4LTAA

The crystal structure of the p132r, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPRGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ltaA00
4YSFA 3OD0A 2Z2SB 2H6BA 3PLQA 1PM7A 3ES4A 4I02A 3ST7A 4AXOA 1UIKA 2ZKLA 3SCGA 3WW3A 1NZCA 5I8YA 1L3JA 4IEUA 4JTOA 2PAEA 2GC1A 4LLOA 3FHIB 4I01A 2PAMA 5JSOA 3BB6A 1QY4A 2QVSB 5HI0A 2GAUA 2XLAA 3QACA 5E16A 3LOIA 2H0VA 4I0BA 4IEWA 1O4TA 2D5HA 3LA2A 2PHLA 1ZVFA 2I45A 3WW1A 4LTAA 1UW8A 4NVPA 2VQAA 3OTFA 4QX5A 4QGLA 4EWEA 5KHHA 3TNQA 4J1XA 2E9QA 3BALA 3FX3A 2Q4SA 2OPKA 5J48A 4XFAA 3NKTA 1RGSA 1J3PA 5CVRA 5FQ0A 3C3VA 3U11A 1CAVB 1RTVA 4PIZA 3E5QA 4H7LA 4PIXA 1CGPA 4BH9A 2ETEA 4AVAA 1CAUA 2OZJA 4Z07A 4ZU7A 4MGZE 1VJ2A 1YUDA 1Y3TA 1O3QA 1ZREA 4AVCA 4N9HA 5KHIA 4META 4EV0A 2O8QA 1U12A 3NVCA 1YHFA 3H8UA 2D5FA 2PYTA 4UBHA 1ZZCA 1NE4A 2IXHA 5EFUA 3LA3A 1ZZ7A 3DV8A 4EWAA 3SMHA 1CAXA 3CO2A 3FJSA 2MPFA 4EROA 1PMIA 4XETA 5I0SA 4KU8A 3U0ZA 5J7MA 4UXAA 4J1WA 3B02A 3HQXA 4I0AA 5CADA 1ZRRA 2ZCWA 1CX4A 3HT1A 1GQGA 1J3RA 1WGPA 3L2HA 4IEPA 3E6BA 4N9IA 5LEJA 4KWLA 4K8FA 5FLHA 1UPIA 5F1RA 2IC1A 4JVAA 2GH2A 2OYZA 5LRSA 4WVZA 2P17A 4D7TA 4E2SA 4IEQA 1J3QA 1FT9A 1XRUA 5JAXA 1Q5OA 2QDRA 1QXRA 2UYAA 4OFGA 1V70A 2B5HA 2MNGA 4XFCA 3U10A 2PTMA 3ZDSA 4YRDA 3H7YA 2PQQA 1CAXB 3GYDA 2D40A 2EVXA 2QJVA 4PJYA 5I0TA 1CAVA 3LAGA 4QGMA 1Q3EA 5FCCA 3WW2A 5D1IA 1O3SA 4XF9A 3H1WA 2Z69A 1X8MA 3RYRA 3UKNA 3EQEA 3MPBA 3KSCA 3H50A 4FAGA 4XFGA 2IXLA 5KHKA 2QNKA 4HVRA 4QM9A 1DZRA 1RUOA 5J3UA 1OFNA 2PAKA 2H6CA 4HSJA 2VECA 2B8MA 2BEOA 5I8SA 1GQHA 2O1QA 4E2QA 4ZU5A 4BHPA 3D0JA 1IPJA 2IXJA 4AQ6A 3H3UA 2GC3A 5KHJA 2N7GA 3FWEA 1J58A 3CJXA 1YWKA 1O5LA 2V09A 5K8SA 3NW4A 4OLLA 4XF1A 3RZZA 1FI2A 3BCWA 4CYDA 3KCCA 2HKXA 4IEXA 3I59B 4IESA 1EYBA 4AVBA 3RNSA 4KL1A 2BNNA 2IXKA 4MUVA 3UKVA 4GULA 3RYKA 1O3RA 5T3NA 4YARA 4IEVA 3USSA 5JSRA 1YFYA 3RYPA 4ZU4A 4XF4A 2XKOA 2VPVA 5FDBA 4IERA 5FLIA 3E5XA 3S0MA 1YFXA 1X82A 2QCSB 4MGYE 3I54A 4QM8A 5BPXA 3CEWA 3I7DA 1OI6A 5JR7B 4D7SA 1Y9QA 4Q0VA 1OD5A 4I2OA 3H9AA 3DL3A 3KGLA 3ELNA 4MV2A 3MYXA 1UCXA 1DZTA 1WA4A 2XL7A 3DN7A 1LR5A 4JTNA 1EPZA 3S7IA 4L11A 2PA7A 2Q0AA 4F7ZA 1CAWB 4I09A 1OMIA 1WLTA 3IWZA 2EAAA 1EP0A 4HLTA 2UYBA 3OCPA 3LWCA 4MGIE 2WC2A 3SHRA 2F4PA 4WBBA 1H1MA 3H3ZA 4HVOA 4LEJA 5C8WA 2UY9A 3FE5A 2GC0A 3EJKA 1RL3A 3PNAA 1ZRDA 4XFIA 4TLFA 3WW4A 2XLGA 2EA7A 4ORFA 1YFWA 2IXCA 4LULA 5C6CA 3H7JA 3IDBB 4XEZA 3NSTA 4HSLA 4FBFA 4O9EA 2OA2A 2XKPA 2XHKA 3NJZA 4B29A 4MGKE 3BU7A 4YYOA 1O5UA 2BNMA 4RD7A 1XE7A 1O7FA 3KGZA 5BY5A 2BYVE 4UBGA 1HW5A 1VP6A 3I59A 3BPZA 5JSPA 2Y0OA 4Q29A 5I91A 1LRHA 3JZVA 3IIAA 4BIFA 5FPXA 1YFUA 3KMHA 5I93A 3IBMA 3M70A 5BUVA 3EBRA 5AVPA 1SFNA 5FLJA 3H1MA 4IEZA 4YNIA 3EO6A 4X6RB 4XF3A 5E1RA 1Q43A 3E97A 4XF0A 3R6SA 2CV6A 2GC2A 1J59A 5LRRA 3SXWA 1ZRCA 3ES1A 4Q0PA 1LB2A 2BGCA 4DINB 4HN1A 3FZ3A 3MDPA 4HN0A 4MH0E 1ZNPA 4E2GA 1O3TA 1DGWA 1NXMA 4LA3A 4F8AA 2IXIA 1H1IA 4R8HA 4AQ2A 4X6QB 3CLPA 3EHKA 5I8TA 2UY8A 3PVBB 4XFBA 4XFHA 3H1YA 1CAWA 1YLLA 4O9GA 2GZWA 3IDCB 3RDIA 3DKWA 3QOPA 4QMAA 4Z82A 4HVQA 4MZUA 2FQPA 3HT2A 1G6NA 3FFQA 4WZCA 1ZZBA 4BYYA 2GU9A 3E6DA 4JV4A 4KWKA 5BV6A 4FAHA 3O14A 3E5UA 1NE6A 2WFPA 3OF1A 5KBFA 4IEYA 1J1LA 5I0RA 3ETQA 3OGJA 3NL1A 5EZWA 3LZZA 3D82A 2CAUA 2FMYA 3LA7A 3E6CC 4QXKA 1X8EA 3N4MA 1ZX5A 4KU7A 4P9GA 1SEFA 2KXLA 4KWJA 1RUNA 3SCHA 2D93A 2HJIA 2K9ZA 4A2UA 1ZZ9A 2ATFA 2BNOA 4EWDA 1ZRFA 1NYWA 2Q1ZB 3VHRA 1QXJA 1JUHA 1I5ZA 4ONUA 4Q0UA 4XFFA 2XL9A 3CL1A 2Q30A 3TNPB 1XE8A 5LEKA 1RC6A 2DCTA 2CGPA 1TQ5A 3D0SA 4MX3A 1FXZA 1ZZ8A 2MHFA 1SQ4A 1IPKA 3ACLA 4LA2A 1LKNA 3HIFA 2PHDA 3UKTA 4HBNA 3S7EA 2CAVA 1DGRA 1I6XA 5I0UA 3CF6E 4QGNA 5FQ0B 3G7DA 1ZZ6A 2XGXA 2OZ6A 2ET7A 3RPQA 5CU1A 4L2NA 4I3PA 2K0GA 1CAUB 2PFWA 4HMZA 4Q0QA 1UD1A 3SCFA 4PIYA 3GBFA 1UIJA 4R52A 3M3IA 1VR3A 5FPZA 2B9UA 1EY2A 4Q0SA 4HZFA 4LUKA 4LUMA 2C0ZA 4FT8A 2ET1A 5KHGA 3ROUA 5BXXA 4IETA 2XLFA 4IEOA 1QWRA 3MZHA 1X7NA 5JCTA
chains in the Genus database with same CATH superfamily
3W20A 3OD0A 3QBQA 4N43A 1GZTA 5C3SA 5DAXA 4JGZC 2FHRA 1PM7A 2RS32 2WL1A 2WNUB 2JG8B 2YC4A 4LHSA 5T50A 1G8WA 3DKQA 3ST7A 1JMUB 4OQ8A 5D8AB 1UYXA 3VBRC 1DGLA 2VZTA 4IE5A 2RJKA 1GANA 1ONAA 4CEWC 1R1A3 1OVSA 1ZA4A 3RZLA 5CKMA 1KQRA 1GU3A 1Y43B 4UW3A 4I01A 1F5JA 3AJYA 3BB6A 4QX1A 2B39A 1W6OB 5A33A 5HXVA 4QX2A 2PLV2 1TME3 2QVSB 5CZKA 1DYPA 2YB7A 4INDA 1QNWA 3ZLIA 1Y7BA 2FDFA 1GSLA 2R7EB 1W9YA 4I0BA 3JB8A 1E57A 4FQ4A 1O4TA 1RUE3 1PIV2 2PHLA 3BN6A 4G3YC 1KD7A 3IAPA 5F5AA 3POJA 1LECA 4IL7A 4NO4A 5APAA 1IS4A 2W95A 3VKMA 2WNVB 1V6OA 1RUJ2 3KS7A 4QQPA 2VOTA 4XJAA 1BBT2 4NVPA 5JDBA 5JXHA 2C9AA 1ND3B 2WSUA 4QX5A 4C1XA 2BUKA 2W1SA 3JU9A 1NOVA 1LOAA 5LWBA 4TLGA 3TNQA 1F15A 3LPGA 3T0DA 2XG3A 3NNFA 4C1WA 4EYUA 4ISQA 1ASJ3 1D0GA 1RYYA 2XDVA 3O0XA 4MO3M 3RMYA 5DABA 1JXNA 3ZXFA 1RHI1 1MS1A 4FPKA 2GMMA 1RUF3 4QQ2A 2VZ1A 3ZSKA 4B4QA 4DEVA 1RTVA 2D44A 2X53S 3TEZA 4Y4RA 1AL21 5A32A 4JGZA 4HKOA 4AAXA 4BMBA 1RMU2 2ARAA 2A75A 1JOJA 5JPNB 1HB1A 1AR81 4QKBA 3WCRA 2ETEA 3VBRA 1GQPA 2Z79A 4CEYC 2WLQA 2OZJA 1AR71 4LJHA 4UT5A 4WM8C 