1H8VA

The x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
ETSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGGQNNVKSYQNSQIAIPQKRTVNSISSMPTTASWSYSGSNIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQSWTLYYGYNGAMQVYSFVAQTNTTNYSGDVKNFFNYLRDNKGYNAAGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title The X-Ray Crystal Structure of the Trichoderma Reesei Family 12 Endoglucanase 3, Cel12A, at 1.9 A Resolution
pubmed doi rcsb
source organism Trichoderma reesei
total genus 53
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h8vA00
3WP5A 1KS5A 3AKSA 2BWCA 3VZNA 1REEA 2B42B 2D98A 2JICA 1REDA 3VL9A 1H0BA 3AKTA 1OLRA 2QZ2A 1PVXA 5K9YA 3AMHA 1XYPA 2B46X 2Z79A 3VZLA 3ZSEA 4XPVA 1XNBA 1W2UA 4HKWA 3VZJA 2DCKA 2JENA 4S2GA 3B7MA 2BW8A 1XNDA 1QH7A 1HV0A 3WP3A 2DFCA 2JEMA 4HKLA 1T6GC 3VHPA 1BCXA 3AMMA 1M4WA 1H4GA 1UKRA 3HD8B 3RI9A 3MF6A 3VZMA 1QH6A 1XYOA 1ENXA 1YNAA 1XNCA 3O7OA 3VZKA 1UU4A 4HK8A 4XQWA 2DCZA 1XYNA 3EXUA 1BK1A 1BVVA 2VUJA 3AKRA 4H7MA 3B5LB 2NQYA 1NLRA 1H1AA 1KS4A 3WXPA 3VHOA 3VGIA 1H8VA 2D97A 5K7PA 4IXLA 2DFBA 1OA2A 1UU5A 4S2FA 4NPRA 1OA4A 1C5IA 5EJ3A 2BVVA 1UU6A 3LB9A 3LGRA 2BWAA 4S2DA 4S2HA 3AMNA 3MFCA 2B45X 1HIXA 3MFAA 2VGDA 4HKOA 1F5JA 3VZOA 3AMQA 3WP6A 1OA3A 2F6BA 3WY6A 3WT3A 3RI8A 4HK9A 2QZ3A 3WR0A 1XXNA 3WX5A 3AMPA 3WQ0A 1H4HA 1XNKA 2DCJA 2VULA 3MF9A 2DCYA 3WQ7A 4XQDA 3AKQA 3VLBB 1OLQA 1TE1B 2C1FA 3VHNA 2NLRA 3M4FA 1HV1A 1C5HA 3WP4A 1REFA 4XQ4A 2VG9A 3VL8A 3WQ1A 1IGOA 3AKPA 5HXVA 1AXKA
chains in the Genus database with same CATH superfamily
2ZACA 3QH6A 1UD1A 1UZWA 1Y9GA 1HRI3 5F3GA 2E63A 2J1EA 5JPNB 5FK7A 3AYEA 3S6PA 3IBMA 3LPFA 4YM2A 5IT6A 3MIBA 4OUMA 1TZOA 1LHOA 2VUCA 4WV8A 1U5YA 2C26A 4I0AA 5BY5A 4AHYA 5FCCA 1JYCA 2NMOA 5I8TA 1SBEA 3ACFA 2QQMA 2YC4A 2YGMA 2RS13 1GP4A 4Z1VA 4LUMA 4LUKA 5FFOC 1CIWA 4A3ZA 2E53A 1YI7A 5C8WA 1J1LA 4UFMA 4OHXA 3F95A 3C7GA 3S5QA 2VC9A 4ZXKA 4M4PA 4Q4V3 4OI1A 2CGPA 2QDNA 1VRH2 1X33A 3JUUA 3RYKA 3ACGA 3V56A 3JQWA 4OZXA 5GZCA 1WKYA 2E9QA 2X09A 4KG0A 2VMEA 1S0GA 4P9IA 3WDWA 1PIV1 4ARXA 5IK4A 3L2YA 4DUWA 5B4NA 3HAGA 1H2MA 3H8UA 1AL0G 3TNPB 3ZSJA 2RM21 2PAMA 3JU9A 4CEYB 1ALYA 3UT0A 1AXZA 5JXJA 4CRQA 4RL7A 5FZIA 1YFWA 3HD8B 5L7OC 1VBD2 1FNZA 2HWD2 1JU3A 1MACA 4J1XA 3RI8A 4RR3C 1S0IA 2QCSB 3WW1A 1WBFA 4LHKA 2R062 3UGGA 1VBB1 3KGZA 3O7OA 5DAWA 4BQ4A 3PIJA 2HWE2 4XIOA 2RR12 4DOUA 5FPBA 2OZ6A 2HLEA 3LA2A 5CFCC 2RDQA 3M70A 4O61A 3GBFA 4AAXA 4X8PA 5L9VA 3F2ZA 3SH5A 3B5LB 1F5FA 1PNFA 2WNOA 2XHKA 3J7MA 3NNJA 3S7IA 5IVCA 3TB0A 5FYYA 1FYUA 5DAVA 1DQ0A 1OH3A 3WINE 2A7AA 3I2GA 1AUYA 5BNOA 2GH2A 1MQTC 1L7QA 2Y0OA 1J3RA 3KM5A 4LK6A 4NMIA 4XFCA 2FCUA 4XOGA 2W52A 5FBZA 5C71A 5J09A 2A5ZA 1RUI3 2IXHA 1YJLA 4KQ7A 5JR7B 2Q30A 2PHUA 4PDWB 2ZGRA 2A3YA 2W5FA 1J83A 3KZ4C 5CVRA 4R9DA 2VJXA 4QDQA 1O5UA 4Q4Y3 1O3SA 4ZS2A 5FZ9A 4LITA 1ZBA3 2VMHA 3LOBA 5BNNA 1LECA 1WUVA 4HK9A 4QGMA 1PGSA 4FOQA 4FPKA 2AEZA 3MIFA 5T5LA 5A7WB 2WYSA 5FIXA 3U1XA 1D7PM 5A1AA 1UOGA 4N7IA 4TLFA 2GMMA 2YFUA 2LM3A 1RUF2 5F5AA 4NIIA 3K4ZA 2VTFA 1PO22 3PJYA 3DXUA 1D2QA 5A32B 1N1YA 1OUXA 2QKDA 2SLIA 2JE7A 2JKXA 3BU7A 3R0RA 3EMRA 5FZ8A 3WP4A 1QDCA 3V0BB 1ZRRA 3PUSA 2BOIA 1O3QA 1RUH3 4PI0A 2B9VA 5HXVA 3Q8FA 1A6CA 1MS4A 2JDKA 4PBPA 4PIYA 1C28A 4IEZA 3IIIA 1JMUB 2VD7A 3AZXA 1QJX2 4RQPA 4D8MA 1RYYA 1ULCA 3ZYPA 4B7KA 4UAPA 1VBE3 3MGUA 2AC1A 2BGCA 4J25A 1AL23 1JOJA 5A80A 5ABJB 4XACA 1HN1A 1GOFA 3K4AA 4Q1RA 2FBEA 1WW5A 3QLQA 3CEWA 4AQ2A 3VKLA 3KCCA 4QB2A 4E4HA 2TEPA 3VZLA 2JECA 3VBUC 1BYHA 3N35A 4Q4X3 1UAIA 4LBNA 3PU3A 3H8RA 3ATGA 2R042 3D8CA 4MADA 2WKKA 1NLSA 1HQLA 3VBFC 4FXKB 4AFMA 5LY2A 5K0UB 4WVZA 2FZ2A 3ILNA 4Q8LA 5IYYA 2MHFA 3INAA 3IZOA 1B09A 1ODNA 2H6CA 2P6HA 5T3NA 1C8M2 1QH7A 5FYIA 5FY4A 4XHXA 1F9KA 2YBKA 2RS51 2HBTA 4NHLA 1V6IA 2OW4A 1DZTA 1RUE2 3VHPA 3N9PA 1DYOA 2V5DA 1UKRA 3BVCA 4QX2A 3WHTA 4I30A 4NN0A 4CU6A 5B4XA 4AVTA 4CCMA 4LBQB 5LATA 5AC92 4BB3A 4KGQA 3MUY1 4ZONA 3AJZA 1GQPA 1IPKA 5DG2A 4YZ1A 5CFDB 1W28A 1OOPC 5KHGA 1JH5A 5LEJA 4V1PA 1K5MC 5DABA 5DUUA 3RMYA 4Q4W3 3BPSA 4LHNA 4XCAA 5A3WA 1LOGA 5JMCA 3TNQA 1QIQA 2GDFA 2VQTA 5L9BA 3RQ0A 1NCQA 1Z78A 4H14A 1I9RA 5EP9A 2D97A 3VBRA 3VD5A 4FI9A 3PIGA 1U12A 2Q1ZB 4YG0A 3VBHB 1SPPB 1ULDA 3KWVA 5GZGA 4NWVA 1SLCA 2HBUA 4FVVA 3VD7A 2K9ZA 4JDNA 3W9AA 2ZGTA 2BERA 3CZUA 1UOJA 3IDEA 3BTZA 3VZOA 2E31A 4K3UA 2OKXA 2ZABA 2WFPA 4DRVA 1DIWA 4XFHA 5T5PA 5LA1A 4DRRA 5EIYB 2V09A 4JVAA 2X5IB 5BNNC 2XPJA 2DVDA 3UJOA 4BQWA 4HN1A 5C3SA 2QQOA 2ZX0A 3DF0A 1RUJ2 1DQ6A 3H1YA 4OI2A 1R081 4XEZA 4O9GA 5E6HA 3WX5A 4DO0A 3O1PA 5FZAA 4FSJA 4NROA 2RE9A 3WHUA 3T1LA 1J3PA 3H0OA 3QOPA 1WD4A 3TAYA 4Q29A 1H6XA 4D7SA 1SACA 5J48A 3FL7A 2D6LX 2D40A 3R05A 4DY5A 5FO7B 4DB5A 4MGIE 2Y6FA 4R9CA 1TMF1 1HB4A 4TWTA 4A6SA 5LWBA 1RJ8A 1Y3TA 3A4UA 3MUZ1 5IW0A 3TEYA 1BMV1 3WF1A 3WF3A 2OPKA 4ONUA 2C24A 4DINB 4CUBA 3LCPA 2DUQA 4QM9A 4UI9L 5A3OA 2ET1A 1LGCA 3P3NA 1RMU1 3C3VA 4XVHA 4ZU7A 3WF4A 1IZ3A 2GC2A 3WCRA 1OF3A 4P14A 2EVXA 5KC6A 1J59A 1LCLA 1R1A2 2EF6A 2Y6KA 1AJKA 1AR92 3BTXA 4D0QA 3T2QA 5EYYA 2TNFA 4Q0UA 4CP2A 3HQUA 4GWNA 2VPVA 1AYN2 5FZOB 