4LTAA

The crystal structure of the p132r, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPRGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ltaA00
1SFNA 3FX3A 3D0SA 4NVPA 4JV4A 4YSFA 4AXOA 3H8UA 3KSCA 3WW4A 5T3NA 3H1YA 3E5UA 4MGZE 1ZZBA 3LZZA 1LKNA 4GULA 2KXLA 2ET1A 3O14A 4PIZA 4Q0SA 3BB6A 5LRRA 3LOIA 1VP6A 1ZZ9A 1ZZ7A 2HJIA 3KMHA 3QOPA 1Y9QA 2PQQA 4J1WA 3HQXA 4IEZA 3BPZA 2Y0OA 3NVCA 1OD5A 2IXLA 1X8EA 2N7GA 2D93A 5BV6A 3ES4A 4JTNA 4HN0A 1O7FA 2H6BA 2UY8A 3H1MA 3L2HA 2QDRA 1ZZ6A 3FWEA 5FQ0B 1QWRA 1UIJA 3H7JA 4Q0VA 5JR7B 3UKVA 2OZ6A 3CLPA 3IBMA 1QXJA 1J58A 3LWCA 3RNSA 4I2OA 4Q29A 4FBFA 2EVXA 5FQ0A 3KGLA 3DKWA 3E6CC 3U10A 5I8TA 2EAAA 4QXKA 1ZRFA 3D0JA 3ST7A 5JCTA 4XFGA 1O3SA 3RYKA 1GQHA 2XLAA 2GC0A 5EFUA 4ORFA 2QCSB 4E2SA 2BNMA 2Q4SA 4X6QB 3R6SA 1Q3EA 5KHKA 2BYVE 4LUKA 1YHFA 4BYYA 2GC2A 2PA7A 4XFAA 4F8AA 2H6CA 5JAXA 2P17A 3ZDSA 4ONUA 3S7IA 4XFFA 4EWDA 4IEYA 5J48A 2VPVA 3I54A 3H3ZA 1EY2A 5BY5A 2PYTA 1FT9A 2GH2A 2IXIA 1HW5A 1U12A 5C8WA 2GAUA 2QJVA 1ZREA 4HN1A 1WLTA 3FFQA 2O8QA 2GC1A 4IEOA 3GYDA 4A2UA 1L3JA 1EPZA 4IEPA 1JUHA 5CADA 1YFXA 2IXJA 2CV6A 2E9QA 4LA2A 1OI6A 3RYRA 2EA7A 2VECA 4L2NA 4XF4A 1X7NA 5I8YA 3SCGA 5AVPA 4AVCA 5KBFA 4YRDA 3FHIB 4HMZA 3N4MA 3OGJA 5CVRA 5KHHA 4I3PA 3HT1A 3KCCA 3H9AA 4HZFA 5C6CA 1SQ4A 1UCXA 2OYZA 4CYDA 4E2QA 5LRSA 2PAEA 3EHKA 5LEJA 4LULA 4WVZA 1UPIA 1NE6A 5FLJA 1O5UA 4K8FA 3BCWA 3IIAA 2MPFA 3OD0A 1O4TA 2V09A 3E97A 3I59B 2B5HA 3RYPA 5FLHA 4R52A 4TLFA 1DGRA 1UD1A 1H1IA 4HVRA 1LRHA 2Q0AA 3CEWA 2C0ZA 4QGLA 1J3PA 5FPZA 1EYBA 3LA2A 2FMYA 3OTFA 3ROUA 3SCFA 3H3UA 4IEQA 1CAVB 4MH0E 2DCTA 3I59A 3NJZA 3BALA 3DN7A 5BXXA 5FDBA 3RPQA 3S7EA 2Q1ZB 4I02A 4Q0QA 4XFHA 1X8MA 4KL1A 3E6DA 2OPKA 4I0BA 3I7DA 2Q30A 4KWJA 1CAVA 4AQ2A 4UBGA 1DZRA 1YFWA 3QACA 3RDIA 2ZKLA 2ZCWA 4WBBA 4JTOA 1DZTA 3CJXA 1FI2A 4QM9A 5I8SA 1RGSA 3TNQA 1QXRA 1GQGA 3NW4A 2OZJA 3EO6A 1YUDA 3DL3A 1RC6A 1PMIA 1UIKA 2CAVA 1O3TA 2IXKA 3PVBB 4HVOA 5E16A 4O9GA 1J59A 3EJKA 3IDBB 4HVQA 4YYOA 1G6NA 1OFNA 2WFPA 5CU1A 4MGKE 5E1RA 2D40A 4MV2A 4N9HA 2FQPA 4XF0A 3D82A 1YFUA 1XE8A 5I91A 1CAUB 3TNPB 4AQ6A 1XE7A 4ZU5A 5FPXA 3LA3A 4I0AA 2UYBA 2Z2SB 2MNGA 4JVAA 4EWEA 2Z69A 4D7SA 1EP0A 2ATFA 3EBRA 2WC2A 2F4PA 1PM7A 4BHPA 1RUOA 3MZHA 4XF3A 4X6RB 3H1WA 2CGPA 3WW2A 1XRUA 2D5HA 4IERA 1DGWA 4N9IA 3G7DA 1VR3A 3ACLA 4UXAA 1ZX5A 3CL1A 3C3VA 4B29A 4ZU7A 3LA7A 4E2GA 5HI0A 1J3RA 1RL3A 3SXWA 1O3QA 4YARA 3WW3A 4I01A 4FAHA 1IPKA 4UBHA 2PAMA 4LA3A 3LAGA 5JSRA 2IXCA 3MDPA 4QMAA 1I5ZA 1YLLA 2PHDA 3M3IA 1TQ5A 3FE5A 2UY9A 2PTMA 2MHFA 5I93A 1CAWB 1ZNPA 4DINB 2I45A 4H7LA 2K9ZA 1ZZ8A 3UKTA 1ZRCA 1ZRDA 1CAXB 2HKXA 3B02A 3JZVA 4LUMA 4MGYE 4MGIE 1NYWA 3U11A 4EROA 4MUVA 2XL9A 1WA4A 1IPJA 3ETQA 1SEFA 2GC3A 2IC1A 3S0MA 4QGNA 4BIFA 1CAWA 5BUVA 3MPBA 5BPXA 4IETA 4Z07A 3HT2A 4XFCA 4D7TA 2ET7A 3E5QA 2PAKA 1CAXA 4F7ZA 1NE4A 2PFWA 1WGPA 4FAGA 4I09A 3PNAA 1Q43A 3VHRA 1Y3TA 4MZUA 4META 1O5LA 3M70A 3SMHA 3IWZA 3UKNA 2H0VA 3GBFA 1J1LA 4QM8A 3H50A 3U0ZA 3DV8A 3E5XA 3PLQA 2XKOA 4HBNA 4L11A 1ZRRA 4KWKA 1O3RA 2XKPA 3FZ3A 4AVBA 4PJYA 5K8SA 2BNNA 5FCCA 4QX5A 1RUNA 3CO2A 1Q5OA 2GU9A 5KHGA 1LB2A 4HSLA 2QNKA 3USSA 1FXZA 4Q0UA 4EV0A 5J7MA 2BNOA 4XFIA 1YWKA 3MYXA 5D1IA 2GZWA 4IEXA 4WZCA 2QVSB 3WW1A 4XEZA 3FJSA 4LLOA 2D5FA 4KU7A 1QY4A 3KGZA 2ETEA 3RZZA 3NL1A 4OFGA 1CX4A 5EZWA 5LEKA 1I6XA 2BEOA 4RD7A 4J1XA 2O1QA 1ZVFA 5I0UA 3SHRA 3ELNA 4R8HA 4KU8A 4KWLA 2OA2A 2UYAA 5KHIA 3EQEA 4HSJA 4P9GA 3E6BA 5I0SA 4BH9A 4PIXA 1CAUA 1OMIA 5F1RA 1NZCA 4AVAA 2B8MA 4Z82A 1RTVA 4ZU4A 1CGPA 1X82A 3NKTA 3H7YA 2XLGA 4QGMA 4XETA 2VQAA 4LEJA 1VJ2A 1ZZCA 4XF1A 3IDCB 4YNIA 2BGCA 5FLIA 3SCHA 4O9EA 4EWAA 5J3UA 4IEWA 2XHKA 3HIFA 2PHLA 4OLLA 4XFBA 4MX3A 4LTAA 5KHJA 2B9UA 5I0TA 1YFYA 4IEUA 5JSPA 5JSOA 3CF6E 4Q0PA 3OF1A 4IEVA 1NXMA 4XF9A 4PIYA 2K0GA 3NSTA 4IESA 2XLFA 1V70A 3OCPA 3ES1A 5I0RA 4HLTA 1H1MA 2XGXA 3BU7A 1J3QA 4FT8A 1UW8A 2CAUA 2IXHA 2XL7A 1LR5A
chains in the Genus database with same CATH superfamily
1QJY2 3FX3A 3K3NA 1NQJA 1GZTA 4NVPA 2ZMKA 3Q8EA 4OHZA 4YSFA 4YG6A 5FXZA 1LJ7A 4OHVA 5CYYA 2ZTNA 3NJYA 1ND2A 3H1YA 4XAAA 4Y5SA 3T3YA 3A4UA 4MGZE 2VR4A 3LIGA 3LZZA 2EALA 1G9DA 2XDVA 5FXWA 3H8OA 4OHYA 4ZS3A 2W46A 3OJBA 4OYUA 2A6WA 4R9CA 1ZA4A 2WYFA 1Y9QA 2PQQA 4DXTA 1UXZA 4FPGA 4TLGA 5L9BA 4GWJA 1DZQA 2N7GA 4GB32 4ZPIA 3ZFFC 3UGFA 4P14A 1AX0A 1VE0A 3ES4A 4OI2A 1SLAA 3AKPA 2X53S 4JCKA 4TN7A 2C6SA 5B4NA 3POYA 1S0FA 4QT6A 5ANNA 2UY8A 2ZA9A 2LUWA 1OF4A 3M3EA 4FP2A 3HN3A 3DEMA 4YGEA 4JGYC 5FQ0B 4CEWB 3KT7A 4LOSA 1AYN3 1UMIA 3POFA 4EN9B 3KB5A 2D97A 2ZEYA 4YPJA 2OZ6A 1POV1 2WAAA 1RUG3 2JIGA 3T2OA 1XYNA 1QXJA 1X33A 5C3PA 3LWCA 5C5TA 1J84A 3EB7A 1PO22 4Q29A 4YFWA 3DUIA 2XJQA 3UT0A 1PGL1 2P2KA 3RMYA 1QOSA 5HCAA 1PK6B 1SLIA 3HD8B 1OVSA 2LS6A 4MADA 4LT5A 1UYZA 4M4PA 1GNHA 2ZGRA 4QPGB 4XUTA 2FDIA 2V5DA 5C3SA 1QQP3 1ZRFA 3GXUA 1BEV2 3K4ZA 3D0JA 3KS7A 4NIHA 2JG8C 1NA1B 1QEXA 2L9LA 4XFGA 1FPN3 2ERFA 4QPWA 1MACA 3M1HA 1O8PA 2XLAA 4Y26A 1KJRA 2QBXA 4ORFA 5EFUA 3SKJE 2QCSB 5LBFA 1PZ8A 3NAPC 1W04A 1Q3EA 3LEIA 4NRPA 2BYVE 