1O4YA

The three-dimensional structure of beta-agarase a from zobellia galactanivorans
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
b'AQDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPAGNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQEIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWRPAATQEELADDSKNIFWVDWIRVYKPVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-agarase A
publication title The Three-dimensional Structures of Two {beta}-Agarases.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 74
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o4yA00
4XXPA 2WKKA 1F9KA 1AF9A 4OZXA 4DRVA 1IS3A 1DYKA 3V65A 1IKPA 4Y22A 5F9TA 2W39A 1KITA 3ENRA 5GM0A 2EALA 2DVAA 2R1BA 4AVVA 4XZPA 4SLIA 1DHKB 2GN3A 2ZGLA 1GLHA 3I4IA 4GWNA 3IPVA 3WG2A 4XJAA 1S0IA 3NV1A 1KJRA 2ZMLA 2DYCA 4XHXA 4U36A 4ITCA 4UW5A 1S0FA 1ULEA 1WD3A 4AGVA 3USUA 4YW2A 3AYDA 4XYXA 1YIFA 3CNAA 3ZXEA 1NLSA 4XTMA 1J1TA 2DUPA 1WLDA 1G86A 1DFQA 1W6PB 4PBPA 1DQ5A 1W6OB 1LGNA 3KQRA 2GMEA 1WW7A 4UW6A 4Y1UA 4YLZA 1DYPA 4LBLA 4FOVA 3ZXLA 2JE7A 3L2YA 3O0WA 4Y1VA 5KXBA 4U2AA 4FPCA 1F31A 2KM2A 1LOEA 3FUQA 3M1HA 3WV6A 5LK5A 1V6MA 2EXKA 3RG0A 5L73A 2VU9A 4FPEA 1JW6A 5AVAA 1Q8OA 3VKMA 1UZZA 1Q8PA 3A4UA 3ZPYA 1LOFC 3DUIA 3AP9A 4M01A 1KQRA 2VY0A 1V6JA 3POYA 4XJWA 2OVUA 2ZGSA 1SBDA 2ZGKA 5DXDA 2PHXA 4GXLA 2D6OX 4XJZA 3Q9OA 5DG1A 4DQAA 4IQPA 3ZVXA 1LJ7A 4K20A 3ZSJA 3N7LA 2JECA 2E6VA 3RQ0A 1JOJA 5GLZA 1LOGA 5JOXA 3FUOA 2A5ZA 3WZ1A 5H9QA 1RIRA 1QOOA 1C57A 1R1ZA 2A6WA 2GNMA 1PZ8A 1GZCA 2BQPA 3O12A 2E53A 2GDFA 3GALA 5JVVA 5IT6A 5DUVA 2DVDA 1WCSA 2E7QA 3WDVA 4CTEA 3BODA 1MS5A 1G7YA 1LENA 3AYAA 3JU9A 3NV4A 2ZKNA 1ENRA 2FMDA 3HR9A 5T52A 1ENSA 4ZXKA 3PJQA 1IS5A 2WSVA 1N3OA 2ZHMA 3ZYRA 4YW4A 1BJQA 3QLQA 2GNTA 2WT2A 2Q5TA 1JYIA 1JUIA 1RINA 3POSA 5IUQA 3ZSKA 5H9RA 4Q8KA 2EIGA 4FPLA 1DQ1A 4GA9A 1WBLA 1YI7A 1ULDA 1RITA 1UPSA 2NZ9A 3MW4A 2ZMNA 2AH2A 1SCRA 1QDOA 5DZFA 3ZSMA 4YZ5A 4K1YA 1MVQA 5JDBA 5EYXA 2PHRA 1CN1A 1LESA 1SBFA 4XMAA 2AGSA 2UURA 5FREA 1KJLA 4LBMA 2DUOA 1S0EA 4FPGA 4YM2A 5FRAA 3SH3A 1GYKA 4JC1A 1FAYA 1DQ6A 4YGCA 4YGBA 1WW5A 5T54A 4BMBA 4XDQA 2C5DA 1SCSA 5EYYA 4Q1RA 2D6KA 4Y20A 1BYHA 2WSUA 5CB7A 2ZAAA 1OKQA 1G8WA 3OYWA 1JHNA 2B7YA 1KDMA 2DURA 4XXAA 3T2TA 4YGDA 1KRIA 1C1LA 2I2SA 4BMEA 3RMXA 4H55A 2GNBA 5CBLA 4RL7A 4BLIA 4YFZA 1SLAA 1ULFA 2A3WA 5EXOA 5BYNA 1H9PA 4YZ4A 3FFZA 2YZ4A 3IPVB 1N1YA 1SBEA 1DLLA 3VKNA 1N47A 1ENQA 1GZWA 2OUJA 4M00A 1Z78A 3ZXJA 1SLCA 5CAZA 1CONA 4YZ1A 4P9YA 1V6IA 1H30A 1QOTA 5DZGA 1LHUA 3BIWE 1N1VA 5T5LA 5JOWA 4FVVA 3HMYA 4GWMA 2A6YA 3W59A 1UKGA 4Y24A 1QNWA 4ISRA 4R9BA 1OFSA 1LOBA 5GALA 5JMCA 4MYEA 3ZYPA 1S0DA 1CJPA 2CTVA 2AR6A 1GKBA 1LOFA 1DGLA 2NN8A 1TEIA 1AX1A 2VUAA 3VKFC 3O5SA 2DV9A 1WW6A 3AP7A 4ISQA 4R9DA 2NYYA 2UWAA 4FQZA 2EF6A 1WW4A 3RS6A 1HQLA 1MS1A 3V0BA 1CVNA 1QGLA 2D3PA 2UWCA 3WUDA 1CPNA 1QOSA 1G9BA 2FHRA 4WZFA 2XB6C 3B00A 2YROA 4YG3A 4C1XA 1QF3A 4LBQD 4XTPA 2D3RA 1O4ZA 1Z0HA 1A3KA 2ZGMA 5CNAA 3GNEA 4NOTA 1S1AA 4KBBA 1MS0A 2SLIA 4RA0A 1DQ4A 2GMMA 4DS0A 3H0OA 4P9WA 4LBQA 3M3OA 1FYUA 2A7AA 1URXA 3N7JA 3WHUA 4CZSA 4GALA 2D6PA 3MW2A 2ENRA 2EAKA 4JCKA 4M3CE 2ZBJA 3PVOA 4Q26A 3WLUA 2AYHA 2ZHLA 1JYCA 2CY6A 3ZSLA 2ARXA 1QMJA 5SV8A 1W6QA 1GZ9A 4XILA 3WUCA 3R4UA 3UJOA 4Y26A 1ZM1A 3OY8A 3BOPA 3D4KA 4HANA 1C1FA 3AJZA 1LODA 3UJQA 1V6KA 2D6NA 4XMIA 3TB0A 3AYCA 1AXKA 1GV9A 1AXYA 3R05A 1BQPA 1UAIA 3T1MA 4M3CA 3IMNA 1FATA 2WT1A 4Q8LA 4BQ1A 4HL0A 1LU1A 5T55A 2ZGPA 1G9FA 2R0HA 5GLVA 1LHWA 3WDUA 1W0OA 3NWKA 2AUYA 3O0XA 4XBQA 2UU8A 1GICA 2ARBA 4TZDA 1DBNA 4FPYA 2VXRA 2OW4A 2G4IA 3N36A 1IS4A 1DQ0A 1ULGA 4UW4A 2P37A 1G9CA 3V0AB 3NV2A 3RRDA 3VKLA 2WT0A 3FLRA 4DRRA 3ILRA 1S0GA 1S0CA 3LCPA 3WCRA 1UL9A 1W6PA 1IKQA 3OYWB 2DU0A 5EWSA 1QNYA 1W6OA 2E7TA 2DVFA 5GZGA 2OUHA 3WDWA 3WVJA 4JRAA 5GLWA 1GSLA 4XBLA 3WDXA 1YXWA 2GNDA 3IKWA 3SLIA 2D44A 1VLNA 4Z8BA 5IK8A 1B09A 1BXHA 2D43A 3JUUA 3N7KA 4R9CA 3VKOA 1HQWA 2ZGQA 5T50A 4LBNA 1SLBA 5JLVA 4YM1A 1D0HA 1PZ9A 1WLWA 4AVTA 5CA6A 1YO8A 3PVEA 3AXEA 4AGRA 3A0NA 1N3QA 1YRZA 1N1SA 5GZCA 4NO4A 4LBKA 1AX0A 3AZXA 4K21A 4P14A 4D69A 1U0AA 4Q27A 2A71A 1MS9A 4Y22B 1DQ2A 4PQ9A 1AJKA 3ILFA 1Q8VA 1GANA 2H0BA 2P3JA 4FP2A 3W58A 1MZ5A 2ZGRA 1MZ6A 5HCBA 1SLIA 4BLJA 1AVBA 2TEPA 2ZMKA 5GZEA 4FPFA 3V0BB 1LHOA 1SFYA 1O4YA 3QCWA 1DZQA 1UN1A 4XHBA 1XQNA 1W6MA 1FV2A 1CQ9A 2W68A 4K1ZA 1MACA 2A6XA 3USUB 2PHFA 4CRQA 1LGBA 3U4XA 2HYKA 1V6OA 5DG2A 2LTNA 1QU0A 1Y7BA 2ZGNA 5GJ6A 1YYNA 3SITA 4YGEA 1LECA 2NMNA 5E89A 5GLTA 4DPNA 2VW2A 1D2SA 2DVBA 1QKQA 4LBQB 5F5QA 3WHTA 2CL2A 2VH9A 2D6LX 1JBCA 3B9CA 3M3QA 5IK5A 1IS6A 1JXNA 1LEMA 2DWRA 4W65A 4YM3A 4YM0A 3OBTA 3LSEA 4GKYA 3INAA 3SH4A 2ES3A 1AJOA 2P3IA 5H9SA 2PELA 4XBNA 2DTWA 2YV8A 3APBA 3N7MA 1AZDA 2JDZA 1I1EA 3OY8B 2WNEA 2PHTA 1H9WA 1WLCA 5T5PA 2CYFA 2ZZJA 1W0PA 1Q56A 4L8QA 3TAYA 4AGGA 2GALA 2NMOA 5T5OA 4C1WA 3POWA 5KXCA 2DVGA 4M3CF 4M3CB 2UWBA 3B3QE 2ZHNA 3OGGA 4XIOA 2ZA9A 2A70A 3AZWA 2V5YA 1LHVA 1CESA 1S0BA 1HLCA 3AP4A 4XIKA 3AXDA 2EXHA 1MR5A 1UZYA 5GZDA 2R49A 4AYUA 2W08A 3AZZA 2ZGOA 1G9AA 1APNA 1BKZA 1DIWA 3RSJA 