1H8VA

The x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
ETSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGGQNNVKSYQNSQIAIPQKRTVNSISSMPTTASWSYSGSNIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQSWTLYYGYNGAMQVYSFVAQTNTTNYSGDVKNFFNYLRDNKGYNAAGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title The X-Ray Crystal Structure of the Trichoderma Reesei Family 12 Endoglucanase 3, Cel12A, at 1.9 A Resolution
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 53
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h8vA00
1UU5A 1H8VA 3VL9A 2DCKA 1BCXA 2DFBA 1HV0A 3WT3A 3WP4A 3WR0A 4S2HA 3WQ0A 1UU6A 4IXLA 1F5JA 2VG9A 1H4HA 1M4WA 2JENA 1OA3A 1QH6A 3EXUA 1KS4A 1PVXA 2B45X 2D97A 2BWAA 2JICA 2C1FA 2VUJA 3WP3A 1XNCA 1C5HA 4XQ4A 1XYOA 3LGRA 1YNAA 2BVVA 1C5IA 3VZKA 1IGOA 1XXNA 1AXKA 3AMMA 1W2UA 5K9YA 3MFAA 3WQ7A 1H1AA 3O7OA 2QZ3A 3WX5A 1HV1A 3WP5A 4XPVA 2NLRA 1BK1A 1XNKA 3VL8A 3M4FA 3AKQA 2Z79A 1XYNA 1XNDA 1XYPA 3B7MA 4HK9A 1UU4A 3AKPA 2DCJA 3VHNA 3WXPA 4HKOA 1QH7A 5K7PA 2F6BA 4S2DA 3AKRA 4H7MA 3VZOA 2VULA 3LB9A 1NLRA 2DFCA 2QZ2A 4HKWA 1OLQA 1OA4A 3MF6A 2DCYA 3AMPA 3VZMA 3VZLA 2NQYA 2VGDA 4S2FA 4HKLA 3AMNA 3WP6A 1T6GC 5HXVA 3VGIA 2JEMA 3AKSA 1REDA 3VHOA 2BWCA 2B42B 1HIXA 3WQ1A 1KS5A 3VHPA 4XQWA 1OA2A 3AKTA 1H4GA 1ENXA 3AMQA 1UKRA 4XQDA 3MFCA 3B5LB 1BVVA 2BW8A 4HK8A 3RI8A 1REEA 3VZJA 1XNBA 2DCZA 3HD8B 1OLRA 4NPRA 2D98A 3VZNA 3MF9A 1REFA 3AMHA 2B46X 5EJ3A 3WY6A 1TE1B 3VLBB 1H0BA 3RI9A 4S2GA 3ZSEA
chains in the Genus database with same CATH superfamily
4NAOA 2IXCA 3U07A 5FP4A 3HQUA 2CGNA 4QQPA 1XQNA 2Y6HA 1ULPA 4QX7A 2A75A 3IZOA 4CP1A 5FYSA 4CP2A 1X82A 2GC2A 1S0GA 1KITA 2DFBA 4QKFA 2O8OA 5F1RA 1CAVB 3MIFA 3P6BA 1ZBA1 2F17A 5LBCA 3ST7A 5J7MA 1RUE1 4IXLA 2VZVA 3POEA 4B1MA 2KM2A 1UIKA 3I2FA 5FK8A 4MHUA 5FYVA 1U12A 2Z42A 3IAQA 3ZYBA 3PL0A 4AL9A 2PN5A 3IM0A 4RSUA 3J8F3 3OGSA 1K12A 4ES9A 2QE3A 2VUJA 4O7XA 5DG2A 4B4PA 3LSDA 2EALA 4PQ9A 1LAJA 1AX2A 5JIAA 1JYVA 2Y34A 1WGPA 4Y1UA 2HWE2 4KWJA 1PO13 4NRMA 5JI9A 4PLNA 1V00A 3WG2A 2JDKA 2R6QA 2RR13 4JQRA 1AR82 1ALYA 4UOJA 4OMDA 4PDWC 2FDGA 1VAMA 3ATGA 5DPNA 2XXZA 3ZYPA 4XPVA 5FY0A 5GZFA 4I3PA 4FP3A 4BQ5A 3WG3A 3VL8A 2PXJA 2QQUA 2BFUL 1UPSA 2VJXA 3AJZA 5DAQA 1IPJA 5A3TA 1NE6A 1S2EA 5JIUA 1UY4A 4PLOA 4IGPA 1BLZA 4XUPA 1DFQA 2W1WA 1AR91 5DDJ3 4PJYA 1VAKA 2W94A 4LBMA 2WLPA 5D8AC 3WCRA 5D1IA 1B09A 4AG4A 2QZ2A 1CX1A 5A7NA 4HKWA 2Y6LA 4CP0A 5BNPC 1ZA4A 3O1MA 1FT9A 1LTEA 1F15A 1EUTA 5IVYA 3VZMA 2BERA 4L99A 1LU1A 2BGOA 4QX5A 1LHWA 3ZYGA 4Y5SA 1JHNA 1W2OA 2JX9A 2VXRA 1E5SA 1XOYA 3VBRB 5A6YA 1UMIA 1TME3 5FPXA 1UY1A 1QJU3 2W46A 3LIGA 3VDBA 4Y1YA 2AR6A 1PX3A 2SLIA 4IL7A 4UF0A 5I0RA 1LCLA 1QJFA 2AGSA 2YPJA 2CDOA 3CHXA 2E33A 5A32B 1Q8PA 5C7GA 3OEBA 1JBCA 4OZXA 1ODMA 4Q5OA 1VJ2A 4QPIC 4UFMA 5FY4A 2O8QA 1ZBE2 1R1A3 1RUG3 1SLBA 3QH7A 3WHUA 3U11A 4A6SA 4BYYA 2O0OA 3I2GA 1DIWA 5A7WB 4Q4Y2 3AFGA 4UAPA 1OFNA 4JX0A 4Q1RA 1ZM1A 5J3UA 1GP4A 1W0PA 4L11A 3Q9OA 3NNGA 4Y22B 5E6HA 3RMXA 1VBA1 1JYIA 3N9QA 2X5IB 1NCQB 1VBC2 1FOD3 5LBBA 1D4M2 2D98A 3J4UH 1WUVA 1ZZBA 4O9EA 4BQXA 1AUYA 2YC0A 4GIQA 4RR3B 4IV3B 5FAXA 4NIGA 4LIVA 3PDQA 3ZFEC 2GU9A 2RMU2 3ZDVA 1JUIA 2PELA 1AYM2 3MI8A 2KA3A 3BKZA 1QQP1 3AP5A 3DXUA 3ORJA 4K3UA 5K0UA 1O3SA 4A7ZA 1EV12 2ILMA 1Q56A 4TSVA 3KHCA 1FATA 1S0EA 1YQ5A 4AE2A 5A3MA 1XC6A 5JPNB 3UKTA 2LW8A 2CYFA 4W8JA 5FTTC 4QPYA 1C8NA 4NN0A 5BUVA 4U2AA 2BOJA 5E1RA 1PVC1 1KGYA 1VMJA 3H0OA 2ZGRA 4AWDA 1JOPA 4RA0A 2VMCA 2HWE3 2QBXA 2UY9A 3R4DB 1DQ6A 4QB6A 4Q26A 2GMEA 5FK7A 5EYXA 3JB8A 4UFIA 3GZAA 3K4ZA 1G9BA 5JWPA 3ZYHA 3WP3A 1CZTA 2VU9A 3PTRB 4AZZA 3AM2A 1DQ2A 3S5QA 1XNCA 1C5HA 1W8OA 1VPHA 5FRAA 4N9HA 5FPUA 1BMV1 3A0KA 1YQ8A 2YBSA 1O3RA 3ZLIA 4YW3A 2UYAA 1FMD2 1FAYA 1T2XA 3SISA 4P9YA 2AEYA 1W9YA 5BNOA 2VMDA 3NRUA 3ZXGA 1W6NA 2PHTA 4FFFA 1WBLA 4XIKA 5FZHA 4CU7A 2TUNA 2A7AA 3B69A 4A2UA 4R9CA 1PGL2 3I2HA 1HQLA 3FBMA 1FI2A 2DCTA 1R092 4R52A 5AC92 2JDHA 2JG8C 1UW8A 3AKPA 4IV1C 4FO9A 4JV4A 3WXPA 3LSEA 4EV0A 5GLZA 2ZMKA 3TEZA 4OI0A 1J3PA 4RGGA 4W6XA 4E9KA 1CJPA 3ZKUA 2XKPA 5F5CA 4DQAA 1ZZ9A 1WD3A 1Y7BA 4M0HA 3ZYIB 5EZWA 3ZFFB 1AF9A 1VBE1 4FAHA 3ZR5A 2QQPA 3KVBA 1AR62 2VW0A 1MZEA 1LHUA 1RUH2 4IGQA 2PQSA 1F8VA 5I0DA 1OQDA 5FZMA 5GLTA 4ISQA 1YXWA 3RYPA 4NRPA 1BQPA 2C26A 3C8XA 3ETPA 1T6BX 3TNQA 1E5HA 2WN3A 3BB6A 4Q4Y3 3A22A 4QXCA 4LO7A 4KMQA 3P5BA 1COV2 5I0TA 1AL0G 1QJY2 2W87A 3IBMA 3M8LA 1CPMA 1PX4A 2VTFA 1ULFA 1Z78A 3O1SA 1BKZA 3J8F1 4KWKA 2X05A 1B35A 3DCQA 3WNPA 4CEYB 5FZAA 3AZZA 3I3QA 4LKDA 5FZDA 3V64A 1GNHA 3TWIA 3PTYA 1PO11 1YQ6A 4AHWA 3T4HB 3LFIA 1LKNA 3AZVA 2RR11 4JGYC 2EXJA 4QWNA 5BNPB 5J1XA 4XYXA 5FPAA 4KWUA 4QXKA 1ODNA 4HG6B 3AVSA 1LGCA 2YU1A 2ZX1A 3QD6A 4K8RB 3MPPG 1D2QA 2YGLA 5FUIA 5BYNA 4X6RB 1Y9MA 3ZXEA 2FZ2A 2Y0IA 4YG3A 2VNOA 4D94A 4Z92B 3H8UA 4N53B 1SCSA 3URFA 2AACA 1I9RA 3B9CA 3VL9A 4E4SA 1NZIA 3L9JT 5GM0A 2V09A 5AFEA 4MGYE 5EV7A 1DGRA 2E7AA 4GAZA 1JUHA 1QWRA 4Q0QA 1HV0A 2D43A 2GALA 4OI4A 3ACGA 4UW3A 5DDJ1 3RDIA 2ZGPA 2DVFA 1Q8OA 1F5JA 3S57A 3MGUA 2QQMA 1N3PA 2W95A 2WL1A 2O1QA 1GWLA 2D97A 5LEKA 2R062 