1O4YA

The three-dimensional structure of beta-agarase a from zobellia galactanivorans
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
b'AQDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPAGNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQEIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWRPAATQEELADDSKNIFWVDWIRVYKPVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-agarase A
molecule tags Hydrolase
source organism Zobellia galactanivorans
publication title The Three-dimensional Structures of Two {beta}-Agarases.
pubmed doi rcsb
total genus 74
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o4yA00
5JOXA 1KRIA 3CNAA 1QGLA 4XHXA 1LHWA 4ATFA 2R0HA 4GWNA 3AFKA 2ZA9A 1WUVA 5IK4A 3C2UA 1HDKA 3WDUA 4DRVA 3BODA 1R1ZA 4OZXA 1KJLA 1SBEA 1S0DA 2GMEA 1AZDA 5GLUA 1GZCA 2WKKA 1V6LA 2KM2A 3AP6A 1G9BA 2ZMNA 1G86A 1ZM1A 1AXZA 2YV8A 3AJYA 3N35A 4FPHA 4YW2A 1CONA 1WCSA 1SBFA 2R1DA 3FLPA 5GZCA 3M2MA 3VKMA 1A3KA 1BZWA 1W6PB 3DGTA 1LGNA 4GKYA 1F31A 1GZWA 2CY6A 2DURA 4XOGA 5BYNA 1DIWA 1MS0A 3JU9A 4YGEA 3BTAA 1DYPA 1LU1A 1BJQA 2C9AA 3T2TA 5JLVA 2DV9A 3FUQA 2D43A 3KM5A 5GM0A 4YZ2A 1CVNA 1AJKA 5E89A 3N7KA 2DUOA 4M3CF 1C1LA 4XTMA 1ENQA 3T1LA 3SH3A 2VH9A 1LGBA 4ASMB 1MVEA 5H9SA 3QCWA 2TEPA 1DQ6A 1C57A 3WDWA 4BLJA 1FYUA 2VXRA 3WG2A 3V0AB 1A8DA 1N1YA 1HLCA 1ULDA 4XILA 3WVJA 1N1SA 3IN9A 3OY8B 1IKPA 3POYA 4AYUA 1G9DA 3B00A 1BYHA 3M3QA 1D0HA 2CTVA 2UURA 5H9QA 3AYDA 2WLQA 3UK9A 4JC1A 1D2SA 2I2SA 5JOZA 2D3PA 2AREA 4YZ4A 4Y24A 1S0JA 4ZKTB 3WCSA 2NP0A 1RIRA 3VUOA 1GV9A 3ZSJA 2AYHA 5CB7A 1FV2A 5E88A 1DBNA 2D44A 2ZMKA 5DUWA 1O4YA 2YROA 3AP7A 5GLWA 1VALA 2DVDA 2D6KA 1N3OA 1CJPA 5DZEA 1F9KA 3WDYA 1AXYA 2ZABA 3O0XA 1PZ9A 1B09A 1AX2A 4BMBA 5F9TA 2ZMLA 4XTPA 3MEPA 4M3CE 4C1XA 5EYXA 4R9AA 3HMYA 4YM1A 2G4IA 3ENRA 1S1AA 2AR6A 2R49A 2H0BA 2W52A 1JBCA 2SLIA 4ZXKA 4FPLA 1ULEA 4Y1VA 1S0GA 1QKQA 1Q8OA 1W6QA 3ZSLA 3V0BB 1ENRA 1W6MB 1A78A 2DVBA 1MS1A 2JD4A 5JMCA 3V0AA 1OFSA 1JN2P 2AUYA 4GA9A 4XIKA 3RMXA 1C1FA 2FMDA 1G7YA 4Q2FA 1QMJA 4F83A 4PCRA 1W6OB 2E7TA 5IK8A 2WJSA 1NLSA 4XJ9A 1HQWA 1QOSA 1UX6A 2BQPA 3IPVA 1BKZA 4W65A 5HCBA 4XJ8A 2D7FA 1KQRA 5T5PA 4FPYA 4DPNA 2A3XA 5KXEA 3B3QE 1VAVA 1H9WA 2C5DA 1LOFA 3DUIA 4Y1YA 4YG0A 5T54A 1SCRA 1O4ZA 4LBQA 4Q8LA 5CNAA 3M3EA 3ILRA 3AP5A 2JJ6A 1OKQA 2RHPA 4BOWA 3I8TA 1SLIA 2ZGNA 3OGGA 2P3IA 4FP2A 4ISQA 2WSVA 2OUHA 2A7AA 3Q9OA 1GBGA 2EXHA 3WG1A 2EIGA 2A6ZA 4YW4A 5KXCA 3O12A 2CWSA 4XJAA 1JYCA 3RSJA 2W08A 5KXDA 1S0IA 1VIWB 4CTEA 1WD3A 3FLTA 1C4RA 4JCKA 1FV3A 3FLRA 1N3PA 3OPZA 4FOYA 1VLNA 2A75A 2SBAA 1ULFA 3B9CA 1WW5A 5DG2A 2R1BA 1LOCA 3M3OA 5GZDA 3FFZA 1Q8PA 3IMNA 3OBRA 3AK0A 4YG6A 1DFQA 5DUVA 1SLAA 1CIWA 1H30A 3FBYA 2YZ4A 1V6KA 3B01A 4U36A 5EXOA 1KDMA 3IPVB 3ZPYA 3USUA 5AVAA 4LBQD 2VY0A 3OBTA 1ONAA 1V00A 1GZ9A 2ZGQA 3AZXA 3D4KA 4WV8A 3RG0A 3R4UA 3NV3A 1WW4A 4FOQA 5H9RA 5T52A 3AZWA 1LOFC 1JW6A 3A0NA 2PHXA 4GKXA 1WBLA 4IQPA 4AVVA 1FATA 4JRAA 3RQ0A 3WNXA 1LOEA 3AYEA 4LBLA 4K21A 1X50A 2DVGA 5HCAA 2DVFA 2EXKA 4R9CA 3L2YA 4FPEA 1W6PA 5FREA 1N1TA 4GXLA 4AGVA 3BOPA 4LBOA 3POWA 5DUXA 1J1TA 3T1MA 3N3HA 1JHNA 2ZGOA 2AGSA 3V65A 3JUUA 1SFYA 4PQ9A 2EAKA 1LGCA 4XIOA 1Q8SA 1MS8A 3POSA 1CPMA 2ENRA 1Q8QA 2DUQA 3LSEA 4BPZA 2CNAA 3MW3A 3W58A 4YM0A 3TB0A 2VUAA 5GZFA 3AYAA 1N1VA 2EXIA 2E6VA 4HANA 1LHUA 2PHTA 2CYFA 2PHFA 5HCFA 1ENSA 1AXKA 1UMZA 3ASIA 3WG4A 4C1WA 4WVVA 3V64A 4TZDA 4YLZA 1UN1A 2B7YA 1WD4A 3RS6A 1MS9A 3B69A 2P2KA 2ZGMA 4FPFA 1DQ2A 3VKLA 1CQ9A 1WBFA 5T55A 1AF9A 2FHRA 2P34A 2UWAA 2WT2A 1AX1A 1QDOA 2A70A 2D6LX 2JDZA 3A4UA 3HR9A 3LSDA 1W6MA 2A3YA 3R05A 5T5OA 5JOYA 2ZHLA 1IS4A 1UZYA 4UW6A 3RRDA 1JUIA 1W0OA 4FVVA 1GNHA 5GALA 1BXHA 1QNWA 3ZSMA 4XXPA 1WLCA 2D6PA 1QU0A 2A6WA 1W6OA 1DLLA 2CL2A 1DYKA 1SLBA 3RMYA 1CESA 2JE7A 2NN8A 2GNDA 1HKDA 2ZGSA 1IS6A 4L8QA 3ZXLA 1JXNA 4NO4A 1DQ0A 1W6NA 3VKFC 4R9DA 1QF3A 3ILNA 3ZYRA 2GNMA 3AZZA 1LU2A 1ULGA 3NV2A 3MW4A 1V6MA 1BQPA 3AZYA 5GJ6A 1DHKB 2GNBA 1Z0HA 1LCLA 4Y22B 4FPGA 1G9FA 1GYKA 4Y20A 2UWBA 3SITA 1UZZA 1WW6A 1W6QB 1WLDA 4FQ4A 4UW3A 3AXEA 2DUPA 3AP4A 3TAYA 1IS3A 1FNYA 2W68A 4FPCA 1OQ1A 2Q5TA 2XB6C 3ILFA 2WT1A 4Q27A 3WG3A 5CAZA 2E7QA 5FRAA 3VKNA 3BIWE 2LTNA 2WQZC 1SACA 4YW1A 4Y1UA 3H0OA 3WDTA 4Q26A 5DXDA 4RA0A 4XMIA 1ZA4A 1G9AA 1CR7A 3N36A 4WVWA 1LENA 2D6MA 5T5JA 4M3CB 4K20A 1SBDA 2XG3A 3D5OA 3UL2A 4P14A 2ZGTA 5GZGA 3INAA 4NOTA 1WW7A 2PHWA 1CPNA 1F5FA 4DS0A 1UKGA 3WDXA 3ZXKA 1EPWA 2V73A 1I3HA 4KBBA 2LALA 2UU8A 1YI7A 3USUB 2A5ZA 2ARBA 4TYSA 5DZFA 3IKWA 2NMOA 3WDVA 2VU9A 3ZYPA 4YG3A 1IOAA 2WT0A 4I30A 1DQ5A 1DZQA 3ZXJA 4CZSA 1QNYA 5L73A 4XBQA 1CN1A 4AVSA 3OYWB 2JE9A 4Y26A 4YW3A 1MZ5A 1YYNA 4ATEA 3WZ1A 5GLTA 1LULA 2V5YA 4YM2A 1VAMA 1KDKA 1MS4A 2ZHMA 3NWKA 4XMAA 1YRZA 2D6OX 4DQAA 3WHUA 5DZGA 3AYCA 4ISRA 1LESA 5DG1A 4AWDA 1GLHA 4YZ1A 3ATGA 3UJOA 1DQ1A 1SLCA 3ZXEA 4FP3A 1AVBA 2ZZJA 1UAIA 2DWRA 1V6NA 2P3KA 2VW1A 1SLLA 2EALA 2GDFA 5EWSA 4BMEA 3FUOA 3WUCA 4FQZA 1G9CA 2ARXA 5IUQA 3A0KA 4UW5A 3AP9A 5CA6A 4FOVA 2PHRA 2HYKA 2ZACA 2ZGPA 4H55A 2OUJA 1W0PA 3VV1A 4HL0A 1GZWB 4K1ZA 3ZSKA 1MZ6A 4DFSA 4BLIA 3OJBA 4XZPA 2R0FA 1GSLA 