1O4YA

The three-dimensional structure of beta-agarase a from zobellia galactanivorans
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
AQDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPAGNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQEIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWRPAATQEELADDSKNIFWVDWIRVYKPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-agarase A
publication title The Three-dimensional Structures of Two {beta}-Agarases.
pubmed doi rcsb
source organism Zobellia galactanivorans
total genus 74
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o4yA00
3ZXEA 3PVEA 1G86A 4FPCA 1MS9A 3MPPG 2BQPA 2ZGMA 1AX0A 1URXA 2ZMKA 1DQ1A 2D6MA 1C4RA 1TEIA 1AXZA 3AJYA 1JOJA 2V5YA 3LSEA 3WDUA 3N7MA 2WQZC 2NYYA 4Q1PA 2ZHMA 5JMCA 3GALA 2A70A 2ZHKA 2WSUA 1EPWA 2YXSA 4BOWA 5T5OA 4WVWA 2NZ9A 2YROA 3T2TA 2ZGKA 2FMDA 1BYHA 3O0WA 2GNBA 4ATEA 5KXCA 3I4IA 3FLTA 3SITA 1UKGA 2JJ6A 2DU0A 1SCRA 2ERFA 1VLNA 1O4YA 2I2SA 3M2MA 4FPJA 3OPZA 5GLZA 3AYAA 1HQWA 1OKQA 2AENA 2EALA 3BOPA 2UWAA 1CPNA 4YG3A 2PELA 4YW5A 2V73A 4CZSA 2A3WA 3TB0A 1WBFA 1S0DA 4FOVA 4Q8KA 4YZ1A 4GALA 2R49A 1J1TA 3AX4A 1MVQA 2DTWA 1HQLA 4XBNA 1MACA 3D5OA 4YZ3A 1W6PA 3Q9OA 4LBNA 1CN1A 3UK9A 1GICA 3VV1A 1AZDA 1DYPA 1QNYA 2DVDA 3NV1A 1LGBA 2UWBA 3SH5A 2EAKA 3FUQA 2JD4A 3QCWA 5DZEA 4YZ4A 3UJQA 1W6PB 2DURA 1NLSA 2PHXA 3OYWB 2ZGRA 3AYEA 1LOFA 1LOAA 4Q2FA 3AP4A 4XHBA 5HCAA 1S0IA 1KRIA 1DQ6A 4FP3A 2WKKA 2NMNA 1ULFA 4K21A 4XJUA 3RMYA 1SLIA 1Q56A 1MR5A 1Q8VA 5F5QA 2PHTA 2R16A 1JYIA 5HCFA 1DQ5A 1CVNA 1V6KA 4Y24A 2P3IA 3WDXA 1AXYA 2WNEA 4XXAA 1Y7BA 3CNAA 2PHUA 1LTEA 3M3QA 4FPYA 1CPMA 4UW4A 4R9AA 1V6NA 5FRAA 2P3JA 2ZGOA 5DG1A 2EXJA 3AXDA 1JW6A 1LOFC 1LESA 2EXHA 1D2SA 3JU9A 1Z0HA 4K1ZA 4P14A 2ZKNA 5EWSA 3RS6A 4LBOA 4BQ1A 3WUCA 1G7YA 4YZ2A 4XIOA 5T5JA 3POSA 4M3CE 1PZ9A 4W65A 1G8WA 3PVNA 4WVVA 1LHNA 1LOBA 2JDZA 2YV8A 1CIWA 1FNYA 2E7TA 3VKNA 1A3KA 3ZXLA 1DYKA 2D6OX 2E6VA 1WD3A 3JUUA 5T5LA 2AYHA 3ZVXA 2G4IA 4FPOB 4PF5A 2P37A 3AZYA 1QOOA 3N36A 3WVJA 1JYCA 4FPEA 1G9AA 1AF9A 3KQRA 3V65A 2KM2A 3N7KA 3VUOA 4OZXA 3O12A 2ENRA 3H0OA 4UW3A 1B09A 1ULCA 1HKDA 2A6WA 1UZYA 5DZFA 3W58A 2ARBA 4FQ4A 1SLAA 2UU8A 4WV8A 2D3RA 5JOWA 1DHKB 1VALA 1ENSA 2ZBJA 4FQZA 2D7FA 5CAZA 2DUOA 4FPFA 1WCSA 4FPGA 1I1EA 4BLIA 3FBYA 3ATGA 4YW4A 3OJBA 1ONAA 4FP2A 4P9YA 1N1SA 3RMXA 1LOEA 1LCLA 1BKZA 2XB6C 3A4UA 1SLTA 4XMIA 4AVSA 2ZHNA 4XJ9A 2CYFA 1S0FA 2ZGNA 5GLWA 1QF3A 1KDKA 1YO8A 4YGDA 1S0CA 2C9AA 3WDWA 4YGCA 4YLZA 1IOAA 3MW3A 3HMYA 2GMMA 3INAA 3M1HA 3O5SA 1N3PA 5JOYA 2DUPA 1G9DA 3R05A 2GALA 1YYNA 2AGSA 4SLIA 1FV3A 1LOGA 1BJQA 3N7JA 4XXPA 3ZSMA 4FPKA 1UMZA 5EYYA 1APNA 1HDKA 1PZ8A 1ULEA 2D6LX 5E88A 3BIWE 5LK5A 2ZGUA 2CWMA 1KQRA 2A3YA 2W39A 3ILRA 4DS0A 1RINA 1JHNA 4YM0A 3ZXFA 1I3HA 1SACA 2ZZJA 1GBGA 1DLLA 1SCSA 3B00A 3W59A 4BPZA 4DFSA 2DVGA 4YFWA 1N3OA 2VU9A 3ASIA 3PMEA 5EXOA 4TZDA 4YZ5A 4HL0A 2ZA9A 3FLRA 4M3CA 2R0FA 1YRZA 1WUVA 4AVTA 1Q8QA 1S0GA 1GZCA 1W0PA 4YGBA 2GMPA 3WZ1A 1VAVA 2A71A 4GXLA 2EXIA 3FUOA 4GWNA 3N35A 3POWA 4BMBA 1GKBA 5H9SA 3AP5A 1WD4A 4Y22A 5DG2A 3T1MA 3AFKA 4U36A 1BXHA 4XE9A 4Q27A 3WHUA 5IK7A 1LGNA 1MS5A 3OYWA 5DUWA 5CB7A 4M3CB 1S0BA 3L2YA 1W6NA 1WLCA 3ILFA 2P34A 1UZZA 3OBTA 5GALA 4MYEA 1YI7A 2JKBA 1JBCA 2WT0A 3APBA 1QDOA 3QLQA 4FOWA 4LBLA 4Y22B 2JE7A 1CR7A 1SLCA 1IS6A 2JE9A 3WG3A 4GKYA 3RRDA 3UL2A 2GN7A 5H9QA 1GANA 1MS4A 2PHRA 1W6NB 3AK0A 5AVAA 5CA6A 1GNHA 2D6KA 3OGGA 5E89A 1AXKA 2OUHA 2YY1A 3VKMA 3NV4A 4ISQA 4M3CF 2DU1A 4Y26A 2YZ4A 3ZSKA 1C1LA 2R1BA 3WDVA 4F83A 2PHFA 1JXNA 1LHOA 1LODA 1RIRA 4BMEA 2A6XA 3RQ0A 1N1VA 2EF6A 4PBOA 1OFSA 1F5FA 2DVBA 2VUAA 2A75A 2TEPA 1LULA 3WCSA 1IS3A 4K1YA 1MZ5A 1FAYA 3USUB 3V0AA 3ENRA 3SH3A 1ZM1A 2AREA 3ZPYA 4BLJA 3WV6A 1LEMA 3IPVA 1LHUA 4RA0A 4P9WA 2D3PA 4Z8BA 4I30A 1AX1A 1G9FA 3O0XA 1LEDA 2ZMLA 1S1AA 1N1TA 3ZSJA 3KM5A 3R4SA 5GZDA 2D3SA 2P2KA 5JDBA 1MS1A 2D6NA 1MS0A 2LALA 4LBQD 4YM1A 1S0EA 1SLLA 1W6MB 4Y1VA 3V0AB 2ZGSA 3AZVA 4XDQA 3FLPA 4K20A 2W52A 4H55A 1AJKA 3IPVB 1G9CA 1MVEA 1LHVA 3AZXA 1KDMA 1FATA 3WHTA 4ITCA 5SV8A 4LBJA 4ZKTB 1GNZA 2ARXA 5JOXA 5CBLA 1AVBA 3ZYPA 5T54A 3WDYA 1W0OA 2A6ZA 4YW3A 3VKLA 3WCRA 2EIGA 3RG0A 1BZWA 2DV9A 2ES3A 2ZGPA 4LBMA 4YG6A 4AVVA 2ZABA 1R1ZA 1H9WA 3SH4A 5F9TA 2GN3A 3PVOA 1ENQA 2Q5TA 1SFYA 4XJWA 1KITA 3MW4A 4XMAA 4U2AA 2P3KA 3V0BA 4XILA 1ENRA 1LHWA 5E8AA 4AGGA 2ZHLA 3WG4A 5IK8A 5EYXA 1FNZA 1FYUA 4XJ8A 1WBLA 3WNXA 5JLVA 1N1YA 1DFQA 2XG3A 3IM0A 4DPNA 4YG0A 4XBLA 5T5PA 3A0NA 3N7LA 1U0AA 4GKXA 2E7QA 1YIFA 4JCKA 2OW4A 4ASMB 4BM8A 3O0VA 4ATFA 3DUIA 3M3OA 1ZA4A 3PJQA 3FFZA 3V0BB 5GZGA 1A8DA 2DWRA 3C2UA 3IN9A 2RHPA 1W6OA 4ISRA 4FPLA 1NXD1 5L73A 3WLUA 4C1XA 4XOGA 1QNWA 2ZAAA 1ULDA 1GV9A 2CWSA 1QKQA 2D43A 2VH9A 1N3QA 4Y20A 1X50A 2R0HA 4AGRA 3B69A 3U4XA 2WT1A 4PQ9A 2A7AA 1H30A 1UPSA 3TAYA 4UW6A 1A78A 1PZ7A 2E51A 3AZWA 1UL9A 1G9BA 4AYUA 3WOGA 1QOSA 5JVVA 1W6OB 2DYCA 2EXKA 4YFZA 2NM1A 2E53A 1JN2P 4Y1ZA 1JUIA 3AJZA 5DUUA 1VAMA 4Y20B 5CNAA 4ZXKA 1DQ0A 5T52A 2GNDA 2DTYA 3A0KA 4D69A 4XIKA 1SBDA 3AP6A 5IK5A 2ZGTA 3AYDA 3AZZA 4AWDA 1Q8SA 1Q8PA 2DVFA 2A6VA 