2VZTA

Complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 275
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vztA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vztA03
1EEYA 1ZVSB 4A2LA 3VFTB 3ARDC 5MEND 3LEVL 3LQAL 1CR9L 5IFAL 3LS4H 3NJVA 5HGHB 4UV4H 2Q7YA 3U48A 5DURD 5DYOB 3WLBB 2P8PB 1Y6NR 4OFYA 1IGTB 4R26L 3CCHA 2V38A 4JDTH 5EJ1B 3BUTA 4JO4L 4RMRA 3WJLC 1MWOA 4PRHD 1A6VL 5D5ME 1QPKA 4HLJA 1R5VA 2V5DA 5I76A 2QR0B 4MCZA 2RCSH 1TA3B 4KTEL 3DWTA 2QL1A 4HWBH 5DR5H 3MLSL 4YK4B 3QQ4A 3PV6B 5KVMC 2AXFB 4HUXA 3R06A 1DSFL 4J3TA 2EPLX 4U3HA 5J06A 4FXGA 5D8JL 5LKNA 4HA3A 1TLKA 3DVIA 4NDMB 3GIZH 1CD8A 3IJ9A 3BMVA 1BZ9A 5AAWA 1CGSL 1V7NH 1GJWA 1MLCA 2ZOLB 3KE0A 2YEZB 5MENB 5A6MA 2AJZB 2H8PA 3IXAA 4TVSa 2N56A 3S34H 1O5DT 4TSBH 2WO2A 1OARL 1L6ZA 1QOKA 5HYSA 3V2AR 3VFWA 1KWGA 4GSDH 4TSCL 5DS8B 1JI6A 2ZUUA 1CDGA 5BXFB 1WAAA 1NANH 2K7PA 2NY7H 3E1F1 1YJDH 3ULSB 2HN7A 4WFED 3HE7D 1CLVA 3SCSA 4Z6AT 1I7RB 3L3OA 1MLCB 1H0DB 3FO0H 3FT4A 4UR9A 5DUMH 3LS5H 3VH8A 4OLYH 1VIWA 2IG2L 1FL6A 2GJJA 1WAAF 1GGIL 4UFMA 3AIUA 3PGDA 5MEOA 2W46A 1KLUA 4YHYB 1XZ0B 5F7LB 3N11A 1OAKH 4AC1X 2HVJB 4V2CB 3D5OF 4QY8A 1W9DM 3FXYA 3CZJA 3LEIA 1IV8A 4JFQB 4YWGL 4M5ZL 4PJEA 1YNTB 2OTPA 3REWA 5DJYA 1I8KB 1MCDA 5ERWB 4GG6B 1A9BA 3U36A 5CSBA 5C07D 5I1AA 5FO9A 5J1SC 4FABL 1MAML 2O92A 3OF6D 1DSFH 1AC6A 1KENH 3QH3B 3MOQA 5F1NB 5CQ1A 3V5HB 1WFTA 1A14H 3SJVB 4XTRD 2E7BA 2H2SC 4N0FA 4U49A 2P45B 3MNVA 3SDYH 1VFBA 2WAGA 3PABB 1Y0LB 4KY1H 1T7YA 5I1EH 3I6KB 4X6CA 4LU5L 1BFOA 4Y2DC 2E33A 3KHQA 5DJCA 4PCTA 2JIXD 2DT3A 4P4KC 4PG9B 4KDWA 1JNLL 4OKVA 5IMKA 4TVPH 4ZG1A 1F4YL 3IDGB 5AWNL 3OAZH 5LQBH 2VIRB 3FO1A 3A3HA 4WWKB 3MRFB 5GRUL 1G9MH 5F89A 4UNVA 4S3JA 3C2AH 4AYFA 4P5TB 4PS4H 1RULH 1YMHB 2EIZB 5D70H 3VXUD 3EFDH 4AM0A 4JFZL 4MNKA 3MO1B 2IQAA 1JDAA 3BIAX 4YZFF 3DO7B 4TNVK 4A6YH 1HZHL 2FZ3B 5BMFL 2VCBA 3SCMB 1XGRA 1N5AB 4L4VE 5CINH 4PJBB 2G60H 4OF3A 3MRHA 2CR6A 2XVLA 4PUDA 3WD1A 4NBXB 4PJ7F 3IDXH 1MREL 8FABB 5DZOA 1E3XA 3KJ6L 1AIFB 1F11B 3REVB 5CFHA 4BQ5A 2XTLA 2FBJH 2PQSA 4N0UE 3CPLA 2JJTA 2BBAA 3FOLA 1KTLA 3ARQA 3UTOA 1J87A 1OTTC 1KJVA 5J11C 2NNAB 4KK5C 1CT8A 1X7QA 4P4RA 1ZBKA 1GHRA 2OJZL 3QI9C 2RHEA 5KSAC 1PEZA 3ZHLA 2ICWB 2YUXA 4NQDB 2ZOKA 5IG7B 2DDQL 2RGLA 4CW1B 4GZIA 2YRLA 4RNRA 4NRSA 3QHZH 1D9KD 5E70A 5E99L 1BWWA 1B6DA 2YZ8A 5C8JA 4MVBC 1DN0B 2IADA 1C5CH 4UIMB 5B4MD 5EBWB 1KCRL 2FATH 3ORJA 4RGNC 1HNGA 4PGDA 1X5FA 2V17L 2W65B 3U7VA 4JFXB 4MVBD 4BZ1H 5JNYA 3MC0A 1DEEA 2EE2A 3FT2B 4U1KA 1KCVH 3T65A 4YNYA 3UZEA 5GSVA 2VXUL 1YY9C 3VFPA 3UJTL 4ODSH 1RPQA 4PGJA 4U1SA 4PGEA 1V08A 4TOYH 4DKEL 3OA5A 1Y7VA 3VGDA 4AZCB 3E6FB 3MLZL 3QIUB 3AAZB 1AMYA 1S9XA 2F61A 3QUXB 4D8MA 3L5XH 4FQ2L 3TYFB 2IEPA 4G5ZH 2VXUH 5J3HC 4UILL 3D2UD 3INUH 3VGGA 5D6CA 3S37X 3CSYB 4HTYA 3C6LB 1TCMA 4OI7A 3BPLC 5C09A 2GSGA 2DSZA 1NX9A 4G3YH 3HUJA 5D9SA 1K8IB 3U6RB 3MMWA 4KJYA 4N0YL 2J4WL 3RAJL 4X7TB 1QYGL 2C3HA 3MV9D 3MLYH 3EFFA 1IBGL 1CEOA 3TJHD 4HUWA 3DUUB 2A6JB 5A40E 2VKXA 1RP8A 1FH5L 2J7GA 2H3NB 1LQ0A 2YK1H 2ZUNA 2H6PA 1OWWA 4I9WE 3LRSA 5ABDE 4LGXA 1NEZB 3O2DH 5F1IB 4EK7A 4H2CA 1GOQA 3OJDB 5IVXA 1G01A 3EOTL 3KPNA 3T77B 4PRWA 1RZ7H 5ALCH 4QHUB 2HJLA 3TO2A 1E6NA 3TESA 4LU5H 5FDWB 4MGSA 4Y5VA 1W1VA 4TUJB 3HZKB 1RZIA 3MJGX 2PC8A 4HUNB 4IMLA 1MLBB 2JLLA 4Z18A 1U8QA 4PRAA 1OH4A 4X4XA 1VGEL 3T8XA 2XQYK 1JHKH 3AY4A 5JHDB 3IB3A 1C93A 1Q8MA 2F74A 1KFAL 2CNCA 5FUCE 1QSFA 2AERT 4MHHI 4HFWB 5JQHC 4FI9A 5IB3B 5EU5A 4PQQA 1CGXA 2YUVA 2VCCA 1VFBB 1MW0A 5F9WC 3ESVF 1UR2A 3RUGE 1BGXL 3CNKA 3QUYD 2Y6KA 3THCA 4TRPL 5GGQL 3BYTA 1N0LA 4ZOCA 2WWKO 4L3EA 4OJFH 4UT9L 1UENA 3HPJB 4NZTL 3CVHA 3WKZA 1C5BL 4FFZH 1WNOA 3CFBA 4X7FC 1F4YH 3CU1A 1J0IA 1SJHA 2DQCL 3TA3A 5C0FB 2BSTB 1OT5A 5CGMA 2X4QA 4QCIB 3VG9C 1FG9C 3GMNB 3WLBA 1JGLL 4QXWA 1WDSA 3FO9B 4BF7A 5GS0H 2E7CA 2DKMA 3QWOB 3VXQB 3KS0H 2Y72A 4UT7L 3HE6C 4JRYB 1GMMA 2CR3A 4OMCA 3JWDL 1MHEB 5JBDA 3FB8B 1MFCL 3V6OA 2A9NH 3MLXH 3QHZL 1OGTA 4LCIL 3MNZA 4U1LA 1OF2B 3GM0A 3IAQA 4C4KT 5DT1L 2Z31C 1BGGA 1NMAL 1I8IB 1U58B 1BJ1J 4NQEE 1L7TL 5F72S 1Z3GL 3G5ZB 3QEHA 2D2OA 4XNMA 5L7XL 2WLYA 3WDRA 3BEWA 3AROA 1LNUA 3MBED 4YPGA 5HYEA 2I9TB 5I6SA 1IQDC 4XVJH 1NGYB 3WYRA 3MUAA 2VE6A 3O8XA 4LDOB 4P2CG 5L2JA 2FJGA 1SR0A 2GSIB 5KS9A 1SJXA 1P84K 2PF6A 4YBQC 2FEDD 3ACGA 4GQ9L 4HMCA 1W3LA 4NDMA 1HVQA 1EAPA 2BNQE 3UTTB 1HJQA 4DWSC 3DI2B 4ZODA 1D5MA 3I84A 3V0AC 4KC3B 4F7EB 1VDGA 1WGOA 3UJJH 4PFEA 3KLAB 3IS0X 2BVOA 2ZICA 1DBML 2VWEE 5B39A 5HYJA 3BMWA 4QGYA 4LIQL 3ZL4H 4R0LA 3EO9H 1GGYA 3AFBA 4UT6L 2OYKA 2ADIA 4D0BB 4G6ML 5I1DA 3HG1D 3QUKB 3AHYA 3MRBA 3H42L 4XPGL 3AY4C 4WO4A 4RZCB 3RZCA 4CD4A 2ZSVA 5CAYB 4YHZH 4D72A 4UMGA 1MLBA 2O5XH 3NCEB 1AXSB 1OL0A 2X1QA 2AJSH 2Y9RT 4GKZB 4E8DA 2PBOA 1A1OB 4LRIA 3BKCH 4HP5A 2IF7A 4M02A 4LSPH 5DD3H 5E7BA 2ICWA 4NQDA 3C08H 3T0AA 5I1JL 1QRNB 4NFCA 4PJ8B 4ONHB 3MO4A 3BUYA 3G6DH 2OSLB 5ANME 5C6WH 4OIFA 5EC2B 4P5TC 3FNDA 4XNQA 3EB7A 4P02B 3LRSB 1UA7A 1JTTA 2X4NA 4LHUG 5IT2L 1FH8A 4Q7DA 3A22A 3QIUC 2EH7H 1JI1A 4H25B 