2R16A 3PVOA 4K1YA 2DVAA 3IM0A 2PHUA 1LEDA 4FPOB 2E51A 5LK5A 5SV8A 4DRRA 1LOBA 4MYEA 2UWCA 1N3QA 1MS3A 2NZ9A 3I4IA 4P9WA 2A6XA 1KITA 2GALA 3O5SA 4WZFA 2D3RA 4SLIA 2ZGRA 4XHBA 1FX5A 1V6JA 4YFZA 1LOAA 3SH4A 4AGRA 4UW4A 2P37A 2YMZA 1Y7BA 2ZGUA 3O0VA 4YZ3A 5KXBA 1Z78A 2YXSA 4BQ1A 1MACA 2NYYA 2OW4A 4Y1ZA 3APBA 2ZHKA 3O0WA 4M01A 2ZHNA 3N7MA 1LHOA 1S0EA 5GLZA 1DQ4A 2OVUA 1LOGA 3HN1A 4XJUA 3M1HA 1LJ7A 3WHTA 1GKBA 4RL7A 2YY1A 4YGCA 2DTYA 5EYYA 3PJQA 2DU1A 1N47A 1XQNA 5IK7A 1QOOA 1W6NB 3N7LA 4FOWA 5IT6A 5GLVA 4P9YA 3WOGA 1SCSA 4Y22A 4Q1PA 1V6OA 1WLWA 1Q8VA 1IKQA 1SLTA 3NV4A 1URXA 1ULCA 4XYXA 1S0CA 1PZ7A 2A6YA 4Y20B 2GN7A 2WSUA 3N7JA 4PBPA 1Q56A 2ZGLA 1NXD1 1UL9A 3ZVXA 1QDCA 1IS5A 3ZXFA 2EF6A 3AXDA 3OY8A 4R9BA 1QOTA 4PF5A 4XDQA 1MVQA 4LBNA 3UJQA 2ES3A 3GALA 2D6NA 1TEIA 2JKBA 2GMMA 2ZBJA 2AENA 3SNMA 2A6VA 1AX0A 2EXJA 4BM8A 3LCPA 4LBJA 3KQRA 1I1EA 3WCRA 2ERFA 4YGBA 2VW0A 1RITA 2WNEA 4ITCA 3SH5A 4XBLA 4Y1XA 2P3JA 3D6EA 3WLUA 3MPPG 1KJRA 1LECA 5F5QA 1YIFA 2ZAAA 4GWMA 1S0FA 2GMPA 2A71A 3QLQA 3PVEA 3SISA 4LBMA 4U2AA 5GZEA 2NM1A 1YXWA 4XJWA 4FPKA 1YO8A 3PVNA 3R4SA 4FPJA 5JVVA 4P9XA 1H9PA 4Q8KA 1JYIA 4YM3A 2VW2A 2AH2A 2Z42A 4YGDA 2GNTA 2DU0A 3AZVA 3OYWA 4YW5A 4GALA 3W59A 2ZGKA 3SLIA 4YZ5A 4AVTA 1FAYA 1U0AA 4XXAA 1GICA 1LHNA 5T5LA 2PELA 4LBKA 5JDBA 2A3WA 1APNA 3V0BA 4Q1RA 5H9PA 1V6IA 4M3CA 3VKOA 1LHVA 1RINA 1FNZA 1UPSA 3AJZA 3MW2A 1LTEA 3WV6A 4PBOA 1S0BA 4XE9A 3U4XA 2NMNA 1G8WA 1HQLA 1LEMA 5E8AA 1MS5A 3M3CA 5T50A 1PZ8A 1LODA 2ZKNA 2GN3A 3WUDA 4AGGA 1AJOA 5JOWA 5IK5A 4XBNA 5CBLA 2E53A 1GANA 4M00A 3GNEA 4YFWA 4CRQA 3AX4A 1DGLA 2CWMA 1MR5A 4LBQB 5DUUA 2JECA 3NV1A 1GNZA 2W39A 2DYCA 4Z8BA 1JOJA 2D3SA 3PMEA 4XJZA 4D69A 2DTWA
chains in the Genus database with same CATH superfamily
1NLQA 2O8OA 4A44A 1GR3A 1MZFA 2ADDA 3E5XA 3GF6A 3I3EA 5L7OA 1VP6A 3CKHA 2HWE2 4IV1B 1LHWA 3P3NA 2R0HA 3VZOA 1JODA 2DCYA 2LROA 1WUVA 5FYZA 3LPFA 5D8AB 1YJKA 4UFKA 3NNGA 4AFMA 1POQA 4QXKA 4KQ7A 4QM8A 5J37A 1KJLA 1SBEA 2RR12 2GMEA 1AZDA 3VDAA 4QHOA 3RI8A 3ZFEC 1PK6B 5LY1A 1VBB3 4IUGA 3AP6A 3ZXGA 5C8CC 1G86A 1POV0 1UU6A 1J84A 2ID4A 2QQOA 3FC0A 2YV8A 4FPHA 3FMGA 3IDBB 3UNPA 1SBFA 3D0SA 4JDMA 1PK6C 5ERLA 4IETA 3DGTA 1SFPA 3S0MA 1O3TA 1RUH2 3OUIA 1GZWA 3VZLA 4XOGA 1DIWA 4YGEA 5A3TA 1QJX1 3BTAA 2BFUS 4LA2A 1H4GA 1D4M3 1MEC3 2B42B 4XEZA 5FP3A 2J7MA 4EWAA 2XJTA 4DUVA 5C5UA 3FUQA 2D43A 3SEPA 4D6SA 1OA2A 4QPGA 1CVNA 1W39A 1GNYA 1PIV3 4TTGA 1US3A 2A73B 1ENQA 5FJKA 1U5YA 3PUQA 1XNAA 3SH3A 3MLJA 3OGVA 3T08A 1LGBA 1XE7A 4ASMB 1MVEA 5H9SA 2WBKA 1BEV2 3CO2A 1E5HA 1HRI2 1C57A 3TYJA 5CKMA 4IV1A 1HLCA 1RUI3 5FZ3A 4CEYB 1UY0A 2BNOA 1MQTB 2ZEWA 4FFGA 3VBHB 3H1WA 2VOXA 1O59A 1D0HA 2VCMA 4CP9A 1JH5A 5F3CA 5A3PA 5HPOA 3ZKYA 2I2SA 5JOZA 2D3PA 3U11A 4K40A 4YZ4A 3KD4A 5LRRA 1F35A 5HI0A 2NP0A 4L97A 3FE5A 3VUOA 1GV9A 1RUJ1 1XYPA 4MGIE 5E88A 3J7MA 1D4M1 1MEC1 2ARCA 3HWJA 4XCAA 5DUWA 4XFFA 3GBFA 4PDWA 3C7OA 1ASJ1 3POBA 2ETEA 1VALA 1Y9MA 2DVDA 1VBE1 1CJPA 4META 4OHVA 2EIEA 4E2QA 2CGPA 2ZXQA 4G9SB 5FZ1A 2W47A 1H2KA 1PZ9A 2WYFA 2C26A 1VBE2 3NJZA 2GC0A 4O7XA 4BMBA 5A7WB 5F9TA 1ASJ2 2JEMA 2ZMLA 3HQUA 5DDJ1 5IYYA 3MEPA 4CCCA 4R9AA 3OEBA 2YPDA 4OFGA 1RUG2 1CAWB 1S1AA 4A41A 5C3OA 1JBCA 2RM22 2SLIA 1ODMA 3C8XA 2OZJA 4FPLA 1ULEA 2D98A 2JG9C 1S0GA 2Z79A 3FX3A 1MPXA 1RUJ3 4URAA 1MZEA 3JD73 5FOBB 2ORZA 5JPMB 2F4LA 1ENRA 2G9FA 1MS1A 1X82A 4JTOA 1XU1A 4FBFA 2FMDA 3T2QA 5FMCA 4O9EA 2E7TA 1LR5A 3FBMA 4PT6A 5J96B 5FWJA 1BEV1 4EZ4A 4H14A 1UX6A 4D0QA 5J48A 1VBC2 3J8F3 1KQRA 4C8DA 4DB5A 4FPYA 2XJSA 1OH3A 1VAVA 2EA7A 5BNPB 1WMXA 1H9WA 2HKXA 3PNAA 1Y4WA 4Y1YA 2VQ0A 2ET1A 2VJXA 1O4ZA 1RUD3 5CNAA 5FXVA 4KWLA 5T54A 1U5IA 3CJIB 3AP5A 3T2PA 1NZIA 2BDRA 1RTVA 3IZOA 4ISQA 1SLIA 3OUJA 3SC7X 4A6SA 4BOWA 4OI2A 4M4RA 4ARYA 4E2GA 2OUHA 3CF6E 4UF0A 4W8JA 3WG1A 4A3XA 4FAGA 2EIGA 3IDEA 1HV0A 5LASA 4EWDA 3IDCB 4XJAA 1JYCA 1W8TA 4QB2A 1UW8A 1W2TA 3MBWA 2PQQA 4COZA 1FV3A 4AI2A 3WQ0A 4E27A 3MGUA 3SCHA 4HOOA 5AC92 2FCUA 1WW5A 5DG2A 2R1BA 1LOCA 5GZDA 4Q5OA 1JZ3A 3VD4A 4RR3C 1HB4A 4QX7A 3IMNA 3WNPA 3OBRA 5BPXA 3AK0A 1WCDJ 2LW8A 1EPZA 5F3GA 5FYYA 2HWE1 3FBYA 3PTYA 3GBWA 2FCVA 3B01A 4XVHA 4MZUA 2GC2A 4PI2A 1GP5A 4NHKA 2QE3A 2R063 2HYXA 2OZ6A 4XUTA 4AHXA 2WZR3 3QH7A 1CZSA 4L2NA 1LKNA 4CCLA 3KGZA 3RYPA 1GZ9A 2ZGQA 4HVOA 1NCRC 3D4KA 2YC4A 4WV8A 5F8PA 3RG0A 2XQXA 3WF0A 2L9LA 2OIIA 5JZGA 4XW3A 3NV3A 2K2SA 1IPSA 4A3ZA 1H2NA 1ND3C 1UMIA 3PL0A 3AZWA 5JSPA 1JW6A 4COYA 1AL23 4E4SA 1H2MA 1J3PA 2QUOA 4JRAA 2WS93 5CU1A 1REFA 2C0ZA 2DVGA 2VMHA 2VL4A 4R9CA 4XF9A 4CP9B 3N9PA 4GXLA 4AGVA 4CEWB 2VZ1A 4TSVA 5FWEA 1FT9A 1S2KA 4LLOA 1YJLA 3WNMA 3MUZ1 1JYNA 3NQHA 1UOGA 4GAZA 5DUXA 2XJVA 3N3HA 3I2KA 1C8M2 1JHNA 2ILMA 3ZXDA 1EY2A 2H0VA 3V65A 3JUUA 1SFYA 4I0WB 4N7IA 4DZGA 2JICA 3AVRA 3ZM8A 3POSA 2XONA 4LORA 1ZBA2 4OCTA 1UWWA 4MUVA 3LSEA 3HJRA 4BPZA 2A1XA 5FXZA 2N7GA 3MW3A 4CDWC 3PUHA 3I2JA 4A4AA 2EXIA 1YQ2A 2WR9A 1JZ2A 1LHUA 2VVEA 4P5HA 1CAXA 4C1WA 5FZHA 1VRH2 1PMHX 1WD4A 2WO3A 4LIVA 3RS6A 1ZBE3 3U1XA 3ZO0B 1G6NA 2P2KA 2ZGMA 4MSVA 2CGNA 5LCWL 1WBFA 4LOTA 4HVRA 4ZXEA 1PIV1 1RHI2 4XFGA 2GH8A 2JDZA 3RZHA 