4LTAA

The crystal structure of the p132r, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
b'MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPRGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ltaA00
4ORFA 4HZFA 2DCTA 3E6BA 1J3QA 1J3PA 2MHFA 5LEKA 3CJXA 2XLGA 1DGRA 3L2HA 1LR5A 3DN7A 4O9EA 4Q0PA 4QGNA 3O14A 4JTNA 4I09A 2XKPA 2BNOA 4XEZA 5E16A 1LKNA 3ST7A 5C6CA 3H7YA 3DL3A 1ZZ8A 2B9UA 3ES1A 3C3VA 2D93A 3CF6E 4Z82A 5FPXA 4BIFA 3U0ZA 3RDIA 4B29A 3E6CC 4KU7A 1CX4A 2BEOA 5KHGA 3BU7A 5AVPA 1FI2A 4HMZA 3NJZA 1WLTA 5BV6A 4EV0A 4Q0QA 4BHPA 1QXRA 1ZNPA 4LTAA 1VR3A 5JR7B 1ZREA 4MGKE 1RTVA 4IEPA 4D7TA 3RNSA 4AVCA 1UW8A 2XLAA 4IEZA 3WW4A 4HBNA 3H9AA 1Y3TA 2D5HA 4E2GA 1G6NA 1SQ4A 1WGPA 4AQ6A 4Q29A 1LRHA 2E9QA 5T3NA 2HJIA 4Q0UA 1OD5A 1LB2A 2BNMA 1O3SA 4QGMA 3SCHA 1YLLA 3GBFA 4Z07A 3VHRA 1IPJA 1Q5OA 2OPKA 4XF0A 3UKNA 1O5LA 4OLLA 3ROUA 3EHKA 2IXCA 3KMHA 4MV2A 4WZCA 2Y0OA 5JCTA 2IXLA 3RZZA 2XL9A 1Y9QA 4HSJA 3U11A 4HVQA 2KXLA 3D0SA 3PLQA 2PHLA 3H1YA 4ZU5A 4JTOA 3USSA 5CU1A 4LUKA 2Q0AA 2GU9A 1CAUA 2ATFA 2MPFA 1X7NA 5I91A 3H3UA 3BCWA 4X6QB 2VECA 4AXOA 4X6RB 5EZWA 2OZ6A 1UIJA 3GYDA 4F7ZA 2UYBA 1YFYA 4R8HA 5KHIA 2FQPA 3I59A 4WVZA 3ETQA 4WBBA 3NKTA 4MGIE 3MDPA 4Q0VA 4JVAA 1YFXA 3D0JA 3FHIB 4GULA 4I02A 5HI0A 4MZUA 2QNKA 1CAUB 2UYAA 3IDCB 1WA4A 4LUMA 5JAXA 3RPQA 2PQQA 3KSCA 1ZRCA 3SXWA 3QOPA 3LWCA 1DGWA 4YRDA 2BGCA 4IEVA 4YNIA 4NVPA 4META 1TQ5A 3I59B 1RL3A 4IEYA 2PFWA 5K8SA 1HW5A 4HSLA 2OYZA 5D1IA 1ZX5A 5BY5A 3IWZA 4OFGA 2H6CA 4PIZA 3CLPA 3ELNA 2GAUA 2XHKA 1OMIA 4F8AA 4K8FA 4N9HA 3SCGA 1NYWA 3RYPA 5KHKA 4IEOA 5KBFA 3H50A 2WFPA 3IDBB 3PNAA 1NE6A 1YUDA 5FLIA 1ZZBA 3TNQA 3RYRA 3E97A 1Q43A 3EO6A 2Z2SB 5KHHA 1XRUA 2XL7A 2EA7A 4XFHA 5C8WA 5JSOA 4IEQA 3QACA 1CAXA 2IC1A 2ZCWA 4L11A 2QVSB 3HIFA 3OD0A 4PIXA 1X8MA 3PVBB 3M70A 2PHDA 3NL1A 4DINB 4FAGA 2PYTA 4EWAA 3DV8A 2VPVA 1EP0A 3M3IA 1GQGA 2B5HA 4ZU7A 1QY4A 2ET1A 3MZHA 2BYVE 2XLFA 5I0SA 1IPKA 3LAGA 3LA7A 3U10A 3OCPA 1J59A 3EBRA 3SHRA 4ONUA 5FPZA 1CAXB 4J1WA 3CEWA 1NXMA 4LULA 1RUOA 5I8SA 1ZVFA 4IETA 5J48A 2EAAA 4XF1A 5LEJA 2CV6A 5I0TA 2UY8A 4I2OA 5EFUA 3E5UA 4UBGA 3IBMA 3E5XA 3FFQA 1ZRFA 3R6SA 3KGZA 4JV4A 2N7GA 3WW1A 4R52A 4RD7A 2CAUA 4MUVA 2EVXA 3FJSA 2Z69A 4XF4A 3D82A 3HT1A 1O7FA 4HN0A 4QX5A 1PMIA 3WW3A 3H8UA 1X8EA 1FXZA 4FBFA 3TNPB 1CAWA 3OGJA 4H7LA 2GC3A 3UKTA 4IEUA 1FT9A 4I3PA 4HVOA 4MH0E 4XETA 3S7EA 4MGYE 2XGXA 3JZVA 4HLTA 4PJYA 4YSFA 3NSTA 2K0GA 4XFIA 5FQ0A 5J7MA 4QM8A 3KGLA 2PAEA 4P9GA 4XF3A 4IESA 4KWJA 1OFNA 2XKOA 5LRSA 2GZWA 1YFWA 4KWLA 2ET7A 3E5QA 4IERA 3ACLA 4E2QA 1CAWB 5JSRA 4ZU4A 2QJVA 1XE7A 3LA3A 3H1MA 4Q0SA 4UXAA 3LA2A 1VJ2A 5I0RA 4XF9A 3BPZA 4AVBA 3S7IA 2UY9A 2HKXA 2O1QA 1XE8A 3EQEA 5FQ0B 3OF1A 4J1XA 2O8QA 1DZRA 1UCXA 2IXJA 2QCSB 1ZZ9A 3I54A 2BNNA 4MGZE 4LA2A 1CAVA 3I7DA 3G7DA 4QXKA 5E1RA 3HT2A 2PA7A 2K9ZA 3FZ3A 3UKVA 1PM7A 1H1IA 3MYXA 4D7SA 4LA3A 2IXHA 4EWDA 2P17A 3H1WA 4HN1A 5F1RA 2OZJA 2H6BA 3SCFA 5BUVA 1SFNA 2D40A 4FAHA 2PAKA 1ZRDA 4YARA 3EJKA 4O9GA 1CAVB 1VP6A 2D5FA 2IXKA 2PAMA 4QGLA 2OA2A 2ZKLA 2Q30A 4KL1A 4L2NA 5I0UA 2I45A 2IXIA 5FDBA 4FT8A 3MPBA 2GC1A 3WW2A 1O3RA 2WC2A 4BYYA 3DKWA 1ZZ7A 3B02A 2QDRA 1O3QA 3ES4A 3S0MA 3ZDSA 3H7JA 4XFFA 1Q3EA 4AQ2A 1NE4A 5FLJA 2GC2A 1OI6A 4TLFA 4KU8A 5KHJA 5JSPA 4XFBA 4IEWA 1I5ZA 3N4MA 4E2SA 2FMYA 4I0AA 2C0ZA 4AVAA 1EPZA 4PIYA 1O3TA 2B8MA 5J3UA 2MNGA 3FWEA 2F4PA 3OTFA 3LOIA 5BPXA 1J3RA 2ETEA 1I6XA 3NVCA 4LLOA 4XFGA 4A2UA 5I93A 1UPIA 4XFCA 3CL1A 1CGPA 3HQXA 4I0BA 1J58A 3NW4A 4N9IA 1H1MA 3KCCA 4XFAA 1QWRA 3CO2A 5BXXA 4LEJA 4UBHA 1V70A 1UD1A 4EROA 1EY2A 3SMHA 1RGSA 1YWKA 1ZZ6A 2GC0A 1QXJA 1UIKA 1X82A 1GQHA 1O4TA 2Q1ZB 5FLHA 3LZZA 3IIAA 1SEFA 1RC6A 4KWKA 1ZZCA 4MX3A 5I8YA 1NZCA 4HVRA 1J1LA 3RYKA 5FCCA 2CGPA 4I01A 1L3JA 3E6DA 2H0VA 3H3ZA 4QMAA 1YFUA 3FE5A 3FX3A 2Q4SA 5LRRA 1YHFA 4EWEA 3BALA 5I8TA 5CADA 1ZRRA 4YYOA 2CAVA 1DZTA 1RUNA 1O5UA 2V09A 2PTMA 4QM9A 1JUHA 3BB6A 4CYDA 1U12A 4IEXA 2GH2A 5CVRA 2VQAA 4BH9A 1EYBA
chains in the Genus database with same CATH superfamily
1MZ5A 2HBUA 3I2FA 4CCOA 4HZFA 4W4ZA 1GNHA 2Y33A 4ISRA 4L8QA 5C4WA 1RB8G 3HNYM 4AK3A 1J3QA 2FDJA 1J3PA 1APNA 2XLGA 1DGRA 1AF9A 3POBA 4RFRB 3U4XA 5IWFA 1NA1B 1RUJ3 1MEC1 1UXXX 4UOJA 5FP8A 4Q0PA 4ITCA 2K46A 5JPNB 4JTNA 4EJRA 3I2IA 3H8OA 3S5QA 5DAVA 1REFA 1DQ1A 5J36A 2ADDA 2WLQA 3MIGA 2WO1A 5E16A 5FREA 4XTPA 5A80A 2QQWA 3ST7A 3POSA 3H7YA 2JB8A 4BQYA 4NHXA 2XPJA 3C3VA 1FX5A 4QQLA 1J83A 1OXCA 3I3DA 3ZYRA 3F95A 3NNJA 1ZM1A 4TZDA 1PIV1 4Z82A 1BEV3 1XYNA 3WCRA 5FPXA 2VMIA 3RDIA 3TWIA 4DEQA 2JDKA 2YDEA 4LXLA 4IE7A 4DUXA 4D8MA 1FI2A 4DO0A 4WV8A 5A1FA 2HEWF 3TN93 4CUAA 4F83A 3RMXA 2JG9A 1GICA 3NJZA 3OBAA 1TMF1 1WLTA 4EV0A 3K3NA 4Q0QA 4BHPA 2K2SA 2QDNA 4CP0A 3RZHA 2P1BA 2ZXQA 1ZREA 4GJYA 2Q8CA 1XBFA 3T30A 4AVCA 3OBZA 4OZOA 4KNCA 5DG1A 1UW8A 4QX8A 1SMVA 4QPIA 2YPJA 4JDOA 2P4EA 3VBUA 1GLHA 2ZMKA 5BNPB 3RZKA 3FLRA 1SQ4A 5AC91 4OYUA 4Q29A 5GJ6A 4NOTA 3SH3A 3O0VA 1VIWB 1ZRIA 1OURA 1OQEA 1ZBA1 3OSDA 3WNKA 2WZR2 4DQAA 1C4RA 3UESA 1O3SA 3QD6A 4WM7A 1YC61 1LGNA 1YLLA 4Z07A 