4LTAA

The crystal structure of the p132r, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPRGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ltaA00
2XL7A 2EVXA 1VP6A 4KWJA 1DZRA 4QMAA 2B8MA 5JSRA 1UD1A 1U12A 3SCFA 1XRUA 1X7NA 1O4TA 3CJXA 3H8UA 1QXRA 1CAUA 1ZX5A 3I59B 3UKTA 5AVPA 5E1RA 4HSJA 5D1IA 3HT1A 1RC6A 1DGWA 4XF3A 1J59A 1Q5OA 2UY8A 2Q1ZB 4EWDA 3S7IA 1CAWA 5FQ0A 4O9GA 1GQGA 5I8YA 3IWZA 1X82A 4AVCA 1O3TA 4XFGA 1YUDA 3FFQA 1JUHA 4IEWA 1CAVB 1O5UA 4D7SA 1ZZ9A 4YYOA 3ACLA 2PTMA 4AVBA 4O9EA 2XHKA 4JTNA 2OA2A 4LTAA 5JSPA 1G6NA 4KU7A 2BEOA 3UKVA 2BYVE 2DCTA 4GULA 4LULA 4QXKA 4Q29A 1LB2A 4XFBA 2EAAA 3NW4A 1CX4A 4HBNA 3GBFA 2CAUA 2ETEA 3EBRA 2PYTA 5CVRA 5I8TA 4F8AA 2MPFA 4IEPA 3TNPB 4N9HA 4HN0A 3DKWA 3H7YA 3LAGA 3KGZA 4BH9A 1FT9A 4XFAA 3RNSA 4I01A 4QGNA 2PA7A 2H6CA 1ZRFA 2D93A 4Q0VA 3BCWA 1ZZ8A 5I0TA 4BHPA 1SFNA 5EZWA 2QVSB 1RTVA 2PHDA 3FJSA 4WBBA 5KHIA 4Q0SA 2ATFA 3HT2A 4BIFA 2UY9A 3H3ZA 1UIKA 1YLLA 2XKPA 2Y0OA 1OMIA 3WW3A 3H50A 2GU9A 3EJKA 3SHRA 2HJIA 5I8SA 5J48A 4TLFA 1EYBA 3LA3A 5FCCA 1LRHA 3NL1A 4YARA 5LEJA 1O7FA 4HLTA 1NZCA 4CYDA 4Z07A 5KHKA 1RUOA 3VHRA 3ELNA 4J1XA 5CADA 4L2NA 1UPIA 1CAWB 5FQ0B 3ROUA 3WW4A 2K9ZA 2GC3A 1XE8A 3E5UA 2PAEA 1UIJA 1Q43A 3E6BA 4KWKA 1ZREA 3NJZA 1IPKA 3S0MA 3MZHA 1OFNA 4Q0PA 4QGLA 3E6CC 4LUKA 4WVZA 5I0UA 2QNKA 3DL3A 5LRRA 3ES4A 1I6XA 1O3RA 3D0SA 5FLJA 4XFCA 3ZDSA 2PHLA 3BU7A 3FE5A 5BPXA 1V70A 2CAVA 1YFXA 5FLHA 4ZU4A 3FWEA 4KL1A 4IEUA 3G7DA 4XFIA 4QM9A 5C6CA 5I0RA 3M70A 4Z82A 4MUVA 3SCHA 3OCPA 4WZCA 4E2GA 1I5ZA 3RYRA 1J1LA 4MGIE 1QY4A 3MDPA 5K8SA 4ORFA 4AXOA 4PIZA 1Y9QA 2Q30A 2BNMA 5KHJA 1ZRCA 1J3QA 1RL3A 5HI0A 4IEOA 3M3IA 1CAXA 3NSTA 4MV2A 1NXMA 2KXLA 1RGSA 5E16A 3H1YA 4I3PA 2XL9A 1CAUB 4F7ZA 3CO2A 3LZZA 3ES1A 3H1MA 1IPJA 4UBHA 4D7TA 1QWRA 2ZKLA 5JCTA 4L11A 1UW8A 3HQXA 1J58A 4EV0A 2BNOA 3SMHA 4FBFA 2C0ZA 1NE4A 1FI2A 1J3RA 1PMIA 3H1WA 3RPQA 3ETQA 3BB6A 1VR3A 3E5QA 5I93A 2VECA 1OI6A 3OD0A 1CAVA 1LKNA 4I0BA 3SXWA 3QOPA 1TQ5A 3E97A 4QGMA 1ZNPA 4FAGA 1YFWA 1O5LA 2BNNA 2MNGA 2OZ6A 1EPZA 3D0JA 3EQEA 3LWCA 3N4MA 4XEZA 2XLAA 1OD5A 4EROA 5KHGA 2Z2SB 3FHIB 5I0SA 3OGJA 4IEYA 3RZZA 2UYAA 2OYZA 4I02A 2V09A 2ET7A 4LEJA 2OPKA 4XF4A 3USSA 3QACA 1HW5A 2PQQA 3LA2A 4OFGA 2VPVA 4PJYA 1VJ2A 3U10A 3RYPA 2WFPA 5LRSA 4HN1A 3H9AA 1ZVFA 4ONUA 5J7MA 2P17A 1EY2A 4Q0UA 3U11A 4PIXA 1ZZBA 1ZZ6A 1SQ4A 3NVCA 4NVPA 2VQAA 4IEXA 2OZJA 1H1IA 2H6BA 4X6QB 4B29A 1CAXB 2ET1A 4H7LA 2D5FA 3PVBB 4JVAA 3ST7A 3UKNA 1ZZCA 4LUMA 4A2UA 3WW2A 2D40A 2E9QA 1DGRA 4YRDA 4HSLA 4LA3A 4P9GA 2GC2A 4EWAA 4ZU7A 2FQPA 5EFUA 4HVQA 2IXHA 1QXJA 4HZFA 2IXKA 3EO6A 2IC1A 2GAUA 3KCCA 4I09A 2IXLA 4E2QA 1ZRRA 4Q0QA 3NKTA 4FT8A 1WA4A 1YWKA 2GH2A 3MPBA 5J3UA 2Q4SA 3PNAA 3U0ZA 3DV8A 3FZ3A 3B02A 1X8MA 3I59A 4PIYA 3GYDA 3IBMA 4IESA 4KU8A 4R8HA 4LLOA 3HIFA 4QM8A 4X6RB 2GC1A 3TNQA 4QX5A 2WC2A 1DZTA 3LOIA 3IIAA 2BGCA 2QDRA 3I7DA 2PAKA 4AVAA 3IDBB 5FDBA 2XKOA 3R6SA 4XFFA 4K8FA 4XF1A 4XFHA 1XE7A 2IXIA 3CF6E 2HKXA 4JTOA 5CU1A 4R52A 1Q3EA 4HVOA 4I2OA 5BUVA 4MGKE 3O14A 2ZCWA 4IEQA 1YFYA 3JZVA 4BYYA 1NYWA 4MGZE 4YNIA 1Y3TA 4UBGA 2N7GA 3I54A 1H1MA 3FX3A 1GQHA 1ZRDA 4IEZA 1O3QA 5BY5A 2Z69A 4AQ2A 1LR5A 3D82A 3CLPA 2GZWA 4E2SA 2O8QA 3CEWA 3RYKA 3L2HA 5C8WA 4FAHA 3CL1A 2FMYA 2XLFA 4MGYE 5T3NA 1WGPA 4YSFA 5BV6A 2B9UA 4MX3A 5KBFA 1NE6A 3OF1A 3KMHA 2K0GA 3IDCB 2B5HA 1ZZ7A 2IXJA 5FPZA 4IEVA 4IETA 2EA7A 2O1QA 4IERA 3MYXA 2XLGA 1SEFA 4UXAA 5FPXA 4KWLA 4ZU5A 4J1WA 5JR7B 1L3JA 1O3SA 2F4PA 4XF9A 4DINB 2PFWA 5BXXA 4JV4A 3BPZA 4MH0E 4XETA 3OTFA 3H7JA 4RD7A 3H3UA 1J3PA 2MHFA 2QCSB 4EWEA 1EP0A 4META 3WW1A 1YFUA 2GC0A 1PM7A 4I0AA 2PAMA 4OLLA 3BALA 3RDIA 3EHKA 2IXCA 2UYBA 4N9IA 3KGLA 1FXZA 5KHHA 2QJVA 2CGPA 3S7EA 3C3VA 3E6DA 2I45A 1WLTA 4MZUA 5LEKA 5JSOA 1UCXA 5JAXA 4HMZA 1RUNA 3LA7A 4XF0A 4HVRA 4LA2A 3PLQA 2D5HA 3SCGA 1CGPA 5I91A 2H0VA 1YHFA 1X8EA 5FLIA 3E5XA 4AQ6A 2XGXA 5F1RA 3KSCA 2Q0AA 3DN7A 2CV6A
chains in the Genus database with same CATH superfamily
5FJKA 2JECA 3GHMA 1W0OA 3RWKX 3ZXEA 3WY6A 2MEV2 4S2DA 1GOGA 2XL7A 2Y6FA 4CDXA 5JMCA 1DZRA 5IK8A 3RZLA 2YFZA 5KC5A 4YW4A 1DLCA 4BZ4A 5LK7B 2W91A 2CHHA 3VBRB 1GUIA 4GH4C 4L0PA 3WZ1A 4EN0A 1O4TA 4R9AA 1QXRA 3AXEA 3MIBA 3KM5A 3B94A 3AYAA 1PX3A 4CP9A 1S0CA 5D1IA 5E88A 3HT1A 1CD3G 3ILFA 5IK7A 4CU6A 1K5JA 3LB9A 5DZFA 2X8KA 5D8AC 1IS4A 1AXKA 2AZ5A 5K7PA 2QQWA 2H0BA 4BCUA 2XVLA 4NRMA 3GZAA 3N7KA 3N9QA 3B01A 1ND3C 1NZIA 5I8YA 3B00A 4RS5B 4AVCA 1UOFA 2E53A 3W9AA 3KLSA 4QHOA 1FYUA 3WNNA 3AKRA 1Q8SA 4DZGA 3H42B 2DUOA 1YUDA 2ID4A 4GD4A 3TN92 2V4VA 2J1RA 4IEWA 1BQPA 1IHMA 1AYM2 1IOAA 3FFZA 3BPSA 1BVVA 2RVAA 5FRAA 1JZ4A 2ORZA 3B93A 3AM2A 3CHXA 3N35A 4D7SA 4MXWB 2PTMA 5D8AB 2WR9A 2WIIB 3ZXGA 1J1TA 3T30A 1PMJX 2OA2A 2FDFA 4LTAA 3AVRA 5JSPA 5JOWA 4KU7A 2BEOA 1LHNA 1DQ5A 3LDKA 4QQOA 3WDYA 1LULA 4JKKA 2QQMA 3PL0A 4G4FA 5C3SA 4GULA 4UFJA 5HCAA 1HN0A 2XH6A 3Q8AA 3ABZA 1TMF3 5FTTC 3TWIA 4UFHA 4LULA 4AE2A 4QXKA 1JW6A 1NX9A 4XFBA 5IWFA 5FO8B 4DXZA 5IAXA 3V0AB 4AEDB 3USUB 2EF6A 4PHZA 1HQWA 2ADEA 5BNNC 2CAUA 2UWCA 2JE8A 2EIBA 