1H8VA

The x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
ETSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGGQNNVKSYQNSQIAIPQKRTVNSISSMPTTASWSYSGSNIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQSWTLYYGYNGAMQVYSFVAQTNTTNYSGDVKNFFNYLRDNKGYNAAGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title The X-Ray Crystal Structure of the Trichoderma Reesei Family 12 Endoglucanase 3, Cel12A, at 1.9 A Resolution
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 53
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h8vA00
1BCXA 4S2GA 1C5IA 3EXUA 2QZ2A 3M4FA 2DCJA 1IGOA 2VUJA 3AMPA 1HIXA 5EJ3A 1YNAA 3WP5A 3WP6A 3WT3A 5K9YA 1OA2A 3ZSEA 2BW8A 3B7MA 4HKWA 2C1FA 3HD8B 3RI8A 1XNBA 1ENXA 2VULA 2VG9A 4NPRA 3WP4A 1T6GC 2DFBA 3VZJA 1XYNA 3WXPA 2D97A 3VZLA 1M4WA 2BWAA 3VL8A 1F5JA 1UU6A 3WQ7A 1UKRA 1REEA 1C5HA 3MF6A 2DCZA 1XNDA 3AKRA 3AKPA 2F6BA 3MFCA 3LB9A 1UU5A 1KS5A 1QH6A 4HKOA 3VHOA 3VLBB 4XPVA 3B5LB 2JEMA 4S2HA 3WX5A 1AXKA 3VHNA 2D98A 5HXVA 2JICA 5K7PA 4HK8A 4XQWA 2JENA 2NLRA 1NLRA 2BVVA 4XQ4A 2DFCA 1OA3A 3VHPA 2BWCA 3VGIA 1HV0A 1H0BA 1PVXA 3VZNA 1OLQA 4HKLA 3WQ1A 4S2DA 2QZ3A 1W2UA 1QH7A 3VL9A 1BK1A 3AMMA 3WP3A 1KS4A 1H8VA 1TE1B 1XNKA 1BVVA 1H4GA 3AKTA 3MFAA 4XQDA 3VZOA 1XYOA 3LGRA 1REFA 2VGDA 3WR0A 1XXNA 3RI9A 1OLRA 3AMNA 3WY6A 3AKSA 1HV1A 3VZMA 3AMHA 4H7MA 1XYPA 3AKQA 3WQ0A 2B46X 1H4HA 4S2FA 2DCYA 4HK9A 1OA4A 2B42B 4IXLA 3VZKA 2DCKA 3O7OA 1REDA 2B45X 2Z79A 3MF9A 1UU4A 2NQYA 3AMQA 1H1AA 1XNCA
chains in the Genus database with same CATH superfamily
3AZWA 4D7TA 3W21A 5EP9A 1W6OB 4Q4Y1 1COV3 5A6ZA 3QOPA 2BOIA 3M4FA 1FI2A 4N53A 1WWYA 5EFUA 3T30A 2ZEXA 1C8M2 3ZIXA 4CUBA 3VBRC 4AEJA 3LFMA 3ETPA 1WCDJ 2WO2A 3WDYA 1Q43A 3H3ZA 1ONAA 1ZZ8A 5EHDA 3V64A 4IE4A 1BBT1 3ELNA 4K6BA 5BXXA 1CIWA 5FP7A 1JOJA 3B02A 3JBG3 4MGZE 3V56A 4CEWB 4U2AA 4W8JA 2JDHA 2Z4FA 3VD7A 3VD9A 4XJUA 1C3HA 1RITA 3FBYA 3LE0A 2P3IA 2ZHKA 1V6MA 2ZX4A 3U0ZA 2DUOA 1CPMA 3MPPG 3N35A 3FLRA 4OHWA 5FO7B 2ERFA 4AI1A 4E4HA 1VE0A 4N53C 2G9GA 1VBE1 1OFNA 1UZ0A 1WMXA 5F5QA 5FYSA 4BQ3A 4X6QB 5JMCA 1BK0A 2R072 2R062 2ZX3A 2YU2A 3ON7A 1LODA 4AXOA 1LECA 3KT1A 4BMBA 1GWKA 4HKOA 4LO8A 5CKNA 2ZGLA 3HNBM 5FZOB 2E63A 3UESA 2R30A 5BNOC 4HT1T 2GNTA 4BU2A 3NQHA 2W1QA 3ZKUA 1RUE1 1BBT3 3DL3A 4OYUA 3Q8FA 1OSGA 5IT6A 3O1TA 2IC1A 3ACIA 1HRI1 1OQ1A 2BUKA 2NYYA 2E7AA 3MV11 2VE1A 5F5CA 4D6SA 3HNMA 1JZ8A 3IN9A 2DU0A 5FYYA 4YFZA 2WFF1 1FXZA 3ZXGA 1K42A 5FLIA 3Q8CA 2CHHA 1XU2A 4LLFA 1NT0A 3UJOA 4XUTA 3E5XA 1WCQA 5IVBA 1J59A 4UI9L 4XIOA 5LASA 2WLPA 1VBE3 2Q30A 4L0PA 1MS8A 1ZA7A 3B3QE 2VO5A 3ENRA 3PUHA 4LLOA 2XOMA 4IE0A 2DVFA 1JOBA 2HWE2 4O65A 5CFDB 3B94A 5LBBA 4BK4A 3R4UA 1JZ4A 1A78A 2ZGPA 2P3YA 4BZ4A 3ILFA 3MIEA 2VAUA 1RUE3 1WBLA 2CAUA 3ES4A 1PK6A 3RMXA 4HMZA 1ZVFA 4KU7A 4FOVA 2R1BA 1HRI3 4IEYA 5I91A 2GU9A 1S0EA 2D43A 2OT7A 2Y6HA 2QVSB 3FN9A 3J9SA 4BB3A 2P3JA 4QXBA 3JXSA 4P9WA 3GZTB 5APAA 2WFF3 1WA4A 1ZZCA 3GM8A 5GM0A 2B46X 4KWUA 4S2FA 1A8MA 3PTRB 4AHYA 1S2KA 3VBHB 3NJZA 4IV3A 5FZ9A 3OTFA 2VZSA 4PI2A 4HSLA 4YGCA 1OC1A 1W6NA 3K77A 1UWWA 4ISQA 1G9BA 4DQAA 5F3EA 4XFIA 5LEJA 3OGVA 2AR6A 1H2MA 2JXAA 4RQPA 5LATA 5E88A 4M4PA 4META 3ZX7A 2W87A 3BALA 2ZEYA 3ZSKA 1OUSA 4JAAA 4QQPA 2BERA 2DVDA 4BPZA 3T2PA 5JOXA 1P8JA 1IHMA 1G9FA 5T5OA 4OHYA 2JKXA 1VBD2 3CIHA 3KCCA 4S2GA 2FBEA 3LPFA 1N3OA 1RUD1 1WCUA 2OZJA 2VNRA 3DXTA 4FXKB 4IEWA 4NHYA 1ZM1A 5FJKA 1HIXA 3KMHA 4OUEA 2DTWA 1ND2C 1YNAA 3WP6A 2ZXQA 3WUDA 3QBQA 1GV9A 4XF9A 3P6BA 4IV3C 2ZAAA 4UBHA 3N4MA 1SLTA 2YBPA 2CGPA 5E6HA 3OPZA 3AP9A 4QM8A 2Q8CA 3H8UA 3U4SA 4CUAA 3I97A 4RL7A 2LS6A 5C8CC 4FTSA 1IS4A 4MADA 1URXA 3ALQA 4AGVA 4AWDA 5LZ6A 2RM22 3OYWA 4Z1VA 2C5DA 2IFWA 5JSPA 3LZZA 1AX0A 1RUC2 2VM9A 3I59A 5JLVA 1I9RA 1ND3B 2LRPA 2PQSA 2C26A 2ZBJA 4NVPA 1R092 4B1MA 4KWJA 1W2TA 2B4KA 1W6QB 3PHMA 1O8SA 5A3PA 3ZYRA 1PGL2 1DG6A 2XPJA 1RUD3 2XJVA 3AYDA 5F8PA 3RRDA 4DUXA 5FZHA 1C57A 1CAVB 1Q8PA 4JTNA 1GZWA 1FYUA 4LUKA 4EN8B 1B09A 2D5FA 2E7QA 5T52A 4CCMA 1NCQA 3WX5A 3WNPA 1BXHA 4IGQA 1RMU1 2D98A 4FQ4A 5A32A 2JICA 1JXNA 2AREA 1IKPA 4N7UA 4CP1A 3D8CA 4R9AA 3ROUA 3NKGA 4CDWB 1GNHA 1EAH1 3UK9A 2MNGA 4I30A 5BNNA 2Y6KA 4FPHA 5F1RA 5JMOA 4FPFA 1F4HA 3AP4A 3E6DA 5JZGB 1E5SA 3NV4A 2B9UA 1FOD2 3AYAA 4Q0VA 1XOYA 1ENSA 2YGMA 4Q0UA 2JE7A 5FIXA 5LRSA 4Z2WA 4XUPA 4A44A 2R6QA 1F15A 5FYBA 1NY72 3LEKA 4JGZC 4RHV2 1XU1A 2WR9A 4M01A 4QHOA 4XABA 3WNKA 4YZ1A 2PHRA 4B4PA 2QTWB 1R081 4D6RA 4AZZA 1DQ1A 1LESA 4RGKA 1FV3A 2DUQA 4EYUA 4Q2FA 1RMU3 1W8ZA 1JBCA 2ADDA 2CDPA 4COUA 1DQ4A 1HDKA 2JB4A 4GMP1 1LHWA 2A3WA 1RUC1 1S2BA 2WZPP 3RYPA 1HV1A 2WYFA 1EAH3 3GBWA 2LW8A 1R091 4L97A 5CFCA 2QDRA 2R49A 2ZA9A 4CP9A 4TTGA 3LSDA 4BIOA 3I8TA 5CU1A 2FZ2A 3KM5A 2QJVA 2VOXA 2XHNA 5BY5A 3KS7A 1UO9A 3QACA 1GOFA 3A23A 3PUIA 4NO4A 5F2SA 4AFDA 2B42B 3ZFEA 1Y7BA 1GQHA 1Q8SA 1TZOA 1CVNA 4YGDA 2J1VA 1W0PA 5BPXA 3USUB 1O4YA 5A33A 1RUH1 3OCPA 4XJ9A 2WABA 4YLZA 5C33A 1AL22 3O1PA 3IMMA 4CDXC 4YWAA 4HXCA 5JIUA 4QPIB 2I45A 5FDBA 5KR7A 2PAMA 2G1MA 1R083 5GZCA 1PO22 3ZPYA 4A7ZA 1DFQA 1OUXA 3SISA 5LCWL 5T5LA 4XBLA 4OUMA 4GWJA 4CDQA 