2VC9A 3SITA 1JYCA 1FPN3 1QJY2 4AW7A 5IT6A 1HRI3 2OPKA 4XF0A 5DABA 3T1LA 3W9AA 4GH4B 4LBOA 1AYM2 3ROUA 1OSGA 2ZABA 1O4YA 3WF1A 4TWTA 3QLQA 5DUXA 2G9FA 3ZXFA 4QHOA 3NV2A 2DUOA 4Y22A 4MV2A 4WZCA 5GALA 1SBDA 5JCTA 1UMZA 3GF6A 1JZ8A 1E5RA 2VJXA 3D4KA 3AZWA 4NROA 4GMP3 1X50A 1XNTA 2RE9A 4HSJA 3FN9A 3VBSA 4COUA 4HVQA 5C3PA 5FYZA 1QOSA 2KXLA 3LE0A 3MPPG 4R9DA 4YM3A 3PLQA 1X36A 1CJPA 5SV8A 3H1YA 5FTTC 2FMDA 1ULDA 1POV1 1NZIA 3GXUA 4HANA 1CAUA 3G6JB 4ASKA 3BYWA 4OUSA 1H4HA 4S2DA 5GLZA 5CNAA 4CUGA 2G1MA 1TE1B 1XNAA 2JICA 4Y3OA 5AVAA 4YVSC 3HWJA 4BQWA 1H9PA 2VECA 2ARXA 4RQPA 1LOGA 5EZWA 4BQ1A 3HQUA 2OZ6A 2ZA9A 4RN5A 1KFUL 1LEDA 3GYDA 3ZXGA 3BTXA 1LHWA 1UF2C 3CMGA 4PLOA 1IKQA 4BMBA 3V65A 4LE3A 1ULPA 2EXIA 3TEWA 4FOVA 3VBRA 4WVZA 1QOTA 4UW5A 3B9IA 3NKTA 2JJ6A 4MGIE 4URTA 3BTAA 1YFXA 3RZGA 1AXKA 2VXRA 3D0JA 4PLMA 3AFGA 4GULA 1PGW1 2QQIA 5HI0A 2WFF3 1XC6A 2I74A 2XJSA 4MZUA 4CDWA 2QNKA 1EAH3 2UYAA 1Q8OA 2WS93 3IDCB 3KM5A 4B4RA 4LUMA 5DDJ2 2AEZA 3RPQA 3I2GA 5FYYA 2EALA 2NMNA 3WG3A 4M01A 4BE3A 4YVWC 1SLLA 2XQXA 3LWCA 3KWVA 4YRDA 3CNAA 2BGCA 2BOIA 3O1RA 4YNIA 3N9NA 2WYSA 4META 1TQ5A 4XURA 1HRV2 1UXZA 4GB31 2RS13 1VRBA 2NZ9A 3NAPC 2W68A 4DXTA 5K8SA 3JQXA 1HW5A 1PNFA 4AF9A 2JG8B 4DZGA 3FLPA 2VMCA 5IJRA 3OPZA 2H6CA 3N9OA 2HWE3 1NG0A 5A70A 4XMAA 1C8M3 1FV3A 2XHKA 1VALA 2A7AA 4FTBA 3OBRA 3T4HB 5C3OA 1WBLA 1PO13 4IV1C 4XQ4A 5FOBB 4IV3A 3MUY1 3OGRA 2YFUA 4Y1YA 5KBFA 5HCHA 1MEC3 2V4VA 1G7YA 4TN7A 3JQWA 1L7QA 3MFCA 1WLDA 4FPYA 3ASIA 3E97A 4M4PA 4YZ3A 5ACA2 3T09A 1OD3A 1WCUA 5BNQA 4CP9A 1BK1A 3PVEA 4PT6A 5FR3A 3BKZA 2YGLA 2YB7A 2Z2SB 2VZ3A 3TB0A 2WNVA 5FYSA 1ST8A 3WP5A 3WP6A 5CISA 2PHFA 1NXD1 1W8WA 1QJU1 1IS4A 2C26A 3A0KA 4GD4A 3OB8A 4WVVA 5C9AB 4TTGA 2WT2A 5IVBA 3OPTA 1CAXA 3QACA 4AOCA 1AYM1 3AP4A 4QDRA 4DXRA 4L11A 2QVSB 3USUB 2LTNA 4CPBA 2JE7A 1ONAA 1STMA 1XNDA 3JCIA 3NJVA 2D98A 4FFHA 4FPGA 1NCRA 3HBKA 4YGCA 1AUYA 1HXS1 2PHDA 3NL1A 2UU8A 4DINB 4LBLA 2XVKA 4RS5C 1OH4A 1EP0A 5ANNA 2RR13 1D0GA 1GQGA 3M3IA 4KGQA 3TBDA 3WINE 1RJ8A 5B4NA 3SH5A 3VL8A 1NLQA 3IIIA 3M3QA 2WBKA 2WRAA 2BYVE 1S2BA 3B00A 3J9SA 2YG0A 5FZOA 3WP3A 4AL9A 1C28A 1GKBA 3OCPA 1W99A 3SHRA 5AC93 3J7HA 3LDBA 4CEYA 3VBOA 1QJZA 1D4VB 4QDSA 4NN0A 4LULA 2E6VA 1BKZA 1ZVFA 1D2SA 2DU1A 4XF1A 4GWNA 1ND3C 5FY0A 2VZQA 1X9PA 4V2WA 2ZMNA 4HG6B 4C1XA 2YYOA 1GZTA 3AZYA 3MLKA 4I2OA 3D6EA 1JN2P 4R9BA 5F3EA 3ITQA 4K40A 3I3EA 4QAWA 4UBGA 1W2TA 2EXJA 5EV7A 4CTEA 1KEXA 1FOD1 1ZRFA 2Q5TA 3GZTB 2WZPP 1LHVA 1DLCA 5DAWA 1XSRA 1UAIA 1BHGA 4CU9A 4FVVA 2MEV1 3WW1A 3ZN6A 4R52A 4RD7A 4EN7B 3A0NA 4NIAA 4OQ8A 3KLSA 4N7IA 2D3RA 4BM8A 2ZGNA 4AEKA 2JKXA 1S0BA 1POV3 5F3GA 3VD3A 1GOHA 4AAXA 4DB5A 3DYOA 5JOYA 3RGBA 5FZEA 2ZHNA 1W6PB 1NQDA 1H2KA 4QX5A 3IAQA 1QQP1 4DUWA 3IZOA 4K21A 4XJ9A 1AR83 4YVWB 2XMLA 3T3YA 3BPSA 1QEXA 4H7LA 1UN1A 4IEUA 2GN3A 4XE9A 1GOFA 2LUWA 5FRAA 3S7EA 2HWC3 2CL2A 2XBO2 4NPMA 4DS0A 3JZVA 1F15A 1JU4A 3NNMA 5LY1A 3ZYIB 5L9VA 3NAPB 3ZOIA 1V6IA 3KB5A 3P1IA 1WMEA 4XFIA 1CIWA 1QKQA 4W8JA 3NNLA 4MGQA 4S2FA 4YZ2A 2PAEA 5T5PA 2ZX0A 1G9DA 4XF3A 5L7OB 3VHOA 5F9TA 1OFNA 3WOGA 5JI7A 5A7SA 1AX0A 2YC2A 1GBGA 1ASJ2 3AM2A 3MO4A 4KWLA 5DXDA 1TG7A 1GYKA 4YPJA 3VB9A 4RL7A 4E2QA 4BQ4A 1CAWB 5FXZA 4ZU4A 3N7MA 3C2UA 3OEAA 4CEWC 1VBB2 2TUNA 1UYXA 4BK4A 2A6WA 1SDWA 3LA2A 4FPCA 4GB33 4BQ2A 5JLVA 3AVSA 2Q1MA 4XF9A 4RR3B 4S2GA 3BPZA 1S0DA 1DP0A 1LHUA 3VBHA 4WM8B 1KS4A 2DFCA 1NLRA 1XE8A 3EQEA 2XWJB 3N9MA 4N43C 4X8PA 2DVAA 2VBBA 4E4DX 4AI8A 2R042 2O8QA 5BNNB 1JZ2A 2W1WA 1A6CA 3ZFEA 3POJA 4OI2A 3VKMA 3V0BB 2AC1A 3UNPA 1GR3A 2QQLA 1T6GC 4O65A 5FYBA 1ZZ9A 4XBNA 3ZXEA 4G3YC 1OOPC 1W6MA 3I7DA 5BNOB 3SKJE 2PA7A 4OHYA 2ARCA 2RM22 3KQ4B 1W2UA 3WZ1A 4IE4A 3I97A 2NYYA 3MYXA 4LA3A 2IXHA 4NUBA 4RGGA 1W0OA 5H9RA 2XOMA 5L9BA 3ZIWA 3B9CA 1VBD2 2H6BA 3SCFA 5C8CB 2A6VA 4P9WA 1SFNA 1JYXA 3PDQA 4FAHA 2VUDA 1YXWA 2ADEA 1Q8SA 4EN8B 1SDDB 2A75A 2FDKA 1JUIA 2JDMA 1EV13 3AKQA 4YARA 3VDAA 1UKRA 5FY5A 1GUIA 5C3QA 1ND2A 4XILA 4CU8A 5CZKA 3ZFFA 4HT1T 3ZPOA 4FI9A 1DQ0A 3R4SA 4UW3A 2D5FA 2JEMA 5KR7A 2PAMA 4QX2A 2QKDA 1HXS3 2Q30A 3AMNA 3MF9A 1U5YA 3LF7A 4UFIA 4XTMA 3AKSA 1VBC3 4CDQA 5IK4A 2D6LX 3N7LA 5GM0A 1R082 1GWKA 3ZVXA 3NMBA 4E8CA 1HKDA 1DFQA 1VBE3 3WSOA 1FV2A 2WC2A 3ZKUA 4BYYA 3DKWA 4YFWA 1W6OB 1WUVA 1GFF2 3AVRA 4XUQA 3AMMA 4Q4X3 2AR6A 2YMZA 3EB7A 3S0MA 3J26N 1W39A 3EXUA 3H7JA 1Q3EA 1D7PM 1IG0A 1W05A 3KCYA 2R0FA 5FMOL 4AQ2A 5FP9A 2ZGSA 3NV1A 3SC7X 3T2PA 4CCDA 5D8AC 3WVJA 1UO9A 2L9LA 4XFBA 5JSPA 5JXJA 2ZX2A 2HEYF 2ZGKA 2ILMA 2XBO1 3MLLA 5LY2A 3I3MA 2CSGA 4I0AA 3IPVA 4AVAA 2DVBA 2WL1A 2XJTA 5EHDA 5T54A 3ZLIA 2WSVA 4MSVA 1SPPA 3IN9A 1RITA 3FWEA 4LBMA 5FZDA 2DVFA 1Y9MA 1O4ZA 2BERA 1DQ5A 1WCDJ 5LBCA 1W90A 4DFSA 4IQPA 4MXWB 1VPHA 1FYUA 2MEV3 2C9AA 1XNKA 1LU1A 4CCLA 4AI3A 3FLTA 2VTXJ 2B46X 5EQUA 5F2SA 5CFDA 3NVCA 3RMYA 1PM4A 3BTYA 3K46A 2WAAA 4XFGA 5I93A 1UPIA 4LBJA 1JYNA 4XFCA 2WQZC 3CL1A 4ZS2A 3L9JT 4AGGA 3OY8B 5FZKA 2E32A 1EUUA 1LOEA 4LPLA 5FZBA 5T55A 3VHNA 5IK8A 4IL7A 3B01A 3C7FA 4FXKB 4OHXA 2GP5A 1V6NA 4D6RA 4CEWB 1PMJX 3CO2A 3K75B 