3T1MA 5GZFA 1UF2C 5EJZB 2AENA 4CU8A 4QDRA 1AXZA 1YIPA 3FHQA 4KI5M 3VHNA 5E89A 1YUDA 1ULEA 3OD4A 1Y3TA 4DFSA 1US3A 2OX0A 2RR13 4AVCA 4YW2A 2XJPA 3GHNA 4NPLA 4NPMA 4KMQA 1GZ9A 1PMJX 2Y6GA 2O8QA 3NAPB 1MQTB 2OPWA 1RUC2 1YHFA 5DAPA 1HQLA 2XJQA 1QDOA 1OF3A 3NV1A 4J25A 2BTVC 5FYZA 1PZ7A 1S55A 3VBFC 1WCUA 4DUVA 1JN2P 1S0GA 3OEBA 4OYUA 5EFUA 5FZ8A 3GDBA 2A3XA 4O7XA 1OSGA 1NCQB 2RS11 2W87A 1Z7S2 4UI9L 5FY7A 4IV1B 2EICA 3ZFFB 1ENXA 4RR3B 2VU9A 1KDMA 5LA2A 2ILMA 2VAUA 2P3JA 2J42A 4NWWA 3LF7A 3LCPA 4NJ4A 2IVIB 4IGPA 4Y1ZA 2NLRA 1JYTA 3SQOA 2I07B 3O7OA 1OHFA 2VTXJ 1RJ7A 3POGA 4EN6B 4XJWA 5IT6A 4QXCA 5IFPA 1HDKA 5FZIA 4CA9A 2WINB 4YW6A 4N9IA 4N90A 5IK8A 4Q1RA 1JYVA 1WLWA 4S2FA 1UOBA 5EXOA 5FY8A 2IC1A 1RUD3 2WFF1 1AYN2 2QQNA 1VAVA 1QGLA 5JOXA 1V00A 4COUA 5B4NA 5IW0A 1RVF2 1JYIA 5AC91 2VMCA 4A6SA 1IGOA 4GMP1 1RUOA 2GN7A 3KV6A 1AVBA 2A3YA 5C9AC 3M2MA 5JAXA 2QDRA 4BQYA 2OUJA 2B5HA 1WCQA 1M4WA 1ULPA 4B1MA 3CJIB 3U10A 2PTMA 1Y4WA 3EMRA 1CR7A 1N47A 5FYIA 3ZDSA 1W28A 1KRIA 1AF9A 2B46X 3GF6A 4M3CA 3AP5A 4TN7A 3AP9A 2RS52 4PJYA 1K5MB 4KGQA 3ZSJA 1OH4A 2VGDA 4DIQA 4JDOA 5FCCA 1Q3EA 3VBFA 3V65A 4AF9A 5D1IA 2BBAA 4BE3A 1O3SA 4DRRA 5JI7A 1X9TA 1UU5A 2Z69A 4YZ2A 2JICA 1GP6A 3BIWE 1TNRA 4RQPC 4BXFA 4ZHNA 3HMYA 2G19A 1W8OA 3OB8A 5CBLA 1XYNA 2IXLA 2QNKA 2R071 1F4HA 2B45X 1OFNA 4NHLA 5C5TA 4I30A 4XVHA 1QQP1 4GWIA 4RS5A 4CU7A 2VECA 3G6JB 2YY1A 2BEOA 2TEPA 1CVNA 3VUOA 1UZWA 1R082 2O1QA 2NM1A 2GN3A 2ZX1A 3W5MA 1JH5A 5A70A 1OVPA 3MIEA 4Q4Y3 1IPJA 3A7QA 2IXJA 1VLNA 3H3UA 2PHFA 1VE0A 3IM0A 1QMJA 2N7GA 3FWEA 5AFBA 5KHJA 3S57A 1QOTA 2WN3A 4QX0A 2V09A 2JDNA 4CUCA 1Z0HA 4FPEA 1AR62 4XJUA 4LKDA 3KCCA 2NMOA 1AR83 3AB0A 5K4LA 1V6MA 1H2KA 2BZDA 3HD8B 3I59B 3OG2A 2Q8CA 1F5FA 3QH6A 4K7JA 2FDJA 4AVBA 5GZGA 1PMHX 1NCRC 3D6EA 4MUVA 1PO11 3ZIXA 4L99A 5IVVA 2CL2A 1DF0A 4QHOA 2EF6A 1HV1A 1WBFA 1O3RA 5FZMA 4YARA 4IEVA 2CGOA 2DVAA 1W3XA 4BB3A 4Y20A 4ZU4A 1D2SA 4QU2A 1W8TA 3ACIA 1LCLA 2RV9A 4FPJA 4IERA 4CP9A 2ZGNA 1QJEA 3J8F1 4NWVA 2JKBA 4LXLA 3DPRB 4IE4A 4GIQA 1D4M2 3I54A 5KXCA 4AAPA 3I2KA 5FZBA 4RQPA 3I7DA 1UZVA 2RS13 1REEA 1Y9QA 1ODMA 5A7WA 4XABA 3KCYA 1A8MA 5HV0A 1OT5A 2YROA 1DQ1A 5LCWL 2DVBA 4YGBA 1DZTA 3KM5A 2Q1MA 1VBB3 3TEWA 1QH7A 4NHYA 3PIJA 1LR5A 1RUH3 2GP5A 1EPZA 2VZ3A 1HJGA 2BV4A 1GMMA 2CHHA 3AMPA 2DCZA 2Q0AA 2X5IB 4F7ZA 2HWD2 3PDQA 4P9XA 5HCFA 4I09A 4COYA 3PUHA 4D69A 3ZR6A 1S0IA 1GWMA 4QQHA 1PIV1 2WA3A 1OOPB 2VTFA 3LWCA 5K0UC 4WBBA 4OUEA 4HVOA 3WNXA 2B4KA 3ZXEA 5C8WA 2UY9A 5LY2A 4FPLA 2VQ0A 1JS9A 1RL3A 4Q5OA 5A7SA 3ZO0B 1F31A 1G9FA 4PLNA 3PNAA 1SBFA 2YZ4A 3J7HA 4QHBA 1MS4A 3WW4A 1KS5A 1YFWA 5HV4A 2J1SA 1NXD1 4LULA 5C6CA 1WW5A 4Y33A 2I2SA 1IKQA 4QXBA 1CQ9A 4Y5SA 2ZHLA 1KDKA 1RJ8A 3NMBA 3GBGA 3T4VA 3WDVA 3VBUC 3BVCA 2BFUL 2YXSA 3NV3A 3ZOIA 4AI9A 4GWMA 2XHKA 4LOTA 4GB32 2HBTA 1AYM3 1DQ4A 2EIGA 1Q8SA 4CEWB 1RMU1 2O8OA 3ATGA 3VDAA 1Q8QA 2PHXA 3BU7A 2E53A 3URFA 2VZOA 4RD7A 3FFZA 4P02B 4M4PA 5C7GA 2R1DA 4J6GA 4P9IA 4QQLA 4W6YA 4WVWA 5L9VA 5BNNC 1NAEA 4LBLA 5ACA1 1PK6C 2R073 3JZVA 3IIAA 2HWB1 2A6XA 3OPZA 2CTVA 1OFSA 4QQOA 3B5LB 5FZFA 2RMU2 3DEMA 1P8JA 3IBMA 3M70A 2W2IA 3EBRA 4LPLA 2J1AA 1RUC1 4NE9A 2LUWA 3WDUA 1FOD2 1OKQA 2OS2A 1N1SA 2DCYA 1J1TA 5FLJA 4FFIA 3H1MA 4A7ZA 4DY5A 3KV9A 3TAYA 5C4WC 3I2FA 3AP6A 3N7KA 4ATFA 5BNOA 1TNFA 2R062 3N35A 4OI4A 1Q43A 4P9LA 2MEV2 2OQ7A 2ORXA 3R6SA 3RVHA 2XUEA 5FIXA 4MXVA 2OKXA 1QJX2 2P6HA 4QB2A 4B4RA 1Z7S1 2R49A 4ET7A 2ZGRA 2X05A 3SISA 1W9FA 4DINB 1VBE2 2HEWF 3K3NA 2EIBA 2D3RA 3A21A 2UWBA 1S2EA 3VD5A 5F3IA 3GBWA 1DGWA 2VW0A 1VBA3 1V0AA 3H8OA 5DZGA 1H1IA 3ABZA 5CFCC 1W6PA 2VCMA 5C33A 2WNOA 2C24A 3KV5A 3Q9OA 4DUXA 3J7MA 2ZEWA 3N9PA 4FFHA 4OUSA 2OUHA 3GCXA 2JX9A 5CA6A 1A8DA 1AJOA 2VW1A 1S0FA 3SH5A 3VBUA 4XFHA 2CWSA 1SPPB 4FXGB 4FCAA 3ZX7A 5F9TA 4HPKA 1EAH2 1QU0A 3O0VA 4CEYB 3I8TA 1ST8A 2GZWA 4RHV1 3ZYHA 4WM8B 3TEYA 1CONA 2D6NA 3IPVA 5IHRA 1DG6A 2BU9A 2VCCA 4MZUA 1ULGA 2DU0A 4YM0A 1BMV2 2RS33 3HT2A 1ULDA 1FATA 5LA1A 2WWSA 5FYHA 5FP4A 2GU9A 2HWC1 4V2WA 3EXUA 2Y6LA 5KR7A 3POBA 5CB7A 3LPFA 4JKLA 1WBLA 3ZFGA 3NV2A 2Y33A 1HXS2 4AYUA 2WN2A 3LFIA 2TNFA 2ZA9A 1SCSA 3KVBA 3PUIA 1F4AA 2VH9A 1GZWB 4IEYA 4L0PA 3T2PA 4CP1A 2HWE2 3N9LA 5A7PA 3NL1A 3BTAA 2VMGA 1G9CA 2FMYA 1F35A 1FPN3 4CUAA 3GNEA 1AR93 2PLV3 1ZX5A 1CIWA 1O8PA 3MUZ1 4P9GA 4YPJA 3ZYRA 4YZ1A 2FCVA 2KXLA 5C4WA 3UGFA 3VBSB 5A6XA 1O59A 1REDA 1S2KA 4RGKA 2K9ZA 3K4DA 1OF4A 3LEKA 1UU4A 4CCKA 1IG3A 3I3MA 1L7RA 1PIV3 2BNOA 1WW4A 3PU8A 4YG3A 2ZEYA 4OI1A 3PMSA 4TTGA 1DZQA 1KEXA 2Q1ZB 4GKXA 1UYZA 2XQXA 4QX3A 4CDXC 1I5ZA 1RUJ3 4ONUA 2YDEA 3SNMA 1BBT3 1GOHA 5C3OA 4XFFA 4WM7C 5CG9A 2JKXA 3BPSA 3R4UA 5CFCA 1NLQA 5LEKA 2CGPA 3O1UA 2ADDA 4YGEA 5A7OA 2MHFA 4XJZA 1R081 1UOGA 2ZEXA 1H2NA 3D5OA 4LA2A 4QWNA 4RA0A 4TWTA 4E8CA 3UKTA 4TZDA 1V9U1 4AHYA 3O1RA 5LY1A 3AL6A 1GP4A 1LU2A 4QKNA 2VUJA 5HCAA 2I74A 5C9AB 1OH3A 4XTMA 5EHDA 1VMHA 2ET7A 5L9RA 1YQ6A 4OHZA 1AR61 3S5QA 3K51A 4AVTA 5GZCA 4BQ5A 2C26A 2WO2A 3C7FA 4HMZA 4Q0QA 1UD1A 4H55A 1RHI2 2PMWB 5L9BA 3S5AA 1IZ3A 4LO8A 3M3IA 4R52A 4ZONA 