2VZTA

Complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 275
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vztA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vztA03
1J88A 1WDSA 1DWGM 1YY8A 5AAMA 1OGTB 4OIBA 3C8XA 4EI6A 1IRAY 1GW1A 5A6JA 4NUGH 1OCWH 1QSZA 3TBTA 1QQDB 1B0RA 1JWMA 1IGCL 2XACC 4HG6B 3Q6FB 4Z76B 2Y6HA 1E0XA 5GGSA 3ZYOA 2CDEB 4WV1C 1KJVA 4WNQA 4WSJA 1T04A 4XB8A 1MXDA 4AH2B 5C8BB 4WI8A 4B7LA 1MFBL 5EUOF 5AZ2H 2Y24A 4KH2A 2YD8A 4ARXA 1ZTXH 3JVGA 1EOMA 3EYVB 5CJ5A 3HI1A 2DLEA 5J9PA 4WHTB 4Q9RH 4MCZB 4PG2A 1NMAH 1KIPA 2ZKHH 1OF3A 4FABL 1B0GB 4RNRA 2V2TA 4FXGA 1FH7A 1FL3A 3K81A 1FNSL 3I2KA 4E5XA 1OGAA 3BZFB 3PN8A 1KCRH 4GS7B 3MCG1 5AWNL 1QP1A 1W1PA 3EO9H 2X9XA 2D7QA 3BKML 5E08H 1D6VH 4R8WH 5IVZA 2R2CA 3ARQA 3QWRA 1I1AD 3HZVA 1GVIA 1RUQH 2FGLA 3C6LD 3CC5B 1UFUA 1PY4A 3IFNL 2I9LB 5L8KB 2XFXA 3H0TA 1E6OL 4DN4H 4XNQA 4UQ2B 4WI6A 4MA8H 3I2IA 2W91A 1UYZA 3WN5C 3DI3B 1HF6A 2YDQA 2GT9B 3MV7A 3F12A 3PWVA 4WTWA 5EO9A 1KQZA 3SCSA 1BYBA 3QCVH 2WDBA 3QDAA 3L3JB 4WUKL 1FL6A 3REWB 2XYCA 3EDKA 3RA7H 1HHGB 3NIDE 1KN4H 2VH5L 4P9MH 2WBJB 4RAUB 3NSMA 4H8WH 5EBWB 1GQLA 5E4EB 2FHBA 2L9LA 2R23B 4PJAF 1RJLB 3EBAA 4CL7A 2X1IA 5CSZB 1MPAH 5CPSA 5D72L 5M17A 2HJFA 4JB9L 3L3DA 4G8FB 4XP6L 4ZOEA 4K7PH 2X4NB 3UJJL 5D7IF 5MEND 4V27A 3H9SB 3L95B 5JQHC 2NY4D 4HAGA 4K9EL 2VL5A 4HZLA 1VADA 4PCTA 5IBTH 2EC9T 4EDWH 1UWWA 3S36X 3F5KA 3DBXA 3O8XC 1A6TB 1MREL 4OIFA 3LN4B 4DK3A 3MSGA 5F88A 4HIIA 2XZZA 3VINA 4PRDB 1O8SA 4IUGA 3HG1A 4J27A 1T3FA 3OF6A 4JZNA 3UAJC 3V5HA 1NCCL 1M05A 3B9EA 1KXTA 4M4RA 3QDME 2W4XA 1XF3B 1U8QA 3LKSA 4R97C 4MDIB 1B90A 2PWGA 3QRGL 3NCFB 4WU5B 4I9WD 4JDVB 2VNCA 2AI0L 1NMBL 5EU7E 4YBQC 1T20B 1QHZA 4LLQA 1M04A 4M7ZC 5A16B 1EO8L 5CCKL 4QY8A 2WC4A 2DL2A 1F02I 4D9LL 3CDGA 3NCEB 4HUNB 2ICCA 5JTWA 1HJUA 5IBLC 3MCLL 2P47B 4OSUH 4ZOAA 2JKXA 5F1NA 3SE8H 4U2ZA 5IDIA 2FGZA 4XMKH 5ALCL 5GHWH 2ZUVA 4V1DE 5K59F 3MJ9L 3ZKXB 4DXRA 3NIFF 1U92A 3SGEI 3KXFA 4WI5A 1IGFH 5BROA 1ZLWH 4HJJH 2X0HA 4Z7QE 1EX0A 2CDGA 4WEUD 5FV2A 4Z7NE 1PJ9A 4EOWL 2Z92A 3GMRB 2CXGA 3CFDA 4F2MB 4MDJA 2GDVA 1JNJA 4ISVA 1KLGA 5IV2B 2LVCA 3V8OA 3MROB 1OTTD 4HIJA 5FUCE 1UWEH 5C09E 5E99H 5EB8A 2CBJA 3S36L 5IM7A 2VISB 3B8SA 5HVHC 1HYSD 2FECI 2VZUA 4ONFL 5EFIB 5FHBH 2AEQH 1UWIA 5ID0B 3VFVB 1JF6A 1NSNH 1V6WA 4P5TD 1A7PH 