2P1BA

Crystal structure of human nucleophosmin-core
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
100
Chain Sequence
QNYLFGCELKADKDYHFKVDEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human nucleophosmin-core reveals plasticity of the pentamer-pentamer interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Nucleophosmin
total genus 14
structure length 100
sequence length 104
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 2p1bA00
2VTXA 4CA9A 2VTXJ 2P1BA 1XB9A 4N8MA 5EHDA 1NLQA 1XE0A 1K5JA 3T30A
chains in the Genus database with same CATH superfamily
4WV8A 3DL3A 5A7QA 4Q4Y1 1BCXA 1V6JA 5ANNA 5FP4A 3WY6A 2XB6C 2K46A 1FYUA 2ZGOA 2R49A 4LKSA 3ZFFA 2X29A 3I7DA 4MYEA 4QHBA 3OJBA 1R083 4R9BA 5GZFA 5A32B 1CIYA 2VCAA 4LBQB 1C4RA 3SISA 4WZFA 3POIA 4MXWB 4Y26A 3O1OA 4RSUA 1XE0A 1ALYA 1JS9A 3GBGA 1PO23 1ZM1A 5E6HA 3DN7A 1BMV2 2D5FA 2YY1A 4RGKA 4L11A 4IEWA 4AL9A 2ZKNA 3AKPA 5JXGA 1NOVA 4NIHA 5IATA 3VL9A 3VDAA 3KV6A 2R061 1MS9A 3BU0A 1ULEA 1QOSA 5KHGA 4A6SA 5CKQA 3A22A 4M3CF 4QHZA 5HV0A 4NHYA 5LRSA 4CEWB 3VBFA 2ZEZA 4QQ2A 1NE6A 1S55A 2EAAA 2WRAA 4JGYA 3SC7X 4N9HA 1U5IA 2VMDA 3AVRA 2BNNA 1LECA 5FZ7A 3WT3A 3AMNA 1ACCA 2VVEA 5DZEA 5C6CA 1IG3A 2Q8OA 5FWJA 4OMDA 2BU9A 5JMCA 3RZLA 2HWB2 4OHYA 1AVBA 3U14A 1JYVA 3VB9A 4LHLA 2DCJA 2IXIA 2X05A 3Q8FA 1IPKA 2PQQA 4XF3A 1ZZCA 1LODA 1RUD2 2VZQA 3KF5A 4RL7A 4COUA 4G3YC 4IE0A 4N90A 2W1UA 3U10A 1W2UA 2JDKA 2PLV1 1ASJ1 4IEXA 4LHKA 1Z0HA 3OD4A 1DGWX 1XNAA 3T1MA 3VZOA 4Q8KA 1CX1A 3SLIA 5A3OA 1CZSA 2DBIA 4RHV3 4NHLA 2W9XA 3I59A 4O61A 1NCRB 1Y9GA 3RMXA 4EQVA 2VW2A 1OC1A 2WS93 2PHUA 3MLJA 4XIOA 4ASLA 2GMPA 3VZNA 3LA3A 5FBJA 3ZN6A 1KRIA 4RN5A 3RDIA 3PUIA 1QOOA 2C9AA 3DPRA 4E4HA 3ZXGA 2J42A 4NO4A 2ATFA 1H2NA 1J1LA 2R0FA 5IK4A 2C1FA 2VPVA 1H1IA 1W6QB 4M01A 3JBG1 1ULGA 4PLOA 3WDUA 4CYDA 5J37A 3AZXA 1PMJX 1UXZA 2VZSA 3BOPA 3LQCA 4XJZA 4YGEA 5A1FA 3N35A 3V0AB 5E89A 5FXXA 2YXSA 4LOSA 1LGBA 1UYYA 4DY5A 1DQ2A 1GOHA 4HZFA 4Y33A 4BHPA 2VNRA 3AFKA 1ZRFA 5C9AA 3IIAA 3VBOA 2FZ2A 4K20A 4KWUA 4I0WB 3BVCA 1MQTB 5LA0A 3KB5A 3FLPA 1UIKA 1CAVB 3VBHB 5FBZA 3MIGA 3OBTA 1RL3A 1Z7S2 2EAKA 2YBKA 3MDPA 1VBD2 2QNKA 2BPA2 4SLIA 5FYUA 2I07B 1QJU3 1PZ9A 2HWF3 3FBMA 1POV1 3FZ3A 4NN0A 3OYWA 4ONUA 1GU3A 5FUIA 4XHXA 3RQ0A 3PLQA 4AFCA 4D7TA 1SEFA 3VBUC 1BXHA 4FTEA 1HIXA 2ZX1A 1SMVA 4NOTA 1EV12 3IN9A 5DUWA 2P3KA 2CSGA 1W9WA 2EA7A 4YVWA 3BPSA 3RWNA 4NWWA 1FOD1 4KI5M 3I2FA 4F3JA 2D5HA 2SLIA 2XJUA 3SNMA 5J98B 5KHHA 1IS5A 2V73A 4GALA 3BALA 2VOWA 3RFRA 3JD73 3WLUA 3N9NA 3D5OA 4META 2VZTA 2ZX0A 4K6BA 5FZHA 2RR13 3T3YA 1POV0 2W68A 2WNVC 3NRUA 5FPAA 3UKNA 4QU1A 3W20A 2YPJA 3DPRB 3WHTA 5KC5A 4ARYA 2GMMA 3AL5A 1RUF2 2VZ1A 3CJIB 1MZ6A 2VCBA 4JTNA 3GNEA 2XQXA 5DDJ3 4BZ4A 3A0NA 3N3HA 2XLAA 5DZFA 5JIUA 1OUSA 1PM4A 2VBDA 1ST8A 3LCPA 1STMA 2XKOA 4JVAA 4CU6A 5C5UA 5A7WA 3U4SA 2DFBA 4S2GA 3RS6A 2FDIA 5C3PA 2IXCA 1GYKA 4NIAA 4TSVA 1UD1A 4JDOA 5FY9A 5FY8A 2X8KA 3DPRC 1ZBE3 2D6OX 2QQIA 3DYPA 4AK3A 1W2TA 2ZHLA 4Z07A 3UGFA 5F3CA 4P5YA 3VHNA 3PMSA 4NIIA 5HV4A 1O5LA 3VBSC 5C3SA 1UCXA 5T5JA 3ZX7A 3RRDA 4FSJA 3QD6A 4C1WA 5DAVA 1RIRA 3ASIA 1OLME 3LDKA 4UF0A 4HG6B 5DAPA 1R64A 2Q5TA 4GQ7A 3T1LA 2NMNA 1CZTA 5CVRA 1PZ7A 5FDBA 3RZGA 5BY5A 1JYCA 3OB8A 1GLHA 1XXNA 2B46X 3LEKA 2Y64A 4CDXA 3KWVA 3HNYM 3U75A 3WR0A 2D7FA 3VV1A 1S2KA 1CPMA 2DCKA 4HPKA 2LUWA 1LU2A 1KDKA 3NNFA 4AI1A 2ZTNA 5A3UA 4OUSA 4HN1A 5AVAA 1AL22 4UFJA 5FZ3A 4BMBA 1H1MA 3URFA 4FPFA 3H50A 4PLMA 1G9FA 1JZ7A 3UESA 3SKJE 4BQXA 4YM0A 1HQNA 1OLRA 2RJKA 1RUE2 2VTXA 4A6OA 2ERFA 1MACA 4JHTA 1WW6A 2J1EA 1ODNA 2A71A 5CISA 3M8LA 1VALA 3ZDSA 5FMDA 1ND2B 2VMGA 1W6NB 1Z7S3 1JYTA 1WBFA 2PHXA 5FZEA 1EAH2 3ZR6A 2A6WA 1A78A 5FZDA 5ERLA 3KF3A 5FZ0A 5FP9A 2RJLA 1JMUB 3B7MA 1GFF2 3MV01 4LBQA 4AR2A 4WVMB 5AFBA 2WWJA 3ZFEC 4AQ6A 1WD3A 1TEIA 1P8JA 5DUUA 4LLOA 3H7YA 2WQ8A 2JB8A 2EICA 5EYXA 1XE8A 3I2IA 2JWPA 1SFYA 4QPYA 3E5UA 5SV5A 1UF2C 4W6WA 4IESA 3FUOA 1QOTA 4NPLA 4AQSA 1OA2A 3AL6A 5HCAA 4CA9A 1N1TA 2BDRA 3ACFA 4YW1A 1YJLA 4NVPA 4XZPA 5KXEA 4QB2A 1D2SA 2RS13 5LBBA 3N9LA 5C4WC 1W28A 4YZ3A 3F2ZA 3ZPOA 1DGRA 3N9PA 1LB2A 5KXCA 4LKDA 2JDHA 1QJZA 5JMOA 2RMU2 4BQ3A 3T0DA 3AZVA 3FX3A 2JIJA 3AP6A 4HT1T 3P1IA 4Q2FA 5IVVA 2A5ZA 2VZPA 5JR2A 4BQ2A 1LHOA 5FUPA 5I8YA 1COV1 3MIFA 3PUSA 1ENQA 2JIGA 3WXPA 1NKGA 2WWUA 1QXJA 5BPXA 2DTYA 1C3HA 2PAMA 2YUEA 3AKRA 5FPUA 1VAKA 3RZKA 1VJ2A 4CE8A 2ARBA 2KR2A 2BV4A 4XFIA 4ISRA 1GR3A 3GBWA 2VC9A 4JGZC 2QQNA 2BGCA 1OQ1A 2OX0A 4AF9A 2JDUA 4C8DA 3WG1A 3I54A 1SLAA 3U1XA 4KNCA 3QLQA 4AGVA 1RUF1 1RUJ2 2OS2A 5LASA 2A75A 4IV1A 3USSA 1UQXA 1UY4A 4BE3A 2VXRA 5FXZA 2W91A 1Y9QA 4GD4A 5D8AB 1VB4A 4TZDA 4EZ4A 5GZGA 1QQP2 3M7AA 5LEJA 2FCVA 3KGZA 1OUXA 1ZZ8A 5HXVA 1COV2 5A3WA 1LHUA 3AMHA 5FYIA 1M4WA 3B3QE 1QJX3 1W2OA 4PHZA 5C3QA 4AHZA 1PGW1 1FMD1 1QEXA 5T52A 3JZVA 4LE4A 4LPLA 2QQOA 3IKWA 2DTWA 4FOVA 2EXIA 3L2HA 1DGLA 3NQHA 5LCWL 4CDUA 2FQPA 2P34A 2GH2A 3POSA 1RUG3 1EYBA 3UJQA 4PBOA 1FMD3 4B4RA 3USUA 1KDMA 4LULA 4AAXA 4KBBA 1GOGA 1R1A2 1ULDA 4BK5A 1I6XA 4XF4A 5DN2A 3W59A 3UV9A 2ZS6B 3CNAA 4LBLA 4JC1A 4AEDA 1R091 1VAVA 3HJRA 1JH5A 4UXAA 1LOCA 2EIDA 4X6RB 2GNMA 1W8TA 4CU7A 4I02A 4QX8A 1A8MA 1Q8SA 2Y33A 4Z2AA 1ENSA 4BPZA 2WDBA 4RR3C 1OVSA 2XVKA 3NW4A 4QX1A 3P3NA 4XUNA 3SH3A 1FMD2 1PK6B 1KITA 1CAUA 1OD3A 4LITA 2PQSA 3OCPA 1DIWA 1R093 2PHLA 4OHVA 3V0BB 4TN7A 5FZOB 3PNAA 1QJY3 1VMJA 2HWF2 2WQZC 5FMBA 1FT9A 4Y20A 1IS6A 2X09A 2A70A 1XYPA 2ZPXA 2DURA 3WG2A 1W9SA 4PIZA 4Q29A 1LOBA 3X29B 2VUAA 4WZCA 1QJU1 3VDDC 2HWD3 1VBE2 3ZLIA 4HONA 4XCBA 5FYYA 2FBEA 2XWJB 4OCTA 1VR3A 5T3NA 1X8MA 4AFMA 3OPTA 1XRUA 1I9RA 4J6GA 2VO5A 2C6SA 1OQDA 2JDAA 2VQAA 1UZYA 4FP2A 2RG4A 2TUNA 2GN7A 3AFGA 3WQ0A 2F4PA 2LS6A 2AREA 3BODA 4Y5SA 4MLOA 5C3RA 1GWKA 4MOAA 5F5QA 3A0KA 3R4UA 1HB4A 2I2SA 4GWMA 4AG4A 4Q1PA 3CIHA 4HPKB 5GM0A 2JE8A 2O8OA 1CZVA 4HFSA 5D8AA 3ACIA 4TWTA 3SITA 5F2WA 3PVBB 4UFKA 5FYBA 2AH2A 4ASKA 1OPOA 2XHNA 4Q0UA 3POJA 4XIKA 1HJGA 5A3PA 3OG2A 4PIYA 5CG9A 4LXLA 1GZWB 1CPNA 4Q4X1 3AP4A 2WQ4A 4FPJA 2ZHMA 2X5IC 1W03A 2Q1ZB 2ZCWA 5ABJA 2RHPA 2MPFA 4XUPA 3UGGA 4DUWA 1H8TA 1ND3A 1AXYA 1Q56A 3Q8AA 3MW3A 4FO9A 4NAMA 4GA9A 1UY1A 2OVUA 3VZKA 5IK5A 2PFWA 3AKSA 3GF6A 4MVTA 4AFDA 1YQCA 1IQDC 1BYHA 2VGDA 1ZZBA 1E5IA 5EP9A 5F8PA 2UWBA 3J26N 4UWDA 1YI7A 4AEDB 1GNHA 2YC4A 3AX4A 3I49A 3S5AA 2VE1A 5BXXA 1GANA 1V70A 2SBAA 3O7OA 3I2HA 5A7SA 4FPGA 4YM3A 3GZEA 1JUIA 2NLRA 5BNOB 5HCFA 1JU4A 4DINB 3CQOA 3LFIA 1HX6A 1W6OB 4QPGB 1JODA 5EJZB 4LHSA 3RSJA 4AHXA 2ORXA 4Y1ZA 1ENXA 4IV3B 4LBMA 5E16A 4FQ4A 1NX9A 2QZ2A 1ENRA 1NG0A 4CDXB 1FPN3 1N1SA 2CHHA 2VUJA 4P9JA 4LA2A 4YM1A 2TEPA 5FQ0A 2XQRA 3WG3A 1PGL1 2WT2A 2GC0A 3ZMNA 5LBFA 3POFA 3ZFFB 2HWD2 1AYN1 1O91A 1TME2 2HLEA 2QFEA 2XJVA 4XILA 2AR6A 3T30A 2Q4SA 3LA7A 3PL0A 1POV3 3RYPA 4RHV2 1UOJA 1OHFA 4L97A 3NNJA 1O7FA 3WNPA 4RQPA 1PK6A 5T54A 4CP9B 2P3YA 4HVRA 2ZGQA 1W6PA 3HMYA 5FOBB 2KD7A 2LW8A 3WW2A 5F3IA 3ZYIB 1CWPA 2TBVA 3KT7A 1V00A 4MGTA 3ORJA 3JU9A 5CA6A 4HOOA 2YROA 4YW3A 4CDWA 2CGPA 3VD9A 1OI6A 3MYXA 2JDZA 3KT4A 4ZU7A 3D0JA 4FOWA 4LE3A 3RMYA 1CQ9A 4K40A 1SBFA 2G1MA 4N9IA 1H8VA 2AZ5A 4GH4B 1US3A 2WFF3 5CFDC 1H1AA 4CDQC 1DU3D 2DF7A 1GQPA 4RD7A 4AQ2A 1QJY1 2ZGSA 2PA7A 3WOGA 3ZXDA 5K0UB 1X36A 1OLQA 1U0AA 2VOTA 1IS4A 4U2AA 2WSUA 3KVAA 4OUMA 2IXKA 2KXLA 5H9QA 1KGYA 1AYN2 1OF4A 2HWD1 2YBSA 2VMFA 5C4WA 1SCRA 3VHPA 3O0XA 4QB6A 3I3QA 1B35B 3IIIA 4L92A 3IDAA 1XU1A 5CU1A 3O1RA 3VHOA 3POWA 2E26A 2A73B 3FL7A 4FFFA 1NCQB 3VBSA 5IFTA 4AVAA 1WD4A 5FK8A 1LJ7A 5JOWA 2RS33 3VD7A 3AP5A 1SG3A 5DXDA 1BEV1 2C24A 4IDZA 1AR71 2RMU3 4A44A 2C9KA 3T2PA 1AHSA 3ZSMA 1REEA 1NXD1 1B35C 3FFZA 1W06A 3VBFC 4NRMA 1Q8VA 2XWBB 3MEPA 1LOFC 2Z5WA 4NROA 3AZWA 5GLWA 4FAHA 1I1EA 2BWCA 5JDBA 5DUVA 4GWIA 1JYIA 4HKLA 3DF0A 1OKQA 3ZXEA 3FFQA 3AJZA 3CMGA 4D7SA 5G04L 5E88A 3HWJA 2RR12 2W47A 4CDQB 3WW1A 1BHGA 2NM1A 1C8M3 3KGLA 4QPWA 2P6HA 2W1WA 1W39A 3PDQA 1K12A 4UW3A 2G19A 4CEYA 2CU5A 5D2AA 1IGOA 1RXGA 1N1VA 3M4FA 5BNPC 4FP3A 1AR82 4JQRA 1IZ3A 3KD4A 1W6OA 5IT6A 2W2IA 4Y3OA 1FNZA 3O12A 3WDYA 3NV4A 1BBT3 4XE9A 3RI8A 4YGDA 2FD8A 2YV8A 1O4TA 2JJ6A 1X8EA 2GN3A 2ADDA 2IXJA 2WFF2 2WS91 3M1HA 4LUMA 4XBQA 3VKFC 4OULA 2VMEA 4NRQA 1VMHA 4P9XA 1WCUA 1OBNA 1CAXA 1H4GA 1NQJA 2BP6A 2VVDA 3THPA 4EN7B 3WCRA 4YG3A 1S0FA 3I2DA 1US2A 2Y26A 4PQQA 2ZKLA 3U78A 2G9ZA 5IVCA 1YQ6A 2BRTA 2XVGA 2BBAA 1XNKA 