2P1BA

Crystal structure of human nucleophosmin-core
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
100
Chain Sequence
QNYLFGCELKADKDYHFKVDEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Nucleophosmin
publication title Crystal structure of human nucleophosmin-core reveals plasticity of the pentamer-pentamer interface
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 100
sequence length 104
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 2p1bA00
1XB9A 3T30A 2VTXJ 4CA9A 5EHDA 1NLQA 1K5JA 4N8MA 1XE0A 2P1BA 2VTXA
chains in the Genus database with same CATH superfamily
5DZFA 2IVIB 1JZ7A 1FYUA 1MACA 3J7LA 4E4SA 3I3DA 4CP2A 1HXS2 2J7MA 1C8M2 4FSJA 2P3KA 4DIQA 5GLTA 3HVDA 4FPYA 3VBSA 2XJVA 1QU0A 4LMFA 3N9OA 2WS92 3WXPA 3KV9A 3N7MA 1K3IA 3HMYA 4Y4RA 1YXWA 1ASJ3 1XNTA 5F37A 1O4ZA 4R9CA 4YW7A 1FMD2 4OI1A 5DG1A 1CZTA 1WW4A 1AL22 2YG0A 3HOBA 4YLZA 5FV3A 1H1AA 3C3VA 1C1FA 1PIV2 1RUI3 3KSCA 3M1HA 4AVSA 3W5NA 3AP4A 4LK6A 4IV3B 3MW2A 4AWDA 1S2EA 1OFNA 2X5IA 3M70A 3ZYGA 4DPNA 4FPFA 5FZBA 5FP4A 1DQ0A 2QKDA 3WF1A 4I0WB 1EPZA 4JRAA 4OI2A 2ORZA 4IW3A 4FTBA 1MS3A 2X10A 4GWIA 1W9FA 4LO7A 2E53A 5HV4A 2DBNA 1IOAA 2W91A 4I3GA 2E63A 1ZRFA 5KC6A 1SDDB 2QQMA 4K21A 4BQ2A 3MIFA 1W2TA 1ODMA 1JZ6A 1FATA 1HRV1 2ZMKA 4JGYA 2ZX2A 3OY8A 2PA7A 1I5ZA 4XMAA 1ONAA 2VZSA 2YMZA 3PL0A 2J1EA 5KR7A 1R1A2 1ULOA 5C5TA 3O12A 3VD4A 1NXMA 4BB3A 4IGQA 2E9QA 2CWMA 1HDKA 4L92A 5F32A 4EQVA 3WHUA 5JXJA 5JOYA 3AZZA 3HN1A 3KM5A 4FFIA 3TAYA 5I0RA 1JYTA 4IV3C 4K3UA 1PGL1 2V5YA 5FYCA 1DU3D 1GWMA 2IWGB 3I59A 1DG6A 3F2ZA 5EYYA 4E27A 1GZWA 4QPIB 3RJ2X 2R32A 3MIHA 4XJAA 1XNKA 5GZFA 4B3NA 4Q4X3 5LASA 5L9BA 4RL7A 1GYKA 3OF1A 1XRUA 5ERLA 4B7EA 4DNYA 2CDOA 3ZYJB 4XUTA 3T0BA 3V0BB 2RS53 1PO12 1DHKB 3WNMA 4L8QA 4QQOA 4XUNA 4ZKTB 5F3EA 4PI2A 1D0HA 1ENQA 3TYJA 4NWVA 4IEXA 1YLLA 4F83A 3WR0A 4L9BA 2FDJA 3WF0A 3SKVA 4BQXA 4OCTA 2E51A 2XL7A 2Q1FA 1OPMA 2JB8A 4XTPA 4M0NA 1HB2A 3AXDA 3KQRA 5D8AB 5J7MA 2HWC3 3MBWA 4QPIC 3H9AA 5EFUA 5FR3A 4QX1A 3NVCA 2R041 5FO7B 2BQPA 2GC0A 4O9GA 3AMPA 2NYYA 3AKPA 3H3UA 3K3OA 1IQDC 3WG1A 2AH2A 3KD4A 4FXKB 3IWZA 3OGVA 4YG6A 1F4HA 4UFKA 1HB1A 5FZ3A 3ZKYA 4BISA 2VZ1A 1NUKA 3UESA 4U2AA 2WLPA 2D6PA 1W8ZA 1LKNA 2L9LA 3D0JA 3HPNA 4YNIA 1JHJA 2HWD2 2RS12 2PHFA 4LXLA 3K75B 1NZCA 5HBAA 5T55A 2G9GA 2RDQA 2CYFA 3HT2A 5CKQA 2WJSA 4Q8LA 1WMFA 4H2AA 3B00A 4A7ZA 1QJU1 3ZXKA 3HQRA 1NE6A 4Q4X2 1C57A 1VMJA 2W47A 1UOFA 3JBG1 5EZWA 3U78A 3RPQA 3AZVA 1PX3A 4RN5A 4M4PA 4CCDA 5D8AC 4DXSA 5FO9B 1NCRB 1R092 1ZBE2 3QACA 4LIVA 5DMYA 2R0HA 4AEJA 1WLCA 1RYYA 1OA4A 4K7JA 3MFCA 5GLZA 1HRI1 4LHLA 3JXSA 4D7YA 2DF7A 1JYIA 2JIJA 2RDSA 1YI7A 3TOJA 1XJAA 3P3PA 5JUVA 1ZYBA 4CXXA 3WUCA 4MXWB 1G9BA 1POQA 3E5XA 1SPPB 4WM8B 1J1LA 3IBMA 3I2FA 4FVVA 2ZEYA 1UZWA 2DBIA 3I2JA 4N7IA 3NV4A 4ZU4A 5KXDA 2XBO3 5A6QA 2YBPA 4PDWA 1AJKA 2R16A 4QB1A 5AFEA 4NPRA 5HV0A 5EHDA 4Q0SA 2BERA 1IG0A 2HWF1 5IVCA 2VZ3A 1VBA1 5JDBA 4LBLA 1RUC3 1SLCA 1OBNA 4MGYE 2H0VA 1OQEA 1NCRC 1QNYA 2J1UA 4GB32 3TEZA 1QH6A 1YJKA 3C2UA 5APAA 3W59A 5ACA2 2JDYA 5A7NA 3WW4A 1WD3A 2W52A 3T0DA 1STMA 5GLUA 1ALYA 3VLBB 1GOHA 3WW1A 1O3TA 1Y9MA 2PFWA 3D8CA 3PMEA 1G8WA 4SLIA 4H7MA 4Y22B 3GGLA 3WDTA 5JSRA 4CTEA 5FO8B 1U5XA 1PNGA 2W1WA 3DYPA 2WO1A 3MICA 4TXWA 1QGLA 2VNVA 4HT1T 4LBQB 4WM8C 2RR12 2CV6A 3UGGA 3OGSA 2P17A 3WY6A 4UFJA 4LKEA 3HN3A 4Q5OA 3ZFFB 2JDKA 3ZYFA 1A34A 3IAPA 2JDHA 4AW7A 4BLJA 4ARYA 3VN4A 4X8NA 5K9YA 1O4TA 3FUOA 3C7EA 5LRRA 5EQUA 1OUXA 4HANA 4M3CA 5I8SA 4ISQA 3ZDSA 4YGEA 2NPIA 2YGMA 3VZNA 4Q4Y1 1ND3A 1AYM3 5A7WB 3VKMA 5JIUA 3MUZ1 1YFYA 3H1YA 2EIBA 2YFZA 4CA9A 3JB8A 3B01A 2W08A 1NCQA 1OXCA 3BOPA 3FLPA 3NKTA 1ZNPA 4JKLA 5IHRA 1GSLA 1MQTB 2XH6A 3A7QA 1T2XA 1PGL2 3ZIWA 1D7PM 2XLFA 1UMZA 2WDBA 3HD8B 3AYCA 1J83A 1OA3A 1RUC2 1W8HA 2WFF1 4GJYA 2KR2A 5FCCA 3ZFFC 2WN3A 4Q0PA 4IDZA 1WLTA 5KBFA 4NHKA 4NHXA 1W9YA 2YBKA 1BQPA 2DWRA 1BJQA 1BLZA 1U5ZA 2VAUA 4YW5A 4YFZA 4CU8A 2VCBA 2VUCA 2XJQA 1JXNA 1W8WA 1RUI1 1XOYA 3FWEA 2A75A 1MZ6A 1KITA 3WDYA 1FPN1 2VZOA 3LEGA 3VGIA 1QOSA 3HQUA 1FOD1 2RE9A 2VL4A 3SKJE 2N7GA 5J1XA 1MQTC 2LTNA 3PU8A 2X09A 1CIYA 2XVGA 2VMFA 3EMRA 1UNBA 4I0BA 1SCRA 4LR4A 4A41A 4DINB 1NX9A 3PLQA 1H2LA 4YPJA 2CAVA 3CU7A 1OOPA 5FP7A 5LBFA 3RYKA 5B4NA 5T5JA 1MZ5A 4ET7A 3AX4A 4PT6A 1NKGA 1AYM2 5IUQA 4CRQA 5BNPA 1I6XA 3N9NA 1T6GC 1HB3A 3AC0A 3U4XA 1EUUA 1Q3EA 3LSDA 5FMOS 5DZGA 1EY2A 3ZKUA 5E89A 3H1WA 4WVVA 4UYBA 1S2BA 5FYBA 1L7QA 1L7RA 3D5OA 4HVRA 3T0AA 4FFFA 4BJ0A 3VZMA 2I07B 1G9AA 1TQ5A 1KXGA 1JYXA 2QE3A 1W0NA 5C71A 1CPNA 3OD4A 2E6VA 3QH7A 4IE7A 5HXVA 2DV9A 3OBZA 4HN0A 1YNAA 2D98A 5JI7A 1ZRCA 5FZ8A 3SISA 3VD3A 2O8OA 1CZVA 2RS51 2VOVA 2VQUA 3HAGA 3WT3A 4RD7A 1RUG2 4IEUA 4E2SA 4FPHA 1VALA 2IVJA 3DUIA 4LUMA 5L19A 2P6HA 3NNLA 3WNNA 3B5LB 1GANA 4QQHA 1Y9QA 5FY8A 2X05A 4NIDA 5FMOL 1HQLA 1S0CA 4Y3OA 2WNOA 1QXRA 2FCTA 4DXRA 4WBBA 1Q8PA 4OHXA 4N53B 4DS0A 4PF1A 2ZOEB 4Q1PA 1UZVA 1KJLA 3WF4A 1W6NB 1W6OA 2Y6FA 3OUIA 3BU0A 2WA3A 1C1LA 2XUMA 2EVXA 2WQZC 2NQYA 2VCAA 4FP3A 1I3HA 3POSA 3VB9A 2HJIA 2BTVC 3WQ7A 2ZX4A 3J8F2 3R05A 2GALA 1XSRA 3NJZA 1WMEA 2YY1A 1VJ2A 4FQZA 4IEVA 3MPPG 5FPVA 1D2SA 1DGLA 1AR63 1O4YA 4MH0E 5CKMA 1LOFA 4COUA 4BH9A 2VMHA 4V2VA 2HEWF 4E9KA 5L7OA 1Z7S1 3FE5A 3ZSEA 5F3CA 2JDUA 2D6MA 3I4IA 1LOAA 4Y1UA 4QXKA 2I74A 4N53C 2RS32 2JWPA 4A2UA 1ZZ9A 2GMMA 3OD0A 2BOJA 3LE0A 3VL8A 1UIKA 2ZGQA 4BIOA 4BQYA 1C5IA 4QXHA 1UY3A 2R062 1W2OA 3LA7A 5L9RA 2LALA 2ORXA 2QJVA 2VE1A 3LDRA 3QCWA 4HFSA 4K1YA 4Q4W3 5FP8A 3T1MA 4XQ4A 4LULA 3VHNA 4L99A 2LS6A 3MZHA 3ROUA 2AUYA 1VBB2 5FYZA 1RTVA 3VHOA 2RM22 1AZDA 2QQWA 1WCSA 1DFQA 1EPWA 3J7NA 4XHXA 4RHV3 4GD4A 4XQDA 4XDPA 5FXXA 3WEZA 2XKOA 3OEBA 4NOTA 2FCUA 2TNFA 1X7NA 3O1VA 1O59A 1MEC3 1FXZA 1QY4A 1PVC1 3AK0A 1BCXA 1C8NA 2ZHLA 4QX8A 5AC93 4BCUA 2EXIA 1AR73 2ZMLA 4KQ7A 4HBNA 5ANNA 4CEWA 5JLVA 5A7PA 5LA0A 4J25A 5IK4A 4O65A 3TN93 2VGDA 4AI9A 1GNYA 1YQ8A 5H9RA 2JE9A 3L9JT 1SFNA 2HWE3 4KWUA 3VV1A 1O7FA 2O1QA 4GULA 3Q9OA 3ZXJA 3AMHA 5A6ZA 5BY5A 4RYDA 5DZEA 1BHGA 3LB9A 5JPMB 1J84A 1NA1A 1UPSA 2RJ2A 4PIYA 5DUXA 5FYTA 2VMIA 4URTA 5A7OA 4AHZA 4BM8A 1H1IA 1CVNA 2PAEA 3BN6A 1N47A 2VBBA 4PCRA 4XPVA 1DZRA 5FYSA 1N3PA 3BYWA 4JKMA 1SBFA 3WP3A 2VW1A 4GKXA 3ZXAC 5I0UA 4QGLA 3UYJA 3RZGA 4DO0A 1EAH2 4D94A 2DUOA 4PF5A 3E1F1 1RMU2 2XQXA 1OHFA 2DDUA 3AFKA 3NO8A 4BMBA 1QQP3 1ZBA3 3BCWA 3JUUA 4P08A 4CDWB 5DABA 4JCKA 4P02B 1UY2A 2PHDA 4UXAA 5E88A 2C4XA 1S55A 2JG8B 3N9LA 5T3NA 3VD9A 4G4FA 1X50A 1WLDA 4AQTA 1AR72 3OG2A 4YVSA 3C7GA 4OQ9A 1BMV1 3PHMA 4U36A 3NV2A 2C0ZA 3GHNA 1F5FA 3B69A 4W4ZA 1CAUA 1BBT1 1DZQA 4YGCA 5E6HA 1OD5A 3BODA 4JAAA 4YVWA 5SV5A 4DEQA 1DF0A 3H42B 2R071 3A4UA 4RS5A 2HWE2 5F2SA 3U11A 5FOBB 5A3NA 2XHKA 2BGPA 3R4SA 2HBTA 3CJIB 3NV3A 3VBHA 5FLJA 2JECA 3IDAA 1WLWA 4RR3B 4R9BA 1GU3A 3WDWA 3N3HA 4A6SA 3ACIA 4AVBA 3NL1A 3IT8A 1E5IA 4WVMB 3RWNA 3SH3A 1HQNA 1YQ2A 2GZWA 2ZX3A 4NRPA 4H55A 4CDWC 4QM8A 1S0GA 3BI3A 2VCCA 3I7DA 1AUYA 2ZHKA 1GNHA 3CHXA 1YJLA 2JG8C 2WL1A 3FZ3A 5FXZA 4ES9A 2VTXA 5FMCA 1LECA 3FJSA 5JXGA 3ZFEB 2IXJA 1JS9A 4EN0A 1VB2A 2DTYA 2WUHA 1YI9A 3ZR5A 1WW6A 3AMNA 3H3ZA 4LOSA 2DTWA 4FPGA 4BYYA 1ZBA2 5A3TA 3DCQA 2VQTA 5FY4A 3CJIC 4Q0VA 1QWRA 2ZGSA 1RGSA 4RGAA 4AEMA 5LZ6A 4RR3C 4YW3A 2JE8A 4C8DA 4XF4A 4IGOA 1HRV3 1V9U2 2WYFA 3NJVA 4QGNA 5FYMA 3DEMA 3AKTA 4OZOA 1GV9A 1LOEA 1GZTA 1N1SA 2IC1A 1PHMA 2A5ZA 4NHMA 5FZOB 3RSJA 5C3PA 1DGWA 1RHI1 1WWYA 1CR7A 2ZEWA 3A21A 1OLRA 3QLQA 3QOPA 4QDSA 4JTNA 5FPZA 1H0BA 1VAKA 3BU7A 3AZYA 1H8TB 3CO2A 3UKVA 3WF2A 4NPLA 3ZFEC 5CFCB 3K4DA 1XXNA 2CDPA 4JX0A 2HBUA 3WP5A 5BNNA 5LEKA 3HR9A 2FBEA 1UXZA 4Y4YA 1F35A 4K6BA 4UBGA 4NMIA 1W6QA 1ULGA 1RUH2 4XFIA 2A1XA 2PQSA 2B7YA 4GA9A 4B29A 1XSQA 4Q0UA 2QQPA 2ZGTA 2YC0A 5KHGA 5FZ4A 3ABZA 3PIJA 2VUJA 4H14A 4PI0A 1W0OA 5CFDA 3ZN4A 3THPA 3BUCA 3ZXLA 1DYKA 1FV2A 1REEA 3N9MA 3POGA 3RI9A 2MPFA 3DYOA 4JGZB 4WM7A 2WZEA 3RMYA 1H8TC 3RRDA 1K12A 2Y60A 5D2AA 3KS7A 1LGBA 4P9LA 1W03A 2OQ7A 5CFCC 2ZBJA 4MV2A 1Y43B 1I1EA 2PELA 2Q8DA 3WX5A 4FOVA 2WNVB 3ME2A 1LU1A 1AX0A 4LTAA 3AYAA 1PNFA 4AVAA 1ULCA 3D82A 1OQDA 3PTRB 3WNXA 2YHJA 1DQ5A 5C3OA 3MF6A 4L0PA 2DURA 1ZRRA 3ECQA 5FZEA 2EXKA 5DAWA 1AXKA 1ZZ6A 2W95A 4I30A 2B4KA 3MEPA 5BXXA 4MGTA 3VD7A 1AX1A 3CKHA 2F6BA 3BIEA 3DL3A 3RFRA 4IERA 3GF6A 3OPWA 3PUHA 4IEQA 1LTEA 4JVAA 5F6KA 4LHNA 4P9JA 4Q4W1 4JGZC 5CEHA 2NP0A 2XOMA 3ZR6A 3JBG3 3JD73 