1JU4A 3A4UA 5GKAC 2CAVA 1ZRCA 1Y9QA 2A3YA 3HNMA 3GZEA 1IS4A 1UZYA 3CDZB 1AR62 3BU7A 5DN2A 1GFF2 1VPHA 3KMHA 1AR63 3KCCA 4IEZA 4XXPA 3OD0A 3W9AA 5I8TA 5FZ4A 1XC6A 3ZN6B 2A6WA 1HRI3 1W6OA 5JR7B 3UKNA 5FYVA 1CESA 3HT1A 5FZGA 1NAEA 1HKDA 1IS6A 1OLQA 2G9GA 4QPWA 3HIFA 2JXAA 3B5LB 3KVBA 4TN7A 4R9DA 1RUNA 2JB8A 2VPVA 3IB3A 1LU2A 3MW4A 4XFAA 5SV5A 1A6CA 1DHKB 5CADA 2GNBA 1ZBA1 2Y6KA 1G9FA 2B9UA 1CWPA 1WW6A 1ZX5A 4QQOA 1WLDA 4UW3A 3TAYA 1FNYA 2RR13 4LO7A 1S2EA 4ES8A 1CAXB 2R32A 2P1BA 2RMU2 4QKNA 4UXAA 1GQGA 3ILFA 3K51A 1AR72 4YW1A 5FLIA 5FZ7A 1OA3A 4ZONA 3HPNA 4XMIA 1G9AA 4WVMA 3N36A 4R8HA 4MXWA 4K20A 4Q0VA 4EN0A 4Z82A 4IEVA 2IXIA 4P14A 3MO4A 4UBGA 3WQBA 3HNYM 3T2OA 1OF4A 4PIZA 2HWC3 4AFCA 4DS0A 1UKGA 1H1IA 1VMFA 4HBNA 4HKWA 4OULA 5IATA 5I0DA 1C3HA 2GH2A 3AL5A 1EV11 2PFWA 1YI7A 3USUB 3H42B 3M3IA 4TYSA 3VBRB 4DIQA 2NMOA 2VGDA 3P6BA 4RD7A 5FYMA 2VU9A 1OI6A 1BVVA 5JZGB 2MNGA 2WNVA 4HONA 4LKSA 2QTWB 4J1XA 4NVPA 1DZQA 3AM2A 4CDQA 1QJY3 5IVBA 1K5MA 1ZRFA 2MEV1 1CN1A 3ES4A 3MV01 2WLPA 5FYCA 4ATEA 4YM2A 4B8EA 1VAMA 1MS4A 2ZHMA 3FHAA 2O14A 3IWZA 4LO4B 3TEYA 2Q8OA 1W3VA 5DZGA 2WAOA 1NE4A 3U0ZA 5DG1A 2LRPA 5AC91 1SMVA 2WWUA 2XVGA 3T30A 5F6KA 3ZXEA 3BUCA 1WLTA 2ZZJA 1NA1A 3LD8A 1Z7S2 3GZTB 2DWRA 1V6NA 2GZWA 2P3KA 2VW1A 2EALA 4BK4A 3VBFC 5CIRA 1GOHA 3FUOA 2EAAA 5CFDC 1JZ7A 1PX4A 1YQ5A 4FQZA 2J1EA 3NNJA 1RUD1 3A0KA 5F2WA 3T3YA 5CA6A 4FOVA 2PHRA 1SDDB 2HYKA 3T0BA 1QJFA 4H55A 5BNOA 1L7RA 3RPQA 1RUF1 1DGWA 4Q0UA 1MZ6A 1QWRA 2MHFA 1OT5A 4XZPA 2R16A 3C7GA 3DXUA 1W9WA 3RJ2X 2DVAA 5BNQA 2O1QA 5FYHA 4QPGC 2RM23 1O3SA 3K2OA 2B39A 3VBRA 5SV8A 1DGWX 4DRRA 1HRV1 2RS11 4IEQA 2UWCA 3LEGA 3EYPA 4MYEA 4ZZ5A 1ZRDA 3I4IA 2QKDA 3FN9A 1NE6A 2HWD1 2RVAA 1VMJA 4CEYC 5CFDA 2FZ1A 3RFRA 2VOTA 3EMRA 2D3RA 2ZGRA 3H8UA 4ONUA 4YFZA 3SH4A 1UOFA 4UW4A 3KHBA 1CIYA 3JXSA 1UXXX 3O0VA 4YZ3A 4AVCA 2VQTA 4HKOA 3O1MA 1VAKA 1MACA 2KD7A 4KU8A 3S5AA 2MEV3 2NYYA 1RJ8A 3APBA 1QJY2 4ZY9A 2RM21 1S0EA 2I45A 3FHIB 1RUG1 3HN1A 3MPBA 4GZ9A 4AFBA 4RL7A 2DTYA 2Y34A 3DEMA 1O6UA 3FZ3A 4CXWA 5CG8A 4P9YA 4QAWA 2XBO2 4K3UA 4OI0A 1VE0A 4L92A 1C8M3 5BNOB 2BBAA 4NPLA 1RYYA 3NV4A 3NNFA 2VNVA 1S0CA 2A6YA 4NIHA 1D4M2 1GUIA 1MEC2 4WM8A 3RYKA 2QQJA 1LB2A 5FPUA 1Q56A 4Q4V1 4QHZA 4HPKB 1NXD1 4OQ9A 4KWUA 3ZVXA 1YC61 1GWKA 4R9BA 4ZPIA 4LBNA 3RZGA 3B9IA 2BWAA 3BKZA 4IERA 1TEIA 1WMEA 3WNKA 3MZHA 5CFDB 2A6VA 1AX0A 4IESA 4MGTA 1I1EA 1WMDA 3CZJA 4GH4C 4HT1T 1X9TA 2ERFA 3T4HB 4YGBA 2VW0A 1UO9A 2WNEA 4ITCA 5FZIA 1W04A 1FI2A 3NAPC 4Y1XA 4Q4W2 1BMV1 3D6EA 1HRI1 4UI9L 1KJRA 1HW5A 4Q4X2 2VVDA 1SDWA 2IXCA 4PQQA 4IE0A 4KG8A 5K7PA 1UIJA 3PVEA 1OUSA 3LWCA 4LBMA 5GZEA 1YXWA 4N7UA 3ORJA 1OUXA 1RVF2 4FPKA 2BNNA 5JVVA 3U78A 4P9XA 4Q8KA 2QQUA 4OVEA 1DYOA 3NJXA 4BB3A 4YGDA 1IZ3A 3AZVA 3W59A 1UY4A 4YW5A 4PLMA 2ZGKA 4N53A 5A3UA 1RGSA 4OHWA 4AVTA 1TMF1 4N9HA 1RUH1 2FDFA 4XXAA 1GICA 3RGBA 1UNBA 5JXJA 4JX0A 1APNA 2VNRA 4Q1RA 1VBE3 1V6IA 1FPN3 2RV9A 2V09A 3DPRA 4M3CA 4NRPA 1ZZ7A 1XNBA 4BK5A 4BQYA 2AEYA 1LTEA 2RS32 4PBOA 4AVSA 1RHI3 1PZ8A 1LODA 4FI9A 4NIAA 3WSOA 2RR11 1YHFA 2WZR2 5FKCA 3O1PA 5IK5A 3VBSC 4XBNA 5CBLA 4L0PA 4I0AA 3JB8A 2VZPA 3PUAA 3PUSA 3KCXA 5FQ0A 4JGZB 1DDLA 2PXJA 5FJHA 3ZYGA 3LOBA 2JECA 4YW7A 2W39A 2DYCA 2K46A 4O61A 4Z8BA 2BGCA 5E16A 2J42A 5KHGA 1JS9A 5FY7A 3OTFA 3PJYA 5JOXA 4UF0B 3TN92 1PO12 4LKEA 1PGL2 3HOBA 2FMYA 1Y43B 3CQOA 3IIIA 1R091 1QGLA 2Y64A 2HWC2 3H1MA 2G19A 3ZFGB 5KC5A 4Y3OA 3O1OA 5IK4A 1AR81 4QWNA 3N9MA 3WDUA 4I2OA 4DRVA 3BODA 3KV9A 4N43B 5FPZA 1S0DA 2RS52 2WFF2 5JR2A 2HWF2 3CU7A 3NJYA 4XPVA 4CCOA 3O1UA 3ES1A 1BHGA 1G9BA 2KM2A 5FYUA 4I01A 3PTRB 5FXXA 3AJYA 3Q8EA 1CONA 1WCSA 3NKTA 2VMCA 5GZCA 4W6XA 3I3BA 3M2MA 3THCA 3H8XA 1HXS3 2ZAHA 3MDPA 4R4XA 4MGKE 2DURA 2CY6A 1IHMA 4CP1A 5BYNA 3JU9A 1PO21 1QXJA 4XFBA 4IDZA 1LU1A 4WZCA 1XB9A 2G9ZA 2Y6LA 2D40A 3VHPA 5BNNA 5JLVA 5A1LA 4IL7A 1EAH2 1RXGA 2JDUA 2R061 4XF4A 4YZ2A 2X5IB 2PAMA 2BP6A 1RUE1 3H3ZA 5HV0A 4AR2A 1C1LA 4JGZA 4AW7A 1YI9A 1PVC2 2UY9A 3I2GA 4N9IA 3I49A 1SFNA 4RQPA 2EVXA 2W1WA 2ZEYA 4YWAA 4AEDB 3LDRA 3CJIC 4WM7A 5JSRA 4CDUC 2R042 4BIFA 4GJYA 4BXSV 5A80A 4MOAA 3WG2A 2OXBA 3QBQA 2YHJA 2QBXA 5EIYB 4AYUA 3B00A 1BYHA 5F32A 2CTVA 2UURA 3CHXA 2HWB2 2YGLA 3NJVA 4JC1A 4QX0A 3UK9A 2VOKA 1UIKA 2AACA 4E4DX 4F8AA 1XPWA 4Y24A 1S0JA 2CV6A 5F5AA 1QJU3 3TEXA 3WCSA 4M0NA 4PLOA 4AHYA 1QQP2 2AYHA 1K12A 3LDKA 4DEVA 1FV2A 2LM3A 4S2HA 3JQWA 4NPRA 1DBNA 2BPA2 2ZMKA 4OQ8A 1O4YA 1XNTA 1FMD3 2YROA 4DOUA 2J1UA 3NO8A 2FDGA 3OOXA 5A3OA 4GMP0 4CPBA 2JDNA 1GWMA 3O0XA 2HWF3 1J3QA 2VZRA 4XF3A 1AX2A 4CEWC 3P3PA 5EYXA 3VBSB 3HMYA 4P02B 1DU3D 3C7FA 3ENRA 5LY2A 4GQ7A 4J25A 3HD8B 2IXKA 2Q1ZB 5J7MA 2WDBA 1R081 1VB2A 2VNGA 4FTBA 1QKQA 1Q8OA 3GGLA 1ZZBA 3ZSLA 4QKDA 4QMAA 3I3MA 4B1MA 4KU7A 1A78A 2DVBA 3V0AA 1OFSA 3RMXA 1E5SA 3TWIA 4LK6A 4CDUA 4WM7C 3ZSEA 1W6OB 5G04L 2WJSA 4XJ9A 5LA1A 2BTVC 3LAGA 3IPVA 5FK8A 5HCBA 3QOPA 4W65A 2DCZA 5T5PA 5KXEA 2Q30A 2A3XA 4XABA 3KF5A 2XLFA 5FZCA 3J26N 1FPN1 2PA7A 1M4WA 3BOWA 3DUIA 5ABJB 4LBQA 2QJVA 1W8OA 5DAXA 3AKPA 3ILRA 5M0TA 1D4VB 4CDXB 1VBB2 4FP2A 1OSGA 4RFT0 1EYBA 2WSVA 2YBKA 3LOIA 5JUVA 