2Y38A 4OLLA 1GP5A 1AXYA 2PLV3 1ND3B 2ZJCA 1JS9A 2JE9A 2VCMA 1NCRC 1KFXL 3POIA 3VV1A 5A1FA 4CCDA 5L9VA 3FFZA 3KM5A 2LRPA 4A44A 5F2WA 1TME1 2CY6A 2WKKA 4UT5A 1QJU1 2A70A 1GMMA 4LK7A 2EIBA 1WD4A 3H42B 2GC1A 4B4QA 3VZKA 4JDOA 1S4CA 4RS5B 1R093 3S7EA 5AC93 5J37A 3CJIA 5LBFA 2D6MA 2VW1A 4CUCA 4HLTA 3IIAA 3IDCB 1AYN2 1BHGA 4I02A 1UKGA 3BPZA 4CDXB 1BEV2 1R1A1 1RUG1 2VW2A 2XOMA 3A4UA 1PHMA 1YFXA 3GALA 4XF1A 3VKMA 5T52A 5KXCA 5FZOA 1LB2A 1UOFA 2OW4A 3ENRA 3JB4C 4HK9A 4BHPA 4XJUA 2FMYA 1GICA 1ZRRA 3CKHA 3NJVA 4MUVA 2XUMA 2Y60A 4HKOA 4XDPA 5K4LA 4E27A 1RUH3 5IK7A 3VUOA 3ELNA 3EHKA 4HMZA 1HRV3 1FOD1 3TBDA 1SFNA 3TB0A 3ZYFA 2PHFA 3OY8B 2WRAA 3UNPA 1BBT3 1DLLA 2XLAA 4OUSA 4BPZA 1RC6A 2HWB3 4BXSV 1MS8A 1OA4A 1W8UA 4N43A 4AQ6A 5JOYA 1MVEA 1H2NA 2ZACA 1MR5A 2NQYA 2VGDA 5FDBA 3CIHA 4IE7A 4U36A 5CNAA 1AL23 2WT2A 1O8PA 3PVBB 2GC3A 3EYPA 4INDA 5TSWA 1OH4A 3SCFA 3WP6A 1OH3A 1QJY3 1YO8A 2XJPA 2DDUA 5F3EA 3AYEA 2WNOA 2B42B 2LS6A 2R30A 4RFRB 3KWVA 1UOGA 4IEZA 4BQ1A 4XQWA 1UMHA 1ZRFA 5FMCA 2PQQA 4JGZA 3TRSB 3B02A 2AH2A 5AVPA 1WMFA 5FMOL 1UWWA 5JOXA 4ZU4A 2WA4A 2HWE1 1LOAA 2DV9A 1W2TA 2FCUA 4EN7B 2WNUB 4QQHA 3NSTA 3I49A 2Q5TA 4F83A 3RG0A 2JG8B 3WHTA 4IV1B 1BVP1 4XFBA 4XMAA 3SKVA 4O9GA 1PK6A 3O0WA 1DQ1A 1ZBA2 4K20A 5A3LA 3SLIA 3HD8B 4Y1VA 2FCVA 2ARAA 3OGRA 1A34A 1RIRA 3IT8A 5AFBA 1S2KA 2GNMA 3HT1A 3UKNA 1DP0A 4TYSA 5E88A 3AMHA 3NO8A 1LEMA 4CCKA 2XJRA 3K3OA 4XC9A 3EB7A 1JYNA 1H0BA 3HBKA 3ZSEA 3IDBB 5IW0A 4LO6B 2R49A 3H8RA 1NLQA 3ABZA 4ZXEA 3LOBA 3PVEA 1H30A 1UU5A 1C57A 2RJLA 3ZFGB 2IZWA 5KBFA 1OI6A 4O65A 2W52A 2VNVA 4NIIA 5LEJA 3FWEA 1SLLA 4LBOA 3T2PA 2C6SA 4XACA 1AX1A 4NHMA 3IN9A 4S2HA 5IK8A 1JN2P 3LIHA 2ET7A 2JENA 2YPDA 2J1EA 2BNMA 4ES8A 2RE9A 2B45X 2G4IA 1BZWA 1W9FA 2BWAA 3I59B 1DYPA 1DYOA 3JU9A 4J1XA 4AI2A 1C8M3 2CV6A 5FQ0A 1YJLA 4CPBA 1FPN2 3E6DA 5DG1A 5L73A 3PUAA 3ZX7A 1AR92 4MGZE 4PI2A 4CDUB 1SMVA 1XYOA 1AYN3 1ULEA 2XVKA 1MS3A 5BNOC 4OFGA 1C5IA 4TWTA 1CVNA 4Q4Y1 2ZGTA 1NG0A 4OHZA 3FHIB 2W2IA 2OKXA 4XFAA 5IAXA 2BPA2 5F8PA 2EXHA 5LWBA 4V2VA 1GOHA 4UWDA 5T54A 3PLQA 2WFF2 4MGKE 5CYYA 3FUOA 1ZREA 1IG3A 1BK1A 5FZ0A 4ASMB 4W65A 1EAH3 4QGMA 5FYTA 1S0JA 2YMZA 1GQGA 3HQRA 4RQPB 3VBSA 2Y8KA 1LOCA 2D7FA 3KQRA 4H7MA 1H1MA 2QCSB 2XL7A 3MUY1 2H6BA 2A5ZA 4BMEA 4GMP0 1SLTA 1G7YA 5FY8A 1ZZCA 2W0XA 3IPVA 3NNLA 1D0HA 1IG0A 5DAVA 4GJYA 2EIEA 2YU2A 4QDRA 2GN7A 2WO1A 1QGLA 4HPKA 2XB6C 4IEOA 4KH9A 3SH5A 4XTPA 5JXGA 4Y4YA 5LRRA 2HBUA 4M01A 4UFLA 4QPGA 1LODA 2EXIA 3BOWA 2JKBA 2J1TA 3KT4A 1REDA 4PDWA 4XHBA 4LORA 4ZPIA 2BU9A 4JKLA 3PHMA 4HVQA 5KXDA 4LHLA 4FPGA 1N47A 1OA2A 5FKBA 1V6MA 2PHXA 5DZGA 4LOSA 1O59A 3RSJA 1RVF3 1D7PM 1B35C 1H4GA 1VALA 4FAGA 5JAXA 4CA9A 5A33A 4LITA 1RUOA 1QQP2 4ASLA 1WLCA 4XQDA 1LESA 1W99A 3AP6A 1GBGA 2PLV1 3FHAA 4UW5A 4EZHA 4GXLA 3TOJA 2DVDA 5A3WA 3PUHA 2AENA 5FZCA 3I2IA 4MX3A 1QOSA 5D8AA 1HB4A 2E26A 1W04A 5FZ6A 4FVVA 1PVC2 1I3HA 1SFYA 3A0NA 5JSRA 3W5MA 2OIIA 3TNPB 3J7MA 1PGL1 4EN9B 1R091 5AC91 3T09A 1WKYA 3VLBB 4H55A 3FL7A 3K46A 3ZXKA 5LASA 2Q1ZB 4UF0B 5FZKA 1VP6A 2WT1A 1RJ7A 4IUGA 4IQPA 1NOVA 4YVWC 4RFT0 5CFCA 2HJIA 1BMV2 4WVMA 4TXWA 5IVEA 4L92A 3T1MA 4Q1PA 1W8FA 4QPIA 4UFHA 3J7NA 2WQ4A 4MGTA 2ZGNA 5A6ZA 2R073 1FPN3 1RUH1 1PZ8A 4CXXA 2VQAA 1P8JA 4OUMA 3AZXA 1HRV1 1PMJX 1OLMA 5FZ4A 2YROA 4YARA 1LGBA 3TEYA 1QH6A 5EPAA 2ZTNA 2MEV2 4UW6A 4JZRA 3VBHC 1V0AA 2EXKA 1BBT1 4RHV3 3WF3A 4CUGA 1DQ4A 4IEPA 2JD4A 5LA2A 4AHXA 2UWCA 2HWB1 3F2ZA 3RYRA 3WW2A 1CQ9A 2V4VA 4BQ2A 2FDIA 4I01A 4XJZA 3U4SA 1AL21 1G8WA 4OZOA 1COV1 4OVEA 2ZX2A 2XLGA 1QJY1 2ZXQA 2BQPA 3NVCA 4GH4B 3DPRC 2WFF3 2VCAA 1JODA 4MADA 4D3WA 3OBTA 2ARCA 4QT6A 2WC2A 2VMFA 5E89A 3ZFEA 5K0UB 2ZGSA 3K3NA 5F9TA 2W39A 1UZWA 5A7SA 1S1AA 2HWD2 1VRH3 1W2AX 3O0VA 4GB33 1BYHA 4M3CA 5FUNA 2E9QA 4IEYA 3SMHA 4CXYA 5A3UA 3D5OA 3IB3A 4CCJA 2WAAA 5CG8A 3OPTA 3OD4A 4P9WA 2OUJA 4FOQA 4YZ1A 2PMWB 1TMF3 2R7EB 4KQ7A 4XETA 5IFTA 1JW6A 5FPLA 4CDWA 3JBG3 3Q8CA 3OF1A 1UXZA 4I3GA 1KD7A 2F6BA 3C7FA 1ENQA 1JHJA 2P3JA 3LFMA 1HKDA 1YIFA 3HT2A 1HXS3 2G1MA 1WMDA 5IVVA 4C0HA 1O8SA 1NQJA 1CX4A 3TN92 1N1YA 4C0BA 1H6XA 3J8F2 1HQNA 2ZHNA 4LT5A 1QJZA 4S2FA 3ROUA 4ZKTB 1VR3A 4GQ7A 3DN7A 3GZUC 5FPBA 2UWAA 4CSWA 5BNOB 1MZ5A 4YVSA 2D3SA 1OUSA 2A6WA 2G9FA 3DYPA 3OB8A 1PO12 4QM9A 3VGIA 1JZ3A 4NROA 1W6NB 4C1XA 2PAMA 1MS4A 1W39A 2YDEA 4HL0A 3LA7A 2AYHA 5FZ8A 1GANA 4PF5A 3UGHA 4XABA 2VTXA 1ZZ7A 1JOBA 2NN8A 1IZ3A 4K6BA 2B4KA 4HZFA 1ZVFA 2WZEA 3T08A 1ACCA 2QQIA 2VZSA 5IWFA 4WBBA 3NQHA 5CAZA 3AMQA 1FV2A 3OPWA 1LR5A 3WW4A 2JDAA 4AEJA 4C90A 5KXBA 4QGLA 3HEIA 1DF0A 3MV01 1C8M1 4N7IA 3RZZA 2GSYA 4TLFA 5A6QA 1K42A 4HK8A 2R043 3N7MA 5CFDA 1ENRA 1AYN1 2CGOA 4YWAA 1W05A 1A78A 3UJQA 4AQSA 2RVAA 2WBKA 4UW4A 3PNAA 1STMA 3O1TA 1LGNA 2IXJA 4LPLA 1YFWA 4P08A 4QX3A 4AVBA 2RJKA 5I93A 2WZPP 4CU9A 3ZN5A 3KMHA 3KZ4C 1GFF2 4KI5M 3ZSKA 2W1SA 4ZS3A 3POGA 1CPNA 3OUIA 3AYAA 4QHOA 5FLJA 5J09A 1N3QA 4ZHNA 2IXIA 2MEV3 2ORZA 2VOVA 2DVGA 2YHJA 2ZGQA 4WZFA 3AP7A 4FPEA 3CZUA 3ITQA 4GD4A 1WBFA 4MG2A 1OVSA 5D2AA 3VKNA 1O5LA 2EAAA 2OZJA 1B35B 3HWJA 3ZVXA 1YIPA 2VG9A 1DQ5A 4HN1A 5T3NA 1H4HA 1OA3A 