2K0GA 1N1YA 2FMYA 2BZDA 3FMGA 3NQHA 2D5HA 2AYHA 3M3IA 4QHZA 3WDUA 4Q8KA 5I0DA 5JI9A 4R9DA 4LPLA 1CGPA 1PO21 2YPJA 2WNVC 3CMGA 3PMSA 5GKAC 3VL9A 4GXLA 3U75A 1JZ5A 1OURA 1V6KA 2DCJA 3SCHA 4LBNA 3NNJA 2ZGPA 1LOGA 3BPZA 4CCMA 1HRI3 2ZGUA 2A3XA 3ZFGA 3HBZA 1AHSA 3E5QA 1VAMA 3Q8BA 4CZSA 1KJRA 2PHUA 3FFZA 5AC91 5EJ3A 2R7EB 3I54A 4CYDA 2FMDA 4JC1A 4CDQB 3KT4A 2JDPA 5A6XA 1K5MB 1CX4A 2QQVA 5A33A 1OPOA 3TN91 5IK7A 2XXZA 3B9IA 2DCKA 1UYXA 2R042 4B4QA 1GZ9A 4HLTA 2FQPA 1MZFA 4S2DA 2YFUA 5FZ0A 2HWF3 4A45A 5KWRA 1E5HA 1W6MA 3URFA 4N90A 4D0QA 3WW2A 3MDPA 3NAPA 3KCYA 2XVKA 1RINA 1JBCA 4IL7A 4QHOA 3ZN5A 3THTA 3FX3A 4XF3A 5F8PA 1R082 5B4XA 1D4M3 1REFA 3UL2A 5FTTC 3OTFA 3SXWA 3T09A 5FZ6A 2EXJA 4QQLA 4PQQA 4XJ9A 4FCAA 1HJGA 1QJU2 4FI9A 4DXTA 2JKXA 1IPSA 2X53S 3UGHA 4GZ9A 4QMAA 4CDQC 1DQ2A 4LA3A 1K5MC 2XPJA 3BOWA 3RG0A 3CEWA 1MS0A 3GNEA 1S0FA 3GZUC 4HN1A 2VM9A 1YYNA 5DXDA 5I0TA 4E4DX 5CYYA 5IT6A 1UU5A 2E7AA 5LB6A 3T3YA 1PM4A 1SZBA 5IWFA 1CESA 3ZSMA 5C4WB 3CBNA 4Q4Y3 2VUAA 1TG7A 4BXSV 4COVA 5F1RA 1BEV2 1UY0A 4HPKB 4P5HA 3SNMA 3GZEA 3AMMA 4HK8A 4I3PA 2CNAA 2ZHMA 1SPPA 2HWF2 1LEMA 2B9VA 4FTSA 1VBC1 1VBA2 4GWJA 5FZDA 2WFF3 4LLFA 4XILA 1E5SA 3ZN6A 1H1MA 5C8CB 2VZQA 1E57A 2IXHA 2QVSB 5JR2A 1EV11 1F31A 1WBLA 4DQAA 4Z8BA 5BV6A 3VBUA 1UCXA 3AP5A 3FUQA 2XWBB 3KQ4B 1LR5A 3IM0A 2PLV2 1GICA 4XUQA 2A6ZA 4AHYA 1IS4A 4YWAA 4AI3A 4Y20B 1REDA 2B46X 2ET7A 5FY5A 3B93A 3KHCA 5C4WC 1WW7A 3GZAA 1FPN3 4XCBA 2GU9A 2Z5WA 5IK5A 5T5PA 1GNZA 1LHVA 2EIDA 1FOD3 1LB2A 4AFCA 5T50A 4I01A 1GWLA 2RV9A 1O5UA 1YUDA 2GMPA 3UKNA 1KGYA 4A3ZA 4LBQA 1ULFA 4E4ZA 5TSWA 1PZ7A 3AKSA 4HMZA 2X8KA 2HYKA 4D7SA 2QQOA 4Z07A 4O61A 1E5RA 5C8CC 4DUXA 1TVGA 4YGBA 1Y4WA 2J22A 4CCLA 1TMF2 3MYXA 3J7HA 1VE0A 1IKPA 2GNMA 1CAVA 5HCHA 1GMMA 4YW6A 3S6PA 5FREA 4M0HA 2XMLA 3ILNA 4IUGA 4XF1A 5FYVA 3R4DB 2ARCA 2HWB1 2QQJA 5C33A 5GALA 2BOIA 5FPBA 2VMDA 1V6IA 4AI0A 1SLLA 3PUQA 4XW3A 4AOCA 1GFF2 4JQRA 4EWEA 5B2GB 1ZRIA 1K45A 4QU2A 4UT5A 4BA6A 1IPKA 3LFIA 1ASJ2 1Q8QA 1VB4A 3ZSLA 2RMU1 2NM1A 2J42A 5LCWL 1LHOA 4LKSA 2FCVA 4TLFA 4LBJA 4CCEA 5H9PA 1RUI2 4UFHA 5D21A 3KT7A 4QPGA 2VOTA 2A6VA 4KMQA 1FOD2 4YZ1A 3GYDA 5GLVA 4LBKA 3VBRB 2P4EA 3KV5A 3MGUA 3NW4A 2R1BA 5M0TA 1DYPA 1NG0A 1X36A 2W5FA 3BIWE 4E8CA 4HVOA 3ETPA 4JQTA 5FZMA 4A7YA 1OLMA 3GCXA 1ST8A 2HKXA 3P1IA 3AVRA 5CVRA 4W50A 3LA2A 5GZEA 1GP5A 5EYXA 2BUKA 4BIFA 5F9TA 1VRH1 1RVF1 4ZS2A 3UK9A 4K40A 1L3JA 1S0BA 4GAZA 5EXOA 5HXMA 2QFEA 3RZKA 1NOVA 1NZIA 2Q1ZB 3HNMA 4I02A 4AVVA 1P8JA 4QQPA 2ATFA 5LEJA 2VXJA 5L36A 4EN8B 3KF5A 1FNYA 2ZA9A 1H30A 1PGW2 3S0MA 2VECA 2XWJB 3VBRC 4D3WA 4COWA 1G9CA 4OI0A 1Z7S3 2OW4A 2VTFA 4N7UA 2E26A 2LM3A 4UFMA 3SH5A 5FQ0A 4XBQA 3JD71 3O5SA 5LBCA 3S5AA 4CPBD 4G9SB 4YG0A 3O0WA 5FY7A 1YFUA 2RS52 4I09A 1Q8OA 1PK6B 2W46A 4JHTA 1UF2C 2J1RA 1X8MA 2B45X 2TUNA 3V0AB 4AEDA 2C5DA 4M3CF 3VDDA 4QM9A 5FBZA 3VZLA 1CN1A 5K0UB 1JYCA 2Y0OA 4CDUB 5LY1A 2RG4A 5JAXA 5JXHA 2A3WA 2WKKA 2PMWB 3NNMA 1UD1A 4OULA 4AFBA 1RC6A 2A6YA 3C7OA 2VPVA 4XFBA 4AYUA 2HWC2 3VBOB 2OPWA 2ARAA 5CG8A 5C8WA 4JZRA 3RVHA 5ANQA 1CZSA 3HQXA 1GP4A 2QQIA 4QX5A 1UZ0A 4KWLA 1J3QA 3ZO0B 2VQAA 1PVC3 4NIGA 1W6NA 2VU9A 3D4KA 2WNUB 3T1LA 5HCAA 1A6CA 1PK6C 1N3QA 2CSGA 4L2NA 1D4M1 3H0OA 2XJRA 2J1AA 4HOOA 4AQ2A 1LGCA 4XJ8A 4XVHA 5K0UC 1SDWA 4QHBA 4CDUC 5FZ9A 4BQ4A 3MHZA 1WMDA 4J1XA 2CTVA 1RIRA 2VULA 4OI4A 1AVBA 1SQ4A 5T5OA 3VBSB 4R9AA 4ZXKA 4MHUA 5KHIA 5FZKA 3LKJA 3DF0A 1SLIA 3WNPA 3VBOC 1ZREA 3B7MA 4MGQA 3DPRA 2QZ2A 4OUEA 4S2HA 4BK4A 2J1VA 3BTYA 4X6QB 3VDBA 2ADDA 5T54A 2WQ4A 3POBA 5CADA 2GDFA 2WS91 4XFAA 2ARXA 2OPKA 2WNUC 4FAHA 4ZU7A 3VBFA 1EUTA 2NLRA 2X5IB 1V00A 1W04A 3KCCA 3W5MA 1W2UA 2WLQA 1PIV1 2VXRA 2A6WA 2XBO2 3EO6A 4NVPA 2Q1MA 5BUVA 1IS3A 3GXUA 3OBTA 3VBSC 3Q8EA 3EQEA 5JSPA 3AYEA 3PVOA 1Z78A 4JGYB 1PVC2 3OY8B 2R30A 1LOCA 3POYA 2BNMA 1OA2A 3T2PA 3TEYA 3J7MA 4BLIA 3OOXA 4S2GA 1W3VA 4NE9A 3GJAA 2Y26A 1BBT3 2V73A 5C70A 1XQNA 5FJKA 1OH4A 2GH8A 2R073 3EHKA 3I8TA 2C9AA 4IV1A 5A80A 1RXFA 5JR7B 1R1A1 2X5IC 5E16A 3S7EA 4LQRA 4DY3A 1CJDA 3I59B 4DZGA 2DFBA 2PAKA 1GZWB 3GHMA 4W8JA 5IVYA 4D69A 1RB8G 3UJQA 4ASMB 4AGVA 3DKQA 5C6CA 1N3OA 2HH9A 4NRQA 2PQQA 4JGYC 1H2KA 1LEDA 1OSGA 2GMEA 2IXCA 4W6XA 1O3SA 4J1WA 4BMEA 5BNQA 3ALQA 5FUIA 5J96B 4COZA 1LCLA 1LULA 1X9PA 2ZZQA 3ZXDA 5JZGA 2FDIA 1PO11 2E7QA 2UYAA 1GQHA 3KGLA 3KVAA 4XURA 1QMJA 1YQCA 1J3PA 1FV3A 3V56A 4XIOA 2GP5A 3ZPOA 4BOWA 5HPOA 2BPA2 2FDHA 1RUJ3 4K1ZA 2XLGA 2D44A 3EB7A 4RQPA 3SLIA 4FOWA 5KHKA 1NY72 2EAKA 4ISRA 2PXJA 1W28A 1JHNA 3IZOA 4B4RA 2Q8EA 1JYNA 2A6XA 4BZ4A 3RNSA 3LPFA 4IESA 1BBT2 2A7AA 1RHI3 2R072 5ABJA 3D0SA 4CCJA 3K4ZA 2XLAA 3LZZA 5FMDA 1RUF3 1MZEA 2YV8A 1S0JA 4QU1A 2H0BA 3QH6A 3BKZA 2HWD1 1QJEA 2G4IA 4O9EA 1NYWA 1WGPA 3OUHA 5JXIA 4LBOA 5FKCA 1AYN3 3TRSB 1D0GA 2GNTA 1X33A 1I9RA 2JE7A 4XFGA 2EICA 1YQ5A 4D6SA 3MV01 1XC6A 4WVMA 1W2AX 2W39A 5A3LA 4QDQA 2W87A 3GJBA 3TEXA 1R091 3IPVA 1ZBE1 2CGOA 2YU2A 4XEZA 3ZYIB 2DVDA 2XHNA 1SLTA 4XXPA 1F8VA 2VW0A 3K4AA 4DUVA 3E5UA 1SBEA 4S2FA 5FZLA 5JMCA 3AP9A 1DYOA 2ZGLA 5JIAA 1IZ3A 4OHWA 4QWNA 4E2QA 1J59A 4CP9A 2YZ4A 4DRRA 2JDNA 2WAAA 4HVQA 3IDCB 4PDWB 4P9GA 5BNOA 2DYCA 1LHUA 2P1BA 2P34A 1CX1A 4G3YC 1OUSA 1RUD3 3VHRA 4A3XA 1RHI2 2NN8A 4GWNA 2ZS6B 1YO8A 4CDXA 1OKOA 2EA7A 2D6NA 2PN5A 2XDVA 2XL9A 4GJZA 4MVTA 3SH4A 3T4VA 3G7DA 1VBD3 4Z82A 1ENSA 5E8AA 2JENA 1XYOA 5FWEA 1ND2A 2MHFA 1XU2A 3H3LA 4GALA 5J36A 3NRUA 4GB31 3O0VA 5ACA1 4CEYA 2WQ8A 3RI8A 2P3IA 3ZXEA 1JH5A 3PNAA 3NMBA 1CAWB 3T30A 5FZHA 3DV8A 3FC0A 4PDWC 2AR6A 3LIHA 1WUVA 3MIBA 1PO23 2YB7A 3INAA 4XUPA 2RR11 3AZWA 3LFMA 3MW4A 3H8XA 1JZ3A 3VZKA 4M3CB 1RUE1 3OPTA 1YIPA 5HCBA 3SEPA 2H6BA 5A6YA 5I93A 5FWJA 1KRIA 3E97A 5EJ1B 2CWSA 1LESA 1JZ4A 1XBFA 4FPJA 3BVCA 4BQ1A 2TBVA 2VO5A 4Y1VA 1ZZ8A 3H1MA 1NCQB 3NWKA 1QJZA 4QB2A 3U0ZA 3MIDA 1AR62 1KFUL 1U0AA 2GN3A 1ZVFA 4IE6A 1GKBA 1BKZA 1J3RA 1UW8A 3FL7A 3OB8A 1LNSA 2LROA 4LO6B 5CB7A 5CAZA 3ILRA 4JTOA 5A3MA 3DKWA 4BPZA 1W8FA 1JW6A 1L7LA 3O14A 1ULDA 2Z42A 2UY9A 4PBPA 4CP1A 4TYSA 5GZGA 4UF0A 5KHJA 4JKKA 2PHWA 4BQ3A 1Q43A 3LDKA 3SCFA 1W05A 4LK7A 3QBQA 4FTEA 2BU9A 1UYYA 3M8LA 4Q4W2 4X6RB 4IE4A 3WINE 1N1VA 1PZ8A 4AQ6A 3AYDA 2VH9A 5FLHA 2PHLA 1NCQC 1K42A 5DAVA 1PZ9A 2CGNA 3O1SA 3ACGA 2ZEZA 1VRBA 3I2HA 1W0PA 1WKYA 3K48A 4AEDB 3E6CC 1PO22 3ASIA 3D6EA 3T2TA 2AGSA 1DGRA 3SC7X 3WZ1A 4RHV2 1BYHA 1HW5A 1OOPB 5C9AA 1WD4A 2BWAA 3T08A 1MEC2 3S7IA 2VVFA 2XUEA 2DCYA 2W92A 2XKPA 3F95A 3HBKA 4GH4A 4QGMA 2BBVA 2W9XA 5FZAA 4M00A 5AC92 5BNPB 1QIQA 2B5HA 2P37A 4JHZA 3MO4A 3LGRA 4C90A 1JUIA 1OF3A 4Q4V1 2QTWB 2VVDA 3TN92 1W6PB 4MOAA 1KD7A 1FNZA 2VZUA 2OYZA 4YSFA 2UWBA 3QD6A 1IS6A 3A0KA 1UZZA 4FT8A 5A32A 1F4AA 2YROA 3K77A 1C5HA 1VBC3 4FXGB 5IJRA 4O7XA 1SLAA 3I2OA 1KDKA 1AL0G 4AEDC 2K46A 4AR2A 3N4MA 3AL6A 4MGIE 2F17A 1EV13 4K8FA 5DDJ1 2Z2SB 2VUDA 1OOPC 4KBBA 1B35B 3PUIA 3I2GA 3I2KA 4DB5A 1GP6A 3I3BA 1DQ1A 4XDOA 2Q8CA 3T2OA 3NKGA 3RYRA 5BNPC 1TNRA 5FYYA 5FBJA 2DCTA 1DQ6A 2EIEA 3ZMNA 3H7JA 3HNYM 2Y64A 3S5QA 2DUPA 2HEYF 3LOBA 5IAXA 2UYBA 3EYPA 1QQP2 1VBE1 2YGLA 2SBAA 1BXHA 3W20A 1SEFA 4H7LA 1OLQA 5A3OA 4RSUA 4Z1VA 1RUJ1 3FFQA 2WC2A 1W6OB 1CAXA 1JN2P 1UMIA 3BPSA 3P6BA 4N43B 4EWDA 2GSYA 1D2QA 3LDBA 2FZ2A 3GDBA 1B35C 3FBMA 5EJZB 4XBLA 3A0NA 2O8QA 1APNA 3O1RA 4MGSA 4JDNA 2YU1A 3EJKA 3AM2A 5FUPA 4AI8A 1TEIA 2IXLA 4KWJA 3BTXA 2OIIA 5FFOC 4ARXA 3R6SA 2QUOA 1OVPA 2Y6JA 4EZ4A 3NSTA 1VBC2 4HPKA 2QQLA 3NJXA 2ZGMA 1YHFA 2HWB3 3OCPA 1RUF1 3J8F1 1DLCA 1CIWA 4MGZE 2BWCA 2VNGA 3LEIA 4LITA 1YRZA 1GUIA 3LD8A 4XMIA 1RITA 3NJYA 1DZTA 5FY9A 3U07A 2XVLA 1AYN1 4QDRA 1KQRA 1QJY1 5C3RA 3ETQA 2QZ3A 1QHDA 3B94A 3TBDA 5K4LA 5DAQA 2RMU3 2WWSA 4MADA 1HLCA 1I5PA 4DEVA 4N43C 2WYSA 5FPAA 5F5CA 2WN2A 3IN9A 2RS31 4ORFA 3TEWA 1UXXX 5KXCA 1ZM1A 1H2MA 1LAJA 4GQ7A 1PM7A 4DUWA 2R061 3M3EA 4IV3A 5FKBA 1V6OA 1LOFC 1WCQA 1OH3A 2Q4SA 1KEXA 2P2KA 3IMMA 1CD3G 1IKQA 2CAUA 1HRV2 4A6OA 1LODA 1VRH3 2VVEA 1VBB1 2BNNA 1RVF3 1WBFA 2JX9A 2ARBA 3IAQA 2OKXA 4KG0A 1NLQA 2RM21 3N7KA 4F3JA 4Y5Z0 2D6LX 1UY4A 1UKGA 1RUOA 1RUD1 4OLLA 5FZ1A 1JMUB 4YW2A 5JCTA 4Y5TA 1ACCA 2AEYA 4YGDA 4FAGA 3H50A 3ZPYA 3LF7A 4N9IA 2V4AA 2A3YA 2XJTA 5F7UA 4CEWB 2FDGA 3VKNA 3WQ1A 1VBD1 4F7ZA 1LGNA 3LSEA 4IEWA 4DFSA 4Y33A 1XB9A 2Z69A 3B3QE 1BVP1 4Y1ZA 2QDRA 4FFHA 1XNBA 4PIXA 4C0HA 2KXLA 1RJ7A 4L11A 2G9FA 2Q8OA 2MEV1 1CJPA 4N8MA 2RMU2 4QPIA 1O8PA 5FY1A 4MSVA 2WA4A 2RJLA 