2QZ2A 3EHKA 4CCDA 5JSRA 1BVP1 2CSGA 1UX6A 5IUQA 1UY3A 1KITA 1RINA 1ZRFA 5A7PA 3S6PA 5IK5A 4GB32 2VZTA 4L2NA 4R4XA 4GMP3 4OFGA 4PI0A 1RUC3 3LWCA 2ARAA 3HPNA 3PJQA 4XYXA 2VMGA 3VDAA 1DF0A 4FP2A 1X7NA 1R093 3VUOA 4QQ2A 4FFFA 4P9JA 1RXGA 1UZZA 5DQ0A 2ENRA 5C3QA 2VTXJ 4XZUG 4Y20B 4FPCA 4NRMA 4RHV1 4UW6A 2ET1A 4K9SA 5BNPC 4I0WB 4LHLA 1LHOA 1PNFA 2BGPA 4LK6A 3IDAA 4A7YA 3DYPA 5M0TA 1RUH3 1OVSA 2D97A 3OY8A 4UW3A 5FJHA 3BIWE 4XDOA 1ODMA 2B9VA 1M4WA 2OZ6A 2XBO3 2XQXA 4A42A 4AFBA 4D69A 3M3QA 1AVBA 2X8KA 4MOAA 2A71A 2VCMA 4C1WA 2XMLA 2WZ8A 3DV8A 3ZFFB 3ZR5A 3BPZA 1W9YA 1J3RA 5FV3A 2DYCA 4U36A 4CDUB 1K5MB 2WO7A 3K75B 3IKWA 5ANQA 4X8PA 3S5AA 2WRAA 3G6JB 3WQBA 4J6GA 3D5OA 5L19A 3IPVA 1C4RA 1R1A1 4M0HA 3THPA 4KWKA 1AL21 2ZGKA 4N43A 4XJAA 3PUSA 5ERLA 5D21A 1OH3A 4UW5A 3RJRA 4D0QA 5C4WC 1AR72 3WNXA 1IPSA 5E1RA 1CIYA 2JIGA 2E9QA 1AJKA 3HQRA 4HETA 4YM2A 4CU6A 2W52A 5A3TA 4N9IA 3KV9A 1N47A 4NHMA 1DYOA 2GNBA 2HEWF 2O0OA 4KU8A 5FKBA 2RG4A 3WW2A 1MR5A 2BFUL 5DN2A 3PJYA 3O1UA 2P6HA 4DRRA 2IXJA 5EIYB 4PLNA 2KXLA 4K21A 3UV9A 2FMYA 1DBNA 1REFA 1R1A3 2QQKA 4DIQA 4YG0A 1W6OA 4JGYB 1AL23 1CAUB 5GZEA 4W6XA 4EE2A 1FNYA 4FAHA 4E8CA 5JDBA 3NJXA 5I0DA 2ZGSA 2A7AA 1UYZA 1LENA 3L2YA 4H2AA 3I2KA 3DF0A 4NIAA 5K8SA 5FUPA 3RZKA 3T08A 3N9OA 4MO3M 2ZACA 4WBBA 1UXXX 3FJSA 3ZPOA 4HK9A 5FXXA 4I2OA 2A6WA 4FFGA 3ES1A 4Z8BA 4A4AA 4RS5C 5IAVA 2QQLA 2DCKA 4PBOA 3PL0A 3ZFGB 1VIWB 3ACGA 2QBXA 3CJIB 2Z79A 3HQUA 3O5SA 1LHVA 3OUIA 3FX3A 2WT2A 5FZ8A 1H1AA 2E51A 2YFUA 3U14A 1NXD1 2ILMA 1W2AX 3GBFA 3A7QA 3NMBA 1UOBA 2IXIA 5EJZB 4RSUA 4BLIA 2VVDA 1BEV2 1OLME 2OIIA 4LR4A 4RD7A 1UMZA 3U11A 1RUOA 1YIFA 1JYNA 2VECA 3ZXFA 5J3UA 2HWB2 2JWPA 1UYYA 5EJ3A 1KDMA 1JZ5A 5JI9A 1OHFA 1V9U2 4M00A 3OD0A 4CP2A 4F3JA 3ORJA 2XJPA 4PF1A 5EQUA 1H2LA 3WF2A 2NN8A 1PGSA 2BYVE 1YCIA 3S7IA 1FPN2 4CEWC 1XYNA 2WA4A 2XG3A 1Y9MA 2WLQA 3DECA 3NNLA 3DYMA 5FYZA 3R4SA 1TG7A 1PK6B 1CPNA 2OQ7A 3ZR6A 4AAXA 2UWCA 3B00A 3NWKA 1D0HA 3ZLIA 5HBAA 3N7LA 2ORXA 4UBGA 5IHRA 2ZKNA 4XUOA 1TME1 3N3HA 1MEC2 3DXUA 5C3PA 4LJHA 2ZGQA 5FZ4A 2XLFA 1W8TA 5LA9A 4CXYA 5FP4A 2YG0A 3NNFA 4FPEA 4BQ1A 5HCHA 3C3VA 1UU5A 1J83A 3S30A 4ASKA 4PQQA 4AVSA 1AR62 4CCEA 2WT1A 3LDRA 1WBFA 3U78A 2GC3A 5B4NA 4H7LA 1AYM3 1H6YA 4LBQD 4NIHA 3N7KA 4JTOA 4RQPB 4ZU7A 4IUGA 4L8QA 3W9AA 3K4ZA 4LBMA 3CO2A 3VDDB 2A5ZA 3HN1A 1ZX5A 1U5YA 3K51A 4FCAA 4DMIA 4O9EA 2JIJA 2P2KA 2XVGA 3DCQA 4RGGA 1LOAA 1ZZBA 2HH9A 2C0ZA 3DPRB 4AFCA 2BBVA 5LB6A 5E8AA 3NVCA 5FBJA 4C8DA 4MGQA 5ABJB 4GULA 3HIFA 2QQOA 2EALA 4BA6A 2CY6A 2PMWB 2HWB1 1H2NA 2YU1A 1TME3 2WZR2 2X5IB 4QHBA 4XXPA 5J98B 1DQ2A 1QOOA 1V9U1 2QCSB 3VBSA 4XAAA 1S0IA 3APBA 4QXKA 5CFDC 3VB9A 2JKBA 3LDBA 4EWAA 1ZNPA 2AYHA 4LKDA 3MFAA 4EWEA 1FPN1 1KQRA 4XOGA 5I0SA 1PIV1 1CR7A 1DP0A 4Q4X2 2D3RA 1A6CA 4JC1A 1QQP2 4LULA 2EVXA 3PMSA 3LIGA 2BOJA 2VTFA 3I59B 3W5NA 4V1PA 3EB7A 1LKNA 4YGEA 2VL4A 1VB4A 2KM2A 3GALA 3QH7A 1APNA 1QY4A 3AKQA 4QPGB 4ZZ8A 1H4HA 3WINE 2R041 3TB0A 3VBHC 3AJZA 2YY1A 1C28A 4F7ZA 1OA4A 3PIGA 4HPKB 3WNOA 2HWB3 4NAOA 3MI8A 1NCQB 1V9U3 3WF1A 1REDA 3OBTA 4Y22B 3UT0A 5A32B 3G7DA 1LTEA 5GKAC 2VMFA 3UKVA 3IIIA 1O91A 3QLQA 1CESA 1FPN3 1F2NA 1PIV3 4IL7A 5KHHA 4HOOA 4LITA 1ND3A 4Q8KA 2Z69A 5CB7A 2CWSA 4AQ6A 5BNNB 1O8PA 1Z7S2 2BPA2 1UZYA 1W6QA 1VAVA 1YFYA 3AMPA 4Q0SA 4RGAA 4D3WA 1SFPA 5J1XA 2A6XA 1CAWB 5F7UA 3M8LA 3OUJA 4PHZA 4EN7B 5FFOC 3K3NA 2YBSA 1UW8A 2RMU1 2WZR1 3HD8B 2R043 4W4ZA 3NL1A 2E7TA 4PIXA 5JR7B 4DY5A 1XQNA 4ASMB 4ZU5A 4KNCA 4CDWA 1JYWA 2BWAA 4JV4A 1UOJA 4Q4X1 4A3XA 4YZ5A 5K0UA 1ND3C 1QQP1 5LBEA 3SLIA 1H9WA 3U1XA 3IWZA 4AVBA 4BQ4A 5CG9A 1QOSA 3FWEA 4I02A 4HVOA 3C7OA 1HJGA 3AVRA 3THTA 4NHLA 2FDGA 5CFCB 3AKRA 4CCCA 2VH9A 5HPOA 2PHXA 1U12A 1M06G 3W20A 2J42A 1TEIA 1YJLA 3LB9A 4MGKE 2FCVA 2WWUA 1RUF2 4E2SA 3AXDA 1H8TA 3HNYM 3TN91 3ZFEB 5GZGA 3E6BA 3PNAA 4PF5A 4E9KA 4XJ8A 3VDBA 1W8WA 3GF6A 5SV8A 5A3NA 2RMU3 2WZR3 3O0WA 5LEKA 1NLRA 4CDWC 5CNAA 2BVVA 4QAWA 4OHZA 4AAPA 5LK5A 1QJY3 3LSEA 4XVHA 3BYWA 3RYKA 4QM9A 4Q4X3 1YLLA 2VZ1A 3UKNA 1JHNA 1Z7S1 1QQP3 5JZGC 2F17A 5CBLA 1XSRA 4LO6B 1Q8VA 2RHPA 4HVRA 2VBPA 4S2DA 1HB3A 1NAEA 4BE3A 3U07A 5LBCA 1JS9A 5JIAA 1NG0A 3KZ4C 2KR2A 5A80A 4LNVA 3S5QA 3M1HA 3KWVA 4XW3A 3USUA 4D7SA 1HRV2 4P5YA 5I8SA 1WUVA 3TN93 1WMDA 1R64A 4H14A 2WO3A 2O1QA 3ATGA 1ULOA 4MXWA 4P00B 4AVCA 1JZ2A 1GUIA 3I3QA 4WM8A 5B2GB 4XBQA 3WR0A 4E2QA 1RUNA 5GLZA 5L7OA 2WS91 3RI9A 5JSOA 3AMNA 3GDBA 2P1BA 3PVNA 4I01A 5EYXA 5ACA2 4GALA 5HV4A 4XETA 4H7MA 2HWD2 1GOGA 1ULPA 2WDBA 3O1OA 3KSCA 4JKLA 4Q26A 4FOQA 3URFA 5C7GA 1Z7S3 4OHVA 3RWKX 3SC7X 4B1LA 2QQNA 2D5HA 3BIEA 3ZYHA 1RUF1 1GFF2 4Y20A 5IVJA 3O7OA 2AENA 2CWMA 3P3PA 4FO9A 2VQUA 3MF9A 4LO4B 4TLFA 5JOZA 5IVYA 1IPKA 4QPIC 2FCUA 4N43B 3AZZA 1YXWA 2OPKA 5FZLA 3MUY1 5H9QA 3RZLA 1NLSA 3HAGA 4IEPA 2WNVB 5FPZA 3T0DA 3MZHA 4BOWA 1C5IA 4QT6A 4RR3A 1O7FA 3LKJA 3BOPA 1G9CA 1OQDA 1Q8QA 3TBDA 3ZFFA 1H30A 3FLPA 4B7EA 2WS93 4IEZA 1G6NA 3PU8A 3OBZA 5IVEA 4CDUA 1MS1A 4QB1A 2ZAHA 1K5MA 2P37A 1AX1A 3AX4A 4MGIE 3WOGA 1LOBA 3UGHA 4DFSA 4BJ0A 1U5XA 1OLMA 2A6ZA 1AR83 2JDUA 3HEIA 4YNIA 1JODA 4P9XA 4QX7A 1IQDC 