4A41A 5KHKA 5ABJC 5CEHA 1UZZA 3NNFA 4AHWA 4K3UA 4A6OA 2O0OA 4FFFA 2FDHA 4Y5Z0 1NCQC 4GA9A 4F8AA 2H6CA 1ACCA 2YUEA 4BISA 5JAXA 1CZTA 2P17A 3LSEA 2Y60A 2GNBA 3IAQA 3S7IA 1JXNA 3J8F2 4EWDA 5J48A 2Y6FA 5EJ3A 1PZ9A 2B42B 1V6NA 2BQPA 4JGZC 4DB5A 4GMP1 5BY5A 2PYTA 1MR5A 2GH2A 3R0RA 5A7NA 2BWAA 3OEAA 2E33A 4W65A 2VW2A 5FAXA 1N1TA 4E27A 3T0AA 4D8MA 3SH5A 1RIRA 3GALA 5JI7A 3ZOIA 1MS0A 5IK7A 5BNOA 2FCUA 1AYN1 2X8KA 4CA9A 1HXS1 5JWPA 3RI9A 3INAA 2AH2A 3D8CA 1US3A 2D6KA 4FTSA 1W9WA 1L3JA 4URTA 1SDWA 3PL0A 1ZBE1 5CADA 5T55A 1AXKA 1RINA 1A6CA 5LK7B 4XURA 1NLSA 1DG6A 2E9QA 2E6VA 5FYSA 5H9RA 1SFPA 2EA7A 2J1AA 2VUAA 3VHNA 5I8YA 3AMQA 4R9BA 5AVPA 2KM2A 1WLWA 1GP4A 2CDOA 3N7LA 4ATFA 5FKCA 1QQP1 2VUDA 2WJSA 5C71A 5JDBA 4HMZA 3WNKA 2PN5A 3BOWA 3MIDA 4IW3A 4YM0A 1GBGA 3VD5A 4YM3A 2XONA 1FPN1 1H6YA 3ZSLA 3LEKA 4HZFA 1OH3A 1FYUA 5IVYA 3ZSMA 5C6CA 5ACA1 1Z7S3 3MW2A 5A7QA 4AZZA 4RHV3 4AFBA 3R4UA 1OOPB 3ZFFB 1CPNA 3DECA 4BA6A 4WVZA 4CCEA 4ARXA 1UPIA 5F6KA 1NE6A 4AEMA 3C8XA 1XU1A 5ERLA 2GNTA 3BCWA 3OOXA 1SLBA 3F2ZA 1MS1A 3LB9A 4WM8A 3VHPA 3VL9A 3GZTB 4XOGA 3TN91 3LIHA 2V09A 4FTBA 5EYYA 5FPBA 4R52A 1KD7A 2JE9A 5DABA 2VZPA 5E8AA 1H1IA 1F4HA 3T2TA 1T6GC 3WP5A 2A6ZA 2Q8CA 2GN3A 2BVBA 2C0ZA 2DDUA 2WWSA 2ZGPA 1HXS2 3VD3A 2DUQA 3GF6A 2X5IA 1KEXA 3OTFA 2I2SA 3O1VA 1IS6A 1CAVB 1AL23 4MH0E 1U5YA 4Y4YA 4AVVA 3TBDA 1PHMA 4E9KA 1ZBE2 2JICA 5FP8A 1FX5A 1VBA1 4HONA 5CIRA 5DZGA 3AFGA 1SACA 5LBBA 3RPQA 3WDVA 3ZXGA 4CTEA 3IB3A 3L2YA 5ANQA 1RB8G 4DRRA 4HK9A 1UY3A 2FZ1A 4KL1A 4CEYC 1AR63 2DBNA 4I0BA 4PDWB 1NY71 3HNBM 4MXWB 1YI9A 1ND2C 2NQYA 4UBGA 1VBB1 1W6MB 1UZWA 3BVCA 2DTWA 5FP7A 4D3WA 3NAPB 4LJHA 5FO9B 2VH9A 4CDUB 1BCXA 1MEC1 1PO13 3WCRA 3CJIA 1W9FA 3T2PA 1W6NB 4Y20A 1XQNA 1PMHX 1NCQB 3DXUA 2VZ3A 3CMGA 4KGQA 5A3PA 1NX9A 1OVPA 2V73A 2RJKA 5GZCA 1K12A 2JDHA 2TUNA 4YZ3A 3OPZA 1QHDA 1RGSA 3IDAA 2JX9A 4AG4A 2OZJA 4QDSA 2KR2A 4LBKA 4RHV1 1WMDA 1SBFA 2VBBA 4GZ9A 1RC6A 4JGZB 3LOBA 1HB1A 2NMNA 1Y9GA 2RS33 1NUKA 3ALQA 1QJX1 2C9KA 2NLRA 3TN92 5FZAA 3UESA 4FVVA 1O6UA 5E16A 4O9GA 3EJKA 3VV1A 5CU1A 1XJAA 1LHVA 1UO9A 2UU8A 4MGKE 2IWGB 3T30A 1GZWA 1DU3D 1Y4WA 1V6IA 4XMAA 3A23A 1LENA 1YFUA 4ASKA 1XE8A 4DXRA 2EXKA 1VBA2 1JYNA 3NNMA 4YM2A 1S0DA 4Q4Y2 3WQ1A 2JDKA 4PT6A 1CAUB 1GU3A 1E57A 1AL21 3ILFA 4RS5C 3I2JA 1GICA 4NRQA 4ZU5A 2W1QA 2WR9A 1W6PA 1GWMA 3AZXA 2D43A 2UYBA 1NY72 2Z2SB 2MNGA 3PHMA 2IFWA 3WG1A 3ZDVA 4CPBA 4EZ4A 1VBB2 2CYFA 2VL4A 1EP0A 1I3HA 5FZHA 4UW3A 2WC2A 2WUHA 4FPYA 2MEV1 4COZA 1DQ1A 4QPIC 4X6RB 1Y7BA 5HXVA 3HEIA 3OYWA 1DGWA 1VAVA 1C3HA 4LXLA 3I3QA 3IDEA 1TEIA 5FY8A 1X36A 3JXSA 3WY6A 5H9QA 1U5IA 2AUYA 3CL1A 3FHAA 1YI7A 4N90A 4FSJA 4NAMA 1GP5A 3CQOA 5A3LA 4E2GA 5EJ1B 5CFCA 3HJRA 3O1UA 4NHKA 1QJX2 1O8SA 1ST8A 2Z5WA 4FFHA 4ATEA 3WW3A 2QQPA 3LPGA 3ZFGA 4BK4A 1AR73 2OW4A 3C7EA 4OUEA 1W9YA 3I2IA 4J6GA 2JE8A 1IG0A 2P1BA 2K46A 4AHXA 1FMD1 1PX4A 5DZFA 3Q8AA 1XOYA 2P3JA 5FMOL 1L7RA 4AI9A 1HJFA 3LSDA 3RMXA 2YU2A 1V6OA 1LOEA 4QMAA 4YW4A 4CCNA 4FPLA 4BM8A 4FPEA 2E32A 1YLLA 3IM0A 2VY0A 3VBFA 3ZN6A 3VZLA 5DMYA 5HPOA 3FE5A 4QDRA 3I2HA 5F5AA 3WG2A 2MHFA 2ZGNA 4KQ7A 1CAWB 2QQIA 3AL5A 2I45A 1UU4A 2NPIA 2D6OX 4XJZA 3UKTA 5EP9A 2D6MA 1ZRCA 3HBKA 4F3JA 3MIGA 2JE7A 1ULOA 1UYXA 1XYPA 2RS51 1CAXB 3MV11 4MGYE 5F5CA 4AOCA 2B39A 4MGIE 5C9AB 2MEV2 5FMBA 4TTGA 2XL9A 2F6BA 2RM21 1A34A 1SEFA 2RDRA 3C2UA 4SLIA 4AHZA 3H42B 3T2QA 3LFIA 4IE7A 1N47A 3MPBA 4QKDA 2QZ2A 2WNVC 4CU8A 1ZBA2 3POGA 4G9SB 5CAZA 2PHWA 4EN8B 5J36A 3N7MA 4KGGA 1GP6A 2PAKA 1QJU3 2BTVC 3NV3A 2JWPA 4AVSA 2PFWA 1OQDA 2RJ2A 3RVHA 5C70A 2WQ8A 1S2EA 4FAGA 4XUNA 2R063 1NLQA 1JMUB 1RUI3 1S55A 3LCPA 5SV8A 1CQ9A 1Y3TA 3H0OA 2GP5A 4RFRB 4META 4CDXC 4YZ5A 1RHI1 4OUSA 1LECA 3UKNA 2HWC1 3GBFA 3OEBA 2ENRA 3K2OA 1W39A 4QM8A 1STMA 1IQDC 3PJQA 2DFBA 3RWNA 3OGSA 1UWWA 3NWKA 3LKJA 5DAWA 2WSUA 4FOYA 4L11A 2VAUA 3AKQA 2X5IC 1ND3A 5BNQA 1O3RA 3C7HA 1SCSA 2JIJA 3AKTA 2QQUA 4Y1XA 1Z78A 2WWUA 3QD6A 2BNNA 4MSVA 4RS5B 5D2AA 4XDOA 5FCCA 4CCJA 2R071 3ZYJB 3RG0A 2GMMA 3O1PA 1AR82 3OUJA 4HSLA 4HETA 3WP6A 1KDKA 2BP6A 3ZR6A 4FQZA 4CU9A 5LA1A 4OI0A 2LW8A 2RS52 3WQBA 3O1MA 2GH8A 3WD5A 1GWKA 2HEVF 4QPIB 3R4SA 2RM22 2VBDA 2AYHA 2YBKA 2QQWA 3ILRA 1DYPA 4YGDA 4DUWA 1DBNA 3FJSA 2CNAA 3FUOA 2Q5TA 4GKXA 1R64A 3W58A 1WWYA 1E5SA 4AEDC 1QY4A 4JDNA 4NN0A 3KGZA 5C4WA 3NL1A 2V4AA 4OFGA 4OZXA 4XQWA 5J98B 5FZ6A 1R1A3 2BEOA 4YG3A 2GNMA 5JR2A 4FOQA 2O1QA 4K6BA 2A5ZA 4Z2AA 2ZZQA 4RGKA 5BYNA 5I0UA 3LFMA 3ASIA 4KU8A 1VALA 2R6QA 3AZYA 4CEYA 4HSJA 2OQ7A 3VBRC 5FMCA 4A44A 2HLEA 1EAH3 1SHWB 4AI0A 4M01A 2QQLA 3B9IA 1RUI1 2A3YA 4QXBA 3W5MA 2NP0A 5F1RA 3JB4C 1JOBA 1JHNA 1R093 1RUC3 2VOXA 3VKNA 3KQRA 4BQ4A 1KXGA 2HWD3 2VOVA 3ABZA 2B8MA 5JOWA 2WQ4A 3B93A 4Q27A 2VNOA 3IPVA 5F3IA 2XBO3 4QGMA 3POJA 3RZLA 2VQAA 1U5XA 3MIBA 4EJRA 1WBLA 4B7KA 1DQ5A 4XE9A 4AE2A 2DU1A 2RMU1 3POBA 1W8WA 2EIEA 1IS5A 2BGCA 4FFGA 2R072 1AXYA 1LEMA 4GD4A 5J1XA 4A3XA 3KD4A 2LM3A 5J3UA 1CR7A 4GJZA 2VMFA 4C91A 4BMBA 1EPWA 2BJSA 2XHKA 1NZIA 3VBSC 4YFZA 3RZJA 3T08A 2WINB 2HWE3 4QX8A 2GMPA 2ZGQA 4JHZA 