4BLIA

Galectin-3c in complex with bisamido-thiogalactoside derivate 1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GALECTIN-3
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bliA00
3MPPG 1MZ6A 1YXWA 3M3CA 3N36A 2VH9A 5CB7A 2Z42A 2ZGSA 1SLTA 1I3HA 5H9PA 2GMEA 1WD4A 4Y1VA 1CQ9A 1JBCA 5H9RA 4C1WA 2CYFA 1AXYA 4Y24A 2NP0A 2A6ZA 1S0GA 5L73A 5CBLA 2PHTA 4PBOA 3C2UA 2ZKNA 4XXAA 5T5OA 2ARBA 3MEPA 1LGNA 1AJOA 3NV4A 2I2SA 3AZVA 4WV8A 2LALA 1JW6A 3UJQA 3JU9A 2ZGOA 3A4UA 5T5JA 4WZFA 1AXKA 1QMJA 1LOFC 1IS5A 3N35A 3W58A 1KDKA 3PJQA 1V6MA 3LSDA 4Y1UA 3SNMA 4SLIA 3AP7A 5EWSA 5JOWA 2WJSA 1IKQA 1LOFA 2CNAA 2GALA 3OBTA 3OY8A 3TAYA 2WLQA 4DFSA 1G9DA 5LK5A 1GKBA 4M3CA 4C1XA 4CTEA 2D3RA 4UW5A 4L8QA 3PMEA 3V0AA 2V5YA 2JJ6A 5GZCA 3TB0A 2VUAA 2W08A 4FOYA 5E88A 1G86A 2ZGUA 1KITA 3D6EA 2C5DA 2YV8A 3WCRA 1MZ5A 1F9KA 2PHRA 4P9WA 4NO4A 5CAZA 2AENA 5HCFA 1N1TA 5GJ6A 4GALA 4AYUA 1QU0A 2JE7A 4BLIA 1QDOA 1OQ1A 3ZSMA 3AZZA 4W65A 3HN1A 1DLLA 4FPYA 1DZQA 3O5SA 1KRIA 4XJWA 1QDCA 4LBJA 4PCRA 4YGBA 3SLIA 4FPHA 4FVVA 4XIKA 3WUDA 4XIOA 1ZA4A 3WDXA 1UPSA 1VAVA 4FPOB 1G8WA 5T5LA 1G9CA 4JCKA 2YZ4A 4YZ4A 4YW5A 1AZDA 1IOAA 3KM5A 1LTEA 2EXHA 2DVDA 2FMDA 1YRZA 2HYKA 4YW1A 1DQ4A 5GLZA 1DFQA 4BLJA 1LHOA 2YMZA 4Q27A 4FOQA 1ONAA 1HDKA 1LGBA 1LU1A 1VLNA 1WLWA 3D5OA 1Q8PA 2ENRA 1N1YA 1G9FA 2WKKA 3WHUA 5GZGA 1UKGA 2VXRA 1CN1A 1GYKA 1OFSA 1SLIA 2KM2A 1WD3A 2FHRA 2JECA 2ZHNA 1GZWB 3NV3A 4JRAA 5JLVA 2CY6A 2ZGKA 1UMZA 3RG0A 2VY0A 2GMPA 1Q8QA 1LOCA 3WG3A 1G7YA 1LHWA 1LJ7A 5DXDA 4FPLA 1VALA 3AXDA 1W6NB 1IS3A 2A3WA 1BJQA 1MS5A 1YO8A 5DUWA 1S0CA 2ERFA 1SLCA 2LTNA 5SV8A 3DUIA 1QKQA 1FV2A 2TEPA 4RL7A 3RS6A 3VKOA 3ZYPA 4XJUA 2EAKA 4Q26A 4Q8LA 1WW5A 2D6KA 2DU1A 4ZXKA 4YG3A 1QOSA 4WVVA 3T1MA 1MS3A 4GKXA 3N7KA 3PVOA 4XHBA 4LBNA 5FREA 3ATGA 1QOTA 3WHTA 3VKFC 4M00A 2SLIA 4K1YA 1Q8SA 5T52A 4Y1XA 1N3QA 3UK9A 2UWAA 3POWA 1V6IA 2EF6A 1LULA 5CNAA 2Q5TA 5GZDA 3SH5A 1V6JA 3BODA 2DUPA 3IMNA 3VKLA 2PELA 1ZM1A 2ZZJA 4KBBA 1GBGA 2JE9A 1W6OA 5IT6A 1HQWA 4Q2FA 1RINA 1GSLA 3AZYA 3IN9A 3O0VA 4FPGA 3WDTA 3AP6A 4YGCA 1SCRA 1S0IA 3O0XA 1Q8OA 2GN3A 1PZ8A 5F5QA 3AYDA 1FV3A 1APNA 4Y1ZA 1KJRA 1N1VA 3WOGA 1YYNA 2DU0A 1C1LA 3POSA 3SISA 1EPWA 4XJZA 3ENRA 4XXPA 4YLZA 5KXDA 2E7QA 1N3PA 4WVWA 5JOXA 1FNYA 3POYA 3ZSKA 2D6PA 5KXCA 2ZHKA 4F83A 3USUA 5HCAA 1JN2P 3OJBA 5EYYA 3SH4A 1J1TA 1DIWA 4LBQB 1AVBA 2ZMNA 3AP9A 3V65A 5KXBA 1FAYA 4GA9A 4DPNA 1F31A 3R4SA 1AJKA 1KQRA 3MW4A 3T2TA 2D3PA 1LOEA 1U0AA 4ISQA 4RA0A 3WG4A 2DTWA 1GV9A 1WUVA 5EYXA 1MS8A 2SBAA 4GWMA 5FRAA 1OKQA 3B69A 4XBQA 3V64A 4U2AA 5GLWA 2AYHA 3AYCA 3SH3A 1HLCA 4YGDA 1WLCA 2GDFA 1W6QA 2OUHA 1ULGA 4M3CF 5H9SA 2CWMA 1CPNA 2P34A 4FOVA 3GALA 2AREA 3MW3A 1GANA 4AVVA 1W6NA 3QLQA 3INAA 2OVUA 3M3OA 1UL9A 1WLDA 4R9CA 2C9AA 1AX2A 2A7AA 3CNAA 4MYEA 4BMBA 2G4IA 2NYYA 2WT1A 3APBA 1LOBA 1AX1A 5DUVA 5E8AA 1SLBA 3OPZA 4D69A 4ZKTB 4FPKA 5BYNA 2R0FA 1BZWA 4XTPA 1JYIA 2ZBJA 2NMOA 3IM0A 3OY8B 4PQ9A 2DVAA 3AP4A 1FX5A 2A6VA 2R0HA 2D43A 4XBLA 3ZYRA 5IK4A 1X50A 1LOGA 1SCSA 2P2KA 3KQRA 5T54A 3VKNA 1CESA 1IKPA 2R1BA 4XMAA 4YFZA 2CWSA 2PHXA 2PHFA 1QNWA 3FLTA 4AVSA 5DUXA 1CR7A 3ILRA 2H0BA 2D3SA 1W6OB 3IKWA 3M3QA 4YM1A 3M3EA 4YGEA 1BYHA 1GZ9A 1MS0A 2CTVA 3ASIA 4YZ5A 3ZXFA 2JD4A 3AZXA 5DUUA 1V00A 4Q1RA 5T50A 4YM0A 1MR5A 1S0BA 1FYUA 2NN8A 3N7JA 4K21A 3A0NA 1ENRA 4XJAA 3B3QE 1IS4A 3IPVB 3AK0A 3M1HA 3W59A 4Q8KA 3WDYA 1DYKA 2ZMLA 3NWKA 3O0WA 4FQ4A 4K20A 2NZ9A 3PVEA 1A8DA 1MS9A 2R49A 4U36A 4YG6A 2AUYA 3AJYA 1FATA 3WNXA 2NMNA 2DVGA 3ILNA 3FUQA 3USUB 1V6OA 1VIWB 1D2SA 2ZACA 2VU9A 2YY1A 1N47A 3RMXA 3FBYA 1SFYA 1G9AA 5DG2A 1LHVA 1CONA 2GNTA 2JKBA 4IQPA 1S1AA 2A6YA 4R9DA 1V6LA 5IK7A 1W6PA 1FNZA 5IUQA 4YG0A 2V73A 3V0BB 3AYEA 4LBLA 1WCSA 4DS0A 2ZHLA 1DQ1A 3AX4A 5DZEA 2D6NA 4Y20B 1SLAA 4Y26A 1HKDA 4FPCA 3VV1A 2OUJA 4R9AA 1BXHA 5GZFA 3WG2A 4TZDA 4XMIA 1Q56A 2R1DA 4FQZA 4UW3A 3ZXJA 1LECA 1JYCA 4DRVA 4P9XA 2ZGNA 3VKMA 4YW4A 3ZPYA 1W6MB 4YZ3A 1S0JA 3I4IA 1IS6A 1N1SA 3ZVXA 5CA6A 1G9BA 1SBEA 1URXA 3FUOA 2DYCA 2P3JA 2YROA 1A3KA 4FOWA 2ZMKA 3IPVA 2ZGQA 4YM2A 1UN1A 4Y1YA 1Z78A 3N7LA 4Y20A 3RSJA 4AGRA 1NLSA 3FLPA 1JHNA 1QGLA 2E53A 2A6WA 4NOTA 2EXIA 5JMCA 3O12A 3R4UA 4M01A 4Y22A 4LBKA 1NXD1 2UWCA 1O4YA 2DVBA 1JUIA 4PBPA 5DZFA 3WLUA 3NV2A 4DRRA 1ULEA 1Z0HA 2EALA 1Y7BA 3ILFA 5E89A 1QNYA 4CZSA 1B09A 1W6MA 3WV6A 1SBDA 1MVEA 1W6PB 1I1EA 2UWBA 1SACA 2CL2A 4M3CE 1VAMA 4XHXA 1DQ6A 3RQ0A 2ZGRA 4XE9A 1LODA 1XQNA 2B7YA 3HR9A 4XBNA 4XZPA 4ATEA 1DHKB 3WVJA 3FFZA 1S0FA 3D4KA 2DTYA 2ZAAA 4YW2A 4AGGA 1WW7A 1RITA 1LHNA 5GLTA 2AH2A 1WW6A 1BKZA 3M2MA 1QOOA 4BMEA 2YXSA 4XJ8A 1Q8VA 2P37A 2GNBA 3RMYA 1ENQA 4GXLA 4ATFA 3B00A 3FLRA 1A78A 3AXEA 3N7MA 4Q1PA 3I8TA 3WDVA 2DV9A 5GZEA 1V6NA 2ARXA 2OW4A 3GNEA 1YI7A 4FP3A 1R1ZA 4HL0A 1H9PA 4XOGA 1H30A 2PHWA 2GNDA 1W0PA 5HCBA 5T55A 4YZ1A 1SLLA 1CVNA 3Q9OA 4Z8BA 1C1FA 3WG1A 1KJLA 1S0DA 2UU8A 3UJOA 1W6QB 5H9QA 1QF3A 3ZXEA 4Y22B 5GLUA 4R9BA 2W39A 1ULDA 3QCWA 2P3IA 1GNHA 1ULFA 3DGTA 2WSUA 3AFKA 4YM3A 1LOAA 2XB6C 4P14A 1DBNA 3LCPA 4OZXA 3ZSJA 3A0KA 2UURA 3H0OA 4LBOA 5IK8A 2W68A 