4AVVA 5JMOA 2YBSA 4ISQA 3T2OA 1HQNA 1HQWA 4LEJA 4PF5A 2C4XA 1N1TA 2VMFA 3WLUA 2ENRA 3MHZA 3MV01 3PVNA 4QPWA 4CDXC 3AP7A 4XUTA 3DF0A 3RZMA 4KBZA 1RMU1 5DAPA 4MHUA 2AUYA 4OI0A 1OQ1A 4LHKA 2AREA 1YWKA 1CN1A 3C7HA 2DDUA 2GC0A 1QXJA 3ABZA 2RDNA 3ZFGA 2VOXA 2HH9A 2Q1ZB 5CKNA 1OLME 1BZWA 4HXCA 4Q27A 5FYCA 1F8VA 4CVUA 1VBD1 2BVVA 5TSWA 1OOPB 3UYJA 2ZEYA 2PHUA 3AZXA 3BOWA 4BWOA 2AZ5A 4NPRA 4ASMB 1Q8VA 2GNBA 2W1SA 4BZ4A 3URFA 1KS5A 3UJQA 3LOBA 1F4AA 3U37A 1I3HA 3Q8BA 5FY7A 1MS8A 2NP0A 4YW1A 3WUCA 2WN2A 2VR4A 1AL22 1BK0A 1RUG2 3DXTA 4AYUA 3K77A 4Y1ZA 1A78A 3RWKX 1CIYA 4PF1A 1YFUA 4CXYA 5E6HA 1AYN1 3PUAA 3WY6A 4XAAA 1YHFA 2A3XA 4INDA 1IS3A 1HIXA 5IHRA 4QKNA 4CCEA 2FCVA 4AEMA 1DZTA 4LBQB 1FPN2 4GMP0 5ERLA 3P3NA 1R081 1RHI2 3AK0A 1O5UA 2ZGRA 1VMFA 5DQ0A 5CB7A 2PTMA 1JUHA 4JHZA 4N53A 1NCQC 1O6UA 5ABJB 1UY3A 4IEXA 4Y26A 2JXAA 3DPRB 4NR1A 3IM0A 1R64A 3WNLA 5H9QA 3E6BA 1ZA7A 2DUPA 1QJEA 3AKRA 5CKMA 5JUVA 1N1SA 2Y0IA 2GMEA 2MHFA 4G9SB 1BQPA 5FZ8A 3OYWB 2D6NA 5IVYA 1G9AA 2IWGB 4PLNA 3O14A 3AP5A 1MVQA 4I09A 5FMOS 3AP6A 5LA0A 1WD3A 2F4LA 2XKPA 3ORJA 4H2AA 5HV0A 1ZBE3 1T6BX 5L73A 5C6CA 3MIDA 1UZVA 1Y4WA 4CCKA 5E88A 1ZZ8A 1VB4A 4L97A 2RG4A 2WUHA 4LHLA 2BBVA 2VVDA 4NWVA 3CF6E 3PJQA 1JI6A 3VDDB 2X5IB 5F5QA 1COV1 1BXHA 2UWAA 5F3IA 2E7QA 4E9KA 3KVAA 4BIFA 2QFEA 5EPAA 5FY9A 5JWPA 4B29A 5F39A 3E6CC 1ZA4A 1CX4A 2WFF2 5KHGA 3C7EA 4EQVA 5AVPA 5C7GA 2Y64A 5EJ1B 1NA1C 4XJWA 4BLJA 1F35A 5J96B 5IW0A 5L36A 5LK7B 1W9YA 1H4GA 5FO8B 3V64A 3WNNA 2AH2A 2PHXA 5BV6A 4P9XA 5A1AA 1GZWA 2W2IA 4YVSA 2R061 5JR7B 5KXEA 2R1DA 2EIBA 1UX6A 4DMIA 1BLZA 2R073 3RNSA 4IEZA 2VUJA 4XXPA 4YFZA 5F6LB 4HBNA 4FSJA 3SISA 3DEMA 1Y3TA 2I07B 5IK5A 1S2EA 2D5HA 4E2GA 1AXYA 1G6NA 1K5MB 1U0AA 5DZFA 3W58A 5FUIA 1GNYA 4OCTA 4CDUC 2VOWA 4QQPA 1OD5A 5FO7B 2W5FA 1C8M2 1LB2A 5C71A 2VQTA 1UMIA 2BNMA 4CCMA 4I0WB 3NWKA 1POQA 4QWNA 5FZLA 3T2QA 3GBFA 3VHRA 4CCNA 3L2YA 1UU4A 5HXMA 1PO12 1LULA 4LK6A 4ZS3A 4OLLA 3HAGA 1RUI2 4DXSA 4AI1A 2HLEA 4N90A 4QXBA 1D0HA 3UV9A 2WT0A 5FP3A 1MVEA 2Y0OA 2IXLA 5FYMA 5BNPC 1AR63 2J42A 1Q8PA 3RQ0A 2QQVA 5LK5A 4LBQD 4W6YA 5FPAA 4B3NA 5KC5A 3I2OA 4DY5A 2NPIA 3ZYHA 2QZ2A 4LKEA 1W8UA 3T0AA 5A3LA 1D4M2 3SQOA 2XWBB 2GU9A 2JWPA 3BODA 4F3JA 1RMU3 3VL9A 1C8NA 1RUE2 1RHI1 1OQDA 3T0BA 4QB6A 4GH4C 2DCZA 2ZX4A 3R0RA 4IV1A 4NHMA 3HD8B 1DGLA 4LO5B 4XACA 3JB4C 3BU0A 4COWA 4E8DA 4CE8A 5CYYA 3VUOA 1DG6A 2FD8A 1B35C 2VO5A 4Y24A 3AC0A 5A32B 4QU2A 4R8HA 1DYPA 2RR12 1X33A 1AR71 1I5PA 1GOGA 1YJKA 2RS32 3ETPA 3I59A 3JBG2 3ETQA 3WNXA 3LEGA 1Z7S3 4PI0A 3B7MA 1UQXA 3FHIB 1JS9A 1E57A 2HBTA 1H6XA 2JD4A 3TRSB 1GMMA 4LOTA 4FPKA 4R9CA 1QJX1 4JAAA 4XDPA 2YBKA 1H9WA 2PQQA 3LQCA 1BVP1 1N3PA 1AYN3 3FHAA 1W6NA 3QH7A 4XJZA 3SXWA 3QOPA 4Q4W3 3VBFA 3ZN4A 2RV9A 4FOYA 5ANQA 1UY2A 4AVTA 2XJPA 3EYPA 2QE3A 3PUSA 3PTYA 4RS5A 4DPNA 1S0CA 2ZHLA 4FFFA 4FPLA 4LO4B 1W0NA 2OYZA 2AACA 4B7EA 5BY5A 2HWB1 3VKNA 1SBEA 1GSLA 2DBIA 2NLRA 2VQ0A 3GCXA 4K20A 4QKFA 5LBFA 4Z92B 1GU3A 4P02B 2WO7A 1LGBA 3AJYA 5A7NA 2B42B 5IVVA 4N9HA 1W6QB 4BMEA 1CWPA 2VY0A 5CFCB 3V0AB 5A7OA 4JCKA 4EN0A 2PXJA 3IDBB 3PNAA 2BGPA 1ND3A 3J8F1 3WF3A 4CPBD 1HJGA 1ZZBA 4YM2A 3TNQA 3ZSLA 3A21A 5GLWA 4JGYA 4K7JA 5GLVA 3VZLA 2W0XA 1Q43A 2JG8C 2RS51 3KT4A 5FPLA 3TAYA 5LATA 3W59A 2ZEXA 3WQ0A 4NRPA 3Q9OA 2VUAA 2HWC2 5CG9A 1H1AA 3MW2A 4Q4V3 3GJBA 2RMU1 1QHDA 2XL7A 3NJYA 4RHV1 4S2HA 4XIKA 2EA7A 2VD7A 3R4DB 2QQJA 1COV3 4XFHA 5B4XA 2VMGA 3VZJA 5FOJB 4OMCA 1RUC3 2IC1A 4E4ZA 1RUI1 2ZCWA 4K8RB 1DHKB 4PIXA 4UFJA 5JVVA 4Q2FA 4CDUB 5A33A 5A3MA 3PVBB 2D6OX 3M70A 5HPOA 1QGLA 1WA6X 2HWD1 4EWAA 1QMJA 4J25A 1GZCA 5F5AA 4AZZA 1OUXA 3OUIA 5KXBA 1KJLA 5D2AA 2D3PA 2GNMA 2VW0A 3V56A 2VM9A 5A7WA 3WR0A 2XLFA 3FC0A 1WW7A 2W39A 1IPKA 5DUVA 4D7YA 5I0SA 1RUD2 1PO22 3U10A 1RUE1 5C9AC 3EBRA 3A7QA 3VKOA 2BDRA 4B8EA 3B5LB 3CEWA 2A6YA 4D69A 1RUOA 4Q4Y2 3ATGA 5A3TA 4HK8A 3WDWA 4GIQA 3VKLA 3WG2A 2CV6A 2UY8A 2RS31 3SH4A 1MZ6A 1VMJA 5HCAA 2DCJA 3I8TA 4H14A 1GP6A 4PHZA 1S1AA 3D8CA 3E5XA 1V6MA 2RDSA 3FFQA 1HB2A 1HB1A 3WDYA 2PLV2 3KGZA 4JV4A 2E7TA 2CTVA 2QQUA 4GWJA 1B35B 2W91A 4XQDA 3DCQA 3H42B 5HCFA 2CAUA 4QPGB 2WQ4A 2OUHA 3RWNA 5JOWA 4N43A 2EVXA 1MS9A 4XBLA 1H6YA 1XB9A 1NUKA 3FJSA 1A8MA 2JDAA 2NMOA 3VZKA 4Z2AA 3AJZA 1UL9A 2OX0A 2Z69A 4XF4A 3B69A 5F8PA 1EV12 3N7JA 3HT1A 4ZXKA 4QXCA 5DUUA 1RUF2 3H8UA 4G4FA 4D6SA 2HYXA 4UFMA 1FXZA 1RVF2 2A3WA 4Q8LA 3TNPB 1SFYA 4QPYA 2P6HA 4YWAA 4HPKA 1W8ZA 2WZ8A 5B2GB 3D3AA 4MH0E 1LOFC 1YCIA 4HVOA 2ZGUA 2I2SA 4C1WA 1AR73 2HWF2 3LKJA 4HLTA 3WCSA 3TEZA 3J7NA 1VBC2 5GLUA 2VCBA 2K0GA 3HNBM 1AR93 1UOJA 1FMD2 1LEMA 4QM8A 2QQOA 3PHMA 4YW4A 5CFDB 1VBE2 3LFMA 1HN0A 1OUSA 4IESA 3SEEA 1VB2A 5LRSA 1F9KA 2ZJCA 1YFWA 1QJX3 2HEVF 2PN5A 3KD4A 2E31A 2ET7A 4HFSA 3E5QA 4HL0A 2CDOA 4FPHA 5A7QA 4IERA 3I4IA 2DTYA 2G9GA 2J1SA 2Q8DA 2QJVA 3OJBA 2A70A 1XE7A 3H1MA 4UXAA 2F17A 3VD5A 1KDKA 3AXDA 1DGRN 2ORZA 3JD72 1WLCA 2YFZA 4YLZA 4CUBA 5FYHA 3O1VA 4QDQA 4CU6A 2O1QA 1NLSA 1SCRA 5FQ0B 1PVC2 5L7OC 1V6KA 2HWB3 3CJIA 4J1XA 1AJOA 4RGKA 2J1AA 1W8FA 3N36A 1DZRA 5IAVA 1UCXA 1DYKA 