3AMHA 3VKMA 1U5IA 1HN0A 2OA2A 2OT7A 2WWSA 4L8QA 1XNBA 1PK6B 4CDQA 5BNQA 2WL1A 2HEVF 1FOD3 2XBO1 5C9AB 2JX9A 1DQ2A 2JDMA 2NP0A 4JHTA 4YVWA 3ZR6A 5L73A 4AGVA 5F3IA 4PJYA 5FYSA 5J7MA 4CZSA 5CU1A 5DUWA 4Z8BA 1JUHA 3VBOB 4XF4A 5F37A 2JDZA 4UW3A 5DXDA 4DFSA 5FP3A 2XJVA 1T2XA 2G9ZA 3PLQA 3ZFEC 2B5HA 1RUOA 2RHPA 2RS12 1LODA 5A7QA 2W68A 3RI9A 4CUAA 1ASJ1 1DU3D 1EY2A 1Y43B 3I59A 1QQP2 4Y33A 5FYMA 2ID4A 2WFF3 4META 4BQXA 3WNMA 4C0HA 4Q4V2 5APAA 5FMOS 4NHXA 1VBC1 4MYEA 1FMD1 3OD0A 4Q5OA 3NJVA 1TQ5A 3K77A 5HI0A 3O1UA 2WS91 4CP1A 3HNYM 2UU8A 3GALA 1XYNA 2VBBA 1W2AX 2EXJA 2UURA 5HBAA 1OKOA 3N9MA 2D6OX 3PURA 4RS5A 1KD7A 3KVBA 3R4UA 3IMNA 2ZHMA 1SDWA 1YQCA 4QHBA 1CGPA 3JZVA 3K3NA 4MXWB 3WG2A 3VBHC 1VMHA 4BQYA 2DFBA 4KGGA 1MEC3 3LAGA 4LHLA 3ELNA 3NV3A 2BFUL 5GKAC 2FCTA 1S0CA 1ZM1A 2PLV3 2QQUA 3I2KA 1GOGA 1SLTA 4FQ4A 1KJRA 3ACLA 3ZFGA 5C4WB 2ZMKA 2B45X 1F35A 2HYKA 3I3QA 5HPOA 1US2A 5KWRA 3AMQA 1R093 2AR6A 2BUKA 2GAUA 1G7YA 1UX6A 4QQPA 3RZMA 1NE6A 3WY6A 4I0WB 1POV3 3MIGA 3VDDC 3H7JA 2ZHLA 2QTWB 5A33A 2QQKA 4ARYA 4EN8B 3RG0A 5EZWA 3ES1A 4M3CB 4QT6A 4JKKA 4QPGA 4KH9A 3W59A 4DUXA 1DGLA 1N3OA 1AR61 1RUI2 2WO2A 4FT8A 3WG3A 2HEYF 3I8TA 3B00A 4AEDA 3TYJA 1VMJA 5JPMB 2O0OA 1I5ZA 1LB2A 2ARBA 1LOFC 4P9GA 4CVUA 1VBD1 2HWD1 2VVDA 3VL8A 3NAPA 1DQ5A 1DGRA 5IFTA 1ZBA2 4K7JA 5HCFA 4AI8A 2R061 3ZXJA 4E4SA 4IL7A 3TEXA 4DMIA 3U14A 3FE5A 2HWE1 2RR11 3AKSA 1DYKA 1W6QA 3SQOA 1UYXA 4K21A 1PNGA 4GH4B 5EJZB 2XJQA 4YG3A 2VTXA 3U0ZA 1WMXA 2YC2A 3RSJA 4EV0A 3VL9A 1RJ7A 4ZHNA 1JYIA 1NZCA 5I0SA 2G9FA 3WF0A 4JQTA 1AF9A 1OLRA 2D6KA 2VY0A 1QWRA 2DTYA 5FZKA 3LFIA 4B4QA 4LORA 2GC3A 5I8SA 1GFF2 1RUH2 1UMZA 1EAH2 2R30A 1CAXB 1DGWX 2WAAA 3LDKA 3FFQA 4AVAA 1YFYA 5ACA3 4XMAA 5FREA 4CDQC 1MS9A 5FP9A 3MW3A 1ODMA 2Q8CA 3AP7A 4B7EA 3TN93 2R1DA 2DUOA 3AJYA 1VBE2 2O1QA 3I2IA 4Q27A 4D94A 5JVVA 4YVWC 3ZXEA 1AL22 2R49A 3B93A 3IM0A 1ND3A 1FATA 1NQJA 2IXCA 5FBJA 3J7HA 1LHNA 1RTVA 4U2AA 1NCRA 4DQAA 1A34A 1NX9A 5FJHA 4E2QA 1CJDA 5GLWA 2ZPXA 4ZU5A 1V6KA 2ZEXA 1LENA 1QJZA 2HJIA 2JKBA 4Q4X2 1WW7A 1H4GA 4YRDA 1OD3A 2GALA 2QUOA 4FPEA 2VO5A 1RUF1 4QB6A 5BXXA 4LIVA 5KC5A 4QPIA 1PO21 3IAQA 2YHJA 4CPBA 1VAMA 2JIJA 2WO7A 3LSDA 4GA9A 3LEMA 4QWNA 1WCQA 4YFZA 1W2TA 4LOTA 4NHMA 4X8NA 3EXUA 1EV13 3VBSB 4A7YA 3VDCA 2A6WA 3KLSA 1SLIA 1H6YA 1QU0A 2WNVA 4CUCA 1GWKA 3BUCA 1CAWA 1UPSA 4J1WA 1XOYA 3IKWA 2IUWA 2Q0AA 5IK8A 1QJX1 2CNAA 4YPJA 1H8VA 2WWUA 5T5OA 2ORZA 1UY4A 2NPIA 4Z2WA 4E8DA 4GULA 3I2OA 3MHZA 3M8LA 2D5FA 2A73B 1C5IA 4IEVA 3ILRA 2PQQA 4YWAA 5LBFA 4D6RA 3ZYIB 3ROUA 1GP6A 3SCFA 2BNOA 3MFAA 4URTA 2CWMA 4Q4W2 2XDVA 4LKSA 4D7YA 4I09A 4M3CE 4E27A 1U5ZA 1YQ6A 3LFMA 3EYPA 3LPGA 4NOTA 5CB7A 3WP6A 2R041 3J7LA 4IETA 2YY1A 2W0XA 2KD7A 2UYAA 3UNPA 2WQ8A 3BODA 1RHI3 4XUTA 5LY1A 2RJLA 1H2NA 4IE0A 1S2BA 3WQ0A 4MGKE 1X8EA 1C8M1 1UMHA 4QPGC 4NJ4A 4YVSB 2XOMA 3N7KA 1XE0A 5M0TA 3WVJA 1G9CA 1CX1A 3LZZA 1O6UA 1VIWB 2GN7A 4A4AA 2A71A 1RUE1 1GMMA 4H7LA 3W5MA 1F31A 2VTXJ 1NZIA 1H1IA 3I97A 3CMGA 5D21A 3VV1A 2BRTA 3OEAA 3ZX7A 1JZ5A 2BBVA 3OGSA 4NAOA 1DP0A 3U10A 1ND2B 4C0BA 4GH4C 5AC91 2VMFA 4WVMA 3HBKA 1W6PB 4BE3A 1URXA 2BWCA 3HR9A 4AOCA 4CCKA 1DQ1A 1ZBE3 4XBLA 4XJ8A 3O14A 3ZSLA 1EUTA 1REDA 4O9EA 2AGSA 4YW5A 4XUNA 5T50A 3R6SA 2GZWA 1SFYA 3UV9A 2E6VA 4QGLA 3HOBA 2WT0A 4GKXA 3N9LA 3DPRA 5FZ0A 1LEDA 1CAVA 4QQHA 5EYXA 2OVUA 3ZDVA 1C8NA 1Y9QA 4QDRA 3ZFFB 4FBFA 3LEGA 3USUA 2VZQA 1JI6A 1XSRA 5IAXA 1UF2C 4NWWA 4DZGA 4H55A 1LR5A 2XGXA 4XPVA 3VD3A 2WLPA 4IUGA 4HVQA 4JGYA 4RHV3 3VKOA 3CU7A 2RDNA 4UFHA 4RFRB 4A6OA 2YDEA 2WNUA 4GALA 3GBWA 3ON7A 3E1F1 4F3JA 3S5AA 1W9WA 2KXLA 1W6OA 2XJSA 5A7SA 5H9QA 2UY8A 1RUJ1 3ZXFA 4BQ1A 4GMP3 4XBQA 4Y3OA 3AMMA 4XFFA 2ARAA 4AZZA 5JZGB 5GM0A 3IPVB 3CO2A 5EPAA 1JS9A 1S0JA 4YW7A 1FOD2 1QH6A 2X53S 1WLDA 1YWKA 2BQPA 1TNRA 4M3CF 5I93A 1PVC3 1J1TA 5J3UA 2D44A 2BBAA 4XCBA 4IEOA 3BPZA 3H8XA 2ZCWA 2DCZA 2JG9B 1GOHA 2B9UA 4GJZA 1EUUA 2K2SA 5ANNA 4OHZA 2VXJA 5IVJA 3AC0A 4ATEA 3OBTA 5IUQA 3I2HA 5CEHA 1ZZ9A 3WUCA 4YFWA 3WNNA 5HCBA 4WM8B 1BZWA 3KCXA 2NQYA 2ILMA 3H3UA 2QQLA 4CCCA 5J1XA 5GALA 4M01A 4QX8A 4BWOA 4E8CA 1W9TA 2NZ9A 1G86A 1IG3A 1QJU3 1GNZA 2ADEA 2WQZC 1GWLA 1R1A1 1OBNA 4JGZB 1AR91 5A1FA 3MPPG 2VOTA 3ZYGA 4R52A 3DYPA 5L7OA 4XF3A 4QX0A 3N36A 2BGOA 2WQ4A 4OUSA 4RR3A 3V0AB 3ZMOA 5C6CA 4HKOA 1DGWA 1AYN1 2P2KA 4P5HA 4ASKA 4CA9A 1UKGA 4A7ZA 4ET7A 4FAHA 5IFPA 3SKJE 4BXSV 3KGLA 3LSEA 1VLNA 2ZAHA 3ZSMA 1JODA 4CDXC 2F6BA 5CZKA 4KBZA 5CFCA 5LW9A 4JTNA 5LK5A 4GB33 3U4SA 1MEC2 2E32A 4YGCA 5E8AA 2AYHA 4L9BA 3FLPA 2PLV2 1WW6A 2PAEA 1QJFA 4AI3A 1YFXA 1G9DA 3OF1A 2UWAA 4UF0B 3T1MA 5KHJA 2QQVA 4Y1ZA 3N7MA 3MPBA 2Z42A 3W21A 1GP5A 3NL1A 2B7YA 2VR4A 4AEJA 1S0EA 4Z07A 1HXS3 3OYWB 4BDVB 2RS11 1R092 3M4FA 4Y22B 5F2SA 1DLLA 1S2KA 2P37A 1SLAA 3E5XA 3I7DA 3T2OA 3UJQA 1POV0 1QQP1 4M00A 1JBCA 2RS33 4Q4V1 4QXCA 1CPMA 1UN1A 3BOWA 3ZXLA 5A6ZA 2PA7A 4E4DX 4IE7A 3K75B 5FMDA 3VZNA 4Z82A 4NAMA 4CDUC 5HCAA 3AZWA 4AVCA 4QX3A 4BPZA 5BNPB 3O1SA 4O65A 3RNSA 1TME3 1VPHA 2H0VA 1H0BA 2VQAA 4R8HA 4XFAA 4KL1A 4Y1XA 2R32A 1WZXA 3CF6E 1C1FA 4N8MA 5JSRA 2W1UA 1EYBA 1S0BA 2PHDA 