2WT2A 2VW0A 2D6LX 2D44A 2GMMA 5T5PA 1AX0A 5GM0A 2EXJA 3AP5A 1GNZA 2A3XA 3B9CA 2WSVA 1UX6A 4CRQA 3BTAA 1YIFA 1C57A 1LU2A 2A6XA 4H55A 2DUOA 1MVQA 1D0HA 2D6MA 2DVFA 2WNEA 3MW2A 1GZWA 3ZXKA 3WCSA 1UAIA 2DURA 4BM8A 4BPZA 1HQLA 2PHUA 3AZWA 4AVTA 3OYWA 3BIWE 2DWRA 3WDUA 2VW1A 3JUUA 1LENA 3B01A 1H9WA 2W52A 3WZ1A 2EIGA 4AWDA 2ZGMA 1WW4A 2DUQA 1ULCA 2R16A 4BOWA 1S0EA 2BQPA 1GLHA 2ZGLA 4AGVA 3SITA 2E6VA 5JOZA 2WT0A 4GKYA 3AJZA 3OGGA 5DG1A 2A5ZA 2EXKA 2GNMA 1KDMA 2ZABA 1CJPA 2ZGTA 3OBRA 2XG3A 4HANA 4XDQA 5GALA 1W0OA 3ZXLA 1PZ9A 3U4XA 5F9TA 1SBFA 2RHPA 2GN7A 4K1ZA 3PVNA 5AVAA 3ZSLA 5JVVA 3V0AB 1DQ0A 1LEDA 1MS1A 1LGCA 3RRDA 4ITCA 1F5FA 1UZZA 2ZHMA 1WBFA 4ISRA 4XJ9A 1DQ5A 2A71A 2ES3A 4FP2A 2AR6A 4DQAA 1BQPA 1GICA 3WUCA 1MS4A 1RIRA 1MACA 1C4RA 1LCLA 1LHUA 1CIWA 2ZGPA 4P9YA 4YW3A 3V0BA 3R05A 4XYXA 5DZGA 4I30A 5JDBA 5IK5A 3L2YA 2E7TA 3LSEA 4ASMB 4YFWA 2A3YA 2NM1A 4UW4A 1PZ7A 1CPMA 1V6KA 2E51A 2D7FA 2WQZC 4GWNA 1JOJA 1LESA 3T1LA 2VW2A 3WDWA 4PF5A 1ENSA 1DGLA 2P3KA 4FPJA 3AYAA 4UW6A 1DQ2A 4FPEA 4M3CB 4YZ2A 5GLVA 5EXOA 3VUOA 3UL2A 4XTMA 1LEMA 1N3OA 1DYPA 1JXNA 4BQ1A 1TEIA 3BOPA 2A70A 3NV1A 3OYWB 1O4ZA 4TYSA 4XILA 5JOYA 3N3HA 1GZCA 4FPFA 1UZYA 4LBMA 4LBQD 2AGSA 2A75A 1AXZA 4LBQA 2ZA9A 3HMYA 4JC1A 5KXEA 1WBLA 2D6OX 1AF9A 2JDZA
chains in the Genus database with same CATH superfamily
3MPPG 1MZ6A 1WCUA 1VBE1 1PVC2 4FT8A 2ZJCA 5J48A 4LT5A 5IAXA 4QDRA 2GMEA 3U11A 4RYDA 1R1A1 3MIEA 1CQ9A 1JBCA 1RVF2 2VCMA 3U75A 3G7DA 4CU7A 5BNPC 1POV1 1NCQB 4XUQA 4JDMA 1AUYA 1QWRA 5A3TA 2YU1A 4DXZA 4DY5A 3ORJA 3OEBA 3VBFB 2VMFA 1K3IA 5JR2A 3T0DA 1JW6A 5FPZA 2VZSA 3NRUA 3JU9A 2ZGOA 3RZKA 2YDEA 1GOFA 1MEC1 4WZFA 4KWLA 5BY5A 5C9AC 1R092 4BH9A 1XE7A 4RQPC 3LZZA 2JXAA 4FO9A 5IFPA 3VDBA 1L7LA 1RHI1 4IE7A 5J7MA 2VVFA 2OKXA 1H1IA 2XJQA 3PJQA 4IERA 3IDEA 4L11A 1V0AA 4IEYA 4Y1UA 3JB8A 1IGOA 4CUCA 3PU8A 1RUH3 3FFQA 2VTXA 4LMFA 2OIIA 1JOPA 1PK6B 2WJSA 1H0BA 1KS5A 1LOFA 1R082 4OHVA 5FLJA 1RUF3 3OY8A 2WLQA 4LO5B 2WZR3 3TAYA 3TBDA 4IETA 2HWF1 4D7YA 1G9DA 1PMHX 4M3CA 4C1XA 2FDHA 4UW5A 4L8QA 3PMEA 5AC93 2RV9A 1YHFA 2BOJA 4MOAA 3OBAA 5FO7B 2Y6GA 3NAPA 4HVQA 3WNOA 3O14A 3M7AA 4KG8A 4S2GA 3CO2A 4J6GA 2ZGUA 3HOBA 3D6EA 1OC1A 3LEMA 2OS2A 3S5QA 4CA9A 2YV8A 5A7PA 1F9KA 2W3JA 5C3QA 2WS92 3TYJA 5JZGA 1W8UA 2AENA 1AYN2 5HCFA 3JBG1 4BLIA 1QU0A 4QXKA 1QQP2 5EPAA 4OQ9A 4EZHA 3AKTA 5JUVA 4FPYA 2FDIA 4E2SA 1GMMA 3KQ4B 5FZDA 5JXHA 1KRIA 4MXWB 5FZMA 1QDCA 4LBJA 4PCRA 3SEEA 3WUDA 2G9FA 5KWRA 5CIRA 3WF2A 4D94A 2W1WA 4MGIE 1RUJ2 1OF3A 1RMU1 1UPSA 1UW8A 3DYPA 4C0BA 5C3PA 3MF9A 3KVAA 4HLTA 1IOAA 3KM5A 5FDBA 1QIQA 4BZ4A 1DFQA 2XOMA 2VMDA 2W46A 4AEDA 3NNGA 2VJXA 1ONAA 4UFHA 3ACHA 4RD7A 5IAVA 3MIDA 5SV5A 2EIDA 2ENRA 1NCRC 5GZGA 3LOBA 1X8MA 2K9ZA 5KR7A 3S0MA 3THTA 4D7TA 2XL7A 5JSPA 2QQJA 1SLIA 1FOD3 1WD3A 2FHRA 4BJ0A 5LY1A 4UBGA 3AMMA 2CY6A 1HJGA 1UMZA 3LEIA 1LNSA 4XAEA 4BXFA 2VY0A 2VGDA 3HBZA 1YNAA 1U12A 2Y64A 4AXOA 4CU6A 2RR11 5A3OA 1W28A 1G7YA 1W06A 4IV3B 5DXDA 3ZFGB 3RZLA 3AXDA 3H3ZA 2ZTNA 2XXZA 2F4PA 2FMYA 4RFRB 5C6CA 5K0UC 1S0CA 2ERFA 1SLCA 1STMA 1GFF2 2LTNA 4HONA 5SV8A 3VKOA 4AAPA 4I0WB 3LDKA 3ZN4A 2DU1A 3NAPC 4L2NA 5ISLA 4ZXKA 4A45A 1K5MB 4WVVA 2QZ3A 3B9IA 4MH0E 2LROA 4I0BA 2G9ZA 3VKFC 4YWAA 5IVCA 4ONUA 5LA2A 4AL9A 1QJX1 5FYUA 4CUBA 5T52A 4Y1XA 4AOCA 2UWAA 3POWA 4Z1VA 2EF6A 5GZDA 2FBEA 5ANQA 2HYXA 3BODA 1TG7A 2VQ0A 3VKLA 1EAH3 2PELA 2JE9A 1W6OA 3OUIA 4FFFA 4NROA 1XE0A 1XE8A 3ZFEA 5BNPB 1XNKA 3AZYA 3IN9A 5E16A 3CJIA 1DGWX 4O9GA 1CIYA 5LB6A 1CAUB 1S0IA 3E97A 2Q0AA 3O0XA 4K8FA 4KWJA 1PZ8A 3AYDA 4AEKA 3UKTA 1KJRA 1NXMA 5JMOA 5K7PA 2QFEA 4YLZA 1WWYA 1S2BA 3ECQA 3J7HA 5DAQA 3VBHC 4URAA 4CEWC 5FYMA 3U78A 4QPIC 4QGLA 5FUNA 5CISA 4D3WA 2ZHKA 2PTMA 3ZSEA 2WS91 1Y9GA 1O8PA 4ZS3A 1BVP1 3ES4A 4PLNA 1OA2A 3JBG2 1J1TA 1DGRN 1K12A 1HIXA 2YB7A 3P5BA 1VBC3 1ZZ9A 3V65A 4DMIA 2Z4FA 4CP0A 3R4SA 5F3EA 2PXJA 4LA3A 3T2TA 3MW4A 2D3PA 3IZOA 2BBVA 2HEWF 2MPFA 1GV9A 2YU2A 4KNCA 4O65A 2IXIA 5ABJC 1MS8A 4GWMA 2VQUA 1OKQA 4ORFA 4EQVA 4IUGA 5A3UA 4U2AA 3IMMA 5T3NA 2AYHA 3OGRA 3SKJE 3VZNA 5LEKA 4EN8B 1PVXA 1VRH1 2W1QA 3ZMNA 1WLCA 2GDFA 2OUHA 4RN5A 4M3CF 4Q4X1 1M06G 1HXS3 2CWMA 1UU4A 3I49A 2RE9A 4KI5M 4GMP1 1RHI3 1ZBA2 4UOJA 4NRPA 3MIHA 3QACA 4ZXEA 1W6NA 1JZ5A 3M3OA 4LITA 4CDWC 2ZAHA 5C5UA 4BMBA 5EP9A 1W2OA 5FP4A 3UKVA 1SLBA 3OPZA 4D69A 1NLQA 4FPKA 5C70A 1BZWA 4O9EA 1QJY1 2NMOA 2HWD1 2V4VA 2DVAA 3J8F2 4A41A 4P00B 2OA2A 2LS6A 3ZR6A 2AEYA 3RJRA 3IDCB 4Q0UA 5T54A 4YFZA 1IKPA 3ZYJB 2WZR1 1D4VB 1YI9A 2CWSA 1QNWA 2ATFA 2VAUA 2WA4A 2P1BA 3P3PA 4E4DX 2WIIB 4LKDA 4LLFA 1S4CA 4YGEA 1BYHA 1QXJA 5FMCA 5F6KA 3ZIXA 3AZXA 3NJYA 4XUOA 2QQWA 4IV1A 1SFPA 3VGIA 3OTFA 4N43C 2NN8A 3I3QA 3MZHA 4NWWA 1ENRA 4WZCA 1UMIA 4XJAA 3THCA 2YGLA 1CJDA 2JDYA 2B46X 4OUEA 2AC1A 2JDNA 4UFKA 2WNUA 4WM7C 2D98A 2IVJA 2ZMLA 3NWKA 3O1PA 2NZ9A 4U36A 2X5IB 5FY4A 3SCGA 2VCCA 4E4HA 4XUPA 1CZTA 1BMV2 3RYPA 1V6OA 2PAKA 4L0PA 4BQXA 5LEJA 3DKQA 1PHMA 2ZACA 3G6JB 3M70A 3UGFA 1NZCA 3VLBB 5FP3A 3FBYA 3GZUC 1SFYA 3UGHA 1G9AA 5DAWA 5DG2A 5IK7A 3O1TA 4HZFA 3DL3A 1ODNA 