4YW1A 5I0UA 3TYJA 3WG3A 5F3GA 4JQRA 4ORFA 5FMOS 2FZ1A 3RS6A 4LOSA 1Y9QA 2W1SA 3ZYBA 4ARXA 1XE8A 1UZWA 2Y6JA 1RUF3 3LPGA 4N9HA 1QIQA 3O0VA 3M3IA 4GD4A 4ZXEA 1ENRA 3VBOA 2VU9A 2YZ4A 3VZLA 5HCAA 2ZMNA 1RUI2 5FOBB 1MS9A 1OKQA 1EV12 4ZHNA 3N9QA 4AI8A 5FYHA 5LW9A 1DZRA 3ECQA 3ZFFC 3ZDSA 4YG6A 1CX4A 1DYPA 3DUIA 3A0KA 1K3IA 2ZMKA 1I6XA 5FYIA 2EXJA 4CDUC 1K5MC 1L3JA 2HWD1 4Y5TA 3PDQA 4XFAA 5FMDA 3VBFA 5A6XA 1RL3A 3M7AA 1QDOA 3HWJA 1SBFA 3K4AA 3MICA 4NWVA 2EIBA 2RS11 4Y4YA 3I3DA 5DDJ3 4DZGA 1IKQA 4Y1VA 2VY0A 1LB2A 5FOJB 1LCLA 3AL5A 3M3CA 2JENA 2KD7A 4YW7A 1KD7A 4EZ4A 2XGXA 2DFCA 4LT5A 2Y0OA 3RQ0A 4FOYA 1RHI2 4JGYA 4QQLA 1BYHA 3AP6A 1CAUA 2EICA 3PVBB 3ST7A 3TOJA 1JU4A 4IETA 1W04A 4L9BA 4Q4Y3 3MUZ1 5BNQA 2ARBA 4HN1A 2W39A 3OG2A 4JRAA 4I3PA 4HN0A 1W2UA 4C90A 3BI3A 3H50A 3WDUA 5L9BA 2EXKA 1I3HA 1BZWA 1YFWA 3BN6A 2HWD3 2HWF2 1DGLA 4QDSA 5H9SA 1IOAA 2J1TA 4DEVA 4WVMA 2WBKA 5L9RA 3ZFGA 2W91A 3CJIA 4XQDA 4AOCA 5A6QA 2WIIB 2YB7A 2RS13 4QPWA 4IV1A 2BTVC 4AI3A 5D2AA 4URAA 1DQ0A 1YYNA 4CPBA 2D6PA 2GP5A 4JZRA 1YRZA 1EV11 5AC92 2CDOA 3BUCA 2J1UA 2VOTA 1BMV2 3JUUA 1UN1A 3O12A 2GN3A 5C5TA 1AUYA 4IEUA 4IE7A 1C8M1 3ACLA 2BJSA 4BMEA 3GJAA 2FCTA 2YGLA 3WVJA 3O1SA 5DMYA 2CAVA 3KQRA 4EN6B 1HN0A 1O4ZA 2UY8A 2NQYA 2B5HA 1UMIA 4QMAA 3VBUB 1I1EA 2X29A 1VBA2 3D4KA 3LFIA 2LTNA 4MGYE 1Z0HA 2BQPA 2ZGOA 2Y6LA 4JDNA 5DAWA 5DAXA 4HBNA 4AGGA 5LWBA 2Q1MA 1VBC2 2PHDA 4YZ4A 1W99A 1SCSA 2DCJA 1BKZA 3F95A 5F32A 1SCRA 2A6VA 1VPHA 1SLIA 3H9AA 4AI9A 5IVVA 1W28A 2ZGMA 1EV13 2H6BA 1OA2A 2R071 2R061 4CU9A 3B7MA 4XTPA 2GC1A 4XF1A 4K20A 4Y1UA 4CSWA 2GH8A 3QH6A 3VBSB 5LY1A 4KMQA 1C8M3 4LA3A 3SH3A 4MXVA 2HWF1 2AEZA 3VDDA 3K46A 5IK7A 2H0BA 2Q1ZB 5DUUA 1RXFA 3POYA 4GH4B 5EZWA 2Q8EA 1PX4A 3UGFA 1PK6C 3V65A 4AHXA 2Y34A 3ABZA 3DPRA 4Y26A 4XDPA 2VPVA 3WQ7A 1QJU2 2PYTA 2YMZA 3I2DA 1REEA 3OOXA 1NOVA 4FPJA 4G4FA 4OCTA 5FREA 2FDFA 2BBAA 1DU3D 4G3YC 1KGYA 2BGOA 2PELA 2VCBA 5ABJA 2SLIA 3ZIWA 1OD3A 5AC91 4QGLA 2WQZC 1IG0A 4RA0A 4DXZA 2XJTA 1BMV1 4TSVA 3OGSA 2CL2A 2X5IA 2FMDA 4O7XA 4CTEA 1NCRA 1MVEA 1H6XA 2R073 2R063 3EYPA 3GZUC 4OI0A 1V6JA 4RQPC 4BH9A 3VDDC 2HWE1 1YI7A 3U75A 3CJXA 2VQ0A 2HWF3 5JXJA 1CWPA 2ET7A 1UY0A 1D4M2 3DPRC 3RFRA 3ZYGA 5FAXA 4FVVA 1I5PA 2VC9A 1US2A 4D7YA 1RTVA 1IZ3A 1VMFA 3W58A 3VD3A 3K2OA 4Q1PA 2VOWA 5ABJC 2JDMA 4Q8LA 4Y3OA 5JXGA 3FZ3A 3QD6A 1NYWA 3E6CC 1JZ6A 4QPGA 3OGRA 1EPWA 4RFRB 3BU7A 2X5IC 1QMJA 2ZZQA 4BLJA 4HPKA 2JDKA 4Z2AA 2Z42A 3TNPB 1NA1A 1HN1A 2ZEWA 3MGUA 1SHWB 3OF1A 4XUNA 4ISRA 3LOBA 2EIGA 4Y22A 4YG3A 4CA9A 1WMFA 1O5UA 1PM4A 1BLZA 2RV9A 3BCWA 4R9CA 5FZBA 1KFUL 4QX3A 4LTAA 2HWE3 4ITCA 1WCKA 3UNPA 3KV4A 5K0UB 2AACA 3KVBA 4NRQA 1GZCA 3WY6A 1JZ3A 3O1MA 3AM2A 2W68A 1VBD1 1QJU1 1IG3A 1N1SA 1WW5A 5DUXA 4QPGC 1CAWA 2PLV2 5T3NA 2XHKA 5HV0A 1DDLA 3KV5A 2DVGA 5FZGA 3T1LA 3MW4A 5E16A 5JXIA 4XDQA 4NE9A 1H8TB 2VZRA 1NCQC 4FOWA 2D44A 1W9SA 4FP3A 4N8MA 5EXOA 4AHZA 3T2TA 5FPUA 3OPWA 4JCKA 3I2OA 3LOIA 1SLLA 2ZHMA 3NAPB 1X82A 3SXWA 1LOCA 2DU1A 4EN0A 2RM21 5BNNC 1Q56A 5A3UA 1X8MA 4ZKTB 1KDKA 2VUJA 5I8YA 1XSQA 2UURA 2FDKA 1ULFA 4IGPA 3J8F2 1RVF2 2XQRA 2ZPXA 3WT3A 4I3GA 5EV7A 5C9AB 1VBD3 5DAQA 1PGL1 5FYCA 1GBGA 5T55A 1JYCA 3I3EA 4B4RA 4PDWA 2UWAA 4ATEA 1LU1A 5FCCA 4TZDA 4WM7B 2RJKA 2XWBB 2DFBA 1TQ5A 3AXEA 1GQPA 4MXWB 1CJPA 1O6UA 3HN3A 2NMOA 4J1WA 3N9PA 1FAYA 2ARCA 3T4VA 5F6KA 4NPMA 4WM8B 1ZBE2 3MPBA 4O61A 2OUJA 1UU6A 1AHSA 5L7OB 3BKZA 4UF0B 2RDRA 3D0SA 5CFCC 3F2ZA 2RM23 3MLJA 4M3CA 4P9LA 1KEXA 2WNUA 5FYUA 4GMP0 4GXLA 1S55A 3VKNA 2D7FA 2PFWA 5A6YA 1CGPA 3T2QA 1FOD1 5JPNB 3ZFEC 1A3KA 1NX9A 2R7EB 3B5LB 4S2HA 1NY71 5ACA1 1SDWA 4URTA 5CZKA 3USSA 2AZ5A 1DIWA 5I0RA 5DAPA 1MVQA 5KXDA 3FUOA 2HBTA 3ZXJA 4LHKA 2GAUA 4RR3B 4CDQC 3H8RA 3KHCA 5K4LA 4QHZA 4KI5M 3SEPA 4AI0A 4X8NA 1V6IA 1CD3G 4XACA 1D7PM 3UETA 3WQ1A 1L7QA 5E89A 1X8EA 5KBFA 3J8F1 1RVF1 1F5FA 4LXLA 3MIBA 5A1FA 4YFWA 4BWOA 2R0HA 1NLQA 1W39A 2I2SA 2WJSA 1H8VA 4P08A 3HBZA 1FOD3 1H4GA 1QHDA 2C4XA 4LBQB 5HCFA 3OPTA 4X6RB 4CCKA 3RNSA 5DUWA 1Z78A 3BPSA 4RHV3 3VBOB 5ACA3 1G9DA 3MIDA 3GHMA 4IGOA 4XFBA 5DXDA 2VGDA 1FNZA 2N7GA 2LROA 2WNVA 1A8DA 3KB5A 4CU8A 1RJ8A 1PO21 1PVC2 2R1DA 3DGTA 4TYSA 5FBZA 3VZMA 4EROA 3FHIB 3RYRA 2UY9A 1S4CA 1XYPA 2V4VA 3NNGA 3WW4A 4DS0A 4O9GA 4XFHA 5FMBA 5FPBA 1PMIA 4GB31 3BTAA 4XMAA 2Y64A 3VBFB 3CU7A 4INDA 1LAJA 3BODA 1QU0A 3GCXA 3SEEA 3O1RA 1OVPA 2CNAA 2Y38A 1RVF3 1QWRA 3HR9A 2YC0A 3J8F3 4QKDA 5FQ0A 5JCTA 1DYKA 1JYTA 3LF7A 1GLHA 4AYUA 1QEXA 5LA0A 1GKBA 1AL0G 4OMCA 5EWSA 4N43C 5IFTA 1MZFA 3O0XA 4IEQA 4E4SA 2XL7A 5T5JA 4AFAA 2BFUS 4XJWA 1LHNA 1GR3A 2IVJA 1W9FA 2VZOA 4XXAA 3WEZA 1LOGA 3MYXA 2W3JA 4GJZA 1IPJA 5DABA 2Q5TA 4L11A 3O1VA 1PO23 2HLEA 1Q3EA 4HL0A 1KRIA 5K9YA 4KL1A 4KG8A 4K1ZA 3WW3A 4BQ2A 3MIHA 2VMDA 2VXJA 4GB33 4LA2A 3SKVA 2VUCA 3IAQA 3ZKYA 3CBNA 1YUDA 3FFZA 4WVMB 5C3SA 1H2KA 3JD72 2DBNA 5A3OA 4YM0A 3SNMA 1POV1 5KC5A 2A1XA 2DVAA 3ZYIB 2BNMA 2O8OA 3I2IA 4IV1B 3W5MA 3U4XA 3N9MA 4PQ9A 3VL8A 2QQUA 1F5JA 5A7OA 1XE0A 2SBAA 1C5HA 2G4IA 1JOPA 1WZXA 3SCGA 1AR71 1PVC1 3POFA 2F6BA 3BTYA 1LOFA 2EXIA 4QGNA 2ZGRA 1MACA 3WDVA 2V5YA 5C6CA 