3PNWA 4X4ME 2PWFA 1QFOA 3QXDB 3NJXA 3LPFA 1C7SA 3V6OE 4W7WA 1BAGA 3OKOB 3PP3K 5HYJB 4GKLA 4JZOA 3E0GA 2XZCH 3S3SA 3G5YA 5ETUA 1NCWL 3L4TA 1UD3A 4UT6L 2HLAB 3BD3A 4PBWD 1VEPA 2NSXA 4WY7L 5GGVY 1HEZA 3DWTA 1I8MA 1YPZE 2JELL 4QXUL 4TRPH 3AISA 2XKUA 1YY9D 4AY1A 4OCYL 2ZOLB 3NDYA 1JHTA 1YA5A 3O41B 4DM1A 4U7SA 3NZ8A 4PP1D 1RHHB 1JWUB 3T1FB 1OP3H 3L9RA 1JPTH 1GGUA 2PW1B 5T5FL 4NOBA 5D1XA 1FVCA 1BLNB 4MQ7B 5H37H 1MCNA 3ULSA 2ZWYA 3IT8D 3S34H 2VDLH 3MRLA 4XXCC 1X7QB 3RGVA 4NCC2 3OHXA 2NXZB 2XY2A 1JFQL 3VH8G 4X98A 2BP3A 5FUIA 5D71H 3AS0A 1TJHH 4I3SL 4XXDB 4HZ8A 1L0XA 4X7DC 3PHSA 1GZQA 1XSKA 1BLIA 4I0CC 3PDGA 4Y1AD 4GRLB 1O8PA 3MS8A 2EXOA 4LVNB 4KDVA 5IOPB 5F7LB 5H35B 4NYLB 4ZNEE 4WW2C 2ZX6A 1A2YA 3MLZH 3SDXF 1P7HL 2XWDA 2EDXA 4HK0A 2DI7A 4PIRF 4MOAA 4Z8FL 1T2QL 2R4SH 1W3LA 1YNKH 2H9GB 3BW9A 5BVJB 1MJ8L 2NQCA 2JCCE 5ISZA 4NM4H 4AXNA 2GIYA 5CSBA 5GS0D 4XP5L 1IKFL 3GSQA 2DJ4A 3PQYB 1XPWA 2JDAA 2WVTA 3GBNL 5E6IA 3NJ3A 5D5MA 3FQXA 1RK1B 3QUMA 3IDMA 3BIKB 2IMNA 2Y23A 1ZLSH 3RHWK 3F5JA 4C59B 4J1UA 1QR1B 4I0KA 5J7CC 3KPMB 3FOMB 2J7EA 1J1OH 1QPXA 1DBKH 1G84A 2FO4B 3VMPA 4YE4H 4GQQA 4JO1H 1C8PA 5IHZB 4ZS7H 3HAEG 4OM1H 8FABA 5IMKB 3HR5B 3MOQA 3NA9L 3GMLA 4LEOA 1YEEH 4JO3H 3HPJA 2VLMD 5ALBH 3OKNB 3HE7A 3ZSTA 4I77L 3VRLF 1BGAA 1MJ7L 1NCUA 4FXKA 2F8QA 4HS3B 1X5FA 2AJYL 2W0FB 3BPLC 1DEEA 4B7IA 1Q0XH 4DZ8B 4FQXB 1CIDA 4HKBB 4TPRH 2DQIL 5EUOB 4J7RA 5CD3B 2EDRA 5FYLD 3GMMA 3KR3H 3KJ4C 4Y0GA 2C7UB 4P2OC 1MCPL 3D0VA 1CECA 5E95B 3WNMA 5E09A 1GPFA 2P4AB 3UBXA 4PJXF 4Y4HC 1MJJB 5KANI 3NNGA 3NCBB 3BUYB 3QULB 3VGHA 4O2CB 4PGCA 1FJ1A 1I9IL 4LGRB 2HKFH 5DMKA 3NUKA 3J7HA 1BFOB 3H42L 3QUZD 4O02H 4O5LL 1WPCA 5F3HB 1HILB 1NEUA 4PGEA 2FJFB 1T5XB 4YDLC 1KCLA 3E6FA 1QOXA 5GS0L 5C2BL 4Z2LA 1RZ7H 3BP6A 3N85L 3LN5B 4F58H 4DM2A 4G43B 5F9OH 3OL2A 1W0VB 1HDMB 5KZCD 5LA0A 2B1HL 2OR7A 4M29A 3TJHD 3T09A 5C1MB 4NN6C 5DJAA 3SCMD 4NRRA 1M7IA 3AXHA 1CD9B 3A47A 1CNVA 1XAUA 4MNKA 2Y36H 4R0LA 4ZTOL 1OB1B 2Z31C 1I1FA 3DO7A 1LK3H 1A64A 3MGTB 4E42B 1AKJA 1H5BB 3HPLA 4LFHG 1PDKA 3MBXH 4PJAB 4F33A 3WEXB 1U8PB 1X44A 5L9DL 3V79C 2F19H 1U3ZA 4HPYL 3KHQA 4G3YL 4ORZC 5DD5H 1F8TH 5HD8D 1CENA 4ZXOA 3GJFA 2MPAL 5DRNB 1E5JA 3FOLA 3GSXA 4GH7B 4PBGA 3Q3GA 1BPVA 4UZSA 1YPZF 5HHOA 2V7NA 5FYLL 2XIDA 3Q1SL 5F7YC 3U30B 4A45A 4Q2ZA 5E2VH 4IIQA 5JBFA 3S6CA 3QJFA 