1VBA2 2IFRA 2WINB 4M3CA 3THTA 2VZRA 4MGZE 2VZOA 1IGOA 4FCAA 2VULA 1KRIA 2O8OA 1HJFA 3P6BA 4JKMA 2K9ZA 1MR5A 1RUD1 5FK7A 2UWBA 2FBEA 3O0WA 4RR3C 3UKVA 2WA3A 5LA2A 1W8OA 4WM8C 1WW5A 4P9JA 2VGDA 2RS53 1PK6C 2OVUA 3OEBA 4HN1A 4KGGA 5EYYA 4AWDA 3WF0A 1BBT2 5BNNC 1WBFA 2WZR1 1C1FA 2DCKA 2VUCA 2GNDA 4A7ZA 2PAKA 4KG0A 3ZSMA 2WIIB 1PIV3 4EN6B 2E7AA 1QJY1 4K1YA 1MQTA 3EJKA 3I3QA 3ZYPA 3N35A 2ZTNA 3HQRA 3ZYBA 5LWBA 1O91A 5LZ6A 5E89A 1CAVB 2ZHMA 1ENXA 3P3PA 4GWIA 1VP6A 3POFA 5BNOC 3O5SA 1N47A 2IXKA 1ULOA 4UF0B 2VU9A 2JDZA 1PZ8A 1XNBA 1TMF3 2ZKLA 3MW3A 5J98B 4LO8A 2CDPA 2CYFA 1W8TA 1BVVA 4N53B 2P3JA 2I45A 3I2DA 1ULGA 5C8CC 2E53A 4FOWA 3ILNA 4FT8A 3MPBA 4PDWB 1UMHA 1UY4A 4L9BA 4M0HA 3B02A 1A34A 4LBKA 1US3A 5A1LA 3K4ZA 1O3QA 3U78A 3I3BA 4LO7A 5LA9A 2XUEA 3ZDSA 4XFFA 4QHBA 1RVF1 1ZBA3 1T2XA 1OI6A 2GC2A 5FFOC 5FLJA 4CDXA 2WQ8A 5KHJA 1GANA 4C90A 3N9QA 1XYPA 1I5ZA 1E5HA 1CZVA 4Z2WA 4L0PA 3IT8A 2C0ZA 1KD7A 1CQ9A 1R1A2 1Z78A 2Z4FA 3I2KA 1O3TA 4TXWA 1FMD1 2MNGA 5FKBA 1N1VA 4NAOA 2ZAAA 1XQNA 2BWAA 2XB6C 1JZ3A 5DDJ1 3PU8A 3ZXJA 3MI8A 2BFUL 4P5YA 5FXWA 3ZMNA 1Z0HA 1I6XA 2BTVC 1RYYA 1JU3A 4YGEA 1GP4A 3LSDA 4LLOA 3LD8A 1GZWB 2Q1FA 2W46A 5K9YA 1UU5A 3IB3A 1HRV1 2A6XA 1GP5A 2ZGMA 4IE6A 2A71A 4JKLA 1OVPA 2W9XA 5FWEA 3NNGA 3DUIA 5FKCA 1UU6A 5EWSA 1J58A 2Y6FA 3NW4A 3C7GA 1O59A 1PVC1 3K3OA 3OUHA 1H2NA 2VOTA 4IDZA 4AEDA 4DXZA 4NAMA 1TNRA 4MGSA 4RFT0 3O12A 2DCYA 4IXLA 3VD4A 2Y6JA 4JX0A 3NNFA 4C91A 2FCUA 1NCQA 2E33A 3MFAA 1H8TA 2QQNA 2Y6GA 4Y4YA 3UGHA 5FYUA 4OZXA 4E4HA 4B4QA 4QB2A 2ZGOA 3SMHA 4P9LA 3FUOA 4FQZA 2YU1A 3NRUA 1JZ6A 2OUJA 4LK7A 5LASA 5ACA1 4YG0A 4AI9A 1X82A 1TME2 1O4TA 2A3YA 2GMPA 4SBVA 2OQ7A 4OUMA 4WVWA 5FLHA 5JZGB 3LZZA 1MS0A 3VBUC 1RUH2 1BBT1 2WNEA 1UZYA 5FZIA 4UFKA 5A3UA 4FFIA 3RYKA 3H8RA 1UWWA 1PK6B 3K51A 4GZ9A 4UT5A 4QU1A 4WM7C 4XABA 4XMIA 2H0VA 3H3ZA 2TBVA 3IAPA 4NIGA 1ENRA 4TYSA 2CGNA 2A73B 3AL5A 5HV4A 2Q4SA 5LRRA 1TZOA 5I8TA 1ZRRA 1LENA 1NA1A 1V9U2 5BYNA 3QCWA 5FV3A 4BXSV 2P3KA 1OT5A 2OS2A 1AL0G 4CYDA 5GZGA 3O1TA 2B45X 1DU3D 3C8XA 3ZIXA 1M4WA 1UYPA 1U12A 4YGDA 3GHNA 1IPSA 2XVGA 3LDKA 1AR62 4BH9A 5H9PA 2WZR3 2BPA2 1SG3A 3PVOA 5A6QA 1Y7BA 1QJU3 4ORFA 1IG3A 3LPGA 1SZBA 4OI4A 1QJY3 1PX4A 3Q8EA 5HCBA 3VBFB 2UWCA 4R4XA 4JGZB 1M06G 1KITA 1AYM3 1QH7A 5LEKA 3L2HA 3WV6A 5A6YA 5GZDA 1LR5A 3DN7A 1N1YA 2RJ2A 4GAZA 3LCPA 4JC1A 3CZJA 3J4UH 1R092 4LO6B 4XEZA 1AVBA 1NKGA 4WVMB 5ABJC 5L19A 1LKNA 3F2ZA 2OW4A 4DY3A 3DL3A 3DPRC 2WNUB 4YW5A 4FTEA 4IGOA 3FBMA 4P9IA 4LITA 2D93A 1DQ6A 1FNZA 4P08A 3VZNA 4C0HA 1Z7S2 4RYDA 5BNPA 5LA1A 2GMMA 3IMNA 2BEOA 5C4WB 3BU7A 2PQSA 3GCWA 4AGRA 1VMHA 5FZ1A 1ULCA 2R6QA 4HMZA 2VG9A 3KQRA 1RINA 4FXGB 4B7KA 4XC9A 4M3CE 1QXRA 1DF0A 1VRH2 1ZNPA 1VR3A 4Q4W2 4QXHA 4GH4A 3O0XA 3KV5A 2RDRA 4IEPA 4MOAA 1NAEA 4D7TA 5A3PA 4FFGA 1NY72 3WEZA 4Y4RA 4ZPIA 1FOD3 5FBZA 1N3QA 3S30A 4QQOA 3VDDC 1MS3A 2X5IC 3QBQA 1GWMA 1WGPA 4AQ6A 1OH3A 1F4HA 2D43A 2E9QA 1ASJ1 5T3NA 1JW6A 4LJHA 3AYCA 4Q0UA 2G4IA 1IQAA 2ZMLA 5F6KA 2ZGPA 5A33B 1Q8QA 2VL4A 4ES8A 3RJRA 3PL0A 4EYUA 2JG9B 1JHNA 2YV8A 2VTXA 3M3EA 3M8LA 3P5BA 3PUIA 1PMHX 4KH9A 1VBB1 4QGMA 3VGIA 4MG2A 5JXHA 4M00A 1HRV3 1VAKA 1W06A 3EHKA 3AYAA 2XJUA 3PIGA 5LCWL 1QQP3 2IXCA 4FPJA 3KMHA 1KFXL 1RUJ2 4K3UA 1HB4A 3ZMOA 3CDZB 1JZ5A 4PBOA 4QPIB 2NQYA 3RZZA 3O1PA 4FPOB 3VBUB 5KC6A 2R041 1K5MC 5FMBA 1DQ4A 2X09A 2D3SA 1QF3A 3GBWA 4BIOA 1V6OA 2PHLA 3ILFA 1G86A 4XHXA 4LUKA 1PZ7A 2Q0AA 2A1XA 1IKPA 2ATFA 2MPFA 3LSEA 1W8HA 3VN4A 4ZZ8A 4WM7B 1BEV2 4SLIA 4H7MA 3H3UA 4X6QB 5DZEA 3VZOA 5IYYA 4J6GA 2FZ1A 1RUC2 2RM21 4PI2A 3KV9A 5ACA3 3FBYA 3TN92 1CX1A 1IQDC 1U5IA 3M3OA 4Y22B 4F7ZA 1H8VA 1X9TA 2UYBA 3MICA 4LKSA 1YFYA 1G9FA 3CKHA 3BIEA 4XHBA 2ZEZA 3VBSB 3Q8CA 3VBOC 1DDLA 3MDPA 4Q0VA 4JVAA 1GZ9A 3RS6A 2XJRA 4A42A 2JG8A 1QJFA 4I02A 4NHLA 4ARYA 1NX9A 4H3WA 2J1VA 4XXAA 1CAUB 3AP9A 3S57A 3OGSA 1QOOA 1K42A 5JAXA 3NJXA 3JUUA 3ZXLA 3M3CA 3CHXA 2KA3A 4UFHA 5IFTA 1W9WA 4IGQA 4GKXA 4RQPB 1R091 2JE8A 3H8XA 4A7KA 2V72A 1UY1A 4IEVA 4M0NA 2ZHKA 1HRI2 3ZX7A 2P2KA 2BU9A 3VBRB 4IEYA 3B94A 1J84A 3WG1A 4HSLA 2WO3A 2XUMA 2ARAA 3M2MA 5D1IA 1ZX5A 1AZDA 5FUNA 1OA3A 1OBNA 4OFGA 4AQSA 4CDWB 3RG0A 3UGFA 1PGL2 1VAVA 1WLWA 1BMV2 3CLPA 5A6ZA 5C3RA 2GAUA 3N9LA 2C5DA 3AKPA 1OMIA 2FDGA 4K8FA 1VRH1 4BB3A 5C9AA 5FPUA 1RXGA 2JKBA 1NYWA 4GKYA 3RYPA 1J1TA 4PCRA 5IVEA 5KHKA 3USUA 1YI9A 2KM2A 1WCQA 2DV9A 1G8WA 3H50A 2WFPA 2R32A 2OKXA 1YUDA 1S0GA 5FLIA 5IUQA 2YZ4A 5L9RA 4WZFA 1QDCA 3CQOA 2NN8A 2VMHA 2R30A 5T5JA 3BUCA 2OXBA 5SV5A 4COVA 4MGTA 3ACIA 2JDNA 1E5IA 4HKOA 2VCAA 1KJRA 3BI3A 5CG8A 1OF4A 3AZZA 4V2VA 3ZXAC 5C8WA 5JSOA 4XW3A 4CXXA 2X10A 4IEQA 4M3CB 1SACA 1ODMA 4Q26A 1ZYBA 4IV3B 4COZA 5CFCC 3HIFA 2FDFA 2JDYA 1KQRA 1EAH2 1RUJ1 1X8MA 2WS92 2ZGTA 3PJYA 4HKLA 4XJUA 5GKAC 5T5OA 5FZFA 5C5UA 3ACHA 4LOSA 4QT6A 3W20A 5FZCA 2PYTA 1UOFA 3DV8A 2XBO3 1XOYA 1UKGA 3PURA 2FDIA 4CP9B 2ET1A 3VDCA 2KR2A 3UK9A 3RJ2X 4AI0A 5M0TA 1K3IA 1OFSA 2WNVB 3MEPA 2R7EB 4Y33A 3ZFEC 2RS12 4KG8A 1W28A 3LAGA 3LA7A 3HNMA 4CP2A 2CHHA 2C6SA 3N9PA 4ONUA 2DUQA 4QHZA 1ASJ3 1CAXB 