3S30A 5CNAA 1BKZA 1W9SA 5FZ3A 4MX3A 2PHRA 4E4DX 5FREA 5FZKA 1NQDA 2KA3A 5KC5A 5I0TA 3T09A 5DAXA 1PIV2 4ZKTB 1B35A 3N9OA 2DU0A 2YYOA 4A4AA 1LTEA 5JSPA 3I2OA 4N7IA 2VZTA 4XXAA 2WNVB 5G04L 3ZYPA 4BLIA 3OF1A 4XJ8A 5BNNC 1SG3A 2I07B 2VW1A 4IV1B 3WNPA 4AFAA 4CU7A 5FYCA 1K5JA 3WF4A 4LBJA 3FHQA 1JH5A 2OT7A 1MVQA 1E5RA 3F95A 1ZYBA 2XLFA 3AYDA 3JBG3 2YFUA 3DYOA 3CKHA 1H4GA 3OCPA 1C1FA 1HN0A 1VBC3 2PQSA 3GHMA 5FFOC 4CDXB 3W21A 2WL1A 4C1XA 1KRIA 1A8DA 2IXHA 2NZ9A 2Y6HA 1BXHA 4Y22A 2NYYA 4LO7A 1CWPA 1DQ0A 2CU5A 1K42A 4GKYA 2ES3A 2W3JA 4XZUG 2IFRA 4AXOA 1H2LA 5JZGA 3VZJA 2X5IB 3A0KA 3WOGA 4D6RA 3KSCA 5FWEA 2WFF2 1QH6A 5FY7A 4YW3A 2YU1A 3E5UA 2ZKNA 4K21A 4I3GA 1ZZBA 3AP6A 2RMU2 3MLLA 1AX1A 4YVSA 3VZOA 2XBO1 3VBFC 1CESA 1WW7A 3WQ0A 1W0PA 2ET1A 3O14A 5FZ9A 4EZHA 4W8JA 5EYXA 3LOIA 1ZZ9A 2HJIA 1ZZ7A 3KMHA 2A3XA 3N35A 5LRRA 5JI9A 3I3DA 1KS4A 2QKDA 3BPZA 3Q8FA 1XSQA 4IEZA 4OI1A 2IXLA 2DCZA 3TB0A 3VBUA 1O7FA 2E7AA 2WZ8A 2HWE1 4FPCA 5DAVA 2R1DA 2TEPA 5FZOB 1BZWA 3VKOA 4W4ZA 5A7WB 4AEDB 1WW6A 1QGLA 3HN1A 1ZZ6A 2FDKA 3WV6A 2LALA 3USUA 2JDNA 4QXCA 3HMYA 4O65A 1QOTA 4Q0VA 3ATGA 3ZIXA 1ENXA 1OHFA 4XTPA 3KQ4B 3BTXA 1ONAA 3UKVA 4GB33 2J1EA 4RL7A 5HCHA 1QOOA 3NNJA 4NHLA 3CLPA 3IAPA 5A3MA 3I3BA 2W68A 4HPKB 1J58A 3U4SA 3VBRB 4DQAA 4I2OA 2OUJA 3ZMNA 4WVVA 1OPMA 1QNWA 1RXFA 2VMCA 5FXXA 4CU6A 4CCLA 3E1F1 1VBC1 5JVVA 1H30A 2A73B 3KWVA 1KITA 3JQXA 3LPFA 2WBKA 1WZXA 1TME1 1UF2C 1C8M2 2D3RA 3B5LB 4JDMA 2HYKA 2PHXA 2WZR3 4Q4W2 3OUIA 3AX4A 1OLME 2D98A 4WM7A 1JZ3A 1O3SA 2HWB1 3BTAA 1SCRA 4NPRA 1U0AA 4D7SA 3KLSA 4NE9A 1PO23 2XJVA 3VDDC 4COWA 4PLMA 1AR92 2R1BA 3ILNA 4QU2A 5APAA 4E2SA 3V0BB 4XVHA 2Q8EA 1LAJA 5F6LB 1YHFA 2D6PA 3VBSB 3UGHA 5JPMB 4OQ9A 2GC2A 2ILMA 5A3WA 5FPAA 4RQPA 5TSWA 4PCRA 5C8CA 2WNEA 3KVBA 1QJY1 2RDSA 5A70A 1IOAA 1M06G 4FPFA 2ZGMA 3MV01 3ZDSA 4FP3A 2VC9A 2A3WA 4XFFA 3THPA 5KXBA 4INDA 2PXJA 2VPVA 5FKBA 1HB3A 2E26A 3VKFC 5BNNB 4LHSA 1IKPA 3H3ZA 1EY2A 2RG4A 3SEEA 1JYIA 4H7MA 1HW5A 3EYPA 1O91A 3ACHA 2C26A 1GYKA 1DFQA 1GSLA 1VB4A 1W8HA 2EXIA 3U37A 4Z1VA 5FZIA 5A3UA 5FZEA 2GAUA 5C4WC 5GLZA 4ASMB 5BNPA 2Y26A 1WLTA 2DVAA 3VB9A 3PURA 3W5NA 2ADDA 4RR3B 3ENRA 4A7KA 4BPZA 3GHNA 4LITA 2Z4FA 4IGQA 4OMCA 4RGGA 3CZJA 2IVJA 1UNBA 1EPZA 5A7PA 4C1WA 5FZLA 5I0DA 1YFXA 1AX2A 3A0NA 1GANA 4AI8A 1TME2 1MQTB 2YBSA 3BODA 3MIEA 3LQCA 1Y9MA 4JQTA 2VECA 1N1YA 4V1PA 1X7NA 4XIKA 3N9LA 3BIEA 3SCGA 1A3KA 3W9AA 5DAPA 4AI2A 4AVCA 1N3QA 4BXFA 5J09A 2HWB2 4XILA 4YRDA 3ZM8A 3FHIB 4KH9A 3IN9A 5FXVA 3U75A 3MFCA 2P34A 3VBFB 1K5MA 3K48A 4B1LA 3OGJA 3BU0A 2ZX4A 4Q26A 5F37A 5JOXA 1CIWA 1QDCA 1I5PA 4RA0A 3HT1A 2VMGA 2JDMA 4OULA 2Y33A 1PO21 4CYDA 2PAEA 1MS5A 1NCRA 4LULA 4KMQA 3QCWA 1VBE2 4N53A 2CGOA 2ZHNA 4NIAA 1ZA7A 3SQOA 4PBPA 4IL7A 5JXHA 3RI8A 3OGRA 2G9GA 1BEV1 5DPNA 3WR0A 1B35C 1W8TA 2VO5A 3ZFEC 3IIAA 4CUGA 4PQQA 4DS0A 1LODA 3E97A 2B5HA 2VOWA 4GMP0 2ID4A 5FLHA 5C7GA 1LHUA 4LBQD 4TLFA 4RFT0 4SBVA 3L9JT 2FZ2A 3GNEA 3HVDA 2ZGUA 5IAVA 1RJ8A 5FPZA 5F5IA 1F8VA 1EYBA 4N43B 3VL8A 1W6OB 3TEXA 5KXCA 5FRAA 5KXDA 3I59A 4CSWA 5GLVA 1XNTA 1YEWA 4FOWA 4GMP3 5FPVA 1ULCA 2ZGOA 3DN7A 1G9CA 4CDWB 5FDBA 3J8F1 5G05L 1X9TA 1GFF2 1X8MA 2QDNA 4LO4B 3CDZB 1LU2A 1DGRN 2RV9A 3APBA 4FPOB 4XQDA 2OPKA 3WLUA 1HXS3 4YVWB 1TNFA 4MOAA 3RSJA 2EXJA 3WINE 1SPPB 3VDDB 4IDZA 3AZZA 1IQAA 4AR2A 3QACA 4YVSC 5CA6A 1S0IA 1ZBE3 3D6EA 4HG6B 3A21A 1V6KA 4LKFA 5T5LA 1ULPA 1H8VA 2R30A 4LHNA 4Q4X2 5IFTA 3ME2A 4UWDA 1FAYA 1OSGA 3QBQA 2E7TA 1G86A 4OZOA 1PVC1 4FO9A 4QM9A 3VBOB 1JZ6A 3Q9OA 3TNQA 4LHLA 1UAIA 4NPLA 3RZHA 2A75A 2FBEA 4BIOA 2VG9A 4ZONA 1OUXA 3DL3A 1PMIA 3T4HB 1DLCA 2BOJA 4OCTA 1VBD2 3SH3A 1NKGA 2WDBA 4OMDA 4JRLA 5GZFA 3WF3A 1DYKA 5ACA3 2WN2A 4HVOA 1JHJA 1VRBA 4Y1YA 5EHDA 4YYOA 2BBAA 5C5UA 3VHOA 4DUVA 4NHMA 1JZ4A 2WYSA 1JYWA 5E1RA 1PNFA 1IZ3A 1YNAA 3IIIA 1JZ7A 2OIIA 1C57A 1JYCA 2EIBA 2OS2A 5FPLA 2VUCA 3B9CA 1POQA 3T0DA 1AJOA 3I2GA 4DUXA 5EWSA 3TN93 1CN1A 5D8AB 2WNUA 1RUE1 5HCBA 1JYTA 3WHUA 3TNPB 2JKBA 5K0UA 1IS3A 4J25A 4F83A 4WV8A 1VMJA 2NM1A 5FPXA 3LA3A 4QXHA 2VVEA 4R4ZA 2ARBA 1MVEA 1LOAA 1UZ0A 2ZMLA 3MF6A 4CP9B 5JXGA 4JVAA 1IPSA 4EWEA 1AUYA 3AVSA 1PX3A 4Z2WA 3SH4A 2BGPA 1HLCA 2W91A 2OPWA 3Q8BA 2WZEA 4B4PA 1NG0A 3EBRA 3ZVXA 1JOPA 1RVF1 1XPWA 2F4PA 1VBA3 4BHPA 5FYVA 1UKGA 2E51A 3OBRA 1V6MA 2PLV1 5IW0A 3ZLIA 3WW2A 4XTMA 1W2TA 3O1TA 2CGPA 1WBFA 2D6NA 4N9IA 4BQ2A 4PF1A 1LHNA 1PVC2 4GQ7A 3UGGA 4LMFA 1H1AA 2W08A 3UNPA 4CUCA 1CZVA 3C3VA 2P6CA 5C8CC 4B29A 1VBB3 3ZKYA 3ZFEB 4QB6A 4CCKA 4QKBA 3AP4A 1J3RA 1RL3A 3OY8B 1MEC3 2VMEA 1O3QA 1UZVA 4FAHA 2HBTA 1PGSA 2VULA 2JECA 3J7MA 1VMHA 3PMSA 1IPKA 4UBHA 2Y6KA 2XMLA 2ZS6B 3OPWA 1H2MA 2XQXA 4B8EA 1UOGA 4W6WA 1WUVA 3MDPA 3VD7A 1XNDA 1Q8QA 4XJ9A 5LK5A 4FPKA 2GMEA 3B00A 4AWDA 1LULA 1XYOA 2BW8A 4Y33A 1QJX3 4D6QA 1RUE2 1TQ5A 3M3IA 4YZ4A 5T54A 4CDQA 4XYXA 1XNKA 2JG9A 1QJEA 2PTMA 1YQ8A 5FK7A 1S0CA 5F9TA 5I93A 2UWBA 1BBT1 4HOOA 4JGYB 4YWAA 4DINB 2YDEA 4H7LA 3O0XA 3U1XA 4FXGB 2ZHMA 4K7JA 4BQWA 5JLVA 3VZMA 3RQ0A 3WF0A 1ZRDA 1UZYA 2YMZA 4FQ4A 3O1RA 4MG2A 1H8TA 2HKXA 4UW6A 