4BM8A 1C4RA 3KM5A 1VIWB 3B01A 2AREA 4AWDA 2WLQA 2CWSA 2XG3A 3VV1A 2JKBA 1Q8QA 5GZFA 3D5OA 4Q1PA 2ZACA 3LSDA 3OBRA 2CWMA 1LCLA 1W6NA 2ERFA 4FPJA 3VUOA 3DGTA 5GLUA 4DFSA 5KXEA 3AYEA 3WG3A 2W52A 3IM0A 1ONAA 3AFKA 1HDKA 1VALA 3M3CA 4ATEA 3FLPA 1ZA4A 1LHNA 1MS4A 2ZHKA 4R9AA 4YW3A 3D6EA 2R0FA 2NM1A 4FOQA 5E8AA 4YW5A 3AP6A 4Y1XA 4ZKTB 3AZYA 3UK9A 3R4SA 2A3YA 3MPPG 1AX2A 2A75A 2EXJA 4FPOB 1EPWA 4TYSA 1S0JA 3N3HA 1A78A 1HKDA 3PVNA 2WQZC 1UX6A 2D7FA 3AJYA 3SH5A 2P34A 3M3EA 1Q8SA 2ZABA 4YG6A 1IOAA 1WD4A 5JOYA 3FLTA 2NP0A 3RMYA 2ZGUA 2DU1A 1CR7A 5DUXA 3WDTA 3HN1A 3AX4A 3AP5A 1FNZA 3NV3A 4FQ4A 2WJSA 4Y20B 2Z42A 1VAMA 1G9DA 5DUWA 3N35A 4XE9A 5T5JA 1KDKA 3MEPA 4UW3A 4P9XA 3ATGA 2C9AA 1V6LA 1A8DA 2D6MA 2VW0A 3OPZA 1MVEA 3SNMA 4LBOA 2R1DA 4GKXA 1WUVA 2DTYA 4Y1YA 1JN2P 2E51A 5DUUA 3WCSA 4XJ9A 5JOZA 1GZWB 4YG0A 3PMEA 1LTEA 4YFWA 1W6MB 1VAVA 1LOAA 3MW3A 1LOCA 4XOGA 1WBFA 1N1TA 3OJBA 3WOGA 4I30A 4YZ2A 2RHPA 2V73A 1MS3A 2ZGTA 3AZVA 5E88A 4PBOA 2D3SA 1LGCA 3I8TA 4FPHA 1GNZA 1LU2A 3FBYA 3ZXFA 1OQ1A 2GMPA 2VW1A 4XJ8A 4YW1A 4BOWA 5HCAA 5KXDA 5IK4A 2PHWA 3M2MA 3ZXKA 3WNXA 1LEDA 3A0KA 1CIWA 4XJUA 1FV3A 2R16A 4PCRA 3ASIA 4LBJA 1FX5A 1FNYA 1MS8A 1SACA 2AENA 2A6ZA 4YZ3A 1PZ7A 4FOWA 2PHUA 4WV8A 1GBGA 2P2KA 4WVVA 5DZEA 5HCFA 2A6VA 1X50A 1QDCA 4WVWA 4ATFA 3V0AA 4FP3A 1CPMA 2JD4A 2GN7A 2YXSA 2LALA 4Q2FA 3C2UA 1V6NA 5IK7A 4BPZA 3WG4A 2YMZA 2YY1A 1F5FA 4F83A 1ULCA 3SISA 3O0VA 1AXZA 1NXD1 3WG1A 3AK0A 4AVSA 4Y1ZA 3V64A 2CNAA 3IN9A 2DUQA 2JE9A 1N3PA 1V00A 4FPKA 2SBAA 3BTAA 4FOYA 1I3HA 1LULA 5H9PA 2P3KA 1SLTA 1BZWA 2A3XA 2EXIA 4ASMB 1SLLA 1W6QB 1GNHA 2JJ6A 3B69A 1W6NB 3UL2A 3ILNA 3T1LA 3WDYA 1UMZA 4PF5A
chains in the Genus database with same CATH superfamily
3U10A 4LNVA 1F9KA 4CDXB 4EZHA 3VGIA 1JOPA 5IVVA 2JDUA 1UY0A 4GULA 1IKPA 3OOXA 4OVEA 1VP6A 1ZRDA 4Y22A 4NE9A 5HI0A 1E5RA 1QH7A 1OC1A 2ORZA 2W9XA 3POIA 2DVAA 1PGW1 4NRQA 2VD7A 3CZJA 4RFT0 1DHKB 3TEWA 4AF9A 5IW0A 5BNNB 2VTXJ 2ZMLA 5FIXA 2DYCA 2CAVA 4U36A 5LBCA 4UFLA 4UBGA 4NIDA 1UNBA 4AGVA 3M3IA 3AYDA 4XYXA 4JX0A 1US3A 2J1EA 4LO6B 4BQ5A 4Z2AA 1J1TA 1KGYA 4KNCA 1UIJA 1OD5A 4FFFA 2QVSB 4PBPA 1DQ5A 4IUGA 3S6PA 1COV3 1LGNA 2YYOA 2GMEA 4CP2A 1QEXA 1YQ5A 2X5IC 3X29B 1WLTA 3GBFA 1OBNA 1DYPA 1UKRA 2VZ1A 3BYWA 3F95A 4COVA 3ELNA 3UKTA 1XNAA 4A2UA 3G6JB 4FPCA 5DQ0A 2RS51 2WBKA 2ZEWA 5FUIA 2ZX1A 2H6BA 4YVSC 1NA1A 2R072 3UGFA 2Y38A 4YYOA 2VCBA 4FPEA 1HRI2 5E16A 5EP9A 4NROA 4L0PA 2ZX0A 4N43C 1C8M3 3VKMA 1TMF2 1SPPB 3A4UA 3I54A 2RDRA 5C8CB 1KQRA 3POYA 2BV4A 4XFCA 1TNRA 3E6CC 1AYM2 4LPLA 2YG0A 2ZGSA 2WNVA 4J1XA 4OHWA 2ZGKA 4P5YA 4B4RA 2C24A 4NUBA 2BP6A 4LR4A 4IQPA 5B4XA 2KR2A 2XUMA 4L11A 3FUOA 1ZZBA 1OH3A 2HWD1 1QOOA 4LBNA 1PGL2 2D93A 2GDFA 5JVVA 4AHXA 5FWEA 3UESA 1UW8A 1ASJ2 1J83A 2DVDA 2I45A 4Z2WA 1RUF2 1G7YA 2KXLA 2RMU1 1W39A 2OPKA 3H50A 3MIBA 4N9IA 2OZJA 2FDJA 1SEFA 1ENSA 4PLMA 5FJHA 4ZXKA 4NAMA 1MQTC 5FLHA 1XPWA 1RHI1 4HG6B 2LM3A 3KVBA 4AFCA 2YGLA 1JMUB 2RS32 4UF0A 3THCA 3MLKA 2W94A 1YIPA 3FX3A 3LPGA 2J1TA 3OPTA 4N7UA 1BJQA 4XFBA 5EPAA 1D4M3 2MNGA 2VO5A 3QLQA 2FDGA 5IUQA 2XBO3 3ORJA 3POGA 4R52A 4BQXA 3LDRA 2IWGB 4GD4A 2NZ9A 4IW3A 4LXLA 5IVEA 2AH2A 3ZSMA 1GWMA 1RVF3 1W3XA 3OUJA 3RWNA 1TQ5A 4JAAA 5JDBA 3OEAA 2W87A 4M4PA 5FY1A 1EAH1 4XVHA 4CDXC 4E8CA 1LESA 1SBFA 1T2XA 1U5XA 1W9TA 3I3DA 1XNBA 4XMAA 5FZAA 2XJRA 4LBMA 5LY2A 2DUOA 2BJSA 4FPGA 2JX9A 1XRUA 4L99A 4RHV3 5FRAA 3SH3A 5FDBA 1AL22 2PLV2 4CDUA 1PO21 4CU6A 3JD71 4A3ZA 4XDQA 4BMBA 3ZYBA 3SKVA 4IEVA 4KBZA 2D6KA 4Y20A 4JKMA 1IQDC 3LIHA 2B7YA 1KDMA 1UCXA 4LORA 5BNNC 4YGDA 5BUVA 4B7EA 1C3HA 1TE1B 2GNBA 5CBLA 3MI8A 4RL7A 4YVWA 4BLIA 4YFZA 2A3WA 4EQVA 5C3PA 5BYNA 1H9PA 2WAAA 1UMIA 1LR5A 4YNIA 5L19A 1SBEA 1DLLA 1UU4A 1NLQA 3VKNA 1GZWA 4AI9A 4YZ1A 1RUH2 1QOTA 2JEMA 3ZOIA 3O1TA 1RTVA 3BIWE 3MYXA 3MLJA 5T5LA 1I5ZA 3HMYA 2P4EA 3UGGA 1QJX3 2A6YA 3W59A 1VAKA 4E4DX 5FMBA 5C4WB 1ZBA3 1QJY3 2WFF3 1LOFA 3EMRA 3NAPB 1AX1A 2VUAA 2CGPA 3O5SA 5C8CC 1NAEA 2DV9A 2P3YA 3BU7A 5JZGB 2JDHA 2XVLA 3RI9A 2V4AA 4R9DA 1RL3A 2UWAA 2VZTA 4KH9A 1LRHA 2JDMA 1UYYA 1H0BA 4XETA 5EV7A 3RS6A 4EN8B 3V0BA 1KD7A 3WUDA 4EE2A 4RS5B 3U75A 4DB5A 2FMYA 1QOSA 5FZ6A 5JUVA 3W5NA 1CIYA 1O8SA 3ZXAC 3IDAA 4IL7A 5FZMA 2IFWA 4E2GA 1G9BA 3IAQA 3B00A 2OPWA 3V56A 3TN93 2VZVA 4LBQD 4BCUA 4BJ0A 4FAGA 4C0HA 1DP0A 5LBFA 1A3KA 3TEYA 1UX7A 2FCTA 1EUUA 4CP9A 3LOBA 4QX1A 2RR12 4RA0A 2GMMA 3DPRA 3NNJA 5EQUA 4DS0A 4ET7A 5FPLA 2WINB 3H3UA 4P5HA 1ND2A 4PF1A 3M3OA 5L9BA 4D7YA 1FYUA 5IVFA 3ZN6B 5HXVA 5FZ4A 3LGRA 4D0QA 2D6PA 2OKXA 3MW2A 2IFRA 4JCKA 3AL6A 3WP6A 3ZPOA 2XL9A 3WLUA 1AR73 2ZHLA 2UY8A 3OGSA 3H1MA 5F39A 2ARXA 3S5QA 5FYZA 3WUCA 1OVSA 4XCBA 4CVUA 3BOPA 1W8UA 4BU2A 1IGOA 1AHSA 3AJZA 5I0DA 3UJQA 2MEV3 2D6NA 5A7PA 3EJKA 1VBD1 2ZS6B 4BQ1A 3FL7A 5FZBA 3E6BA 2C1FA 4B4PA 2J1SA 1LHWA 2O8OA 3WDUA 3NWKA 5A7WA 3O0XA 3WT3A 4YW6A 2YPDA 4B4QA 4ZXEA 1GICA 2WA3A 3GZTB 1QWRA 3I97A 2VZSA 5I0UA 3ZX7A 4AFMA 2OW4A 4DY3A 2VOTA 5IWFA 4A3XA 5F5AA 3VKLA 2VTXA 2L9LA 3ILRA 4XF9A 1S0GA 4DRRA 3BCWA 1UL9A 1W6PA 5EWSA 4EROA 2HWE3 1W6OA 2VZQA 3RWKX 2UY9A 2IXKA 4CYDA 5F5CA 1UD1A 4J1WA 5F6KA 