4CE8A 5C8CA 2P3JA 2ES3A 1TZOA 2JD4A 4XTPA 1AR73 1FMD2 4QWNA 3JD71 1DF0A 2VZOA 5FZGA 1KFXL 1ODMA 3POGA 2YROA 3RGBA 4IEPA 3TNPB 3T2OA 1RUC1 1W8TA 3DKWA 3AZVA 4IUGA 1HV1A 2QQVA 3LAGA 3KGZA 1W6OA 1FT9A 4MOAA 3T08A 3D6EA 4CTEA 5KXEA 2P5BA 3RNSA 1CWPA 1PVC3 4JQRA 2H6CA 2IZWA 4NROA 2D93A 1W28A 4Q0VA 4QQHA 1HQNA 2JDZA 3DGTA 3LEMA 2Q8CA 4W65A 4BHPA 3AJZA 4QB6A 1G9CA 5HCBA 1RTVA 3NAPA 2WAAA 5C9AA 5IW0A 5FO9B 2PHDA 4TLGA 5KHIA 3HR9A 4Q4X2 1QQP1 2ATFA 2BBAA 3WD5A 3WNLA 3HT2A 2NZ9A 2CU5A 4MSVA 4M3CA 1SBDA 3PTYA 4Q4X3 3GF6A 3D3AA 1KJLA 3WCSA 1SLIA 1YLLA 3AJYA 1LOEA 2XKPA 3AMPA 2WQZC 3NJXA 1GU3A 4UF0A 5L7OA 2EXKA 2PHWA 4PDWA 4QU1A 2Z4FA 5A1AA 3TEZA 1D0GA 1VBE1 3PUAA 1US2A 3SHRA 2WQ8A 2XUEA 4JHTA 2DU1A 3QCWA 1W9YA 5I8SA 5J48A 2G9FA 5F3CA 4TLFA 1RVF1 4TZDA 1UZ0A 4NIDA 4PBPA 3OUHA 3J8F1 1LRHA 4LIVA 4YARA 1ACCA 4HK9A 2RE9A 4YZ3A 1O7FA 2ILMA 5F5AA 2ZMKA 4UAPA 3BIWE 1DG6A 4CXXA 4Y1VA 5CISA 2J1SA 4XAAA 4ES9A 1K45A 2OXBA 4Z07A 4Z8BA 4GJYA 4ATFA 2XPJA 1G9DA 3JD72 2W3JA 1RUOA 1GP4A 3MIFA 2E31A 2WA3A 3DXTA 4I3GA 3ELNA 4FPKA 4LE3A 1CAWB 1H9PA 1GWKA 1UAIA 2UU8A 2BOIA 5FO7B 2K9ZA 2GC3A 4EN7B 2DCYA 3FLPA 3ZYBA 2D97A 2C5DA 3POYA 2Y6LA 5EWSA 4EN6B 5GALA 1COV3 1JUIA 2RS12 2WL1A 2HEWF 1TMF2 4KWKA 1VBE2 2WWSA 1GR3A 5FMOL 1ASJ1 3N36A 3I3EA 1POV0 1D7PM 3H8OA 1C1LA 4K7JA 1PMHX 1MQTA 5DZGA 3VD9A 1LODA 2E32A 3AP4A 3P5BA 1DQ2A 1C1FA 3DCQA 4ISQA 3WVJA 3LCPA 4QPGB 4XOGA 1LGCA 2WO3A 4M0HA 4XUOA 3PHMA 1G9AA 5FZ3A 2GNBA 1AYM3 1POV1 1DHKB 3D0SA 1SBFA 2X10A 2PHLA 5K0UA 3BU7A 3H8XA 4HK8A 1OH4A 1XXNA 2CAVA 2YG0A 1IGOA 2XQXA 4LO7A 4AF9A 1LAJA 1RXFA 5LBBA 4QM9A 1FPN2 5SV8A 4E9KA 1BHGA 4JRLA 4Y4YA 4WZCA 1JYTA 3CNAA 3HNYM 1T2XA 4M0NA 1IZ3A 2HWF2 2WABA 3CKHA 1SLCA 3VBHB 4MGQA 4AXOA 3ME2A 1RUD2 1MEC2 2JDNA 1JYVA 3AB0A 1QJY2 1J3QA 1OF4A 3O0VA 4QHZA 1S0IA 2PHUA 4GWMA 1K5MC 2BWCA 5FY8A 3M3IA 4DEVA 2WZPP 5HI0A 1V9U3 2VOKA 5FZ0A 4KGGA 3GNEA 1LECA 3H1YA 2VMGA 4GJZA 1AL0G 1AXYA 4F7ZA 2G9ZA 2ZXQA 3SQOA 1UXXX 3I3MA 1SMVA 2P3IA 1LHOA 2HWD3 4CDXC 1QH7A 3LSEA 4UBHA 1ZRIA 2K46A 2VMDA 2FDHA 1LHUA 5AFBA 4RHV1 5JCTA 1GZWB 1TMF1 1UW8A 5A3UA 4EV0A 1J58A 3HN3A 1UNBA 3HAGA 4GIQA 4IGPA 3VZKA 4FBFA 1Y4WA 2C0ZA 2PXJA 1FI2A 3LEGA 4LBOA 5FZ9A 1YQCA 3WP4A 2RMU3 1CJPA 3ETQA 3MUY1 3RG0A 5D8AA 4S2HA 4NIGA 5FP4A 2QTWB 5FY7A 1PZ8A 2E6VA 3OD0A 1GICA 3SXWA 2LM3A 4URTA 1W6OB 1TME3 1MZFA 4FAGA 4D7YA 4ZPIA 4KMQA 5F3IA 4PLNA 2R043 2WZ8A 1DYPA 4XABA 2OZ6A 2K2SA 5FZOB 4XXAA 4QHBA 2KD7A 1H8TB 2GH8A 1KD7A 2WFF2 2R063 1R081 3R4SA 4XACA 2XLAA 1OD5A 5KHGA 2Z2SB 2ZGPA 5C9AB 5AC91 5D2AA 5I0SA 4BQWA 3OGJA 5BNPC 5DAXA 5A7WB 3ZPOA 2R1DA 2ET7A 4QDQA 2OPKA 3QACA 2AENA 2ZX4A 3J26N 5LATA 4OQ9A 2JG9A 2JDHA 3WR0A 1HW5A 5FXZA 2PQQA 2HH9A 3RWNA 3P3PA 4OFGA 3BTYA 2VPVA 4PJYA 1VBC3 5IATA 1QKQA 4XUPA 3C7FA 3CU7A 3RYPA 2WFPA 3U10A 3POSA 5FYSA 3Q8EA 4WM7A 1UPSA 1R093 4N43C 3PIJA 5CAZA 1VBA3 4C90A 4DS0A 3KV4A 1V6IA 3QBQA 4RN5A 1EY2A 4XZPA 2E51A 1UF2C 2YHJA 4R9CA 3U11A 4AQSA 3MHZA 3M4FA 4PIXA 5EXOA 3I4IA 5H9RA 5BNNB 4QQLA 2NMNA 5GLUA 2DVAA 2DFCA 1HRV2 1W3VA 1RB8G 1H1IA 1OT5A 2HWD1 2VVFA 3VKFC 4MHUA 3RRDA 1CAXB 2BVBA 3GXUA 5CKMA 4TXWA 5JPMB 4JVAA 1Y9GA 2ARAA 2YXSA 4Y1ZA 1KGYA 4Y22A 4WVMA 4G9SB 4LUMA 3PVOA 3WW2A 2FD8A 5LA9A 1JTZX 3ZFFA 4N7IA 1YEWA 2E9QA 3B69A 4ZU7A 4LA3A 2GC2A 5F9TA 4CEWB 1U5ZA 5EFUA 1YI9A 1CIWA 3INAA 3SEPA 1QDOA 3ON7A 1QHDA 2ZOEB 4WM8C 4HVQA 2XJUA 2XXZA 1IG0A 3NV1A 4YGBA 1TME1 3RI8A 3VZOA 2IXKA 3EO6A 3ASIA 4GZ9A 4MLOA 2LALA 2GAUA 5BNOA 1ZRRA 3MPPG 4Q0QA 5FZAA 4FT8A 1DQ4A 3T1LA 3WF1A 1GBGA 2W2IA 5J3UA 2Q4SA 5CYYA 1UOGA 4BE3A 5JPNB 4GA9A 5CA6A 3I59A 3SISA 4F83A 5A3WA 3I2DA 3IKWA 5J09A 2OPWA 3BTXA 4WV8A 1NOVA 5HPOA 3RSJA 3HIFA 3UGFA 2ZMNA 3WUDA 1ULFA 4NUBA 2VH9A 1JYXA 5BNPA 1CN1A 1J83A 5L9RA 4P9LA 3TNQA 3WHUA 2FDIA 1SHWB 5A7OA 1V6JA 1XNTA 4OI2A 3LSDA 3RMYA 5IVCA 1UY3A 2PAKA 4QXCA 3IDBB 4NPRA 5FDBA 2XKOA 1F5FA 3R6SA 1AUYA 4DPNA 5FY9A 1W9SA 3JQWA 1YQ6A 1LHWA 4XFHA 1XE7A 3GJBA 3PVEA 4SBVA 1BJQA 4FPHA 4AVVA 4BQXA 3VD7A 3CF6E 4GWNA 4Z1VA 4Q5OA 2P1BA 5CU1A 2RM23 5LW9A 1FV2A 3UYJA 4OULA 5IVVA 1Q3EA 4HVOA 5F6KA 3WNOA 1C4RA 5BUVA 1DU3D 1MVEA 2XWBB 4MGKE 5ANQA 4LHNA 3NJVA 4JKLA 3O1RA 1YFYA 1C57A 3JZVA 5EYYA 4MGZE 5FZEA 3ZKUA 1OPOA 3KF5A 4AL9A 4BYYA 5T54A 3ZSMA 1VAVA 1Y3TA 4UBGA 1H1MA 1LJ7A 2R32A 3FC0A 2WLQA 4OHVA 5F5CA 2QQPA 3WXPA 1VBC1 3WOGA 4OI4A 4YW2A 2XUMA 2UWAA 1LTEA 4E2SA 3AKSA 4CPBD 2OIIA 5FPVA 1C8M3 2ZGKA 1LNSA 3D4KA 3J9SA 3L2HA 3RZJA 2BWAA 2RG4A 3CL1A 4LK6A 4RR3B 5EP9A 4A42A 5T3NA 2Q8DA 1WGPA 4YSFA 1MQTC 1SACA 2VZ3A 5BNQA 1AR81 1O8SA 3VKOA 4YM0A 5KBFA 5FXVA 5LWBA 1OVPA 4CCNA 3KMHA 1JHJA 2Q8EA 2JENA 2XJSA 1BEV1 2IXJA 3KWVA 4SLIA 4AR2A 5JLVA 4W50A 4IV3C 3MYXA 2BPA2 3T2PA 4ZY9A 1KFUL 3CZUA 3F95A 1VIWB 5KXDA 1ZYBA 2WLPA 4Q8LA 4YPJA 3PU8A 5FPXA 3V0BA 2WZR3 4AI0A 2QDNA 1DZQA 1QIQA 3MICA 1L3JA 5IK5A 5A3TA 1YNAA 4N8MA 3ZN6A 1GNYA 4JV4A 4Q4V3 4DXRA 3BPZA 4XETA 1PGSA 4RR3C 4RS5A 3PUQA 1JZ5A 2GDFA 1Z0HA 3CQOA 3OY8B 3POFA 4J25A 1TE1B 2D3RA 2Q1MA 4BPZA 3H3UA 5IVYA 3NQHA 4QPIC 1F8VA 2QCSB 2TBVA 5A3MA 5EPAA 