4A42A 2UYBA 1XSQA 2C0ZA 1R1A2 1RUG2 3AXDA 1W3XA 2VMEA 2X8KA 3MW4A 4KNCA 1GKBA 2JG9A 2EIGA 4XCAA 2JICA 4DEVA 1A3KA 1HRI3 4KG8A 4YGBA 4NHKA 1MS1A 2HWD3 4JGYA 2B5HA 5FZEA 1F4HA 1QXJA 3H3LA 1UYZA 4QXHA 4FPYA 3HN3A 1FOD2 3JZVA 3NMBA 4FI9A 2JB8A 4AFBA 3NAPC 4P5YA 1GV9A 3PJYA 5K8SA 1RUI3 2QDRA 1C3HA 1NT0A 1RVF1 1RHI3 1S2BA 2JDMA 5APAA 4E8DA 5CU1A 3VBSC 4ISRA 4Q4W3 1UMZA 1O7FA 1WZXA 1XYPA 3TN93 5FJKA 3K51A 3H7YA 4CCLA 5C8WA 3GZTB 1RXGA 4AQ2A 4S2DA 4LA2A 4XUQA 5FXXA 3POFA 3NNFA 1J83A 1WLTA 2JDZA 1ULCA 5FYIA 3PVNA 1NCRA 4I0AA 3V56A 3HNMA 2BFUS 1XJAA 3R4SA 1SLIA 4QPGC 5I8SA 2W08A 2NYYA 2QTWB 2ADDA 3THPA 3LZZA 3W59A 4QMAA 5DZEA 3RZMA 5FY1A 4DRVA 3MYXA 2XBO3 1R64A 5C4WA 5C33A 3CJIB 4ORFA 2QDNA 5CADA 5JOWA 3HR9A 1WCQA 5HCFA 5I0UA 1EPZA 1RUJ3 2XQRA 4EROA 1W28A 1RINA 2W3JA 4H3WA 4ZONA 4YZ3A 2R071 1FPN1 5FZOB 1H8TC 2BP6A 4NOTA 4AGRA 5DAWA 5B2GB 3PMEA 1MVQA 3FMGA 2VVFA 3MW3A 4EN8B 3OD0A 2RS32 3VBOA 2JD9A 2DTYA 4ASKA 4JHZA 4NHYA 2RDNA 1W8ZA 2JIJA 4RHV1 3S6PA 4HVRA 3LA2A 1J3QA 4L8QA 1QXPA 2VZ1A 2ORXA 4MXWA 4A7KA 2E31A 4COUA 2VD7A 1IPSA 4AFMA 3H1WA 1REEA 1C1FA 1NLSA 4QB2A 4N43B 3VZJA 2DCZA 2E53A 2WFF1 4A3ZA 3NJZA 2JIGA 4IGOA 2NP0A 3UGFA 2RG4A 3POWA 1REFA 1V6NA 2GP5A 5KHHA 1AJOA 5C9AA 3HAGA 3HN1A 2A71A 2DU0A 3POJA 4PQQA 5CFCC 4LKSA 5ACA3 4GB31 4R9DA 3CL1A 3DKWA 5G04L 4FSJA 1WW5A 4KGQA 5JZGC 3MW2A 1PNGA 3IKWA 3GHMA 5FREA 3BYWA 4JGZB 2RDSA 1TMF1 5FYZA 5J48A 3OBAA 1UX6A 2XGXA 4HSLA 3JBG1 4NPLA 5JOZA 4Y33A 2CAUA 3KV6A 4IEXA 4IE4A 5FWJA 2GMPA 3WQ0A 1JZ2A 2B39A 1ZRIA 3I3DA 4Y20A 4LIUA 1PK6B 5FP9A 1HXS1 4ARYA 2P37A 2VE1A 2AZ5A 3AP9A 3AZWA 1PVXA 2YGMA 4XBQA 5F3GA 3WNOA 4LA3A 1GWKA 2WNEA 5LB6A 4URTA 2TEPA 3ZR6A 1SZBA 3WVJA 5CEHA 4C1WA 5I8TA 1W6QB 4PIYA 1DCSA 2HYXA 3O12A 1EY2A 2ZX3A 4JKMA 3QACA 4MGIE 4EQVA 2BVVA 4FQZA 1RB8G 2WWSA 1D2SA 3S0MA 3N9NA 4J25A 3K77A 2LALA 5L19A 3V65A 4YPJA 3WX5A 4CDWC 5EJ1B 2DBNA 4AAXA 4CDQA 3KF3A 3IIIA 5A70A 3AKQA 2XWBB 1CAXA 5DAXA 4CEWC 4GKYA 1QDCA 2DCJA 2J1SA 2W9XA 2R041 2ZZQA 1OFSA 1NY71 3FJSA 2OXBA 5DAPA 5FQ0B 3VHRA 2P6CA 3DKQA 1GSLA 4ATFA 3MICA 4Q4V3 1GZTA 2G19A 4BISA 1O3TA 5FJHA 4P00B 3T30A 2UWBA 2PLV2 3O1VA 4YVSC 3UT0A 4CUBA 5JXIA 1CZVA 1DGRN 3VBFA 4D69A 1NE4A 3EO6A 2BOIA 4BDVB 2DYCA 3AMNA 3KCXA 3MZHA 4LUMA 2RS33 1OQ1A 1S0BA 2WR9A 5FP3A 2MEV1 3N7JA 2BUKA 3MHZA 3AKSA 3WCSA 5HCHA 2BGCA 1DGWA 1WW4A 3GF6A 5FZ1A 3OBZA 2Q8CA 3VHPA 1PIV3 2J1VA 5ERLA 1OKQA 3GCWA 4G3YC 4WZCA 3AYCA 1QF3A 2IFWA 3EMRA 3WOGA 1V6JA 1G9CA 2JECA 1V70A 2OS2A 4DZGA 1I1EA 1TEIA 3KGLA 3CNAA 2X53S 3ETQA 3LCPA 4KU7A 4MH0E 3K4AA 3SCHA 3ZXAC 5CFDC 1CWPA 4XJAA 1HRI1 3KQ4B 1URXA 2P4EA 2CL2A 3IPVB 5KR7A 1U5YA 4MLOA 1NA1A 1WA6X 3H3ZA 4XILA 2HWD1 5F37A 1EP0A 4HPKB 1OPMA 4M0NA 3V0AA 3ZXLA 1OLRA 1UOJA 1HRV2 2QUOA 2VECA 5C5TA 3AL5A 4CXWA 4BU2A 3ME2A 2VY0A 1RUI1 1BBT2 3KSCA 4QPGB 4DUXA 4OHWA 2HWB2 5CA6A 4PDWB 3V0BA 3DYMA 3U1XA 3WW1A 1OQEA 1RHI1 3NJXA 5FZ3A 1PGW2 4QKNA 4Q0PA 1AL22 3JXSA 3U0ZA 1JZ8A 2CNAA 3BTXA 3D0JA 4AR2A 1XRUA 1RGSA 3ZYJB 4CU8A 1IKQA 1DGWX 2JDNA 2WUHA 3E5UA 3NKTA 4Q4W1 3LPGA 2A6XA 4X6QB 3TN91 4GWIA 3FLRA 3P1IA 4L9BA 3D6EA 3C2UA 5IK5A 1G9AA 2WO2A 1UY3A 5H9QA 2V72A 4LBQB 5C5UA 3ACHA 2JG9C 2ZX4A 5FYBA 1MZ6A 1ULDA 4JKKA 3WEZA 4IEUA 4XZPA 4YZ5A 5D8AB 2WS93 3Q8FA 5KHGA 3U14A 5JI7A 2N7GA 1SQ4A 2XHKA 3RQ0A 2E7TA 4FTEA 4YFZA 5DUUA 4QAWA 2C1FA 3ZO0B 2I74A 2YBKA 4DEQA 1WW7A 4OHXA 2XBO1 3BODA 1J59A 4P9XA 2JDUA 2VC9A 1YNAA 1WW6A 1PZ9A 1RUJ1 2RHPA 4XURA 4OI1A 1L3JA 2XKOA 4JDNA 1AXKA 2ENRA 2GNBA 4WVMB 2W1UA 2YB7A 5L9BA 3MIEA 3ON7A 4B7KA 1X8EA 4YVWA 5HV4A 2G9GA 4P9GA 4E2QA 1G6NA 3DUIA 4QPIB 2KD7A 5HI0A 2UU8A 3RGBA 3VBUA 2IXKA 3H7JA 1VBD2 5JR2A 2HWF2 3M4FA 5A3PA 5GLVA 1HN1A 2RV9A 4AVTA 5GLUA 2X10A 2TNFA 5EFUA 3GYDA 4AFDA 1YCIA 3ES4A 2F4PA 1LOEA 3I2DA 5CKQA 2E51A 5FYUA 1HB1A 3CMGA 3VBHA 2PYTA 4B7EA 1NLRA 1WWYA 1HJGA 1UZZA 4FCAA 3WF2A 5CKNA 1O3QA 1FNYA 4LBKA 3JQWA 3RFRA 5JDBA 1CR7A 3C7GA 2QQJA 2WQ8A 5C4WC 2OVUA 2JKXA 1C8M2 4FXKB 5ACA1 2VPVA 3DPRA 5LW9A 3ZFEB 2A6VA 4J1WA 1X7NA 2BYVE 2V4AA 5FOBB 1VLNA 4PHZA 2QKDA 3MLKA 4I30A 4WM7C 3F95A 2J1UA 4P9LA 1DGLA 4FPFA 2OYZA 3ZKYA 1KS5A 2OUHA 3VBOC 4FQ4A 3POSA 4FBFA 1MEC3 4BWOA 3VD7A 4SBVA 1CIYA 2WSVA 1LEDA 2ARBA 5FP8A 4XE9A 1GLHA 4BMBA 4DRRA 5LCWL 4XDQA 1ENXA 3LDBA 4D6QA 4XFFA 1U0AA 1W6OB 4FPJA 3AJYA 5A7OA 4FTSA 1JZ5A 5EIYB 5EJZB 3U10A 2ADEA 5FOJB 1EAH2 4AOCA 4LXLA 1ZNPA 2A73B 4MYEA 3I54A 5C9AC 5T5OA 1ENSA 2HEYF 5T5JA 2W5FA 2BBAA 1UL9A 3WW3A 1JYTA 2GC0A 4F7ZA 3KCYA 1QNYA 1X50A 4FPOB 3MF9A 2D6NA 4R8HA 5BNNA 4YVSB 2B46X 1DG6A 2WDBA 2W91A 1IS4A 1K45A 1TE1B 2VUCA 2ZABA 2AEZA 3LAGA 2WABA 4E4HA 1IS3A 5FO8B 3JD73 4JRAA 3Q8EA 3I3EA 4YW2A 1IKPA 4XIOA 5B4XA 4GMP3 5FZFA 1LECA 4W4ZA 3W21A 3M3EA 4EZ4A 3RNSA 2D5HA 2ZZJA 2R1DA 1CONA 1LULA 1CAWB 3MIBA 3QCWA 5FV3A 2DUOA 3L2HA 4M00A 1RVF2 3WNXA 3MIDA 1HQWA 4MXVA 3WDWA 1M4WA 1RJ8A 2YYOA 4LHKA 3A23A 4Q4V1 3SXWA 1YFUA 2QVSB 3GJBA 4A7YA 1MPXA 5CFDB 2QQNA 1VB4A 2P3YA 2QQKA 3NV4A 4OQ8A 3BALA 3WZ1A 1LRHA 4BIFA 4EWEA 1Y43B 2CWMA 3M3CA 5H9RA 3SEPA 2RS31 4A41A 4Z2AA 1GZWA 5C8CA 1QEXA 5EP9A 2XH6A 1VBD3 1QY4A 3OTFA 4LBQD 