4BLIA

Galectin-3c in complex with bisamido-thiogalactoside derivate 1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GALECTIN-3
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bliA00
1AXZA 1CQ9A 1KJLA 4FQ4A 3A0NA 1V6OA 1ULGA 2GALA 4F83A 1DFQA 2WQZC 2E6VA 3N36A 1LEDA 2EIGA 1F9KA 4LBKA 4XDQA 1QDCA 2D6MA 1GANA 2GMEA 2GDFA 2JE9A 4XILA 3WG4A 1KJRA 1ZM1A 1H30A 2P3IA 4DRRA 1APNA 1FYUA 2PHRA 2DYCA 4ATEA 1MS1A 4XJ8A 2NP0A 3WLUA 5GZCA 4YFWA 4KBBA 4LBQB 2ZGRA 1UPSA 1UZZA 1YIFA 1DHKB 2AUYA 5GJ6A 2VXRA 1V6NA 2P3JA 4GA9A 4Y1ZA 3AP9A 1GSLA 4YW2A 1JXNA 5L73A 3WHTA 3AP6A 3BODA 4Q8LA 5GZFA 1Q8VA 4K21A 4M3CA 4Y22B 4FPCA 4Q1RA 4Y26A 4AVVA 1GYKA 1QNWA 2ZA9A 1UL9A 4HANA 5GZDA 4FPEA 3OPZA 3HR9A 2DVAA 2PHWA 1S0GA 4YZ3A 3OBRA 2ZGQA 3RRDA 1YO8A 2AR6A 5T5LA 1HDKA 2WLQA 2D44A 1CONA 1ULEA 2EF6A 3USUB 4BMEA 1LHUA 2A6ZA 3WV6A 1G9DA 3IPVB 2AYHA 1LESA 1YI7A 3NV3A 1WW6A 4UW5A 1GLHA 1Q8PA 2PHFA 4YM2A 4FPKA 1YRZA 1V6MA 4Q26A 3AXDA 1VAVA 1LGBA 2YROA 4W65A 2CY6A 5GLUA 3ILNA 1LTEA 3W59A 4UW4A 1LULA 2R1BA 4Y22A 1LGCA 3HMYA 3WG1A 1WLCA 1I1EA 4XYXA 1LOEA 1QF3A 1S0BA 5CAZA 5GALA 1LOAA 1BYHA 4ZKTB 4XMAA 3PVEA 3POYA 1V00A 1QDOA 1W6NB 2SLIA 4WVVA 3A4UA 3N7JA 5GLZA 3WDWA 4BM8A 3LCPA 1V6JA 3POSA 1VALA 3MW3A 1MS4A 2OW4A 3ILRA 1ENSA 4YM3A 2A3YA 2D6PA 3DUIA 3T1MA 2P2KA 4HL0A 2ZBJA 4PQ9A 1IS3A 2JECA 4ATFA 1Q8OA 2CNAA 2UWBA 1LOGA 2UWAA 4Z8BA 2AREA 1LU2A 5IK7A 4FPGA 5GZEA 4FPLA 2KM2A 2P3KA 3ZXLA 1QMJA 2VW1A 3AYAA 2DVDA 3VKOA 3WHUA 1AF9A 1QOTA 3IKWA 5EYXA 2DUPA 1RIRA 1LOCA 4CRQA 2ZABA 4XTMA 5DUVA 4YG3A 3N7KA 3NV2A 2CTVA 3ILFA 5DXDA 4DRVA 4GALA 1CIWA 3MW2A 1CPMA 2JKBA 4UW3A 3ZVXA 1PZ7A 1G9CA 2B7YA 3AZXA 2A3XA 1N3OA 1W6NA 2D43A 1KDMA 5HCAA 4TZDA 3ZXFA 1GZWA 1FV2A 4YGCA 3AZYA 2P37A 3LSDA 4GWMA 1H9WA 1S0DA 3FUOA 3OGGA 2E7QA 3B01A 1DZQA 3AJZA 3SH5A 2EAKA 1CN1A 2P34A 3LSEA 1LU1A 5KXCA 3L2YA 2WT2A 3SNMA 3ZXKA 1DQ4A 1LHOA 1S0IA 2G4IA 4YW4A 4U2AA 1W6MB 4P9XA 3UL2A 3O5SA 1VIWB 1GNZA 2ZHLA 4ISRA 5LK5A 3USUA 2E7TA 3D5OA 5T55A 1N1TA 4FOYA 4JRAA 4Y1YA 5IK4A 1CVNA 1LECA 2Z42A 3ZPYA 1SLCA 2AH2A 4LBNA 1UN1A 3B00A 1G9BA 3OYWA 1WD3A 3AYDA 2PHTA 3C2UA 2D6KA 1MS8A 1X50A 5DZFA 3M2MA 1N1YA 1SFYA 2GNBA 3FBYA 4NO4A 4YM0A 1FATA 2ZGKA 3WG3A 1LHWA 3VKLA 1C1LA 2H0BA 3NV4A 5HCBA 3NV1A 4WVWA 2ZACA 5EWSA 1F5FA 1MZ6A 1HKDA 1V6IA 3IN9A 2YY1A 1SBFA 3RMYA 2AENA 3CNAA 5GLWA 5E88A 1NXD1 4Y1XA 4NOTA 4H55A 4FOVA 3UJOA 2EALA 3IMNA 5DUWA 1LENA 5JOWA 3R4SA 5E8AA 2C5DA 3OYWB 2DURA 1WBFA 2ZAAA 4RA0A 5CBLA 4PCRA 4XBNA 1G8WA 2VW0A 2A70A 4GKXA 1BXHA 3WCRA 1YXWA 2LTNA 3IM0A 4LBOA 1AJOA 1YYNA 2DVGA 2FMDA 2R0HA 1ENQA 2YXSA 4DPNA 3WVJA 1MVQA 4XJWA 1SBDA 4YZ4A 4I30A 5F9TA 2DTYA 2GN3A 2WT1A 4R9DA 4FVVA 1DGLA 4FPHA 1IOAA 1DQ0A 2A6WA 4ITCA 3M3OA 1W0PA 4XHBA 3VV1A 1S0FA 3BTAA 1MR5A 5DUUA 3U4XA 2D3PA 1IS6A 3I8TA 1O4ZA 3PVNA 2CWMA 5KXEA 1DQ1A 5GZGA 5FRAA 2C9AA 5JMCA 4YZ1A 2ZHNA 3AJYA 3SH4A 2UWCA 4C1XA 3B9CA 4XHXA 1BZWA 1OFSA 2PHXA 2ZGOA 2W52A 1MS0A 3WDXA 2YMZA 3V0BB 3V0AA 1S1AA 1CPNA 1SLIA 1GV9A 1JUIA 1EPWA 1SACA 2VY0A 1GZWB 1LEMA 2WSVA 4P9YA 3FLRA 2EXHA 4XJUA 4YM1A 4YZ5A 3T2TA 3ZSMA 3VUOA 5FREA 3IPVA 3PJQA 2JDZA 4GKYA 3SH3A 2W39A 4PF5A 1W6MA 2ARXA 1HQWA 2D3SA 3ZSJA 1S0JA 1W6OB 3O12A 5CB7A 1HQLA 1W6PB 3NWKA 2D6NA 4L8QA 5DG1A 3VKNA 1S0CA 5IT6A 1LCLA 4K1YA 1W6QB 3O0VA 4XBQA 5EYYA 1JBCA 1WUVA 1VLNA 2ZGPA 3R4UA 2ZGLA 1W6OA 5EXOA 1W0OA 4RL7A 1DYPA 4Q27A 1XQNA 4M3CB 1LOFC 1WLDA 3FLTA 2EXIA 1J1TA 5T50A 1JYCA 4SLIA 2PHUA 1N3PA 3MEPA 4FP2A 3WG2A 2R0FA 2ZGSA 1JW6A 2EXKA 3SITA 4AVTA 1DBNA 3D4KA 3ZSLA 4R9BA 1IKQA 1SLBA 1W6PA 1CR7A 4FPYA 4M01A 3T1LA 4Y20B 5GLTA 1RITA 2UU8A 3SLIA 2E51A 1W6QA 2XG3A 4IQPA 4XBLA 4JC1A 3RQ0A 5CNAA 1R1ZA 5JOXA 1JYIA 1UAIA 3TAYA 1KQRA 2A71A 4Q8KA 1KDKA 2OUJA 1GKBA 4WV8A 2R49A 5H9RA 2GMMA 2OUHA 1SLLA 2D6LX 2A6VA 1G9FA 1QOOA 2UURA 3AZVA 4Y1VA 5AVAA 4DQAA 3WDUA 1N1VA 3ASIA 2OVUA 4FOQA 5T54A 1FV3A 2JJ6A 2W08A 4LBLA 3UK9A 3V0BA 1SLTA 2E53A 4XTPA 2DU0A 1G9AA 1CJPA 1MS5A 4XE9A 1AVBA 1G86A 4AYUA 2DU1A 3AFKA 1LHNA 1HLCA 2GNDA 5HCFA 1BQPA 1OQ1A 3AP5A 4BMBA 2A7AA 2DTWA 2DVFA 3B69A 1UMZA 1FX5A 1WD4A 3B3QE 2ERFA 1URXA 3GNEA 3AZZA 5H9PA 1QU0A 1VAMA 1QOSA 3R05A 2DUOA 1AX1A 3RSJA 4XXPA 3V64A 4PBOA 4BLJA 2ZGTA 3MPPG 2JE7A 5IUQA 3ENRA 2A3WA 2DWRA 3AX4A 2CYFA 3WCSA 4GXLA 1LGNA 3WUCA 3W58A 1DQ5A 1O4YA 2RHPA 4XJ9A 4YLZA 5IK5A 1SLAA 2NZ9A 1C1FA 2NMOA 2XB6C 2ZZJA 4XJAA 4AGVA 1ULFA 1DYKA 1MZ5A 4GWNA 3N3HA 4LBMA 2WNEA 4FP3A 4ZXKA 1AXKA 4YGBA 3RG0A 3AXEA 3FUQA 1GICA 1OKQA 1H9PA 1QNYA 1V6KA 2NM1A 3WUDA 4YGEA 1KRIA 5KXDA 2WKKA 3AP4A 3WZ1A 1GZCA 1GBGA 4R9AA 1DIWA 3AP7A 5DG2A 3POWA 2AGSA 4XMIA 1FNZA 5SV8A 2NMNA 1WCSA 1AJKA 3OY8A 3N35A 4Y1UA 1MS9A 5JOZA 5H9QA 1MVEA 2EXJA 3PMEA 1D2SA 3SISA 4LBJA 1C4RA 3RS6A 2D3RA 3ZXEA 3V65A 1WW5A 5GLVA 1ZA4A 4ISQA 1Q56A 1FNYA 4Y20A 3FFZA 3WDTA 4WZFA 4XZPA 5CA6A 1GZ9A 3ZYRA 2YV8A 3OJBA 2LALA 1SCRA 2TEPA 1BKZA 4XOGA 2YZ4A 1LOFA 1AXYA 2DVBA 4P14A 4PBPA 5DZEA 1CESA 3TB0A 1GNHA 5H9SA 5JLVA 5DZGA 3M1HA 5T5OA 1IKPA 4AVSA 4FQZA 3OY8B 2ZMKA 1BJQA 2ZGNA 5F5QA 2ZKNA 3VKFC 2A6XA 5JOYA 1ULDA 2R16A 4M3CE 