1TME2 2DVFA 2XUEA 1QJU2 3GZAA 3KV5A 4UFHA 1JU4A 3ZN4A 4JHZA 5E1RA 3WDXA 5J48A 1ALYA 2GNDA 3K3NA 1DF0A 4AE2A 4Z8BA 5IK8A 1BXHA 4LT5A 5K0UB 3I49A 1HQWA 2IVJA 5A33B 2J42A 5C4WC 3M70A 5JLVA 3E97A 4UBHA 1AR62 5T3NA 5JR2A 3NAPC 4S2FA 5LBEA 4KWUA 3RJRA 4AGRA 1AR82 1N3QA 4A7YA 3Q8CA 5L7OA 5JZGC 4E4ZA 1AX0A 3AZXA 3HWJA 4K21A 2ZTNA 4P14A 1U0AA 3T2PA 4R4ZA 3R6SA 3VBSB 4PQ9A 4RS5C 4BA6A 4CDQB 4NR1A 5FZ8A 2H0BA 4L9BA 2JIJA 4LE3A 2ZGRA 1RXGA 3MIDA 2WS91 4ORFA 1VMJA 4UOJA 3VHPA 1Y9GA 3WW1A 2WL1A 2RJ2A 4LK7A 3PJYA 4UXAA 3ZXDA 4Q4X2 1AYN3 1BCXA 1CAUA 1VBC1 1YHFA 4XHBA 1DZQA 2JKXA 2HEVF 3WP4A 4AQTA 1S2EA 2WN3A 1RUC3 1SQ4A 2Q8OA 4AK3A 5JXGA 4CCLA 3TNQA 4NRMA 4CRQA 5ABJB 2NPIA 1HB2A 1R64A 3LEGA 4Y5TA 5FQ0B 3Q8BA 5E89A 1ODNA 5I0RA 4Q4V3 4DPNA 5HBAA 2X05A 2VW2A 3C3VA 5FAXA 3K4ZA 4LBQB 3WW3A 4DXZA 1JH5A 2VH9A 3OD4A 4JQTA 1JBCA 1L7LA 5CFDB 1MZFA 1VBE2 2DWRA 1VBB2 2O0OA 4GH4A 4MXVA 3HQRA 2R063 1UZ0A 2FDKA 1L7QA 5ACA2 1GOHA 4I09A 1UU5A 4EN9B 1Y43B 1W9FA 4W8JA 1RGSA 4CPBD 1I1EA 2OQ7A 2PHTA 4FO9A 4QPIA 4CCKA 4NHLA 4TN7A 1AR92 2YBSA 4XQDA 1Q56A 3C7OA 1QQP1 4AGGA 4LO8A 2NMOA 3PL0A 1PO11 1W8ZA 5FUPA 4A6SA 1HXS3 4XF3A 4M3CF 4O65A 2IXJA 1IHMA 2BOIA 2UWBA 2VVFA 2ZHNA 2A70A 1WMDA 2K46A 5J1XA 4GJYA 2V5YA 4NHKA 5A1FA 2GP5A 2HEYF 3IDEA 3RYKA 1OMIA 5GZDA 2VR4A 2VMFA 3W5MA 4AYUA 5LZ6A 1C8NA 5CFCA 3RSJA 3G7DA 1VIWB 2XVGA 4COWA 3E5XA 5FZ0A 5CVRA 2GC2A 1R1A3 3TBDA 3WSOA 3DKQA 4AEDB 2CWMA 3BPSA 4IV3A 4BIOA 4QXHA 1HB3A 2C6SA 4UFMA 3EYPA 4XACA 2W0XA 3DEMA 3WINE 4DFSA 1UOJA 1HDKA 5FWJA 3FLPA 5LRRA 1HJGA 2VNRA 5ERLA 5K0UC 4KI5M 3D6EA 4FOQA 4HN0A 4QB1A 4CCOA 3AMPA 5LEJA 4EZ4A 4ZKTB 3UK9A 3R4SA 2A3YA 3ZFFB 2A75A 4I3PA 2EXJA 4FPOB 3VL9A 2IUWA 2RS11 5CU1A 3SXWA 3N3HA 3PVNA 3O1RA 1UX6A 2D7FA 3AJYA 5A6YA 3M3EA 1Q8SA 2CHHA 4QHOA 4AAPA 5I8SA 1OA2A 1ZBE3 1O91A 3WF1A 3RMYA 1GZTA 3VBSC 2ZGUA 3NJVA 3WDTA 4CDQC 4HXCA 1DGRN 4KG8A 4KU7A 4MH0E 3QH6A 4MXWB 2CGNA 3OEBA 4DXSA 2BU9A 2HWB2 5DUWA 4W6XA 3N35A 4CU9A 4O9GA 2WNOA 4QMAA 1MEC2 4P9XA 2OQ6A 4FI9A 3ATGA 1I6XA 1V6LA 2OT7A 3NW4A 1F2NA 2D6MA 1MVEA 3SHRA 3SNMA 2R1DA 4MSVA 2DTYA 3T08A 5ABJC 2E51A 2W3JA 2J7MA 3JB8A 3PMEA 3C8XA 1W6MB 1VAVA 3U14A 3IIAA 2WWSA 4XOGA 1B35B 2RV9A 3OJBA 3BPZA 3IB3A 3MIEA 3I7DA 1H1IA 4WVZA 5FYVA 3OSDA 3WOGA 3WF2A 4YZ2A 5FK7A 3PURA 2LW8A 5CFDC 2PHDA 3UKNA 3GJBA 1JYXA 4DNYA 1REDA 2R071 5FK8A 1GNZA 4D6SA 3ZXFA 2W95A 4Z07A 1OQ1A 5A3NA 1YFWA 2WDBA 2GZWA 5HCAA 1H8TA 1TMF1 5KXDA 5K9YA 3SMHA 3WNXA 1YJKA 3VZKA 2Y34A 1YFUA 2QZ2A 4Y5Z0 1CIWA 3TEXA 4E2SA 3I59A 1AYM1 1FX5A 2R32A 1SACA 4LK6A 5FZEA 1ZREA 2BBAA 1JU3A 4FOWA 4Q0UA 2PHUA 1H6YA 3LA7A 4BQ2A 2Q4SA 3MIGA 4DO0A 5M0TA 1QDCA 3I2HA 4WVWA 3VBRB 3VBOA 1FOD2 5FPVA 3OF1A 1CPMA 4IE4A 1PO23 1RB8G 3LOIA 2XLGA 4LLOA 4W4ZA 4KL1A 4Q2FA 1PGL1 3C2UA 3FZ3A 5IK7A 3WG4A 2GC3A 1W2OA 5KC5A 2CU5A 2VUDA 5C3QA 3I3MA 1RUF1 2BGCA 3AK0A 2HWF2 3K3OA 1NQJA 2BZDA 4Y1ZA 2WO3A 3LPFA 4QAWA 1Z7S2 3V64A 3VD4A 4DXTA 4AEDC 2RDQA 2XJUA 1V00A 5F7UA 1J3QA 3VBUB 3WF0A 4FOYA 1I3HA 5AFEA 5A3WA 1LULA 5FV3A 4E9KA 2Q30A 2VGDA 5H9PA 3E1F1 2RS31 1SLTA 4JGYB 4BH9A 3PUAA 3ETQA 3MGUA 3S7IA 1XBFA 4AHYA 5J37A 1W6QB 2JJ6A 2VUCA 4QGNA 5DAWA 1E5SA 4Y33A 3OGJA 1HX6A 3ILNA 4CXWA 4NIIA 1EYBA 3ZFFC 3CZUA 3A0KA 1RUJ2 4XXPA 2QQVA 1NY72 4E4HA 4OI4A 1AF9A 2F6BA 4OZXA 2FZ2A 1JUHA 2ILMA 2VVEA 2ZX2A 2TBVA 4XAAA 5F9TA 1CZSA 2CDOA 2VZUA 3GCWA 5CEHA 5FP4A 3AMHA 3ENRA 4LO5B 2EALA 5GM0A 1AL21 2KA3A 3H7YA 3FHIB 3NMBA 4RR3B 2GN3A 1EUTA 1ZZ9A 2QDNA 1GLHA 2ZGLA 4QPGB 4BHPA 4ES9A 4GWNA 4XJAA 3NV1A 3ZLIA 4CCDA 4QKNA 1O3RA 3I2KA 3FC0A 1FXZA 4ITCA 2Y0OA 3DKWA 1ULEA 1RUI2 1WD3A 2QQKA 2YGMA 3USUA 5A3TA 5DDJ2 1YIFA 5JSOA 3ZXEA 1NCRA 4XTMA 1PNFA 1G86A 1UY2A 4FCAA 4LITA 4AVCA 1GR3A 4CSWA 4LE4A 4HONA 3USSA 2JG9B 1WW7A 5HPOA 1S4CA 3S0MA 3UETA 1TZOA 3KVAA 1B35C 3A21A 1SFPA 3O0WA 2JDAA 3RFRA 3PDQA 3FWEA 4URTA 4U2AA 3H7JA 1PMJX 1PK6A 2KM2A 4OI2A 4EN7B 5F37A 1W03A 4QKFA 4HSJA 4IGPA 2VVDA 5LK5A 5L73A 1NLRA 1VJ2A 3E6DA 3KV4A 1QXPA 1W8WA 4H3WA 2GH2A 1Q8PA 2TNFA 4GB33 4XZUG 3ZPYA 1UOGA 1U5IA 1HV0A 1V6JA 1XXNA 2RM23 3GHNA 4TLFA 1XE0A 2OVUA 5JSRA 2DCYA 5DXDA 1VBA3 4RD7A 3NNGA 1XU1A 2CSGA 5BNOB 4D3WA 4PT6A 1NXMA 1VBD3 4K20A 3ZSJA 3Q8AA 1W06A 3VBRC 3RQ0A 1JOJA 5GLZA 5JOXA 3ZXGA 1OFNA 1RIRA 1C57A 1PZ8A 2BQPA 3GALA 5A6QA 3P1IA 3LZZA 3B7MA 5A1LA 3GM8A 1FT9A 3HQXA 2E7QA 1WCSA 2Y33A 3WDVA 5DMYA 1MS5A 2Y26A 3AYAA 3NV4A 1RUG2 4MADA 3C7FA 2FMDA 3HR9A 3OUHA 5T52A 4BQWA 2XJPA 3O1UA 4F7ZA 1NCQA 1BVP1 1M4WA 2OYZA 4JVAA 1GOGA 3VBUC 5I0SA 4LA2A 3VD5A 2VCMA 4AXOA 2VC9A 4XDOA 2XMLA 1OQEA 4JGYC 1JZ2A 3J8F3 3PIGA 4AI3A 2DDUA 5EHDA 1RINA 3ZSKA 5H9RA 4Q8KA 2EIGA 4LOTA 2WQ4A 4XW3A 1ULDA 1RITA 2E31A 2QKDA 1PM4A 5DZFA 1YFYA 4N90A 5C33A 2FQPA 3RZHA 5F3IA 2PHRA 1CAWB 2ADEA 3RYPA 2BNOA 4GMP0 4D6QA 1X7NA 2AGSA 4NHYA 4YM2A 1S0EA 1GYKA 1POV0 5JI7A 3WY6A 1PVC3 4YGCA 1WW5A 3O1PA 4P02B 2C5DA 1VMFA 4FFGA 4RR3C 4Q1RA 5EYYA 1O59A 4ZPIA 4QPGC 4FBFA 1OKQA 2VUJA 2ZZQA 1V70A 3I2OA 2DURA 3T2TA 2VMIA 5EZWA 1KRIA 2I2SA 4W6WA 3W21A 1PGSA 4BWOA 4H55A 3WEZA 1W04A 3JQXA 2VJXA 3ZYJB 1SLAA 2ID4A 4YZ4A 3WP3A 2WS93 3FFZA 2PYTA 2QTWB 