4PMOA 2YPLE 1A22B 3IFPA 5FYLE 1XRVA 1RZJL 4G6FB 1A6TA 3SCMC 5JUEH 4U1IA 4TTGA 5A8QA 5KJRL 4M4PA 4NNPH 4RFNB 3KPOA 3WD3A 1V3MA 3BP7A 3MUGA 3SBWA 3FQUB 1CWVA 2EC9U 4GBXC 4HIHB 3V5DA 4PJ9C 4PTVA 1RJCA 5IBTL 4X4ZA 2VH5L 4NHUA 3EDDA 5CJQH 5SWZA 4WFGE 5T5FH 5BXTA 1U3HB 2JJTC 4PJBF 5SV3A 1OARH 1QBAA 1YMHA 5IXEA 3HAEG 4WU7B 3SCOA 2P47B 5DMKB 2GJRA 1T0NB 4JFEA 4E5XB 1IT9H 1FVCB 5C3LD 3N50A 4MA8H 4XVHA 3M17B 3TNNA 4J3VA 1TZIB 1XIWC 2G2RB 4UU9A 1NDMA 4P57B 2Y6HA 1GUVA 3DGGB 1Q9WA 2VUYA 3OBAA 4ENED 1UA6H 5JPNB 1UWIA 4CGTA 4NNXA 4DGVL 2J6EA 5D1XC 5FGCE 5FYLL 4PMVA 4H5SB 4H0IA 2EKSA 2QBWA 3BGMA 5EZJA 1HHGA 1UMIA 2Q86A 3IFNL 4PBGA 5DVOA 4HWEH 1LE5A 3INUL 1A3LH 3A7QA 5HVFB 3Q5YA 2NY5L 3VCLB 4ZNEA 3AI0A 1HQ4B 4A6OA 1KQZA 1UYXA 2A3AA 5BS0A 4C7FA 1WWCA 5CSZA 1EAPB 1H3TA 4O4YH 2DH3A 4R0LB 3GKZA 3AXIA 1F00I 1CYGA 4HW6A 5J13B 1VJSA 1FFRA 5DVMA 3HCVA 4ZUSA 2XKNB 2ORZA 5IDIA 5CP7B 1EO8H 1I9EA 3QIBA 4N1EA 2YDSA 3OPZH 3WKNA 2HG5A 5GSRA 4YXHH 1VACB 2DI9A 4Z7NE 1TJGH 4FQXC 3ZT7A 1RZKH 3IJYB 1U30A 4NSBA 4KUCF 4QLRA 3NJ3A 4LGRB 4KK9D 1UYQA 4PBXA 3WBDA 1MHCA 3VXNB 4ACZA 1QSFB 2FGWH 2VTFA 3QA3A 5FUIA 1UQSA 3DHJA 1MHHA 1A7NH 2XG9A 1KCSL 1SYTA 3D3AA 2VMEA 4ZPTB 3MRGA 1Q6GA 1NKGA 2HFFA 2OTWB 4CAGA 3KL0A 1GHFH 4LIQE 2EEXA 2FLRT 3VRJA 3C6SA 3EYUH 4HA1A 4KI5C 4GAFB 4FQLH 1WT5A 3VH8G 4I3RH 2H26A 2AQ3A 4XP1H 5BJTA 4AENA 2V3EA 3QA3B 4JHAH 5JZ7C 4LRIC 1NCDL 1ACZA 1E4WL 4P49A 2QQOA 3T2PA 1JWUA 5CBEA 1QACA 3L5IA 1CD1A 3L2MA 4K71B 1L9NA 5IVNA 1XIWB 2WWDA 1MCIA 1UACH 5CEYA 1ULVA 1LHZA 2V9QA 2W59A 4N0YH 2IXVA 3THDA 3WO3B 3W6LA 1AJ7H 2UWFA 4EI5B 2B5IB 2CK0H 2EPMX 2XFYA 2D1ZA 5GGSB 5EB9A 1Q6DA 2JJSC 5IB3A 4J4PC 5GS2H 3ULUD 1FV1A 1FOBA 3ZSTA 4YX2L 1EO8L 4E41B 2YD8A 2DS4A 3WFHB 1ZWIB 3IF1A 4JHOA 1L9MA 4JY6B 3M6DA 1HSBA 4JFFA 4OLZL 3ARBD 1HDMB 1HIML 3QDJD 5IK3A 4JKKA 3W11D 5CP3A 3SGKA 3I2CL 2VDOL 3VFPB 4UNIA 1ZA6A 4PYGA 1PBGA 4HJGA 4UU9B 2EO7A 4MDJA 3UETA 3EYOA 4W5UA 3MLWL 4CUBA 1BVKB 5AYBA 3E2HB 3D39B 1NC4D 3RY5A 3CFCL 2EYRA 3GSQA 3MV7E 1KNOB 5FHAL 3VXRA 1JU3A 2W94A 2I9LA 3CUHA 4MXWH 4Y1AB 1I8MB 3QJFB 4KJWC 1KULA 4ATWA 3N1MC 1UA6L 4QCFA 1C5CL 3LN4B 5KVGH 3TV3H 5E2WL 1ROWA 1X1NA 1HXJA 5EO9A 1DANT 1PSKH 4G7VL 5E9DE 1KSRA 3QYCA 2WIIA 3IFOA 4KJYB 3FFCA 1A6ZB 1YY8A 4ZTPL 1RUAH 2E7HA 5I79A 1YEEH 1CNVA 4R2GB 4N0UA 3BRDA 1L7IL 1SJHB 1OGAE 4PJXF 4P5TD 2J77A 4IS6A 2Y5TA 2IAND 1FH9A 2QHRL 4WW2C 5DJXA 5DEFA 3TT1H 2R1YB 1ZLVK 4M03A 2X4UB 4D0QA 1TVBB 3WXVL 1JFHA 4L5FL 3O3EA 4W5ZA 4Z2HA 4WO4D 2W60B 3LMJH 5JO5A 3MRMB 4MHHG 4R2GD 4JKLA 4XXCC 4BK4A 3CCHB 4BS0A 4YBLC 2VURA 5FKPB 2ZX8A 1R7AA 1UB5B 4X4XB 3QIWB 3AMCA 2C4FU 2LFGA 3O4OB 1T4KA 4EOWL 4JPIB 4ZFZA 3RWGA 1P4IL 5BVJA 1MI5A 5F3BA 4LEXH 2DRUA 2EC8A 5K9QI 3IDGA 1BM3L 3FRUB 1IGJB 2OKXA 1OAYH 4IM8A 5TPWL 1HXYB 2GAZA 2WV3A 1EZVY 1V6XA 4C57C 2FHFA 1RK0A 3GXDA 3MNVB 2XN9D 1DN0A 2YD9A 1IGML 4HUWB 1RZJH 5JUEL 3AIQA 3CLWA 1CVSC 3RI5K 1HX0A 3LPFA 3U4AA 3VFUA 4R26H 3VFMA 4Z7OF 5I30H 3CPLB 2AXHA 5GS1A 1LEIB 5F6HI 4PLOB 4XH2A 3U9UA 3MCKA 2IC2A 2WWMC 4TUKH 3V4UL 1F90L 1JGVH 3K8MA 2JK5B 4M5ZH 1DWIM 4KRPB 4IOFD 4PV8B 3BPOB 4I13B 5H37G 1OCWL 2XN9B 4M7JL 4Z7VE 2ZWZA 1A0QL 1TVGA 3K1DA 4XP4H 1ED3B 4RA3A 3H8NA 3QIWD 5MEOB 4OIIH 3C8XA 1MWAH 5JXEA 3NH7L 1XCQA 1GVYA 2I9LB 1U58A 3CGTA 1GOKA 3MRHB 4LCWE 4JFOB 3OKOA 2G60L 2FLBT 5B8CA 3PWNA 3AHTA 1I4FB 3QCUH 3ZOAA 3NRUA 5EB8A 3DSFH 3WS6A 5JORB 4PJ9A 5I17B 3WFLA 4PGDB 4Z95H 5DHVB 5IFAH 1JFXA 1EAJA 3GYCA 2FWOA 3QG7H 5ICZB 5I18L 1M7DA 3BAEL 3OF6A 4MAZA 4FQQB 1NC2D 1QPPA 2H8PB 4JFPA 5GGSY 5C0AE 2Q3AA 5I1IH 2J1RA 5C0DA 1C7TA 3VXUE 3I3EA 5E1AB 4PTTA 3K74B 2UY2A 1FNGA 1GNYA 1FC1A 2QQIA 4XCEB 2AEPH 3V6ZB 4JFFB 1JYNA 5DSCB 1FFOB 1Q72L 5CJ8A 4PD4K 1MW3A 4IRJB 1SFSA 4LCCB 4W88A 4PRIA 5MI0B 2ITCB 5JHLH 3IDJB 4RSVA 3D1MC 4MJIE 1PIFA 5L88L 1TVHA 2WQRA 4XXCA 4FFYH 2FJFA 35C8H 4DVBB 2OSXA 4NUGH 3VG0H 2H45A 2W9LA 1L7IH 2CJUH 3GRWA 3IRPX 2EE6A 4XB3A 1S9YB 3RIAK 5F8RC 4GPNA 3WUFA 5D2LA 5L0QC 4M62H 1J0YA 5J13C 1M7DB 43CAB 4RGOH 4XX1E 4TRPH 2XONA 4ODVL 5A69A 4IRSA 1QI0A 5T5NF 4JHWL 3CU7A 4X0VA 3N85H 3BJLA 1S7UB 1BZ7B 4F58L 5HHXH 4Z2LA 3KXFB 1KACB 3C5JA 4AZIA 2MKLC 2VSCA 4ETQA 32C2A 1RZGA 4D6JA 4KJPC 4KH2A 2QQLH 4OD1H 1BSIA 4G7YH 4MNQB 5IIEB 4M43L 1MRFL 2Z8RA 3P9LB 3BX7C 4N5ED 2AXJA 3OXRA 2AJVH 4UQEA 3WH7A 4W7WA 4U1LB 1XCTA 4NO0B 4YO0B 3H9SA 2XZAL 2XXCB 3AB0B 2VABB 3V6OC 1ERNA 1NCNA 4PV8A 3QUZA 3C6LC 2DICA 3JWOL 5TDOA 2X05A 2NY6C 3HE6A 4CNIB 4CDGC 2O5YH 3I6GA 5F9JB 3O3UN 3EDFA 1WICA 5F1SA 3QO1B 4MAYD 3STLA 4GRWB 2RVAA 4PJHA 5EDXA 1JAKA 1IGCH 4NM4H 3HOBA 5IJKA 1UWTA 1UWWA 4GWIA 1HL9A 5DRXA 4CL7A 5KVEH 4QO1A 4DZ8B 3UTSA 1R85A 1BTCA 1CXKA 2HFTA 3L7FB 3IS1X 1W1PA 1HNFA 2G5BA 3QXWA 4P48A 4XURA 4OQ1A 1ZVSA 5HDOA 4H8HA 3GB7B 1BMGA 3QO0A 1B0WA 3KPSA 4KTEH 4QHMA 4AD5A 4GS7B 3V9FA 1UG9A 2Y1VA 4R4ND 2VLKD 4KUCD 5AYUH 5B4MC 4RMTA 1UM6H 3PE9A 2A77L 2HKFH 2VZTA 4QTIL 3GBLA 4FFVC 3FQNB 5E6YA 4EN3B 5IMOB 2VDQH 5EFIA 4ZUWA 3ALPA 2VDKL 3ZKQD 3NN8A 5FYKE 3GTNA 3LKQB 5IFJA 2VDLH 3O3BA 5F71A 3LEXA 3ZDXE 