4YW5A 3VKMA 2SBAA 3BIWE 1JHNA 1UX6A 3PVOA 1B09A 5E89A 4ASMB 2HYKA 4YG0A 5GM0A 4CTEA 4JCKA 3BOPA 2NN8A 3AYCA 3D6EA 2GNTA 1S0EA 4BPZA 4LBQA 2GNMA 2R1DA 1WLWA 3MW4A 4BOWA 1ONAA 3UJQA 4Q2FA 1V6LA 5KXBA 1Y7BA 1FAYA 2WSUA 2WT0A 2NYYA 2DUQA 4XIOA 4YW1A 4TYSA 2GMPA 3WOGA 1DLLA 1DQ2A 2Q5TA 1WBLA 2A6YA 3INAA 4YGDA 2JD4A 1U0AA 5T5JA 1WW4A 5T5PA 4FPOB 5T52A 5JDBA 3H0OA 3HN1A 4AGRA 1UZYA 1N3QA 1I3HA 1JOJA 2V73A 4C1WA 4YZ2A 3V0AB 4FOWA 1AX2A 4M3CF 1LJ7A 3RMXA 1F31A 2ZMNA 2ZMLA 1Q8SA 4FPFA 4DFSA 2ENRA 5IK8A 1LOBA 3QCWA 1IS5A 1D0HA 1Q8QA 2D7FA 4K1ZA 3M3CA 4K20A 5DUXA 3ZSKA 1ENRA 1MS3A 2VH9A 3M3EA 4AGGA 1C57A 1NLSA 1Z0HA 1SBEA 1QGLA 3GALA 4P9WA 5JVVA 1LHVA 3WNXA 2ES3A 3QLQA 2ZHMA 4YG6A 2ZGUA 2ZGMA 2VW2A 1AZDA 4BLIA 4YW3A 2BQPA 1IS4A 1A3KA 4BQ1A 1AX0A 2PELA 1RINA 5BYNA 4XXAA 3FLPA 4R9CA 1PZ9A 3DGTA 2FHRA 3ATGA 3Q9OA 1SCSA 4Y24A 2VUAA 3N7LA 3AZWA 2I2SA 4XJZA 1MACA 3KQRA 3A0KA 1N1SA 1WW7A 2W68A 1A78A 2CWSA 3WDYA 2WJSA 3O0XA 3ZYPA 4YFZA 3KM5A 4D69A 4M00A 3JU9A 4XIKA 1JN2P 1A8DA 1N47A 1LODA 1UKGA 3APBA 3M3QA 3N7MA 1KITA 2V5YA 4FPJA 3AK0A 3AYEA 3WDVA 1TEIA 2CL2A 4DS0A 3JUUA 1G7YA 2GN7A 2VU9A 1QKQA 2ARBA 2ZHKA 4UW6A 3ZXJA 4MYEA 2A5ZA 1DQ6A 3O0WA 4AWDA 4LBQD 3I4IA 3OBTA 4OZXA 1PZ8A 1Z78A 4Q1PA 2DV9A 4U36A 4CZSA 1ULCA 2A75A 2D6OX
chains in the Genus database with same CATH superfamily
1CQ9A 2RS13 3T0BA 3WP3A 3GM8A 4B7KA 5LY1A 2RJKA 4QDQA 3RYPA 1DFQA 1SFPA 2WQZC 4RQPB 3N36A 2FMYA 2EICA 1L3JA 1QDCA 5CFCA 4HBNA 3H8OA 4DRRA 5FP9A 3WG4A 4XW3A 1H30A 2JWPA 3ZMNA 1FYUA 2DYCA 1MS1A 3WLUA 4NWWA 4KBBA 5FY9A 1UPSA 2N7GA 4H7LA 4ORFA 2F4LA 1YIFA 1DHKB 2ZXQA 4Q4X3 3SKJE 2C6SA 3VD4A 4LO4B 3F2ZA 1UO9A 3MUY1 4LUKA 1V6NA 2P3JA 2X53S 3C7FA 3AP9A 2WZEA 4OI2A 4QQLA 2Y6GA 4R8HA 1JXNA 1Y9MA 3SCGA 1L7QA 4Q8LA 3MHZA 2RJLA 1EAH1 5FZ9A 4Q1RA 3K46A 4AVVA 1OF4A 3NJVA 1NCRA 1GU3A 1QNWA 2IXIA 1OQDA 4OUSA 5GZDA 2WNOA 3OD0A 4XDPA 4MGSA 4YZ3A 3U78A 4LT5A 3MIGA 4L2NA 1HDKA 2WLQA 1W9TA 1ULPA 1ZBE3 2KA3A 3Q8BA 1GWLA 1W8NA 3LGRA 4J1XA 1ULEA 1RVF2 5LWBA 3VBSC 4UBHA 3IPVB 3ZFFC 1YI7A 3CO2A 3CJIB 4UW5A 3MZHA 4AEKA 2JENA 2Z79A 2ZEWA 4OI0A 1YRZA 3AXDA 1LGBA 4GH4C 3OGVA 3T3YA 3W59A 3C7EA 1LULA 3AVRA 2QQMA 3HMYA 4GWJA 1XB9A 2Y0IA 1W39A 2ZZQA 1S2EA 5F3CA 2XDVA 1HB3A 4XQ4A 3WP5A 3PUAA 1W6NB 2VZVA 3A4UA 4LK7A 3LPFA 1BK0A 2J1AA 2OW4A 5A6ZA 1ENSA 4RGKA 2D6PA 1S2KA 4R52A 2P2KA 2K46A 2ZBJA 5DDJ1 2JECA 1RHI1 4O65A 1W8HA 1UY3A 5FYSA 3WEZA 1CAVA 1K5JA 1RUF1 5FBJA 4Q4Y2 2KM2A 5DAVA 4A44A 5L9VA 1BK1A 1JZ8A 2UY9A 5FO8B 5J96B 5EYXA 4AEJA 3MYXA 4LPLA 1H8VA 2VE1A 5IYYA 4GH4B 3PNAA 2WYSA 5LA0A 3NV2A 2CTVA 5DXDA 1L7RA 3GZUC 3O7OA 2W1UA 4HVRA 1XBFA 3J9SA 1N3OA 1BLZA 3VBSB 1KDMA 4AF9A 4RYDA 1EP0A 1OLME 3NKTA 4LIUA 5HCAA 4HXCA 3VHPA 2ORZA 3OEBA 5FPLA 1HXS2 2QQWA 3LSDA 4CP2A 2B4KA 1H9WA 3ZX7A 3B01A 3K4DA 3SEEA 1Z7S2 1TME2 2QQLA 2VJXA 5FYMA 4BQXA 3L2YA 4HONA 3UETA 1UZVA 1E5RA 4XFGA 2MEV3 4E2QA 4B8EA 3HNYM 1LHOA 1S0IA 1WWYA 2Q1ZB 5F2SA 5FMCA 2BGPA 2XGXA 5FZHA 3WP6A 1VIWB 3N9QA 5FY8A 3BB6A 5LK5A 4I0BA 2E7TA 4BMEA 2F4PA 2JG8A 5T55A 1N1TA 4OCTA 3CDZB 4Y1YA 1VBA2 3WF0A 1OPMA 1CVNA 2K2SA 2Y6HA 1ALYA 5BNPA 3FL7A 4PDWC 2GP5A 1G9BA 3P1IA 2PHTA 4QU2A 2JICA 1X50A 1FOD3 3JQXA 4IETA 1SFYA 1WLTA 4NO4A 3U14A 4C8DA 4TXWA 2W1WA 2H0BA 3NV4A 3NV1A 1VRH1 2ZACA 3UKNA 5B4NA 3K4AA 1YQ5A 1BEV3 1W2AX 3J7NA 4DINB 3IN9A 1NOVA 5FP4A 3JD73 3CJIA 2XQRA 3RMYA 2AENA 3CNAA 2I74A 3ETPA 4BE3A 4HKOA 5GLWA 5E88A 1NXD1 2DCKA 4MO3M 1H6YA 2CAVA 4Q0PA 3D0JA 1W8UA 3IMNA 5JOWA 5E8AA 1E57A 1QXPA 3HJRA 2RS52 2C5DA 1YCIA 1ND3A 3OYWB 5A7PA 1WBFA 3P3NA 5DAWA 2ZAAA 3LPGA 5CBLA 4PCRA 1XSQA 3VDDA 1K42A 4WVMB 4BHPA 4GH4A 4FSJA 2BEOA 2WAAA 3ZR5A 1OFNA 1SEFA 5JZGB 2TNFA 4LBOA 5A7OA 2HWE3 2LRPA 3O1RA 1YIPA 1OH3A 2JG9B 2YXSA 1AR92 4B29A 3KHCA 1FMD3 1W0NA 2DF7A 1MVQA 4NIAA 4A3XA 4LTAA 4UFMA 5F37A 5CYYA 3DF0A 4I30A 2JB4A 2GN3A 2RDNA 2WT1A 1ZZ9A 3CLPA 1DGLA 4GQ7A 2EIBA 1WCKA 5FKCA 2RS11 4QDRA 1DQ0A 2A6WA 4Q4W3 1UYPA 2QDNA 4K8RB 2FZ1A 3VV1A 1MR5A 3U4XA 5A6YA 5C4WC 4JGYB 3PVNA 5GZGA 1QH6A 3RNSA 5JMCA 5KHJA 4PF1A 2F6BA 4C1XA 2WC2A 3B9CA 4XHXA 1HXS1 1AYM3 1BZWA 3AMPA 4K40A 2PHXA 3O1VA 1VBC3 2Q4SA 1PMJX 2XBO1 2YFZA 4LO8A 2WNVA 4YVSC 5J7MA 1S1AA 1HN1A 1YJLA 3I3BA 3W21A 2VCAA 4D6RA 3OSDA 2QFEA 1UXZA 1LEMA 2HJIA 2QTWB 2WSVA 3ECQA 4P9YA 4YM1A 5IFTA 2BFUL 2WWJA 3RWNA 1XYOA 4JX0A 4P08A 2ZX1A 4UYBA 3RI9A 2JDZA 3SH3A 5LBCA 4PF5A 4CU7A 3H1WA 1S0JA 5ABJB 1RL3A 3KWVA 1HQLA 1W6PB 1OSGA 4EN9B 1GWMA 2X10A 4QMAA 5DG1A 4CU8A 4J6GA 1JI6A 4QKNA 1AL22 3H8RA 2QQUA 1JBCA 1MEC1 3OGSA 4NIGA 2ZGPA 3R4UA 1PGW2 2ZGLA 3AMQA 3BVCA 1W0OA 4G9SB 3K51A 3B94A 1XOYA 4XUTA 4DXRA 1KS4A 1AR72 1HIXA 2RS12 1US3A 4KWLA 1JYCA 3MI8A 4SLIA 1X33A 3ACLA 1N3PA 3QD6A 3LA2A 4EWEA 1RUE1 3WG2A 1DU3D 2EXKA 1VP6A 3MV11 2JKXA 4QPYA 3N9MA 3RZZA 5KC6A 2XQXA 4CXWA 2P6HA 4MZUA 2VTXJ 1SLBA 1RJ8A 1WMXA 2PAKA 4M01A 3T1LA 3WW4A 3D82A 1NG0A 2RS32 1AYM1 1PIV3 1RITA 2UU8A 1W6QA 4GZ9A 1J3PA 4XBLA 3SEPA 1JMUB 5JOXA 5LCWL 2ZOEB 1UAIA 1RUG1 5DAXA 5ISLA 5EHDA 1KQRA 4NAMA 4D6SA 3IDBB 4NPLA 5L36A 4JGZA 3VBRB 4Q8KA 2E26A 1O7FA 