3U11A 1RVF2 5L7OC 4MUVA 4JRAA 4IV3A 1K5MC 1RUF2 3WNLA 1LGCA 1GLHA 2PLV2 4CCDA 4QGNA 2ORZA 3N3HA 3M3QA 5BPXA 2ZABA 2Q8OA 3MBWA 2WS91 4L97A 5CKMA 5DDJ2 4Z07A 3BKZA 1QF3A 4Q4Y1 1HIXA 2G4IA 4XFCA 1RUH1 4AFCA 4CXXA 2YROA 1XXNA 4M0NA 4XUPA 4LBMA 5A6XA 2VNRA 3W59A 4ARYA 5JOYA 2EXHA 1RYYA 2JG8B 3PNAA 3PU8A 3OGGA 2ZX3A 2MEV3 3VHRA 1W03A 1D0GA 2C24A 1O4YA 1RUD1 3SNMA 1VRH2 3TEWA 3AZWA 3ZPYA 2YHJA 3IWZA 1H2NA 2ZOEB 3PDQA 4GH4A 4P00B 5F7UA 4JQRA 4DZGA 1ZBA3 5ABJB 3AK0A 3TYJA 1S4CA 4U36A 4A45A 3P5BA 2WWJA 5C3RA 3PLQA 2CSGA 5EPAA 3URFA 3ZXFA 3AVRA 3ZR5A 4MHUA 4XJWA 1ZRRA 2XKPA 3FZ3A 4W50A 1N3PA 5A1FA 5C33A 3QH6A 4AVBA 5K8SA 1ENQA 1AYM1 1LNSA 2HWF2 2YFZA 4M3CA 3EXUA 5B2GB 1BBT2 4JX0A 3PU3A 5CG9A 1FMD3 1Q5OA 3CO2A 4ZZ8A 5A33B 4QX1A 1LB2A 1GZCA 1OKOA 2XHNA 4GALA 1DGLA 3DYMA 4XW3A 1JW6A 5GZDA 2Z79A 4D6SA 2BDRA 2P6HA 1JZ2A 1GOFA 1D4M1 1OT5A 4Q0UA 2YB7A 3OPTA 1UYYA 1YRZA 2A7AA 2BNOA 3MYXA 4NO4A 4QB1A 4QQLA 4XFIA 3DPRA 2VZQA 3NMBA 3OD4A 5IT6A 3WW1A 1FOD1 4QB2A 2ZGSA 4XEZA 3WVJA 1N1SA 4NOTA 1ALYA 2WS92 4UF0A 5A32B 1SFYA 2D5FA 5CZKA 2XVLA 3HQRA 2JB8A 5IUQA 1RUH2 2ETEA 1AR83 3FBYA 1W0NA 1XBFA 3RZZA 5FWJA 2GALA 5LEKA 3ACFA 5AFEA 2Y34A 2PHFA 2RS53 3OUHA 4RGAA 2IUWA 4YW7A 1YC61 1JYXA 4GWNA 2RM23 1WCUA 2OA2A 1KS5A 1RUD2 2UYAA 3AJZA 5GLUA 3EQEA 5F2WA 1O59A 4ASLA 3V0AB 3NNLA 4QQPA 1DLLA 5FK8A 3E6BA 5I0SA 3FBMA 4XAEA 3WCSA 2VTXA 3OBTA 3ORJA 4D7TA 1BHGA 1WMXA 2ZBJA 3RJRA 2W1SA 1HQNA 4BQ3A 5FP4A 1A78A 4Z82A 1ENRA 1X82A 5FJHA 1HV0A 1ZBA1 3H7YA 3RZMA 3O7OA 1WKYA 2R7EB 4LEJA 1OA2A 5LASA 1H2KA 4PI0A 4BU2A 3R4DB 2KD7A 1ZZCA 4XF1A 2CDPA 1AYM2 5E89A 5DG1A 1RHI3 4WVWA 3ZYHA 1RJ7A 2DBIA 2HWC3 4O9EA 1Q8PA 4QX3A 4EWAA 5K0UC 2VZ1A 4P5HA 5FYUA 2VE1A 2VMHA 2PHLA 3HAGA 3POEA 4OLLA 5LA2A 5IK8A 2QQOA 1D4M2 1WD4A 3MI8A 1US2A 4LTAA 5FBJA 1W6QA 5L7OB 4LNVA 3W20A 1H4HA 5CISA 1NOVA 2WO7A 2X10A 1S0EA 5BNOC 1A8MA 1FOD2 3MIHA 3KV6A 3N9MA 4IEUA 4WVMB 4OHWA 1E5HA 2W9XA 4YGBA 5A1LA 2R073 3H3LA 4ISQA 4Q0PA 4LBQA 4FFIA 3V65A 4BJ0A 2XUEA 1H9PA 2ZHKA 4N7UA 3BTYA 4QX7A 4LQRA 2XPJA 4D94A 2AEYA 1PZ7A 3U78A 3NSTA 2ZZJA 4COVA 1QH7A 4IXLA 1JODA 2WA4A 1V70A 4IQPA 1AR81 1G9AA 3ES1A 3ZYRA 1ND2B 1PIV3 2XGXA 1C28A 3BU7A 4QU1A 5T50A 1D7PM 1UW8A 1BVP1 3LF7A 3VN4A 3FLRA 1DCSA 2W47A 3VZNA 3ZYBA 2B4KA 5DUWA 2XL7A 3ZIWA 3JD71 1SFNA 4DY5A 4K1ZA 4JV4A 2JKXA 2XQRA 5FV3A 3RZGA 1ODMA 3M7AA 4V2VA 3VBHA 3V56A 1H0BA 1CD3G 5T3NA 1F9KA 5IVVA 4NUBA 2JENA 3CHXA 3THCA 1QIQA 2B9VA 2VZRA 1LKNA 1URXA 1OH4A 4AW7A 3VD4A 2AZ5A 4E4SA 5AC92 5LZ6A 4GULA 2KXLA 3AFKA 4NROA 5HBAA 5GZEA 2WLPA 3BB6A 4UW4A 3GJAA 2JG9C 2JXAA 1VP6A 5FYBA 4WM8C 4XIOA 2Y0IA 3KT1A 2Y0OA 3NVCA 5EQUA 1X8EA 2EICA 1PO12 4HN0A 1KGYA 2RDQA 4QX0A 1JYVA 2RMU3 2H6BA 2QQJA 4XDQA 4IV3C 3M8LA 4Y1UA 3H1MA 3L2HA 4CP1A 2ZACA 2OQ6A 1YJLA 2XJUA 1WCDJ 3FWEA 4TYSA 4B1MA 3AB0A 1LOGA 1UIJA 4LE3A 3H7JA 5FMOS 5JR7B 5T5OA 3MFAA 3WUCA 4OHXA 5IATA 1LEDA 2P3YA 4S2HA 3AMPA 1FNYA 1MS3A 3UETA 4MGTA 3UYJA 4FI9A 4P5YA 2EVXA 5EXOA 1UOFA 4CEWA 5FQ0A 5T5JA 3KV4A 3KGLA 2WO3A 3JD72 2BPA2 1R081 1PIV1 3DKWA 5EV7A 5FY9A 4GH4C 4D69A 3O12A 3FC0A 3PMEA 3TOJA 3MW3A 4XZPA 2EAAA 3CJIC 2P3IA 4MGQA 1LOFA 3ZMOA 3ST7A 5JCTA 1XNAA 2VVDA 2J1TA 1TMF1 3D4KA 3PTYA 1VAMA 3RYKA 4L8QA 1GQHA 2W87A 2H0BA 4KI5M 1WCSA 3A7QA 2GC0A 1DGWX 1PK6A 4EYUA 2BNMA 2Q4SA 4X6QB 3R6SA 3PVEA 4LUKA 2YC4A 4QPGA 4ZHNA 2GDFA 3M4FA 4BYYA 3OGVA 3ZYFA 1J83A 1W06A 2PA7A 5J37A 4XFAA 4Q5OA 1C8M3 4DEVA 1NA1A 2LRPA 4Q4W3 5F8PA 5A7OA 5LA9A 4Y24A 2D44A 4CUBA 4Q4V1 2YC2A 1FATA 5BNOB 3VDAA 4ONUA 5C3QA 1CZSA 1W8OA 1D2SA 4IEYA 3UK9A 4JZRA 2VQ0A 1UMHA 3GZEA 4OUMA 5GKAC 4AI3A 5JMOA 2AENA 2WFF1 4AGRA 2J1VA 5DUVA 1U12A 2CHHA 4BMEA 3BGAA 5C8WA 5FUIA 1NAEA 1Q8SA 2W95A 5LBEA 1ZRIA 4Y3OA 2VMIA 1HJGA 4CZSA 3NJVA 4AYUA 3JUUA 2WRAA 1AR72 4A2UA 1F5JA 2ZEWA 3B01A 1L7QA 3ZXDA 4IEPA 4LOTA 1JUHA 1R082 4HK8A 4EN7B 4YLZA 3PVNA 1OXCA 2G1MA 3POIA 5LY2A 3C7GA 1BK1A 4RYDA 3V64A 1OI6A 4XQ4A 4XF4A 4L2NA 3WNMA 1GOHA 1KDMA 1TMF2 4BWOA 3LDRA 4E4HA 1O4ZA 1UL9A 2E63A 2FHRA 4IE4A 4K9SA 3ZSKA 2TBVA 3WQ7A 4JKLA 4R9AA 2DWRA 5CVRA 1HRV1 4WM8B 4I3PA 5KHHA 5CFCC 3N7KA 4H3WA 4JC1A 1UCXA 5DZEA 1TME3 3NRUA 2VQTA 1YQ5A 3ZFGC 2X05A 1H6XA 2YPDA 3H8XA 4L92A 3AKSA 3T1MA 2VCCA 4Q4V2 2BRTA 4S2DA 1O5UA 2JDUA 2HWB3 1C8M1 4K8FA 1C5IA 3POWA 4Q4W1 2VTXJ 1WMEA 3AXDA 1YQ2A 2MPFA 3OD0A 2PMWB 1KQRA 5KWRA 2QQNA 2WT2A 1UX6A 1WMFA 2W1WA 1OOPA 1YQ6A 3ZFFA 5K7PA 1XE0A 1UD1A 1AR91 1EV12 1QKQA 1LRHA 1K3IA 2EIDA 2Q0AA 2ZX2A 1VBE3 2FCTA 1QJY3 1DHKB 1AHSA 5JOZA 1J3PA 1W0OA 3HNMA 2Y38A 3LA2A 2FMYA 3SCFA 5CFDA 4I0WB 3H3UA 1SDDB 4IGOA 5F3EA 4AFMA 5SV5A 2YG0A 5L73A 2BFUL 3BALA 5BXXA 1EUTA 1F5FA 2Q1ZB 4I02A 3THDA 3SITA 4XFHA 5FPUA 3CJIB 4Y20B 3G6JB 3O1SA 1W3VA 2R32A 3E6DA 3KHBA 1UMZA 3VBHC 4ZXKA 3GCWA 3JB8A 2O14A 1CAVA 1ULFA 4LIUA 4HKLA 3I4IA 1DIWA 1DZRA 1YFWA 3POSA 1AL0G 4X8NA 5JIAA 2ZKLA 3WNNA 2ZCWA 1HRV2 5GLTA 3J7LA 5LBCA 3AMHA 3RGBA 1FV2A 1RUJ2 3B94A 1SZBA 3SLIA 3GJBA 3TEZA 2ADEA 4M0HA 2A6YA 3CJXA 4DPNA 2W0XA 4UW5A 5FP9A 4EQVA 4PDWA 1FI2A 1S0GA 3JCIA 4S2FA 2Y6GA 4MXWA 1WCQA 