1YRZA 1W9SA 2HWF3 5KHKA 1PIV1 2C9AA 3VD9A 3TEWA 2D6OX 4H7LA 1W2UA 4V2WA 5F2SA 2WA3A 4CDQC 3KT1A 3O5SA 1L7RA 2VR4A 4MGSA 4HT1T 2D3PA 1C4RA 5I0SA 1WCUA 1X9TA 4BCUA 3AFKA 1YYNA 4RR3A 4LUKA 5LY2A 2VCBA 4NHXA 2WWUA 1UU4A 3BGAA 3KV9A 4QDSA 1KJRA 3APBA 4HBNA 2R072 2ZBJA 4X8PA 4XXAA 2ZA9A 1SBDA 3O1RA 5A3OA 3INAA 1W6PA 1PO22 2QJVA 3B01A 3VBFC 3WSOA 5LATA 2HEWF 4JGYB 2VZRA 5IAVA 3WQBA 4QM8A 4RHV2 3DL3A 1GYKA 5EXOA 1QJEA 1S0IA 4XOGA 3RZKA 3UL2A 3RZJA 3HOBA 1RUD3 1LJ7A 2MPFA 1CGPA 1AZDA 2Q1FA 4BK4A 2J22A 3NV1A 3R6SA 3NAPA 4XXPA 3T2QA 3AYDA 2JEMA 2VAUA 3VHOA 4J6GA 1K5MA 1N1VA 3MIGA 3UV9A 4OHYA 2JXAA 1CJDA 5IVBA 1FYUA 3E5XA 4AF9A 1LHVA 1MQTC 1RMU2 1ND2A 3FLTA 5T55A 4E2SA 2EAKA 4NO4A 2DVBA 1VRH2 2BTVC 4GB32 4CCCA 4KG0A 1S0CA 3GGLA 2WS91 2ZX0A 1NA1C 1PGSA 2ZHKA 4YG6A 5IATA 5GLWA 4AVCA 4UBGA 3WUDA 4K40A 5FXWA 4Q0VA 3N36A 1TMF2 4YM3A 5FIXA 2HEVF 3LEGA 5CG9A 5DUVA 3MFCA 5DUWA 1NCRB 1CESA 2VZPA 1TNRA 3JBG2 4XEZA 3GJAA 4DPNA 4TTGA 4XW3A 3BVCA 3POYA 4QHZA 3WF0A 1POV0 1JMUB 4MHRA 1JXNA 3T0BA 1JOJA 4EE2A 1YWKA 5FMDA 4CCNA 2HYKA 2P3KA 3OUJA 1A8MA 1HXS2 1CIWA 1QNWA 1WMXA 2TBVA 5C4WB 1E5RA 2YXSA 1IHMA 3HPNA 5KXEA 4LBLA 5LA0A 1V6LA 4KL1A 3ZN4A 1KJLA 1F2NA 4DB5A 3M1HA 3U75A 4AK3A 4LO4B 2W47A 1MZFA 1OSGA 4K8FA 1VB2A 1ULGA 3OEAA 2AC1A 3FC0A 2ZGMA 4XDOA 1G9FA 1H8TA 3VBOB 3ZDSA 4AHZA 2VOXA 4ZU7A 3EBRA 4FFHA 3PU8A 5GZCA 1OMIA 1Q43A 3PMSA 5GZEA 1I5PA 2ZS6B 1D0GA 3NL1A 4MXWB 1JYCA 4MSVA 3CQOA 5C70A 2YC4A 1UYYA 4DNYA 3I2JA 1R083 3M2MA 3FZ3A 2RM23 3DEMA 4AW7A 1QU0A 1GR3A 5BXXA 4DXTA 3LPFA 5B4NA 3RWKX 4WM8C 3I2KA 4K1YA 1V9U3 5T50A 1LOFC 3HMYA 2WSUA 3S5AA 1AR73 1PM4A 4YNIA 2R042 1NY72 2A6ZA 3LGRA 2ETEA 3TYJA 2EIDA 2BZDA 1L7LA 5F6LB 1O4TA 2YUEA 2ZOEB 2DBIA 3H3UA 1UOBA 3VBUC 1DHKB 1X8MA 1DQ0A 2OPWA 2VZ3A 4KBBA 3ZXJA 4BLJA 3H9AA 5JZGA 2QNKA 5K9YA 3WLUA 1C28A 3GHNA 5A7PA 1H1AA 1QJX3 2WAOA 1TZOA 5ISLA 3LD8A 5FYHA 3UYJA 4DIQA 2VH9A 4IE0A 2CWSA 1PO23 1W2NA 2V5YA 3BI3A 4PF1A 2PHUA 2Z79A 4XAAA 4Y20B 1IS6A 3B7MA 4Y26A 3VD3A 4JVAA 2DTWA 3SITA 1ASJ3 1QH7A 1SBEA 2RDRA 3MBWA 4RN5A 1PGW1 2BV4A 2FDJA 2VOTA 4LO8A 5FYCA 1X36A 4CU6A 1GQPA 2ZEWA 1AHSA 5C71A 3E97A 3ZN6A 1F4AA 2ZPXA 4NHLA 1ZRDA 4D7TA 5BY5A 2XDVA 3B9IA 4HXCA 3MF6A 1HRI2 1RMU3 1UZYA 3NNMA 4YGDA 2IFRA 3JD71 4E4ZA 2D40A 3KV4A 2W92A 3ZXDA 4NMIA 2YFZA 5KHIA 3BPSA 4FPHA 4GMP1 5H9PA 1US2A 2UY8A 1AJKA 5DN2A 5CB7A 2GMMA 5C3QA 1NQDA 1RUI2 4CDQB 3CJXA 1O4ZA 2J42A 2VL4A 2VUDA 4GWMA 1VE0A 3SHRA 1CAXB 1RHI2 1W90A 2VNRA 2H0VA 2VQUA 3EQEA 5BNQA 3PVOA 5FO9B 5HV0A 4EYUA 4CEWA 1SFPA 2R0FA 1E57A 1ONAA 4M3CF 3ZMNA 4Q4W2 2Q8OA 2R0HA 4JRLA 4IETA 5JR7B 4FOYA 5F6KA 3BIWE 5IK4A 5DQ0A 3CO2A 4PBPA 5BNNC 1OKOA 3VBFB 2WO3A 4XF9A 2OX0A 1VBD1 3O1OA 2HWF1 1OF4A 1XU2A 1W6MA 3VZNA 1J58A 3KV5A 1Y3TA 2HLEA 3A7QA 3HNBM 3NV2A 2Y6FA 1AVBA 3KS7A 3D3AA 3RVHA 5L9RA 2CU5A 4FXGB 3ALQA 4YYOA 2VMIA 2E6VA 2XBO2 2XG3A 3N7KA 4RGKA 3D8CA 4GULA 1DLCA 4ITCA 4XF4A 1RUJ2 5HCBA 4P02B 4META 3IMMA 4AVAA 1JI6A 3B94A 3MDPA 2D3RA 3K75B 2G9ZA 4KWLA 2BBVA 1OHFA 1GUIA 5GJ6A 3M3QA 4LNVA 1UPIA 1UU6A 2Q8EA 1NA1B 3T0DA 2VQ0A 2I2SA 2ZEXA 2RS13 1X9PA 2GN3A 1E5IA 5C3RA 3N9LA 4KBZA 5JSPA 3V0AB 3GDBA 4YZ4A 1MS5A 3ZOIA 4EN0A 5A6XA 3H1MA 5C8CC 1RUD1 1GP6A 2QFEA 3OGJA 4LHNA 2Y33A 1RTVA 1QDOA 1GU3A 3ZMOA 1GWMA 2WNUA 5DMYA 4XJWA 4XUNA 3PJQA 1W9TA 3SNMA 2YBPA 5JPMB 3V0BB 3B00A 5EWSA 3LOIA 2X5IC 4ZY9A 1NCQC 4BM8A 2Y0OA 1IOAA 4LK6A 1GOFA 3FBYA 2ZKLA 1EAH1 2NPIA 4RR3C 3LEKA 3J26N 3MFAA 1XB9A 2JE8A 5ACA2 5JSOA 2C24A 2V73A 5JMOA 5I91A 3MEPA 2ZHMA 4TN7A 3ZPOA 1UIJA 3AVRA 3OJBA 1UZVA 2E32A 3SH4A 2ATFA 2XWJB 1RXFA 2P34A 3BU0A 1GOGA 4LQRA 4ZS2A 4COVA 3VHNA 1JZ7A 3WD5A 4DXZA 2OQ7A 3R4UA 4NPMA 2A1XA 2PHRA 3BN6A 1HX6A 3AKRA 4E8CA 4DUWA 2ET1A 5J96B 3RZHA 4ZU5A 4AAPA 4BQYA 5FZLA 5FP7A 1OOPA 4QX1A 2YC2A 1QOTA 3LF7A 4Q0UA 4EWDA 1R1ZA 1UY2A 5FPZA 3ZYRA 2CTVA 1YJKA 4K7JA 1JZ4A 5FPVA 1J1LA 3OGGA 1SPPA 2IVIB 3WDTA 3WINE 1UD1A 3RMYA 4CE8A 3AMPA 5CISA 1K5MC 4QQOA 5A3NA 4HVOA 5CKMA 1I5ZA 1VMHA 3AK0A 1ND2C 4YVWB 3VD4A 2RJ2A 5SV5A 3ZXFA 4Z82A 1OURA 1YQCA 2BGPA 2BWCA 1HIXA 1JH5A 2VZUA 3VBUB 5LA1A 1RUC3 2SBAA 2AREA 1CN1A 2WZR3 2WWJA 3KCCA 3THDA 1OXCA 1W0OA 4YFWA 4QDQA 1UYXA 1KQRA 3Q8BA 5H9SA 3T3YA 4IEVA 2GH2A 3VKLA 1VMFA 1R081 4E4DX 2RM21 4OMCA 5F5QA 2FDFA 3H1YA 3VBHB 2BNOA 2WYFA 3ZIXA 4DOUA 2I45A 2YV8A 4RGAA 1V9U1 4AYUA 3H8OA 4URAA 4BQ4A 5I8YA 4KU8A 1AR71 1I6XA 4XTMA 5CZKA 5HCAA 3ACFA 4L0PA 4BZ4A 2PAKA 1QXRA 1VAVA 3DPRB 4B4RA 3M3IA 4NPRA 1UAIA 1W8WA 2HKXA 4RQPA 4JAAA 3WF1A 4UI9L 4Q4V2 4Y3OA 5C3SA 3ZFFC 1JU4A 5LK5A 4IESA 3I97A 3FX3A 3OYWA 1WCKA 4DFSA 3ZIWA 4BA6A 1QJX1 4WM7A 3WV6A 1YI9A 3ZSLA 3BUCA 3LWCA 4YSFA 2R32A 1CD3G 3C7EA 1PO21 1YFYA 4PIZA 2VOKA 2K0GA 4OCTA 1VBB3 2LROA 4DS0A 1N1SA 4A4AA 2DCKA 2IXHA 5F5IA 1PIV2 3RPQA 1ASJ1 4GJZA 1F5FA 3AX4A 2PA7A 3RS6A 4DXSA 1DDLA 3WNNA 4BXFA 4DO0A 4Z8BA 5KHJA 1RUF3 2EA7A 1C1LA 1W8NA 2ZEYA 5FXVA 3HJRA 4CEYC 4OI2A 2JDYA 3DF0A 4FTBA 1RMU1 3FE5A 3SCGA 1JYXA 5F5AA 4GZ9A 5BNNB 1IQAA 3VDDA 1VRH1 4YGCA 5FLIA 3KLSA 3WG4A 2J1AA 2BVBA 2ZCWA 3ACIA 2CHHA 5FZIA 1NXD1 1VIWB 2CAVA 3LDKA 4LLOA 4QB1A 4UFJA 