5FDBA 1GZWA 4IEYA 1NA1A 2K0GA 4IE5A 1CZVA 4JZRA 1NT0A 5JSPA 2AEYA 3OY8A 4IGQA 2DBIA 2BYVE 2FDJA 2VUDA 3KB5A 1SBFA 3CKHA 3GYDA 3KS7A 4CCEA 5IWFA 4CXYA 3OG2A 4IV1B 4LXLA 4JKLA 5FPUA 1RXGA 2CL2A 1WLCA 3JD73 4GZ9A 4FPOB 4BYYA 5L9RA 2XVKA 1LEMA 3LE0A 1PO13 3TEWA 3URFA 3WG4A 3DCQA 1KGYA 2JEMA 1T6GC 2VZSA 2BOJA 1CAUA 4N53C 3O1OA 5ACA2 2DVBA 4Y1YA 2ZEWA 3G6JB 4AG4A 1RB8G 5JCTA 5C3RA 4MHRA 3A0KA 1RUI1 5I0TA 3UGHA 1D0GA 3TN92 3I3MA 2YZ4A 1PGL2 3JBG2 1W0OA 4URAA 2WZR2 3VBUA 2Y6HA 1UY3A 5FMOL 3AXEA 3UYJA 3KCYA 4Q1PA 1AR83 2ARXA 4K1ZA 3W58A 2JDUA 3VBFA 1OFSA 1ZBA1 1UL9A 4MGYE 1HDKA 4QPWA 4XDQA 1TEIA 1FI2A 1AVBA 2G19A 3FHAA 1MR5A 5D8AC 1ZZ6A 1KS4A 3WXPA 2VZ1A 1W8OA 4DXTA 3FBMA 4MGSA 2WNEA 2WO3A 2E26A 2X10A 4GIQA 5C33A 5K8SA 3OEBA 5JIAA 1OLMA 4XXPA 2OS2A 1RUD2 5I91A 2BVVA 4Y4YA 4OUEA 5C8CB 4PBOA 1WA6X 1DDLA 2JG8B 4IGOA 1EV12 1RUC3 2LTNA 4HSJA 1RUH1 1EAH1 3C7OA 1BK0A 2R0HA 5FP7A 1I1EA 1NOVA 4B4RA 1UY0A 2ZGOA 2A75A 2GU9A 4LA3A 1A3KA 1LULA 1YQ5A 2Q5TA 1OOPA 2G9GA 2V73A 1K5MA 3MLLA 4QPYA 1VBE1 5I0RA 3MI8A 4J6GA 4M0HA 1AL21 4OULA 1O5LA 3VUOA 3AZVA 3ZYBA 5LA0A 2VNRA 2VQ0A 3HT1A 1SFNA 2HYXA 1W6NA 2WWJA 4L97A 3WOGA 3PUAA 3BI3A 3UGFA 1J84A 1WCDJ 3VLBB 5IAVA 2D5HA 4NRQA 4H3WA 3P1IA 2LS6A 3MBWA 4G9SB 3MO4A 4L2NA 5ERLA 4JTOA 4Q4X1 3UL2A 4QQ2A 1ENRA 4UWDA 1ENSA 5LBBA 1CVNA 1ULGA 4DIQA 1IS6A 2HWB3 5G04L 1FPN1 2GP3A 1UZ0A 5LRSA 1UYZA 2BNNA 1RHI2 1AXKA 3D0JA 3FZ3A 3LIGA 4I3GA 4QQLA 4B1MA 1MZFA 4CEWB 1KDMA 1JZ8A 2Q8OA 2P3YA 3CJIB 2BTVC 3SMHA 1PMHX 1CIYA 3NQHA 4K8RB 4NRPA 5A7WA 3D5OA 2BDRA 5A1LA 4LKFA 4TN7A 5FRAA 5FZ1A 1IOAA 3OPWA 1WCSA 3AB0A 3FC0A 4WM7C 5JSOA 1DZQA 3HJRA 4K40A 2BP6A 3ME2A 4EZ4A 5A32A 5BNOB 1OQEA 3GGLA 4QB1A 1NA1C 3N9QA 1RGSA 5DUXA 1KITA 4LMFA 4LULA 3V0BA 2WUHA 2AUYA 5FYUA 1U0AA 1I6XA 2JDYA 3NV1A 4XJUA 1C57A 1VJ2A 1N3PA 4NIHA 1W2UA 2C9AA 1ZBE2 4GXLA 4MO3M 2PHFA 4MOAA 3VZJA 3DECA 2Z69A 1E5SA 1V00A 4Q4W1 3T4VA 4IE4A 1GNYA 4EJRA 3I4IA 2XJRA 2W08A 4S2GA 1UXZA 1D0HA 2WJSA 1XNDA 4HL0A 1PIV3 1V6JA 5E88A 3V64A 4CCOA 2VCBA 2VMIA 4EN7B 1UNBA 1GANA 3M7AA 4UOJA 4YM1A 5KHIA 2BPA2 1M4WA 2Y64A 3Q9OA 4AW7A 2ZGKA 4KI5M 4RHV2 2GNMA 2QFEA 2PN5A 3TRSB 3GCWA 1YNAA 4GJYA 1XNCA 1DQ4A 1OMIA 3I2JA 1QOSA 5FXVA 4DPNA 1D4M2 5FZ4A 3WDVA 1JTZX 1XB9A 3HQXA 3N4MA 1X7NA 3NSTA 4UFIA 2AREA 5FJKA 1WA4A 4GMP0 3NKGA 1BVVA 4RQPB 1ULOA 4JX0A 3BYWA 2PHRA 1G8WA 5F5IA 5DPNA 1SG3A 4QX5A 3HQRA 3ZIWA 3ECQA 1OQ1A 3KT1A 4L11A 2R16A 4JV4A 4CEYC 1HB2A 3VGIA 4YYOA 4XFIA 4Y5Z0 3ETQA 2IVJA 2Y34A 2DVAA 2XWJB 3T09A 3ZFEA 5CISA 3NKTA 1RUG3 1G9AA 2XVLA 4PLOA 2RMU3 4LHSA 1ST8A 1YCIA 3BN6A 3Q8BA 4KBBA 3BTAA 4LNVA 3S30A 3I2FA 3ZSKA 2Y60A 2L9LA 2VUAA 2CDPA 1IQDC 3PNAA 4HZFA 4N9HA 3EO6A 3A23A 4GWMA 4E2SA 1HRV3 3AM2A 3WD5A 4YM3A 2YC0A 5F2WA 1ONAA 3PU8A 5I0UA 3OUJA 4Y4RA 3B94A 3I3BA 4GQ7A 4MGZE 2OZJA 2I74A 3HNBM 3VBHA 2EXIA 4ASLA 1SPPA 4RA0A 4WBBA 2VZVA 3AKQA 4QDSA 4XQDA 1OLQA 4NHKA 1LKNA 1KXGA 2ZGSA 5H9RA 2AENA 2AH2A 2C1FA 1UOBA 2VE1A 3GF6A 4Q0SA 4OHYA 3K46A 4PDWC 4ATFA 1X82A 1DZRA 3KT7A 3NJYA 3EHKA 1FOD1 2GH8A 4GB32 2HKXA 2VBPA 2YGLA 2Y0IA 1OH4A 3ZYRA 2VZPA 2JE9A 4RGGA 3ZIXA 1AYM2 2P17A 2D6PA 4BA6A 2GC1A 4D7TA 4FFFA 4CPBD 2W1QA 3IMMA 1O8PA 2B4KA 1PX4A 5FK8A 3VDDA 4QAWA 1COV1 5A6XA 2CDOA 4FTSA 5DMYA 1GZTA 1POQA 3POSA 5LASA 4NPLA 1XU1A 2UY9A 1P8JA 4KG8A 1JYNA 4QKNA 2CTVA 3M3EA 2OIIA 4I0BA 5FXZA 2RS32 4QKBA 5C5UA 2MEV3 3X29B 4ORFA 4MZUA 1BJQA 1LOFA 2HEWF 2UYBA 2EXKA 1PZ7A 1HKDA 1W03A 3QH7A 4N9IA 5IK7A 2DCKA 4AL9A 2H6BA 1XQNA 1DHKB 1TME2 4NHYA 2ZTNA 2YPDA 1LTEA 3ACIA 4AGRA 4OHVA 4FTEA 4EWDA 2J22A 3SXWA 4WZFA 2ZGNA 3ZN5A 5ABJC 2PELA 4A44A 1YO8A 2RS53 1MEC1 4AVVA 2A6YA 5FWEA 1GZCA 5DDJ3 5LBEA 1MS5A 1NUKA 3RJ2X 2PLV1 2VZOA 4UW5A 5IHRA 2ADDA 1QOOA 2J1TA 3K2OA 3AXDA 3ABZA 4I3PA 1W6MA 2W39A 2XONA 1ENXA 2ETEA 3WLUA 1H8TB 5GZFA 1ZVFA 1R091 1UU4A 2QJVA 4RD7A 5K0UC 3JD72 1HRI2 4EYUA 2HWC3 5FR3A 1PO12 1XBFA 4A45A 1POV1 4PQQA 2AACA 3EQEA 3ZKYA 4G3YC 1ZA7A 2VAUA 4W6XA 1BVP1 2W47A 2Y33A 3MLJA 4FOVA 4BMBA 4CDWB 3I49A 1XE8A 2O8QA 4Y5TA 3VHOA 3ZKUA 3GXUA 2I07B 4LKDA 3RYPA 1UU5A 1KJLA 1OURA 4IV3B 1S0DA 3POYA 1U5XA 2QQIA 4S2DA 3NW4A 4MX3A 1AR82 1UYPA 5CFDC 5CIRA 4RGKA 5F39A 3IT8A 2PHXA 5FZ3A 1ZYBA 3GZAA 1KEXA 1F5JA 2JDHA 5FV3A 1QXPA 1O7FA 4BM8A 2IFWA 4OLLA 5A7PA 1VRBA 4QHOA 5IVEA 2W94A 5JOYA 1W06A 4AYUA 3E6CC 1NLQA 3RS6A 4P08A 5FO8B 1Q3EA 1W90A 1NAEA 3BIEA 4TYSA 1CJPA 3E5UA 3E6BA 3RZGA 4HLTA 1QJY3 1W04A 2WO1A 1PZ9A 1W8FA 1RUC2 2V4AA 4IEXA 5A7OA 3WNKA 2WYFA 5FLIA 3I59B 1Q8QA 5F32A 4G4FA 4XQ4A 4Y5SA 2RV9A 2F4LA 5FY8A 1WCKA 2X5IC 1PGL1 1MVEA 2QQJA 4DXSA 1JHNA 3JBG1 4YW4A 1IPSA 2WZR1 4P02B 4R9BA 4XAEA 2JDPA 1AJOA 4RSUA 1SFPA 1REEA 1DCSA 5GLUA 1MZEA 3MIEA 4C1WA 3POFA 4M3CA 3ZN4A 1VRH1 3A0NA 4K8FA 2OUHA 3EB7A 3H42B 5CAZA 4C90A 4ISQA 4COUA 2VCMA 1LAJA 1VR3A 2A3XA 2A6VA 2XHNA 5F6LB 5IVYA 3THCA 3VD9A 5JOZA 4LBJA 2QZ2A 4H2AA 3SITA 1B35B 2RG4A 3AP4A 4XUQA 4D69A 4XYXA 1OQDA 1RUD1 2WDBA 3OBAA 5GZDA 2D3SA 4Q4Y2 5SV8A 2DVFA 1EV11 1G9FA 2IZWA 4FOYA 4GAZA 4AEMA 5LA9A 4CSWA 3W5NA 2JENA 4GH4A 2W46A 4XETA 3ZN6B 3EBRA 3I54A 1YXWA 2Q1MA 5FY9A 2JJ6A 4YZ5A 