2OUHA 1PO23 4FXGB 2D6LX 2A6VA 5FMOS 1G9FA 1JODA 2YPJA 3K77A 5AVAA 1JZ3A 1GWKA 2PTMA 4KGQA 3WDUA 4DQAA 1H8TA 3NRUA 2R063 1N1VA 1D2QA 3ASIA 5A32B 1NCRC 5T54A 5BNQA 2QQVA 4N7IA 2E53A 2CV6A 2VMDA 4Q4Y1 3LDKA 2VZQA 1G9AA 3AM2A 2J1EA 1R083 2HWB1 1AVBA 1RHI3 1T6BX 1BBT3 1A6CA 3AFKA 1LHNA 1H2MA 2BJSA 2LW8A 2FDKA 2GC3A 4RS5C 3AP5A 4BMBA 5IVFA 2WO3A 1UOJA 4CDUB 4BJ0A 5FR3A 5CZKA 3AZZA 4IGQA 3ACIA 5H9PA 1H1MA 5KHGA 1OUXA 2XJRA 1D4VB 1VBA1 2O8OA 1Q3EA 3RSJA 3LQCA 2OZ6A 3V64A 3SQOA 5K9YA 4PBOA 1O3QA 1UCXA 1DDLA 4MSVA 3ENRA 3I59A 5AC92 3JBG2 3WCSA 5JXJA 3ACFA 3PUSA 3OUIA 4UBGA 5I0UA 1O59A 1LGNA 3WUCA 4PT6A 1W06A 1DGRA 4CP0A 4FFIA 4HK9A 1QEXA 4YLZA 1VRH3 5IK5A 1W2TA 2NMOA 3LEKA 3U37A 1YLLA 2XB6C 4XJAA 1ULFA 4W6XA 1MZ5A 1C8M3 1R092 4LBMA 4CCEA 1ZBE1 2IVIB 3RG0A 4E4ZA 3FUQA 1DZTA 2ZCWA 1GICA 1OKQA 5FYVA 2VXJA 5JAXA 5DQ0A 4BU2A 2NM1A 3ON7A 2ZPXA 4KWJA 3HBZA 4ASKA 5AC91 5FZEA 1PHMA 5L19A 1EAH3 4R9AA 5JUVA 4Q29A 1EY2A 4AI2A 2R7EB 2Q8OA 3NJZA 4IE5A 5FZ1A 3OPTA 1IG3A 5FXVA 5FYZA 1ZZ8A 1WCSA 2UY8A 3JB4C 5BNOC 1MS9A 4JGZB 4P00B 4QX5A 1MVEA 3POJA 4AI8A 1AL21 3GBWA 1FXZA 1D2SA 1TME3 1Z7S3 3FC0A 3GHMA 3H1YA 3SISA 2X29A 3S5QA 3VDDC 2YB7A 4MG2A 2VOTA 1W90A 2D3RA 4K6BA 4UFJA 3KZ4C 3Q8AA 2DCTA 3FHIB 1D4M1 5CFDC 2I07B 2XKOA 4HZFA 4ZU5A 5L7OA 1C5IA 4ISQA 4AFCA 5A1LA 2RS51 1Q56A 4QX7A 3WDTA 2A73B 2R061 4WZFA 5FZ3A 1CAWB 1GP6A 2YV8A 1DCSA 5CFCB 4QB6A 2YBPA 3CQOA 1YFYA 2G9GA 1PO21 2YZ4A 4NN0A 3T2OA 4N53A 1AXYA 4PBPA 5DZEA 1QJU1 3K75B 3WP4A 3I2OA 3U10A 1RUG3 1SFNA 4KWKA 3OY8B 4W6YA 3VKFC 1YQ6A 4GAZA 4Z2WA 4N8MA 4ZS3A 4NJ4A 2R16A 4M3CE 4R4ZA 5F1RA 2SBAA 5LEJA 3VHNA 3PVOA 2XWJB 3ZMOA 4YG0A 1ND2B 5LBBA 1PVXA 4Z2AA 4KQ7A 4G4FA 3IDAA 4MH0E 3POIA 1S0EA 2E33A 4LBQA 2R1DA 5IVYA 4FCAA 4QU1A 2JDUA 4BOWA 1ONAA 5KXBA 1UZ0A 3HOBA 3UKVA 1Y7BA 2OYZA 1KXGA 1FAYA 1QQP1 2VECA 2WSUA 4BH9A 3O1SA 2DUQA 5CVRA 1BVP1 2GMPA 1DLLA 1DQ2A 1VR3A 2A6YA 2Q5TA 4AW7A 1XNCA 1U0AA 5HV4A 1WW4A 5FYTA 4TLGA 4AGRA 1H4HA 1UZYA 4LUMA 2QQNA 3DKQA 1N3QA 4LNVA 1VBE1 4CCJA 2V73A 1FMD2 3PUQA 4I0AA 4CEWA 2OX0A 2Z5WA 1V0AA 2HWC1 3DL3A 1TE1B 4FOWA 4M3CF 4PIYA 4EWDA 4X8NA 4W8JA 1RVF1 4DFSA 1ZA7A 2ENRA 2WRAA 5IK8A 5FK8A 1D0HA 1TQ5A 4QX8A 5FYIA 5DUXA 2Y6KA 5I8YA 1UY2A 2WN3A 3IDCB 3MFCA 3HPNA 5FY4A 1GR3A 1VMHA 4OULA 4IEQA 1W2OA 4DXZA 4QXBA 1O5UA 1O4TA 2YU1A 1IS4A 2BU9A 4NAOA 3B7MA 5K4LA 3I97A 3M70A 2DCJA 2GU9A 1AYM2 3AKRA 3KMHA 5CU1A 3VHOA 1GOFA 1PZ9A 3DGTA 3FMGA 5K0UA 2YDEA 2R6QA 4EYUA 2W9XA 5DPNA 3EYPA 4IEZA 2EAAA 5G04L 3ZYGA 2JXAA 4E2GA 4QWNA 4BYYA 5B4XA 1RMU2 3ZOIA 2W68A 2CWSA 3CBNA 3CJIC 2WJSA 3O0XA 3WDYA 4YFZA 2AEZA 1UY0A 2PFWA 5I8SA 1YEWA 2WNUA 1N47A 1UKGA 2X8KA 3N7MA 3M3QA 4D7TA 4L0PA 4FPJA 1WCUA 3ZYHA 3WDVA 2DBIA 1H2NA 4C0BA 4DS0A 3HD8B 2GN7A 3SXWA 2ZHKA 1MZEA 3AMMA 3ZFFA 3SC7X 4A45A 2A5ZA 2PAEA 3O0WA 1EV12 1ZBA1 1AL23 3ZKUA 4AWDA 2RVAA 3C7OA 2QZ2A 3I3MA 5JIAA 3I4IA 2P6CA 1POV3 3TN93 2BTVC 4JKLA 5FZAA 4A7YA 3GF6A 1AR73 1QJX2 5FIXA 1VRBA 4FQ4A 5FDBA 1V6OA 2GALA 4NRQA 3VBHC 2E6VA 1FT9A 1LEDA 4AEDB 4YW6A 2PAMA 4UF0B 2D6MA 1W8TA 1GANA 2GMEA 2GDFA 3BN6A 4XILA 1KJRA 1CIYA 1ZM1A 3ACGA 2PHRA 3ROUA 4IV3B 4LBQB 3PJYA 4Q4V1 4KBZA 4NHKA 1UX7A 3ZXGA 2VVFA 2FZ2A 1R091 5A6QA 2Q1MA 2RS33 2AACA 3ZFGC 5GJ6A 2VXRA 2Z4FA 1PK6C 4GA9A 4MXWB 3GHNA 1GSLA 2PLV1 2VMEA 4JKMA 3RYRA 2K0GA 3AP6A 3BODA 4NRPA 4K21A 3W9AA 3NNLA 1F4AA 4Y22B 5HPOA 1JYTA 4L99A 1PO22 4LXLA 4HANA 4FPEA 4QPWA 3OPZA 4A42A 3PTRB 3LKJA 1S0GA 4CXYA 1NT0A 1YO8A 5T5LA 5K0UB 4A41A 3ALQA 2F17A 2D44A 4CCKA 2AC1A 4IESA 4XFIA 2XUMA 3POEA 1F4HA 5BXXA 3WV6A 2AYHA 1LESA 3VGIA 2RG4A 5JZGA 1GLHA 1VPHA 2ARAA 1SDDB 2VTXA 4YM2A 5C7GA 3WF4A 4J25A 3R4DB 2XJQA 4OQ8A 2J1RA 4M0NA 2HWD3 1JU4A 2CY6A 4Y1ZA 3WF1A 4WZCA 3HQXA 3KT1A 2YC0A 4XF4A 5FYBA 3VD9A 1RB8G 1XC6A 1LR5A 1QJX1 4MXVA 1E5HA 3WG1A 4XAEA 4GB33 1LOEA 1QF3A 1S0BA 2VC9A 1OOPA 4LA3A 1LOAA 5CAZA 1OLQA 3POYA 1K5MC 1H0BA 1QDOA 2SLIA 1AR83 3LCPA 3GZTB 1Y3TA 4AG4A 1VALA 3USSA 4YM3A 2EA7A 3O1OA 3WY6A 2BYVE 5FLJA 1UY4A 4PQ9A 1IS3A 4Z8BA 2CNAA 2UWBA 2AREA 3N9LA 4E8DA 1H1IA 2B46X 2WNVB 3HT2A 4FPGA 4KG0A 4FPLA 1B35B 3C3VA 2P3KA 1YUDA 3GBFA 3MF6A 5FKBA 5JZGC 4GULA 3POBA 4OMDA 3T30A 3VZOA 4CCCA 2XJTA 2W46A 1D0GA 4YARA 4QPGA 4CSWA 1KFXL 5F5IA 4CRQA 5A3WA 3N7KA 4BQWA 4DRVA 5K8SA 4GALA 4XPVA 5FZKA 5LB6A 1CPMA 1HRV1 4IGOA 4N43C 1PZ7A 4UW3A 4A6OA 1G9CA 2E63A 2WA4A 1W6NA 4NHYA 3C7GA 3MBWA 5FZ8A 4KU7A 4O9GA 2P37A 4TWTA 3ETQA 3OGGA 3FUOA 1JOBA 1HB1A 2E7QA 1MEC2 4LHNA 3AJZA 4D94A 3LSEA 1VBE2 4A7KA 1LU1A 1VJ2A 3BGAA 2NPIA 4Q5OA 5I0TA 3VBUC 4Y5SA 1XNBA 3H1MA 2WT2A 4LK6A 4L9BA 4LHSA 4QDSA 4QHZA 4UF0A 3ZXKA 4YW4A 3G6JB 3WQ7A 1W6MB 1NZCA 1JH5A 4CP1A 3AL5A 2VL4A 3ZN6A 3D5OA 4ZZ8A 4FBFA 4FOYA 3HEIA 3TRSB 5IK4A 3VBRC 4H7MA 4QKBA 1B35C 1LECA 2RM23 2Z42A 2JDPA 1SLCA 2AH2A 1ULOA 1WMEA 3ES1A 5BPXA 4IV3C 5D8AA 1RUD1 3OGJA 3JZVA 1VAKA 3TEXA 2X5IB 1PO12 2VUDA 1X82A 1POQA 4RFT0 3VZNA 1ZRDA 1CAVB 2OXBA 1UWWA 4Q0QA 2L9LA 1QWRA 1MZ6A 1HKDA 4DO0A 2TUNA 4PHZA 5EPAA 3MFAA 2HWF3 3E6BA 3D8CA 2VULA 3E5XA 1BVVA 5CKQA 4IV1C 1H2KA 1O91A 2QCSB 4HLTA 4Y33A 