2J1UA 1UOJA 1LU1A 5FZ1A 2RR11 4AI1A 1GQGA 1W6MA 4KG8A 5FP3A 4XUOA 2WQZC 1E5IA 1GZWB 3NAPA 2NMOA 4GWIA 4HKOA 2VM9A 4CDUA 2J22A 4P9JA 2OXBA 1UIKA 2CAVA 2ZX0A 1W6NA 1ND3C 1F31A 5H9PA 4CUAA 3DCQA 1ULGA 1NCQA 4A7YA 4E4ZA 2IXKA 1S0JA 1R1A2 2ZGLA 1J59A 1ASJ1 3IDBB 4DIQA 1TZOA 4HVQA 1G6NA 1OFNA 4UFJA 5FZ4A 4DO0A 4YZ2A 3O5SA 3WG3A 1JU4A 1W6PB 4GJYA 4MV2A 4N9HA 1MZ6A 2J7MA 1W2OA 3NV2A 4JGZA 3PUSA 2VZVA 4PF5A 1LHWA 4AEJA 1BEV3 1XC6A 2RS11 1HQWA 2WAOA 5JIUA 1VBE1 4BQXA 4EN6B 1VBD3 4LKSA 5FR3A 4JKKA 2OVUA 5FZDA 3MUY1 1OBNA 1LCLA 5DQ0A 1XE7A 2O8OA 3OYWB 3K4AA 5KR7A 1IG3A 4M4RA 1UPSA 2E31A 4DXSA 2HEWF 1HRI2 4UFLA 3ON7A 2YXSA 2JD4A 3IT8A 4TZDA 1W9TA 5CFCB 1PK6C 2VOKA 3H1WA 3J8F3 4V2WA 1XRUA 1BJQA 1M4WA 1S0BA 2D5HA 4IERA 3P6BA 4JDOA 1VIWB 2VQUA 4LE4A 3ZFGB 1DQ4A 4AF9A 1RXGA 2DV9A 2YGMA 1RMU2 1N3OA 3MGUA 4GIQA 2SBAA 1JBCA 2TNFA 2RR12 2JJ6A 4NPMA 4NHXA 1XSRA 5L36A 3B7MA 3K3OA 3NV1A 3NO8A 3AJYA 4QDQA 4FPJA 3KF5A 1Q56A 3KM5A 4RN5A 4IE5A 1KJLA 1YYNA 4I30A 4YARA 5FIXA 2RVAA 1XNCA 3ZN6B 1VMFA 1ASJ2 3AP9A 5FZ7A 4H2AA 3LE0A 2PAMA 3I97A 3N9QA 4LA3A 1PVC3 4UAPA 5IVFA 2IXCA 4Q4X1 5L9VA 2Y6JA 1V9U1 2RS12 4PQ9A 5IVBA 1QDOA 1DQ6A 3GZAA 1OKQA 4ES8A 4UYBA 2PHDA 5IK5A 2VOTA 3MF9A 4UI9L 4B4QA 1UQXA 3B3QE 2UY9A 1MPXA 1COV1 3C7FA 5F32A 1VBD1 4KBZA 1H9WA 2B46X 2IVIB 2K9ZA 3PIJA 4G3YC 4M3CE 2HEYF 1ODNA 2XWBB 4Q8KA 1WLDA 2A1XA 5FUNA 5FZMA 1QJZA 2CGNA 5FO8B 4C0HA 4LUMA 5DUXA 3TEYA 4ZXEA 4EROA 2J1RA 1QXPA 3RZKA 3WG4A 1WA4A 2GC3A 4XCBA 2IC1A 1RUE3 1AZDA 1CAWA 3HBZA 2A6VA 4IETA 1W2AX 4P9WA 4OVEA 5M0TA 2PELA 4QHOA 4XBNA 5LA0A 3J7NA 3P3NA 3PUHA 5FUPA 2ET7A 4MLOA 3E5QA 3AXEA 4C8DA 4AAXA 4R4XA 1CAXA 4F7ZA 2FDJA 5C9AA 1NE4A 1OURA 5JZGC 1RVF3 2DURA 3T0BA 3ZN4A 1ND3B 2R49A 1RUF3 4MZUA 3ZSJA 5FZBA 2PLV3 4NWWA 4UFMA 1O5LA 3OBZA 3M70A 3VGIA 1X50A 4HXCA 3SMHA 3K4DA 5JXIA 2H0VA 2JEMA 4UFIA 1J1LA 2Q8DA 5DDJ3 1OOPC 2WO2A 3H50A 3U0ZA 4AFDA 2WT0A 3DV8A 3ZO0B 4AQTA 2RHPA 2R041 3OG2A 1V9U2 2GSYA 2XKOA 3FLTA 4KWKA 3VDBA 1YO8A 4NMIA 1SMVA 5CFDC 5LWBA 4PJYA 2CL2A 4BDVB 4UT5A 4E8CA 3AP7A 3BPSA 3VBUC 2VXRA 1VRH3 2DCYA 3GM8A 1COV2 5AVAA 3AM2A 1FNZA 3RJ2X 2WZR2 1RUNA 1GMMA 2GU9A 4CRQA 2DUPA 3SC7X 2WO1A 5C4WB 3USSA 4Y1ZA 4P9YA 4KG0A 3RWKX 1VLNA 2WT1A 1G9BA 4UFHA 4EV0A 1PNGA 5J7MA 2DVFA 1HX6A 2GZWA 4LHKA 3N7JA 4RS5A 5DUUA 2HYXA 4ZS2A 5KBFA 1SBEA 3AKRA 4CEYB 2VTFA 5L19A 2HWF3 3KT4A 3WHTA 5L9RA 2J42A 2DCKA 2ZPXA 4LLOA 5HV0A 1OA4A 1Q8VA 1BBT3 1L7LA 2BZDA 4KU7A 1CJPA 5IYYA 5A6ZA 2BU9A 4LK6A 1HDKA 4PDWC 1MZ5A 3O0VA 1I6XA 5F3GA 2E53A 3AYCA 4QQ2A 1JZ5A 4FPHA 4QPIA 1BVVA 1ULEA 2DFCA 3IPVB 3SHRA 2ARXA 3ELNA 2Y6LA 3NNGA 4P9LA 1OA3A 3ZXLA 4CDUC 4WM7C 2JDPA 5IFPA 4JKMA 1PVXA 4AQSA 4CCOA 5KHIA 3WXPA 4AEKA 2JD9A 3BOPA 2C4XA 5CKNA 2XH6A 2WS93 5IAXA 1OLQA 1RUF1 2QUOA 3GDBA 4PI2A 4Q4Y3 2WKKA 1RUH3 4YW6A 5EJZB 3M3OA 4N8MA 4Q2FA 2R042 2W94A 4ZU4A 4PLNA 1JUIA 4AVAA 1CGPA 1JN2P 3NKTA 5DDJ1 2AR6A 2F4LA 1NXD1 1G8WA 4FOVA 4GAZA 4XETA 3VDCA 3TAYA 2DVDA 1VJ2A 4RQPC 2PHUA 3GZUC 4LKDA 1RUD3 3T1LA 1B35B 2E7QA 4BQYA 5FLIA 1GNYA 3SCHA 2LROA 3B69A 3KHCA 3PVOA 3I49A 1VRH1 4XMIA 4CXYA 4PHZA 3WSOA 1BMV1 1WW5A 2XWJB 3OB8A 2B45X 1IGOA 1RUG1 2BUKA 5BNPC 2UWCA 5KHJA 1PGL2 1YFYA 3HOBA 5A1AA 4IE6A 4M00A 3U4XA 1W8ZA 1AYM3 5JSOA 1OLMA 5JMCA 4B3NA 3CF6E 1CONA 3ZXAC 4IEVA 4H55A 1NXMA 1I1EA 4PIYA 1S2KA 2ARCA 4Y22B 5HV4A 2HWF1 1IHMA 3P1IA 1REFA 4LORA 3BUCA 4AVTA 4FXKB 4LR4A 2OX0A 2FDGA 3N9NA 1D4M3 5JZGB 2WLQA 5FZFA 1UY0A 1SLTA 2DF7A 1JTZX 2WNOA 1H1MA 4HLTA 2WNVA 3ETPA 1FOD3 4FT8A 5AC93 1W2UA 2YZ4A 3IMMA 4BLJA 1GQPA 4IV1A 4YVSB 5CBLA 4BK5A 1UXXX 1LR5A 1F4AA 1V00A 3WNXA 1G7YA 3D0SA 3GBWA 3ITQA 5FZ0A 1C4RA 5F3CA 5KXEA 1DDLA 5JUVA 3K51A 3H8UA 4D7YA 1CIYA 2ORXA 4CDXA 3WW4A 5CFDB 3ZXKA 1NCRC 2JDZA 5IJRA 4B7EA 5IVCA 4N53C 2P4EA 4LLFA 1HQLA 3VBUB 3N36A 5GLWA 3RRDA 5CG8A 4BB3A 4ISRA 2XG3A 4PIZA 4ITCA 4Q0SA 5FYHA 3QOPA 4J1WA 1AYN2 2SLIA 3HQXA 1RITA 3DKQA 3USUB 1BMV2 3MIFA 3GCXA 3T4VA 2XXZA 1OD5A 4Z8BA 4MGSA 2CTVA 2UURA 1RUG2 2D93A 4BCUA 3VZKA 5BV6A 4JTNA 3GGLA 1HN1A 1EUUA 3CIHA 3S6PA 2GP3A 3LD8A 5FZ8A 2CWMA 1AVBA 2QZ3A 2FMDA 4QQOA 4MHRA 2QDRA 2GNDA 3WF1A 1QWRA 3LEMA 1QQP2 2W5FA 4A3ZA 4LPLA 1OF3A 2FCVA 1VPHA 2BOIA 5C9AC 4NJ4A 1FPN2 1F15A 3IBMA 2G9ZA 4WM7B 2C9AA 5FZOA 3O1OA 4CP2A 5A7WA 1WA6X 3RNSA 4AEDA 5ACA2 3SISA 4XABA 4FBFA 4W6XA 3ZSEA 5FYZA 3AMMA 1MS8A 1YJKA 2VZUA 3FLPA 3E6CC 1OC1A 4TSVA 4W6YA 3U10A 3WP4A 5I8TA 4CE8A 5AC91 3MHZA 1Z7S1 3KZ4C 3LEGA 4XUQA 1DP0A 4QXKA 2YBPA 3WZ1A 4QWNA 2DVBA 3C7OA 4YZ1A 2EIGA 4U2AA 4RQPB 5C8CB 4HPKA 3VBRA 3IZOA 4XBLA 5DXDA 2C1FA 4X8PA 3U07A 4OI4A 3JD73 4M3CF 3AC0A 1WD3A 2W52A 1K45A 2IZWA 5LATA 4DEQA 5T52A 3VD9A 3GBGA 4AHYA 1BYHA 4O61A 4C0BA 5BNPB 3RS6A 3J26N 1JS9A 2PHTA 3BIWE 3LDBA 4JAAA 2ZHLA 3PJYA 2ZX1A 1Q8OA 1JU3A 3ACIA 1UY4A 3V0BA 4Y4RA 2Y8KA 3I54A 1KFXL 2VJXA 4FCAA 4NIIA 2ZXQA 2RJLA 4Y1VA 1FT9A 3VBSA 2BBVA 2IXIA 3PUAA 5FZGA 4DFSA 2WNUC 2QJVA 1ZREA 1SLLA 4HN1A 4LO8A 3FN9A 2DTYA 4ES9A 5KC6A 2R16A 3FFQA 1AR61 2GC1A 2O8QA 1MEC2 3BTZA 4IEOA 2WN3A 4AGVA 3GYDA 5BNNA 2YY1A 5HCFA 4LK7A 