3JQXA 5A33B 3AYDA 4AQ6A 3WQBA 3O0XA 4AEKA 4C91A 2WT2A 1ULPA 2VM9A 4D3WA 4OQ8A 5EQUA 1CAXA 3POJA 1H8TC 4AEDB 3M3CA 4YGEA 3AVRA 5A7NA 1F4HA 1PK6C 3VZMA 5F3CA 5KHKA 5C9AC 1A8DA 1ZZ8A 2WZPP 4JQRA 3NAPB 5BPXA 2WS93 5J98B 1IG0A 3WW2A 3H50A 1JYXA 5GLTA 1EP0A 4CP9A 3SCHA 3PVOA 1QMJA 4A42A 4CDWC 2WINB 5FYTA 5FUPA 1UIKA 4JDOA 4XTPA 1RHI1 1W6QB 4H7MA 3VBOC 4ES8A 5J96B 3ZPOA 4NPMA 4MG2A 4XILA 4ZY9A 4BMEA 1FAYA 2GC0A 3T30A 4QXBA 4L92A 4NPRA 5FKBA 2IC1A 1LGBA 2XR4A 1WCUA 3TWIA 2E7TA 2E7AA 2F17A 3BTYA 4AHWA 1F8VA 5EHDA 1VBA3 1UWWA 2VGDA 3SEEA 1L7LA 1W8HA 2P3IA 2XJTA 3LOIA 5IATA 2ZKNA 3ZXGA 2DUPA 2OX0A 4P9XA 2XMLA 1XE7A 4B4PA 2JXAA 1W39A 1ZBE1 2CGOA 2QDRA 2XUEA 3RJRA 1PMIA 3ZLIA 2R073 3AL6A 4AR2A 3T4HB 4COWA 5KBFA 1EPWA 1ND3B 3VD4A 4MV2A 1W3XA 5FZCA 4INDA 1H4HA 1NCRB 1RUG2 4CCNA 2RMU2 3H3ZA 4AQSA 5CKQA 4OVEA 2FHRA 2DCYA 3R4DB 4FQZA 5ANQA 3WNOA 4AE2A 1AR63 1BBT3 3DYOA 1TE1B 1QEXA 3FLRA 3POBA 4HT1T 5C4WC 4PIZA 4YZ2A 4NE9A 2EXHA 5FP4A 1ULEA 5JR2A 1VBD3 1HRV2 1CWPA 4FFHA 4RHV1 1NY72 2VOKA 1Y4WA 2Z5WA 2ZAAA 3LQCA 4SBVA 4XF1A 5FYZA 2PHLA 4FPGA 4PIXA 1K42A 4XW3A 1SCRA 1MS0A 3QACA 3GJBA 1UY2A 4N43B 4YG6A 1D4M1 1WWYA 4RFT0 5KXEA 5JI7A 2JICA 1BXHA 2WNVB 4CDXA 5F1RA 1CAWB 4YVSA 1W8UA 1HQWA 3WNPA 1WLWA 3NV2A 5FQ0B 3SH3A 1WGPA 4MLOA 5I8YA 5L36A 1RVF3 3NNMA 2ZXQA 2WN3A 2ZX2A 5FZ6A 1R64A 2QNKA 4QU1A 1PVXA 3WZ1A 4PCRA 4XURA 5CKNA 1WD3A 1W9YA 1JZ7A 3BALA 3JB4C 1Z7S3 3DUIA 3IWZA 1ND2A 4HANA 2HWF3 3U75A 1E5RA 2QBXA 5EWSA 4EN0A 1W6PA 2A1XA 5A3MA 3OUHA 1Q8PA 1Y9MA 2D3RA 5AFEA 4P9YA 5CG8A 4NIDA 4CU8A 3PUQA 2DDUA 1L7RA 1YYNA 3Q8CA 1AHSA 2VCCA 5F8PA 1S55A 4LO7A 3BU0A 2QQWA 2TUNA 2WABA 1W9FA 1V6MA 2MEV2 1I3HA 2Y6GA 3FN9A 4W4ZA 3CDZB 4XMIA 3MEPA 2EIEA 5FLJA 3O1MA 2J1RA 3HN1A 2CV6A 4K9SA 3CBNA 1JU4A 1KRIA 2ZS6B 1C3HA 2QVSB 1VAKA 1OC1A 4P9JA 2ZMLA 5FYHA 4WVMB 4JDMA 1V9U3 5FMCA 5A3UA 1IS4A 4GB31 2V4VA 3DV8A 4HOOA 5DDJ2 4P9WA 3KMHA 2YUEA 4AF9A 4LO5B 1AYM1 2J7MA 4DNYA 1QJX3 3POIA 5C7GA 1JYTA 5AFBA 4C1XA 4B3NA 5JZGA 2C0ZA 5C3QA 1OA2A 2ZZQA 3PTRB 4LT5A 4K1YA 4N53A 2I2SA 3USUB 1V6NA 2HWC2 2RS31 3I3EA 1PGW2 3VBSC 2XWBB 2BZDA 3C2UA 4JGYB 4OMDA 2EICA 2IXJA 1KFUL 1X50A 2A3WA 1VE0A 2R043 2VBDA 2ZEZA 3FWEA 3GBGA 4HVRA 4LO4B 1BKZA 4Y1VA 5FYCA 3WT3A 2WNUB 1UZYA 5GLZA 4N90A 4TTGA 3M3QA 3JB8A 1XXNA 2Y6JA 3D3AA 3ENRA 1TME1 5FZGA 3AMPA 4NUBA 2K46A 2QE3A 3RDIA 4HXCA 5D8AA 5T5JA 2JB4A 4Q2FA 3KQ4B 4XJ9A 3MF9A 1DBNA 4QXKA 2WFF2 3J26N 1AR73 5JOXA 5CG9A 3LIHA 4CXXA 4QKFA 3POEA 3D4KA 2WBKA 5IVVA 3V0AA 1W05A 5TSWA 1O4TA 5D1IA 1KQRA 4HONA 4QQOA 1A8MA 4KWKA 4OI4A 4IESA 1IGOA 2QQNA 1N3QA 2ZHKA 4CU9A 1MS1A 2WZ8A 1ZRDA 2C5DA 2N7GA 3I3DA 2GMEA 2B42B 3IDAA 1HRI1 5LK7B 1ZRIA 4QX1A 4YVSC 1QJY2 5F5QA 5A3NA 1HJFA 1PO11 3IB3A 2ERFA 1YRZA 4ZZ5A 5J36A 4R9AA 1GKBA 3CNAA 3J9SA 1YIPA 4BCUA 4N7UA 3OYWA 3J8F3 1QOTA 5FZLA 3SKVA 4CCLA 2EIDA 4Y22A 4YSFA 2VMCA 5K9YA 1VP6A 4BIOA 3AX4A 4P9LA 4LBLA 5L7OB 1LHVA 2XLGA 4YGDA 1ND2C 5HV4A 1OVSA 2FQPA 4Y1UA 1FNYA 1AR81 2GNBA 3OGVA 4HG6B 4BQ2A 2ZBJA 5LRRA 2IVIB 4L0PA 3WDTA 2D93A 3C7HA 1EPZA 2WLQA 3D6EA 5CFCB 2VVEA 3PUIA 5FTTC 4AI1A 3RFRA 1OPMA 1JW6A 2WN2A 1LHWA 5FY1A 4KNCA 4UFLA 3ZFFC 4LBOA 3RVHA 3KHCA 4UYBA 1FT9A 3S57A 1WMFA 4WM7A 3GZUC 4IDZA 1SQ4A 4TSVA 4PF1A 1MQTB 1RUC1 1M06G 4UBGA 1IQAA 2P3JA 1WMDA 5FZDA 1UO9A 5IVFA 1JXNA 2EA7A 4HK8A 2JIGA 1NG0A 1W9SA 1ZNPA 5JMOA 5FY0A 1J3QA 1SMVA 2DBNA 2VW2A 5FPZA 3FUQA 1RIRA 1BK1A 4YARA 1CR7A 2IFRA 4XZUG 5H9SA 3AKRA 1V6OA 3KV9A 4FO9A 1E57A 1JUIA 4PLNA 3EJKA 1QNWA 5FO9B 4GKYA 4Y20B 3VDAA 4LQRA 1YQ8A 5A6YA 3VDBA 2D43A 2PXJA 5A6QA 1H2LA 1IS5A 2C4XA 4IXLA 1RITA 4Q0QA 4OMCA 5JZGC 5K7PA 1LJ7A 4D6QA 2W3JA 2MNGA 2RJ2A 1OF4A 4HN0A 4BZ4A 2LALA 5JDBA 4CYDA 3K4DA 2B8MA 3WEZA 5BUVA 2WS92 1GZWB 4ES9A 2XLAA 4WVVA 2JG9C 4HPKB 3UESA 3OY8B 5F6KA 1L3JA 2W2IA 2X05A 2VZ3A 4XJAA 1E5HA 5AVAA 4Q4Y1 1OA3A 4CU7A 4WM8C 2X8KA 2JD4A 1ZRFA 3SEPA 2VZUA 4O7XA 3AK0A 1RC6A 4FPLA 4IQPA 5CA6A 3ORJA 1MZ6A 4BLIA 4CEYA 3APBA 2FMYA 4JGZC 1CAUB 1E5IA 2WSUA 5FAXA 2YFZA 2PQSA 5JI9A 3RZHA 5BV6A 1VBA2 2NM1A 1JOBA 5C8CA 5F5CA 2JG8A 3LDBA 4ZS3A 3AP9A 5C3PA 5FMBA 3H9AA 3WNLA 4YNIA 3J4UH 1QQP3 1HLCA 4IE6A 3VBUB 2R072 3AKPA 1IKPA 3AVSA 4YW3A 3H1MA 3VBFB 2R0FA 3PVBB 2P5BA 4WVWA 3QCWA 1JZ2A 3O1VA 1UW8A 1MZ5A 4BJ0A 1O4YA 4NO4A 2ZEYA 1AR62 4NIGA 3C7EA 1BBT2 3AKTA 1OFNA 3HN3A 4EQVA 2DVGA 5LB6A 3N3HA 5SV5A 2XLFA 4BQ5A 1MVQA 1W8NA 1W2NA 4AFBA 3MV01 2FMDA 4BIFA 4KU8A 4P00B 4XFGA 4JHZA 1BHGA 1A78A 4FPCA 1BEV3 4U36A 3PTYA 4PDWA 3LA7A 1OXCA 2FDKA 4CEWA 1VAVA 3NNGA 4E4ZA 1SHWB 3D0SA 1GNHA 1C4RA 3HIFA 2RJKA 2WA4A 2VXRA 3CL1A 4B8EA 1XRUA 3CJIA 2R1BA 2YXSA 4AQTA 1OOPB 4X6RB 5DQ0A 5BNPC 2FDHA 3OUIA 1K5MB 4EE2A 1RVF2 4OI0A 4E9KA 4BOWA 2P1BA 3O0VA 3ZVXA 2J1AA 3GCXA 1JHJA 1H9PA 1N1VA 2DF7A 1HB1A 2JWPA 3MIDA 1LRHA 5FZ7A 1IS3A 1GBGA 2DFCA 4HKLA 4OQ9A 1JYWA 1W6NB 5ISLA 3DGTA 3C7FA 1RUG1 3MIHA 5LA2A 5T54A 4KMQA 1Z7S2 2RMU1 2ATFA 2YPJA 2ZOEB 2RDRA 2HWF2 4I02A 1SDDB 3FMGA 3SH4A 3M1HA 3PDQA 3WUDA 4M0NA 3VZKA 2VMDA 2MPFA 3ILFA 4XUPA 4FPFA 5FLHA 2IXLA 1HRV1 4IV1C 2YV8A 4Y24A 1NY71 3WW4A 3VKNA 3WNXA 4Q8KA 3IDCB 4LBKA 4UW6A 