5FZMA 2YPDA 4FOVA 3UJOA 2E9QA 5FPZA 2BW8A 3SCFA 4MGYE 1J58A 5DUWA 3R4SA 1XYPA 4CCLA 5ACA1 5IW0A 2RE9A 2GZWA 1G8WA 4E4DX 2A70A 4GKXA 3WCRA 1YXWA 5FY1A 1AR63 3H7YA 1JZ4A 1RUNA 1LNSA 2DVGA 3WW1A 5ABJC 1ENQA 5C8CB 3THTA 4D7SA 4XJWA 2XJSA 1NAEA 1ENXA 3DYMA 5F9TA 2O1QA 5JPNB 1ZRCA 4R9DA 3OEAA 2YUEA 1RYYA 3GZAA 1X9PA 5FPUA 4AFAA 5FOBB 2YGMA 3A21A 3DPRA 4RHV1 4CYDA 5A3NA 2QVSB 2LUWA 2J7MA 2IUWA 1HB4A 1S0FA 5FO9B 1XXNA 1VBD3 1EUTA 2D3PA 5C3RA 1O4ZA 2VNGA 3MIFA 1REDA 4JZRA 1DQ1A 1EV11 1ZBA2 4QX0A 5CFDB 5KXEA 5FOJB 3CKHA 5BNNC 2YYOA 4CP9B 4LE4A 5JIUA 3NQHA 4BXFA 3IDEA 2W52A 1MS0A 1W8OA 4QGNA 2YMZA 3WDXA 4AVBA 2R071 3H8XA 1H2LA 4HPKB 3EXUA 4KU8A 1R1A2 1RUC2 1SACA 4JQRA 2VY0A 3CIHA 3NAPB 2OKXA 1K12A 2EXHA 3KT7A 4XJUA 3VUOA 5FLHA 1RUD2 1I5PA 2YBSA 4B1LA 4N43A 4IEOA 1WGPA 4DUVA 2Y8KA 1X8EA 5G05L 4Q0SA 4BK4A 1W6MA 3DYOA 4IERA 1ND3B 1AR71 3BTYA 3WINE 4JGYA 1W6OB 3JQWA 1NCQA 4WVMA 1K45A 1YWKA 1V9U2 5FYHA 2W1SA 2Y26A 4IL7A 3NWKA 5CKMA 1PNFA 2D6NA 5A3UA 5FPXA 3LB9A 4QXHA 1PO11 3QACA 2OT7A 2BPA2 1PGL1 1LCLA 3RDIA 3J8F2 4NIHA 1EV13 3O0VA 2TBVA 4K1YA 3BKZA 3RZGA 3WQBA 1U5YA 1WUVA 4QB1A 3ZFEA 3VBFA 5C6CA 3ZIXA 1Y43B 1OD5A 2QDRA 2FBEA 4ASLA 4RL7A 1DYPA 4Q27A 3OB8A 1XQNA 1YQ2A 5ACA3 5EJ1B 3FLTA 4AHXA 4RHV2 2EXIA 1NX9A 1QJY3 4B3NA 3ZN4A 3J26N 4WM7C 2G1MA 1S2BA 4GWIA 2HBUA 1STMA 3MEPA 5FAXA 2R0FA 2ZGSA 4AVTA 1DBNA 1XU2A 2DCZA 4DXSA 5L7OC 5A1FA 1XE0A 2IXJA 3O1TA 4RS5B 4I0WB 1W6PA 2O8QA 4FPYA 4RR3C 3NNFA 3BPZA 2G9FA 3P3PA 5GLTA 4AVAA 3WNMA 2ILMA 3MIHA 4JC1A 4UFLA 1R1ZA 3FE5A 3LEGA 5T3NA 2W3JA 1JUHA 4WV8A 1SLLA 4Z82A 4Y1VA 5ANQA 3RZHA 4AAXA 3OUJA 3URFA 4YSFA 2OVUA 3UK9A 1FV3A 4LBLA 1NKGA 1ZBE2 3JXSA 4XTPA 5CKNA 2Q30A 1CJPA 1RVF3 4QQHA 4TSVA 1NY71 3AL6A 1T6GC 2W47A 1D4M2 2WFF1 3VZMA 1I6XA 1YFUA 4DNYA 2AZ5A 2P4EA 1F15A 4WM8A 3H3LA 1BQPA 2VBBA 1M06G 3RFRA 2A7AA 5FLIA 1UMZA 3B3QE 4EV0A 1ZZ6A 1URXA 2VBDA 3TEZA 2VBPA 5C8WA 1NCQB 2HH9A 1J84A 2BV4A 1AX1A 3CF6E 3KSCA 3AKTA 3MGUA 4XXPA 4DXTA 2LS6A 2ZGTA 1E5SA 2JE7A 2IWGB 4L92A 3NKGA 5FZDA 2A3WA 5A7SA 3GJAA 1NA1B 1UKRA 4XC9A 2CYFA 1PNGA 2RMU3 5F5CA 3ZSEA 3J8F1 1QJFA 2VOXA 3OBAA 2KR2A 4NUBA 3VZJA 4E9KA 2QKDA 5A33B 5IJRA 4XJ9A 1W8WA 1SLAA 4FI9A 3N4MA 4FAHA 5C3OA 1US2A 4AGVA 4XF3A 5EJZB 4QPIA 1DYKA 1OA2A 4HOOA 3OGRA 4GWNA 3N3HA 4XETA 3TBDA 1SDWA 1F35A 3LZZA 1OVSA 1AXKA 1F8VA 2WIIB 1GOGA 3AXEA 3UYJA 5LEKA 4EZHA 5FMBA 3I2GA 4H2AA 4JKKA 4AL9A 1AR81 1UQXA 2C26A 2Y38A 4INDA 3AP4A 3UGHA 2JG8B 4NROA 3LA7A 5J3UA 4QPGC 5FUPA 3ZFEB 3AFGA 2OPWA 5A32A 3LD8A 4I02A 4LOTA 5FZFA 4CXXA 3TEYA 4JGZC 4B4PA 3FFQA 3KCXA 4JDMA 5DAPA 1AJKA 1HXS3 2C24A 3N35A 4Y1UA 4YVSB 2VQ0A 5JOZA 4JDNA 5FP8A 4UFIA 3ZFFB 1W9YA 2QJVA 2VCCA 3BPSA 3VL9A 2VMGA 3U0ZA 4Z07A 3RS6A 1YHFA 2ADEA 2MNGA 2J1SA 3V65A 3ZXEA 2VZTA 4MHUA 2WNUC 1I5ZA 5F8PA 4IUGA 3WW3A 1TNFA 4WM7A 1UYYA 1PGSA 3MDPA 5FZGA 3PLQA 5FQ0A 3KCYA 1UU6A 4AQ6A 2J42A 1IG0A 1GZ9A 1ODNA 5FJKA 2RM22 2LALA 5SV5A 1C3HA 1BKZA 1ODMA 2J1VA 4R4XA 4XFFA 2J22A 2BVBA 3KV6A 3OCPA 4P14A 1CESA 3TB0A 3KT4A 1PGL2 3FWEA 2PN5A 1PO13 3BCWA 4LO6B 1U5ZA 5T5OA 4OUMA 4CEWC 1QY4A 2ZMKA 1BJQA 4MOAA 5F5QA 1CGPA 1YJKA 5IAVA 4A7ZA 4UOJA 5CEHA 1JHNA 1UX6A 5DDJ2 1B09A 4CTEA 1BEV2 2HYKA 3L9JT 4MGIE 3NSTA 4M4PA 2VUCA 3JD72 4QM9A 4CEYC 3KVBA 3D6EA 2VQTA 3VBUB 4OQ9A 3KHBA 1VBB1 3IAQA 2JEMA 1PVC2 1WLWA 3KV5A 3S6PA 4SBVA 3BTZA 3UJQA 4Q2FA 3WNOA 5FMDA 3VDBA 1YNAA 2JG8C 4XIOA 4TYSA 4XF0A 5CISA 2W87A 4QAWA 3WOGA 1PK6A 5F6LB 1W28A 2PHDA 1W2NA 5T5JA 1OXCA 2VNRA 3IMMA 4OHZA 4COWA 3H0OA 3HN1A 4OZOA 3DXUA 4YYOA 4C1WA 4BA6A 3KS7A 4XEZA 1AX2A 1KGYA 3CL1A 1LJ7A 3I2KA 1F31A 4FPFA 4LKEA 1Q8SA 2XL9A 4PI2A 3ZFGB 4CDXA 4N53C 1LOBA 3QCWA 5A33A 3ZSKA 4E4SA 4LKFA 4YNIA 4JHZA 4XDOA 2XVGA 5EP9A 4Q4W2 2IFRA 1C57A 4QXCA 5LBFA 2FDFA 3U1XA 1POV1 1SBEA 4F3JA 3MV01 2WO2A 3LDRA 5LZ6A 4N90A 1ZBA3 1C5HA 3QLQA 4YG6A 4IE7A 5FZ6A 1AX0A 2PELA 4HG6B 1NE4A 5KHIA 5BYNA 4R9CA 3GBGA 1VBC2 3VHRA 2KXLA 3R6SA 3Q9OA 3LAGA 5L9BA 3AZWA 5F2WA 1SZBA 1UOFA 4FTEA 2ZX0A 3KQRA 3A0KA 1RUD3 5DN2A 4IEWA 2W0XA 1MPXA 2YFUA 2GH8A 3LOBA 1WW7A 2WUHA 4EN7B 3PUIA 4LKSA 1CX1A 2HWF1 3KM5A 1IHMA 3JU9A 2W95A 4Q0UA 3FX3A 4XIKA 3VD7A 4META 1LODA 3N9NA 1R64A 3HBKA 1KITA 1YQ8A 5LBEA 1IQAA 3AYEA 2VZRA 1C28A 3IZOA 4KNCA 2CL2A 1WZXA 3P5BA 4LOSA 4F7ZA 4ZZ5A 3JUUA 1GUIA 1QKQA 2ARBA 3H3UA 1YI9A 1QJZA 4UW6A 3ZXJA 1QJU2 1QHDA 3J8F3 4IE6A 1W2UA 4LIVA 4BK5A 3S57A 4LBQD 4Q1PA 1PZ8A 3NL1A 1J1LA 2A75A 3M4FA 4YRDA 5F39A 3TOJA 5ACA2 2I2SA 2WR9A 4MLOA 1AXZA 1XNAA 2VD7A 2ET1A 1KJLA 4LR4A 4V1PA 1QQP3 3A0NA 3CZJA 4CEYB 5BNPC 2ZTNA 2EVXA 4C90A 2EIGA 5A70A 1F9KA 2BOIA 4LBKA 1VB4A 2JE9A 4ZU4A 1KEXA 2JD9A 2P3IA 4JTNA 4BQ2A 4ATEA 1OLMA 2H6BA 3ZFGA 5CG8A 2NP0A 2O14A 3MIEA 5GZCA 4YFWA 4LHKA 4X6QB 5HI0A 2ZGRA 5EJ3A 2PLV2 2FDIA 3DV8A 1UZZA 2WNVC 5DAQA 1LAJA 4RQPA 4HKLA 4LJHA 4N7UA 2ZAHA 5FYCA 2AUYA 4Q4X1 1LRHA 4YW2A 3RI8A 1OF3A 3PVBB 2EIEA 5FP3A 3TNPB 1HRV2 5JMOA 2Y6FA 3MLKA 3E1F1 4M3CA 4RSUA 4FPCA 4AOCA 1PVC1 1GYKA 1OC1A 2JX9A 2ZA9A 4AI1A 4D8MA 4D0QA 5DMYA 3HR9A 2VNVA 2BERA 2WS91 2PHWA 1CAUB 3ZN5A 3OBRA 4Q4W1 2R062 