4AVAA 1GBGA 1V70A 2EXHA 4S2GA 4Y33A 4YW4A 2P17A 1JU3A 5BXXA 2CWSA 4HG6B 4FAHA 1PNFA 1AR93 4TLGA 4AEJA 2IFWA 1C4RA 3WQ7A 3FL7A 1KS5A 1AYM2 1YQCA 3IBMA 3OPZA 4FOYA 5F5CA 4AVBA 5A70A 4NMIA 1QHDA 3B9CA 2C4XA 4P9IA 3VD3A 2FCTA 3GXUA 1RMU1 5CKQA 4URTA 1HJGA 1EUUA 1Q8PA 4B4RA 4YG6A 5DUVA 2W95A 2IXLA 4OHZA 1NCRA 3DYMA 4LHNA 2ZJCA 2IVIB 5KHIA 2YZ4A 1V6KA 3B94A 3H1YA 4Q4W3 2WWJA 3WD5A 3IPVB 3KQ4B 3MICA 1ZA7A 2OA2A 2Y33A 4COWA 1ONAA 4QPGB 1UYYA 1V00A 5L36A 3OBAA 3WP6A 1E57A 1WW4A 4N43A 4LE4A 2VZ3A 4Q29A 1LOFC 3ZR6A 3EXUA 1VBA2 1CAVB 3AL6A 3H7YA 3M4FA 4TXWA 1FATA 3RVHA 5HCAA 4GMP1 4LBLA 1Q3EA 3IMMA 3MIBA 1X50A 1YFYA 2DVFA 2EXKA 1KFUL 4X6QB 1PO13 4JGYA 3L2YA 1REDA 5DAWA 4QT6A 3QH6A 5FYBA 3RZJA 5FREA 3TN93 1JOBA 2RDRA 2YPJA 3EO6A 3ETPA 3VD7A 5K0UB 2G1MA 4I3PA 3O1SA 1O3RA 4BH9A 5HXVA 1SG3A 2V5DA 5ABJC 4P00B 4OHYA 2KXLA 4PQ9A 3WP5A 3THTA 3VBHC 4CCMA 4XDPA 1OF3A 2WUHA 4LK7A 4RQPB 1OD3A 4PLNA 3ZFEA 1XOYA 1OLRA 2WYSA 1PVC1 4INDA 4GIQA 3W58A 1PHMA 3THPA 5FY4A 1RUE2 2VUAA 1N1VA 2E6VA 2VXJA 2WNVC 4Z2WA 1EAH1 2PHTA 3VBFB 1ENSA 5C6CA 3PU3A 2DCKA 4IV3B 2RDQA 1U12A 3ZYIB 3BGAA 2B7YA 4HFSA 4BQ5A 1NKGA 1MS9A 3LEMA 3CJXA 3VKLA 1CQ9A 4JRLA 5IJRA 5T55A 4ASKA 4BZ4A 3KLSA 2P34A 4DO0A 4DY5A 2JIJA 1RMU2 1HJFA 1QDOA 3LSDA 1LNSA 3R05A 3AKSA 4QPIA 2TUNA 4QXHA 4GWIA 3RRDA 1UYZA 1UZ0A 1AL0G 5FZKA 5FFOC 3JBG2 1NCQB 3VBUA 2WINB 5GALA 3PLQA 1QNWA 5I93A 1WWYA 1WLCA 1ZVFA 2FBEA 3PUIA 3F95A 1UF2C 3GHMA 1DLLA 1JZ5A 4GH4A 4IGQA 2JE7A 2NN8A 2GNDA 4IEXA 1SPPB 2ZGSA 4AEMA 4L8QA 1KFXL 1B35C 1R092 1VBB1 4NO4A 5FZOB 3VBUC 1W6NA 4AE2A 4KG0A 3ZYRA 4AQSA 4DY3A 5BNPA 3RZLA 4IE4A 4QPIC 2B8MA 1PNGA 1DZTA 2JD9A 4UFLA 5GJ6A 2ZPXA 4CPBD 1EAH3 1LCLA 4Y22B 2R6QA 3PURA 1GYKA 2XJUA 3PDQA 3LPGA 1ZBE2 2UWBA 2VO5A 2YB7A 3SITA 4RS5A 2BW8A 2WL1A 4QXCA 5A3WA 2WNOA 2DUPA 5KR7A 5KWRA 1IS3A 5EFUA 5FBJA 3MIHA 1OQ1A 3LKJA 3RYRA 3SKJE 2BYVE 2WT1A 3SKVA 3OGSA 3Q8AA 4GWJA 1XJAA 1H8TB 3VKNA 4BJ0A 5CAZA 2WQZC 1DP0A 1W8WA 3EHKA 3POEA 3OG2A 4Y1UA 2E31A 1DG6A 3HQXA 1HB3A 1NLRA 3PVBB 4QD2A 1R082 2XLGA 5C4WC 4CUBA 1R1A3 1W28A 5GZGA 2YG0A 4NOTA 2WN2A 5IVCA 3MI8A 3WDXA 3ZXKA 4AAPA 2V73A 1I3HA 4QKFA 5C5TA 2F4PA 2A5ZA 3WXPA 3HEIA 3K4DA 2QQLA 5FCCA 1CZTA 4N43C 5B4NA 2BOJA 3BI3A 2W91A 2QNKA 2W87A 1C28A 1RVF1 3GM8A 2J1AA 1IOAA 4I30A 4Q4X3 4YVSC 2HEYF 4CDWA 4NWWA 1QNYA 5FTTC 2UYBA 3ZN4A 2HBUA 2RMU3 5DPNA 1TME2 4Q4X1 1YYNA 1PO23 3B7MA 3NL1A 5FKBA 3HAGA 1TME3 4Q4W1 4TLFA 5FZAA 1O4TA 4LO5B 2AZ5A 2GP3A 3A7QA 4CDQC 3K3NA 4XUPA 5A7PA 5I91A 1UY3A 2KA3A 4W50A 3I7DA 5FZDA 4QQHA 5FP9A 4FP3A 2GSYA 3VGIA 2VQUA 1COV2 3Q8FA 1UAIA 5EWSA 2XVKA 4BMEA 4XUNA 5FIXA 5CG9A 3HBZA 3ROUA 3K77A 1ND2B 3WT3A 1G9CA 1UY2A 4W6WA 5IUQA 4UW5A 2BZDA 2IWGB 4QX1A 2OUJA 1W9TA 3ECQA 5BNPC 4HL0A 1GZWB 4K1ZA 4QPYA 3C7HA 3S30A 4S2FA 5F3IA 1YQ6A 2OYZA 2P4EA 4BISA 4BLIA 2DF7A 2R0FA 4CYDA 5FY9A 4ZU7A 2XH6A 4K1YA 3KT4A 4MGSA 1BEV3 4YVSB 3TRSB 2TBVA 1LEDA 2K9ZA 4FPOB 3ZFGA 5LK5A 5C7GA 5JPNB 2RE9A 3MF9A 1EUTA 2OKXA 3WNOA 5IVVA 4P9WA 4B7KA 5LEKA 1QJY1 4D8MA 1KITA 3ACGA 5DMYA 5A3MA 3P5BA 4BU2A 4YPJA 5EJZB 4SLIA 1L3JA 1FX5A 2O8QA 1X7NA 2J22A 2HEWF 5A1FA 2HWF1 1FMD2 4AGRA 3ZX7A 4LT5A 5JSOA 2WFF1 2YMZA 2RS51 3MFAA 4KGQA 2X8KA 1Z78A 4C90A 1MQTA 4EN6B 1AR82 4IV3C 4GH4B 4IGPA 4IE6A 1CZVA 2IXHA 1WCKA 5FZ9A 2X5IC 3N7MA 2F17A 5D1IA 1LHOA 5FPLA 5GLZA 1LOGA 1HIXA 4QHBA 1LJ7A 1PGL1 2VBBA 3TN91 4XFCA 5EYYA 3TBDA 4NRMA 3MYXA 1BLZA 1TE1B 4QU2A 4BQ4A 4IV3A 5GLVA 1SCSA 4MGZE 1YIPA 3JB4C 3KT1A 1RUF2 1Q8VA 1UY1A 3WHTA 1ULCA 5DQ0A 1PZ7A 4LHKA 2Q1MA 2Y6JA 4Y20B 5I8SA 3KS7A 4PBPA 1Q5OA 3ACIA 4YARA 3Q8CA 2ZGLA 1VBD2 3ZOIA 3ZXFA 2VMGA 2WZR1 2EF6A 1NCQA 3DCQA 4XFHA 3OY8A 3VBUB 1QOTA 3NRUA 1MVQA 2X09A 4QX5A 2RJ2A 3I2OA 2ES3A 1QJEA 2D6NA 2PTMA 4C0BA 2GMMA 1OKOA 5CKNA 3WEZA 3EBRA 4QU1A 2P3JA 5FZOA 4ORFA 4S2DA 1H6XA 4Q0PA 4RHV3 5A7NA 3WY6A 2WC2A 2VTXJ 1XRUA 3DXTA 1UZVA 2JWPA 2Y8KA 4JGZC 3VBOA 1IQDC 3ZLIA 4PDWB 2NM1A 2XBO3 5EJ1B 4IGOA 1AUYA 3DECA 3PVNA 1H8VA 1SEFA 2ZZQA 3R4SA 4FPJA 4IW3A 4KWJA 3IIAA 4RS5B 5KC6A 4CSWA 4HN0A 4YW6A 2Z42A 5EV7A 2DU0A 5LA2A 5A6YA 1WZXA 4GALA 4HK9A 4LKFA 5C3SA 2DCTA 1PGW2 3KV4A 3SLIA 1FAYA 3D0JA 1U0AA 5IW0A 4Y5TA 2WA3A 3QACA 2PELA 4LBKA 1I5ZA 4MXVA 2DFCA 3V0BA 1X8EA 5H9PA 1FNZA 3AJZA 3WV6A 4XE9A 1AR73 2NMNA 5E8AA 5T50A 2XOMA 3URFA 3M3CA 5B4XA 1KGYA 2GN3A 1AR71 4AGGA 1AJOA 4JVAA 4H2AA 5JOWA 4MO3M 2RMU1 5FZ6A 1XYNA 4A2UA 4H7MA 1GP4A 3OD4A 3GNEA 4D7SA 1QJX3 4CDXC 4CRQA 1NXMA 3AX4A 1DGLA 2BVBA 4NAMA 5DUUA 3ITQA 4HETA 1WGPA 4OI1A 2JDYA 4UBHA 2QDNA 5E1RA 4AOCA 4D69A 3AKQA 3CNAA 3VZNA 4JHTA 5A1AA 2WS92 3B02A 4ATFA 2CDPA 4GWNA 3W5NA 4QDRA 2H6BA 2ZA9A 1NY71 5J1XA 3ZDSA 3V56A 1Y9GA 3NNLA 5FZFA 2YDEA 3C2UA 4LNVA 4NHXA 4LLFA 5JZGC 2W1QA 1R1ZA 1WCUA 2ZX3A 4OZXA 5J09A 1NOVA 3RZKA 1GZCA 1J3RA 4NN0A 1AR61 1YFUA 4UFMA 2ZMNA 4K8RB 1ZM1A 2JE8A 3S5QA 1ND2A 1OOPC 3N35A 4YW2A 3SQOA 5FY5A 4EJRA 3FLPA 5CFCA 5EJ3A 3BTXA 2HWD2 2FDHA 1RHI1 2QCSB 1A3KA 1BZWA 1W6PB 1F8VA 1V9U1 4JAAA 4CEWA 4KI5M 2MPFA 4LEJA 1MS0A 1DYPA 2IFRA 4BA6A 1BJQA 1W8FA 2C9AA 3VDDA 3CMGA 2BOIA 4B29A 3MF6A 5GM0A 3LQCA 4AZZA 4CUGA 1AJKA 5E89A 3N7KA 