2ZJCA 1JBCA 2QQVA 2V5DA 1ULPA 1BQPA 4DRVA 1DYOA 1WKYA 2W3JA 5LA1A 1YO8A 1IKPA 4OI0A 1C5IA 1W3XA 3CZJA 3PUQA 3VBRA 3N9OA 3VN4A 2BUKA 3D4KA 1TME1 4RA0A 4R8HA 2RS32 4ZS3A 3WV6A 4JKMA 3PJYA 3GCXA 2IC1A 2FHRA 3GHNA 1UAIA 2BOJA 3NVCA 4HXCA 5CB7A 1MZEA 3PIJA 4N53C 5FO7B 4JGYB 4CXYA 1RMU2 4CCEA 1C28A 2VBBA 4H7MA 4XPVA 1LNSA 1BVP1 1H2MA 2FDJA 1W2AX 5AC91 2WAAA 4B7EA 5HXMA 5C71A 2IZWA 1T6BX 2GDFA 2MHFA 2RDRA 3LEMA 3GYDA 5T55A 2XJPA 3ZXFA 1MR5A 4DS0A 1ULOA 3GZTB 4K1YA 4JKKA 5T5PA 3BTYA 1AXZA 2ZMNA 3WZ1A 4PDWC 4IUGA 4MUVA 1F9KA 1VP6A 3TNPB 4BH9A 3G6JB 4TLGA 5FPLA 2AGSA 1AYM3 4IERA 4MXWA 5KBFA 4RQPB 3CBNA 3OEBA 4ASMB 4EN6B 3KCCA 4LO5B 3M70A 3VHRA 2PTMA 2YG0A 4UF0B 1WA6X 3SH5A 3U4XA 2UY8A 5EZWA 2WIIB 5A33B 4ZPIA 3PHMA 2R043 3KT1A 3B69A 2VMHA 2A6YA 2ZABA 1LHVA 1RUOA 2CAVA 4UFHA 3W58A 3ZMOA 4YARA 2K2SA 3RPQA 1YNAA 1W2NA 4AE2A 2J1AA 1SQ4A 2FMYA 2VUDA 3VD3A 1KJRA 1XU2A 2AUYA 4XF9A 4XOGA 5AC92 3AVSA 2BVBA 2P5BA 4DUXA 4P9WA 5I93A 1AX1A 1REDA 2A1XA 1UZZA 4WVZA 5LY1A 2BTVC 2R041 1GZCA 2DUPA 4KL1A 4PIXA 2VMIA 4I3PA 2WZR1 2OXBA 4XW3A 4XAEA 5M0TA 4Z92B 2ZA9A 4ZONA 3RVHA 2ZX2A 3WDXA 3SCHA 3IM0A 2LTNA 1WUVA 4X8PA 4HLTA 2W0XA 3R0RA 1LHWA 4QPIA 4TLFA 5FMOS 4LHNA 1HRI3 3JQXA 4Q0VA 4B4PA 3H7JA 1TMF1 1UXXX 5IW0A 2VQ0A 5A32A 1O8SA 3C3VA 3HQUA 1HKDA 2E51A 3QH6A 4QXCA 2Z2SB 5K4LA 3ACHA 2OQ7A 4OZXA 4XFHA 2CNAA 5C33A 4HKWA 2WN3A 2VTFA 2PHWA 4CDWC 5K9YA 1G9AA 3K51A 4BMEA 4Y1VA 4BB3A 4EJRA 3Q8BA 1AR81 2UWAA 2JE7A 3GM8A 4N53A 4XXAA 3NV1A 3OGSA 1GWMA 3IAPA 3K75B 4LORA 2D6NA 3LPGA 4MV2A 5FZ1A 4QDRA 2VZ3A 1MEC1 2Q8CA 3TNQA 4RYDA 1HXS1 2YPDA 3Q8CA 5JOZA 3IAQA 1H4HA 2W52A 2ZBJA 4OHXA 2P17A 3WSOA 3VBSB 1MQTA 3O1UA 2HWC2 3AK0A 5FAXA 1HJFA 5JZGA 5L36A 1HW5A 4LBJA 2D3SA 1XOYA 1BLZA 2YGLA 1XSQA 4N7UA 3U37A 1O4ZA 1WW4A 4YRDA 2WZEA 4K9SA 3WVJA 5JI9A 3AC0A 2QQWA 1EPZA 1PGSA 2W46A 1V6KA 3VBHC 1HXS3 4CUBA 2J1UA 2XL9A 4FBFA 1YWKA 1PGW2 2JD9A 1UOGA 4YLZA 2VH9A 1JUHA 4K8FA 2XKPA 3FUQA 4GWNA 2R32A 5F3EA 4Q8LA 3ZXKA 5FLHA 2ZGTA 3BCWA 4W8JA 3TEXA 3KV4A 2HBUA 1CIWA 4I0AA 2OT7A 1QIQA 1CX4A 4CU8A 2XJQA 3VBRB 5HPOA 1UYXA 4LNVA 2WWSA 3ENRA 3NV3A 3UL2A 1PO21 1RYYA 2IFWA 1FOD3 2PELA 3ACGA 5LWBA 4CSWA 1JZ4A 4WM7B 2LALA 3PTYA 1YFYA 1D4M3 4C0HA 5KHKA 5I0UA 1K5MA 4KG0A 5C8CC 1OOPA 5GLTA 1KXGA 5JXJA 4KBZA 1RUI1 4FVVA 3FBYA 2WKKA 3O1SA 1ZBE2 3B00A 5BV6A 1WW5A 1IHMA 2XONA 4IE7A 1YQ2A 4R52A 5JR7B 2QJVA 3C7FA 3C7EA 2Q8EA 4QQPA 2ZACA 2JX9A 3N7JA 1F8VA 1NQDA 1UMHA 5J36A 2NYYA 4PJYA 1RGSA 5FZMA 3AMQA 3VDDA 3FHQA 3GDBA 2G9FA 3OD0A 4XEZA 3PVNA 4MSVA 4XBNA 4CXWA 4D94A 4MG2A 1JYWA 3QACA 4PI2A 4YZ4A 5IJRA 1AYM1 4GWJA 2JG8C 3EXUA 3VL8A 4JDMA 4ZZ8A 1O6UA 2Y6HA 5FP8A 5LY2A 4PF1A 2WLPA 2X10A 1DLCA 3K46A 4N43A 4QKFA 4YM2A 2D40A 2IXLA 4RFT0 4AHYA 1KQRA 2ZHNA 2BYVE 2ZGNA 3WP4A 1MS8A 1MS4A 2OPWA 3HIFA 5J09A 2QDNA 2ZGMA 1AJKA 5DMYA 3P3PA 4XVHA 5GLVA 2WFPA 2JDMA 1QJU2 5FZIA 2P2KA 1VBB3 1X50A 3ALQA 3WNKA 1CGPA 4V1PA 5F37A 2VOXA 2EXHA 5CKMA 4L8QA 3CJIC 2R072 3POEA 4YWAA 1YHFA 3WF3A 3R4DB 1AJOA 1DG6A 2OZ6A 3TN91 3WDWA 4IQPA 1H6XA 2V4AA 3MBWA 5EQUA 1RJ8A 3GALA 3O1VA 1SLTA 1WCSA 1OD5A 2VNGA 2QQMA 1LOGA 2XLFA 1CAVA 1S1AA 3THDA 1CVNA 3RGBA 1GSLA 5J7MA 3VBUA 4ET7A 5EJ1B 3MZHA 4E2GA 1VE0A 4CCMA 1QU0A 1RJ7A 4N53B 4K8RB 5GKAC 1DF0A 2VY0A 3KV9A 5GZEA 3R4SA 4QM8A 5T50A 2RM22 3JBG2 2VW0A 4H14A 3KS7A 4Q1RA 2V5YA 3EB7A 3HD8B 2WA3A 1DGRN 1UPIA 3O1PA 2ENRA 3PU8A 1UW8A 3I2GA 4PDWB 4Q4Y3 5EWSA 1VAMA 3E1F1 4IV3A 1D4M2 4M0HA 5FY1A 4CEWA 2JKBA 3OTFA 4E2SA 4E2QA 4AVCA 3LFMA 5FJHA 2JDNA 4JX0A 3THCA 3ZKUA 2BZDA 3TAYA 3OPZA 1RHI2 1LENA 3A4UA 3BGAA 3T2OA 5DPNA 3NL1A 2WNVA 4LKFA 3AP7A 1KEXA 3M3OA 1FNYA 1UZWA 2E7AA 5FYMA 3CKHA 3NJXA 4LOTA 4AGGA 4HVOA 2ET7A 1VBD1 4AXOA 1NE4A 2VZOA 3RG0A 3K4ZA 3VZMA 5FOJB 4YGBA 4P9LA 4QKBA 3OGGA 4OZOA 4CP9A 5I8TA 4Y24A 5F3GA 2AEZA 2W1SA 3MFCA 3P6BA 5LBCA 3UK9A 4ORFA 5A3NA 1VIWB 1Q5OA 3W21A 2B4KA 5DQ0A 4B1MA 2J7MA 3ZFEB 1SLBA 4HETA 4EYUA 3MF9A 2E7QA 3NAPB 4KG8A 4MGKE 5H9RA 1PM7A 3ZFFC 4AI9A 3W5MA 2BBVA 3WX5A 4MGSA 2ARXA 4D6SA 4FPLA 3WG4A 4DOUA 1JXNA 1QDOA 4IE4A 3UYJA 4C0BA 1UN1A 1JN2P 2OUJA 2YGMA 4ZXEA 1DQ0A 3NKGA 1A3KA 2ORZA 3AYAA 3KQ4B 2GNTA 4WM8A 3DCQA 1XQNA 4I3GA 2DUOA 1LR5A 2D98A 4QU2A 4L2NA 1AUYA 5FFOC 5FPXA 2PLV3 3VBFB 2XOMA 5BNOA 5FZKA 5JLVA 1ONAA 1W8UA 1OMIA 1ZNPA 5C9AB 2BW8A 1NXMA 2GC1A 3O0VA 1R082 5FYZA 1UY3A 2HYKA 1AR93 3HT1A 4XUOA 3RZMA 5CIRA 3E6CC 5FWEA 4HK8A 1SBDA 2NQYA 2ZZJA 1U5XA 4C1XA 2MEV1 2UURA 3RYRA 4MZUA 1UL9A 3APBA 1YFXA 3ZSKA 3MF6A 4UBGA 1J3PA 1W8FA 1XNTA 3H3ZA 4N43B 3GCWA 1AR91 3KM5A 5JPMB 1XNDA 2ZOEB 1RUJ1 1CAUB 2IWGB 4KWJA 1YQ5A 3T08A 2BVVA 1HLCA 2DCZA 1CESA 2R1BA 5FZ8A 5F39A 2MEV3 3FMGA 3V0BA 1S0GA 5LBEA 1RUH3 4WM8B 4Z2WA 5H9PA 1UYPA 4FPKA 3KHBA 1NA1A 4NJ4A 1JZ6A 1GOFA 1QF3A 1RUC3 4FFHA 2Q30A 4MH0E 5ANQA 2BJSA 4FI9A 5CFDA 3W5NA 3VD4A 1RUNA 3ZSJA 1NY71 3QOPA 2B8MA 3VBOB 5KHJA 5TSWA 4E9KA 5L9BA 1J83A 5A1LA 1HB2A 2WNVB 4CEYC 4JV4A 2CV6A 1GMMA 1OKOA 3FLRA 3ON7A 2RDNA 3CJIA 5F2SA 4XJ9A 3GGLA 3HQXA 3WNLA 1ZRDA 2JG9A 3H42B 1JZ3A 2OZJA 1RB8G 2ZHKA 1WA4A 2WT0A 5C8CB 3THTA 1ZBA1 5FYVA 3JQWA 1O3RA 4GZ9A 4XFCA 5FYHA 4DO0A 1S0IA 2BWAA 4IL7A 4CP2A 5IFPA 1SDDB 3E5XA 5G05L 4M3CA 2WYSA 5EJ3A 1LRHA 5DG2A 5JUVA 4B8EA 5A7PA 1KFUL 1Y3TA 2R16A 4XFBA 3VKOA 2VW1A 3TRSB 1X9TA 2DCYA 2PLV2 3HPNA 2VECA 4GIQA 3K48A 4XC9A 3ES1A 5CADA 5F5AA 5KWRA 2FCUA 3C2UA 1PMIA 3AZYA 3K2OA 5GALA 1CAXB 5FJKA 4DQAA 5FZFA 5LATA 3H8RA 4COVA 4E27A 1DQ1A 2HWE1 3LIGA 3AMMA 4CCKA 5E1RA 3WW4A 4AHWA 1JTZX 5IVJA 4CTEA 4ZU5A 3HN3A 2UYAA 1AX2A 3W9AA 3LPFA 2HBTA 1U5ZA 4MGZE 5IYYA 1AL0G 1RUI3 5F32A 1VBB2 2VAUA 1Y4WA 2YZ4A 3ATGA 1JOBA 2GNBA 5I8SA 5B4XA 5AFEA 1V6MA 4QXHA 1CR7A 4OFGA 4JGZB 5DZGA 5C5TA 4FPYA 4FQZA 4AW7A 4EN8B 2WUHA 4QT6A 4OHWA 1HV1A 5FY4A 5BNPA 2WA4A 3DECA 1S0JA 2WAOA 1V6LA 4Z82A 3OUIA 5EXOA 5A3TA 4DPNA 4AVTA 2RJ2A 3M3EA 2GC2A 1K42A 4LO6B 3VKMA 2XR4A 4QPIB 1NUKA 2VD7A 2RS31 4JRLA 4Q0SA 2B9UA 3VZJA 1D4VB 1G9BA 2O14A 4BLJA 2RS12 3I3BA 1W9YA 1EY2A 3HEIA 1TMF3 4CCDA 4QDQA 3WF1A 4AFAA 1PVC3 4FT8A 2DBNA 2QBXA 4O65A 4MHRA 1DDLA 1WMDA 3KLSA 4X6QB 3ZYGA 1DZQA 2JG8A 2VJXA 5C3OA 4WVVA 2NN8A 4LUKA 3BTAA 4UT5A 1JOPA 4YW6A 4MADA 1JZ5A 3ZM8A 3M3IA 4AEDC 3F95A 3RI9A 5CNAA 4XF0A 3TOJA 3H3UA 3IDEA 3NJZA 4YPJA 1W05A 4JQTA 3WP5A 4GMP0 2Z42A 2XMLA 5FKBA 4HBNA 1H8TB 1ND3B 1YXWA 1G8WA 2DYCA 1OPMA 2EIBA 4YW2A 4KWLA 2R1DA 5EFUA 5A80A 5A33A 1W6MB 2ARAA 3A7QA 3WHUA 1RUG1 3T2TA 5FZCA 1CONA 1FV3A 2D3PA 4OMCA 1UMIA 2X5IB 2YB7A 3AXEA 2F4LA 3I4IA 3CJXA 1D0GA 3WDTA 1EP0A 1RUJ3 4Y5Z0 1UY0A 4W65A 1H30A 5JI7A 3B5LB 2PXJA 2WO1A 3ZOIA 1YFUA 3DXTA 4GMP1 4J25A 4BYYA 1I5ZA 1DBNA 4LMFA 5L7OB 5A6QA 2CGOA 4GXLA 4DRRA 4CU9A 2GC3A 4QGNA 2DFCA 4BM8A 2WO3A 3LKJA 2QQJA 1LTEA 4WM7A 2J1SA 3LA2A 2V09A 1SDWA 4FAGA 2Z4FA 1WBLA 4A2UA 1GZ9A 4BA6A 2DCTA 3MW4A 1EV13 2KA3A 3ZKYA 1KS4A 2GU9A 4AEKA 3NJVA 5JCTA 3FHAA 1G9DA 2A7AA 1ZZ7A 1XC6A 1SLLA 5FV3A 1T6GC 3UKTA 2XJTA 1IQAA 3C7OA 3D0SA 3D8CA 3KSCA 4S2DA 5C7GA 5J3UA 4Q4W1 3AKTA 1J58A 1UPSA 4JGZA 2CWSA 2DVGA 2RS53 1YQ8A 4P14A 3ME2A 1VBD3 3IWZA 1VRH2 3KCXA 4OI4A 4DXSA 4QXKA 5KHIA 5FYCA 1JYNA 1UYZA 1CJPA 1XPWA 3OBZA 4NUBA 4WM8C 1ZA7A 4WM7C 4QDSA 1KFXL 1A8DA 1H2LA 1SACA 1C1LA 3K3OA 3PIGA 3VLBB 1UZ0A 3IDBB 2R063 3BTZA 1YJKA 1F5FA 4LT5A 4LK6A 4BWOA 4XFFA 4U36A 2RV9A 2D6LX 4QPGA 3J4UH 2MNGA 2VQTA 4XUQA 4P9GA 1MS1A 2ZXQA 3EBRA 2VOVA 1W9FA 2JDYA 5FO9B 3V64A 1RC6A 1Y43B 5I0RA 1A6CA 1VRH3 1W99A 2PMWB 3U0ZA 1XB9A 2VG9A 4LQRA 4C91A 1HQLA 2ZMKA 4XF1A 2BFUS 4CPBA 3WP6A 4E4SA 4Q4X3 3N9MA 1VBB1 4B29A 1HB1A 4FFGA 2OPKA 2VZRA 1EAH1 1PNGA 4XETA 4YZ5A 5D1IA 4B4QA 4H2AA 2HJIA 1QDCA 4Q26A 1UX7A 4PF5A 1AL23 1FOD2 1W9TA 2PHFA 2KM2A 1VRH1 1QH7A 3O1TA 1D2QA 1H0BA 4GH4A 3QBQA 5F5CA 3VDBA 5KC6A 2TNFA 1Q3EA 3RZJA 4AI3A 4B3NA 5IVEA 2YFZA 1HRV3 1VBC3 1BZWA 1YIFA 2B9VA 3VBOC 2O0OA 1AR61 2DVFA 4KU7A 3K3NA 1GWLA 3H0OA 3PJQA 4K21A 4QX2A 2VVFA 5J48A 3ETPA 2YYOA 3OYWB 4DB5A 2D43A 1SCSA 4KMQA 3O14A 4XURA 4BXSV 3HVDA 4DEVA 4H7LA 3ST7A 3UGHA 1YRZA 3VDCA 5A6XA 4AYUA 1NLSA 1MZFA 1X7NA 2BERA 1V0AA 3NWKA 1TNFA 4I30A 4YZ1A 1G6NA 3PVEA 2OKXA 3UJOA 4CPBD 5IHRA 4LJHA 2FDKA 3MUY1 1LGCA 1PX3A 1KS5A 2JG9C 1BBT1 4XZUG 1O3TA 4BQYA 3M2MA 4K3UA 2WN2A 4FXKB 1N47A 2XDVA 4QQHA 3N7KA 4MGQA 1DYPA 3SQOA 3ETQA 1J3QA 1OSGA 1RUC1 1QXRA 3OPWA 1S2BA 3ECQA 4UW5A 1LKNA 5CEHA 4ZXKA 3CHXA 4EN0A 2DV9A 1X82A 4OUEA 5A70A 4JZRA 4LK7A 3UETA 