4LBKA 1BQPA 5DZGA 4M01A 2CY6A 3HN1A 1WW7A 2AH2A 3N3HA 4FOYA 4YGEA 3SNMA 1V6LA 1DGLA 2VW2A 4WZFA 2A6YA 2B7YA 5T50A 2SBAA 1WLWA 3BODA 3ZSLA 3R4UA 4CRQA 5GZCA 4P9XA 3V64A 4DRVA 2WJSA 4KBBA 3RSJA 1DZQA 2WLQA 5HCBA 5KXEA 1Q8OA 1LU1A 3OBRA 1IS5A 3D6EA 4YW2A 2A5ZA 3ZYRA 2A3XA 4XBQA 1AJOA 1CQ9A 3GNEA 4YW1A 3AXEA 1O4ZA 1V6JA 2DVAA 2JECA 2OVUA 3AP9A 1VIWB 2W08A 1AX2A 1FX5A 2ZGQA 2W68A 1SLBA 2ZMNA 3MEPA 3POYA 4Y1UA 5GLTA 1SBEA 3B3QE 3B9CA 2GMEA 2DUQA 3HR9A 4XYXA 3ZXJA 3USUA 5GM0A 3T1LA 4YM3A 3D4KA 1W6QA 1DBNA 4FOQA 1QDCA 1V6IA 2GNMA 1LU2A 3NV2A 5JOZA 1V6OA 5GLUA 2C5DA 4Q1RA 4Y1YA 4PCRA 3M3CA 1MS3A 4PBPA 2SLIA 4XZPA 2PHWA 2R1DA 2D6PA 2ZGLA 2VW1A 2CL2A 4GWMA 4DQAA 5DUXA 2AUYA 1GSLA 4AGVA 1UN1A 3ILNA 1W6MA 4RL7A 3UJOA 3WUDA 2ZACA 1DQ4A 1W6QB 2WSVA 4R9CA 1WW6A 1CESA 2CNAA 5GZEA 4Y1XA 1RITA 5T55A 1SBFA 1XQNA 3BTAA 1LOCA 1QMJA 4Q8LA 3SISA 2LTNA 4R9DA 4HANA 1C1FA 1LENA 2VW0A 3I8TA 1CJPA 1MS8A 3AYCA 4XJAA 4M00A 1V6MA 5KXBA 1YXWA 4XJZA 1N47A 1F31A 3VKFC 1MZ6A 3AP7A 4TYSA 5H9PA 2GNTA 4NOTA 5GZFA 3LCPA 2OUJA 3M3EA 3IKWA 1IS4A 4FPHA 3WDTA 1S0JA 1LJ7A 1LGCA 4DRRA 5DXDA 2H0BA 3OY8A 3VKOA 1H9PA 4GA9A 1Z78A 4JC1A 2NMOA 4IQPA 5IUQA 1KJRA 1QOTA 5GLVA 4L8QA 3ZXKA 1UX6A 2UURA 1HLCA 1F9KA 5H9RA 2NP0A 1QU0A 2D44A 1CONA 5DUVA 1C57A 1IKPA 1LECA 3LSDA 4YM2A 1WLDA 1UAIA 2CTVA 1KJLA 1ULGA 3WG1A 3NWKA 2FHRA 4R9BA 5IK4A 1GYKA 2UWCA 3OY8B 3SLIA 1GZWA 4NO4A 2HYKA 4JRAA 2NN8A 4XTPA 4Q26A 2WT2A 3MW2A 4XTMA 1OQ1A 2YMZA 1DIWA 1DQ2A 2GDFA 4UW5A 4C1WA 4CTEA 1GZ9A 4LBQA 5BYNA 5KXDA 1WW5A 3NV3A 2VY0A 3IMNA 4XHXA 1FV2A 2Z42A 3WG2A 1D0HA 5FREA 5IT6A 5GJ6A 1GZWB 3B01A 1IKQA 2VXRA 1WW4A 1QGLA 1V00A 2AR6A 3DGTA 4LBQB 4FVVA 1GLHA
chains in the Genus database with same CATH superfamily
3I3DA 3PVEA 1EPZA 1W05A 4XZUG 1NA1C 4FPCA 1PK6A 3MPPG 5DABA 3MV11 2FCVA 4MO3M 3POIA 3VZLA 1W8UA 3FZ3A 3N9LA 1STMA 1J58A 1RJ8A 5F3EA 3WQ1A 5JSPA 3THDA 2RM23 3AJYA 1JOJA 1OC1A 3LSEA 4KQ7A 4Q1PA 2NYYA 1VBE3 3GALA 2ZHKA 4KG0A 4KL1A 3GF6A 4XFGA 2WSUA 3OUHA 4JQTA 3ACFA 4IEQA 4LITA 4F3JA 5ERLA 4WVWA 4H14A 4IEVA 3TWIA 5B4NA 3T2TA 1QXPA 4GAZA 3O0WA 2R042 4MGQA 2XVGA 2R7EB 3DYPA 2XR4A 2QQOA 2VNRA 5FMBA 5L7OB 3M2MA 2R063 5LBBA 3OPZA 3VDAA 1MZFA 2XL7A 3AYAA 4E2SA 2C24A 3BOPA 4ARYA 2UWAA 1ULPA 2D40A 2WL1A 3RJ2X 4LQRA 5BNOA 3TB0A 1WBFA 3DN7A 1CX1A 5HV4A 1BLZA 1H2LA 1X82A 3BGAA 3SQOA 3FMGA 1MVQA 5CADA 4KH9A 5DAWA 1MACA 3D5OA 3ZMNA 1W6PA 2VR4A 2YBPA 1ZZ8A 3Q9OA 4CU8A 3VBRA 1AZDA 2WNVC 3MDPA 4Q4V2 1RGSA 5LB6A 2UWBA 3T0BA 5ABJB 2E7AA 3MFAA 4RQPB 5FP3A 3VDDC 5IAXA 1UY2A 3HNBM 1GWKA 1KXGA 1JH5A 2W1WA 3NQHA 1UNBA 1JHJA 5LY2A 5C70A 1OT5A 1SG3A 4V1PA 4AEDB 3FUQA 1LKNA 3QCWA 1GOGA 1RUI2 4CDWA 4OZOA 1DF0A 4WM8A 4CDXB 4MG2A 2PHXA 5F3IA 4TLGA 3AYEA 2YBSA 1LOFA 1LOAA 4Q2FA 3AP4A 2PN5A 2KD7A 5A1LA 3H8XA 2ZJCA 4LHLA 2OS2A 1KRIA 2IXIA 3K51A 1PM7A 4N90A 1BEV3 5FUIA 3M4FA 1K5MA 3NSTA 2WLPA 4EWDA 3QH6A 1ULFA 2ZX4A 3BALA 5FUNA 1EP0A 1WMFA 3FC0A 2VMGA 4EROA 1EUUA 3VHNA 4GJYA 3T2QA 5F5QA 2PHTA 3B93A 1JYIA 1DQ5A 1V6KA 3WNLA 3PUQA 3WDXA 4A7KA 2WA4A 1R092 4RS5B 1YQ8A 3M3QA 1CPMA 5D21A 4BK4A 4R9AA 5J1XA 1FOD3 5DG1A 3ZN6A 3ZXDA 4BISA 4BDVB 3H9AA 5KBFA 3AKTA 3MFCA 4ZZ8A 3FHQA 3IDEA 1CZVA 5FY9A 2ZKNA 5EWSA 3T2PA 2ZZQA 1XYPA 4YZ2A 4XIOA 2O1QA 1RUG1 3NJZA 1PZ9A 4M3CE 4K6BA 3PVNA 4WVVA 1LOBA 1W8HA 2WNUB 2WINB 5FY0A 4JTOA 5KC5A 2W5FA 3KGZA 2ZAHA 2VZQA 2G19A 3DYMA 5T5LA 3ZVXA 2AYHA 4QX8A 2RMU1 4DEVA 5EJ1B 2P37A 5JIAA 3SKVA 5A3OA 3I49A 3A21A 2KM2A 3DPRC 3N7KA 2ZEWA 3T4HB 4OZXA 3O12A 4OHXA 3I3MA 1O3QA 4Z82A 5DZFA 4CCMA 3TEZA 1HB3A 3H3ZA 4OI0A 4V2WA 2CGOA 2X8KA 1ENSA 2OYZA 3NKGA 4FPFA 1CX4A 4FPGA 5D8AA 4LOTA 1WA6X 5CU1A 1CAVB 4BLIA 1JZ6A 3ATGA 5KWRA 2CAUA 3OJBA 1ONAA 3NO8A 5JXIA 1HXS1 2BVBA 1LOEA 2FZ2A 2XJUA 1C5IA 2VAUA 4IEZA 5DDJ2 2DCZA 2VZUA 5A3WA 5A6YA 1J83A 4Y5TA 1QF3A 1QQP1 1QY4A 3I54A 3WW4A 3WY6A 1X9TA 1S0CA 2C9AA 3KVBA 5J3UA 4YLZA 5FLJA 2GMMA 5CIRA 4IXLA 1BBT1 5C4WC 3O5SA 3CJIC 5JOYA 2DUPA 4E4SA 4JDNA 1YYNA 1D4M3 1BJQA 1FPN2 2R043 1UMZA 4FPKA 5EYYA 2Y0IA 1ZZCA 1HDKA 1PZ8A 4IV1B 4QQPA 5A33B 1KQRA 1VBD2 4QX0A 2W39A 3VBOC 2IXLA 4HETA 3ZN5A 1ZZ9A 1JHNA 2Y33A 2VMCA 1DGRN 1I3HA 1SACA 2EIDA 3GXUA 5FK7A 2ZZJA 1GBGA 4BPZA 4MGZE 2DVGA 1H2MA 1N3OA 3ASIA 1R081 3BPZA 4YZ5A 4HL0A 4IE7A 4MGYE 2YYOA 4M3CA 3DYOA 2RG4A 4NWWA 5CFCB 3THTA 3WW1A 2GMPA 3FFQA 3GZTB 2P4EA 3K3OA 4GXLA 2EXIA 3FUOA 4GWNA 3N35A 3RJRA 4CCOA 1YFXA 3LA3A 2RS12 2C26A 5B4XA 3K3NA 1ZBE2 4HONA 1AYM2 1WD4A 3GDBA 4Y22A 3SKJE 3T1MA 5I0RA 4XE9A 3WHUA 4O61A 1VP6A 4Q27A 2PQQA 2D97A 2Z5WA 1LGNA 4QU1A 4L97A 5DUWA 1AR81 2R072 1RUI3 4C0BA 3VB9A 5FZ4A 4GMP0 1S0BA 2ZX2A 3E5UA 4LO7A 1WLCA 4M0NA 5IVCA 3JD71 4QB2A 2QNKA 4QX3A 5C3OA 2VXJA 1JBCA 2WT0A 3J9SA 1XXNA 4P08A 3APBA 3KHCA 5BNPC 1QDOA 1AR72 2WZR3 4LBLA 1NYWA 2JX9A 4BE3A 3AB0A 3I2KA 1JYVA 2ZPXA 1HB2A 4ASLA 5SV5A 5I8YA 5H9QA 1OLME 1JZ4A 1POQA 5CA6A 5BNNC 3OGGA 5JXGA 1AXKA 4URTA 2PA7A 4YARA 3NNGA 4BIOA 1MPXA 1OH3A 3ZR5A 4JKKA 2G9ZA 4ISQA 3ZSKA 5HCHA 1R093 4OI1A 2VULA 4R8HA 1HRI1 2W0XA 3CLPA 4IDZA 3R4DB 2BV4A 3ZXAC 1H8TB 1SFNA 5FZOA 2EF6A 1F5FA 3HQXA 2H6CA 3VHOA 5C5TA 1EAH1 