1COV2 4JDNA 3T4HB 4FSJA 1NOVA 4PI2A 1ENQA 2HBUA 2X5IA 1Z78A 1RYYA 2JG9C 1QXRA 1QJU1 3HNBM 1R083 3T4VA 4BYYA 5LRSA 5DZGA 1I9RA 1K5MA 2Y64A 2HJIA 5FZ9A 2W47A 1H4GA 1BEV2 4FVVA 4GWMA 4OHZA 4YVSA 3GZEA 3QH7A 4ISRA 4NVPA 4OI1A 2YUEA 1Y9MA 1GOFA 4CUGA 4NIAA 4MYEA 4EWEA 3S5AA 3IDBB 2FCUA 4N43A 1YC61 4HKOA 4QHZA 1GKBA 1DGLA 2NN8A 4HSLA 5KXEA 4XF4A 4FTBA 1WW6A 3N9PA 1NA1B 4ISQA 4AVAA 1UYZA 4FQZA 2EF6A 1OPOA 1WW4A 2EAAA 5KR7A 1OHFA 3J9SA 1MS1A 1J3RA 4AHZA 4C91A 5IAVA 3RZZA 3ACFA 4XDPA 4R8HA 4QT6A 4LUKA 5BNOC 1W9WA 1ZZCA 2FHRA 4WZFA 4YG3A 4DMIA 3PMSA 3AKSA 5C5TA 4OQ9A 1O4ZA 1Z0HA 1PO13 2F17A 5CNAA 5FP9A 4A42A 4A4AA 1S1AA 4KBBA 5FXZA 4JHTA 4LEJA 4LA3A 3O1VA 4RQPA 3H0OA 1DGWX 2YHJA 4B3NA 3NKTA 4XFGA 3BGAA 1TNFA 1URXA 5FY5A 3CEWA 4AFBA 5FLJA 1GQGA 2ENRA 3CJIB 2OZ6A 2QQPA 1XSQA 1D4M2 2ZBJA 4BB3A 4IEUA 4Q26A 4GQ7A 1JYCA 3EQEA 1PIV2 5SV8A 5JXIA 1GZ9A 2IZWA 3KT4A 1VBE1 1VBB1 1X8MA 1ZM1A 5E6HA 3VN4A 4X8NA 1RVF2 1O7FA 2BGPA 3MPBA 4Q5OA 2BW8A 3ZFEC 1FPN3 1H2KA 3LD8A 3ME2A 3N9NA 4CDXA 1V6KA 5FMCA 3TB0A 1XNCA 3AYCA 4OHYA 1AXKA 3LDKA 1AXYA 1BQPA 1UAIA 1WCUA 1X82A 4N53B 3ST7A 2WT1A 4Q8LA 4AI1A 1BVVA 4HL0A 2VQUA 1AR91 3NNFA 5DABA 3DL3A 3R4DB 3VBFB 2R0HA 1W0OA 2WO7A 2AUYA 4GAZA 1EPZA 3AMNA 3KT1A 2QQNA 4LULA 3P3PA 5A70A 2ARBA 4TZDA 1DBNA 1OUSA 2G4IA 1CAVB 2P37A 2K2SA 2YPJA 2DBIA 1DGRA 2OS2A 3FLRA 1CWPA 4CEYA 3LCPA 5C3RA 4RN5A 4IE7A 1E5IA 3I2DA 1VRH3 3VZMA 2E7TA 5GZGA 2Y8KA 5JMOA 4F8AA 2Q1FA 2YBKA 1GSLA 1KS5A 4XBLA 1YQ8A 1QJX2 2W2IA 3PLQA 2ARAA 3TRSB 3SLIA 4BK5A 1VLNA 2EIEA 3WNKA 4K6BA 1B09A 1Y3TA 3ZDSA 1ZBA2 3N7KA 4R9CA 1QJY2 3ACGA 3AB0A 5T50A 1PX3A 4W50A 3IIIA 4YM1A 1D0HA 1SPPA 2ADDA 3VL8A 4AVTA 1YO8A 5FZOB 3AXEA 5C8CA 1TVGA 1BBT3 1GFF2 1NA1C 2Z4FA 3OGRA 3ZDVA 5FY4A 2VAUA 2R073 2RG4A 2UYBA 1RXFA 3MZHA 4Q27A 2AZ5A 1MS9A 4HVQA 3GBGA 2WWUA 1ZRRA 1Q8VA 1GANA 2P3JA 3W58A 3TN92 5HCBA 1MZ6A 1SLIA 4BLJA 4EN6B 4Z1VA 2WA4A 2TEPA 5GZEA 3UYJA 2HWB1 1LHOA 4JKLA 3V0BB 1IPSA 5DAPA 1MEC1 3VBHA 3LA2A 2XONA 4XABA 2YC4A 2WNUB 2PHFA 1EV12 4Y4RA 3AL5A 3U4XA 2C9KA 2HYKA 5DG2A 5GJ6A 3WNNA 2ZGNA 4YWAA 1YYNA 3BOWA 4YGEA 3RVHA 5LA9A 3SEPA 5KHGA 1DDLA 1LECA 1UY3A 5JCTA 1DU3D 3DPRB 5GLTA 3WXPA 1AR72 2XJSA 3CJIC 3AKRA 3B9CA 3MDPA 1IS6A 5C8WA 1OLRA 3OPWA 5APAA 2XL7A 3HAGA 3OBTA 3FBMA 4D7SA 4A44A 3INAA 5JWPA 2MEV2 4LIUA 4UT5A 2QFEA 5H9SA 2YC2A 1WMEA 1OLMA 2D98A 5LA1A 2YV8A 4PI0A 5JIAA 1IZ3A 3PVBB 4N53C 2AC1A 1RUOA 4CDWB 4LMFA 2ZZJA 4QU1A 4L8QA 1CZTA 1UXZA 2FBEA 3C7GA 4Q4W3 4ARXA 3VBFC 5FPXA 5C5UA 1PMIA 4K40A 4FAHA 4OCTA 3OGGA 3AMMA 1FOD1 4O9EA 4X6RB 5FO9B 4CDUC 4YARA 1MR5A 1D4VB 3ABZA 2HWE2 2YC0A 4MGSA 5A7WB 3A7QA 1MZEA 1VMHA 5FJKA 5FPZA 1GQHA 1JZ6A 4AWDA 2WLQA 2G9GA 2JKBA 5AC92 1C5HA 1Q8QA 4HMZA 4OLLA 2DCZA 1QHDA 4K8RB 1WCKA 3M4FA 1Z7S1 3D5OA 2ZACA 1Y4WA 2E32A 1HJFA 3ZYRA 3VUOA 2B4KA 1W3VA 4NWWA 3AYEA 2W52A 2GH8A 3AFKA 4NAOA 4W6YA 4BQ4A 2FDIA 5EJZB 1ZA4A 4TLGA 3NNMA 2ZHKA 1ZZ6A 4MZUA 4R9AA 4RGKA 4UYBA 5KHHA 5C4WA 4CEWB 3AKPA 3HPNA 5FYTA 3AP6A 3AVSA 3C7EA 4X6QB 4YRDA 1AX2A 3MFAA 1EPWA 1JS9A 2BNMA 2XXZA 3DYPA 3KCYA 1S0JA 1RJ8A 4XFFA 4FXKB 5KHKA 1RUJ1 1W2TA 4EWDA 1A78A 3MIFA 5JZGA 2VCCA 5JPMB 2OX0A 2ZABA 3HOBA 3IZOA 3JCIA 1IOAA 1IPJA 1OKOA 1WD4A 2WN2A 5FZGA 3FLTA 2FD8A 2NP0A 1O3TA 4NHMA 4JRLA 1CR7A 1HB4A 2XWBB 1UO9A 1JODA 4KGGA 4FQ4A 4Y3OA 5BNQA 1UYXA 2W1SA 1Q5OA 3RGBA 3H3LA 2Z42A 5I8YA 4DUWA 1H1AA 4XE9A 4LKSA 1RUC2 4ZU7A 1JYWA 1RUNA 5C6CA 4AI8A 3E5UA 4CCEA 2QQMA 1KFUL 2WNUC 2GC0A 5DDJ1 4EN0A 1A8DA 3ZN6A 3OPZA 1Q43A 4IEOA 4Q4V2 4Y1YA 1W9YA 1CAUB 1W99A 1SMVA 4YG0A 3ZR6A 5JI9A 1LOAA 2B5HA 3DPRC 1XE8A 3JXSA 2B42B 3MW3A 5FYHA 1RUD3 3LAGA 1N1TA 3H42B 2VOKA 4K9SA 4PLOA 2VMEA 4CU7A 2Q1MA 1HN0A 1O5UA 4ZY9A 3KF3A 1MS3A 3POJA 1ODMA 5BNPB 2VQAA 5E88A 2VG9A 3DN7A 4QXKA 5IJRA 1LGCA 3PTYA 3ZYFA 1VPHA 1EP0A 4ZHNA 4XJ8A 4K3UA 2B45X 3P6BA 4BISA 4IEXA 3ZXKA 3WW4A 1O3SA 1HRV1 2QUOA 3VDDB 1ZYBA 2VL4A 4CDWC 1MS8A 2RE9A 5FCCA 1GP5A 1HXS2 1U12A 2IC1A 1PZ7A 1W90A 3GCXA 4XAEA 4QQOA 1ZRFA 3HNMA 2P2KA 4WVVA 5DZEA 2A6VA 3ACLA 4Q4Y1 1X50A 1J1LA 4ATFA 2WWJA 4FP3A 2WO2A 3OD0A 2WABA 3T30A 1LKNA 1I5PA 2VNGA 3J7MA 4BIFA 1V6NA 4BPZA 3B94A 4XQ4A 3T3YA 4F83A 1R1A2 4MGYE 4A41A 2QQJA 2XWJB 2XHKA 5FP7A 1CX1A 2Q1ZB 2WLPA 4AVSA 4QB6A 1HIXA 3IN9A 4GJZA 2DUQA 1N3PA 2CAUA 3MIHA 3PIJA 4BE3A 2CGOA 3ZIXA 5CFCB 3SEEA 4QX2A 2VMGA 4FTEA 1W8OA 4XUPA 3IMMA 2Z69A 2BTVC 4COZA 2A3XA 5K0UA 3ZN5A 4ASMB 5A3MA 3BTYA 3FHQA 1T6BX 1DGWA 5A33A 3VZNA 3J7NA 3B69A 4CEWC 4PIZA 1QJU3 1BK0A 1YNAA 4NJ4A 2V09A 1H2MA 2XJVA 4CCJA 5GKAC 3D3AA 2B9UA 3T1LA 3WDYA 4PF5A 3ZFGA 2XKOA 2WKKA 4KG0A 4FFHA 2ORXA 5L9RA 1ZBE2 4N9HA 3ACHA 1YUDA 2G9ZA 2JDYA 2K0GA 3AKTA 4GIQA 4PIYA 3V65A 4E8DA 4LTAA 3VBSA 3GDBA 3NJXA 4QKBA 5F2SA 2QQLA 1W8HA 4I0AA 5FZ7A 1JOBA 4XPVA 4XZPA 3MICA 4AVVA 5J09A 4V2WA 4D6RA 3I4IA 3WG2A 3IPVA 2PXJA 1S0IA 1KJRA 4NMIA 4Y5SA 2VECA 1CZVA 4HK8A 4CP0A 4UW5A 1C5IA 1S0FA 1OI6A 1Q3EA 2QCSB 4YW2A 1NLSA 3GYDA 1RUE2 3THPA 4LKEA 4AHWA 1WLDA 4QWNA 3IDCB 3RPQA 2GP3A 1DFQA 2JENA 1COV1 1WMFA 3GJAA 3KQRA 4UW6A 3T0BA 3KF5A 4YLZA 2B46X 4XEZA 1QJZA 2DCTA 3IT8A 4FOVA 1H4HA 2JE7A 3L2YA 