4BQWA 3VV1A 4GALA 1N3OA 4DQAA 2WNEA 3T2OA 1AL22 2BGPA 1GOFA 1EY2A 2DURA 3NNJA 4HZFA 4Q0SA 3SH3A 1JYXA 3V56A 1JZ7A 3KVAA 4MHRA 2EAKA 4Z8BA 4FSJA 2WQZC 5I0DA 2ET1A 3LD8A 4YZ3A 1Q56A 5CYYA 3KQRA 4QD2A 2V72A 4AEDC 1LHOA 5L7OB 4QPIB 1JZ5A 4COZA 1NA1C 4Z2AA 3GJAA 4G4FA 5FZHA 5C5UA 1H30A 3K4AA 1CPNA 1OD3A 3HJRA 3P6BA 3W21A 3MLLA 1YIFA 5JIUA 2BP6A 3AMNA 4AXOA 3B9IA 4PLMA 1IOAA 4D3WA 4IDZA 1YXWA 4R4XA 4NPRA 1URXA 3HQUA 4BWOA 3SCGA 4FVVA 1CJPA 4XTPA 5IVJA 2GALA 3NJVA 4XQDA 2BW8A 3GGLA 4QPIC 1JZ3A 4JTOA 3FLTA 1OQ1A 3K4ZA 4K3UA 4D8MA 4IE6A 2PAEA 4JGYA 1LGNA 3GZEA 4NIAA 2WLPA 2A6VA 3LB9A 3VD9A 1DQ6A 2HWD1 2CDOA 2LRPA 1RITA 4M0NA 4B4PA 4CDQC 2GAUA 4LHKA 3JUUA 3IT8A 4JQTA 5H9PA 3ZYJB 4LT5A 5E16A 1POV1 3JBG1 4FQZA 1NCRB 2D5HA 1W8WA 4NHXA 2LROA 1HRI3 4OUMA 3ENRA 2J1UA 1AYN3 4H3WA 3B93A 1HRV2 4XZUG 1V6KA 3WW1A 4LTAA 2ZGUA 3KHCA 1RVF3 2RDSA 2QQUA 2GMEA 2R6QA 2RE9A 3PJQA 4JRLA 2E33A 1HX6A 2ZOEB 4YW7A 3ZYBA 1OUXA 1SLBA 5EJ3A 2RDNA 5KHHA 5L19A 1UZYA 2DVDA 1W90A 3RS6A 2CU5A 3VKFC 3UESA 2E9QA 4ZPIA 3FX3A 4JKKA 3T0AA 3IKWA 3GZTB 3VBHC 4PQQA 2NN8A 5J48A 1VAKA 1XU1A 2WWJA 3NQHA 4KQ7A 2DVFA 2VQTA 4Y1VA 3WNKA 5AC92 2ZAHA 1GBGA 1NA1A 2Y34A 1KS4A 3VN4A 2RS53 3F2ZA 2VXJA 1YNAA 1SDWA 3C3VA 3BTYA 3KF5A 3U14A 5T52A 2JIGA 4JDMA 3VKLA 2YFZA 2PXJA 4XQ4A 4L97A 1B35B 2ES3A 5K9YA 1AX2A 4AHXA 3USUA 3CKHA 3K2OA 1SLIA 4BDVB 1GICA 1QJY2 3WSOA 4DY3A 4ZU7A 3AC0A 4LKEA 5FRAA 3AZWA 1OLME 3I4IA 4MGZE 3SLIA 1TEIA 4OHXA 1RXFA 4TSVA 2VMFA 1AL0G 1NQDA 1X50A 4G9SB 4NAOA 2Y6FA 2RMU1 1LGBA 4PBOA 1BXHA 3OYWA 3MV01 2D3PA 1ZYBA 5DAQA 1BEV3 5K0UB 2J22A 1FOD1 1R083 2RG4A 5KHIA 4CU9A 1OPMA 4CDQA 4FP3A 1QJU3 4HETA 1Q8VA 1U12A 4WVMB 3MLJA 3RRDA 4K1ZA 2PYTA 5GLTA 5FPVA 4ZXEA 1ZZCA 2IXHA 1HB4A 1H0BA 1YI9A 2HYXA 4H14A 4D6SA 3OGGA 1W8FA 1AR63 4ZXKA 1SBEA 2GNTA 4XAAA 2Q1FA 3NJXA 4NR1A 2DCJA 3SMHA 1W6NA 3I2JA 5CIRA 4LOSA 3FJSA 2DBNA 2D6OX 3HR9A 2YGMA 1WUVA 5I0SA 3CZJA 5J98B 3AVRA 3U0ZA 2Q8EA 4RL7A 1RXGA 1UNBA 4UXAA 2R16A 3HQXA 3J7LA 3VBHA 4CDUA 3V0AB 3ZIWA 2R0FA 2ZCWA 5FZEA 3WNOA 2W91A 5FWEA 1E5HA 1EAH1 1GQGA 1J3RA 1CJDA 1LJ7A 2GNBA 1JOBA 4XUNA 3FLPA 4IEPA 1U5IA 3B00A 4HONA 3IZOA 3RZGA 4GH4C 4RYDA 2VMDA 3M3EA 1LOGA 2WS91 3AZZA 5BNNB 3W9AA 1PK6B 2X09A 4BCUA 4KWLA 5F3CA 1O4YA 4R4ZA 5FLHA 1UPIA 5IUQA 4D6QA 3R0RA 2GH2A 4OI2A 1KFUL 2OYZA 1D4M3 3WZ1A 5LRSA 5BNPC 3U1XA 5JZGB 2XPJA 2P17A 4LIUA 2ZACA 4XILA 2FDKA 1YQ2A 1ND2C 1YCIA 3WNPA 5DN2A 1H2MA 2XBO2 1SG3A 1HXS1 1VBC2 3ZDVA 1W05A 1UYPA 3U4SA 1VB4A 5FPUA 1NG0A 1UYYA 2VUCA 1Q5OA 3C7GA 3QH7A 2UYAA 4KGGA 4AI8A 3J8F2 2HWE1 1CX1A 1W6MB 2XJVA 5DXDA 2KR2A 1WZXA 3H7YA 3VKNA 2PQQA 4JDNA 5IFTA 1PGW1 2AEYA 2KA3A 3AZXA 3I2IA 1CAXB 1CPMA 3N9QA 4FOQA 2HWD3 3MF6A 5FOJB 2D40A 4LKSA 3POYA 3KB5A 5FXWA 2YG0A 4ATEA 1CAVA 1WLDA 4QGMA 2E32A 3AKQA 4FP2A 5DG2A 5IYYA 2SLIA 2HEYF 5DUUA 4JAAA 1VPHA 4A42A 3JQWA 5A1AA 1YQCA 1X8MA 3UKNA 1V6IA 2F4LA 4KG8A 4OCTA 5EV7A 4AHWA 4IQPA 1WKYA 4XFGA 5FOBB 5KHKA 4YW4A 2D3SA 2VNVA 1DZRA 3K77A 4OI0A 5GZEA 2PAKA 2V73A 3AJZA 4UFLA 5EWSA 5EPAA 5F37A 3AK0A 4XYXA 4ES9A 3V0BB 3VBOC 3ZMNA 3AL5A 4LHNA 3ORJA 3IB3A 1SDDB 2HWF2 4GH4A 4GB33 3C7EA 2C4XA 5FYCA 2GC3A 5LBCA 3DYOA 4NAMA 4R9CA 1J58A 4XDPA 3AFGA 3OY8B 3O0WA 3NW4A 4M00A 3RZZA 5BNPA 4UAPA 3BCWA 1FYUA 3T3YA 4CYDA 1AHSA 3AFKA 2ADEA 2HKXA 4HL0A 4K8RB 1ND2A 3ZM8A 5IVCA 1NX9A 1ULCA 3FUOA 4IESA 1EYBA 3MLKA 4UW4A 3FL7A 3J7NA 5FPBA 4ITCA 4KL1A 3FN9A 3HEIA 3ZXLA 4ASKA 2VZQA 3UKVA 2A3WA 2GDFA 1HQNA 1UPSA 1BCXA 3BYWA 3RYKA 1F9KA 5FO9B 5EYYA 1HN0A 2RMU3 3POEA 2D6KA 2V4AA 3HBZA 5T3NA 3SEEA 2WDBA 1ODNA 4M01A 4MSVA 5JSRA 4CDXB 3RYPA 1FOD3 4CCCA 2XKOA 3RJ2X 3KLSA 1SMVA 4A45A 2Y26A 1VRH3 2GNDA 2Y8KA 1LOCA 3POSA 4YW3A 1UKRA 1H8TB 4CCLA 4WM7B 5ACA2 1W8UA 2R063 2HWB2 2R041 2LW8A 5FY4A 1DQ2A 1KGYA 1BHGA 2MEV3 2XR4A 3KT7A 4N7UA 5C3RA 1X9PA 3PTRB 4A6OA 1QJX3 1SFYA 5K7PA 1YFXA 1CZVA 2EXJA 1DU3D 2QFEA 2W46A 1OXCA 5T5JA 2DF7A 5EP9A 4RN5A 1VBE3 5F8PA 5JR7B 2ARCA 5ABJB 2H0BA 1KITA 3N7JA 4Q0VA 5T5LA 4I2OA 3HVDA 1BVP1 4PF1A 3ELNA 1W8HA 4YG0A 5IK5A 1NT0A 3WG4A 3ILNA 4CZSA 1BK1A 1WA4A 3O12A 2XL7A 2VZUA 3N7LA 3K48A 3DN7A 4PBPA 2JG9C 2YGLA 5F2WA 3I2HA 3ZFEB 4DRVA 5E8AA 4JTNA 3S7IA 3VBOA 4IV3B 4BQ4A 2PA7A 4PDWB 1W2NA 2XXZA 4QT6A 1DHKB 2GH8A 2Y6JA 3B9CA 5EQUA 5FZ1A 4EN9B 1EUUA 4LBQA 2XH6A 1C8M3 3IWZA 3KCXA 2QQIA 3ITQA 1GV9A 1AX1A 4AE2A 4RS5C 1EP0A 2VY0A 4HLTA 2UYBA 1MS3A 1HRV1 1YYNA 3OCPA 2WC2A 2F4PA 3PU3A 4MXWB 4A4AA 3CU7A 3LFMA 1HN1A 5CKQA 1K5JA 1XYOA 2JD9A 3EJKA 1RUG2 3T1LA 4QPGA 1ACCA 3M3CA 4RHV2 4AEDB 4H7MA 5FP3A 5A3MA 1ZRDA 1GOGA 2E6VA 2XMLA 3PVOA 1PX4A 2XLGA 4TLFA 1UN1A 2GNMA 5JVVA 2IXCA 5DPNA 5TSWA 3OJBA 4GWJA 3IDBB 1R64A 1XJAA 1W2TA 2OXBA 4XEZA 4YGDA 1T6BX 2FCUA 1WD3A 2VVFA 3AVSA 2HWC2 5CFDC 1HQWA 4I3GA 3BKZA 1PO22 2ZZJA 1WCDJ 2RVAA 4E4ZA 5GALA 4JHZA 1O6UA 3KV4A 3VZKA 1QJZA 1OA3A 1XSQA 5EYXA 4B7KA 5KC5A 2VOXA 2ORZA 5ERLA 4DXZA 2VBPA 3ZSLA 4NMIA 1O5UA 4E4HA 5DDJ2 3AKRA 5FZOB 3N9OA 1QJY1 3H8XA 3KGZA 3BU0A 4UBGA 3OBZA 3BPZA 4QX8A 3Q8CA 1DDLA 2WZ8A 4UF0A 2DU1A 1XNBA 2XONA 2D6PA 4OQ9A 3ZN6A 