4FPKA 5F3GA 1AR93 1XPWA 5IAVA 5DPNA 5FPXA 1HV0A 2IXIA 3E6DA 1CPMA 1CONA 5C5UA 1COV3 1PMJX 4SBVA 1PX4A 2BGCA 3V0BA 2A70A 2UWAA 2OZJA 2PTMA 3ES1A 4WZCA 4EN7B 1WMXA 5J09A 4CEWC 3AZXA 1QKQA 1TNFA 4ZS3A 3O1PA 4E2GA 4UWDA 5AFBA 5KC5A 1MS4A 1ENRA 3UJOA 4YM0A 3P5BA 3ZDVA 4YM3A 4PLNA 4EN6B 3WP4A 4P9WA 3BALA 2BBAA 3LIGA 3OSDA 2EIGA 4IEOA 2CGPA 1VRH2 1IS5A 2PAMA 1O91A 1RVF2 4OZXA 1OFSA 4NRMA 3U10A 2WSUA 3KV6A 1RMU1 4TLGA 1H9WA 2ERFA 2K2SA 3PVNA 4XXAA 5D8AA 4NWWA 1W39A 4XCAA 5FK8A 4YVSB 1HN0A 5I0SA 3HNBM 3K51A 2ZGOA 4LORA 1ENXA 2OA2A 1CAUB 3V65A 3ZSJA 4YVWB 4AHXA 4RS5B 1T6BX 3PJYA 2QQUA 3ZYRA 4YYOA 5F5QA 2Y6HA 3VBHB 1POV1 1X9TA 1W8UA 5FP3A 3JBG2 3JD72 4KGQA 4P9XA 1HJFA 1RUNA 1QNWA 1H8VA 4KH9A 3CLPA 4P9YA 2YXSA 5FZFA 1FI2A 4XZPA 1JI6A 4CUGA 1UZYA 2OUHA 3ACLA 1H2NA 2WIIB 2BV4A 1US3A 3IKWA 3POWA 5IVEA 4XHBA 5LW9A 3WF3A 2XB6C 2PHXA 2XR4A 1HRI2 1YQ6A 3ZYHA 1JTZX 1NCRA 1W8OA 2WS93 3SITA 3USUB 2DUQA 3L2YA 4YVSC 3VKFC 3D3AA 4HETA 1H4GA 1VP6A 1V0AA 3OYWB 1HN1A 1HQWA 2AACA 2C6SA 5IATA 1AL23 4V2WA 4YVWC 4RS5C 1PIV3 3H8UA 1UYPA 1VPHA 2AC1A 2VNOA 3E6BA 4YM2A 2GC3A 4LUKA 4MXWA 3VBHC 3MPBA 2XJPA 4XYXA 2BVVA 2Y6GA 1JUHA 4WM8A 2XG3A 1S4CA 2I45A 2ZCWA 2VW2A 2SLIA 4AHWA 4B1MA 4HK9A 1S0IA 1FAYA 5IYYA 1RXGA 1D4M2 1V9U1 2VMEA 3V64A 2O0OA 2OXBA 1W3XA 4RGKA 3JQWA 5FDBA 2EAAA 5JOWA 3I3EA 2CHHA 2VOXA 1R1A3 1CWPA 3RGBA 4UW6A 2EF6A 2B39A 3A23A 1WW5A 5BNNB 1QJX1 2OT7A 5KXEA 1HX6A 2FHRA 2KD7A 4IETA 4LOTA 3HJRA 4Y22A 1ZA4A 1W6QB 4UW5A 3Q8CA 4YZ2A 1A78A 4M4RA 3ILFA 3T4HB 2OZ6A 2UURA 3AKRA 5L9VA 3ZFFA 5JOXA 1POV0 5CFDB 1SFPA 1RUH1 1SCSA 1XYNA 2BFUS 4Q4Y2 1KS5A 4FOQA 4P00B 2DVGA 2A73B 1PO13 5J37A 1NE4A 4WM7B 1SACA 2VNRA 2VZVA 2Y6KA 4HSLA 2R49A 1SBDA 2WZR1 5A7WA 4M01A 1F15A 2VMGA 3L2HA 3Q8AA 4C1XA 1UIJA 1V6MA 4B8EA 2DFCA 4DMIA 5BNNC 2FDKA 3SQOA 4NIHA 3IIAA 5FZGA 2WFF2 4R4ZA 2JXAA 3VDCA 2BVBA 3ZXGA 4MYEA 1GLHA 1MQTA 4IEPA 4E4HA 3C8XA 1S0EA 4ASLA 2B8MA 3MIGA 2ZHNA 5CZKA 2LRPA 4QKNA 5GLWA 4CP0A 3O1UA 2GH2A 2OVUA 4MLOA 3ON7A 4UFLA 1H6XA 3WG2A 4CU9A 4QQ2A 3JZVA 2WINB 3ZSKA 3WG4A 5CFDC 5FZIA 5FYUA 3JQXA 4XDQA 3HT1A 4R8HA 1G7YA 3AJYA 1FPN2 3AL5A 3PJQA 5FMBA 4DY5A 3VKOA 4NO4A 3U14A 5A1FA 1GZCA 2JD4A 1HV1A 3UV9A 2HWD3 3C7FA 2RS13 2WNEA 2BFUL 2ZGNA 4NAMA 1Y3TA 4WM7C 3ZM8A 4BQ5A 4XFFA 1OD3A 1EYBA 2G9ZA 3O0XA 4LKFA 2H6CA 1GQGA 2ZXQA 4LKDA 3RJRA 2VZRA 1V70A 4UBHA 2JDAA 1U12A 3ZX7A 2D40A 5LK7B 3KMHA 1R093 4FO9A 4QX0A 1ZBE3 2OUJA 5HCFA 3ZFGB 4Z92B 3N9QA 4KU8A 1TME1 3ZYPA 1IPJA 1OF4A 3R4UA 5F6LB 4K9SA 3O1TA 4GMP1 3LOIA 4OFGA 3RZLA 4AI2A 2VQ0A 5G05L 1Z0HA 1XNAA 2Q5TA 5A33B 5LA9A 4P14A 4LO5B 3KVBA 3J4UH 5DAXA 1N1TA 3OBAA 1YCIA 4RGGA 1U5IA 4F8AA 1A8MA 4ZXEA 1W2NA 2MNGA 3ELNA 1W6MB 3OGRA 1AR81 4B7KA 1UX6A 3NAPB 3LEKA 3WCSA 5AVAA 3KHBA 5CU1A 2RHPA 3PIGA 1DBNA 1QJFA 2W2IA 1AR91 3PUSA 3OPZA 3ZFGC 4GB33 2CU5A 2ILMA 1NLSA 3WG3A 2V4VA 1COV1 2YYOA 2YDEA 2ZZJA 4Q1RA 5FJHA 3S30A 1O5LA 1DGRN 1R081 1RL3A 2WZ8A 4IQPA 4IXLA 4IGPA 4ATEA 1QH7A 1SFYA 5IK8A 3ENRA 1TE1B 1XYPA 4QX7A 3NV1A 4OHYA 1S1AA 3IMNA 1XE0A 3Q8FA 4HKLA 4FPLA 4Q27A 4BWOA 1GOGA 2RR13 4CXYA 1UN1A 1SMVA 1RUE3 2GNDA 2JG9B 4OVEA 4YW4A 3NAPC 3ST7A 4CE8A 1Q5OA 1W9TA 4N53A 4HONA 1O3RA 4I2OA 4FQ4A 1PVXA 3PVEA 3M2MA 1OVSA 1DGWX 2UWCA 4MO3M 2ZACA 2V09A 4Q0QA 4NIIA 4XQWA 1LOBA 4YZ4A 2BYVE 4Y1YA 4NJ4A 5F39A 1IG3A 1Z7S2 2IFWA 4LBMA 1JU4A 1BEV1 2ZJCA 4QKDA 4OHVA 2W94A 1SG3A 3ZN6B 5A7QA 1W99A 1VR3A 2GNBA 1Q8SA 4GMP0 4ZU5A 3B9CA 1HXS1 3VBUB 3MV11 1C8M1 3SCGA 1BZWA 2JG9C 1O3QA 5FY0A 4QPWA 2Q30A 3SHRA 1K5JA 3I97A 4ONUA 2XJSA 2WZPP 3USSA 3GBWA 2W1QA 4GKYA 2PLV1 2W1SA 2HLEA 4D8MA 3WUDA 3VZOA 1FMD1 3P3NA 3T2QA 3IIIA 1AL21 1IHMA 3FHAA 2VBPA 5L73A 4AZZA 1G9FA 3PU3A 5IVBA 1CAWA 2G1MA 4PQ9A 2IFRA 4AFMA 5CISA 4GIQA 1Q8VA 4E8DA 3ATGA 1RUE2 2LUWA 1HIXA 1YWKA 4X8PA 4JDOA 4OMCA 3GBGA 3WCRA 2BEOA 2DCZA 1YFWA 4LE4A 4ITCA 5LATA 3KZ4C 1DCSA 1QXJA 3VBUC 4Q26A 5F3IA 1DQ4A 2VTXJ 1WZXA 3ZYBA 4YW1A 4CU7A 1CAVB 5FAXA 5A3UA 5A70A 2FDFA 4Q4V3 3FHQA 2GAUA 4QAWA 5J48A 2D6KA 3CZUA 4EV0A 1TMF1 1XE7A 2R6QA 1QDCA 1F9KA 1ZZ7A 4CXWA 2WABA 3DYMA 3ZVXA 4W6YA 2VBDA 2W0XA 4YZ3A 4PJYA 5IVFA 3PTYA 3U37A 4OHZA 5FXWA 4NAOA 1LENA 2HEVF 5C7GA 5H9QA 5DDJ3 1FT9A 2F4LA 4BK5A 4CCCA 1QXPA 2ZX0A 3CNAA 4CPBA 1C4RA 4LEJA 3H8OA 3LEMA 1UPIA 3LPGA 2X29A 4W6WA 5F5AA 4QPGB 4KGGA 3UNPA 2V5DA 1ASJ1 1URXA 4QKBA 4XUOA 1NAEA 3WP6A 4UOJA 5FK7A 4A7KA 5JWPA 4ASKA 1G9DA 5E1RA 2D6OX 1RUG3 3M3QA 1DDLA 1HKDA 2IZWA 3M4FA 1WCUA 4YZ5A 1CQ9A 3W21A 2XONA 1VBE3 3R0RA 2ENRA 2VMCA 1OT5A 4I0AA 4XABA 4PLOA 3RMXA 3MLLA 1KFXL 3A22A 4ZZ5A 3OGJA 3CZJA 2VR4A 3BTAA 4FBFA 4CDWA 1VMHA 1LRHA 4BQWA 4Q4V2 1BMV2 1OI6A 3LQCA 2ZABA 4Z2AA 5A1AA 4C1WA 1X8EA 2JG8A 4L97A 4XC9A 2C9KA 4QPGC 1JU3A 4KI5M 4CCOA 3OGGA 5I91A 5JOZA 2BRTA 1W6PA 4CVUA 3KV4A 2WFPA 3N9PA 3J8F3 3POFA 3OBRA 2E31A 3MUY1 1LHWA 4TZDA 5LK5A 2QQNA 2RS11 3CF6E 4MUVA 4Y5SA 3OUJA 5DDJ2 5FQ0B 2PYTA 1FX5A 3CJIA 4OYUA 3WOGA 1PGW1 2Z4FA 4EJRA 5IVJA 1QJY3 5IFTA 3AXEA 4RR3A 4NIAA 2JDZA 4URAA 3ZIXA 3RDIA 3W58A 2BP6A 5LA1A 4Q4X1 1M06G 5FYHA 2ES3A 1XNDA 2AENA 1B35A 4Q29A 1WA4A 5CIRA 2YUEA 4AF9A 3IDBB 3VDDB 4AEKA 2RS33 2XGXA 5CNAA 2W1UA 2WO2A 4LE3A 5K7PA 4K8RB 1MPXA 5FUNA 1R64A 5ACA3 1NT0A 1PMIA 1MVEA 4ZONA 3C7HA 2R063 1VBE2 3VDAA 3ZFEA 2WRAA 3GM8A 3KT1A 3WNOA 4META 5A1LA 3LWCA 1RUJ2 3GALA 4D7TA 5JVVA 1JYWA 5T52A 2ET1A 5GZCA 4NPMA 1VBB3 2D3PA 3WNLA 3FHIB 4ZY9A 2IXKA 4B4PA 2RM23 3KB5A 3KLSA 5FRAA 1XE8A 2HWC1 4QX2A 4V1PA 1AJOA 1ZX5A 2GN7A 2XJUA 4MG2A 3BGAA 5DUUA 2RJKA 5DUWA 3ORJA 3VZJA 3AKQA 3OJBA 4N43A 2A71A 4TTGA 2EXHA 4TN7A 4XJUA 3M7AA 4LO4B 1AF9A 5FXVA 2LW8A 1W9WA 5FZOA 3VDDC 4AL9A 4XAAA 2G19A 1RUF2 1W90A 1OC1A 2OS2A 4CCKA 1QF3A 4CUAA 1ODNA 2JD9A 2ZEXA 1UMHA 1H8TA 3U4SA 2VC9A 1AYN2 1NQJA 1QJY2 5CFCA 5KHHA 5EIYB 1AX2A 1OMIA 1Y7BA 3HIFA 5DQ0A 5GM0A 3G6JB 1VLNA 2MEV3 3UKTA 4ATFA 3MF9A 3DPRB 4PLMA 4MX3A 3VKLA 4OQ8A 2E33A 5CA6A 4RA0A 4NUBA 3CIHA 3RYPA 3DXUA 4ZZ8A 4W65A 4XFHA 3UETA 5C3SA 1M4WA 2AEZA 1EP0A 1D4VB 2JKBA 2Y33A 4PBOA 2QNKA 3VBFB 4CUBA 5FOJB 1G6NA 1DP0A 4XF9A 3RZHA 1ND3B 3O7OA 4QXCA 2RVAA 3HWJA 1GBGA 1MS8A 4HKWA 2YC4A 4IEYA 1V6LA 1C3HA 3LCPA 1UQXA 2XQRA 4XZUG 4A4AA 5DG2A 5J98B 1OLME 4JGZA 1H6YA 1EAH3 1SHWB 2JICA 4B1LA 3RWKX 5CBLA 1RMU3 1OQ1A 1RUD2 2XBO1 3BB6A 3GZTB 2DVAA 3N7LA 3PUAA 4H3WA 3WNKA 5I8YA 4AE2A 3DPRC 3WVJA 2JIGA 2WNVA 3FLRA 4YM1A 4CCNA 1HB4A 2ID4A 1UU6A 2B9UA 1VBD2 2D3RA 3N36A 4UI9L 1BK1A 1RUC1 3FBYA 3J26N 4YRDA 5DAPA 4D6QA 4IEZA 4RFRB 3RZMA 1J58A 4AK3A 1UAIA 5DN2A 2PHRA 4IV1B 1GWKA 1US2A 2BDRA 4Y26A 3VBFC 4EWAA 1UU4A 3O1MA 1ND3C 1PMHX 1POV3 1DIWA 4AAPA 4YG3A 2VD7A 2MEV2 4K20A 1SLBA 5CKNA 4EE2A 2EALA 1S2KA 1ZZBA 5LRSA 2D7FA 2W68A 3WLUA 1UY1A 2BW8A 3LA3A 4QPYA 2UY8A 3IDEA 1RJ8A 3MFAA 4QB6A 2FZ1A 3BTZA 3POIA 5LA2A 3ACHA 5CG9A 1GQPA 1QDOA 4WZFA 2CL2A 3RZZA 1LU2A 2NMNA 1OKQA 1Y9GA 2KM2A 2YC2A 5FPLA 2ZAAA 1F2NA 1GR3A 5JZGB 2JB4A 4PHZA 3SMHA 1VAVA 3U1XA 5ISLA 4BE3A 4XBNA 3X29B 4JRLA 1B09A 2J1SA 4IV1C 2VOWA 3CQOA 3H7YA 1JZ2A 1AYM1 5EPAA 1KS4A 2VY0A 3I3MA 4UW4A 4RQPB 4KL1A 2WWUA 4CDQA 3I2DA 3OEAA 1K5MA 1O8SA 2OQ6A 3TB0A 2WR9A 4R4XA 1WA6X 3ZOIA 4NHLA 4C91A 2ZGRA 3J9SA 3WDVA 4LT5A 5GZDA 2O14A 3O1OA 2AREA 1PGSA 5I8TA 1V9U3 5H9SA 1NY71 5ABJB 2I2SA 2ZKLA 1H9PA 5FYIA 3THDA 3MW3A 3N35A 3DXTA 1UOJA 5JZGC 5A7SA 3AMQA 2B42B 1LHNA 1QJX3 4FPCA 4DXZA 5JPNB 1NQDA 2E7TA 1AXYA 1MS1A 1RUG1 4XFCA 5T5LA 3WW3A 3RZJA 1AXZA 2QDNA 4EROA 3PDQA 4FPOB 2WT2A 4RQPC 3AB0A 4UW3A 4XETA 3AVSA 2AZ5A 2JEMA 4AVTA 3M3CA 4AGRA 1QOTA 4PIZA 1RUH3 4LHSA 2E32A 2ETEA 3PURA 4AXOA 3THCA 2GC1A 3IPVB 1JYVA 4DOUA 4IE0A 4M3CE 1QOOA 1IQAA 3TNQA 4LNVA 3USUA 4QXBA 1MVQA 5ABJC 1W06A 1ZA7A 2DU0A 4FOYA 4QT6A 5D1IA 1JZ8A 3I3QA 4EYUA 2ZX1A 3OYWA 5C4WA 2WZR3 4CP9B 3S57A 5BNOB 3DGTA 1NXD1 1S0DA 4AFDA 1ULEA 3AP7A 4LA2A 1XNCA 5DUVA 3FN9A 5L7OB 1XU1A 5FLIA 4NR1A 3TWIA 1EV12 5IW0A 4UFIA 1UOGA 5A3PA 3PVBB 4XE9A 1VIWB 4CDXB 1YC61 4HG6B 4AAXA 5C8CA 1YIFA 5EWSA 3SEEA 2C24A 1ND2B 3AJZA 2KA3A 1UKRA 4P5YA 5HI0A 1QJX2 4CEYB 4D6RA 4Z2WA 4HL0A 1MR5A 4Y20A 1A8DA 2R0FA 2D93A 4A42A 2W3JA 5FPUA 1C28A 4BXFA 4EZHA 3WHTA 5BNOC 1WCDJ 3EXUA 3NNFA 2VG9A 3I2IA 2Q0AA 3LAGA 5LY2A 4ZPIA 3H8RA 5L7OC 4HSJA 2BJSA 4INDA 4KNCA 2D3SA 5SV8A 5J3UA 3RQ0A 2Y8KA 4XACA 1BVVA 2YBSA 4TWTA 4CDXC 2WBKA 5JMOA 2TEPA 3TNPB 1TME3 3K2OA 5C3QA 4XJWA 5LWBA 3MI8A 1LJ7A 2R1DA 4CUCA 2WZR2 1ND2C 4GMP3 1X82A 1H4HA 