1UX7A 2IXCA 5GZFA 1BHGA 1S0JA 2XXZA 3VD5A 4KBBA 4Y1XA 3T2OA 1HB1A 4BXSV 2RS32 4M4RA 4UFHA 2AEYA 3EBRA 3NJYA 3N9LA 4Q0PA 2J1AA 1POV3 1O3SA 1POV0 1T2XA 2G9FA 2ADEA 1OOPA 2ID4A 2XKOA 4LOTA 1YFUA 3NKTA 2XL9A 3I2GA 3POGA 3DKWA 5EPAA 5A7WB 3WDWA 5C71A 1H0BA 2W5FA 3VZNA 5FY5A 2ZGNA 2VMIA 4HKLA 4Y1ZA 5FZ7A 4B7KA 1LOFC 2QZ3A 4OLLA 4NIGA 2WWSA 4CRQA 1AR73 1POQA 1FMD2 1XC6A 1JW6A 1LHUA 2MEV2 2BV4A 2UWBA 1RUJ2 4F83A 2BVBA 1GSLA 2E33A 3H1YA 1XRUA 1OXCA 2WN3A 4MGSA 1XNKA 2JECA 4YM3A 3NRUA 1VBB2 2IVIB 2GN7A 3VZOA 4CP0A 3J7MA 3WF4A 4HLTA 3VKOA 3T0AA 3VBUA 3CHXA 2E6VA 4D8MA 4ATFA 1EUTA 1VAMA 3WLUA 2ZZJA 4ES9A 1JTZX 4LIVA 1C1LA 1VMJA 1OLRA 3AB0A 3CNAA 5FY9A 3D3AA 4FPGA 3WNMA 3FHQA 5F5AA 4BDVB 1BEV1 2W47A 2HEYF 3FHAA 1FX5A 2GH2A 3H7JA 3SH5A 3ZN6A 3T0BA 2Q1FA 1SACA 3T1MA 1A34A 3FMGA 3ZN5A 4F8AA 4MGTA 2JG9B 1DGWA 1PMHX 2FDJA 1MZ6A 2C9KA 2HBUA 4QDQA 4ASLA 1TVGA 1UYXA 3VZKA 1NCRB 2R0FA 2OA2A 2BP6A 2D3PA 2VBBA 3HOBA 3P3NA 4CU7A 2AUYA 2VMHA 2XJRA 3VBUC 2JD9A 1AX2A 3MO4A 2P3KA 2BGCA 3AYCA 1SLBA 3GNEA 4GH4A 3ZSLA 5EYYA 4KGQA 3EXUA 4H3WA 5T50A 5CKQA 4BIFA 3POIA 1DLCA 3IB3A 1T6BX 4WVWA 3ZXAC 2I07B 1F35A 4A6OA 3OBAA 2FQPA 4PIYA 3WDXA 2JJ6A 4YW4A 1GMMA 4G9SB 1Q8OA 1GU3A 4UYBA 4C1XA 4C91A 1H1IA 2GZWA 1MEC1 1W90A 4J1XA 5FZCA 1RB8G 1BEV3 3WG4A 1FV2A 5KHGA 3B9IA 4FTBA 2D6KA 1YHFA 3VBSC 4A41A 2MEV1 1ENXA 1YQCA 4DB5A 1AR61 4LBKA 1NA1B 1TNFA 5HCBA 5KHKA 2WZEA 4OUSA 5F3CA 2YBKA 2WWJA 2ZX1A 4GWNA 1VBB1 2OUHA 2XJUA 3IM0A 5F39A 2GMEA 4XF3A 4GH4C 4GQ7A 2ZHNA 2I74A 2IXKA 3TAYA 3SH4A 4MHRA 2V73A 1N1VA 3WG1A 4MG2A 1US3A 1DCSA 1YWKA 2GC2A 3GBGA 4TLGA 2A3YA 3A22A 4WZFA 1UD1A 3PIJA 2TNFA 4BISA 1NQDA 2CGOA 2WQ8A 3HQXA 4A7KA 4JGZB 2VOVA 3WG2A 4QGMA 4COWA 3TEWA 4XPVA 1K45A 2WNEA 1UXZA 1MEC3 1U0AA 1VRBA 4QB6A 1N1TA 1LGBA 1VRH2 4K40A 4XURA 1AYN2 1NQJA 2VCCA 3T3YA 1AF9A 3VV1A 1N3PA 1QJX2 2PN5A 4FSJA 2Y33A 3INAA 1AR63 1OQEA 2ZOEB 5FY1A 1IS3A 1VAKA 2HWC2 2Y60A 1E5IA 5FZFA 1VBB3 5C8WA 2VZPA 1G9AA 1Y3TA 4IESA 4D94A 3VHPA 5A7QA 5D1IA 1WLDA 2WL1A 3PLQA 5GJ6A 2ZTNA 3OJBA 4EV0A 3PURA 3EO6A 1UNBA 3PMEA 5CG8A 5JWPA 1UQXA 4Y24A 1QH7A 1JN2P 4KQ7A 4RN5A 1Y43B 2BU9A 1OFSA 2W2IA 4GA9A 2ZMLA 3MBWA 3I49A 4V2VA 3JU9A 4PDWB 1V0AA 4Y33A 4JQTA 4OQ8A 2VMEA 3HBKA 1QJEA 1F4AA 1XYOA 3V0AA 3RDIA 1ENQA 2K2SA 4PT6A 3PVOA 3IZOA 2GSYA 3BTZA 4UFKA 2EF6A 4CXXA 3NAPA 4QWNA 1DQ6A 4XCAA 2FDIA 1CX1A 4P14A 5K0UC 1S0FA 4Q1RA 4YVWB 4UT5A 3CL1A 2IWGB 3POWA 1HKDA 2LALA 3PUQA 1V6LA 2PXJA 5A3LA 4M3CB 5FP8A 4LE3A 5C9AA 2WNUB 2E26A 2XVLA 3OB8A 1ASJ2 4XJZA 1YI9A 1H8TC 3E1F1 4MUVA 2Q8OA 2QNKA 3VD4A 3RZGA 1O3RA 1WLTA 1SQ4A 4WM7A 2VBDA 2B45X 3BU0A 1GOHA 4YZ3A 5DZGA 4AQSA 5GZDA 3U10A 1AYN1 3KT7A 4CE8A 1QJX1 3IBMA 1JYVA 3NAPC 3VN4A 2P34A 2UYBA 2HWC1 2DCTA 2H0VA 4XILA 1D2QA 1O5LA 4UF0A 2IXHA 1B35A 5C9AC 3KGLA 5D8AA 3RGBA 2YUEA 2F4PA 3E5QA 2C1FA 4PIZA 4E4DX 1QXPA 1JHJA 1SLAA 3OD4A 2VULA 3WP4A 4NPRA 1GP6A 4WM7C 1ZRDA 1F9KA 5J36A 4XZPA 1NXMA 5FY0A 4XE9A 5KHJA 4E4ZA 1HB4A 4WM8C 1ULGA 4PBPA 3AZVA 1AYN3 1UKRA 4OI1A 2VNVA 5FYMA 1VR3A 3WF0A 1QJX3 5L7OC 3W59A 5LRRA 2DCZA 1XNDA 4DXSA 5IK8A 1W8HA 2HWC3 5T54A 1BBT2 1JYXA 4DXRA 4IEVA 1U5IA 1YQ8A 2QQJA 1YIPA 1O59A 3MIGA 1QH6A 3VHOA 2XLGA 4DRVA 4YW3A 1AXYA 2R16A 2VUAA 3FBMA 4MVTA 1ASJ1 4KH9A 5FQ0B 1SG3A 3E97A 4LBQA 3WNLA 4Z07A 4RYDA 4Z92B 1YC61 2ZGUA 4EWDA 1V00A 1HRV1 5FLHA 5CISA 1O4TA 1RJ7A 5A3WA 3AP5A 2RJLA 4M3CE 4ZPIA 5J96B 3JCIA 5CEHA 2PHWA 4XFFA 2GP3A 2WAAA 1ST8A 3CEWA 4RR3C 4DUVA 5IAXA 4TN7A 4B29A 2BWCA 4GJYA 2PA7A 1JUIA 3RPQA 3VBRA 1HW5A 4LO7A 5IFPA 4R9BA 1OLQA 1Q5OA 2XKPA 3AVSA 2X05A 3TEZA 4GKXA 3PVEA 4COYA 1VLNA 2B8MA 4K8RB 5J7MA 1RUE2 4RS5B 5FZIA 3JB8A 4RFT0 4AL9A 4ET7A 1LEMA 4AVAA 2ZX0A 4R8HA 3WD5A 1YO8A 2Z5WA 2QFEA 1O3QA 2OX0A 1ASJ3 3NJVA 2WSVA 4M3CF 1S1AA 3MDPA 5C70A 3VBOC 4LBJA 3S0MA 1PX3A 2W46A 3I2HA 1WW4A 1HRV3 5FK7A 4JKKA 1MS3A 4LHNA 1QKQA 4UOJA 2X09A 5LA2A 3C7GA 4IEXA 2A3XA 4K1YA 5LY2A 3FFQA 5L9VA 4HVQA 3PU3A 1QF3A 4A3ZA 1LULA 3WF3A 2V5DA 3ZXDA 3AZYA 4QKNA 3VBFC 1D2SA 3EMRA 2GDFA 4Z82A 2C24A 5BNOA 1ZA4A 4WZCA 5AVPA 3U37A 4ZS3A 3MV01 4BXFA 4UFMA 3POJA 3K3OA 4LORA 4N90A 1GWLA 2D6OX 3AMQA 4NR1A 4AR2A 1NZIA 2XWJB 3OSDA 5FY7A 1V6KA 4DEQA 1MS0A 5J37A 1UIJA 3ZXKA 4GAZA 4ZY9A 2RJ2A 2BDRA 3ZOIA 1OH4A 4JGYC 5FZAA 3IAPA 1RUI1 4XEZA 1OOPB 2DTYA 3VKFC 4YM1A 4LHSA 4NHKA 4BQXA 1F8VA 3WP5A 5L73A 1SBEA 2EXHA 1PMJX 2CGNA 2YPJA 3VKMA 5GLTA 2EAAA 1PHMA 1R1ZA 3JQXA 2QUOA 3Q9OA 1W2NA 5AFEA 4JHTA 1MQTB 4CYDA 4FPYA 2DV9A 2HKXA 1WKYA 2YC4A 5EJ1B 2WINB 2J7MA 1ZREA 2XUEA 1K12A 2VG9A 2Q4SA 3ZFGC 2VNOA 3VZJA 3OUHA 1RGSA 3CJIC 3KGZA 1UF2C 3B93A 3R4DB 4M0NA 4ZS2A 1CN1A 3WXPA 4ARYA 4CCNA 4IV1C 1EUUA 2XDVA 4IE6A 4SBVA 1RUD2 1N1YA 1GYKA 1W03A 3S7EA 4DXTA 3ZSMA 5IK4A 3NV2A 4C0BA 3I2JA 1MZEA 3R05A 1ZRRA 1LGCA 3JQWA 3MEPA 2WNOA 1RHI1 2VJXA 1QJZA 2PTMA 5A7WA 1QOTA 4LO5B 4P9GA 4XC9A 1L7RA 1UY2A 2TBVA 3WV6A 3ZN6B 4YZ2A 1RUI3 2PAEA 1CQ9A 4BQ5A 1DLLA 3N7JA 4EZHA 3IIAA 2ZEZA 3KD4A 4HSJA 2VD7A 3A0NA 4Y5Z0 2OXBA 1AXKA 2YDEA 5FR3A 2DBIA 5CA6A 2WFPA 1ULCA 1WD4A 4LBOA 5FZKA 3ILNA 3I3BA 1EP0A 3BTXA 2CTVA 4KWLA 3WDTA 1YJKA 1W3VA 