4CD7A 4WKAA 1G7LB 3LPPA 4RGMB 1G6VK 2KD7A 4C57C 15C8L 1PLGH 1BVKA 5EZOL 3K8KA 1QBBA 4M7LH 4N8CL 2ERJB 4KDTC 1GUVA 4EKJA 1XSIA 3UCQA 4XZUA 1WAAE 4LAQL 1FNGB 5EBMA 1M6OB 1GOWA 4K3JH 5FF6A 3MLXH 3HFMH 3RY5A 1NC4A 5L0QC 4DOHB 3WH8A 5GS2D 2V6HA 2V72A 3GIVA 1HSBA 2XY1A 4LGSB 2JD9A 4XCFH 3STZA 5FAAA 3ZE0E 3MACL 5L2KB 3G04A 2IH3B 1H15B 3VFPB 4XHJD 4HCRH 1MHCA 1WFUA 1F6AA 5J12B 2WBJD 2B1AL 3DIFB 3C2SA 3GYCA 3WF3A 3DECA 5EJ1B 3IDNB 4CRPA 3AIEA 1BQCA 2DQGL 2R2BA 2Z93B 4HUXB 2JCCF 1Q6DA 4TNWK 5DLMH 5C8JA 3U0TA 1EHLH 3VI3E 1ZA3A 3FO0H 3RWCB 5FECA 5A43C 4K3DL 2FX7L 3RNKA 3SDAC 3H9SD 3FT4B 4R27A 1A4KA 1I3UA 4QOKB 5T1LA 1UXXX 1I1YA 2WW8A 3PZVA 1JRHI 4WFHD 2QQJA 3OLIA 4BQ8A 1E4MM 3DX8B 3BSHA 1HX0A 3W2DL 3S6TA 1CU4H 3U37A 1XGTB 4Y1AE 4PSRA 5J3HD 1XRVA 1J84A 3F5LA 4MZ3A 1NUKA 1LEGB 2OJEB 3PG2A 4R2GC 3FQUB 4IHOB 2HLFC 1CDGA 1ZT4B 3ULVD 3BQUA 3F65A 2AS5M 1SDDB 1A6VL 1CBVL 4BH7A 3TGXA 3VGAC 1RULH 2AEIT 2RFXB 1RZJL 4ZAKC 3VFGL 5HGBA 2WSKA 3C5ZB 3AZRA 1ZT7B 3QQNA 1S7SA 3WSQH 1XGQA 3B2UD 4GKZB 4YDJB 2IQAB 4WKFA 5CYYA 4KTDH 3PZQA 5E2UH 2OYPA 2QR0A 5DJ0A 3RKDD 1CTOA 5IR1B 1G9NL 1L7TH 2VLJA 4WI9A 5EIVA 2ZXBA 4F79A 3IDXH 3AHVA 2FHCA 4U05A 1D9KD 1BWMA 4MQSB 3BRGC 4Z7VB 5DJ2B 2G41A 1T7XA 4WO4B 3IJ9A 3SUUA 2WUCH 3HC4L 3KPOA 4EK7A 5JUEL 5DD6B 3RWDB 4NKMB 4D6CA 1CK0H 2V7HB 2DQHL 2J8UE 2QEJA 4GUPA 1DWAM 4POUB 5FOBB 1LO4H 2BOCB 2XG5A 1S9XB 3QEQB 3DROB 4CADB 1FGNH 5IJKA 2TAAA 3M1BB 1ZJAA 2OSXA 5A6KA 1ZS8A 1CLZH 2DH2A 3UO1H 3G6DH 4NJAL 5IMOB 4XNZC 2EC9U 4TNWF 1WCQA 2DBLL 4G8IA 1FDLL 1UZ6E 3HI6L 3RWHB 1EHNA 3IJYB 5EU6B 4P9HL 3D5HA 5D96B 1UACH 2VSCA 4HF5L 3UPRB 5DI8A 3SCPA 2DTMH 3L5XL 3PGFL 1TTFA 4N5ED 4YQXH 3ULVL 2ZUUA 4L3ED 3QOMA 2WZ8A 3SDXB 3V5KA 5DRXA 4OD1H 2X5PA 2VZOA 2G60L 3NDZA 25C8L 2AJZB 4HT1L 4MA7L 5D1ZA 2V4VA 3PZNA 1CGVA 2J4WL 2VLKA 3VWKC 3WNNA 3U57A 4JPKH 3RBSA 5HGAA 4N90D 4OZFB 4Y7MA 3PXHA 2O9PA 5I1JH 3PE9A 2BHYA 4UI2A 5HYJD 5CZXC 1VBUA 1IBGH 1QLFB 1HHKA 4LGXA 2LV4A 1ZA6A 3NFSL 1GAFL 4X4XB 3GH4A 4WEMB 2XNAB 2Y7QA 1IZJA 4H26B 5ERWB 4OQTH 1KT2B 4ZPVA 4YN5A 5EU4A 3CH8A 2D03H 4YXKH 3RWGB 3PWPA 2XPKA 4L3AA 2R0WL 1K3IA 1LDPH 3BWAB 2Q8XA 1MLCB 1KJ2H 2CIIA 1KOAA 4X83A 2HJLA 35C8L 3TLRA 5FDYA 5H37G 1EO7A 5EIIB 3WDIA 1QHOA 1L4IA 4AMKL 1ISVA 2Y1VA 4ACZB 3L4VA 2BMKB 3VD7A 1WDQA 1OB0A 2OMNA 1ZGLA 3CHFA 4KRUA 4CW1B 5I8OL 