2W1QA 4K1YA 2J1AA 1MZ5A 1H1AA 3N9MA 3WP5A 5IFTA 3V0AA 1F8VA 3MI8A 2JB8A 1JUHA 1OQDA 1SDDB 4DY3A 5BV6A 3IPVA 4LXLA 2JIJA 1AR61 4W4ZA 4Z8BA 2XONA 4HOOA 3GHMA 1LEDA 2ZMLA 4GH4A 1Z7S3 4KGGA 1XBFA 2HKXA 3FX3A 4CU6A 1RJ7A 3C3VA 3H7YA 4OVEA 4D8MA 5FYBA 1SLLA 2VTXA 1W90A 4HXCA 2FD8A 5FZ1A 3AZXA 1ZBA1 4Q0SA 4JVAA 4QHZA 4W6YA 1PGSA 2G1MA 1UXZA 4LBJA 4XABA 5SV8A 4B1MA 2ARXA 1H4HA 2A1XA 4LKDA 5C8CC 5KR7A 3WDYA 5FXVA 2A6ZA 1OA3A 3ZFFA 5J37A 1C8M1 4KWJA 1VMHA 4OLLA 5FLIA 2WS92 4AHWA 2YG0A 4JKMA 2IXKA 5DDJ3 3ZLIA 4BJ0A 3GCWA 4Y4RA 3V56A 4FBFA 1R1A3 4NN0A 5FFOC 5IVBA 3W5MA 1OLMA 2YUEA 3ZXGA 3V0BA 2MHFA 5LA1A 1F35A 4RHV2 1ST8A 2ZHLA 3JB4C 2XOMA 5FZDA 5IK8A 3S5AA 2QTWB 2WWSA 3KCCA 2C6SA 1FYUA 4QDSA 4XJ8A 3WINE 3VBSB 4TTGA 3WNXA 4PHZA 1MEC1 2W92A 3VZKA 2WO7A 4YG0A 4XBLA 4YPJA 2BWAA 3VZJA 3CKHA 4H3WA 5LA9A 2E7QA 4CCDA 1TME1 4ASMB 4JGZA 1W8FA 3O0VA 2V72A 4CEWA 3I3EA 3M3OA 1ZA4A 3ZYBA 5DN2A 1O3SA 4KGQA 1A8DA 1W28A 2RHPA 2JDYA 4FXKB 3K4DA 5L73A 4C1XA 4XOGA 3CQOA 4MGKE 2X29A 3VD5A 1FMD2 1V9U1 4IEXA 4RFT0 4Y20A 4XPVA 4CEYC 1KFXL 5C71A 2WFF3 2WT1A 4YVWA 1ENXA 3JBG1 1VBA1 1H30A 1UPSA 1UYPA 1DDLA 3W9AA 3AZWA 1NCRC 1Y3TA 4A4AA 4R52A 3JQWA 5FY1A 2TNFA 5KHJA 1MQTB 3AL5A 1W6OB 4DXRA 1QIQA 2VCAA 2X05A 1XSQA 2E53A 3WP4A 2VZTA 4AHYA 2YBKA 1JUIA 3AJZA 4PI0A 5DUUA 1AYM3 4S2DA 4ZXKA 3HT2A 2VZPA 5IVVA 4MOAA 2AC1A 3IAQA 2Y6LA 4Y33A 1CZSA 3A0KA 1UZ0A 3P3PA 4XIKA 3S7IA 2KA3A 1JU4A 2ZGTA 3WT3A 2Y6GA 3FJSA 3LDKA 5DPNA 4AWDA 4E27A 5DAVA 1PX4A 2Y60A 4JHZA 1HV0A 1YWKA 5F39A 1X33A 4ARXA 3CDZB 2RS11 5K9YA 3T09A 1WCQA 1WW7A 1AR73 2AH2A 3N3HA 4O9EA 1GQPA 1K45A 1JZ3A 1V6LA 3D3AA 2VW2A 3K4AA 2B7YA 5CFDA 1WLWA 1UYYA 3ZSLA 2Z4FA 5A32B 5CISA 4CRQA 5FKBA 2RJLA 2CSGA 1NY72 3ZYHA 1XNBA 2VBBA 2XJQA 1HW5A 1KGYA 2EAAA 1ASJ1 5HCBA 5I0SA 3CHXA 5FYSA 2HEVF 3ZYRA 3WQ0A 4YW1A 1V70A 3DKQA 4CDQC 4A3ZA 2DVAA 2HWF2 3EQEA 4GB32 3RZGA 4ZZ5A 3POYA 4Y1UA 5K0UA 3B3QE 1VBB3 3ZXJA 3USUA 3T1LA 4PDWA 3KT7A 3D4KA 2YC0A 5JIUA 5JOZA 4IV3C 1V6OA 2C5DA 4W6WA 5FZHA 4IEOA 4XCBA 4FFGA 3VBRB 4XDPA 3BU0A 5C3PA 4MGTA 2ZGLA 2VW1A 1RUOA 4AGVA 5ACA2 3ILNA 4J1XA 3IWZA 5FV3A 2ZACA 5CEHA 1RUE2 2KXLA 5C9AA 1VRBA 2E63A 4KNCA 4WVMB 4YVSA 2VNOA 3DV8A 3I2JA 5FPVA 1QJX2 3RZMA 5JZGA 4HVRA 1LOCA 4QDQA 2LTNA 4R9DA 4AOCA 2VW0A 4B1LA 1XNDA 3ETPA 1CJPA 4ZPIA 2JXAA 4XJAA 5KXBA 4M00A 1DYOA 1YXWA 3AP7A 3ZO0B 2VMEA 2XWJB 1I5ZA 2Y0OA 4ZY9A 4COUA 4FI9A 3M3EA 2XGXA 1IS4A 5IVJA 3RPQA 2V09A 2WS93 4A7YA 3H1MA 2JDHA 4TXWA 4XC9A 4QXKA 1LGCA 3RZHA 1NCQA 1W8ZA 5DXDA 3OY8A 4IW3A 1B35A 1Z78A 4RHV3 2HWC1 4L8QA 3ZXKA 4NRQA 1NE6A 3N4MA 2D44A 3VBUA 1NA1A 3AMMA 4LO4B 4EWEA 5I8TA 3KCYA 1KJLA 4R9BA 4ZU5A 2VG9A 4AFMA 1VRH3 3GM8A 1NG0A 2LW8A 2ZXQA 4M4PA 4RD7A 3FHIB 5HI0A 1X7NA 4I3PA 2YMZA 1POV3 2GDFA 4C1WA 1OVSA 5F3GA 4RYDA 1PIV2 2RR13 5FYUA 4KU8A 5LBFA 1FMD3 1YFWA 4E2QA 2VY0A 1AR91 3IMNA 2WNOA 4LHNA 2QQVA 3RVHA 1AL0G 3K77A 4FAHA 3WP6A 3BOWA 1CJDA 1W2NA 2IXHA 1JOBA 3C7OA 1GZWB 5K4LA 5IT6A 4XUTA 4WVZA 1WW4A 3AMPA 1QGLA 3M8LA 5A3MA 4JKLA 3KGLA 1IHMA 2BW8A 1UY0A 3AMNA 5J36A 3SMHA 3BI3A 1GLHA 1XC6A 4BQ3A 2BBVA 4MLOA 1FT9A 3O1VA 2BQPA 2OIIA 4OUEA 1YEWA 2IXJA 2ZMKA 3ZFEB 5IHRA 2D6MA 1TEIA 2PLV1 1W04A 2MNGA 2V5YA 3OBAA 4HVOA 3ON7A 5JMCA 2WNVA 3LIGA 3C7EA 4HKWA 1SMVA 3LB9A 3ZR6A 1OUXA 1EPWA 4P9JA 2YXSA 3VDDA 1RYYA 3T3YA 5FXWA 4RR3A 3I2GA 2RM22 2NZ9A 3OSDA 2BUKA 4HPKB 4Q4W1 3BKZA 3WNPA 1BYHA 1OPMA 4ATEA 5KXCA 1VBE2 3BIEA 1O8PA 4Y4YA 1GP6A 3AVSA 3FLTA 4XUNA 1RL3A 2JJ6A 2WQ4A 4JDOA 3SITA 1H8VA 1BVVA 2EA7A 2ERFA 5LBCA 1O4YA 4ZS2A 2QVSB 2RDQA 2EALA 1OKQA 3E6BA 3NJYA 3OG2A 4YG3A 1ZRFA 1YIPA 2PELA 2V73A 4MXWA 2HWF3 4GB33 2A3WA 5L9RA 2ORXA 3C7GA 2EIEA 1S0DA 4HMZA 3AX4A 5E1RA 4MGIE 4XCAA 4YZ3A 1HQLA 1IG0A 1ZYBA 2PHLA 1CN1A 2X09A 3PUAA 4LBNA 4QPYA 1DYPA 5L7OC 3NV1A 1X8MA 2O8OA 2JEMA 1ZRCA 5FZ7A 2JICA 1JZ2A 2E32A 1XE8A 2JE8A 3SH5A 4ASKA 3IDAA 5FZCA 3RZZA 3RWKX 3J4UH 3GJBA 5DZEA 1RUH1 3UYJA 4NE9A 2Z69A 4FCAA 4B4PA 3NRUA 1VMJA 2ZGRA 3ZYJB 3Q8AA 1YQ2A 5HCAA 4BXFA 1CAXA 5ABJC 1SEFA 5JXHA 4RQPC 2D93A 4XEZA 3ZPOA 3O7OA 3U78A 2BDRA 3ABZA 2NMNA 3TRSB 4YSFA 2QCSB 1GMMA 1RUF3 3EXUA 4K21A 4QPGB 4R4ZA 5FXXA 1Q56A 4L92A 4CDXC 1QJX1 1MR5A 2MEV3 1BEV2 5I0TA 1JZ8A 5FYZA 2BTVC 1COV1 3KQ4B 4NHKA 4BWOA 1CIYA 1CAWA 3DPRA 2GC1A 1VAKA 5ANNA 2RVAA 2VGDA 4PIZA 1BCXA 3POEA 4FPYA 4K40A 2P3JA 2ZGOA 3P5BA 2OT7A 4X8PA 2XPJA 2Q4SA 1XPWA 3I97A 5EV7A 3ACLA 3LPGA 3ZYGA 1Y9QA 4K1ZA 5J98B 3I2FA 3M70A 5LASA 1GOHA 2P17A 2ZEZA 3ES1A 3SCFA 3RS6A 2RS52 4RS5C 2AEZA 1ND3C 3WUCA 5T5JA 5BY5A 3POSA 3ZIWA 4JGYB 1L7RA 3J7MA 4CP9B 4QPIB 1CIWA 1FNYA 4PIYA 1A3KA 1PGW2 1JTZX 3ZXLA 3IDCB 5FYIA 5C4WA 4PF5A 2VUJA 3CJIA 3IBMA 1OF3A 1OI6A 4Z2WA 1JOPA 1JYCA 4FPEA 1G9AA 4HK8A 3OF1A 3VUOA 2XKPA 4BQ2A 5FY8A 3H0OA 5FYTA 4MUVA 1B09A 2VPVA 1UYZA 5FPZA 1PM4A 3TNQA 1ND2B 3VBOA 2VBPA 1PO11 2WNUC 1XE0A 1ZRIA 2HEWF 2UU8A 3J7HA 5AVPA 2D3RA 2JG9B 3S30A 2D7FA 5A3LA 2DUOA 1IPJA 1REDA 1WCSA 2VJXA 1EV11 5LCWL 1I1EA 2HWE1 3FBYA 3NVCA 3VBHB 4FP2A 3DXTA 1W2OA 4H2AA 3BN6A 1LCLA 1BKZA 3A4UA 3BCWA 1SLTA 3JXSA 1JYXA 1NXMA 1L7LA 4GJZA 2CYFA 1UMHA 2B46X 2ZGNA 4EN7B 5IWFA 