3T09A 3U10A 2DUOA 2JG8B 4M3CF 5FDBA 2BBVA 4XTMA 3T1LA 2JDMA 1F4HA 5FP4A 1CX1A 5FLHA 1EV13 4Q4Y2 2XWBB 1ZRIA 1ZZ9A 3QCWA 4O9GA 2TEPA 4Q4V3 2J1VA 1JZ4A 1Z7S1 3ACHA 3WDWA 2NPIA 2BUKA 1A8MA 2W3JA 1FYUA 2VXRA 3KV6A 1Q43A 4HPKA 2PMWB 4AI1A 2IC1A 4XILA 1TG7A 3IDAA 1D0GA 3IN9A 4XAEA 3WVJA 4BWOA 3NAPA 4V2WA 3UKVA 5FO7B 2WABA 1H0BA 2ZX1A 3M3QA 2W1SA 4OMCA 1D7PM 3AYDA 2BVVA 5DABA 5HXMA 3O1VA 3WP4A 1W2NA 3WQ1A 1NYWA 3H3UA 4LTAA 5LBBA 1V9U3 4BCUA 4CCDA 3UETA 4RQPC 1XXNA 5A32B 1VR3A 1W8UA 2MEV2 2GU9A 4JKKA 1QQP3 3WNLA 4KNCA 1QJU2 3AP7A 4KMQA 2PHLA 3BTZA 5DZEA 5A7SA 4MGYE 1H8TC 3WDYA 1AXYA 1T2XA 2ZABA 2BEOA 3POFA 3ZMOA 5K8SA 1XU2A 1B09A 2W1UA 3E97A 5FUPA 1QJU1 3I2HA 4XTPA 3RZMA 5BY5A 3KV5A 4FTEA 4QX3A 5FV3A 4YM1A 3H7JA 4PDWC 1GWLA 1PMIA 3WW2A 4COVA 4F3JA 2R49A 5C71A 5LBFA 2PLV3 2V4VA 4LJHA 1R1A2 2VTXA 2VR4A 3SMHA 2V4AA 2JX9A 2LS6A 1W6QA 3KF3A 3VL8A 2HEVF 2J1RA 4AXOA 4EN7B 3HVDA 1W6MB 1L7QA 1BVP1 2WO7A 4UYBA 5JMCA 2QQVA 1JN2P 4P5YA 4RGGA 2KR2A 4Q2FA 4F83A 4AAXA 5IK8A 3MFCA 5BUVA 1QXRA 3D3AA 3LGRA 4BQWA 1HQWA 1QOSA 4Q4Y1 2BQPA 2W94A 1BKZA 5FBZA 4LKDA 4DUXA 4DPNA 4QXBA 2QVSB 3UYJA 3B3QE 2XJPA 3GZUC 3KGLA 1TQ5A 4NHMA 4KWKA 4XF0A 5ANNA 2C5DA 4Z92B 1LOFA 5F7UA 1KXGA 1XSRA 4YG0A 1JUHA 1W90A 3I54A 5CYYA 5A7OA 1HN1A 2ZX0A 3M3EA 2YUEA 5APAA 2YC2A 2JJ6A 2B5HA 2RHPA 5IVJA 2HJIA 4UFHA 3I8TA 3BVCA 3DF0A 3OGGA 4RHV1 5FPAA 4XCBA 5K9YA 3Q9OA 4HMZA 1XNDA 1NQJA 3LA3A 2A6ZA 3ACLA 5KXCA 3O12A 5D8AA 5TSWA 2WNUC 2Y0OA 2ZX4A 1V9U2 2W08A 4JKLA 1S0IA 3NKGA 4CDQB 4CTEA 1C5IA 2IXJA 3FLTA 3E5UA 4JCKA 4P9JA 1N3PA 2HH9A 4IEUA 1PK6A 3N9QA 1ND3B 2QQMA 2A75A 2SBAA 3C7EA 4LMFA 4EZHA 4L9BA 4D6RA 1GP6A 1PIV2 1YFWA 3FFZA 4NRQA 3DKQA 2RJKA 1P8JA 1ZZ8A 2WN3A 4BHPA 3HN3A 4XQ4A 1DFQA 5C8WA 4FXKB 5FYTA 3VHRA 1SLAA 3T0AA 4E8DA 2Z2SB 5EQUA 4CUCA 4U36A 5EXOA 3ALQA 4CA9A 5DDJ2 3P1IA 5L7OC 3ZPYA 1LAJA 1WA4A 4QGNA 5AVAA 4LBQD 3USUA 4XJZA 5L19A 3OBTA 2WQ8A 3Q8BA 4DINB 2BFUL 4P9LA 2FZ2A 4RSUA 5HBAA 3UGHA 1WA6X 3R4UA 3POJA 4KBZA 1AL21 3VDCA 3PIGA 5FO8B 5H9RA 1C8M1 4ZU5A 1BK0A 1S55A 5T52A 1ZNPA 1RUJ2 4ET7A 2PHXA 4IQPA 1HB1A 4AVVA 2XVLA 1W8HA 3RQ0A 3AYEA 3WNXA 5DAQA 5CFCB 3ZN5A 4FSJA 5IFPA 2XKOA 2YFZA 5EZWA 5FYSA 4GB33 4A42A 4AF9A 1W6PA 3OUHA 3ZYBA 3RZZA 1K3IA 1B35A 2JB4A 3BOPA 1O3QA 1UKRA 4RN5A 3UGFA 5CISA 5JIUA 5BNNB 2IZWA 2Q0AA 1GU3A 1OOPB 4ES9A 1OBNA 2E32A 1OXCA 3ZYFA 2EAKA 2ARAA 1ZRRA 1LGCA 2J1TA 4LE3A 2W46A 3FHQA 3M70A 4XIOA 1MS8A 4XUOA 4K7JA 1CPMA 1Q8QA 3O7OA 2DUQA 5FPVA 3ZYHA 2W5FA 3O1RA 3AYAA 4AFDA 2OS2A 5JIAA 5EP9A 3JQXA 1ZBA3 4Y5SA 3KZ4C 2CYFA 2PHFA 4UFJA 2R073 1UMZA 3ASIA 3K4AA 4YLZA 5A3NA 3OBZA 2RG4A 5F1RA 5LRSA 3B69A 1AYN1 4FPFA 3T0DA 2IUWA 4YSFA 2D5HA 1AF9A 2FHRA 3E6DA 4IE5A 2BNMA 4HXCA 1W6MA 4L11A 3NVCA 2ZHLA 2PAEA 4UW6A 1J58A 2XHKA 4CCKA 5JOYA 5B2GB 4XDOA 1JUIA 1W0OA 4FVVA 4MADA 2CSGA 1GNHA 3SXWA 4C91A 4R4ZA 1QU0A 4PJYA 1AYN2 1SQ4A 2CL2A 1JTZX 2D5FA 5FY8A 3RMYA 1W05A 5C9AB 2C24A 4JQRA 4AQ6A 1O5LA 1JXNA 3GCXA 1QF3A 3ILNA 4HLTA 3CJIA 3AZZA 4LHSA 1K5MB 2B9VA 5LZ6A 1OH4A 3VD9A 3NV2A 1V6MA 1BQPA 3HQRA 3FJSA 1X8MA 4CDXA 3BN6A 4MH0E 4Y20A 3MLKA 2XR4A 1VBC1 1UZZA 4FQ4A 1W6QB 3AP4A 2W68A 4AEKA 5IWFA 2PN5A 4OYUA 2Q5TA 1JMUB 4KL1A 2FDIA 2VTFA 2XB6C 4Q27A 4XETA 1ND3A 2HLEA 5FRAA 4N53B 4EROA 3HT2A 4BYYA 4K6BA 4XF1A 1W9SA 1RUF3 2P5BA 3TEWA 4MG2A 1NA1B 5DXDA 4RA0A 4I02A 2I74A 4Q0QA 1CR7A 5T5JA 1LENA 4YVWA 5FZLA 3DPRB 4M3CB 2WZ8A 1CJDA 1SBDA 1YNAA 2CU5A 1CD3G 2ZGTA 3H50A 3INAA 2QDRA 1WW7A 1QJZA 2PHWA 1CPNA 2H6CA 3OPWA 2XUMA 3J4UH 3LE0A 3WX5A 3MIEA 1EPWA 1S2BA 1W03A 1ZZCA 2VULA 4SBVA 5D21A 4KBBA 1AL22 3AMNA 2LALA 2UU8A 3GHNA 2BWCA 1W3XA 4B3NA 2ARBA 4WVZA 3SCGA 2FDKA 1ASJ3 3POIA 1J1LA 3IKWA 4AHZA 2JDHA 5A33B 1STMA 2FDJA 4ASLA 4YG3A 2WT0A 5LBCA 4V2VA 1DQ5A 1W9FA 4QB6A 4CZSA 2VD7A 5L73A 1W2UA 3OYWB 1XNCA 1S4CA 2ADEA 2JE9A 4NR1A 4Y26A 4YW3A 3WZ1A 2V5YA 3CEWA 2EIBA 2JENA 2JG9B 3FWEA 4DQAA 2UYAA 5F2SA 1X36A 3WHUA 4AI8A 4ISRA 2VAUA 1GLHA 5KHJA 3ATGA 3UJOA 2OPWA 1DQ1A 1XBFA 1SLCA 3O1TA 3ZFFC 2WO2A 1AVBA 1OQDA 2VMDA 4NJ4A 2YU2A 2VZTA 4HKLA 4M4PA 2WWSA 4IEWA 4CCJA 1HXS1 3BCWA 1TME1 3DYOA 3ZIXA 3A22A 2WQ4A 1JI6A 1VMHA 5CZKA 1RUC3 1UPIA 5I8YA 2ZGPA 5FQ0B 1F5JA 5L9VA 4RHV2 1H1MA 4LITA 1W0PA 3ZSKA 1DGRN 1GQHA 4BQ2A 2Q4SA 3OJBA 4QQ2A 3ME2A 4R52A 2Z4FA 4CUAA 1PGSA 3IM0A 1QJX2 2E51A 2X5IA 4NPMA 1OFNA 4CP0A 2Y26A 2VMIA 1NX9A 2VC9A 1N3QA 3W5MA 3BTYA 1MS3A 2NZ9A 3VN4A 3RJRA 1JYTA 2D97A 3J8F1 3O5SA 4NHLA 4WZFA 5JI7A 3VB9A 3WF2A 2Y60A 1V6JA 1ND2C 3ZFGC 4LPLA 4ZS2A 3W20A 5C70A 4DNYA 1OA4A 2E9QA 2VMEA 5JXHA 3T4VA 4CP2A 4OHXA 2VZQA 3PHMA 2YXSA 4UWDA 4A7YA 1R1A1 1JZ6A 4Y1ZA 5ISLA 2ZKLA 4M01A 4AI3A 2OVUA 5FZBA 1YLLA 1PMJX 1C5HA 1GKBA 2XJQA 2YY1A 3M1HA 1UZWA 2OQ7A 2XL7A 3O14A 4YGCA 5FZ0A 2DU1A 3DYPA 2VECA 1N47A 3VHNA 2B4KA 5IK7A 1QOOA 1W6NB 2P3YA 4Z07A 5IT6A 3BALA 5ANQA 3WOGA 1T6BX 4Q1PA 4P08A 4O65A 1IKQA 2DBNA 2C9KA 5FZEA 4XYXA 4NIIA 1VBA3 2GN7A 2WSUA 1W2OA 5FAXA 3TEZA 2XPJA 4QDSA 2QQIA 4LA3A 1UL9A 1Z7S3 1QDCA 1IS5A 3AXDA 2WO1A 2YYOA 1PM4A 4PF5A 3UJQA 1A34A 2O0OA 5FPBA 4JDNA 4RR3B 2ZBJA 2AENA 3BU0A 3GJAA 2EXJA 3RI9A 4BM8A 2R30A 4RFRB 2E26A 