4AVSA 3WINE 3T4HB 5T54A 2JG9A 2WZR2 4PLOA 4FOVA 2A6WA 1SHWB 2HEVF 5BUVA 3I3QA 4LKFA 5FUPA 4YVWA 1SLTA 5A3OA 5C3PA 4XC9A 1SFNA 5A3LA 1K12A 4WVVA 4YNIA 1OURA 3EO6A 3HOBA 3MFAA 1MPXA 4SLIA 4X6RB 4W4ZA 1UY1A 2CNAA 2W92A 4XF3A 4Y5Z0 5E1RA 3E97A 1TZOA 5G04L 3T09A 4Z1VA 4MADA 2CV6A 4UFHA 1QIQA 5DUXA 3U37A 2XVLA 5KWRA 1C57A 1VMJA 2DDUA 5FZ4A 5LRRA 1ZRCA 1ULFA 2LALA 3ES1A 4Q0PA 4BLIA 3MFCA 1X33A 3MIFA 1V9U2 1DGWX 4HN0A 2WYSA 4N53C 3W58A 1RHI3 1Y9GA 1H9PA 4IE0A 1UU6A 3VDDC 4F8AA 4GXLA 2VVEA 5BYNA 1AL23 2LS6A 3VZLA 4X6QB 2XUMA 3M3OA 2VCAA 3CLPA 3EHKA 5FYMA 5GLZA 5CFDA 4OULA 3IN9A 4ASLA 1CAWA 1AR73 3INAA 3UGGA 4JKMA 4O9GA 1ZM1A 3PVEA 2QE3A 5JXIA 1VMFA 3IDCB 4N43B 5A1LA 3CMGA 4Z82A 4LMFA 3WCSA 4CRQA 4Y1UA 4FI9A 1I1EA 4AI2A 2BJSA 3A22A 1G6NA 3ON7A 4Q27A 4DMIA 3VHOA 4O65A 4AFDA 4DPNA 3E6DA 1W9WA 4KWKA 5BV6A 3OUJA 1WW7A 5T5OA 3WF0A 2XBO1 5ISLA 1O4ZA 1VBC1 4LBOA 1MS0A 3NNLA 4Q4X1 3RI8A 3LSEA 5IK7A 3L2YA 4P5YA 3HNBM 3FC0A 3OF1A 3NKGA 5KBFA 2VM9A 3BTXA 2P5BA 2WZPP 2VOWA 4MLOA 2YBKA 4FFFA 1W6QA 2ZXQA 2ZMNA 3ETQA 4W50A 5I0RA 4LQRA 2YV8A 2E7AA 2ZS6B 3JD71 3LA7A 5A33B 3E6CC 2HLEA 1X8EA 2VULA 2QUOA 2PHTA 2QQJA 2RJ2A 3HAGA 3IIIA 4KU7A 3WNNA 3ZYPA 3N4MA 4KWJA 3SCHA 4Q4V1 4F83A 1OA2A 1W2AX 3ACGA 4TXWA 4A2UA 1ZZ9A 2ATFA 1LHNA 2YHJA 4AQTA 1UMZA 5F7UA 4CSWA 4XMIA 5LZ6A 3DECA 4YWAA 1ZRFA 1NYWA 4V1PA 4OMDA 5FPLA 5FXVA 1E5SA 3ZXJA 4W65A 4AFCA 1CZSA 4NIDA 4N53A 1GZCA 1T2XA 2V5YA 3M7AA 3LKJA 3WP5A 5BNOC 3CL1A 3VDDA 2Q30A 3JBG2 2DTYA 3HNMA 3CZUA 3D0SA 4HK8A 3NNMA 2WFF3 3L9JT 3T2QA 4OHYA 1W04A 4HK9A 4UFMA 1GNHA 4HBNA 2CSGA 5CNAA 5A3NA 2VVDA 4Y1XA 4FPYA 5AC93 2HWF1 2WT0A 2CAVA 4GMP3 2RJLA 4R9DA 3RGBA 3AMHA 1JYCA 4LR4A 1ZZ6A 3N3HA 2XGXA 4EZ4A 3Q8BA 5FZKA 4NRMA 3WX5A 4YZ5A 3RPQA 5A32B 4CDWC 4JGZB 5EIYB 2YMZA 1LOBA 4LLFA 2XJUA 2VNOA 2D97A 3J26N 4AGVA 4RGGA 4AEKA 4EQVA 2O0OA 2ZPXA 3VBRB 1EV11 1QJY3 5E88A 1UZ0A 3RZHA 3PTYA 3GBFA 3UJQA 3FMGA 3O1PA 2CY6A 1N3PA 3PIGA 2VNGA 3I3DA 4Q8LA 4WZFA 5FPZA 2WO3A 3CNAA 5FMOS 1UQXA 1HKDA 4S2HA 4URTA 3A4UA 4LUMA 3OOXA 4H2AA 1WMDA 4LO5B 4CUBA 1N3QA 5KHGA 3MF9A 3ROUA 2JEMA 3ME2A 3PMEA 4IETA 3ZFGC 4DB5A 1QWRA 2VZRA 2OVUA 4RSUA 2ZZQA 5FO7B 4AK3A 5JCTA 3I3EA 3LE0A 1DCSA 2B42B 1QQP3 3VL8A 3WNLA 4D7YA 4LBKA 4XHBA 1GWLA 1IHMA 1JI6A 3ES4A 4I02A 5LASA 4K6BA 2A6YA 2E31A 3T08A 3WDWA 2W3JA 3CBNA 5LBFA 2NPIA 2ZKLA 4Y4YA 1ASJ2 4LIVA 5I8YA 2BOIA 1LHVA 1I5PA 1L3JA 1O91A 2UWAA 3LSDA 3VDBA 2ZMLA 1Q8OA 4IEUA 2IWGB 1VBD2 2RDQA 3P1IA 1ULOA 1LHUA 1H4HA 3FHIB 2PAMA 4HXCA 5FZLA 5JSOA 1QY4A 4HKLA 4KG0A 4BQ3A 3ZKYA 2L9LA 1QXPA 2R30A 3DF0A 5HI0A 5JOWA 1HV0A 3VZOA 3RZMA 2XB6C 3WG2A 4MG2A 2A73B 1SLAA 3QACA 4BXSV 5KXEA 2EXHA 3LIHA 1PO13 2W5FA 2JDHA 4IEWA 3MW2A 4YVSA 4CDWA 4CXWA 4CVUA 1ZVFA 2R0HA 3MHZA 4GJYA 5FZDA 4GA9A 2X29A 5D8AC 3ZXKA 5A3PA 1RUG1 2G9ZA 2BGOA 3BIEA 3ALQA 2P2KA 3RFRA 2A70A 5C8CA 1VBC3 1UAIA 4P14A 5JXGA 2WS92 2Y0IA 1STMA 4EWEA 4NIHA 1JZ8A 3J8F3 3TN91 4XQWA 4J1XA 2ARBA 4P9WA 4BA6A 2Q4SA 1CZTA 2OPKA 2O14A 1PO21 5F2SA 4A41A 2FZ2A 4M3CB 2VZVA 1VAMA 1SFPA 1G86A 3C8XA 4Y22A 1NLRA 5CVRA 5FQ0A 1OUSA 1C5HA 3VBFB 2EXKA 2BDRA 4AQSA 5DDJ1 2R1BA 3F95A 1YJLA 4BH9A 1IG0A 2UURA 1C8NA 4FPGA 4BLJA 2ZHMA 1KXGA 2CGNA 1CAUA 2WNVC 5FMCA 3UT0A 1PGW2 4FPCA 2AC1A 3I97A 1D2QA 2RM22 4XIOA 1LOFC 5SV8A 3VZJA 3ZYGA 3DYMA 4K1YA 5FP7A 2VNRA 4W8JA 4B1LA 1ND3C 5FK8A 3GCWA 5FO8B 2WZR1 4FO9A 2JDZA 1ZA7A 2ZMKA 4RS5B 5FY1A 1O3QA 4FOYA 4XMAA 4Z92B 3NV4A 1UX6A 4C8DA 4FPOB 2JE9A 1PVC1 4QHZA 5FZ9A 2DBIA 4K9SA 1IS3A 4EV0A 3POIA 5HPOA 1AXKA 2WQ8A 3NVCA 1V6JA 4LK6A 2W52A 3WNMA 3WP3A 2HWF3 5LATA 2DV9A 2VZSA 4JX0A 4UFIA 4UBHA 5LK5A 1NE4A 4JGYC 2BPA2 4E8DA 2WNUA 2DCKA 2P3KA 3VD7A 1CD3G 2JG8A 2VMEA 3LEMA 3GM8A 1NLSA 5D8AA 3TOJA 4E27A 4XHXA 1PGL2 1UMHA 1CAXA 2HH9A 3EB7A 4M3CE 1KJRA 2OW4A 3WUCA 4ES8A 2MPFA 5IVEA 1IS5A 3M4FA 4XETA 3TBDA 1RMU3 3N7MA 4DNYA 5J7MA 3RWKX 3B02A 5F5IA 5HCBA 5FUIA 4V2VA 1ZRRA 1W6OA 1CX4A 1N1YA 3OEAA 4QXHA 1W0NA 3HT1A 1B09A 5F39A 4Y20B 1WGPA 1OPOA 2K2SA 3ASIA 3NAPC 3LDKA 1JOPA 5FKCA 5ACA3 5GLUA 1C1LA 5FXXA 3WD5A 4CP9B 2FDHA 2HWB3 4AL9A 1LNSA 2BOJA 4K8FA 2WKKA 4JVAA 1DQ5A 5C3QA 3AM2A 1W9SA 3R4SA 4WVZA 2WNVA 1NCQC 1GNYA 4RFRB 4RQPB 4IV1C 1LOFA 1RUC3 3MW4A 3H0OA 4E2SA 3ZFFC 4XAEA 4DO0A 1FT9A 2YC2A 5A7WB 4HANA 1ND3A 5FBJA 1XRUA 4AVVA 4XUQA 3UYJA 4YM2A 4OFGA 2R042 1V70A 2VQUA 5EJ1B 3ZKUA 4AR2A 1OLQA 2VJXA 2YBSA 2MNGA 4XFCA 5FYYA 1JTZX 4CCOA 1Z7S3 4MVTA 4KNCA 1SCRA 1ALYA 1SZBA 3AYEA 4C91A 2WYFA 4LBQD 3FBMA 2VG9A 4UYBA 5L36A 5I0TA 3LEGA 4QKFA 5AVAA 1UY2A 4UW5A 1ZBA1 4Q4W2 4BZ4A 5FZCA 3RG0A 3ILFA 4O61A 4WV8A 3WHUA 2X8KA 4XF9A 3ILRA 3H1WA 5FK7A 1UY3A 2Y60A 3HQRA 3TWIA 3DCQA 4AEJA 4K21A 3KSCA 4EN7B 4QDSA 4NUBA 1CESA 1BZWA 4FAGA 4RHV3 1S2BA 4HVRA 3AYCA 4QM9A 4CTEA 3NO8A 2H6CA 4HSJA 3WF4A 2XQRA 2WO7A 2KM2A 2B8MA 1RINA 2YUEA 3WUDA 3Q8FA 2WT1A 3WQBA 2QQPA 1LESA 2HWC3 4UW6A 2D7FA 3GHMA 3PJYA 4E2QA 4MGSA 3NAPA 1MQTA 4LO4B 3W59A 1R1A1 2WWUA 2VTXA 4AQ6A 2E7TA 1OQEA 1GR3A 5H9RA 3AP7A 5FY5A 1YWKA 5FJKA 1O5LA 1U5ZA 3WG1A 4AGGA 4CDUC 4XF1A 3I2OA 1AX0A 1VBB2 