1K45A 5FMOL 5JOXA 4BQWA 1RVF2 5ACA2 1QQP3 2ZX4A 5KXDA 2LROA 3LSEA 4DUVA 1XYNA 4XMIA 4J1XA 5B4NA 5FCCA 3INAA 3SEEA 1UNBA 1W8WA 2Y6KA 1S0CA 5L73A 1WCDJ 4TXWA 1DQ5A 5FTTC 4QXBA 5BNNB 2QE3A 1QQP1 3PTRB 2XL7A 4MO3M 3WF2A 1RUE1 1BK0A 1BBT2 2B42B 4HK9A 4Q4V2 1JYXA 2ZZQA 2BNMA 1MVQA 4CVUA 4OLLA 4F7ZA 5IVFA 2R0HA 1LULA 3OGJA 4PQ9A 1X33A 1EUUA 4BIFA 5FUNA 4BQ5A 1VMFA 1RUC2 1FAYA 4DEQA 5ABJB 3A21A 5JWPA 3AMPA 3B01A 2HWE3 3PUHA 1GZTA 4CUGA 4DXTA 3VZLA 2Y6FA 4Y1XA 4Q4W3 2HWB1 4E4ZA 1RUE3 4OVEA 4BK4A 2FDHA 2Y0OA 1LGNA 2NPIA 2Y6LA 3SXWA 3AKQA 5F1RA 2I45A 2WO7A 3ACLA 1HV0A 3EYPA 3DYMA 4MHUA 4QKNA 1RVF1 4LA3A 3D82A 5K0UA 5I0SA 1GQGA 4XACA 1WLWA 4V2WA 5DDJ1 3SEPA 3MFAA 3E5QA 1W6QA 3C7GA 3J8F2 4PT6A 2DU0A 4BIOA 4CDQA 1F2NA 3J9SA 5LA9A 2NP0A 1CJDA 1ZZ9A 1DP0A 3CLPA 4COWA 2HWB3 1J59A 4E8CA 4XFAA 1FX5A 1NZCA 4QWNA 1GP5A 2E6VA 1U5YA 3P5BA 1TNRA 2PHTA 1F4AA 4P5HA 2HYXA 5SV8A 4ITCA 1KJLA 1H9WA 2XUEA 3FLTA 2WL1A 4IETA 1D0HA 3HAGA 2PAKA 4PCRA 4LO7A 1E5SA 2DU1A 4OQ8A 4UI9L 1NT0A 3ABZA 1HDKA 2QQKA 3LD8A 4CCNA 3TEZA 4KU8A 4ATFA 3LOBA 1UOBA 3LSDA 2C4XA 1VBE3 3AYEA 4Y5TA 1Z78A 2BNOA 4GKXA 4KH9A 4AVVA 1YFWA 3LEGA 1IS3A 3T4HB 4V2VA 3ZFEA 4Y20B 2HEYF 4FTSA 1QJX2 3ZXLA 3WEZA 4RQPC 1DZRA 4LLFA 1JI6A 5JVVA 3KHCA 1LOAA 1ZVFA 1A34A 3JBG3 5FLIA 3NSTA 4NPRA 2JDPA 5DDJ2 3J8F1 1LEMA 2PN5A 3MI8A 4DNYA 4GB32 1AXKA 3OF1A 1C8NA 3BB6A 4FPCA 2FMDA 1FV2A 4G4FA 5FREA 4LR4A 2B39A 4ATEA 4FFIA 4X8NA 3BN6A 3NMBA 3ZYBA 4RGAA 3TN93 2W94A 4G9SB 1ZBA3 4O9GA 2VUCA 2WZR2 3BI3A 1Z7S1 4AQTA 1W3VA 2RS52 4QHOA 2ZGPA 3LWCA 5C70A 4JDNA 3S0MA 2A6XA 4URAA 3PMEA 3T0AA 3QCWA 1QHDA 5LK5A 4D69A 2VULA 1XBFA 1I5PA 2VQUA 4URTA 3SCGA 4J1WA 3JB8A 4XQWA 4RFRB 1T2XA 4RR3B 1UU6A 2BEOA 5HCHA 3POYA 2ZMLA 1TG7A 4M00A 5F5IA 4ZS2A 1GBGA 5DUXA 1W8ZA 1W0NA 2MEV2 1GP4A 3LF7A 1R1ZA 4WVWA 5ACA1 1KD7A 4RS5B 5FK7A 4JGYC 3HOBA 4LKEA 2W5FA 2JXAA 5J96B 4M3CE 3JD71 3VDDB 2WNUC 2RDQA 2V72A 2RE9A 2ZGRA 1OT5A 3AJYA 5DAWA 5FQ0B 3C8XA 4CEWC 1RUD1 3AZZA 1H6YA 2WZ8A 1J84A 2XLGA 2Y34A 3TWIA 4COZA 1OFSA 3S6PA 2AEYA 2R062 2WSVA 5FYTA 5ACA3 1ULFA 5A7OA 4R9CA 1PMHX 2ILMA 4FCAA 3S7IA 2BQPA 1NYWA 2E33A 1UKGA 5FO8B 4Q4V1 3FJSA 2YC2A 4XJAA 2OIIA 3JXSA 2BGOA 4XCAA 4Y4YA 2A3YA 2VNOA 1PO11 1AX0A 5FKCA 3V0AA 1LCLA 2O8QA 4A42A 4DZGA 4IW3A 2W95A 1O3SA 2Q8DA 4NHXA 4XMAA 4EE2A 4XJUA 1UWWA 5C4WB 5LEKA 3NJYA 5GLUA 5C8CA 1DCSA 5L9VA 3FWEA 1NLQA 3I2JA 4XBLA 1S0EA 4EWEA 1ZYBA 5LA2A 3G7DA 3OGRA 2WC2A 3DEMA 4CDUB 3KZ4C 2XBO3 4QPIC 5EIYB 3AM2A 3NKTA 4IGPA 3H1WA 4NRPA 4DXZA 4YVWB 1PX4A 2EIEA 1DYKA 1K5MC 2I74A 3SH4A 4YNIA 4RHV1 2XH6A 2P37A 3VUOA 5LZ6A 1WLTA 4BQ4A 2X53S 1GKBA 1QNWA 3J7NA 4IEPA 1AL21 3CO2A 4OHZA 4IXLA 4ISQA 1LEDA 2YC0A 1IOAA 4XQDA 2PHRA 4FOYA 4DMIA 4L0PA 3N9QA 3KVBA 3ELNA 2P3JA 4UYBA 3BIEA 1GUIA 2CGNA 2WZR3 1DZTA 2YU2A 3CEWA 4NIDA 3ZYPA 3ROUA 1K5MB 1AR63 2B7YA 1AYM2 2NMOA 4GB33 5F6KA 3BUCA 3WCSA 4XDPA 4ES8A 4CUCA 1PO12 4P02B 3WDVA 3WP3A 2QUOA 3D6EA 4D8MA 4QD2A 4OI1A 3N7MA 1XJAA 1ZRRA 3HN1A 5JZGC 2V4VA 5FY0A 2D3RA 4XUTA 5DAXA 4ZKTB 5C8WA 1IPSA 4BXFA 3ZPYA 2QQUA 3LE0A 5FY5A 2E53A 3K4AA 3MO4A 4XDQA 5IK8A 4BOWA 5KR7A 1QKQA 4DY3A 2J22A 4E8DA 5IK7A 3VGIA 2A6ZA 5CKNA 2VZVA 4PLNA 1F4HA 3KMHA 4M4RA 4ZU4A 2VOKA 5A3LA 3I3DA 2OW4A 4QQOA 2XJSA 4LBOA 1NLRA 1TZOA 5GZCA 4JHZA 3ILNA 3ZO0B 5J1XA 5FZOA 5K8SA 1MEC2 2Y6GA 4B1LA 2UU8A 2RS11 5JXHA 1HXS2 2Y38A 3T4VA 5F7UA 1WMEA 2RS51 3I2KA 2A3XA 3WUDA 1F5JA 4GAZA 3UNPA 4UW4A 5EYYA 2Q1MA 5L7OC 2VNVA 3M3QA 3T2QA 5AC93 1LESA 2VCMA 3JCIA 3ZVXA 4XABA 2ETEA 2XG3A 3B94A 4A7YA 1Q8QA 4XHBA 4AVBA 1REFA 4QGMA 2JB4A 2DVBA 4AOCA 3WF0A 4Z1VA 1APNA 1JOJA 1LU1A 2JECA 3FHIB 2Z79A 4YFWA 1X9PA 2F17A 2RR11 5FIXA 1L3JA 1W8OA 1N3PA 5FZ6A 1OA3A 1Q8PA 1B09A 3DV8A 3U07A 1LAJA 5JOYA 2VL4A 3OY8B 4RGGA 4MGIE 4Q4Y2 2XBO2 5HBAA 2CYFA 1TQ5A 4YFZA 2H0VA 1LOEA 1D4M1 1VLNA 1QJEA 2R6QA 2VTXJ 5HI0A 1PO22 2Y8KA 4AEMA 4UW6A 5CG8A 4IEUA 4O7XA 2DVDA 3TEYA 4FOQA 5A6ZA 4D7YA 3L9JT 3LEIA 3LDBA 1QGLA 1RUF3 5FRAA 4AFBA 1HQWA 5FPBA 3OGVA 1NCQC 3ZSEA 4CCCA 1ZBE1 2RM23 4EV0A 4A7ZA 4YVSA 3I59B 2NZ9A 4CDWB 1W8NA 3UKVA 1Y9MA 4CCOA 2VR4A 2ID4A 4FPOB 4QX7A 4AEJA 1HRV1 1VBC1 1SBEA 5FMCA 2J1VA 1U12A 1JW6A 3V56A 2JKXA 4D6QA 4JAAA 2EXKA 1RITA 3IB3A 4YG0A 3WW3A 4W4ZA 4FXGB 4QMAA 3GBFA 2CL2A 2VCCA 1F31A 1W6PB 1SFNA 3PUAA 4W50A 5DG1A 5K0UC 3O1MA 4P9IA 3BKZA 2K0GA 4NMIA 1EPWA 1MZ5A 2W87A 1J1TA 3CDZB 2AC1A 4HL0A 1UO9A 1W8HA 1JHNA 2XPJA 2EXJA 3WNXA 3B02A 3GJAA 3I8TA 2WLQA 4K7JA 2X5IA 4ES9A 2XBO1 1WLDA 2Y60A 2ZEWA 4Q4W2 5APAA 1GZWA 1OA4A 4JTOA 1G86A 1PIV2 3HBZA 3VKLA 2AACA 2Y0IA 2W1QA 4EWDA 5GJ6A 3OUJA 3H3LA 1JZ8A 2PHDA 3Q8EA 1RUH2 3HR9A 5DABA 1O8PA 2LRPA 3GZUC 3MIEA 4N7IA 1VRBA 1W0OA 4N43C 3T09A 1ASJ2 2VU9A 5A7WB 5EV7A 1BEV2 1JZ2A 3N7LA 3MIDA 2ET1A 3ZR5A 1WLCA 4Y4RA 3AB0A 4HSJA 5JSOA 1Q8OA 1E5RA 3ZFGA 3HT2A 4IEVA 2UWCA 3TN92 1MEC3 1HRV2 1VBC2 2QZ3A 3H1YA 3IPVB 4LIUA 1V6OA 1NY72 4SBVA 4RS5C 1DLLA 4H3WA 2JEMA 2XUMA 1F15A 1D7PM 1H2KA 2G4IA 3CF6E 2QCSB 2CDOA 2GZWA 2HWF1 2N7GA 4B7KA 2Z69A 3O0WA 3VKNA 1FI2A 2P6CA 3USUB 5A6YA 4PI0A 4OQ9A 3ZDVA 2D97A 4LO4B 3WQBA 2YFUA 1RMU3 4F8AA 1QH6A 2JG9B 4XJWA 4CUAA 1AR92 4EROA 1G9CA 1ULCA 1C5HA 4QX0A 1GNYA 2Q1FA 3B9IA 3OOXA 1DFQA 4A4AA 2ES3A 3LB9A 2IVIB 4NAOA 1PIV1 4I01A 4QB1A 3S57A 4UFIA 3GZAA 2F6BA 3LGRA 4QPGC 3LDRA 1ZZ6A 3JUUA 3MIHA 4QX5A 1QXPA 2GP3A 5CAZA 3CU7A 3BYWA 4WVMA 2BGPA 2QKDA 4YW4A 3WUCA 4GJYA 1GICA 1VBA3 2UY9A 1GNZA 1COV3 4EZHA 5BNNA 2R073 1UMZA 1BK1A 3H9AA 3ZN4A 3NNGA 2WFF1 2WS92 3GHMA 4OYUA 2ZGUA 4PBPA 2ZAAA 5B2GB 5JSPA 3KV5A 1W04A 2C5DA 3EMRA 2FDFA 1CD3G 3AYDA 2IUWA 3NV2A 4S2FA 1OOPB 2GAUA 2GH8A 5I0DA 1B35A 4XTPA 5ABJC 2RVAA 1URXA 2VBPA 1ZBA2 3IMMA 1YYNA 3PURA 4W6XA 1DGWA 4BISA 3MW2A 3HNMA 3H1MA 4CEYB 1WMFA 2W92A 4NPMA 3WQ7A 4M3CB 4P00B 3WINE 4CP0A 4XDOA 5IVBA 2ZAHA 4ARXA 4YGCA 4KGQA 1R1A3 5IAVA 3TYJA 3MGUA 4TTGA 1SLCA 1ND2C 2DDUA 4R4XA 1RHI3 1PVXA 1XYOA 2H6CA 3OBRA 4XAAA 2D6PA 2EVXA 4MX3A 2WYFA 4YYOA 1BEV3 2ZEXA 1WCKA 4XFGA 5JPNB 2BFUL 3AYCA 5FPVA 2D93A 4ZY9A 2P3IA 2B45X 4JCKA 3TB0A 3RZHA 2HWE2 4QGLA 3CZUA 2YU1A 1R1A1 4MGYE 5L9RA 2OUHA 3N4MA 3T0BA 4CP1A 3TEWA 3KQRA 2GMEA 1GP6A 4W6YA 1OLMA 3MHZA 1OH4A 4GULA 3A23A 3POGA 2K9ZA 4QKDA 4P08A 1HRI2 1NCRC 4LO8A 1CN1A 1TE1B 2H6BA 2GP5A 3H8UA 4IE5A 5FXWA 3SMHA 1K5JA 2O1QA 1V6IA 4XTMA 3LZZA 1QWRA 1MS5A 2EALA 1C57A 4N8MA 1QMJA 3RZZA 1E5HA 1YEWA 4XQ4A 5H9SA 4IV3C 4IV1C 1OF3A 3SKVA 1POQA 1UIJA 3DXUA 2IVJA 1IKQA 2YDEA 1MQTC 2C0ZA 2G9GA 3WNOA 3R6SA 1ZREA 3QH7A 1RUH1 3EQEA 1AYN3 2LM3A 5HCBA 1G7YA 3IPVA 3U11A 3ZXJA 1N3QA 2DWRA 4YVSB 1WMXA 4GJZA 1OFNA 4HSLA 2CTVA 1MVEA 4Z8BA 2ZGLA 5EHDA 5KXBA 1C1FA 2R30A 1O4YA 3BIWE 4ZZ5A 1L7LA 3FC0A 3MV11 3RWKX 1JHJA 4D6RA 1UX6A 4C90A 4TYSA 3DUIA 3WQ1A 3UT0A 4CXXA 2R042 3HNBM 5I91A 4YG6A 5E8AA 4AWDA 1NA1C 1Y7BA 2ZEYA 3CL1A 3GXUA 2DUQA 5CZKA 5JIAA 4WBBA 4YW7A 3OBAA 2XVLA 3S5QA 5BNPB 5F6LB 3E6BA 2PAEA 1L7RA 3J7HA 5BYNA 1SHWB 1RUD3 3I97A 1DHKB 1LHNA 1AZDA 2RDSA 3D3AA 2D44A 3NNLA 3KCYA 3POBA 4IGQA 5FP3A 3ZFGC 3WNMA 1BJQA 3BOWA 4RS5A 4NHMA 4IE6A 1WW7A 4BJ0A 4DFSA 1YIPA 4BDVB 5FR3A 5LK7B 3EO6A 2WBKA 5JXIA 1GQHA 1ND2A 4XYXA 3MUZ1 3TBDA 2E9QA 3VBHA 1PK6C 4NHKA 3OSDA 4CZSA 3MPBA 3MICA 2WNOA 1QJFA 2E7TA 1K3IA 4CCLA 4UFLA 1VBA1 4H55A 3N36A 1YC61 1HN0A 2JICA 2R071 2YBPA 4AGRA 3L2YA 4XXPA 5BNOC 4A41A 1IG0A 2IFRA 1YCIA 2WNUB 2QTWB 2FZ1A 2ZGKA 2WJSA 4P9YA 2RMU1 4AI8A 2HWC1 3C7HA 5L7OA 1Q43A 4HKOA 1QY4A 1UOFA 5I0TA 2D6KA 4O9EA 2GSYA 3ZXAC 1FPN2 2HEVF 2HKXA 5CFCC 2CY6A 4Q0PA 4HN0A 3AXDA 1TVGA 1J3RA 4PDWA 3K77A 5FZBA 4BU2A 1QJX1 3OY8A 3RJRA 4CDXC 1NA1B 2WABA 2VXJA 1XSRA 3ILRA 1ASJ3 2HWC3 3ZN6B 3DKQA 4CDUC 1IPJA 2B5HA 1OVPA 5T5LA 2WT1A 5FZGA 2WNEA 1DQ6A 2VZUA 1XNCA 3J7MA 2OYZA 3ZIXA 4GB31 2EIGA 1RXFA 4NWVA 5LRRA 5BNQA 4M4PA 4DIQA 5IVYA 3SHRA 4HANA 1MS3A 3LIHA 5D21A 3H8OA 1V9U1 3EHKA 4K1ZA 4R9DA 3IZOA 3EJKA 5FPZA 3ES4A 1ZA4A 4DXRA 1XE7A 3E97A 1VB2A 4L99A 1YLLA 4QM9A 4AZZA 4F83A 1RUI2 1PHMA 1W6NA 2GNDA 2JENA 5CFCA 1SPPB 4QQLA 4AVSA 4E4DX 2E63A 2R7EB 1QNYA 3ZIWA 3LAGA 1V9U3 5GLZA 1HRI1 1H8TC 1ND3C 1SZBA 4OI2A 5T5OA 3WD5A 5IUQA 1FPN1 2EF6A 2WO2A 1FXZA 3DKWA 4I0BA 1YI9A 4INDA 4D0QA 1WWYA 2GALA 3MPPG 4IEQA 2E32A 4YZ2A 4JKLA 4XJ8A 5DAQA 2A3WA 3K4DA 4D3WA 1BVVA 3Q9OA 1F35A 2WR9A 3DYOA 4L9BA 3S30A 1PGL2 5BNNC 5L19A 4I2OA 3ZYHA 3NO8A 1RUG2 3OEAA 1AR62 1SLIA 4CRQA 5FZ9A 1S4CA 1ZRCA 3JD72 4LTAA 5LB6A 2VM9A 