2AR6A 2ADDA 4MADA 4XF1A 1CONA 1UIJA 1VBC1 2EF6A 4AE2A 1LHUA 3LF7A 4XFAA 1R082 3NAPC 3WNNA 3NV3A 3UNPA 1UMHA 2B42B 1D4M3 1ST8A 1RHI2 5EV7A 1BBT2 5KHHA 1CWPA 1RTVA 1Q8PA 2VMHA 2VPVA 2PHFA 4I3GA 5AFBA 2KD7A 2PQQA 2P1BA 3VBOB 2IXLA 3KF5A 4IE0A 1EYBA 2XVKA 5GLUA 3IIAA 5M0TA 1H8TC 5LK7B 5BNNB 4UW4A 3GCXA 2R1BA 4GMP3 3WXPA 4Y22A 1NQJA 1UD1A 2VCMA 3QH7A 3TEWA 4XYXA 3ZYIB 3AB0A 1TMF1 3EBRA 3PVEA 4B7EA 5KR7A 5AC93 3JBG3 2Q8DA 3Q8EA 3WDWA 4CUAA 2JDHA 3UGGA 5JWPA 3SKVA 2RDQA 3ILRA 3DUIA 3U07A 2W5FA 4ATFA 2C0ZA 4TLFA 3BOWA 4GJZA 1VRH2 4XACA 5IFPA 2UWAA 1LKNA 1LOGA 2HWB2 4PDWB 1LU2A 5EZWA 1R093 3ZXLA 4HVQA 1QMJA 2VW1A 3AYAA 2DVDA 4QX3A 3VKOA 1AF9A 3WHUA 1DGRN 1J83A 1QOTA 4XCBA 3IKWA 4C91A 5A1AA 3NJYA 3VBSA 1RIRA 2MHFA 4N9IA 4QXKA 3BUCA 1LOCA 5HBAA 2ZABA 4XTMA 5DUVA 4YG3A 3BIEA 2QQIA 1ASJ2 3OBZA 3MW2A 1EAH2 4BQ3A 3VDAA 3VLBB 1XE7A 2PHLA 3IIIA 3C7HA 1YFWA 2B7YA 4H3WA 2A3XA 4HVOA 1ZNPA 1S4CA 3VL8A 4PI0A 1C8M1 4AZZA 4TZDA 1OT5A 1GZWA 2E31A 3ZXFA 4FTSA 4GWMA 4QHOA 1Q43A 1S0DA 1UYXA 1E5IA 1DZQA 2RDSA 3SH5A 2EAKA 2P34A 5FWJA 3PUHA 5EFUA 3SNMA 2XHKA 3W5NA 2G4IA 4U2AA 4LA2A 4AQSA 1JOPA 3O5SA 5C5TA 5C71A 3GCWA 3B93A 1GP5A 2B45X 5I8TA 2ZHLA 4ISRA 5JXGA 2VZPA 4JRAA 1H1AA 2VOVA 3AC0A 3GDBA 2GH2A 4AI3A 4UT5A 3ZPYA 4LBNA 4ES9A 1ACCA 2RR13 4CUGA 2VNOA 2WDBA 3AYDA 1W03A 4DIQA 1MS8A 5JSPA 4RS5A 3ZYJB 5DZFA 4M4RA 4IEPA 3M2MA 5FZBA 5LRRA 5FMOL 2ZX2A 2GNBA 2XJUA 1YC61 3K3OA 4YM0A 5IVEA 1FATA 1XU1A 3LOIA 1DGWA 1LHWA 3VKLA 5HCBA 4E2SA 1COV1 1WKYA 5DDJ3 1XE8A 4KI5M 2YY1A 4AHZA 2WS93 1SBFA 4EE2A 1TNRA 4O9EA 3VDDB 4AQTA 2GSYA 1JU3A 1PVC3 1HJFA 2ATFA 2VTFA 4RFRB 3B02A 4X8PA 3C8XA 2YG0A 2E7AA 2R042 1AL0G 2B9UA 3FBMA 5D8AB 2DURA 5LATA 2OS2A 2X09A 4XBNA 2VW0A 3M3IA 1NLQA 1BXHA 3IM0A 1G6NA 4P9JA 3OOXA 3J7MA 2FCUA 1AJOA 5HXMA 1YYNA 3WVJA 3O1UA 2Z2SB 4YZ4A 4B1MA 5J37A 2DTYA 1OURA 1W9FA 3J7HA 4FVVA 4D7YA 2FDGA 4ONUA 3KVAA 4CPBA 4FPHA 1O6UA 4DUWA 1C8NA 4PDWA 3M3OA 1K5MB 3MICA 4FFFA 1DG6A 1W0PA 1LB2A 1ASJ1 2Y34A 1IQDC 1IS6A 3I8TA 4QQOA 4URTA 1JZ5A 2WNUB 1PX4A 2C9AA 2ZHNA 3AJYA 2GC1A 3SH4A 4DZGA 1R1A1 1RUC1 3T1MA 1GQGA 5AFEA 1OFSA 1DLCA 1XNTA 2BGCA 1VE0A 5FZOA 3V0BB 3V0AA 1CPNA 4N53B 3UESA 1JUIA 4JTOA 5FWEA 1EPWA 2WO7A 3WX5A 5C8CA 1FI2A 1GZWB 4KWUA 3FLRA 4BXSV 4HKWA 1DGWX 4KG8A 3ZSMA 3S7IA 2LROA 5CFCC 3IPVA 2WZR2 3H3ZA 3PJQA 4LE3A 4D6QA 1RMU3 2DBNA 2WN2A 4GKYA 2H0VA 2YGLA 3ZSJA 2JDNA 3EB7A 3B5LB 1OA4A 3O12A 2QQJA 4HFSA 4LEJA 4YVWA 5CB7A 5JXHA 5E6HA 5FBZA 2D40A 3T4HB 1HW5A 3NO8A 2JDAA 1QH7A 1QJU3 2J1TA 2JE8A 4IW3A 4XBQA 5EYYA 3JCIA 3N9PA 1FPN3 5EXOA 3N9OA 4CDQA 4WBBA 4XFHA 1LOFC 1P8JA 2CGOA 2QQKA 1CD3G 1J1TA 1QJX3 5T50A 2Q1FA 3KD4A 4AEDC 2PHUA 1HB2A 2VZSA 3ACHA 3TYJA 1RMU1 2ORXA 4FP2A 4JHTA 4XUOA 5TSWA 3SITA 4PJYA 1AYN1 2IC1A 4JRLA 3ZSLA 3QOPA 4MVTA 2J1UA 1J59A 4R9BA 1IKQA 2XXZA 3WF3A 1ZYBA 1GQPA 4PLOA 4Q4X2 3RZMA 3VDCA 4ZS2A 1PMIA 3POFA 4I3PA 2VG9A 4HT1T 3H9AA 5FZLA 3SLIA 4IQPA 5FO7B 3NAPA 4GMP0 5CNAA 1JYIA 1RUOA 2OA2A 3ZXAC 4Z1VA 5J1XA 4H14A 2IXCA 2A71A 1GKBA 3DEMA 2R49A 3NNMA 2RJ2A 2WZR1 4CDWB 1HRI3 5JPMB 1SMVA 3EMRA 3OUHA 2UURA 4QT6A 3AZVA 4TN7A 4URAA 5F7UA 1W8ZA 4CDQC 4A6SA 5FXXA 2ZX3A 5K7PA 5FZOB 3V0BA 2JJ6A 1SLTA 1UZWA 2DU0A 2O0OA 4CDXC 1UNBA 3KF3A 4COYA 5IVBA 2DU1A 3ZFEC 4Q4V3 1U12A 1EPZA 4RR3B 4YPJA 5GKAC 1BMV1 2QQPA 3IT8A 3VBFB 2DTWA 4O61A 4DY5A 3B69A 2HWD2 1WD4A 2VUJA 5LW9A 2WZ8A 4Y5Z0 4CDXB 2ERFA 4OLLA 2JIJA 1TMF3 1HJGA 4BQ4A 1NCRB 1VAMA 1QOSA 3R05A 3RVHA 4YVWB 5BY5A 2YC4A 2DUOA 1ZRRA 3MF9A 4BLJA 4GB32 3T09A 4GMP1 5IUQA 1JTZX 1CAXA 3TN91 4PLMA 1BHGA 3RZJA 1PM4A 4XFBA 1AR82 2X05A 2YU2A 4Y4RA 5JR2A 3PMSA 1RUI1 4PIXA 3W58A 5AVPA 5IWFA 1O4YA 2RHPA 1F2NA 4ZPIA 3ZDSA 3ZXDA 1C1FA 2HWB3 5FXWA 4Q4Y3 2B8MA 2WNEA 4FP3A 2XH6A 3L2HA 3FN9A 3HIFA 1KD7A 4ZHNA 4OHYA 1GQHA 2HYXA 1H9PA 1V6KA 5KHKA 4YGEA 1KRIA 1CZTA 5KXDA 2WKKA 4S2DA 1RUE3 1YFXA 1WMDA 1GBGA 4HSJA 3SHRA 2IZWA 1DIWA 1XNKA 3ZDVA 2CAUA 3EO6A 3RPQA 3POWA 2XR4A 4OYUA 3U4SA 4QB2A 2D97A 2NMNA 1RUF3 3T2QA 4YW7A 4W50A 1MEC3 4PQQA 5H9QA 2EXJA 3PMEA 5A3TA 1OUSA 2RMU1 2MEV2 4P9IA 4QX2A 3ZIWA 5CIRA 1AHSA 4OHVA 2RM21 3MPBA 2K9ZA 5GLVA 3RGBA 3ZM8A 1FNYA 4XZPA 3ZYRA 4AEMA 3OJBA 3H50A 1SCRA 4CUBA 2ZKLA 4PIZA 1VBB3 2Q0AA 1HRI1 1ZVFA 2HKXA 3ZLIA 1UXXX 2V72A 4RGGA 2QE3A 5DZGA 5H9SA 1O8PA 4NWVA 1FOD2 5A7WB 1IKPA 4AVSA 5IVJA 2ZGNA 5CG9A 1A8MA 2BWCA 2ZKNA 4EWAA 3I3QA 1ULDA 4YW5A 3WQ0A 3BIWE 1UW8A 2ID4A 5FZCA 3RWKX 4NVPA 1A34A 5D2AA 1NCQC 2HWF2 4JCKA 1JYWA 1AYN3 2OIIA 2WS92 5C4WB 3BOPA 2NN8A 2GNTA 1X9TA 3MW4A 1CAUA 2VM9A 1B35A 1V6LA 3E5QA 3S0MA 3AKPA 2WT0A 1MZFA 1RUH2 2NYYA 4XQWA 1ND2A 3Q8FA 4YW1A 2BBVA 4L97A 4DY3A 3INAA 1IZ3A 4W6WA 4YGDA 4YVSA 3I2IA 4AI9A 2FCTA 1IPKA 2YHJA 5T5PA 2ET7A 1PGW1 4FPOB 4DEQA 1Y9QA 4COVA 5JDBA 1FMD1 1CX4A 1BMV2 1JZ7A 2HWE2 2YC2A 1XJAA 1I3HA 1AR93 4IXLA 5I0SA 4YZ2A 2NQYA 2UYAA 5BNNA 2B39A 1RJ7A 2ZMLA 2ZMNA 1QJEA 2VZ3A 5F6KA 5GZEA 3RMXA 1UPIA 4Z92B 1JYXA 4K1ZA 4GB31 4QGMA 2D7FA 1Q8QA 3PHMA 4AQ2A 2WFPA 3M3CA 1BCXA 1OLRA 1ENRA 2XONA 2VH9A 4I01A 4K3UA 4AGGA 4CCNA 2WLPA 5ERLA 1UMIA 4OI4A 1RUJ2 1OBNA 1EUUA 