2WAOA 3IIAA 5BNNB 1X9PA 3P5BA 3RZZA 1S0FA 5FXXA 5ABJA 4LR4A 2YYOA 4UBHA 2XB6C 3FFZA 1AX0A 2RM23 3A21A 3I2DA 4UFJA 1QHDA 5HCHA 2WA3A 5EJ3A 4MVTA 3ALQA 4ISRA 5FUIA 2XQRA 2BWAA 2LUWA 4S2HA 2YROA 4Q0VA 2DWRA 1V9U2 3N7JA 4XF0A 4AHZA 1VBB3 1EAH3 2P4EA 2W91A 2YBPA 3NRUA 3T3YA 4W65A 3NMBA 4OFGA 4QMAA 5K0UA 3ZOIA 2ZJCA 4JRAA 1DF0A 3RWNA 2VNGA 4IW3A 3U37A 1O4ZA 1XPWA 2JE8A 1W3VA 3WDXA 4XTMA 2P34A 2UWBA 2XKPA 4W8JA 5KHHA 1PMJX 3CIHA 4RGAA 1QDOA 2VCAA 4W6YA 3MW2A 3PVNA 3HMYA 1GU3A 4LEJA 4PQ9A 4QM8A 1D2SA 4XXAA 5C8CC 5JXIA 4LOSA 4V2WA 1AX1A 2JG8C 3KF5A 3DXTA 1PVC2 1UX7A 2WRAA 4ZPIA 2MEV1 4XIKA 5KR7A 2BJSA 4LBQA 1YIFA 2FZ1A 1CPNA 2C9KA 2JB8A 2CU5A 5CFDA 2NYYA 1FPN3 4UFKA 3T0DA 3LEKA 1MPXA 1KS5A 3VHRA 3H8OA 2ZX1A 1JZ6A 1AZDA 2D98A 3P6BA 1Q56A 4FPHA 2ENRA 4YZ4A 1OLME 3HT2A 5IK5A 2EAAA 1SLBA 1AR72 2JDNA 1QJU2 2NN8A 3M3IA 4XABA 5F3EA 4AI9A 5DDJ1 5JIUA 5IVBA 4QX7A 4XFBA 3VKFC 4CCDA 3PVEA 1O8SA 2DTWA 3KV6A 3ZFEB 5AVPA 3NWKA 4W6WA 1NKGA 1CN1A 5DAQA 5DAXA 1Q8OA 1XYPA 1GV9A 1US3A 3ZSEA 2J42A 4CEWC 3HEIA 1ZRCA 2LROA 1W2OA 4HKWA 3RMXA 3BKZA 2HWC1 4PLMA 1PGW1 3AYAA 2X5IA 3CJIC 3ITQA 5IJRA 3CHXA 4JAAA 5H9PA 3ZXAC 5GJ6A 4MHUA 2XVGA 3J7NA 2V72A 4MGQA 3J8F2 3KT4A 4HETA 3LA3A 4YLZA 1NCQB 5BNOC 3AZZA 4OZOA 1HXS2 5EFUA 4CUGA 1NXMA 4EROA 2QQPA 2CHHA 4JC1A 3VBRB 5A70A 4AFAA 3WF2A 2FDIA 3FBYA 4IGPA 2KA3A 1WW4A 2ZMNA 2BV4A 5FOBB 1JOPA 2WFF1 3H3LA 3OJBA 4K6BA 1BLZA 1CD3G 4CTEA 5FOJB 1XYOA 3N9OA 5FZEA 5FZBA 4BK5A 4MXVA 4CXWA 3Q8EA 3ZMNA 4LIUA 3GDBA 1LOEA 4CE8A 2P3KA 1GUIA 2VOVA 2RVAA 3IAPA 1FV3A 5F9TA 3PL0A 2J1VA 5HV0A 1NLRA 4EN9B 1YJKA 4PT6A 2ORXA 1QJY1 1SLLA 3VDDB 3VN4A 4FAGA 4BISA 4BK4A 3GM8A 4S2FA 1UIJA 1LOCA 4FPJA 1OHFA 2CWSA 5FZOA 1VALA 3MW4A 4D6SA 2GNTA 2VNVA 1N1SA 1H8TA 3MFCA 4I01A 4XF9A 4F7ZA 1RXFA 1HIXA 3FX3A 3JCIA 1QJEA 1PK6A 2EIGA 3PHMA 3SISA 4AFCA 3RZJA 4QHZA 1OI6A 3UK9A 3RYRA 5C9AA 4RN5A 3M3OA 5FZFA 1JZ3A 1QY4A 1YC61 4Z92B 2E51A 4A41A 3A22A 4RQPC 5BYNA 4CCJA 2XQXA 2EIBA 2YU2A 5I0DA 4PHZA 1S4CA 2RDSA 4CDWA 1UCXA 4QXHA 1GWMA 3VBOA 3T0AA 4Z2AA 2KR2A 3SC7X 1XNKA 5FPLA 2D7FA 2DCJA 1UZVA 3GHMA 3P3PA 2W1SA 4DY3A 3WQ7A 1CX4A 2YMZA 1OT5A 4IV3A 4LO6B 1YI9A 3BIWE 1LGNA 3THPA 1O3TA 1IHMA 4JCKA 2NLRA 3IN9A 4OYUA 4LTAA 4AI0A 3E97A 4AXOA 1W6MB 2CSGA 3LF7A 3OOXA 2VG9A 3D82A 2W9XA 2NMNA 4IEQA 4R4ZA 4CDQB 4YZ3A 3C8XA 2XH6A 4OHWA 3NVCA 3Q8AA 3SHRA 3WP5A 3AFKA 2WZEA 2XJUA 1QXRA 2XL7A 5E1RA 4YVWB 2YB7A 4MXWA 5K4LA 4AVSA 2C6SA 1RINA 2WC2A 3BGAA 3KV5A 1R083 3OSDA 2Y6LA 1COV3 1K12A 2Q8DA 2VZRA 1WBLA 5JUVA 3DEMA 2ZGQA 5FKCA 4LK7A 3CLPA 1GQGA 1DFQA 5J37A 1OVPA 4X6QB 1JYVA 4TXWA 1GZ9A 3OPZA 5C4WA 2O8OA 3WSOA 4BXFA 2B46X 5ACA1 4HBNA 2HH9A 2ZKLA 1TMF3 1ULFA 4RYDA 3O12A 1ZA4A 3TN91 2Q8EA 4EWAA 5CADA 1BQPA 2WR9A 3GHNA 3B3QE 1LHUA 5KXBA 1XC6A 4Q0PA 2BGPA 2PYTA 3FHQA 4RS5B 4UT5A 2E7QA 3HWJA 1NCQC 3OTFA 3KHBA 4YW1A 1RMU3 1HV0A 3VBRC 2J1SA 2WSVA 3LKJA 1VB4A 3L2HA 3POWA 2PHWA 4XJWA 2ZGPA 2OQ7A 5KXDA 1NE4A 1HQNA 1B35A 1XNAA 2VOWA 2Y8KA 1BEV2 3OB8A 2DYCA 2ET7A 1ZZBA 5FY5A 3O1TA 4QD2A 5LZ6A 2HWB2 2A6ZA 4YW6A 3HVDA 1VBA1 4HFSA 4DEVA 2Y26A 2Y38A 1YHFA 1R1ZA 2GMPA 4YGBA 3ZFGB 4WZCA 4XQWA 2DURA 4AFDA 3ZN6A 1KFXL 1CONA 2XBO3 1UXXX 3N7LA 2A6XA 3ZYFA 5C70A 2R071 2VUJA 1Q5OA 2GNDA 1X36A 3RWKX 3WV6A 2ZA9A 3AZYA 3T2PA 4A2UA 3MYXA 2VZTA 4K20A 4NIAA 1LOBA 3HPNA 4QPGB 3TEZA 1BBT1 4IEPA 1OA4A 3OGJA 2BEOA 3RZKA 4FPYA 3LDRA 4M4RA 5FWJA 3LB9A 3LGRA 1ASJ3 1SZBA 5C5TA 5LCWL 4TZDA 1PM4A 3AMNA 3FLTA 4PF5A 3DKQA 4XJZA 1TG7A 2ZGUA 4ASMB 1VBC3 3ETPA 1FMD3 4AHXA 1XU2A 2LRPA 3THDA 1W0PA 5HXMA 2BVBA 1OKQA 2XXZA 1PIV2 1V0AA 3KVAA 3KSCA 3SNMA 4JRLA 1XNTA 5E16A 4A3XA 4CP0A 3V65A 5B2GB 3ZM8A 2XG3A 2RM22 2R6QA 1QKQA 3B01A 1UOFA 1OSGA 2AZ5A 3ACHA 1RVF1 4AAPA 1MS8A 3WW3A 2OUJA 3SCGA 4IV3C 5KXCA 1D4VB 4FXGB 4V2VA 1SBDA 3FHIB 4YW2A 3ZPYA 2XL9A 2XUMA 1VBB2 1PM7A 3NNLA 1PZ8A 2WT1A 4HSLA 5JXGA 1C5HA 1HV1A 1Z7S1 1H9WA 1G6NA 5FYBA 1W8ZA 1S2EA 2HWF1 5LBCA 3WQ1A 5JXHA 3RZLA 2VNOA 1OPOA 3PMEA 3VBSA 3WDYA 4BLJA 1O91A 2UWCA 3JBG3 1AXYA 2WZR3 2OQ6A 4KWJA 3HBZA 4AK3A 3MDPA 4AGGA 1C1LA 2Z4FA 2J1UA 4GD4A 3FUOA 1MS3A 4CP9B 5JLVA 5LEKA 2FD8A 2YG0A 1ACCA 1GYKA 5T52A 1VRH3 4BQ3A 2O14A 1UQXA 2VOXA 3H7YA 3O0WA 4XBNA 4XDOA 4LJHA 1HJGA 5FY7A 1HW5A 4FOWA 3U78A 2DCTA 4BHPA 4Q26A 3ZO0B 2ARCA 4NR1A 3HNMA 5FP8A 4FP2A 5FZHA 1FPN2 1UPIA 2OXBA 3OGGA 4LO8A 4AI2A 4DXRA 2BU9A 1RUD3 4HVOA 2EAKA 2HWD3 2IWGB 4FP3A 4LE4A 4ZKTB 1UY1A 3B69A 4QPIB 5FPXA 4I2OA 5JAXA 2ZGLA 5A3PA 1J58A 4N43A 4RS5C 4C8DA 1V9U1 1QF3A 2R063 1HX6A 3U4XA 4B29A 2HWE3 2RR13 3L9JT 3M2MA 2BW8A 3S7EA 3ST7A 4IEWA 2FDGA 4E2GA 5FQ0A 1YEWA 3BB6A 4EZHA 3WP3A 3UETA 4GMP1 1B35C 1LESA 3FJSA 1DG6A 2XKOA 3VB9A 3ES4A 1WMEA 3T2TA 2ZX4A 2V5YA 3U07A 3MF6A 4P5YA 3OGRA 5EJ1B 1GICA 1UMIA 3ZFGC 1NQDA 1CQ9A 3NV4A 4LPLA 5GZEA 4DEQA 5DZGA 2LW8A 1PVC1 4UXAA 2B39A 2VU9A 4SLIA 4XHBA 1WLTA 2VH9A 4FFGA 4BH9A 2YBSA 2IXKA 2JDAA 1T6BX 4QGNA 3S0MA 3ZYHA 1ZX5A 3NNFA 1Z0HA 2JD9A 1VB2A 2ZGMA 3USSA 5DZFA 2OYZA 4CDXB 1YFUA 1TVGA 5EV7A 4FCAA 1ZREA 1H1AA 3IDBB 5FXWA 2W92A 5JWPA 3K51A 4QKDA 2W95A 1AR71 2W87A 1QJU1 3WG1A 3ZFFA 4AEDC 4F83A 