2D7FA 1K5MB 3QLQA 5E6HA 1PO11 2CV6A 2IXJA 4CP0A 2W1UA 4COUA 1OQ1A 4BQ5A 2JDAA 1Z7S2 1LOBA 2Z42A 4LA2A 1W90A 4RHV2 3UL2A 3AP5A 3RYRA 1UN1A 2YPJA 4CVUA 1NCRB 1UY2A 4RR3A 1C5HA 3I2DA 3RFRA 4N53B 2VGDA 5FOJB 1AXZA 4ET7A 3NKGA 3OBAA 3PIGA 1SLCA 3U14A 1V6JA 3N4MA 3HWJA 1D4VB 1W3XA 4JHTA 2RS31 3CU7A 3TWIA 1R083 3HNYM 1MQTA 3J7HA 3KCCA 3H9AA 1UOBA 5FY1A 1SQ4A 4L9BA 1YIFA 1DQ2A 4LO5B 2OYZA 3EHKA 4E2QA 5LEJA 5LRSA 3PUQA 5GJ6A 4EE2A 3K75B 1YQCA 1REEA 2R0HA 5FLJA 1TMF3 2V5YA 4KBBA 3SEPA 5A7SA 5A6QA 1AL22 2XJPA 4TXWA 3ECQA 1GV9A 2A70A 1MZFA 1O4TA 2ZEZA 3I59B 3PUIA 3RYPA 4DRVA 1X9PA 4QKNA 1UKRA 3WUDA 3TRSB 1DGRA 5IVEA 4HVRA 4CCCA 4CDQC 1UYPA 5LY1A 3UJOA 3CEWA 4A6SA 1AR62 4QGLA 3S57A 4Q4V3 3ZPOA 4HKWA 4IUGA 3ROUA 1C8NA 2VXJA 4IEQA 1YXWA 2DCTA 3QH7A 1KFUL 1YIPA 2WFF3 5F5QA 3NJXA 5AFBA 3NJZA 2ZJCA 5D21A 4KNCA 1H8TC 3ACGA 3WDXA 4IV1C 4NIDA 1IS4A 3S7EA 3FL7A 4Q0QA 5FO7B 2R0FA 2G9FA 4HL0A 1VAKA 1EV13 1UY1A 2ZAAA 4XACA 5FY0A 2VNGA 1HB4A 2YV8A 3I7DA 4N43A 2Q30A 5DAQA 1MZEA 3CZUA 2W39A 1W6OA 4KWJA 4AL9A 1Z0HA 4K40A 4ZY9A 2V72A 4AQ2A 4P9IA 3WX5A 3I2FA 1HB2A 5A3NA 4YW2A 3RDIA 5GALA 4CDWA 2XJSA 2RS32 3J9SA 1FMD2 4XXPA 4WBBA 2FDFA 1AR71 3MICA 4JTOA 5FYMA 1DZTA 3DXTA 3BYWA 4Q1PA 4YVWA 5I8SA 3KV5A 1SPPA 1QXRA 4D0QA 3AZVA 3NW4A 4HANA 3EO6A 3VDDA 1YUDA 2X09A 2X29A 4P08A 4WZFA 4XBQA 1W99A 5DG2A 1HRV3 1O3TA 3D3AA 2NN8A 2QFEA 4UFKA 1N1VA 1RUJ3 2ZEXA 1TVGA 3PVBB 4GWMA 2WNUB 3PTRB 5K0UB 2C5DA 3VBOA 2WFPA 2AGSA 2ZGKA 4L99A 4QKFA 4BXSV 1QJFA 3WNOA 2D40A 1C1LA 2FQPA 4XF0A 1Y43B 4UOJA 3D82A 1WCKA 1UX7A 1R1ZA 2ARAA 2WABA 5I91A 1SBDA 5LB6A 1WLCA 3BN6A 3HPNA 4IE0A 3DPRC 4QAWA 4AQ6A 1AR93 2K2SA 4BZ4A 5IVJA 4YW1A 3AL6A 4A42A 4XHXA 3OSDA 4I0AA 2XJRA 1XU2A 1OLRA 4Q8LA 1QJU1 2VNVA 5FZCA 3ZN5A 2YC0A 1EV11 1NT0A 2Z69A 3AYEA 3MEPA 1RHI2 3K46A 1PM4A 1B09A 1F35A 1ULDA 5FJKA 1ZM1A 2ATFA 2HWC2 2R061 4TWTA 5FYIA 1PM7A 2EF6A 5D8AA 4HFSA 1RUOA 2BV4A 3MO4A 2QE3A 4XF3A 3MZHA 2VVFA 1HV1A 5C3OA 3H8RA 5K4LA 4LIVA 3HQUA 3G7DA 2HBUA 1NLRA 1VR3A 3ACLA 2G19A 5T5PA 5FY5A 2AACA 4CP9A 2P37A 1GOGA 3I2KA 3KV9A 4UXAA 3WDUA 1ZX5A 3AMNA 2VCMA 3P3PA 2DCJA 3JQWA 4XCAA 5IK4A 1HRI3 2UWAA 4G4FA 1ENSA 2AREA 2DVGA 4O7XA 4ZU7A 3LA7A 5H9SA 5HI0A 3UV9A 2XJTA 5FOBB 3SXWA 1AF9A 3K77A 3NV4A 2XVKA 4I01A 2W92A 3MLJA 2RDNA 3ZXEA 1D2QA 5A3TA 2QQKA 4Q1RA 3WDWA 4CDQB 2JG9B 2P5BA 1RMU3 1LGBA 4KWUA 3LAGA 4YG0A 1AJKA 3KCYA 1OPOA 1QMJA 1RUJ1 5JSRA 2RR13 5A3OA 4NR1A 3ZFEA 1GWLA 4DY3A 5LCWL 1W05A 2XUMA 4L0PA 3OY8A 1LHOA 1H8TB 1I5ZA 4LKEA 3ZYIB 4GXLA 2QQMA 4S2GA 1CPMA 1BLZA 3M3CA 4IV3B 1FV3A 2QTWB 2VW0A 5FTTC 4P02B 4MXVA 1ASJ3 4HT1T 2A6XA 1P8JA 3NQHA 1ZNPA 4PLOA 2W2IA 3J4UH 2JDYA 1OUSA 1ZZ8A 1OQEA 1QJU2 5A6YA 1R1A1 4RR3C 3Q8CA 5CB7A 3VLBB 4YM1A 2RS13 3CNAA 3JZVA 3B02A 3KCXA 3AYAA 2R062 4DMIA 1RUI2 1LESA 1NYWA 2FD8A 3THTA 4QHZA 1IPJA 1VB2A 3ETQA 5JXJA 3S0MA 5DN2A 5GM0A 4BIFA 5FYTA 5BUVA 1EAH1 1MQTC 1YCIA 4JGYA 3MPPG 4MO3M 1BQPA 4GH4B 1R091 3HT2A 1RUC1 2XR4A 2DUOA 5FYYA 2V4VA 2VBPA 3ZXJA 2HWD1 2Y64A 4NAOA 4NIGA 5HXMA 3WT3A 5IWFA 3I3EA 5IHRA 3DYPA 1GUIA 1WGPA 4I09A 1Q43A 4QD2A 2AEZA 2Q1FA 5JPNB 4XHBA 4QX2A 4BOWA 1HRI1 4E8DA 5LW9A 5FY4A 3FMGA 3JU9A 5E88A 2F17A 2XOMA 4CCMA 1REDA 4M3CB 3FUQA 2ZMNA 2ZGTA 2CWSA 3LDKA 4RSUA 1OFSA 1APNA 2BVVA 2VZSA 2CY6A 3E5XA 1W2NA 3S5AA 2A71A 1T2XA 1S2BA 1UU5A 1I9RA 2I74A 2XB6C 4NRMA 2JG8A 4HBNA 1RMU1 2EAKA 3WF2A 4AK3A 4QHBA 1CVNA 4MYEA 2QQVA 5B4XA 1TG7A 3DPRB 4XJUA 3KVAA 4LBNA 2VCBA 5ABJA 3ZYGA 4DXZA 4QX5A 3ZX7A 3X29B 2XVGA 4UF0B 5KHGA 1HKDA 1W8FA 3N9PA 2B7YA 4Q4X3 2QNKA 2WA3A 4K1YA 5ISLA 2VZOA 5F39A 4DOUA 4N43C 2Q1MA 1FXZA 3JBG1 1V9U3 2OUHA 1QNYA 4XC9A 3WDYA 1GNZA 1JI6A 3IKWA 5D1IA 1YWKA 3CBNA 4IEXA 1IKQA 2OKXA 3FFZA 4WZCA 1T6BX 2P3KA 2QVSB 2ZAHA 4K8RB 4CDWC 1EAH2 3MUZ1 5FBZA 1MS9A 5FMDA 1COV3 2VUJA 5A33A 1LGNA 4YW5A 3VKMA 1J1TA 1R092 1RUC2 1CX1A 4QPYA 4CEWC 3DF0A 1PGW1 3WEZA 1CX4A 2HWD2 3EMRA 5EZWA 3D5OA 4YVWC 2AC1A 1JOJA 3A22A 4RD7A 4J1XA 2XBO2 1V6LA 1ZVFA 4P9XA 4LO6B 4R8HA 1LOFC 4AAPA 4KWLA 4Y5TA 2BFUS 2LTNA 2BWCA 5F2SA 1UU6A 1F2NA 2BERA 2VMDA 3S5QA 3UJQA 3WDTA 4LBLA 2JB4A 1QU0A 5A32A 4P9GA 5EIYB 5CKQA 3DGTA 4XJAA 1BK0A 1G9FA 4BH9A 4PIXA 1CAUA 1OMIA 2VU9A 1NZCA 4NWVA 3VUOA 3KF3A 1W28A 4R9DA 2WZPP 3VBOC 2RE9A 1GKBA 2HWE2 4QPGC 1RTVA 4CXWA 1XNBA 4A7ZA 1V0AA 5K9YA 2XLGA 3R05A 1JZ8A 3MLKA 1PMJX 3V0AA 1WW4A 1W6QB 1NA1C 4Z92B 2BGOA 4EN0A 1D0HA 1DF0A 2VD7A 1DYOA 3IDCB 3IMNA 4YNIA 3VKLA 1GZ9A 3O0WA 1TE1B 2J1SA 1LOCA 2D6LX 4IEWA 4LBQB 4K20A 1POV0 1W8UA 5A80A 3LGRA 3HIFA 4AGGA 4C90A 2R043 1U5ZA 3JBG2 4LBOA 4CPBD 4GB31 4XFBA 5J96B 4H14A 2DYCA 4BQ1A 3M2MA 1VBC2 3SKVA 4OQ8A 2B9UA 1GR3A 2VCAA 3WP3A 4B4RA 4URAA 1MS4A 2WIIB 3BI3A 2D3SA 3I8TA 4FTEA 5D8AC 2YGLA 3MW4A 4ZZ5A 3HR9A 1POV3 4COYA 4XF9A 4XDPA 2D3PA 1S1AA 1PGW2 2K0GA 2WSVA 1OD3A 4IESA 4DNYA 1CJDA 5L7OA 2WZR1 2GN7A 3ZKUA 3VBHB 4WVMA 5I0RA 4NHYA 4XPVA 1XB9A 1W8NA 4YGCA 4MVTA 1J3QA 4BE3A 5GZGA 2CAUA 4IGPA 4QQHA 1TNRA 2HH9A 3I3MA 4PBOA
chains in the Genus database with same CATH topology