4QX2A 3MHZA 5FUNA 3SH5A 3WF4A 2VOWA 4B1LA 2VBPA 1VBC3 1GQPA 4CU8A 4NIDA 1IG0A 2ZX2A 1ACCA 1WCQA 1JYVA 4GWMA 2Y6FA 1S0FA 2A71A 5FLJA 3OF1A 2YFUA 3LZZA 3MIDA 3VL9A 3OB8A 4U2AA 4LQRA 4EN9B 5A33A 4QX8A 1PVXA 4D7TA 5L9RA 1H9PA 3AC0A 4BQXA 4CU6A 3ZFFB 1X9PA 2VW2A 1RUOA 4IXLA 2R7EB 2ZEZA 5FK7A 1AYN3 1CAWA 2GNTA 3OYWA 4HSJA 3USSA 3VBOC 1U5ZA 5JI9A 2XQRA 4E8CA 4CDWB 3KCYA 1XE8A 4J6GA 3JCIA 4NUBA 2GC3A 4CCNA 1AR83 1AR91 1LHNA 2CHHA 5T5LA 3UT0A 5JDBA 4NIGA 1U5XA 4AHWA 4WM8B 5I0SA 4MXWB 3VKOA 3JD71 3D82A 1S0BA 4A7KA 2E63A 1W9YA 3EJKA 1MS5A 2XMLA 4B4PA 1BBT1 5KBFA 5DDJ3 4AI0A 2DCJA 5FY0A 3M8LA 1VBA1 4F7ZA 1O7FA 2E53A 2FQPA 1NCQC 1UD1A 1L7LA 3DPRC 3DV8A 3MV11 2QZ2A 2XUEA 1NY72 2VCBA 4JDOA 2K0GA 4YNIA 2YBSA 5FXWA 5KHHA 1ST8A 1DF0A 2WS91 1MR5A 4DXSA 5ACA1 3NV1A 1F15A 5DAPA 1GNZA 1RL3A 4AEDA 5J36A 3B93A 2D3SA 3I2IA 2UY8A 2Y6HA 3BPSA 5FMOS 1KRIA 2W9XA 3WINE 4XHXA 1E5IA 5A6ZA 1X33A 3AFKA 3A21A 3BPZA 3RDIA 1GOFA 1TVGA 4JV4A 3WW4A 4DXTA 4EV0A 2NLRA 2X53S 3CL1A 1YQ8A 1VJ2A 1HDKA 2VUCA 1FOD1 1JZ8A 4WM8C 1CGPA 1NQDA 5GLUA 5IAVA 4MHRA 4EN8B 4FFFA 1ENXA 1I6XA 2WKKA 1V6LA 3WW3A 1K45A 2VZUA 3TOJA 4PF1A 1OMIA 1AYM1 1AXZA 1FXZA 4BXFA 1KS4A 2ZEXA 4LHLA 2R1DA 1YCIA 1OHFA 1J59A 3VKMA 3UESA 3N9LA 4GKYA 1LGNA 1F31A 1MQTC 2JKXA 3SHRA 1PGW1 2YGMA 2HWD3 4DMIA 2VVFA 3CZUA 1RUE3 3T2TA 2DV9A 4E4ZA 3KM5A 4E9KA 3UKTA 1RUI1 3I2DA 2CGOA 1BBT3 4LUMA 1FPN2 3G6JB 5JMOA 3LFMA 4FCAA 4P9GA 3OGRA 2VH9A 5FMDA 4CE8A 2RDNA 2VZOA 4A45A 2AEZA 1DQ6A 2VNOA 1RUG3 4BLJA 3K48A 1FOD3 3L2HA 4HSLA 1SZBA 4LOSA 1A8DA 1N1YA 3V0AB 1ULDA 5ACA3 5CEHA 1N1SA 1T6GC 3OY8B 1IKPA 1B35B 2BV4A 3JBG3 3POYA 4NWVA 5BNNC 2B45X 1G9DA 4MX3A 2GAUA 4W6YA 4JGYB 4CVUA 1RC6A 5H9QA 1AYM3 2WLQA 3ZIWA 1JYWA 1D2SA 5I0RA 3RWNA 5IHRA 3RNSA 2AREA 3F2ZA 1VB4A 3ON7A 4JGYC 4ZKTB 1O91A 2OX0A 4E2SA 1R083 1VBD1 5HCHA 3VZKA 1RIRA 3ZSJA 5CB7A 2R072 2Q8DA 3N9OA 5C33A 2D44A 4X6RB 4DXRA 5D8AC 3AMHA 5GLWA 2D6KA 1N3OA 4GB31 3M7AA 1F9KA 4JQTA 5LEJA 2XLAA 4EYUA 4G3YC 4OUEA 1OVPA 2I07B 3ZXAC 3UV9A 2WFF3 2ZS6B 4M3CE 4C1XA 3ZDVA 2WNUA 2Y6GA 3UGGA 3VBFA 3N4MA 5C4WA 4FFIA 1QEXA 2G4IA 2X05A 1QQP1 2PYTA 2AR6A 2W52A 2WFPA 2H0BA 3K46A 4TWTA 1XSQA 1GMMA 4ZXKA 3I97A 2QQWA 1HRV3 1V0AA 2RS13 4Y1VA 2XDVA 4V1PA 3VDBA 3IT8A 3SCFA 5FYIA 3SEEA 2HWB1 4K8FA 1IPJA 4LXLA 3V0BB 4RGAA 2X29A 3H9AA 1I9RA 1FMD1 2E33A 2JD4A 3JZVA 5FR3A 2AUYA 3GZAA 2OQ6A 4GA9A 1NCRB 4XIKA 4Z2AA 1C1FA 5C9AC 2XJRA 1G7YA 2WA4A 3C3VA 1CAUA 1QMJA 3J9SA 1UX7A 3GBGA 4LR4A 4PCRA 3ZN6A 5C3QA 1NLSA 1UU4A 4QB1A 1K5MC 2JDKA 2BGOA 3ETQA 1COV3 1ULOA 1M06G 1K42A 2XWJB 4XJ8A 2WRAA 4BQ3A 2D7FA 4QGMA 3KB5A 1QXPA 4XQDA 1SPPA 5C3PA 4IEOA 3KT7A 3GJBA 1SCRA 5JAXA 1R64A 4Q8LA 5J3UA 1PX3A 1OKQA 2CAUA 2R062 3ZPOA 4NROA 5K0UC 1C8NA 2ORXA 1LRHA 2ZGNA 2P3IA 2A7AA 1J83A 4RS5C 1PO22 1D2QA 2WIIB 5LATA 1UXZA 3G7DA 4AFAA 5FP8A 4JZRA 4JTNA 3LIGA 3TNPB 3X29B 3RSJA 5KXDA 2XHNA 2BGPA 5LBEA 1VIWB 1WD3A 3CBNA 1COV1 1XE0A 3FLRA 4KH9A 1VLNA 4N8MA 2WZPP 4WVMB 1ULFA 4ZZ8A 1YEWA 2PHDA 3M3OA 4G4FA 2Z5WA 1RUC2 5F6LB 1UYXA 1H2LA 2VUDA 3AB0A 3ZFEB 4X8NA 5AFEA 1CIWA 1H30A 2HWC1 4QGLA 1OQEA 4H7LA 4OUMA 4GD4A 3AVSA 4PIXA 2Q8EA 3S7IA 1KDMA 4XACA 3U14A 4D6QA 1OVSA 5F37A 2W2IA 2VY0A 5F39A 5AVPA 2QFEA 5FP7A 3AZXA 3K75B 4QQPA 3AFGA 3H3LA 5ABJA 5JCTA 2QZ3A 1ZYBA 4I0BA 1UOBA 4FOQA 4XC9A 5F3EA 1K5JA 4OZOA 4GMP3 3A0NA 3ZKUA 2EIDA 2PLV1 4GKXA 4FTSA 4M0HA 1WBLA 2JG9A 4AI9A 5I0TA 1OPOA 2CDOA 4DUWA 4XQWA 1LOEA 2RS33 1H6YA 4K21A 1AHSA 4HVQA 3LIHA 3AMPA 4FPEA 4FO9A 1NUKA 2JDAA 2RS31 3MIFA 5EPAA 1N1TA 3NMBA 3NAPB 4LBOA 3AMQA 3VBHA 4EWEA 2RS53 2V72A 4GJZA 1HX6A 2VMFA 4OLLA 4EQVA 5A3LA 2DDUA 2R043 2QQKA 3POWA 2PLV2 5DAVA 3WP3A 4CU7A 1J1TA 2RDSA 1OLMA 1TMF2 3T1MA 1JOPA 1OC1A 3LEIA 2ZGOA 1E5RA 2AGSA 2VCAA 1QY4A 4YRDA 3WR0A 5T3NA 1Q8SA 1ZBE1 4AG4A 5LK7B 1ODNA 3U4SA 1RUH3 2ENRA 2XGXA 3WF3A 2JDPA 1O8PA 3W21A 1NT0A 4BDVB 2CNAA 4J1WA 3PMSA 4YM0A 4WM7B 1OPMA 3E5QA 5GZFA 3TB0A 3I3DA 4CXYA 2RJLA 1F4AA 4HANA 2WNUB 3VZMA 5HCFA 5C4WB 3VBRC 3BIEA 1AXKA 3WG4A 4DEQA 3BB6A 4WVVA 3V64A 5JXIA 4CCEA 1BCXA 1ZZ6A 1VBD3 4TZDA 1I5PA 1UN1A 3LEKA 3OEAA 2YBPA 4KGGA 1EP0A 3QD6A 4AQTA 4EE2A 2DFBA 2JG8C 1BMV2 1RUC1 1DQ2A 2WAAA 4NHYA 1OLME 3LFIA 2WT2A 2UWAA 4CXXA 1AX1A 4LULA 2A70A 2D6LX 2X10A 2XKPA 3HR9A 3VD5A 1DGRA 5IVFA 5T5OA 3JBG1 1CAVA 2VBDA 3ZYJB 4AK3A 3DKWA 1RVF3 4IE7A 1BXHA 1O8SA 3ZSMA 3I59B 1NA1C 1FOD2 1CX4A 2D6PA 4Q4V2 1Y3TA 2TNFA 1DYKA 1SLBA 5C8CB 5BV6A 5LA0A 1H4HA 2VZVA 3NW4A 2XL9A 3ZXLA 5AFBA 4B4QA 4JHZA 1DQ0A 3VKFC 2XBO1 2NQYA 1PVC3 2GNMA 3VBSA 1ULGA 5E6HA 5EHDA 3AZYA 5KHKA 2F6BA 3KSCA 1Z0HA 2ZTNA 3VBOB 3TNQA 4FPGA 4JKMA 5FY1A 1JHJA 5C3RA 1NG0A 5G05L 4BQ1A 3AXEA 4COUA 4BE3A 4FPCA 1ALYA 3IAPA 4QKBA 2C6SA 3LF7A 1TNFA 4HK8A 5D2AA 3VLBB 3WG3A 5FZMA 2E7QA 4XAAA 4I09A 3BIWE 2LTNA 4CDUB 1SACA 2HWB3 4RR3A 3H0OA 4HZFA 3WDTA 5FOJB 4Q26A 1KD7A 1UMHA 5FUIA 1ZA4A 4FT8A 4WVWA 2D6MA 3JD72 4YYOA 3S6PA 4UAPA 2XG3A 2HBTA 3D5OA 3HBKA 2PQSA 3UL2A 1XYOA 1AR92 4WBBA 3ABZA 1HRV2 2RS12 3ELNA 1F5FA 2HWE3 4W4ZA 3AKTA 4HN1A 1POV1 2VZSA 3J7HA 1HN0A 4LO8A 4PI0A 4LO6B 3KWVA 4AL9A 1HQNA 4LIUA 4RGKA 5DZFA 3S7EA 3ZFFA 