3M3EA 5KR7A 1EP0A 3U4SA 4Y3OA 1N1YA 4CUGA 2J1TA 2GC0A 3UT0A 3W5MA 1MR5A 1RUF3 2PAMA 1HIXA 1RJ7A 3BALA 4XMIA 4CCJA 5FYIA 1UKGA 2Y8KA 5IT6A 1UMHA 2ADDA 1F4HA 2JDKA 1D2SA 4AHWA 3WQ7A 4D6QA 3N9NA 2P4EA 3TN91 1VPHA 4GMP0 3L2YA 2X09A 4O61A 3S7EA 2ZZQA 1VRH3 1XE0A 2FCUA 1L7RA 1LU1A 3OEBA 1WLTA 5JSOA 1UCXA 5CG9A 4HMZA 4P5YA 2Y26A 1HKDA 3LA7A 4XF0A 3VV1A 4HVRA 4P9WA 3W5NA 1CIYA 4YG6A 5C8CB 1HXS1 2EIGA 3AKQA 5JIUA 3I2GA 2LS6A 3MW2A 1XQNA 3JQXA 1ENRA 1SLTA 1TNRA 2VW1A 2ZKNA 1WW7A 2QZ2A 1I5PA 3DPRA 4NO4A 1VAKA 3SCGA 3UESA 3PUSA 1KITA 2VCMA 2HWB3 2PHTA 2EXJA 3WNPA 5DQ0A 5T5JA 5B4NA 5KC6A 4FO9A 4QB1A 4LE4A 1X8EA 2JG9B 4P9XA 2AC1A 3LIGA 2CY6A 3AFKA 4AK3A 4CEWA 4Z2AA 1JYNA 1AX0A 5F1RA 4PDWB 1H8VA 1RUG3 3AP7A 5T52A 3KHBA 1MS3A 1GWMA 2VTFA 2ZGNA 1URXA 2E7AA 2C6SA 2ZEXA 4QMAA 3VD3A 2C9KA 4RA0A 1UD1A 4BK5A 1NXD1 2IVJA 1XRUA 1X7NA 1CJDA 3IB3A 3LGRA 1OSGA 3H8UA 4CP0A 5LA1A 4DXSA 1FNYA 1YC61 3IAQA 1RHI2 4CRQA 1XU2A 1NUKA 2A6WA 3I59B 3J8F3 4GKYA 3ILRA 3DXUA 2ZHLA 5E1RA 1UL9A 2WZR2 2Y6JA 1RC6A 1BEV3 4Q2FA 4OMCA 2B42B 3ZYRA 1V0AA 1VBA2 1HXS2 2P3KA 5H9PA 1J59A 1SPPA 1OF3A 3OB8A 3AZYA 1CAWA 1ULGA 3JXSA 3PVNA 4CCMA 1SFPA 1YJKA 5HXVA 1KDKA 1T6GC 3IWZA 2LTNA 3C8XA 3QH6A 3SITA 1GWLA 5ABJC 1O3TA 1W2UA 4N43B 2RJKA 5DPNA 2VNOA 1MS4A 2G9GA 2FDJA 4FP2A 4BMEA 1AL21 4V1PA 1CAVB 2VR4A 2ZMLA 3LPGA 4YVWA 4XUQA 5FZ6A 2X29A 4RQPC 1IS3A 1W8OA 4O9EA 1HB1A 2XHKA 3WG3A 1AR61 2NM1A 4CXWA 5ERLA 2JB4A 4K1YA 5DUWA 3N9OA 3UKVA 2WNVB 4XC9A 5M0TA 3RFRA 5A80A 4XJUA 2D6MA 4U36A 1QJFA 3VKMA 4EYUA 1U5IA 2WKKA 4DO0A 2VVEA 5BNPB 2BUKA 2VE1A 3DPRC 4E4SA 2CWSA 3IDAA 2PMWB 4BLJA 1N3QA 4LBQA 1WD3A 1E5SA 3NW4A 1XU1A 1XB9A 1ASJ3 1UYYA 3AVSA 4KGQA 4MHRA 3WQBA 3WNKA 5A7QA 4UW4A 5CKQA 3GBFA 4XBLA 1W8FA 2ETEA 1NA1B 3J7NA 4HXCA 4NJ4A 2PYTA 1NA1C 1N1VA 4LIUA 2MPFA 4MG2A 5FYZA 4Z92B 5FP7A 5FZ4A 2J42A 2WWJA 4KQ7A 3KS7A 5LBFA 4LHLA 5IFTA 2RDQA 3K46A 4BH9A 1W3XA 4XFAA 3WF3A 3WF0A 2R7EB 4GB31 4I01A 3M3CA 4FXKB 2P2KA 3KT7A 1WMXA 2DURA 2QQOA 3HNMA 4W8JA 1NY71 1RUE2 3UETA 4A45A 2DCKA 3VBUB 3BCWA 1WCDJ 4W6YA 5GZDA 3ZDVA 3RZMA 1I9RA 1SFNA 4CU8A 4BOWA 1UOBA 5J1XA 4A7KA 3IM0A 2JJ6A 1CZTA 2ERFA 2HWF3 3FJSA 1H8TC 5EV7A 1GZWA 1GMMA 1UYZA 2D6OX 4BIFA 2UY9A 2R072 1EV12 2A3WA 5LZ6A 3DN7A 2IWGB 5LASA 3VGIA 3KD4A 1VBB2 1W8HA 3AL6A 2R061 4M3CE 3WW3A 4A3XA 1AR62 1KEXA 1W9FA 1KXGA 1QGLA 4IV1A 4LBNA 3ACHA 5CFCC 4NHYA 1KS4A 1ONAA 1H4GA 2PN5A 3DEMA 2OT7A 4IGQA 4J6GA 1UMIA 2HJIA 1S0FA 2VZSA 1EYBA 4FTEA 3LA3A 1RUH1 3W59A 3HNBM 4NRQA 1H6XA 4LITA 5FZOA 2Z5WA 3NL1A 2VD7A 1YQ8A 2BW8A 3HD8B 3T09A 4PI2A 4CDXB 2VBBA 3KV6A 1NZCA 4HLTA 3WEZA 4Y5SA 5EJZB 3DYOA 1IS5A 2PLV1 4CYDA 1Z78A 1SLBA 5FZ1A 1FMD1 1VBE3 3VHRA 3KCXA 4LKEA 3ZYJB 1QEXA 3THTA 1UPIA 4LO6B 5FQ0B 1JN2P 3ROUA 1QOOA 3VHNA 1W6QA 1RUC2 2VZ1A 4IE7A 3IMMA 4M4PA 1SCSA 1BVP1 1JOBA 2R041 3ACGA 3C7OA 2YFUA 4LO4B 4A41A 4AFMA 5LA0A 1RUC3 3E5UA 5FXXA 2YBSA 3RZKA 1Q43A 1T6BX 2FCVA 5FYBA 2Q8OA 1O4ZA 1Y7BA 4K9SA 1JZ7A 5F8PA 1KDMA 1QMJA 4ZS2A 4GMP1 1NY72 1RUE1 3TAYA 5FZHA 1YQ2A 3NV2A 4KNCA 3K2OA 2R0FA 4FI9A 1GNHA 3S30A 1ST8A 3I3QA 4QKBA 5I0UA 2W47A 4WZFA 2JG8C 2GSYA 5J96B 4K40A 5KWRA 2XONA 1S2EA 1I6XA 1MS8A 2A73B 4NAOA 5FOBB 5GLWA 3ZDSA 4OZOA 1SZBA 3SH3A 3FE5A 3ZFFB 1V70A 3P1IA 2JD9A 1ZBE2 1LOBA 1YFXA 4JKMA 1VBD3 4NPMA 3JBG2 4D3WA 1PK6A 3POEA 5DUXA 5FLHA 3FWEA 3I97A 1LHVA 3G7DA 1JHNA 2UWBA 2RDRA 4FFIA 3HMYA 4Q4Y2 1VBB3 1VB2A 1S0JA 5L73A 2JKBA 1BK1A 5C6CA 2OX0A 2RR13 2P6HA 2ZGQA 1EV13 2GN3A 3BVCA 3K4AA 4Z82A 2D3PA 4C91A 4CDUC 3VD5A 1RUI2 5T50A 3R05A 3KVBA 1YO8A 4AVTA 3RYRA 3A0NA 2ARBA 4LBJA 4YW6A 4MGIE 4AW7A 2VBPA 5FZBA 3OEAA 4L99A 5LBCA 2W92A 5F2SA 1US3A 4W4ZA 4D94A 1IKPA 5KHJA 3I2FA 3KQRA 2DBNA 4Q1RA 2WNVA 3GBGA 1CAXA 2W39A 5J37A 3SH5A 2WSUA 2KXLA 1RGSA 5E16A 2XDVA 3ORJA 1PO23 2J22A 3AMQA 4QAWA 3VDCA 1MS9A 1AR63 1CAUB 1XPWA 3CO2A 2TUNA 3T0DA 1WMFA 3AK0A 5JXJA 4QU2A 3TB0A 2VNVA 3O0XA 3LZZA 3H1MA 1IPJA 1QWRA 5K4LA 5AC92 5T5PA 2ZKLA 4NHKA 5GZGA 5JZGB 2XVGA 1ALYA 2ZTNA 2HWC3 3NNFA 5FMCA 1W2TA 4E4HA 2BNOA 1FMD3 4XMAA 2X05A 5A70A 1UYXA 2YDEA 4D8MA 4K21A 5DN2A 2XBO2 3H1WA 5EYXA 3K77A 2JKXA 3LEIA 2VVDA 2ZX1A 2WINB 1QJU1 2ZZJA 5KXCA 1PM4A 1VE0A 4ASMB 4NMIA 1LENA 5FP9A 3UL2A 1R1ZA 4BQ3A 5C4WC 3FHQA 1RJ8A 1W9TA 3ZIXA 5C4WB 4HPKA 2VOWA 4OHWA 1F31A 2BNNA 1ZBA1 1QF3A 3NNMA 4IQPA 5L7OB 1WCSA 2MNGA 1HB2A 3HQUA 1EPZA 1MS0A 2WA4A 4CP1A 3AZWA 3D0JA 2D6LX 1XNAA 1PK6C 1S55A 4XEZA 4YW1A 5A6XA 1OFSA 3KF3A 2ZGLA 2ZBJA 4RQPA 5IUQA 3VBUC 2BBVA 1HJFA 3NO8A 3CJIC 3ZMOA 2ORXA 2GP3A 2GALA 2UYAA 3OSDA 4H14A 4N53A 4I02A 1MS1A 3ECQA 2Y64A 4B4QA 2JDPA 3VBRC 4XF4A 3USSA 4AEJA 1OKQA 2VW0A 1A6CA 2VTXA 1LGNA 3VBFA 4FQ4A 4XURA 4IW3A 3MV01 1FV3A 2AACA 2ZJCA 5C3OA 4MXWA 1ODNA 4FPEA 1Z7S2 1C8NA 3VDBA 1AR82 1W03A 5CIRA 1RYYA 4HN1A 2GNTA 5LRSA 1K12A 1BXHA 4K3UA 3WP6A 1HB3A 2WN2A 2XHNA 4RSUA 1JZ2A 5FZLA 5L7OC 2P17A 1BEV2 2C9AA 4PBOA 1W8WA 4AGVA 3X29B 4TTGA 3AL5A 1ZZBA 1E57A 1ZZ6A 3OBZA 4JGYB 3NVCA 2QQLA 4QX1A 1I1EA 4P14A 1OC1A 1AL22 1C28A 1LOAA 1ND3B 1STMA 4IEXA 4Y20A 2ZA9A 1QQP3 4B7EA 4BA6A 