4Y1VA 4HFSA 4MVTA 4WVMB 1F15A 1VB4A 1BEV1 2JWPA 2VOVA 1F31A 3WV6A 1LOEA 1UYPA 1CAXB 5BNPC 3TNPB 1H2LA 2RS53 2HLEA 2VQTA 1VB2A 4JKKA 3RG0A 2VU9A 1ST8A 3AM2A 3ZSEA 5DN2A 5IVYA 1UZZA 4KWJA 4RSUA 3HQUA 3AP9A 4M01A 4V2VA 2VY0A 4B1LA 1VBE3 4GH4C 4ZZ5A 5LK7B 1VBB3 2JXAA 2VMDA 5D8AB 5FZKA 3VDDC 5EJ3A 1OOPA 4UFKA 2AACA 3BU0A 2D6OX 4XJZA 1UZWA 2DFBA 5DG1A 5K4LA 1DZTA 1NG0A 2ZOEB 3ZVXA 3RZGA 5IFPA 4XUNA 2JECA 2E6VA 2VZ3A 1PO22 3NJZA 3ZMOA 3WQ1A 3THDA 1AR93 2A5ZA 4CA9A 1NUKA 2J22A 3U78A 4PHZA 2A6WA 1UY1A 3O12A 1EY2A 1JI6A 2HWD3 3JQWA 5JPNB 2Z2SB 4OI0A 1C28A 3CQOA 4CTEA 3O1OA 2IVIB 1SFNA 3BODA 3CF6E 1Y9QA 4JDMA 1LENA 1SHWB 2HWC2 2J1UA 2ZKNA 1ENRA 1GUIA 5FP3A 4AEDA 3KQ4B 3RZMA 2RMU3 4V1PA 4I2OA 4QX3A 4HLTA 3O14A 4XQWA 1LNSA 5CFCC 1IS5A 1UOFA 2BERA 4JGZB 1OH4A 3J4UH 4SBVA 1RHI3 4LHSA 1RMU2 1HRI1 4JTOA 4YW4A 2AEZA 4CUAA 5J96B 2GNTA 1PIV1 2WT2A 2JG8A 2Q5TA 1NZCA 1JUIA 1JYIA 2J1RA 4GWIA 3VZOA 4FPLA 3ZFFA 1DQ1A 4GA9A 1RVF1 1WBLA 3H1YA 5L36A 3SCGA 2ZMNA 1R092 1UQXA 1MVQA 1A34A 1CN1A 4NPMA 3K48A 2QNKA 1EAH3 5ISLA 2UURA 5FREA 3KGZA 5JR7B 1YFXA 1S55A 4JC1A 4ASLA 1FMD2 5A80A 4YGBA 5LCWL 5A7OA 4IERA 1SCSA 3POEA 3WD5A 4AAXA 3JD73 4XXAA 2XGXA 1IG3A 3OYWA 5J36A 1O5LA 4IDZA 1C1LA 1UMHA 1W2NA 2WZR2 1ASJ1 4BMEA 4QX8A 2XJQA 3OG2A 4QXBA 1ULFA 5EXOA 4HKWA 3B5LB 4JQRA 1N1YA 3EO6A 2OUJA 2W46A 4M00A 3ZXJA 4IETA 2ZPXA 5CAZA 3JB4C 3KHBA 3P5BA 1V6IA 2EIBA 1GU3A 4AEMA 2BFUL 1QXJA 3CJXA 4MX3A 4QPWA 5A6XA 5JOWA 3PU3A 3KV9A 3O1SA 2PFWA 3UKVA 1QIQA 1UOBA 3W9AA 3HBZA 5KHIA 1OFSA 1ZBA1 5JMCA 1U5YA 1QJY1 3ZYPA 4A7KA 4GB32 1CJPA 2WR9A 4WM8B 2AR6A 4G4FA 2RM22 1TEIA 3URFA 3VKFC 1KFXL 1HN1A 2PLV1 3VB9A 3ROUA 1VBA2 5D8AC 1HQNA 4CXYA 2XKPA 1HQLA 1JZ7A 4IE6A 1CVNA 2UWCA 2D3PA 1BK1A 2QJVA 2OIIA 4AZZA 3H8RA 4NPLA 3TN91 1ACCA 2EICA 2YROA 1QF3A 1VE0A 3RNSA 4CPBA 2I07B 2D3RA 2ZGMA 1M06G 2NQYA 2E26A 3RI8A 4OMCA 2X09A 2QBXA 2PAEA 3HT2A 1RUH1 3QBQA 1EV11 2WIIB 4ZONA 3N7JA 4JTNA 3WHUA 3FE5A 4GALA 3VBUA 3S57A 3K4AA 5D2AA 2WYSA 3T2OA 4DEQA 2EAKA 3J8F2 4JGZC 3PVOA 1PM7A 4A6OA 3NNLA 1YWKA 5LW9A 4IV1B 1XC6A 2Y6KA 5JXJA 1W6QA 4IE5A 1K45A 3H8OA 1ZNPA 1K3IA 2WQ8A 2BFUS 3K75B 3OY8A 4PLNA 4Y26A 5A32B 2XH6A 3HN3A 4UFIA 4RGAA 4AG4A 2F4LA 2MEV1 3D4KA 1C1FA 4HANA 4XF1A 1LODA 1KEXA 4OHVA 4XMIA 2R042 5LWBA 4E4SA 1GV9A 4PDWB 3HIFA 4Z82A 4ZS3A 4YPJA 4HVOA 3KLSA 1SG3A 1W2AX 3IMNA 3ES4A 4M3CA 2RJLA 1UZVA 1PVC2 5FMDA 4B7KA 4DZGA 5FOJB 3H8UA 5LB6A 1LU1A 5T55A 3LEKA 2ZGPA 3OUIA 3EHKA 3JBG2 4RR3A 3THTA 4QPGA 2CV6A 3GBWA 2HEWF 1OURA 2RJKA 2UU8A 5LA2A 2YU1A 2RR11 3I2IA 2J1VA 3MO4A 3N36A 4UWDA 5FZDA 5I8TA 1G9CA 4UW4A 3V0AB 5C7GA 3RRDA 2LS6A 4IXLA 5B4NA 5KHJA 2WT0A 1S0CA 3WQ7A 4GWJA 4NIHA 2JG9A 2R30A 1R082 1V9U2 1OXCA 5AC91 4C0BA 4EJRA 2OUHA 3WDWA 3WVJA 4JRAA 4WM7B 1GWKA 5GLWA 4QGMA 4Q29A 5DDJ3 1D0GA 1ND3B 4LLFA 1HW5A 1KS4A 2D44A 5DAVA 5C9AB 3OBZA 4UAPA 3ZFEB 1F35A 4AFAA 1LAJA 1A6CA 1ZX5A 5FLIA 3MHZA 1O6UA 2ZGQA 3HT1A 3SQOA 2HH9A 5FZIA 1SLBA 3PNAA 3IAPA 1K5MB 4WM8C 5FXXA 3CBNA 3PVEA 2QQUA 4CU8A 4Q0SA 4E2QA 5A3UA 1S2KA 1N1SA 1T6GC 2QE3A 1A8MA 4QU2A 4NO4A 5FKBA 5BV6A 2ET7A 4WZCA 2GC1A 3NJYA 4Y22B 4Q0QA 1DQ2A 2PN5A 5BNOA 1AJKA 3ILFA 5FYBA 2D97A 5FO7B 4META 1HRV3 4O7XA 3CL1A 3WNPA 3TWIA 1AVBA 3VHRA 4XUQA 1VR3A 1U5ZA 4HT1T 4BZ4A 3GXUA 3LWCA 1J58A 4QKDA 2E7AA 1O4YA 3QCWA 1UN1A 2YDEA 1VBC3 4K1ZA 2B39A 1TME1 4Q4Y3 1MACA 2A6XA 5FYIA 3KCXA 4M0NA 2LTNA 4HK9A 3VD9A 4HKLA 2WYFA 4JV4A 3SITA 2Z5WA 1OF3A 4Q4V1 1YQ2A 5IYYA 3LIGA 1OLME 2NMNA 4IEZA 3LB9A 4XUOA 5FZHA 2DVBA 1C8M2 3RZJA 2VOWA 2YBPA 1XB9A 3O7OA 5F5QA 2CL2A 3KV6A 1AR61 3M3QA 3B9IA 4IV1C 5IK5A 1JXNA 1OT5A 1LEMA 4KGQA 2DCKA 4QM9A 4W65A 4YM3A 4YM0A 1X9TA 3OB8A 3BKZA 3LSEA 1AR81 1FPN2 5C3SA 3SH4A 5J7MA 2ES3A 1AJOA 4QDQA 2O14A 3SC7X 4J25A 2PELA 4XBNA 2W1WA 1CAWA 3N7MA 1TG7A 1AZDA 2FZ1A 3KZ4C 2BYVE 4PDWC 1NYWA 1WGPA 1H1MA 1OUXA 2DFCA 1W0PA 3TAYA 2WNVB 4MGTA 2GALA 2JE8A 4FTSA 1HXS1 1QQP3 2BWAA 5T5OA 4URAA 3POWA 1BLZA 4Q4X1 5KXCA 2DVGA 1WZXA 1XOYA 3B3QE 1CX4A 3MF9A 1YLLA 3AZWA 1LHVA 1CESA 4PIXA 2G9FA 4XIKA 2EXHA 4G3YC 2R49A 1G9AA 2W08A 3AZZA 1MQTA 1ENXA 1UWWA 1VRH2 3CMGA 5J3UA 4BM8A 1C4RA 3KM5A 2Q8CA 3B01A 2AREA 1R1A1 5FP8A 5F3CA 2CWSA 5AFBA 2XG3A 3VV1A 4HETA 2X53S 1YQCA 5GZFA 2XBO2 4CEYB 4Q1PA 4MO3M 2Z79A 4HBNA 1W6NA 2ERFA 3KD4A 4WM7C 3WX5A 3DGTA 5GLUA 1ND3C 2VE1A 2VNVA 4HPKA 3N9MA 2C26A 3LFIA 3MLLA 5A7QA 3M3CA 5C9AC 2A73B 4UF0B 1W2UA 1W9SA 5ACA1 4Q0VA 1MS4A 1YQ6A 2XJTA 1AUYA 1WMXA 2R0FA 5E8AA 1E5HA 5BXXA 4YW5A 4MUVA 3VZJA 3D82A 4RHV2 3AZYA 3LQCA 4CUBA 2BGOA 5FR3A 1K5MC 2D5FA 3H9AA 3MPPG 5B2GB 3IWZA 4UI9L 3CKHA 1BBT2 4XCAA 2WZPP 1BEV3 1NQDA 5FY8A 3KS7A 2RS13 1JZ3A 3N9OA 3EXUA 2E63A 4YG6A 1ZBE1 1JZ5A 5JOYA 3FFQA 4OZOA 5BNNA 3FN9A 1XNDA 3QD6A 3MF6A 2X29A 4OYUA 1ULPA 3U11A 1PNGA 5DUXA 2W1QA 1ZA7A 4XC9A 4CDUB 5DPNA 3AP5A 3NV3A 4Y20B 3KHCA 1VAMA 2PMWB 4TTGA 2YB7A 2BOJA 1KDKA 3MEPA 4UW3A 4DXRA 2VBDA 4YVWB 2C9AA 3QACA 4XURA 1SDDB 1PMHX 1RUE1 1YI9A 2VW0A 2R6QA 4GKXA 2XR4A 4CE8A 3H8XA 3I3BA 5JOZA 1ZRIA 1O4TA 1DYOA 1GZWB 3VBHB 3CJIA 1LOCA 4RQPC 4AQSA 3VD7A 4CP1A 2WFF2 1VRBA 3T0AA 4AFDA 1PVXA 4LO7A 4QX5A 