3NAPC 4Q0QA 4Y1YA 1V9U2 4HVQA 1O5UA 1TME3 4A7KA 1V6NA 5JZGB 4NE9A 5BUVA 2FDGA 1OOPC 2D6MA 2XXZA 1RMU1 2Q0AA 2BOIA 4IEYA 1UY2A 1O59A 2WZPP 1FATA 2AYHA 1WGPA 2XHKA 4Q27A 3RJ2X 3ZYFA 4AI0A 5A3MA 5CFDB 4A3XA 1R092 2A6VA 3LOIA 3HQRA 4Y1UA 4CCJA 4FTBA 1S2EA 2E31A 2FCTA 5FZLA 3ZSLA 1OH3A 4BQ1A 3ZYRA 1AR72 3NAPA 3SCFA 4KQ7A 1EUTA 5C9AC 2YHJA 3O5SA 1PVC2 1CAWB 1I3HA 1QJY2 3BU7A 1NZIA 1LOFA 1S0DA 4NIGA 2WINB 1C8M2 1RINA 2W08A 1BKZA 1AF9A 2YMZA 2P1BA 3WNNA 4LBQD 4YW5A 5ISLA 1W0PA 4IGOA 4LIVA 4UOJA 3M3CA 2RM21 2JE9A 3HBKA 2VMCA 4Q5OA 4UFMA 2C26A 2CAUA 4NR1A 1UZVA 1UU4A 3H8XA 1MPXA 4QAWA 4UBHA 5A7NA 1WCQA 1PZ8A 5F9TA 3I3MA 3IMNA 1AR73 4EN9B 2WNUA 3ITQA 2JD4A 5FYSA 3RNSA 4A45A 1HN1A 3AP9A 3E6DA 4GH4C 1RVF3 4COYA 1VBA2 3DGTA 3GJBA 4KWKA 5EPAA 3I2OA 1W90A 3WF4A 4LEJA 5A1AA 1H9PA 4Q4V3 1RHI1 5JAXA 5JSRA 1OURA 5K7PA 1ZX5A 1GV9A 5D8AC 1PNFA 4IEZA 4IV1B 4LBKA 1SPPA 4BLIA 4R4ZA 5IAXA 5FY7A 3B9CA 1PO13 4MXVA 1EAH3 2UYBA 1HB3A 2L9LA 3BPZA 3IT8A 3MLKA 4UAPA 1MS0A 1PVC1 3PVOA 3R05A 4FPEA 1XNBA 4EWAA 1VPHA 2P4EA 3FN9A 1C8M1 5FP7A 1NCQA 1TMF2 4I09A 2ARCA 4YVSC 2IXHA 5FLJA 5FZAA 3V65A 5AVPA 4KGGA 1S0BA 1YUDA 1M06G 1SFPA 4IEOA 1VBE1 1DQ4A 3VBUB 4GKYA 1JU3A 3VD5A 4BCUA 2ZX3A 3B93A 5FXVA 1O3QA 3BTXA 1N1YA 2QQLA 2QQPA 1E57A 3OUHA 2DVAA 3FE5A 1UKRA 5GZDA 1ODMA 2QVSB 4S2HA 3ZYJB 3MLLA 2OA2A 3RYKA 3PU3A 4QX3A 2J1RA 4Y22A 5CYYA 2CDPA 4AAPA 2HH9A 4RR3A 4ZHNA 4YSFA 3IBMA 4LBNA 5FZ4A 1AR83 2QDRA 2PYTA 2JG8B 1N3OA 1BMV1 3J8F3 3VBRC 4JRAA 2Y6JA 3JB4C 2CWMA 4FPHA 3S7EA 3ZFGB 4GMP3 2XGXA 3MIBA 5IWFA 2J1TA 3ZN5A 5CFCB 5LW9A 1PIV3 1UU5A 4A3ZA 1NCRA 2H0BA 3NNMA 5CBLA 1L7QA 1OXCA 4AI2A 2XJRA 4M0NA 3ILFA 4Q4X2 4Y22B 3IDCB 1R081 2AENA 2HEWF 1RTVA 1OQEA 1ZRIA 4R9AA 3J7LA 4YVWC 2OQ6A 1EV11 1WZXA 2W39A 1CAWA 1NAEA 4HMZA 1W6MA 2ADEA 3I3EA
chains in the Genus database with same CATH topology
2VTXA 4CA9A 2VTXJ 2P1BA 1XB9A 4N8MA 5EHDA 1NLQA 1XE0A 1K5JA 3T30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VTX A;  4CA9 A;  2VTX J;  2P1B A;  1XB9 A;  4N8M A;  5EHD A;  1NLQ A;  1XE0 A;  1K5J A;  3T30 A; 
#chains in the Genus database with same CATH topology
 4WV8 A;  3DL3 A;  5A7Q A;  4Q4Y 1;  1BCX A;  1V6J A;  5ANN A;  5FP4 A;  3WY6 A;  2XB6 C;  2K46 A;  1FYU A;  2ZGO A;  2R49 A;  4LKS A;  3ZFF A;  2X29 A;  3I7D A;  4MYE A;  4QHB A;  3OJB A;  1R08 3;  4R9B A;  5GZF A;  5A32 B;  1CIY A;  2VCA A;  4LBQ B;  1C4R A;  3SIS A;  4WZF A;  3POI A;  4MXW B;  4Y26 A;  3O1O A;  4RSU A;  1XE0 A;  1ALY A;  1JS9 A;  3GBG A;  1PO2 3;  1ZM1 A;  5E6H A;  3DN7 A;  1BMV 2;  2D5F A;  2YY1 A;  4RGK A;  4L11 A;  4IEW A;  4AL9 A;  2ZKN A;  3AKP A;  5JXG A;  1NOV A;  4NIH A;  5IAT A;  3VL9 A;  3VDA A;  3KV6 A;  2R06 1;  1MS9 A;  3BU0 A;  1ULE A;  1QOS A;  5KHG A;  4A6S A;  5CKQ A;  3A22 A;  4M3C F;  4QHZ A;  5HV0 A;  4NHY A;  5LRS A;  4CEW B;  3VBF A;  2ZEZ A;  4QQ2 A;  1NE6 A;  1S55 A;  2EAA A;  2WRA A;  4JGY A;  3SC7 X;  4N9H A;  1U5I A;  2VMD A;  3AVR A;  2BNN A;  1LEC A;  5FZ7 A;  3WT3 A;  3AMN A;  1ACC A;  2VVE A;  5DZE A;  5C6C A;  1IG3 A;  2Q8O A;  5FWJ A;  4OMD A;  2BU9 A;  5JMC A;  3RZL A;  2HWB 2;  4OHY A;  1AVB A;  3U14 A;  1JYV A;  3VB9 A;  4LHL A;  2DCJ A;  2IXI A;  2X05 A;  3Q8F A;  1IPK A;  2PQQ A;  4XF3 A;  1ZZC A;  1LOD A;  1RUD 2;  2VZQ A;  3KF5 A;  4RL7 A;  4COU A;  4G3Y C;  4IE0 A;  4N90 A;  2W1U A;  3U10 A;  1W2U A;  2JDK A;  2PLV 1;  1ASJ 1;  4IEX A;  4LHK A;  1Z0H A;  3OD4 A;  1DGW X;  1XNA A;  3T1M A;  3VZO A;  4Q8K A;  1CX1 A;  3SLI A;  5A3O A;  1CZS A;  2DBI A;  4RHV 3;  4NHL A;  2W9X A;  3I59 A;  4O61 A;  1NCR B;  1Y9G A;  3RMX A;  4EQV A;  2VW2 A;  1OC1 A;  2WS9 3;  2PHU A;  3MLJ A;  4XIO A;  4ASL A;  2GMP A;  3VZN A;  3LA3 A;  5FBJ A;  3ZN6 A;  1KRI A;  4RN5 A;  3RDI A;  3PUI A;  1QOO A;  2C9A A;  3DPR A;  4E4H A;  3ZXG A;  2J42 A;  4NO4 A;  2ATF A;  1H2N A;  1J1L A;  2R0F A;  5IK4 A;  2C1F A;  2VPV A;  1H1I A;  1W6Q B;  4M01 A;  3JBG 1;  1ULG A;  4PLO A;  3WDU A;  4CYD A;  5J37 A;  3AZX A;  1PMJ X;  1UXZ A;  2VZS A;  3BOP A;  3LQC A;  4XJZ A;  4YGE A;  5A1F A;  3N35 A;  3V0A B;  5E89 A;  5FXX A;  2YXS A;  4LOS A;  1LGB A;  1UYY A;  4DY5 A;  1DQ2 A;  1GOH A;  4HZF A;  4Y33 A;  4BHP A;  2VNR A;  3AFK A;  1ZRF A;  5C9A A;  3IIA A;  3VBO A;  2FZ2 A;  4K20 A;  4KWU A;  4I0W B;  3BVC A;  1MQT B;  5LA0 A;  3KB5 A;  3FLP A;  1UIK A;  1CAV B;  3VBH B;  5FBZ A;  3MIG A;  3OBT A;  1RL3 A;  1Z7S 2;  2EAK A;  2YBK A;  3MDP A;  1VBD 2;  2QNK A;  2BPA 2;  4SLI A;  5FYU A;  2I07 B;  1QJU 3;  1PZ9 A;  2HWF 3;  3FBM A;  1POV 1;  3FZ3 A;  4NN0 A;  3OYW A;  4ONU A;  1GU3 A;  5FUI A;  4XHX A;  3RQ0 A;  3PLQ A;  4AFC A;  4D7T A;  1SEF A;  3VBU C;  1BXH A;  4FTE A;  1HIX A;  2ZX1 A;  1SMV A;  4NOT A;  1EV1 2;  3IN9 A;  5DUW A;  2P3K A;  2CSG A;  1W9W A;  2EA7 A;  4YVW A;  3BPS A;  3RWN A;  4NWW A;  1FOD 1;  4KI5 M;  3I2F A;  4F3J A;  2D5H A;  2SLI A;  2XJU A;  3SNM A;  5J98 B;  5KHH A;  1IS5 A;  2V73 A;  4GAL A;  3BAL A;  2VOW A;  3RFR A;  3JD7 3;  3WLU A;  3N9N A;  3D5O A;  4MET A;  2VZT A;  2ZX0 A;  4K6B A;  5FZH A;  2RR1 3;  3T3Y A;  1POV 0;  2W68 A;  2WNV C;  3NRU A;  5FPA A;  3UKN A;  4QU1 A;  3W20 A;  2YPJ A;  3DPR B;  3WHT A;  5KC5 A;  4ARY A;  2GMM A;  3AL5 A;  1RUF 2;  2VZ1 A;  3CJI B;  1MZ6 A;  2VCB A;  4JTN A;  3GNE A;  2XQX A;  5DDJ 3;  4BZ4 A;  3A0N A;  3N3H A;  2XLA A;  5DZF A;  5JIU A;  1OUS A;  1PM4 A;  2VBD A;  1ST8 A;  3LCP A;  1STM A;  2XKO A;  4JVA A;  4CU6 A;  5C5U A;  5A7W A;  3U4S A;  2DFB A;  4S2G A;  3RS6 A;  2FDI A;  5C3P A;  2IXC A;  1GYK A;  4NIA A;  4TSV A;  1UD1 A;  4JDO A;  5FY9 A;  5FY8 A;  2X8K A;  3DPR C;  1ZBE 3;  2D6O X;  2QQI A;  3DYP A;  4AK3 A;  1W2T A;  2ZHL A;  4Z07 A;  3UGF A;  5F3C A;  4P5Y A;  3VHN A;  3PMS A;  4NII A;  5HV4 A;  1O5L A;  3VBS C;  5C3S A;  1UCX A;  5T5J A;  3ZX7 A;  3RRD A;  4FSJ A;  3QD6 A;  4C1W A;  5DAV A;  1RIR A;  3ASI A;  1OLM E;  3LDK A;  4UF0 A;  4HG6 B;  5DAP A;  1R64 A;  2Q5T A;  4GQ7 A;  3T1L A;  2NMN A;  1CZT A;  5CVR A;  1PZ7 A;  5FDB A;  3RZG A;  5BY5 A;  1JYC A;  3OB8 A;  1GLH A;  1XXN A;  2B46 X;  3LEK A;  2Y64 A;  4CDX A;  3KWV A;  3HNY M;  3U75 A;  3WR0 A;  2D7F A;  3VV1 A;  1S2K A;  1CPM A;  2DCK A;  4HPK A;  2LUW A;  1LU2 A;  1KDK A;  3NNF A;  4AI1 A;  2ZTN A;  5A3U A;  4OUS A;  4HN1 A;  5AVA A;  1AL2 2;  4UFJ A;  5FZ3 A;  4BMB A;  1H1M A;  3URF A;  4FPF A;  3H50 A;  4PLM A;  1G9F A;  1JZ7 A;  3UES A;  3SKJ E;  4BQX A;  4YM0 A;  1HQN A;  1OLR A;  2RJK A;  1RUE 2;  2VTX A;  4A6O A;  2ERF A;  1MAC A;  4JHT A;  1WW6 A;  2J1E A;  1ODN A;  2A71 A;  5CIS A;  3M8L A;  1VAL A;  3ZDS A;  5FMD A;  1ND2 B;  2VMG A;  1W6N B;  1Z7S 3;  1JYT A;  1WBF A;  2PHX A;  5FZE A;  1EAH 2;  3ZR6 A;  2A6W A;  1A78 A;  5FZD A;  5ERL A;  3KF3 A;  5FZ0 A;  5FP9 A;  2RJL A;  1JMU B;  3B7M A;  1GFF 2;  3MV0 1;  4LBQ A;  4AR2 A;  4WVM B;  5AFB A;  2WWJ A;  3ZFE C;  4AQ6 A;  1WD3 A;  1TEI A;  1P8J A;  5DUU A;  4LLO A;  3H7Y A;  2WQ8 A;  2JB8 A;  2EIC A;  5EYX A;  1XE8 A;  3I2I A;  2JWP A;  1SFY A;  4QPY A;  3E5U A;  5SV5 A;  1UF2 C;  4W6W A;  4IES A;  3FUO A;  1QOT A;  4NPL A;  4AQS A;  1OA2 A;  3AL6 A;  5HCA A;  4CA9 A;  1N1T A;  2BDR A;  3ACF A;  4YW1 A;  1YJL A;  4NVP A;  4XZP A;  5KXE A;  4QB2 A;  1D2S A;  2RS1 3;  5LBB A;  3N9L A;  5C4W C;  1W28 A;  4YZ3 A;  3F2Z A;  3ZPO A;  1DGR A;  3N9P A;  1LB2 A;  5KXC A;  4LKD A;  2JDH A;  1QJZ A;  5JMO A;  2RMU 2;  4BQ3 A;  3T0D A;  3AZV A;  3FX3 A;  2JIJ A;  3AP6 A;  4HT1 T;  3P1I A;  4Q2F A;  5IVV A;  2A5Z A;  2VZP A;  5JR2 A;  4BQ2 A;  1LHO A;  5FUP A;  5I8Y A;  1COV 1;  3MIF A;  3PUS A;  1ENQ A;  2JIG A;  3WXP A;  1NKG A;  2WWU A;  1QXJ A;  5BPX A;  2DTY A;  1C3H A;  2PAM A;  2YUE A;  3AKR A;  5FPU A;  1VAK A;  3RZK A;  1VJ2 A;  4CE8 A;  2ARB A;  2KR2 A;  2BV4 A;  4XFI A;  4ISR A;  1GR3 A;  3GBW A;  2VC9 A;  4JGZ C;  2QQN A;  2BGC A;  1OQ1 A;  2OX0 A;  4AF9 A;  2JDU A;  4C8D A;  3WG1 A;  3I54 A;  1SLA A;  3U1X A;  4KNC A;  3QLQ A;  4AGV A;  1RUF 1;  1RUJ 2;  2OS2 A;  5LAS A;  2A75 A;  4IV1 A;  3USS A;  1UQX A;  1UY4 A;  4BE3 A;  2VXR A;  5FXZ A;  2W91 A;  1Y9Q A;  4GD4 A;  5D8A B;  1VB4 A;  4TZD A;  4EZ4 A;  5GZG A;  1QQP 2;  3M7A A;  5LEJ A;  2FCV A;  3KGZ A;  1OUX A;  1ZZ8 A;  5HXV A;  1COV 2;  5A3W A;  1LHU A;  3AMH