4EDXB 1IEBA 3GMLA 4IDLA 3PTQA 5C2BL 2QLVB 5GGVY 2Y5EA 3QI9D 3UMTA 3MSDA 5BXRA 1MCNA 3A6CH 4YIQB 2WP3O 1FA2A 4MWFA 4PJDA 3GHBH 3TZVB 4WVRA 3O9WB 5J6GA 4OZGA 4TXWA 1C1EH 1T0MB 3CUPB 3U7WH 4RDQF 3L5JA 4JPVH 2OQJB 1XCQB 5JW4M 4HS8H 3FO2A 1NBZB 2ERJB 3MSGA 3DUUA 1HXMA 2C1OA 4I0KA 4CMHC 1PZ5A 1EFXB 2PWDA 2VCAA 3C60A 5J56B 1ZSDA 3G6DL 1NBVL 2H32A 1A4KA 4KKLD 5T1KA 2P4AB 3NIFF 1MFBH 2NW2A 4IOSD 4X99B 1FNSH 1V8HA 4YX2H 2CGRH 2D0HA 4PJ8A 3P9MB 2YOCA 4V1DE 1NP2A 4KHXL 3OKEB 4D9RD 2QPSA 1CLOH 1KYOK 1QPXA 5T1MB 3KJ4B 3RVWC 2CJUL 1WF5A 4RWYH 4UOW0 4C56D 4P46D 1N8ZA 4U0RC 4JR9L 4OT1H 2WN3A 5MEQB 1FC2D 1HHGB 2CKNA 5JW3L 1NC4B 3QNYA 3K2MC 4CDHA 3B5TA 3MGTB 2VXQL 3U4BH 2YC2A 1W2KT 2M26A 1T04B 1QSVA 5GGUB 4BFIA 3EOAA 5DC4B 3ARGA 2LAGB 1BIHA 3E0GA 4NYLB 2FGLA 3FCTB 4JEGB 3VXSA 2DF3A 3JV6A 1CBVL 5F3HB 3NACH 5GHWH 1M05A 5DFVC 1HI6B 3TBSA 3PABA 1IJ9A 3SUVA 2NX5A 1WFOA 3BW9A 5ABFB 3RVWD 4XAWH 4AMCA 4YE4L 2W65A 3QIWC 4F80A 4NNYB 1QW8A 3SJVA 2G41A 2J79A 3LOWA 1TE1A 2R29H 4YBQD 5EUKB 2KQNA 5SX4I 4A4AA 5F7HA 4ZTOH 1AGDA 2BRRL 1DQLH 2XVNA 4WKHA 1IARB 2XV6B 4NKMA 1MIML 2UZIH 3KWXA 1XCXA 2FHBA 4HBCL 2ZX9A 5D7SH 3O45A 2OCFD 4X9BA 4HXAL 4H8WL 3SDAA 5DO2C 5DN2A 1TR1A 5C0GB 4M80A 2FO4B 3QEUB 2GVYA 5E95B 3GSUB 2XM1A 4I77L 1E28B 2ADGA 5K9KA 4HIEA 4EQ3A 4RYDA 4YO0A 2DT2A 5CJ5A 4Q6IC 2FJHB 1IZKA 3OXRB 5D1XA 5EO1B 2X4SA 2GITA 3SOBH 4AZGA 2AJXL 1XYFA 3WN5C 4HJ0D 3C8DA 1K6QL 4K23L 3DHPA 5EWIL 1QLEH 4PJBA 5E8OB 3LPOA 3O8XD 2XOTA 1E6JL 1LJYA 3LEXB 4Y19E 5KW9L 2RGMA 4YEFA 4WGWB 3WQVA 5IB1A 1A47A 1I1YB 5GS0D 3DOSA 3EJJX 2SEBA 5I16B 4JG1H 4P23A 1GOWA 1I8LA 4MS8C 2DL2A 1KEML 3NA4A 2JIEA 1CU4L 4PJXB 4EVNB 4TQEL 3ARUA 1MPXA 5CCKH 4NFDA 5EUOB 1RYYA 4BQ2A 1P4BL 2W9EH 4HS6A 5ENWA 5EZIH 2YN3A 3VD3A 3QQ4B 3PHAA 2GJ6B 1IM9D 1K4CA 1G7IB 4E41E 3BHBA 2R4RL 4PJ5B 4JANA 4AG4H 3VI4E 3V4VL 4NWUL 4OF7A 3CHFA 3KPRD 3AGVA 1UVQB 3S3PA 4X6DE 1HKLL 4QFUA 3KVQA 3LN5B 4FTVA 3HPNA 1BIIA 5DUPH 4JG0H 4OLVH 1TFVA 1EHXA 2NSXA 4N8VA 1CWYA 3WBAA 5F97E 2DWDB 4Y4HC 3ZYZA 2VZPA 4JM2A 3VOCA 4RMVA 3NH7H 2Z92A 4KJWD 2E6PA 3TC9A 1WP6A 2DM2A 4S10A 3LZFL 3SPVA 5JPNA 3CKHA 3WHE0 3L1OL 4KKNA 4HS6B 4ISVB 1U8MA 2WPGA 4HX1B 5ALCL 5DFAA 3G5ZA 2F74B 3H9SD 1YN6A 1OSZA 3CH1A 1Y6KR 5JMOA 1H8OA 1WV7T 3BN9D 2F53D 4FTVD 1IKFH 4U31A 5C9JB 4Y2DD 1XH2A 4AY1A 2YHGA 3B9KC 3MRRA 4XP9H 2FYYA 3HR5B 2VZQA 3L95B 1CQYA 3VIMA 4Y8AA 3ZKND 1MQRA 3BGFB 4LPXA 3NFPB 1CTNA 3BAXA 4OCXH 3BKCL 2CKSA 3BIBX 3PXHA 4WKAA 3P4NA 4RNRB 4KQ4L 4NO3B 3MUGB 1WC7A 5B38A 4ESKA 3WD2A 1INQB 2W4XA 4LNRA 3SY0B 1ZGLB 1KTDA 5HHQB 3ULUL 4LLVB 1BZ9B 1FPTH 1YYLL 5C86A 5D72H 2QADB 1B0GA 1HEZB 5SX4H 4UFJA 2NY3D 4OJFL 3I2CH 4JJHA 4UT9H 5F96L 5HVWA 1E28A 1ACYH 3GSRB 3MV9A 4XCCH 4XNYL 2WAOA 1NEZG 2JF1A 1PYWA 3NGBB 4E8CA 1UWXH 4YHNB 1IGYB 4J1UA 4YAQB 4XP6H 2V5TA 4CD5A 1JV5A 3G9VA 1A1NA 5HD8D 5D1QA 2MCG1 1CD1B 3SDCD 2DQXA 2VDRL 5EBAA 1XGQA 1TMQA 4RGNE 4BQBA 2MSPA 1KEXA 3TPKA 1NFIA 3GMRA 3MNWA 1UYZA 4GQQA 4PP2A 1G7PB 4U0RB 2CBUA 3MJ9L 2PB1A 1HILA 1M7IB 5IW6A 3VM7A 4KROB 3OJ2C 1GC1C 2ADIB 3DSNA 4ZYKB 1KPVB 3SN6N 4NQXB 4OJYA 1F4WL 1BBDL 1OSPH 2VO5A 3SKJH 3PUCA 2MNUA 4D8PB 2MHAB 5FKYA 5BZDB 4GKSB 3GSNB 3H6JA 4JHAL 2P8MA 4NRZB 5F9OL 2IALB 4BSWB 3EYQD 4O2CA 2H6PB 4NN6B 4XNZB 2P5EE 2EDOA 5L2KD 3WJLA 4L8CB 3S3JA 4XUTA 4ZAKB 3SDCB 1M03A 4GOSA 4LYRA 4MJ5A 1ZS8B 1GZQB 1XGPA 3CVIH 3MUIA 4F7PA 4WV1A 1XR8B 2JELH 2MJWA 5D9SB 5BO1H 1KFAH 3BN6A 3UJIL 1NAEA 2A3EA 2WINB 1GGUA 1GOFA 1AD0B 4K3HA 4LF3B 2YL6A 2W38A 3HLAA 3FAXA 4N8PA 4YDJB 3QUYC 2FIKB 3MRPB 5E8PB 3P73A 3UCRA 1W72L 1ZHKA 4JCLA 1RZKL 2J3SA 7FABH 4W7VA 3MCLH 4NRYB 4WUUD 2ZNXA 1AXTL 5C3TA 4Y2OA 3TPUB 1DLFL 1H4PA 1XNTA 4PS4L 3LKNA 2IQAB 3DX9B 4PJFF 4H1LB 2IH1B 5ANMB 1FGVH 4ODSL 4GRLB 3MZGB 3AVEA 3O3DB 3PJSB 1QQDB 4WLCA 3QDGD 4R97B 3F5KA 5M3WA 5E9AA 3BUYB 4HOXA 3AYSA 3I2KA 1RUPL 1BLNB 4LHUA 3MXWH 4PLKD 1GNXA 5HDQH 4WUUB 3P9WB 2Z0BA 2F19H 5I24A 4Z7VF 2E40A 4PLNC 4KI5F 3VFWB 2EPKX 2FECL 2OJEB 4NPYA 3G04B 1TETL 4HQQH 4OLEA 4HAGA 4L4PA 3WFHA 1CGYA 1MWAA 4DVRL 1NC4A 3QNYB 3UBXG 1JBJA 3D0LB 4O02L 3S96B 1SEBB 4LMQE 3D3VE 5I23A 2JJVA 2G3MA 2DIJA 4C56B 2D24A 1JJUA 3V5DB 1OTUC 4ZXBC 5GZOC 5J1AB 3GB7A 5A6BD 1S5HB 3DURA 2F5BH 3BSGA 1PG7H 4QF1A 1W0WA 3O2DL 1S7RB 1PKQE 5JR2A 1KB5L 3X3FL 1U8PA 3TBYA 1S7TB 2P49B 1RUQL 2Z9TA 4Y4KA 1QFHA 2VZSA 5BRZE 2EXYC 5IP4A 1CI5A 4EVNA 2BVDA 3ZDYE 3ARFD 2ZEXA 3IFOB 4PBWD 5IROC 1U8QB 1CZVA 1CDCA 5FCUL 4P8XA 1H0DA 4ONHA 4NQCD 1I7RA 4YHKL 1QRNA 4OFKA 1RK1B 3MTRA 5FF6B 5E0FA 5FYKD 2W87A 5DURB 1EEUA 1FL6B 1V02E 2GSJA 3SKMB 4HJJL 1KLGB 5IVXF 1JGDA 2YA1A 2G4FA 3C2AL 4NQEB 3RGVA 3W28A 1BQHA 4UUJB 5LQBL 2DB8A 2YB7A 4HAFA 4LSVH 3ZE2F 2RJMA 1Q0YL 5TDNA 4P2RD 2VZRA 1C3FA 1E6PA 3OZPA 2GITB 2CIPA 2WBJA 4PGCA 3WFBL 1FGNH 2ZG1A 3AMGA 3SCQA 2EYSB 2CD0A 2DTML 4DWSA 4NQCA 3B9AA 4ZMAT 1YQ2A 3VXOA 5CG0A 3L4XA 3UO1L 3CSPA 3QO0B 2W1UA 2NPLX 1J9YA 2AJZA 4JB9L 5CGTA 5E9DB 1RPKA 3V5HA 4KK6C 1AY1H 4DZBA 4XP4L 3T0EA 3T0WA 5DJ8B 1WPCA 2X4QB 1P2CB 4BH8B 4DEVA 5IFHH 3MRRB 4MLIA 5ADOH 3V7AE 