1QJY2 3FX3A 1NQJA 4OHZA 4NVPA 2ZMKA 4YSFA 4YG6A 1LJ7A 4OHVA 2ZTNA 1ND2A 3H1YA 3A4UA 4MGZE 3LZZA 2EALA 1G9DA 4OHYA 3OJBA 2A6WA 4R9CA 1ZA4A 1Y9QA 2PQQA 4FPGA 1DZQA 2N7GA 4GB32 3ZFFC 4P14A 1AX0A 3ES4A 4OI2A 1SLAA 3AKPA 2X53S 4JCKA 3POYA 1S0FA 4QT6A 2UY8A 2ZA9A 2LUWA 3M3EA 4FP2A 4YGEA 4CEWB 4JGYC 5FQ0B 3KT7A 1AYN3 4EN9B 3KB5A 2D97A 2OZ6A 1POV1 1RUG3 1XYNA 1QXJA 1X33A 3LWCA 1PO22 4Q29A 4YFWA 3DUIA 2XJQA 1PGL1 2P2KA 3RMYA 1QOSA 5HCAA 1PK6B 1SLIA 3HD8B 4LT5A 1GNHA 2ZGRA 4QPGB 1QQP3 1ZRFA 1BEV2 3D0JA 3KS7A 2JG8C 1NA1B 4XFGA 1FPN3 2ERFA 1MACA 3M1HA 2XLAA 4Y26A 1KJRA 5EFUA 4ORFA 2QCSB 1PZ8A 3NAPC 1Q3EA 5KHKA 2BYVE 5ABJC 1UZZA 4AHWA 4K3UA 2O0OA 4Y5Z0 1NCQC 4GA9A 4F8AA 2H6CA 2YUEA 5JAXA 2P17A 3LSEA 2GNBA 3S7IA 1JXNA 3J8F2 4EWDA 5J48A 5EJ3A 1PZ9A 2B42B 1V6NA 2BQPA 4JGZC 4DB5A 4GMP1 5BY5A 2PYTA 1MR5A 2GH2A 3R0RA 2BWAA 4W65A 2VW2A 5FAXA 1N1TA 4E27A 3SH5A 1RIRA 3GALA 5JI7A 5IK7A 1MS0A 5BNOA 1AYN1 2X8KA 1HXS1 5JWPA 3RI9A 3INAA 2AH2A 3D8CA 4FTSA 2D6KA 1L3JA 4URTA 1SDWA 1ZBE1 5CADA 5T55A 1AXKA 1RINA 1A6CA 5LK7B 1NLSA 1DG6A 2E9QA 2E6VA 5H9RA 2EA7A 2VUAA 3VHNA 5I8YA 3AMQA 4R9BA 5AVPA 2KM2A 1WLWA 4ATFA 3N7LA 1QQP1 2WJSA 5JDBA 4HMZA 2PN5A 3BOWA 3MIDA 4YM0A 1GBGA 4YM3A 1FPN1 3ZSLA 4HZFA 1FYUA 5C6CA 3ZSMA 5ACA1 1Z7S3 3MW2A 4RHV3 4AFBA 3R4UA 1OOPB 3ZFFB 1CPNA 4BA6A 4WVZA 1UPIA 5F6KA 1NE6A 4AEMA 1XU1A 2GNTA 3BCWA 1SLBA 1MS1A 3LB9A 4WM8A 3VHPA 3VL9A 3GZTB 4XOGA 3TN91 2V09A 4FTBA 5EYYA 4R52A 1KD7A 2JE9A 5E8AA 1H1IA 3T2TA 1T6GC 3WP5A 2A6ZA 2WWSA 2BVBA 2C0ZA 2GN3A 2ZGPA 1HXS2 2DUQA 3GF6A 2X5IA 3OTFA 2I2SA 1IS6A 1CAVB 1AL23 4MH0E 1U5YA 4Y4YA 4AVVA 3TBDA 1PHMA 4E9KA 1ZBE2 2JICA 1FX5A 1VBA1 5CIRA 5DZGA 3AFGA 1SACA 3WDVA 3RPQA 3ZXGA 4CTEA 3L2YA 1RB8G 4DRRA 4HK9A 2FZ1A 4KL1A 1AR63 4I0BA 4PDWB 1NY71 4MXWB 1YI9A 1ND2C 2NQYA 4UBGA 1VBB1 1W6MB 2DTWA 4D3WA 3NAPB 5FO9B 2VH9A 4CDUB 1BCXA 1MEC1 1PO13 3WCRA 3CJIA 1W6NB 4Y20A 1XQNA 1NCQB 4KGQA 2V73A 2RJKA 5GZCA 2TUNA 4YZ3A 3OPZA 1QHDA 1RGSA 2JX9A 4AG4A 2OZJA 4LBKA 4RHV1 1WMDA 1SBFA 1RC6A 4JGZB 3LOBA 2NMNA 2RS33 3ALQA 3TN92 1QJX1 2NLRA 4FVVA 5E16A 4O9GA 3EJKA 3VV1A 5CU1A 1LHVA 2UU8A 4MGKE 2IWGB 1GZWA 1DU3D 1V6IA 4XMAA 1LENA 1YFUA 1XE8A 2EXKA 1VBA2 4YM2A 1S0DA 4Q4Y2 3WQ1A 1CAUB 1E57A 1AL21 3ILFA 4RS5C 1GICA 4ZU5A 1W6PA 3PHMA 3AZXA 2D43A 2UYBA 1NY72 2Z2SB 2MNGA 3WG1A 2IFWA 1VBB2 2CYFA 1EP0A 1I3HA 4UW3A 2WC2A 4FPYA 2MEV1 4COZA 1DQ1A 4QPIC 4X6RB 1Y7BA 5HXVA 3OYWA 1DGWA 1VAVA 1C3HA 3IDEA 1TEIA 1X36A 3WY6A 5H9QA 1U5IA 2AUYA 3CL1A 4N90A 1YI7A 4FSJA 5A3LA 4E2GA 5CFCA 4NHKA 1QJX2 2Z5WA 4ATEA 2QQPA 3WW3A 3ZFGA 1AR73 2OW4A 4J6GA 4AHXA 1FMD1 5DZFA 2P3JA 5FMOL 3LSDA 3RMXA 1V6OA 1LOEA 4QMAA 4YW4A 4FPLA 4BM8A 4FPEA 1YLLA 3IM0A 2VY0A 3VBFA 3ZN6A 3VZLA 3FE5A 3WG2A 2MHFA 2ZGNA 4KQ7A 1CAWB 2I45A 1UU4A 2NPIA 2D6OX 4XJZA 3UKTA 2D6MA 1ZRCA 4F3JA 3MIGA 2JE7A 1XYPA 2RS51 1CAXB 4MGYE 5C9AB 2B39A 4MGIE 2MEV2 2XL9A 2F6BA 2RM21 1SEFA 3C2UA 4SLIA 4AHZA 1N47A 3MPBA 2QZ2A 2WNVC 1ZBA2 4G9SB 5CAZA 2PHWA 4EN8B 5J36A 3N7MA 4KGGA 2PAKA 1QJU3 2BTVC 3NV3A 4AVSA 2PFWA 1OQDA 4FAGA 2R063 1RUI3 1S55A 3LCPA 5SV8A 1CQ9A 1Y3TA 3H0OA 4CDXC 4META 4YZ5A 1RHI1 4OUSA 1LECA 3UKNA 2HWC1 3GBFA 2ENRA 1W39A 4QM8A 3RWNA 3PJQA 2DFBA 3NWKA 3LKJA 2WSUA 4FOYA 4L11A 3AKQA 2X5IC 1ND3A 5BNQA 1O3RA 1SCSA 3AKTA 4Y1XA 1Z78A 3QD6A 4MSVA 2BNNA 4RS5B 5FCCA 2R071 3ZYJB 3RG0A 2GMMA 1AR82 4HSLA 4HETA 3WP6A 1KDKA 4FQZA 4OI0A 2RS52 2GH8A 3WD5A 2HEVF 4QPIB 3R4SA 2RM22 2AYHA 3ILRA 1DYPA 4YGDA 1DBNA 3FJSA 2CNAA 3FUOA 2Q5TA 4GKXA 3W58A 4AEDC 1QY4A 4JDNA 4NN0A 3KGZA 5C4WA 3NL1A 4OFGA 4OZXA 4XQWA 5J98B 1R1A3 2BEOA 4YG3A 2GNMA 4FOQA 2O1QA 4K6BA 2A5ZA 5BYNA 2ZZQA 5I0UA 3ASIA 4KU8A 1VALA 2R6QA 3AZYA 4CEYA 4HSJA 3VBRC 1EAH3 4AI0A 4M01A 3B9IA 1RUI1 2A3YA 2NP0A 5F1RA 3JB4C 1JHNA 1R093 1RUC3 2VOXA 3VKNA 3KQRA 2VOVA 1KXGA 2HWD3 5JOWA 2B8MA 2WQ4A 3B93A 4Q27A 2VNOA 3IPVA 2XBO3 4QGMA 2VQAA 1U5XA 3MIBA 4EJRA 1WBLA 4B7KA 1DQ5A 4XE9A 4AE2A 2DU1A 2RMU1 1IS5A 2BGCA 2R072 1AXYA 1LEMA 4A3XA 3KD4A 2LM3A 5J3UA 1CR7A 4C91A 4BMBA 1EPWA 2XHKA 3VBSC 4YFZA 2WINB 2HWE3 2GMPA 2ZGQA 3S30A 5CNAA 1BKZA 4E4DX 4MX3A 2PHRA 5FREA 1NQDA 2KA3A 5KC5A 5I0TA 1PIV2 4ZKTB 1B35A 2DU0A 2YYOA 1LTEA 5JSPA 4N7IA 4XXAA 2WNVB 4BLIA 3ZYPA 3OF1A 4XJ8A 5BNNC 2I07B 2VW1A 4IV1B 4AFAA 4LBJA 1JH5A 1MVQA 1ZYBA 2XLFA 3AYDA 3JBG3 1H4GA 3OCPA 1C1FA 1VBC3 3GHMA 4CDXB 5FFOC 2WL1A 4C1XA 1KRIA 1A8DA 2IXHA 2NZ9A 1BXHA 4Y22A 2NYYA 4LO7A 1DQ0A 4GKYA 2ES3A 2IFRA 4AXOA 1H2LA 5JZGA 2X5IB 3A0KA 3WOGA 3KSCA 2WFF2 1QH6A 4YW3A 3E5UA 4K21A 2ZKNA 4I3GA 1ZZBA 3AP6A 2RMU2 3MLLA 1AX1A 4YVSA 3VZOA 2XBO1 3VBFC 1CESA 1WW7A 3WQ0A 1W0PA 2ET1A 3O14A 5EYXA 3LOIA 1ZZ9A 2HJIA 1ZZ7A 3KMHA 2A3XA 3N35A 5LRRA 5JI9A 1KS4A 2QKDA 3BPZA 4IEZA 4OI1A 2IXLA 2DCZA 3TB0A 3VBUA 1O7FA 2E7AA 2HWE1 4FPCA 2R1DA 2TEPA 1BZWA 3VKOA 4AEDB 1WW6A 1QGLA 3HN1A 1ZZ6A 3WV6A 2LALA 3USUA 3HMYA 1QOTA 4Q0VA 3ATGA 3ZIXA 1ENXA 1OHFA 4XTPA 1ONAA 3UKVA 4GB33 4RL7A 1QOOA 4NHLA 3CLPA 5A3MA 2W68A 4HPKB 1J58A 3VBRB 4DQAA 4I2OA 2OUJA 3ZMNA 4WVVA 1OPMA 1QNWA 1VBC1 5JVVA 1H30A 2A73B 1KITA 3JQXA 1TME1 1UF2C 1C8M2 2D3RA 