A;  5FYI A;  1M4W A;  3B3Q E;  1QJX 3;  1W2O A;  4PHZ A;  5C3Q A;  4AHZ A;  1PGW 1;  1FMD 1;  1QEX A;  5T52 A;  3JZV A;  4LE4 A;  4LPL A;  2QQO A;  3IKW A;  2DTW A;  4FOV A;  2EXI A;  3L2H A;  1DGL A;  3NQH A;  5LCW L;  4CDU A;  2FQP A;  2P34 A;  2GH2 A;  3POS A;  1RUG 3;  1EYB A;  3UJQ A;  4PBO A;  1FMD 3;  4B4R A;  3USU A;  1KDM A;  4LUL A;  4AAX A;  4KBB A;  1GOG A;  1R1A 2;  1ULD A;  4BK5 A;  1I6X A;  4XF4 A;  5DN2 A;  3W59 A;  3UV9 A;  2ZS6 B;  3CNA A;  4LBL A;  4JC1 A;  4AED A;  1R09 1;  1VAV A;  3HJR A;  1JH5 A;  4UXA A;  1LOC A;  2EID A;  4X6R B;  2GNM A;  1W8T A;  4CU7 A;  4I02 A;  4QX8 A;  1A8M A;  1Q8S A;  2Y33 A;  4Z2A A;  1ENS A;  4BPZ A;  2WDB A;  4RR3 C;  1OVS A;  2XVK A;  3NW4 A;  4QX1 A;  3P3N A;  4XUN A;  3SH3 A;  1FMD 2;  1PK6 B;  1KIT A;  1CAU A;  1OD3 A;  4LIT A;  2PQS A;  3OCP A;  1DIW A;  1R09 3;  2PHL A;  4OHV A;  3V0B B;  4TN7 A;  5FZO B;  3PNA A;  1QJY 3;  1VMJ A;  2HWF 2;  2WQZ C;  5FMB A;  1FT9 A;  4Y20 A;  1IS6 A;  2X09 A;  2A70 A;  1XYP A;  2ZPX A;  2DUR A;  3WG2 A;  1W9S A;  4PIZ A;  4Q29 A;  1LOB A;  3X29 B;  2VUA A;  4WZC A;  1QJU 1;  3VDD C;  2HWD 3;  1VBE 2;  3ZLI A;  4HON A;  4XCB A;  5FYY A;  2FBE A;  2XWJ B;  4OCT A;  1VR3 A;  5T3N A;  1X8M A;  4AFM A;  3OPT A;  1XRU A;  1I9R A;  4J6G A;  2VO5 A;  2C6S A;  1OQD A;  2JDA A;  2VQA A;  1UZY A;  4FP2 A;  2RG4 A;  2TUN A;  2GN7 A;  3AFG A;  3WQ0 A;  2F4P A;  2LS6 A;  2ARE A;  3BOD A;  4Y5S A;  4MLO A;  5C3R A;  1GWK A;  4MOA A;  5F5Q A;  3A0K A;  3R4U A;  1HB4 A;  2I2S A;  4GWM A;  4AG4 A;  4Q1P A;  3CIH A;  4HPK B;  5GM0 A;  2JE8 A;  2O8O A;  1CZV A;  4HFS A;  5D8A A;  3ACI A;  4TWT A;  3SIT A;  5F2W A;  3PVB B;  4UFK A;  5FYB A;  2AH2 A;  4ASK A;  1OPO A;  2XHN A;  4Q0U A;  3POJ A;  4XIK A;  1HJG A;  5A3P A;  3OG2 A;  4PIY A;  5CG9 A;  4LXL A;  1GZW B;  1CPN A;  4Q4X 1;  3AP4 A;  2WQ4 A;  4FPJ A;  2ZHM A;  2X5I C;  1W03 A;  2Q1Z B;  2ZCW A;  5ABJ A;  2RHP A;  2MPF A;  4XUP A;  3UGG A;  4DUW A;  1H8T A;  1ND3 A;  1AXY A;  1Q56 A;  3Q8A A;  3MW3 A;  4FO9 A;  4NAM A;  4GA9 A;  1UY1 A;  2OVU A;  3VZK A;  5IK5 A;  2PFW A;  3AKS A;  3GF6 A;  4MVT A;  4AFD A;  1YQC A;  1IQD C;  1BYH A;  2VGD A;  1ZZB A;  1E5I A;  5EP9 A;  5F8P A;  2UWB A;  3J26 N;  4UWD A;  1YI7 A;  4AED B;  1GNH A;  2YC4 A;  3AX4 A;  3I49 A;  3S5A A;  2VE1 A;  5BXX A;  1GAN A;  1V70 A;  2SBA A;  3O7O A;  3I2H A;  5A7S A;  4FPG A;  4YM3 A;  3GZE A;  1JUI A;  2NLR A;  5BNO B;  5HCF A;  1JU4 A;  4DIN B;  3CQO A;  3LFI A;  1HX6 A;  1W6O B;  4QPG B;  1JOD A;  5EJZ B;  4LHS A;  3RSJ A;  4AHX A;  2ORX A;  4Y1Z A;  1ENX A;  4IV3 B;  4LBM A;  5E16 A;  4FQ4 A;  1NX9 A;  2QZ2 A;  1ENR A;  1NG0 A;  4CDX B;  1FPN 3;  1N1S A;  2CHH A;  2VUJ A;  4P9J A;  4LA2 A;  4YM1 A;  2TEP A;  5FQ0 A;  2XQR A;  3WG3 A;  1PGL 1;  2WT2 A;  2GC0 A;  3ZMN A;  5LBF A;  3POF A;  3ZFF B;  2HWD 2;  1AYN 1;  1O91 A;  1TME 2;  2HLE A;  2QFE A;  2XJV A;  4XIL A;  2AR6 A;  3T30 A;  2Q4S A;  3LA7 A;  3PL0 A;  1POV 3;  3RYP A;  4RHV 2;  1UOJ A;  1OHF A;  4L97 A;  3NNJ A;  1O7F A;  3WNP A;  4RQP A;  1PK6 A;  5T54 A;  4CP9 B;  2P3Y A;  4HVR A;  2ZGQ A;  1W6P A;  3HMY A;  5FOB B;  2KD7 A;  2LW8 A;  3WW2 A;  5F3I A;  3ZYI B;  1CWP A;  2TBV A;  3KT7 A;  1V00 A;  4MGT A;  3ORJ A;  3JU9 A;  5CA6 A;  4HOO A;  2YRO A;  4YW3 A;  4CDW A;  2CGP A;  3VD9 A;  1OI6 A;  3MYX A;  2JDZ A;  3KT4 A;  4ZU7 A;  3D0J A;  4FOW A;  4LE3 A;  3RMY A;  1CQ9 A;  4K40 A;  1SBF A;  2G1M A;  4N9I A;  1H8V A;  2AZ5 A;  4GH4 B;  1US3 A;  2WFF 3;  5CFD C;  1H1A A;  4CDQ C;  1DU3 D;  2DF7 A;  1GQP A;  4RD7 A;  4AQ2 A;  1QJY 1;  2ZGS A;  2PA7 A;  3WOG A;  3ZXD A;  5K0U B;  1X36 A;  1OLQ A;  1U0A A;  2VOT A;  1IS4 A;  4U2A A;  2WSU A;  3KVA A;  4OUM A;  2IXK A;  2KXL A;  5H9Q A;  1KGY A;  1AYN 2;  1OF4 A;  2HWD 1;  2YBS A;  2VMF A;  5C4W A;  1SCR A;  3VHP A;  3O0X A;  4QB6 A;  3I3Q A;  1B35 B;  3III A;  4L92 A;  3IDA A;  1XU1 A;  5CU1 A;  3O1R A;  3VHO A;  3POW A;  2E26 A;  2A73 B;  3FL7 A;  4FFF A;  1NCQ B;  3VBS A;  5IFT A;  4AVA A;  1WD4 A;  5FK8 A;  1LJ7 A;  5JOW A;  2RS3 3;  3VD7 A;  3AP5 A;  1SG3 A;  5DXD A;  1BEV 1;  2C24 A;  4IDZ A;  1AR7 1;  2RMU 3;  4A44 A;  2C9K A;  3T2P A;  1AHS A;  3ZSM A;  1REE A;  1NXD 1;  1B35 C;  3FFZ A;  1W06 A;  3VBF C;  4NRM A;  1Q8V A;  2XWB B;  3MEP A;  1LOF C;  2Z5W A;  4NRO A;  3AZW A;  5GLW A;  4FAH A;  1I1E A;  2BWC A;  5JDB A;  5DUV A;  4GWI A;  1JYI A;  4HKL A;  3DF0 A;  1OKQ A;  3ZXE A;  3FFQ A;  3AJZ A;  3CMG A;  4D7S A;  5G04 L;  5E88 A;  3HWJ A;  2RR1 2;  2W47 A;  4CDQ B;  3WW1 A;  1BHG A;  2NM1 A;  1C8M 3;  3KGL A;  4QPW A;  2P6H A;  2W1W A;  1W39 A;  3PDQ A;  1K12 A;  4UW3 A;  2G19 A;  4CEY A;  2CU5 A;  5D2A A;  1IGO A;  1RXG A;  1N1V A;  3M4F A;  5BNP C;  4FP3 A;  1AR8 2;  4JQR A;  1IZ3 A;  3KD4 A;  1W6O A;  5IT6 A;  2W2I A;  4Y3O A;  1FNZ A;  3O12 A;  3WDY A;  3NV4 A;  1BBT 3;  4XE9 A;  3RI8 A;  4YGD A;  2FD8 A;  2YV8 A;  1O4T A;  2JJ6 A;  1X8E A;  2GN3 A;  2ADD A;  2IXJ A;  2WFF 2;  2WS9 1;  3M1H A;  4LUM A;  4XBQ A;  3VKF C;  4OUL A;  2VME A;  4NRQ A;  1VMH A;  4P9X A;  1WCU A;  1OBN A;  1CAX A;  1H4G A;  1NQJ A;  2BP6 A;  2VVD A;  3THP A;  4EN7 B;  3WCR A;  4YG3 A;  1S0F A;  3I2D A;  1US2 A;  2Y26 A;  4PQQ A;  2ZKL A;  3U78 A;  2G9Z A;  5IVC A;  1YQ6 A;  2BRT A;  2XVG A;  2BBA A;  1XNK A;  2ZJC A;  1JBC A;  2QQV A;  2V5D A;  1ULP A;  1BQP A;  4DRV A;  1DYO A;  1WKY A;  2W3J A;  5LA1 A;  1YO8 A;  1IKP A;  4OI0 A;  1C5I A;  1W3X A;  3CZJ A;  3PUQ A;  3VBR A;  3N9O A;  3VN4 A;  2BUK A;  3D4K A;  1TME 1;  4RA0 A;  4R8H A;  2RS3 2;  4ZS3 A;  3WV6 A;  4JKM A;  3PJY A;  3GCX A;  2IC1 A;  2FHR A;  3GHN A;  1UAI A;  2BOJ A;  3NVC A;  4HXC A;  5CB7 A;  1MZE A;  3PIJ A;  4N53 C;  5FO7 B;  4JGY B;  4CXY A;  1RMU 2;  4CCE A;  1C28 A;  2VBB A;  4H7M A;  4XPV A;  1LNS A;  1BVP 1;  1H2M A;  2FDJ A;  1W2A X;  5AC9 1;  2WAA A;  4B7E A;  5HXM A;  5C71 A;  2IZW A;  1T6B X;  2GDF A;  2MHF A;  2RDR A;  3LEM A;  3GYD A;  5T55 A;  2XJP A;  3ZXF A;  1MR5 A;  4DS0 A;  1ULO A;  3GZT B;  4K1Y A;  4JKK A;  5T5P A;  3BTY A;  1AXZ A;  2ZMN A;  3WZ1 A;  4PDW C;  4IUG A;  4MUV A;  1F9K A;  1VP6 A;  3TNP B;  4BH9 A;  3G6J B;  4TLG A;  5FPL A;  2AGS A;  1AYM 3;  4IER A;  4MXW A;  5KBF A;  4RQP B;  3CBN A;  3OEB A;  4ASM B;  4EN6 B;  3KCC A;  4LO5 B;  3M70 A;  3VHR A;  2PTM A;  2YG0 A;  4UF0 B;  1WA6 X;  3SH5 A;  3U4X A;  2UY8 A;  5EZW A;  2WII B;  5A33 B;  4ZPI A;  3PHM A;  2R04 3;  3KT1 A;  3B69 A;  2VMH A;  2A6Y A;  2ZAB A;  1LHV A;  1RUO A;  2CAV A;  4UFH A;  3W58 A;  3ZMO A;  4YAR A;  2K2S A;  3RPQ A;  1YNA A;  1W2N A;  4AE2 A;  2J1A A;  1SQ4 A;  2FMY A;  2VUD A;  3VD3 A;  1KJR A;  1XU2 A;  2AUY A;  4XF9 A;  4XOG A;  5AC9 2;  3AVS A;  2BVB A;  2P5B A;  4DUX A;  4P9W A;  5I93 A;  1AX1 A;  1RED A;  2A1X A;  1UZZ A;  4WVZ A;  5LY1 A;  2BTV C;  2R04 1;  1GZC A;  2DUP A;  4KL1 A;  4PIX A;  2VMI A;  4I3P A;  2WZR 1;  2OXB A;  4XW3 A;  4XAE A;  5M0T A;  4Z92 B;  2ZA9 A;  4ZON A;  3RVH A;  2ZX2 A;  3WDX A;  3SCH A;  3IM0 A;  2LTN A;  1WUV A;  4X8P A;  4HLT A;  2W0X A;  3R0R A;  1LHW A;  4QPI A;  4TLF A;  5FMO S;  4LHN A;  1HRI 3;  3JQX A;  4Q0V A;  4B4P A;  3H7J A;  1TMF 1;  1UXX X;  5IW0 A;  2VQ0 A;  5A32 A;  1O8S A;  3C3V A;  3HQU A;  1HKD A;  2E51 A;  3QH6 A;  4QXC A;  2Z2S B;  5K4L A;  3ACH A;  2OQ7 A;  4OZX A;  4XFH A;  2CNA A;  5C33 A;  4HKW A;  2WN3 A;  2VTF A;  2PHW A;  4CDW C;  5K9Y A;  1G9A A;  3K51 A;  4BME A;  4Y1V A;  4BB3 A;  4EJR A;  3Q8B A;  1AR8 1;  2UWA A;  2JE7 A;  3GM8 A;  4N53 A;  4XXA A;  3NV1 A;  3OGS A;  1GWM A;  3IAP A;  3K75 B;  4LOR A;  2D6N A;  3LPG A;  4MV2 A;  5FZ1 A;  4QDR A;  2VZ3 A;  1MEC 1;  2Q8C A;  3TNQ A;  4RYD A;  1HXS 1;  2YPD A;  3Q8C A;  5JOZ A;  3IAQ A;  1H4H A;  2W52 A;  2ZBJ A;  4OHX A;  2P17 A;  3WSO A;  3VBS B;  1MQT A;  3O1U A;  2HWC 2;  3AK0 A;  5FAX A;  1HJF A;  5JZG A;  5L36 A;  1HW5 A;  4LBJ A;  2D3S A;  1XOY A;  1BLZ A;  2YGL A;  1XSQ A;  4N7U A;  3U37 A;  1O4Z A;  1WW4 A;  4YRD A;  2WZE A;  4K9S A;  3WVJ A;  5JI9 A;  3AC0 A;  2QQW A;  1EPZ A;  1PGS A;  2W46 A;  1V6K A;  3VBH C;  1HXS 3;  4CUB A;  2J1U A;  2XL9 A;  4FBF A;  1YWK A;  1PGW 2;  2JD9 A;  1UOG A;  4YLZ A;  2VH9 A;  1JUH A;  4K8F A;  2XKP A;  