2BFUL 3OEAA 1YO8A 2WAOA 3H7JA 3WDWA 4Q4Y2 3RYRA 3MW3A 1N3PA 4WBBA 3PIJA 4PLNA 1QJU3 3J8F1 5A3UA 3LZZA 1G9DA 2AGSA 3UGGA 1YJKA 2B8MA 2XBO2 1K12A 5LBEA 1ULEA 2D6LX 1RUJ2 1EYBA 4GULA 3IAPA 2A3YA 2P6HA 2WWJA 2VZVA 4DS0A 4W50A 2XHNA 4YM0A 4EWAA 1D4M2 5BNPA 4D0QA 3ETQA 1W3XA 2VQUA 4XURA 4DFSA 1QJY1 1VBE1 4Q4X1 2VOWA 3LE0A 3HBKA 4IGQA 4IV1C 2R0FA 1WUVA 4DMIA 2HWD1 4XF1A 1Q8QA 4CE8A 2ZX3A 5BNNA 1GZCA 1T6GC 4LMFA 1OD5A 2OXBA 1HB1A 2VZ3A 1POV0 4BZ4A 4WM7B 2HEYF 4NJ4A 1HJGA 3N9NA 1GKBA 2K2SA 3MHZA 4L99A 5DG2A 4ORFA 3TN91 3AFKA 3KZ4C 5IK7A 1MS5A 2R061 3ECQA 3OYWA 5CB7A 1QHDA 1W6NA 3QD6A 5CFCC 1UZZA 3H8OA 4CP1A 5LY1A 4H7MA 4IE0A 2O14A 1XOYA 4MYEA 3W5NA 1ZA7A 4XF3A 4E4ZA 3K46A 3WR0A 3QLQA 4NPLA 4XF9A 4AI0A 2JE7A 1CR7A 4LJHA 2PQSA 2JG8B 3I59A 4LNVA 3KMHA 3WG3A 2Q8EA 1REFA 4COWA 1RC6A 2J1TA 4DXSA 2XUEA 1MS4A 2X5IB 1GNHA 2D6KA 2WZR2 3ELNA 5E89A 2HLEA 4ES9A 1IZ3A 2IFWA 2JKXA 4XFIA 3VKMA 3GBGA 2AZ5A 1OUSA 4Y26A 2DU1A 2YZ4A 2VQTA 1A8MA 2W1UA 1C1LA 4I3GA 3TEXA 4NPRA 1LHOA 1LODA 4EN8B 1PVC1 2A6XA 2ADDA 2WBKA 2F4PA 3RQ0A 1N1VA 5A70A 5F7UA 2EICA 5C8CA 1OFSA 4QXCA 3U75A 2DVBA 1H2KA 1ND3B 1PVXA 4P9IA 4MZUA 1NX9A 1IS3A 3WCSA 3P6BA 2XL9A 5F5IA 3USUB 3TEYA 1HRV2 3ENRA 4N43B 4PDWB 4OHZA 3U07A 3ACHA 2RS53 4IEYA 4META 3ZPYA 4BLJA 5C6CA 1ZZ6A 3K75B 4YW7A 3GBWA 1UCXA 4RA0A 4PT6A 4I30A 1AX1A 1M4WA 4LO8A 1W8NA 3H1YA 1H8TC 5IVEA 3ZSJA 4B3NA 3R4SA 1WGPA 5CKMA 5JDBA 4FTBA 1GQHA 2D6NA 1MS0A 4MX3A 1F5JA 4YM1A 3KHBA 5DQ0A 4XFCA 2DF7A 1FOD1 2VZOA 2ZGSA 4X6QB 1XYOA 1OOPA 5JPNB 2YHJA 1AJKA 1Z7S2 1MVEA 5FP4A 1W9SA 1KDMA 1WMDA 3LOBA 3KF3A 2VMFA 4QAWA 3PUSA 2BZDA 3PDQA 3ZYPA 3BTXA 3WNKA 2EIGA 2QDNA 4CEYA 1NQJA 2ZGPA 1H9WA 5APAA 5F9TA 2QQKA 2GN3A 3BVCA 2WZPP 1ENQA 1NCRA 1KITA 1VBC2 4NIHA 5KC6A 2GSYA 1UU6A 5BNQA 4AQTA 2VOKA 1ENRA 1LHWA 5E8AA 5FQ0B 5JPMB 5EYXA 4Q4Y3 2P1BA 5FMCA 4XAEA 1CAUB 5A7NA 3T08A 1AL21 4I09A 3O1RA 4A6OA 2W9XA 5JLVA 1N1YA 2VM9A 1DFQA 3IM0A 4AK3A 1R1A2 2XBO3 2PTMA 3N7LA 3HPNA 1T6BX 1RUJ3 2OW4A 4BM8A 5CKQA 4DXTA 2R30A 1VJ2A 4ATFA 5FZEA 4YW6A 3MIHA 5A7WB 2NQYA 4FPLA 4QKNA 4QB1A 1YLLA 1QNWA 2IVIB 1ULDA 3MIFA 2D43A 2VH9A 3RNSA 3VBSC 1BBT3 3MIGA 2YC2A 3ZKUA 4NRPA 4AGRA 3U4XA 4NHMA 1WLTA 4OHYA 2J1EA 4NUBA 4UW6A 2E51A 2XJTA 1RUD2 5HXVA 4DOUA 1O8SA 3NJXA 4AYUA 1UY3A 4SBVA 2DYCA 2QQNA 4P00B 2WZ8A 2R041 2WFF2 2DCKA 1YHFA 4ZS3A 2YFUA 1TMF2 2YGLA 3B7MA 4IEUA 5EJZB 1XNKA 2OZJA 1DQ0A 4MV2A 4CDQA 5FZ8A 1CWPA 2W2IA 1R083 3PU8A 4COZA 3AP6A 4D7TA 1QJEA 5G05L 2OA2A 1PNFA 1OA4A 1RHI2 3AZZA 1PO22 1Q8PA 4QM9A 3J7NA 2A6VA 3MF9A 1MQTC 1BQPA 3NNMA 4K9SA 4LBKA 5T3NA 4IV3A 1UZVA 4UBGA 3WF0A 4UFIA 5FZMA 4UBHA 4Q4V1 3W21A 1YCIA 2SBAA 1UU4A 3FN9A 1UX7A 1PX3A 1AR83 2CHHA 2WO2A 4H7LA 3WF4A 4LTAA 1UIKA 5GZCA 2OQ7A 2OX0A 1UOGA 4KBBA 3JD73 4RR3B 4QQLA 4KWLA 4CPBD 2WLQA 5KXEA 3CF6E 1RUI1 3OBRA 2IUWA 4JAAA 2A5ZA 2B9UA 3UKTA 3IDBB 2J1VA 5AFEA 1AJOA 3D0SA 3LF7A 4EN6B 1OLQA 3AXEA 5FZIA 1O4ZA 1V6JA 1OURA 3J7LA 2OVUA 4UT5A 2W08A 3KV9A 1UO9A 2RDNA 1SBEA 4QQHA 2DUQA 2GP5A 4XYXA 4YM3A 2VZ1A 1TVGA 3J26N 1W6QA 1AYN2 1DBNA 2JDUA 5K8SA 1W8OA 1YUDA 4N53B 5LW9A 4AQ6A 3S57A 1HRV3 4AW7A 2LS6A 4PCRA 4CDUB 3ZFGB 3Q8CA 3GZUC 4DNYA 1VBB2 3R0RA 1MS3A 4CUAA 1OF4A 5AC92 2VQAA 4XDOA 1F4AA 1I9RA 1HRI3 2D6PA 2CL2A 2ETEA 5DUXA 1GSLA 4IEPA 4B7EA 4DXZA 3WEZA 3BTZA 1XNCA 1R091 3WD5A 2WSVA 2PHDA 1US2A 4BIFA 1WW6A 1CESA 5GZEA 3LKJA 3GZEA 1E57A 1RITA 2E26A 1SBFA 2JWPA 3FWEA 3LEKA 1S2KA 2C0ZA 4Q8LA 4YRDA 5A6QA 3VBRC 3OOXA 4LA3A 1LENA 1UZWA 5FP8A 1V6MA 1CAXB 1AR63 4S2HA 2PXJA 1N47A 3N9QA 1F31A 2D5HA 1MZ6A 4XJZA 3VKFC 3FHAA 4D6QA 4QM8A 4NOTA 3E6CC 3I3QA 1ZVFA 1HN0A 4XQWA 3WDTA 5FJHA 2HYXA 4AI9A 1S0JA 1RVF2 4P5HA 1RB8G 1C28A 4OULA 3OB8A 1X8EA 3VKOA 1VBC3 4PF1A 2FQPA 4JC1A 1ZBA3 4IQPA 3CBNA 5IUQA 4IGOA 3VBFB 1QOTA 5GLVA 4XUOA 4L9BA 3GCXA 3MLJA 3LOIA 2HWB2 1K5MC 1SPPB 1Y9GA 1C57A 1PGL2 1IKPA 1LECA 4AL9A 1C8M3 1UAIA 2P3YA 3WG1A 4COVA 2TBVA 1ALYA 5IK4A 2UWCA 3SLIA 4AI2A 4JRAA 2NN8A 4LKFA 5F1RA 2WT2A 3ZMOA 3O1MA 5FMOL 1DQ2A 4NAOA 1JZ5A 2FCTA 5C5UA 5DDJ1 4CTEA 1C3HA 1K3IA 3VHPA 2K9ZA 1ZREA 2XWBB 1VRH2 2W95A 1MEC3 1LR5A 3NJVA 5C3QA 1EY2A 2Z42A 2WWUA 1RUD3 5KHIA 1TME3 1UXXX 5LA0A 2BNMA 5FKCA 1F15A 3KB5A 1VB2A 2RR12 3B01A 5GJ6A 1JZ7A 3VZMA 1S4CA 3KT1A 1W2AX 3NAPB 1FPN1 1FI2A 2CDOA 3DGTA 1GQGA 4JQRA 4LBQB 4FVVA 1TMF3 4X6RB 4JDMA 4RN5A 3ZXEA 1SHWB 1VBD1 1V9U3 2XHKA 4OMDA 4NPMA 1O91A 3CZUA 3HD8B 4FXGB 5JR2A 2VNGA 3WSOA 1AX0A 1QXJA 2OZ6A 1URXA 2VL4A 4PJYA 5I8SA 1RHI3 1DQ1A 1PO23 2VMIA 4J6GA 1C4RA 5E6HA 5FMOS 1AXZA 1UIJA 2PMWB 2ZS6B 3WDUA 2WQZC 5L9BA 3QH7A 5EP9A 3ACGA 3WF1A 1CD3G 3E1F1 1PK6B 4QQ2A 5T5OA 4AHZA 2YROA 4PLOA 2ZGKA 1UY1A 2Y38A 2FMDA 3ZFEC 2GNBA 1ZBE1 3MLLA 1AYM1 5IATA 5JAXA 4KMQA 3WQBA 2YPJA 5EHDA 4AR2A 2R071 2DU0A 2YPDA 4FPJA 4KWUA 5F5AA 1O5UA 1W9FA 3SEPA 4N8MA 5ABJA 2E31A 3CL1A 2YU1A 2FDHA 1UYXA 4RQPA 4CZSA 3I2HA 4CXXA 5FLHA 2D5FA 4FOVA 4Q8KA 1AR71 4AEDA 4YZ1A 1J1TA 4AVBA 3AKQA 5FO9B 2BGOA 4KI5M 3LIHA 4XBNA 1AYN3 3UK9A 4CDXA 4GWIA 4OI4A 4AI3A 1ASJ3 1QNYA 2DVDA 5F2WA 1JI6A 5EZWA 1QXRA 3T2OA 1H0BA 3CIHA 3DF0A 5AC93 3E5XA 3OD4A 4M4RA 4DZGA 5JMOA 5BNOB 