4JKMA 4B1LA 3PMSA 1UU6A 3POGA 3KF3A 3BOPA 3NAPC 4GWJA 1CZTA 1RUF3 2D3PA 5FUNA 3A7QA 1PO23 2CGNA 1N47A 1W8TA 1XSQA 1GSLA 3ZXKA 1ENQA 5CYYA 1APNA 4IERA 3AL5A 3H1WA 3CQOA 5T55A 5A3LA 3B9IA 2G4IA 4FTBA 2FCVA 4LLFA 4NRMA 3UKTA 2VECA 3NO8A 1CZSA 2RS52 1X8MA 2PHTA 1DGRN 1K45A 1LNSA 3R4SA 3WR0A 4A7KA 3LEIA 4CDUB 3DN7A 4COVA 1O59A 4GWIA 3THTA 4COZA 4XUOA 1I5PA 3QD6A 3QBQA 2ES3A 4NVPA 3UKNA 2Q1FA 3DPRB 3J8F1 4CDUA 1F4AA 4KWLA 3IPVA 1CAVB 5FYVA 1YQ2A 1HXS1 2DV9A 4TLGA 1REFA 3UKVA 1N1TA 2Z2SB 5EXOA 2TBVA 1H2KA 2VW1A 4UW4A 1F15A 2GN3A 4MUVA 4EWEA 1SCSA 1Q8SA 3ZXDA 2JG9A 1DYPA 2ZX3A 1ND3C 1V6LA 4BU2A 5D2AA 3T0BA 1D4M3 5FPVA 3KV4A 5FZMA 3B9CA 3GZTB 5C3OA 4WM8A 3WCSA 1NCRC 1UZZA 2I45A 3AFGA 3OCPA 1W6OB 3TOJA 4LBMA 1ZZ7A 1RUNA 2EALA 1C8M3 5A3TA 2D6MA 3WDUA 1AX2A 3BCWA 4JGZA 2DU0A 4N53B 3MLKA 1RUE3 1LOAA 5FPAA 1DLCA 4IEUA 4QPIC 1TNFA 2IXIA 4XDPA 3RPQA 1SEFA 1X9TA 1UYYA 1IKQA 1W0NA 2Z79A 3OD4A 4ZZ8A 1Q43A 2DU1A 4Y26A 1F2NA 1H30A 1PHMA 4N43C 3CJXA 4ZU4A 3GZEA 4AWDA 2WNVC 4R4XA 3K3OA 5AC93 1JN2P 1R082 4L99A 4DUVA 1COV2 2PAKA 1K3IA 5CBLA 2F4PA 3JD71 3B7MA 3RGBA 3GJAA 4XAAA 1W8WA 2E33A 2H0BA 2CY6A 3OBRA 1JZ4A 1KDKA 4LA2A 3LWCA 5D8AB 3LD8A 4UF0A 1QGLA 4XC9A 3U11A 2VL4A 4DXZA 2G1MA 1BCXA 4QU2A 1S1AA 1PX3A 1TMF2 4COYA 3GNEA 1BMV2 2VMGA 3W20A 1G9BA 4MGTA 3RRDA 2YU1A 3O5SA 1OD5A 3DYMA 1STMA 3K48A 3PUHA 2OPWA 2ZHNA 4RR3B 3OBZA 1OUSA 1V70A 2ZZJA 4LKEA 5GLVA 4DS0A 4MSVA 2P6CA 1ZZCA 4AVBA 2KM2A 1RMU2 3KQRA 2PFWA 2SBAA 4LE3A 4LBQD 3JXSA 3TBDA 3DKWA 3N9NA 2A70A 5BNPA 5DG1A 5DUVA 1AYM3 2WIIB 1CESA 1Q8VA 2BFUS 3CZJA 3OPTA 2R7EB 5E89A 3PJQA 1RUJ3 1VMFA 3NJZA 1FV2A 5JOWA 1NXD1 4OCTA 1MQTA 1H1MA 4XE9A 2XJPA 2GP5A 2VVFA 5CNAA 1W99A 4F8AA 1GQHA 2CYFA 2GSYA 2XBO2 4MH0E 2Q4SA 2VQUA 1O3RA 4XZPA 5F7UA 1LU1A 3MZHA 3E6DA 3ZDSA 1Y7BA 1FXZA 5DN2A 3AP5A 4KWUA 2D6NA 4HMZA 4IV1A 2BNMA 5DAPA 3MV11 4ZXEA 1HB3A 1GLHA 3G7DA 4Y20A 1QXJA 2QZ3A 5CKMA 5DZEA 3DL3A 4PI2A 3DPRC 3SLIA 1IPJA 3AP6A 2W1WA 3AYCA 2CAVA 4W50A 5G05L 5L19A 4FFIA 3KD4A 2PMWB 2VULA 1ASJ2 2CAUA 1YLLA 3ASIA 1FX5A 2PTMA 3NJXA 3T08A 3ZR5A 1GR3A 1LU2A 4WM7B 1NYWA 1VBC2 1K5JA 1FMD2 1R1A3 3VHNA 4KU7A 1AR93 1YUDA 3E5QA 3O1RA 1BEV1 3ZYJB 4HPKA 2X29A 1NA1B 1RL3A 2VW0A 4JGYC 4EN6B 1QNYA 1XJAA 2HWB1 4ITCA 2FDFA 3MICA 1AYN3 2WNUC 4LLOA 4YM0A 3B02A
chains in the Genus database with same CATH topology
2ZACA 3QH6A 1UD1A 1HRI3 2E63A 5JPNB 3AYEA 3S6PA 3IBMA 5IT6A 4YM2A 3MIBA 4OUMA 1LHOA 4WV8A 1U5YA 4I0AA 5BY5A 4AHYA 5FCCA 1JYCA 2NMOA 5I8TA 1SBEA 2YGMA 2RS13 4Z1VA 4LUMA 4LUKA 5FFOC 1CIWA 2E53A 1YI7A 5C8WA 1J1LA 4OHXA 4ZXKA 4Q4V3 4OI1A 2CGPA 2QDNA 1VRH2 1X33A 3JUUA 3RYKA 3V56A 3JQWA 4OZXA 5GZCA 2E9QA 5IK4A 4KG0A 1S0GA 4P9IA 3WDWA 1PIV1 3L2YA 3HAGA 1H2MA 3H8UA 1AL0G 3TNPB 3ZSJA 2RM21 2PAMA 3JU9A 4CEYB 1ALYA 1AXZA 4CRQA 4RL7A 1YFWA 3HD8B 5L7OC 1VBD2 1FNZA 2HWD2 1MACA 4J1XA 4RR3C 1S0IA 2QCSB 3WW1A 1WBFA 4LHKA 2R062 1VBB1 3KGZA 3O7OA 2HWE2 4XIOA 2RR12 4DOUA 2OZ6A 3LA2A 5CFCC 3M70A 3GBFA 4X8PA 3SH5A 3B5LB 1F5FA 1PNFA 2XHKA 3S7IA 3TB0A 1FYUA 1DQ0A 3WINE 2A7AA 1AUYA 5BNOA 2GH2A 1MQTC 2Y0OA 1J3RA 3KM5A 4XFCA 5FBZA 4XOGA 2W52A 5J09A 2A5ZA 1RUI3 2IXHA 1YJLA 4KQ7A 5JR7B 2Q30A 2PHUA 4PDWB 2ZGRA 2A3YA 3KZ4C 5CVRA 4R9DA 1O3SA 1O5UA 4Q4Y3 1ZBA3 2VMHA 3LOBA 5BNNA 1LECA 1WUVA 4HK9A 4QGMA 1PGSA 4FOQA 4FPKA 3MIFA 5T5LA 4N7IA 4TLFA 2GMMA 2LM3A 1RUF2 1PO22 3PJYA 1D2QA 5A32B 1N1YA 2SLIA 2QKDA 3R0RA 2JE7A 3BU7A 3WP4A 1QDCA 3V0BB 1ZRRA 1O3QA 1RUH3 5HXVA 1A6CA 1MS4A 4PBPA 4PIYA 1C28A 4IEZA 4RQPA 3AZXA 1QJX2 1ULCA 3ZYPA 4B7KA 1VBE3 3MGUA 2BGCA 1AL23 1JOJA 5ABJB 4Q1RA 2FBEA 1WW5A 3QLQA 3CEWA 4AQ2A 3VKLA 3KCCA 2TEPA 3VZLA 2JECA 3VBUC 1BYHA 3N35A 4Q4X3 1UAIA 4LBNA 3ATGA 2R042 3D8CA 2WKKA 1NLSA 1HQLA 3VBFC 4FXKB 4AFMA 5K0UB 4WVZA 2FZ2A 3ILNA 4Q8LA 2MHFA 3INAA 1B09A 2H6CA 5T3NA 1C8M2 1QH7A 4XHXA 1F9KA 2RS51 4NHLA 1V6IA 2OW4A 1DZTA 1RUE2 3VHPA 1UKRA 3WHTA 4I30A 4NN0A 4AVTA 4LBQB 5AC92 4KGQA 3AJZA 1IPKA 5DG2A 4YZ1A 5CFDB 1OOPC 5KHGA 1JH5A 5LEJA 4V1PA 1K5MC 5DUUA 3RMYA 4Q4W3 4LHNA 1LOGA 5JMCA 3TNQA 2GDFA 3RQ0A 1NCQA 1Z78A 4H14A 1I9RA 2D97A 3VBRA 1U12A 2Q1ZB 4YG0A 3VBHB 1ULDA 5GZGA 4NWVA 1SLCA 4FVVA 2K9ZA 4JDNA 3W9AA 2ZGTA 3IDEA 3VZOA 4K3UA 4DRVA 2ZABA 2WFPA 1DIWA 4XFHA 5T5PA 4DRRA 2V09A 4JVAA 2X5IB 5BNNC 2XPJA 2DVDA 3UJOA 4HN1A 2ZX0A 3DF0A 1RUJ2 1DQ6A 3H1YA 4OI2A 1R081 4XEZA 4O9GA 3WX5A 4FSJA 2RE9A 3WHUA 3T1LA 1J3PA 3H0OA 3QOPA 1WD4A 3TAYA 4Q29A 4D7SA 5J48A 1SACA 2D6LX 2D40A 3R05A 4DY5A 5FO7B 4DB5A 4MGIE 4R9CA 1TMF1 4TWTA 1RJ8A 1Y3TA 3A4UA 1BMV1 2OPKA 4ONUA 4DINB 3LCPA 2DUQA 4QM9A 2ET1A 1LGCA 3P3NA 1RMU1 3C3VA 4ZU7A 1IZ3A 2GC2A 3WCRA 4P14A 5KC6A 2EVXA 1J59A 1LCLA 1R1A2 2EF6A 1AJKA 1AR92 5EYYA 2TNFA 4Q0UA 4CP2A 4GWNA 2VPVA 1AYN2 3AMHA 3VKMA 1U5IA 2OA2A 5BNQA 2WWSA 4L8QA 1XNBA 1PK6B 4CDQA 2WL1A 2HEVF 1FOD3 2XBO1 5C9AB 2JX9A 1DQ2A 2NP0A 4YVWA 5L73A 4AGVA 4PJYA 5J7MA 4CZSA 5CU1A 5DUWA 4Z8BA 1JUHA 3VBOB 4XF4A 2JDZA 4UW3A 5DXDA 4DFSA 2XJVA 3PLQA 3ZFEC 2B5HA 1RUOA 2RHPA 2RS12 1LODA 2W68A 3RI9A 1ASJ1 1DU3D 1EY2A 1Y43B 3I59A 1QQP2 2WFF3 4META 4C0HA 4Q4V2 5FMOS 1VBC1 4MYEA 1FMD1 3OD0A 