3WG3A 5DDJ3 1UY0A 5IVYA 1NCQA 1RUH2 1OQDA 4IV1A 1TME1 4IEXA 1IS6A 1D7PM 1QJFA 3ZFFA 1GKBA 4RR3A 5C71A 4L9BA 2IFRA 3U4XA 3EYPA 4YLZA 4LK7A 2IXKA 3BUCA 5LA0A 4L92A 5GLWA 4XXPA 2ZABA 4CE8A 2ZHNA 2ZGLA 1CN1A 3TYJA 1UKGA 2QQWA 2VO5A 4K40A 4Q26A 3P5BA 4AI3A 4XF4A 2WRAA 4B3NA 5FYVA 5JIAA 3WVJA 5DAVA 5FLIA 5BNOB 2HYKA 2IUWA 2B7YA 3E5XA 2BBVA 1DYKA 2JECA 1F8VA 1ASJ1 2FDGA 5FMDA 1JYNA 1V9U3 2DUPA 2YFUA 4KBZA 4XZPA 1OI6A 1DIWA 2Z4FA 3N9NA 4D7SA 2Y6HA 3AYDA 5JWPA 4BMEA 1BK0A 1RUF1 1MVQA 3ZSMA 1W06A 3DL3A 4GAZA 4MV2A 1COV2 4AGRA 1VBD1 4MYEA 1W6PB 1AYM2 3DYPA 3N9MA 5FFOC 3CJIA 3KZ4C 4C90A 4QPYA 3BOWA 3VBUB 2NP0A 4MGQA 4ZZ8A 4HPKB 4Z2WA 1LODA 1OMIA 1WLTA 2ZGSA 1K5MA 4FTEA 2W1WA 2YBPA 5A6ZA 3ECQA 4KH9A 4A3ZA 1CWPA 1M06G 3M8LA 3IPVB 1N1TA 1WCSA 3VD4A 3SHRA 4MGIE 4QKDA 4BPZA 1H1MA 5FTTC 3H3ZA 3MPPG 3AKSA 4UOJA 3FE5A 5DZFA 1BYHA 3AYAA 4Y24A 2WO1A 2AEZA 3ZFGB 4FPHA 4BQ1A 2D98A 4MGTA 3KT1A 2DYCA 5FMOL 1RUI2 2TBVA 4XACA 2CYFA 3OUHA 4ORFA 4GMP0 4GZ9A 2JXAA 2J1EA 2ZHKA 1FMD2 2RHPA 3NSTA 4HSLA 2YU1A 2X5IC 4AG4A 4PI2A 1YQ5A 2W39A 4P9JA 2OA2A 2XKPA 3HN3A 4Q4X2 1PNFA 4B29A 5C4WB 5JOZA 1G9DA 2AZ5A 2ZGKA 3TRSB 1K3IA 1NZIA 3IMNA 5AFEA 2YU2A 1JBCA 1GWKA 4MGKE 4QDQA 4IW3A 4YYOA 2A6ZA 4FTSA 1S0CA 4D94A 1XE7A 3LIGA 1QF3A 5DAWA 5F3GA 1VALA 3BTZA 2RM21 2E51A 5C70A 3JD72 2BYVE 2Q5TA 2VCBA 1OKOA 1HW5A 3A0NA 3I59A 4CUGA 3VKOA 3VDCA 1POV3 2JENA 4Q4V2 4XCBA 5I91A 3AKPA 1LRHA 5CFCB 3JBG3 2QZ3A 1C3HA 3MEPA 2OIIA 3RSJA 5CAZA 1APNA 1RUD1 4XW3A 4BIFA 2Q8OA 1YFUA 4FOWA 3KMHA 4BJ0A 5I93A 3GZAA 1XSRA 5FY0A 3HN1A 2YC0A 5JXJA 4XBLA 5AVPA 3VZMA 3BODA 3TEXA 2FDIA 1LOEA 3IDEA 4AWDA 4IEZA 1QKQA 1H2LA 1W2OA 4NIGA 2WA4A 2WQ4A 3A23A 1SACA 4YW5A 3B01A 2GC2A 5FZ3A 3DPRA 1J59A 1WA6X 3SXWA 4PF5A 4QB6A 1W0PA 2BWAA 5G05L 2XVKA 4HN1A 1PGL1 3FZ3A 3MDPA 4BQXA 4ZS3A 1FPN2 3Q8AA 3D8CA 1AR92 1A6CA 4CCEA 4E2GA 3B7MA 1O3TA 5KXDA 3AZYA 4LA3A 2IXIA 1MEC2 4XOGA 4R8HA 1HJFA 4AQ2A 2Q8DA 3K3OA 4B8EA 4FXKB 4HG6B 1PNGA 2AYHA 2UY8A 2Z5WA 1ZBE2 2JE7A 4XFBA 2G4IA 1EV12 2AUYA 2X5IA 1DGRN 2V4VA 5L73A 4QPGC 2WABA 5J1XA 5HCHA 4FFGA 4P08A 3RDIA 3DKWA 1PHMA 4I0WB 1OOPA 3QOPA 1QOOA 3MW3A 1LU1A 1GP5A 3FFQA 3O1MA 4WZCA 3VL9A 1BVVA 1BQPA 1QOSA 4FAHA 1X36A 2ZAAA 3APBA 3O14A 4X8PA 4Q4Y1 4L8QA 1NE6A 2WFPA 2BERA 5FKBA 4XDQA 1VBD3 2YYOA 5LB6A 4JGYB 2PQSA 3RQ0A 1KFXL 3B3QE 2QBXA 3LZZA 1XB9A 3D82A 5FYUA 1WW6A 2CAUA 2P3IA 4QXKA 2JDMA 1H8VA 2XVGA 4Q4W1 4IGOA 4KWUA 5FREA 2FZ1A 2ZEZA 4AZZA 4CEWA 1L7LA 4YZ4A 2HJIA 3AP4A 4CCDA 4CU6A 4D0QA 1F2NA 3C2UA 3C7OA 4COVA 3WV6A 1I3HA 1DYOA 1W2UA 3D3AA 4RGAA 3LOBA 4YVWC 3WQ0A 3VHRA 1EAH3 3WHTA 3ZR5A 4Q0UA 2LTNA 4PI0A 4OHVA 4XBNA 2WT2A 3E1F1 1VB2A 2WS93 3TNPB 4UFJA 1RC6A 1TQ5A 2AACA 4ZS2A 1SQ4A 1IPKA 3ACLA 4LORA 1G9BA 4YM1A 1LKNA 3HIFA 2PHDA 3J9SA 5FYTA 4IUGA 5T55A 5FUNA 5GM0A 3S7EA 4XDOA 1WCKA 2Y64A 1GYKA 1I6XA 4NRPA 5I0UA 1NA1B 3CF6E 1HXS3 2J1TA 2OQ6A 3K46A 2PELA 4QGNA 3CQOA 3VBSC 1US2A 4M4RA 1MR5A 4AW7A 2Z42A 1JZ6A 1VBB1 2JD4A 1XPWA 2HWE3 3TN92 2SBAA 4L2NA 3J4UH 4I3PA 1RUH1 4QX7A 3WR0A 3AZVA 2ZX4A 3GALA 1UXXX 2K0GA 2P1BA 3USUB 1OC1A 5A3TA 3SCFA 3ZYIB 2RM23 1W8NA 4PIYA 3UJOA 5DUWA 1W0OA 4EN8B 1VR3A 2WAAA 3MI8A 1YEWA 1XNCA 1TMF2 2ZKNA 1LHWA 4QAWA 2ERFA 1UL9A 2QQKA 2K46A 3U78A 3CIHA 4LUKA 3WQ1A 4XJ9A 3PVNA 3OYWB 4OVEA 2G1MA 1HRI2 2AREA 3MO4A 5IK4A 2XWBB 1SPPA 4CDQB 4LNVA 1WMXA 2XLFA 3O1SA 4CEYA 1X7NA 3QD6A 1V6NA 4WM8A 5DUVA 1S0BA 2ZGPA 1JHNA 4YSFA 1MS9A 2V5DA 3AMQA 1WMFA 3K75B 2Z2SB 2H6BA 1JODA 2J7MA 3PLQA 5A1FA 3JCIA 3WDXA 4NHKA 1UIKA 3IMMA 3S30A 1PVC2 5IAVA 3THPA 1U0AA 3WW3A 3BI3A 1NZCA 1COV1 2PN5A 3ACHA 1W6NB 1H4GA 4Y3OA 2XJRA 1AYM1 3T0BA 4SBVA 1U5YA 3RJRA 3WQ7A 1GZWA 4LLOA 2GC1A 2JB4A 2EIEA 4HKWA 3VBHB 3WXPA 4A7YA 4CDUB 5CEHA 2W08A 5F3EA 5A7NA 2VOVA 3LGRA 3R05A 5IJRA 4DZGA 4P9YA 1R092 4YM3A 3QCWA 5LK7B 5L7OC 1ENSA 4DXRA 2XLAA 1IPSA 1DFQA 1DLCA 1EPWA 1YRZA 2JIJA 3DXTA 3FUQA 3POFA 2A5ZA 5FYBA 4NIIA 1N1VA 3LOIA 3VBSA 3X29B 2H0VA 5CISA 1MVEA 4DS0A 4OZXA 1SBDA 2RDRA 4DXSA 3I49A 3FHAA 3LA2A 3N36A 1UXZA 2WIIB 5J09A 2I45A 3PUSA 3OGSA 4DOUA 4FPFA 3SC7X 1NQJA 3T2TA 1UW8A 5JOYA 1BEV2 2JE8A 1JYWA 1RUI1 5FBZA 1QJU2 3AMMA 3RZJA 2VQAA 3M3QA 3OTFA 1XBFA 3MBWA 5H9QA 3W5NA 4QGLA 4BIOA 4U2AA 2R043 2ZGTA 1G7YA 1O8SA 4CPBA 2NQYA 1QH6A 3UETA 2BWCA 1FMD1 3BALA 4W6WA 2YPDA 5J37A 4XFAA 3NKTA 3VD3A 1L7QA 1WMEA 4P5HA 4A7KA 1RGSA 1S0JA 1J3PA 5IAXA 1Z78A 2XOMA 4GWNA 1VBA1 3U11A 2VZPA 1CAVB 3IDAA 4PIZA 3E5QA 4H7LA 4PIXA 4Q4W3 5D2AA 5C9AA 1CGPA 4XURA 3WDTA 5FWJA 5JI9A 4URAA 3RZKA 1GUIA 4XPVA 2TUNA 2PHUA 1DBNA 1OLRA 1MS8A 1C28A 4YFWA 4HT1T 5IWFA 4Q8KA 2J1VA 4XBQA 4Z07A 1JZ2A 1QDCA 2P6CA 2NZ9A 3OBRA 4AOCA 1PX3A 4NHMA 5F5CA 1VJ2A 1ZBA2 1DQ0A 1DP0A 3FLRA 3OGRA 2ZTNA 2DTWA 1E5IA 1HRV3 2RS31 5FY9A 1ZREA 4XUPA 4OHWA 1PGSA 2D43A 4N9HA 1YQ8A 4S2GA 2AH2A 4JCKA 3SKJE 3WY6A 4GJZA 4JZRA 4META 1XNAA 5L7OA 4QPIA 1UY4A 2G9FA 1AXYA 4AI1A 2ZGOA 4OZOA 2ZBJA 2D5FA 3H8UA 3KHBA 3MGUA 4GH4B 3ZYFA 5IVFA 5H9SA 2P3YA 2R32A 1A3KA 5DQ0A 3ZMOA 3HNYM 5A7QA 1C5IA 2W1QA 1B35C 3ETPA 5BNPB 3V64A 4C0HA 3LA3A 1ZZ7A 