4NIKB 1DE4B 5A6BA 4W84A 1XD0A 4NKOA 1F2XK 2HFGH 1EEZB 4KZDL 4NKQB 4S2SA 3MRNA 2I60H 5FYKU 1RAMA 4PRPA 4KTYA 1DJSA 4PY8J 1RUKH 4LKSA 3RIKA 3NDZA 5F88B 5ADPL 4PTTB 3QZWA 4JKPL 5C0IB 2HH0L 3G08A 3JUZA 4PTUA 4QHNB 4OLVL 4GAYA 1FDLL 1FLTX 1RURL 5E8EA 5HHXL 4F58H 4JX0A 2YFZA 3U57A 3LMYA 5C0BD 1UCBL 5HHNA 3MRGB 4LP4A 3B5GA 3BISA 5FGRA 1XH3A 2Z91B 4HZLB 1IFHL 2IPTH 3PUHA 4LFHD 4P3CH 2YWZA 1UD3A 3VKKA 1PZ3A 3LRGA 4UZSA 1MHCB 1CFNA 3GGWA 3W39A 3BE1H 5AG8A 1DN2A 4QCIA 5T3XH 4O51A 3PWVA 4X9FA 1QFWL 2A6IA 4AEFA 1H09A 4C7DA 3K80A 4ZFFB 3U2SA 4L29B 4KRTA 2AXFA 5SV4A 1YEJH 4GLRH 1QLFA 2NY3C 1KIRA 2I25N 2MPAH 1IGIH 1UH3A 1U0QA 4WCYH 3CFEA 1OTSD 4S1SH 1MIMH 3CDYA 4PJDB 4Y4KC 1QFWH 4NNPL 3DV6A 2ICEA 4IMKC 3IKCA 2FZ3A 1XF3B 2HWZL 3E2HC 2DD8L 1ORSB 2PBGA 4Y5YA 2DJUA 2VJXA 4HMEA 4U6HA 1ZT1A 5GGVH 5MERB 4XCNB 3U79A 2JEQA 5L8JB 4LGPB 4PJEF 3B2VL 3H3PH 5INDB 4AZCA 1UM5H 4LSRL 4ZUWB 1PG7W 1YMME 1EFXD 4MA1B 3CH8A 1RK0B 3WHXA 2WCAA 5F7EL 2VX6A 1RIVH 4ZS7H 4OB5H 4JN2A 5FHAH 4F7CB 5EZIL 4UIKH 2W1SA 4W89A 1EPFA 3MLRH 1GQJA 1AGFA 3VXTB 1U8JA 5GGUA 5CILH 4U6YA 4DXRA 5TQ0L 3ARZA 1T7VA 3QHMA 4P2QE 1NBYA 1RVFL 4MB5A 3OKYA 2C4XA 3IFLL 5TF1L 4EI6B 4NSKA 4F3FB 3CBWA 1YJDL 1EVTC 4KV5F 2QQJA 2ZZUT 5C0RL 3ARSA 1OOAA 2XJ7A 1I7TB 3P77B 3RNKA 3FB6A 3SGEH 5I15H 2JALA 3VXTA 1A4KB 2HVJA 3JTSA 5JQ6H 4CN6A 1SDDB 3QI9A 4Y4FD 2EDWA 1FIGL 1LP9A 4C58B 4YN5A 4JRXD 3BP6B 1H9VA 1ETZA 5E00B 4D1JA 1K3ZA 3SDCA 1FVEA 2J8UA 2GI7A 1BFTA 1S7QA 4W93A 3MXVH 4MD4B 5KSUA 4F9PC 3I2IA 1JN6A 2IGFL 4TPRH 4PJBE 3WUWA 1IL1B 4YHPA 3V0VA 1U8LA 3GMPB 4ATDA 3U30B 5CPQA 2J22A 2R56L 3S88H 2ARWA 1UJ3B 3AIVA 4DGIL 5SWZD 4Z2AA 3ZYOA 4LEXL 4JFSA 4GAJH 4H20H 5CBAB 1HINH 5T33L 3WIJA 1A7RL 3RWIB 2KQMA 3RVVD 4RFOL 2BOCB 2HKFL 4QTIH 3VDAA 2DM7A 3QWQB 4QEGA 1SYVB 5HHPA 5LGKA 4TOQA 4I8DA 3EYUL 2W0FB 5HHVH 2A1WH 4IMKA 4QXUL 3EMCA 2GFBA 3NZ8A 2ATPB 1NUFA 3LH2H 2GQHA 4L8DA 5C08D 3BWUC 3CO4A 2XQBL 3MRMA 4WY7L 5DDHA 1D7PM 1U42A 4Z7WE 2G5BB 2JCCB 4JJ5A 4UAOC 2BFGA 2CPUA 2F19L 3MRKA 1E0WA 2OTUB 3FONA 1IC4H 3I50L 2J8HA 5C07E 3VI3F 4HEME 5LG1A 3O3BB 1N6QH 5DZNA 1Q9OA 5T1DH 5FFLA 4NF7A 4R8WL 4XCEA 3V6ZA 2ZG2A 1G7MA 3WKML 4KRNA 2DDQH 2DQCH 3IDMA 4GRLD 5HGHA 1E6OL 2I5YL 3BAKA 4BKLB 4AIZB 3BPLB 1E27A 3TBTB 4KUZL 3AICA 1BX2B 1WZ1L 1SJVA 4FA8A 4TUOB 2C3WA 5BVPL 3PQYE 4J2XA 2ZSWA 3SE4A 1JP5A 2PCPB 5FKAB 2J4WH 4PJXE 1MVYA 4V27A 1KG0A 4WO4C 5DFVD 4IDJL 3PP4L 3RNQB 1T83C 2NTFA 5HYSG 4ODTL 3FKUS 1LO2H 1E1FA 5LGHH 1UD6A 1NCUA 3BP5B 4M48H 4KK5D 5GJSL 4KXZH 5ID0A 3ULUC 3RWHA 4OB5L 1G1YA 1BZ7A 4G6AD 4KKCD 1B6UA 3CX5J 4ZXLA 3CMGA 4YQXL 3UR8A 3ZE2E 2ZSWB 4RFOH 3SPVB 2PF0A 3BAIA 3F4VA 4ARXA 3RKPA 5KANI 1HINL 5T33H 3JWOH 1F3DJ 4D6HA 3M46A 4WHTB 3DV4A 3DETC 4ZXBD 4BK5A 2YEZA 5MENA 5IJKC 4WGVB 5A2KH 2P46B 1EVUA 1J05B 3MV9E 2E9WA 3G5YA 4P23D 1RQ5A 2YMXL 3QNXB 5JIWA 4JAMB 3ZYIA 5IQ9B 4PLJC 5F9WB 3FZUD 3SE8H 2XZCH 1KTKE 1KXVC 4ZSOA 32C2B 4NO0D 4I0PD 3C5JB 3QFDB 4G8GE 2ED7A 5E99H 2NY3B 3RM8A 2AS5M 5EU5B 2D31A 4PJAA 2DAVA 2PXYA 4HGWA 4EN3D 4NN5B 5BS0B 1QI4A 1EGZA 4H41A 3GGLA 1S9VA 1W0NA 1I1AD 3ZDXF 3N04A 2DYPB 1CL7I 3TBTA 5DMJB 1DANU 4RL3A 4L9LB 2WK2A 3K46A 4QLJA 5BRZB 3UPCA 3QIWA 4UOJA 2X4PA 5DD1L 2CIIB 3VFOA 3VFNA 2AJSL 2WKGA 1N4XH 1F4HA 2VC2H 2P1YA 2CDEB 1AQHA 1AP2B 1I1WA 3DX8A 1FDLH 4DGIH 3CC5A 3EOYG 4QF1B 2A3BA 4QHLA 1IC4L 3I50H 3WV0A 5ESQB 2H1PH 3TNNB 2B4CL 1HP4A 3FO0L 2WB5A 3WSOA 4X4YB 1P1ZA 4XXDA 4OZGF 1U8NB 5FYJU 1G7HB 3SDAC 3E8UL 1GU3A 3QDAA 4PJDF 5IJVB 3L3DB 4MD4A 1GUIA 1A9EA 1K9EA 3IVKA 3NCJL 3N17A 1JPSL 5HDLA 4HXBL 4NBZB 4NJ9L 4JO1L 3AHZA 4UFIA 3BOVA 4RDQG 4LKCA 5B22A 2QQNA 3WDPP 4HWZB 4HIIA 3WF0A 5I17A 4G9DB 4TVCA 3A6BL 4HCRL 4W85A 1KV3A 2NY6D 1ADQA 3C60C 1FJ1A 5GNZA 4FFVD 2AKRA 2H32H 1PBYA 4NKMB 1JHJA 1AR2A 4RA0C 4HK3J 3VTRA 4NSKB 4QRSA 35C8L 2VITB 2QSCL 5AZEH 1KG0B 2WBKA 3MA7A 1Z2KA 2OSLA 5E5MB 3SE4C 2NY1C 3HAEB 5J1TC 3CDZB 5IMLB 2YUZA 1ZA3A 4QOKA 1FFPB 3LEYH 5IB5A 4AEIL 1W9WA 5HD8C 1NUGA 1DL7L 4JZJB 3ES6A 4FQHB 4CCEA 1MHPL 4HWZA 1ZJAA 3ZIZA 3GHEL 3EO9L 1HDMA 1P6AB 1F90H 4B3LA 5C0AA 1MY7A 4X0KA 3IK2A 2ARJQ 4B53A 3VXUA 5A6KA 3D3VA 5DJ2A 5FEBA 3U9PH 2DBLH 3R8QA 1CFTA 4PP1C 4L8CA 3OLEA 4YJZL 3BXWA 4PSPA 2QADC 3PTMA 4UB0H 2ZOKB 3JV5A 2APXA 3E8UH 4UV7L 4D94A 1VFOA 4TULH 5C0CB 1I1XA 4PPTA 4PJEB 2R23B 4NRRA 2QTEA 2CBVA 3W29A 2HRLA 1MJ8H 2E5EA 5CILL 4M00A 1IGJA 1JL8A 1JGEA 3IT8D 4YXKH 1LP9F 1UD4A 4D9QE 1U8HA 1HILB 4F7MB 4K2UL 4XZBA 4L9LA 3S7GA 1Z5LB 1E70M 4ODVH 7TAAA 2VERN 1JZ6A 1W9SA 1CIUA 1INEL 4WI3A 5DTFA 2B4CC 4DGYL 3R8BB 1KGCD 4KI5E 1UXWB 1FYTA 4OQTA 5T1LD 5I73C 1CCZA 4PJCE 3EIFA 5GS3A 5FO8A 4O02H 5A3HA 1NWRA 4MA3B 1WIUA 2P7TA 1TVPA 4ZFOA 4BQ8A 5HPCA 2HT4D 4O58H 1BAFH 1VFUA 2QF8A 4GIAA 4JM4H 1MCJA 1U92B 5CUSH 4OGZA 4WO4B 5JOFA 1J05A 1E4XI 1UC6A 3WDIA 4MYWB 4MDJB 3H9SE 2VL5A 2IAMA 2PTVA 5HGGS 4TTDD 4NQED 1G0DA 2YBRA 1EJ6A 4JFDE 1BVLB 4LSVL 3I2HA 1OAYL 3QUZD 3KWWB 4GSDL 4ZOAA 4K7PX 3CZFA 2DWEA 1US2A 1GQIA 5F93C 1AXTH 1QRKA 3VMPA 3HKFA 2FD6L 2BNRE 3U0WL 1P7QA 3DUSA 4FN0A 1DP0A 3N1FC 