1V6LA 4HKOA 2Q8DA 1FNZA 4CEYB 4LBLA 3KF3A 1WCSA 2ZHLA 2JG8C 4GJZA 3AX4A 3K48A 2D6NA 2Z79A 3DECA 4PLOA 4Y20B 1Z7S1 2J1SA 1AYM3 1XXNA 4FPCA 1QJX3 2OUJA 1PIV1 4W8JA 1GNYA 3WG2A 1GP4A 1I5ZA 4XMIA 5ABJA 4XACA 1UU5A 3KV4A 1PGL2 4B29A 3FX3A 3EYPA 1HX6A 1AR82 1NQDA 3KT4A 1ZBE1 5FY8A 4XABA 4GD4A 2YYOA 2ZGNA 3FBMA 3VKMA 4QXBA 4XZUG 1W8NA 5CA6A 4MO3M 5HI0A 1HV1A 1URXA 3AMQA 1OD3A 3DF0A 1RUE3 2P3JA 2VZQA 5D1IA 3UT0A 2WNVC 1A3KA 3RFRA 2ZMKA 1GWKA 3IPVA 3ACFA 1D4M3 5FXZA 2QQIA 4BQ3A 1UN1A 4E9KA 3BYWA 4GB33 4LULA 1W90A 4Y1YA 3MICA 5CG8A 1UNBA 1R1A3 1ZRIA 1JHNA 2V09A 3VN4A 2BWAA 4NOTA 3K51A 4Y4YA 4XQWA 1OPOA 1Y43B 3E6BA 1UYYA 3MFAA 4LO7A 4NN0A 5FCCA 1HQNA 1O4YA 2DVBA 4JGYC 3LFMA 4Q4V2 4DRRA 4HKLA 1XC6A 1WMDA 1JYWA 2KXLA 4CDWA 4L9BA 3SQOA 4AK3A 4HSLA 2XBO2 3LFIA 4WVZA 1I1EA 5A3WA 2UWBA 4SBVA 5LBFA 2CL2A 4M3CE 4XHXA 2WZEA 2WZR2 1YLLA 1NA1C 4XE9A 2Y6KA 2J1TA 3HR9A 4DXTA 4XBNA 1PK6A 2BEOA 3PJYA 5L7OA 1DHKB 2BW8A 3WVJA 4X6RB 2VOKA 2WWSA 2ZAAA 4YW2A 3LB9A 3LOIA 3MO4A 3OPTA 2O14A 2R7EB 2QQLA 3E6DA 1SPPB 1VBC1 1AR93 5A32A 2YBPA 4CCJA 3RMYA 5BNOB 2YC0A 4GXLA 4QHBA 1A78A 2ZXQA 3U1XA 4ZU7A 4Q1PA 2FQPA 2WL1A 2DV9A 5KC5A 5C4WC 2OQ7A 3EHKA 3X29B 3K4AA 3TNQA 1RUC1 1R1ZA 1UD1A 5IWFA 4GWIA 4R52A 2OX0A 4XOGA 5HCBA 1W0PA 4YZ1A 3H1WA 1CVNA 1SDWA 3MV11 5K0UB 2B42B 4XPVA 4EWEA 4MXWA 4AFBA 4GJYA 1QY4A 5GLUA 5A7WB 1PM4A 5DN2A 2XL9A 3B7MA 5IFTA 4AVAA 2OZJA 1ULDA 3RZHA 1WCQA 1GNHA 2QQMA 3D0SA 2RDSA 4M0NA 3TWIA 2WSUA 4YM3A 4NHLA 1VB4A 2QVSB 4MV2A 5DDJ3 1OA3A 1Z7S2 4OZXA 2JEMA 5IK8A 3NNJA 3AFGA 3SCFA 2W68A 4QB2A 3VD7A 2NQYA 1FMD3 3P1IA 4NIGA 5T5PA 5C71A 1IQAA 5GM0A 3IWZA 2Q1MA 3BIEA 2JDHA 1W8FA 3W21A 1QJU2 5JCTA 3B9CA 2WSVA 5BNNC 5LCWL 5KHJA 1LU2A 2A6XA 3MPBA 4Q0PA 4QX3A 5K8SA 1VBE2 1NCQC 2DVFA 1LKNA 1GZWA 1S55A 2RMU2 4AI2A 3OEAA 2DURA 1VJ2A 1R1A2 2LW8A 2VZVA 3CHXA 4I09A 3VHRA 4BM8A 2IXLA 2B45X 3HJRA 5FR3A 2DCTA 3JUUA 4OUMA 4GH4A 1H9WA 3QD6A 1OURA 4JX0A 4AWDA 1ZNPA 2BERA 1GUIA 1S0EA 2BQPA 3WF3A 1RB8G 4P9LA 1NQJA 2ZGLA 3VHPA 3LEKA 4D0QA 3DPRC 1DU3D 3SITA 1YJLA 3AJZA 3HNYM 3UETA 3WQ7A 2WR9A 5GALA 3C7EA 1CJPA 3ZFFA 3PL0A 1EV13 1W0OA 4RHV2 2IFWA 3I2JA 3EQEA 5D8AB 1E5IA 1COV1 1UYXA 2RHPA 4K1ZA 3VD9A 1ZZ6A 3V0AB 2O8QA 3K4ZA 3TN93 1ENXA 2HWC1 2XBO1 1REFA 1F5FA 4NPRA 5FTTC 2JDUA 1AL22 2BJSA 2VULA 4QKFA 3JD71 2IVIB 4XJ9A 2A71A 5HBAA 1OMIA 2AR6A 4DQAA 2XUEA 3K3OA 3ZR5A 1MS4A 3HT2A 1MACA 4IGOA 4DEQA 2V5DA 4JGZC 2WO3A 3I59B 3V0BA 5DZGA 4I30A 5JDBA 2LUWA 3L2YA 1IPJA 2OPKA 3VBOC 1QH6A 3VDDC 1JS9A 2YUEA 3RVHA 4ZZ5A 1CPMA 1J3QA 1V6KA 2D7FA 1JOJA 2ZX2A 5EV7A 1DGLA 2P3KA 4WM7B 4HVOA 3AYAA 3NQHA 3KHCA 1DQ2A 1VBB2 1UZWA 1AYN1 2BVVA 2VNOA 3VUOA 1UU6A 4XTMA 2WN2A 1DYPA 1NE6A 1ZA7A 4QX2A 3ZXAC 2A70A 1O4ZA 3OGJA 4XFFA 3VHOA 3AVRA 3N3HA 1GZCA 4LBMA 4JDOA 4CCNA 4HPKA 4Q4X3 4L92A 1XNTA 4MHRA 5C9AA 5F2WA 4Q4W3 2D6OX 5FZAA 2VBDA 2ZCWA 4H2AA 2IUWA 2BFUL 1YQ2A 5CB7A 4UFLA 5H9PA 2HKXA 1H1AA 4LR4A 4Y1VA 5LBEA 5ACA3 3ZFFB 1A8MA 2YPDA 2Y33A 3OB8A 1TZOA 2VD7A 4HK9A 1QQP3 1S0GA 4N53C 5CBLA 3MHZA 5T5OA 3PUQA 4LQRA 3WNMA 3MLKA 2LALA 1H2KA 4DXRA 3CMGA 1QJZA 5F7UA 4H7LA 3A4UA 5B4XA 3VZMA 4GZ9A 1NAEA 1AXKA 5F2SA 4CDWB 5FPUA 5F1RA 1J84A 3THDA 2ZKLA 3ZYGA 4JTOA 3ST7A 4OYUA 1GOGA 2YGMA 2R32A 4CEYC 2BYVE 1RUOA 2W94A 2HEYF 2A1XA 1V6MA 3SNMA 1JMUB 3VHNA 1IHMA 5I0UA 2BGOA 5CKNA 5I0TA 2C1FA 3KCXA 1IKQA 2I45A 3ETPA 4Q0SA 3H8RA 3KSCA 2Y6HA 4PIZA 5LK5A 1GKBA 4CTEA 1NCQA 3BB6A 5C3OA 3ZIWA 4QPGA 5GZCA 5JXGA 3VBFA 1ND2B 4AQTA 3ZN6A 4Y33A 1RUG1 2MEV3 2O0OA 5A7SA 1MEC3 1DLCA 4I02A 1WZXA 3RJ2X 3ZMOA 3OD4A 3BKZA 4QQLA 4RHV1 4EJRA 4QB6A 2F4LA 5FXXA 3WF1A 1COV2 1VBD3 5CAZA 1OVPA 4D7SA 2ZEWA 5I93A 5E6HA 5GJ6A 5FV3A 2VBPA 1RMU2 3WSOA 3TEXA 4ET7A 3A22A 3ZSMA 4IEOA 1OSGA 1NOVA 4N53B 5K9YA 1RUI2 4JTNA 3H50A 5DAXA 3MDPA 4XJWA 2UY9A 2VG9A 2VZTA 5I0RA 3BU0A 3DXUA 2CU5A 2X8KA 2VL4A 4ZU5A 3HAGA 1OXCA 4UT5A 3NW4A 4XDPA 4Q0VA 4BQWA 1G9CA 4YZ4A 2YZ4A 2QDNA 4YVWC 3ZFGC 1NUKA 4YW5A 1LTEA 4QXCA 4BIOA 2EXHA 3S57A 4QAWA 1W3VA 1DQ4A 4CVUA 1W39A 3CJIC 5FMDA 2FCTA 4EWDA 4OI2A 1LU1A 2QTWB 5FZ1A 2FDGA 4UFMA 1WLWA 3D5OA 1AR61 1CAWB 1W8HA 1G9FA 1ZX5A 4IESA 3AVSA 4FFIA 5FZEA 2P17A 4QX8A 1CN1A 2YC4A 1GYKA 1PX4A 1OFSA 1REDA 2WNOA 2KM2A 4JRAA 1GZWB 5FP9A 2ZGKA 1RC6A 3KT1A 3NAPB 2WZPP 4A3XA 4MHUA 4QQPA 3RZJA 2GMPA 5L7OC 5IVEA 4GB31 1H1MA 1WCDJ 3VD5A 1VALA 1X33A 4LKSA 5J3UA 3K46A 3HPNA 1BHGA 1X9TA 1IS3A 2RG4A 3OD0A 4OHXA 3I2KA 1SHWB 1MS5A 4CP9A 3HT1A 3FC0A 4C90A 1H6YA 1QJX2 2C24A 3AL5A 1BK1A 1OD5A 1WW5A 4AG4A 2RJKA 3K77A 4GULA 4YG3A 4N8MA 3NKTA 4GKXA 4UF0A 3N7KA 2CGPA 2W87A 4XHBA 4LBNA 2Y0OA 3S7EA 5HV0A 3ATGA 1QOTA 2VUJA 3SEPA 4X8PA 1O8SA 1N3QA 3H7JA 4P9IA 1CZSA 1V6IA 4OQ8A 2W95A 3SH5A 1JH5A 1LAJA 1QJFA 3DPRB 3OG2A 4XQDA 2DUPA 3EMRA 3J8F1 1GQPA 2PFWA 4LO8A 1L3JA 4HN1A 1GBGA 1UYPA 2GP3A 4ZZ8A 3WY6A 1XJAA 4Q2FA 1T6BX 2W0XA 1F5JA 5F8PA 3HIFA 2HBUA 3AP6A 3OUHA 2HWE3 4QPGC 2RVAA 1NE4A 1JTZX 3BTYA 1S2EA 2V4AA 4B1LA 1NCRA 4DNYA 2IXCA 4INDA 3ENRA 5KXDA 3NJVA 2E7QA 1N3PA 1XU1A 4WVWA 1EY2A 4JVAA 5JOXA 3MI8A 3ZSKA 1OLME 2D6PA 2CDOA 4NRQA 1JN2P 1FOD1 