1FPN1 3DV8A 1AR91 2PLV1 4EWAA 1UMIA 5LEJA 1ND2B 3SITA 1H9WA 2ZX3A 2VMHA 3GJBA 1JHJA 1MEC1 1XQNA 1XXNA 1R1A2 1UZZA 3BGAA 3CO2A 4DEQA 2FD8A 4EROA 1PMIA 4JRAA 2F17A 4KU8A 4YVSC 2OT7A 4HFSA 5IATA 4J1WA 1CIYA 1ZBE1 2GSYA 4I0AA 5CADA 3MV11 3KF3A 3THTA 5FPAA 1RUJ1 1TME2 1AUYA 1OLMA 1NY72 5C8CC 1BBT1 1VIWB 2IFWA 3GXUA 3L2HA 2JWPA 3E6BA 1JW6A 3DUIA 1NKGA 1XC6A 1BJQA 1SLLA 1NCRA 1RUE2 5F1RA 2W68A 4CCJA 4R9AA 4XXAA 3PUAA 2DFCA 3RI9A 5LBBA 4D7TA 1PM4A 4YW1A 4IEQA 1J3QA 3B69A 4Y26A 4XE9A 3Q8EA 1COV3 3KWVA 1QXRA 3AX4A 3AXDA 4EE2A 4ZKTB 4CCMA 1LGCA 5FJHA 3UNPA 1ENQA 4YRDA 3LEIA 2VBBA 2QZ2A 3PHMA 2C5DA 4XCAA 1TG7A 5FZ7A 3VBOB 5B2GB 3GYDA 4FTBA 2WJSA 1POQA 1XNKA 2A1XA 1RUF2 2E7QA 2EVXA 2QJVA 4LBQB 2NMNA 5HXMA 2BRTA 3LAGA 5FYSA 2QDNA 2Y38A 3WF1A 3I2GA 3WW2A 3CHXA 1WWYA 4PT6A 4RFT0 1B35A 1XU2A 1LEDA 2VR4A 1POV0 1H1AA 3KQ4B 3R4DB 5JZGC 1W99A 3O1OA 3RYRA 3NNGA 2VC9A 4AVAA 2QQVA 4UFKA 3EQEA 1R1ZA 3MPBA 1V6LA 3H50A 4P00B 4QPGB 2CDPA 4LBNA 4UWDA 4XIKA 3THDA 3WF2A 3OSDA 4QPWA 1RUI3 1XYPA 2ID4A 3LDBA 5E6HA 3THCA 1VRH2 4LE3A 4QB1A 4ASMB 5J3UA 2WNUC 4M3CF 4CXYA 1W9TA 2JB8A 2JG8C 5JPMB 2ZX2A 2RR12 2DVGA 1OA4A 2P34A 3ZPYA 2FMDA 5JUVA 1K42A 5K0UA 1HB2A 4JHTA 2X10A 1FMD3 1GQHA 2ZX0A 5I8SA 1VRBA 3WEZA 2XBO3 4ZU5A 1A34A 4Q4X3 4WVMA 4BHPA 1T6GC 3D0JA 3OPWA 2C1FA 4QU1A 3ZXGA 3CJXA 4XJ8A 4ISRA 4GD4A 2QTWB 5LA9A 4U36A 3WF3A 5K8SA 4YG6A 4OLLA 2BVVA 5F6LB 1FI2A 5JR2A 1JU4A 3B94A 2VUDA 5FAXA 5FZGA 2W94A 3JD73 3P3PA 2VOKA 3WOGA 1ZRIA 4R9BA 5B4XA 4Q2FA 1Y9MA 1TMF1 2GP3A 3RNSA 4Q4V3 4UF0B 4NRQA 1MZFA 1C8M2 4A3XA 2BNNA 2WAOA 5A80A 3VB9A 3ZN6B 4GULA 1HRI1 3MIHA 2JG9B 1AYN1 3H8RA 3MUY1 3POWA 2C9KA 3V0AA 2CWMA 3USSA 1RVF1 2DFBA 1YFYA 3U75A 1MZEA 4YVWB 3ZXAC 2A7AA 2P37A 1LTEA 4XUTA 1D4VB 2VPVA 4BU2A 5FDBA 5J96B 5BNNA 2VMIA 3OPTA 1BLZA 1PK6A 4XUOA 5D21A 5BNQA 4AEMA 1GLHA 2FCTA 4IGQA 1LULA 1RUD2 3S0MA 2WR9A 2QCSB 1X82A 4MGYE 5JZGA 4QM8A 5BPXA 1PZ8A 5FP8A 4NROA 3CEWA 1FX5A 1A78A 1FNZA 4AFAA 4YGCA 2QQLA 1OD5A 2ZJCA 3MIDA 4GKYA 3ZN4A 2RS51 3H9AA 3U07A 3KGLA 2JDKA 3MYXA 1UCXA 5SV5A 5LW9A 2JJ6A 1MEC3 2C6SA 2JDUA 2LM3A 3JXSA 1W6MA 1J83A 4BISA 1JU3A 2J1RA 4BQ2A 1R091 1ZBE3 5CFDB 4Y5TA 4L11A 1EV13 5GLVA 2BVBA 2JDPA 1CAWB 4ZZ5A 1UOJA 5F6KA 2PHRA 1H8TC 5ANNA 2EAAA 3CDZB 5DG1A 4BK5A 2D6LX 3ZPOA 2VXRA 1FAYA 4E4DX 5DMYA 1BEV1 2ARXA 4LEJA 2UWCA 2GC0A 5A6QA 1MQTC 1QJU1 2XJSA 1W39A 5ABJC 5F32A 4F3JA 5IVBA 2VW2A 3HWJA 3OBTA 4XFIA 2EALA 2EA7A 3PURA 3JQXA 2Y6KA 3H7JA 3ZFEC 1W6QB 1HB3A 5GJ6A 4E4SA 4MOAA 5FZ0A 3V0BA 4E9KA 1GFF2 3MIBA 4IV3C 4PDWC 1HIXA 4S2DA 4RR3C 4FBFA 5CG8A 4O9EA 2XWJB 2W1UA 4Q4Y2 1REFA 3NJZA 1QHDA 4IXLA 5ANQA 3WP4A 2W0XA 1U5XA 1I9RA 2KD7A 2BQPA 1FNYA 3ZXDA 1KJLA 2QKDA 3OY8A 1MZ6A 3ZSEA 5FR3A 2PHWA 3JB4C 4Q1PA 2BNMA 2ENRA 2FBEA 2WBKA 1O7FA 5BY5A 1IKPA 2W47A 4ARYA 1AR82 3DXUA 4N53B 1VP6A 3M1HA 5JSPA 3I2DA 1AR72 3AKTA 2Y0OA 2DUOA 4HOOA 4IE7A 3VDDB 4KBBA 4Q29A 4AFMA 4COWA 1YI7A 1XNTA 2VBDA 3VHPA 5FPXA 1AJKA 1D4M1 1PZ9A 4W6XA 1OBNA 5A3UA 1PVXA 1S1AA 4PCRA 3H3LA 1XOYA 4DUWA 2D6MA 1RUG3 4CDXA 2IZWA 4TYSA 4EZHA 2E63A 2DWRA 1QEXA 3ZVXA 2EIDA 1H8TA 2EXIA 3NJYA 4WM7A 4AI0A 4BK4A 3UV9A 4XF0A 5FP9A 3CJIC 3TN93 1G9AA 1XNDA 3RWNA 2QQOA 4AHZA 5GKAC 4K20A 1LB2A 1UO9A 2BGCA 1PO23 2ZGQA 3MICA 1QNYA 1UOFA 4JQRA 2RS12 4MH0E 2IVJA 1FV2A 1ZNPA 5ABJA 1K5MC 3O1VA 1RIRA 2WSVA 3WDYA 2P4EA 1GNZA 1D0HA 1NXMA 5GZDA 3RMXA 1TMF3 3LQCA 5J36A 5A3WA 5T5PA 2VD7A 3I3BA 2JDYA 4LO7A 3WP6A 3ZFEA 5FZ6A 3S6PA 2W9XA 5I8TA 5JMOA 3PVBB 4IV3A 1NY71 2B9VA 4PDWA 1EUTA 3H1YA 1MS5A 1MZ5A 1YLLA 2DUQA 4LO6B 3KD4A 3AXEA 1K45A 1RUE1 3KT4A 5JLVA 2NYYA 1H6YA 2WZR3 4QMAA 1SLCA 3PUQA 1W03A 4HVQA 5HBAA 2FQPA 4MXWA 1C4RA 1NUKA 4BYYA 1ZZBA 2WFF2 4JV4A 4A44A 3O1TA 1PVC3 4CCNA 4MHUA 1FV3A 2JDAA 3GZUC 3OGVA 4NN0A 4AEDA 5FMBA 4Y1YA 3E5UA 3UK9A 5JMCA 1RB8G 4GB31 1JUIA 3A0KA 2WZEA 3HPNA 3ZN5A 5KC6A 3WT3A 4ZY9A 4D6RA 2UU8A 1DLLA 5FV3A 2VUAA 3FBYA 1J1LA 1LEMA 2QQMA 3NRUA 4LHLA 2XHNA 3SEPA 3O5SA 1Q8PA 5CKNA 3OGJA 3OBAA 5LBEA 3TB0A 5EZWA 2E26A 1IQDC 3VGIA 1R093 4YFZA 4LBMA 1JZ4A 1SEFA 3H42B 3VLBB 4AFBA 4BM8A 1RUNA 1XE0A 3NWKA 1E5RA 5F5QA 1YO8A 1BKZA 1S0DA 1S0EA 2D93A 1YJKA 4N43C 1WLCA 4CDWB 2VE1A 4EJRA 3BOPA 4YVSB 3VZNA 4DXTA 4EWDA 5FZOA 1LAJA 1QXJA 5A6YA 1JUHA 3SH4A 1W8ZA 3MIGA 3DGTA 5C8CB 1VRH1 2XL9A 1WD4A 1XE8A 2R072 4OMCA 2R061 2DCTA 4CPBD 2RR11 2MEV1 3DPRC 4MX3A 1FXZA 4CP2A 1QQP2 1ZZ8A 3P3NA 1QJX1 1TVGA 5M0TA 4PQ9A 1MACA 5FXZA 1VBE1 4CXXA 4ARXA 1H6XA 1TE1B 5DZEA 1J84A 2WUHA 1DGRA 4Y22B 4N7IA 5FQ0B 2AGSA 3G7DA 2GMPA 4LITA 4LE4A 2OZ6A 1YC61 2ZGMA 1HLCA 2XJTA 1IQAA 5CU1A 4X8NA 4CP0A 4PHZA 3IAQA 1LENA 1UX7A 3ACFA 4N8MA 1CAUB 2PFWA 3OUIA 4EN0A 1AZDA 3PL0A 1S4CA 4LBJA 2A71A 1UIJA 2VL4A 2YPJA 1C8M1 1VBA2 3QLQA 2AR6A 3UL2A 1W3VA 1OOPC 4GQ7A 3HBKA 1ZBA3 3LDRA 3UGHA 2B9UA 3C7HA 4B7EA 2F6BA 4BOWA 1BMV1 2C0ZA 1ENRA 2G9GA 1PO12 5FZAA 4FT8A 5KXBA 1UWWA 3D4KA 4JC1A 1C1FA 5BXXA 4C0BA 3WLUA 4IEOA 3MZHA 3SKVA 4NOTA 2HBUA 3T30A 2BFUS 4M0HA
chains in the Genus database with same CATH topology