2J62A 4N90E 4ZQKB 3STBA 2BNRB 5FOJA 3HFMH 5HI4D 1OGGA 3RM9A 5LA1A 4UCFA 2C7FA 1C08B 4MJIB 2HKHL 3BKYH 1KJ2B 4GW4A 4HKJA 1R24A 4HX1A 5JW3H 3BGMB 3M7SA 4R97C 4XI5C 4QTHA 4M93B 4HC1H 3TCXA 4JLRB 4P4KB 5FO7A 4HG6B 1U3JA 5I75C 3L4ZA 2UZYB 5CBEB 4CRPA 1GGBL 1EV2E 4FQCH 5F7FA 4KRPC 3W0WE 2Y4SA 4HFWA 3MRNB 3D6GA 1OAXL 1AH1A 4GG8A 5HVGB 4MNQE 4P5MB 1H6YA 3QNXA 2V7NB 4NOBA 1C08A 3NFNA 1CR9H 1V0KA 5ID1A 3DV6B 1WFUA 1TZHB 1KN2L 4J3XA 1FE8H 4EI5A 5CSUA 1IGFL 4MGXA 2W63A 1NJ9B 4YC2B 4X6BB 3MV11 4L9LC 1DBJL 2O26U 3TBWA 1QNSA 4RE2A 3TTOA 1MRCH 3TO2B 1KCSH 2Y8KA 2DQJH 3O81A 2XA3A 1MH5A 4NCC1 5LBSL 4BH7B 4MX7A 5ESAB 5FV1L 2XTKA 5A2AA 4PRHA 3O6KH 3FO9A 3GXIA 3WQ5A 2NY2B 3EKCA 4PMNA 2OK0H 5F7DA 2IPUG 3RWHB 3U83A 2CLZA 5K9JL 1FCGA 3T4YB 4F57L 5JXEC 2XSAA 1SVCP 4YXHL 1R3HB 3WJJC 3Q3GA 3DVNA 1AD9A 3EO0A 5EIIA 4D9LH 2BSRA 3HB3D 5C0JA 3KPQB 4UUJA 3BO8A 1D5BA 1QD0A 3JWDC 5D1XD 4V1DA 5I8EB 3BSHA 3QXTA 3L3HA 2Y7QB 5HY9B 2A6DB 2AABL 3D2UA 2NXYD 3U7AA 1P4LB 1P84J 1QFWI 2PW1A 4NC2B 4S0SD 3W38A 3WFDH 5KN5A 5KVDL 3ULVD 4G8IB 4J4PA 1DQJB 3SGJA 3VXNA 4ACZB 3VFTA 1S9XB 4JFHE 1E4KC 2B1AH 4H88L 5FYKL 2EDDA 2DJ4A 3VFRB 5B38G 1ETZB 2Q8BH 1KBKA 1BD2E 4K9EH 1HKJA 3QR2A 3KG5A 1EBPA 1ITBB 4QHKJ 1MCWW 5HHOA 2NY1B 2E9LA 1KN2H 2ZOXA 4FRWA 4NZUH 4NHCH 3OKOB 4MDPA 1MRDL 3O3AB 4Q6IA 1PJ9A 4PJFB 3P3YA 4NRXB 1FZJA 1DWJM 4AAXA 2A38A 4X6EA 1A6UL 5LCWL 5HGDA 4HF5H 1T0PB 5C9KA 5BQ7A 3VA2C 1IC7H 2H3NA 4Y16D 2GT9A 4L8BB 4M7LL 2KKQA 4WK9A 1B0IA 1ZS2A 5KS9F 2YPLD 2BOCA 4U1MA 1MNUH 3STZB 3MRPA 1A14L 3HNVL 2VDNL 4U33A 5IHLB 3CMOL 4M8QB 4WHYH 4UFKA 2VE6B 4W70A 1YY9D 1NM9A 1MF2L 5TDNB 1HQRA 2W95A 1JYVA 1ZHBB 2IBZY 1QNQA 1Z6JT 2R4RH 4Z2KA 3GJFK 3QUXA 2G3NA 1NSNL 3AAZA 3QUXD 3A0OA 1U95A 4MQTB 4KKAD 5IVZA 3Q2CA 2D0GA 2AXGA 3HNSL 4WEMB 3IKCB 2D22A 1NMCB 4DCQB 3IDIB 2CIKA 2WSKA 3MREB 1CGTA 4C83A 4DUXA 3BP7B 4Q9CA 4KI5D 5DD0L 3GM8A 4M43H 3JVGC 5E0QA 3BQUA 4PRBB 3TWCH 5ACZA 4UFHA 4OD1L 4LARL 3ULVC 5LCVL 1PLGH 5I1LB 1WZKA 1E15A 3PWVB 4JQIH 4GG6F 3RY4A 1U91A 2L4OA 5CMAA 5CEXA 1OP5K 2APVA 3TIDA 3OLIA 1NQBA 2D0FA 2YLAA 1P8JA 4WNQA 3U46A 2G3IA 3SJVD 1DL7H 2G3JA 3KR3H 1J84A 3RX7A 4LASL 3MRDB 4XCCL 4XNYH 4OCRL 2F15A 1GGBH 4FQCL 1TQCC 3GMLB 3CZGA 3RHWK 5JA8B 4ZUUA 1QFUL 5DO2D 4OF6A 1W9UA 5FUCC 4F79A 3PN8A 1HHJB 1HHKA 3ARDA 5IB2A 5CLTA 4YFEA 5D1QC 4BSVB 5ACZB 5ALBL 3NPSC 5GNYA 4X9GA 2NW0A 4MZ2A 4YGVA 1F6AA 3DBXA 3IU4L 1RIHH 4LPYA 4N8CL 4NO3A 4ZS7L 4UT6H 4P2OA 5L8KB 2X4RB 2BOBA 2EE3A 4R90H 3V4VH 1MFEH 3FL7A 5BCAA 1KJ2L 4M7JH 1TJGL 1A21A 3QG6A 12E8H 1E4NA 1JNHB 2JIXA 1XPWA 1DZBA 4Y1AA 5KANG 1I8MA 1QLFB 1U95B 3DVNB 2HT4C 3WUGA 1H1NA 3E3QC 4FZ8L 1YEIL 4JL2A 3G5YB 5DO8A 4B50A 3WD0A 1TJHH 3OB8A 4GRMB 5IFTA 1E5NA 3HLAB 1NGQL 2EZ0C 1MFAL 1PLGL 1R64A 1X6LA 3H7LA 4ATLA 4TX6A 2GTZB 4XP5H 5IKCB 3TH3T 5IK3B 4KQ3H 5I1HL 1FVDB 4QAWA 5MP6H 4OZHA 1AI1H 4XRCA 2EO1A 1UGNA 3T3PE 4DAGL 1UJTA 2BP3A 3AXLA 3RZWA 3RTQA 4PJ5D 2BS9A 2F54A 3FN3A 2VL5B 3OXSA 4JO4H 3AXXA 4QRUB 1XC6A 4Y2DA 5B4XA 3TJEH 4YEEA 1I7UB 1WIPA 4POZC 1EGJA 5DMGD 4A44A 4AD4A 1ZHNA 2KPNA 2GDVA 2FNBA 4GXUN 15C8L 4M7LT 4OQTL 5D2NE 3ARFB 1N3NB 3UR7A 4KGLA 1AP2A 2J7BA 4HZAA 3HE7C 3HZYB 2VLKB 4M6OH 5CJQL 3M1BA 4PP1D 4CVZB 5DHYA 2WHMA 1G7QB 5IHRA 1JWUB 4NKOB 2CKRA 4MGQA 1X5GA 3ZKSD 3RP1A 1KB3A 3NTCH 3UTTD 5BW7C 4Z2JA 3DTXA 4MAYB 2VZ3A 2OWCA 3OXSB 1ZT7A 1CGWA 4DZBB 4WTZG 3WD4A 3ZSSA 3AOFA 1J8KA 4OLWH 1SEQH 4HLZG 5GGQH 4LBEB 4D0CA 3NACL 3GMMA 1KJMB 3OR7B 1DQML 3PWJB 4NQVA 4WNQB 3OKKB 5HGAA 4WSJA 1XFPA 3HC4H 5FXCH 2BGPA 4LX4A 5ITBH 1BYDA 4AEEA 4DN3L 3EFFB 4HLZH 3F5LA 3ARBB 4B0MM 1RHHB 1TCRA 4WHTA 1QLRB 1KR0A 2EIBA 4LLQB 2FH8A 1G6RA 2VZ1A 5D7IB 4GRWH 5J3HD 4OLXL 2MQCA 2BY2A 1UM4L 3V6BR 3P4MA 5I1HH 2CDGA 1LEKB 2RCSL 4ZOEA 3SKVA 4DFHA 3W4RA 4Q2ZA 4JZNA 3VXRE 4JY5H 5AYIA 5GS0L 4XB8A 5E08H 1T2JA 1E4XL 3KPRB 1PPIA 1QRND 1FAIH 1OLZA 3QSKB 4S1DD 1GH7A 4Q9QL 1A6AB 4N0CC 5DHVH 4FF5A 5DYOA 4GRLA 3RY6C 4XMKL 5ETUB 3EYSL 1OT1A 1B3JA 3BPCA 5E09A 1K4DA 1CZ8L 1ZVHA 5I78A 2PO6B 2AJXH 1QBLL 1MCOL 4G6JH 4U2YA 1EEYB 3QFJB 1QVOA 2XWJB 4HIEB 4BZ2L 4PJGE 4YQXH 3OG2A 3V8CA 4W68A 1CZTA 1S7RA 2X41A 4X6CF 1KB5B 2HYMA 3ZZ1A 1MQKL 1K3IA 2V17H 1YMMB 2DWDA 4KRLB 2VN4A 1VESA 4P3DB 5FB8A 5LGHL 1GC1L 4JDZA 4PJEE 1DQQA 4QRUA 5L6YL 5I1GL 2E7LC 3PL6C 3X13B 2WMGA 1UXZA 3UBXI 2A1WL 1H8NA 3IVKB 2V2XB 3QH3A 1VPOL 4X6FB 5L2KB 4BQ3A 4UNTA 1ZLSL 3BZFA 5T1MA 4FZEH 5C0AB 1IC7L 1NCDH 3BH4A 3RI5F 2D7QA 5L9DL 5HHME 4Y5VC 2J1AA 1XGYL 3NSMA 4Y89A 1Z3GH 4W7UA 4KVNH 4XPAL 1PKQA 1FORH 4PG2C 4KDTC 3MR9A 5FYJD 5C08E 3T65B 4DKDC 4UTFA 2V7HB 2FBJL 1UX7A 1N0XH 2P8LB 3FCTA 1T4KB 5BRZA 4LLUB 4DKFH 4ZY9A 1OGAD 4PP2B 5EZOL 1H0GA 3AMLA 4U1JA 1UZ1A 1LO5A 3RAJH 3GSVA 3LKSB 5EO0B 3SE8L 1XSIA 1JGUH 2Y06L 1QRNE 3DRTB 3DVGB 3WLWD 5E6IC 4OCWL 2VX4A 2JJWA 4HPGA 3SCMA 2TAAA 1N7MH 2X70A 3O3EB 1UWGH 2WANA 2XHNA 2YKLH 3O2VL 2RFXA 5SWSD 3OPZL 1MELA 25C8H 4YHNA 4BYHA 2A73A 4AQOA 2WZ8A 1I1AA 3L5XL 1HYSD 4M9PA 3NCBB 1BECA 1HHKB 5IB2B 1RP9A 3AJ7A 1LWRA 1X5YA 4NQDD 3LN9A 3RFZC 3QPXH 3NABH 1ZJBA 