1TQ5A 5HI0A 2WS91 4CP1A 2UU8A 3GALA 1XYNA 2EXJA 2UURA 5HBAA 2D6OX 4RS5A 1KD7A 3R4UA 3IMNA 2ZHMA 1SDWA 4QHBA 1CGPA 3JZVA 4MXWB 3WG2A 3VBHC 2DFBA 4KGGA 1MEC3 3LAGA 4LHLA 3ELNA 3NV3A 2BFUL 5GKAC 1S0CA 1ZM1A 2PLV3 1SLTA 4FQ4A 1KJRA 3ACLA 3ZFGA 5C4WB 2ZMKA 2B45X 2HYKA 5KWRA 3AMQA 1R093 2AR6A 2BUKA 2GAUA 1G7YA 1UX6A 4QQPA 1NE6A 3WY6A 4I0WB 1POV3 3MIGA 3VDDC 3H7JA 2ZHLA 5A33A 4EN8B 3RG0A 5EZWA 3ES1A 4M3CB 4QT6A 4QPGA 4KH9A 3W59A 1DGLA 1N3OA 1AR61 1RUI2 4FT8A 3WG3A 2HEYF 3I8TA 3B00A 4AEDA 3TYJA 5JPMB 2O0OA 1I5ZA 1LB2A 2ARBA 1LOFC 4P9GA 1VBD1 2HWD1 2VVDA 3VL8A 3NAPA 1DQ5A 1DGRA 1ZBA2 4K7JA 5HCFA 4AI8A 2R061 3ZXJA 4E4SA 4IL7A 4DMIA 3FE5A 2HWE1 2RR11 3AKSA 1DYKA 1W6QA 4K21A 1PNGA 4GH4B 2XJQA 4YG3A 3U0ZA 3RSJA 4EV0A 3VL9A 1RJ7A 1JYIA 1NZCA 5I0SA 2G9FA 1AF9A 1OLRA 2D6KA 2VY0A 1QWRA 2DTYA 4B4QA 5I8SA 2GC3A 1GFF2 1RUH2 1UMZA 1EAH2 2R30A 1CAXB 1DGWX 4AVAA 5ACA3 3FFQA 1YFYA 4XMAA 5FREA 4CDQC 1MS9A 3MW3A 3AP7A 4B7EA 3TN93 2R1DA 2DUOA 3AJYA 1VBE2 2O1QA 4Q27A 4D94A 5JVVA 4YVWC 3ZXEA 1AL22 2R49A 3B93A 3IM0A 1ND3A 1FATA 1NQJA 2IXCA 1LHNA 1RTVA 4U2AA 1NCRA 4DQAA 4E2QA 1CJDA 5GLWA 2ZPXA 4ZU5A 1V6KA 1LENA 1QJZA 2HJIA 2JKBA 4Q4X2 1WW7A 1H4GA 4YRDA 2GALA 2QUOA 4FPEA 1RUF1 5BXXA 5KC5A 4QPIA 1PO21 2YHJA 1VAMA 3LSDA 4GA9A 4YFZA 4NHMA 4X8NA 3EXUA 1EV13 3VBSB 4A7YA 2A6WA 3KLSA 1SLIA 1QU0A 2WNVA 1CAWA 1UPSA 4J1WA 3IKWA 2Q0AA 5IK8A 1QJX1 2CNAA 1H8VA 5T5OA 2NPIA 4Z2WA 4GULA 3M8LA 2D5FA 2A73B 1C5IA 4IEVA 3ILRA 2PQQA 3ZYIB 3ROUA 3SCFA 2BNOA 3MFAA 4URTA 2CWMA 4Q4W2 4D7YA 4I09A 4M3CE 4E27A 1U5ZA 5CB7A 4NOTA 3WP6A 2R041 4IETA 2YY1A 2W0XA 2UYAA 3BODA 1RHI3 2RJLA 1H2NA 1S2BA 3WQ0A 4MGKE 1X8EA 1C8M1 4QPGC 4YVSB 3N7KA 3WVJA 1G9CA 3LZZA 1VIWB 2GN7A 1RUE1 2A71A 4H7LA 1F31A 3VV1A 1H1IA 3ZX7A 2BBVA 3U10A 1ND2B 4C0BA 4GH4C 5AC91 4WVMA 1W6PB 4BE3A 1URXA 2BWCA 3HR9A 1DQ1A 1ZBE3 4XBLA 4XJ8A 3O14A 3ZSLA 4CDUA 1REDA 4O9EA 2AGSA 4YW5A 5T50A 3R6SA 3UV9A 2GZWA 1SFYA 2E6VA 4QGLA 2WT0A 4GKXA 3DPRA 1LEDA 1CAVA 4QQHA 5EYXA 2OVUA 1C8NA 1Y9QA 3ZFFB 4FBFA 3USUA 1UF2C 4NWWA 4DZGA 4H55A 1LR5A 2XGXA 4XPVA 2WLPA 4HVQA 4JGYA 4RHV3 3VKOA 3CU7A 2YDEA 2WNUA 4GALA 3GBWA 4F3JA 2KXLA 1W6OA 2XJSA 5H9QA 2UY8A 1RUJ1 3ZXFA 4BQ1A 4GMP3 4XBQA 3AMMA 4XFFA 5JZGB 5GM0A 3IPVB 3CO2A 1S0JA 1FOD2 1QH6A 2X53S 1WLDA 1YWKA 2BQPA 1TNRA 4M3CF 5I93A 1PVC3 1J1TA 5J3UA 2D44A 4IEOA 3BPZA 2ZCWA 2DCZA 2JG9B 2B9UA 4OHZA 2K2SA 4ATEA 3OBTA 5IUQA 1ZZ9A 3WUCA 4YFWA 5HCBA 4WM8B 1BZWA 3KCXA 2NQYA 2ILMA 3H3UA 5GALA 4M01A 4BWOA 2NZ9A 1G86A 1QJU3 1GNZA 2WQZC 1R1A1 4JGZB 1AR91 3MPPG 3ZYGA 4R52A 5L7OA 4XF3A 3N36A 4RR3A 2WQ4A 4OUSA 3V0AB 3ZMOA 5C6CA 4HKOA 1DGWA 1AYN1 2P2KA 4P5HA 4FAHA 1UKGA 4A7ZA 3KGLA 3LSEA 1VLNA 2ZAHA 3ZSMA 4CDXC 2F6BA 5CFCA 4JTNA 5LK5A 4GB33 1MEC2 4YGCA 5E8AA 2AYHA 4L9BA 3FLPA 2PLV2 1WW6A 2PAEA 4AI3A 1YFXA 1G9DA 3OF1A 2UWAA 3T1MA 5KHJA 4Y1ZA 3N7MA 3MPBA 2Z42A 3NL1A 4AEJA 2B7YA 1S0EA 4Z07A 1HXS3 3OYWB 2RS11 1R092 3M4FA 4Y22B 1DLLA 1S2KA 2P37A 1SLAA 3E5XA 3I7DA 3UJQA 1POV0 1QQP1 4M00A 1JBCA 2RS33 4Q4V1 1CPMA 1UN1A 3BOWA 3ZXLA 2PA7A 4E4DX 3VZNA 4Z82A 4CDUC 5HCAA 3AZWA 4AVCA 4BPZA 5BNPB 3RNSA 1TME3 2H0VA 1H0BA 2VQAA 4R8HA 4XFAA 4KL1A 4Y1XA 2R32A 3CF6E 1C1FA 5JSRA 1EYBA 1S0BA 2PHDA 5FDBA 1GZWA 4IEYA 1NA1A 2K0GA 5JSPA 3OY8A 2BYVE 3KB5A 1SBFA 3GYDA 3KS7A 4IV1B 2CL2A 1WLCA 3JD73 4FPOB 4BYYA 2XVKA 1LEMA 1PO13 3URFA 3WG4A 2JEMA 1T6GC 1CAUA 4N53C 5ACA2 2DVBA 4Y1YA 3G6JB 4AG4A 1RB8G 5JCTA 3A0KA 1RUI1 5I0TA 1D0GA 3TN92 2YZ4A 1PGL2 3JBG2 1W0OA 2WZR2 3VBUA 5FMOL 3AXEA 3KCYA 4Q1PA 1AR83 2ARXA 4K1ZA 3W58A 3VBFA 1OFSA 1ZBA1 1UL9A 4MGYE 1HDKA 4XDQA 1TEIA 1FI2A 1AVBA 1MR5A 5D8AC 1ZZ6A 1KS4A 3WXPA 3FBMA 2WNEA 5C33A 5K8SA 4GIQA 5JIAA 4XXPA 5I91A 1RUD2 2BVVA 4Y4YA 5C8CB 4PBOA 1DDLA 2JG8B 1EV12 1RUC3 2LTNA 4HSJA 1RUH1 1EAH1 2R0HA 1I1EA 1NOVA 4B4RA 2ZGOA 2A75A 2GU9A 4LA3A 1A3KA 1LULA 2Q5TA 1OOPA 2G9GA 2V73A 1K5MA 3MLLA 4QPYA 1VBE1 5I0RA 3MI8A 4J6GA 4M0HA 1AL21 4OULA 1O5LA 3VUOA 3AZVA 2VNRA 2VQ0A 3HT1A 1SFNA 1W6NA 4L97A 3WOGA 1WCDJ 3VLBB 2D5HA 4H3WA 4G9SB 4L2NA 4JTOA 4Q4X1 3UL2A 4QQ2A 1ENRA 1ENSA 1CVNA 1ULGA 1IS6A 2HWB3 1FPN1 5LRSA 2BNNA 3D0JA 1RHI2 1AXKA 3FZ3A 4I3GA 4QQLA 4CEWB 1MZFA 1KDMA 2Q8OA 3CJIB 2BTVC 3SMHA 3D5OA 5FRAA 1IOAA 1WCSA 3AB0A 3FC0A 4WM7C 5JSOA 1DZQA 4K40A 3ME2A 5A32A 5BNOB 1OQEA 1NA1C 1RGSA 5DUXA 1KITA 4LULA 3V0BA 2AUYA 1U0AA 1I6XA 3NV1A 4XJUA 1C57A 1VJ2A 1N3PA 1W2UA 2C9AA 1ZBE2 4GXLA 2PHFA 3VZJA 2Z69A 1V00A 4Q4W1 4EJRA 3I4IA 2XJRA 2W08A 4S2GA 1D0HA 2WJSA 1XNDA 4HL0A 1PIV3 1V6JA 5E88A 3V64A 2VMIA 4EN7B 1GANA 3M7AA 4YM1A 5KHIA 2BPA2 1M4WA 3Q9OA 4AW7A 2ZGKA 4RHV2 2GNMA 2QFEA 2PN5A 3TRSB 1YNAA 1XNCA 1DQ4A 1OMIA 1QOSA 4DPNA 1D4M2 3WDVA 1JTZX 3HQXA 3N4MA 1X7NA 3NSTA 2AREA 1WA4A 4GMP0 3NKGA 1BVVA 4RQPB 2PHRA 1G8WA 4QX5A 3ZIWA 3ECQA 1OQ1A 3KT1A 4L11A 2R16A 4JV4A 4CEYC 3VGIA 4YYOA 4XFIA 4Y5Z0 3ETQA 2DVAA 2XWJB 3ZFEA 3NKTA 1RUG3 1G9AA 2XVLA 4PLOA 2RMU3 1YCIA 4LNVA 4KBBA 3BTAA 3S30A 3ZSKA 2VUAA 4HZFA 3PNAA 4N9HA 3EO6A 4GWMA 4E2SA 1HRV3 3AM2A 3WD5A 4YM3A 2YC0A 1ONAA 5I0UA 3B94A 4GQ7A 4MGZE 2OZJA 2I74A 3VBHA 2EXIA 4ASLA 4WBBA 4RA0A 4XQDA 3AKQA 