3OD0A 3QBQA 4N43A 4JGZC 2FHRA 1PM7A 2RS32 2WL1A 2WNUB 2JG8B 5T50A 1G8WA 3ST7A 5D8AB 3VBRC 1DGLA 2RJKA 1GANA 1ONAA 4CEWC 1R1A3 1ZA4A 1KQRA 1Y43B 4UW3A 4I01A 1F5JA 3AJYA 3BB6A 2B39A 1W6OB 5A33A 5HXVA 2PLV2 1TME3 2QVSB 1DYPA 4INDA 1QNWA 1Y7BA 1GSLA 4I0BA 3JB8A 1E57A 4FQ4A 1O4TA 1RUE3 1PIV2 2PHLA 4G3YC 1KD7A 1LECA 4IL7A 4NO4A 1IS4A 3VKMA 2WNVB 1V6OA 1RUJ2 3KS7A 4QQPA 4XJAA 1BBT2 4NVPA 5JDBA 2C9AA 1ND3B 2WSUA 4QX5A 4C1XA 2BUKA 3JU9A 1NOVA 1LOAA 3TNQA 2XG3A 4C1WA 4ISQA 1ASJ3 1D0GA 3O0XA 3RMYA 1JXNA 3ZXFA 1RHI1 1MS1A 4FPKA 2GMMA 1RUF3 4QQ2A 3ZSKA 4B4QA 1RTVA 2D44A 2X53S 1AL21 5A32A 4JGZA 4HKOA 4BMBA 1RMU2 2A75A 1JOJA 5JPNB 1AR81 3WCRA 2ETEA 3VBRA 2Z79A 4CEYC 2WLQA 2OZJA 1AR71 4WM8C 3T1MA 5GZFA 1UF2C 2AENA 1AXZA 1YIPA 3VHNA 5E89A 1YUDA 1ULEA 3OD4A 1Y3TA 4DFSA 4AVCA 2RR13 4YW2A 2XJPA 3GHNA 1GZ9A 2O8QA 3NAPB 1MQTB 1RUC2 1YHFA 1HQLA 2XJQA 1QDOA 3NV1A 2BTVC 1PZ7A 1S55A 3VBFC 1JN2P 1S0GA 5EFUA 2A3XA 1OSGA 1NCQB 2RS11 1Z7S2 4IV1B 3ZFFB 1ENXA 4RR3B 2VU9A 1KDMA 2ILMA 2P3JA 4NWWA 3LCPA 4Y1ZA 2NLRA 2I07B 3O7OA 1OHFA 1RJ7A 4EN6B 4XJWA 5IT6A 1HDKA 2WINB 4N9IA 4N90A 5IK8A 4Q1RA 1WLWA 4S2FA 5EXOA 2IC1A 1RUD3 2WFF1 1AYN2 1VAVA 1QGLA 5JOXA 1V00A 4COUA 1RVF2 1JYIA 5AC91 1IGOA 4GMP1 2GN7A 1AVBA 2A3YA 5C9AC 3M2MA 5JAXA 2QDRA 2OUJA 2B5HA 1M4WA 3CJIB 3U10A 2PTMA 3ZDSA 1CR7A 1N47A 1KRIA 1AF9A 2B46X 3GF6A 4M3CA 3AP5A 3AP9A 2RS52 4PJYA 1K5MB 4KGQA 3ZSJA 2VGDA 4JDOA 5FCCA 1Q3EA 3VBFA 3V65A 4AF9A 5D1IA 4BE3A 1O3SA 4DRRA 5JI7A 1UU5A 2Z69A 4YZ2A 2JICA 3BIWE 1TNRA 4RQPC 3HMYA 5CBLA 1XYNA 2IXLA 2QNKA 2R071 2B45X 1OFNA 4NHLA 4I30A 1QQP1 4RS5A 2VECA 3G6JB 2YY1A 2BEOA 2TEPA 1CVNA 3VUOA 1R082 2O1QA 2NM1A 2GN3A 2ZX1A 1JH5A 3MIEA 4Q4Y3 1IPJA 2IXJA 1VLNA 3H3UA 2PHFA 3IM0A 1QMJA 2N7GA 3FWEA 5AFBA 5KHJA 1QOTA 2V09A 1Z0HA 4FPEA 1AR62 4XJUA 3KCCA 2NMOA 1AR83 3AB0A 1V6MA 1H2KA 3HD8B 3I59B 1F5FA 3QH6A 4K7JA 4AVBA 5GZGA 1NCRC 3D6EA 4MUVA 1PO11 3ZIXA 4L99A 2CL2A 1DF0A 2EF6A 1HV1A 1WBFA 1O3RA 4YARA 4IEVA 2CGOA 2DVAA 4Y20A 4ZU4A 1D2SA 4QU2A 1LCLA 4IERA 4FPJA 2ZGNA 3J8F1 4NWVA 2JKBA 3DPRB 4GIQA 1D4M2 3I54A 5KXCA 4RQPA 3I7DA 2RS13 1REEA 1Y9QA 3KCYA 1A8MA 2YROA 1DQ1A 2DVBA 4YGBA 1DZTA 3KM5A 2Q1MA 1VBB3 1QH7A 1LR5A 1RUH3 1EPZA 3AMPA 2DCZA 2Q0AA 2X5IB 4F7ZA 2HWD2 4P9XA 5HCFA 4I09A 4COYA 4D69A 1S0IA 4QQHA 1PIV1 2WA3A 1OOPB 3LWCA 5K0UC 4WBBA 4HVOA 3WNXA 3ZXEA 5C8WA 2UY9A 4FPLA 2VQ0A 1RL3A 3ZO0B 1F31A 1G9FA 4PLNA 3PNAA 1SBFA 2YZ4A 4QHBA 1MS4A 3WW4A 1KS5A 1YFWA 4LULA 1NXD1 5C6CA 1WW5A 2I2SA 1IKQA 1CQ9A 2ZHLA 1KDKA 1RJ8A 3WDVA 3GBGA 3VBUC 2BFUL 2YXSA 3NV3A 4GWMA 2XHKA 4GB32 1AYM3 1DQ4A 2EIGA 1Q8SA 4CEWB 1RMU1 2O8OA 3ATGA 1Q8QA 2PHXA 3BU7A 2E53A 3URFA 4RD7A 3FFZA 2R1DA 4J6GA 4P9IA 4QQLA 4W6YA 4WVWA 5BNNC 4LBLA 5ACA1 1PK6C 2R073 3JZVA 3IIAA 2HWB1 2A6XA 3OPZA 2CTVA 1OFSA 4QQOA 3B5LB 2RMU2 3IBMA 3M70A 3EBRA 1RUC1 3WDUA 2LUWA 1FOD2 1OKQA 1N1SA 2DCYA 1J1TA 5FLJA 3H1MA 4A7ZA 4DY5A 3TAYA 5C4WC 3AP6A 3N7KA 4ATFA 5BNOA 1TNFA 2R062 3N35A 4OI4A 1Q43A 4P9LA 2MEV2 3R6SA 4MXVA 1QJX2 4B4RA 1Z7S1 2R49A 2ZGRA 3SISA 4DINB 1VBE2 2HEWF 2D3RA 2UWBA 3GBWA 1DGWA 2VW0A 1VBA3 5DZGA 1H1IA 5CFCC 1W6PA 5C33A 3Q9OA 4OUSA 2OUHA 2JX9A 5CA6A 1A8DA 1AJOA 2VW1A 1S0FA 3SH5A 3VBUA 4XFHA 2CWSA 4FXGB 4FCAA 3ZX7A 5F9TA 4HPKA 1EAH2 1QU0A 3O0VA 4CEYB 3I8TA 4RHV1 2GZWA 4WM8B 1CONA 2D6NA 3IPVA 1DG6A 4MZUA 1ULGA 2DU0A 4YM0A 1BMV2 2RS33 3HT2A 1ULDA 1FATA 2WWSA 2GU9A 2HWC1 3EXUA 5CB7A 1WBLA 3ZFGA 3NV2A 1HXS2 4AYUA 2TNFA 2ZA9A 1SCSA 4IEYA 4CP1A 2VH9A 1GZWB 2HWE2 3NL1A 3BTAA 2VMGA 1G9CA 2FMYA 1FPN3 3GNEA 1AR93 2PLV3 1ZX5A 1CIWA 4P9GA 4YZ1A 3ZYRA 2KXLA 5C4WA 3VBSB 1REDA 1S2KA 2K9ZA 1UU4A 1PIV3 2BNOA 1WW4A 4YG3A 4OI1A 3PMSA 1DZQA 4CDXC 2Q1ZB 4GKXA 1I5ZA 1RUJ3 4ONUA 2YDEA 3SNMA 1BBT3 4XFFA 4WM7C 5CG9A 3R4UA 5CFCA 5LEKA 2CGPA 4YGEA 2MHFA 4XJZA 1R081 1H2NA 3D5OA 4LA2A 4RA0A 4TWTA 4TZDA 3UKTA 1V9U1 4AHYA 1LU2A 2VUJA 5HCAA 2I74A 5C9AB 4XTMA 2ET7A 4OHZA 1AR61 4AVTA 3K51A 5GZCA 4HMZA 4Q0QA 1UD1A 4H55A 1RHI2 1IZ3A 4LO8A 3M3IA 4R52A 3VV1A 4GALA 1N3OA 4DQAA 2WNEA 1AL22 2DURA 1EY2A 3SH3A 4Q0SA 4HZFA 3V56A 4FSJA 2EAKA 4Z8BA 2WQZC 2ET1A 4YZ3A 1Q56A 3KQRA 4QD2A 4AEDC 1LHOA 5L7OB 4QPIB 4COZA 1NA1C 4G4FA 1H30A 1CPNA 3MLLA 1YIFA 5JIUA 3AMNA 4AXOA 3B9IA 4PLMA 1IOAA 4D3WA 1YXWA 4R4XA 4NPRA 1URXA 4BWOA 3SCGA 4FVVA 1CJPA 4XTPA 2GALA 4XQDA 2BW8A 4JTOA 3FLTA 1OQ1A 4K3UA 2PAEA 4JGYA 1LGNA 2WLPA 2A6VA 3LB9A 1DQ6A 2HWD1 1RITA 4M0NA 4B4PA 4CDQC 2GAUA 4LHKA 3JUUA 3IT8A 5H9PA 3ZYJB 4LT5A 5E16A 1POV1 3JBG1 4FQZA 1NCRB 2D5HA 4OUMA 1HRI3 3ENRA 1AYN3 4H3WA 3B93A 1HRV2 1V6KA 3WW1A 4LTAA 2ZGUA 1RVF3 2RE9A 3PJQA 2GMEA 2R6QA 4JRLA 1HX6A 2ZOEB 1SLBA 5EJ3A 5KHHA 5L19A 1UZYA 2DVDA 3RS6A 3VKFC 2E9QA 3FX3A 3VBHC 3IKWA 3GZTB 2NN8A 5J48A 1VAKA 1XU1A 4KQ7A 2DVFA 4Y1VA 5AC92 2ZAHA 1GBGA 1NA1A 3VN4A 1KS4A 2RS53 1YNAA 1SDWA 3C3VA 5T52A 4JDMA 3VKLA 4XQ4A 4L97A 1B35B 2ES3A 5K9YA 1AX2A 4AHXA 3USUA 1SLIA 1GICA 1QJY2 4DY3A 4ZU7A 5FRAA 3AZWA 3I4IA 4MGZE 3SLIA 1TEIA 4OHXA 4TSVA 1AL0G 1NQDA 1X50A 4G9SB 2RMU1 1LGBA 4PBOA 1BXHA 3OYWA 2D3PA 1ZYBA 1BEV3 5K0UB 1FOD1 1R083 5KHIA 1OPMA 4CDQA 