5CADA 4LBNA 1YQ2A 4CEYB 2JB8A 1HLCA 5LA1A 3BGAA 1ND2A 4W6WA 5IW0A 4Y5SA 3VKLA 4E8DA 2D6LX 3LD8A 1RHI3 1UPSA 3A21A 3OGJA 4WVZA 3WCRA 2JG9A 5DAVA 2GNDA 4TXWA 1RMU2 3C7EA 4BYYA 1QDCA 4LE4A 3WZ1A 3WP3A 2EAKA 3JB4C 1KS4A 3GZEA 4EJRA 1DGRA 4ZONA 4IQPA 5C8CA 2QDNA 1EAH2 2UU8A 4NWWA 1WW7A 3POBA 2WA3A 1WD3A 3RVHA 1C8NA 1VBA1 3I7DA 1IS6A 4YVSB 4DNYA 1LGNA 3SCFA 4DUWA 1HB2A 1W0NA 1WA6X 2VQTA 1W6MA 1SEFA 2PHTA 2OW4A 3AMHA 4UFLA 4MLOA 1VBC1 2ZCWA 4R9DA 4SLIA 4A6SA 4BQWA 1LNSA 1S0CA 2P17A 4OHXA 2AC1A 2XR4A 1SLCA 4XCBA 2JG9C 5F5IA 2QKDA 3IDBB 3I3MA 4P5HA 4GZ9A 4A2UA 1R082 5AC93 3ZSJA 2WSUA 2DDUA 2V4AA 2G19A 1NCRC 1OBNA 1S0GA 4PCRA 5CYYA 2P5BA 5F6LB 4CXWA 2IUWA 4JKMA 4D6QA 1UU4A 1DZQA 1W8OA 4WVVA 3LEGA 2TUNA 1BJQA 2Q0AA 1BCXA 2R32A 3POSA 1TNRA 1U5ZA 2JDAA 3P1IA 2DUPA 2JG8B 3CMGA 3QCWA 3J26N 3J7HA 4XUQA 4Y4RA 3Q8EA 3LEIA 3EQEA 1VBA3 4P02B 4UFIA 2Q8DA 2YROA 3P5BA 4CVUA 1LJ7A 4I0BA 3ASIA 3ZSEA 4QD2A 2RDNA 1VBC3 1RUH2 2DURA 4JGZA 4LKEA 3AP7A 1PNGA 4QXHA 2XBO2 5DZEA 2FDHA 1BQPA 2VR4A 1XNBA 2VMCA 4NPLA 5IWFA 1NA1C 4OVEA 3V0BA 4L99A 3V0AB 1J84A 1GP4A 2XB6C 3H3LA 2IFRA 4CUCA 2VQAA 1OF4A 5DZFA 3J7NA 5KC6A 4BM8A 4JX0A 3WUCA 2XONA 5JI7A 4COVA 4QU1A 1D4M1 3POEA 3EJKA 3UYJA 5F37A 2JE9A 3LA3A 2WAOA 1LEDA 3AFKA 3RSJA 1RUG2 2W08A 3N9NA 2QE3A 2ORZA 1QJU3 4LK7A 5L36A 1W9TA 1GICA 3ZVXA 4HZFA 2Y6FA 1CONA 3KF5A 3SHRA 2W94A 1NE4A 1E57A 4QX8A 4V2WA 1UOFA 1XPWA 3B01A 5HXVA 4AI2A 5FPXA 3CF6E 2D6NA 4AVVA 4CDXA 4HK8A 4XQWA 3ZM8A 1UY1A 2ZJCA 4GWIA 4KG0A 4QX0A 2C9AA 5C5UA 5DG2A 4EQVA 2NM1A 2VCAA 5JOYA 4FPOB 1HX6A 2ES3A 4YRDA 4YVWA 1VJ2A 1DGWX 5IJRA 1KFXL 5A7NA 2NMNA 5AFBA 3N36A 1ZRCA 4W6YA 1W06A 2KA3A 2WUHA 1W05A 1B35B 3AYEA 1D4M3 2MHFA 1PZ9A 1CAXA 4BHPA 2Y0IA 5D8AB 4JRLA 1JU3A 2EA7A 1R1A2 1XE7A 2PLV1 4XMIA 2VVFA 1NE6A 3KV6A 3MW3A 4MSVA 5I8TA 4PDWC 3DEMA 2YHJA 3D82A 5FZ1A 4COZA 5BNPA 2XUMA 2LM3A 2XBO1 3M70A 3UJQA 1PZ8A 1QXRA 1WLCA 3UKTA 2W95A 5FO8B 1W2OA 3M3OA 1UYPA 4NOTA 5FO9B 4UXAA 1ZZ7A 1JMUB 2A6YA 5DUVA 3LA2A 1NUKA 3LIHA 4KGGA 5HXMA 5FXWA 3TWIA 4Y1YA 4BCUA 4XFCA 4YVWC 5GLUA 3AKSA 3FE5A 4PJYA 1GZ9A 1PO12 1W6PA 2W9XA 4FXGB 4Q4V2 4QB2A 3RMYA 4AEDB 4AE2A 2AH2A 4Q5OA 4NUBA 2WNUC 1H9PA 2OQ6A 4C0HA 1DZTA 4GWMA 2VNGA 3VHRA 1RUG1 4CCOA 1QNWA 3H1WA 3IDEA 2PLV3 5FZ6A 3WSOA 5FPAA 3AL6A 2BRTA 1AXZA 1AZDA 4IEOA 1KXGA 1ZZ6A 1SPPB 2RE9A 2BEOA 5C4WA 3Q8BA 1C1FA 3UGGA 4EN9B 5CVRA 3ITQA 1ULDA 2WQ4A 4NJ4A 3SQOA 3SCHA 1ZBE1 4OZXA 1GZTA 5ANNA 5FP3A 3S57A 4GIQA 4UFJA 4MHUA 4OI4A 5FZDA 3VBRB 1SMVA 3N7MA 1WW6A 5FZEA 3CLPA 1CJDA 1RIRA 4YW6A 4DINB 1STMA 3MIFA 2BW8A 3TEYA 2NZ9A 4NAMA 2JDNA 4CCJA 5FY4A 3RI8A 2E31A 2X10A 5DG1A 1RUG3 1W8UA 3C2UA 1XNTA 1PGW2 4LEJA 5H9RA 2HJIA 4PLOA 4ES8A 2V72A 4FQZA 3R0RA 4HG6B 2L9LA 3OBRA 1JYIA 2NP0A 1LU2A 2PHLA 2WNVC 2O8QA 4YPJA 4N53B 2XVKA 1XBFA 2OYZA 5IVCA 3MF6A 1AYM2 3NNMA 1PO11 1J1LA 3GJBA 1ZBE3 4Q4V1 4UW4A 4E27A 5FWJA 3ZYFA 1XJAA 3CZJA 1KS5A 4OI2A 4R4ZA 3ZXLA 5BNOB 1UIKA 3VLBB 1VALA 4RS5A 5KXEA 2Y8KA 4ONUA 4LKSA 1KJRA 1N3QA 5FPVA 3DN7A 3IDCB 1XB9A 5K7PA 2C6SA 1ACCA 3HT1A 2K0GA 4YYOA 3H3UA 5FLJA 1OMIA 1OURA 2OKXA 3NV3A 2AGSA 4JDOA 1TME2 1X50A 3NSTA 5FRAA 1IS5A 2CU5A 3LA7A 4K3UA 4FBFA 5IYYA 4AW7A 2ZS6B 2JDPA 3KQ4B 2D40A 2QQIA 3GHNA 1D4VB 1UAIA 3BVCA 4JDMA 3KLSA 1YQ6A 1OKOA 1XNAA 3FC0A 5FYVA 3VL9A 1PO13 4LIUA 4Q4V3 2J22A 3KVAA 2VUDA 1OT5A 4FI9A 4QU2A 5CIRA 4CEWA 1D0GA 1SBDA 1W3XA 1YQ5A 2FHRA 3TEXA 3AKTA 2W92A 3PUAA 4XTMA 5FXVA 2RS52 3LGRA 5FY8A 5F9TA 2YC2A 4NROA 1K5JA 3DKQA 1PGW1 5C3RA 1QJFA 2WC2A 2B39A 1GP5A 2CYFA 2RDQA 4XHBA 3I2FA 3RJ2X 2W1UA 3B69A 3GGLA 2V09A 4ZU4A 1AJOA 1SFYA 3LCPA 1HQWA 2W1WA 2P4EA 1NKGA 1AR92 2XJSA 5TSWA 1AYM1 4LQRA 4WV8A 5FZOA 4L92A 5KXCA 2Z2SB 2VVEA 1PVC3 1WCSA 3LEMA 4B4QA 1MQTA 3L2HA 4IXLA 1ZRIA 3C7HA 5KXBA 1G86A 3ZMNA 5B4XA 1GQGA 1PIV2 4FPLA 4UAPA 4XF4A 3LQCA 2VZ3A 3PTYA 4ZXKA 1CZVA 1V6NA 4LPLA 4AG4A 4LUMA 5GALA 5F3IA 2X53S 2IZWA 3THCA 3JD71 4CUGA 1FT9A 1Y4WA 2GNMA 5FP9A 4QQHA 1J3PA 4XF0A 1IGOA 1E5HA 1OOPC 1V70A 2ZHLA 2R042 2E32A 3WHUA 2TEPA 4BQYA 1ND2B 4A45A 5IATA 3HMYA 2DF7A 1H1MA 3MW2A 2HEVF 4JHZA 4YW2A 3NO8A 1NZCA 2YXSA 1ALYA 2K46A 4IV3B 4Q0QA 3WNNA 3Q8AA 1EPZA 4TWTA 1W6NB 1W9WA 1MQTC 3ZYPA 4AQ2A 1JZ7A 4IE5A 4OQ9A 5CFDA 2VW1A 3KF3A 3TNQA 1OI6A 4XAEA 1T6GC 3RZHA 4XFGA 5C8CB 1YEWA 5DPNA 2ATFA 2DWRA 4AK3A 2K9ZA 3OGGA 1W8NA 3HVDA 2RS51 4IERA 4NRPA 5JXHA 2RS31 2QQMA 5FUNA 5F2WA 2BNOA 2YYOA 3JD73 4NHXA 1Y9GA 4I09A 1X33A 4CEYA 4MYEA 4DY3A 1W6MB 5C3OA 3AKPA 3GZAA 3E5UA 4QKFA 2NPIA 2EIDA 2RMU2 4IW3A 3VBHA 3MFCA 2D3SA 4Q29A 3ZO0B 1AR91 2JX9A 3AFGA 4QKBA 2JEMA 1PZ7A 4FT8A 2GALA 1FMD1 1TMF2 2YV8A 1QJY2 2XLAA 5FKCA 4FAGA 1RUJ1 3L9JT 4YARA 1LRHA 2O14A 3ZMOA 1J3QA 1J58A 4FTEA 2OVUA 5AVAA 5JR2A 4XIKA 4BK5A 3OYWB 1OF3A 4XQ4A 4XHXA 4CZSA 1V6OA 1MZ5A 2JDZA 2EIEA 2VW2A 2BZDA 2VZUA 3CKHA 3MHZA 2PQQA 4YVSA 1OA3A 1S2EA 2PAKA 2RS53 4AF9A 4CEYC 2RS33 3RWNA 4MZUA 4QX1A 5A7SA 1UMHA 2VOKA 3SITA 1JUHA 4W50A 1S0DA 3TN92 4FFHA 4DOUA 1DHKB 2ARXA 2CV6A 4I0AA 4MX3A 4PLMA 2HYXA 1GWMA 1GZWB 5FPLA 4OULA 4Q4W2 2VW0A 1VB2A 1BK1A 1SDDB 5G05L 1HXS2 2VZQA 5FUIA 1AR93 3TRSB 4AQTA 