5FPUA 1WBLA 4BQYA 3UKNA 3ZMNA 1AVBA 2OUJA 5CKNA 4A2UA 1GFF2 4FPCA 4WVWA 2ZEWA 1GSLA 4FTBA 2G4IA 3S6PA 1AYN1 4P9GA 1BKZA 4BQ5A 3B9CA 3TEXA 4EWAA 2VXJA 1SLLA 2FQPA 3AXDA 3APBA 4NE9A 2P37A 4XJ9A 3MFAA 2IXHA 5IVBA 1MEC1 1VMJA 1HXS3 2ZHKA 4HZFA 5T55A 4LPLA 1OLQA 4AEKA 2RS51 4JDNA 5FYUA 2V4AA 2CDOA 1DQ0A 3THPA 4AGRA 4GALA 1BMV1 1ND2A 2R0HA 2CYFA 2GH2A 3MPBA 1JI6A 5DDJ1 3S5QA 1W8NA 4XBQA 4AGGA 1I3HA 1JODA 1E5RA 2SBAA 4IESA 5CFDC 5HCHA 5ACA3 4R8HA 1PVC2 5SV5A 4U2AA 4B3NA 1DIWA 4BWOA 1CR7A 2Q5TA 2WYFA 2GC1A 3ALQA 3LIHA 1V6NA 3CJIA 5LY2A 4QX5A 3GJAA 1UKRA 4C1XA 1N1SA 1VALA 2YBKA 4UFMA 3ZFGA 3WLUA 1BBT2 1FOD3 2WYSA 3VBFC 4AVAA 1O4YA 3GCWA 1RUH2 3R4UA 1AXZA 1BBT3 2VMFA 4UW6A 1D2QA 4XQ4A 2DVGA 4H2AA 2FDKA 1JOJA 1AR72 3ZSJA 3LEKA 4NHXA 4QDSA 2A6XA 2PLV2 2D43A 3LPFA 4GMP3 4R52A 1MPXA 3ZR5A 3RZHA 4C8DA 4QDRA 2V72A 2JG8B 2KM2A 2ZCWA 4XILA 4C0BA 2DVFA 4IEQA 2Y34A 1PVXA 4ASKA 4JZRA 1G86A 1NQDA 1RMU2 2N7GA 3FX3A 1G9FA 2RS11 4CEYC 2J1EA 2Z69A 4JC1A 4AQ2A 3D82A 5IVFA 2NQYA 1UX7A 3MEPA 2O8QA 4OCTA 4TN7A 4XYXA 3C7GA 1W9WA 3WDVA 3WQ1A 3RYKA 1JZ6A 3OG2A 4FAHA 2FMYA 2XLFA 4XAEA 2WDBA 4N7UA 4RGKA 2VTXJ 1VRBA 2B9UA 3VBOC 3LFIA 2A71A 1AX2A 1NE6A 3KV5A 4B4RA 3OF1A 4INDA 2BZDA 2WSVA 1ULOA 3IDCB 1HX6A 2B5HA 1AL23 1GOHA 3O5SA 5FPZA 3VHPA 4IEVA 2EA7A 2O1QA 4IERA 5IK4A 4LORA 1FNZA 1SEFA 1JYCA 3GZEA 4LOTA 5AFEA 3EB7A 3KQ4B 1PVC1 3NV3A 1OHFA 5CFDA 4AI9A 4LO8A 2QBXA 5JR7B 2G19A 4L97A 2V5YA 4FPOB 4F3JA 1SPPB 4L8QA 4L92A 2ZGRA 4UW5A 5FZKA 4JAAA 4XF9A 5JI7A 1WCKA 4BXSV 5JOYA 1NKGA 3A4UA 3JCIA 4QKNA 5FR3A 2ZX3A 2A75A 3MW4A 4RD7A 5FZFA 1UY1A 4XVHA 2UURA 3ZFEC 2QFEA 5I0DA 3SH4A 1JZ8A 3T4HB 3CIHA 2Y6GA 3WW1A 2GMPA 1NLSA 1UMZA 2GNMA 3N7JA 1C8M2 5FZCA 2XJQA 2FDGA 3WHTA 3M2MA 2W87A 3RDIA 2ZPXA 3A7QA 1B35B 5DDJ2 5FZ7A 4XIKA 4FFGA 3I2OA 4NAMA 1A8DA 3NJYA 2CGPA 2E63A 4DY3A 2DU0A 4E8DA 4HL0A 3DYPA 4XXPA 2R16A 1R091 2JDAA 1L7QA 3C3VA 4ZZ8A 5B4XA 5FP3A 1CONA 4MZUA 5DG1A 2WT1A 5DG2A 1UU6A 2DTYA 3T2TA 2XBO1 1KQRA 2RM22 2QQKA 3FBMA 1H2KA 2LROA 4OZXA 1LU2A 1NCRC 2A1XA 4LXLA 4DXTA 5A3PA 1R1A1 4JGYC 2HWC2 1CQ9A 2YMZA 3MBWA 4DOUA 1CGPA 3VDDA 4A6SA 2TNFA 1YCIA 1S0EA 3GCXA 5FLIA 5FXWA 1LOCA 2XGXA 3FL7A 5A3OA 4AQ6A 3AYDA 5IYYA 1OOPC 2BRTA 3VBSA 1OQDA 1HV0A 4AVSA 4G3YC 2AREA 1S0GA 1DQ6A 2R071 4W6WA 2RHPA 3OUIA 1IKQA 1ZM1A 2A6VA 4KWJA 1HRI3 4FPLA 5E6HA 2B8MA 5A1FA 3VZLA 3JUUA 5JSRA 3CBNA 1LEDA 4K20A 1XYNA 1ZA4A 4M3CF 3SCFA 3VBUA 4AFAA 2E7QA 3CJXA 1BLZA 1VB4A 2HWB1 3F2ZA 5BNOC 4XQWA 4R4ZA 3FUOA 5AVPA 4HSJA 3K48A 3ZFEA 4E27A 2VZRA 1DGWA 4GB32 4LJHA 1Q5OA 2RR12 1W6NB 3GZUC 2DCZA 2WO1A 3S7IA 1PGL2 5FQ0A 5IVJA 4O9GA 3I2JA 1RUJ1 3NNGA 1B09A 1X82A 2BJSA 4P9YA 4ASLA 4K6BA 4XJWA 1PO11 2RS31 3FFQA 3VB9A 1QQP2 1LCLA 1JUHA 4HKWA 1HRV1 1NLRA 2VZVA 4XPVA 1EUUA 4QXBA 1OD3A 2XR4A 3O1MA 3AZZA 3FMGA 3NNLA 4K8RB 1REDA 1POQA 4Y1UA 2B39A 3ACLA 4BLIA 3KHCA 4Y1XA 3B3QE 3WUCA 4AAXA 4QXHA 4JTNA 3PJYA 3K3OA 2VNRA 2WFF3 4URAA 3BI3A 5T5OA 4AFDA 4AEDA 2YC0A 4JQTA 5LB6A 5BNNA 3OYWA 3UJQA 3MO4A 1DCSA 2BYVE 3WG4A 1TME2 2W95A 1DFQA 4OQ8A 1C5HA 2NYYA 1B35C 3Q8BA 2VBDA 4Q4W3 2RJ2A 4WVMB 1JYIA 1AF9A 1RUJ2 1PK6B 1MZ5A 1EAH1 2BTVC 1CX4A 2HBUA 5FP8A 1YXWA 3AMMA 4HBNA 5B2GB 1SBEA 1CPNA 1OVSA 4B7KA 2WWUA 5JI9A 3ZN6B 5ABJB 3LDBA 1R64A 3EBRA 3LDRA 5CVRA 3BYWA 4KG0A 3MIEA 3DECA 4PLOA 1VBB1 3OPTA 3I2HA 2YBPA 1ZBE1 4CCEA 1DYOA 4N9HA 2VQUA 4BU2A 4CDUB 5C71A 2HWD2 2R042 4Q4Y1 1RHI1 3H7YA 3VKNA 4AYUA 1UXZA 1ENXA 4D6SA 1O91A 1PGW2 1HDKA 3POJA 1HN1A 1V9U2 1NT0A 5EHDA 2JX9A 2AEYA 1MZEA 5F32A 2WO2A 3PU3A 4YVSC 1R083 2VAUA 3ZXFA 1SFYA 2XBO3 5I0TA 3LOBA 1MEC3 3ZYPA 3AMNA 5EZWA 2QVSB 3ZSLA 4PDWC 5FYTA 1D4M3 1OUSA 2EAKA 2Y6KA 3GM8A 3ZSKA 4DRVA 3MW3A 1GZ9A 2NN8A 3H3ZA 1JS9A 4Y1YA 1D4M2 1GQPA 1W90A 1J84A 2QZ3A 5A6YA 3H0OA 1UIKA 4CDWB 1IQDC 1LESA 5GKAC 3J7HA 3Q8CA 4AEMA 4Y5TA 4DMIA 4OHYA 1PO22 2Y60A 3I2KA 3AZXA 4H3WA 3H50A 4XDOA 5C5UA 3MLLA 5C3QA 5DUUA 4CEYB 5FK8A 2J1VA 2VQTA 4FOVA 2ZACA 4IXLA 1UY2A 5DABA 2HYXA 1UX6A 4ZKTB 5FCCA 4DIQA 1PO13 2RS33 1EAH3 1W2AX 1PGL1 3VBOA 4CU9A 4BISA 4UF0B 2ZHNA 5GZEA 3VL9A 2AR6A 4AZZA 1RUI3 4JDOA 1S0DA 2XB6C 3OUJA 4PCRA 4MGSA 4XCAA 5JMOA 1UYPA 1OBNA 2XJRA 1RUG1 1WKYA 4ISRA 5FZ8A 4AAPA 3MLJA 1QDCA 3JBG1 4XUTA 3T0BA 3VBFB 3WW4A 3C7HA 1MQTB 5CBLA 4OI0A 4PQQA 2V73A 3KCYA 3WDXA 1S2KA 4Q4W2 2AYHA 5FY5A 3ZXKA 4CUAA 2XVKA 3T1MA 5FK7A 4ZZ5A 1YIPA 2VMCA 1ZREA 4UT5A 4YZ5A 1IPKA 3T3YA 1U5XA 3MZHA 1OFNA 5K0UC 4IE5A 2J1AA 2YUEA 3AKPA 4AFBA 1BCXA 1DYKA 5AVAA 2FHRA 2LW8A 3WSOA 4LUKA 4WVZA 2X53S 5JXHA 2Z79A 3DL3A 3OY8A 1NQJA 1REEA 3ES4A 1LOGA 2IVIB 3DYMA 1R1A3 1QJEA 5FKCA 1OQ1A 2WAOA 1D4M1 2D98A 2F4LA 4AHZA 1TVGA 3WF2A 3LQCA 3VKLA 4QX8A 1DQ1A 1ZA7A 4ES8A 1OURA 3JD73 4XFIA 1VMHA 2WJSA 2AEZA 1K5MA 2GMEA 5GLTA 3M70A 1YQ5A 4AG4A 5K0UB 5JVVA 3ETPA 3O1PA 3K75B 3J8F2 5JXIA 3RJRA 1QJU2 1W6MA 3MDPA 5K8SA 4JGYA 4A7YA 2BNMA 4Y20B 4LBQD 4UFKA 1RL3A 1ZRCA 1WWYA 4IEOA 4XUNA 2HEVF 3VD4A 4ZXKA 2OUHA 4M00A 4MV2A 5LY1A 1NXMA 4NIIA 5G04L 4X8PA 4LBKA 1EV11 2WNEA 2XL9A 3IMNA 4FQZA 5DXDA 3VBHA 4E8CA 5I0RA 5JOXA 5JWPA 