3FUQ A;  4GWN A;  2R32 A;  5F3E A;  4Q8L A;  3ZXK A;  5FLH A;  2ZGT A;  3BCW A;  4W8J A;  3TEX A;  3KV4 A;  2HBU A;  1CIW A;  4I0A A;  2OT7 A;  1QIQ A;  1CX4 A;  4CU8 A;  2XJQ A;  3VBR B;  5HPO A;  1UYX A;  4LNV A;  2WWS A;  3ENR A;  3NV3 A;  3UL2 A;  1PO2 1;  1RYY A;  2IFW A;  1FOD 3;  2PEL A;  3ACG A;  5LWB A;  4CSW A;  1JZ4 A;  4WM7 B;  2LAL A;  3PTY A;  1YFY A;  1D4M 3;  4C0H A;  5KHK A;  5I0U A;  1K5M A;  4KG0 A;  5C8C C;  1OOP A;  5GLT A;  1KXG A;  5JXJ A;  4KBZ A;  1RUI 1;  4FVV A;  3FBY A;  2WKK A;  3O1S A;  1ZBE 2;  3B00 A;  5BV6 A;  1WW5 A;  1IHM A;  2XON A;  4IE7 A;  1YQ2 A;  4R52 A;  5JR7 B;  2QJV A;  3C7F A;  3C7E A;  2Q8E A;  4QQP A;  2ZAC A;  2JX9 A;  3N7J A;  1F8V A;  1NQD A;  1UMH A;  5J36 A;  2NYY A;  4PJY A;  1RGS A;  5FZM A;  3AMQ A;  3VDD A;  3FHQ A;  3GDB A;  2G9F A;  3OD0 A;  4XEZ A;  3PVN A;  4MSV A;  4XBN A;  4CXW A;  4D94 A;  4MG2 A;  1JYW A;  3QAC A;  4PI2 A;  4YZ4 A;  5IJR A;  1AYM 1;  4GWJ A;  2JG8 C;  3EXU A;  3VL8 A;  4JDM A;  4ZZ8 A;  1O6U A;  2Y6H A;  5FP8 A;  5LY2 A;  4PF1 A;  2WLP A;  2X10 A;  1DLC A;  3K46 A;  4N43 A;  4QKF A;  4YM2 A;  2D40 A;  2IXL A;  4RFT 0;  4AHY A;  1KQR A;  2ZHN A;  2BYV E;  2ZGN A;  3WP4 A;  1MS8 A;  1MS4 A;  2OPW A;  3HIF A;  5J09 A;  2QDN A;  2ZGM A;  1AJK A;  5DMY A;  3P3P A;  4XVH A;  5GLV A;  2WFP A;  2JDM A;  1QJU 2;  5FZI A;  2P2K A;  1VBB 3;  1X50 A;  3ALQ A;  3WNK A;  1CGP A;  4V1P A;  5F37 A;  2VOX A;  2EXH A;  5CKM A;  4L8Q A;  3CJI C;  2R07 2;  3POE A;  4YWA A;  1YHF A;  3WF3 A;  3R4D B;  1AJO A;  1DG6 A;  2OZ6 A;  3TN9 1;  3WDW A;  4IQP A;  1H6X A;  2V4A A;  3MBW A;  5EQU A;  1RJ8 A;  3GAL A;  3O1V A;  1SLT A;  1WCS A;  1OD5 A;  2VNG A;  2QQM A;  1LOG A;  2XLF A;  1CAV A;  1S1A A;  3THD A;  1CVN A;  3RGB A;  1GSL A;  5J7M A;  3VBU A;  4ET7 A;  5EJ1 B;  3MZH A;  4E2G A;  1VE0 A;  4CCM A;  1QU0 A;  1RJ7 A;  4N53 B;  4K8R B;  5GKA C;  1DF0 A;  2VY0 A;  3KV9 A;  5GZE A;  3R4S A;  4QM8 A;  5T50 A;  2RM2 2;  3JBG 2;  2VW0 A;  4H14 A;  3KS7 A;  4Q1R A;  2V5Y A;  3EB7 A;  3HD8 B;  2WA3 A;  1DGR N;  1UPI A;  3O1P A;  2ENR A;  3PU8 A;  1UW8 A;  3I2G A;  4PDW B;  4Q4Y 3;  5EWS A;  1VAM A;  3E1F 1;  4IV3 A;  1D4M 2;  4M0H A;  5FY1 A;  4CEW A;  2JKB A;  3OTF A;  4E2S A;  4E2Q A;  4AVC A;  3LFM A;  5FJH A;  2JDN A;  4JX0 A;  3THC A;  3ZKU A;  2BZD A;  3TAY A;  3OPZ A;  1RHI 2;  1LEN A;  3A4U A;  3BGA A;  3T2O A;  5DPN A;  3NL1 A;  2WNV A;  4LKF A;  3AP7 A;  1KEX A;  3M3O A;  1FNY A;  1UZW A;  2E7A A;  5FYM A;  3CKH A;  3NJX A;  4LOT A;  4AGG A;  4HVO A;  2ET7 A;  1VBD 1;  4AXO A;  1NE4 A;  2VZO A;  3RG0 A;  3K4Z A;  3VZM A;  5FOJ B;  4YGB A;  4P9L A;  4QKB A;  3OGG A;  4OZO A;  4CP9 A;  5I8T A;  4Y24 A;  5F3G A;  2AEZ A;  2W1S A;  3MFC A;  3P6B A;  5LBC A;  3UK9 A;  4ORF A;  5A3N A;  1VIW B;  1Q5O A;  3W21 A;  2B4K A;  5DQ0 A;  4B1M A;  2J7M A;  3ZFE B;  1SLB A;  4HET A;  4EYU A;  3MF9 A;  2E7Q A;  3NAP B;  4KG8 A;  4MGK E;  5H9R A;  1PM7 A;  3ZFF C;  4AI9 A;  3W5M A;  2BBV A;  3WX5 A;  4MGS A;  2ARX A;  4D6S A;  4FPL A;  3WG4 A;  4DOU A;  1JXN A;  1QDO A;  4IE4 A;  3UYJ A;  4C0B A;  1UN1 A;  1JN2 P;  2OUJ A;  2YGM A;  4ZXE A;  1DQ0 A;  3NKG A;  1A3K A;  2ORZ A;  3AYA A;  3KQ4 B;  2GNT A;  4WM8 A;  3DCQ A;  1XQN A;  4I3G A;  2DUO A;  1LR5 A;  2D98 A;  4QU2 A;  4L2N A;  1AUY A;  5FFO C;  5FPX A;  2PLV 3;  3VBF B;  2XOM A;  5BNO A;  5FZK A;  5JLV A;  1ONA A;  1W8U A;  1OMI A;  1ZNP A;  5C9A B;  2BW8 A;  1NXM A;  2GC1 A;  3O0V A;  1R08 2;  5FYZ A;  1UY3 A;  2HYK A;  1AR9 3;  3HT1 A;  4XUO A;  3RZM A;  5CIR A;  3E6C C;  5FWE A;  4HK8 A;  1SBD A;  2NQY A;  2ZZJ A;  1U5X A;  4C1X A;  2MEV 1;  2UUR A;  3RYR A;  4MZU A;  1UL9 A;  3APB A;  1YFX A;  3ZSK A;  3MF6 A;  4UBG A;  1J3P A;  1W8F A;  1XNT A;  3H3Z A;  4N43 B;  3GCW A;  1AR9 1;  3KM5 A;  5JPM B;  1XND A;  2ZOE B;  1RUJ 1;  1CAU B;  2IWG B;  4KWJ A;  1YQ5 A;  3T08 A;  2BVV A;  1HLC A;  2DCZ A;  1CES A;  2R1B A;  5FZ8 A;  5F39 A;  2MEV 3;  3FMG A;  3V0B A;  1S0G A;  5LBE A;  1RUH 3;  4WM8 B;  4Z2W A;  5H9P A;  1UYP A;  4FPK A;  3KHB A;  1NA1 A;  4NJ4 A;  1JZ6 A;  1GOF A;  1QF3 A;  1RUC 3;  4FFH A;  2Q30 A;  4MH0 E;  5ANQ A;  2BJS A;  4FI9 A;  5CFD A;  3W5N A;  3VD4 A;  1RUN A;  3ZSJ A;  1NY7 1;  3QOP A;  2B8M A;  3VBO B;  5KHJ A;  5TSW A;  4E9K A;  5L9B A;  1J83 A;  5A1L A;  1HB2 A;  2WNV B;  4CEY C;  4JV4 A;  2CV6 A;  1GMM A;  1OKO A;  3FLR A;  3ON7 A;  2RDN A;  3CJI A;  5F2S A;  4XJ9 A;  3GGL A;  3HQX A;  3WNL A;  1ZRD A;  2JG9 A;  3H42 B;  1JZ3 A;  2OZJ A;  1RB8 G;  2ZHK A;  1WA4 A;  2WT0 A;  5C8C B;  3THT A;  1ZBA 1;  5FYV A;  3JQW A;  1O3R A;  4GZ9 A;  4XFC A;  5FYH A;  4DO0 A;  1S0I A;  2BWA A;  4IL7 A;  4CP2 A;  5IFP A;  1SDD B;  3E5X A;  5G05 L;  4M3C A;  2WYS A;  5EJ3 A;  1LRH A;  5DG2 A;  5JUV A;  4B8E A;  5A7P A;  1KFU L;  1Y3T A;  2R16 A;  4XFB A;  3VKO A;  2VW1 A;  3TRS B;  1X9T A;  2DCY A;  2PLV 2;  3HPN A;  2VEC A;  4GIQ A;  3K48 A;  4XC9 A;  3ES1 A;  5CAD A;  5F5A A;  5KWR A;  2FCU A;  3C2U A;  1PMI A;  3AZY A;  3K2O A;  5GAL A;  1CAX B;  5FJK A;  4DQA A;  5FZF A;  5LAT A;  3H8R A;  4COV A;  4E27 A;  1DQ1 A;  2HWE 1;  3LIG A;  3AMM A;  4CCK A;  5E1R A;  3WW4 A;  4AHW A;  1JTZ X;  5IVJ A;  4CTE A;  4ZU5 A;  3HN3 A;  2UYA A;  1AX2 A;  3W9A A;  3LPF A;  2HBT A;  1U5Z A;  4MGZ E;  5IYY A;  1AL0 G;  1RUI 3;  5F32 A;  1VBB 2;  2VAU A;  1Y4W A;  2YZ4 A;  3ATG A;  1JOB A;  2GNB A;  5I8S A;  5B4X A;  5AFE A;  1V6M A;  4QXH A;  1CR7 A;  4OFG A;  4JGZ B;  5DZG A;  5C5T A;  4FPY A;  4FQZ A;  4AW7 A;  4EN8 B;  2WUH A;  4QT6 A;  4OHW A;  1HV1 A;  5FY4 A;  5BNP A;  2WA4 A;  3DEC A;  1S0J A;  2WAO A;  1V6L A;  4Z82 A;  3OUI A;  5EXO A;  5A3T A;  4DPN A;  4AVT A;  2RJ2 A;  3M3E A;  2GC2 A;  1K42 A;  4LO6 B;  3VKM A;  2XR4 A;  4QPI B;  1NUK A;  2VD7 A;  2RS3 1;  4JRL A;  4Q0S A;  2B9U A;  3VZJ A;  1D4V B;  1G9B A;  2O14 A;  4BLJ A;  2RS1 2;  3I3B A;  1W9Y A;  1EY2 A;  3HEI A;  1TMF 3;  4CCD A;  4QDQ A;  3WF1 A;  4AFA A;  1PVC 3;  4FT8 A;  2DBN A;  2QBX A;  4O65 A;  4MHR A;  1DDL A;  1WMD A;  3KLS A;  4X6Q B;  3ZYG A;  1DZQ A;  2JG8 A;  2VJX A;  5C3O A;  4WVV A;  2NN8 A;  4LUK A;  3BTA A;  4UT5 A;  1JOP A;  4YW6 A;  4MAD A;  1JZ5 A;  3ZM8 A;  3M3I A;  4AED C;  3F95 A;  3RI9 A;  5CNA A;  4XF0 A;  3TOJ A;  3H3U A;  3IDE A;  3NJZ A;  4YPJ A;  1W05 A;  4JQT A;  3WP5 A;  4GMP 0;  2Z42 A;  2XML A;  5FKB A;  4HBN A;  1H8T B;  1ND3 B;  1YXW A;  1G8W A;  2DYC A;  1OPM A;  2EIB A;  4YW2 A;  4KWL A;  2R1D A;  5EFU A;  5A80 A;  5A33 A;  1W6M B;  2ARA A;  3A7Q A;  3WHU A;  1RUG 1;  3T2T A;  5FZC A;  1CON A;  1FV3 A;  2D3P A;  4OMC A;  1UMI A;  2X5I B;  2YB7 A;  3AXE A;  2F4L A;  3I4I A;  3CJX A;  1D0G A;  3WDT A;  1EP0 A;  1RUJ 3;  4Y5Z 0;  1UY0 A;  4W65 A;  1H30 A;  5JI7 A;  3B5L B;  2PXJ A;  2WO1 A;  3ZOI A;  1YFU A;  3DXT A;  4GMP 1;  4J25 A;  4BYY A;  1I5Z A;  1DBN A;  4LMF A;  5L7O B;  5A6Q A;  2CGO A;  4GXL A;  4DRR A;  4CU9 A;  2GC3 A;  4QGN A;  2DFC A;  4BM8 A;  2WO3 A;  3LKJ A;  2QQJ A;  1LTE A;  4WM7 A;  2J1S A;  3LA2 A;  2V09 A;  1SDW A;  4FAG A;  2Z4F A;  1WBL A;  4A2U A;  1GZ9 A;  4BA6 A;  2DCT A;  3MW4 A;  1EV1 3;  2KA3 A;  3ZKY A;  1KS4 A;  2GU9 A;  4AEK A;  3NJV A;  5JCT A;  3FHA A;  1G9D A;  2A7A A;  1ZZ7 A;  1XC6 A;  1SLL A;  5FV3 A;  1T6G C;  3UKT A;  2XJT A;  1IQA A;  3C7O A;  3D0S A;  3D8C A;  3KSC A;  4S2D A;  5C7G A;  5J3U A;  4Q4W 1;  3AKT A;  1J58 A;  1UPS A;  4JGZ A;  2CWS A;  2DVG A;  2RS5 3;  1YQ8 A;  4P14 A;  3ME2 A;  1VBD 3;  3IWZ A;  1VRH 2;  3KCX A;  4OI4 A;  4DXS A;  4QXK A;  5KHI A;  5FYC A;  1JYN A;  1UYZ A;  1CJP A;  1XPW A;  3OBZ A;  4NUB A;  4WM8 C;  1ZA7 A;  4WM7 C;  4QDS A;  1KFX L;  1A8D A;  1H2L A;  1SAC A;  1C1L A;  3K3O A;  3PIG A;  3VLB B;  1UZ0 A;  3IDB B;  2R06 3;  3BTZ A;  1YJK A;  1F5F A;  4LT5 A;  4LK6 A;  4BWO A;  4XFF A;  4U36 A;  2RV9 A;  2D6L X;  4QPG A;  3J4U H;  2MNG A;  2VQT A;  4XUQ A;  4P9G A;  1MS1 A;  2ZXQ A;  3EBR A;  2VOV A;  1W9F A;  2JDY A;  5FO9 B;  3V64 A;  1RC6 A;  1Y43 B;  5I0R A;  1A6C A;  1VRH 3;  1W99 A;  2PMW B;  3U0Z A;  1XB9 A;  2VG9 A;  4LQR A;  4C91 A;  1HQL A;  2ZMK A;  4XF1 A;  2BFU S;  4CPB A;  3WP6 A;  4E4S A;  4Q4X 3;  3N9M A;  1VBB 1;  4B29 A;  1HB1 A;  4FFG A;  2OPK A;  