1ODNA 2GMPA 3BOWA 3V0BB 1IQAA 1JI6A 3ZXEA 1FMD3 4QXCA 2JD4A 2W0XA 3AK0A 2MEV3 5H9PA 3RZZA 1RUJ3 2JDYA 4AGRA 2WT0A 4CPBD 4QQOA 4MH0E 1FATA 5SV5A 1JH5A 1ULEA 1XXNA 4YVSC 1QNYA 5G04L 2XH6A 1O3TA 2JG8A 5HI0A 2MPFA 2WN2A 5FYTA 1UY4A 3FL7A 5FK8A 2RR12 4YW5A 3WQ0A 5BV6A 4IDZA 1CAVA 3NV1A 4QX5A 2DCYA 2DVBA 2F4LA 4KBZA 2BNNA 1ZBA2 2H6CA 3MLKA 2ZKLA 5A3MA 4P9IA 2WYSA 3J7LA 1TMF1 4QX2A 1QJY1 4K7JA 4R52A 4CDXB 2ZABA 5FZ0A 1XNCA 5JVVA 2PHUA 5FXZA 5JPMB 2WS92 5KHIA 1MS4A 4W65A 1VMHA 5ISLA 3H42B 2G9ZA 5A1AA 2JG8C 4UWDA 3K4DA 5GLWA 1AR82 2D93A 3I4IA 4XBNA 3ZDVA 5JZGA 4LMFA 4CP9B 1GANA 1RC6A 1WMEA 3GCWA 3KCYA 4H55A 4N7IA 2GMMA 1WGPA 5FZMA 3CDZB 3ACHA 4HFSA 4B3NA 3ZN4A 1CAXB 4J25A 2WKKA 1X9PA 2RVAA 2Y26A 3LDKA 4HKWA 5GLVA 4B8EA 5A33B 3RZMA 3GXUA 2J1RA 4Q4W1 1COV2 5BNPB 4DPNA 5A70A 1LR5A 5CAZA 2A70A 1HXS1 1OD5A 3ACFA 3H7YA 2XJQA 5J09A 1UKGA 2YFZA 2ZX2A 1I5ZA 4OZOA 1VRH1 1CZTA 2UYAA 2VTXA 3H0OA 4Q27A 5A1LA 1TMF3 3RG0A 1X36A 5I0TA 4AVTA 4CDQB 1UPIA 4QPYA 4YGBA 3AZXA 2B7YA 2HYKA 1W6PB 4AFMA 2A75A 4OMDA 3DYOA 3KCXA 2D6MA 3LAGA 5DDJ2 1EYBA 2JE8A 3JBG2 3ETQA 5IVFA 1UCXA 2RR11 3WW1A 4DO0A 4QDRA 2Y6GA 3VDCA 3KT4A 3R6SA 1QXJA 4GKYA 2OS2A 5JOWA 3B9CA 3CZUA 1G7YA 1ZBA1 1WLWA 3VHNA 1GNYA 3C7FA 1HJFA 4CCLA 4QPIA 3OY8B 4Q4W3 4Q4Y2 2NLRA 4HONA 4HANA 1ZZ9A 5I93A 1HXS3 3M3EA 3IT8A 3O14A 1VP6A 1UL9A 4ZZ5A 5C4WB 1G8WA 1OPMA 3SKJE 4YSFA 1VRH3 2IXLA 1MS5A 5FMCA 3MLLA 3T4HB 3VGIA 3GYDA 3HJRA 3SMHA 2LUWA 3OEBA 4NN0A 1HV0A 4AHWA 1SZBA 1AR81 1PVXA 1CZSA 5CKMA 2QQVA 1X9TA 4AEDA 2QQWA 2VXRA 3I54A 1B35C 4LKFA 3A4UA 3X29B 5J48A 2VZVA 5D8AC 2RS12 3AC0A 4FPKA 3RZJA 4MV2A 1EY2A 1KJLA 1YFXA 1OPOA 1W0OA 3JZVA 3AMMA 1PM7A 2RR13 3K48A 4AEKA 5BYNA 3HT2A 3IPVB 3ME2A 4FFIA 1TE1B 2ZGTA 1L7LA 2ETEA 1BVVA 1LOEA 3WCSA 1COV1 1DGRN 2WO1A 1GNZA 4NIIA 2YPDA 5BUVA 1ZBA3 2RDSA 3D6EA 1SPPA 1UOGA 1S0BA 3KHBA 5LK7B 2P6CA 3UL2A 1SFNA 3NNJA 1VBE2 5KWRA 1UZVA 3BB6A 5FTTC 5LBFA 5T5PA 2J1SA 4K8FA 3J4UH 5FWEA 3ILRA 4AEMA 3FLTA 3WHTA 4LBLA 3NW4A 2OPWA 2J1EA 3IMNA 5FMOL 4AEDC 3M2MA 4NMIA 1QGLA 3THDA 1HQNA 4NIDA 2QQPA 3ZYJB 5JUVA 3FUQA 1E5RA 5DDJ1 1HQLA 3D0JA 3JBG1 4P9YA 1MPXA 1ZYBA 1W8FA 2A73B 3H8OA 2PHFA 3CQOA 3OEAA 4E2GA 1DQ5A 1RYYA 5JAXA 3AJYA 1HRI2 2FD8A 3T09A 4JVAA 1J1TA 1F31A 2E53A 2GC0A 3C8XA 5FZ3A 3H8XA 3H1MA 2WFF2
chains in the Genus database with same CATH topology
3AZWA 4D7TA 1W6OB 4Q4Y1 1COV3 3QOPA 3M4FA 1FI2A 4N53A 5EFUA 1C8M2 3ZIXA 3VBRC 4AEJA 1WCDJ 3WDYA 1Q43A 3H3ZA 1ONAA 1ZZ8A 3V64A 1BBT1 3ELNA 4K6BA 5BXXA 1CIWA 1JOJA 3B02A 3JBG3 4MGZE 3V56A 4CEWB 4U2AA 4XJUA 1C3HA 1RITA 3FBYA 2P3IA 2ZHKA 1V6MA 2ZX4A 3U0ZA 2DUOA 1CPMA 3MPPG 3N35A 3FLRA 4OHWA 5FO7B 2ERFA 4AI1A 4N53C 2G9GA 1VBE1 1OFNA 5F5QA 4X6QB 5JMCA 2R072 2R062 2ZX3A 1LODA 4AXOA 1LECA 3KT1A 4BMBA 4HKOA 4LO8A 2ZGLA 5BNOC 2E63A 2R30A 4HT1T 2GNTA 1RUE1 1BBT3 3DL3A 1OSGA 5IT6A 2IC1A 1HRI1 1OQ1A 2BUKA 2NYYA 2E7AA 3IN9A 2DU0A 4YFZA 2WFF1 1FXZA 3ZXGA 5FLIA 1XU2A 4LLFA 3UJOA 3E5XA 1J59A 4XIOA 2WLPA 1VBE3 2Q30A 1MS8A 3B3QE 3ENRA 4LLOA 2DVFA 2HWE2 5CFDB 3B94A 3R4UA 1A78A 2ZGPA 4BZ4A 3ILFA 3MIEA 1RUE3 1WBLA 2CAUA 3ES4A 1PK6A 3RMXA 4HMZA 1ZVFA 4KU7A 4FOVA 2R1BA 1HRI3 4IEYA 5I91A 2GU9A 1S0EA 2D43A 3J9SA 2QVSB 2P3JA 4P9WA 3GZTB 2WFF3 1WA4A 1ZZCA 5GM0A 2B46X 4S2FA 1A8MA 4AHYA 1S2KA 3VBHB 3NJZA 4IV3A 3OTFA 4HSLA 4YGCA 1W6NA 4ISQA 1G9BA 4DQAA 5LEJA 4XFIA 2AR6A 1H2MA 2JXAA 4RQPA 5E88A 4META 3ZX7A 3BALA 3ZSKA 4JAAA 4QQPA 2DVDA 4BPZA 5JOXA 1IHMA 1G9FA 5T5OA 3KCCA 1VBD2 4S2GA 2FBEA 1N3OA 1RUD1 2OZJA 2VNRA 4FXKB 4IEWA 1ZM1A 1HIXA 3KMHA 2DTWA 1ND2C 1YNAA 3WP6A 3WUDA 3QBQA 1GV9A 4XF9A 4IV3C 2ZAAA 4UBHA 3N4MA 1SLTA 2CGPA 3OPZA 3AP9A 4QM8A 3H8UA 4RL7A 5C8CC 4FTSA 1IS4A 4AGVA 1URXA 3ALQA 4AWDA 2RM22 3OYWA 4Z1VA 2C5DA 2IFWA 5JSPA 3LZZA 1AX0A 1RUC2 3I59A 5JLVA 1I9RA 1ND3B 4NVPA 2ZBJA 1R092 4KWJA 1W6QB 3PHMA 3ZYRA 1PGL2 1DG6A 2XPJA 1RUD3 2XJVA 3AYDA 3RRDA 1C57A 1CAVB 1Q8PA 4JTNA 1GZWA 1FYUA 4LUKA 4EN8B 1B09A 2D5FA 2E7QA 5T52A 1NCQA 3WX5A 1BXHA 1RMU1 2D98A 4FQ4A 5A32A 2JICA 1JXNA 2AREA 1IKPA 4N7UA 4CP1A 3D8CA 4R9AA 3ROUA 3NKGA 4CDWB 1GNHA 1EAH1 3UK9A 2MNGA 4I30A 5BNNA 4FPHA 5F1RA 4FPFA 3AP4A 3E6DA 5JZGB 3NV4A 2B9UA 1FOD2 3AYAA 4Q0VA 2YGMA 1ENSA 4Q0UA 2JE7A 4Z2WA 2R6QA 1NY72 4RHV2 4JGZC 5ACA2 1XU1A 4M01A 4YZ1A 2PHRA 4B4PA 1R081 1DQ1A 1LESA 1FV3A 2DUQA 4Q2FA 1RMU3 1JBCA 4COUA 1DQ4A 1HDKA 4GMP1 1LHWA 2A3WA 1RUC1 1S2BA 2WZPP 3RYPA 1HV1A 1EAH3 3GBWA 5CFCA 1R091 4L97A 2QDRA 2R49A 2ZA9A 2FZ2A 3LSDA 4BIOA 3I8TA 5CU1A 3KM5A 2QJVA 2VOXA 5BY5A 3KS7A 3QACA 4NO4A 4AFDA 2B42B 3ZFEA 1Y7BA 1GQHA 1Q8SA 4YGDA 1CVNA 5BPXA 3USUB 1W0PA 1O4YA 5A33A 1RUH1 3OCPA 4XJ9A 4YLZA 5C33A 1AL22 5JIUA 4CDXC 4QPIB 2I45A 5FDBA 2PAMA 1R083 5GZCA 1PO22 3ZPYA 4A7ZA 1DFQA 3SISA 5T5LA 4XBLA 4OUMA 4CDQA 2QZ2A 3EHKA 5JSRA 1BVP1 1UX6A 5IUQA 1KITA 1RINA 1ZRFA 3S6PA 5IK5A 4GB32 4L2NA 4R4XA 4GMP3 4OFGA 1RUC3 3LWCA 3PJQA 4XYXA 2VMGA 1DF0A 4FP2A 1X7NA 1R093 3VUOA 4QQ2A 4P9JA 1UZZA 2ENRA 4Y20B 4FPCA 4RHV1 4UW6A 2ET1A 4K9SA 5BNPC 4I0WB 4LHLA 1LHOA 1PNFA 4A7YA 1RUH3 2D97A 3OY8A 4UW3A 3BIWE 2OZ6A 1M4WA 2XBO3 4AFBA 4D69A 3M3QA 