5EYYA 2R043 4TTGA 3SH4A 1AR63 4TLGA 1XPWA 3IIAA 1AVBA 1V9U2 3AP9A 3J7LA 3LE0A 4RFT0 4YRDA 3WF0A 3KHBA 4GA9A 4HFSA 5JPMB 3ZFEB 4CU9A 1RXFA 1VRH2 3VBUB 4KH9A 1Z7S3 1LOEA 3DN7A 4RA0A 3JB4C 3WG4A 2DTWA 1K5JA 3J8F3 4AVBA 2ET1A 2WNVB 3B69A 3LWCA 4PHZA 3MF6A 3GXUA 3THPA 1VBA3 1VBA2 5GLWA 3V64A 3O1SA 2N7GA 4M4PA 3SH3A 4MG2A 1AYN3 1ULGA 4B4QA 1W8ZA 2WFF2 5FYTA 1CPNA 2P34A 2BU9A 2XDVA 1E5RA 4Q4W2 2IXKA 2AREA 2Q4SA 1VR3A 2ZPXA 1C5IA 3QLQA 5F39A 4CCLA 1FPN1 2HEVF 4IV1C 4R9CA 4LORA 3CNAA 1AX2A 2A7AA 2H6BA 2XLGA 1FMD2 3DYMA 5FLIA 2NYYA 3D3AA 4BQ2A 5A1LA 1PGL1 5FZIA 1AX1A 5CFCA 5CEHA 5A7NA 4ZKTB 2FDFA 1JHJA 3ACLA 1RUD3 2R0FA 3LIHA 2Q8EA 1Q3EA 2ZBJA 3NMBA 3F2ZA 3SHRA 4C91A 1H2NA 1G6NA 2R0HA 3FZ3A 3JZVA 4N7UA 4QHZA 2H6CA 4HG6B 3HD8B 3C8XA 3VKNA 5JZGC 3KQRA 1HXS1 5CYYA 3GDBA 4QHOA 1CR7A 3ILRA 2E33A 3T0BA 1LB2A 2Z69A 5FFOC 1F35A 3D8CA 2WO7A 2Y38A 3M3EA 4MLOA 1QJEA 1UOJA 2BDRA 2XQXA 3GCXA 2C6SA 3ASIA 5CKMA 2C9KA 4J25A 5DUUA 3T0AA 4Q1RA 5FZFA 3T2OA 2D93A 3A7QA 1E5SA 3AKSA 3VBSC 3PDQA 2CSGA 4XW3A 4RGAA 4K21A 1PGSA 2WNVA 3A0NA 4WM8A 1JYNA 1UXXX 2ARCA 2VMHA 2BNOA 4TN7A 1DF0A 2X05A 3E5QA 3WDYA 2P6HA 3O0WA 1KEXA 3PVEA 1UWWA 2WFF3 5EIYB 4CYDA 4OHYA 2RS31 4NHYA 2NMNA 5FZ8A 2AZ5A 3FUQA 4CUAA 3ABZA 4EN7B 1OBNA 1D2SA 2VNRA 2BBAA 4MXVA 2XJSA 2CHHA 5BUVA 2UYAA 3PHMA 2VU9A 4YNIA 3N9MA 2J42A 5C8WA 1C28A 1RUNA 4A42A 1UOBA 2WN3A 1YCIA 2LRPA 3U10A 2YFUA 4MSVA 4IQPA 2VQTA 1S1AA 2A6YA 4R9DA 3V0BB 2Q8OA 1OH3A 2VTXJ 4XCAA 4Z2AA 2FD8A 4IE6A 4AFDA 1DQ1A 1J83A 2WWJA 1XYNA 3VD3A 1WMEA 2WNUB 4K6BA 2WFPA 1V9U1 2VZUA 3VV1A 2WNUC 4WM7A 4DO0A 1RUC2 4Q29A 5KHGA 3AMPA 1B35B 2X09A 1Q56A 3GBFA 1RVF1 1TQ5A 1W2UA 2VMIA 3WX5A 3GZAA 1T6GC 4YVWB 1NY72 4DRVA 3ZDVA 2J1UA 3ZPYA 1S0JA 3I4IA 1IS6A 1G9BA 3AB0A 3PNAA 3FUOA 2J1AA 2DYCA 3CF6E 1PMIA 2YROA 1Y9MA 1BBT3 1PO13 2PLV3 1W9WA 2XMLA 2D97A 2ZGQA 5D21A 4PF1A 3ZN5A 3J4UH 3CBNA 4Q4V1 1DYOA 1Z78A 2E7AA 4Y20A 3RSJA 3H1MA 1NLSA 4BYYA 2E53A 1QGLA 2A6WA 5FQ0A 2EXIA 3K4DA 3NO8A 5CZKA 3MLLA 3VDCA 4N43B 1ALYA 1ACCA 4P08A 1QJU1 4A6OA 2O8OA 2ET7A 3WLUA 1Z0HA 4QQHA 4D6SA 3W20A 3ILFA 4Y5TA 3R6SA 2G9GA 1AR92 4CZSA 2WA3A 1MVEA 4LE3A 5A3MA 5LW9A 1XRUA 3N9QA 3HQXA 1VAMA 1KXGA 1DQ6A 1HV0A 2ORXA 4HXCA 1L7RA 4ARXA 2J1VA 3FJSA 2XWJB 5K4LA 1XQNA 5FBZA 4ATEA 3LGRA 3NNMA 4AW7A 3D4KA 2DTYA 1NX9A 1UY2A 5FPLA 1WW7A 3HEIA 1LHNA 5JR7B 5JAXA 4LK7A 3PVBB 1XOYA 4A6SA 3HWJA 1QOOA 1IPKA 2C26A 3BPSA 2XR4A 1Q8VA 2P37A 4V2WA 4V2VA 4EROA 5HXVA 4AF9A 2WYSA 3FLRA 3FHIB 5FPVA 3WDVA 1HRI3 1RUJ1 4JAAA 4QDSA 3ZYIB 1YI7A 4RR3A 4HL0A 1H9PA 1RJ7A 3EBRA 2PHWA 2GNDA 3JD73 1OI6A 5JIUA 1ODMA 5BXXA 2EIBA 2B8MA 2YPJA 1C1FA 3VBHA 1GP5A 4N53A 3UJOA 2P3YA 3W5NA 5H9QA 5FQ0B 1PIV3 3ZXEA 4R9BA 4CP2A 2DCZA 4K3UA 5ABJB 1VRH3 5FZOA 5A80A 4W4ZA 1POV0 3WP6A 2P3IA 1FXZA 4NVPA 4BK4A 4IGPA 1AL23 3GCWA 4Z92B 2VMEA 2XB6C 4P14A 3VBRB 5FBJA 3ZSJA 2UURA 3H0OA 1WMXA 3LPFA 3KT7A 3OGVA 1Y3TA 2XJRA 3VL8A 4CP1A 4Z2WA 1O5LA 2B4KA 1ND3C 4UFJA 3I2OA 2WZ8A 1R093 4IDZA 1H8TA 2E31A 1CAWA 2R072 5BNOC 4W6XA 5FY5A 4CRQA 2ADDA 1YIFA 1UIKA 1C57A 4H55A 2R6QA 2DUOA 4KGQA 1WMFA 3WQ1A 1H6XA 4Z82A 1X7NA 4GAZA 3ZXKA 5A32B 3WCSA 2MHFA 4CXWA 3AZWA 4AVTA 5BNOA 2DWRA 3B01A 1NA1B 2B5HA 1X9PA 4QU2A 1UY0A 4MUVA 4O61A 1HB2A 1BBT2 4ASLA 5C8CC 3URFA 1PO21 4BOWA 3KZ4C 2JWPA 3TEZA 2TUNA 4AI3A 1BK0A 2JX9A 1O7FA 1O3RA 5JOZA 3NNFA 2WT0A 3DKWA 1XBFA 3QBQA 4LE4A 5EJ3A 2HWC2 3OGGA 1FI2A 5DG1A 4ZONA 5FMOS 4XDQA 4HANA 5K0UA 2L9LA 2XG3A 1YWKA 1YFUA 3J7NA 1PZ9A 4CSWA 5JWPA 4BPZA 5F9TA 3WNKA 5LA1A 1SBFA 5A7WA 2GC2A 3C7OA 2I07B 1HRI1 3K3NA 1DQ0A 2BZDA 3RRDA 4ITCA 4UXAA 1U5XA 1W2AX 3FWEA 4K7JA 5IW0A 1WBFA 1YQ6A 4FP2A 3RGBA 1BQPA 2DCJA 2XJUA 4UYBA 4ZPIA 3OF1A 3UESA 2ZGPA 1LHUA 1ZZ7A 2BTVC 1SFNA 4IEXA 3KCCA 1EYBA 3EXUA 4W6YA 1W9FA 1NLRA 5FMOL 1W2NA 2E7TA 1UPIA 4YFWA 5FYHA 2NM1A 2A3YA 5FIXA 4GWNA 2E51A 3BPZA 2W1SA 4LKFA 1W9SA 2ZS6B 3T1LA 1EAH1 4PIYA 3WDWA 5CFDA 1UCXA 4PF5A 5FXVA 5LA9A 3LDBA 1VMHA 4FPJA 1K42A 4CE8A 1B35A 1UIJA 1RL3A 1W2TA 2W5FA 3C7FA 3RZZA 4AR2A 1N3OA 1NYWA 3BOPA 2JE8A 2VQAA 2DF7A 4GWJA 4PT6A 4C0HA 3JQXA 1RUI1 1VP6A 3VZKA 2Y6FA 4AAXA 2AGSA 2K46A 2A75A 4RS5B 3I97A 5A3NA 1OLRA 3WF4A 2O1QA 3BI3A 5KXEA 2W9XA 3D82A 4AEDB 4QXHA 3PIGA 3N36A 3RI9A 3OGSA 2VH9A 3Q8FA 4J1XA 3ZYHA 1JZ8A 1SLTA 1I3HA 1WD4A 1OUSA 3PUHA 4J1WA 1RUD2 4LEJA 2CYFA 2VE1A 4UI9L 5H9RA 1AXYA 4Y24A 5A1AA 2NP0A 2A6ZA 1HB4A 1RMU3 4PBOA 1C8M3 3C2UA 2JDAA 1O91A 2ARBA 3ACGA 3MEPA 1LGNA 1AJOA 3CEWA 3NV4A 2I2SA 4A7YA 1XYOA 3N9OA 4WV8A 3T09A 5C4WB 3UJQA 2ZEYA 1QJY2 2D5FA 4KWKA 4PDWB 3ZM8A 1YUDA 5T5JA 2HLEA 5APAA 1C8NA 3VBRC 1LOFC 1IS5A 4KL1A 3W58A 2WRAA 4F7ZA 4CDUB 2ZX0A 4CP9B 3GJAA 3LSDA 1ZBE3 4JKLA 4SLIA 1YQ8A 4GB32 4ZHNA 2IZWA 4WVMB 3AP7A 2XJPA 3WR0A 3U37A 1F4AA 2CNAA 2GALA 4KG0A 4YSFA 4ES8A 3OBTA 5FZ7A 4BXSV 4HMZA 1UMHA 1X82A 2VM9A 3BOWA 2ZZQA 3V0AA 3TEWA 1UX7A 1XB9A 2XVGA 1HW5A 3TB0A 2BWCA 2VUAA 5LATA 3WT3A 2HWB2 5FZCA 2W08A 1AR83 3NJXA 4CCEA 2BP6A 4NPLA 1O3QA 5FY0A 4QDQA 1G86A 3C7HA 4RQPB 4EYUA 1KITA 4MGSA 4CDXA 5C9AB 5A6YA 4ASKA 1R64A 4R8HA 4Y5SA 3I59A 3S5AA 5F5AA 