1YFXA 4HKOA 4MGKE 1ZRDA 5FZ7A 1W8TA 1UWWA 1F5JA 2DU1A 4CU6A 2GP3A 4CEYC 2HWB2 5AVPA 1DLLA 3B02A 3KF3A 4YFWA 1ZZCA 1JOJA 3DECA 2Z79A 2C1FA 3WQBA 1NLRA 1W9SA 4LLOA 4AI1A 4CSWA 4DRVA 1AR61 3NNGA 4XJZA 5IVVA 5G04L 1AR83 5A3WA 1NA1B 5GJ6A 3WQ0A 2R043 3MIEA 4WVWA 4WV8A 4BDVB 2Y6LA 4UF0B 1ULPA 1QEXA 2V72A 3POEA 1UOBA 2WT1A 4JDMA 3UGFA 4FPEA 4MZUA 2BNOA 3AP6A 3WV6A 3M3OA 4BU2A 4Y1XA 5BYNA 2ADEA 2NZ9A 3ES4A 3KCXA 1R083 4FFGA 5F5IA 2Y34A 2ZTNA 3KGZA 3UT0A 3GCWA 4LJHA 5LBEA 4A44A 1Q56A 1QJU3 4RFT0 5FP9A 3VBRA 2ZPXA 5KXBA 2QQKA 2VCMA 3K46A 3I49A 2QBXA 4BHPA 4LBQD 1U5YA 4NROA 4N9HA 2WAOA 4C0BA 5C9AB 5IFPA 1EAH1 4LIUA 2K9ZA 5F2WA 1JOPA 4MXVA 2UU8A 3HEIA 1NA1C 2D5FA 4GH4B 1UX7A 1TME2 2FD8A 4RHV1 2J1TA 4TSVA 4R52A 4AG4A 4ZHNA 1JOBA 4OMDA 1MEC1 3MLKA 4OUMA 4XOGA 3APBA 4HZFA 1WCKA 4AVCA 4JV4A 1J1TA 1AR71 5A32B 2DVFA 4AFAA 4XIKA 3IB3A 3RS6A 1BEV3 2YPDA 3CDZB 2VJXA 3GBFA 3POJA 1AR82 4KBZA 3ZMOA 1JODA 1UL9A 4IE5A 1YEWA 2VZPA 3JCIA 3K3NA 2HWE1 4LO8A 2VZTA 2P6CA 2ZKNA 4XF0A 2P3JA 2ZGKA 1HXS3 1KDMA 1VBA3 5C9AC 1C8M3 1AR92 3DN7A 5EV7A 3MLJA 1O6UA 4XAEA 4XTMA 1BK0A 4GH4C 1TZOA 2DVBA 1COV2 4QX3A 2D43A 3CJXA 4HXCA 3ZXFA 5BPXA 2P3YA 2Y0IA 1PK6A 3WD5A 4YARA 2JJ6A 2PLV3 3WSOA 1V6NA 2WO7A 3JB4C 3V0AA 1FMD3 2WSVA 4NN0A 1V6JA 2BGOA 5K0UA 2F4PA 4Q2FA 4CDUA 2GC2A 2IUWA 3ITQA 3JU9A 2WWJA 3ZLIA 4COYA 4EN9B 3VUOA 1A3KA 5LBBA 1IGOA 3W9AA 1MS5A 4KU7A 4ES8A 2JDMA 1GOFA 2NMOA 2QCSB 2VOKA 1CAXB 4J6GA 2OX0A 4KWKA 2RDRA 4MHRA 1QQP1 1ZBA1 4NHYA 4WVZA 5FIXA 3VBOA 1R1ZA 4UAPA 2HYXA 2RDNA 4KG8A 4QD2A 4FP2A 2JG9A 4Y24A 5EP9A 4AQSA 3FLTA 2Y38A 2ZAHA 3AFGA 2ZMNA 3KWVA 1G86A 4OUSA 3N7JA 4GWMA 3WDXA 4P9IA 3CL1A 1TMF3 2WNUA 4LHKA 3VHPA 2WO3A 5FZCA 3VD5A 5K8SA 2D97A 1UO9A 2P5BA 1MS9A 1UYZA 4AGGA 2CY6A 5JSOA 3ACFA 1VMFA 2PHTA 4QKFA 3EBRA 2WT0A 2C26A 1W8NA
chains in the Genus database with same CATH topology
1XB9A 3T30A 2VTXJ 4CA9A 5EHDA 1NLQA 1K5JA 4N8MA 1XE0A 2P1BA 2VTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB9 A;  3T30 A;  2VTX J;  4CA9 A;  5EHD A;  1NLQ A;  1K5J A;  4N8M A;  1XE0 A;  2P1B A;  2VTX A; 
#chains in the Genus database with same CATH topology
 5DZF A;  2IVI B;  1JZ7 A;  1FYU A;  1MAC A;  3J7L A;  4E4S A;  3I3D A;  4CP2 A;  1HXS 2;  2J7M A;  1C8M 2;  4FSJ A;  2P3K A;  4DIQ A;  5GLT A;  3HVD A;  4FPY A;  3VBS A;  2XJV A;  1QU0 A;  4LMF A;  3N9O A;  2WS9 2;  3WXP A;  3KV9 A;  3N7M A;  1K3I A;  3HMY A;  4Y4R A;  1YXW A;  1ASJ 3;  1XNT A;  5F37 A;  1O4Z A;  4R9C A;  4YW7 A;  1FMD 2;  4OI1 A;  5DG1 A;  1CZT A;  1WW4 A;  1AL2 2;  2YG0 A;  3HOB A;  4YLZ A;  5FV3 A;  1H1A A;  3C3V A;  1C1F A;  1PIV 2;  1RUI 3;  3KSC A;  3M1H A;  4AVS A;  3W5N A;  3AP4 A;  4LK6 A;  4IV3 B;  3MW2 A;  4AWD A;  1S2E A;  1OFN A;  2X5I A;  3M70 A;  3ZYG A;  4DPN A;  4FPF A;  5FZB A;  5FP4 A;  1DQ0 A;  2QKD A;  3WF1 A;  4I0W B;  1EPZ A;  4JRA A;  4OI2 A;  2ORZ A;  4IW3 A;  4FTB A;  1MS3 A;  2X10 A;  4GWI A;  1W9F A;  4LO7 A;  2E53 A;  5HV4 A;  2DBN A;  1IOA A;  2W91 A;  4I3G A;  2E63 A;  1ZRF A;  5KC6 A;  1SDD B;  2QQM A;  4K21 A;  4BQ2 A;  3MIF A;  1W2T A;  1ODM A;  1JZ6 A;  1FAT A;  1HRV 1;  2ZMK A;  4JGY A;  2ZX2 A;  3OY8 A;  2PA7 A;  1I5Z A;  4XMA A;  1ONA A;  2VZS A;  2YMZ A;  3PL0 A;  2J1E A;  5KR7 A;  1R1A 2;  1ULO A;  5C5T A;  3O12 A;  3VD4 A;  1NXM A;  4BB3 A;  4IGQ A;  2E9Q A;  2CWM A;  1HDK A;  4L92 A;  5F32 A;  4EQV A;  3WHU A;  5JXJ A;  5JOY A;  3AZZ A;  3HN1 A;  3KM5 A;  4FFI A;  3TAY A;  5I0R A;  1JYT A;  4IV3 C;  4K3U A;  1PGL 1;  2V5Y A;  5FYC A;  1DU3 D;  1GWM A;  2IWG B;  3I59 A;  1DG6 A;  3F2Z A;  5EYY A;  4E27 A;  1GZW A;  4QPI B;  3RJ2 X;  2R32 A;  3MIH A;  4XJA A;  1XNK A;  5GZF A;  4B3N A;  4Q4X 3;  5LAS A;  5L9B A;  4RL7 A;  1GYK A;  3OF1 A;  1XRU A;  5ERL A;  4B7E A;  4DNY A;  2CDO A;  3ZYJ B;  4XUT A;  3T0B A;  3V0B B;  2RS5 3;  1PO1 2;  1DHK B;  3WNM A;  4L8Q A;  4QQO A;  4XUN A;  4ZKT B;  5F3E A;  4PI2 A;  1D0H A;  1ENQ A;  3TYJ A;  4NWV A;  4IEX A;  1YLL A;  4F83 A;  3WR0 A;  4L9B A;  2FDJ A;  3WF0 A;  3SKV A;  4BQX A;  4OCT A;  2E51 A;  2XL7 A;  2Q1F A;  1OPM A;  2JB8 A;  4XTP A;  4M0N A;  1HB2 A;  3AXD A;  3KQR A;  5D8A B;  5J7M A;  2HWC 3;  3MBW A;  4QPI C;  3H9A A;  5EFU A;  5FR3 A;  4QX1 A;  3NVC A;  2R04 1;  5FO7 B;  2BQP A;  2GC0 A;  4O9G A;  3AMP A;  2NYY A;  3AKP A;  3H3U A;  3K3O A;  1IQD C;  3WG1 A;  2AH2 A;  3KD4 A;  4FXK B;  3IWZ A;  3OGV A;  4YG6 A;  1F4H A;  4UFK A;  1HB1 A;  5FZ3 A;  3ZKY A;  4BIS A;  2VZ1 A;  1NUK A;  3UES A;  4U2A A;  2WLP A;  2D6P A;  1W8Z A;  1LKN A;  2L9L A;  3D0J A;  3HPN A;  4YNI A;  1JHJ A;  2HWD 2;  2RS1 2;  2PHF A;  4LXL A;  3K75 B;  1NZC A;  5HBA A;  5T55 A;  2G9G A;  2RDQ A;  2CYF A;  3HT2 A;  5CKQ A;  2WJS A;  4Q8L A;  1WMF A;  4H2A A;  3B00 A;  4A7Z A;  1QJU 1;  3ZXK A;  3HQR A;  1NE6 A;  4Q4X 2;  1C57 A;  1VMJ A;  2W47 A;  1UOF A;  3JBG 1;  5EZW A;  3U78 A;  3RPQ A;  3AZV A;  1PX3 A;  4RN5 A;  4M4P A;  4CCD A;  5D8A C;  4DXS A;  5FO9 B;  1NCR B;  1R09 2;  1ZBE 2;  3QAC A;  4LIV A;  5DMY A;  2R0H A;  4AEJ A;  1WLC A;  1RYY A;  1OA4 A;  4K7J A;  3MFC A;  5GLZ A;  1HRI 1;  4LHL A;  3JXS A;  4D7Y A;  2DF7 A;  1JYI A;  2JIJ A;  2RDS A;  1YI7 A;  3TOJ A;  1XJA A;  3P3P A;  5JUV A;  1ZYB A;  4CXX A;  3WUC A;  4MXW B;  1G9B A;  1POQ A;  3E5X A;  1SPP B;  4WM8 B;  1J1L A;  3IBM A;  3I2F A;  4FVV A;  2ZEY A;  1UZW A;  2DBI A;  3I2J A;  4N7I A;  3NV4 A;  4ZU4 A;  5KXD A;  2XBO 3;  5A6Q A;  2YBP A;  4PDW A;  1AJK A;  2R16 A;  4QB1 A;  5AFE A;  4NPR A;  5HV0 A;  5EHD A;  4Q0S A;  2BER A;  1IG0 A;  2HWF 1;  5IVC A;  2VZ3 A;  1VBA 1;  5JDB A;  4LBL A;  1RUC 3;  1SLC A;  1OBN A;  4MGY E;  2H0V A;  1OQE A;  1NCR C;  1QNY A;  2J1U A;  4GB3 2;  3TEZ A;  1QH6 A;  1YJK A;  3C2U A;  5APA A;  3W59 A;  5ACA 2;  2JDY A;  5A7N A;  3WW4 A;  1WD3 A;  2W52 A;  3T0D A;  1STM A;  5GLU A;  1ALY A;  3VLB B;  1GOH A;  3WW1 A;  1O3T A;  1Y9M A;  2PFW A;  3D8C A;  3PME A;  1G8W A;  4SLI A;  4H7M A;  4Y22 B;  3GGL A;  3WDT A;  5JSR A;  4CTE A;  5FO8 B;  1U5X A;  1PNG A;  2W1W A;  3DYP A;  2WO1 A;  3MIC A;  4TXW A;  1QGL A;  2VNV A;  4HT1 T;  4LBQ B;  4WM8 C;  2RR1 2;  2CV6 A;  3UGG A;  3OGS A;  2P17 A;  3WY6 A;  4UFJ A;  4LKE A;  3HN3 A;  4Q5O A;  3ZFF B;  2JDK A;  3ZYF A;  1A34 A;  3IAP A;  2JDH A;  4AW7 A;  4BLJ A;  4ARY A;  3VN4 A;  4X8N A;  5K9Y A;  1O4T A;  3FUO A;  3C7E A;  5LRR A;  5EQU A;  1OUX A;  4HAN A;  4M3C A;  5I8S A;  4ISQ A;  3ZDS A;  4YGE A;  2NPI A;  2YGM A;  3VZN A;  4Q4Y 1;  1ND3 A;  1AYM 3;  5A7W B;  3VKM A;  5JIU A;  3MUZ 1;  1YFY A;  3H1Y A;  2EIB A;  2YFZ A;  4CA9 A;  3JB8 A;  3B01 A;  2W08 A;  1NCQ A;  1OXC A;  3BOP A;  3FLP A;  3NKT A;  1ZNP A;  4JKL A;  5IHR A;  1GSL A;  1MQT B;  2XH6 A;  3A7Q A;  1T2X A;  1PGL 2;  3ZIW A;  1D7P M;  2XLF A;  1UMZ A;  2WDB A;  3HD8 B;  3AYC A;  1J83 A;  1OA3 A;  1RUC 2;  1W8H A;  2WFF 1;  4GJY A;  2KR2 A;  5FCC A;  3ZFF C;  2WN3 A;  4Q0P A;  4IDZ A;  1WLT A;  5KBF A;  4NHK A;  4NHX A;  1W9Y A;  2YBK A;  1BQP A;  2DWR A;  1BJQ A;  1BLZ A;  1U5Z A;  2VAU A;  4YW5 A;  4YFZ A;  4CU8 A;  2VCB A;  2VUC A;  2XJQ A;  1JXN A;  1W8W A;  1RUI 1;  1XOY A;  3FWE A;  2A75 A;  1MZ6 A;  1KIT A;  3WDY A;  1FPN 1;  2VZO A;  3LEG A;  3VGI A;  1QOS A;  3HQU A;  1FOD 1;  2RE9 A;  2VL4 A;  3SKJ E;  2N7G A;  5J1X A;  1MQT C;  2LTN A;  3PU8 A;  2X09 A;  1CIY A;  2XVG A;  2VMF A;  3EMR A;  1UNB A;  4I0B A;  1SCR A;  4LR4 A;  4A41 A;  4DIN B;  1NX9 A;  3PLQ A;  1H2L A;  4YPJ A;  2CAV A;  3CU7 A;  1OOP A;  5FP7 A;  5LBF A;  3RYK A;  5B4N A;  5T5J A;  1MZ5 A;  4ET7 A;  3AX4 A;  4PT6 A;  1NKG A;  1AYM 2;  5IUQ A;  4CRQ A;  5BNP A;  1I6X A;  3N9N A;  1T6G C;  1HB3 A;  3AC0 A;  3U4X A;  1EUU A;  1Q3E A;  3LSD A;  5FMO S;  5DZG A;  1EY2 A;  3ZKU A;  5E89 A;  3H1W A;  4WVV A;  4UYB A;  1S2B A;  5FYB A;  1L7Q A;  1L7R A;  3D5O A;  4HVR A;  3T0A A;  4FFF A;  4BJ0 A;  3VZM A;  2I07 B;  1G9A A;  1TQ5 A;  1KXG A;  1JYX A;  2QE3 A;  1W0N A;  5C71 A;  1CPN A;  3OD4 A;  2E6V A;  3QH7 A;  4IE7 A;  5HXV A;  2DV9 A;  3OBZ A;  4HN0 A;  1YNA A;  2D98 A;  5JI7 A;  1ZRC A;  5FZ8 A;  3SIS A;  3VD3 A;  2O8O A;  1CZV A;  2RS5 1;  2VOV A;  2VQU A;  3HAG A;  3WT3 A;  4RD7 A;  1RUG 2;  4IEU A;  4E2S A;  4FPH A;  1VAL A;  2IVJ A;  3DUI A;  4LUM A;  5L19 A;  2P6H