4J1WA 5FP4A 3TOJA 2WWSA 2WR9A 1XE0A 1O8SA 2W3JA 4IETA 4JQTA 2HWE2 5I8SA 2EAAA 4A3ZA 5LEJA 1NCRB 3KF5A 1W6PA 2VH9A 3AYDA 3BN6A 5FZ7A 3WNPA 1W03A 1AJKA 2X8KA 5A3NA 4CSWA 5EFUA 1QNYA 2JDPA 4JDMA 3IBMA 5E8AA 2F6BA 1MEC2 2ZBJA 4YVWA 2XQRA 3MW4A 1ENSA 5FAXA 1Y43B 4A6OA 4JKKA 3NV3A 1AL21 5FZOB 1RUG1 1LOBA 4K1ZA 4NMIA 5FBJA 5AFBA 3NAPA 3VBOB 4CEYB 3HOBA 3CBNA 5FZ9A 4QB1A 1F5JA 1LU2A 3DYMA 1ULEA 2Q8OA 2VZUA 5F32A 1FPN1 3D82A 2VOVA 4MLOA 1HRI1 4PBPA 5T50A 2ZEWA 1QU0A 3ZN5A 2RM23 4N7UA 1K12A 4AHXA 2Y6LA 3UGGA 1DGWX 1X8EA 5I0DA 3ZDVA 4FBFA 1CAWA 3Q8AA 3UKTA 1TMF2 2HYKA 1VBD3 4NHKA 1FT9A 1OC1A 4GMP1 1BYHA 2BW8A 2EIEA 3T4VA 3MIEA 3KVBA 4RR3A 4QPGC 4PJYA 3ZN6B 4YSFA 3FHQA 4NIIA 3NSTA 4WM8A 1JTZX 2FZ2A 3OUJA 1IOAA 2PELA 2VVFA 4KI5M 2ZX3A 1YQCA 1UZWA 1W9FA 1C5IA 4P9GA 1WW6A 2CY6A 2BOJA 4W6WA 5FWJA 4NIHA 5BNNA 4KWJA 2XKOA 5AC92 1US2A 1W2AX 3KHBA 1PHMA 3PUQA 4YW7A 3V0BA 2WO2A 2UURA 2Z42A 4CUCA 3APBA 4LIVA 4JDNA 3ACLA 4BOWA 1SLIA 5FZ6A 1AXZA 3QH6A 2D6KA 5BNOA 2Y60A 3GNEA 1PX3A 3CU7A 4AEDB 3LA3A 2VCMA 1R083 4BLIA 4NRMA 5I0RA 2KD7A 4ZKTB 1AHSA 1LOCA 2WZEA 4OUEA 2HKXA 3W21A 2DYCA 4LR4A 1POV0 5FXXA 2WFF1 3JU9A 5CFDC 5J1XA 1LODA 1EAH1 5C8CA 5GLTA 2WS91 4Q1RA 4DOUA 1HN1A 4LIUA 1UZZA 4UWDA 1OA2A 4Y5SA 4JRAA 1F31A 2WWJA 2VW2A 5FK8A 2W08A 3GM8A 4LA2A 3G7DA 4QXKA 3ZYFA 3KHCA 2LS6A 1FAYA 2JIJA 1JYTA 4DIQA 2VMEA 4W50A 4Y20A 1H1IA 2B9VA 1PGSA 5F2WA 3KV4A 1AR82 3ILRA 4GWMA 4D7SA 3VBHB 4CCCA 3H1WA 3WD5A 4EWDA 3AFKA 2OZJA 5H9SA 3WQ1A 2GH8A 4A3XA 1C8M1 1HV0A 2YU2A 3KCXA 4K6BA 3M4FA 3AL6A 2WABA 2VBDA 4FP2A 5FY1A 4Y5TA 3WX5A 3ZFEB 1MS5A 3WDVA 1W6OA 4A41A 1ZRDA 1JOBA 1PO11 1YQ8A 3ZFGC 3ZSKA 2BQPA 4P5HA 1PGW2 1H2LA 2XONA 1BJQA 2YBPA 2FCTA 3AMPA 3AKTA 3UL2A 1WD4A 1W6MB 5C33A 2TEPA 2JX9A 4QX3A 3LEIA 4HKWA 1VAMA 1FATA 2CWSA 3HPNA 2EIGA 4XOGA 1SLTA 4L2NA 2R063 5I0UA 3ZM8A 1S0JA 2IXIA 1S4CA 2BRTA 2VNGA 5FDBA 1JMUB 1D4M1 4ZHNA 4LKFA 4OMDA 4U2AA 3SNMA 1GNZA 2R0HA 4FO9A 4GB32 2GC1A 2VXJA 4MXWA 1ZZ7A 3ZXDA 2QDRA 3WF2A 1PZ9A 3RZLA 3ES4A 4L99A 3FL7A 1K5JA 1OKOA 5G04L 1ND2B 3IDAA 4AE2A 5FMDA 3ZFFB 1NE4A 4YW6A 2E26A 5FIXA 3HMYA 4XPVA 1F2NA 3R05A 2EIDA 3T08A 3PU3A 3OPWA 2WLPA 4BQXA 4IEWA 3N4MA 2RR11 3JBG1 1JZ7A 4GJZA 2FMYA 3OY8A 4N53C 4Y5Z0 1EPZA 4PIYA 4AHZA 2W1UA 1JXNA 4XUPA 4C0BA 4CDQB 5J3UA 4QKDA 2F4PA 4PDWC 5FZAA 3O1SA 4H55A 4CEWA 3LOIA 4QX0A 4XBQA 1AL23 4FOQA 1RUG3 1ALYA 4YM1A 1UOGA 3AX4A 2VAUA 3KV6A 2ETEA 2W92A 3U1XA 2X05A 1ACCA 3LDRA 3WF4A 2G9ZA 1SBFA 3POYA 1QJU2 2VBPA 5A3OA 4P14A 5FY8A 2EXHA 3RFRA 1UZ0A 1FNYA 1IHMA 3LFIA 3WDUA 1RHI3 4LBNA 3IPVB 5DAQA 5FYVA 1CGPA 2X53S 4UI9L 1SPPB 2GSYA 4YZ5A 4IE0A 2X29A 3ACGA 1OOPA 4GXLA 1HXS2 1V00A 3KCCA 2ZZQA 5BXXA 4XZPA 3RI9A 5FMCA 1WMXA 3HBZA 1K45A 2VZTA 3R4UA 1V70A 4KQ7A 4UBHA 4EROA 3BTZA 4ZZ5A 1C1LA 2SBAA 2QQMA 3JB8A 1W2NA 2BWCA 4XUNA 5JOXA 5JMCA 2JECA 5F5CA 5LW9A 4Q4X2 1JYIA 1VE0A 3WNMA 1ZZ6A 2ZX1A 1W8NA 2WAOA 4W65A 1AR81 2D44A 1UPSA 4DNYA 5KWRA 5LB6A 3RI8A 4D3WA 1CZTA 1JOPA 3IIAA 4LBQA 4AFCA 4Z1VA 3S5AA 1SEFA 2HWC1 1SHWB 4KBBA 2V5DA 1HQLA 3NV4A 3UJOA 4ARXA 3PUHA 3GZAA 1LAJA 5FPVA 1J1LA 1FOD2 3DXUA 3GBGA 5ABJA 3POEA 1IS5A 2ERFA 3U07A 3DPRA 3E6DA 3EMRA 4NWWA 1N3OA 2DVDA 2MEV2 4QMAA 4W6XA 2BGOA 2WN3A 2YC0A 3PIJA 4YM0A 3ZFGB 5JZGC 4IUGA 5CADA 3N7KA 1YNAA 2XH6A 3OYWA 4QQHA 5C5TA 2XHNA 1PVXA 5EIYB 4UW4A 4E27A 2GDFA 3ZYGA 4AGVA 2JIGA 3J8F3 5D8AA 3O1OA 2WWUA 4EN9B 1PO21 1QQP2 3FFZA 4TSVA 1YQ5A 3T1MA 1JYVA 2GP3A 1H30A 4XYXA 4ZXEA 4LNVA 4OHZA 3WDTA 4XJAA 2YHJA 4LHSA 4Q4Y1 3AMHA 3ENRA 2AEYA 3VDDA 2Y8KA 2RMU3 4RHV3 2X5IA 4BPZA 2ID4A 2DCTA 1JH5A 4OI1A 1S0FA 2W95A 2QZ3A 1RUI3 3CJXA 4ZONA 4O9EA 4QGNA 2PLV1 1LJ7A 3D5OA 5K0UC 3I2JA 4Q1PA 2VOKA 4FPFA 3WNOA 4D6QA 3UT0A 4Y1UA 2HWD3 2BNOA 3ZPYA 4YGBA 4XQWA 3SKVA 4B4PA 3TYJA 5FZHA 3NKGA 2B9UA 1D4M3 3ES1A 1RJ7A 1WWYA 5GZEA 1U5ZA 4Q5OA 2EXKA 5DMYA 4OQ9A 1EV11 1K5MA 1RUE3 3JXSA 4IW3A 3VBFC 4AFBA 3U0ZA 3PMSA 4JGZC 2P3YA 2Y6KA 2GNTA 1RUF1 2W1QA 4KU7A 5CIRA 2NM1A 2W52A 4AHWA 4LT5A 4NJ4A 2OIIA 3WHTA 4BCUA 1LGCA 5FJHA 4AQTA 4CA9A 4XZUG 3IKWA 1G9BA 5IFPA 4MVTA 5FYTA 4TLGA 4LTAA 1B09A 4UAPA 3THCA 5FZMA 3JBG3 5AFEA 2HWF1 2RS33 1GQPA 1WKYA 1A3KA 4MGKE 1RTVA 5EYXA 1VBC1 2WNUC 2XLAA 4LQRA 3WW4A 1C57A 1H2MA 4DEVA 2J1RA 4RA0A 3J7MA 1VBE1 2LRPA 3H9AA 1TNFA 4BXFA 1DIWA 1MPXA 1W9SA 4Q4X1 1LRHA 4XCAA 5C4WC 1WMDA 2HJIA 1HLCA 1R1ZA 1CVNA 4U36A 2WA4A 2ZGLA 2CNAA 2ZGQA 5JXGA 4NHYA 1RXFA 2VW1A 1OLMA 1KXGA 3SCHA 1JHJA 1IPJA 1Q5OA 4JGYC 3X29B 4YVSB 3UKNA 1O5LA 3I2HA 2Q8EA 4K9SA 3JD71 5FZ3A 5APAA 1P8JA 4CU7A 3RZJA 4O7XA 4A4AA 1REEA 1ENQA 3CIHA 2JENA 2DWRA 2QQKA 2VCCA 4QQ2A 5CKQA 5A32A 3VDBA 4JRLA 2XL9A 1Y9QA 3U11A 4XJ8A 1ZBE2 2VNRA 3D0SA 2VE1A 1VBA1 3M7AA 4A45A 3RVHA 1WZXA 2OT7A 4ZU5A 4ZY9A 2LM3A 2ZZJA 4JTOA 3USSA 3ZYJB 5CU1A 2JG9C 3BOPA 1X7NA 5I91A 1TEIA 4AFDA 3BCWA 3H3LA 3THDA 2V4AA 5JIAA 3C7OA 3ALQA 4X6RB 4AXOA 2Y34A 4DRVA 4AFMA 3THPA 1CR7A 1UIJA 3LIGA 4EE2A 5JDBA 5JI9A 4DRRA 1UOBA 4QPIC 3ZSJA 2O0OA 3OD4A 1BCXA 2XG3A 5FZ0A 5FUPA 2ZOEB 1EUTA 2IVIB 5KHIA 2FQPA 1OLRA 2R072 3LEMA 4WBBA 4BISA 1YI7A 