4Y5Z0 1MZ5A 4ZY9A 3E1F1 3KS7A 4NO4A 3UGGA 2FDKA 5J1XA 4Z07A 1HRI2 1OLQA 3VDAA 2JE7A 2PQQA 1W8TA 4YVSA 1OQ1A 4AVCA 1MPXA 5FUIA 1BLZA 4UFIA 3AZZA 4W65A 3HN1A 1DLLA 4JGYA 3O5SA 2PHLA 3BU7A 2HWB3 4JRLA 5D2AA 1TNFA 3J26N 2ILMA 4FPHA 4FVVA 4XIKA 4YGBA 2B9UA 5DPNA 4XIOA 2XVLA 3BN6A 1ZA4A 3POBA 5FZOB 2NPIA 5AC92 5BNQA 4YVSC 1MZFA 2WUHA 3LQCA 4FPOB 3HNMA 4MGZE 5IVJA 1G8WA 1RVF3 2VO5A 4JCKA 1O3SA 1AR62 3BUCA 2OPWA 5FKCA 5F6LB 5LY2A 1TMF2 2HYKA 1OQEA 2DVDA 1YRZA 4YW1A 4CCKA 1OPMA 2JG9C 2CAUA 4BLJA 5A3LA 4LO6B 4QPIA 5IVYA 4Q27A 5EQUA 1HDKA 2RDRA 4Q4Y2 1VBB3 3O1UA 4QQOA 1VLNA 4MZUA 1EV12 1AR81 2PHDA 3DYOA 4XEZA 5CVRA 3ROUA 3VZOA 1OFNA 3O1VA 1N1YA 1GQGA 2WKKA 3WHUA 4DB5A 1X36A 2JG9A 3V56A 5JXIA 5L9BA 3QH6A 1CAVA 2VXRA 3B02A 4UWDA 2ZHNA 4LJHA 2JECA 3B94A 3EB7A 3CQOA 2JKXA 4ZU4A 2JG8A 2Y0IA 5DAVA 3RG0A 2PAEA 1D4M1 1YJKA 1O6UA 5AFBA 4UAPA 3QH7A 1LOCA 3WG3A 2VZ1A 1LHWA 1LJ7A 3BGAA 3PIJA 4FPLA 3GM8A 4MGKE 1OF4A 4XETA 1W6NB 4XFIA 1RUD1 4YVWA 2A3WA 4E8DA 1JZ2A 2VOVA 1RXGA 1YO8A 5DUWA 4B4RA 5DAPA 2X5IC 3DUIA 5L19A 1QKQA 5DABA 2TEPA 4PIXA 4RL7A 3RS6A 2P4EA 4EN9B 2EAKA 4JV4A 4Q26A 2Q8CA 5FJKA 5FO9B 1QOSA 3T1MA 1MS3A 3MBWA 3PVOA 5FREA 2NLRA 3I3BA 4COYA 1ZREA 2HWE1 4M00A 2SLIA 2RS52 1FMD1 4W50A 4K1YA 1Q8SA 2PAMA 2VNGA 3H3UA 4URTA 1I5PA 2YG0A 3JXSA 5CNAA 3SMHA 4BDVB 1DP0A 3ZN6B 3I3MA 1V70A 5A1FA 4TSVA 2ZZJA 1ZM1A 4COZA 4DIQA 2W2IA 5ERLA 4XF1A 4DOUA 4IEUA 1U5YA 1XSRA 5IT6A 4LTAA 1HQWA 1RINA 1GSLA 2JENA 3O0VA 1ULOA 1YQ5A 3UV9A 2WQ4A 4CCDA 2J1RA 3DCQA 4AI1A 4CEWA 2CGOA 3MIGA 1Q8OA 2GN3A 2XLAA 2HH9A 1FV3A 1KFXL 1APNA 4Y1ZA 3OOXA 3M3IA 2KA3A 1N1VA 4XFBA 3WOGA 2Z5WA 4V1PA 4CCOA 1QJU3 2DU0A 1JYTA 1AR72 2DBIA 2VVEA 3POSA 4K9SA 5KHIA 2B9VA 1O3TA 4BK5A 1DGWA 1RUE1 1DDLA 5J37A 1FNYA 3POYA 1PGW1 4F83A 3CDZB 5FK7A 3USUA 4NAOA 3DPRA 1OUXA 3UYJA 4AHXA 4LBQB 4QPWA 3RYRA 4LNVA 1FAYA 4HETA 4I2OA 3TN91 4DPNA 4LHLA 1F31A 2RS32 1AJKA 2YFZA 5BNPA 4FTSA 1UF2C 5FYCA 3LD8A 1U0AA 4ISQA 2Q30A 1YC61 1WUVA 5EYXA 1KD7A 1OT5A 3HBKA 5AC91 4AQ2A 3Q8EA 4Q4W1 5FRAA 3O1MA 3GYDA 3WW1A 3KMHA 2BRTA 3HNBM 3VDDA 1BEV1 4YGDA 2VOWA 2HJIA 5H9SA 2VMCA 2RS11 3JCIA 3VB9A 2QQOA 4P5HA 3M8LA 3TRSB 4QWNA 4CDUC 4XFCA 4AI9A 5FJHA 5I91A 3ZFGA 5FOBB 2QUOA 3J7MA 3JBG3 3L2HA 1UL9A 5C8CA 3HQRA 4CDUA 3MFCA 1UY4A 1US2A 4I0AA 5EFUA 3VBUA 1ASJ2 1JOBA 3WP3A 3APBA 4CEWB 1VBD1 3DV8A 4WVMA 2IXJA 2XJVA 1T2XA 3MIFA 4XFAA 5FKBA 1TMF3 4JKMA 1QXRA 1D4M2 4XFGA 4XTPA 5FZBA 1IZ3A 5FY9A 1JYIA 3IM0A 4MVTA 2A6VA 5IK4A 2D43A 1C8M1 3GBGA 5AFEA 2OT7A 1SCSA 1YIPA 2P2KA 5DDJ1 4DY3A 5FZ4A 2PHFA 4OFGA 3FLTA 4N7IA 4AVSA 1GR3A 5DUXA 4E2GA 1LR5A 2B39A 1NT0A 5LASA 2XONA 1W6OB 1CWPA 2WABA 2XKOA 1VRBA 2K0GA 3IKWA 5FMBA 4CDXB 4F8AA 4X8NA 1GZ9A 3KV5A 1MS0A 2CTVA 3ZXFA 2JD4A 2RS51 1V00A 3C3VA 2H0VA 2ZX4A 5T50A 5E1RA 1AYM2 3H8UA 3NKGA 1AL21 4IGQA 1FYUA 1D7PM 2QBXA 3PUAA 1POQA 4I3GA 4LOSA 4P5YA 1A6CA 2J7MA 3B3QE 2W1UA 3AK0A 1OOPA 1PNGA 3GBWA 3M1HA 2C4XA 4K20A 3LA7A 1A8DA 1MS9A 4YG6A 1FATA 1HN0A 3WNXA 5LBCA 2DVGA 1CAXB 3R0RA 1RUF2 3SCHA 4IV3C 2RDNA 1RGSA 5FWEA 2GP5A 3WP5A 3RMXA 3ME2A 5ACA1 2XLFA 1LHVA 1TME2 4RSUA 3RPQA 2IXHA 2GNTA 4BWOA 4D6RA 4JHZA 1FPN3 1W6PA 4JHTA 5IUQA 2V73A 1CX1A 3AYEA 1W99A 3I3DA 4DS0A 4PI2A 5EJZB 4AHYA 4DUVA 3PU3A 1P8JA 3HN3A 4XQ4A 4Y4RA 4B7KA 2VZOA 5DZEA 1CAVB 1SLAA 1M4WA 4COWA 4OI4A 4R4ZA 3MLJA 3NNLA 4Y26A 2Q1FA 3OCPA 3WW3A 1RYYA 5CFDB 5I8YA 2Y8KA 3IB3A 4EZ4A 4E27A 4TZDA 1HB1A 4BISA 2X5IA 5IJRA 4MGTA 4CDQC 1HB3A 1AR73 3U07A 5F32A 4FQZA 4JQTA 3ZXJA 4AHWA 4CPBA 1S2KA 1LECA 2WLPA 4P9XA 3RZMA 3BVCA 4RS5A 1OQDA 1W6MB 2AEZA 4YZ3A 3N4MA 2JDPA 2GH8A 4LPLA 4ZS2A 1SBEA 1U5IA 5IHRA 2R30A 1O4TA 4IL7A 3IAQA 2X53S 3CIHA 5CFCC 4YM2A 2ZOEB 3IDBB 3JQWA 1KGYA 3KV6A 2JICA 2W92A 4GMP0 1SMVA 3FLPA 3H8OA 5LRRA 3AKRA 5JMCA 3O12A 3R4UA 4Y22A 5A33A 3RZGA 2RS53 4NWVA 1Y4WA 2V72A 1JYXA 1ASJ1 1YFWA 1NXD1 4A2UA 2UWCA 2R071 1JUIA 4NPMA 5I8TA 4PDWA 4NHXA 3NV2A 3WW4A 1ULEA 4QX7A 1Y7BA 2XKPA 1H8VA 4DUXA 1QNYA 2KR2A 1ULPA 1B09A 2RMU3 1C8M2 2GU9A 3I2HA 4N90A 5I0SA 1O59A 1SACA 1RUI3 2A73B 3PTYA 5DDJ2 1RUG2 2W91A 2Y60A 3RQ0A 2ZGRA 4UBHA 3S30A 4GH4C 2B7YA 3T4VA 3KVBA 2QZ2A 1YFYA 3MUY1 4GQ7A 4XZPA 3H8XA 1JZ3A 1S0FA 2ZX1A 4IEWA 3RDIA 3RWKX 1D0GA 2RS33 3A23A 4L99A 4FAGA 1BKZA 1J3RA 2E26A 4N43A 2PQSA 4QX5A 2GNBA 4ATFA 5FPBA 3POEA 4QKDA 3I8TA 1REEA 2PMWB 5GZEA 3VBFC 1V6NA 1CX4A 2ARXA 4TWTA 3LDRA 5FYBA 1GWMA 3T4HB 4IE5A 5J36A 5A6ZA 4HSJA 1H30A 4FXKB 4A7ZA 4Z8BA 3FL7A 3VDDB 3KWVA 1XU2A 1RUF1 5CFCB 1RUG3 2MEV1 4H3WA 3WG1A 1S0DA 1DGRA 1DCSA 2UU8A 2VCAA 4N9IA 4OCTA 1W6QB 5L36A 2VC9A 4Y22B 3MV01 2W39A 2QQNA 3KB5A 3QCWA 4M4RA 4LHKA 5F3GA 1H2LA 1EAH2 1PNFA 1PM7A 3PUIA 1RJ8A 5AVPA 3VBOA 3BALA 4IE0A 1OA4A 2XUMA 4OI1A 4AFCA 4NIAA 2VZ3A 1HJFA 1DBNA 3GF6A 3ALQA 1OVSA 3LCPA 4HK8A 4S2DA 4XDOA 3LA3A 3E5UA 2EVXA 1IG3A 2WT2A 3DXTA 1ZZBA 1H2MA 4AE2A 1W03A 5KHKA 1RUC3 2D44A 2XHNA 2Q1ZB 1QXPA 4LA2A 2F17A 4HKWA 4PDWC 1GNZA 5FK8A 1J58A 5FYVA 1W0NA 4Q4V3 1UX6A 2JG9B 4A3ZA 2FDJA 4TLFA 1CZVA 2JB8A 3LPGA 5FAXA 2VTFA 1NKGA 3VBHB 3WXPA 3ZYFA 1WGPA 4D8MA 1MVQA 5C5TA 3AL6A 4NIDA 