5APAA 3DPRB 3U75A 3RZGA 1XOYA 3V64A 1ULPA 2E7TA 3B9IA 4IE0A 4W6XA 4Y4RA 4D7TA 4HKOA 3KZ4C 3ZYIB 2WBKA 4L11A 5FPAA 2FMDA 3HQXA 4A44A 2CNAA 2NP0A 5L19A 1YYNA 4XJ8A 4CA9A 4YGDA 1ND2B 4ITCA 4Y26A 4CCOA 2NPIA 3RPQA 3OGRA 5EJ1B 2P6CA 4CDQB 3BB6A 2E26A 1VR3A 1WA6X 4MYEA 1RUE3 4COWA 1IPSA 3BTZA 5IAVA 1W2NA 2XQRA 1IQAA 4LBLA 3IIIA 5F6LB 1R1A2 2W1SA 4I0BA 1V6LA 1OPMA 1QJY1 1W04A 1QU0A 1TQ5A 2RJLA 3E97A 3QOPA 4QGMA 1ZNPA 5A6QA 1AZDA 1O5LA 2VCBA 3W20A 3ZM8A 1QJZA 3IAPA 2PHRA 3U07A 1WLDA 2HEYF 4CP9B 3EQEA 2YC2A 3LWCA 1S1AA 1KJRA 2WS91 4LQRA 4EROA 1FPN1 3AP5A 1OLRA 3I2IA 4LK7A 4WM7C 2J7MA 4IEYA 2YY1A 4FSJA 2B45X 2OYZA 5JZGC 1UY4A 2V09A 3BGAA 1XBFA 4LEJA 1ASJ2 1MZ6A 5FOJB 3A23A 4YVWB 3ZIWA 3LA2A 1VBD1 3BOPA 3A22A 4N90A 4MGTA 2EXHA 1VJ2A 3GALA 1WCQA 5JIAA 5A7WA 1W6QB 3JU9A 1W0NA 1ZVFA 2IFRA 3GBWA 2JDYA 5CFCA 5G05L 4X8NA 3DF0A 1NAEA 1ZBA2 4LHKA 3UJOA 3VBHC 1SQ4A 4NIHA 5GJ6A 4A6OA 5DAVA 2X5IA 4RYDA 4P00B 1AYM1 2VG9A 2YZ4A 1KRIA 1OA4A 2H6BA 4IDZA 4X6QB 4FTSA 2VGDA 2JEMA 2FZ2A 4N43A 5IFPA 3PVBB 3M3OA 3N7MA 3ST7A 2HWE1 3V0AA 1ZZCA 3WDUA 1UO9A 5BNOB 4C0HA 2D40A 3I3BA 2VCCA 1RUI1 1DGRA 1V9U1 4YRDA 4HSLA 5FBZA 4Y24A 4CDWA 4JCKA 2KR2A 2YGMA 4EN9B 4LNVA 1IG3A 1RUD1 2VOTA 1QXJA 2V5DA 4Q1PA 4YVSA 5HXMA 1M4WA 1COV1 1JH5A 4LMFA 4UFIA 2VUCA 1F2NA 3FHAA 3NKTA 3IT8A 3MIGA 3MIHA 1YWKA 4CCLA 2WRAA 3U0ZA 2R49A 3DV8A 5FZDA 4QX3A 4C1WA 4YZ1A 1R082 3B02A 4V2WA 5A32B 4PIYA 2A6YA 3GYDA 4MADA 1W6PB 3IBMA 1W8UA 2MEV3 4OI1A 3PMEA 4KU8A 4LR4A 1VLNA 4QM8A 4RHV2 3LD8A 2YGLA 1DBNA 3WDTA 3ZXJA 3AC0A 4RFT0 4D6RA 1Q8PA 4BJ0A 1DZTA 1NCRB 1POV3 2DWRA 2QQUA 1ENQA 2VNGA 2VMHA 4XIOA 2W5FA 4BQ4A 3THDA 1OXCA 5FUNA 2OW4A 3BODA 2DTWA 4GAZA 2A5ZA 4K8FA 1YJLA 5FAXA 1N47A 3VN4A 5JXGA 4GH4B 4QD2A 4QKFA 1PNFA 2D3SA 2HKXA 4FPGA 4JTOA 3L9JT 4FFHA 4XTMA 4YG3A 4AHXA 3I49A 3POBA 2A70A 1CVNA 5FFOC 2BGPA 1RUJ3 2NLRA 4AWDA 2J1UA 1W05A 4HONA 2I74A 5GM0A 5KXBA 3O14A 2JICA 3J4UH 2ZS6B 2X5IC 1NYWA 4LKFA 1H1AA 2Z42A 4YNIA 3RJ2X 3ZFEB 2CGNA 4JX0A 3O0WA 4IEZA 4YW5A 4BK4A 1O3QA 4LT5A 1ENSA 2B9VA 4OUMA 5BY5A 3FLTA 1AYN3 3PIGA 4KG8A 4PQ9A 1LR5A 3CLPA 3RS6A 4QPIB 1PO21 4K1ZA 4B1LA 5C8CC 1RUF2 4KBZA 5FYCA 4EJRA 2YC4A 4CDWC 4XHXA 1HRI1 2XMLA 4HPKB 3U14A 3ZLIA 2WZR1 2RMU1 2YU1A 3S57A 3QH7A 4GWIA 4CUCA 2YV8A 4HANA 4UYBA 3ZXDA 2RS52 2RR11 5BV6A 2W9XA 4MX3A 2W46A 2AGSA 1X9PA 2ZEYA 4XW3A 2HYKA 1H0BA 1HRV3 4Q4V2 3GHNA 2VUAA 5FZMA 3ENRA 4RR3A 1X33A 1W6MB 4BQ1A 2XLGA 3IZOA 4UXAA 1XNCA 3TYJA 5JOZA 5FYYA 5A3NA 3VUOA 1XJAA 3AFGA 3OYWB 4GB33 4XDPA 4KWLA 5C3RA 3M1HA 1HJGA 2C24A 3HEIA 3K4DA 3KVAA 4GQ7A 4J1WA 1V6OA 5EQUA 4PI0A 4FFFA 1W06A 1AR83 2HWE2 1Z7S3 4DINB 2PFWA 4YW3A 1VBC2 5BXXA 1BBT1 3K3NA 4FPJA 4MH0E 1WLWA 2JIJA 3FBYA 3RI9A 4LBMA 2I07B 1W8ZA 2OVUA 3H7JA 2PHXA 3RMXA 3UGGA 1HRI2 3VDAA 3WP3A 1J3PA 3V0BB 2ZEZA 3KB5A 2EIDA 3EMRA 4YFZA 4YW7A 4HKLA 1H2MA 4EWEA 4B4PA 1VBA1 3B5LB 2VM9A 4OVEA 1PM7A 1AR92 1OA2A 2CSGA 3EHKA 5TSWA 2IXCA 4N53C 3MLKA 2UYBA 3BN6A 4N9IA 5CG8A 1UY0A 2B7YA 2QJVA 5KHHA 3PUHA 1AHSA 2YB7A 1RMU1 2XJTA 2OQ7A 3ACIA 1C3HA 5DZEA 4D0QA 3NAPB 4JGZB 3BUCA 1XC6A 4YM1A 1BYHA 1PZ7A 1UZWA 1WZXA 1FX5A 3AMHA 2W1UA 5F3GA 2DV9A 3WNXA 3UNPA 2WUHA 1UZZA 2I45A 5FUIA 4M3CB 1DLLA 3LE0A 1Q56A 5L9VA 3WF4A 3LKJA 3DUIA 2D6PA 4EN8B 3U4XA 1RUNA 1JBCA 1A78A 2RMU2 3AP9A 3PLQA 1GNZA 1AR71 1V6MA 3GGLA 2CL2A 2F17A 1F9KA 2ENRA 4M01A 2D5HA 2ZGUA 4YLZA 1WUVA 3PMSA 2QKDA 1Q8OA 5I91A 2H0VA 1YHFA 1AR91 4PLMA 2DUQA 4FXGB 4PF1A 4DFSA 2VZQA 2Q0AA 3KSCA 4OUEA 3ZFGB 2AUYA 1UWWA 4E4DX 3MGUA 5F5IA 1RITA 2P34A 2ARXA 5GZCA 3T0AA 2EVXA 4XE9A 1VP6A 1A3KA 1QJX1 3ZSEA 2D6KA 1U12A 4BB3A 4IE4A 2VUJA 2A3YA 1RUD3 4RGGA 2YU2A 1GANA 3VZJA 1CAUA 1ZX5A 4FPYA 2I2SA 3ZN5A 4DRRA 4CEWC 2ZHMA 1M06G 2QQIA 4WM7B 1A8MA 5DUVA 3UKTA 1VRH1 2VZPA 3ZYHA 5A32A 3VHOA 4NWVA 2VL4A 3WDWA 1Y43B 4XF3A 4RQPB 2UY8A 3TBDA 2Q1ZB 3GZTB 4NRPA 2DF7A 5CZKA 1REFA 5F2WA 4EWDA 3TRSB 3ZXAC 2WQ4A 2ZGTA 1GQGA 1FAYA 3HPNA 3O1UA 2A6ZA 1CZSA 3JBG3 4TSVA 2O14A 4XFGA 2BQPA 4EE2A 2Y6HA 4EQVA 1HQLA 4Q4X1 4CXYA 1GOFA 2RS53 3K51A 5CB7A 3P3NA 5LBEA 2JXAA 3HN1A 1O5UA 1JU3A 4Q27A 5DAWA 4KBBA 3LF7A 1LOFA 1ZZ9A 4YYOA 1S4CA 2HBTA 4ZHNA 3IN9A 2RV9A 4AVBA 3NWKA 3D8CA 2W08A 4Q8KA 5A33A 3AYCA 1WW4A 1AYN2 1G6NA 3PTRB 3AP6A 2DFBA 4S2FA 4ET7A 3WNMA 1RMU3 5IVEA 2DCTA 2B4KA 1CPMA 1SLAA 1NA1A 1H4HA 1XYPA 4HG6B 1S0BA 1COV2 1AJOA 1NG0A 2RS13 2ARCA 4N53B 4Q29A 1LB2A 4KH9A 2P3YA 4IL7A 2EAAA 4O65A 3OGGA 1OOPB 3SKVA 4YZ4A 2VQ0A 5FV3A 1QJX3 3W58A 3SC7X 1UOJA 4UI9L 4F8AA 2BDRA 3FN9A 5I8TA 3S5AA 4HETA 4NN0A 2JE9A 1LEMA 2R062 2W1QA 1QOSA 3BKZA 4CDQC 2DVDA 2VULA 3W21A 4HN0A 2WO7A 1F15A 4Q4W1 1JU4A 1CESA 2JDUA 4COVA 5F7UA 3EYPA 5DMYA 4RHV3 4CU7A 2Y33A 4AI3A 2Q1FA 4QX0A 4QGNA 1F35A 3POIA 3UV9A 2PA7A 4AQTA 4Z2WA 1ZRFA 1PIV1 1EPWA 3CJIB 4AOCA 1ZZ8A 3N9MA 4L9BA 2VC9A 5FYVA 1QJU3 4A7ZA 3C7EA 1G9BA 4IGOA 3WP5A 4WBBA 1UU5A 4Q0SA 1K5MB 4YZ2A 1GP6A 1RVF3 2LUWA 2JG9C 4YFWA 4BDVB 5C7GA 3PURA 2CWMA 1SDDB 4CUBA 1LOFC 5D21A 2EXIA 2JWPA 2ZGMA 2Y0OA 1OMIA 5FPBA 2VW2A 1CZVA 2GU9A 4CP2A 3G6JB 2QUOA 1H8TA 3EJKA 