5F7UA 2BVBA 1W9TA 2DTWA 5FZGA 4O61A 4M4RA 2VNVA 3DECA 1NQJA 1WA4A 3KT1A 1UYYA 3K4AA 1W6QA 3AXEA 3KSCA 5F37A 3ZR6A 1ZRCA 2QUOA 4IV1B 3GALA 5CFCA 4JHTA 3V0AA 1DGWA 3GGLA 2OQ6A 3MIHA 2P37A 1V6LA 4NVPA 3ECQA 3VBSC 5KXCA 1RUD3 3I59B 1U5XA 5K0UB 1RL3A 4FPEA 1PO23 2LW8A 2PFWA 1JODA 2R1BA 4D94A 3MLJA 3IWZA 4PQ9A 1JZ4A 4PIZA 3B93A 4Q4Y3 5K7PA 3ELNA 1SFPA 3LB9A 1GWLA 4AFAA 4F8AA 4RQPC 2D7FA 3SCGA 2JDHA 2RJKA 3BGAA 1W6NB 2R16A 1R1A1 4RGAA 4IEOA 3WXPA 4CDUA 2IVJA 2JD9A 2YY1A 1RMU2 3H0OA 4XCBA 3VLBB 4P9YA 2P6CA 3MUZ1 1NE6A 2PLV3 3OGGA 3VBRC 4A6SA 4XAEA 1YQ2A 4ET7A 5EXOA 3RYRA 1HV1A 5DG2A 4RS5B 3A22A 2XR4A 3GJAA 1CESA 3EO6A 3GZUC 4NPLA 4PQQA 3HN3A 2VNOA 3T2TA 5KHHA 3WG4A 4B1LA 4CDWC 1XRUA 1L7LA 1WW4A 3NQHA 3M1HA 2OPWA 1C5HA 3ZKYA 4XUOA 1S0IA 4NO4A 4M3CF 1GV9A 1Q56A 1RUF3 1ODNA 2QTWB 4XIOA 3OD0A 3U4SA 2IFWA 1DQ2A 1RVF3 1SLAA 3IDEA 1ND3B 2BFUS 3HJRA 2B4KA 5A3WA 4FAGA 1AYN2 3DKQA 4Y20B 5FY4A 1ZBE1 2VPVA 2VTFA 1XSQA 2HWF3 2B5HA 4JGYB 4FQ4A 1V6JA 5FYIA 4ZU7A 4YZ1A 1QY4A 3MZHA 1JBCA 5DAXA 3VHPA 4A44A 1QXPA 3CJIC 2J1UA 1FMD3 1QDOA 2RDQA 1B35A 4OHWA 4OVEA 5DPNA 2ZKNA 2O14A 4Y1VA 5JPMB 1J59A 1OHFA 5DDJ3 5FPZA 4QPGA 3KS7A 2V73A 4IV3C 4P00B 4LORA 1NXMA 4YG3A 2YPDA 1D2QA 5J48A 1TME1 1YO8A 3LPFA 4OULA 1LNSA 2DFBA 5I0TA 1RUH1 2PHWA 2VZ1A 2VZSA 1I1EA 3HVDA 1LCLA 2D6PA 3WDXA 4MYEA 2DF7A 1F5FA 2J22A 2R071 4QD2A 3E5UA 3J7LA 2WJSA 3JD73 2ARBA 4GQ7A 4R4ZA 4BQ5A 3DYPA 2W94A 2WNVC 2YROA 5A7WB 3R6SA 1CPNA 5DUWA 1CPMA 1PVC3 2B39A 3OOXA 1JYWA 2N7GA 3A23A 1XU2A 4NIDA 1MQTC 4AEJA 3A4UA 1VBA3 3ZXKA 4MUVA 3FMGA 3S6PA 4Q4V2 1NCRC 1V9U1 2ZS6B 1OVSA 1REDA 1COV2 1MZFA 1ULFA 4C8DA 4BQ3A 1O7FA 3KF3A 4MHRA 4HN0A 1DBNA 1PMIA 3WQ7A 3WW3A 1XU1A 1W2OA 4D0QA 1LOAA 1O8PA 5IVFA 3OGJA 4I3GA 1YIPA 2GC3A 4FP3A 2WSUA 3GDBA 4Y1XA 1YIFA 4AG4A 4EZ4A 1AR61 1BBT3 4I3PA 4XETA 2R062 4AR2A 4MGYE 2GALA 2WT1A 2XGXA 3HR9A 4JZRA 4L92A 1QIQA 4CEYC 4BA6A 2AENA 2YXSA 2RHPA 5FQ0A 1MACA 1UY0A 3Q8FA 5J7MA 3KGLA 4N43B 1QH6A 3OG2A 1MS1A 4MXVA 3ZO0B 1DLLA 1TVGA 5FP7A 3BIWE 2GZWA 5JXIA 5J09A 3DGTA 1YRZA 3K2OA 5C70A 4I30A 3VV1A 4GA9A 3WHUA 2DURA 3SLIA 4HETA 3PTRB 5JSRA 4ATFA 2Y6HA 2Y38A 4HPKB 4R9AA 2H0BA 2JE9A 2YC4A 1CZSA 1H0BA 3INAA 4Q0SA 5FO9B 2LROA 3MV11 3NO8A 1VJ2A 5JOZA 1Z7S1 2WKKA 4BK5A 3N3HA 4AVBA 1S2KA 3S7IA 3O1UA 2UY9A 2R49A 2WNOA 3VD9A 3LIHA 2E63A 1DZQA 3MIFA 3OF1A 3PMEA 2WYFA 4GALA 5GZCA 1OLQA 3KT7A 5FXVA 2IXJA 2QCSB 2XJQA 5LBBA 4URAA 1XPWA 5KXDA 1DYOA 3GHMA 2C9KA 2YUEA 3I54A 3AZVA 2BNNA 4Q4W1 5D21A 5EP9A 1OA4A 2A5ZA 1YJLA 2JDUA 1R1A3 2C1FA 1CAVA 2LALA 2ORXA 4QKBA 1NY71 4CRQA 4AEDC 5E1RA 3HT2A 4UF0A 1YQ6A 5CAZA 1VLNA 2VVEA 1DCSA 1LTEA 3FZ3A 3TEYA 3AYEA 3SEPA 2Z79A 1PM7A 2PHTA 2P17A 1CD3G 2CWMA 1HB3A 1XXNA 5FPBA 4OHVA 1H8TC 5F1RA 1IZ3A 4NRQA 4AHYA 1OKQA 5BUVA 3CJIB 4PDWA 1AR72 1CJDA 2D40A 3RSJA 3I49A 1XJAA 2DU0A 3IMMA 3WUDA 4CZSA 2WDBA 3WT3A 1AR92 1W3XA 5A7PA 2FDHA 1JOJA 3U75A 2J1TA 1MS4A 2ZPXA 4MO3M 4O9GA 1KGYA 2IUWA 2BZDA 3WQBA 4BDVB 2EAKA 4QGLA 2E51A 1QJX2 2OA2A 5FZ4A 5T5LA 3VZMA 5D8AB 5K4LA 3LGRA 1L7RA 4RSUA 4KL1A 3UETA 4CXWA 4Z8BA 5IK7A 5J37A 4BU2A 3VBHC 4LLFA 3KZ4C 3ZSEA 1YEWA 5A6XA 2A6ZA 4YW2A 5LBEA 4XDOA 1LHOA 4Q4V1 1W3VA 3WP4A 3WW2A 2ES3A 2SLIA 3POWA 1O3RA 1LOFA 5C3SA 2P3IA 1BEV1 4ATEA 1WCKA 5FJKA 2J7MA 1MQTB 1RUC1 4HOOA 1YYNA 4COYA 5CA6A 3POIA 2QQPA 1URXA 3O7OA 1V0AA 2HWB2 3TN91 1TME3 5T52A 2D97A 1WMFA 4TLFA 4KU8A 4XDQA 2PMWB 2VZVA 4CCJA 1RUH3 1VBB3 4AVSA 1Y9GA 2VMDA 3W5NA 5GZFA 4E2SA 5JIUA 5JR2A 4MADA 2ZAHA 4X8NA 2Y26A 4A7YA 2B8MA 5IVJA 2XJVA 3ACFA 3J8F2 3OTFA 3K4DA 5DZGA 2EF6A 1EPWA 2YGMA 5EJ3A 3O1MA 5IVCA 3U14A 1SCSA 2R043 5HXVA 3HEIA 1PNGA 2W87A 5BPXA 2TNFA 2AYHA 4FTSA 2RS52 3VKFC 2W47A 1ND2C 1J3RA 5K0UA 3ZFFC 4JQRA 1NT0A 1SLBA 4CDXB 2RMU2 4RHV2 5CEHA 5L7OA 4YZ4A 2EICA 1V9U3 1PIV2 1UX7A 4QX7A 2P5BA 1XNCA 1HDKA 1I9RA 3E1F1 4LHNA 4UFLA 3RRDA 4A2UA 4ASLA 1HX6A 2JB4A 2D6MA 1UYZA 2PHRA 4B1MA 4AAPA 4LMFA 4YW3A 4AI2A 3CZUA 4KMQA 4CDQC 4CP1A 3HQXA 5JZGA 4KWUA 4I0BA 2B7YA 4N9IA 4E4SA 2CU5A 1H1MA 2BUKA 5F5IA 1PGL1 4XFAA 1QWRA 1BMV1 2HWD2 1XYOA 2GN7A 1SLCA 3OBTA 1UD1A 2IZWA 3ON7A 4ES9A 1NOVA 1PK6A 3MIBA 3MF6A 1EY2A 3POGA 1OF3A 3B3QE 1RGSA 4N8MA 5CBLA 1AX1A 2XXZA 1UNBA 3BVCA 3ZR5A 1LHNA 1ZBA2 4HK9A 5HBAA 1R093 3T0DA 1UIKA 1GQHA 2J1EA 1KDMA 2Z5WA 4V1PA 1RIRA 4UYBA 1RC6A 2RVAA 1ZZCA 4KWKA 4MX3A 3W5MA 1W0PA 2BBAA 2VZPA 3GZEA 4EZHA 1NZCA 1S0EA 5I8YA 4HVRA 3FUQA 4XVHA 1LESA 1AR91 2CGOA 3OGVA 5FCCA 2AGSA 5DN2A 1NCQB 1QNWA 1L3JA 4I01A 4QX1A 2CGPA 3HN1A 1H8TB 4IGPA 4LKDA 4UW6A 1S55A 5G05L 1WCSA 2RJLA 4HONA 2QBXA 1CONA 3AB0A 1MZEA 1OPOA 3AMQA 1E5SA 3FE5A 2BJSA 3FX3A 1VRH3 3MBWA 3MGUA 4Q8KA 4JGZA 4EWEA 2XVLA 3BALA 2FHRA 5ISLA 4YYOA 2VQUA 3LEKA 2CAVA 4LE4A 5EJZB 2G19A 1G9CA 4YG6A 1RUNA 4BJ0A 1AX2A 1IS6A 3TEXA 2DBNA 1C3HA 2RS11 3K48A 2V09A 3ME2A 3VD7A 4DUVA 4QM9A 2BV4A 2DVGA 1A8DA 1LECA 2P34A 2V5YA 3BB6A 4WVMA 5IATA 2ZACA 2BP6A 5IAXA 2C24A 4NE9A 5F3CA 2WNUA 5CVRA 2GH2A 2XDVA 2VQAA 1OPMA 2HWE1 1W04A 4IE5A 1EYBA
chains in the Genus database with same CATH topology