A;  3NNL A;  3WNN A;  3B5L B;  1GAN A;  4QQH A;  1Y9Q A;  5FY8 A;  2X05 A;  4NID A;  5FMO L;  1HQL A;  1S0C A;  4Y3O A;  2WNO A;  1QXR A;  2FCT A;  4DXR A;  4WBB A;  1Q8P A;  4OHX A;  4N53 B;  4DS0 A;  4PF1 A;  2ZOE B;  4Q1P A;  1UZV A;  1KJL A;  3WF4 A;  1W6N B;  1W6O A;  2Y6F A;  3OUI A;  3BU0 A;  2WA3 A;  1C1L A;  2XUM A;  2EVX A;  2WQZ C;  2NQY A;  2VCA A;  4FP3 A;  1I3H A;  3POS A;  3VB9 A;  2HJI A;  2BTV C;  3WQ7 A;  2ZX4 A;  3J8F 2;  3R05 A;  2GAL A;  1XSR A;  3NJZ A;  1WME A;  2YY1 A;  1VJ2 A;  4FQZ A;  4IEV A;  3MPP G;  5FPV A;  1D2S A;  1DGL A;  1AR6 3;  1O4Y A;  4MH0 E;  5CKM A;  1LOF A;  4COU A;  4BH9 A;  2VMH A;  4V2V A;  2HEW F;  4E9K A;  5L7O A;  1Z7S 1;  3FE5 A;  3ZSE A;  5F3C A;  2JDU A;  2D6M A;  3I4I A;  1LOA A;  4Y1U A;  4QXK A;  2I74 A;  4N53 C;  2RS3 2;  2JWP A;  4A2U A;  1ZZ9 A;  2GMM A;  3OD0 A;  2BOJ A;  3LE0 A;  3VL8 A;  1UIK A;  2ZGQ A;  4BIO A;  4BQY A;  1C5I A;  4QXH A;  1UY3 A;  2R06 2;  1W2O A;  3LA7 A;  5L9R A;  2LAL A;  2ORX A;  2QJV A;  2VE1 A;  3LDR A;  3QCW A;  4HFS A;  4K1Y A;  4Q4W 3;  5FP8 A;  3T1M A;  4XQ4 A;  4LUL A;  3VHN A;  4L99 A;  2LS6 A;  3MZH A;  3ROU A;  2AUY A;  1VBB 2;  5FYZ A;  1RTV A;  3VHO A;  2RM2 2;  1AZD A;  2QQW A;  1WCS A;  1DFQ A;  1EPW A;  3J7N A;  4XHX A;  4RHV 3;  4GD4 A;  4XQD A;  4XDP A;  5FXX A;  3WEZ A;  2XKO A;  3OEB A;  4NOT A;  2FCU A;  2TNF A;  1X7N A;  3O1V A;  1O59 A;  1MEC 3;  1FXZ A;  1QY4 A;  1PVC 1;  3AK0 A;  1BCX A;  1C8N A;  2ZHL A;  4QX8 A;  5AC9 3;  4BCU A;  2EXI A;  1AR7 3;  2ZML A;  4KQ7 A;  4HBN A;  5ANN A;  4CEW A;  5JLV A;  5A7P A;  5LA0 A;  4J25 A;  5IK4 A;  4O65 A;  3TN9 3;  2VGD A;  4AI9 A;  1GNY A;  1YQ8 A;  5H9R A;  2JE9 A;  3L9J T;  1SFN A;  2HWE 3;  4KWU A;  3VV1 A;  1O7F A;  2O1Q A;  4GUL A;  3Q9O A;  3ZXJ A;  3AMH A;  5A6Z A;  5BY5 A;  4RYD A;  5DZE A;  1BHG A;  3LB9 A;  5JPM B;  1J84 A;  1NA1 A;  1UPS A;  2RJ2 A;  4PIY A;  5DUX A;  5FYT A;  2VMI A;  4URT A;  5A7O A;  4AHZ A;  4BM8 A;  1H1I A;  1CVN A;  2PAE A;  3BN6 A;  1N47 A;  2VBB A;  4PCR A;  4XPV A;  1DZR A;  5FYS A;  1N3P A;  3BYW A;  4JKM A;  1SBF A;  3WP3 A;  2VW1 A;  4GKX A;  3ZXA C;  5I0U A;  4QGL A;  3UYJ A;  3RZG A;  4DO0 A;  1EAH 2;  4D94 A;  2DUO A;  4PF5 A;  3E1F 1;  1RMU 2;  2XQX A;  1OHF A;  2DDU A;  3AFK A;  3NO8 A;  4BMB A;  1QQP 3;  1ZBA 3;  3BCW A;  3JUU A;  4P08 A;  4CDW B;  5DAB A;  4JCK A;  4P02 B;  1UY2 A;  2PHD A;  4UXA A;  5E88 A;  2C4X A;  1S55 A;  2JG8 B;  3N9L A;  5T3N A;  3VD9 A;  4G4F A;  1X50 A;  1WLD A;  4AQT A;  1AR7 2;  3OG2 A;  4YVS A;  3C7G A;  4OQ9 A;  1BMV 1;  3PHM A;  4U36 A;  3NV2 A;  2C0Z A;  3GHN A;  1F5F A;  3B69 A;  4W4Z A;  1CAU A;  1BBT 1;  1DZQ A;  4YGC A;  5E6H A;  1OD5 A;  3BOD A;  4JAA A;  4YVW A;  5SV5 A;  4DEQ A;  1DF0 A;  3H42 B;  2R07 1;  3A4U A;  4RS5 A;  2HWE 2;  5F2S A;  3U11 A;  5FOB B;  5A3N A;  2XHK A;  2BGP A;  3R4S A;  2HBT A;  3CJI B;  3NV3 A;  3VBH A;  5FLJ A;  2JEC A;  3IDA A;  1WLW A;  4RR3 B;  4R9B A;  1GU3 A;  3WDW A;  3N3H A;  4A6S A;  3ACI A;  4AVB A;  3NL1 A;  3IT8 A;  1E5I A;  4WVM B;  3RWN A;  3SH3 A;  1HQN A;  1YQ2 A;  2GZW A;  2ZX3 A;  4NRP A;  4H55 A;  4CDW C;  4QM8 A;  1S0G A;  3BI3 A;  2VCC A;  3I7D A;  1AUY A;  2ZHK A;  1GNH A;  3CHX A;  1YJL A;  2JG8 C;  2WL1 A;  3FZ3 A;  5FXZ A;  4ES9 A;  2VTX A;  5FMC A;  1LEC A;  3FJS A;  5JXG A;  3ZFE B;  2IXJ A;  1JS9 A;  4EN0 A;  1VB2 A;  2DTY A;  2WUH A;  1YI9 A;  3ZR5 A;  1WW6 A;  3AMN A;  3H3Z A;  4LOS A;  2DTW A;  4FPG A;  4BYY A;  1ZBA 2;  5A3T A;  3DCQ A;  2VQT A;  5FY4 A;  3CJI C;  4Q0V A;  1QWR A;  2ZGS A;  1RGS A;  4RGA A;  4AEM A;  5LZ6 A;  4RR3 C;  4YW3 A;  2JE8 A;  4C8D A;  4XF4 A;  4IGO A;  1HRV 3;  1V9U 2;  2WYF A;  3NJV A;  4QGN A;  5FYM A;  3DEM A;  3AKT A;  4OZO A;  1GV9 A;  1LOE A;  1GZT A;  1N1S A;  2IC1 A;  1PHM A;  2A5Z A;  4NHM A;  5FZO B;  3RSJ A;  5C3P A;  1DGW A;  1RHI 1;  1WWY A;  1CR7 A;  2ZEW A;  3A21 A;  1OLR A;  3QLQ A;  3QOP A;  4QDS A;  4JTN A;  5FPZ A;  1H0B A;  1VAK A;  3BU7 A;  3AZY A;  1H8T B;  3CO2 A;  3UKV A;  3WF2 A;  4NPL A;  3ZFE C;  5CFC B;  3K4D A;  1XXN A;  2CDP A;  4JX0 A;  2HBU A;  3WP5 A;  5BNN A;  5LEK A;  3HR9 A;  2FBE A;  1UXZ A;  4Y4Y A;  1F35 A;  4K6B A;  4UBG A;  4NMI A;  1W6Q A;  1ULG A;  1RUH 2;  4XFI A;  2A1X A;  2PQS A;  2B7Y A;  4GA9 A;  4B29 A;  1XSQ A;  4Q0U A;  2QQP A;  2ZGT A;  2YC0 A;  5KHG A;  5FZ4 A;  3ABZ A;  3PIJ A;  2VUJ A;  4H14 A;  4PI0 A;  1W0O A;  5CFD A;  3ZN4 A;  3THP A;  3BUC A;  3ZXL A;  1DYK A;  1FV2 A;  1REE A;  3N9M A;  3POG A;  3RI9 A;  2MPF A;  3DYO A;  4JGZ B;  4WM7 A;  2WZE A;  3RMY A;  1H8T C;  3RRD A;  1K12 A;  2Y60 A;  5D2A A;  3KS7 A;  1LGB A;  4P9L A;  1W03 A;  2OQ7 A;  5CFC C;  2ZBJ A;  4MV2 A;  1Y43 B;  1I1E A;  2PEL A;  2Q8D A;  3WX5 A;  4FOV A;  2WNV B;  3ME2 A;  1LU1 A;  1AX0 A;  4LTA A;  3AYA A;  1PNF A;  4AVA A;  1ULC A;  3D82 A;  1OQD A;  3PTR B;  3WNX A;  2YHJ A;  1DQ5 A;  5C3O A;  3MF6 A;  4L0P A;  2DUR A;  1ZRR A;  3ECQ A;  5FZE A;  2EXK A;  5DAW A;  1AXK A;  1ZZ6 A;  2W95 A;  4I30 A;  2B4K A;  3MEP A;  5BXX A;  4MGT A;  3VD7 A;  1AX1 A;  3CKH A;  2F6B A;  3BIE A;  3DL3 A;  3RFR A;  4IER A;  3GF6 A;  3OPW A;  3PUH A;  4IEQ A;  1LTE A;  4JVA A;  5F6K A;  4LHN A;  4P9J A;  4Q4W 1;  4JGZ C;  5CEH A;  2NP0 A;  2XOM A;  3ZR6 A;  3JBG 3;  3JD7 3;  2K0G A;  1N1Y A;  2FMY A;  2BZD A;  3FMG A;  3NQH A;  2D5H A;  2AYH A;  3M3I A;  4QHZ A;  3WDU A;  4Q8K A;  5I0D A;  5JI9 A;  4R9D A;  4LPL A;  1CGP A;  1PO2 1;  2YPJ A;  2WNV C;  3CMG A;  3PMS A;  5GKA C;  3VL9 A;  4GXL A;  3U75 A;  1JZ5 A;  1OUR A;  1V6K A;  2DCJ A;  3SCH A;  4LBN A;  3NNJ A;  2ZGP A;  1LOG A;  3BPZ A;  4CCM A;  1HRI 3;  2ZGU A;  2A3X A;  3ZFG A;  3HBZ A;  1AHS A;  3E5Q A;  1VAM A;  3Q8B A;  4CZS A;  1KJR A;  2PHU A;  3FFZ A;  5AC9 1;  5EJ3 A;  2R7E B;  3I54 A;  4CYD A;  2FMD A;  4JC1 A;  4CDQ B;  3KT4 A;  2JDP A;  5A6X A;  1K5M B;  1CX4 A;  2QQV A;  5A33 A;  1OPO A;  3TN9 1;  5IK7 A;  2XXZ A;  3B9I A;  2DCK A;  1UYX A;  2R04 2;  4B4Q A;  1GZ9 A;  4HLT A;  2FQP A;  1MZF A;  4S2D A;  2YFU A;  5FZ0 A;  2HWF 3;  4A45 A;  5KWR A;  1E5H A;  1W6M A;  3URF A;  4N90 A;  4D0Q A;  3WW2 A;  3MDP A;  3NAP A;  3KCY A;  2XVK A;  1RIN A;  1JBC A;  4IL7 A;  4QHO A;  3ZN5 A;  3THT A;  3FX3 A;  4XF3 A;  5F8P A;  1R08 2;  5B4X A;  1D4M 3;  1REF A;  3UL2 A;  5FTT C;  3OTF A;  3SXW A;  3T09 A;  5FZ6 A;  2EXJ A;  4QQL A;  4PQQ A;  4XJ9 A;  4FCA A;  1HJG A;  1QJU 2;  4FI9 A;  4DXT A;  2JKX A;  1IPS A;  2X53 S;  3UGH A;  4GZ9 A;  4QMA A;  4CDQ C;  1DQ2 A;  4LA3 A;  1K5M C;  2XPJ A;  3BOW A;  3RG0 A;  3CEW A;  1MS0 A;  3GNE A;  1S0F A;  3GZU C;  4HN1 A;  2VM9 A;  1YYN A;  5DXD A;  5I0T A;  4E4D X;  5CYY A;  5IT6 A;  1UU5 A;  2E7A A;  5LB6 A;  3T3Y A;  1PM4 A;  1SZB A;  5IWF A;  1CES A;  3ZSM A;  5C4W B;  3CBN A;  4Q4Y 3;  2VUA A;  1TG7 A;  4BXS V;  4COV A;  5F1R A;  1BEV 2;  1UY0 A;  4HPK B;  4P5H A;  3SNM A;  3GZE A;  3AMM A;  4HK8 A;  4I3P A;  2CNA A;  2ZHM A;  1SPP A;  2HWF 2;  1LEM A;  2B9V A;  4FTS A;  1VBC 1;  1VBA 2;  4GWJ A;  5FZD A;  2WFF 3;  4LLF A;  4XIL A;  1E5S A;  3ZN6 A;  1H1M A;  5C8C B;  2VZQ A;  1E57 A;  2IXH A;  2QVS B;  5JR2 A;  1EV1 1;  1F31 A;  1WBL A;  4DQA A;  4Z8B A;  5BV6 A;  3VBU A;  1UCX A;  3AP5 A;  3FUQ A;  2XWB B;  3KQ4 B;  1LR5 A;  3IM0 A;  2PLV 2;  1GIC A;  4XUQ A;  2A6Z A;  4AHY A;  1IS4 A;  4YWA A;  4AI3 A;  4Y20 B;  1RED A;  2B46 X;  2ET7 A;  5FY5 A;  3B93 A;  3KHC A;  5C4W C;  1WW7 A;  3GZA A;  1FPN 3;  4XCB A;  2GU9 A;  2Z5W A;  5IK5 A;  5T5P A;  1GNZ A;  1LHV A;  2EID A;  1FOD 3;  1LB2 A;  4AFC A;  5T50 A;  4I01 A;  1GWL A;  2RV9 A;  1O5U A;  1YUD A;  2GMP A;  3UKN A;  1KGY A;  4A3Z A;  4LBQ A;  1ULF A;  4E4Z A;  5TSW A;  1PZ7 A;  3AKS A;  4HMZ A;  2X8K A;  2HYK A;  4D7S A;  2QQO A;  4Z07 A;  4O61 A;  1E5R A;  5C8C C;  4DUX A;  1TVG A;  4YGB A;  1Y4W A;  2J22 A;  4CCL A;  1TMF 2;  3MYX A;  3J7H A;  1VE0 A;  1IKP A;  2GNM A;  1CAV A;  5HCH A;  1GMM A;  4YW6 A;  3S6P A;  5FRE A;  4M0H A;  2XML A;  3ILN A;  4IUG A;  4XF1 A;  5FYV A;  3R4D B;  2ARC A;  2HWB 1;  2QQJ A;  5C33 A;  5GAL A;  2BOI A;  5FPB A;  2VMD A;  1V6I A;  4AI0 A;  1SLL A;  3PUQ A;  4XW3 A;  4AOC A;  1GFF 2;  4JQR A;  4EWE A;  5B2G B;  1ZRI A;  1K45 