1PO22 3AMHA 4NRMA 3AC0A 2XBO3 5C33A 3OBZA 4NIHA 2FZ2A 2D5HA 1UAIA 4NUBA 1HQLA 4IEPA 1GOHA 1C5HA 1VE0A 5I0DA 4XAAA 1Y9QA 4CU8A 2ETEA 1VAKA 5A6XA 3ETQA 2ZGMA 1KFUL 4QGMA 2DUQA 2R16A 4B3NA 2CAVA 3KGZA 1I9RA 4AGVA 1MQTB 3T2PA 4CDQB 5IVVA 1Q5OA 1WA4A 3H42B 1MZEA 1OOPB 2QQPA 4XF3A 2ZABA 2GNMA 1H8TB 1KDMA 2ZGTA 3OBRA 4NHKA 4QM9A 2Y6JA 4AHZA 2R041 4DINB 3EJKA 3U4XA 3RYKA 3ZXGA 1ZYBA 2GN7A 2K2SA 5M0TA 3PVNA 5FWJA 1UY1A 2E9QA 4QM8A 1O5UA 4A4AA 2DFBA 2ZHMA 3ZFFC 4FAHA 3POFA 1DQ5A 2ES3A 4X6QB 3RWNA 4GH4B 5LWBA 3N9PA 5JXJA 3WUCA 3VBRA 1RUJ3 3I2DA 5FPAA 1ZVFA 1C4RA 3MGUA 3MIBA 4XYXA 2HWB1 4FSJA 4OZOA 1FOD2 4AEJA 1TME3 2QDRA 3GZTB 1BMV1 4HVRA 4ASMB 1TVGA 2HBTA 2P5BA 1PZ7A 1W9TA 4UW4A 4CXYA 2WQZC 1LESA 2VW2A 2J22A 1ENSA 4LUMA 1I6XA 4UW6A 4FPEA 4AEMA 1K45A 3IAPA 4M3CB 5GLVA 4YZ2A 4HN0A 2ARAA 5JSRA 3UL2A 1ZRCA 1LEMA 4OI0A 2RDQA 4BQ1A 1HRV1 2EAAA 3NV1A 1VBA1 4TYSA 4XILA 1IPSA 1NA1A 1E5HA 5FXWA 4FFHA 1UZYA 4WM8C 5CU1A 4LBQA 1OKOA 3U4SA 1W05A 4CDXC 3HMYA 4KWUA 1H4GA 1GZTA 4HT1T 5BYNA 5FPXA 2RJ2A 1AF9A 4E4SA 2JDZA 4L97A 4QPYA 1YXWA 3M3CA 4PQQA 5EJ1B 5BPXA 5JZGB 1PIV2 2DCKA 2Z42A 4COUA 2ZGSA 1JZ7A 5LBBA 3Q8BA 2VZRA 3K75B 3QOPA 1TMF1 4R4XA 3WINE 4C1WA 2CGNA 1SQ4A 1UKRA 1ZBE2 4YZ5A 2GC1A 3AM2A 5L73A 2PHTA 1ASJ3 1PO11 2PLV1 3SKVA 5G05L 4QT6A 2ZKNA 4XXAA 5FYYA 2Y26A 3AZVA 5I8SA 4FXGB 1SZBA 3IIIA 5JPNB 3ZOIA 4XC9A 5C3RA 2BOIA 2JDKA 2VBBA 2WDBA 1SDDB 1QMJA 1GQHA 4HPKB 4E8CA 1HXS2 3N35A 3CLPA 3BTZA 4QQ2A 1KDKA 2WO2A 4OULA 4AI0A 4E2QA 3IBMA 1JZ6A 3ZO0B 3ZPOA 2QQKA 1EPZA 1MEC2 3HQUA 1UO9A 1XNAA 3DEMA 5EWSA 1JUHA 2W47A 5JOWA 4UF0B 5FYSA 4XUNA 4DFSA 3WW2A 4OHWA 1XNCA 1A34A 2E63A 2D3RA 5IATA 2V5YA 1CD3G 2JJ6A 4PI0A 2XVKA 5C4WA 4BU2A 3NJZA 4FOYA 5FLHA 4IEQA 2VPVA 2GZWA 4CCCA 5E88A 2OZ6A 4IV3A 1F8VA 1DG6A 4RGGA 5C3SA 3KCYA 5FUPA 2C5DA 2XPJA 2PHRA 4P9WA 1X8EA 1WKYA 2X10A 4BQ5A 2KD7A 4CUGA 4G9SB 1N1TA 4GALA 4AYUA 1QDOA 1UOGA 3LF7A 3GHNA 1VBC2 1WLTA 4QD2A 5LK7B 2F6BA 3KGLA 3U0ZA 1DZQA 2QE3A 2AACA 3WNLA 4C8DA 3SLIA 3WDXA 2YHJA 1QQP1 1VAVA 4QPGB 1PMJX 1CAXA 5FZ6A 3WQBA 2RR13 1PVC1 4P02B 1AR71 5T5LA 1WA6X 4KU7A 1AZDA 1JI6A 5LZ6A 3I54A 4FTBA 4XF4A 5HV4A 1RUE2 3PLQA 2FMDA 4RQPA 1NG0A 4YW6A 2FCVA 5GLZA 4E4ZA 4G3YC 1LHOA 1HN1A 2YMZA 2G19A 4QKBA 4FOQA 1LGBA 3LKJA 3B93A 3WEZA 1NY71 1Q8PA 1HRV2 4EV0A 5FY1A 1ZZ8A 1UKGA 3GHMA 3VZLA 1VMJA 4ARYA 1R091 4MADA 2FCUA 2MNGA 5JLVA 3NV3A 1SG3A 3HVDA 2RM23 1Q8QA 5FZGA 2PN5A 2IC1A 4BQ4A 1UY3A 2ID4A 2QKDA 2RJLA 3ITQA 4EN0A 5C7GA 1BJQA 4B8EA 2PA7A 2RS12 2HWE2 4N9HA 1W8OA 5FZKA 1F15A 3AKQA 1FV2A 2E32A 3K2OA 3L9JT 4IEZA 4NMIA 2CV6A 4XJUA 3ZYPA 4Q8LA 2D6KA 3TEYA 2BFUS 2OYZA 2GC3A 4AI8A 3SC7X 4OMCA 2RM21 4JGYB 2TNFA 2D40A 3W5MA 1AR91 3WHTA 1QEXA 4GMP3 5A7QA 4A7KA 3UK9A 2ADEA 1VBD2 3RNSA 4B7EA 1LULA 2QCSB 2Q5TA 5A33B 2JG8B 1MQTC 1V6JA 1F4HA 2VUCA 3IMNA 2HWF3 4KBBA 3PURA 5B4NA 5F5CA 5FP8A 3USSA 4LLOA 3R4DB 4RGKA 3WDTA 4FPGA 2R062 4YGCA 1SCRA 5FY7A 2HWD3 2GSYA 2DCYA 2DBNA 2JB4A 4YVSB 4B1MA 3ELNA 1PGW2 2VOXA 5FOJB 4LOTA 1YYNA 1UZVA 2R073 1C1LA 2WINB 3SISA 1EPWA 3JD72 4XJZA 4XXPA 3I3EA 3NVCA 4NAMA 5JIAA 3N9NA 1VBE3 3TN92 1EUUA 5KXCA 1Q43A 4FI9A 3T3YA 5HCAA 4XUTA 2XQRA 3OJBA 3BTXA 4G4FA 4LHNA 4BE3A 4NE9A 1DIWA 1BCXA 5FO8B 3H7YA 2ZMNA 5KBFA 5KXBA 3LIGA 4XFHA 3O1RA 4QPIB 3AMNA 1BEV2 1KQRA 1BVVA 1VBB1 2UY8A 4Y3OA 2GC0A 4LUKA 3S6PA 5FZ9A 4A44A 2SBAA 2VXJA 3ZXDA 4XBQA 4XCBA 4BIFA 1JZ4A 2RR12 5ACA2 3AYCA 3Q8CA 1HLCA 1W6QA 2LM3A 1ST8A 4HBNA 2BNMA 1PO23 3LEGA 2WAOA 4FOVA 4QGNA 4IE4A 3W9AA 3GALA 4CXXA 3FHQA 3MW3A 4NHMA 5GKAC 2G1MA 1GANA 1R083 1WCKA 3D0JA 4AVVA 4B4PA 3INAA 2OVUA 2QNKA 5D8AC 5DMYA 1WLDA 3ZX7A 3POJA 5DQ0A 2C9AA 1EUTA 4MYEA 5CFDC 4IV1B 1VMFA 2G4IA 3TOJA 1VPHA 1ZRRA 2WT1A 1JU3A 1LOBA 5DUVA 1ZBA1 3GZEA 5E8AA 5JSOA 4NIIA 1BBT1 4KMQA 5F3IA 3H3LA 3I2IA 4COVA 3OY8B 4JQRA 4PQ9A 1EP0A 4BA6A 3AP4A 1FX5A 3ZYRA 4XBLA 3T30A 1X50A 3ZYBA 5IYYA 4YARA 1YEWA 1LOGA 4S2HA 2VUDA 2RS13 4MGYE 1CESA 2R1BA 4XMAA 5L9VA 5BV6A 2PHXA 3PUSA 1AYM1 5F5IA 5A70A 2H0BA 3ZLIA 2D3SA 1UOFA 2QJVA 2ZX3A 4BB3A 2Y34A 3M3QA 4YM1A 1DZTA 2RM22 5J96B 4RS5C 1QJY3 1GP6A 3VBUC 2JIJA 3OSDA 1OLMA 3VD4A 2OQ6A 3C7GA 4PLMA 1RTVA 4YM0A 1E57A 1MR5A 1S0BA 1YQCA 2UYBA 1MQTA 3N7JA 1RUH1 1YFXA 3CU7A 2IFRA 1NCRB 1PX3A 3SXWA 1IS4A 4OVEA 3IPVB 5G04L 3W59A 4LIUA 3WD5A 4Q8KA 1DYKA 3T08A 1LRHA 4FQ4A 5A6QA 3KD4A 4JKKA 3RI8A 2R49A 3F95A 2JD9A 5CG9A 2AUYA 3AJYA 1TME1 3I2FA 4BHPA 2R061 3ACIA 4OHZA 3ILNA 3USUB 1ND3A 1VIWB 1SPPA 5LA0A 1AL0G 1UQXA 3I2GA 4KGGA 2XGXA 2VOTA 3POIA 4DEVA 3CL1A 2YY1A 1N47A 1J59A 4LKEA 2VR4A 2TBVA 3FHAA 2I74A 3ZKUA 4JGZA 1CONA 2YC2A 2JKBA 3M4FA 4Q4X2 1D2QA 4GIQA 2EA7A 4YG0A 4RR3B 1UZ0A 2JIGA 4WM8B 3H9AA 1H4HA 1TE1B 3Q8AA 2ORZA 2DDUA 1J3PA 2XWBB 5J09A 3PMSA 1US3A 4TXWA 4W6WA 1COV3 1HKDA 4YW7A 1ZZCA 4R9AA 5JI7A 1BXHA 5GZFA 2WYFA 1QHDA 3LA2A 2R1DA 2VZPA 1U5ZA 1W9YA 2VNVA 4RR3C 4CPBD 4EE2A 2MEV2 1XYPA 4KBZA 4UW3A 4WBBA 3ZDSA 3B5LB 1JYCA 4XURA 4BQYA 5B2GB 2HWD2 4Q4Y3 1JU4A 4QB1A 4YW4A 4CCMA 5C8CB 1N1SA 3ZVXA 2R063 4AQSA 5F37A 2Z2SB 4DXSA 4AEDC 4YPJA 3NL1A 4FCAA 5LRSA 5A3PA 