1MZ5A 4HZFA 1GNHA 4L8QA 4ISRA 5C4WA 1RB8G 4AK3A 1J3QA 1J3PA 1APNA 2XLGA 1DGRA 1AF9A 3U4XA 1NA1B 1RUJ3 1MEC1 4Q0PA 4ITCA 5JPNB 4JTNA 4EJRA 1REFA 1DQ1A 5J36A 2WLQA 3MIGA 5E16A 5FREA 4XTPA 3ST7A 3POSA 3H7YA 2XPJA 3C3VA 1FX5A 4QQLA 3ZYRA 1ZM1A 4TZDA 1PIV1 4Z82A 1BEV3 1XYNA 3WCRA 5FPXA 2VMIA 3RDIA 3TWIA 2YDEA 1FI2A 4WV8A 2HEWF 3TN93 4F83A 3RMXA 2JG9A 1GICA 3NJZA 1TMF1 1WLTA 4EV0A 4Q0QA 4BHPA 2K2SA 2QDNA 4CP0A 1ZREA 4AVCA 4KNCA 5DG1A 1UW8A 1SMVA 4QPIA 2YPJA 4JDOA 3VBUA 1GLHA 2ZMKA 5BNPB 3FLRA 1SQ4A 5AC91 4Q29A 5GJ6A 4NOTA 3SH3A 3O0VA 1VIWB 1OQEA 1ZBA1 2WZR2 4DQAA 1C4RA 1O3SA 3QD6A 4WM7A 1LGNA 1YLLA 4Z07A 3SITA 4AW7A 1JYCA 1FPN3 1QJY2 5IT6A 1HRI3 2OPKA 4XF0A 3T1LA 3W9AA 4GH4B 4LBOA 1AYM2 3ROUA 1OSGA 2ZABA 1O4YA 4TWTA 3QLQA 5DUXA 2G9FA 3ZXFA 3NV2A 2DUOA 4Y22A 4MV2A 4WZCA 5GALA 1SBDA 5JCTA 1UMZA 3GF6A 3D4KA 3AZWA 4GMP3 1X50A 4HSJA 2RE9A 3VBSA 4COUA 4HVQA 1QOSA 2KXLA 3MPPG 4R9DA 4YM3A 3PLQA 1X36A 1CJPA 5SV8A 3H1YA 5FTTC 2FMDA 1ULDA 1POV1 4HANA 1CAUA 3G6JB 4OUSA 1H4HA 4S2DA 5GLZA 5CNAA 5IK5A 1TE1B 2JICA 5AVAA 4YVSC 3HWJA 1H9PA 2VECA 2ARXA 4RQPA 1LOGA 5EZWA 4BQ1A 2OZ6A 2ZA9A 1KFUL 1LEDA 3GYDA 3ZXGA 1LHWA 1UF2C 4PLOA 1IKQA 4BMBA 3V65A 4LE3A 2EXIA 4FOVA 3VBRA 4WVZA 1QOTA 4UW5A 3B9IA 3NKTA 2JJ6A 4MGIE 4URTA 3BTAA 1YFXA 1AXKA 2VXRA 3D0JA 4PLMA 3AFGA 4GULA 1PGW1 5HI0A 2WFF3 2I74A 2XJSA 4MZUA 4CDWA 2QNKA 1EAH3 2UYAA 1Q8OA 2WS93 3IDCB 3KM5A 4B4RA 4LUMA 5DDJ2 3RPQA 2EALA 2NMNA 3WG3A 4M01A 4BE3A 4YVWC 1SLLA 3LWCA 4YRDA 3CNAA 2BGCA 4YNIA 4META 1TQ5A 1HRV2 4GB31 2RS13 2NZ9A 3NAPC 2W68A 5K8SA 3JQXA 1HW5A 1PNFA 4AF9A 2JG8B 4DZGA 3FLPA 3OPZA 2H6CA 2HWE3 1NG0A 4XMAA 1C8M3 1FV3A 2XHKA 1VALA 2A7AA 4FTBA 3OBRA 1WBLA 1PO13 4IV1C 4XQ4A 5FOBB 4IV3A 4Y1YA 5KBFA 1MEC3 1G7YA 3JQWA 3MFCA 1WLDA 4FPYA 3ASIA 3E97A 4YZ3A 5ACA2 5BNQA 1BK1A 3PVEA 2YGLA 2Z2SB 3TB0A 2WNVA 3WP5A 3WP6A 2PHFA 1NXD1 1QJU1 1IS4A 3A0KA 4WVVA 5C9AB 2WT2A 3QACA 1CAXA 1AYM1 3AP4A 4L11A 2QVSB 3USUB 2LTNA 2JE7A 1ONAA 1XNDA 4FPGA 3JCIA 2D98A 1NCRA 4YGCA 1AUYA 1HXS1 2PHDA 3NL1A 2UU8A 4DINB 4LBLA 2XVKA 4RS5C 1EP0A 2RR13 1D0GA 1GQGA 3M3IA 4KGQA 3TBDA 3WINE 1RJ8A 3SH5A 3VL8A 3M3QA 2BYVE 1S2BA 3B00A 3J9SA 3WP3A 1C28A 1GKBA 3OCPA 3SHRA 5AC93 4CEYA 3VBOA 1QJZA 1D4VB 4NN0A 4LULA 2E6VA 1BKZA 1ZVFA 1D2SA 2DU1A 4XF1A 4GWNA 1ND3C 2ZMNA 4C1XA 2YYOA 3AZYA 4I2OA 3MLKA 3D6EA 1JN2P 4R9BA 4K40A 4UBGA 2EXJA 5EV7A 4CTEA 1FOD1 1ZRFA 2Q5TA 3GZTB 2WZPP 1LHVA 1UAIA 4FVVA 2MEV1 3WW1A 3ZN6A 4R52A 4RD7A 4EN7B 3A0NA 3KLSA 4N7IA 2D3RA 4BM8A 2ZGNA 4AEKA 1S0BA 1POV3 4DB5A 5JOYA 2ZHNA 1W6PB 1NQDA 1H2KA 4QX5A 1QQP1 4K21A 4XJ9A 1AR83 4YVWB 4H7LA 1UN1A 4IEUA 2GN3A 4XE9A 2LUWA 5FRAA 3S7EA 4DS0A 2HWC3 2CL2A 2XBO2 3JZVA 3ZYIB 3NAPB 1V6IA 3KB5A 1WMEA 4XFIA 1CIWA 1QKQA 4YZ2A 2PAEA 5T5PA 2ZX0A 1G9DA 4XF3A 5L7OB 3VHOA 5F9TA 1OFNA 3WOGA 5JI7A 1AX0A 1GBGA 1ASJ2 3AM2A 4KWLA 5DXDA 1GYKA 4RL7A 4E2QA 1CAWB 4ZU4A 3N7MA 3C2UA 4CEWC 1VBB2 2TUNA 2A6WA 1SDWA 3LA2A 4FPCA 4GB33 5JLVA 2Q1MA 4XF9A 4RR3B 4S2GA 3BPZA 1S0DA 1LHUA 3VBHA 4WM8B 1KS4A 2DFCA 1NLRA 1XE8A 3EQEA 2XWJB 4X8PA 4N43C 2DVAA 4E4DX 4AI8A 2R042 2O8QA 5BNNB 1A6CA 3ZFEA 4OI2A 3VKMA 3V0BB 1GR3A 1T6GC 1ZZ9A 4XBNA 3ZXEA 4G3YC 1OOPC 1W6MA 3I7DA 5BNOB 2PA7A 4OHYA 2RM22 1W2UA 3WZ1A 2NYYA 3MYXA 4LA3A 2IXHA 4RGGA 1W0OA 5H9RA 3ZIWA 3B9CA 1VBD2 2H6BA 3SCFA 5C8CB 2A6VA 4P9WA 1SFNA 4FAHA 4EN8B 1YXWA 1Q8SA 2A75A 1JUIA 1EV13 3AKQA 4YARA 1UKRA 1ND2A 4XILA 3ZFFA 4HT1T 1DQ0A 3R4SA 4UW3A 2D5FA 2JEMA 2PAMA 2QKDA 1HXS3 2Q30A 3AMNA 3MF9A 1U5YA 4XTMA 3AKSA 1VBC3 4CDQA 5IK4A 2D6LX 3N7LA 5GM0A 1R082 3ZVXA 1HKDA 1DFQA 1VBE3 1FV2A 2WC2A 4BYYA 3DKWA 4YFWA 1W6OB 1WUVA 1GFF2 3AMMA 4Q4X3 2AR6A 2YMZA 3S0MA 3J26N 1W39A 3EXUA 3H7JA 1Q3EA 3KCYA 5FMOL 4AQ2A 2R0FA 2ZGSA 3NV1A 5JSPA 5D8AC 3WVJA 4XFBA 2ZX2A 2HEYF 2ZGKA 2ILMA 2XBO1 3MLLA 4I0AA 3IPVA 4AVAA 2DVBA 2WL1A 2XJTA 5T54A 2WSVA 4MSVA 3IN9A 1RITA 3FWEA 4LBMA 2DVFA 1O4ZA 1DQ5A 1WCDJ 4DFSA 4IQPA 4MXWB 1FYUA 2MEV3 2C9AA 1XNKA 1LU1A 4AI3A 3FLTA 2B46X 5CFDA 3NVCA 3RMYA 4XFGA 5I93A 1UPIA 4LBJA 4XFCA 2WQZC 3CL1A 3L9JT 4AGGA 3OY8B 1LOEA 5IK8A 5T55A 3VHNA 4IL7A 3B01A 4FXKB 4OHXA 1V6NA 4CEWB 3CO2A 4AVVA 4ISQA 1HQNA 1HQWA 4LEJA 4PF5A 3WLUA 1N1TA 2ENRA 4CDXC 3PVNA 3AP7A 3DF0A 1RMU1 2AUYA 4OI0A 1OQ1A 4LHKA 2AREA 1YWKA 1CN1A 2GC0A 3ZFGA 1QXJA 2VOXA 2Q1ZB 1BZWA 4Q27A 1F8VA 1VBD1 2BVVA 5TSWA 1OOPB 2PHUA 3AZXA 3BOWA 4BWOA 2AZ5A 4NPRA 4ASMB 1Q8VA 2GNBA 4BZ4A 3URFA 1KS5A 3UJQA 3LOBA 1I3HA 1MS8A 2NP0A 4YW1A 3WUCA 1AL22 1RUG2 4AYUA 4Y1ZA 1A78A 1YFUA 1AYN1 3WY6A 1YHFA 2A3XA 4INDA 1IS3A 1HIXA 4AEMA 1DZTA 4LBQB 1FPN2 4GMP0 3P3NA 1R081 1RHI2 3AK0A 1O5UA 2ZGRA 5CB7A 2PTMA 1JUHA 4N53A 1NCQC 5ABJB 4IEXA 4Y26A 2JXAA 3DPRB 4NR1A 3IM0A 5H9QA 3E6BA 2DUPA 3AKRA 1N1SA 2Y0IA 2GMEA 2MHFA 4G9SB 1BQPA 3OYWB 2D6NA 1G9AA 2IWGB 4PLNA 3O14A 3AP5A 1MVQA 4I09A 5FMOS 3AP6A 1WD3A 2XKPA 1ZBE3 5L73A 5C6CA 3MIDA 5E88A 1ZZ8A 1VB4A 4L97A 4LHLA 2BBVA 2VVDA 4NWVA 3CF6E 3PJQA 3VDDB 2X5IB 5F5QA 1COV1 1BXHA 2UWAA 2E7QA 4E9KA 4BIFA 2QFEA 5JWPA 4B29A 3E6CC 1ZA4A 1CX4A 2WFF2 5KHGA 5AVPA 5J96B 1NA1C 4XJWA 4BLJA 5L36A 