3SC7X 1KRIA 4QQ2A 4LULA 2XLFA 3CF6E 1A8DA 3AMMA 3UKVA 4OHVA 1GNZA 3J9SA 4AGGA 2ERFA 5HPOA 4LR4A 4QX8A 2I07B 4F8AA 1W0NA 3H50A 4XF0A 3PUQA 3WP5A 2NLRA 4N53C 2VZQA 2ZGOA 3OGVA 3UESA 3IWZA 2BJSA 4NWWA 4A45A 4BLIA 2IWGB 5FY5A 4CZSA 3N9PA 2HWC3 3LKJA 2NMNA 1AX0A 4R9BA 5EQUA 3WUCA 2WO7A 3G7DA 3JUUA 4FP2A 1FXZA 2WS92 1W06A 1XBFA 3NWKA 5SV8A 3OUHA 4LLFA 1GZWB 5D21A 5C8CB 1S0FA 1ND3C 2Y6KA 1UY0A 3W9AA 4HANA 3QH6A 2IXLA 3RRDA 1DZQA 2W1QA 3W58A 5KC5A 2D6LX 4MV2A 3W20A 4QKDA 4AEMA 5C3OA 1H1IA 1APNA 1K5JA 2D6KA 5LBEA 1S55A 1SEFA 2YY1A 4GH4A 1IPKA 1BK0A 4OULA 4QX2A 2XMLA 4RS5C 3ASIA 5ANQA 4ARXA 4MGQA 1KEXA 2MHFA 3VN4A 3B3QE 4R4ZA 4A6OA 4YZ2A 2GDFA 3D0SA 2F4LA 1CAUA 3N9MA 4Z2WA 3LDRA 4CDXC 4WVWA 3J7LA 1UNBA 2RS11 3CBNA 3SQOA 1SHWB 2VM9A 1W6PB 4Q2FA 4PCRA 1TNFA 3AL6A 4N8MA 2WNVA 2Z69A 1BXHA 4AI0A 2DURA 4NVPA 4BE3A 4ZZ8A 1KDKA 2IVJA 3DGTA 1Z0HA 1AR83 3BU7A 2QQOA 3DYOA 3NAPB 5DUXA 1XE8A 5EJ3A 2ZGLA 3KGZA 1O6UA 2P1BA 2K9ZA 3BTAA 1K5MB 4QU1A 1LNSA 1POQA 1Q8SA 3HQXA 3OBRA 3ZSJA 1ND2B 4P14A 2XHNA 1UQXA 3VBSB 1UF2C 1H8VA 1UXXX 2X29A 1MQTA 3T2OA 3KHBA 4D6SA 3POBA 4HOOA 4AHYA 1ZYBA 2PTMA 1YC61 4XF3A 1MEC2 3AP4A 3LEMA 3WP4A 3SH3A 3O1PA 1GQHA 3WR0A 5IVFA 3I2OA 4Q27A 4CCMA 4RD7A 2RS52 4BB3A 4QKBA 4AI9A 2ZAHA 3T1LA 3ACLA 3OCPA 2Q1MA 2XR4A 2WNUC 3RWNA 2O14A 1IQDC 3K48A 4I0WB 5ABJA 2WFPA 4MO3M 2EVXA 4BQWA 1XNTA 5F32A 3OOXA 1W8TA 1KXGA 5FFOC 2A3XA 4CP9A 4BK5A 1H2KA 1QOOA 3CDZB 5L7OA 2YZ4A 2P3IA 4DMIA 4AEDA 2PHWA 4YM0A 4QD2A 4XUTA 3USUA 1RUC1 1F9KA 3P3NA 4ET7A 3MLJA 5A33B 2D44A 2P6HA 1H2LA 2WZR1 3M70A 3IDEA 2D93A 3NNJA 4G9SB 3ZPYA 1H8TB 3DECA 3T0AA 3WQ7A 3JD72 4Q4X2 3O7OA 3E6BA 1ZBE3 1N3OA 2FQPA 3ZFGC 4ZZ5A 1LHNA 4NE9A 1ZZ8A 2FD8A 4IDZA 1XYNA 2XJUA 4D0QA 1OOPC 1J1TA 5FBJA 5FZ7A 3OSDA 3K4DA 1DBNA 5BPXA 1VRBA 5JUVA 4UBHA 1VBC3 4W6WA 4WM8A 1D4M3 4MOAA 4FPLA 2Q4SA 4NUBA 5FKCA 3WNKA 4WV8A 4LE4A 1LU2A 1LOFA 1PMIA 4XJ9A 1LHOA 4YM1A 2DCYA 2YFUA 5CFCB 2RMU3 4RL7A 2VNGA 1AYM3 2E7QA 4HKLA 4COYA 5JZGB 4CDUC 3RZLA 3NKGA 2Z4FA 1T6GC 1DZTA 4XFGA 1EV13 1VBB1 1OVPA 2C4XA 4GA9A 4LOTA 3GXUA 1PMHX 2B9VA 4QGNA 4B29A 4FOWA 4PBOA 3HBZA 2XJVA 4CCEA 4DY5A 5DZFA 2VZOA 2W68A 1QKQA 1RUF1 2VUAA 3B93A 1CAVA 4EWAA 4XFHA 1UKRA 2AUYA 3ILRA 3RJRA 5IVJA 3W5NA 4COZA 3MV11 3WNLA 5A80A 3I7DA 3Q8AA 4MVTA 4WVZA 4AI1A 4FPKA 1OPOA 3THCA 3ZN6B 3DXTA 4JHTA 1BVVA 4RQPC 1HN0A 2BW8A 5FO7B 3VDCA 4BJ0A 1Q8VA 3RI8A 1YQ2A 2LTNA 3GNEA 4GKXA 2B8MA 4UFKA 2JJ6A 4Y5Z0 4Q29A 2JDPA 1FMD3 2QQWA 5G05L 3O14A 4M3CB 1V6KA 5F7UA 1EUUA 4CPBD 1RUD2 1TVGA 3UETA 3CLPA 4YG0A 2HBTA 3GBFA 4CDWB 4H2AA 2RS53 4V1PA 2V5DA 5GALA 1OC1A 1XNAA 4XBLA 3R05A 4JTNA 3WG1A 4DXRA 2P2KA 2KXLA 2VOWA 1BCXA 2PHDA 3SEEA 4I2OA 4CEWB 2HWC1 2PAEA 4K21A 1TQ5A 4PLMA 1Z7S2 4CYDA 4SLIA 3WT3A 2DUQA 2GZWA 2PHLA 5ANNA 3BOPA 4BOWA 3D4KA 1WA4A 4GWJA 1ZZ6A 4YW7A 3N7LA 1G9DA 5FMOS 3UK9A 1L7QA 2FZ1A 1RUNA 4COWA 2ZMNA 3VDDC 2D6PA 5JVVA 5F39A 4AVSA 1UN1A 2BRTA 1AR63 2VXJA 4LHSA 1O5UA 4K9SA 2DF7A 2J7MA 1U5IA 4LTAA 1W6MB 4JCKA 3VKOA 1MS0A 1JTZX 4Q4X3 4CUAA 5A1AA 1S0DA 4XQ4A 3AB0A 4YM2A 2Z2SB 2DU1A 4LKEA 3S7IA 3SKJE 4IEQA 3JQXA 1NUKA 1ZX5A 1IGOA 2WLQA 2CSGA 4R9AA 3UJOA 3I3MA 3VBRA 3C7HA 1F31A 5JXHA 1X33A 1SLCA 4D6RA 5JXJA 2EICA 1COV3 5GZDA 3LA3A 4ONUA 3C7OA 3P3PA 1POV3 3ZM8A 1XNKA 3LE0A 3WDXA 3S30A 5A32A 3EJKA 5FCCA 1XNDA 2GAUA 1NYWA 2XJQA 3KD4A 1SBFA 4YRDA 4IE5A 4QPWA 4QXBA 4LMFA 3BTYA 2GH8A 2ID4A 3VZOA 4XAEA 2VBDA 2VULA 2XL9A 3KF5A 5A7WA 2DFCA 4IW3A 4LKFA 1R082 2RM22 2XVLA 1AR81 3MPBA 1G86A 2IC1A 3MIHA 1DYKA 1OLQA 4Y22A 2VMHA 1LOBA 4AGVA 3KB5A 1HJFA 1V9U2 4P9IA 2X5IA 4YW6A 1NCQA 4PIXA 1AR72 1UCXA 1RUE2 5FZGA 4GH4C 4TLGA 5FZ9A 3KT7A 2VBBA 4JDMA 3IDAA 4DY3A 1W9WA 1Q5OA 5FY9A 4IV3A 3X29B 4B8EA 2WIIB 4L2NA 4B1LA 3NJYA 4EN6B 1F35A 1W6QA 3HIFA 5K0UC 2B7YA 4QX0A 4FT8A 1BJQA 5HXMA 1WMEA 3VDAA 2XVGA 2JG9B 3QBQA 1QJX2 5A7QA 5J36A 5IUQA 3PURA 1KFUL 2WNVC 2R063 5DXDA 3G6JB 2VCCA 4AXOA 1OOPB 2LM3A 3FLPA 4Z07A 5F3IA 5FLHA 2WQZC 4QU2A 5LRSA 3B5LB 2QQVA 4NAMA 1ASJ2 5IHRA 1K3IA 1SPPB 4XJ8A 2Y6JA 3NV3A 1XNBA 1MACA 2FMDA 3N9OA 4Q8KA 5LZ6A 5M0TA 2MNGA 4P5HA 3GZEA 3GM8A 4I09A 2B9UA 5AVAA 4DINB 1EYBA 1U5ZA 3QOPA 1H9PA 3AC0A 3WY6A 1Z7S3 4FPCA 2HH9A 4MZUA 3RI9A 4HONA 2XPJA 4LBJA 1ZBE1 3M7AA 2WN2A 3HNYM 2K46A 2XQXA 1BEV3 2FBEA 3K2OA 3WDUA 5FZBA 2Z5WA 1OT5A 4BH9A 1LENA 4EJRA 3CZJA 5E16A 3IMNA 2R16A 3CEWA 2XJTA 2VVEA 2JB4A 2WYSA 3VKFC 2Q8DA 5KC6A 3D82A 4NRQA 2K2SA 2BDRA 5ABJC 2VO5A 2FDHA 1UO9A 4F3JA 1TG7A 1VBC1 5FR3A 1D4M1 1QIQA 5EHDA 4GWNA 4M4PA 5CVRA 2DWRA 1XSRA 3WDYA 2FHRA 3T2TA 5L7OC 4FFIA 3ILNA 4I0BA 4XMIA 3ILFA 4XZUG 5T5PA 1WCDJ 2RMU1 2BEOA 4AEDC 4C91A 1AYM1 2ZMLA 3T4VA 3OYWB 4AFAA 5IVCA 4AFCA 1PNFA 1UZ0A 4KGGA 3RJ2X 5FMBA 1EV11 2Q0AA 2H6CA 3ZFFA 4WM7B 1SACA 1SCRA 3PUSA 2C9KA 3N35A 1XXNA 4G4FA 4Y1ZA 3UGGA 3WNMA 5C3PA 1NX9A 2GP3A 4Y5TA 2VQTA 4C8DA 1M06G 2UURA 1VBA2 4UXAA 1JU3A 2CDPA 2A6YA 4XCBA 3RYKA 5KWRA 2NMOA 4L97A 2ARXA 1H9WA 5GZGA 1W3VA 1HLCA 5F3CA 2A3WA 2ES3A 2LUWA 2XUEA 3FHQA 4RYDA 4NJ4A 1ZBA3 4JC1A 4JTOA 2C5DA 5C9AB 4W50A 4XBNA 1H2MA 1RUE3 4BIOA 4CEYA 2VBPA 2VTXJ 4NIAA 3O1UA 4OYUA 1FV3A 