3LQZA 4G42B 2FX9H 3RVVC 2CRZA 3HMXA 3TYFB 3ZKNC 3WIHL 2XVLA 1U6AH 4HMDA 5IP4A 5AUMB 3W25A 2E9IA 3ARVA 4HIHB 1KB5H 4TUFA 4OLUH 3VXMA 1BYCA 5E1AB 1N59B 2DI9A 3U82B 3ZE0F 1X5YA 2VMEA 3TIDA 1A14H 4DTGH 4GRLD 4PJXB 1LF1A 4ODVL 1N8ZA 3ZO9A 2C7FA 3AREA 1QFWL 1GGCL 1Z5LB 1S7WA 5KJRH 3F58L 3UDWC 3QXTA 3DUHA 4O51B 3PWNA 4YO0A 1BIIB 1SMAA 3SQOH 4A6YA 4DXSA 3WS3A 5F6IC 4Q9CA 3UJIH 3VIHA 5ACLA 1FCGA 2W9EH 2DWEA 2D7TL 2VZSA 2IANB 5DDHA 1RUML 1TENA 5AYIA 3SCNA 3MRRB 1JPGA 2XFFA 1J12A 3JWDC 4K71B 3MFGB 1QLEL 1IGYB 3SY0A 5C0DB 2V9TA 4CD4A 3GSRA 1W2VA 1F6FB 3F7YB 4OKVB 2GJZA 1UWGH 4LLMA 2X09A 4GBXB 4L5FL 4LCCB 5EUKB 1CL7L 3OBAA 3KPPB 3G5VA 5DEGA 3S3JA 1OD3A 3SUSA 3X17A 5B38A 4JY6A 4LHSA 3ARFA 3CSYB 1NUGA 2X4RA 5ESQB 1VFAA 1F4XH 4JM2F 1H6YA 1CXLA 1B3WA 2EC8A 4XCCH 1BQSA 4Z7OF 5TE7L 2E40A 3VRJA 1J0JA 4MDPA 4P7OA 4XURA 3NFPB 1ADQH 3HUJF 1YDPA 4HX1A 1JAEA 1NWTA 3CUGA 4P2QB 5C07D 1T0NB 2B5IB 1WEJL 3NABH 3FN9A 4KJQD 1E0VA 3W9DB 2H3NA 1T6VN 2DQDH 3MRGB 1KNOA 3H3PH 5MEPB 1UWQA 5D70H 4WFHE 1TZGH 3KPNA 4KUCD 2V5SA 2HG5A 1KCSH 3C7HA 3O3DA 4R96B 1N82A 1WBZB 1ZXQA 4EIGB 3UTSA 4YXHL 2D7PA 1L7QA 2A0LD 2V2XB 4FFYL 5FUCC 3CH1A 2LS6A 4XPGL 1QEWA 3WUFA 4DKDC 3ULVE 2Q8AH 3H3KA 3OKDB 5FOJA 4D6GA 4RBPH 3P4MA 4K7FB 2Y6KA 1QSEB 3QQ3A 3OGOE 4JFQA 2Y5TA 3KYOB 2OZ4L 3L4ZA 3C8KB 4NO2A 3V6OC 1F3DH 5BRZA 2J5LC 2VDPL 3KL0A 4G6FB 4NHCL 1I7TA 4GQ9L 1G01A 4ZTPH 1J0KA 3HMWH 3WBAA 1NFKA 4CCDA 1HQRA 5D8ZA 4I3GA 5MHSD 1XR8B 3O6KH 5DZNA 1D3CA 2C1OB 5F8RC 3HEIA 4BELD 1JGEA 4BK5A 5HHXH 3EJZD 4XCYB 1OW0A 3GMQB 2WMPA 4RMSA 4KUZL 4UTFA 4NQEA 2VXTH 3EKCA 1YEHL 3VA2C 4UFMA 4LDEB 5A6SA 5DFVD 4WFED 4EDXA 3BGFC 5JA9A 2XZAH 3UYRH 3L3GA 3ZIZA 2FGWH 4PEEA 2ZG3A 4LHUB 4X7TA 3PZGA 3UPCA 1Q9KB 4X6DA 3TA3A 1BQLH 1JNHB 3LHPH 1YEKH 4K3EL 1ZKAA 4X80L 3QWRD 3CIVA 1DP0A 3T0AA 3S88H 4F7TB 3H8NA 2DEPA 1JK8B 1EEUA 3OIHA 1ZVSB 2UWEE 4K9EC 4KHTH 4ZUWA 3NAAH 3GNPA 1Q38A 1YECL 4WFGD 2NW3B 1YQ2A 4N0UB 2DWDA 4S1SH 2WIMA 3UC0H 4L4JA 3MV7D 4PMQA 4PB0H 3UJTH 3OKYA 2DSVA 1IFHL 4NSKB 3U7YL 4IM4A 3T4YB 3MGAA 5IB2B 2SEBA 4OFYA 1FZMB 2A6DA 4KZEL 2OL3B 2FH6A 4L3EE 2FDMA 4P5KB 4LSPL 4FRWA 3AMCA 3B5GA 1IGCH 4L3CB 2D7NA 1VFOA 2Y6SD 4HFUL 4CDHA 4DGIH 3VKKA 3C6LC 4U1IB 5HYJE 4H0HB 1MFVA 5CJOL 1H3VA 5C0EA 4X7FC 2YHGA 4K94L 5FO7A 3C09B 3FJTA 1V7NH 5L2KD 1F3JA 5A95A 3IDUA 3HG1D 