5LK7B 1H4GA 5FO8B 3V64A 5BV6A 2AH2A 2PHXA 4P9XA 1GZWA 4YVSA 2R061 5JR7B 5KXEA 2R1DA 1UX6A 4DMIA 2R073 3RNSA 4IEZA 2VUJA 4XXPA 4YFZA 5F6LB 4HBNA 4FSJA 3SISA 1Y3TA 2I07B 2D5HA 4E2GA 1AXYA 1G6NA 1K5MB 1U0AA 5DZFA 3W58A 4CDUC 2VOWA 4QQPA 1OD5A 5FO7B 1LB2A 1C8M2 2BNMA 4I0WB 3NWKA 3GBFA 3VHRA 3L2YA 1UU4A 1PO12 1LULA 4OLLA 3HAGA 1RUI2 4AI1A 4N90A 1D0HA 3UV9A 2WT0A 1MVEA 2Y0OA 2IXLA 5BNPC 1AR63 1Q8PA 3RQ0A 5LK5A 4LBQD 4W6YA 4B3NA 5KC5A 4DY5A 2NPIA 2QZ2A 5A3LA 1D4M2 2XWBB 2GU9A 3BODA 4F3JA 1RMU3 3VL9A 1C8NA 1RUE2 1RHI1 1OQDA 4GH4C 2DCZA 2ZX4A 3R0RA 4IV1A 4NHMA 3HD8B 1DGLA 4LO5B 3JB4C 4COWA 3VUOA 1DG6A 1B35C 4Y24A 5A32B 4QU2A 4R8HA 1DYPA 2RR12 1X33A 1AR71 1YJKA 2RS32 3I59A 3JBG2 4KG0A 5K0UA 3ETQA 3WNXA 1Z7S3 3B7MA 3FHIB 1E57A 2JD4A 3TRSB 4FPKA 4R9CA 1QJX1 4JAAA 3QH7A 1H9WA 2PQQA 1BVP1 1N3PA 1AYN3 3VBFA 1W6NA 4XJZA 3SXWA 3ZN4A 3QOPA 4Q4W3 4FOYA 4AVTA 2XJPA 2QE3A 3PTYA 4RS5A 4DPNA 1S0CA 2ZHLA 4FPLA 4LO4B 2OYZA 4B7EA 5BY5A 2HWB1 3VKNA 1SBEA 1GSLA 2NLRA 2VQ0A 4K20A 4Z92B 3AJYA 1LGBA 2B42B 4N9HA 1W6QB 4BMEA 2VY0A 5CFCB 3V0AB 4JCKA 4EN0A 3IDBB 3PNAA 1ND3A 3J8F1 4YM2A 1ZZBA 3TNQA 3ZSLA 5GLWA 4JGYA 4K7JA 5GLVA 3VZLA 2W0XA 1Q43A 2JG8C 2RS51 3KT4A 3TAYA 3W59A 3WQ0A 3Q9OA 2VUAA 2HWC2 5CG9A 1H1AA 3MW2A 4Q4V3 4S2HA 2RMU1 1QHDA 2XL7A 4RHV1 4XIKA 4XXAA 2EA7A 4XFHA 3R4DB 1COV3 5FOJB 2VMGA 3VZJA 1RUC3 2IC1A 4E4ZA 1RUI1 2ZCWA 1DHKB 4PIXA 5JVVA 4Q2FA 4CDUB 5A33A 5A3MA 3PVBB 2D6OX 3M70A 1QGLA 2HWD1 4EWAA 1QMJA 1GZCA 5KXBA 1KJLA 2D3PA 2GNMA 2VW0A 3V56A 3WR0A 2XLFA 3FC0A 1WW7A 2W39A 1IPKA 5DUVA 4D7YA 5I0SA 1RUD2 1PO22 3U10A 1RUE1 5C9AC 3EBRA 3VKOA 4B8EA 3B5LB 3CEWA 2A6YA 4D69A 1RUOA 4Q4Y2 3ATGA 4HK8A 3WDWA 4GIQA 3VKLA 3WG2A 2CV6A 2UY8A 2RS31 3SH4A 1MZ6A 5HCAA 2DCJA 3I8TA 4H14A 1S1AA 3D8CA 3E5XA 1V6MA 3FFQA 3WDYA 2PLV2 3KGZA 4JV4A 2E7TA 2CTVA 1B35B 4XQDA 5HCFA 2CAUA 4QPGB 2WQ4A 2OUHA 3RWNA 5JOWA 4N43A 2EVXA 1MS9A 4XBLA 3FJSA 3VZKA 1A8MA 2NMOA 3AJZA 1UL9A 2Z69A 4XF4A 3B69A 1EV12 3N7JA 3HT1A 4ZXKA 5DUUA 1RUF2 3H8UA 4G4FA 1FXZA 1RVF2 2A3WA 4Q8LA 3TNPB 1SFYA 4QPYA 4HPKA 5B2GB 4MH0E 1LOFC 1YCIA 4HVOA 2ZGUA 2I2SA 4C1WA 1AR73 2HWF2 3LKJA 4HLTA 3WCSA 1VBC2 5GLUA 2K0GA 1AR93 1FMD2 1LEMA 4QM8A 4YW4A 3PHMA 5CFDB 1VBE2 4IESA 1VB2A 5LRSA 1F9KA 2ZJCA 1YFWA 1QJX3 2HEVF 2PN5A 3KD4A 2ET7A 4HFSA 3E5QA 4HL0A 4FPHA 4IERA 3I4IA 2DTYA 2G9GA 2QJVA 3OJBA 2A70A 1XE7A 3H1MA 4UXAA 1KDKA 3AXDA 1DGRN 3JD72 1WLCA 4YLZA 2O1QA 1NLSA 1SCRA 5FQ0B 1PVC2 5L7OC 1V6KA 2HWB3 3CJIA 4J1XA 1AJOA 3N36A 1DZRA 1UCXA 1DYKA 1VBA2 2IFRA 2WINB 4M3CA 3THTA 4MGZE 1IGOA 4FCAA 2VULA 1KRIA 2O8OA 2K9ZA 1MR5A 1RUD1 2UWBA 2FBEA 3O0WA 4RR3C 3UKVA 2WA3A 4WM8C 1WW5A 4P9JA 2VGDA 2RS53 1PK6C 2OVUA 4HN1A 5EYYA 4KGGA 4AWDA 1BBT2 5BNNC 1WBFA 2WZR1 1C1FA 2DCKA 2GNDA 4A7ZA 2PAKA 3ZSMA 2WIIB 1PIV3 4EN6B 1QJY1 2E7AA 4K1YA 1MQTA 3EJKA 3ZYPA 3N35A 2ZTNA 1O91A 5E89A 1CAVB 2ZHMA 1ENXA 3P3PA 5BNOC 1VP6A 3O5SA 1N47A 2IXKA 2VU9A 2JDZA 1PZ8A 1XNBA 1TMF3 2ZKLA 3MW3A 5J98B 4LO8A 2CYFA 1BVVA 4N53B 2P3JA 2I45A 3I2DA 1ULGA 5C8CC 2E53A 4FOWA 3ILNA 4FT8A 3MPBA 4PDWB 4L9BA 4M0HA 3B02A 4LBKA 1O3QA 4LO7A 3ZDSA 4XFFA 4QHBA 1RVF1 1ZBA3 2GC2A 1OI6A 5FFOC 5FLJA 4CDXA 5KHJA 1GANA 4C90A 1XYPA 1I5ZA 4Z2WA 3IT8A 2C0ZA 1KD7A 1CQ9A 1R1A2 1Z78A 1O3TA 1FMD1 2MNGA 1N1VA 2ZAAA 1XQNA 2XB6C 2BWAA 5DDJ1 3ZXJA 3MI8A 2BFUL 3ZMNA 1Z0HA 1I6XA 2BTVC 4YGEA 3LSDA 4LLOA 1GZWB 5K9YA 1UU5A 1HRV1 2A6XA 2ZGMA 2A71A 3DUIA 1UU6A 5EWSA 1J58A 3NW4A 1PVC1 1H2NA 4AEDA 4DXZA 1TNRA 4RFT0 3O12A 2DCYA 4IXLA 4C91A 1NCQA 3MFAA 1H8TA 4Y4YA 4OZXA 4B4QA 2ZGOA 3SMHA 4P9LA 3FUOA 4FQZA 2OUJA 5ACA1 4YG0A 1X82A 1TME2 1O4TA 2A3YA 2GMPA 4SBVA 4WVWA 4OUMA 5FLHA 5JZGB 3LZZA 1MS0A 3VBUC 1RUH2 1BBT1 2WNEA 1UZYA 3RYKA 1PK6B 3K51A 4XMIA 4WM7C 2H0VA 3H3ZA 2TBVA 1ENRA 4TYSA 2CGNA 2A73B 2Q4SA 5LRRA 5I8TA 1ZRRA 1LENA 1NA1A 1V9U2 5BYNA 3QCWA 2P3KA 1AL0G 4CYDA 5GZGA 2B45X 1DU3D 3ZIXA 1M4WA 1U12A 4YGDA 3GHNA 2XVGA 1AR62 4BH9A 5H9PA 2WZR3 2BPA2 3PVOA 1Y7BA 1QJU3 4ORFA 4OI4A 1QJY3 5HCBA 3VBFB 2UWCA 4R4XA 4JGZB 1M06G 1KITA 1AYM3 1QH7A 5LEKA 3L2HA 3WV6A 5GZDA 1LR5A 3DN7A 1N1YA 3LCPA 4JC1A 3J4UH 1R092 4LO6B 4XEZA 1AVBA 4WVMB 5ABJC 5L19A 1LKNA 2OW4A 4DY3A 3DL3A 3DPRC 2WNUB 4YW5A 4FTEA 3FBMA 4P9IA 3VZNA 2D93A 1DQ6A 1FNZA 5BNPA 4C0HA 1Z7S2 2GMMA 3IMNA 2BEOA 5C4WB 3BU7A 4AGRA 1ULCA 2R6QA 4HMZA 2VG9A 3KQRA 1RINA 4FXGB 4B7KA 4M3CE 1QXRA 1DF0A 1VRH2 1ZNPA 1VR3A 4Q4W2 4GH4A 3O0XA 4IEPA 4D7TA 1NY72 1FOD3 5FBZA 1N3QA 3S30A 4QQOA 3VDDC 1MS3A 2X5IC 3QBQA 1WGPA 4AQ6A 2D43A 2E9QA 1ASJ1 5T3NA 1JW6A 3AYCA 4Q0UA 2G4IA 1IQAA 2ZMLA 5F6KA 2ZGPA 5A33B 1Q8QA 4ES8A 3RJRA 2JG9B 1JHNA 2YV8A 3M8LA 3M3EA 4QGMA 3VGIA 4KH9A 1VBB1 4M00A 1HRV3 1VAKA 3EHKA 3AYAA 2XJUA 1QQP3 2IXCA 4FPJA 3KMHA 1KFXL 1RUJ2 4K3UA 3ZMOA 4PBOA 4QPIB 2NQYA 3RZZA 4FPOB 3VBUB 5KC6A 2R041 1K5MC 1DQ4A 2D3SA 1QF3A 3GBWA 4BIOA 1V6OA 2PHLA 3ILFA 1G86A 4XHXA 4LUKA 1PZ7A 2Q0AA 3VN4A 1IKPA 2ATFA 2MPFA 3LSEA 4WM7B 1BEV2 4SLIA 4H7MA 3H3UA 4X6QB 5DZEA 3VZOA 4J6GA 2FZ1A 1RUC2 2RM21 5ACA3 3FBYA 3TN92 1U5IA 3M3OA 4Y22B 4F7ZA 1H8VA 3MICA 2UYBA 1YFYA