2L9LA 3VDDB 1OF3A 2X09A 1FMD1 3I8TA 2RS12 4HN0A 4LBQA 4NR1A 4PI0A 1OBNA 3FFQA 5A1LA 4N7UA 1MEC1 1OUXA 5GKAC 2FDKA 3VZLA 5T5LA 4CVUA 5IT6A 1JYWA 5LK7B 4TZDA 4HFSA 4UYBA 5BNPA 4Y1XA 2RS51 2ZKNA 3ES1A 4NIHA 3PIJA 2NM1A 3GBWA 5HXVA 1CZSA 4Q8LA 1UX7A 4H14A 4D7YA 1FX5A 4WVVA 1NKGA 5LA9A 2P17A 4YW5A 3VD5A 1JZ6A 3WF4A 1SDWA 4N53A 3ZSMA 5FWEA 2KR2A 5JLVA 5FBZA 5IFPA 4FOVA 1OLME 3LEIA 3MUZ1 1HB3A 1US3A 2DUPA 4ATEA 4R4XA 1SDDB 1AR61 1Y4WA 4YLZA 2XJSA 4N9IA 2ZGKA 1Y9GA 1XPWA 2VMGA 1OD5A 1ULOA 4XFCA 3N4MA 4Q4X1 1AR93 4E2GA 1XE0A 4QHBA 1RYYA 3RZGA 2Y64A 1ND3A 3E6CC 4QQLA 5FXZA 3DV8A 3QLQA 4O61A 1IS5A 1YUDA 3PU3A 4JQTA 5EYYA 2P5BA 1GZCA 3VB9A 4S2GA 5FY7A 4AEKA 5HBAA 3U78A 4M3CE 4AVVA 1POV1 3CJIC 1ZA7A 4ZXKA 3C3VA 4RS5A 1CAUB 3AZYA 3ECQA 3H8XA 1VBE2 1OD3A 1RUC2 1XE7A 2OQ6A 3FN9A 3OPZA 1Q3EA 3CU7A 4LEJA 2WZR2 3J7HA 2D5FA 3IAPA 4CDXA 2ZGUA 3NW4A 2GNTA 1HDKA 2JE7A 3E1F1 3U37A 2XONA 4GALA 1W03A 2DVAA 2WNVB 3EXUA 3M3OA 4HETA 1H6YA 3LQCA 3U4XA 3GCXA 1KS4A 1SG3A 4YW4A 2WINB 1Q8QA 2FCTA 2ZAAA 4NIDA 1PZ7A 1SLAA 1UYPA 1W6OA 1YI7A 4BQ3A 4Y4RA 2QQLA 3TAYA 4LO5B 2Y6GA 4N43C 1O4YA 1VBA3 3OY8A 3VBRC 3WDVA 1D4VB 5C6CA 3GBGA 4IERA 5CBLA 1ZRCA 3E5QA 5JMCA 3PUIA 5FUPA 1MQTB 3MLLA 3A21A 4OUEA 1GNYA 4CCOA 2GNDA 4D8MA 4IEWA 4N90A 2H0BA 2QZ3A 3BCWA 2R1BA 1HV1A 1QQP3 2BNNA 1O91A 1W8HA 3USSA 2NZ9A 5IJRA 2R061 4JGZC 3HVDA 1VBB2 2RR12 3OG2A 3THTA 4AI3A 2WZ8A 2A3YA 1MS9A 4A3XA 1ST8A 4Y24A 4YW1A 2CGPA 1KDMA 4FFGA 1EPWA 3FUQA 4IE6A 4M4RA 5K7PA 5CIRA 5LY1A 1A6CA 2JWPA 2WT0A 1HW5A 5E8AA 4Z1VA 5ABJB 5IYYA 5L36A 1PVC3 5BV6A 1AXZA 1NZCA 2EF6A 2VVDA 3LB9A 3PIGA 1N1TA 1NXMA 1PK6C 2JG8A 4IV1A 1RUF2 4NWVA 1CAWA 2OA2A 4XVHA 4CP9B 5L7OB 1XU1A 2WJSA 5JCTA 1QMJA 1WLDA 2ZHLA 1Z7S1 4AEDB 3USUB 4IV3C 5DDJ2 3TEXA 4PT6A 4YGEA 4LE3A 4XFIA 4Q0SA 2OZ6A 1BEV1 3BIEA 4X8NA 2IUWA 2OT7A 2ZEZA 3I3BA 2PFWA 2E63A 3WQ1A 1NAEA 1QHDA 3I4IA 3N3HA 5FYMA 4P9JA 4AQTA 4XHXA 1DU3D 4XUOA 1Y9QA 1HB2A 1V6IA 1RL3A 3AKTA 1PM7A 4W6YA 4CTEA 2Q30A 3ZFGA 1YEWA 1DZRA 1U5XA 4DUVA 5J98B 3JCIA 3O0XA 1TME2 3BTZA 1YHFA 1QJU2 3L2YA 3R0RA 4D7SA 4OQ9A 4CRQA 5DABA 4LJHA 4LBNA 4AI8A 1J84A 5FYYA 1V6OA 4WM8B 1J3RA 2HWC2 1GZ9A 3AXEA 1WLWA 3MO4A 3KVAA 1FNZA 2VZTA 1WCSA 3I59A 2RDQA 2Y26A 1RITA 2OPKA 1VBE3 4CDUA 4B3NA 1YLLA 1LOGA 2YG0A 4K1ZA 2J1RA 4HSJA
chains in the Genus database with same CATH topology
2IXCA 3U07A 2CGNA 4QQPA 1XQNA 2A75A 4CP1A 4CP2A 1X82A 2GC2A 1S0GA 1KITA 2DFBA 5F1RA 2O8OA 1CAVB 3MIFA 1ZBA1 3ST7A 5J7MA 1RUE1 4IXLA 2KM2A 1UIKA 1U12A 2Z42A 2PN5A 3IM0A 4RSUA 3J8F3 4ES9A 2QE3A 2VUJA 5DG2A 4B4PA 3LSDA 2EALA 4PQ9A 1AX2A 5JIAA 1WGPA 4Y1UA 2HWE2 4KWJA 1PO13 5JI9A 4PLNA 1V00A 3WG2A 2R6QA 2RR13 4JQRA 1AR82 1ALYA 4PDWC 1VAMA 3ATGA 3ZYPA 4XPVA 5GZFA 4I3PA 4FP3A 3WG3A 3VL8A 2BFUL 1UPSA 3AJZA 1IPJA 1NE6A 5JIUA 4PLOA 1DFQA 1AR91 5DDJ3 4PJYA 1VAKA 4LBMA 2WLPA 5D8AC 3WCRA 5D1IA 1B09A 4AG4A 2QZ2A 4HKWA 4CP0A 5BNPC 1ZA4A 1FT9A 1LTEA 3VZMA 4L99A 1LU1A 4QX5A 3ZYGA 1LHWA 1JHNA 2VXRA 2JX9A 3VBRB 5FPXA 1TME3 1QJU3 4Y1YA 2AR6A 2SLIA 4IL7A 5I0RA 1LCLA 2AGSA 2YPJA 5A32B 1Q8PA 1JBCA 4OZXA 4QPIC 1VJ2A 2O8QA 1ZBE2 1R1A3 1RUG3 1SLBA 3QH7A 3WHUA 3U11A 4BYYA 2O0OA 1DIWA 4Q4Y2 3AFGA 1OFNA 4Q1RA 1ZM1A 5J3UA 4L11A 1W0PA 3Q9OA 4Y22B 3RMXA 1VBA1 1JYIA 2X5IB 1NCQB 1VBC2 1FOD3 1D4M2 2D98A 3J4UH 1WUVA 1ZZBA 4O9EA 1AUYA 2YC0A 4GIQA 4RR3B 4IV3B 5FAXA 3ZFEC 2GU9A 2RMU2 1JUIA 2PELA 1AYM2 3MI8A 2KA3A 1QQP1 3AP5A 4K3UA 5K0UA 1O3SA 4A7ZA 1EV12 2ILMA 1Q56A 4TSVA 1FATA 1S0EA 4AE2A 5A3MA 5JPNB 3UKTA 2CYFA 5FTTC 4QPYA 1C8NA 4NN0A 5BUVA 4U2AA 5E1RA 1PVC1 3H0OA 2ZGRA 4AWDA 4RA0A 2HWE3 2UY9A 3R4DB 1DQ6A 4Q26A 2GMEA 5EYXA 3JB8A 3GZAA 1G9BA 5JWPA 3WP3A 2VU9A 3AM2A 1DQ2A 1XNCA 1C5HA 5FRAA 4N9HA 1BMV1 3A0KA 1O3RA 4YW3A 2UYAA 1FMD2 1FAYA 3SISA 4P9YA 5BNOA 3ZXGA 1W6NA 2PHTA 4XIKA 1WBLA 2TUNA 2A7AA 3B69A 4A2UA 4R9CA 1PGL2 1HQLA 3FBMA 1FI2A 2DCTA 1R092 4R52A 5AC92 2JG8C 1UW8A 3AKPA 4IV1C 4FO9A 4JV4A 3WXPA 3LSEA 4EV0A 5GLZA 2ZMKA 4OI0A 1J3PA 4RGGA 4W6XA 4E9KA 1CJPA 2XKPA 4DQAA 1ZZ9A 1WD3A 1Y7BA 4M0HA 3ZYIB 5EZWA 3ZFFB 1AF9A 1VBE1 4FAHA 2QQPA 1AR62 2VW0A 1MZEA 1LHUA 1RUH2 1F8VA 1OQDA 5GLTA 4ISQA 1YXWA 3RYPA 1BQPA 3TNQA 3BB6A 4Q4Y3 4LO7A 1COV2 5I0TA 1AL0G 1QJY2 3IBMA 3M8LA 1CPMA 1ULFA 1Z78A 1BKZA 3J8F1 4KWKA 4CEYB 1B35A 3AZZA 3V64A 1GNHA 3TWIA 3PTYA 1PO11 4AHWA 1LKNA 3AZVA 2RR11 4JGYC 2EXJA 5BNPB 4XYXA 4QXKA 1LGCA 2ZX1A 3QD6A 3MPPG 1D2QA 2YGLA 5BYNA 4X6RB 3ZXEA 2FZ2A 2Y0IA 4YG3A 2VNOA 4D94A 4Z92B 3H8UA 4N53B 1SCSA 3URFA 3VL9A 1I9RA 3B9CA 4E4SA 3L9JT 5GM0A 2V09A 5AFEA 4MGYE 5EV7A 1DGRA 2E7AA 1JUHA 1QWRA 4Q0QA 1HV0A 2D43A 2GALA 4OI4A 4UW3A 5DDJ1 3RDIA 2ZGPA 2DVFA 1Q8OA 1F5JA 3MGUA 1N3PA 2WL1A 2O1QA 2D97A 5LEKA 2R062 2Y38A 4OLLA 1AXYA 2PLV3 1ND3B 2ZJCA 2JE9A 1NCRC 1KFXL 3VV1A 3FFZA 3KM5A 1TME1 2CY6A 2WKKA 1QJU1 2A70A 1WD4A 4B4QA 2GC1A 3VZKA 4JDOA 4RS5B 1R093 3S7EA 5AC93 5J37A 3CJIA 2D6MA 2VW1A 4HLTA 3IIAA 3IDCB 1AYN2 4I02A 1UKGA 3BPZA 4CDXB 1BEV2 1R1A1 1RUG1 2VW2A 3A4UA 4XF1A 1PHMA 1YFXA 3GALA 3VKMA 5KXCA 5T52A 1LB2A 2OW4A 3ENRA 3JB4C 4HK9A 4BHPA 4XJUA 2FMYA 1GICA 1ZRRA 4MUVA 2XUMA 4HKOA 