3B5LB 4JDMA 2HYKA 2PHXA 2WZR3 4Q4W2 3AX4A 2D98A 4WM7A 1O3SA 2HWB1 3BTAA 1SCRA 4NPRA 1U0AA 3KLSA 4COWA 1PO23 2XJVA 3VDDC 4PLMA 1AR92 2R1BA 3ILNA 4QU2A 4E2SA 3V0BB 5F6LB 1YHFA 2D6PA 3VBSB 5JPMB 2GC2A 2ILMA 4RQPA 5TSWA 4PCRA 5C8CA 2WNEA 1QJY1 1IOAA 1M06G 4FPFA 2ZGMA 3ZDSA 4FP3A 5KXBA 2A3WA 4XFFA 3THPA 4INDA 2VPVA 3VKFC 5BNNB 1IKPA 3H3ZA 1EY2A 1JYIA 4H7MA 1HW5A 1O91A 1GYKA 1DFQA 1GSLA 1VB4A 2EXIA 4Z1VA 2GAUA 5C4WC 5GLZA 4ASMB 5BNPA 2Y26A 1WLTA 2DVAA 4RR3B 3ENRA 4A7KA 4BPZA 3GHNA 4RGGA 1EPZA 4C1WA 1YFXA 1AX2A 3A0NA 1GANA 4AI8A 1TME2 1MQTB 3BODA 3MIEA 2VECA 1N1YA 4V1PA 1X7NA 4XIKA 3SCGA 1A3KA 3W9AA 4AI2A 4AVCA 5KBFA 1N3QA 5J09A 2HWB2 4XILA 4YRDA 3FHIB 4KH9A 3IN9A 3MFCA 2P34A 3VBFB 1K5MA 3K48A 3OGJA 2ZX4A 4Q26A 5JOXA 1CIWA 1QDCA 4RA0A 3HT1A 2VMGA 4OULA 1PO21 4CYDA 2PAEA 1MS5A 1NCRA 4LULA 3QCWA 1VBE2 4N53A 2CGOA 2ZHNA 4PBPA 4IL7A 3RI8A 2G9GA 1BEV1 3WR0A 1B35C 3ZFEC 3IIAA 4DS0A 1LODA 3E97A 2B5HA 2VOWA 4GMP0 5FLHA 1LHUA 4LBQD 4TLFA 4RFT0 4SBVA 3L9JT 2FZ2A 3GNEA 2ZGUA 1RJ8A 5FPZA 1F8VA 1EYBA 4N43B 3VL8A 1W6OB 5KXCA 5FRAA 5KXDA 3I59A 5GLVA 4FOWA 1G9CA 4GMP3 1ULCA 2ZGOA 3DN7A 4CDWB 5FDBA 3J8F1 1GFF2 1X8MA 2QDNA 4LO4B 1LU2A 1DGRN 3APBA 4FPOB 4XQDA 2OPKA 3WLUA 1HXS3 4YVWB 1TNFA 3RSJA 2EXJA 3WINE 3VDDB 3AZZA 1IQAA 3QACA 4YVSC 5CA6A 1S0IA 1ZBE3 3D6EA 1V6KA 5T5LA 1H8VA 2R30A 4LHNA 4Q4X2 3ME2A 1FAYA 1OSGA 3QBQA 2E7TA 1G86A 1PVC1 4FO9A 4QM9A 3VBOB 3Q9OA 3TNQA 4LHLA 1UAIA 2A75A 2FBEA 4BIOA 2VG9A 3DL3A 1PMIA 1VBD2 3SH3A 4JRLA 5GZFA 1DYKA 5ACA3 4HVOA 4Y1YA 4YYOA 3VHOA 4NHMA 5E1RA 1PNFA 1IZ3A 1YNAA 2OIIA 1C57A 1JYCA 3B9CA 1AJOA 5EWSA 3TN93 1CN1A 5D8AB 2WNUA 1RUE1 5HCBA 3WHUA 3TNPB 2JKBA 5K0UA 1IS3A 4F83A 4WV8A 2NM1A 5FPXA 3LA3A 2VVEA 4R4ZA 2ARBA 1MVEA 1LOAA 3MF6A 2ZMLA 4JVAA 4EWEA 1AUYA 4Z2WA 3SH4A 1HLCA 4D7SA 4B4PA 1NG0A 3EBRA 3ZVXA 1RVF1 2F4PA 1VBA3 4BHPA 1UKGA 2E51A 3OBRA 1V6MA 2PLV1 2CGPA 3WW2A 4XTMA 1WBFA 2D6NA 4N9IA 1LHNA 1PVC2 4GQ7A 1H1AA 2W08A 3C3VA 5C8CC 4B29A 1VBB3 3ZFEB 3AP4A 1J3RA 1RL3A 3OY8B 1MEC3 1O3QA 4FAHA 1PGSA 2VULA 2JECA 3PMSA 1IPKA 4UBHA 2ZS6B 1H2MA 4B8EA 4W6WA 1WUVA 3MDPA 1XNDA 1Q8QA 4XJ9A 5LK5A 4FPKA 2GMEA 3B00A 4AWDA 1LULA 1XYOA 2BW8A 1QJX3 1RUE2 1TQ5A 3M3IA 4YZ4A 5T54A 4CDQA 4XYXA 1XNKA 2JG9A 2PTMA 1S0CA 5F9TA 5I93A 2UWBA 1BBT1 4JGYB 4DINB 2YDEA 4H7LA 3O0XA 4FXGB 2ZHMA 4K7JA 5JLVA 3VZMA 3RQ0A 1ZRDA 1UZYA 2YMZA 4FQ4A 1H8TA 2HKXA 4UW6A 3U11A 1RVF2 5L7OC 4MUVA 4JRAA 4IV3A 1K5MC 1RUF2 1LGCA 1GLHA 2PLV2 4QGNA 3N3HA 3M3QA 5BPXA 2ZABA 2Q8OA 2WS91 4L97A 5DDJ2 4Z07A 1QF3A 4Q4Y1 1HIXA 2G4IA 4XFCA 1RUH1 4AFCA 2YROA 1XXNA 4M0NA 4LBMA 2VNRA 3W59A 5JOYA 2EXHA 3PNAA 2JG8B 3OGGA 2ZX3A 2MEV3 3VHRA 1D0GA 1O4YA 1RUD1 3SNMA 1VRH2 3AZWA 3ZPYA 2YHJA 3IWZA 1H2NA 2ZOEB 4GH4A 4JQRA 4DZGA 1ZBA3 5ABJB 3AK0A 3TYJA 4U36A 3PLQA 3ZXFA 3URFA 4XJWA 1ZRRA 2XKPA 3FZ3A 1N3PA 5C33A 3QH6A 4AVBA 5K8SA 1ENQA 1AYM1 2HWF2 4M3CA 3EXUA 5B2GB 1BBT2 5CG9A 1FMD3 1Q5OA 3CO2A 1LB2A 5A33B 1GZCA 4GALA 1DGLA 4XW3A 1JW6A 5GZDA 2Z79A 1D4M1 4Q0UA 4QQLA 1YRZA 2A7AA 2BNOA 3MYXA 4NO4A 4XFIA 3DPRA 3OD4A 5IT6A 3WW1A 1FOD1 4XEZA 2ZGSA 3WVJA 1N1SA 4NOTA 1ALYA 2WS92 5A32B 1SFYA 2D5FA 2XVLA 5IUQA 1RUH2 2ETEA 1AR83 3FBYA 3RZZA 2GALA 5LEKA 5AFEA 2PHFA 2RS53 4RGAA 4GWNA 2RM23 2OA2A 1KS5A 1RUD2 2UYAA 3AJZA 5GLUA 3EQEA 4ASLA 3V0AB 4QQPA 1DLLA 3E6BA 5I0SA 3FBMA 3WCSA 3OBTA 2ZBJA 3RJRA 1HQNA 1A78A 4Z82A 1ENRA 1X82A 1HV0A 1ZBA1 3H7YA 3O7OA 4LEJA 1OA2A 1H2KA 3R4DB 1ZZCA 4XF1A 1AYM2 5E89A 5DG1A 1RHI3 4WVWA 1RJ7A 2HWC3 4O9EA 1Q8PA 4EWAA 5K0UC 4P5HA 2VMHA 2PHLA 3HAGA 4OLLA 5IK8A 1D4M2 1WD4A 3MI8A 4LTAA 5L7OB 1W6QA 4LNVA 1H4HA 1NOVA 1S0EA 5BNOC 1A8MA 1FOD2 3MIHA 4IEUA 4WVMB 5AC92 4OHWA 4YGBA 2R073 4ISQA 4Q0PA 4LBQA 3V65A 1H9PA 2ZHKA 4N7UA 2XPJA 4D94A 1PZ7A 3NSTA 2ZZJA 4COVA 1QH7A 4IXLA 2WA4A 1V70A 4IQPA 1AR81 1G9AA 3ES1A 3ZYRA 1ND2B 1PIV3 2XGXA 1C28A 3BU7A 5T50A 1UW8A 1BVP1 3VN4A 3FLRA 3VZNA 5DUWA 2XL7A 3ZIWA 3JD71 1SFNA 4DY5A 4K1ZA 4JV4A 3M7AA 3VBHA 3V56A 1H0BA 1CD3G 5T3NA 1F9KA 2JENA 1LKNA 1URXA 4AW7A 2AZ5A 4E4SA 4GULA 2KXLA 3AFKA 5HBAA 5GZEA 2WLPA 3BB6A 4UW4A 2JXAA 2JG9C 1VP6A 4WM8C 4XIOA 2Y0IA 3KT1A 2Y0OA 3NVCA 1X8EA 1PO12 4HN0A 2RMU3 2H6BA 4XDQA 4IV3C 3M8LA 4Y1UA 3H1MA 3L2HA 4CP1A 2ZACA 1YJLA 2XJUA 1WCDJ 3FWEA 4TYSA 3AB0A 1LOGA 1UIJA 4LE3A 3H7JA 5FMOS 5JR7B 5T5OA 3MFAA 3WUCA 4OHXA 1LEDA 4S2HA 3AMPA 1FNYA 1MS3A 2EVXA 5EXOA 4CEWA 5FQ0A 5T5JA 3KGLA 3JD72 2BPA2 1R081 1PIV1 3DKWA 5EV7A 4GH4C 4D69A 3O12A 3FC0A 3PMEA 3TOJA 3MW3A 4XZPA 2EAAA 3CJIC 2P3IA 1LOFA 3ZMOA 3ST7A 5JCTA 2VVDA 1TMF1 3D4KA 3PTYA 1VAMA 3RYKA 4L8QA 1GQHA 2H0BA 1WCSA 2GC0A 1DGWX 1PK6A 2BNMA 2Q4SA 4X6QB 3R6SA 3PVEA 4LUKA 4QPGA 2GDFA 3M4FA 4BYYA 2PA7A 5J37A 4XFAA 1C8M3 1NA1A 4Q4W3 4Y24A 2D44A 4Q4V1 1FATA 5BNOB 4ONUA 4IEYA 1D2SA 3UK9A 2VQ0A 4OUMA 5GKAC 4AI3A 2AENA 2WFF1 4AGRA 5DUVA 1U12A 5C8WA 4BMEA 1Q8SA 2VMIA 4CZSA 4AYUA 3JUUA 1AR72 4A2UA 1F5JA 3B01A 3ZXDA 4IEPA 1JUHA 1R082 4HK8A 4EN7B 4YLZA 3PVNA 1BK1A 3V64A 1OI6A 4XQ4A 4XF4A 4L2NA 1KDMA 1TMF2 4BWOA 1O4ZA 1UL9A 2E63A 2FHRA 4K9SA 3ZSKA 2TBVA 3WQ7A