3URFA 1UZZA 2ZGQA 3CLPA 3AM2A 4LBOA 2VG9A 4Q0SA 1H9WA 5HCBA 4YGEA 3LSDA 1I3HA 2PA7A 2XJTA 3IPVA 4Q4W2