1OLQA 4NHKA 1LKNA 1KXGA 2ZGSA 5H9RA 2AENA 2AH2A 2C1FA 3GF6A 4Q0SA 4OHYA 4PDWC 4ATFA 1X82A 1DZRA 3KT7A 3EHKA 1FOD1 2GH8A 4GB32 2HKXA 2YGLA 2Y0IA 3ZYRA 2JE9A 4RGGA 3ZIXA 1AYM2 2P17A 2D6PA 4BA6A 2GC1A 4D7TA 3VDDA 4FTSA 1COV1 3POSA 1XU1A 2UY9A 4KG8A 2CTVA 3M3EA 2OIIA 4I0BA 2RS32 2MEV3 3X29B 4ORFA 4MZUA 1BJQA 1LOFA 2HEWF 2UYBA 2EXKA 1PZ7A 1HKDA 3QH7A 4N9IA 5IK7A 2DCKA 2H6BA 1XQNA 1DHKB 1TME2 2ZTNA 1LTEA 4AGRA 4OHVA 4FTEA 4EWDA 3SXWA 3ZN5A 4WZFA 2ZGNA 5ABJC 2PELA 1YO8A 2RS53 1MEC1 4AVVA 2A6YA 1GZCA 5DDJ3 1MS5A 3RJ2X 2PLV1 4UW5A 1QOOA 3AXDA 4I3PA 1W6MA 2W39A 1ENXA 2ETEA 3WLUA 1H8TB 5GZFA 1ZVFA 1R091 1UU4A 2QJVA 4RD7A 5K0UC 3JD72 1HRI2 2HWC3 1PO12 1POV1 3EQEA 4G3YC 4W6XA 1BVP1 3MLJA 4FOVA 4BMBA 4CDWB 1XE8A 2O8QA 3VHOA 2I07B 3RYPA 1UU5A 1KJLA 4IV3B 1S0DA 3POYA 1U5XA 4S2DA 3NW4A 4MX3A 1AR82 5CFDC 5CIRA 3IT8A 2PHXA 1ZYBA 3GZAA 1F5JA 1QXPA 1O7FA 4BM8A 2IFWA 4OLLA 5JOYA 4AYUA 3E6CC 3RS6A 5FO8B 1Q3EA 4TYSA 1CJPA 3E5UA 3E6BA 4HLTA 1QJY3 1PZ9A 1RUC2 4IEXA 5FLIA 3I59B 1Q8QA 4G4FA 4XQ4A 1WCKA 2X5IC 1PGL1 1MVEA 1JHNA 3JBG1 4YW4A 2WZR1 4R9BA 4RSUA 1AJOA 1REEA 5GLUA 1MZEA 3MIEA 4C1WA 4M3CA 3ZN4A 1VRH1 3A0NA 4K8FA 2OUHA 5CAZA 4C90A 4ISQA 4COUA 1VR3A 2A3XA 2A6VA 5F6LB 5JOZA 4LBJA 2QZ2A 3SITA 1B35B 3AP4A 4D69A 4XYXA 1OQDA 1RUD1 5GZDA 2D3SA 4Q4Y2 5SV8A 2DVFA 1EV11 1G9FA 2IZWA 4FOYA 4AEMA 2JENA 4GH4A 4XETA 3ZN6B 3EBRA 3I54A 1YXWA 2Q1MA 4YZ5A 2JJ6A 3JQXA 5A33B 3AYDA 4AQ6A 3O0XA 4AEKA 4C91A 2WT2A 4D3WA 1CAXA 1H8TC 4AEDB 3M3CA 4YGEA 5KHKA 1PK6C 3VZMA 5C9AC 1A8DA 1ZZ8A 2WZPP 4JQRA 3NAPB 5BPXA 2WS93 5J98B 3WW2A 3H50A 5GLTA 1EP0A 3SCHA 3PVOA 1QMJA 4CDWC 2WINB 4ES8A 1UIKA 4JDOA 4XTPA 1RHI1 1W6QB 4H7MA 3VBOC 5J96B 4XILA 4BMEA 1FAYA 2GC0A 4L92A 4NPRA 2IC1A 1LGBA 3TWIA 2E7TA 2E7AA 4AHWA 1F8VA 1VBA3 2VGDA 2P3IA 2XJTA 3LOIA 2ZKNA 3ZXGA 2DUPA 4P9XA 1XE7A 4B4PA 2JXAA 1W39A 1ZBE1 2CGOA 2QDRA 3RJRA 4COWA 1PMIA 2R073 5KBFA 1EPWA 1ND3B 4MV2A 4INDA 1H4HA 1NCRB 1RUG2 2RMU2 3H3ZA 4AQSA 4OVEA 2FHRA 2DCYA 3R4DB 4FQZA 4AE2A 1AR63 1BBT3 1TE1B 3FLRA 4HT1T 5C4WC 4PIZA 4YZ2A 2EXHA 1ULEA 1VBD3 1HRV2 4RHV1 1NY72 2VOKA 2Z5WA 2ZAAA 4SBVA 4XF1A 2PHLA 4FPGA 4PIXA 4XW3A 1SCRA 1MS0A 3QACA 4N43B 4YG6A 1D4M1 4RFT0 5KXEA 5JI7A 2JICA 1BXHA 2WNVB 4CDXA 5F1RA 1CAWB 4YVSA 1HQWA 1WLWA 3NV2A 5FQ0B 3SH3A 1WGPA 4MLOA 5I8YA 5L36A 1RVF3 2ZX2A 2QNKA 1PVXA 3WZ1A 4PCRA 1WD3A 3BALA 3JB4C 1Z7S3 3DUIA 3IWZA 1ND2A 4HANA 2HWF3 5EWSA 4EN0A 1W6PA 5A3MA 1Q8PA 2D3RA 5AFEA 4P9YA 5CG8A 1YYNA 1AHSA 1S55A 4LO7A 2TUNA 1V6MA 2MEV2 1I3HA 4XMIA 3MEPA 5FLJA 3HN1A 2CV6A 4K9SA 1KRIA 2ZS6B 1C3HA 2QVSB 1VAKA 4P9JA 2ZMLA 4WVMB 4JDMA 1V9U3 1IS4A 4GB31 3DV8A 5DDJ2 4P9WA 3KMHA 2YUEA 4AF9A 4LO5B 1AYM1 4DNYA 1QJX3 5AFBA 4C1XA 4B3NA 5JZGA 2C0ZA 1OA2A 2ZZQA 4LT5A 4K1YA 4N53A 2I2SA 3USUB 1V6NA 2HWC2 2RS31 1PGW2 3VBSC 2XWBB 3C2UA 4JGYB 2IXJA 1KFUL 1X50A 2A3WA 3GBGA 2R043 3FWEA 4HVRA 4LO4B 4Y1VA 1BKZA 3WT3A 2WNUB 1UZYA 5GLZA 4N90A 3M3QA 3JB8A 1XXNA 3ENRA 1TME1 3AMPA 2QE3A 3RDIA 5D8AA 5T5JA 4Q2FA 4XJ9A 3MF9A 1DBNA 4QXKA 2WFF2 3J26N 1AR73 5JOXA 5CG9A 3D4KA 3V0AA 5TSWA 1O4TA 5D1IA 1KQRA 4QQOA 1A8MA 4KWKA 4OI4A 4IESA 1IGOA 1N3QA 2ZHKA 1MS1A 1ZRDA 2C5DA 2N7GA 2GMEA 2B42B 1HRI1 5LK7B 4YVSC 1QJY2 5F5QA 1PO11 2ERFA 1YRZA 5J36A 4R9AA 1GKBA 3CNAA 3J9SA 1YIPA 4BCUA 4N7UA 3OYWA 3J8F3 1QOTA 4Y22A 4YSFA 5K9YA 1VP6A 4BIOA 3AX4A 4P9LA 4LBLA 5L7OB 1LHVA 2XLGA 4YGDA 1ND2C 2FQPA 4Y1UA 1FNYA 1AR81 2GNBA 2ZBJA 5LRRA 3WDTA 2D93A 1EPZA 2WLQA 3D6EA 5CFCB 2VVEA 4AI1A 5FTTC 1OPMA 1JW6A 1LHWA 4KNCA 3ZFFC 4LBOA 1FT9A 1WMFA 4WM7A 3GZUC 1SQ4A 4TSVA 1MQTB 1RUC1 1M06G 4UBGA 1IQAA 2P3JA 1WMDA 1JXNA 2EA7A 4HK8A 1NG0A 1ZNPA 4YARA 1J3QA 1SMVA 2VW2A 5FPZA 3FUQA 1RIRA 1BK1A 1CR7A 2IFRA 5H9SA 3AKRA 1V6OA 4FO9A 4PLNA 1E57A 1JUIA 3EJKA 1QNWA 5FO9B 4GKYA 4Y20B 2D43A 1H2LA 1IS5A 4IXLA 4Q0QA 1RITA 5K7PA 5JZGC 1LJ7A 2MNGA 4HN0A 4BZ4A 2LALA 5JDBA 4CYDA 5BUVA 2B8MA 2WS92 1GZWB 4ES9A 2XLAA 4WVVA 2JG9C 4HPKB 3OY8B 5F6KA 1L3JA 4XJAA 5AVAA 4Q4Y1 1OA3A 4WM8C 2X8KA 2JD4A 1ZRFA 3AK0A 1RC6A 4FPLA 4IQPA 5CA6A 1MZ6A 4BLIA 4CEYA 3APBA 2FMYA 4JGZC 1CAUB 5FAXA 2WSUA 5JI9A 5BV6A 1VBA2 2NM1A 5C8CA 2JG8A 3AP9A 3H9AA 4YNIA 3J4UH 1QQP3 1HLCA 3VBUB 2R072 3AKPA 1IKPA 4YW3A 3H1MA 3VBFB 2R0FA 3PVBB 4WVWA 3QCWA 1UW8A 1MZ5A 1AR62 1O4YA 4NO4A 1BBT2 3AKTA 1OFNA 2DVGA 3N3HA 5SV5A 2XLFA 1MVQA 4AFBA 2FMDA 4BIFA 4KU8A 4XFGA 1A78A 4FPCA 1BEV3 4U36A 3PTYA 4PDWA 3LA7A 4CEWA 1VAVA 4E4ZA 3D0SA 1GNHA 1C4RA 3HIFA 2RJKA 2WA4A 2VXRA 3CL1A 4B8EA 1XRUA 3CJIA 2YXSA 2R1BA 4AQTA 1OOPB 4X6RB 5BNPC 1K5MB 1RVF2 4OI0A 4E9KA 4BOWA 3O0VA 3ZVXA 3MIDA 1H9PA 1N1VA 2DF7A 1LRHA 1IS3A 1GBGA 2DFCA 4HKLA 1W6NB 3DGTA 1RUG1 3MIHA 5T54A 1Z7S2 2RMU1 2ATFA 2YPJA 2ZOEB 3SH4A 2HWF2 4I02A 3FMGA 3M1HA 3WUDA 4M0NA 3VZKA 2MPFA 3ILFA 4FPFA 5FLHA 2IXLA 1HRV1 4IV1C 2YV8A 4Y24A 1NY71 3WW4A 3VKNA 3WNXA 4Q8KA 3IDCB 4LBKA 4UW6A 3IIAA 5BNNB 3RZZA 1S0FA 5ABJA 4LR4A 2YYOA 4UBHA 2XB6C 3FFZA 1AX0A 2RM23 3I2DA 1QHDA 2WA3A 5EJ3A 4MVTA 3ALQA 4ISRA 2BWAA 2LUWA 4S2HA 2YROA 4Q0VA 2DWRA 1V9U2 3N7JA 4XF0A 4AHZA 1VBB3 1EAH3 4W65A 4OFGA 4QMAA 5K0UA 2ZJCA 4JRAA 1DF0A 3RWNA 2VNG