5H9QA 2DCJA 5ANNA 3VDDB 3ZPYA 1E5IA 4QKDA 1QJY3 2BERA 2GNDA 2VXRA 1PGW1 3C2UA 3SEEA 4JGZA 5GLZA 2PQSA 2BP6A 1V6KA 1W39A 3WQ0A 1WW5A 5FPLA 5LEJA 1ZBA3 2F6BA 3ZX7A 2CDPA 4IV1C 3V65A 2DYCA 2VU9A 2ZAAA 1LGBA 3O1OA 5DAQA 3ZFFC 4NIAA 3CMGA 1FPN3 2W94A 4A4AA 3HQRA 5KHKA 2WS93 4Q26A 4J1XA 5CADA 5C3PA 4WM8A 4L2NA 5FZIA 4CDQA 4OHZA 2VZTA 1JZ3A 1K3IA 3D5OA 4LHSA 4OHXA 4XCBA 1RXGA 1XE8A 3NNJA 4LKDA 1AJKA 1NLQA 1EUTA 1FATA 4YGEA 2BV4A 3N3HA 4P9IA 1WLCA 1PZ9A 1XYOA 2OS2A 2PAEA 4R9BA 2JG8A 3ACFA 3VDDC 3IDEA 1UIJA 2O8OA 3E6BA 4BMBA 3TEYA 4MXVA 3VZMA 1F5JA 3NJZA 4ATEA 5CFDB 5FWJA 3S0MA 3MFCA 3VBSC 3P6BA 1PIV2 1WMEA 5L36A 4OMDA 4OUSA 3ZKYA 1A34A 3TEWA 1ULEA 1XSRA 2WNUC 4FPFA 4Q0PA 1PIV3 4QGLA 4MVTA 2X5IB 5HV0A 3E6CC 1EAH2 1AX1A 1XNDA 3N9LA 4FVVA 1N1TA 3U78A 3VLBB 3WT3A 2QNKA 5J98B 2PHFA 5LRRA 1O3RA 2CTVA 1XNBA 4CSWA 5FLJA 4NWWA 4R4XA 3WG2A 4XFCA 4CPBA 3M8LA 4EZ4A 3MV11 5BPXA 3Q8FA 1UZYA 2WFF1 4ZU4A 2VMIA 1N3OA 4KL1A 4IEUA 4YG0A 3QLQA 2WS92 3IPVB 1MS5A 2WNUB 3HVDA 2QE3A 4QT6A 3OJBA 2RM21 4MUVA 3SCHA 3OCPA 3R0RA 2DUPA 5AC93 4E2GA 5CFCB 1RVF2 1MVQA 3CZJA 1I5ZA 3ZXLA 4BQ2A 1WMDA 1J1LA 1W0PA 5FMDA 3THCA 2VOVA 4RFRB 4JRAA 1QY4A 4ORFA 4PIZA 3JB8A 3O1SA 3ZO0B 5LA2A 1Y9QA 2Q30A 3MUZ1 3ZVXA 2RDNA 2JB8A 2VJXA 4UOJA 3I8TA 3BIEA 2W0XA 3NSTA 4DEQA 1UZVA 1KS5A 3ZYFA 4AEDC 4CDUA 4I3PA 2D7FA 2XOMA 2IFWA 1RUG2 2JE7A 3OPZA 4P08A 4HOOA 5FWEA 3FLRA 4NOTA 2W68A 2FCTA 1GZTA 5FMOS 4NHMA 5E8AA 4O7XA 4YM2A 2BOJA 3M3QA 3ES1A 4AI1A 5CEHA 1OUXA 3KV9A 2BVVA 4NHLA 1B35A 2HWB2 2W52A 4YVSB 4CVUA 2WNVC 5FUPA 4BM8A 1OH3A 2C26A 5DAPA 1X50A 3K4ZA 1OQEA 4IV3A 4Q4Y3 3SMHA 4CCDA 1NE4A 5C33A 3R4DB 1NCQC 1J3RA 1PMIA 1TNFA 2D6NA 1VBD2 5FKBA 1ZBE3 2OKXA 1UQXA 2WT0A 4QX2A 5FY4A 5C5TA 3E5QA 3HOBA 4I30A 5I93A 5A33B 2VECA 4TYSA 3VZNA 5HBAA 1OI6A 1CAVA 1LKNA 3I3DA 3M7AA 2B46X 4FP3A 3OBAA 2VZUA 1YFWA 4RS5C 3NV4A 3U37A 4BIOA 4LLFA 2BFUS 5C70A 5E89A 5HCFA 1QXPA 2L9LA 4QX7A 4QPIA 1UN1A 5H9SA 3QD6A 4HFSA 4DUWA 4CZSA 4GXLA 2VY0A 5FYMA 3N4MA 1NCQB 1W99A 4E4ZA 4Y33A 2BU9A 4D69A 5F37A 2Y0IA 5C4WA 1QJX2 3FHIB 4GH4A 2XG3A 5FY0A 3MIDA 3N7LA 4AHYA 3O1VA 1Y9MA 3RZZA 1GYKA 4NPLA 2ZX2A 3AKTA 3ZOIA 1JMUB 4COUA 3KT4A 3WV6A 5JR2A 4GKXA 1SCRA 2WT2A 2DVBA 2Y38A 2YPJA 3A0KA 3NRUA 1WCUA 4P9JA 4RL7A 1V00A 5F39A 3AX4A 2FBEA 4H55A 4DQAA 3H9AA 1ND3A 4YWAA 3ITQA 3MI8A 2DBIA 2R1BA 2GMMA 4ONUA 3LFMA 4A3ZA 5J7MA 3Q9OA 1GLHA 3VBRA 4Q0UA 1W6NA 5A6ZA 4UFLA 1H2NA 1PO12 2RS32 5A7PA 4NVPA 2VQAA 4QPGA 4JDMA 5A7NA 1K42A 2WZEA 1QNWA 2XJVA 2OZJA 3OPWA 1YI7A 1OA3A 3KT1A 2GP5A 1QOTA 3OD4A 3BOWA 4B29A 2ET1A 4UWDA 2NMOA 4H7LA 1G8WA 3TN93 2D5FA 4GWJA 4LBQB 1O8PA 2ZAHA 1OLME 1ND2C 4QQPA 3ZYGA 3NMBA 4EZHA 5FBJA 3T4VA 4WM8B 3PDQA 2R30A 2IUWA 3O12A 1H30A 3BTAA 4WVVA 4PT6A 5EIYB 2R073 4KWUA 5EJ3A 1JXNA 1Z7S1 2EALA 4KI5M 4ARXA 2IC1A 3KCCA 2JDMA 3OOXA 4FOWA 4I09A 4LOSA 5JUVA 2IXLA 4HT1T 4P02B 4E2QA 2LRPA 2VMEA 1WA4A 3ZFGC 1O6UA 1PNGA 4FOQA 4XJZA 4XDQA 2W1WA 4Q4V1 3PNAA 3J7LA 3FZ3A 4QPWA 1X8MA 1U5YA 2WNOA 1PX4A 3O7OA 1DGWX 5HV4A 1RINA 2RDSA 3N9PA 4TWTA 4QPYA 3V56A 4LLOA 4ARYA 4X6RB 1CX1A 4S2GA 2BFUL 1D4VB 1H2LA 2WC2A 4LO5B 1IS6A 5ABJA 1E5HA 1F4AA 4I0WB 4ZXEA 1RUF1 3IIAA 3LOIA 3WG1A 2BGCA 2QDRA 4MO3M 3I7DA 1BK0A 2VUDA 4YVWC 2XJPA 1AR93 1VMFA 1XNKA 2DDUA 2PELA 3POWA 4JGZC 4XF1A 4XFFA 5F5QA 2A7AA 5L9BA 1TEIA 3AYEA 2IXIA 3HBZA 4V2VA 2G1MA 1WD4A 3NAPC 5FREA 5C9AC 4YM3A 3VL8A 1C8M1 1WW6A 3NKGA 2ZABA 3OBRA 3MF9A 4IV1B 4I2OA 1G7YA 2E33A 1APNA 1X36A 4CCCA 1JYWA 3OGVA 1FOD1 4ZS3A 4QPGC 3VBOB 5FY1A 3RVHA 2HWE3 4DUXA 3I54A 2EICA 2VCAA 4XHBA 5J36A 1GQHA 1VAMA 3WINE 2O0OA 1ZRDA 3FUQA 4XZUG 1MACA 5IJRA 3HJRA 3HWJA 2GZWA 5ACA1 4COZA 1RIRA 3CEWA 2C4XA 2R6QA 1U0AA 1TG7A 4M4RA 3UK9A 5C8WA 1GP5A 3SKJE 1QH6A 4MGYE 3UGHA 5GZFA 3IPVA 4B8EA 2WNUA 5IHRA 1DP0A 4CEYA 2HWC1 1BMV2 3T2QA 1ULDA 2K0GA 4IV3B 3O1TA 1GKBA 1ZZ7A 2WN3A 3SNMA 1OLMA 1DGRN 3MF6A 3WCRA 4IETA 1C5IA 3H3LA 1P8JA 2YYOA 4DB5A 5JDBA 1OKOA 2HLEA 3JB4C 1N3PA 3HBKA 1X9TA 2C1FA 2ZGOA 2GN7A 4Y5Z0 3B7MA 1WBFA 4ZU5A 4YGCA 5K9YA 1R092 2MEV1 4FCAA 1H6YA 2ZGSA 1L7LA 1RHI3 1O3SA 2F4PA 4DNYA 4LKSA 1BZWA 1YIFA 3E1F1 4XJAA 5FMBA 3U1XA 4R9DA 1GV9A 2VO5A 3J7MA 3OTFA 2HWF1 2KA3A 2MHFA 5GLVA 1SG3A 4H7MA 3ATGA 2PLV3 1W2OA 3ZR6A 4Y22B 5FIXA 4META 2AH2A 3DKQA 2EIEA 1YFUA 3H8RA 3URFA 4I0AA 4OLLA 3CDZB 4AI8A 4CCKA 3EXUA 1D0HA 5JZGA 1DDLA 1RUH3 4UW3A 4ZONA 1FOD2 3KGLA 1FXZA 4RGAA 4FOYA 1QNYA 4AFCA 4COYA 2JIGA 2QQNA 2SLIA 1S2BA 2D44A 4QB2A 5A7SA 3WX5A 2XWJB 4B1MA 1HB4A 2FZ1A 1YRZA 5ACA2 1GZCA 3E6DA 4OYUA 2VOXA 4QQ2A 4XQDA 5LEKA 3USUA 1JOPA 5F3EA 4DUVA 2BGOA 5JAXA 2ZX0A 1XSQA 1VRH2 3ZN4A 2YPDA 1OOPA 3A21A 1NCQA 4P5HA 4LA2A 5FYHA 5LCWL 3OGSA 4NR1A 1O59A 3VBSB 2A3XA 5T5LA 3GDBA 3PJQA 3SLIA 1UU4A 1DGLA 5A1LA 5LK5A 3PUIA 5ISLA 1HLCA 1W6PA 5DDJ3 4PF5A 4AI2A 3OBTA 3TOJA 1Q8VA 1Q8QA 3ILNA 2QQJA 5FJHA 4IE6A 3E5XA 3RQ0A 5A3LA 5BYNA 1PHMA 1ULCA 2CGOA 3BU0A 1H9WA 2TEPA 4XBNA 5CNAA 4JHZA 1SDWA 4DY5A 2OQ6A 2CV6A 1NCRA 4BXFA
chains in the Genus database with same CATH topology