1AVBA 2X8KA 2A71A 4C1WA 3DV8A 3ZFFB 3BPZA 1J3RA 2DYCA 4U36A 4CDUB 1K5MB 3IKWA 4X8PA 3G6JB 4J6GA 3D5OA 5L19A 3IPVA 1C4RA 1R1A1 4M0HA 3THPA 4KWKA 1AL21 2ZGKA 4N43A 4XJAA 4UW5A 3RJRA 5C4WC 1AR72 3WNXA 5E1RA 2E9QA 1AJKA 4HETA 4YM2A 2W52A 4N9IA 1N47A 4NHMA 2GNBA 2HEWF 2O0OA 4KU8A 3WW2A 1MR5A 2BFUL 3PJYA 4DRRA 2IXJA 4PLNA 2KXLA 4K21A 3UV9A 2FMYA 1DBNA 1REFA 1R1A3 4YG0A 1W6OA 4JGYB 1AL23 1CAUB 5GZEA 4W6XA 4FAHA 1FNYA 5JDBA 2ZGSA 2A7AA 3L2YA 1LENA 3DF0A 5K8SA 2ZACA 4WBBA 3FJSA 4HK9A 4I2OA 2A6WA 3ES1A 4Z8BA 4RS5C 2DCKA 4PBOA 3ZFGB 1VIWB 3CJIB 2Z79A 3O5SA 1LHVA 3FX3A 2WT2A 1H1AA 2E51A 1NXD1 2ILMA 3GBFA 2IXIA 4BLIA 4RSUA 2VVDA 1BEV2 4LR4A 2OIIA 4RD7A 1UMZA 3U11A 1RUOA 1YIFA 2VECA 3ZXFA 5J3UA 2HWB2 5EJ3A 1KDMA 5JI9A 1OHFA 1V9U2 4M00A 3OD0A 4CP2A 4F3JA 2XJPA 1H2LA 2NN8A 1PGSA 2BYVE 1YCIA 3S7IA 1FPN2 4CEWC 1XYNA 2WA4A 2XG3A 2WLQA 3R4SA 1PK6B 1CPNA 2UWCA 3B00A 3NWKA 1D0HA 5HBAA 3N7LA 4UBGA 2ZKNA 1TME1 3N3HA 1MEC2 2ZGQA 2XLFA 4FPEA 4BQ1A 3C3VA 1UU5A 3S30A 4AVSA 1AR62 2WT1A 1WBFA 2GC3A 4H7LA 1AYM3 4LBQD 3N7KA 4JTOA 4RQPB 4ZU7A 4L8QA 3W9AA 4LBMA 3VDDB 3CO2A 2A5ZA 3HN1A 1ZX5A 1U5YA 3K51A 4FCAA 4DMIA 4O9EA 2P2KA 2XVGA 4RGGA 4AFCA 1LOAA 1ZZBA 3DPRB 2C0ZA 2BBVA 5E8AA 3NVCA 5ABJB 4GULA 3HIFA 2EALA 4BA6A 2CY6A 2HWB1 1H2NA 1TME3 2WZR2 2X5IB 4QHBA 4XXPA 5J98B 1DQ2A 1QOOA 1V9U1 2QCSB 3VBSA 1S0IA 3APBA 4QXKA 5CFDC 2JKBA 4EWAA 1ZNPA 2AYHA 3MFAA 4EWEA 1FPN1 1KQRA 4XOGA 5I0SA 1PIV1 1CR7A 4Q4X2 2D3RA 1A6CA 4JC1A 1QQP2 4LULA 2EVXA 3PMSA 3I59B 4V1PA 1LKNA 4YGEA 1VB4A 2KM2A 3GALA 3QH7A 1APNA 1QY4A 3AKQA 4QPGB 1H4HA 3WINE 2R041 3TB0A 3VBHC 3AJZA 2YY1A 1C28A 4F7ZA 1OA4A 4HPKB 2HWB3 3MI8A 1NCQB 1V9U3 1REDA 3OBTA 4Y22B 5A32B 3G7DA 1LTEA 5GKAC 3UKVA 1O91A 3QLQA 1CESA 1FPN3 1F2NA 1PIV3 4IL7A 5KHHA 1ND3A 4Q8KA 2Z69A 5CB7A 2CWSA 4AQ6A 5BNNB 1Z7S2 2BPA2 1UZYA 1W6QA 1VAVA 1YFYA 3AMPA 4Q0SA 4RGAA 4D3WA 2A6XA 1CAWB 3M8LA 4EN7B 5FFOC 1UW8A 2RMU1 2WZR1 3HD8B 2R043 3NL1A 2E7TA 4PIXA 5JR7B 4DY5A 1XQNA 4ASMB 4ZU5A 4KNCA 4CDWA 2BWAA 4JV4A 4Q4X1 4A3XA 4YZ5A 5K0UA 1ND3C 1QQP1 3SLIA 1H9WA 4AVBA 3IWZA 5CG9A 1QOSA 3FWEA 4I02A 4HVOA 3THTA 4NHLA 5CFCB 3AKRA 2VH9A 2PHXA 1U12A 1M06G 1TEIA 1YJLA 3LB9A 4MGKE 4E2SA 1RUF2 3AXDA 1H8TA 3TN91 3ZFEB 5GZGA 3E6BA 3PNAA 4PF5A 4E9KA 4XJ8A 3GF6A 5SV8A 2RMU3 2WZR3 3O0WA 5LEKA 1NLRA 4CDWC 5CNAA 2BVVA 4OHZA 5LK5A 1QJY3 3LSEA 3RYKA 4QM9A 4Q4X3 1YLLA 3UKNA 1JHNA 1Z7S1 1QQP3 5JZGC 5CBLA 4LO6B 1Q8VA 2RHPA 4HVRA 4S2DA 4BE3A 3U07A 5JIAA 1NG0A 3KZ4C 4LNVA 4D7SA 3M1HA 4XW3A 3USUA 1HRV2 5I8SA 1WUVA 3TN93 1WMDA 4H14A 4AVCA 3ATGA 2O1QA 4MXWA 4WM8A 5B2GB 4XBQA 3WR0A 4E2QA 1RUNA 5GLZA 5L7OA 2WS91 3RI9A 5JSOA 3AMNA 3PVNA 4I01A 5EYXA 4GALA 4XETA 4H7MA 2HWD2 3KSCA 4Q26A 4FOQA 3URFA 1Z7S3 4OHVA 2D5HA 1RUF1 1GFF2 4Y20A 3O7OA 2AENA 2CWMA 3P3PA 4FO9A 3MF9A 4LO4B 4TLFA 5JOZA 1IPKA 4QPIC 4N43B 3AZZA 1YXWA 2OPKA 5H9QA 1NLSA 3HAGA 4IEPA 2WNVB 5FPZA 3MZHA 4BOWA 1C5IA 4QT6A 4RR3A 1O7FA 3LKJA 3BOPA 1G9CA 1OQDA 1Q8QA 3TBDA 3ZFFA 1H30A 3FLPA 4B7EA 2WS93 4IEZA 1G6NA 4CDUA 1MS1A 2ZAHA 1K5MA 2P37A 1AX1A 3AX4A 4MGIE 3WOGA 1LOBA 4DFSA 1U5XA 2A6ZA 4YNIA 1AR83 4YW1A 4P9XA 3WG3A 5I0UA 4OHYA 3TYJA 4JQRA 4ORFA 5FMOS 2FZ1A 3RS6A 1Y9QA 1XE8A 4N9HA 1RUF3 3O0VA 3M3IA 3VBOA 1ENRA 2VU9A 2YZ4A 3VZLA 5HCAA 2ZMNA 1RUI2 5FOBB 1MS9A 1OKQA 1EV12 4AI8A 1DZRA 3ECQA 3ZFFC 3ZDSA 4YG6A 1CX4A 1DYPA 3DUIA 3A0KA 2ZMKA 1I6XA 2EXJA 4CDUC 1K5MC 1L3JA 2HWD1 3VBFA 4XFAA 1RL3A 3M7AA 1QDOA 3HWJA 1SBFA 3MICA 4NWVA 2RS11 4Y4YA 5DDJ3 4DZGA 1IKQA 4Y1VA 2VY0A 1LB2A 5FOJB 1LCLA 3M3CA 2JENA 1KD7A 2XGXA 2DFCA 4LT5A 2Y0OA 3RQ0A 4FOYA 1RHI2 4JGYA 4QQLA 1BYHA 3AP6A 1CAUA 3PVBB 3ST7A 3TOJA 4IETA 5BNQA 4L9BA 4Q4Y3 2ARBA 4HN1A 2W39A 4JRAA 4I3PA 4HN0A 1W2UA 4C90A 3H50A 3WDUA 2EXKA 1I3HA 1BZWA 1YFWA 2HWD3 2HWF2 1DGLA 5H9SA 1IOAA 4WVMA 3ZFGA 3CJIA 4XQDA 2WIIB 2RS13 4IV1A 2BTVC 4AI3A 1DQ0A 1YYNA 2D6PA 1YRZA 1EV11 5AC92 1BMV2 3JUUA 1UN1A 3O12A 2GN3A 1AUYA 4IEUA 1C8M1 3ACLA 4BMEA 3WVJA 2YGLA 2CAVA 3KQRA 4EN6B 1O4ZA 2UY8A 2NQYA 2B5HA 4QMAA 3VBUB 1I1EA 2X29A 1VBA2 3D4KA 2LTNA 4MGYE 1Z0HA 2BQPA 2ZGOA 4AGGA 4JDNA 4HBNA 2Q1MA 1VBC2 2PHDA 4YZ4A 2DCJA 1SCSA 1BKZA 1SCRA 2A6VA 3H9AA 1SLIA 2ZGMA 1EV13 2H6BA 1OA2A 2R071 2R061 3B7MA 4XTPA 2GC1A 4XF1A 4K20A 4Y1UA 2GH8A 3QH6A 3VBSB 1C8M3 4LA3A 3SH3A 4MXVA 2HWF1 3VDDA 5IK7A 2H0BA 2Q1ZB 5DUUA 3POYA 4GH4B 5EZWA 1PK6C 3V65A 4AHXA 3DPRA 4Y26A 3WQ7A 2VPVA 1QJU2 2PYTA 2YMZA 3I2DA 1REEA 5FREA 1NOVA 4FPJA 4G4FA 1DU3D 4G3YC 5ABJA 2PELA 2SLIA 3ZIWA 5AC91 4QGLA 2WQZC 4RA0A 4DXZA 2XJTA 1BMV1 4TSVA 2CL2A 2X5IA 2FMDA 4CTEA 1NCRA 1MVEA 2R063 2R073 3GZUC 1V6JA 4RQPC 4BH9A 3VDDC 2HWE1 1YI7A 3CJXA 2VQ0A 2HWF3 2ET7A 1D4M2 3DPRC 3ZYGA 5FAXA 4FVVA 4D7YA 1RTVA 1IZ3A 3W58A 4Q1PA 2VOWA 5ABJC 4Q8LA 3FZ3A 3QD6A 1NYWA 3E6CC 4QPGA 1EPWA 3BU7A 2X5IC 1QMJA 2ZZQA 4BLJA 4HPKA 2Z42A 3TNPB 1NA1A 3MGUA 3LOBA 3OF1A 4ISRA 2EIGA 4Y22A 4YG3A 1WMFA 1O5UA 3BCWA 4R9CA 1KFUL 4LTAA 2HWE3 4ITCA 1WCKA 5K0UB 1GZCA 3WY6A 3AM2A 2W68A 1VBD1 1QJU1 1N1SA 1WW5A 5DUXA 4QPGC 1CAWA 2PLV2 5T3NA 2XHKA 1DDLA 2DVGA 3T1LA 3MW4A 5E16A 4XDQA 1H8TB 1NCQC 4FOWA 2D44A 4FP3A 