3IFLH 5TF1H 4KKAC 3L6FA 1M71A 2CRMA 1XF5B 5DA4A 4ONFH 5DRWB 3GSXA 1EEQA 1JD7A 2HMID 4X9YA 4ALAH 4YHGA 2W91A 3FN0H 4YDKL 5A2BA 5K9QG 3RZCD 3ARPA 2EKJA 1W1YA 2W62A 2QJDA 3HMXA 5DPNA 1E4IA 1PD6A 3GRWL 1I9RH 3GNRA 3IGAB 3PV6A 3HI5L 1L7RA 1GCYA 4YFDB 5DC0A 4JZ5A 3BVNA 3EJYD 4ZZ8A 2WHKA 1K85A 3F6LA 1HH9B 1MRCL 5HVHC 1P5UA 3VFOB 2GK1A 4X6FA 3T0ED 5C6TH 4AM0B 1MQ8A 1G7LB 2EIZA 4FXKB 1UWUA 2ZUTA 1IQWL 2VXTH 2X6MA 3D39E 4JDVB 5CZXC 4Z77A 4TUKL 3V4UH 2GDUA 2VRKA 3PL6A 4ODWA 2A83A 3A47A 2XIBA 1PVHA 2DSVA 2AJYL 1KB5A 3MREA 5T5FL 4A3HA 4MAVA 2W92A 4NQSA 5J1XA 3IDYC 3GSOB 1UWRA 1H3WM 1HCVA 4WCYL 5E6ID 1WSST 3SQBA 2EXWC 2J78A 1XCTB 4NO0A 5JHDE 3IAGC 4HC1L 1E27B 3UTSD 5EU6D 1OPGL 4F8TA 1GOOA 2ENSA 5FO9B 4OZIA 1MAMH 3GJFH 1R3HA 3K4AA 4Q9BA 4RGND 4LLVA 1P7KA 5AZ2L 3D0VA 5C0BE 4AZ8A 4JFUA 1P2CA 4X9IA 1DDHB 3FONB 2BVYA 1ZVYA 4M8QA 1I1FA 2OBGA 3MRKB 1YEGH 2ZPKH 1X4XA 2WO1A 1VCAA 4ETYA 1IM9B 3HC3L 5E6IB 1RH9A 4PRPD 2NXYC 1BYAA 1N59B 3U0TA 1T6VN 1FO0B 2NZIA 2DWEB 2DIAA 4FLSA 1HXMB 1FFQA 3D69A 2APTA 4X98B 1KBBA 1AGCA 3I2JA 3HI6H 3W2DL 1ZBCA 5KOMC 3TO4A 1DBBH 1J9CT 4WEBL 4ZO7A 2Z8SA 1HH6A 1P7KB 4NQUA 3TO4D 1TZHA 2EPNA 1UFUA 3QULA 2R2EB 2VDPL 3QXDB 2SEBB 1UWQA 4DKAA 1DUYB 2GCYB 1E5JA 2M8XA 2ZEZA 3T4AA 5E6IA 1XD1A 4XP5L 5CBAA 1XSJA 3SGKC 5EA0L 1JPST 1ZT4A 5IHZA 1NFDB 4O58L 2EQDA 3UAJC 2DQHH 2O5ZL 3LKQA 4TSCH 4J12A 3D39D 1KEGL 1B4JH 1A2YB 2X9XA 4IHOB 5JDSB 5IOPA 1RUAL 4LLMB 5HI5D 4PTUB 3PIQA 1R24B 2W66A 5DGQA 2DQDH 4KTDL 4GG8B 4Z77B 2FJHA 5FV2A 2DSKA 5CD3B 5J11B 3A4AA 1YECH 2R69H 5DJ0B 1QSFE 5DI8A 2AOSA 3DECA 4I18B 4URIA 2I07B 4QX1A 2WP3T 2G8ZA 2ADGB 4RE3A 2R8SH 1LP9B 2R39A 1EHAA 3LHPH 4F66A 3QCUL 3W0WD 2V7HA 2F8QA 2O5XL 2P44B 3PNWA 5H8DA 4ZFOL 2H1PL 2WMIA 2DT1A 2OI9B 3AREC 1WBZA 3HNTH 5DMIL 2R0LH 3O0RL 3B9KB 5CINL 1RY7B 4CU6A 4JO3H 5BW7A 4CUAA 1WJ3A 1EZVX 2DQFB 5J9PA 3NA9H 2AJUH 1ZAGA 3TTSA 2DMCA 5L7XH 4Z7UF 8A3HA 3OZOA 4X7TA 3U37A 3B2UD 4IOIB 3HPLA 3C9NA 3ACHA 3WEXB 3PZ9A 1FG2B 2VABA 2A2QT 2DD8H 1XGZA 2QHAA 4XWOD 5EORH 3V6OE 3TFKC 3MLXL 2G2RA 5ADOL 1LG2A 5D7KE 3O11B 2J8UE 5BWFA 2PTTB 1VSCA 3EOAB 1DUZA 2V5RA 2OX5A 3LB6C 5E2VL 2DLTA 2CETA 4WHYG 1UHVA 4YHIA 3IDNB 4KRMB 1RUQH 5ELIA 3BPNC 2NY0B 2DQTL 2WBWB 4I5BA 1QNZL 3RGHA 6FABL 4KKCC 4B7IA 2J7HA 2AJYH 3ARED 3MZTA 3FB5A 5DD1H 3S6TA 3SO5A 3D48R 3B8SA 4XGZB 3T04D 3WDQA 1AO7B 2LVEA 3HNSH 3GMOA 3RMEA 1MIEH 4LL9A 4W6WB 4P3CL 3WEXA 1H11A 4QCEA 2CHNA 2W1NA 1Z5LA 1AGEA 3RKDC 2R0ZL 4BKLA 4U1JB 2NY6B 5KS9E 3I2FA 5KVGL 3DUSB 4FLRA 3FOMB 3CZKA 1B88A 1U8PB 3CSBA 1UB5A 4Z0XB 2PO6D 1GHFL 1GGTA 2R0KH 2WUBH 4KI1A 5GGRA 1LG1A 4U0QB 2X89D 4HH9B 4LVHC 4L4TE 1VJZA 3C5SA 5DVKA 2Z93B 2B1HL 4MNMA 4NQDE 2CDPA 5LCVH 1FZJB 5DJ6A 4GKLA 2JCCA 1MJ8L 1H5BA 1XR9A 4JJ5B 3TWCL 1CZ1A 3UAJD 4X4MA 4ZUVB 2YMXH 4HOZA 5DD0H 5C7GA 3QDGB 3I3BA 1V0LA 1HJUA 1NAKH 2V5MA 2IAMB 1A4JB 2YD1A 1T1XB 1YZZA 5DJZA 3ARGC 1KPVA 1NLBL 4QLLA 3R1GL 2CIIA 3ZKMD 3SO3B 1UEYA 2ZCLH 2PXYC 3C8HA 3S37H 5ICZA 2BXYA 3PDOB 4ZTPH 3K81A 2WWKT 2NLJA 1T6WA 1UR1A 1L6XA 3U4EB 2XPGA 3GSWB 4G43B 4LPCA 3C87A 4XHQA 1FNEB 2YK1L 1N64L 1OD0A 2CKBA 3PZOA 5IFPA 5FUZL 2C3VB 3WH5A 4BA8A 1XGRB 3LEYL 2ESVA 4MCYB 1BBJB 3BH8A 3UJIH 3RVTD 4RMQA 1ZMYA 3WNMA 3VXMA 2C7UA 3CFCH 1DWFM 5C0JB 1N3NA 2BSED 2QEJA 3OL2A 1WDQA 1KELL 3WN5A 2CLZB 2B39A 4U6VH 4O00A 2FIKA 4XAKD 1JU4A 3L5WA 1FGNL 3QRFM 5FIPA 4WFEE 3PGCA 4EIZC 5I8KL 3ZJ6A 5L9DH 3BPNB 1W72B 4YDIL 3AU1A 4HPYH 4XH2B 3U9UB 1ZXQA 3LQAH 2E9JA 3OKLB 2MKWA 4OI8A 4MJ5B 3BH9B 3WKMH 1XGTA 4JQXA 5CLWA 4L9DA 2DMBA 2GUOB 5EPMB 4NC1E 3K8LA 5F6IB 1OD8A 3EJZC 5H94B 3VFNB 1CXIA 4X0KB 3I6LE 1KIUA 3U36B 1JYWA 1UADC 2P8MB 3N1PC 4OZOA 1JDDA 1S9WB 3F58H 4OGYL 3VI4F 1N5YH 4R7NA 5BRPA 5ESQA 4FQHA 4DXSA 3UC0H 3QEQE 5E4EC 1YN6B 1N26A 4LRNL 1UA3A 1SQ2N 4UILH 2VR9A 5EU7E 1QBLH 4G6JL 2ZX5A 4HUMB 3MRJB 4HWBA 4OIBA 1ZEAL 3O6LL 2OL3L 1CZ8H 4I2XE 1NAMH 1C8PA 2ZXBA 2FB4L 3HRZB 1FAKT 1TMCB 2GY5A 5IR1A 4OLZH 1AQKH 4MDIA 5A3IC 1R5IA 1NCTA 3VW3L 4E41A 4K7PY 1ULPA 5IEKA 3RWFA 1JF5A 1JNDA 1YNLL 1XF3A 3KPRA 1MFDL 1GAFH 1KR1A 3D2UB 2X42A 3S88L 1NAML 4NBYB 1DFBH 2BNQB 4Y4FC 1IGYA 4J1UB 1QSFD 1NFDA 4ZZ5A 4OM1H 5LBSH 4DGVH 1QNOA 3PZMA 1FVDA 5AG9A 3HE7A 5DEGA 4ZD3H 2AK4D 3C2SA 3Q3GB 3CIHA 3FHAA 3QXAA 3IDAA 4AZ6A 2BHZA 1R3IH 1IGCL 4NUJB 3MUHL 3D0LA 4ZXEA 1CICA 2X1IA 3K75B 1H5VA 2FD6H 2AV1B 2XNAB 3OGCA 4PY7B 5IIEA 1YEHL 5JIKA 3TYGL 4XRCB 4N42A 2EDTA 3MLVL 2EEAA 4LOUC 2BVUA 3ULUF 1MY5A 3D9AH 1WVZA 1QOXA 2BK8A 4LNVA 3UJJL 5B4NA 1IM9A 3MCLL 4R90L 2XTJC 5I66A 4I48A 3SDXA 3GMQB 4P9HL 4OF0A 4ZOBA 3TNMA 3CUFA 1LLOA 1MSPA 4S1QL 2EICA 5M95B 1IGTA 4U6VL 2UWEB 1HE7A 3K7UA 5DUBB 4IRSD 2N1KA 3EYQC 3G6JF 3QISA 3QNZA 4PSRA 4F33B 5DD5H 1W3JA 4JZOB 1OHQA 3F7YA 1BWMA 5BMFH 1UH4A 1Y6MR 5IGXH 4XUQA 3TP4A 4XCYB 3S4SA 1J0KA 1PKQB 1LNSA 1ZHNB 5I1JH 1JAEA 4BSVA 1E1EA 5AD0A 5C0AD 4K07A 1XR8A 2DCKA 3CZLA 1VBRA 3NIDF 4TQEH 1FBIL 3FTGA 2A9NL 5F1OB 5C92A 1I3RB 4Z8FL 4ZUUB 2D03H 4GI6A 1EQCA 1EH9A 3S2CA 2JF7A 1UR0A 2YKKA 1C5DB 3QWRD 1GW1A 2NY4C 4ZS6D 3BQUD 4EJ1C 2Y6LA 5I3DA 