2JECA 3GHMA 1W0OA 3ZXEA 3WY6A 2MEV2 4S2DA 2XL7A 4CDXA 5JMCA 5IK8A 1DZRA 5KC5A 4YW4A 4BZ4A 5LK7B 3VBRB 4GH4C 3WZ1A 4EN0A 1O4TA 4R9AA 1QXRA 3AXEA 3MIBA 3KM5A 3B94A 3AYAA 1S0CA 5D1IA 5E88A 3HT1A 1CD3G 3ILFA 5IK7A 3LB9A 5DZFA 2X8KA 5D8AC 1IS4A 1AXKA 2AZ5A 5K7PA 2H0BA 4BCUA 2XVLA 3GZAA 3N7KA 3B01A 1ND3C 5I8YA 3B00A 4RS5B 4AVCA 2E53A 3W9AA 3KLSA 1FYUA 3AKRA 1Q8SA 4DZGA 2DUOA 1YUDA 3TN92 4IEWA 1BQPA 1IHMA 1AYM2 1IOAA 3FFZA 1BVVA 5FRAA 3B93A 3AM2A 3N35A 4D7SA 4MXWB 2PTMA 5D8AB 2WIIB 3ZXGA 1J1TA 2OA2A 4LTAA 5JSPA 5JOWA 4KU7A 2BEOA 1LHNA 1DQ5A 4QQOA 3WDYA 1LULA 4G4FA 4GULA 5HCAA 2XH6A 1TMF3 5FTTC 3TWIA 4LULA 4AE2A 4QXKA 1JW6A 4XFBA 3V0AB 5FO8B 4DXZA 4AEDB 3USUB 2EF6A 1HQWA 5BNNC 2CAUA 2UWCA 5C8CA 2P3JA 2ES3A 2JD4A 4XTPA 1AR73 1FMD2 3JD71 1DF0A 1KFXL 2YROA 4IEPA 3TNPB 1RUC1 3DKWA 3AZVA 1HV1A 3LAGA 3KGZA 1W6OA 1FT9A 3D6EA 4CTEA 5KXEA 3RNSA 1PVC3 4JQRA 2H6CA 2IZWA 2D93A 4Q0VA 4QQHA 1HQNA 2JDZA 3DGTA 4W65A 4BHPA 3AJZA 1G9CA 5HCBA 1RTVA 3NAPA 5C9AA 5FO9B 2PHDA 5KHIA 3HR9A 4Q4X2 1QQP1 2ATFA 3WD5A 3HT2A 2NZ9A 4MSVA 4M3CA 1SBDA 3PTYA 4Q4X3 3GF6A 1KJLA 3WCSA 1SLIA 1YLLA 3AJYA 1LOEA 2XKPA 3AMPA 2WQZC 5L7OA 2EXKA 2PHWA 4PDWA 1D0GA 1VBE1 3SHRA 2DU1A 3QCWA 5I8SA 5J48A 2G9FA 4TLFA 1RVF1 4TZDA 4PBPA 3J8F1 1LRHA 4YARA 4HK9A 2RE9A 4YZ3A 1O7FA 2ILMA 2ZMKA 3BIWE 1DG6A 4Y1VA 4ES9A 4Z07A 4Z8BA 2XPJA 4ATFA 1G9DA 3JD72 1RUOA 3MIFA 2WA3A 4I3GA 3ELNA 4FPKA 4LE3A 1CAWB 1H9PA 1UAIA 2UU8A 5FO7B 2K9ZA 2GC3A 4EN7B 2DCYA 3FLPA 2D97A 2C5DA 3POYA 5EWSA 4EN6B 5GALA 1COV3 1JUIA 2RS12 2WL1A 2HEWF 1TMF2 4KWKA 1VBE2 2WWSA 1GR3A 5FMOL 1ASJ1 3N36A 1POV0 1C1LA 4K7JA 1MQTA 5DZGA 1LODA 3AP4A 1DQ2A 1C1FA 4ISQA 3WVJA 3LCPA 4QPGB 4XOGA 1LGCA 4M0HA 1G9AA 3PHMA 1AYM3 2GNBA 1POV1 1DHKB 3D0SA 1SBFA 2PHLA 5K0UA 3BU7A 4HK8A 1XXNA 2CAVA 1IGOA 4LO7A 4AF9A 4QM9A 1FPN2 5SV8A 4E9KA 4JRLA 4Y4YA 4WZCA 3CNAA 4M0NA 1IZ3A 2HWF2 1SLCA 3VBHB 4AXOA 3ME2A 1RUD2 1MEC2 3AB0A 1QJY2 1J3QA 3O0VA 1S0IA 2PHUA 4GWMA 1K5MC 2BWCA 5HI0A 3M3IA 2WZPP 1V9U3 2VOKA 4KGGA 3GNEA 1LECA 3H1YA 2VMGA 1AL0G 1AXYA 4F7ZA 1SMVA 2P3IA 1LHOA 2HWD3 4CDXC 1QH7A 3LSEA 4UBHA 1LHUA 5AFBA 4RHV1 5JCTA 1GZWB 1TMF1 1UW8A 4EV0A 1J58A 3VZKA 3HAGA 4GIQA 4FBFA 2C0ZA 4LBOA 1FI2A 3WP4A 2RMU3 1CJPA 3ETQA 3RG0A 5D8AA 4S2HA 1PZ8A 2E6VA 3OD0A 1GICA 3SXWA 2LM3A 4URTA 1W6OB 1TME3 1MZFA 4FAGA 4D7YA 4PLNA 2R043 1DYPA 2OZ6A 2K2SA 4XXAA 4QHBA 1H8TB 2GH8A 1KD7A 2WFF2 2R063 1R081 3R4SA 2XLAA 1OD5A 5KHGA 2Z2SB 2ZGPA 5C9AB 5AC91 5I0SA 3OGJA 5BNPC 2R1DA 2ET7A 2OPKA 3QACA 2AENA 2ZX4A 3J26N 2JG9A 3WR0A 1HW5A 2PQQA 3RWNA 3P3PA 4OFGA 2VPVA 4PJYA 1VBC3 1QKQA 3U10A 3CU7A 3RYPA 2WFPA 3POSA 4WM7A 1UPSA 1R093 4N43C 5CAZA 1VBA3 4DS0A 3QBQA 1V6IA 4XZPA 1EY2A 2E51A 1UF2C 2YHJA 4R9CA 3U11A 4AQSA 3M4FA 4PIXA 5EXOA 3I4IA 5H9RA 5BNNB 4QQLA 2NMNA 5GLUA 2DVAA 2DFCA 1HRV2 1RB8G 1H1IA 2HWD1 2VVFA 3VKFC 3RRDA 1CAXB 2BVBA 5JPMB 4JVAA 3ZVXA 4Y22A 2YXSA 4Y1ZA 4WVMA 4G9SB 4LUMA 3PVOA 3WW2A 1JTZX 3ZFFA 4N7IA 2E9QA 3B69A 4ZU7A 4LA3A 2GC2A 5F9TA 4CEWB 1U5ZA 5EFUA 1YI9A 1CIWA 3INAA 1QDOA 1QHDA 2ZOEB 4WM8C 4HVQA 2XJUA 3NV1A 3RI8A 4YGBA 1TME1 3VZOA 2IXKA 3EO6A 3ASIA 4MLOA 2LALA 2GAUA 5BNOA 1ZRRA 3MPPG 4Q0QA 4FT8A 1DQ4A 3T1LA 1GBGA 5J3UA 2Q4SA 4BE3A 5JPNB 4GA9A 5CA6A 3I59A 3SISA 4F83A 3I2DA 3IKWA 5J09A 4WV8A 1NOVA 3RSJA 3HIFA 3WUDA 2ZMNA 1ULFA 2VH9A 5BNPA 1CN1A 3TNQA 4P9LA 3WHUA 3RMYA 1V6JA 4OI2A 3LSDA 2PAKA 3IDBB 4NPRA 5FDBA 2XKOA 1F5FA 3R6SA 1AUYA 4DPNA 3JQWA 1LHWA 4XFHA 1XE7A 3PVEA 4SBVA 1BJQA 4FPHA 4AVVA 4Z1VA 3CF6E 4GWNA 5CU1A 2RM23 1FV2A 4OULA 1Q3EA 4HVOA 5F6KA 1C4RA 5BUVA 1DU3D 1MVEA 2XWBB 4MGKE 4LHNA 1YFYA 1C57A 3JZVA 5EYYA 4MGZE 4BYYA 1OPOA 5T54A 3ZSMA 1VAVA 1Y3TA 4UBGA 1H1MA 1LJ7A 2R32A 3FC0A 2WLQA 4OHVA 2QQPA 3WXPA 1VBC1 3WOGA 4OI4A 4YW2A 2XUMA 2UWAA 1LTEA 4E2SA 3AKSA 2OIIA 1C8M3 2ZGKA 3D4KA 3J9SA 3L2HA 2BWAA 3CL1A 4RR3B 5T3NA 1WGPA 4YSFA 1MQTC 1SACA 5BNQA 1AR81 3VKOA 4YM0A 5KBFA 3KMHA 2XJSA 2JENA 1BEV1 2IXJA 4SLIA 5JLVA 4IV3C 3MYXA 2BPA2 1KFUL 1VIWB 5KXDA 1ZYBA 2WLPA 4Q8LA 5FPXA 3V0BA 2WZR3 4AI0A 2QDNA 1DZQA 3MICA 1L3JA 5IK5A 1YNAA 3ZN6A 4JV4A 4Q4V3 3BPZA 4XETA 1PGSA 4RR3C 4RS5A 2GDFA 1Z0HA 3OY8B 4BPZA 1TE1B 2D3RA 2Q1MA 3H3UA 4QPIC 1F8VA 2QCSB 2TBVA 5A3MA 3M3EA 1EP0A 1N1YA 2GC0A 1MR5A 1RUF3 2PAMA 1HIXA 1RJ7A 3BALA 4XMIA 1UKGA 5IT6A 1D2SA 4AHWA 3WQ7A 3TN91 4GMP0 3L2YA 3S7EA 2ZZQA 1VRH3 1LU1A 1WLTA 5JSOA 1UCXA 5CG9A 4HMZA 2Y26A 1HKDA 3LA7A 4XF0A 3VV1A 4HVRA 4P9WA 4YG6A 5C8CB 1HXS1 2EIGA 3AKQA 5JIUA 3MW2A 4C90A 1XQNA 3JQXA 2VW1A 1ENRA 1SLTA 1TNRA 2ZKNA 1WW7A 2QZ2A 4NO4A 3DPRA 1VAKA 3SCGA 1KITA 2HWB3 2PHTA 2EXJA 5KC6A 5T5JA 4FO9A 4LE4A 1X8EA 2JG9B 4P9XA 2CY6A 3AFKA 4AK3A 4CEWA 1AX0A 5F1RA 4PDWB 1H8VA 1RUG3 3AP7A 5T52A 1MS3A 2ZGNA 1URXA 2E7AA 4QMAA 4RA0A 1UD1A 1NXD1 1XRUA 1X7NA 1CJDA 3LGRA 1OSGA 3H8UA 4CP0A 1FNYA 4CRQA 1RHI2 1XU2A 3I59B 2A6WA 3J8F3 4GKYA 3ILRA 2ZHLA 5E1RA 1UL9A 2WZR2 4Q2FA 1RC6A 1BEV3 2B42B 3ZYRA 1VBA2 1HXS2 2P3KA 5H9PA 1J59A 3AZYA 1CAWA 1ULGA 3PVNA 1YJKA 5HXVA 1KDKA 1T6GC 3IWZA 2LTNA 3QH6A 3SITA 5ABJC 1O3TA 1W2UA 4N43B 2RJKA 2VNOA 1MS4A 2G9GA 4FP2A 4BMEA 