4FOWA 5FYZA 1PK6C 3IDAA 4QU1A 5L7OB 2OXBA 5BNNB 4FTEA 1UXZA 4BCUA 3ZFEC 3N7LA 4AGRA 1JYVA 1OHFA 4YYOA 2CDPA 2J1EA 4OMDA 4M01A 3A21A 5JI9A 1ND3B 4LBKA 5EZWA 1NZIA 1DZRA 4RHV3 4NJ4A 4QKNA 5DZFA 5HXMA 2WO1A 4PBPA 1H8TC 4AFMA 1K5MC 4IW3A 3ZKYA 2EALA 3GJBA 4AQ6A 5E89A 1F2NA 1W8WA 3CJIB 1W6MA 4HOOA 1SBDA 4META 4MGQA 3WV6A 1W6PB 3OUJA 5FZ3A 4XVHA 2X29A 3O1OA 4F3JA 4AZZA 1LODA 5IVBA 4S2FA 1XNBA 3P6BA 4Q5OA 3FFZA 1UYZA 2BGCA 3T2QA 1IG0A 2WS93 2ZEZA 4I3PA 3AKPA 4AGGA 1RITA 4P9GA 4EWAA 3MUZ1 5GLTA 1IQDC 2AH2A 1WW6A 3M2MA 4KQ7A 3VL9A 4BMEA 4FBFA 2YXSA 4XJ8A 3WNNA 1ENQA 2XHKA 1RUH2 2R042 3B00A 5HCHA 3N7MA 3AXEA 2GH2A 4K40A 4MX3A 1XSQA 2OW4A 3E5XA 3GNEA 3U14A 2QQUA 4FP3A 4DZGA 5HPOA 4KU8A 4XF0A 5T55A 1SLLA 1ND2C 3Q9OA 5BNNA 1C3HA 5FZLA 1KJLA 1QF3A 4LK6A 5D8AA 4H7MA 4Q4Y1 2WBKA 5EHDA 3IT8A 1EV11 2EICA 1BEV3 1OH4A 1W3XA 1ULFA 1V9U3 3DGTA 1SEFA 3AFKA 3OPWA 2VMGA 1LOAA 1PVC3 3H1YA 5TSWA 5IVFA 3A0KA 4LBOA 1B35C 2Y6LA 5KC6A 2P6CA 2QQVA 2VW0A 1L7QA 3UNPA 2D6LX 5CKQA 2GMMA 2WFF1 4DUWA 2BGPA 1AX0A 1W04A 4PJYA 2BUKA 2EXJA 2ZEXA 3AP5A 3O7OA 2JDMA 3TNPB 2A3XA 2IWGB 5KHHA 5FZHA 3ES1A 1RHI2 1ZBA3 3BTAA 3POGA 4OUSA 2EIEA 1KS4A 1FPN2 2C0ZA 2D6MA 1D0HA 2VVDA 2WNEA 1XNDA 4D6QA 3MW2A 1AHSA 3E6CC 2PHUA 3OYWA 3VBSA 1R081 3BIWE 3ON7A 2VW1A 3WDUA 1LENA 2VECA 2W52A 3WZ1A 2EIGA 2HWF2 1PO12 2PLV2 1VB2A 3CKHA 1WW4A 3EO6A 4QX1A 5F3CA 2WC2A 1GWLA 1ULCA 3GGLA 3J9SA 2RMU1 4I01A 1GLHA 2BVBA 3KV9A 2DFCA 3WQ0A 4P9JA 2E6VA 4LIVA 4FFGA 3WP4A 4GKYA 4AFAA 3CZJA 1HRV3 4IEVA 1K5MA 2A5ZA 2EXKA 5F5QA 5FP7A 1OOPC 2PYTA 3WNPA 3ZXLA 4LXLA 4NR1A 4JDNA 4OLLA 3NSTA 5AVAA 3ZSLA 5JVVA 3FN9A 3BCWA 2BPA2 1LEDA 1MS1A 1LGCA 2XH6A 3S7IA 3UKNA 1GU3A 5FYIA 2XJTA 1UZZA 4M0HA 4ISRA 3VBOB 4QMAA 2VCBA 3FMGA 4QX0A 3VZJA 1GICA 1QH7A 5ANNA 4IXLA 1RIRA 4JGZB 4LO4B 2BV4A 1LCLA 1POV3 1CIWA 3MYXA 4P9YA 4XF9A 3KF5A 2YBSA 3R05A 4YW3A 1JODA 4CEYA 2WQ8A 1CAUA 5IK5A 4CDQA 2YBKA 3LSEA 5J98B 4H14A 4K8RB 3WCRA 2HWC3 3N9LA 3CZUA 3PTRB 2WAAA 5A7OA 4EN6B 3P3NA 5EXOA 1JXNA 1TEIA 3OYWB 3VBSB 1ZRFA 4Q0QA 5JOYA 1ND2A 5L9RA 4FPFA 4LBQD 2WWUA 1TNRA 2FZ1A 3CJXA 1CGPA 1AXZA 1J1LA 1ZRDA 2ZA9A 3KLSA 3I7DA 5FZ0A 3FE5A 4JC1A 4LHSA 2GAUA 3LAGA 4JZRA 1WBLA 2BNNA 4ES9A 5CADA 1FT9A 4O7XA
chains in the Genus database with same CATH topology
3MPPG 1MZ6A 1VBE1 1PVC2 4FT8A 2ZJCA 5J48A 4LT5A 2GMEA 3U11A 1R1A1 3MIEA 1CQ9A 1JBCA 1RVF2 3G7DA 5BNPC 1POV1 1NCQB 4JDMA 1AUYA 1QWRA 4DXZA 4DY5A 3VBFB 1JW6A 5FPZA 3JU9A 2ZGOA 2YDEA 1MEC1 4WZFA 4KWLA 5BY5A 5C9AC 1R092 4BH9A 1XE7A 4RQPC 3LZZA 2JXAA 4FO9A 1RHI1 5J7MA 2VVFA 1H1IA 2XJQA 3PJQA 4IERA 3IDEA 4L11A 4IEYA 4Y1UA 3JB8A 1IGOA 1RUH3 3FFQA 2OIIA 1PK6B 2WJSA 1H0BA 1KS5A 1LOFA 1R082 4OHVA 5FLJA 1RUF3 3OY8A 2WLQA 4LO5B 2WZR3 3TAYA 3TBDA 4IETA 2HWF1 4D7YA 1G9DA 4M3CA 4C1XA 4UW5A 4L8QA 3PMEA 5AC93 1YHFA 5FO7B 3NAPA 4HVQA 3O14A 3M7AA 4KG8A 4S2GA 3CO2A 4J6GA 2ZGUA 3D6EA 2YV8A 1F9KA 2WS92 3TYJA 5JZGA 2AENA 1AYN2 5HCFA 3JBG1 4BLIA 1QU0A 4QXKA 1QQP2 3AKTA 4FPYA 4E2SA 1KRIA 4MXWB 1QDCA 4LBJA 4PCRA 3WUDA 2G9FA 5KWRA 5CIRA 4D94A 4MGIE 1RUJ2 1RMU1 1UPSA 1UW8A 4C0BA 3MF9A 4HLTA 1IOAA 3KM5A 5FDBA 4BZ4A 1DFQA 4AEDA 5SV5A 1ONAA 4RD7A 3MIDA 2ENRA 1NCRC 5GZGA 3LOBA 1X8MA 2K9ZA 3S0MA 3THTA 4D7TA 2XL7A 5JSPA 1SLIA 1FOD3 1WD3A 2FHRA 4UBGA 3AMMA 2CY6A 1UMZA 2VY0A 2VGDA 3HBZA 1YNAA 1U12A 4AXOA 2RR11 1G7YA 4IV3B 5DXDA 3ZFGB 3AXDA 3H3ZA 2ZTNA 2F4PA 2FMYA 5C6CA 5K0UC 1S0CA 2ERFA 1SLCA 2LTNA 1GFF2 5SV8A 3VKOA 4I0WB 3ZN4A 2DU1A 3NAPC 4L2NA 4ZXKA 1K5MB 4WVVA 2QZ3A 3B9IA 4MH0E 4I0BA 3VKFC 4ONUA 1QJX1 5T52A 4Y1XA 2UWAA 3POWA 4Z1VA 2EF6A 5GZDA 2FBEA 3BODA 2VQ0A 3VKLA 1EAH3 2PELA 2JE9A 1W6OA 1XE8A 3ZFEA 5BNPB 1XNKA 3AZYA 3IN9A 5E16A 3CJIA 1DGWX 4O9GA 1CAUB 1S0IA 3E97A 2Q0AA 3O0XA 4K8FA 4KWJA 1PZ8A 3AYDA 4AEKA 3UKTA 1KJRA 1NXMA 5K7PA 2QFEA 4YLZA 3ECQA 1S2BA 3VBHC 4CEWC 4QPIC 4QGLA 4D3WA 2ZHKA 2PTMA 3ZSEA 2WS91 1BVP1 3ES4A 4PLNA 1OA2A 3JBG2 1J1TA 1DGRN 1HIXA 1VBC3 1ZZ9A 3V65A 4DMIA 4CP0A 3R4SA 4LA3A 3T2TA 3MW4A 2D3PA 2BBVA 2HEWF 2MPFA 1GV9A 4KNCA 5ABJC 2IXIA 1MS8A 4GWMA 1OKQA 4ORFA 4U2AA 5T3NA 2AYHA 3VZNA 5LEKA 4EN8B 1PVXA 1VRH1 3ZMNA 1WLCA 2GDFA 2OUHA 1M06G 4M3CF 4Q4X1 1HXS3 2CWMA 1UU4A 2RE9A 4GMP1 1RHI3 1ZBA2 3MIHA 3QACA 1W6NA 3M3OA 4CDWC 2ZAHA 4BMBA 3UKVA 1SLBA 3OPZA 4D69A 4FPKA 1BZWA 4O9EA 1QJY1 2NMOA 2HWD1 2DVAA 3J8F2 2OA2A 3RJRA 3IDCB 4Q0UA 5T54A 4YFZA 1IKPA 3ZYJB 2WZR1 1D4VB 1YI9A 2CWSA 1QNWA 2ATFA 2WA4A 3P3PA 4E4DX 2WIIB 4LLFA 4YGEA 1BYHA 1QXJA 5F6KA 3ZIXA 3AZXA 4IV1A 3VGIA 3OTFA 4N43C 2NN8A 3MZHA 4NWWA 1ENRA 4WZCA 4XJAA 2YGLA 1CJDA 2B46X 2WNUA 4WM7C 2D98A 2ZMLA 3NWKA 2NZ9A 4U36A 2X5IB 3SCGA 1BMV2 3RYPA 1V6OA 2PAKA 5LEJA 1PHMA 2ZACA 3G6JB 3M70A 1NZCA 3VLBB 3FBYA 3GZUC 1SFYA 1G9AA 5DG2A 5IK7A 4HZFA 3DL3A 4HKOA 1V6LA 4CEYB 1FNZA 4LBLA 1WCSA 2ZHLA 2JG8C 3AX4A 3K48A 2D6NA 2Z79A 4PLOA 4Y20B 1Z7S1 1AYM3 1XXNA 4FPCA 1QJX3 2OUJA 1PIV1 3WG2A 1I5ZA 4XMIA 5ABJA 1UU5A 1PGL2 4B29A 3FX3A 1HX6A 1AR82 1NQDA 3KT4A 1ZBE1 2YYOA 2ZGNA 3FBMA 3VKMA 5CA6A 5HI0A 1HV1A 1URXA 3AMQA 3DF0A 1RUE3 2P3JA 5D1IA 2WNVC 1A3KA 2ZMKA 3IPVA 