2FSEB 3OF6D 3QP3A 43CAA 1U2HA 3OGSA 1MHEA 1TZIA 3WELA 5GRYA 1FNSH 2AEWA 1WBYB 1MWAB 1UZ8B 5AWNH 4ZSOA 3BKMH 1KCVH 4YNYA 5EIYB 1TE1A 3KAAA 4CD6A 4ZODA 1CXKA 1Y18B 2XQYG 2XVKA 3O9NA 3HRPA 3IFNH 3WE6A 2QQMA 2NY4C 3ZTNL 3HTLX 4WWKB 4Y19B 4E0RA 2V9RA 4RE4A 3BZ4B 3VIOA 2DQCL 1LEKB 2QPUA 2DM3A 1B88A 4Y4KB 5GNZA 3A7QA 1P5VA 5LGHL 4I18B 5BW7A 2Q76B 4JPWH 4FQJL 4HUMB 1FA2A 4AIUA 2VH5H 2DPEA 4E41B 1ZWIB 1FRGL 1JL8A 4JRWA 3GZKA 1ZVYA 3B5TA 4PJ9A 5HJ3B 5I1DB 5KVFH 3RX7A 3LS5L 4YR6B 1II4E 3QUYA 1NGWB 2YDSA 1IEHA 3UJJH 4CNIA 4MAYA 1EXUB 3DVGA 1LVEA 4EI5A 2IUZA 4QHLA 4NQSB 1LD9A 1K8IB 2A9MH 1UCTA 4K9EH 2V5CA 2VDKL 3FN0L 1CG9B 3QHZL 4TUOB 2ATKB 4QTIL 1DFBH 2X4UA 5TDPA 3BESR 4URTB 3HE6A 3RDTA 4ZUVB 1YMMA 1MREH 3PDDA 3V7AE 4FF5A 4G6KL 4LPCA 4NQVB 4CN4A 4N0CD 4M1GH 4PRHE 2GCYB 4WI7A 3GIZH 3DYOA 4Q6YA 3T2QA 4JRXA 1AQDA 4IOIA 1US3A 2YBUA 3VOCA 1RZIA 2OR9L 3X3GL 5JMRA 3CDZB 4GI9A 3QWOA 4ZUUB 1JDDA 1JHKL 4OLWH 3F7PC 1G7MB 3QRGH 5JXEA 5I17B 1NMBH 4NKDA 3DI2B 5C07E 3FO2B 4F9LA 5DHVA 3BH8B 5CS7A 5E0FA 5FIPA 1WWCA 1YUHA 2X1PA 5EZJB 2NX5B 1FGVH 5CCKH 5I73C 3OLDA 1JI6A 4E2OA 4OD2B 4D9LH 3K1DA 3QJHB 3MREB 1OTTC 3MLWL 1FLRL 1A6WL 3T0WA 4Q22A 4U3CA 1K6AA 3SJVD 1FAIH 2Q7YA 3L7FA 3WD0A 3G08A 4XVSL 1VA9A 2V5MA 5D1XD 1HYSC 5HPMB 4Y2DB 2BBAA 1XZ0B 2EIZA 3BXNA 4P5TC 1AHWC 5D8JL 1XIWA 3MRHB 5DT1L 3RGVD 2BSTB 4Y5VC 5K93A 1ETZA 4CBPA 2UWEF 1XNAA 1QBLL 1FZKB 1I9JL 1O7AA 2X0YA 2FB4L 4DFHA 1HCVA 2H26B 3IFLL 5MHSE 2D31B 4Q6IA 1SY6L 4PMRA 1JJUA 2JLLA 1IAKA 3ZE1E 5I74B 5E94A 5DO2D 3HZYB 4LYRA 1W9XA 4PP1C 4Y2OA 3S36H 4CUBA 3CBWA 1RZKL 4PRIB 1DVFB 5EO1A 5INDB 4WFEE 2A74A 1F2XK 1YNLL 3RZWA 4LPTA 4JM2B 4ONFH 4RZCA 4D6JA 2WIIA 1W9SA 5ABEA 3LEYL 4GKNB 5ISZD 4FMFA 3W24A 5DD3L 5SWZB 1YHTA 2PYEB 1E3XA 3GTNA 3UX9B 3S5LB 4P3CH 3HUJB 3LE0A 1YEFL 5I1IL 5HYQB 4LLUA 4QRPA 2PO6A 1INQB 3DJ9A 5JPNA 5E6ID 4J3OC 4LKCB 3SKVA 1RU9H 4UT6H 4GRMB 5CP3H 4GINA 1V3MA 4WY7H 3UNPA 3F6LA 5JW5A 2JELH 4QXUH 3CFEB 5F1OB 3ZJ8A 3MV7E 1R5IA 3PL6A 5EWIH 4W7VA 1H3TA 2JIXA 1UJ3A 3G9AB 2CKRA 3BAIA 1RMFH 3MU7A 2E8ZA 1MI5A 4LCYA 5K9JL 5F7DA 4C7DA 1EO5A 2E8YA 3HE7D 3ORJA 5IB5B 5LJYH 2UVFA 1O7VA 2IGFL 4JQXC 4YHYC 2FATL 2NZ9D 3FHAA 2VDNL 1GZPA 4QO1A 5I8CB 5GS0C 4PTMA 2ARJA 1S9VA 5CD5D 3SIMA 4JFOB 5J06A 4ACYA 2FEDD 3T0XA 5KTEH 4I3SH 2GJ6B 4GRWF 1B3ZA 1AFVL 2A3EA 4G9FB 2XN9A 