5EFUA 2RHPA 3AZVA 2VQ0A 4PBOA 1UXXX 4B29A 3U1XA 1RJ7A 1F5JA 3I8TA 4CXXA 1LU2A 2VXJA 3FBYA 3UT0A 2JDNA 4ZU5A 2GMPA 1L3JA 2VW1A 4Q0PA 3OCPA 4XFHA 1HRI3 3BIEA 5IK4A 4P9GA 2PHWA 3WR0A 4N53A 2PHLA 1PIV3 1LEDA 1TMF3 2IXLA 3I3QA 5IATA 1HV1A 1QY4A 1O3QA 2VBBA 4Q4W2 3WW2A 4XJUA 2R16A 2LUWA 3DYMA 3NVCA 2PTMA 3VBFA 3I2GA 4IE0A 1AYM3 2WNVC 4OMDA 2A6ZA 2JIGA 4TSVA 4LUMA 1GBGA 3KCCA 5HCFA 3U0ZA 2BEOA 4GMP1 1CAVA 2GAUA 5G04L 2GN7A 1POV1 3LEIA 5JXHA 2YXSA 2BPA2 3I2FA 2LALA 4CP9B 4O61A 3VHNA 1K5JA 1D7PM 2X10A 4BXFA 2YY1A 2TUNA 2VULA 1ULCA 3SISA 3O0VA 4AR2A 3FJSA 3PHMA 1NXD1 4GZ9A 1ND2B 3WG1A 2EVXA 1ASJ3 2HWC1 5FYSA 1RUF3 3BN6A 4B8EA 2O1QA 2JE9A 4CEYC 2JDKA 2IXHA 3MV01 3BTAA 2W91A 2ET1A 4CCNA 5EJ1B 2EIDA 2P3KA 5ANQA 1UY4A 1RMU1 1PHMA 1QH6A 1SLLA 2RS33 3AFGA 1JYVA 4LHLA 4DOUA 2IXIA 4HN1A 5F6LB 5FZOA 2W92A 3UL2A 2HBTA 5FBZA 4K7JA 2Y0IA 2VPVA 1UMZA 1R091 1STMA 4KWLA 4QHBA 2J1AA 4DRVA 1IS3A 1DYKA 3HBKA 3MUZ1 5HV0A 2VCAA 3ALQA 4D94A 1JYNA 1W0NA 1SZBA 5FYYA 1O8PA 1XYPA 2W39A 4N7IA 1KITA 4AI0A 3PUSA 1H2NA 1FMD1 2R1BA 3CU7A 3WNLA 4EV0A 5D21A 4SLIA 1AL23 2PLV3 3U07A 4DINB 5A7NA 4XHXA 5FZCA 2D40A 2WZR1 4QB2A 5JAXA 3FHAA 4C8DA 2WNUA 1GP6A 2HWF1 2HYXA 3CNAA 4YVWC 4ASKA 2DUPA 3BTZA 1LB2A 3R0RA 1W6PB 4WBBA 5F1RA 4DEVA 1W6OB 1L7RA 4LHNA 1RUD2 1WCQA 4Y1UA 2QZ3A 3VBHC 3MFCA 3PTRB 4NRPA 5BY5A 4LBLA 1HB1A 2WC2A 3ZXLA 4QGLA 1RUH3 1UU6A 3NAPA 1EV13 1UIKA 1XNKA 1X8EA 1NX9A 5FXVA 3T09A 3ZKUA 5KXBA 2FDFA 2VTFA 3NSTA 3FUQA 1BMV2 4H14A 1W8FA 3M1HA 3ON7A 5FZ1A 1P8JA 4I0WB 1V6MA 2EXKA 5FY0A 1NY71 2XOMA 1JW6A 4KWKA 1Q8OA 4GB31 5AVAA 5TSWA 1LOFC 2RM21 2QQWA 4RS5A 3DUIA 5K8SA 2I74A 4B1MA 1J3PA 4AI2A 4XJWA 4G9SB 4IEQA 4CDWA 3AMQA 4RYDA 5L7OB 1VBA1 3ZYHA 1SBDA 1AYN2 1XJAA 2PHXA 1OD3A 4GXLA 1OQDA 1JHJA 2MPFA 5DAXA 5DAQA 5CZKA 3HNYM 3Q9OA 4CUCA 1X9PA 2FCVA 4MHRA 5CADA 4DQAA 1NE6A 5FOBB 1US2A 1LJ7A 1XU2A 3LE0A 4MV2A 3N7LA 3LF7A 4OQ8A 4QDSA 1RUI1 1LOGA 3LKJA 2BVVA 4BDVB 3WZ1A 5H9QA 2GNMA 2B9VA 1R1ZA 3CLPA 3NKGA 5FKCA 1GZCA 3VDAA 5IT6A 2E53A 1UF2C 2OXBA 5A6ZA 3I3EA 5DUVA 1YCIA 4I02A 1WA6X 2RR13 2ZX3A 3DXTA 3Q8FA 3JU9A 1ND2C 5C71A 1GMMA 5A7SA 4KMQA 2R062 2Y6JA 5LY1A 4OHXA 3PJQA 2V5DA 1ZVFA 2WSVA 4QD2A 2WZ8A 1N3OA 2ZHMA 3J8F1 2QQOA 4CEWA 5AC93 3POSA 4R4XA 2PQSA 4GH4B 2E33A 3J26N 5CKMA 5LEKA 1YI7A 3MW4A 1UPSA 2BDRA 4YZ5A 1SCRA 1QDOA 2JB8A 4K1YA 3A22A 3DYOA 5EYXA 1GQPA 2R041 5JIUA 4L92A 3KT7A 1IPKA 1DG6A 2VM9A 5F3GA 3EBRA 3ECQA 5LATA 4QQPA 5FY7A 1KJLA 1W28A 2WFPA 1PVC1 1MPXA 4QPIB 2RVAA 2Y6LA 1PGW2 1FAYA 1DQ6A 3OGVA 3ZFGB 2BUKA 4COYA 5T54A 1J59A 2VOXA 3JBG1 2WZEA 1JYTA 4I3GA 1DZRA 4XF0A 1BYHA 2WSUA 3H3ZA 4TXWA 5CB7A 2ZAAA 1G8WA 5F32A 1JHNA 3T2QA 2Y6GA 3LDBA 1NE4A 4M4RA 3HEIA 5SV5A 3RMXA 1QJFA 2XQXA 1REFA 3E5QA 3M8LA 3NL1A 1RUG1 3BTXA 3VD3A 4LOSA 1DCSA 3DF0A 1CJDA 2YZ4A 3IPVB 5FFOC 1JZ8A 4DUXA 3MV11 1N47A 2W5FA 4J6GA 4ZZ8A 1R081 1V9U1 1W05A 1SLCA 2P6CA 1CONA 5FUNA 4P9YA 1H30A 1TME3 3KMHA 3B02A 1LHUA 3NRUA 4RFRB 4OFGA 2VBPA 1N1VA 3TOJA 4IV3B 2VZOA 5BNPA 2RS52 2PAMA 4S2DA 3BUCA 2XVKA 1UKGA 3ZM8A 4Y24A 1QNWA 4R9BA 4ARYA 1LOBA 5GALA 3M7AA 1S0DA 2CTVA 2UYAA 3K77A 4P9IA 4QXCA 2Q8EA 1AR63 4CDQA 4JDOA 4INDA 3AP7A 3VDDA 3GGLA 2N7GA 3SCFA 1AR83 5KWRA 4I01A 5L7OC 2NYYA 1RC6A 3LFMA 2XPJA 5IAXA 5FZ3A 3TEZA 1QGLA 5LBBA 3OBAA 3D0SA 1CPNA 4P9LA 1WCDJ 1ZZ7A 1ULOA 3ZIWA 1WKYA 1OOPB 2XB6C 4C1XA 2HKXA 5ABJA 4XTPA 5FBJA 2HWD2 2WAOA 5FQ0A 5FTTC 3GNEA 4NOTA 1OPMA 4ES8A 1MS0A 4JZRA 3WF4A 2SLIA 3B93A 4Q4X3 1DQ4A 3RJ2X 3ZO0B 4QX0A 4P9WA 3RZKA 4LBQA 2RMU2 4XFAA 2A7AA 4MGIE 1V0AA 4MLOA 5CFDA 4HZFA 2RDSA 5FZLA 4CZSA 2BRTA 1RHI2 1CGPA 4P08A 1K42A 4LKFA 3J7HA 2P5BA 4M3CE 1C8M1 2XDVA 4H7LA 2AYHA 2ZX4A 3WNOA 2CY6A 2WRAA 5C3OA 1W8NA 3ZSLA 5FPUA 1QMJA 4XILA 4IEPA 3R4UA 3UJOA 3VDCA 4D7TA 2O8QA 5FO8B 1QJEA 4MG2A 1FPN1 5CKQA 4BK4A 1EAH2 3PUQA 5ACA3 2ZXQA 2Y6HA 1H8TB 5IVBA 2JG8B 3R05A 2VNOA 3T1MA 1OSGA 4H7MA 2P1BA 3HD8B 5FPAA 1FATA 4PQQA 1ZRCA 1ZZ8A 3AC0A 2Q0AA 4QPIC 3I59B 2BNNA 1G9FA 3JD72 5GLVA 3ZFGC 4AEJA 5LA0A 4XBQA 5FYCA 3UV9A 1XSRA 4EWAA 3FMGA 2VXRA 2Y60A 4FPYA 4N8MA 1IS4A 1DQ0A 1ULGA 2LROA 3VBOB 5A1AA 5KC6A 3NV2A 2B8MA 2ZJCA 2VMCA 2H6CA 1X36A 1H6XA 4I0BA 4TWTA 4MGZE 5LASA 4NHXA 2QQIA 3WCRA 3BALA 5HXMA 4X8PA 1IKQA 1VRH1 2DU0A 3OYWB 1QNYA 2XLFA 4LHKA 2FDHA 2ZEYA 4MGKE 1D4M1 4NWVA 5L9VA 5EIYB 3D8CA 1NKGA 3K2OA 3PUHA 1S2BA 2XBO1 2ZEZA 4UFJA 1F4AA 4YW7A 4EYUA 4AQ2A 4QX7A 1E57A 4LO4B 4OUMA 5I0TA 1YXWA 3IKWA 4WVMA 1RUE3 4IV3C 2G19A 3WF3A 1X33A 3S30A 1CAXA 2A1XA 5AVPA 3W20A 1IG0A 2EA7A 2D43A 3JUUA 3P3NA 4CCCA 1AL0G 2E9QA 2ZEXA 3VKOA 5CISA 5CYYA 2PQQA 3POBA 1GP4A 1PZ9A 4RHV1 1WLWA 3RYRA 5CA6A 4RGGA 4AW7A 3I2JA 2ZCWA 3A0NA 1BBT1 3BI3A 4H2AA 3ACIA 2ATFA 1YRZA 4K8FA 5D8AA 1JZ4A 3MUY1 5F5IA 3UGHA 5GZCA 4LBKA 4MXWA 3KWVA 2R7EB 4Y4YA 4D69A 2JICA 2A71A 4XFIA 4MGQA 4ZU4A 5A3OA 2DBNA 4QQHA 4FP2A 3WP5A 3ZYIB 1MZ5A 5CG8A 1FI2A 3HJRA 4L97A 1OOPC 3CHXA 2AEYA 3NQHA 2ZMKA 4DY5A 4FPFA 2YFUA 4F3JA 4KU8A 1SFYA 4COUA 1XE7A 2HWB3 1XQNA 5HV4A 1W6MA 2DF7A 1FV2A 1CQ9A 1XYOA 1OVPA 1XYNA 2W68A 4HVRA 2Q8DA 1MEC3 3MBWA 3USUB 1B35A 4GMP3 4P9JA 1LGBA 1NCRB 1V6OA 1QU0A 