5EXOA 4AHZA 3T2TA 4JCKA 3LOIA 1SLLA 2ZHMA 3NAPB 1X82A 3SXWA 1LOCA 2DU1A 4EN0A 2RM21 5BNNC 1Q56A 1X8MA 4ZKTB 1KDKA 2VUJA 5I8YA 2UURA 1ULFA 3J8F2 1RVF2 2ZPXA 3WT3A 4I3GA 5EV7A 5C9AB 1VBD3 1PGL1 1GBGA 5T55A 1JYCA 4B4RA 4PDWA 2UWAA 4ATEA 1LU1A 5FCCA 4TZDA 4WM7B 2RJKA 2XWBB 2DFBA 1TQ5A 3AXEA 4MXWB 1CJPA 2NMOA 4J1WA 1FAYA 5F6KA 4WM8B 1ZBE2 3MPBA 2OUJA 1UU6A 1AHSA 5L7OB 3D0SA 5CFCC 2RM23 3MLJA 4M3CA 4P9LA 2WNUA 4GMP0 4GXLA 1S55A 3VKNA 2D7FA 2PFWA 1CGPA 1FOD1 5JPNB 3ZFEC 1A3KA 3B5LB 4S2HA 1NY71 5ACA1 1SDWA 4URTA 3USSA 2AZ5A 1DIWA 5I0RA 1MVQA 5KXDA 3FUOA 3ZXJA 4LHKA 2GAUA 4RR3B 4CDQC 4AI0A 4X8NA 1V6IA 1CD3G 3WQ1A 5E89A 1X8EA 3J8F1 1RVF1 1F5FA 3MIBA 4YFWA 4BWOA 2R0HA 1W39A 2WJSA 2I2SA 1H8VA 3HBZA 1FOD3 1H4GA 1QHDA 4LBQB 5HCFA 4X6RB 3RNSA 5DUWA 1Z78A 4RHV3 5ACA3 3VBOB 1G9DA 3MIDA 3GHMA 5DXDA 4XFBA 2VGDA 1FNZA 2N7GA 2WNVA 1A8DA 3KB5A 1RJ8A 1PO21 1PVC2 2R1DA 3DGTA 4TYSA 5FBZA 3VZMA 4EROA 3FHIB 3RYRA 2UY9A 1XYPA 3WW4A 4DS0A 4O9GA 4XFHA 1PMIA 4GB31 3BTAA 4XMAA 3VBFB 3CU7A 4INDA 3BODA 1QU0A 2CNAA 2Y38A 1RVF3 1QWRA 3HR9A 2YC0A 3J8F3 5FQ0A 5JCTA 1DYKA 1GLHA 4AYUA 1GKBA 1AL0G 5EWSA 4N43C 1MZFA 3O0XA 4IEQA 4E4SA 2XL7A 5T5JA 4AFAA 2BFUS 4XJWA 1LHNA 1GR3A 4XXAA 1LOGA 3MYXA 1IPJA 2Q5TA 4L11A 1PO23 4HL0A 1Q3EA 1KRIA 5K9YA 4KL1A 4KG8A 4K1ZA 3WW3A 3MIHA 4GB33 4LA2A 1YUDA 3FFZA 4WVMB 1H2KA 3JD72 3SNMA 4YM0A 1POV1 5KC5A 2DVAA 3ZYIB 2BNMA 2O8OA 4IV1B 3U4XA 4PQ9A 3VL8A 1F5JA 2SBAA 1C5HA 2G4IA 3SCGA 1AR71 1PVC1 2F6BA 1LOFA 2EXIA 4QGNA 2ZGRA 1MACA 3WDVA 2V5YA 5C6CA 2IXCA 5GZFA 1S0JA 4KBBA 4Y1XA 2RS32 3EBRA 4Q0PA 1POV3 1O3SA 1POV0 2G9FA 1OOPA 2XKOA 1YFUA 3NKTA 2XL9A 3WDWA 5KBFA 3DKWA 1H0BA 3VZNA 2ZGNA 2VMIA 4HKLA 4Y1ZA 4B7KA 1LOFC 2QZ3A 4OLLA 2WWSA 4CRQA 1AR73 1FMD2 2UWBA 1JW6A 1LHUA 2MEV2 1RUJ2 4F83A 2BVBA 1GSLA 3H1YA 1XRUA 4YM3A 1XNKA 2JECA 1VBB2 2GN7A 3VZOA 4CP0A 4HLTA 3VKOA 3VBUA 2E6VA 4ATFA 1VAMA 3WLUA 2ZZJA 4ES9A 1JTZX 1C1LA 1OLRA 3AB0A 3CNAA 4FPGA 1BEV1 3ZN6A 2HEYF 3H7JA 1FX5A 2GH2A 3SH5A 3T1MA 1SACA 3FMGA 3ZN5A 4F8AA 2JG9B 1DGWA 1MZ6A 4ASLA 3VZKA 1NCRB 2R0FA 2OA2A 2D3PA 3P3NA 2AUYA 2VMHA 2XJRA 3VBUC 1AX2A 2P3KA 2BGCA 3AYCA 1SLBA 3GNEA 4GH4A 3ZSLA 5EYYA 4KGQA 3EXUA 4H3WA 5T50A 4BIFA 4WVWA 3ZXAC 2I07B 2FQPA 4PIYA 3WDXA 2JJ6A 4YW4A 4G9SB 1Q8OA 4C91A 4C1XA 1H1IA 2GZWA 1MEC1 4J1XA 1RB8G 1BEV3 3WG4A 1FV2A 5KHGA 3B9IA 4FTBA 2D6KA 1YHFA 3VBSC 2MEV1 1ENXA 4DB5A 1AR61 4LBKA 1NA1B 1TNFA 5HCBA 5KHKA 4OUSA 2ZX1A 4GWNA 1VBB1 2OUHA 2XJUA 3IM0A 2GMEA 4XF3A 4GH4C 4GQ7A 2ZHNA 2I74A 2IXKA 3TAYA 3SH4A 2V73A 1N1VA 3WG1A 1YWKA 2GC2A 3GBGA 2A3YA 4WZFA 1UD1A 2TNFA 1NQDA 2CGOA 3HQXA 4A7KA 4JGZB 2VOVA 3WG2A 4QGMA 4COWA 4XPVA 2WNEA 1MEC3 1U0AA 1N1TA 1LGBA 1VRH2 4K40A 1AYN2 1NQJA 1AF9A 3VV1A 1N3PA 1QJX2 2PN5A 4FSJA 3INAA 1AR63 1OQEA 2ZOEB 1IS3A 1VAKA 2HWC2 5C8WA 1VBB3 1G9AA 1Y3TA 4IESA 4D94A 3VHPA 5D1IA 1WLDA 2WL1A 3PLQA 5GJ6A 2ZTNA 3OJBA 4EV0A 3EO6A 3PMEA 5CG8A 5JWPA 4Y24A 1QH7A 1JN2P 4KQ7A 1Y43B 4GA9A 1OFSA 2ZMLA 3JU9A 4PDWB 1XYOA 3V0AA 3RDIA 1ENQA 2K2SA 3PVOA 2GSYA 2EF6A 3NAPA 1DQ6A 4P14A 5K0UC 1S0FA 4Q1RA 4YVWB 3CL1A 2IWGB 3POWA 1HKDA 2LALA 1V6LA 5A3LA 4M3CB 4LE3A 5C9AA 2WNUB 2XVLA 1ASJ2 4XJZA 1YI9A 1H8TC 4MUVA 2Q8OA 2QNKA 1O3RA 1WLTA 1SQ4A 4WM7A 2B45X 4YZ3A 5DZGA 4AQSA 5GZDA 3U10A 1AYN1 3KT7A 1QJX1 3IBMA 3NAPC 3VN4A 2P34A 2UYBA 2HWC1 2DCTA 2H0VA 4XILA 1D2QA 1O5LA 2IXHA 1B35A 5C9AC 3KGLA 5D8AA 2YUEA 2F4PA 3E5QA 2C1FA 4PIZA 4E4DX 1QXPA 1SLAA 3OD4A 2VULA 3WP4A 4NPRA 4WM7C 1ZRDA 1F9KA 5J36A 4XZPA 1NXMA 4XE9A 5KHJA 4E4ZA 4WM8C 1ULGA 4PBPA 3AZVA 1AYN3 1UKRA 4OI1A 5L7OC 1VR3A 1QJX3 3W59A 5LRRA 2DCZA 1XNDA 5IK8A 2HWC3 5T54A 1BBT2 4IEVA 1U5IA 1YIPA 3MIGA 1QH6A 3VHOA 2XLGA 4DRVA 4YW3A 1AXYA 2R16A 2VUAA 3FBMA 4MVTA 1ASJ1 4KH9A 5FQ0B 3E97A 4LBQA 4Z07A 4Z92B 2ZGUA 4EWDA 1V00A 1HRV1 5FLHA 1O4TA 1RJ7A 3AP5A 2RJLA 4M3CE 5J96B 3JCIA 2PHWA 4XFFA 3CEWA 4RR3C 4B29A 2BWCA 2PA7A 1JUIA 3RPQA 3VBRA 1HW5A 4LO7A 4R9BA 1OLQA 1Q5OA 2XKPA 4GKXA 3PVEA 4COYA 1VLNA 2B8MA 5J7MA 1RUE2 4RS5B 3JB8A 4RFT0 1LEMA 4AVAA 2ZX0A 4R8HA 3WD5A 1YO8A 2Z5WA 2QFEA 1O3QA 1ASJ3 2WSVA 4M3CF 1S1AA 3MDPA 3VBOC 4LBJA 3S0MA 1WW4A 1HRV3 1MS3A 4LHNA 1QKQA 4IEXA 2A3XA 4K1YA 3FFQA 4HVQA 1QF3A 1LULA 3ZXDA 3AZYA 3VBFC 1D2SA 4Z82A 2GDFA 5BNOA 1ZA4A 4WZCA 5AVPA 4N90A 2D6OX 3AMQA 4NR1A 2XWJB 1V6KA 1MS0A 5J37A 1UIJA 3ZXKA 4JGYC 1RUI1 4XEZA 1OOPB 2DTYA 3VKFC 4YM1A 4NHKA 1F8VA 3WP5A 5L73A 1SBEA 2YPJA 2CGNA 2EXHA 3VKMA 5GLTA 2EAAA 1PHMA 1R1ZA 3JQXA 2QUOA 3Q9OA 5AFEA 1MQTB 4CYDA 4FPYA 2DV9A 2HKXA 2WINB 1ZREA 2VG9A 2Q4SA 3ZFGC 2VNOA 3VZJA 1RGSA 3CJIC 3KGZA 1UF2C 3B93A 3R4DB 4M0NA 3WXPA 1CN1A 4IV1C 3S7EA 4SBVA 1RUD2 1N1YA 1GYKA 3ZSMA 5IK4A 3NV2A 4C0BA 1MZEA 3R05A 1ZRRA 1LGCA 3JQWA 3MEPA 4OI0A 1RHI1 1QJZA 2PTMA 1QOTA 4LO5B 4P9GA 3WV6A 2TBVA 3ZN6B 4YZ2A 1RUI3 2PAEA 1CQ9A 1DLLA 3N7JA 3IIAA 3KD4A 4HSJA 3A0NA 4Y5Z0 1AXKA 2YDEA 5CA6A 2WFPA 1ULCA 1WD4A 4LBOA 3ILNA 1EP0A 2CTVA 4KWLA 3WDTA 1YJKA 5CADA 4LBNA 4CEYB 1HLCA 1ND2A 4W6WA 3VKLA 2D6LX 1RHI3 1UPSA 3OGJA 4WVZA 3WCRA 2JG9A 2GNDA 1RMU2 4BYYA 1QDCA 4LE4A 3WZ1A 3WP3A 2EAKA 3JB4C 1KS4A 4EJRA 1DGRA 4IQPA 5C8CA