4E27A 5IK7A 1RUH3 3VUOA 3ELNA 3EHKA 4HMZA 1HRV3 1FOD1 3TBDA 1SFNA 3TB0A 2PHFA 3OY8B 1BBT3 1DLLA 2XLAA 4OUSA 4BPZA 1RC6A 2HWB3 5JOYA 1MS8A 1OA4A 4N43A 4AQ6A 1MVEA 1H2NA 2ZACA 1MR5A 2NQYA 2VGDA 5FDBA 4U36A 5TSWA 5CNAA 1AL23 2WT2A 3PVBB 2GC3A 4INDA 3SCFA 3WP6A 1QJY3 1YO8A 2XJPA 3AYEA 2B42B 2R30A 4IEZA 4BQ1A 4XQWA 1ZRFA 2PQQA 4JGZA 3TRSB 3B02A 2AH2A 5AVPA 1WMFA 5FMOL 5JOXA 4ZU4A 2WA4A 2HWE1 1LOAA 2DV9A 4EN7B 2WNUB 4QQHA 3NSTA 2Q5TA 4F83A 3RG0A 2JG8B 3WHTA 4IV1B 1BVP1 4XFBA 4XMAA 4O9GA 1PK6A 3O0WA 1DQ1A 1ZBA2 4K20A 5A3LA 3SLIA 3HD8B 4Y1VA 1RIRA 3IT8A 5AFBA 1S2KA 2GNMA 3HT1A 3UKNA 5E88A 4TYSA 3AMHA 3NO8A 1LEMA 2XJRA 1H0BA 3ZSEA 3IDBB 4LO6B 2R49A 3LOBA 3PVEA 1H30A 1UU5A 1C57A 2RJLA 3ZFGB 2IZWA 5KBFA 1OI6A 5LEJA 2W52A 3FWEA 1SLLA 4LBOA 1AX1A 4NHMA 3IN9A 4S2HA 5IK8A 1JN2P 2ET7A 2JENA 2BNMA 4ES8A 2RE9A 2B45X 2G4IA 1BZWA 2BWAA 3I59B 5FQ0A 1DYPA 3JU9A 4J1XA 4AI2A 1C8M3 2CV6A 1YJLA 1FPN2 3E6DA 5DG1A 5L73A 3ZX7A 1AR92 4MGZE 4CDUB 1SMVA 1XYOA 1AYN3 1ULEA 2XVKA 1MS3A 5BNOC 4OFGA 1C5IA 4TWTA 1CVNA 4Q4Y1 2ZGTA 1NG0A 4OHZA 3FHIB 4XFAA 2BPA2 2EXHA 5T54A 3PLQA 2WFF2 4MGKE 3FUOA 1ZREA 1BK1A 4ASMB 4W65A 1EAH3 4QGMA 1S0JA 2YMZA 1GQGA 4RQPB 3VBSA 1LOCA 2D7FA 3KQRA 4H7MA 1H1MA 2QCSB 2XL7A 4BMEA 2H6BA 2A5ZA 4GMP0 1SLTA 1G7YA 1ZZCA 2W0XA 3IPVA 1D0HA 2GN7A 4HPKA 1QGLA 2XB6C 4IEOA 4KH9A 3SH5A 4XTPA 4Y4YA 5LRRA 4M01A 4QPGA 1LODA 2EXIA 3BOWA 2JKBA 3KT4A 4PDWA 1REDA 4XHBA 3PHMA 4HVQA 5KXDA 4LHLA 4FPGA 1N47A 1OA2A 1V6MA 2PHXA 5DZGA 3RSJA 1RVF3 1B35C 1H4GA 1VALA 4FAGA 5JAXA 5A33A 1RUOA 1QQP2 4ASLA 1WLCA 4XQDA 1LESA 3AP6A 1GBGA 2PLV1 4UW5A 4GXLA 3TOJA 2DVDA 2AENA 4MX3A 1QOSA 5D8AA 4FVVA 1PVC2 1I3HA 1SFYA 3A0NA 5JSRA 2OIIA 3TNPB 1PGL1 4EN9B 1R091 5AC91 3VLBB 4H55A 3ZXKA 2Q1ZB 1VP6A 2WT1A 1RJ7A 4IQPA 1NOVA 4YVWC 4RFT0 5CFCA 2HJIA 1BMV2 4WVMA 4L92A 3T1MA 4Q1PA 4QPIA 2WQ4A 2ZGNA 2R073 1FPN3 1RUH1 1PZ8A 2VQAA 4OUMA 3AZXA 1HRV1 2YROA 4YARA 1LGBA 1QH6A 2ZTNA 2MEV2 4UW6A 5KXEA 3VBHC 2EXKA 1BBT1 4RHV3 1DQ4A 4IEPA 2JD4A 4AHXA 2UWCA 2HWB1 3RYRA 3WW2A 1CQ9A 4I01A 4XJZA 1AL21 1G8WA 1COV1 4OVEA 2ZX2A 2XLGA 1QJY1 3NVCA 2BQPA 4GH4B 3DPRC 2WFF3 4D3WA 3OBTA 4QT6A 2WC2A 5E89A 3ZFEA 5K0UB 2ZGSA 5F9TA 2W39A 1S1AA 2HWD2 1VRH3 3O0VA 4GB33 1BYHA 4M3CA 3SMHA 2E9QA 4IEYA 3D5OA 5CG8A 3OD4A 4P9WA 2OUJA 4FOQA 4YZ1A 1TMF3 4KQ7A 4XETA 1JW6A 4CDWA 3JBG3 3OF1A 4I3GA 1KD7A 2F6BA 1ENQA 2P3JA 1HKDA 1YIFA 3HT2A 1HXS3 1WMDA 4C0HA 1NQJA 1CX4A 3TN92 1N1YA 4C0BA 3J8F2 1HQNA 2ZHNA 4LT5A 1QJZA 4S2FA 3ROUA 4ZKTB 1VR3A 4GQ7A 3DN7A 3GZUC 2UWAA 5BNOB 1MZ5A 4YVSA 2D3SA 2A6WA 2G9FA 4QM9A 3VGIA 1PO12 1W6NB 4C1XA 2PAMA 1MS4A 1W39A 2YDEA 4HL0A 3LA7A 2AYHA 1GANA 4PF5A 1ZZ7A 2NN8A 1IZ3A 4K6BA 4HZFA 1ZVFA 4WBBA 5CAZA 3AMQA 1FV2A 1LR5A 3WW4A 4AEJA 4C90A 5KXBA 4QGLA 1DF0A 1C8M1 4N7IA 3RZZA 2GSYA 4TLFA 4HK8A 2R043 3N7MA 5CFDA 1ENRA 1AYN1 2CGOA 3UJQA 4AQSA 1A78A 4UW4A 3PNAA 1LGNA 2IXJA 1YFWA 4AVBA 2RJKA 5I93A 2WZPP 3ZN5A 3KMHA 3KZ4C 1GFF2 3ZSKA 1CPNA 3AYAA 5FLJA 5J09A 1N3QA 2IXIA 2MEV3 2YHJA 2VOVA 2DVGA 2ZGQA 4WZFA 3AP7A 4FPEA 1WBFA 3VKNA 1O5LA 2EAAA 2OZJA 1B35B 3HWJA 3ZVXA 1YIPA 2VG9A 1DQ5A 4HN1A 5T3NA 1H4HA 1OA3A 2UYBA 2C0ZA 1R1A2 1RUG2 3AXDA 2X8KA 3MW4A 4KNCA 1GKBA 2JG9A 2EIGA 2JICA 1A3KA 1HRI3 4KG8A 4YGBA 4NHKA 1MS1A 2HWD3 4JGYA 2B5HA 1QXJA 4FPYA 1FOD2 3JZVA 4AFBA 3NAPC 1GV9A 3PJYA 5K8SA 1RUI3 2QDRA 1C3HA 1RVF1 1RHI3 1S2BA 5CU1A 3VBSC 4ISRA 4Q4W3 1UMZA 1O7FA 1XYPA 3TN93 3K51A 3H7YA 5C8WA 3GZTB 4AQ2A 4S2DA 4LA2A 1WLTA 2JDZA 1ULCA 3PVNA 1NCRA 4I0AA 3V56A 2BFUS 3R4SA 1SLIA 4QPGC 5I8SA 2W08A 2NYYA 3THPA 3LZZA 3W59A 4QMAA 5DZEA 4DRVA 3MYXA 2XBO3 5C4WA 5C33A 3CJIB 4ORFA 2QDNA 5CADA 5JOWA 3HR9A 5HCFA 5I0UA 1EPZA 1RUJ3 4EROA 1RINA 4H3WA 4YZ3A 2R071 1FPN1 1H8TC 4NOTA 4AGRA 5B2GB 3PMEA 1MVQA 3FMGA 2VVFA 3MW3A 4EN8B 3OD0A 2RS32 3VBOA 2DTYA 4RHV1 3S6PA 4HVRA 3LA2A 1J3QA 4L8QA 1QXPA 4MXWA 4A7KA 4COUA 4AFMA 3H1WA 1REEA 1C1FA 1NLSA 4N43B 3VZJA 2DCZA 2E53A 2WFF1 3NJZA 2NP0A 3POWA 1REFA 1V6NA 5KHHA 5C9AA 1AJOA 3HAGA 3HN1A 2A71A 2DU0A 5CFCC 5ACA3 4GB31 4R9DA 3CL1A 3DKWA 4FSJA 1WW5A 4KGQA 5JZGC 3MW2A 1PNGA 3IKWA 3GHMA 5FREA 4JGZB 5J48A 1TMF1 1UX6A 2XGXA 4HSLA 3JBG1 5JOZA 2CAUA 4IEXA 2GMPA 3WQ0A 2B39A 4Y20A 1PK6B 1HXS1 2P37A 2AZ5A 3AP9A 3AZWA 1PVXA 2YGMA 4XBQA 4LA3A 2WNEA 4URTA 2TEPA 3WVJA 4C1WA 5I8TA 1W6QB 4PIYA 3O12A 1EY2A 2ZX3A 4MGIE 3QACA 2BVVA 4FQZA 1RB8G 2WWSA 1D2SA 3S0MA 2LALA 5L19A 3V65A 3WX5A 4CDWC 4CDQA 3AKQA 2XWBB 1CAXA 4CEWC 4GKYA 1QDCA 2DCJA 2R041 2ZZQA 1OFSA 1NY71 3FJSA 5FQ0B 3VHRA 1GSLA 4ATFA 3MICA 4Q4V3 1O3TA 2UWBA 2PLV2 4YVSC 1DGRN 3VBFA 4D69A 1NE4A 3EO6A 2DYCA 3AMNA 3KCXA 3MZHA 4LUMA 2RS33 1OQ1A 1S0BA 2MEV1 3N7JA 2BUKA 3WCSA 3AKSA 2BGCA 1DGWA 1WW4A 3GF6A 3VHPA 1PIV3 1OKQA 4G3YC 4WZCA 3AYCA 1QF3A 2IFWA 3WOGA 1V6JA 1G9CA 2JECA 1V70A 4DZGA 1I1EA 1TEIA 3KGLA 3CNAA 2X53S 3ETQA 3LCPA 4KU7A 4MH0E 3SCHA 3ZXAC 5CFDC 4XJAA 1HRI1 1URXA 3IPVB 2CL2A 1U5YA 4MLOA 1NA1A 3H3ZA 4XILA 2HWD1 1EP0A 4HPKB 1OPMA 4M0NA 3V0AA 3ZXLA 1OLRA 1HRV2 2QUOA 2VECA 3ME2A 2VY0A 1RUI1 1BBT2 3KSCA 4QPGB 4OHWA 2HWB2 5CA6A 4PDWB 3V0BA 3WW1A 1OQEA 1RHI1 1PGW2 4Q0PA 