1Y7BA 1REEA 1QJX1 5F3EA 4AEKA 1POV3 3ES1A 4AQ6A 3O1MA 4BQ3A 1YEWA 4NPRA 4JGZA 1D2SA 3IBMA 3QOPA 1QKQA 2WFF1 5IHRA 5A3LA 3WHTA 2JB4A 2D6LX 2HWC3 1PK6B 4S2GA 3L9JT 4GKYA 5FYMA 5C70A 3GHMA 2JD9A 2P3IA 4QM8A 4QQ2A 3VHOA 2DTWA 1J84A 3F2ZA 3GF6A 3APBA 2VZRA 1RMU3 4NIGA 2YU2A 2PA7A 1H8TC 2XHNA 2JDZA 1VBD2 2JG8C 3S7EA 3OY8B 2WNEA 2X8KA 5D1IA 1H9WA 4Q4W1 3VBRA 3WNMA 1WLCA 3Q8EA 5T5PA 2CYFA 5FY9A 2QDRA 5K7PA 1R093 1NZIA 3C7HA 3K46A 4C1WA 3A23A 1WWYA 3HVDA 4M3CB 2NLRA 5FXWA 5F8PA 4XIOA 2ZA9A 2C0ZA 3VBOC 4A7ZA 1S0BA 4LKDA 1HLCA 3AP4A 1FOD3 3AXDA 2OA2A 4QDRA 1FMD3 4Z92B 1UZYA 2BWCA 1POQA 4DIQA 2BVBA 2ZGOA 1APNA 1BKZA 1DIWA 3VZLA 1G6NA 1OLQA 2YFZA 4ZS2A 4CCMA 1AR71 3N9QA 4E27A 4OULA 1K12A 4JGYA 2G1MA 3PUIA 2WZR3 2ARCA 3DECA 1CD3G 3T0DA 2Y6FA 5CIRA 2BBVA 3N9LA 3LSDA 2HWF3 3OBRA 1NCQB 1NT0A 1LCLA 3K4DA 5FPBA 2VMHA 1Z7S3 3CIHA 4FPJA 4AL9A 4PJYA 3D0JA 4P00B 3ZR5A 3WG3A 3KGLA 4OUSA 1WA4A 1KXGA 1ONAA 1VALA 3IM0A 4ATEA 1LHNA 4YW3A 4IEYA 3VLBB 4BQYA 3RDIA 2NM1A 1OA3A 3NO8A 4WM8A 4Y1XA 1F4HA 5G05L 3ZKYA 3CDZB 2ETEA 4LJHA 4TYSA 4QPYA 4M0HA 2JDPA 1HKDA 2K9ZA 2WQZC 5FZFA 3UNPA 1RUJ3 3SH5A 2P34A 3ZYGA 1H8VA 4C90A 2MHFA 4AOCA 1D2QA 2KD7A 1HRV2 3AVRA 2DU1A 1IQAA 1UPIA 3DXUA 3HN1A 3AX4A 1FNZA 3LEMA 2WS92 5J98B 2CDPA 2LRPA 4AVBA 3ITQA 3N4MA 2WJSA 2HWE1 3VDBA 1G9DA 1VBC2 5T5JA 4Q4Y2 2H0VA 4IEWA 4L2NA 4A45A 3SKJE 1F8VA 2W1UA 1RUI3 3WQBA 1NCRC 2PAKA 2RDNA 2GSYA 3KB5A 1WUVA 3JZVA 4LBOA 1JN2P 5DUUA 3TYJA 3WCSA 4XJ9A 5IVJA 4YFWA 2X5IB 1LTEA 1RUD1 2XQRA 5FMOL 2V4VA 3POFA 3GZUC 1WBFA 3BB6A 3ZMNA 5I91A 4IV1A 4I30A 4HOOA 1DLCA 2V73A 1GNYA 2ZGTA 1BMV1 5A32A 3PU8A 2P6HA 1PK6C 2D3SA 1SDWA 2IXCA 4IGQA 4MOAA 2ZAHA 4YVSB 5JSPA 4FPHA 2GU9A 4NN0A 2ZKLA 4N43B 4XUTA 4BOWA 1XNTA 4YW1A 5ANNA 3M2MA 4PDWA 5BPXA 4IESA 1BHGA 3WQ0A 5IVCA 5HCHA 1FV3A 4PCRA 2DCJA 3ASIA 2C4XA 4LBJA 1QQP2 4DUVA 1FNYA 2XLAA 5IFTA 1PO12 1AYN1 2AENA 4ONUA 4YZ3A 4KQ7A 1W8TA 4WV8A 3CO2A 2R043 2WUHA 1RUC1 4QQLA 4FXGB 3RZLA 2V72A 3V0AA 1PX4A 2VZPA 2JD4A 3DV8A 4FT8A 3ETPA 3LA3A 4OUEA 3SCHA 5CKNA 2D5HA 3EB7A 3JBG3 5CG9A 1OA4A 2YMZA 4D8MA 5KBFA 4RQPB 1F5FA 4FFIA 3J7LA 1AXZA 2CNAA 4LIVA 4WM7A 1RUG3 3U37A 4FPKA 1MQTB 1NCQC 1ND3A 2P17A 2R061 2SBAA 3BVCA 5C9AA 3K51A 3ZFEA 3DCQA 4S2HA 4BXSV 1BZWA 3L2HA 2EXIA 1JTZX 4LQRA 4MHUA 5FMOS 3KSCA 1V9U3 5FYUA 1GNHA 2WO1A 3AKQA 3U4SA 1W6NB 2F4PA 4YSFA 1YJLA 5F2WA 3H1WA 5A3PA 4HPKB 3OTFA 1GWLA 1OF4A 2RS12 4IGOA 5I93A
chains in the Genus database with same CATH topology
3U10A 4LNVA 1F9KA 4CDXB 3VGIA 4GULA 1IKPA 4OVEA 1VP6A 1ZRDA 4Y22A 5HI0A 1QH7A 2DVAA 1PGW1 4RFT0 1DHKB 4AF9A 5BNNB 2ZMLA 2DYCA 2CAVA 4U36A 4UBGA 4AGVA 3M3IA 3AYDA 4XYXA 4LO6B 1J1TA 4KNCA 1UIJA 1OD5A 2QVSB 4PBPA 1DQ5A 3S6PA 1COV3 1LGNA 2YYOA 2GMEA 4CP2A 2X5IC 3X29B 1WLTA 3GBFA 1DYPA 1UKRA 4COVA 3ELNA 3UKTA 4A2UA 3G6JB 4FPCA 2RS51 2ZX1A 2H6BA 4YVSC 1NA1A 2R072 2Y38A 4YYOA 4FPEA 1HRI2 5E16A 2ZX0A 4N43C 1C8M3 3VKMA 1TMF2 3A4UA 3I54A 5C8CB 1KQRA 3POYA 4XFCA 1TNRA 3E6CC 1AYM2 2ZGSA 4J1XA 2WNVA 4OHWA 2ZGKA 4B4RA 4LR4A 4IQPA 2XUMA 4L11A 3FUOA 1ZZBA 2HWD1 1QOOA 4LBNA 1PGL2 2D93A 2GDFA 5JVVA 4AHXA 1UW8A 1ASJ2 2DVDA 2I45A 4Z2WA 1RUF2 1G7YA 2KXLA 2RMU1 1W39A 2OPKA 3H50A 3MIBA 4N9IA 2OZJA 1SEFA 1ENSA 4PLMA 4ZXKA 1MQTC 5FLHA 1RHI1 2LM3A 4AFCA 2YGLA 2RS32 3MLKA 4XFBA 1YIPA 3FX3A 4N7UA 3ZIWA 3ZYRA 1BJQA 1D4M3 2MNGA 3QLQA 5IUQA 2XBO3 4R52A 2IWGB 2NZ9A 2AH2A 3ZSMA 1RVF3 3RWNA 1TQ5A 4JAAA 5JDBA 4CDXC 1EAH1 1LESA 1SBFA 1U5XA 1XNBA 4XMAA 2XJRA 4LBMA 2DUOA 4FPGA 4RHV3 2JX9A 1XRUA 4L99A 5FRAA 3SH3A 5FDBA 1AL22 2PLV2 4CDUA 1PO21 3JD71 4BMBA 4XDQA 4IEVA 2D6KA 4Y20A 2B7YA 1KDMA 1UCXA 5BNNC 4YGDA 5BUVA 4B7EA 1C3HA 1TE1B 2GNBA 5CBLA 3MI8A 4RL7A 4YVWA 4BLIA 4YFZA 2A3WA 5BYNA 1H9PA 1LR5A 4YNIA 5L19A 1SBEA 1DLLA 1UU4A 3VKNA 1GZWA 4YZ1A 1RUH2 1QOTA 2JEMA 1RTVA 3BIWE 3MYXA 3MLJA 5T5LA 1I5ZA 3HMYA 1QJX3 2A6YA 3W59A 1VAKA 4E4DX 5C4WB 1ZBA3 1QJY3 2WFF3 1LOFA 3NAPB 1AX1A 2VUAA 2CGPA 3O5SA 5C8CC 2DV9A 5JZGB 3BU7A 3RI9A 2XVLA 4R9DA 1RL3A 2UWAA 4KH9A 1LRHA 3RS6A 1H0BA 4XETA 5EV7A 4EN8B 3V0BA 1KD7A 3WUDA 4RS5B 4DB5A 2FMYA 1QOSA 4E2GA 3ZXAC 4IL7A 2IFWA 1G9BA 3B00A 3V56A 3TN93 4BCUA 4LBQD 4FAGA 4C0HA 1A3KA 3LOBA 2RR12 4RA0A 2GMMA 3DPRA 4DS0A 2WINB 3H3UA 4P5HA 1ND2A 3M3OA 4D7YA 1FYUA 3ZN6B 5HXVA 3LGRA 2D6PA 3MW2A 2IFRA 4JCKA 3WP6A 2XL9A 3WLUA 1AR73 2ZHLA 2UY8A 3H1MA 2ARXA 3WUCA 3BOPA 1IGOA 1AHSA 3AJZA 3UJQA 2MEV3 2D6NA 3EJKA 1VBD1 2ZS6B 4BQ1A 3E6BA 2C1FA 4B4PA 1LHWA 2O8OA 3WDUA 3NWKA 3O0XA 3WT3A 4B4QA 1GICA 2WA3A 3GZTB 1QWRA 4DY3A 3ZX7A 5I0UA 4AFMA 2OW4A 4A3XA 3VKLA 4XF9A 4DRRA 3ILRA 1S0GA 3BCWA 1UL9A 1W6PA 5EWSA 4EROA 2HWE3 1W6OA 2UY9A 2IXKA 4CYDA 1UD1A 4J1WA 5F6KA 1TME2 2DVFA 1QJU2 3GZAA 3ZN4A 5E1RA 3WDXA 5J48A 1ALYA 2GNDA 1DF0A 4AE2A 4Z8BA 5IK8A 1BXHA 4LT5A 5K0UB 1HQWA 5A33B 5C4WC 3M70A 5JLVA 3E97A 4UBHA 1AR62 5T3NA 3NAPC 4S2FA 3RJRA 4AGRA 1AR82 1N3QA 4A7YA 5L7OA 5JZGC 4E4ZA 1AX0A 3AZXA 3HWJA 4K21A 2ZTNA 4P14A 1U0AA 4R4ZA 3R6SA 3VBSB 4PQ9A 4RS5C 4BA6A 4CDQB 4NR1A 2H0BA 4L9BA 4LE3A 2ZGRA 3MIDA 4ORFA 2WS91 3VHPA 3WW1A 2WL1A 3PJYA 4UXAA 3ZXDA 4Q4X2 1AYN3 1BCXA 1CAUA 1VBC1 1YHFA 