A;  4QU2 A;  4UT5 A;  4BA6 A;  1IPK A;  3LFI A;  1ASJ 2;  1Q8Q A;  1VB4 A;  3ZSL A;  2RMU 1;  2NM1 A;  2J42 A;  5LCW L;  1LHO A;  4LKS A;  2FCV A;  4TLF A;  4LBJ A;  4CCE A;  5H9P A;  1RUI 2;  4UFH A;  5D21 A;  3KT7 A;  4QPG A;  2VOT A;  2A6V A;  4KMQ A;  1FOD 2;  4YZ1 A;  3GYD A;  5GLV A;  4LBK A;  3VBR B;  2P4E A;  3KV5 A;  3MGU A;  3NW4 A;  2R1B A;  5M0T A;  1DYP A;  1NG0 A;  1X36 A;  2W5F A;  3BIW E;  4E8C A;  4HVO A;  3ETP A;  4JQT A;  5FZM A;  4A7Y A;  1OLM A;  3GCX A;  1ST8 A;  2HKX A;  3P1I A;  3AVR A;  5CVR A;  4W50 A;  3LA2 A;  5GZE A;  1GP5 A;  5EYX A;  2BUK A;  4BIF A;  5F9T A;  1VRH 1;  1RVF 1;  4ZS2 A;  3UK9 A;  4K40 A;  1L3J A;  1S0B A;  4GAZ A;  5EXO A;  5HXM A;  2QFE A;  3RZK A;  1NOV A;  1NZI A;  2Q1Z B;  3HNM A;  4I02 A;  4AVV A;  1P8J A;  4QQP A;  2ATF A;  5LEJ A;  2VXJ A;  5L36 A;  4EN8 B;  3KF5 A;  1FNY A;  2ZA9 A;  1H30 A;  1PGW 2;  3S0M A;  2VEC A;  2XWJ B;  3VBR C;  4D3W A;  4COW A;  1G9C A;  4OI0 A;  1Z7S 3;  2OW4 A;  2VTF A;  4N7U A;  2E26 A;  2LM3 A;  4UFM A;  3SH5 A;  5FQ0 A;  4XBQ A;  3JD7 1;  3O5S A;  5LBC A;  3S5A A;  4CPB D;  4G9S B;  4YG0 A;  3O0W A;  5FY7 A;  1YFU A;  2RS5 2;  4I09 A;  1Q8O A;  1PK6 B;  2W46 A;  4JHT A;  1UF2 C;  2J1R A;  1X8M A;  2B45 X;  2TUN A;  3V0A B;  4AED A;  2C5D A;  4M3C F;  3VDD A;  4QM9 A;  5FBZ A;  3VZL A;  1CN1 A;  5K0U B;  1JYC A;  2Y0O A;  4CDU B;  5LY1 A;  2RG4 A;  5JAX A;  5JXH A;  2A3W A;  2WKK A;  2PMW B;  3NNM A;  1UD1 A;  4OUL A;  4AFB A;  1RC6 A;  2A6Y A;  3C7O A;  2VPV A;  4XFB A;  4AYU A;  2HWC 2;  3VBO B;  2OPW A;  2ARA A;  5CG8 A;  5C8W A;  4JZR A;  3RVH A;  5ANQ A;  1CZS A;  3HQX A;  1GP4 A;  2QQI A;  4QX5 A;  1UZ0 A;  4KWL A;  1J3Q A;  3ZO0 B;  2VQA A;  1PVC 3;  4NIG A;  1W6N A;  2VU9 A;  3D4K A;  2WNU B;  3T1L A;  5HCA A;  1A6C A;  1PK6 C;  1N3Q A;  2CSG A;  4L2N A;  1D4M 1;  3H0O A;  2XJR A;  2J1A A;  4HOO A;  4AQ2 A;  1LGC A;  4XJ8 A;  4XVH A;  5K0U C;  1SDW A;  4QHB A;  4CDU C;  5FZ9 A;  4BQ4 A;  3MHZ A;  1WMD A;  4J1X A;  2CTV A;  1RIR A;  2VUL A;  4OI4 A;  1AVB A;  1SQ4 A;  5T5O A;  3VBS B;  4R9A A;  4ZXK A;  4MHU A;  5KHI A;  5FZK A;  3LKJ A;  3DF0 A;  1SLI A;  3WNP A;  3VBO C;  1ZRE A;  3B7M A;  4MGQ A;  3DPR A;  2QZ2 A;  4OUE A;  4S2H A;  4BK4 A;  2J1V A;  3BTY A;  4X6Q B;  3VDB A;  2ADD A;  5T54 A;  2WQ4 A;  3POB A;  5CAD A;  2GDF A;  2WS9 1;  4XFA A;  2ARX A;  2OPK A;  2WNU C;  4FAH A;  4ZU7 A;  3VBF A;  1EUT A;  2NLR A;  2X5I B;  1V00 A;  1W04 A;  3KCC A;  3W5M A;  1W2U A;  2WLQ A;  1PIV 1;  2VXR A;  2A6W A;  2XBO 2;  3EO6 A;  4NVP A;  2Q1M A;  5BUV A;  1IS3 A;  3GXU A;  3OBT A;  3VBS C;  3Q8E A;  3EQE A;  5JSP A;  3AYE A;  3PVO A;  1Z78 A;  4JGY B;  1PVC 2;  3OY8 B;  2R30 A;  1LOC A;  3POY A;  2BNM A;  1OA2 A;  3T2P A;  3TEY A;  3J7M A;  4BLI A;  3OOX A;  4S2G A;  1W3V A;  4NE9 A;  3GJA A;  2Y26 A;  1BBT 3;  2V73 A;  5C70 A;  1XQN A;  5FJK A;  1OH4 A;  2GH8 A;  2R07 3;  3EHK A;  3I8T A;  2C9A A;  4IV1 A;  5A80 A;  1RXF A;  5JR7 B;  1R1A 1;  2X5I C;  5E16 A;  3S7E A;  4LQR A;  4DY3 A;  1CJD A;  3I59 B;  4DZG A;  2DFB A;  2PAK A;  1GZW B;  3GHM A;  4W8J A;  5IVY A;  4D69 A;  1RB8 G;  3UJQ A;  4ASM B;  4AGV A;  3DKQ A;  5C6C A;  1N3O A;  2HH9 A;  4NRQ A;  2PQQ A;  4JGY C;  1H2K A;  1LED A;  1OSG A;  2GME A;  2IXC A;  4W6X A;  1O3S A;  4J1W A;  4BME A;  5BNQ A;  3ALQ A;  5FUI A;  5J96 B;  4COZ A;  1LCL A;  1LUL A;  1X9P A;  2ZZQ A;  3ZXD A;  5JZG A;  2FDI A;  1PO1 1;  2E7Q A;  2UYA A;  1GQH A;  3KGL A;  3KVA A;  4XUR A;  1QMJ A;  1YQC A;  1J3P A;  1FV3 A;  3V56 A;  4XIO A;  2GP5 A;  3ZPO A;  4BOW A;  5HPO A;  2BPA 2;  2FDH A;  1RUJ 3;  4K1Z A;  2XLG A;  2D44 A;  3EB7 A;  4RQP A;  3SLI A;  4FOW A;  5KHK A;  1NY7 2;  2EAK A;  4ISR A;  2PXJ A;  1W28 A;  1JHN A;  3IZO A;  4B4R A;  2Q8E A;  1JYN A;  2A6X A;  4BZ4 A;  3RNS A;  3LPF A;  4IES A;  1BBT 2;  2A7A A;  1RHI 3;  2R07 2;  5ABJ A;  3D0S A;  4CCJ A;  3K4Z A;  2XLA A;  3LZZ A;  5FMD A;  1RUF 3;  1MZE A;  2YV8 A;  1S0J A;  4QU1 A;  2H0B A;  3QH6 A;  3BKZ A;  2HWD 1;  1QJE A;  2G4I A;  4O9E A;  1NYW A;  1WGP A;  3OUH A;  5JXI A;  4LBO A;  5FKC A;  1AYN 3;  3TRS B;  1D0G A;  2GNT A;  1X33 A;  1I9R A;  2JE7 A;  4XFG A;  2EIC A;  1YQ5 A;  4D6S A;  3MV0 1;  1XC6 A;  4WVM A;  1W2A X;  2W39 A;  5A3L A;  4QDQ A;  2W87 A;  3GJB A;  3TEX A;  1R09 1;  3IPV A;  1ZBE 1;  2CGO A;  2YU2 A;  4XEZ A;  3ZYI B;  2DVD A;  2XHN A;  1SLT A;  4XXP A;  1F8V A;  2VW0 A;  3K4A A;  4DUV A;  3E5U A;  1SBE A;  4S2F A;  5FZL A;  5JMC A;  3AP9 A;  1DYO A;  2ZGL A;  5JIA A;  1IZ3 A;  4OHW A;  4QWN A;  4E2Q A;  1J59 A;  4CP9 A;  2YZ4 A;  4DRR A;  2JDN A;  2WAA A;  4HVQ A;  3IDC B;  4PDW B;  4P9G A;  5BNO A;  2DYC A;  1LHU A;  2P1B A;  2P34 A;  1CX1 A;  4G3Y C;  1OUS A;  1RUD 3;  3VHR A;  4A3X A;  1RHI 2;  2NN8 A;  4GWN A;  2ZS6 B;  1YO8 A;  4CDX A;  1OKO A;  2EA7 A;  2D6N A;  2PN5 A;  2XDV A;  2XL9 A;  4GJZ A;  4MVT A;  3SH4 A;  3T4V A;  3G7D A;  1VBD 3;  4Z82 A;  1ENS A;  5E8A A;  2JEN A;  1XYO A;  5FWE A;  1ND2 A;  2MHF A;  1XU2 A;  3H3L A;  4GAL A;  5J36 A;  3NRU A;  4GB3 1;  3O0V A;  5ACA 1;  4CEY A;  2WQ8 A;  3RI8 A;  2P3I A;  3ZXE A;  1JH5 A;  3PNA A;  3NMB A;  1CAW B;  3T30 A;  5FZH A;  3DV8 A;  3FC0 A;  4PDW C;  2AR6 A;  3LIH A;  1WUV A;  3MIB A;  1PO2 3;  2YB7 A;  3INA A;  4XUP A;  2RR1 1;  3AZW A;  3LFM A;  3MW4 A;  3H8X A;  1JZ3 A;  3VZK A;  4M3C B;  1RUE 1;  3OPT A;  1YIP A;  5HCB A;  3SEP A;  2H6B A;  5A6Y A;  5I93 A;  5FWJ A;  1KRI A;  3E97 A;  5EJ1 B;  2CWS A;  1LES A;  1JZ4 A;  1XBF A;  4FPJ A;  3BVC A;  4BQ1 A;  2TBV A;  2VO5 A;  4Y1V A;  1ZZ8 A;  3H1M A;  1NCQ B;  3NWK A;  1QJZ A;  4QB2 A;  3U0Z A;  3MID A;  1AR6 2;  1KFU L;  1U0A A;  2GN3 A;  1ZVF A;  4IE6 A;  1GKB A;  1BKZ A;  1J3R A;  1UW8 A;  3FL7 A;  3OB8 A;  1LNS A;  2LRO A;  4LO6 B;  5CB7 A;  5CAZ A;  3ILR A;  4JTO A;  5A3M A;  3DKW A;  4BPZ A;  1W8F A;  1JW6 A;  1L7L A;  3O14 A;  1ULD A;  2Z42 A;  2UY9 A;  4PBP A;  4CP1 A;  4TYS A;  5GZG A;  4UF0 A;  5KHJ A;  4JKK A;  2PHW A;  4BQ3 A;  1Q43 A;  3LDK A;  3SCF A;  1W05 A;  4LK7 A;  3QBQ A;  4FTE A;  2BU9 A;  1UYY A;  3M8L A;  4Q4W 2;  4X6R B;  4IE4 A;  3WIN E;  1N1V A;  1PZ8 A;  4AQ6 A;  3AYD A;  2VH9 A;  5FLH A;  2PHL A;  1NCQ C;  1K42 A;  5DAV A;  1PZ9 A;  2CGN A;  3O1S A;  3ACG A;  2ZEZ A;  1VRB A;  3I2H A;  1W0P A;  1WKY A;  3K48 A;  4AED B;  3E6C C;  1PO2 2;  3ASI A;  3D6E A;  3T2T A;  2AGS A;  1DGR A;  3SC7 X;  3WZ1 A;  4RHV 2;  1BYH A;  1HW5 A;  1OOP B;  5C9A A;  1WD4 A;  2BWA A;  3T08 A;  1MEC 2;  3S7I A;  2VVF A;  2XUE A;  2DCY A;  2W92 A;  2XKP A;  3F95 A;  3HBK A;  4GH4 A;  4QGM A;  2BBV A;  2W9X A;  5FZA A;  4M00 A;  5AC9 2;  5BNP B;  1QIQ A;  2B5H A;  2P37 A;  4JHZ A;  3MO4 A;  3LGR A;  4C90 A;  1JUI A;  1OF3 A;  4Q4V 1;  2QTW B;  2VVD A;  3TN9 2;  1W6P B;  4MOA A;  1KD7 A;  1FNZ A;  2VZU A;  2OYZ A;  4YSF A;  2UWB A;  3QD6 A;  1IS6 A;  3A0K A;  1UZZ A;  4FT8 A;  5A32 A;  1F4A A;  2YRO A;  3K77 A;  1C5H A;  1VBC 3;  4FXG B;  5IJR A;  4O7X A;  1SLA A;  3I2O A;  1KDK A;  1AL0 G;  4AED C;  2K46 A;  4AR2 A;  3N4M A;  3AL6 A;  4MGI E;  2F17 A;  1EV1 3;  4K8F A;  5DDJ 1;  2Z2S B;  2VUD A;  1OOP C;  4KBB A;  1B35 B;  3PUI A;  3I2G A;  3I2K A;  4DB5 A;  1GP6 A;  3I3B A;  1DQ1 A;  4XDO A;  2Q8C A;  3T2O A;  3NKG A;  3RYR A;  5BNP C;  1TNR A;  5FYY A;  5FBJ A;  2DCT A;  1DQ6 A;  2EIE A;  3ZMN A;  3H7J A;  3HNY M;  2Y64 A;  3S5Q A;  2DUP A;  2HEY F;  3LOB A;  5IAX A;  2UYB A;  3EYP A;  1QQP 2;  1VBE 1;  2YGL A;  2SBA A;  1BXH A;  3W20 A;  1SEF A;  4H7L A;  1OLQ A;  5A3O A;  4RSU A;  4Z1V A;  1RUJ 1;  3FFQ A;  2WC2 A;  1W6O B;  1CAX A;  1JN2 P;  1UMI A;  3BPS A;  3P6B A;  4N43 B;  4EWD A;  2GSY A;  1D2Q A;  3LDB A;  2FZ2 A;  3GDB A;  1B35 C;  3FBM A;  5EJZ B;  4XBL A;  3A0N A;  2O8Q A;  1APN A;  3O1R A;  4MGS A;  4JDN A;  2YU1 A;  3EJK A;  3AM2 A;  5FUP A;  4AI8 A;  1TEI A;  2IXL A;  4KWJ A;  3BTX A;  2OII A;  5FFO C;  4ARX A;  3R6S A;  2QUO A;  1OVP A;  2Y6J A;  4EZ4 A;  3NST A;  1VBC 2;  4HPK A;  2QQL A;  3NJX A;  2ZGM A;  1YHF A;  2HWB 3;  3OCP A;  1RUF 1;  3J8F 1;  1DLC A;  1CIW A;  4MGZ E;  2BWC A;  2VNG A;  3LEI A;  4LIT A;  1YRZ A;  1GUI A;  3LD8 A;  4XMI A;  1RIT A;  3NJY A;  1DZT A;  5FY9 A;  3U07 A;  2XVL