1AL21 4V1PA 1CAVB 2ZMLA 4YVWA 2X29A 4RQPC 1IS3A 4O9EA 2XHKA 3WG3A 1AR61 2NM1A 4K1YA 5DUWA 3UKVA 2WNVB 4XJUA 2D6MA 4U36A 3VKMA 1U5IA 2WKKA 2VVEA 5BNPB 2BUKA 3DPRC 4E4SA 2CWSA 4BLJA 1N3QA 4LBQA 1WD3A 3NW4A 1XU1A 1ASJ3 4KGQA 4UW4A 3GBFA 4XBLA 2ETEA 1NA1B 2PYTA 1NA1C 1N1VA 2MPFA 4Z92B 4KQ7A 3KS7A 4LHLA 4BH9A 4XFAA 4GB31 4I01A 3M3CA 4FXKB 2P2KA 3KT7A 2DURA 1NY71 1RUE2 2DCKA 3VBUB 3BCWA 1WCDJ 4W6YA 5GZDA 1I9RA 1SFNA 4BOWA 4A7KA 3IM0A 2JJ6A 2ERFA 2HWF3 3FJSA 1H8TC 5EV7A 1GZWA 2D6OX 4BIFA 2UY9A 2R072 1EV12 2A3WA 2IWGB 3VGIA 3KD4A 1VBB2 2R061 4M3CE 3WW3A 4A3XA 1AR62 4IV1A 1KXGA 1QGLA 4LBNA 5CFCC 1KS4A 1ONAA 1H4GA 2PN5A 4J6GA 2HJIA 1S0FA 1EYBA 4FTEA 3LA3A 1RUH1 3W59A 2Z5WA 3NL1A 2BW8A 3HD8B 4CDXB 4HLTA 1NZCA 4CYDA 1IS5A 2PLV1 1Z78A 1SLBA 1FMD1 1VBE3 3VHRA 3KCXA 3ZYJB 3THTA 1UPIA 4LO6B 5FQ0B 1JN2P 3ROUA 1QOOA 3VHNA 1W6QA 1RUC2 1SCSA 1BVP1 2R041 4AFMA 4LO4B 1RUC3 3E5UA 1Q43A 2Q8OA 1O4ZA 1Y7BA 4K9SA 1KDMA 1QMJA 4GMP1 1NY72 1RUE1 3TAYA 3NV2A 4KNCA 2R0FA 1GNHA 3S30A 5I0UA 4WZFA 2JG8C 2GSYA 5J96B 4K40A 5KWRA 1I6XA 1MS8A 2A73B 5FOBB 5GLWA 3ZDSA 3SH3A 3FE5A 3ZFFB 1V70A 1ZBE2 1LOBA 1YFXA 1VBD3 4D3WA 3JBG2 1PK6A 5DUXA 5FLHA 3FWEA 1LHVA 3G7DA 1JHNA 2UWBA 4Q4Y2 3HMYA 1VBB3 1VB2A 1S0JA 5L73A 2JKBA 1BK1A 5C6CA 5I0RA 2RR13 2ZGQA 4Z82A 1EV13 2GN3A 4C91A 2D3PA 4CDUC 1RUI2 5T50A 3R05A 4AVTA 1YO8A 3RYRA 3A0NA 2ARBA 4LBJA 4MGIE 4AW7A 4L99A 4D94A 1IKPA 5KHJA 4Q1RA 3KQRA 2WNVA 3GBGA 1CAXA 2W39A 5J37A 3SH5A 2WSUA 2KXLA 1RGSA 5E16A 1PO23 3AMQA 1MS9A 1AR63 1CAUB 3CO2A 2TUNA 1WMFA 3AK0A 4QU2A 3TB0A 3O0XA 3LZZA 3H1MA 1IPJA 1QWRA 5AC92 5T5PA 2ZKLA 4NHKA 5GZGA 5JZGB 2XVGA 1ALYA 2ZTNA 2HWC3 2BNOA 1FMD3 4XMAA 2YDEA 4K21A 2XBO2 3H1WA 5EYXA 2VVDA 2ZX1A 2WINB 1QJU1 2ZZJA 5KXCA 4ASMB 1LENA 3UL2A 1R1ZA 5C4WC 1RJ8A 3ZIXA 5C4WB 4HPKA 2VOWA 4OHWA 1F31A 2BNNA 1ZBA1 1QF3A 4IQPA 5L7OB 1WCSA 2MNGA 1EPZA 1MS0A 2WA4A 4CP1A 3AZWA 3D0JA 2D6LX 1PK6C 1S55A 4XEZA 4YW1A 1OFSA 4RQPA 2ZGLA 2ZBJA 5IUQA 3VBUC 2BBVA 3NO8A 3CJIC 3ZMOA 2GALA 2UYAA 4H14A 4N53A 4I02A 1MS1A 3ECQA 4B4QA 3VBRC 4XF4A 3USSA 4AEJA 1OKQA 2VW0A 1A6CA 3VBFA 1LGNA 4FQ4A 1FV3A 2ZJCA 4MXWA 4FPEA 1Z7S2 1C8NA 1AR82 5CIRA 4HN1A 5LRSA 2GNTA 1BXHA 4K3UA 3WP6A 4RSUA 5L7OC 2P17A 1BEV2 2C9AA 4PBOA 4AGVA 3X29B 1ZZBA 1E57A 1ZZ6A 4JGYB 3NVCA 1I1EA 4P14A 1AL22 1C28A 1LOAA 1ND3B 4IEXA 4Y20A 2ZA9A 1QQP3 4B7EA 4BA6A 1WBLA 3UKNA 3ZMNA 1AVBA 2OUJA 4A2UA 1GFF2 4FPCA 4WVWA 1GSLA 4FTBA 2G4IA 3S6PA 1AYN1 4P9GA 1BKZA 4EWAA 3B9CA 1SLLA 2FQPA 3AXDA 3APBA 4XJ9A 2P37A 3MFAA 2IXHA 1MEC1 2ZHKA 1HXS3 5T55A 4HZFA 1OLQA 4AEKA 2RS51 4JDNA 1DQ0A 3THPA 4AGRA 4GALA 1BMV1 1ND2A 2R0HA 2CYFA 2GH2A 3MPBA 5DDJ1 4XBQA 4AGGA 1I3HA 2SBAA 4IESA 5CFDC 5ACA3 4R8HA 1PVC2 5SV5A 4U2AA 4B3NA 1DIWA 4BWOA 1CR7A 2Q5TA 2GC1A 3ALQA 1V6NA 3CJIA 4QX5A 1UKRA 4C1XA 1N1SA 1VALA 3ZFGA 3WLUA 1BBT2 1FOD3 3VBFC 4AVAA 1O4YA 1RUH2 3R4UA 1AXZA 1BBT3 4UW6A 1D2QA 4XQ4A 2DVGA 1JOJA 1AR72 3ZSJA 2A6XA 2PLV2 2D43A 4GMP3 4R52A 2JG8B 2KM2A 2ZCWA 4XILA 4C0BA 2DVFA 4IEQA 1PVXA 1G86A 1NQDA 1RMU2 2N7GA 3FX3A 1G9FA 2RS11 4CEYC 2Z69A 4JC1A 4AQ2A 3D82A 2NQYA 3MEPA 4XYXA 2O8QA 3WDVA 3WQ1A 3RYKA 4FAHA 2FMYA 2XLFA 4N7UA 2B9UA 3VBOC 2A71A 1AX2A 1NE6A 4B4RA 3OF1A 4INDA 2WSVA 3IDCB 1HX6A 2B5HA 1AL23 3O5SA 5FPZA 3VHPA 4IEVA 2EA7A 2O1QA 4IERA 5IK4A 1FNZA 1SEFA 1JYCA 5AFEA 1PVC1 3NV3A 1OHFA 5CFDA 4LO8A 5JR7B 4L97A 2V5YA 4FPOB 4F3JA 4L8QA 4L92A 2ZGRA 4UW5A 5JOYA 4JAAA 4XF9A 5JI7A 1WCKA 3A4UA 3JCIA 2ZX3A 2A75A 3MW4A 4RD7A 2UURA 3ZFEC 2QFEA 3SH4A 3WW1A 2GMPA 1NLSA 1UMZA 2GNMA 3N7JA 1C8M2 2XJQA 3WHTA 3M2MA 3RDIA 2ZPXA 1B35B 5DDJ2 4XIKA 1A8DA 2CGPA 2E63A 4DY3A 2DU0A 4HL0A 4XXPA 2R16A 1R091 3C3VA 1CONA 4MZUA 5DG1A 2WT1A 5DG2A 1UU6A 2DTYA 3T2TA 2XBO1 1KQRA 2RM22 3FBMA 1H2KA 4OZXA 1LU2A 1NCRC 1R1A1 4JGYC 2HWC2 1CQ9A 2YMZA 4DOUA 1CGPA 3VDDA 2TNFA 1YCIA 1S0EA 5FLIA 4AQ6A 1LOCA 2XGXA 3AYDA 1OOPC 3VBSA 1OQDA 1HV0A 4AVSA 4G3YC 2AREA 1S0GA 1DQ6A 2R071 4W6WA 2RHPA 1IKQA 1ZM1A 2A6VA 4KWJA 1HRI3 4FPLA 2B8MA 5JSRA 3VZLA 3JUUA 1LEDA 4K20A 1XYNA 1ZA4A 4M3CF 3SCFA 3VBUA 4AFAA 2E7QA 3CJXA 1VB4A 2HWB1 5BNOC 4XQWA 4R4ZA 3FUOA 5AVPA 4HSJA 3K48A 3ZFEA 4E27A 1DGWA 4GB32 1Q5OA 2RR12 1W6NB 3GZUC 2DCZA 3S7IA 1PGL2 5FQ0A 4O9GA 1RUJ1 1B09A 1X82A 4P9YA 4ASLA 4K6BA 4XJWA 1PO11 2RS31 3FFQA 1LCLA 1QQP2 1JUHA 4HKWA 1HRV1 1NLRA 4XPVA 3AZZA 3FMGA 1REDA 4Y1UA 2B39A 3ACLA 4BLIA 4Y1XA 3B3QE 3WUCA 4JTNA 3PJYA 2VNRA 2WFF3 5T5OA 4AFDA 4AEDA 2YC0A 5BNNA 3OYWA 3UJQA 2BYVE 3WG4A 1TME2 1DFQA 1C5HA 2NYYA 1B35C 4Q4W3 4WVMB 1JYIA 1AF9A 1RUJ2 1PK6B 1MZ5A 1EAH1 2BTVC 1CX4A 1YXWA 3AMMA 4HBNA 5B2GB 1SBEA 1CPNA 4B7KA 5JI9A 3ZN6B 5ABJB 3EBRA 5CVRA 4KG0A 3MIEA 4PLOA 1VBB1 1ZBE1 4N9HA 4CDUB 2HWD2 2R042 4Q4Y1 1RHI1 3H7YA 3VKNA 4AYUA 1ENXA 1O91A 1PGW2 1HDKA 1V9U2 2JX9A 1MZEA 4YVSC 1R083 3ZXFA 1SFYA 2XBO3 5I0TA 3LOBA 1MEC3 3ZYPA 3AMNA 5EZWA 2QVSB 3ZSLA 4PDWC 1D4M3 2EAKA 3ZSKA 4DRVA 3MW3A 1GZ9A 2NN8A 3H3ZA 4Y1YA 1D4M2 2QZ3A 3H0OA 1UIKA 4CDWB 1LESA 5GKAC 4AEMA 4DMIA 4OHYA 1PO22 4H3WA 3AZXA 3H50A 3MLLA 5DUUA 4CEYB 4FOVA 2ZACA 4IXLA 1UX6A