2Y6GA 1ND0B 1X9QA 1URLA 4Y4HB 5K93A 3JTTB 3FQUA 4MNLA 4D6DA 3ALWA 4AEHH 5KJRH 1M05B 5TE6H 4WI9A 5DRWA 2P42B 1NARA 2DCJA 2DQGL 1UJ3A 1YPZA 5F6HJ 3RWIA 2BC4B 4NI3A 5DMKA 1MHPH 3MV7A 5D7IF 3B2VH 3H3PL 1CG9B 4R6UA 2H9GA 3BZ4B 3I9GL 4N8CH 2P7TB 4MQ7B 4Y4FA 1R3JA 2UYLB 3N1AA 3RWJB 1YC7A 5EN2B 3WL0A 4ET7A 1MVUA 4YXKL 1SM3H 3SCRA 1R5WA 3DVGA 3FFCE 1S78C 5EOQH 3V79C 1CT8B 1EOKA 5HYFA 1R3KA 1D7FA 4L8SC 5DJXB 5DVLA 5K9KB 2DTMH 3AIBA 2G5RA 4XC1L 4D3CH 2NY0C 4I0PC 1F11A 2YWYA 3QUXC 4LSSH 1CTOA 4N0UB 1LEGA 5C08B 3TFKD 2ZXQA 3JZ7A 3ARBC 3W11C 2G75B 2DLGA 4UV4L 5IT2H 3W39B 5B38B 4DQOL 1P9MA 1E6RA 3QIUD 4KK8C 4HUVB 5HHMD 1FH7A 4RIRB 5D7LB 5B3JF 1K12A 4M1CD 4PJIA 5D1ZC 3K2UH 1D9KA 4JGUA 2YUWA 4RGMC 1YEKL 2O5ZH 4LSSL 1QYGH 3MRQA 3QWRA 4JN2B 5DD3L 4F7CA 1A1OA 4MAYA 1IGMH 5TGBA 4RX4D 5CEZE 2QV4A 2WC7A 4OTXL 3RA7L 1CFVH 1VEOA 5FKPA 3T2OA 4YDKH 1MI5E 3PHOB 1CLOL 3H3KA 5E0CA 3GXFA 2XY1A 5FA3B 4JZJA 1NOFA 1C5BH 4FFZL 3V95A 4LVNC 2O61A 1L0QA 2H2PD 3ARGB 3LHPL 2ADJA 5CWSB 4G8FB 4L1DA 4M6AA 4JZOA 2WYSA 3BWAA 4LCUB 2J12B 2APBA 3BSZH 5IM7A 1Z9LA 5LA0A 1ORQB 3KPQA 2ZXDA 4IS6B 5EIIB 1GOIA 3O9WD 1HEZA 2ICEB 5LGJB 4P2QD 5ISZB 2HWZH 5DLML 3TN0C 4RCAA 3U7WL 4B15A 1E4MM 4BZ1L 5I8EA 4AEHL 4JFQA 5HI3C 4I48B 3SDXB 4HT1L 3KPOB 3KPSD 4XNXH 4P7OA 5D7IE 5D2LE 5CEYB 2F53E 4M1GL 3P4MB 2YS4A 5E2JA 1PZ5B 3V52L 3X14A 1UG6A 3ZR6A 1UACL 4GW1A 2HP4A 1NFDF 3U2SB 3F5JA 3ULVF 5KSVB 1T1WA 3T4YA 2VLRD 2XWEA 1I1FB 3BEWB 1OAZH 4PRNB 1CD0A 3EO1B 2EYRB 3Q5OA 4OAWA 4RAVA 4N90D 1LO0H 3NGBC 3LPWA 43C9B 1FNSL 4NKIL 4JO2H 1S9KC 2ENYA 4LCWA 5D7KD 4P5MA 1JNHA 2JIXB 3A67L 3SEPA 1ISWA 4L3EE 3S4SB 3QDMD 3SDDD 5TDPB 1S78D 3NCYS 1MQPA 4UI2A 1B3ZA 3RO8A 4MXVF 1NCWL 4MD5B 4NQCE 3MFFB 1P9MC 4JM2C 3IF1B 1QHOA 2E32A 3OGSA 3DYPA 1H0IA 5KSBF 4MLSA 4XBPA 1BOGB 4F7TB 2ZKHH 4P3WA 3QUKA 2O9PA 3VE0A 5E8DH 3RVTC 2VMCA 3O6FA 4AL8L 2AABH 1NUDA 1V3KA 3L9RB 3O2WH 4I0PA 4IHOA 5ADPH 1RUPH 5T1LB 3G5XA 2VLKE 1B2YA 4ZQKA 3X3GH 5IHUH 4CVZA 5HPOA 3KYMA 4HUXB 3GBDA 4UOZA 5I66B 1HH9A 4JFZH 1A1MB 4E42B 4S2SB 4NM8H 1IEHA 5IBLC 4ZUSB 3UTSE 2F5AL 4LCWB 4LSDA 4ZXBB 1SY6A 4L29A 4CVXB 4HUVA 5CD5D 1TCRB 1I7UA 3SDCC 2PR4L 2QKIB 3EZ8A 1SMAA 1MRFH 5EUOE 3SCPA 3O6FD 4Y7EA 1QO3A 3CTTA 3ZJ8A 3P0YL 1KTRL 5JOFB 1VHPA 2X1OA 2XZQL 1QR1A 2DEPA 2RB8A 3TN0B 3N15A 1AKJB 2XA8H 2YL8A 2V9TA 2BY3A 3AFLA 3VX1A 1PG7X 4LPVA 3ZJ7A 2YBRB 4JHWH 3WFDL 2P5WB 4Y19B 4EKJA 3VXPB 4RBPH 5E8OA 4FG6D 2XRAH 4CCCA 3VGHA 3VRLF 3W9DA 1NH6A 5B8CB 5CEZL 3BDYL 3DTXB 3WCYA 3OKDB 5IVZB 1G0CA 5D6DA 1NC2A 1OSZB 3RL1B 1FFNB 2L7JA 1ZGLM 3MLUL 2PWFA 4DM2A 3EYFB 2E8ZA 2YBUA 3F65A 2IH3A 3KYNA 5BV7L 5CP7A 5A2CA 2EJ1A 3HCVB 4F37F 2PI6A 1X5ZA 5E2TL 1KUMA 2YJQA 4G43A 3O2WL 2JCCF 3RNKB 1ES0B 1MCSA 1YNKL 1S5IH 3CSYA 3LKOA 2MQ3A 3K4DA 2NY5C 2JDAA 3A6OA 3WL1A 2YG0A 1LE5B 3VFUB 4BQ9A 3ZTNL 2YPKB 1TVHB 2Z35B 1JGEB 5I1CL 5HSFA 3ABZA 4TSBL 5HTSA 1C12B 4Y16B 3DMMA 1M6OB 1XH0A 3S35L 1B4RA 5IG7A 4P7NA 1R3LA 3GNML 4P8WA 1IAMA 2IPKB 4H1LG 3D18A 2YZ1A 4OV6F 4I3RL 4OGXL 2ED8A 3HG1A 4LHUB 1UD8A 4QWWD 3N18A 3VXSE 5IB5B 3MV8E 3MRIA 3DYMA 2W0FA 3APGA 4OM0H 1FRGH 2QQMA 4Z7UB 2XA8L 1WZMA 2FO1A 5DT5A 3RBGA 4Z2IA 3MRBB 3IDXL 4KQ3L 4MNGB 3ARXA 4PRBA 1RJLA 3KGRA 1N8ZB 1HKKA 3HFML 4NKDA 5M5DA 3MRLB 4PF1A 1KPRB 1I4FA 4CCDA 3DX7B 1FL3A 3GH7A 5SWZE 2PR4H 4AH2A 1Q94A 1MJJA 4LPLA 1IKFL 3BO8B 4YDJA 3GBMH 4JZNB 3LKSA 2ORBL 4K8RD 5D1XB 5EO1A 4JFHD 5FOBB 1NKOA 3KLAA 4MNJA 1X7QB 1G6RB 3TBYB 5E6ZA 3W24A 2BGOA 2FCBA 2JKXA 3LZFH 4C7GA 3OGCB 4XVUD 1YQVL 3QDJA 4APQB 5IHUL 5JW5A 3U6RA 3LQMA 4HKBB 4E0RB 2EH8H 1C8XA 3JXAA 5I1EL 4C55A 5ACLA 2NQCA 2FRGP 4YGAB 3EYPA 5KAQF 1SHWB 3RL2B 1YEFL 1SBSL 4RFEB 1RU9H 4CKVX 5EFFA 4J3OC 4PR5A 4PGBA 5HNNA 5CKGA 4OYUA 3SEEA 2DI8A 3DX8B 3VXRD 1LF1A 1AE6L 1L0YA 4F2MB 4OCXL 3NFSL 4OQTH 4UNUA 3GHEH 3SGJC 4AQ1B 1LD9A 3ILQC 4X6EB 4QWWC 3G6JB 1NFIB 2DLFH 3GMRB 3MNWB 2ZX7A 4M62L 1YMMA 3PZIA 2WMIB 3V7AG 2PN5A 5F3HA 5DQ0A 4KVCH 1DBAH 5A6AA 2VLJA 3BKJL 4G80B 1OPGH 2NX5E 1CECA 4S1SL 5IVOA 4XNUL 1JF1B 3CUIA 2CRYA 4TTDC 2HT2C 1FZKA 3MBXL 4JY6A 1QP1A 4MSWB 4GI9A 3FQWB 1M4KA 3CIQA 5I8CA 2D03L 3RX8A 4ZTOL 1AQ0A 4D6EA 4F8QA 2VR5A 3LN5A 4FTVB 1HSAB 3N0PB 5EWIH 3H9HB 4Y19A 3QFDA 2VUOA 4HG4K 4LAQH 1CFQA 3BAEH 5EMYA 2ZUWA 3NUKA 5TDOB 3J8F7 4AT6B 3MOBH 3W5MA 2ZUQC 4OZFH 4W8JA 3IXAB 3HC3H 3MACH 3BRGC 4U1GC 3QULB 3O41A 4MMXC 1OGBA 4LPTA 3AIWA 4JQVA 4GQ9H 4RAUA 3NFPA 2P24A 3UEQA 3GJFA 5HGAB 1LDSA 3CMJA 4JGJA 1X4YA 3PDGA 2WIIB 4OM1L 3MJ8B 3CMOH 4DXTA 1VGEH 2FX7L 1PMJX 3O4LB 1WBZB 5ITFA 2AK1H 2H26B 3SDXE 1S7UA 1XMWA 3RVUD 1ONQA 3DO7A 3QG6B 3KZSA 4LGSB 1BFSA 3VRJB 1Z9OA 3CVHH 5DK2A 1U41A 2XXMB 3PQYD 3FQNA 4U4BA 2V3GA 1Z0NA 3H0TA 2WNWA 2HT3D 4K94C 4OFPA 2A6JA 2DQIH 5KOVC 4WJ5A 5I1CH 5HOSA 1Q9LB 3PHQA 2XFXA 2OYPA 1U8HB 4QXTB 3W26A 1A2YA 5JDSA 2DOCA 1KJ2H 1GJUA 4YDVB 3TV3L 4PTWA 4L3EB 3WMCA 5TDPA 3WLWC 1PKOA 1UD5A 2FX8L 3WH6A 1HL8A 4L3CA 4TTUA 1EXPA 4LCCA 4FHBD 5J1AA 4GWJA 1S9WA 1DYOA 2IUZA 3VMNA 1P69B 2HTKC 2BSRB 1GYAA 4L0PA 4JM2D 1CN4A 1GORA 4WF7A 3QXDA 4Y2DB 1RIUL 