3WDVA 1UOJA 4GB32 1OD5A 5CVRA 3ZYPA 1RMU3 1RUD2 3ZXJA 4CU9A 4QDQA 2R071 4XBQA 4D7YA 3R4DB 4MGQA 4QQLA 1MZ5A 4Z1VA 3J7NA 4MHUA 4Q0SA 5GLTA 1LULA 3DL3A 3PIJA 1KDKA 3NWKA 4XMAA 5FO9B 2VG9A 1PM7A 1RB8G 1YRZA 2D6OX 1BK1A 1H1AA 3MUY1 1QH6A 3AYCA 4AWDA 1LESA 1ZREA 1GOGA 3EQEA 3OGJA 4YZ1A 3S57A 1W8ZA 5K0UA 2VM9A 3WF1A 2BJSA 2EICA 5JXGA 4MLOA 4UFIA 1ULPA 1XNKA 5JWPA 1SLLA 3PU8A 2GDFA 1OURA 4K9SA 2B46X 1QH7A 3CIHA 1OOPA 1TNRA 3WUCA 1UYPA 3ZR5A 5CFCC 2ZOEB 4IEPA 3OCPA 4A6OA 3WNNA 2ARXA 3AP9A 2ZACA 2W0XA 5AC93 1W8NA 5FMOL 2Y38A 5IVYA 3VV1A 1RUI2 4DFSA 3EB7A 2Z69A 4YVWC 3LA2A 4XURA 5IFTA 1GSLA 3PVOA 3CLPA 2GP5A 5FMBA 1GZTA 3BYWA 1EV12 1WKYA 2PHUA 3AMMA 1IPKA 4NAOA 4UT5A 4AQ2A 2BU9A 5L7OB 1LOBA 4ZU4A 5F5IA 1QIQA 4A7ZA 5K4LA 5L9BA 2A6XA 3E1F1 3MLLA 1POV3 4C0HA 2GALA 4Y4YA 1YFXA 1IGOA 5A7QA 3WW1A 4FXGB 3RWKX 4XHBA 3H8OA 5IAXA 4OI4A 5LWBA 3U75A 1LOAA 4IV1C 2P37A 4OUSA 5LW9A 3I59A 1IG3A 1Y7BA 2ZGUA 3K4ZA 4MVTA 4PHZA 4CEYA 5KXBA 3ST7A 3J8F2 3LB9A 2ET7A 2OPKA 2OW4A 3E6BA 2ZHKA 3D8CA 1F2NA 3O0WA 1VRBA 2ZHNA 2Q8CA 1O5UA 2E7AA 2QQNA 1JYXA 1DQ4A 4XJUA 2Q1FA 2J1SA 3K3OA 3ZMNA 5C9AA 4Q4Y3 3THDA 3PJQA 3VDDB 1RJ7A 5A32A 2QQPA 1XQNA 4UOJA 5IVEA 3N7LA 4FOWA 1REEA 2DBIA 4OMDA 4Y22A 5ACA2 5HV4A 2GC1A 1V6OA 2JG8A 1WLWA 4B7EA 1SLTA 1URXA 3HNBM 5LA9A 1UQXA 1NZCA 5FPXA 2Y0IA 4N90A 4QPIB 3N7JA 2IVJA 5BNOC 3E6CC 2BRTA 1RXFA 2OT7A 4YVSA 5A7WA 1HXS2 1DLCA 3GCWA 3U37A 3IAQA 1BBT2 3GDBA 2BERA 4FFHA 1WMFA 4XDQA 4BIOA 3I2FA 1UCXA 3GALA 3A23A 2WZEA 2JKBA 3OSDA 2VQAA 3SNMA 3H8RA 5C8CA 3R6SA 3LCPA 4LBJA 3KQRA 2P6HA 3WCRA 3MIGA 1RITA 3LA7A 4YVWB 4XBLA 2D93A 1UU5A 4GULA 4NE9A 1DZRA 3WLUA 3MPPG 3KHCA 2R041 1VRH1 3LDBA 1LECA 1KEXA 4PIYA 5F5QA 1YIFA 4XUQA 2ZAAA 4XFIA 4XZUG 1YWKA 4Y4RA 5A6QA 1IQAA 2GMPA 2PAKA 4QM9A 5J98B 1TMF3 4N53C 2P6CA 3QLQA 3SISA 3VZJA 4ARXA 4XJWA 1YO8A 3I3QA 3NNMA 1W0NA 1JYIA 4YM3A 4X8PA 2AH2A 3ACFA 1DCSA 3AKRA 3N9NA 2WNVB 3NSTA 3GYDA 3R0RA 4Y5Z0 3VHOA 4DXZA 3L9JT 4E4HA 1H8TA 2XXZA 4MV2A 2YC0A 1HV1A 4YZ5A 2C1FA 3POGA 3J7LA 4IEYA 1TZOA 3KVAA 4RYDA 2A3WA 2VCCA 1VRH3 4LUKA 1LHVA 1RINA 2ZCWA 1UPSA 3MW2A 3U4XA 2JIGA 1SHWB 4D3WA 1G8WA 1HQLA 1LEMA 1W2AX 2AC1A 1CAUB 2ATFA 3DN7A 5LB6A 2VUJA 1W06A 1US2A 2ZKNA 3OPTA 4ZHNA 2VE1A 3WUDA 4AEDC 4I3GA 2VOVA 4H3WA 4D94A 1GANA 4L99A 2LUWA 2W92A 4M00A 2FD8A 1R093 2YU1A 3VDDC 4YFWA 1HB2A 5FZ8A 1W99A 2CWMA 4LBQB 1PO11 3U07A 5I0UA 1JOJA 4ZS3A 5A6XA 3PMEA 3FFQA 1YUDA 2DTWA
chains in the Genus database with same CATH topology
2O8OA 1GR3A 1MZFA 3E5XA 3GF6A 5L7OA 1VP6A 4IV1B 2HWE2 1LHWA 3P3NA 2R0HA 3VZOA 2DCYA 1WUVA 5D8AB 1YJKA 4AFMA 4QXKA 4KQ7A 4QM8A 5J37A 1KJLA 1SBEA 2RR12 2GMEA 1AZDA 3RI8A 3ZFEC 1PK6B 1VBB3 3AP6A 3ZXGA 5C8CC 1G86A 1POV0 1UU6A 3FC0A 2YV8A 4FPHA 3FMGA 3IDBB 1SBFA 3D0SA 4JDMA 1PK6C 4IETA 3DGTA 3S0MA 1O3TA 1RUH2 1GZWA 3VZLA 4XOGA 1DIWA 4YGEA 1QJX1 3BTAA 2BFUS 4LA2A 1H4GA 1D4M3 1MEC3 2B42B 4XEZA 4EWAA 2XJTA 3FUQA 2D43A 1OA2A 4QPGA 1CVNA 1W39A 1PIV3 2A73B 1ENQA 1U5YA 3SH3A 3MLJA 1LGBA 1XE7A 4ASMB 1MVEA 5H9SA 1BEV2 3CO2A 1HRI2 1C57A 3TYJA 4IV1A 1HLCA 1RUI3 4CEYB 2BNOA 1MQTB 3VBHB 3H1WA 2VOXA 1D0HA 1JH5A 2I2SA 5JOZA 2D3PA 3U11A 4K40A 4YZ4A 3KD4A 5LRRA 5HI0A 2NP0A 4L97A 3FE5A 3VUOA 1GV9A 1RUJ1 1XYPA 4MGIE 5E88A 1D4M1 1MEC1 3HWJA 5DUWA 4XFFA 3GBFA 4PDWA 1ASJ1 2ETEA 1VALA 2DVDA 1VBE1 1CJPA 4META 4OHVA 4E2QA 2CGPA 4G9SB 1H2KA 1PZ9A 3NJZA 1VBE2 2GC0A 4BMBA 5F9TA 1ASJ2 2JEMA 2ZMLA 5DDJ1 3MEPA 4R9AA 4OFGA 1RUG2 1CAWB 1S1AA 1JBCA 2RM22 2SLIA 2OZJA 4FPLA 1ULEA 2D98A 2JG9C 1S0GA 2Z79A 3FX3A 1RUJ3 1MZEA 3JD73 5FOBB 5JPMB 1ENRA 2G9FA 1MS1A 1X82A 4JTOA 1XU1A 4FBFA 2FMDA 4O9EA 2E7TA 1LR5A 3FBMA 5J96B 1BEV1 4H14A 1UX6A 5J48A 1VBC2 3J8F3 1KQRA 4DB5A 4FPYA 2XJSA 2EA7A 1VAVA 5BNPB 1H9WA 2HKXA 3PNAA 4Y1YA 2VQ0A 2ET1A 5CNAA 1O4ZA 1RUD3 5T54A 4KWLA 1U5IA 3CJIB 3AP5A 1RTVA 4BOWA 4ISQA 1SLIA 4E2GA 4OI2A 4FAGA 2OUHA 3CF6E 3WG1A 4A3XA 2EIGA 3IDEA 1HV0A 4EWDA 3IDCB 4XJAA 1JYCA 1UW8A 2PQQA 4COZA 1FV3A 4AI2A 3WQ0A 4E27A 3MGUA 3SCHA 5AC92 1WW5A 5DG2A 2R1BA 1LOCA 5GZDA 4RR3C 3IMNA 3OBRA 5BPXA 3AK0A 1WCDJ 1EPZA 2HWE1 3FBYA 3PTYA 3GBWA 3B01A 4MZUA 2GC2A 4NHKA 2QE3A 2R063 2OZ6A 4AHXA 2WZR3 3QH7A 4L2NA 1LKNA 3KGZA 3RYPA 1GZ9A 2ZGQA 4HVOA 1NCRC 3D4KA 5JZGA 4WV8A 3RG0A 2OIIA 4XW3A 3NV3A 2K2SA 1H2NA 1ND3C 3AZWA 5JSPA 1JW6A 4COYA 1AL23 4E4SA 1H2MA 1J3PA 2QUOA 4JRAA 2WS93 5CU1A 1REFA 2C0ZA 2DVGA 2VMHA 4R9CA 4XF9A 4GXLA 4AGVA 4CEWB 4TSVA 1FT9A 1S2KA 4LLOA 1YJLA 5DUXA 2XJVA 3N3HA 1C8M2 1JHNA 2ILMA 3ZXDA 1EY2A 2H0VA 3V65A 3JUUA 1SFYA 4I0WB 4N7IA 4DZGA 2JICA 3POSA 1ZBA2 4MUVA 3LSEA 4BPZA 2N7GA 3MW3A 4CDWC 2EXIA 1LHUA 2VVEA 4P5HA 1CAXA 4C1WA 1VRH2 3RS6A 1WD4A 1ZBE3 3ZO0B 1G6NA 2P2KA 2ZGMA 4MSVA 2CGNA 1WBFA 4HVRA 1PIV1 1RHI2 4XFGA 2GH8A 2JDZA 3A4UA 5GKAC 1ZRCA 2CAVA 1Y9QA 2A3YA 1IS4A 1UZYA 1AR62 3BU7A 1GFF2 3KMHA 1AR63 3KCCA 4IEZA 4XXPA 3OD0A 3W9AA 5I8TA 3ZN6B 2A6WA 1HRI3 1W6OA 5JR7B 3UKNA 1CESA 3HT1A 1HKDA 1IS6A 1OLQA 2G9GA 3HIFA 2JXAA 3B5LB 4R9DA 1RUNA 2VPVA 1LU2A 3MW4A 4XFAA 5SV5A 1A6CA 1DHKB 5CADA 2GNBA 1ZBA1 1G9FA 2B9UA 1WW6A 1ZX5A 4QQOA 1WLDA 4UW3A 3TAYA 1FNYA 2RR13 4LO7A 4ES8A 