4COYA 2V4VA 2WQ8A 4MXVA 2JD4A 4BQWA 1U5XA 1W6PB 3LDRA 4LA2A 2DURA 1NLSA 1O4TA 3SHRA 2ET7A 1IPKA 2C9KA 3A7QA 3OYWB 4N9HA 1LB2A 2OQ6A 1VBB1 1GUIA 4E4HA 4HKLA 1DQ6A 2XJSA 4AVCA 4AFCA 3S0MA 4FSJA 3VZNA 4RS5A 3UKVA 2IZWA 1WCDJ 1RMU2 2X53S 4O7XA 4XJUA 4CDWB 2UYAA 2DBNA 3EB7A 3BUCA 1W9YA 4WM8B 5FMDA 3MUY1 5A6ZA 3O1PA 2R16A 1RVF3 5HCFA 2QDRA 1W06A 1NKGA 2P3IA 2JDAA 4I02A 1RUF2 4QKFA 4PLMA 5FXZA 4BH9A 2DDUA 2WNEA 1K5MB 1Y7BA 3ACIA 4UFKA 4XXAA 3CNAA 4QD2A 1LTEA 2MEV2 4QQOA 4QPGC 4OHWA 5FRAA 3VN4A 1QH7A 2EXJA 1RUC2 2HWB3 2WNUA 2LM3A 3AXDA 3PTRB 3OGRA 1LESA 3JU9A 1W9WA 1Z0HA 4P14A 2ORZA 2GH2A 4LBOA 3MGUA 4F8AA 1A6CA 1E5IA 1G7YA 2WC2A 2ARCA 2WS91 3SXWA 3NMBA 1G8WA 2W1SA 2Y6JA 2XLAA 1MZEA 2JDZA 3ZN6B 1BMV2 1YNAA 5FZ3A 1PGL1 2E7TA 3VKNA 5J09A 1OVPA 3JUUA 1WD3A 3PLQA 4CCJA 1IQAA 4Q0PA 5JI7A 4RHV1 3OUIA 1W3VA 4FPOB 5JUVA 1CAVA 2I74A 1QOOA 2IXCA 3N36A 3WVJA 4AE2A 4RGGA 4IESA 3KQRA 3V65A 2RDRA 1YQ6A 3I2OA 3VD9A 3MV01 5F6LB 2QQIA 2ENRA 3F2ZA 5CYYA 1KFUL 3OPWA 2A6WA 1UZYA 5A7SA 4JGYC 3U11A 3L2HA 3OD0A 1SLAA 2EIBA 3H8UA 2YDEA 4QPIC 4WV8A 1VALA 2ZBJA 4FQZA 4QT6A 3O1SA 4LUKA 3C7HA 2G9GA 2BWCA 2AEYA 3VL9A 4P9YA 2NLRA 2FDJA 5FYHA 1N1SA 5FZFA 2RR11 1NQDA 1FMD1 4XMIA 4UOJA 2F6BA 4IV1A 2W87A 3NNFA 5ISLA 5A33A 5DAPA 3MF6A 1ND2C 3FL7A 1JU3A 5GLWA 3VL8A 2A73B 3P3NA 1A34A 5FPUA 1KDKA 2JG9C 4CCEA 4AAXA 3HMYA 5D8AB 3INAA 1DCSA 2J7MA 1JYNA 4IL7A 2D98A 3TN92 3R05A 3VBHC 4SLIA 2BOIA 4DUVA 1FV3A 5C7GA 1LOGA 3S5QA 3KCXA 3DECA 3N7JA 3ZSMA 2OPWA 4IE6A 2QQPA 1APNA 4IETA 1GP4A 5E88A 1EUTA 2B39A 2NPIA 1H2NA 4D94A 2CWMA 3ALQA 4MHRA 4PI2A 5B2GB 5CFCA 1D0GA 3ILRA 4Q0VA 1QJU2 2RS33 4WZCA 3ZXFA 2UY9A 3LA7A 4QB6A 1NUKA 1L3JA 1DLLA 1SCSA 2Q30A 3B00A 3W59A 3RFRA 4YFWA 4TZDA 2QQLA 2CU5A 3PMEA 4UYBA 4Q4W3 3AKPA 4UFHA 3FLRA 5C3SA 4PQQA 3D82A 3LD8A 4LK6A 1S0GA 3EYPA 3WZ1A 1VAVA 4QX7A 5JSRA 3LFIA 1NY71 4TN7A 5A80A 5H9SA 3I7DA 2VOVA 3WF3A 4U36A 1BXHA 1PNGA 1ZX5A 2YB7A 4UF0A 1OD3A 4Q5OA 2QQUA 4RGKA 3SC7X 4BQYA 3MLKA 4M3CB 3O1TA 1S55A 4B29A 2HWF1 2P34A 4GB31 1O7FA 3OBTA 2WR9A 4BK5A 2ZX1A 2R32A 4WM7C 1GWLA 2BYVE 4FFHA 4L11A 3PIGA 1XNAA 4FOWA 4G4FA 3OUJA 4Y22B 5LATA 4CXYA 1O3TA 2BU9A 3JQXA 1GR3A 4LEJA 4C90A 1RMU3 3AMHA 2H0VA 3RRDA 1NLQA 1VB4A 5L36A 4DEQA 2PHRA 5FJKA 5F5CA 1H8TA 2BJSA 4RGAA 3AVRA 2YY1A 5ACA1 5A1AA 1RUE1 4M3CF 5GKAC 1Y43B 2R1BA 2JG8C 2JDNA 3HJRA 3N9PA 4OYUA 5FO8B 1RIRA 1RUC3 3BPSA 2X5IC 3MBWA 1JS9A 3U14A 4NIAA 4FTEA 1F2NA 4XETA 1KD7A 2VUAA 2A75A 1YFYA 2TEPA 1LULA 3POBA 4V2VA 4D6RA 4CVUA 4QKBA 3HQUA 1FAYA 3BU7A 4AQ2A 1ZM1A 3WXPA 5JSOA 3DKWA 3WV6A 1LEMA 5HBAA 3MO4A 3I2DA 4BHPA 1LHUA 4LOSA 4P9WA 4XFFA 1UPIA 1QWRA 2XUMA 3O0XA 3KWVA 1IG3A 1S1AA 4QWNA 1N1TA 5FZOB 3KM5A 4K8FA 4LHSA 5GZDA 2JB4A 1MS1A 2LALA 4LBQD 2QZ2A 1S0EA 3V0AB 1ACCA 2LROA 4N43C 4PDWC 2BVVA 1VMFA 3FLPA 3KSCA 5FPBA 3DCQA 2W52A 5IYYA 3IPVB 4Z92B 1G9CA 1LHVA 5FO7B 3WHTA 4ITCA 4P02B 2WA3A 3KD4A 2WDBA 4BQ5A 4ZKTB 4LT5A 1U5YA 4GH4B 5IW0A 5JOXA 2CGPA 1QJZA 4XW3A 5CBLA 5FZGA 5FOJB 1O59A 1W0OA 4YW3A 2BP6A 2J1UA 3HEIA 2CGNA 3VBSA 3BYWA 3RG0A 1PIV1 2DV9A 2FZ1A 4YG6A 4AVVA 4Z1VA 1RUNA 2ZABA 1R1ZA 3W20A 2QZ3A 4R4XA 5JR7B 2BPA2 3MW4A 1QH6A 1GU3A 3HWJA 4U2AA 4XMAA 4XILA 2RMU2 5AFBA 1PO13 3WG4A 1LNSA 3GYDA 3QACA 1J3PA 1FNZA 3MUZ1 3TN93 3ZFFB 2VCCA 2XG3A 5JXJA 4Y5Z0 2HWE3 5A7QA 2I45A 1DG6A 5T5PA 3A0NA 3IIAA 3ZYIB 4XFAA 4G3YC 1YIFA 4JCKA 4URAA 4GMP1 1J3QA 3JB8A 1VR3A 4BU2A 3GZAA 2BRTA 3M3IA 3V0BB 4UFMA 5GZGA 3T0DA 3IN9A 3C2UA 2J1RA 4LULA 1MQTA 4X8NA 1W6OA 3LFMA 1J84A 1SZBA 4EZ4A 3WLUA 1B35C 4OHVA 4CSWA 2ZAAA 4QX5A 3ZX7A 1QKQA 1RXFA 4Y3OA 1NZCA 1X50A 2R0HA 4HN1A 3J8F3 4CP0A 4PQ9A 1BHGA 3TAYA 4JGZB 1A78A 1AHSA 2XLFA 1QQP2 4CEWB 1UL9A 1C8NA 3IZOA 4HVQA 1US3A 3LEGA 1QJU1 1W99A 2AACA 2RM21 1YQ5A 4QGLA 1BBT2 3C7FA 3SCGA 2EXKA 4YFZA 5G04L 5FZAA 4OI2A 3Q8FA 4QGNA 2Q8CA 1VAMA 4Y20B 5CNAA 5T52A 4AF9A 4YVWB 5FYYA 2GNDA 3MIDA 1QJY3 1OH4A 3PL0A 4D69A 4Q4X3 2BFUS 1SBDA 1OQEA 5F8PA 4XF0A 3VD4A 2PAKA 5A32A 3AYDA 2J22A 3GGLA 1Q8SA 2DVFA 2HWD3 1ULOA 4LIUA 4QX1A 2CY6A 1R082 4A45A 4XAAA 2UYBA 1YC61 3OTFA 4LPLA 3SNMA 1P8JA 4B7KA 1DGLA 3S7EA 3U4SA 3UGFA 4CCCA 4Y5SA 2BEOA 3PTYA 2YGMA 5FP9A 5T50A 4J1WA 3RDIA 3SCHA 1DGRA 4DRVA 1UW8A 3RSJA 1XU1A 3U1XA 4C0HA 1YFUA 1Q8OA 1LU1A 1OBNA 5EFUA 1IS5A 1NLRA 4K3UA 4LLFA 1W03A 2VE1A 4YYOA 1AR82 4G9SB 2A3XA 4XBQA 1CQ9A 3GNEA 3VHRA 1WZXA 5CFDB 4KBZA 2PYTA 3JD72 1UOJA 1VIWB 2ZMNA 5GLTA 1FX5A 4CXWA 2W68A 1SLBA 2QQMA 4EN0A 3WNOA 4RR3C 5FWJA 4WVMA 2XXZA 4YNIA 1PMHX 1ODNA 2GNMA 3NV2A 4PIXA 3ZOIA 1OXCA 2K46A 2OPKA 4UAPA 3H8RA 2Q0AA 4XUQA 4OUMA 3M3CA 1BEV1 1GFF2 2ARAA 2SLIA 4XZPA 3UT0A 2R1DA 4RFRB 4GWMA 2RE9A 2F17A 5K0UB 1I5PA 4OUSA 1PVC3 4RL7A 1W6MA 4TWTA 3UJOA 1G6NA 1K5JA 4AFAA 1WCUA 1DQ4A 5FZ9A 5LK7B 2QQWA 4LE4A 2YU2A 2CNAA 2ET1A 4N53C 5FR3A 4Y1XA 3BTYA 4CUBA 1UD1A 1HRI2 5T55A 4OQ9A 3HNYM 5J96B 1XQNA 3BTAA 1QMJA 3G6JB 3ZFGC 4CDUC 4EQVA 4D7YA 1JODA 1C1FA 4HANA 4MGSA 1MS8A 5JWPA 3PHMA 3EO6A 4TYSA 4FFIA 5FP7A 3KLSA 1EAH2 5C9AB 1H6YA 2RS51 4YVSB 4MADA 3LCPA 1UOFA 3LEMA 2OUJA 1HN1A 3IKWA 2CAVA 4FPHA 3VGIA 2XMLA 1RUG3 2ID4A 5JZGB 1PGW1 1AR62 