4XHBA 1DZQA 3WP4A 2HEVF 4AQTA 1RUC3 1SQ4A 2Q8OA 4AK3A 3TNQA 4CRQA 5ABJB 2NPIA 5FQ0B 5E89A 5I0RA 4Q4V3 4DPNA 5HBAA 2VW2A 3C3VA 5FAXA 4LBQB 3WW3A 4DXZA 1JH5A 2VH9A 3OD4A 1JBCA 5CFDB 1MZFA 1VBE2 2DWRA 1VBB2 2O0OA 4GH4A 4MXVA 2R063 5ACA2 4I09A 1UU5A 4EN9B 1Y43B 1RGSA 1I1EA 2PHTA 4FO9A 4QPIA 4NHLA 1AR92 4XQDA 1Q56A 1QQP1 4AGGA 4LO8A 2NMOA 1PO11 1HXS3 4XF3A 4M3CF 2IXJA 1IHMA 2UWBA 2VVFA 2ZHNA 2A70A 1WMDA 2V5YA 4NHKA 2HEYF 3IDEA 3RYKA 1OMIA 5GZDA 4AYUA 1C8NA 5CFCA 3RSJA 3G7DA 1VIWB 2XVGA 4COWA 3E5XA 5CVRA 2GC2A 1R1A3 3TBDA 4AEDB 2CWMA 4IV3A 4BIOA 4DFSA 2W0XA 3WINE 1HDKA 3FLPA 5LRRA 2VNRA 5K0UC 3D6EA 4FOQA 4HN0A 3AMPA 4ZKTB 3UK9A 3R4SA 2A3YA 3ZFFB 2A75A 4I3PA 2EXJA 4FPOB 3VL9A 2RS11 5CU1A 3SXWA 3N3HA 3PVNA 1UX6A 2D7FA 3AJYA 3M3EA 1Q8SA 5I8SA 1OA2A 1ZBE3 1O91A 3RMYA 3VBSC 2ZGUA 3WDTA 4CDQC 1DGRN 4KG8A 4KU7A 4MH0E 3QH6A 4MXWB 2CGNA 2HWB2 5DUWA 4W6XA 3N35A 4O9GA 4QMAA 1MEC2 4P9XA 3ATGA 1I6XA 1V6LA 3NW4A 1F2NA 2D6MA 1MVEA 3SHRA 3SNMA 2R1DA 4MSVA 2DTYA 5ABJC 2E51A 3JB8A 3PMEA 1W6MB 1VAVA 3IIAA 2WWSA 4XOGA 1B35B 3OJBA 3BPZA 4WVZA 3MIEA 3I7DA 1H1IA 3WOGA 4YZ2A 5CFDC 2PHDA 3UKNA 4DNYA 1REDA 2R071 1GNZA 3ZXFA 4Z07A 1OQ1A 1YFWA 2GZWA 5HCAA 1H8TA 1TMF1 5KXDA 5K9YA 3SMHA 3WNXA 1YJKA 3VZKA 1YFUA 2QZ2A 4Y5Z0 1CIWA 4E2SA 3I59A 1AYM1 2R32A 1FX5A 1SACA 1ZREA 4Q0UA 4FOWA 2PHUA 3LA7A 2Q4SA 3MIGA 1QDCA 4WVWA 3VBRB 3VBOA 1FOD2 3OF1A 1CPMA 1PO23 1RB8G 3LOIA 2XLGA 4LLOA 4KL1A 4Q2FA 1PGL1 3C2UA 3FZ3A 5IK7A 3WG4A 2GC3A 5KC5A 1RUF1 2BGCA 3AK0A 2HWF2 1NQJA 4Y1ZA 3V64A 1Z7S2 4AEDC 2XJUA 1V00A 1J3QA 3VBUB 4FOYA 1I3HA 5AFEA 1LULA 4E9KA 2Q30A 2VGDA 5H9PA 2RS31 1SLTA 4JGYB 4BH9A 3ETQA 3MGUA 3S7IA 5J37A 4AHYA 1W6QB 2JJ6A 4QGNA 3OGJA 1HX6A 3ILNA 1EYBA 3ZFFC 3A0KA 1RUJ2 4XXPA 1NY72 4OI4A 1AF9A 2F6BA 4OZXA 2FZ2A 1JUHA 2ILMA 2VVEA 2ZX2A 2TBVA 5F9TA 3AMHA 3ENRA 4LO5B 2EALA 5GM0A 1AL21 2KA3A 3H7YA 3FHIB 4RR3B 2GN3A 1ZZ9A 2QDNA 1GLHA 2ZGLA 4QPGB 4BHPA 4ES9A 4GWNA 4XJAA 3NV1A 1O3RA 3FC0A 1FXZA 4ITCA 2Y0OA 3DKWA 1ULEA 1RUI2 1WD3A 2YGMA 3USUA 5JSOA 5DDJ2 1YIFA 3ZXEA 1NCRA 4XTMA 1PNFA 1G86A 4FCAA 4AVCA 1GR3A 4LE4A 3USSA 2JG9B 1WW7A 3S0MA 1B35C 3O0WA 3FWEA 4URTA 4U2AA 3H7JA 1PK6A 2KM2A 4OI2A 4EN7B 4HSJA 2VVDA 5LK5A 5L73A 1NLRA 1VJ2A 3E6DA 4H3WA 1QXPA 2GH2A 1Q8PA 2TNFA 4GB33 3ZPYA 1U5IA 1HV0A 1V6JA 1XXNA 2RM23 3GHNA 4TLFA 2OVUA 5JSRA 2DCYA 5DXDA 1VBA3 4RD7A 1XU1A 5BNOB 4D3WA 1NXMA 1VBD3 4K20A 3ZSJA 3VBRC 3RQ0A 1JOJA 5GLZA 5JOXA 3ZXGA 1OFNA 1RIRA 1C57A 1PZ8A 2BQPA 3GALA 3LZZA 3B7MA 1FT9A 3HQXA 2E7QA 1WCSA 3WDVA 2Y26A 1MS5A 3AYAA 3NV4A 1RUG2 2FMDA 3HR9A 5T52A 2XJPA 4F7ZA 1NCQA 1BVP1 1M4WA 2OYZA 4JVAA 3VBUC 5I0SA 4LA2A 4AXOA 1OQEA 4JGYC 3J8F3 4AI3A 1RINA 3ZSKA 5H9RA 4Q8KA 2EIGA 2WQ4A 4XW3A 1ULDA 1RITA 2QKDA 5C33A 5DZFA 1YFYA 4N90A 2FQPA 2PHRA 1CAWB 3RYPA 2BNOA 4GMP0 1X7NA 2AGSA 4YM2A 1S0EA 1GYKA 1POV0 5JI7A 3WY6A 1PVC3 4YGCA 1WW5A 2C5DA 4RR3C 4Q1RA 5EYYA 4QPGC 4FBFA 1OKQA 2VUJA 2ZZQA 1V70A 2DURA 3T2TA 2VMIA 5EZWA 1KRIA 2I2SA 4W6WA 1PGSA 4BWOA 4H55A 3JQXA 3ZYJB 1SLAA 3WP3A 4YZ4A 2WS93 3FFZA 2PYTA 1COV2 4JDNA 4FSJA 1NOVA 1ENQA 2X5IA 1Z78A 2JG9C 1QXRA 1QJU1 1R083 4BYYA 5LRSA 5DZGA 1I9RA 1K5MA 2HJIA 1H4GA 1BEV2 4FVVA 4GWMA 4OHZA 4YVSA 3QH7A 4NVPA 4ISRA 4OI1A 2YUEA 4MYEA 4EWEA 3IDBB 4N43A 4HKOA 1GKBA 1DGLA 2NN8A 4HSLA 4XF4A 4FTBA 1WW6A 1NA1B 4ISQA 4AVAA 4FQZA 2EF6A 1OPOA 1WW4A 2EAAA 1OHFA 3J9SA 1MS1A 1J3RA 4AHZA 4C91A 3RZZA 4R8HA 4QT6A 4LUKA 5BNOC 1ZZCA 2FHRA 4WZFA 4YG3A 4DMIA 3PMSA 3AKSA 1O4ZA 1Z0HA 1PO13 5CNAA 1S1AA 4KBBA 4LEJA 4LA3A 4RQPA 3H0OA 1DGWX 2YHJA 4B3NA 3NKTA 4XFGA 1TNFA 1URXA 3CEWA 4AFBA 5FLJA 1GQGA 2ENRA 3CJIB 2OZ6A 2QQPA 1D4M2 2ZBJA 4IEUA 4Q26A 4GQ7A 1JYCA 3EQEA 1PIV2 5SV8A 1GZ9A 2IZWA 3KT4A 1VBE1 1VBB1 1X8MA 1ZM1A 3VN4A 4X8NA 1RVF2 1O7FA 3MPBA 2BW8A 3ZFEC 1FPN3 1H2KA 3ME2A 4CDXA 1V6KA 3TB0A 1XNCA 3AYCA 4OHYA 1AXKA 1AXYA 1BQPA 1UAIA 1X82A 4N53B 3ST7A 2WT1A 4Q8LA 4AI1A 1BVVA 4HL0A 1AR91 3DL3A 3R4DB 3VBFB 2R0HA 1W0OA 2AUYA 1EPZA 3AMNA 3KT1A 4LULA 3P3PA 2ARBA 4TZDA 1DBNA 2G4IA 1CAVB 2P37A 2K2SA 2YPJA 1DGRA 3FLRA 4CEYA 3LCPA 3I2DA 1VRH3 3VZMA 2E7TA 5GZGA 4F8AA 1GSLA 1KS5A 4XBLA 3PLQA 1QJX2 3TRSB 3SLIA 1VLNA 4K6BA 1B09A 1Y3TA 3ZDSA 1ZBA2 3N7KA 4R9CA 1QJY2 3AB0A 5T50A 4YM1A 1D0HA 3VL8A 4AVTA 1YO8A 3AXEA 5C8CA 1BBT3 1GFF2 1NA1C 2R073 2UYBA 3MZHA 4Q27A 2AZ5A 1MS9A 3GBGA 1ZRRA 1Q8VA 1GANA 2P3JA 3W58A 3TN92 5HCBA 1MZ6A 1SLIA 4BLJA 4EN6B 4Z1VA 2WA4A 2TEPA 5GZEA 2HWB1 1LHOA 3V0BB 1MEC1 3VBHA 3LA2A 2WNUB 2PHFA 1EV12 3U4XA 2HYKA 5DG2A 5GJ6A 2ZGNA 1YYNA 3BOWA 4YGEA 1DDLA 5KHGA 1LECA 5JCTA 1DU3D 3DPRB 5GLTA 3WXPA 1AR72 2XJSA 3CJIC 3AKRA 3B9CA 3MDPA 1IS6A 5C8WA 1OLRA 2XL7A 3HAGA 3OBTA 3FBMA 4D7SA 3INAA 5JWPA 2MEV2 2QFEA 5H9SA 1WMEA 2D98A 2YV8A 5JIAA 1IZ3A 3PVBB 4N53C 1RUOA 4CDWB 2ZZJA 4L8QA 2FBEA 4Q4W3 3VBFC 5FPXA 1PMIA 4K40A 4FAHA 3OGGA 3AMMA 1FOD1 4O9EA 4X6RB 5FO9B 4CDUC 4YARA 1MR5A 1D4VB 2HWE2 2YC0A 1MZEA 5FPZA 1GQHA 4AWDA 2WLQA 2G9GA 2JKBA 5AC92 1C5HA 1Q8QA 4HMZA 4OLLA 2DCZA 1QHDA 1WCKA 3M4FA 1Z7S1 3D5OA 2ZACA 3VUOA 4NWWA 3AYEA 2W52A 2GH8A 3AFKA 4W6YA 1ZA4A 4MZUA 2ZHKA 1ZZ6A 4R9AA 5KHHA 5C4WA 4CEWB