1CAXB 2R32A 2RMU2 4UXAA 1GQGA 3ILFA 3K51A 1AR72 4YW1A 5FLIA 1OA3A 4XMIA 1G9AA 4WVMA 3N36A 4R8HA 4MXWA 4K20A 4Q0VA 4EN0A 4Z82A 4IEVA 2IXIA 4P14A 4UBGA 4PIZA 2HWC3 4AFCA 4DS0A 1UKGA 1H1IA 4HKWA 4HBNA 4OULA 1C3HA 2GH2A 1EV11 2PFWA 1YI7A 3USUB 3M3IA 4TYSA 3VBRB 2NMOA 2VGDA 4RD7A 5JZGB 2VU9A 1OI6A 1BVVA 2MNGA 2WNVA 4NVPA 4J1XA 1DZQA 3AM2A 4CDQA 1QJY3 1K5MA 1ZRFA 2MEV1 1CN1A 3ES4A 2WLPA 4ATEA 4YM2A 4B8EA 1VAMA 1MS4A 2ZHMA 3IWZA 4LO4B 2Q8OA 5DZGA 1NE4A 3U0ZA 5DG1A 5AC91 1SMVA 2XVGA 5F6KA 3ZXEA 1WLTA 2ZZJA 1NA1A 1Z7S2 3GZTB 2DWRA 1V6NA 2GZWA 2P3KA 2VW1A 2EALA 3VBFC 5CIRA 3FUOA 2EAAA 5CFDC 4FQZA 1RUD1 3A0KA 5CA6A 4FOVA 2PHRA 2HYKA 4H55A 5BNOA 3RPQA 1RUF1 1DGWA 4Q0UA 1MZ6A 1QWRA 2MHFA 4XZPA 2R16A 3RJ2X 2DVAA 5BNQA 2O1QA 4QPGC 2RM23 1O3SA 2B39A 3VBRA 5SV8A 1DGWX 4DRRA 1HRV1 2RS11 4IEQA 2UWCA 4MYEA 1ZRDA 3I4IA 2QKDA 1NE6A 2HWD1 4CEYC 5CFDA 2FZ1A 2D3RA 2ZGRA 3H8UA 4ONUA 4YFZA 3SH4A 4UW4A 3O0VA 4YZ3A 4AVCA 4HKOA 1VAKA 1MACA 4KU8A 2MEV3 2NYYA 1RJ8A 3APBA 1QJY2 2RM21 1S0EA 2I45A 3FHIB 1RUG1 3HN1A 3MPBA 4AFBA 4RL7A 2DTYA 3FZ3A 5CG8A 4P9YA 2XBO2 4K3UA 4OI0A 4L92A 1C8M3 5BNOB 3NV4A 1S0CA 2A6YA 1D4M2 1MEC2 4WM8A 3RYKA 1LB2A 1Q56A 4Q4V1 4HPKB 1NXD1 3ZVXA 4R9BA 4LBNA 3B9IA 2BWAA 4IERA 1TEIA 1WMEA 3MZHA 5CFDB 2A6VA 1AX0A 4IESA 1I1EA 1WMDA 4GH4C 4HT1T 2ERFA 4YGBA 2VW0A 2WNEA 4ITCA 3NAPC 1FI2A 4Y1XA 1BMV1 4Q4W2 3D6EA 1HRI1 1KJRA 1HW5A 4Q4X2 2VVDA 1SDWA 2IXCA 4KG8A 5K7PA 1UIJA 3PVEA 3LWCA 4LBMA 5GZEA 1YXWA 4N7UA 1RVF2 4FPKA 2BNNA 5JVVA 4P9XA 4Q8KA 4OVEA 4YGDA 1IZ3A 3AZVA 3W59A 4YW5A 4PLMA 2ZGKA 4N53A 1RGSA 4OHWA 4AVTA 1TMF1 4N9HA 1RUH1 4XXAA 1GICA 1APNA 2VNRA 4Q1RA 1VBE3 1V6IA 3DPRA 1FPN3 2V09A 4M3CA 1ZZ7A 1XNBA 1LTEA 2RS32 4PBOA 4AVSA 1RHI3 1PZ8A 1LODA 2RR11 1YHFA 2WZR2 5IK5A 3VBSC 4XBNA 5CBLA 4I0AA 3JB8A 3KCXA 5FQ0A 4JGZB 1DDLA 3ZYGA 3LOBA 2JECA 2W39A 2DYCA 4Z8BA 2BGCA 5E16A 5KHGA 3OTFA 3PJYA 5JOXA 3TN92 1PO12 1PGL2 2FMYA 1Y43B 1R091 1QGLA 2HWC2 3H1MA 3ZFGB 5KC5A 5IK4A 1AR81 4I2OA 3WDUA 4DRVA 3BODA 5FPZA 4N43B 1S0DA 2RS52 2WFF2 2HWF2 3CU7A 4XPVA 3ES1A 1G9BA 2KM2A 4I01A 3AJYA 1CONA 1WCSA 3NKTA 5GZCA 4W6XA 3M2MA 1HXS3 2ZAHA 3MDPA 4R4XA 4MGKE 2DURA 2CY6A 1IHMA 4CP1A 5BYNA 3JU9A 1PO21 1QXJA 4XFBA 1LU1A 4WZCA 2D40A 3VHPA 5BNNA 5JLVA 4IL7A 1EAH2 4XF4A 2R061 4YZ2A 2X5IB 2PAMA 1RUE1 3H3ZA 1C1LA 4JGZA 4AW7A 1YI9A 1PVC2 2UY9A 4N9IA 1SFNA 4RQPA 2EVXA 4AEDB 5JSRA 3CJIC 4WM7A 4CDUC 2R042 4BIFA 3WG2A 3QBQA 2YHJA 4AYUA 3B00A 1BYHA 2CTVA 2UURA 2HWB2 2YGLA 3UK9A 4JC1A 2VOKA 1UIKA 4E4DX 4F8AA 4Y24A 1S0JA 2CV6A 1QJU3 3WCSA 4M0NA 4PLOA 4AHYA 1QQP2 2AYHA 1FV2A 2LM3A 4S2HA 3JQWA 4NPRA 1DBNA 2BPA2 2ZMKA 1O4YA 4DOUA 1FMD3 2YROA 3NO8A 4GMP0 3O0XA 4XF3A 2HWF3 1J3QA 1AX2A 4CEWC 3P3PA 5EYXA 3VBSB 3HMYA 1DU3D 3ENRA 4GQ7A 3HD8B 2IXKA 2Q1ZB 5J7MA 1R081 1VB2A 2VNGA 4FTBA 1QKQA 1Q8OA 1ZZBA 3ZSLA 4QMAA 4KU7A 1A78A 2DVBA 3V0AA 1OFSA 3RMXA 3TWIA 4CDUA 4WM7C 3ZSEA 1W6OB 2WJSA 4XJ9A 2BTVC 3LAGA 3IPVA 5HCBA 3QOPA 4W65A 2DCZA 5T5PA 5KXEA 2Q30A 2A3XA 2XLFA 3J26N 1FPN1 2PA7A 1M4WA 3BOWA 3DUIA 5ABJB 4LBQA 2QJVA 3AKPA 3ILRA 1D4VB 4CDXB 1VBB2 4FP2A 1OSGA 4RFT0 1EYBA 2WSVA 3LOIA 4AVAA 1GBGA 1V70A 2EXHA 4S2GA 4YW4A 2P17A 5BXXA 2CWSA 4FAHA 1PNFA 1AR93 4AEJA 2IFWA 1C4RA 3WQ7A 1KS5A 1AYM2 3IBMA 4AVBA 3OPZA 4FOYA 1QHDA 3B9CA 4P9IA 1RMU1 4URTA 1Q8PA 4B4RA 4YG6A 5DUVA 4OHZA 2IXLA 1NCRA 4LHNA 2ZJCA 5KHIA 2YZ4A 1V6KA 3B94A 3H1YA 4Q4W3 3WD5A 3IPVB 3MICA 2OA2A 4COWA 1ONAA 4QPGB 1V00A 5L36A 3WP6A 1E57A 1WW4A 4N43A 4LE4A 4Q29A 1LOFC 3EXUA 1VBA2 1CAVB 3H7YA 3M4FA 1FATA 5HCAA 4GMP1 4LBLA 1Q3EA 3MIBA 1X50A 1YFYA 2DVFA 2EXKA 1KFUL 4X6QB 1PO13 4JGYA 3L2YA 1REDA 4QT6A 3QH6A 5FREA 3TN93 2YPJA 3EO6A 5K0UB 4I3PA 1O3RA 4BH9A 5HXVA 5ABJC 4OHYA 2KXLA 4PQ9A 3WP5A 3THTA 3VBHC 4RQPB 4PLNA 3ZFEA 1OLRA 1PVC1 4INDA 4GIQA 3W58A 1PHMA 3THPA 1RUE2 2VUAA 1N1VA 2E6VA 4Z2WA 2WNVC 1EAH1 2PHTA 3VBFB 1ENSA 5C6CA 2DCKA 4IV3B 1U12A 3ZYIB 2B7YA 4HFSA 1MS9A 3CJXA 3VKLA 1CQ9A 4JRLA 5T55A 4BZ4A 4DY5A 3KLSA 2P34A 1RMU2 1QDOA 3LSDA 3R05A 4QPIA 3AKSA 2TUNA 3RRDA 1AL0G 5FFOC 3JBG2 1NCQB 3VBUA 2WINB 5GALA 3PLQA 1QNWA 5I93A 1WLCA 1ZVFA 2FBEA 1UF2C 3GHMA 1DLLA 4GH4A 2JE7A 2NN8A 2GNDA 4IEXA 2ZGSA 4AEMA 4L8QA 1KFXL 1B35C 1R092 1VBB1 4NO4A 3VBUC 1W6NA 4AE2A 4KG0A 3ZYRA 4AQSA 4DY3A 5BNPA 4QPIC 2B8MA 1PNGA 1DZTA 5GJ6A 2ZPXA 1EAH3 1LCLA 4Y22B 2R6QA 1GYKA 2XJUA 1ZBE2 2UWBA 3SITA 4RS5A 2BW8A 2WL1A 5KWRA 2DUPA 1IS3A 5EFUA 3MIHA 1OQ1A 3LKJA 3RYRA 2BYVE 2WT1A 5CAZA 3VKNA 1H8TB 2WQZC 3EHKA 4Y1UA 1DG6A 3HQXA 1NLRA 3PVBB 4QD2A 1R082 2XLGA 5C4WC 1R1A3 5GZGA 4NOTA 3MI8A 3WDXA 3ZXKA 2V73A 1I3HA 2F4PA 2A5ZA 3WXPA 5FCCA 4N43C 2QNKA 1C28A 1RVF1 1IOAA 4I30A 4Q4X3 4YVSC 2HEYF 4CDWA 4NWWA 1QNYA 5FTTC 2UYBA 3ZN4A 2RMU3 1TME2 4Q4X1 1YYNA 1PO23 3B7MA 3NL1A 3HAGA 1TME3 4Q4W1 4TLFA 1O4TA 4LO5B 2AZ5A 4CDQC 5I91A 2KA3A 3I7DA 4QQHA 4FP3A 2GSYA 3VGIA 1COV2 1UAIA 5EWSA 2XVKA 4BMEA 5CG9A 3HBZA 3ROUA 3WT3A 1ND2B 1G9CA 4W6WA 5IUQA 4UW5A 2IWGB 2OUJA 3ECQA 5BNPC 4HL0A 1GZWB 4K1ZA 4QPYA 3S30A 4S2FA 4BLIA 4CYDA 2OYZA 2DF7A 2R0FA 4ZU7A 2XH6A 4K1YA 3KT4A 1BEV3 4YVSB 3TRSB 2TBVA 1LEDA 2K9ZA 4FPOB 3ZFGA 5LK5A