2E33A 1UU5A 1WMEA 1QJFA 3KT4A 3X29B 1PMIA 1H9PA 1UMIA 2PAMA 3PUHA 4GA9A 3R6SA 3RI9A 4ZXEA 1HB4A 2NMOA 1OMIA 1JMUB 2RMU3 5FBJA 4IUGA 5L19A 4JX0A 1UX6A 1OPOA 1NT0A 2Z79A 1IQDC 1WMXA 4KG8A 1YJLA 2J42A 5DUVA 1H1MA 4NIDA 5IJRA 1HJFA 4QHOA 2CTVA 4LUMA 4AAPA 1ZBA2 3LEIA 1ULGA 4XUPA 3NWKA 5FBZA 1NCQB 2P6CA 2XH6A 2XKOA 3OY8B 3VLBB 4F7ZA 1B35B 1GZWA 4A44A 5F3CA 4NO4A 4XTPA 5CG8A 4S2GA 4XTMA 3UESA 2JIGA 3VBFC 1OQ1A 4Z2AA 1DIWA 3HAGA 5EQUA 5A3NA 1C8M2 2P5BA 4LK7A 2WZEA 1GZ9A 4DUWA 1HXS3 5BYNA 1AL23 3VBUB 1WW5A 4E9KA 2WN3A 5KHHA 2J1SA 1NA1B 2VOXA 3D0JA 1FV2A 3AM2A 4AI1A 3KV4A 2Q1FA 5KHGA 4Q4Y1 1QQP3 1D0HA 5FREA 1D2QA 3ZFEA 2FMYA 1IKQA 3POFA 1DLCA 1D7PM 5F32A 1U5IA 4ZONA 4JRLA 2XBO1 5JCTA 4ZU7A 1MEC2 2Y8KA 2VMDA 3WW3A 1RUJ1 2DCTA 1U5ZA 2IVJA 4E4DX 2VUCA 1CGPA 2JD9A 3FBMA 1TME2 2ILMA 1G86A 3I3BA 4LKSA 4NHXA 2VZRA 1MS9A 4A7ZA 1W8TA 3B5LB 2ZGMA 4GD4A 2ZEYA 1D4M1 4HPKA 4AFBA 4HFSA 1BK1A 2DCYA 3B94A 2RDSA 3ST7A 3NAPC 1GWMA 1XSRA 2W46A 4EYUA 3RZKA 1V9U2 5FY4A 3N7MA 5FTTC 2ZHMA 2Y34A 3HQRA 1GZTA 2A70A 4TSVA 5FY7A 3JBG2 1VBA2 2GU9A 5FK8A 4BOWA 2VQ0A 5F6KA 4LO6B 1W39A 4ET7A 3ZKYA 4I0AA 5HV0A 2ATFA 5FZ6A 1HV1A 1TG7A 3I4IA 2FDFA 2WAAA 1UKGA 5FYVA 4NHYA 2WNVB 2I07B 1SCRA 2I2SA 1VLNA 3CZJA 5GLZA 3ZN4A 2E9QA 1UF2C 1ODMA 1RTVA 1HQWA 2AENA 3VDDB 1DZRA 1PK6C 1T2XA 1CPNA 4YW5A 4Q4V3 2WIIB 4B8EA 3L9JT 3ITQA 2WYSA 4QX2A 2W91A 4GALA 3H42B 2R49A 4UFLA 1UKRA 2DTWA 3VV1A 1F4HA 1GICA 3H50A 3HT1A 5I0DA 4ZHNA 3IT8A 3T4VA 1LGBA 3RYPA 3T30A 2WZR1 4HSJA 4EV0A 4MXWB 5J7MA 3GHNA 2ZTNA 2EAKA 2PFWA 4FFFA 3AMQA 4AEMA 5FYCA 1ASJ2 1TNRA 3PMSA 4QPGA 4P5YA 1E5HA 4YZ4A 3UJQA 4FT8A 3QOPA 4UF0B 2MPFA 3N9OA 1L7QA 4HLTA 5FY5A 3PU3A 1XJAA 4P9LA 4XHBA 3H1WA 1TQ5A 4QKDA 3U0ZA 4UXAA 1S0IA 2GZWA 3VD3A 4AEKA 4FP3A 4INDA 4KU7A 5FPAA 5BNOC 2WKKA 4Q0UA 5FZ0A 4DY5A 4D6SA 4HSLA 1HRV1 3OPTA 1EAH3 3THPA 3RMYA 4CPBA 3HNMA 1SLIA 5I91A 4DIQA 1WCKA 3T0AA 5DAXA 3ZIXA 3H3LA 1Q8VA 3U37A 4AVAA 4IE5A 3RZJA 2DBIA 3AKSA 4BB3A 1CVNA 1X9PA 3LQCA 4Y24A 3HVDA 3OBZA 4NROA 5E16A 3O1OA 4W8JA 1AXYA 4ONUA 5CG9A 1ZNPA 4O65A 3HBZA 2PHUA 4AI8A 4UW4A 5FAXA 1V6NA 2BGPA 2JDPA 4JGYA 4CDWC 4CP9A 1DU3D 3A23A 4QPIA 3URFA 1Z7S1 4WM8C 2WUHA 1M06G 1BK0A 5JI9A 1JW6A 1LOFC 3PNAA 4D7SA 1Q3EA 2EXHA 1VPHA 1D2SA 3E97A 1BVP1 4IGPA 2GC2A 4BQXA 1CAWB 1OA2A 1W8WA 3CO2A 5IFPA 4O9GA 3DPRB 3RYKA 5LRSA 3DL3A 4QHBA 5EJ3A 3NW4A 3PUIA 1E5SA 4EN9B 4BQ1A 3DEMA 3CU7A 3VDCA 4W65A 1ND2A 2JDKA 1LHNA 4HG6B 2YV8A 1DZTA 3HN3A 3JZVA 2JG9A 1VBC1 1DYKA 2D6OX 2E6VA 2XDVA 4YWAA 2G4IA 5D1IA 3AZYA 5FWEA 3WP3A 3VBHA 4LHKA 1AF9A 2HWC2 3Q8BA 3K4ZA 5LRRA 1R1A1 1ZRRA 4QXHA 4UW3A 1ULCA 1HKDA 4BA6A 5F37A 3W58A 2ARBA 3CEWA 4FQ4A 4Q0QA 2B4KA 3QBQA 5LZ6A 5JOWA 1DHKB 1SDWA 3IMMA 4A3XA 3GBFA 5C4WB 5CAZA 3HIFA 5DMYA 3CJIB 4C91A 5FIXA 1HX6A 3VD7A 3O14A 1ZZBA 4YW4A 4HKOA 3S6PA 1XNTA 1GNYA 3RMXA 2XB6C 4HBNA 4N7IA 4AVSA 1IPSA 3MIEA 2QBXA 4QGMA 2ZHNA 3ME2A 2VD7A 3MZHA 2L9LA 4I01A 5FZKA 5CZKA 1O3RA 2R6QA 4XJ9A 1FPN3 3VBOB 2HJIA 1AR92 1S0FA 4NRMA 5A3TA 3F95A 1RUD1 1OOPC 2QFEA 3JBG3 1TE1B 1VBA3 4GZ9A 4YGDA 3WX5A 1UOBA 5D2AA 4YGCA 2FDIA 1IOAA 1VBD3 3EMRA 3M1HA 5M0TA 4QMAA 1XYNA 2K0GA 2Q1ZB 2WFF1 2GALA 1OSGA 1TMF1 4XXPA 5L7OA 2KR2A 1W0NA 4MHUA 3BIWE 2JDMA 3H3UA 5LK5A 2ZGUA 3POJA 3WF2A 1H1IA 3E5QA 3TOJA 2WABA 1RINA 1RHI1 2VCMA 4WM7A 1PO21 2WRAA 5D8AC 1QEXA 3AC0A 1CZTA 1RXGA 2XQXA 4HN0A 5HPOA 2PLV2 2BERA 2VU9A 5EXOA 1V0AA 2RS13 4XACA 3O1UA 2ZA9A 1TZOA 1ZBE3 4MVTA 2O8QA 2RJKA 1YRZA 4AVTA 1NE4A 2RS32 1WWYA 3CJXA 4MSVA 4YGBA 1W0PA 2R073 2VC9A 2A71A 2XVLA 1YI9A 3POWA 2QQJA 3G7DA 4LE3A 4Q4W2 4BMBA 5BNPB 3AP5A 1Q5OA 5A6XA 3NKTA 1WKYA 3PVBB 5IAVA 3ZDSA 2JG8A 1XB9A 5J48A 1WA4A 3L2YA 2Y6FA 2X5IA 1D4VB 3ILFA 4CU9A 5BNNB 5GALA 1YI7A 2JKBA 2XJRA 3I2IA 4N7UA 3POGA 5I0UA 2H6BA 2XVKA 1AYN1 2QJVA 5KHKA 2XJVA 4LIVA 2LUWA 4NIIA 3ZYFA 3TNPB 1SLCA 4D3WA 4A41A 1U12A 1IS6A 1DP0A 2JE9A 4GKYA 5TSWA 5A7PA 1DGWX 3UL2A 2GN7A 2Y64A 3KV6A 1GANA 3LWCA 1W6NB 3AK0A 5AC91 5AVAA 3UNPA 4JHTA 4OFGA 2ZX0A 2B45X 2OUHA 3VDBA 4NIGA 1ND3A 3NV4A 2G9FA 2WN2A 4E8DA 3RZLA 1LRHA 1RUH2 3MIBA 4N43A 4BCUA 2FDKA 4UI9L 2TUNA 3WDVA 3WW2A 4F83A 3VZOA 3I59B 2GC3A 3MPBA 2PHFA 1JXNA 2VZSA 4BMEA 4NMIA 4AZZA 2FDGA 1HIXA 2VUDA 2IWGB 3JCIA 4A42A 3TEWA 4E8CA 4PBOA 2ZOEB 1KS5A 2BNNA 3THCA 5I93A 2YFZA 1Y4WA 2BGCA 2V4AA 2ZEXA 3SH3A 2AREA 2VTFA 3ES4A 2QKDA 3ZDVA 4CUGA 4NHLA 1RVF1 3Q8EA 4M0HA 1E5RA 2D3PA 2X10A 1G9FA 5IVFA 1S2EA 4QU2A 4CCKA 1COV2 2W94A 5C8CB 2GH8A 5L9VA 3GJAA 2B42B 2D3SA 2P2KA 4AEJA 3OEBA 3LDBA 4XFHA 5C3RA 1W6MB 2VCBA 4OCTA 4Y1VA 2HWB1 1YQCA 2HWC3 3AZVA 4XDQA 2W47A 1K42A 2Z2SB 4I2OA 4K20A 3ZSEA 4H55A 1PMJX 2WYFA 2GAUA 3LPFA 1FATA 5LA2A 5IVYA 1GNZA 5FQ0A 4CCLA 5LEJA 1AVBA 3EHKA 5FZBA 5FUPA 1CAUA 3RWNA 2Q1MA 4DINB 3VKLA 5BUVA 3WCRA 4CYDA 5FOBB 4EE2A 3C8XA 4EJRA 1BZWA 2ES3A 2EVXA 4LBMA 3UGHA 1OKOA 1OOPB 3SH4A 1Y9MA 1ZRDA 1VRH1 5F2SA 3PVOA 4DB5A 1DGWA 5FPXA 4ZU4A 2Q5TA 1SFYA 4XJWA 3WNMA 4Z07A 4E2GA 1W2TA 1AR93 2P3KA 4QPWA 2CDPA 4L0PA 1POV1 5A7WA 4AGGA 4GH4C 2JENA 2QE3A 2Q8OA 2VECA 4TLFA 4CUCA 2HH9A 4HK9A 2FBEA 1WBLA 1GP5A 2GP3A 4CEYB 3OGVA 4DPNA 3RGBA 4IE4A 