1QGLA 3GALA 4P9WA 1O3RA 2XLGA 3WNXA 2ES3A 2JDYA 5FXZA 3K3NA 2VW2A 1AZDA 1W05A 2HWE1 1Z7S1 2BQPA 4YW3A 3FHAA 1BEV1 4BLIA 4BQ1A 3HQUA 1H4GA 1RINA 2BVVA 4P9LA 4XXAA 5J09A 3MIBA 1XSRA 1OMIA 3LWCA 2FHRA 3ATGA 1H8TB 1R1A3 1RUC3 1SCSA 1KS5A 1ZREA 2VUAA 2ETEA 3N7LA 5FPVA 4IEYA 5LA2A 4CVUA 2FQPA 3WNKA 3PIGA 4XJZA 2VOKA 4B4RA 1MACA 4Q0VA 3RJRA 1N1SA 1JYVA 3ZYPA 2HLEA 2RDRA 5C3QA 4J1WA 5FTTC 2JDKA 4M00A 2ZEYA 5FZIA 5ANNA 2QUOA 1A8DA 3HWJA 5FYUA 4IEXA 4OHWA 1DYOA 3TWIA 4EZ4A 4JVAA 5C9AA 2VVDA 4CCOA 2VU9A 4P5YA 4RGAA 3NNJA 1FOD1 1UU4A 4QPIC 3LEMA 4JV4A 3KGLA 2QBXA 2WFF3 1FPN2 3SMHA 1NYWA 3OBTA 1Z78A 4U36A 2PYTA 4E27A 2VMFA 4IV3A 4RHV3 2RV9A 1UYZA 3HT1A 1QJY2 1ULGA 4BIOA 4F83A 4M0HA 5I0RA 1O3SA 4XDQA 1QXJA 3WD5A 1ZX5A 4MGZE 2H6CA 2MPFA 3QH6A 1APNA 3LDBA 3LFIA 4XJ8A 3I54A 2BZDA 4RQPC 3I3EA 3WF2A 3NNGA 4WVZA 1OQEA 4MUVA 4BCUA 1NY72 1IPJA 4FFGA 2IVJA 2VZUA 3BU7A 4V2VA 1PIV2 3NW4A 1UIKA 1VMJA 1Y9GA 5IHRA 5L73A 5FJHA 3WHTA 3PDQA 3X29B 5GZFA 1Q8VA 3DXTA 1HQNA 1Y4WA 3E6DA 4C0HA 4Y26A 5FZ0A 1HRI2 1UL9A 4MX3A 3VD3A 1DP0A 2DVAA 3TNQA 5FCCA 4X6RB 1T2XA 1O5LA 3RRDA 2ZGQA 3VZLA 4E4HA 4AK3A 1SPPB 4MGQA 3ME2A 2FD8A 5F3IA 4JDOA 2OQ6A 2C1FA 1WCDJ 3USUB 4FAGA 3HN3A 2A6ZA 1G9DA 3GXUA 3I7DA 1WW6A 2V09A 4WM8C 3VBOC 3AKQA 4N43B 4Q4V2 4EROA 2VZ1A 2P17A 4FPKA 4AFMA 3QBQA 1HV1A 5FPBA 2CGPA 2XJVA 1V6MA 4Q26A 4LO7A 2VCBA 1VAVA 2WA3A 2YROA 4XUQA 5C3SA 4W65A 3ILNA 1LTEA 4BZ4A 1TMF2 5D1IA 5J36A 2YBKA 1LGCA 3T2PA 1RUH1 1I1EA 1WLCA 2VOWA 3EJKA 4CA9A 5A7NA 4AVCA 2XVLA 5GALA 4K8FA 1BYHA 4ZKTB 4XMAA 4DB5A 1V00A 5GLZA 1VB2A 4WVVA 4BM8A 3N7JA 4BQYA 5JSRA 1V6JA 1W8FA 3POSA 3G7DA 2BBAA 1CJDA 2RMU2 4KMQA 3THCA 4AFBA 3MW3A 1MS4A 2A3YA 4XUNA 3E97A 3H7JA 3PL0A 4HL0A 4IGPA 5E1RA 1Q8OA 1J3QA 1OOPB 5IK7A 1MQTC 1IPSA 2XUEA 4CCDA 1C8M2 5EQUA 2WO1A 3KLSA 3MIDA 3AKSA 3U11A 3IB3A 2OZJA 3VBOA 5JI9A 3POGA 5J48A 2DUPA 3ORJA 1GNYA 3AMHA 3I2HA 5C9AB 2Y0OA 5A3LA 2FCVA 1UOGA 4AXOA 5CADA 3ILFA 3JBG1 1RUE2 3J4UH 1CIWA 3ZKYA 2XL7A 3OTFA 2JKBA 3OD4A 3ZVXA 1RXFA 4AHWA 4ZXEA 3AZXA 4CDUC 3VBFC 2FDJA 2D43A 3D0SA 4QPGB 1RUF2 2HEVF 1FV2A 2I45A 4YGCA 3AZYA 2HWC2 5FUNA 3GJBA 5KXCA 1CN1A 2E32A 4ARYA 1NLRA 4O7XA 4NR1A 1DQ4A 4NHLA 3HAGA 2D5FA 3VZKA 1REEA 4P9XA 3UL2A 1WA4A 1ZZ7A 3DN7A 3HQRA 3RYKA 2P5BA 1GNZA 1QJY1 3EHKA 3USUA 3WR0A 4ZY9A 4D3WA 1XNDA 2P3YA 2W2IA 3IAPA 4QQPA 3M7AA 1UN1A 1VBB2 4HN0A 3B00A 4I2OA 3OYWA 4JQTA 1WD3A 1NA1C 3A22A 4G3YC 3C2UA 3O1MA 2D6KA 3ZO0B 2VGDA 1RUG2 4OFGA 1COV2 1N1YA 2UYBA 4EJRA 2WABA 1V9U1 3FBYA 3VBHB 5BUVA 5IATA 2JG9A 3KV9A 4CCMA 1HV0A 2D5HA 2IXHA 2ZGKA 3WG3A 1C1LA 4WVWA 5IAXA 5EWSA 1F5FA 1V6IA 2CHHA 2WAOA 1TG7A 4IEVA 3U75A 4BQ5A 1AYN2 3BTXA 1SHWB 3DPRC 4Y1XA 3RZKA 4NOTA 4QPIB 4H55A 5FY5A 4LO5B 3ZYBA 2EALA 3K2OA 1LENA 4OHXA 1RUH3 1W3VA 2C4XA 2BNNA 1RGSA 5E16A 3E5UA 4KH9A 4RA0A 2RS31 5ABJA 1W04A 1OHFA 3FHQA 4LULA 3LIGA 2VMCA 5FY0A 4ES8A 2LTNA 3PU8A 4RR3A 2JIGA 3HNMA 3LFMA 4NIIA 2BP6A 1W3XA 2FMDA 4DPNA 2R0HA 4QQ2A 4ET7A 2HEYF 5LY2A 3CU7A 1SBDA 5BNOA 3UT0A 3KV4A 2W91A 3A7QA 1OKOA 2VMIA 3MLLA 1D7PM 2Y60A 1IOAA 4HETA 4ITCA 3WW2A 2LM3A 4QGLA 4DEVA 2WWUA 1RUJ3 4XHBA 2Y33A 3BTAA 5DABA 5DUUA 4JAAA 2VAUA 4MXWA 2CWMA 2MEV1 2WL1A 4WM7B 5FZ4A 5FRAA 3CZUA 4XF9A 4YZ1A 4QHBA 5A7QA 2CDOA 5C5UA 4BB3A 3DYPA 4S2HA 5FPAA 2UWCA 3BI3A 1AUYA 1TVGA 2BWAA 2R072 3ELNA 1R081 3PU3A 1ZRIA 2ZGOA 4COUA 1DZRA 4CEWB 2B5HA 1V70A 1WMFA 4JGYC 2ZEXA 1L7LA 1SLIA 4AI0A 1X7NA 1GV9A 4DUXA 2PXJA 3AMNA 2VR4A 2R041 1RUI3 1HN0A 5FUIA 1PMHX 1JZ2A 4YZ5A 3T2TA 5I91A 5FREA 3VBRA 3VB9A 1GP4A 1H6XA 3MO4A 4IE4A 4OVEA 5D21A 3AVSA 4CU6A 4CEYA 3LIHA 3VBHA 4A2UA 2W39A 1CZVA 2ARXA 1HQWA 3MUZ1 4MGKE 4QM8A 2D3SA 2XWBB 3DKWA 1PIV1 2FDHA 2XBO2 3V56A 4XVHA 1WCQA 1JZ6A 4K9SA 3RJ2X 1JYNA 2CDPA 3DCQA 1UOBA 4FFHA 3VD5A 4LORA 3CMGA 3E6CC 1Q5OA 4L8QA 3VKNA 1S0CA 4UFHA 3WSOA 4DOUA 5IT6A 4F8AA 2GAUA 3R0RA 5IVCA 3O1PA 1W6QB 1CZSA 4GJYA 1ZZCA 4Y4YA 2C9KA 2WFF2 1VLNA 3LEIA 5EIYB 3ZPOA 1W6OA 4Y3OA 4UAPA 4CDUA 3TN92 2Q8CA 4Y5TA 1GOHA 5L9RA 4M3CB 1WLDA 3ES4A 1K5MA 1NE6A 1QQP2 4EN0A 3A23A 3W5MA 4AHYA 4UXAA 5I93A 5BNPB 2WZPP 1JW6A 2D93A 3WNPA 3D4KA 2BOJA 2R30A 2GC2A 5A7WA 4MV2A 4P5HA 4OUEA 2HBTA 1J3RA 1UY1A 2PLV3 1CR7A 3OG2A 3M8LA 2DDUA 4Y20B 2CGNA 3F95A 2BNOA 4COZA 2E51A 4XAAA 2XG3A 4KL1A 4IDZA 2V5DA 3RQ0A 4NPRA 1HRV3 3CEWA 5J98B 3TAYA 3IBMA 1KDKA 2OUJA 2BNMA 3PURA 5H9RA 4CDQB 2A1XA 2GMMA 3S5AA 2W94A 1RXGA 1JS9A 3GYDA 1QIQA 4IV1A 1QOOA 1XRUA 4HK8A 4CDWC 4A4AA 2XPJA 4GIQA 4AEDA 3IWZA 4LHLA 1K3IA 4QD2A 1OVPA 5FV3A 1SQ4A 3NJXA 5BNOB 2XJPA 4FOQA 5F32A 3T0DA 2W08A 4LQRA 3FJSA 2CSGA 5LASA 1MS5A 4NRMA 4XE9A 3LA3A 2QQOA 1G86A 4AYUA 5A80A 3ZN6B 4XCAA 1HX6A 3OF1A 1HLCA 2GNDA 5HCFA 1OQ1A 2VVEA 1AR61 2DVFA 1NA1A 1FX5A 1OI6A 5LA1A 1RC6A 3GNEA 2JB8A 4CE8A 3RZLA 1QU0A 4AFDA 4XURA 1ND2C 1PM7A 3CJXA 3J7LA 2X5IA 4UFKA 4K7JA 2W1QA 1X8MA 2X5IC 3MPPG 3I2FA 4BIFA 5BV6A 4FO9A 2DFCA 2DWRA 3AX4A 4NE9A 4LKDA 3HNBM 2HWD1 4GD4A 4UI9L 1DF0A 4QX1A 5JSOA 4GXLA 1AR91 4P02B 1DQ5A 3B9IA 5C3PA 2NZ9A 4B4QA 1GZTA 2WBKA 2ZZJA 5FZ7A 3MLJA 5FYYA 4TTGA 5JR7B 2ZEZA 2AEYA 4ARXA 