2VZR A;  1EAH 1;  1PNG A;  4XET A;  4YZ5 A;  5D1I A;  4B4Q A;  4H2A A;  2HJI A;  1QDC A;  4Q26 A;  1UX7 A;  4PF5 A;  1AL2 3;  1FOD 2;  1W9T A;  2PHF A;  2KM2 A;  1VRH 1;  1QH7 A;  3O1T A;  1D2Q A;  1H0B A;  4GH4 A;  3QBQ A;  5F5C A;  3VDB A;  5KC6 A;  2TNF A;  1Q3E A;  3RZJ A;  4AI3 A;  4B3N A;  5IVE A;  2YFZ A;  1HRV 3;  1VBC 3;  1BZW A;  1YIF A;  2B9V A;  3VBO C;  2O0O A;  1AR6 1;  2DVF A;  4KU7 A;  3K3N A;  1GWL A;  3H0O A;  3PJQ A;  4K21 A;  4QX2 A;  2VVF A;  5J48 A;  3ETP A;  2YYO A;  3OYW B;  4DB5 A;  2D43 A;  1SCS A;  4KMQ A;  3O14 A;  4XUR A;  4BXS V;  3HVD A;  4DEV A;  4H7L A;  3ST7 A;  3UGH A;  1YRZ A;  3VDC A;  5A6X A;  4AYU A;  1NLS A;  1MZF A;  1X7N A;  2BER A;  1V0A A;  3NWK A;  1TNF A;  4I30 A;  4YZ1 A;  1G6N A;  3PVE A;  2OKX A;  3UJO A;  4CPB D;  5IHR A;  4LJH A;  2FDK A;  3MUY 1;  1LGC A;  1PX3 A;  1KS5 A;  2JG9 C;  1BBT 1;  4XZU G;  1O3T A;  4BQY A;  3M2M A;  4K3U A;  2WN2 A;  4FXK B;  1N47 A;  2XDV A;  4QQH A;  3N7K A;  4MGQ A;  1DYP A;  3SQO A;  3ETQ A;  1J3Q A;  1OSG A;  1RUC 1;  1QXR A;  3OPW A;  1S2B A;  3ECQ A;  4UW5 A;  1LKN A;  5CEH A;  4ZXK A;  3CHX A;  4EN0 A;  2DV9 A;  1X82 A;  4OUE A;  5A70 A;  4JZR A;  4LK7 A;  3UET A;  1K45 A;  5FMO L;  5JOX A;  4BQW A;  1RVF 2;  5ACA 2;  1QQP 3;  2ZX4 A;  5KXD A;  2LRO A;  3LSE A;  4DUV A;  1XYN A;  4XMI A;  4J1X A;  5B4N A;  5FCC A;  3INA A;  3SEE A;  1UNB A;  1W8W A;  2Y6K A;  1S0C A;  5L73 A;  1WCD J;  4TXW A;  1DQ5 A;  5FTT C;  4QXB A;  5BNN B;  2QE3 A;  1QQP 1;  3PTR B;  2XL7 A;  4MO3 M;  3WF2 A;  1RUE 1;  1BK0 A;  1BBT 2;  2B42 B;  4HK9 A;  4Q4V 2;  1JYX A;  2ZZQ A;  2BNM A;  1MVQ A;  4CVU A;  4OLL A;  4F7Z A;  5IVF A;  2R0H A;  1LUL A;  3OGJ A;  4PQ9 A;  1X33 A;  1EUU A;  4BIF A;  5FUN A;  4BQ5 A;  1VMF A;  1RUC 2;  1FAY A;  4DEQ A;  5ABJ B;  3A21 A;  5JWP A;  3AMP A;  3B01 A;  2HWE 3;  3PUH A;  1GZT A;  4CUG A;  4DXT A;  3VZL A;  2Y6F A;  4Y1X A;  4Q4W 3;  2HWB 1;  4E4Z A;  1RUE 3;  4OVE A;  4BK4 A;  2FDH A;  2Y0O A;  1LGN A;  2NPI A;  2Y6L A;  3SXW A;  3AKQ A;  5F1R A;  2I45 A;  2WO7 A;  3ACL A;  1HV0 A;  3EYP A;  3DYM A;  4MHU A;  4QKN A;  1RVF 1;  4LA3 A;  3D82 A;  5K0U A;  5I0S A;  1GQG A;  4XAC A;  1WLW A;  4V2W A;  5DDJ 1;  3SEP A;  3MFA A;  3E5Q A;  1W6Q A;  3C7G A;  3J8F 2;  4PT6 A;  2DU0 A;  4BIO A;  4CDQ A;  1F2N A;  3J9S A;  5LA9 A;  2NP0 A;  1CJD A;  1ZZ9 A;  1DP0 A;  3CLP A;  4COW A;  2HWB 3;  1J59 A;  4E8C A;  4XFA A;  1FX5 A;  1NZC A;  4QWN A;  1GP5 A;  2E6V A;  1U5Y A;  3P5B A;  1TNR A;  2PHT A;  1F4A A;  4P5H A;  2HYX A;  5SV8 A;  4ITC A;  1KJL A;  1H9W A;  2XUE A;  3FLT A;  2WL1 A;  4IET A;  1D0H A;  3HAG A;  2PAK A;  4PCR A;  4LO7 A;  1E5S A;  2DU1 A;  4OQ8 A;  4UI9 L;  1NT0 A;  3ABZ A;  1HDK A;  2QQK A;  3LD8 A;  4CCN A;  3TEZ A;  4KU8 A;  4ATF A;  3LOB A;  1UOB A;  3LSD A;  2C4X A;  1VBE 3;  3AYE A;  4Y5T A;  1Z78 A;  2BNO A;  4GKX A;  4KH9 A;  4AVV A;  1YFW A;  3LEG A;  1IS3 A;  3T4H B;  4V2V A;  3ZFE A;  4Y20 B;  2HEY F;  4FTS A;  1QJX 2;  3ZXL A;  3WEZ A;  4RQP C;  1DZR A;  4LLF A;  1JI6 A;  5JVV A;  3KHC A;  1LOA A;  1ZVF A;  1A34 A;  3JBG 3;  5FLI A;  3NST A;  4NPR A;  2JDP A;  5DDJ 2;  3J8F 1;  1LEM A;  2PN5 A;  3MI8 A;  4DNY A;  4GB3 2;  1AXK A;  3OF1 A;  1C8N A;  3BB6 A;  4FPC A;  2FMD A;  1FV2 A;  4G4F A;  5FRE A;  4LR4 A;  2B39 A;  4ATE A;  4FFI A;  4X8N A;  3BN6 A;  3NMB A;  3ZYB A;  4RGA A;  3TN9 3;  2W94 A;  4G9S B;  1ZBA 3;  4O9G A;  2VUC A;  2WZR 2;  3BI3 A;  1Z7S 1;  4AQT A;  1W3V A;  2RS5 2;  4QHO A;  2ZGP A;  3LWC A;  5C70 A;  4JDN A;  3S0M A;  2A6X A;  4URA A;  3PME A;  3T0A A;  3QCW A;  1QHD A;  5LK5 A;  4D69 A;  2VUL A;  1XBF A;  1I5P A;  2VQU A;  4URT A;  3SCG A;  4J1W A;  3JB8 A;  4XQW A;  4RFR B;  1T2X A;  4RR3 B;  1UU6 A;  2BEO A;  5HCH A;  3POY A;  2ZML A;  1TG7 A;  4M00 A;  5F5I A;  4ZS2 A;  1GBG A;  5DUX A;  1W8Z A;  1W0N A;  2MEV 2;  1GP4 A;  3LF7 A;  1R1Z A;  4WVW A;  5ACA 1;  1KD7 A;  4RS5 B;  5FK7 A;  4JGY C;  3HOB A;  4LKE A;  2W5F A;  2JXA A;  5J96 B;  4M3C E;  3JD7 1;  3VDD B;  2WNU C;  2RDQ A;  2V72 A;  2RE9 A;  2ZGR A;  1OT5 A;  3AJY A;  5DAW A;  5FQ0 B;  3C8X A;  4CEW C;  1RUD 1;  3AZZ A;  1H6Y A;  2WZ8 A;  1J84 A;  2XLG A;  2Y34 A;  3TWI A;  4COZ A;  1OFS A;  3S6P A;  2AEY A;  2R06 2;  2WSV A;  5FYT A;  5ACA 3;  1ULF A;  5A7O A;  4R9C A;  1PMH X;  2ILM A;  4FCA A;  3S7I A;  2BQP A;  1NYW A;  2E33 A;  1UKG A;  5FO8 B;  4Q4V 1;  3FJS A;  2YC2 A;  4XJA A;  2OII A;  3JXS A;  2BGO A;  4XCA A;  4Y4Y A;  2A3Y A;  2VNO A;  1PO1 1;  1AX0 A;  5FKC A;  3V0A A;  1LCL A;  2O8Q A;  4A42 A;  4DZG A;  4IW3 A;  2W95 A;  1O3S A;  2Q8D A;  4NHX A;  4XMA A;  4EE2 A;  4XJU A;  1UWW A;  5C4W B;  5LEK A;  3NJY A;  5GLU A;  5C8C A;  1DCS A;  5L9V A;  3FWE A;  1NLQ A;  3I2J A;  4XBL A;  1S0E A;  4EWE A;  1ZYB A;  5LA2 A;  3G7D A;  3OGR A;  2WC2 A;  3DEM A;  4CDU B;  3KZ4 C;  2XBO 3;  4QPI C;  5EIY B;  3AM2 A;  3NKT A;  4IGP A;  3H1W A;  4NRP A;  4DXZ A;  4YVW B;  1PX4 A;  2EIE A;  1DYK A;  1K5M C;  2I74 A;  3SH4 A;  4YNI A;  4RHV 1;  2XH6 A;  2P37 A;  3VUO A;  5LZ6 A;  1WLT A;  4BQ4 A;  2X53 S;  1GKB A;  1QNW A;  3J7N A;  4IEP A;  1AL2 1;  3CO2 A;  4OHZ A;  4IXL A;  4ISQ A;  1LED A;  2YC0 A;  1IOA A;  4XQD A;  2PHR A;  4FOY A;  4DMI A;  4L0P A;  3N9Q A;  3KVB A;  3ELN A;  2P3J A;  4UYB A;  3BIE A;  1GUI A;  2CGN A;  2WZR 3;  1DZT A;  2YU2 A;  3CEW A;  4NID A;  3ZYP A;  3ROU A;  1K5M B;  1AR6 3;  2B7Y A;  1AYM 2;  2NMO A;  4GB3 3;  5F6K A;  3BUC A;  3WCS A;  4XDP A;  4ES8 A;  4CUC A;  1PO1 2;  4P02 B;  3WDV A;  3WP3 A;  2QUO A;  3D6E A;  4D8M A;  4QD2 A;  4OI1 A;  3N7M A;  1XJA A;  1ZRR A;  3HN1 A;  5JZG C;  2V4V A;  5FY0 A;  2D3R A;  4XUT A;  5DAX A;  4ZKT B;  5C8W A;  1IPS A;  4BXF A;  3ZPY A;  2QQU A;  3LE0 A;  5FY5 A;  2E53 A;  3K4A A;  3MO4 A;  4XDQ A;  5IK8 A;  4BOW A;  5KR7 A;  1QKQ A;  4DY3 A;  2J22 A;  4E8D A;  5IK7 A;  3VGI A;  2A6Z A;  5CKN A;  2VZV A;  4PLN A;  1F4H A;  3KMH A;  4M4R A;  4ZU4 A;  2VOK A;  5A3L A;  3I3D A;  2OW4 A;  4QQO A;  2XJS A;  4LBO A;  1NLR A;  1TZO A;  5GZC A;  4JHZ A;  3ILN A;  3ZO0 B;  5J1X A;  5FZO A;  5K8S A;  1MEC 2;  2Y6G A;  4B1L A;  2UU8 A;  2RS1 1;  5JXH A;  1HXS 2;  2Y38 A;  3T4V A;  5F7U A;  1WME A;  2RS5 1;  3I2K A;  2A3X A;  3WUD A;  1F5J A;  4GAZ A;  3UNP A;  4UW4 A;  5EYY A;  2Q1M A;  5L7O C;  2VNV A;  3M3Q A;  3T2Q A;  5AC9 3;  1LES A;  2VCM A;  3JCI A;  3ZVX A;  4XAB A;  2ETE A;  2XG3 A;  3B94 A;  4A7Y A;  1Q8Q A;  4XHB A;  4AVB A;  1REF A;  4QGM A;  2JB4 A;  2DVB A;  4AOC A;  3WF0 A;  4Z1V A;  1APN A;  1JOJ A;  1LU1 A;  2JEC A;  3FHI B;  2Z79 A;  4YFW A;  1X9P A;  2F17 A;  2RR1 1;  5FIX A;  1L3J A;  1W8O A;  1N3P A;  5FZ6 A;  1OA3 A;  1Q8P A;  1B09 A;  3DV8 A;  3U07 A;  1LAJ A;  5JOY A;  2VL4 A;  3OY8 B;  4RGG A;  4MGI E;  4Q4Y 2;  2XBO 2;  5HBA A;  2CYF A;  1TQ5 A;  4YFZ A;  2H0V A;  1LOE A;  1D4M 1;  1VLN A;  1QJE A;  2R6Q A;  2VTX J;  5HI0 A;  1PO2 2;  2Y8K A;  4AEM A;  4UW6 A;  5CG8 A;  4IEU A;  4O7X A;  2DVD A;  3TEY A;  4FOQ A;  5A6Z A;  4D7Y A;  3L9J T;  3LEI A;  3LDB A;  1QGL A;  1RUF 3;  5FRA A;  4AFB A;  1HQW A;  5FPB A;  3OGV A;  1NCQ C;  3ZSE A;  4CCC A;  1ZBE 1;  2RM2 3;  4EV0 A;  4A7Z A;  4YVS A;  3I59 B;  2NZ9 A;  4CDW B;  1W8N A;  3UKV A;  1Y9M A;  4CCO A;  2VR4 A;  2ID4 A;  4FPO B;  4QX7 A;  4AEJ A;  1HRV 1;  1VBC 1;  1SBE A;  5FMC A;  2J1V A;  1U12 A;  1JW6 A;  3V56 A;  2JKX A;  4D6Q A;  4JAA A;  2EXK A;  1RIT A;  3IB3 A;  4YG0 A;  3WW3 A;  4W4Z A;  4FXG B;  4QMA A;  3GBF A;  2CL2 A;  2VCC A;  1F31 A;  1W6P B;  1SFN A;  3PUA A;  4W50 A;  5DG1 A;  5K0U C;  3O1M A;  4P9I A;  3BKZ A;  2K0G A;  4NMI A;  1EPW A;  1MZ5 A;  2W87 A;  1J1T A;  3CDZ B;  2AC1 A;  4HL0 A;  1UO9 A;  1W8H A;  1JHN A;  2XPJ A;  2EXJ A;  3WNX A;  3B02 A;  3GJA A;  3I8T A;  2WLQ A;  4K7J A;  2X5I A;  4ES9 A;  2XBO 1;  1WLD A;  2Y60 A;  2ZEW A;  4Q4W 2;  5APA A;  1GZW A;  1OA4 A;  4JTO A;  1G86 A;  1PIV 2;  3HBZ A;  3VKL A;  2AAC A;  2Y0I A;  2W1Q A;  4EWD A;  5GJ6 A;  3OUJ A;  3H3L A;  1JZ8 A;  2PHD A;  3Q8E A;  1RUH 2;  3HR9 A;  5DAB A;  1O8P A;  2LRP A;  3GZU C;  3MIE A;  4N7I A;  1VRB A;  1W0O A;  4N43 C;  3T09 A;  1ASJ 2;  2VU9 A;  5A7W B;  5EV7 A;  1BEV 2;  1JZ2 A;  3N7L A;  3MID A;  2ET1 A;  