1U0AA 4GKXA 4W6XA 4CCNA 2VO5A 4BQ4A 1PO12 1NCRB 3DUIA 4MH0E 3PJQA 4AFDA 3FFZA 1XU2A 3B02A 3E6DA 4AHXA 3PJYA 3USSA 2DWRA 5EIYB 1EV12 4ISRA 2VTXJ 2HWE2 1NXD1 2VVEA 3WQ7A 1GV9A 2CWSA 1W9TA 2WO3A 3ORJA 1NOVA 1N3QA 3ZFFC 2PLV3 3B69A 5BXXA 4LR4A 4LKEA 2A7AA 2BOJA 1PHMA 1PZ7A 2VNVA 4Q29A 4RSUA 4XVHA 4I0WB 3TBDA 4A6SA 1G9BA 3WOGA 4AXOA 1QOSA 5JVVA 5FPLA 3RI8A 4GIQA 2Y26A 3J8F2 2NM1A 3LGRA 3NL1A 2OKXA 1JN2P 4Y1ZA 2VVFA 1HQNA 2DTYA 2XLGA 2BBAA 4JGZC 2Y6HA 5EPAA 2PAEA 2RS31 5IK5A 4CEWC 3WNNA 1J1LA 4NR1A 2O0OA 3MYXA 1H4GA 5DZGA 4M01A 3FE5A 1J3RA 2IC1A 1OHFA 3HN1A 1QJY2 5FZLA 4YGEA 3UETA 4FOYA 4Q4X2 4LO5B 1AUYA 3LA2A 4WZFA 4DUXA 2A6YA 4S2FA 4YVWC 4CDQB 2HWD2 1Q43A 4K8RB 4LORA 3BODA 3AKRA 3R4UA 4IEWA 1R64A 5A3PA 2N7GA 1JYTA 2VBDA 4P9XA 2HBUA 3V64A 2WJSA 3UKNA 1DZQA 1KEXA 1FXZA 1J59A 4N53A 4IV3B 3D6EA 2R062 4YW2A 1I6XA 1REEA 1RUH3 2W3JA 4CDUA 3ZFGA 4XFBA 1VE0A 1KS4A 1S2BA 2LRPA 2JECA 1NZIA 3AP9A 3BB6A 2ZGQA 2V5DA 1AX2A 1GOFA 1C5HA 1OLRA 3D8CA 3MEPA 5T54A 3ROUA 3TYJA 4J25A 3HR9A 3B9CA 2VOTA 2GMEA 4NVPA 4BYYA 3A22A 5GM0A 3K2OA 2C1FA 4FAGA 4FOQA 1QDCA 1V6IA 1LU2A 1RMU1 3B9IA 5ACA3 5K7PA 4IERA 5GLUA 4AQSA 1RUE3 4Q1RA 4DO0A 4Y1YA 4OQ8A 4QDRA 3ZM8A 2YC4A 2B5HA 4LLOA 2VVDA 4CU7A 2CV6A 5CFDC 1QJX3 2WFPA 4PBPA 2PHWA 4I0BA 4OMCA 4DQAA 3AL6A 4UFJA 2AUYA 1RUF1 4GWJA 1W2UA 1UN1A 1COV3 3WUDA 3IB3A 3SEEA 4B4QA 1ZZ7A 4GQ7A 1W6QB 1SFPA 2RJ2A 2MEV1 4QXBA 4R9CA 4XF4A 3NNLA 5C8WA 3AFGA 3EBRA 4AEDC 4KWKA 1IGOA 4P9GA 1RUC1 1UQXA 1XE7A 3UV9A 4C8DA 2WO1A 3SISA 1PVC2 4BXSV 1UWWA 4JZRA 4UWDA 4NAMA 2F4LA 3I8TA 5LEKA 3AYCA 5DAQA 5BPXA 3MICA 5K0UC 3VBFA 1UY4A 5H9PA 2VMHA 4HZFA 5HXMA 2BNOA 2GNTA 3KV5A 5GZFA 1SPPA 5ANQA 5A7OA 4JV4A 2HBTA 3KS7A 1BMV1 4L2NA 1H6XA 1LJ7A 4DRRA 1XRUA 3OGSA 3OCPA 2H0BA 3PURA 4AG4A 5C33A 5FDBA 2UY8A 4CA9A 3EJKA 4XQDA 1LAJA 4EZHA 1KJRA 5FCCA 2UURA 1RUG2 1HLCA 3OGJA 5C9AC 1F9KA 1FOD2 1NAEA 4K7JA 4YVSC 2XQRA 1QU0A 5H9RA 2Q8DA 2NP0A 1CONA 1OFNA 2RV9A 3LSDA 4FO9A 4N9IA 4YM2A 1SQ4A 1WLDA 4CP2A 5JZGC 1PIV3 4FTSA 2FCUA 3KF5A 2FHRA 1GYKA 1O5LA 5A1FA 4ES8A 3IIIA 5CKNA 2ADEA 3LAGA 2C4XA 2DFBA 2HYKA 2ZKLA 4Q26A 3K48A 3MW2A 3NAPA 1EV13 2DCJA 4UW5A 1O6UA 2B9VA 5LWBA 4LBQA 5KXDA 2XJPA 1JYWA 3NV3A 2ZCWA 3CMGA 4XHXA 1NCQC 2IFRA 3U10A 3DXUA 3WG2A 3KVAA 4GMP3 2VXRA 1HXS2 2QUOA 1X36A 2Y6KA 3M7AA 1AL22 3P1IA 2DFCA 4JTNA 4NWVA 4XQ4A 1V00A 5FYMA 4B4RA 2AR6A 3NNJA 1TNFA 4A2UA 4HT1T 2GC0A 5CVRA 3HOBA 3VBUC
chains in the Genus database with same CATH topology
3PVEA 1EPZA 1NA1C 4FPCA 1PK6A 3MPPG 3VZLA 3FZ3A 1J58A 1RJ8A 3WQ1A 5JSPA 2RM23 3AJYA 1JOJA 3LSEA 4KQ7A 4Q1PA 2NYYA 1VBE3 3GALA 2ZHKA 4KG0A 4KL1A 3GF6A 4XFGA 2WSUA 4IEQA 4F3JA 4WVWA 4H14A 4IEVA 3TWIA 3T2TA 1QXPA 3O0WA 2R042 2XVGA 2VNRA 5L7OB 3M2MA 2R063 3OPZA 1MZFA 2XL7A 3AYAA 4E2SA 3BOPA 2UWAA 2D40A 2WL1A 3RJ2X 5BNOA 3TB0A 1WBFA 3DN7A 1H2LA 1X82A 3FMGA 1MVQA 5CADA 4KH9A 1MACA 3D5OA 3ZMNA 1W6PA 3Q9OA 1ZZ8A 3VBRA 1AZDA 2WNVC 3MDPA 4Q4V2 1RGSA 2UWBA 5ABJB 2E7AA 3MFAA 4RQPB 3VDDC 1KXGA 1JH5A 4V1PA 4AEDB 3FUQA 1LKNA 3QCWA 4CDWA 1RUI2 1DF0A 4WM8A 4CDXB 2PHXA 3AYEA 1LOFA 1LOAA 4Q2FA 3AP4A 2PN5A 2ZJCA 4LHLA 1KRIA 2IXIA 3K51A 1PM7A 4N90A 1BEV3 3M4FA 1K5MA 3NSTA 2WLPA 4EWDA 3QH6A 1ULFA 2ZX4A 3BALA 1EP0A 1WMFA 3FC0A 2VMGA 4EROA 3VHNA 5F5QA 2PHTA 3B93A 1JYIA 1DQ5A 1V6KA 3WDXA 4A7KA 2WA4A 1R092 4RS5B 3M3QA 1CPMA 4R9AA 1FOD3 5DG1A 3ZN6A 3ZXDA 3H9AA 5KBFA 3AKTA 3MFCA 3IDEA 2ZKNA 5EWSA 2ZZQA 1XYPA 4YZ2A 4XIOA 2O1QA 1RUG1 3NJZA 1PZ9A 4M3CE 4K6BA 3PVNA 4WVVA 1LOBA 2WINB 2WNUB 4JTOA 5KC5A 3KGZA 2ZAHA 5T5LA 3ZVXA 2AYHA 2RMU1 2P37A 5JIAA 3DPRC 2KM2A 3N7KA 4OZXA 3O12A 4OHXA 1O3QA 4Z82A 5DZFA 4OI0A 3H3ZA 2CGOA 2X8KA 1ENSA 2OYZA 3NKGA 4FPFA 1CX4A 4FPGA 5D8AA 4BLIA 5CU1A 1CAVB 3ATGA 2CAUA 3OJBA 1ONAA 3NO8A 1HXS1 2BVBA 1LOEA 2FZ2A 2XJUA 1C5IA 4IEZA 5DDJ2 2DCZA 1QF3A 1QQP1 1QY4A 3I54A 3WW4A 3WY6A 1S0CA 2C9AA 5J3UA 4YLZA 5FLJA 2GMMA 5CIRA 4IXLA 1BBT1 5C4WC 3O5SA 3CJIC 5JOYA 2DUPA 4E4SA 4JDNA 1YYNA 1D4M3 1BJQA 1FPN2 2R043 1UMZA 4FPKA 5EYYA 2Y0IA 1ZZCA 1HDKA 1PZ8A 4IV1B 4QQPA 5A33B 1KQRA 1VBD2 3VBOC 2W39A 2IXLA 4HETA 3ZN5A 1ZZ9A 1JHNA 1DGRN 1I3HA 1SACA 2ZZJA 1GBGA 4BPZA 4MGZE 2DVGA 1H2MA 1N3OA 3ASIA 1R081 3BPZA 4YZ5A 4HL0A 4MGYE 2YYOA 4M3CA 4NWWA 5CFCB 3THTA 3WW1A 2GMPA 3FFQA 3GZTB 4GXLA 2EXIA 3FUOA 4GWNA 3N35A 3RJRA 1YFXA 3LA3A 2RS12 4BE3A 1ZBE2 1AYM2 1WD4A 4Y22A 3T1MA 5I0RA 4XE9A 3WHUA 4Q27A 1VP6A 2PQQA 2D97A 2Z5WA 1LGNA 4L97A 5DUWA 1AR81 2R072 1RUI3 4C0BA 4GMP0 1S0BA 2ZX2A 3E5UA 4LO7A 1WLCA 4M0NA 3JD71 2QNKA 1JBCA 2WT0A 3J9SA 1XXNA 3APBA 5BNPC 1QDOA 1AR72 2WZR3 4LBLA 1NYWA 2JX9A 3AB0A 2ZPXA 5I8YA 4ASLA 5SV5A 5H9QA 5CA6A 5BNNC 3OGGA 1AXKA 4URTA 2PA7A 4YARA 4BIOA 4ISQA 3ZSKA 1R093 4OI1A 2VULA 4R8HA 1HRI1 2W0XA 3CLPA 3R4DB 3ZXAC 1H8TB 1SFNA 2EF6A 1F5FA 3HQXA 2H6CA 3VHOA 1EAH1 4K1YA 1MZ5A 1H1AA 3WP5A 3V0AA 1F8VA 3MI8A 1JUHA 1OQDA 4DY3A 5BV6A 3IPVA 1AR61 4Z8BA 3GHMA 1LEDA 2ZMLA 4GH4A 1Z7S3 4KGGA 2HKXA 3FX3A 1RJ7A 3C3VA 3H7YA 4OVEA 1SLLA 3AZXA 1ZBA1 4Q0SA 4JVAA 4W6YA 1PGSA 5SV8A 4LBJA 2ARXA 1H4HA 5C8CC 3WDYA 2A6ZA 1OA3A 3ZFFA 5J37A 1C8M1 4KWJA 4OLLA 5FLIA 2WS92 