5CEYB 3FB7B 2PWEA 4MJ6A 3TZVB 3NH7L 4NKQB 4OCXL 4HKJB 1U2CA 5IBUB 2WBGA 4PBXA 3OJ2C 3X14A 3I2CL 2N56A 3HG1E 3JUGA 2J8OA 1LDSA 2ORBL 4GAGL 4ODSH 2DLFL 4DAGL 4C7GA 5C0ND 3HOBA 2FEEI 3IDGA 1T2QH 4Z8FH 2BZDA 2NW0A 4PMVA 1IGTA 5KN5B 4JN2B 1F58L 1MJ8H 4R3SA 3EIFA 4L9LC 2FL5B 3DGGA 1NCAL 3V52H 1XF2A 3S7GA 4MADA 4EAMA 2KDGA 4BKLA 1HOCA 4MJ2A 1IKFH 4HWBL 4OF6A 5JR1H 3VH8A 2PQSA 2GFBB 3GBNH 4JM4L 3VXUB 5CEZD 3QOKA 3QQ4A 2DCKA 3GKWL 1JHLL 3B5HA 3LY6A 3KLAA 4UT7L 3TO4A 1JF1A 5E8DH 1DWFM 1EFXA 1K6QL 1CBGA 4PTVA 4IMLB 4AYSA 1EVTC 2WZEA 3N1GC 4URIA 4ELMA 3QEUB 2OMBA 1NQBA 1OARL 3GI9L 1S5HA 3EJYD 1AKJD 3NA9H 2VE6B 2B39A 5I2IB 2QBXA 3QUZC 1BVLA 3BE1L 2X4TA 3FONA 4LARH 1MJ7H 5DTFA 1OINA 3PZTA 1HXYB 1OAYH 1TITA 4P99A 4PREA 5KSAB 5GQBA 5ANMA 3L4WA 3FQWA 4H88H 1SYSB 3RY6C 2QHRH 1JPSL 5D7SH 2EDKA 3LSOA 3OGCA 1FNEB 5GGUB 3RUGA 4RAHA 3JTTB 5HHOD 2AXGA 1KEML 3TJHC 2MANA 3SCMC 4DZBB 1RUAL 3IVKB 1DQDL 1PBGA 4BFBD 1J8HB 4NQDA 4DKEL 2CLZA 2A77L 3V4PL 2YD1A 3FFDB 2Q86B 5IJVA 4B3KA 3HAEA 2J77A 1I9IH 5B4XA 3KPSB 4KGJA 5AD0A 1TJIL 4ODWB 1J1PL 4O5LH 3QO0B 2BK8A 3L3HB 6CGTA 2KZ1B 4W5UA 4X9FA 3VXTA 3EJJX 5C2BH 1QI5A 3G6AA 3N85H 3QQ9D 4JVUA 3T2PA 5HD8C 3P9WB 4YGVA 5CEZL 5F44A 2B1HH 3CFBA 3QIWA 4ATWA 4H25B 4XNMA 5CBEB 1XSJA 5BCAA 3MV8A 2PN5A 4HK3N 4KV5E 2DTSA 1KIUA 4XPAH 4YDVA 5GZND 2ZNXA 3I3DA 5TF1L 3RY4A 4M8QA 3WKZA 4LP5A 5KVGL 3MXVL 1I3VA 5FGCB 1MVYA 3SJVE 3ZHDA 1G7HA 4WFFE 4HEPG 1E4JA 3SCOA 1RZJC 4OUOA 2YD2A 5I24A 4GS7C 1ZLVK 4F57L 1VGKA 4W8LA 5L9DH 1UA7A 5L2JB 5MERB 1EMTL 5DC4B 1A6AB 2C9AA 4JDTH 4F7CA 1WK0A 1HQ4A 3MC0A 4G8GA 3TCXA 2MPAH 3B9AA 4NQXB 1XH1A 5LA1A 1RZFH 4AIOA 3VE0B 1HIML 2C4XA 2BVTA 4JR9L 1G9NC 4ORGB 5TE4H 4JQIL 1LK2B 5FYLH 3AHZA 3RJYA 4FI9A 3KNBB 3VFUB 3IDJB 1IE5A 3MJ8B 3BISA 1XT5A 4RFOH 2R8SH 4XHJC 2LW8A 15C8H 5EZOH 2W0KA 1P2CB 2G5BA 4MVBD 1GNYA 3IU3B 2WBJC 4N8CH 2AJVL 5C70A 4D6EA 3GDBA 5KS9A 5A6MA 1P8JA 4QX2A 1UYYA 5JIWA 1MCFA 3J8F7 1FYTA 5E4EC 1IGJB 4OQ1A 3AAZB 4GLRI 4MNQB 5DK2A 5ISZE 1W1TA 1MF2H 2VB5A 2D9CA 4OLXH 4X9BA 2J6EL 1SJXA 3C7GA 4I5BB 2IPKB 4G6JL 5CJBA 4D6FA 3W11D 5IF0A 4F9PA 4KROB 5D5ME 3Q5OA 4WWKD 2ZUXA 4GSDH 4XZBA 2NTFA 3CZUA 1VEOA 1IM3B 1OLZA 2DQUL 2R2EA 4UDUA 4TOYL 3BEWB 4GKSA 4P9HC 4EVNB 4I4WB 2VAAA 2G9HB 3CDCA 3RL2A 4LDLB 5J3HC 3UZQA 3NFNA 5C0GB 3BPCB 1AQHA 3SQBA 5D2LF 3PGDA 