3ZR5 A;  1WLC A;  4Y4R A;  3AB0 A;  4HSJ A;  5JSO A;  1Q8O A;  1E5R A;  3ZFG A;  3HT2 A;  4IEV A;  2UWC A;  3TN9 2;  1MEC 3;  1HRV 2;  1VBC 2;  2QZ3 A;  3H1Y A;  3IPV B;  4LIU A;  1V6O A;  1NY7 2;  4SBV A;  4RS5 C;  1DLL A;  4H3W A;  2JEM A;  2XUM A;  1F15 A;  1D7P M;  1H2K A;  2G4I A;  3CF6 E;  2QCS B;  2CDO A;  2GZW A;  2HWF 1;  2N7G A;  4B7K A;  2Z69 A;  3O0W A;  3VKN A;  1FI2 A;  2P6C A;  3USU B;  5A6Y A;  4PI0 A;  4OQ9 A;  3ZDV A;  2D97 A;  4LO4 B;  3WQB A;  2YFU A;  1RMU 3;  4F8A A;  1QH6 A;  2JG9 B;  4XJW A;  4CUA A;  1AR9 2;  4ERO A;  1G9C A;  1ULC A;  1C5H A;  4QX0 A;  1GNY A;  2Q1F A;  3B9I A;  3OOX A;  1DFQ A;  4A4A A;  2ES3 A;  3LB9 A;  2IVI B;  4NAO A;  1PIV 1;  4I01 A;  4QB1 A;  3S57 A;  4UFI A;  3GZA A;  2F6B A;  3LGR A;  4QPG C;  3LDR A;  1ZZ6 A;  3JUU A;  3MIH A;  4QX5 A;  1QXP A;  2GP3 A;  5CAZ A;  3CU7 A;  3BYW A;  4WVM A;  2BGP A;  2QKD A;  4YW4 A;  3WUC A;  4GJY A;  1GIC A;  1VBA 3;  2UY9 A;  1GNZ A;  1COV 3;  4EZH A;  5BNN A;  2R07 3;  1UMZ A;  1BK1 A;  3H9A A;  3ZN4 A;  3NNG A;  2WFF 1;  2WS9 2;  3GHM A;  4OYU A;  2ZGU A;  4PBP A;  2ZAA A;  5B2G B;  5JSP A;  3KV5 A;  1W04 A;  2C5D A;  3EMR A;  2FDF A;  1CD3 G;  3AYD A;  2IUW A;  3NV2 A;  4S2F A;  1OOP B;  2GAU A;  2GH8 A;  5I0D A;  1B35 A;  4XTP A;  5ABJ C;  2RVA A;  1URX A;  2VBP A;  1ZBA 2;  3IMM A;  1YYN A;  3PUR A;  4W6X A;  1DGW A;  4BIS A;  3MW2 A;  3HNM A;  3H1M A;  4CEY B;  1WMF A;  2W92 A;  4NPM A;  3WQ7 A;  4M3C B;  4P00 B;  3WIN E;  4CP0 A;  4XDO A;  5IVB A;  2ZAH A;  4ARX A;  4YGC A;  4KGQ A;  1R1A 3;  5IAV A;  3TYJ A;  3MGU A;  4TTG A;  1SLC A;  1ND2 C;  2DDU A;  4R4X A;  1RHI 3;  1PVX A;  1XYO A;  2H6C A;  3OBR A;  4XAA A;  2D6P A;  2EVX A;  4MX3 A;  2WYF A;  4YYO A;  1BEV 3;  2ZEX A;  1WCK A;  4XFG A;  5JPN B;  2BFU L;  3AYC A;  5FPV A;  2D93 A;  4ZY9 A;  2P3I A;  2B45 X;  4JCK A;  3TB0 A;  3RZH A;  2HWE 2;  4QGL A;  3CZU A;  2YU1 A;  1R1A 1;  4MGY E;  5L9R A;  2OUH A;  3N4M A;  3T0B A;  4CP1 A;  3TEW A;  3KQR A;  2GME A;  1GP6 A;  4W6Y A;  1OLM A;  3MHZ A;  1OH4 A;  4GUL A;  3A23 A;  3POG A;  2K9Z A;  4QKD A;  4P08 A;  1HRI 2;  1NCR C;  4LO8 A;  1CN1 A;  1TE1 B;  2H6B A;  2GP5 A;  3H8U A;  4IE5 A;  5FXW A;  3SMH A;  1K5J A;  2O1Q A;  1V6I A;  4XTM A;  3LZZ A;  1QWR A;  1MS5 A;  2EAL A;  1C57 A;  4N8M A;  1QMJ A;  3RZZ A;  1E5H A;  1YEW A;  4XQ4 A;  5H9S A;  4IV3 C;  4IV1 C;  1OF3 A;  3SKV A;  1POQ A;  1UIJ A;  3DXU A;  2IVJ A;  1IKQ A;  2YDE A;  1MQT C;  2C0Z A;  2G9G A;  3WNO A;  3R6S A;  1ZRE A;  3QH7 A;  1RUH 1;  3EQE A;  1AYN 3;  2LM3 A;  5HCB A;  1G7Y A;  3IPV A;  3U11 A;  3ZXJ A;  1N3Q A;  2DWR A;  4YVS B;  1WMX A;  4GJZ A;  1OFN A;  4HSL A;  2CTV A;  1MVE A;  4Z8B A;  2ZGL A;  5EHD A;  5KXB A;  1C1F A;  2R30 A;  1O4Y A;  3BIW E;  4ZZ5 A;  1L7L A;  3FC0 A;  3MV1 1;  3RWK X;  1JHJ A;  4D6R A;  1UX6 A;  4C90 A;  4TYS A;  3DUI A;  3WQ1 A;  3UT0 A;  4CXX A;  2R04 2;  3HNB M;  5I91 A;  4YG6 A;  5E8A A;  4AWD A;  1NA1 C;  1Y7B A;  2ZEY A;  3CL1 A;  3GXU A;  2DUQ A;  5CZK A;  5JIA A;  4WBB A;  4YW7 A;  3OBA A;  2XVL A;  3S5Q A;  5BNP B;  5F6L B;  3E6B A;  2PAE A;  1L7R A;  3J7H A;  5BYN A;  1SHW B;  1RUD 3;  3I97 A;  1DHK B;  1LHN A;  1AZD A;  2RDS A;  3D3A A;  2D44 A;  3NNL A;  3KCY A;  3POB A;  4IGQ A;  5FP3 A;  3ZFG C;  3WNM A;  1BJQ A;  3BOW A;  4RS5 A;  4NHM A;  4IE6 A;  1WW7 A;  4BJ0 A;  4DFS A;  1YIP A;  4BDV B;  5FR3 A;  5LK7 B;  3EO6 A;  2WBK A;  5JXI A;  1GQH A;  1ND2 A;  4XYX A;  3MUZ 1;  3TBD A;  2E9Q A;  3VBH A;  1PK6 C;  4NHK A;  3OSD A;  4CZS A;  3MPB A;  3MIC A;  2WNO A;  1QJF A;  2E7T A;  1K3I A;  4CCL A;  4UFL A;  1VBA 1;  4H55 A;  3N36 A;  1YC6 1;  1HN0 A;  2JIC A;  2R07 1;  2YBP A;  4AGR A;  3L2Y A;  4XXP A;  5BNO C;  4A41 A;  1IG0 A;  2IFR A;  1YCI A;  2WNU B;  2QTW B;  2FZ1 A;  2ZGK A;  2WJS A;  4P9Y A;  2RMU 1;  4AI8 A;  2HWC 1;  3C7H A;  5L7O A;  1Q43 A;  4HKO A;  1QY4 A;  1UOF A;  5I0T A;  2D6K A;  4O9E A;  2GSY A;  3ZXA C;  1FPN 2;  2HEV F;  2HKX A;  5CFC C;  2CY6 A;  4Q0P A;  4HN0 A;  3AXD A;  1TVG A;  1J3R A;  4PDW A;  3K77 A;  5FZB A;  4BU2 A;  1QJX 1;  3OY8 A;  3RJR A;  4CDX C;  1NA1 B;  2WAB A;  2VXJ A;  1XSR A;  3ILR A;  1ASJ 3;  2HWC 3;  3ZN6 B;  3DKQ A;  4CDU C;  1IPJ A;  2B5H A;  1OVP A;  5T5L A;  2WT1 A;  5FZG A;  2WNE A;  1DQ6 A;  2VZU A;  1XNC A;  3J7M A;  2OYZ A;  3ZIX A;  4GB3 1;  2EIG A;  1RXF A;  4NWV A;  5LRR A;  5BNQ A;  4M4P A;  4DIQ A;  5IVY A;  3SHR A;  4HAN A;  1MS3 A;  3LIH A;  5D21 A;  3H8O A;  1V9U 1;  3EHK A;  4K1Z A;  4R9D A;  3IZO A;  3EJK A;  5FPZ A;  3ES4 A;  1ZA4 A;  4DXR A;  1XE7 A;  3E97 A;  1VB2 A;  4L99 A;  1YLL A;  4QM9 A;  4AZZ A;  4F83 A;  1RUI 2;  1PHM A;  1W6N A;  2GND A;  2JEN A;  5CFC A;  1SPP B;  4QQL A;  4AVS A;  4E4D X;  2E63 A;  2R7E B;  1QNY A;  3ZIW A;  3LAG A;  1V9U 3;  5GLZ A;  1HRI 1;  1H8T C;  1ND3 C;  1SZB A;  4OI2 A;  5T5O A;  3WD5 A;  5IUQ A;  1FPN 1;  2EF6 A;  2WO2 A;  1FXZ A;  3DKW A;  4I0B A;  1YI9 A;  4IND A;  4D0Q A;  1WWY A;  2GAL A;  3MPP G;  4IEQ A;  2E32 A;  4YZ2 A;  4JKL A;  4XJ8 A;  5DAQ A;  2A3W A;  3K4D A;  4D3W A;  1BVV A;  3Q9O A;  1F35 A;  2WR9 A;  3DYO A;  4L9B A;  3S30 A;  1PGL 2;  5BNN C;  5L19 A;  4I2O A;  3ZYH A;  3NO8 A;  1RUG 2;  3OEA A;  1AR6 2;  1SLI A;  4CRQ A;  5FZ9 A;  1S4C A;  1ZRC A;  3JD7 2;  4LTA A;  5LB6 A;  2VM9 A;  3NAP C;  4Q0Q A;  4Y1Y A;  1V9U 2;  4HVQ A;  1O5U A;  1TME 3;  4A7K A;  1V6N A;  5JZG B;  4NE9 A;  5BUV A;  2FDG A;  1OOP C;  2D6M A;  2XXZ A;  1RMU 1;  2Q0A A;  2BOI A;  4IEY A;  1UY2 A;  1O59 A;  2WZP P;  1FAT A;  2AYH A;  1WGP A;  2XHK A;  4Q27 A;  3RJ2 X;  3ZYF A;  4AI0 A;  5A3M A;  5CFD B;  4A3X A;  1R09 2;  2A6V A;  3LOI A;  3HQR A;  4Y1U A;  4CCJ A;  4FTB A;  1S2E A;  2E31 A;  2FCT A;  5FZL A;  3ZSL A;  1OH3 A;  4BQ1 A;  3ZYR A;  1AR7 2;  3NAP A;  3SCF A;  4KQ7 A;  1EUT A;  5C9A C;  2YHJ A;  3O5S A;  1PVC 2;  1CAW B;  1I3H A;  1QJY 2;  3BU7 A;  1NZI A;  1LOF A;  1S0D A;  4NIG A;  2WIN B;  1C8M 2;  1RIN A;  2W08 A;  1BKZ A;  1AF9 A;  2YMZ A;  2P1B A;  3WNN A;  4LBQ D;  4YW5 A;  5ISL A;  1W0P A;  4IGO A;  4LIV A;  4UOJ A;  3M3C A;  2RM2 1;  2JE9 A;  3HBK A;  2VMC A;  4Q5O A;  4UFM A;  2C26 A;  2CAU A;  4NR1 A;  1UZV A;  1UU4 A;  3H8X A;  1MPX A;  4QAW A;  4UBH A;  5A7N A;  1WCQ A;  1PZ8 A;  5F9T A;  3I3M A;  3IMN A;  1AR7 3;  4EN9 B;  2WNU A;  3ITQ A;  2JD4 A;  5FYS A;  3RNS A;  4A45 A;  1HN1 A;  3AP9 A;  3E6D A;  4GH4 C;  1RVF 3;  4COY A;  1VBA 2;  3DGT A;  3GJB A;  4KWK A;  5EPA A;  3I2O A;  1W90 A;  3WF4 A;  4LEJ A;  5A1A A;  1H9P A;  4Q4V 3;  1RHI 1;  5JAX A;  5JSR A;  1OUR A;  5K7P A;  1ZX5 A;  1GV9 A;  5D8A C;  1PNF A;  4IEZ A;  4IV1 B;  4LBK A;  1SPP A;  4BLI A;  4R4Z A;  5IAX A;  5FY7 A;  3B9C A;  1PO1 3;  4MXV A;  1EAH 3;  2UYB A;  1HB3 A;  2L9L A;  3BPZ A;  3IT8 A;  3MLK A;  4UAP A;  1MS0 A;  1PVC 1;  3PVO A;  3R05 A;  4FPE A;  1XNB A;  4EWA A;  1VPH A;  2P4E A;  3FN9 A;  1C8M 1;  5FP7 A;  1NCQ A;  1TMF 2;  4I09 A;  2ARC A;  4YVS C;  2IXH A;  5FLJ A;  5FZA A;  3V65 A;  5AVP A;  4KGG A;  1S0B A;  1YUD A;  1M06 G;  1SFP A;  4IEO A;  1VBE 1;  1DQ4 A;  3VBU B;  4GKY A;  1JU3 A;  3VD5 A;  4BCU A;  2ZX3 A;  3B93 A;  5FXV A;  1O3Q A;  3BTX A;  1N1Y A;  2QQL A;  2QQP A;  1E57 A;  3OUH A;  2DVA A;  3FE5 A;  1UKR A;  5GZD A;  1ODM A;  2QVS B;  4S2H A;  3ZYJ B;  3MLL A;  2OA2 A;  3RYK A;  3PU3 A;  4QX3 A;  2J1R A;  4Y22 A;  5CYY A;  2CDP A;  4AAP A;  2HH9 A;  4RR3 A;  4ZHN A;  4YSF A;  3IBM A;  4LBN A;  5FZ4 A;  1AR8 3;  2QDR A;  2PYT A;  2JG8 B;  1N3O A;  1BMV 1;  3J8F 3;  3VBR C;  4JRA A;  2Y6J A;  3JB4 C;  2CWM A;  4FPH A;  3S7E A;  3ZFG B;  4GMP 3;  2XGX A;  3MIB A;  5IWF A;  2J1T A;  3ZN5 A;  5CFC B;  5LW9 A;  1PIV 3;  1UU5 A;  4A3Z A;  1NCR A;  2H0B A;  3NNM A;  5CBL A;  1L7Q A;  1OXC A;  4AI2 A;  2XJR A;  4M0N A;  3ILF A;  4Q4X 2;  4Y22 B;  3IDC B;  1R08 1;  2AEN A;  2HEW F;  1RTV A;  1OQE A;  1ZRI A;  4R9A A;  3J7L A;  4YVW C;  2OQ6 A;  1EV1 1;  1WZX A;  2W39 A;  1CAW A;  1NAE A;  4HMZ A;  1W6M A;  2ADE A;  3I3E A; 
#chains in the Genus database with same CATH homology
 2VTX A;  4CA9 A;  2VTX J;  2P1B A;  1XB9 A;  4N8M A;  5EHD A;  1NLQ A;  1XE0 A;  1K5J A;  3T30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...