1D4M3 1UN1A 4E9KA 4GB33 4LULA 4Y1YA 3MICA 5CG8A 1R1A3 2V09A 1JHNA 3VN4A 2BWAA 4NOTA 3K51A 4Y4YA 4XQWA 1OPOA 1Y43B 3E6BA 4NN0A 3MFAA 4LO7A 5FCCA 1HQNA 1O4YA 2DVBA 4JGYC 4Q4V2 4DRRA 4HKLA 1WMDA 2KXLA 4CDWA 4L9BA 4AK3A 4HSLA 2XBO2 4WVZA 1I1EA 2UWBA 4SBVA 2CL2A 4M3CE 4XHXA 2WZR2 1YLLA 1NA1C 4XE9A 3HR9A 5L7OA 4XBNA 1PK6A 2BEOA 3PJYA 1DHKB 2BW8A 3WVJA 4X6RB 2VOKA 2WWSA 2ZAAA 4YW2A 3LB9A 3LOIA 3E6DA 1VBC1 1AR93 5A32A 3RMYA 5BNOB 2YC0A 4GXLA 4QHBA 1A78A 4ZU7A 4Q1PA 2FQPA 2WL1A 2DV9A 5KC5A 5C4WC 3EHKA 3X29B 3TNQA 1RUC1 1R1ZA 1UD1A 4R52A 4XOGA 5HCBA 1W0PA 4YZ1A 3H1WA 1CVNA 1SDWA 5K0UB 2B42B 4XPVA 4EWEA 4MXWA 4AFBA 1QY4A 5GLUA 2XL9A 3B7MA 4AVAA 2OZJA 1ULDA 1GNHA 3D0SA 3TWIA 4M0NA 2WSUA 4YM3A 4NHLA 1VB4A 2QVSB 4MV2A 5DDJ3 1OA3A 1Z7S2 4OZXA 2JEMA 5IK8A 3SCFA 3AFGA 2W68A 2NQYA 1FMD3 5T5PA 1IQAA 5GM0A 3IWZA 2Q1MA 5JCTA 1QJU2 3B9CA 2WSVA 5BNNC 5KHJA 1LU2A 2A6XA 3MPBA 4Q0PA 5K8SA 1VBE2 1NCQC 2DVFA 1LKNA 1GZWA 1S55A 2RMU2 4AI2A 2DURA 1VJ2A 1R1A2 4BM8A 4BPZA 4I09A 3VHRA 2IXLA 2B45X 2DCTA 3JUUA 4OUMA 4GH4A 1H9WA 3QD6A 4AWDA 1ZNPA 1S0EA 2BQPA 1RB8G 4P9LA 1NQJA 2ZGLA 3VHPA 3DPRC 1DU3D 3SITA 1YJLA 3AJZA 3WQ7A 5GALA 1CJPA 3ZFFA 1EV13 1W0OA 4RHV2 2IFWA 3EQEA 5D8AB 1COV1 2RHPA 4K1ZA 1ZZ6A 3V0AB 2O8QA 3TN93 1ENXA 2HWC1 2XBO1 1REFA 1F5FA 4NPRA 5FTTC 1AL22 2VULA 4XJ9A 3JD71 2A71A 5HBAA 1OMIA 2AR6A 4DQAA 1MS4A 3HT2A 1MACA 4JGZC 3I59B 3V0BA 5DZGA 4I30A 5JDBA 2LUWA 3L2YA 1IPJA 2OPKA 3VBOC 1QH6A 3VDDC 2YUEA 1CPMA 1J3QA 1V6KA 2D7FA 1JOJA 2ZX2A 5EV7A 1DGLA 2P3KA 4WM7B 4HVOA 3AYAA 1DQ2A 1VBB2 1AYN1 2BVVA 2VNOA 3VUOA 1UU6A 4XTMA 1DYPA 1NE6A 3ZXAC 2A70A 1O4ZA 3OGJA 4XFFA 3VHOA 3N3HA 1GZCA 4LBMA 4JDOA 4HPKA 4Q4X3 4L92A 5C9AA 4Q4W3 2D6OX 2ZCWA 2BFUL 5CB7A 5H9PA 2HKXA 1H1AA 4LR4A 4Y1VA 5ACA3 3ZFFB 1A8MA 4HK9A 1QQP3 1S0GA 4N53C 5CBLA 5T5OA 3MLKA 2LALA 1H2KA 1QJZA 4H7LA 3A4UA 3VZMA 1AXKA 4CDWB 5F1RA 3ZYGA 2ZKLA 4JTOA 3ST7A 2YGMA 2R32A 4CEYC 2BYVE 1RUOA 2HEYF 1V6MA 3SNMA 3VHNA 1IHMA 5I0UA 5I0TA 2C1FA 3KCXA 1IKQA 2I45A 4Q0SA 3KSCA 4PIZA 5LK5A 1GKBA 4CTEA 1NCQA 3BB6A 3ZIWA 4QPGA 5GZCA 3VBFA 1ND2B 4AQTA 3ZN6A 1RUG1 2MEV3 2O0OA 1MEC3 4I02A 3RJ2X 3ZMOA 3OD4A 4QQLA 4RHV1 4EJRA 1COV2 1VBD3 5CAZA 4D7SA 5I93A 5GJ6A 1RMU2 3ZSMA 4IEOA 1OSGA 1NOVA 4N53B 5K9YA 1RUI2 4JTNA 3H50A 3MDPA 4XJWA 2UY9A 2VG9A 5I0RA 2X8KA 4ZU5A 3HAGA 3NW4A 4Q0VA 1G9CA 4YZ4A 2YZ4A 2QDNA 4YVWC 3ZFGC 4YW5A 1LTEA 4BIOA 2EXHA 1DQ4A 1W39A 3CJIC 4EWDA 4OI2A 1LU1A 1WLWA 3D5OA 1AR61 1CAWB 1G9FA 1ZX5A 4IESA 2P17A 1CN1A 1GYKA 1OFSA 1REDA 2KM2A 4JRAA 1GZWB 2ZGKA 1RC6A 3KT1A 3NAPB 2WZPP 4A3XA 4QQPA 2GMPA 5L7OC 4GB31 1H1MA 1WCDJ 1VALA 1X33A 5J3UA 1IS3A 3OD0A 4OHXA 1MS5A 3HT1A 3FC0A 4C90A 1QJX2 1BK1A 1OD5A 1WW5A 4AG4A 2RJKA 4GULA 4YG3A 3NKTA 4GKXA 2CGPA 3N7KA 4XHBA 4LBNA 2Y0OA 3S7EA 3ATGA 1QOTA 2VUJA 4X8PA 1N3QA 3H7JA 4P9IA 1V6IA 3SH5A 1JH5A 3DPRB 4XQDA 2DUPA 3J8F1 2PFWA 4LO8A 1L3JA 4HN1A 1GBGA 3WY6A 4Q2FA 2W0XA 1F5JA 3HIFA 3AP6A 2HWE3 4QPGC 1NE4A 1JTZX 1NCRA 4DNYA 2IXCA 4INDA 3ENRA 5KXDA 2E7QA 1N3PA 1XU1A 4WVWA 1EY2A 4JVAA 5JOXA 3MI8A 3ZSKA 2D6PA 1JN2P 1FOD1 5EYYA 2R043 3SH4A 1AR63 3IIAA 4RFT0 1AVBA 1V9U2 3AP9A 4YRDA 5JPMB 4GA9A 4HFSA 3ZFEB 1VRH2 3VBUB 4KH9A 1Z7S3 1LOEA 3DN7A 4RA0A 3JB4C 3WG4A 2DTWA 3J8F3 4AVBA 2ET1A 2WNVB 3B69A 3LWCA 3MF6A 3THPA 3V64A 1VBA3 1VBA2 5GLWA 2N7GA 3SH3A 1AYN3 1ULGA 4B4QA 2WFF2 1CPNA 2P34A 4Q4W2 2IXKA 2AREA 2Q4SA 1VR3A 2ZPXA 1C5IA 3QLQA 1FPN1 2HEVF 4IV1C 4R9CA 3CNAA 1AX2A 2A7AA 2H6BA 2XLGA 1FMD2 5FLIA 2NYYA 1PGL1 1AX1A 4ZKTB 3ACLA 1RUD3 2R0FA 1Q3EA 2ZBJA 3SHRA 4C91A 1H2NA 1G6NA 2R0HA 3FZ3A 3JZVA 4N7UA 2H6CA 3HD8B 3VKNA 5JZGC 3KQRA 1HXS1 1CR7A 3ILRA 1LB2A 2Z69A 5FFOC 3D8CA 2Y38A 3M3EA 4MLOA 3ASIA 4YZ5A 5DUUA 4Q1RA 2D93A 3AKSA 3VBSC 4XW3A 4RGAA 4K21A 1PGSA 3A0NA 2WNVA 4WM8A 2VMHA 2BNOA 1DF0A 3E5QA 3WDYA 3O0WA 3PVEA 2WFF3 4CYDA 4OHYA 2RS31 2NMNA 2AZ5A 3FUQA 4EN7B 1D2SA 2VNRA 4MXVA 2XJSA 5BUVA 2UYAA 3PHMA 2VU9A 4YNIA 5C8WA 1C28A 1RUNA 1YCIA 3U10A 4MSVA 4IQPA 4R9DA 1S1AA 2A6YA 3V0BB 2Q8OA 4AFDA 1DQ1A 1XYNA 1WMEA 2WNUB 4K6BA 2WFPA 1V9U1 3VV1A 2WNUC 4WM7A 1RUC2 4Q29A 5KHGA 3AMPA 1B35B 1Q56A 3GBFA 1RVF1 1TQ5A 1W2UA 2VMIA 3WX5A 3GZAA 1T6GC 4YVWB 1NY72 4DRVA 3ZPYA 1S0JA 3I4IA 1IS6A 1G9BA 3AB0A 3PNAA 3FUOA 2DYCA 3CF6E 1PMIA 2YROA 1BBT3 1PO13 2PLV3 2D97A 2ZGQA 3ZN5A 3J4UH 4Q4V1 1Z78A 2E7AA 4Y20A 3RSJA 3H1MA 1NLSA 4BYYA 2E53A 1QGLA 2A6WA 5FQ0A 2EXIA 3NO8A 3MLLA 4N43B 1ALYA 1QJU1 2O8OA 2ET7A 3WLUA 1Z0HA 4QQHA 3ILFA 3R6SA 2G9GA 1AR92 4CZSA 2WA3A 1MVEA 4LE3A 5A3MA 1XRUA 3HQXA 1VAMA 1KXGA 1DQ6A 1HV0A 3FJSA 2XWJB 1XQNA 5FBZA 4ATEA 3LGRA 4AW7A 3D4KA 2DTYA 1WW7A 1LHNA 5JR7B 5JAXA 3PVBB 3HWJA 1QOOA 1IPKA 1Q8VA 2P37A 4EROA 5HXVA 4AF9A 3FLRA 3FHIB 3WDVA 1HRI3 1RUJ1 4JAAA 3ZYIB 1YI7A 4RR3A 4HL0A 1H9PA 1RJ7A 3EBRA 2PHWA 2GNDA 3JD73 1OI6A 5JIUA 5BXXA 2B8MA 2YPJA 1C1FA 3VBHA 4N53A 3UJOA 5H9QA 5FQ0B 1PIV3 3ZXEA 4R9BA 4CP2A 2DCZA 4K3UA 5ABJB 1VRH3 1POV0 3WP6A 2P3IA 1FXZA 4NVPA 1AL23 4Z92B 2XB6C 4P14A 3VBRB 3ZSJA 2UURA 3H0OA 3KT7A 1Y3TA 2XJRA 3VL8A 4CP1A 4Z2WA 1O5LA 1ND3C 1R093 1H8TA 1CAWA 2R072 5BNOC