5EPMB 3LKOB 3ULVC 1LWHA 5CBAA 1LO3H 1DLHB 1FL5B 2B1AH 2EKSA 4GAYB 4PTUB 4RGNB 3AHXA 1MUJA 3WHXA 2GJXA 1F5WA 3D25A 3RVUD 1KJ3H 1KR0A 4BFIA 4QRSB 3PIQA 1HH6B 1RJZB 4U6YB 1QTYT 5HI5D 4CU9A 4OV5B 4N8VB 3SDYH 3BZEA 1R3KB 1RZGA 2VC2L 2FX7H 3VDAA 3DX9A 5KVMC 3M8OL 1W72B 1LEIA 5EORL 2XQXA 1PQZB 4KZDL 2ZX7A 3G6LA 4FQHB 5DMYA 3U6RB 3GJEA 3RKDC 4H2CA 1FFRA 3FHQA 2I9TA 1GJWA 1EZVX 1CLXA 1AD9B 1FFOB 3W2DH 2ED8A 1XGUA 5T1DL 3U5YA 3IAPA 4LPLA 3GM8A 1D9KC 4PJGA 3BAXA 3UTZA 3D48R 3DX6A 1YZZA 2PXYA 1KV3A 1IEBB 1A6VH 5I18H 1CBVH 4AZHA 2QSVA 3BPNB 1HZHL 2AQ1A 3VFGH 1RZJH 1MWAL 2BNQA 5ABFB 2DIAA 5BXRA 1JNNL 1KLUA 1P69B 5F96H 5F72S 1NMCB 4ET7A 1EVUA 2X4QA 4YC2B 2E9WA 2PUQT 2YXFA 3N9GL 3AIRA 3WD3A 5CEZE 3WD5H 5EMYA 2ADFL 4NRZB 1MRFL 1D6EA 1GVYA 1BZ7A 1G9NH 3BAWA 2OLHA 4P7NA 1GUIA 1JGIA 4TVPD 3PWPD 4ZNCD 5DO8A 4MA3A 5HDBE 3ZMRA 3NIYA 1O0VA 4KY1H 3FN3A 3T4AA 5CSYA 4N5EC 3HC4H 1UZ4A 4C4KO 3WJLA 3UTPD 3NIGE 3C08H 3D69A 4MWFB 2E7LC 4WV1A 4Y2DD 5FYJE 2DQHH 4E9LA 1LG1A 3ZR6A 5H94A 4HXBL 4ZDHA 2XKNA 1A9EB 3ESUF 2IG2L 4X8JA 3SCRA 4M80A 4PT6A 1UXSB 2XICA 3UCRA 1K2DB 2MKLC 3C7OA 2A1WH 2WUHA 1UMHA 3HS0A 2WC3A 4NJAH 3ILQD 4JO2L 3VXMD 1VSCA 2DBLH 5HHOE 4PLNC 4ATLA 1CFQA 4QLKA 3WQBA 4PRBB 4P9HH 1W3JA 4OLZL 4LQ1A 5DJ6B 1XR9B 3IRZA 4HF5H 4NI3A 2EO7A 3ARED 3KLSA 3IFPB 3L5XH 1AGEA 4RWHA 3PABB 3PGFH 4X5LA 4QRTA 1ZHLA 4TVUA 1ZHKB 3LV3B 3VXPA 1PKQA 1TTGA 3VXQB 5K9QG 1TR1A 4D6DA 2WK2A 5IB4A 2G60H 1IKNC 4MA7H 4HT1H 2E7HA 1A4JB 1NCNA 2J4WH 2VZTA 2JIEA 4X7SL 2PYED 5DXWA 2YLLA 2VJXA 2DKSA 3FB8A 3K4AA 2AXFB 3VXSB 5BVPL 2VX7A 5IKCA 1AC0A 1R3JB 4L4TA 4NKOB 2ZSWB 3DV4B 4M03A 4MPKA 1GAFH 2FWOA 4QNPE 2GSGB 5GJTH 1KELH 4G7YL 4IDJL 3TBYB 3BRFA 1R7OA 1B2WL 2R0WH 4GRLC 3MMWA 4W93A 4M62L 2BV9A 4LVNC 3HJEA 4PJHF 3ARFD 2BERA 4PJDA 5E9DD 3L5WA 4AMKH 4EIZC 1SJEA 4UOZA 4EEEA 4Z77B 1RIVH 4UIMB 4X5WB 3VXNA 1IAII 3NQHA 4F15C 1UWXH 4WWID 3O4LB 2EEAA 1N64L 3ARBB 1FFPA 5I8OH 1U8IA 3ZHLA 4FZ8H 3WIHH 5E8PB 3HMXL 4QHMA 4QYOA 2CXKA 3LB6D 3DVNA 3QZWG 3TBVA 3DTXA 4OD3L 3KL5A 3O8XA 4CDGC 4HPHA 2J8HA 4YPJA 5E0QA 3TYGL 5JXAL 1W2KT 3CIHA 4TULL 2IJ0C 2JJVA 4KGLA 4X8XA 4DKFL 1IQDB 4CVZB 1DANT 1NCBL 3UETA 4ODVH 2R0LH 3ARDB 3FCTB 4S0SD 1GGCH 1JV5A 1S7VA 4DQOL 3IB3A 5MEOB 3F58H 3SKNA 1CX1A 1GRWA 3WEMA 3GJFK 3QAZC 5T33L 2KL6A 3VO0A 4L4VB 4IJ3B 3OPZL 4OIIH 4S2SA 5CJXC 