1AL22 3U0ZA 2CNAA 3D0JA 1XRUA 1RGSA 3ZYJB 1IKQA 1DGWX 3E5UA 3NKTA 4Q4W1 2A6XA 4X6QB 3TN91 3FLRA 4L9BA 3D6EA 3C2UA 5IK5A 1G9AA 5H9QA 4LBQB 2JG9C 2ZX4A 1MZ6A 1ULDA 4IEUA 4XZPA 4YZ5A 5D8AB 2WS93 5KHGA 5JI7A 2N7GA 1SQ4A 2XHKA 3RQ0A 2E7TA 4FTEA 4YFZA 5DUUA 2C1FA 3ZO0B 2I74A 1WW7A 4OHXA 2XBO1 3BODA 1J59A 4P9XA 1YNAA 1WW6A 1PZ9A 1RUJ1 2RHPA 4OI1A 1L3JA 2XKOA 4JDNA 1AXKA 2ENRA 2GNBA 4WVMB 3MIEA 4B7KA 1X8EA 4YVWA 2G9GA 4P9GA 4E2QA 1G6NA 3DUIA 4QPIB 5HI0A 2UU8A 3VBUA 2IXKA 3H7JA 1VBD2 2HWF2 3M4FA 5GLVA 4AVTA 5GLUA 2TNFA 5EFUA 3GYDA 4AFDA 1YCIA 3ES4A 2F4PA 1LOEA 3I2DA 2E51A 3VBHA 2PYTA 4B7EA 1NLRA 4FCAA 1UZZA 1O3QA 1FNYA 4LBKA 3JQWA 5JDBA 1CR7A 5C4WC 2OVUA 1C8M2 4FXKB 5ACA1 2VPVA 3DPRA 3ZFEB 2A6VA 4J1WA 1X7NA 2BYVE 5FOBB 1VLNA 2QKDA 3MLKA 4I30A 4WM7C 4P9LA 1DGLA 4FPFA 2OYZA 1KS5A 2OUHA 3VBOC 4FQ4A 3POSA 4FBFA 1MEC3 4BWOA 4SBVA 2WSVA 1LEDA 2ARBA 4XE9A 1GLHA 4BMBA 4DRRA 4XDQA 1ENXA 4XFFA 1U0AA 1W6OB 4FPJA 3AJYA 4FTSA 3U10A 5FOJB 1EAH2 1ZNPA 2A73B 4MYEA 3I54A 5C9AC 5T5OA 1ENSA 2HEYF 5T5JA 1UL9A 3WW3A 2GC0A 4F7ZA 3KCYA 1QNYA 1X50A 4FPOB 3MF9A 2D6NA 4R8HA 5BNNA 4YVSB 2B46X 1DG6A 1IS4A 1TE1B 2ZABA 3LAGA 1IS3A 5FO8B 3JD73 4JRAA 4YW2A 1IKPA 4XIOA 4GMP3 1LECA 3M3EA 3RNSA 2D5HA 2ZZJA 2R1DA 1CONA 1LULA 1CAWB 3MIBA 3QCWA 2DUOA 3L2HA 4M00A 1RVF2 3WNXA 3MIDA 1HQWA 4MXVA 3WDWA 1M4WA 1RJ8A 2YYOA 4LHKA 4Q4V1 3SXWA 4A7YA 1YFUA 2QVSB 5CFDB 1VB4A 3NV4A 3BALA 3WZ1A 1LRHA 4BIFA 4EWEA 1Y43B 2CWMA 3M3CA 5H9RA 2RS31 5C8CA 1GZWA 2XH6A 1VBD3 1QY4A 3OTFA 4LBQD 1YRZA 2HWF3 5KHKA 1PIV1 2C9AA 2D6OX 4H7LA 1W2UA 4CDQC 2WA3A 3KT1A 3O5SA 4HT1T 2D3PA 1C4RA 5I0SA 4BCUA 3AFKA 1YYNA 4RR3A 4LUKA 1UU4A 1KJRA 3APBA 4HBNA 2R072 2ZBJA 4X8PA 4XXAA 2ZA9A 1SBDA 3INAA 1W6PA 1PO22 2QJVA 3B01A 3VBFC 2HEWF 4JGYB 4QM8A 4RHV2 3DL3A 1GYKA 5EXOA 1S0IA 4XOGA 3UL2A 1RUD3 1LJ7A 2MPFA 1CGPA 1AZDA 3NV1A 3R6SA 3NAPA 4XXPA 3AYDA 2JEMA 3VHOA 4J6GA 1K5MA 1N1VA 3MIGA 3UV9A 4OHYA 2JXAA 1CJDA 1FYUA 3E5XA 4AF9A 1LHVA 1MQTC 1RMU2 1ND2A 3FLTA 5T55A 4E2SA 2EAKA 4NO4A 2DVBA 1VRH2 2BTVC 4GB32 4KG0A 1S0CA 2WS91 2ZX0A 1NA1C 1PGSA 2ZHKA 4YG6A 5GLWA 4AVCA 4UBGA 3WUDA 4K40A 4YM3A 4Q0VA 3N36A 1TMF2 5CG9A 2HEVF 5DUVA 3MFCA 5DUWA 1NCRB 1CESA 3JBG2 1TNRA 4DPNA 4XEZA 4XW3A 3POYA 1POV0 1JXNA 1JOJA 1YWKA 2HYKA 2P3KA 1A8MA 1HXS2 1CIWA 1QNWA 2TBVA 5C4WB 2YXSA 1IHMA 4LBLA 1V6LA 4KL1A 3ZN4A 1KJLA 1F2NA 4DB5A 3M1HA 4AK3A 4LO4B 1MZFA 1OSGA 4K8FA 1VB2A 1ULGA 3FC0A 2ZGMA 3VBOB 1G9FA 1H8TA 3ZDSA 4ZU7A 2VOXA 3EBRA 5GZCA 1OMIA 1Q43A 3PMSA 5GZEA 2ZS6B 1D0GA 3NL1A 4MXWB 1JYCA 4MSVA 4DNYA 3M2MA 1R083 3FZ3A 2RM23 4AW7A 1QU0A 1GR3A 5BXXA 4WM8C 4K1YA 1V9U3 5T50A 1LOFC 3HMYA 2WSUA 1AR73 4YNIA 2R042 1NY72 2A6ZA 3LGRA 2ETEA 3TYJA 5F6LB 1O4TA 2YUEA 2ZOEB 3H3UA 3VBUC 1DHKB 1X8MA 1DQ0A 4KBBA 3ZXJA 4BLJA 5JZGA 5K9YA 3H9AA 2QNKA 3WLUA 1C28A 3GHNA 1H1AA 1QJX3 2VH9A 2CWSA 1PO23 2V5YA 2PHUA 2Z79A 4Y20B 1IS6A 3B7MA 4Y26A 4JVAA 2DTWA 3SITA 1ASJ3 1QH7A 1SBEA 1PGW1 4LO8A 1X36A 1AHSA 3E97A 3ZN6A 2ZPXA 4NHLA 1ZRDA 4D7TA 5BY5A 3B9IA 3MF6A 1HRI2 1RMU3 1UZYA 4YGDA 2IFRA 3JD71 4E4ZA 2D40A 3ZXDA 5KHIA 4FPHA 4GMP1 5H9PA 2UY8A 1AJKA 5CB7A 2GMMA 1NQDA 1RUI2 4CDQB 3CJXA 1O4ZA 4GWMA 3SHRA 1CAXB 1RHI2 2VNRA 5BNQA 2H0VA 3EQEA 5FO9B 3PVOA 4CEWA 2R0FA 1E57A 1ONAA 4M3CF 3ZMNA 4Q4W2 2Q8OA 2R0HA 4JRLA 4IETA 5JR7B 4FOYA 5F6KA 3BIWE 5IK4A 3CO2A 4PBPA 5BNNC 3VBFB 4XF9A 1VBD1 2HWF1 1XU2A 1W6MA 3VZNA 1J58A 1Y3TA 3NV2A 1AVBA 3KS7A 4FXGB 3ALQA 4YYOA 2VMIA 2E6VA 2XBO2 2XG3A 3N7KA 3D8CA 4GULA 4ITCA 4XF4A 1RUJ2 5HCBA 4META 4AVAA 3B94A 3MDPA 2D3RA 4KWLA 2BBVA 1OHFA 5GJ6A 3M3QA 4LNVA 1UPIA 1UU6A 1NA1B 2VQ0A 2I2SA 2RS13 2GN3A 5JSPA 3V0AB 4YZ4A 1MS5A 4EN0A 5C8CC 3H1MA 1RUD1 2QFEA 3OGJA 4LHNA 1RTVA 1QDOA 3ZMOA 2WNUA 4XJWA 3SNMA 3PJQA 5JPMB 3V0BB 3B00A 5EWSA 3LOIA 2X5IC 1NCQC 4BM8A 2Y0OA 1IOAA 3FBYA 2ZKLA 1EAH1 2NPIA 4RR3C 3J26N 3MFAA 5ACA2 5JSOA 2V73A 5I91A 3MEPA 2ZHMA 1UIJA 3OJBA 3SH4A 2ATFA 2XWJB 2P34A 4COVA 3VHNA 3WD5A 4DXZA 3R4UA 2PHRA 1HX6A 3AKRA 5J96B 2ET1A 4ZU5A 1OOPA 4EWDA 1QOTA 4Q0UA 1R1ZA 3ZYRA 5FPZA 2CTVA 1YJKA 4K7JA 1J1LA 3OGGA 3WDTA 3WINE 1UD1A 3RMYA 3AMPA 1K5MC 4QQOA 4HVOA 1I5ZA 3AK0A 1ND2C 4YVWB 5SV5A 3ZXFA 4Z82A 2BWCA 1HIXA 1JH5A 3VBUB 1RUC3 2SBAA 2AREA 1CN1A 2WZR3 3KCCA 1W0OA 4YFWA 1KQRA 5H9SA 3VKLA 4IEVA 2GH2A 1R081 4E4DX 2RM21 5F5QA 3H1YA 3VBHB 2BNOA 3ZIXA 4DOUA 2I45A 2YV8A 4RGAA 1V9U1 4AYUA 5I8YA 4KU8A 1AR71 1I6XA 4XTMA 5HCAA 4BZ4A 2PAKA 1QXRA 1VAVA 3DPRB 4B4RA 3M3IA 4NPRA 1UAIA 2HKXA 4RQPA 4JAAA 4Q4V2 3ZFFC 5LK5A 4IESA 3FX3A 3OYWA 1WCKA 4DFSA 3ZIWA 4BA6A 1QJX1 4WM7A 3WV6A 1YI9A 3ZSLA 3LWCA 4YSFA 2R32A 1CD3G 1PO21 1YFYA 4PIZA 2VOKA 2K0GA 1VBB3 4DS0A 1N1SA 2DCKA 2IXHA 1PIV2 3RPQA 1ASJ1 1F5FA 3AX4A 2PA7A 3RS6A 1DDLA 4Z8BA 5KHJA 1RUF3 2EA7A 1C1LA 4CEYC 4OI2A 3DF0A 4FTBA 1RMU1 3FE5A 3SCGA 5BNNB 1IQAA 3VDDA 1VRH1 4YGCA 5FLIA 3KLSA 3WG4A 2BVBA 2ZCWA 1NXD1 1VIWB 2CAVA 4LLOA 1KRIA 4QQ2A 4LULA 2XLFA 3CF6E 1A8DA 3AMMA 3UKVA 4OHVA 1GNZA 3J9SA 4AGGA 2ERFA 4LR4A 2I07B 4F8AA 3H50A 4XF0A 3WP5A 2NLRA 4N53C 2ZGOA 3IWZA 4NWWA 4BLIA 2IWGB 4CZSA 2HWC3 3LKJA 2NMNA 1AX0A 4R9BA 3WUCA 3G7DA 3JUUA