4FP3A 1QJU3 4HETA 1Q8VA 1U12A 4WVMB 3MLJA 3RRDA 4K1ZA 2PYTA 5GLTA 1ZZCA 2IXHA 1YI9A 1H0BA 4H14A 3OGGA 1AR63 4ZXKA 1SBEA 2GNTA 4NR1A 2DCJA 3SMHA 1W6NA 5CIRA 3FJSA 2D6OX 3HR9A 2YGMA 1WUVA 5I0SA 5J98B 3U0ZA 4RL7A 4UXAA 2R16A 3HQXA 3VBHA 4CDUA 3V0AB 3ZIWA 2R0FA 2ZCWA 1EAH1 1GQGA 1J3RA 1CJDA 1LJ7A 2GNBA 3FLPA 4IEPA 1U5IA 3B00A 4GH4C 3M3EA 1LOGA 2WS91 3AZZA 5BNNB 3W9AA 1PK6B 5LEJA 4BCUA 4KWLA 1O4YA 4R4ZA 5FLHA 1UPIA 5IUQA 3R0RA 2GH2A 4OI2A 1KFUL 2OYZA 1D4M3 3WZ1A 5LRSA 5BNPC 5JZGB 2XPJA 2P17A 4XILA 2ZACA 1ND2C 1YCIA 1H2MA 2XBO2 1HXS1 1VBC2 1VB4A 1NG0A 4AI8A 1Q5OA 4KGGA 3QH7A 2UYAA 3J8F2 2HWE1 1W6MB 2XJVA 5DXDA 3H7YA 3VKNA 2PQQA 4JDNA 1PGW1 2KA3A 3AZXA 4B8EA 5FOJB 1CAXB 1CPMA 4FOQA 2HWD3 3MF6A 2D40A 3POYA 3KB5A 4ATEA 1CAVA 1WLDA 4QGMA 5DG2A 3AKQA 4FP2A 2SLIA 2HEYF 5DUUA 4JAAA 3JQWA 1X8MA 3UKNA 1V6IA 4KG8A 5EV7A 4AHWA 4IQPA 4XFGA 5FOBB 5KHKA 4YW4A 2D3SA 1DZRA 4OI0A 5GZEA 2PAKA 2V73A 3AJZA 5EWSA 3AK0A 4XYXA 4ES9A 3V0BB 3VBOC 3ZMNA 4LHNA 4GH4A 2HWF2 4GB33 2GC3A 4R9CA 1J58A 3AFGA 3OY8B 3O0WA 3NW4A 4M00A 3RZZA 5BNPA 3BCWA 1FYUA 4CYDA 1AHSA 3AFKA 2HKXA 4HL0A 1ND2A 1ULCA 3FUOA 4IESA 1EYBA 3MLKA 4UW4A 4ITCA 4KL1A 3ZXLA 3UKVA 2A3WA 2GDFA 1HQNA 1UPSA 1BCXA 3RYKA 1F9KA 5FO9B 5EYYA 2RMU3 2D6KA 3HBZA 5T3NA 4M01A 4MSVA 5JSRA 4CDXB 3RYPA 1FOD3 2XKOA 3RJ2X 3KLSA 1SMVA 5KC5A 2Y26A 1VRH3 2GNDA 4YW3A 1LOCA 3POSA 5ACA2 1UKRA 1H8TB 4WM7B 2R063 2HWB2 2R041 1DQ2A 2MEV3 3KT7A 4N7UA 1QJX3 1SFYA 5K7PA 1YFXA 2EXJA 2QFEA 1DU3D 5T5JA 2DF7A 1VBE3 5JR7B 5ABJB 2H0BA 1KITA 3N7JA 4Q0VA 5T5LA 4I2OA 1BVP1 3ELNA 4YG0A 5IK5A 3WG4A 3ILNA 4CZSA 1BK1A 1WA4A 3O12A 2XL7A 3N7LA 4PBPA 3K48A 3DN7A 4DRVA 2JG9C 2YGLA 3ZFEB 5E8AA 4JTNA 3S7IA 3VBOA 4IV3B 2PA7A 4PDWB 4QT6A 4EN9B 1DHKB 2GH8A 3B9CA 4LBQA 2XH6A 1C8M3 3IWZA 3KCXA 1GV9A 1AX1A 4AE2A 4RS5C 1EP0A 2VY0A 4HLTA 2UYBA 1MS3A 1HRV1 1YYNA 3OCPA 2WC2A 2F4PA 4MXWB 3CU7A 1XYOA 3EJKA 1RUG2 3T1LA 4QPGA 3M3CA 4RHV2 4AEDB 4H7MA 5A3MA 1ZRDA 3PVOA 2E6VA 4TLFA 2XLGA 1UN1A 2GNMA 5JVVA 2IXCA 5TSWA 3OJBA 3IDBB 4YGDA 4XEZA 1WD3A 2VVFA 2HWC2 5CFDC 1HQWA 4I3GA 1PO22 2ZZJA 1WCDJ 4E4ZA 5GALA 3VZKA 1QJZA 1OA3A 5EYXA 4B7KA 2VOXA 4DXZA 3ZSLA 1O5UA 5DDJ2 3AKRA 1QJY1 3KGZA 4UBGA 3BPZA 1DDLA 2DU1A 1XNBA 2D6PA 3ZN6A 4AVSA 3WINE 5T54A 2JG9A 2WZR2 4PLOA 4FOVA 2A6WA 2HEVF 5BUVA 4YVWA 1SLTA 1SFNA 5A3LA 4WVVA 4YNIA 3EO6A 3MFAA 4SLIA 4X6RB 4Y5Z0 2CNAA 4XF3A 5E1RA 4Z1VA 3E97A 5JWPA 2CV6A 5DUXA 2XVLA 5KWRA 1C57A 5LRRA 1ZRCA 1ULFA 2LALA 3ES1A 4Q0PA 4BLIA 3MFCA 1X33A 3MIFA 1V9U2 1DGWX 4HN0A 4N53C 3W58A 1RHI3 1H9PA 1UU6A 3VDDC 4F8AA 4GXLA 2VVEA 5BYNA 1AL23 3VZLA 4X6QB 2XUMA 3M3OA 3CLPA 3EHKA 5GLZA 5CFDA 4OULA 3IN9A 4ASLA 1CAWA 1AR73 3INAA 4O9GA 1ZM1A 3PVEA 2QE3A 3IDCB 4N43B 4Z82A 3WCSA 4CRQA 4Y1UA 1I1EA 4AI2A 4Q27A 1G6NA 4DMIA 3VHOA 4AFDA 4DPNA 3E6DA 4KWKA 5BV6A 1WW7A 5T5OA 2XBO1 1O4ZA 1VBC1 4LBOA 1MS0A 4Q4X1 3RI8A 3LSEA 5IK7A 3L2YA 3FC0A 3OF1A 3NKGA 5KBFA 2WZPP 2VOWA 4MLOA 5I0RA 1W6QA 3ETQA 2ZMNA 2YV8A 2E7AA 2ZS6B 3JD71 3LA7A 5A33B 3E6CC 2VULA 1X8EA 2QUOA 2PHTA 3HAGA 4KU7A 3ZYPA 3N4MA 4KWJA 3SCHA 4Q4V1 4F83A 1OA2A 4A2UA 1ZZ9A 2ATFA 1LHNA 2YHJA 4AQTA 1UMZA 4XMIA 1ZRFA 1NYWA 4V1PA 4AFCA 4W65A 4N53A 1GZCA 2V5YA 3M7AA 3LKJA 3WP5A 5BNOC 3CL1A 3VDDA 2Q30A 3JBG2 2DTYA 3D0SA 4HK8A 2WFF3 3L9JT 4OHYA 4HK9A 1GNHA 4HBNA 5CNAA 2VVDA 4Y1XA 4FPYA 5AC93 2HWF1 2WT0A 2CAVA 4GMP3 2RJLA 4R9DA 3AMHA 1JYCA 4LR4A 1ZZ6A 3N3HA 2XGXA 4YZ5A 3WX5A 3RPQA 5A32B 4CDWC 4JGZB 2YMZA 1LOBA 4LLFA 2XJUA 2VNOA 2D97A 3J26N 4AGVA 4RGGA 4AEKA 2O0OA 2ZPXA 3VBRB 1EV11 1QJY3 5E88A 3PTYA 3GBFA 3UJQA 3FMGA 2CY6A 1N3PA 4Q8LA 2VNGA 4WZFA 5FPZA 3CNAA 5FMOS 1HKDA 4S2HA 4URTA 3A4UA 4LUMA 1WMDA 4LO5B 1N3QA 5KHGA 3MF9A 3ROUA 2JEMA 3ME2A 3PMEA 4IETA 3ZFGC 4DB5A 1QWRA 2OVUA 4RSUA 2ZZQA 5FO7B 4AK3A 5JCTA 2B42B 1QQP3 3VL8A 4D7YA 4LBKA 4XHBA 3ES4A 1IHMA 4I02A 4K6BA 2A6YA 3WDWA 2NPIA 2ZKLA 4Y4YA 1ASJ2 5I8YA 1LHVA 1L3JA 1O91A 2UWAA 3LSDA 2ZMLA 1Q8OA 4IEUA 2IWGB 1VBD2 1LHUA 1H4HA 3FHIB 2PAMA 5JSOA 1QY4A 4HKLA 4KG0A 1QXPA 2R30A 3DF0A 5HI0A 5JOWA 1HV0A 3VZOA 2XB6C 3WG2A 2A73B 1SLAA 3QACA 5KXEA 2EXHA 4IEWA 1PO13 4CDWA 3MW2A 4YVSA 1ZVFA 2R0HA 4GA9A 2X29A 5D8AC 3ZXKA 1RUG1 3ALQA 2P2KA 5C8CA 2A70A 1VBC3 1UAIA 4P14A 2WS92 2Y0IA 4EWEA 3J8F3 3TN91 4XQWA 4J1XA 2ARBA 4P9WA 4BA6A 2Q4SA 2OPKA 1PO21 2FZ2A 4M3CB 1VAMA 1G86A 4Y22A 1NLRA 5CVRA 5FQ0A 1C5HA 3VBFB 2EXKA 4AQSA 5DDJ1 2R1BA 1YJLA 4BH9A 2UURA 1C8NA 4FPGA 4BLJA 2ZHMA 1KXGA 2CGNA 1CAUA 2WNVC 3ZXJA 4AVAA 1PGW2 4FPCA 5SV8A 4XIOA 1D2QA 2RM22 1LOFC 3VZJA 3ZYGA 4K1YA 2VNRA 1ND3C 5FO8B 2WZR1 4FO9A 2JDZA 2ZMKA 4RS5B 1O3QA 4FOYA 4XMAA 4Z92B 3NV4A 1UX6A 4FPOB 2JE9A 1PVC1 4K9SA 1IS3A 4EV0A 1AXKA 3NVCA 1V6JA 2W52A 3WP3A 2HWF3 2DV9A 4UBHA 5LK5A 1NE4A 4JGYC 2BPA2 2WNUA 2DCKA 2P3KA 1CD3G 2JG8A 3TOJA 4E27A 1NLSA 5D8AA 4XHXA 1PGL2 1CAXA 4M3CE 3WUCA 4ES8A 1KJRA 2OW4A 2MPFA 1IS5A 3M4FA 4XETA 3TBDA 1RMU3 3N7MA 4DNYA 5J7MA 3B02A 5HCBA 1ZRRA 1W6OA 1CX4A 1N1YA 3HT1A 1B09A 4Y20B 1WGPA 1OPOA 2K2SA 3ASIA 3NAPC 5ACA3 5GLUA 1C1LA 3WD5A 2HWB3 4K8FA 2WKKA 4JVAA 1DQ5A 3AM2A