4N9HA 5FP7A 4ZXKA 2Y6LA 3GZEA 4XFCA 4YGBA 2IXKA 3T4VA 2BRTA 2V4VA 2XOMA 4XQDA 3I2DA 1QXRA 1POV0 3D3AA 1QNYA 4PLNA 4FT8A 3WQ1A 3WUDA 4CDWA 5HV0A 4FXKB 4OMCA 5JI7A 3WZ1A 1CAWA 1ASJ3 4IEUA 3BU0A 4L11A 3JD71 1GZCA 1GMMA 4XZUG 3AP7A 5DG2A 3PIJA 1GFF2 2AGSA 4XMIA 5IVVA 5KWRA 1FNZA 5SV8A 1JHJA 4HSLA 3EQEA 3OY8A 2XLFA 1MQTA 5LRSA 2HWC3 4NPMA 5C9AC 5JXIA 3DPRB 5KBFA 1VBE3 4IV1B 4LBJA 4BWOA 5B2GB 2Q8EA 1C4RA 2BDRA 4RN5A 4CU9A 2VO5A 1WW5A 4EQVA 2ZS6B 1IGOA 5F3GA 3UKTA 4P9GA 5LA9A 1ND3C 1OOPC 2V4AA 4LLFA 1ZA4A 5APAA 3S7EA 3NVCA 1W9SA 3DECA 3GGLA 3FFZA 3PTYA 4Y20A 1VBA3 1W9WA 4RD7A 1CAXB 1U5XA 2W92A 5A3PA 5CA6A 3VN4A 1O8SA 3SCHA 2TEPA 4NHMA 4XOGA 3ABZA 2RR12 3ITQA 1LOFA 2VQUA 5FK7A 4HPKA 3I49A 2DVBA 1OD3A 1GNHA 4HMZA 5JLVA 3M1HA 5FQ0B 2WWSA 2JG9C 3ST7A 3S30A 4FQZA 4LMFA 1COV3 4YWAA 1NXMA 2OPKA 2OQ7A 3UGFA 2A6XA 1F5JA 2QZ3A 5JOYA 3T08A 5KC5A 4NIDA 3I2JA 3VKMA 3FZ3A 1PX3A 5D8AC 5E89A 4ASMB 2BUKA 2QNKA 5GM0A 2G19A 4YVWC 4QKFA 1ZZBA 3AYCA 3H8UA 2GC0A 2XMLA 4LITA 2RR11 4S2FA 5HXVA 2GNMA 4BPZA 2Y6JA 4AAPA 2WYFA 1SPPA 2R043 4FTBA 4NMIA 4CUCA 3ZR6A 3KQ4B 2RS53 2JDMA 1WBLA 2JD4A 2ARCA 5F5AA 3VBUA 5JCTA 2BFUS 5C8CC 2BGOA 2Z69A 4NHXA 5T52A 4DMIA 4HN1A 1AR62 2DFBA 5A3MA 3BALA 3WNLA 4S2GA 2G9ZA 1TME1 1JOJA 4MGTA 4MHRA 3V0AB 5HCHA 1OPOA 3W20A 3Q8CA 4QKDA 1PK6B 5C70A 4ZU7A 3JB8A 4W4ZA 1RUJ1 2WINB 1IS5A 2ZJCA 4K20A 3O14A 5C4WA 2WQ8A 3THDA 1MQTB 1MS3A 3M3EA 4AR2A 1NUKA 4BDVB 1M4WA 1U5IA 2VQAA 3H42B 1NLSA 1Z0HA 5I0DA 1W99A 5JVVA 3THPA 1VBD2 1X36A 3I59B 1LHVA 3KB5A 1ZRFA 1WA6X 2ZHMA 2ZGUA 2PMWB 2ZGMA 1NZIA 4I09A 4EN6B 1XPWA 1A3KA 1OA3A 2XKPA 5A3OA 2VZOA 3UV9A 2R073 4XABA 4OI1A 1UF2C 1REFA 3FLPA 1UU5A 2HEWF 2Y64A 3WT3A 3BYWA 1OH4A 2IFWA 2XLAA 5F3EA 2PA7A 2ZX4A 4Y24A 4ZONA 1RUI2 3I3DA 3NMBA 4UWDA 5A6XA 1S55A 2WZR3 4CP9A 1VBD1 3K48A 4EN8B 3KGZA 2EIDA 2NLRA 3CHXA 1A78A 2B9VA 4WM8B 1I9RA 2GP3A 4D69A 5FY7A 1JN2P 5C33A 5CFDA 3APBA 2DCYA 2V5YA 2PQSA 1YQCA 2CU5A 2XBO3 3AK0A 5K0UC 1TEIA 2D98A 1TZOA 5FFOC 1NQDA 4A3ZA 3P6BA 1V9U3 1VMFA 3HVDA 2R32A 1FPN1 3ZYFA 1G7YA 4CPBD 4MYEA 4V2WA 3T0AA 4BISA 4LLOA 1DQ6A 2XHNA 3OPWA 4KGGA 1SG3A 1O3TA 3K4ZA 2WQ4A 1BBT1 4CZSA 1KFUL 3LE0A 4OZXA 1XYNA 2DV9A 1ULCA 3KCCA 4XUPA 5L7OB 4E8CA 2D6OX
chains in the Genus database with same CATH topology
1CQ9A 2RS13 3WP3A 4B7KA 2RJKA 3RYPA 1DFQA 2WQZC 4RQPB 3N36A 2FMYA 1L3JA 1QDCA 5CFCA 4HBNA 4DRRA 3WG4A 4XW3A 1H30A 3ZMNA 1FYUA 2DYCA 1MS1A 3WLUA 4NWWA 4KBBA 1UPSA 2N7GA 4H7LA 4ORFA 4Q4X3 1YIFA 1DHKB 4LO4B 4LUKA 1V6NA 2P3JA 2X53S 4OI2A 3AP9A 4QQLA 4R8HA 4Y1ZA 3SCGA 1JXNA 4Q8LA 2RJLA 1EAH1 4Q1RA 4AVVA 1NCRA 1QNWA 2IXIA 1OQDA 4OUSA 5GZDA 3OD0A 4YZ3A 4LT5A 3MIGA 4L2NA 1HDKA 2WLQA 1ZBE3 2KA3A 4J1XA 3LGRA 1ULEA 1RVF2 3VBSC 4UBHA 3IPVB 3ZFFC 1YI7A 3CO2A 3CJIB 4UW5A 3MZHA 4AEKA 2JENA 2Z79A 4OI0A 1YRZA 3AXDA 1LGBA 4GH4C 3W59A 1LULA 3HMYA 2Y0IA 1W39A 2ZZQA 4XQ4A 3WP5A 1W6NB 3A4UA 2OW4A 1ENSA 2D6PA 1S2KA 4R52A 2P2KA 5DDJ1 2ZBJA 3T1MA 1RHI1 2JECA 1CAVA 1RUF1 4Q4Y2 2KM2A 1BK1A 2UY9A 5FO8B 5J96B 5EYXA 4AEJA 3MYXA 1H8VA 4GH4B 3PNAA 3NV2A 2CTVA 5DXDA 3GZUC 3O7OA 4HVRA 3J9SA 1N3OA 3VBSB 1KDMA 4AF9A 1EP0A 3NKTA 5HCAA 3VHPA 4CP2A 1HXS2 3LSDA 1H9WA 3ZX7A 3B01A 1Z7S2 1TME2 3L2YA 4XFGA 2MEV3 4E2QA 4B8EA 1LHOA 1S0IA 2Q1ZB 2XGXA 3WP6A 1VIWB 3BB6A 5LK5A 4I0BA 2E7TA 2F4PA 2JG8A 5T55A 1N1TA 4Y1YA 1VBA2 1OPMA 1CVNA 2K2SA 1ALYA 5BNPA 4PDWC 1G9BA 2PHTA 4QU2A 2JICA 1X50A 1FOD3 3JQXA 4IETA 1SFYA 1WLTA 4NO4A 2H0BA 3NV4A 3NV1A 1VRH1 2ZACA 3UKNA 1BEV3 4DINB 3IN9A 1NOVA 3JD73 3CJIA 3RMYA 2AENA 3CNAA 2I74A 4BE3A 4HKOA 5GLWA 5E88A 1NXD1 2DCKA 2CAVA 4Q0PA 3D0JA 3IMNA 5JOWA 5E8AA 1E57A 1QXPA 2RS52 2C5DA 1YCIA 1ND3A 3OYWB 1WBFA 3P3NA 2ZAAA 5CBLA 4PCRA 3VDDA 4WVMB 4BHPA 4GH4A 4FSJA 2BEOA 1OFNA 1SEFA 5JZGB 2TNFA 4LBOA 2HWE3 1YIPA 2JG9B 2YXSA 4B29A 1AR92 1FMD3 2DF7A 1MVQA 4A3XA 4LTAA 3DF0A 4I30A 2GN3A 2WT1A 1ZZ9A 3CLPA 1DGLA 4GQ7A 1WCKA 2RS11 1DQ0A 2A6WA 4Q4W3 2QDNA 2FZ1A 3VV1A 1MR5A 3U4XA 5C4WC 4JGYB 3PVNA 5GZGA 1QH6A 3RNSA 5JMCA 5KHJA 2F6BA 4C1XA 2WC2A 3B9CA 4XHXA 1HXS1 1AYM3 1BZWA 3AMPA 4K40A 2PHXA 1VBC3 2Q4SA 2XBO1 4LO8A 4YVSC 5J7MA 2WNVA 1S1AA 1YJLA 2QFEA 1LEMA 2HJIA 2WSVA 3ECQA 4P9YA 4YM1A 2BFUL 3RWNA 1XYOA 2ZX1A 3RI9A 2JDZA 3SH3A 4PF5A 3H1WA 1S0JA 5ABJB 1RL3A 1HQLA 1W6PB 1OSGA 4EN9B 4QMAA 5DG1A 4J6GA 1AL22 1JBCA 1MEC1 2ZGPA 3R4UA 3AMQA 1PGW2 2ZGLA 1W0OA 4G9SB 3K51A 3B94A 1KS4A 1AR72 1HIXA 2RS12 4KWLA 1JYCA 3MI8A 4SLIA 1X33A 3ACLA 1N3PA 3QD6A 3LA2A 4EWEA 1RUE1 3WG2A 1DU3D 2EXKA 1VP6A 4QPYA 3RZZA 5KC6A 4MZUA 1SLBA 1RJ8A 2PAKA 4M01A 3T1LA 3WW4A 3D82A 1NG0A 2RS32 1AYM1 1PIV3 1RITA 2UU8A 1W6QA 1J3PA 4XBLA 5JOXA 2ZOEB 1UAIA 1RUG1 5L36A 1KQRA 3IDBB 4JGZA 3VBRB 4Q8KA 1O7FA 2OUHA 1PO23 4FXGB 2D6LX 2A6VA 5FMOS 1G9FA 2YPJA 5AVAA 2PTMA 4KGQA 3WDUA 4DQAA 1H8TA 2R063 1N1VA 1D2QA 3ASIA 5A32B 1NCRC 5T54A 5BNQA 4N7IA 2E53A 2CV6A 4Q4Y1 1G9AA 3AM2A 1R083 2HWB1 1AVBA 1RHI3 1BBT3 1A6CA 3AFKA 1LHNA 1H2MA 2GC3A 4RS5C 3AP5A 4BMBA 4CDUB 3AZZA 5H9PA 1H1MA 5KHGA 2XJRA 1D4VB 1VBA1 2O8OA 1Q3EA 3RSJA 2OZ6A 3V64A 5K9YA 4PBOA 1O3QA 1UCXA 1DDLA 