A;  1AYN 1;  4QDR A;  1KQR A;  1QJY 1;  5C3R A;  3ETQ A;  2QZ3 A;  1QHD A;  3B94 A;  3TBD A;  5K4L A;  5DAQ A;  2RMU 3;  2WWS A;  4MAD A;  1HLC A;  1I5P A;  4DEV A;  4N43 C;  2WYS A;  5FPA A;  5F5C A;  2WN2 A;  3IN9 A;  2RS3 1;  4ORF A;  3TEW A;  1UXX X;  5KXC A;  1ZM1 A;  1H2M A;  1LAJ A;  4GQ7 A;  1PM7 A;  4DUW A;  2R06 1;  3M3E A;  4IV3 A;  5FKB A;  1V6O A;  1LOF C;  1WCQ A;  1OH3 A;  2Q4S A;  1KEX A;  2P2K A;  3IMM A;  1CD3 G;  1IKQ A;  2CAU A;  1HRV 2;  4A6O A;  1LOD A;  1VRH 3;  2VVE A;  1VBB 1;  2BNN A;  1RVF 3;  1WBF A;  2JX9 A;  2ARB A;  3IAQ A;  2OKX A;  4KG0 A;  1NLQ A;  2RM2 1;  3N7K A;  4F3J A;  4Y5Z 0;  2D6L X;  1UY4 A;  1UKG A;  1RUO A;  1RUD 1;  4OLL A;  5FZ1 A;  1JMU B;  4YW2 A;  5JCT A;  4Y5T A;  1ACC A;  2AEY A;  4YGD A;  4FAG A;  3H50 A;  3ZPY A;  3LF7 A;  4N9I A;  2V4A A;  2A3Y A;  2XJT A;  5F7U A;  4CEW B;  2FDG A;  3VKN A;  3WQ1 A;  1VBD 1;  4F7Z A;  1LGN A;  3LSE A;  4IEW A;  4DFS A;  4Y33 A;  1XB9 A;  2Z69 A;  3B3Q E;  1BVP 1;  4Y1Z A;  2QDR A;  4FFH A;  1XNB A;  4PIX A;  4C0H A;  2KXL A;  1RJ7 A;  4L11 A;  2G9F A;  2Q8O A;  2MEV 1;  1CJP A;  4N8M A;  2RMU 2;  4QPI A;  1O8P A;  5FY1 A;  4MSV A;  2WA4 A;  2RJL A;  4FPK A;  5F3G A;  1AR9 3;  1XPW A;  5IAV A;  5DPN A;  5FPX A;  1HV0 A;  2IXI A;  3E6D A;  1CPM A;  1CON A;  5C5U A;  1COV 3;  1PMJ X;  4SBV A;  1PX4 A;  2BGC A;  3V0B A;  2A70 A;  2UWA A;  2OZJ A;  2PTM A;  3ES1 A;  4WZC A;  4EN7 B;  1WMX A;  5J09 A;  4CEW C;  3AZX A;  1QKQ A;  1TNF A;  4ZS3 A;  3O1P A;  4E2G A;  4UWD A;  5AFB A;  5KC5 A;  1MS4 A;  1ENR A;  3UJO A;  4YM0 A;  3P5B A;  3ZDV A;  4YM3 A;  4PLN A;  4EN6 B;  3WP4 A;  4P9W A;  3BAL A;  2BBA A;  3LIG A;  3OSD A;  2EIG A;  4IEO A;  2CGP A;  1VRH 2;  1IS5 A;  2PAM A;  1O91 A;  1RVF 2;  4OZX A;  1OFS A;  4NRM A;  3U10 A;  2WSU A;  3KV6 A;  1RMU 1;  4TLG A;  1H9W A;  2ERF A;  2K2S A;  3PVN A;  4XXA A;  5D8A A;  4NWW A;  1W39 A;  4XCA A;  5FK8 A;  4YVS B;  1HN0 A;  5I0S A;  3HNB M;  3K51 A;  2ZGO A;  4LOR A;  1ENX A;  2OA2 A;  1CAU B;  3V65 A;  3ZSJ A;  4YVW B;  4AHX A;  4RS5 B;  1T6B X;  3PJY A;  2QQU A;  3ZYR A;  4YYO A;  5F5Q A;  2Y6H A;  3VBH B;  1POV 1;  1X9T A;  1W8U A;  5FP3 A;  3JBG 2;  3JD7 2;  4KGQ A;  4P9X A;  1HJF A;  1RUN A;  1QNW A;  1H8V A;  4KH9 A;  3CLP A;  4P9Y A;  2YXS A;  5FZF A;  1FI2 A;  4XZP A;  1JI6 A;  4CUG A;  1UZY A;  2OUH A;  3ACL A;  1H2N A;  2WII B;  2BV4 A;  1US3 A;  3IKW A;  3POW A;  5IVE A;  4XHB A;  5LW9 A;  3WF3 A;  2XB6 C;  2PHX A;  2XR4 A;  1HRI 2;  1YQ6 A;  3ZYH A;  1JTZ X;  1NCR A;  1W8O A;  2WS9 3;  3SIT A;  3USU B;  2DUQ A;  3L2Y A;  4YVS C;  3VKF C;  3D3A A;  4HET A;  1H4G A;  1VP6 A;  1V0A A;  3OYW B;  1HN1 A;  1HQW A;  2AAC A;  2C6S A;  5IAT A;  1AL2 3;  4V2W A;  4YVW C;  4RS5 C;  1PIV 3;  3H8U A;  1UYP A;  1VPH A;  2AC1 A;  2VNO A;  3E6B A;  4YM2 A;  2GC3 A;  4LUK A;  4MXW A;  3VBH C;  3MPB A;  2XJP A;  4XYX A;  2BVV A;  2Y6G A;  1JUH A;  4WM8 A;  2XG3 A;  1S4C A;  2I45 A;  2ZCW A;  2VW2 A;  2SLI A;  4AHW A;  4B1M A;  4HK9 A;  1S0I A;  1FAY A;  5IYY A;  1RXG A;  1D4M 2;  1V9U 1;  2VME A;  3V64 A;  2O0O A;  2OXB A;  1W3X A;  4RGK A;  3JQW A;  5FDB A;  2EAA A;  5JOW A;  3I3E A;  2CHH A;  2VOX A;  1R1A 3;  1CWP A;  3RGB A;  4UW6 A;  2EF6 A;  2B39 A;  3A23 A;  1WW5 A;  5BNN B;  1QJX 1;  2OT7 A;  5KXE A;  1HX6 A;  2FHR A;  2KD7 A;  4IET A;  4LOT A;  3HJR A;  4Y22 A;  1ZA4 A;  1W6Q B;  4UW5 A;  3Q8C A;  4YZ2 A;  1A78 A;  4M4R A;  3ILF A;  3T4H B;  2OZ6 A;  2UUR A;  3AKR A;  5L9V A;  3ZFF A;  5JOX A;  1POV 0;  5CFD B;  1SFP A;  1RUH 1;  1SCS A;  1XYN A;  2BFU S;  4Q4Y 2;  1KS5 A;  4FOQ A;  4P00 B;  2DVG A;  2A73 B;  1PO1 3;  5J37 A;  1NE4 A;  4WM7 B;  1SAC A;  2VNR A;  2VZV A;  2Y6K A;  4HSL A;  2R49 A;  1SBD A;  2WZR 1;  5A7W A;  4M01 A;  1F15 A;  2VMG A;  3L2H A;  3Q8A A;  4C1X A;  1UIJ A;  1V6M A;  4B8E A;  2DFC A;  4DMI A;  5BNN C;  2FDK A;  3SQO A;  4NIH A;  3IIA A;  5FZG A;  2WFF 2;  4R4Z A;  2JXA A;  3VDC A;  2BVB A;  3ZXG A;  4MYE A;  1GLH A;  1MQT A;  4IEP A;  4E4H A;  3C8X A;  1S0E A;  4ASL A;  2B8M A;  3MIG A;  2ZHN A;  5CZK A;  2LRP A;  4QKN A;  5GLW A;  4CP0 A;  3O1U A;  2GH2 A;  2OVU A;  4MLO A;  3ON7 A;  4UFL A;  1H6X A;  3WG2 A;  4CU9 A;  4QQ2 A;  3JZV A;  2WIN B;  3ZSK A;  3WG4 A;  5CFD C;  5FZI A;  5FYU A;  3JQX A;  4XDQ A;  3HT1 A;  4R8H A;  1G7Y A;  3AJY A;  1FPN 2;  3AL5 A;  3PJQ A;  5FMB A;  4DY5 A;  3VKO A;  4NO4 A;  3U14 A;  5A1F A;  1GZC A;  2JD4 A;  1HV1 A;  3UV9 A;  2HWD 3;  3C7F A;  2RS1 3;  2WNE A;  2BFU L;  2ZGN A;  4NAM A;  1Y3T A;  4WM7 C;  3ZM8 A;  4BQ5 A;  4XFF A;  1OD3 A;  1EYB A;  2G9Z A;  3O0X A;  4LKF A;  2H6C A;  1GQG A;  2ZXQ A;  4LKD A;  3RJR A;  2VZR A;  1V70 A;  4UBH A;  2JDA A;  1U12 A;  3ZX7 A;  2D40 A;  5LK7 B;  3KMH A;  1R09 3;  4FO9 A;  4QX0 A;  1ZBE 3;  2OUJ A;  5HCF A;  3ZFG B;  4Z92 B;  3N9Q A;  4KU8 A;  1TME 1;  3ZYP A;  1IPJ A;  1OF4 A;  3R4U A;  5F6L B;  4K9S A;  3O1T A;  4GMP 1;  3LOI A;  4OFG A;  3RZL A;  4AI2 A;  2VQ0 A;  5G05 L;  1Z0H A;  1XNA A;  2Q5T A;  5A33 B;  5LA9 A;  4P14 A;  4LO5 B;  3KVB A;  3J4U H;  5DAX A;  1N1T A;  3OBA A;  1YCI A;  4RGG A;  1U5I A;  4F8A A;  1A8M A;  4ZXE A;  1W2N A;  2MNG A;  3ELN A;  1W6M B;  3OGR A;  1AR8 1;  4B7K A;  1UX6 A;  3NAP B;  3LEK A;  3WCS A;  5AVA A;  3KHB A;  5CU1 A;  2RHP A;  3PIG A;  1DBN A;  1QJF A;  2W2I A;  1AR9 1;  3PUS A;  3OPZ A;  3ZFG C;  4GB3 3;  2CU5 A;  2ILM A;  1NLS A;  3WG3 A;  2V4V A;  1COV 1;  2YYO A;  2YDE A;  2ZZJ A;  4Q1R A;  5FJH A;  3S30 A;  1O5L A;  1DGR N;  1R08 1;  1RL3 A;  2WZ8 A;  4IQP A;  4IXL A;  4IGP A;  4ATE A;  1QH7 A;  1SFY A;  5IK8 A;  3ENR A;  1TE1 B;  1XYP A;  4QX7 A;  3NV1 A;  4OHY A;  1S1A A;  3IMN A;  1XE0 A;  3Q8F A;  4HKL A;  4FPL A;  4Q27 A;  4BWO A;  1GOG A;  2RR1 3;  4CXY A;  1UN1 A;  1SMV A;  1RUE 3;  2GND A;  2JG9 B;  4OVE A;  4YW4 A;  3NAP C;  3ST7 A;  4CE8 A;  1Q5O A;  1W9T A;  4N53 A;  4HON A;  1O3R A;  4I2O A;  4FQ4 A;  1PVX A;  3PVE A;  3M2M A;  1OVS A;  1DGW X;  2UWC A;  4MO3 M;  2ZAC A;  2V09 A;  4Q0Q A;  4NII A;  4XQW A;  1LOB A;  4YZ4 A;  2BYV E;  4Y1Y A;  4NJ4 A;  5F39 A;  1IG3 A;  1Z7S 2;  2IFW A;  4LBM A;  1JU4 A;  1BEV 1;  2ZJC A;  4QKD A;  4OHV A;  2W94 A;  1SG3 A;  3ZN6 B;  5A7Q A;  1W99 A;  1VR3 A;  2GNB A;  1Q8S A;  4GMP 0;  4ZU5 A;  3B9C A;  1HXS 1;  3VBU B;  3MV1 1;  1C8M 1;  3SCG A;  1BZW A;  2JG9 C;  1O3Q A;  5FY0 A;  4QPW A;  2Q30 A;  3SHR A;  1K5J A;  3I97 A;  4ONU A;  2XJS A;  2WZP P;  3USS A;  3GBW A;  2W1Q A;  4GKY A;  2PLV 1;  2W1S A;  2HLE A;  4D8M A;  3WUD A;  3VZO A;  1FMD 1;  3P3N A;  3T2Q A;  3III A;  1AL2 1;  1IHM A;  3FHA A;  2VBP A;  5L73 A;  4AZZ A;  1G9F A;  3PU3 A;  5IVB A;  1CAW A;  2G1M A;  4PQ9 A;  2IFR A;  4AFM A;  5CIS A;  4GIQ A;  1Q8V A;  4E8D A;  3ATG A;  1RUE 2;  2LUW A;  1HIX A;  1YWK A;  4X8P A;  4JDO A;  4OMC A;  3GBG A;  3WCR A;  2BEO A;  2DCZ A;  1YFW A;  4LE4 A;  4ITC A;  5LAT A;  3KZ4 C;  1DCS A;  1QXJ A;  3VBU C;  4Q26 A;  5F3I A;  1DQ4 A;  2VTX J;  1WZX A;  3ZYB A;  4YW1 A;  4CU7 A;  1CAV B;  5FAX A;  5A3U A;  5A70 A;  2FDF A;  4Q4V 3;  3FHQ A;  2GAU A;  4QAW A;  5J48 A;  2D6K A;  3CZU A;  4EV0 A;  1TMF 1;  1XE7 A;  2R6Q A;  1QDC A;  1F9K A;  1ZZ7 A;  4CXW A;  2WAB A;  3DYM A;  3ZVX A;  4W6Y A;  2VBD A;  2W0X A;  4YZ3 A;  4PJY A;  5IVF A;  3PTY A;  3U37 A;  4OHZ A;  5FXW A;  4NAO A;  1LEN A;  2HEV F;  5C7G A;  5H9Q A;  5DDJ 3;  1FT9 A;  2F4L A;  4BK5 A;  4CCC A;  1QXP A;  2ZX0 A;  3CNA A;  4CPB A;  1C4R A;  4LEJ A;  3H8O A;  3LEM A;  1UPI A;  3LPG A;  2X29 A;  4W6W A;  5F5A A;  4QPG B;  4KGG A;  3UNP A;  2V5D A;  1ASJ 1;  1URX A;  4QKB A;  4XUO A;  1NAE A;  3WP6 A;  4UOJ A;  5FK7 A;  4A7K A;  5JWP A;  4ASK A;  1G9D A;  5E1R A;  2D6O X;  1RUG 3;  3M3Q A;  1DDL A;  1HKD A;  2IZW A;  3M4F A;  1WCU A;  4YZ5 A;  1CQ9 A;  3W21 A;  2XON A;  1VBE 3;  3R0R A;  2ENR A;  2VMC A;  1OT5 A;  4I0A A;  4XAB A;  4PLO A;  3RMX A;  3MLL A;  1KFX L;  3A22 A;  4ZZ5 A;  3OGJ A;  3CZJ A;  2VR4 A;  3BTA A;  4FBF A;  4CDW A;  1VMH A;  1LRH A;  4BQW A;  4Q4V 2;  1BMV 2;  1OI6 A;  3LQC A;  2ZAB A;  4Z2A A;  5A1A A;  4C1W A;  1X8E A;  2JG8 A;  4L97 A;  4XC9 A;  2C9K A;  4QPG C;  1JU3 A;  4KI5 M;  4CCO A;  3OGG A;  5I91 A;  5JOZ A;  2BRT A;  1W6P