4AHWA 2IXKA 5DDJ3 3V56A 4FBFA 1R1A3 4NN0A 5FFOC 2YUEA 3V0BA 3ZXGA 2MHFA 4RHV2 3JB4C 2ZHLA 5IK8A 2WWSA 3WINE 3KCCA 1FYUA 4XJ8A 3VBSB 3WNXA 1MEC1 3VZKA 4YG0A 4XBLA 2BWAA 3VZJA 4H3WA 2E7QA 1TME1 4ASMB 4JGZA 3O0VA 4CEWA 3M3OA 1ZA4A 1O3SA 4KGQA 1A8DA 2RHPA 4FXKB 5L73A 4C1XA 4XOGA 4MGKE 2X29A 1FMD2 1V9U1 4IEXA 4RFT0 4Y20A 4XPVA 4CEYC 1KFXL 2WFF3 2WT1A 4YVWA 1ENXA 3JBG1 1VBA1 1H30A 1UPSA 1DDLA 3W9AA 3AZWA 1NCRC 1Y3TA 4R52A 3JQWA 2TNFA 5KHJA 1MQTB 1W6OB 2E53A 3WP4A 4AHYA 1JUIA 3AJZA 5DUUA 1AYM3 4S2DA 4ZXKA 3HT2A 3A0KA 3P3PA 4XIKA 3S7IA 2KA3A 2ZGTA 3WT3A 3FJSA 4E27A 4AWDA 1HV0A 1YWKA 1X33A 2RS11 5K9YA 1WW7A 2AH2A 1AR73 3N3HA 4O9EA 1V6LA 2VW2A 2B7YA 5CFDA 1WLWA 3ZSLA 5A32B 4CRQA 2RJLA 1NY72 1XNBA 2XJQA 1HW5A 2EAAA 1ASJ1 5HCBA 5I0SA 2HEVF 3ZYRA 3WQ0A 4YW1A 1V70A 4CDQC 2DVAA 2HWF2 3EQEA 4GB32 3POYA 4Y1UA 5K0UA 3B3QE 1VBB3 3ZXJA 3USUA 3T1LA 4PDWA 3KT7A 3D4KA 2YC0A 5JIUA 5JOZA 4IV3C 1V6OA 2C5DA 4W6WA 4IEOA 3VBRB 2ZGLA 2VW1A 1RUOA 4AGVA 5ACA2 3ILNA 4J1XA 3IWZA 2ZACA 1RUE2 2KXLA 5C9AA 2E63A 4KNCA 4WVMB 4YVSA 2VNOA 3DV8A 1QJX2 5JZGA 4HVRA 1LOCA 2LTNA 4R9DA 2VW0A 1XNDA 1CJPA 2JXAA 4XJAA 5KXBA 4M00A 1YXWA 3AP7A 3ZO0B 4COUA 2XWJB 1I5ZA 2Y0OA 3M3EA 2XGXA 1IS4A 3RPQA 2V09A 2WS93 4A7YA 3H1MA 4QXKA 1LGCA 1NCQA 5DXDA 3OY8A 1B35A 1Z78A 4RHV3 2HWC1 4L8QA 3ZXKA 1NE6A 3N4MA 2D44A 3VBUA 1NA1A 3AMMA 4LO4B 4EWEA 5I8TA 3KCYA 1KJLA 4R9BA 4ZU5A 2VG9A 4AFMA 1VRH3 1NG0A 4RD7A 3FHIB 5HI0A 1X7NA 4I3PA 2YMZA 1POV3 2GDFA 4C1WA 1PIV2 2RR13 4KU8A 1FMD3 1YFWA 4E2QA 2VY0A 1AR91 3IMNA 4LHNA 1AL0G 4FAHA 3WP6A 3BOWA 1CJDA 2IXHA 5IT6A 1GZWB 4WVZA 1WW4A 3AMPA 1QGLA 3M8LA 5A3MA 3KGLA 1IHMA 2BW8A 3AMNA 5J36A 3SMHA 1GLHA 2BBVA 4MLOA 1FT9A 2BQPA 2OIIA 2IXJA 2ZMKA 3ZFEB 2D6MA 1TEIA 2PLV1 2MNGA 2V5YA 4HVOA 5JMCA 2WNVA 4HKWA 1SMVA 3LB9A 1EPWA 4P9JA 2YXSA 3VDDA 4RR3A 2RM22 2NZ9A 2BUKA 4HPKB 4Q4W1 1BYHA 1OPMA 4ATEA 5KXCA 1VBE2 4Y4YA 3FLTA 3SITA 1RL3A 2JJ6A 2WQ4A 4JDOA 1H8VA 1BVVA 2EA7A 2ERFA 1O4YA 2QVSB 1OKQA 2EALA 3E6BA 4YG3A 1ZRFA 1YIPA 2PELA 2V73A 4MXWA 2HWF3 4GB33 2A3WA 1S0DA 4HMZA 3AX4A 5E1RA 4MGIE 4YZ3A 1HQLA 4LBNA 1ZYBA 2PHLA 1CN1A 4QPYA 1DYPA 5L7OC 3NV1A 1X8MA 2O8OA 2JEMA 1ZRCA 2JICA 1XE8A 3SH5A 3RZZA 3J4UH 5DZEA 1RUH1 2Z69A 4FCAA 4B4PA 2ZGRA 3ZYJB 5HCAA 1CAXA 5ABJC 1SEFA 4RQPC 2D93A 4XEZA 3O7OA 2NMNA 3TRSB 4YSFA 2QCSB 1RUF3 3EXUA 4K21A 4QPGB 4R4ZA 1Q56A 4L92A 4CDXC 1QJX1 1MR5A 2MEV3 1BEV2 5I0TA 2BTVC 1COV1 4NHKA 4BWOA 1CAWA 3DPRA 2GC1A 1VAKA 4PIZA 2VGDA 1BCXA 4FPYA 4K40A 2P3JA 2ZGOA 4X8PA 2XPJA 2Q4SA 5EV7A 3ACLA 3ZYGA 1Y9QA 4K1ZA 5J98B 3M70A 2P17A 3SCFA 3ES1A 3RS6A 2RS52 4RS5C 3WUCA 1ND3C 5BY5A 5T5JA 3POSA 3ZIWA 4JGYB 4QPIB 1CIWA 1FNYA 4PIYA 1A3KA 1PGW2 1JTZX 3ZXLA 3IDCB 5C4WA 4PF5A 2VUJA 3CJIA 3IBMA 1OI6A 4Z2WA 1JYCA 4FPEA 1G9AA 4HK8A 3OF1A 3VUOA 2XKPA 3H0OA 4MUVA 1B09A 2VPVA 5FPZA 3TNQA 1ND2B 3VBOA 1PO11 2WNUC 2HEWF 2UU8A 5AVPA 2D3RA 2JG9B 3S30A 2D7FA 5A3LA 2DUOA 1IPJA 1REDA 1WCSA 1I1EA 1EV11 2HWE1 3FBYA 3NVCA 3VBHB 4FP2A 1LCLA 1BKZA 3A4UA 3BCWA 1SLTA 1NXMA 2CYFA 2B46X 2ZGNA 4EN7B 2BFUL 1YO8A 3H7JA 3WDWA 4Q4Y2 3RYRA 3MW3A 1N3PA 4WBBA 4PLNA 1QJU3 3J8F1 1G9DA 3LZZA 2AGSA 1YJKA 2B8MA 2XBO2 1ULEA 2D6LX 1RUJ2 1EYBA 4GULA 2A3YA 4DS0A 4YM0A 4EWAA 1D4M2 5BNPA 3ETQA 4DFSA 1QJY1 1VBE1 4Q4X1 2VOWA 4IV1C 2R0FA 1WUVA 4DMIA 2HWD1 4XF1A 1Q8QA 2ZX3A 5BNNA 1GZCA 1T6GC 1OD5A 1POV0 4BZ4A 4WM7B 2HEYF 1GKBA 2K2SA 4L99A 5DG2A 4ORFA 3AFKA 3KZ4C 5IK7A 1MS5A 2R061 3ECQA 3OYWA 5CB7A 1QHDA 1W6NA 3QD6A 5CFCC 1UZZA 4CP1A 4H7MA 4MYEA 4XF3A 4E4ZA 3WR0A 3QLQA 4XF9A 4AI0A 2JE7A 1CR7A 2JG8B 3I59A 4LNVA 3KMHA 3WG3A 1REFA 4COWA 1RC6A 1MS4A 2X5IB 1GNHA 2D6KA 2WZR2 3ELNA 5E89A 4ES9A 1IZ3A 2IFWA 4XFIA 3VKMA 3GBGA 2AZ5A 4Y26A 2DU1A 2YZ4A 4I3GA 1A8MA 1C1LA 4NPRA 1LHOA 1LODA 4EN8B 1PVC1 2A6XA 3RQ0A 2F4PA 1N1VA 5C8CA 1OFSA 2DVBA 1H2KA 1ND3B 1PVXA 4P9IA 4MZUA 3WCSA 1IS3A 2XL9A 3USUB 1HRV2 3ENRA 4N43B 4PDWB 4OHZA 3U07A 2RS53 4IEYA 4META 3ZPYA 4BLJA 5C6CA 1ZZ6A 3GBWA 1UCXA 4RA0A 4I30A 1AX1A 1M4WA 4LO8A 3H1YA 1H8TC 3ZSJA 4B3NA 3R4SA 1WGPA 5JDBA 4FTBA 1GQHA 2D6NA 1MS0A 4MX3A 1F5JA 4YM1A 4XFCA 2DF7A 1FOD1 2ZGSA 4X6QB 1XYOA 1OOPA 5JPNB 2YHJA 1AJKA 1Z7S2 1MVEA 3LOBA 1KDMA 1WMDA 3ZYPA 2EIGA 2QDNA 4CEYA 1NQJA 2ZGPA 1H9WA 5F9TA 2GN3A 2WZPP 1ENQA 1NCRA 1KITA 1VBC2 5KC6A 2GSYA 1UU6A 5BNQA 4AQTA 2VOKA 1ENRA 1LHWA 5E8AA 5FQ0B 5JPMB 5EYXA 4Q4Y3 1CAUB 1AL21 4I09A 5JLVA 1N1YA 1DFQA 3IM0A 4AK3A 1R1A2 2XBO3 2PTMA 3N7LA 2OW4A 1RUJ3 4BM8A 2R30A 1VJ2A 4ATFA 3MIHA 2NQYA 4FPLA 1YLLA 1QNWA 3MIFA 1ULDA 3VBSC 2VH9A 2D43A 3RNSA 1BBT3 3MIGA 4AGRA 3U4XA 4NHMA 1WLTA 4OHYA 4UW6A 2E51A 2XJTA 1RUD2 5HXVA 4DOUA 4AYUA 4SBVA 2DYCA 2R041 2WFF2 2DCKA 1YHFA 1TMF2 2YGLA 3B7MA 4IEUA 1XNKA 2OZJA 1DQ0A 4MV2A 4CDQA 1R083 4COZA 3AP6A 4D7TA 2OA2A 1PNFA 1OA4A 1RHI2 3AZZA 1PO22 1Q8PA 4QM9A 3MF9A 2A6VA 1MQTC 1BQPA 4K9SA 4LBKA 5T3NA 4IV3A 4UBGA 4UBHA 4Q4V1 1YCIA 2SBAA 1UU4A 4H7LA 1AR83 4LTAA 1UIKA 5GZCA 4RR3B 4KBBA 3JD73 4QQLA 4KWLA 2WLQA 5KXEA 3CF6E 1RUI1 3OBRA 4JAAA 3UKTA 2A5ZA 2B9UA 3IDBB 5AFEA 1AJOA 3D0SA 4EN6B 1OLQA 3AXEA 1O4ZA 1V6JA 2OVUA 2W08A 1SBEA 4QQHA 2DUQA 4XYXA 4YM3A 3J26N