3WDJA 1C91A 5H94A 4L8DB 4GRWF 4FTVE 1RFDL 1BM3H 2BX5A 4LLWA 4MJ6A 3JUGA 4KVNL 4XPAH 5ABGA 1Q38A 3T8XB 5CIPH 4AZ7A 2F53B 1W9XA 3B9VA 4OZ4A 3CDCA 3MU7A 4LASH 4RE4A 1KGYA 2ZPKL 1AGEB 1LK2A 3PQYA 3I75A 3ROLB 4P59H 4PJ9B 3ES6B 4M4RA 1HI6A 2EDBA 2F9BT 2YIHA 4X6BA 2DH2A 3H9SB 1U3HC 4RX4A 4EUPH 2A0LC 5IMLA 3L6FB 5E5MA 1MEXL 1CFBA 3D5HA 3TTYA 3VD9A 2CERA 5J12C 3ET9F 4XVSL 1QUNA 1BQHB 2VXQH 4HGMA 3RWDB 2P5EA 5EH1A 1MXGA 3SHSA 1P5VA 2W67A 2EIDA 1IEAA 1WLHA 4JGMA 1BREA 3AREB 4G8EA 4N5EC 4XHJC 3TCLB 4S11A 1KXTB 5IUSA 1QLEL 2J8GA 1AO7D 2NLJB 4IRSC 2Z8VC 1US3A 4JDVA 4PJ9D 3ZDYF 5D6DC 1AFVL 3ZO0A 1Q9OB 4FZEL 5E00A 3WFCL 4FQLL 1ZE3C 1FSKB 2NYYC 1J1PL 4YZFE 2PYEA 1SBBA 1WTGT 2BVPB 2C8NA 4UQ2A 3IGAA 1ZLWK 3KL3A 4XMLL 4G8GA 4MADA 2PW2B 4B7LA 4PJ7A 2BRQA 2NX5B 3OHXB 5ICYA 2DQEH 5JPMA 5D7SL 3AS0A 4F9DA 4L8SA 1NCBH 3VRLE 1FNGB 3H3BC 2VISA 3ILPA 5JBEA 1MUJA 4QOKE 1OTUD 4W6YB 4R4FL 4CD7A 3I3DA 4GUPA 4GKZA 1SYVA 5JIIA 4ONGH 2HLEA 4FG6C 5JW4N 5JXGA 2KH2B 2V5YA 4AD2A 2VT0A 3VIHA 1EDGA 2NZ9C 1A6UH 3MGTA 4NCC2 1LGVA 2ZX6A 3GMOB 3SKJE 4OD2B 4C4KO 1AO7A 4D9QD 5DJZB 1VENA 4OGAC 1QFOA 2IQ9L 3VXSB 3PXJA 2A9ML 1ITCA 3I6KA 5TE7L 3RWJA 1Q6CA 1XCWA 1BD2D 2X1XR 2Y7QA 2Q1EA 5HY9A 4G6KH 5CJBA 1WZLA 3VJ6B 4AL8H 5C0EA 1XF4B 2ZCKL 1CG9A 3HHRB 4P8UA 2F58L 2D20A 5SWSB 3DIFB 1IKNC 3ZO9A 4XPHH 4OFIA 1HQRB 3V4PL 1CFSA 4LLUA 5CZXD 2YDQA 2DJSA 1QNPA 5J0BA 2QSTA 5I1KL 3S36H 2OXHA 1U8IB 3MV7D 3ZJKA 3AUVA 1J7VR 4HIIB 3IJ8A 1SEQL 1JNNL 4XGZA 3MLZH 1LE9B 4IISA 2Z31A 4X5WA 3RVXC 1XGUA 1RZ8B 2C1PA 3N1QC 1VPOH 3BFOA 4PJCA 3VG0L 3QJFA 1N6QL 4YHZL 3VIPA 3TBVA 3QDMB 3BGFC 3BKYL 4G9FB 1XF4A 2B9VA 3NSXA 2Q8AL 3TA9A 4J28A 1C1EL 1Q72H 1J11A 2Y24A 4JDZB 1FSKC 4AYSA 3RUGF 3NIGF 4LLYA 4ORGB 3MXVL 4GXVH 1RZGB 4ZPVA 4L3CB 5CJOH 3CDGA 3WY1A 3O2DA 4XCYA 5E8EB 1FFPA 3NZHH 1OCWH 4U1NB 2E3ZA 1F97A 4UDUB 5K33A 4XP6L 1QR1B 2ORBH 12E8L 2W9XA 1F3JA 1AGBB 1GL4B 4G6FD 4H0HB 1A7RH 2GTWA 1VGKB 3HZVA 3D25B 1W0VB 3BP4A 4PD4J 5DQJB 4DK3A 1XF2B 4PMXA 4HKXB 1ZBVA 2BNRA 1F42A 1FN4A 5DJYB 1G7LA 1MCPL 3VFVA 2PW2A 2HRPL 5AC4A 1ONQB 2H32B 5HBBA 1EEZA 1V05A 4G9DA 3SGEI 5L8LB 3UXFA 1CLYL 3HE6B 5KZ6A 4KQ4H 4MXVE 1KJ3L 1MCEA 5DEFB 1D5MB 4QRTA 3QUMB 5MHSD 1T5XB 1W0VA 3BP4B 3KLHD 3STLB 4HUUB 4I0CC 3L9RA 3I6LD 1Q0YH 3VA6A 4PMZA 4JFYB 1FIGH 4YWGH 1YEIH 3TIEB 2Q86B 2BCKB 2ADFL 2X4TA 4FXLA 2X0YA 4YPJA 1QZ1A 3QHFL 1FYTE 2VAAB 2CXKA 5C70A 1JMXA 3QUZC 1T03L 1JFQL 3HA0A 4AT6A 1CDHA 3QBTB 1EJOL 1NEUA 1WAWA 3RIFF 3CVHL 1DDHA 2VH5H 5I73B 1HK6A 5IV2A 3QJHA 1U6AH 4PJHE 5I19L 4XNZC 3LDBC 1ZT7B 2PETA 4UBDD 2MANA 4NC0B 4MA3A 2XG4A 5ID1B 5EFIB 1L0XA 1JF6A 1JK8A 1NCAL 1I3UA 2CDFB 2CHOA 2WN2A 2GHWB 3MJ8A 1S7VB 4HIXH 2NTFB 4W8AA 4HDIB 1H15B 5I19H 4U7KA 2D9CA 1O8SA 4M7KH 3TN0D 3MANA 2GYSA 2HG5B 1ED3A 5GSRB 1FO0A 4OCNC 3UNPA 1A3HA 1GQPA 5GQBA 4DN4H 3UBXB 2K1MA 1RUML 2BHYA 3GKWL 3IDJA 1ADQH 2YD7A 4MB1A 1U8IA 1KB9K 4HD9A 1CGSH 2UY7A 5AAMA 2EXYD 4LAQL 4Y4KB 3OWEA 3LE0A 3VDCA 3CLFL 1D5XA 2NZ9D 4L4TA 1OP3H 3V4PH 1OLLA 2VDNH 4EI5D 1M04A 2CXGA 1QBMH 2JCCE 5GIRA 3FN0L 1G5AA 2XZCL 4N68A 1J1XH 1U8KA 3R4DA 4HS3A 2DN7A 4PRPE 5BZDA 5FGCB 1NGQH 5EOCL 5J4MA 4HCRH 1QSZA 2EDJA 4ORGA 3BYYA 5M94B 3ETPA 5HHOE 1DR9A 2FEDC 1A6WH 1HWGB 1MI5B 3T2QA 2NX5D 5F3BB 2J8FA 2ZSVB 1JRHH 4Z7QF 2NYYD 4XBGB 1JFQH 2FIRT 3CFKA 3HZKA 2NY0D 2VMDA 4RWHA 2A73B 3RNQA 1JZ8A 2ID4A 4TVPE 1IQDB 1ORSA 1A7QL 4MXQD 4ZUTA 1JPSH 4U2ZA 4XVUC 3EYVA 4MCYA 4I77H 4OD3H 3HRPA 2ARJB 4AEIH 4QLKA 1QSED 2ZKHL 2BVQA 2R2HB 5D7LE 5D2LB 5DMIH 1XT5A 4P46A 1D9KC 4L5FH 2Y36L 2WCSA 1LEGB 1FRGL 2F8XC 2UZIL 2ID5A 1K5NA 1MWAL 1NBQA 4XAKE 5GRVK 4F7MA 1UR4A 1GZQA 5KVFH 1WK0A 3NABL 5KSAD 1T89A 1FO0L 5DJAB 3P0VL 4F9PA 4DTGH 2K3TA 5DJDB 5SX5K 3DO3A 4PRIB 5FOBA 1AD0A 4LF3A 2LU7A 1RZ7L 1BEYL 5C71A 1WISA 3OLGA 2VX5A 5EU7C 3FFCB 1NCCH 4Q9RH 2KD7A 1CDJA 5JIHA 3L2LA 3CUJA 2EEDA 3SJVE 4MMZC 2HT3C 2OK0L 4L4TD 3DRQB 3DXAB 2ZUSA 4ZYKA 2LABA 2OI9C 4ARYA 1B3XA 1GXEA 1Z32X 3NVQA 5I1LA 3DHUA 3L95A 4MXWL 5HHPB 1CIYA 1PW3A 3ARGD 1UWEH 3MBEA 4P3DA 2EKSB 1IAKB 3DX6B 4KJQC 5FB8B 1B1YA 3BW9B 4LPUA 4WY7H 5JORA 4OLUL 2GAZB 3SCTA 4HPOH 3ZM8A 1BLNA 4HGKC 3P4LA 4NQXA 4OKVB 5IMKB 4DEQA 4PJ8C 2ED9A 3QCTH 1R0AH 4H7VA 1LP9E 3PWPD 3HI1A 2XKUA 4LOUD 2BNQD 3JV6B 2W9DH 4KJPD 2PNDA 2VL4A 5M7QA 4PRDA 4KFZC 2Z92B 4M6NL 4F9LC 4Y16A 2O9OA 3WUBA 1I1AC 2OL3H 2YPKA 2Z35A 3FT3B 3AB0C 3BT2L 1YJDC 1RFDH 2W9DL 1BJMA 1T1ZA 1V6VA 1NFDE 5DQ9B 4JCMA 3FMGL 1X5XA 2F54B 4YAQA 3T0DA 5D71L 1G1CA 1J0ZA 2E7LA 3P2TA 4CN4A 1IAOA 2VI0A 2DM3A 2NY2C 2M2DA 4B41A 4FK9A 3ARYA 1RHHA 1EDQA 3V6FA 4P23C 3PWPB 4EIGB 1WT5C 4X8JB 1GPOH 3K2UL 4MXQC 5T3ZE 3EJYC 1I9JH 1GOHA 3JWOC 5E9DD 4HFUH 3B3IB 3VRIB 2AV7B 4NC1C 4Q9RL 1PG7L 2BDNL 5ISZD 1BVKA 4QB6A 5A6JA 4CVXA 3TZVA 1G0XA 1UKPA 5BJTB 3POCA 3EOBA 4V28A 2OJZH 4ZXBA 4ETQB 1FAIL 2FBOJ 1AGFB 1NLBH 1ZA6B 1PX3A 3S9DB 2VM9A 2PWEA 4XVSH 3O4LD 4K94L 3UZQA 1T21B 2ORXA 4JRYE 1B30A 2C9KA 3LDBB 3WIHL 3B3IA 4JFTA 1WE5A 5KSBE 1CICD 4EI5C 4WI2A 3HZMA 5EU3A 2F54D 5JW4R 5F88A 1MQKH 1UZ8A 4GLRI 1HWHB 3BIKB