A;  4CVU A;  3KV4 A;  2WFP A;  3N9P A;  3J8F 3;  3POF A;  3OBR A;  2E31 A;  3MUY 1;  1LHW A;  4TZD A;  5LK5 A;  2QQN A;  2RS1 1;  3CF6 E;  4MUV A;  4Y5S A;  3OUJ A;  5DDJ 2;  5FQ0 B;  2PYT A;  1FX5 A;  3CJI A;  4OYU A;  3WOG A;  1PGW 1;  2Z4F A;  4EJR A;  5IVJ A;  1QJY 3;  5IFT A;  3AXE A;  4RR3 A;  4NIA A;  2JDZ A;  4URA A;  3ZIX A;  3RDI A;  3W58 A;  2BP6 A;  5LA1 A;  4Q4X 1;  1M06 G;  5FYH A;  2ES3 A;  1XND A;  2AEN A;  1B35 A;  4Q29 A;  1WA4 A;  5CIR A;  2YUE A;  4AF9 A;  3IDB B;  3VDD B;  4AEK A;  2RS3 3;  2XGX A;  5CNA A;  2W1U A;  2WO2 A;  4LE3 A;  5K7P A;  4K8R B;  1MPX A;  5FUN A;  1R64 A;  5ACA 3;  1NT0 A;  1PMI A;  1MVE A;  4ZON A;  3C7H A;  2R06 3;  1VBE 2;  3VDA A;  3ZFE A;  2WRA A;  3GM8 A;  3KT1 A;  3WNO A;  4MET A;  5A1L A;  3LWC A;  1RUJ 2;  3GAL A;  4D7T A;  5JVV A;  1JYW A;  5T52 A;  2ET1 A;  5GZC A;  4NPM A;  1VBB 3;  2D3P A;  3WNL A;  3FHI B;  4ZY9 A;  2IXK A;  4B4P A;  2RM2 3;  3KB5 A;  3KLS A;  5FRA A;  1XE8 A;  2HWC 1;  4QX2 A;  4V1P A;  1AJO A;  1ZX5 A;  2GN7 A;  2XJU A;  4MG2 A;  3BGA A;  5DUU A;  2RJK A;  5DUW A;  3ORJ A;  3VZJ A;  3AKQ A;  3OJB A;  4N43 A;  2A71 A;  4TTG A;  2EXH A;  4TN7 A;  4XJU A;  3M7A A;  4LO4 B;  1AF9 A;  5FXV A;  2LW8 A;  1W9W A;  5FZO A;  3VDD C;  4AL9 A;  4XAA A;  2G19 A;  1RUF 2;  1W90 A;  1OC1 A;  2OS2 A;  4CCK A;  1QF3 A;  4CUA A;  1ODN A;  2JD9 A;  2ZEX A;  1UMH A;  1H8T A;  3U4S A;  2VC9 A;  1AYN 2;  1NQJ A;  1QJY 2;  5CFC A;  5KHH A;  5EIY B;  1AX2 A;  1OMI A;  1Y7B A;  3HIF A;  5DQ0 A;  5GM0 A;  3G6J B;  1VLN A;  2MEV 3;  3UKT A;  4ATF A;  3MF9 A;  3DPR B;  4PLM A;  4MX3 A;  3VKL A;  4OQ8 A;  2E33 A;  5CA6 A;  4RA0 A;  4NUB A;  3CIH A;  3RYP A;  3DXU A;  4ZZ8 A;  4W65 A;  4XFH A;  3UET A;  5C3S A;  1M4W A;  2AEZ A;  1EP0 A;  1D4V B;  2JKB A;  2Y33 A;  4PBO A;  2QNK A;  3VBF B;  4CUB A;  5FOJ B;  1G6N A;  1DP0 A;  4XF9 A;  3RZH A;  1ND3 B;  3O7O A;  4QXC A;  2RVA A;  3HWJ A;  1GBG A;  1MS8 A;  4HKW A;  2YC4 A;  4IEY A;  1V6L A;  1C3H A;  3LCP A;  1UQX A;  2XQR A;  4XZU G;  4A4A A;  5DG2 A;  5J98 B;  1OLM E;  4JGZ A;  1H6Y A;  1EAH 3;  1SHW B;  2JIC A;  4B1L A;  3RWK X;  5CBL A;  1RMU 3;  1OQ1 A;  1RUD 2;  2XBO 1;  3BB6 A;  3GZT B;  2DVA A;  3N7L A;  3PUA A;  4H3W A;  3WNK A;  5I8Y A;  4AE2 A;  3DPR C;  3WVJ A;  2JIG A;  2WNV A;  3FLR A;  4YM1 A;  4CCN A;  1HB4 A;  2ID4 A;  1UU6 A;  2B9U A;  1VBD 2;  2D3R A;  3N36 A;  4UI9 L;  1BK1 A;  1RUC 1;  3FBY A;  3J26 N;  4YRD A;  5DAP A;  4D6Q A;  4IEZ A;  4RFR B;  3RZM A;  1J58 A;  4AK3 A;  1UAI A;  5DN2 A;  2PHR A;  4IV1 B;  1GWK A;  1US2 A;  2BDR A;  4Y26 A;  3VBF C;  4EWA A;  1UU4 A;  3O1M A;  1ND3 C;  1PMH X;  1POV 3;  1DIW A;  4AAP A;  4YG3 A;  2VD7 A;  2MEV 2;  4K20 A;  1SLB A;  5CKN A;  4EE2 A;  2EAL A;  1S2K A;  1ZZB A;  5LRS A;  2D7F A;  2W68 A;  3WLU A;  1UY1 A;  2BW8 A;  3LA3 A;  4QPY A;  2UY8 A;  3IDE A;  1RJ8 A;  3MFA A;  4QB6 A;  2FZ1 A;  3BTZ A;  3POI A;  5LA2 A;  3ACH A;  5CG9 A;  1GQP A;  1QDO A;  4WZF A;  2CL2 A;  3RZZ A;  1LU2 A;  2NMN A;  1OKQ A;  1Y9G A;  2KM2 A;  2YC2 A;  5FPL A;  2ZAA A;  1F2N A;  1GR3 A;  5JZG B;  2JB4 A;  4PHZ A;  3SMH A;  1VAV A;  3U1X A;  5ISL A;  4BE3 A;  4XBN A;  3X29 B;  4JRL A;  1B09 A;  2J1S A;  4IV1 C;  2VOW A;  3CQO A;  3H7Y A;  1JZ2 A;  1AYM 1;  5EPA A;  1KS4 A;  2VY0 A;  3I3M A;  4UW4 A;  4RQP B;  4KL1 A;  2WWU A;  4CDQ A;  3I2D A;  3OEA A;  1K5M A;  1O8S A;  2OQ6 A;  3TB0 A;  2WR9 A;  4R4X A;  1WA6 X;  3ZOI A;  4NHL A;  4C91 A;  2ZGR A;  3J9S A;  3WDV A;  4LT5 A;  5GZD A;  2O14 A;  3O1O A;  2ARE A;  1PGS A;  5I8T A;  1V9U 3;  5H9S A;  1NY7 1;  5ABJ B;  2I2S A;  2ZKL A;  1H9P A;  5FYI A;  3THD A;  3MW3 A;  3N35 A;  3DXT A;  1UOJ A;  5JZG C;  5A7S A;  3AMQ A;  2B42 B;  1LHN A;  1QJX 3;  4FPC A;  4DXZ A;  5JPN B;  1NQD A;  2E7T A;  1AXY A;  1MS1 A;  1RUG 1;  4XFC A;  5T5L A;  3WW3 A;  3RZJ A;  1AXZ A;  2QDN A;  4ERO A;  3PDQ A;  4FPO B;  2WT2 A;  4RQP C;  3AB0 A;  4UW3 A;  4XET A;  3AVS A;  2AZ5 A;  2JEM A;  4AVT A;  3M3C A;  4AGR A;  1QOT A;  4PIZ A;  1RUH 3;  4LHS A;  2E32 A;  2ETE A;  3PUR A;  4AXO A;  3THC A;  2GC1 A;  3IPV B;  1JYV A;  4DOU A;  4IE0 A;  4M3C E;  1QOO A;  1IQA A;  3TNQ A;  4LNV A;  3USU A;  4QXB A;  1MVQ A;  5ABJ C;  1W06 A;  1ZA7 A;  2DU0 A;  4FOY A;  4QT6 A;  5D1I A;  1JZ8 A;  3I3Q A;  4EYU A;  2ZX1 A;  3OYW A;  5C4W A;  2WZR 3;  4CP9 B;  3S57 A;  5BNO B;  3DGT A;  1NXD 1;  1S0D A;  4AFD A;  1ULE A;  3AP7 A;  4LA2 A;  1XNC A;  5DUV A;  3FN9 A;  5L7O B;  1XU1 A;  5FLI A;  4NR1 A;  3TWI A;  1EV1 2;  5IW0 A;  4UFI A;  1UOG A;  5A3P A;  3PVB B;  4XE9 A;  1VIW B;  4CDX B;  1YC6 1;  4HG6 B;  4AAX A;  5C8C A;  1YIF A;  5EWS A;  3SEE A;  2C24 A;  1ND2 B;  3AJZ A;  2KA3 A;  1UKR A;  4P5Y A;  5HI0 A;  1QJX 2;  4CEY B;  4D6R A;  4Z2W A;  4HL0 A;  1MR5 A;  4Y20 A;  1A8D A;  2R0F A;  2D93 A;  4A42 A;  2W3J A;  5FPU A;  1C28 A;  4BXF A;  4EZH A;  3WHT A;  5BNO C;  1WCD J;  3EXU A;  3NNF A;  2VG9 A;  3I2I A;  2Q0A A;  3LAG A;  5LY2 A;  4ZPI A;  3H8R A;  5L7O C;  4HSJ A;  2BJS A;  4IND A;  4KNC A;  2D3S A;  5SV8 A;  5J3U A;  3RQ0 A;  2Y8K A;  4XAC A;  1BVV A;  2YBS A;  4TWT A;  4CDX C;  2WBK A;  5JMO A;  2TEP A;  3TNP B;  1TME 3;  3K2O A;  5C3Q A;  4XJW A;  5LWB A;  3MI8 A;  1LJ7 A;  2R1D A;  4CUC A;  2WZR 2;  1ND2 C;  4GMP 3;  1X82 A;  1H4H A;  1YFX A;  4HKO A;  4MGK E;  1ZRD A;  5FZ7 A;  1W8T A;  1UWW A;  1F5J A;  2DU1 A;  4CU6 A;  2GP3 A;  4CEY C;  2HWB 2;  5AVP A;  1DLL A;  3B02 A;  3KF3 A;  4YFW A;  1ZZC A;  1JOJ A;  3DEC A;  2Z79 A;  2C1F A;  3WQB A;  1NLR A;  1W9S A;  4LLO A;  4AI1 A;  4CSW A;  4DRV A;  1AR6 1;  3NNG A;  4XJZ A;  5IVV A;  5G04 L;  1AR8 3;  5A3W A;  1NA1 B;  5GJ6 A;  3WQ0 A;  2R04 3;  3MIE A;  4WVW A;  4WV8 A;  4BDV B;  2Y6L A;  4UF0 B;  1ULP A;  1QEX A;  2V72 A;  3POE A;  1UOB A;  2WT1 A;  4JDM A;  3UGF A;  4FPE A;  4MZU A;  2BNO A;  3AP6 A;  3WV6 A;  3M3O A;  4BU2 A;  4Y1X A;  5BYN A;  2ADE A;  2NZ9 A;  3ES4 A;  3KCX A;  1R08 3;  4FFG A;  5F5I A;  2Y34 A;  2ZTN A;  3KGZ A;  3UT0 A;  3GCW A;  4LJH A;  5LBE A;  4A44 A;  1Q56 A;  1QJU 3;  4RFT 0;  5FP9 A;  3VBR A;  2ZPX A;  5KXB A;  2QQK A;  2VCM A;  3K46 A;  3I49 A;  2QBX A;  4BHP A;  4LBQ D;  1U5Y A;  4NRO A;  4N9H A;  2WAO A;  4C0B A;  5C9A B;  5IFP A;  1EAH 1;  4LIU A;  2K9Z A;  5F2W A;  1JOP A;  4MXV A;  2UU8 A;  3HEI A;  1NA1 C;  2D5F A;  4GH4 B;  1UX7 A;  1TME 2;  2FD8 A;  4RHV 1;  2J1T A;  4TSV A;  4R52 A;  4AG4 A;  4ZHN A;  1JOB A;  4OMD A;  1MEC 1;  3MLK A;  4OUM A;  4XOG A;  3APB A;  4HZF A;  1WCK A;  4AVC A;  4JV4 A;  1J1T A;  1AR7 1;  5A32 B;  2DVF A;  4AFA A;  4XIK A;  3IB3 A;  3RS6 A;  1BEV 3;  2YPD A;  3CDZ B;  2VJX A;  3GBF A;  3POJ A;  1AR8 2;  4KBZ A;  3ZMO A;  1JOD A;  1UL9 A;  4IE5 A;  1YEW A;  2VZP A;  3JCI A;  3K3N A;  2HWE 1;  4LO8 A;  2VZT A;  2P6C A;  2ZKN A;  4XF0 A;  2P3J A;  2ZGK A;  1HXS 3;  1KDM A;  1VBA 3;  5C9A C;  1C8M 3;  1AR9 2;  3DN7 A;  5EV7 A;  3MLJ A;  1O6U A;  4XAE A;  4XTM A;  1BK0 A;  4GH4 C;  1TZO A;  2DVB A;  1COV 2;  4QX3 A;  2D43 A;  3CJX A;  4HXC A;  3ZXF A;  5BPX A;  2P3Y A;  2Y0I A;  1PK6 A;  3WD5 A;  4YAR A;  2JJ6 A;  2PLV 3;  3WSO A;  1V6N A;  2WO7 A;  3JB4 C;  3V0A A;  1FMD 3;  2WSV A;  4NN0 A;  1V6J A;  2BGO A;  5K0U A;  2F4P A;  4Q2F A;  4CDU A;  2GC2 A;  2IUW A;  3ITQ A;  3JU9 A;  2WWJ A;  3ZLI A;  4COY A;  4EN9 B;  3VUO A;  1A3K A;  5LBB A;  1IGO A;  3W9A A;  1MS5 A;  4KU7 A;  4ES8 A;  2JDM A;  1GOF A;  2NMO A;  2QCS B;  2VOK A;  1CAX B;  4J6G A;  2OX0 A;  4KWK A;  2RDR A;  4MHR A;  1QQP 1;  1ZBA 1;  4NHY A;  4WVZ A;  5FIX A;  3VBO A;  1R1Z A;  4UAP A;  2HYX A;  2RDN A;  4KG8 A;  4QD2 A;  4FP2 A;  2JG9 A;  4Y24 A;  5EP9 A;  4AQS A;  3FLT A;  2Y38 A;  2ZAH A;  3AFG A;  2ZMN A;  3KWV A;  1G86 A;  4OUS A;  3N7J A;  4GWM A;  3WDX A;  4P9I A;  3CL1 A;  1TMF 3;  2WNU A;  4LHK A;  3VHP A;  2WO3 A;  5FZC A;  3VD5 A;  5K8S A;  2D97 A;  1UO9 A;  2P5B A;  1MS9 A;  1UYZ A;  4AGG A;  2CY6 A;  5JSO A;  3ACF A;  1VMF A;  2PHT A;  4QKF A;  3EBR A;  2WT0 A;  2C26 A;  1W8N A; 
#chains in the Genus database with same CATH homology
 1XB9 A;  3T30 A;  2VTX J;  4CA9 A;  5EHD A;  1NLQ A;  1K5J A;  4N8M A;  1XE0 A;  2P1B A;  2VTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...