4MSVA 3ENRA 3I59A 5AC92 3JBG2 3WCSA 4UBGA 5I0UA 1LGNA 3WUCA 1DGRA 4CP0A 4YLZA 4HK9A 5IK5A 1VRH3 2NMOA 1YLLA 2XB6C 4XJAA 1ULFA 4W6XA 1MZ5A 1C8M3 1R092 4LBMA 1ZBE1 3RG0A 4E4ZA 3FUQA 1DZTA 2ZCWA 1GICA 1OKQA 5JAXA 2NM1A 2ZPXA 4KWJA 3HBZA 5AC91 5L19A 1PHMA 1EAH3 4R9AA 4Q29A 1EY2A 4AI2A 2Q8OA 3NJZA 1ZZ8A 1WCSA 2UY8A 3JB4C 5BNOC 1MS9A 4JGZB 4QX5A 1MVEA 4AI8A 1AL21 3GBWA 1FXZA 1D2SA 1TME3 1Z7S3 3FC0A 3GHMA 3H1YA 3SISA 2X29A 3VDDC 2D3RA 4K6BA 3KZ4C 2DCTA 3FHIB 1D4M1 5CFDC 2I07B 2XKOA 4HZFA 4ZU5A 5L7OA 1C5IA 4ISQA 4AFCA 2RS51 1Q56A 3WDTA 2A73B 2R061 4WZFA 1CAWB 2YV8A 5CFCB 2YZ4A 1YFYA 1PO21 2G9GA 4NN0A 4N53A 1AXYA 4PBPA 5DZEA 1QJU1 3WP4A 3U10A 1RUG3 1SFNA 4KWKA 3OY8B 4W6YA 3VKFC 4Z2WA 2R16A 4M3CE 4R4ZA 5F1RA 2SBAA 5LEJA 3VHNA 3PVOA 2XWJB 3ZMOA 4YG0A 1ND2B 1PVXA 4KQ7A 4G4FA 4MH0E 1S0EA 4LBQA 2R1DA 4BOWA 4FCAA 1ONAA 5KXBA 3UKVA 1Y7BA 2OYZA 1KXGA 1FAYA 2WSUA 1QQP1 2VECA 4BH9A 2DUQA 5CVRA 1BVP1 2GMPA 1DLLA 2Q5TA 1DQ2A 1VR3A 2A6YA 4AW7A 1XNCA 1U0AA 1WW4A 4AGRA 1H4HA 1UZYA 4LUMA 1N3QA 4LNVA 1VBE1 2V73A 1FMD2 4I0AA 4CEWA 3DL3A 2Z5WA 2HWC1 4FOWA 4PIYA 1TE1B 4M3CF 4EWDA 4X8NA 1RVF1 4DFSA 2ENRA 5IK8A 1D0HA 1TQ5A 5DUXA 5I8YA 3IDCB 3MFCA 1GR3A 4OULA 4IEQA 4DXZA 1O5UA 1O4TA 1IS4A 3B7MA 3M70A 2DCJA 2GU9A 1AYM2 3AKRA 3KMHA 5CU1A 3VHOA 1PZ9A 3DGTA 3FMGA 5K0UA 2YDEA 2R6QA 4IEZA 2EAAA 3ZYGA 4E2GA 2JXAA 4BYYA 1RMU2 2W68A 2CWSA 3WDYA 3CJIC 2WJSA 3O0XA 4YFZA 2PFWA 5I8SA 2WNUA 1N47A 1UKGA 2X8KA 3N7MA 3M3QA 4D7TA 4FPJA 3WDVA 1H2NA 4DS0A 3HD8B 2GN7A 3SXWA 2ZHKA 1MZEA 3AMMA 3ZFFA 2A5ZA 2PAEA 3O0WA 1EV12 1ZBA1 1AL23 4AWDA 2QZ2A 5JIAA 3I4IA 1POV3 3TN93 2BTVC 4A7YA 3GF6A 1AR73 1QJX2 4FQ4A 5FDBA 1V6OA 2GALA 3VBHC 2E6VA 1FT9A 1LEDA 4AEDB 2PAMA 2D6MA 1GANA 2GMEA 2GDFA 4XILA 1KJRA 1ZM1A 2PHRA 3ROUA 4IV3B 4LBQB 3PJYA 4Q4V1 4NHKA 3ZXGA 2FZ2A 2VVFA 1R091 2Q1MA 2RS33 3ZFGC 5GJ6A 2VXRA 1PK6C 4GA9A 4MXWB 3GHNA 1GSLA 2PLV1 3RYRA 2K0GA 3AP6A 3BODA 4K21A 3W9AA 4Y22B 4L99A 1PO22 4HANA 4FPEA 3OPZA 3LKJA 1S0GA 1YO8A 5T5LA 5K0UB 3ALQA 2D44A 4IESA 4XFIA 2XUMA 5BXXA 3WV6A 2AYHA 1LESA 3VGIA 5JZGA 1GLHA 4YM2A 3R4DB 2XJQA 4M0NA 2HWD3 2CY6A 4WZCA 3HQXA 3KT1A 2YC0A 4XF4A 1RB8G 1LR5A 1QJX1 4MXVA 3WG1A 4GB33 1LOEA 1QF3A 1S0BA 4LA3A 1OOPA 5CAZA 1LOAA 1OLQA 3POYA 1K5MC 1H0BA 1QDOA 2SLIA 1AR83 3LCPA 3GZTB 1Y3TA 4AG4A 1VALA 3USSA 4YM3A 2EA7A 3WY6A 2BYVE 5FLJA 4PQ9A 1IS3A 4Z8BA 2CNAA 2UWBA 2AREA 1H1IA 2B46X 2WNVB 3HT2A 4FPGA 4KG0A 4FPLA 1B35B 3C3VA 2P3KA 1YUDA 3GBFA 3MF6A 5JZGC 4GULA 3VZOA 2XJTA 1D0GA 4YARA 4QPGA 1KFXL 4CRQA 3N7KA 4DRVA 5K8SA 4GALA 4XPVA 1CPMA 1HRV1 4N43C 4UW3A 1PZ7A 1G9CA 2E63A 2WA4A 1W6NA 4KU7A 4O9GA 2P37A 4TWTA 3ETQA 3OGGA 3FUOA 4LHNA 2E7QA 1MEC2 3AJZA 4D94A 3LSEA 1VBE2 4A7KA 1LU1A 1VJ2A 3VBUC 2NPIA 5I0TA 1XNBA 3H1MA 2WT2A 4L9BA 3ZXKA 4YW4A 3G6JB 3WQ7A 1W6MB 1NZCA 1JH5A 4CP1A 3ZN6A 3D5OA 4FBFA 4FOYA 3TRSB 5IK4A 3VBRC 4H7MA 1B35C 1LECA 2RM23 2Z42A 1SLCA 2AH2A 5BPXA 1WMEA 3ES1A 4IV3C 5D8AA 1RUD1 3OGJA 3JZVA 1VAKA 2X5IB 1PO12 1X82A 3VZNA 4RFT0 1ZRDA 1CAVB 4Q0QA 1QWRA 1MZ6A 1HKDA 2TUNA 3MFAA 2HWF3 3E6BA 3D8CA 2VULA 3E5XA 1BVVA 4IV1C 1H2KA 1O91A 2QCSB 4HLTA 4FOVA 3UJOA 2E9QA 5FPZA 2BW8A 3SCFA 4MGYE 1J58A 5DUWA 3R4SA 1XYPA 5ACA1 2RE9A 2GZWA 1G8WA 4E4DX 2A70A 4GKXA 3WCRA 1YXWA 1AR63 3H7YA 1RUNA 2DVGA 3WW1A 5ABJC 1ENQA 5C8CB 3THTA 4D7SA 4XJWA 2XJSA 5F9TA 1ENXA 5JPNB 2O1QA 1ZRCA 4R9DA 2YUEA 3GZAA 4AFAA 5FOBB 2YGMA 3DPRA 4RHV1 4CYDA 2QVSB 2LUWA 1S0FA 5FO9B 1XXNA 1VBD3 2D3PA 1O4ZA 2VNGA 3MIFA 1REDA 5KXEA 1DQ1A 1EV11 1ZBA2 5CFDB 5FOJB 5BNNC 2YYOA 4LE4A 5JIUA 3IDEA 2W52A 1MS0A 4QGNA 3WDXA 2YMZA 4AVBA 2R071 1H2LA 4HPKB 3EXUA 4KU8A 1R1A2 1RUC2 1SACA 4JQRA 2VY0A 3NAPB 2EXHA 4XJUA 3KT7A 3VUOA 5FLHA 1RUD2 4N43A 4IEOA 1WGPA 1X8EA 4Q0SA 1W6MA 4IERA 1ND3B 1AR71 3WINE 4JGYA 1W6OB 3JQWA 1NCQA 4WVMA 1YWKA 1V9U2 5FPXA 5JSOA 2Y26A 4IL7A 3NWKA 1PNFA 2D6NA 3LB9A 1PO11 3QACA 2BPA2 1PGL1 1LCLA 3RDIA 3J8F2 1EV13 3O0VA 2TBVA 4K1YA 3ZFEA 1U5YA 1WUVA 3VBFA 5C6CA 3ZIXA 1Y43B 1OD5A 2QDRA 2FBEA 4ASLA 4RL7A 1DYPA 4Q27A 1XQNA 5ACA3 4AHXA 3FLTA 4RHV2 2EXIA 1QJY3 4B3NA 3ZN4A 3J26N 4WM7C 1S2BA 3MEPA 5FAXA 2R0FA 2ZGSA 4AVTA 1DBNA 1XU2A 2DCZA 5L7OC 2IXJA 4RS5B 4I0WB 1W6PA 2O8QA 4FPYA 4RR3C 3BPZA 2G9FA 3P3PA 5GLTA 4AVAA 2ILMA 3MIHA 4JC1A 1R1ZA 3FE5A 5T3NA 1JUHA 4WV8A 1SLLA 4Z82A 4Y1VA 3URFA 4YSFA 2OVUA 3UK9A 1FV3A 4LBLA 1ZBE2 4XTPA 2Q30A 1CJPA 1RVF3 4QQHA 4TSVA 1NY71 1T6GC 1D4M2 2WFF1 3VZMA 1I6XA 1YFUA 4DNYA 2AZ5A 4WM8A 1BQPA 1M06G 2A7AA 5FLIA 1UMZA 3B3QE 4EV0A 1ZZ6A 1URXA 5C8WA 3CF6E 1NCQB 1AX1A 3KSCA 3AKTA 3MGUA 4XXPA 2ZGTA 2JE7A 2IWGB 4L92A 3NKGA 2A3WA 1NA1B 1UKRA 2CYFA 1PNGA 2RMU3 3ZSEA 3J8F1 2VOXA 3VZJA 4E9KA 2QKDA 5A33B 4XJ9A 1SLAA 3N4MA 4FAHA 4AGVA 4XF3A 3TBDA 4QPIA 1DYKA 1OA2A 4XETA 4GWNA 3N3HA 1SDWA 3LZZA 1F8VA 1AXKA 2WIIB 3AXEA 5LEKA 1AR81 4INDA 2Y38A 3AP4A 2JG8B 3LA7A 5J3UA 4QPGC 3ZFEB 3AFGA 5A32A 4I02A 4JGZC 4B4PA 3FFQA 3KCXA 4JDMA 1AJKA 1HXS3 3N35A 4Y1UA 4YVSB 2VQ0A 5JOZA 4JDNA 3ZFFB 2QJVA 3VL9A 2VMGA 3U0ZA 4Z07A 3RS6A 1YHFA 2MNGA 3ZXEA 3V65A 2WNUC 1I5ZA 3WW3A 1TNFA 4WM7A 1PGSA 3MDPA