1RUMH 1DQJB 1PG7L 3O3BB 1K4CB 5BRZD 1G94A 2JEQA 1T1YB 3K77A 3VDHA 5ACMA 1QLEH 4ODXA 4KJQC 3ZL4L 5GS1B 5A6LA 1HWGB 1KPUB 4WSKA 1WDPA 3EHBD 4FQXC 3M6DA 1R8LA 5C86A 4P3WA 4L5FH 2IH1B 2YPKA 1DQQA 1CL7H 1KTDA 3V5DB 1BOYA 2V2TB 2A0LC 1CE6B 3S96A 5HHVL 3RI5K 1OAZL 2YL6A 1FL3B 2VN7A 2Y6JA 2W92A 1OGAB 4LQFL 3BYYA 2CIKB 2NY2D 5TE7H 3WQVA 4ZEPA 3BFOA 2A38A 4NWTH 3TA3D 3AI0A 4YHML 3KPRA 1HJSA 5DR5L 3PF2A 5A2CA 2GEEA 4V2BA 5KSAD 3MNZB 1JPFA 1WEJH 1WWAX 2HVJB 4GMTH 1DWJM 2Z35B 5FM5O 3BPOB 1MRCL 4K94C 4PJIA 3JVGC 4WGWB 1MCBA 2QMJA 1FVEA 5DC0A 4JX0A 4AIEA 3EGSB 3DGCR 5EC2B 4NGHL 3GHBH 4ZFOB 2X89D 5C0BA 4GXPA 5SX5K 5IVXA 4H5SA 3EJZC 1FL6B 1WTGT 4FFYH 1T21B 4EUPB 3GUTA 4X6FA 4AC1X 3G5ZA 2FX8L 5DFVC 1MFAL 3HC3L 3KPSD 3RBGA 5C0FB 5HTSA 3IGAB 1TXKA 4C56A 1N5AA 1P1ZB 4V28A 1WE5A 4XPHL 3KPQB 2VLKE 3PBGA 2OZ4H 5GRJH 2VDPH 3TJEH 2EPNA 4MAVA 3HNSL 3MOBL 1SJHA 3P0VL 4KAQH 1U8JA 2FJHA 1NARA 4KI5D 1Y0LB 4NHCH 3NACL 1KC5L 2DRUA 2VL5B 5EO0A 1PYWA 4OZIB 4LRIC 1JWSB 1BBDL 5DQ0A 4M61B 4FQIL 5D6DC 3RJDA 2EEDA 1UB5A 1EAJA 2GTZB 1JN6A 2B0SL 2HKHL 3PWPE 4TVPE 3U30C 3ZLQC 1H3WM 1OWWA 1UYWL 3P2TA 1CGSL 3U4BH 4TOQA 1HNYA 1G9ML 5D2LB 1E4NA 1AIFB 5FCSH 3RWJB 4RGMC 2AKRB 4WIWA 4X0KB 3BXWA 3EYUL 1T0MA 3UTPE 1G0YR 5I1CL 3OJVC 1B2YA 1UUQA 1XGPA 4UOQA 3K74B 4XXCA 4P7QA 1S7QA 1VF8A 4TVDA 4RQQA 3TBWB 4OF3A 3VJ6B 4X80H 5JW4N 3RI5F 1UZ0A 4QHNB 4KMTL 3EO1A 1E1EA 2Y6SC 4M5YL 5A3HA 2KZWA 3PDOB 5C0AB 1QBML 5LYRA 3WNLA 4QNPF 3QIUA 1KSRA 3VXME 3TIEA 4MGSA 2XZQH 2LU3A 3BKCL 1XYFA 4WW2A 3CDGB 4P4RA 3U7YH 2WHKA 2CDFB 1OSPL 2G75B 3FT3A 5E8OB 2DQXA 1AO7B 1VAHA 4DWSA 1E72M 5TDNB 5J12C 4PJ9D 5F1NB 1UH4A 1D7FA 4BXSV 3VFNB 1JMZA 4WTZG 3CZLA 3QUYD 1F4WL 1PPIA 5C0JA 5JMOA 1MCIA 4K8RH 2IPUK 1UG9A 3GXMA 5T5NG 4JY4B 4NP4H 4GG6F 1PKOA 4NRXB 2DBJA 2JJUA 4N5UA 4KROD 1T2XA 4G7VL 4WW1B 2RCSH 5I0ZA 1J0IA 4K94H 2AK4B 1MH5A 2BVEA 4ISVB 3RDTD 3PUHA 1YMMD 4WJ5B 2X4SA 3I02A 3LKQB 5FUOL 1U42A 3RVXD 1GXEA 1HJQA 1B3XA 5FA3B 1HSAB 4APQB 3GGWA 1NFDB 4KRPB 2XFYA 5DVOA 4RMUA 4RGND 5E9DE 1FVDA 3SGEH 1F4YL 4DUXA 3NSXA 1NGQL 1WDRA 2ICWA 5KSUA 4Q0XL 4NBYB 4HV8A 2WNWA 5D7LA 3JV6B 4YPGA 3ROLA 5C9JA 1NBQA 3B4NA 4NBXB 1AQ0A 4P2OA 3C60B 3P4OB 4KPHL 3V0WL 1U91B 2DQCH 1L0PA 2F74B 3D0LA 4OB5L 4HCRA 1QO3A 4L8CA 4A44A 1OSZA 3QA3B 5LGHH 1NUDA 4FFWD 2E27L 4FQJH 1U8NB 4N0CC 4M81A 4M9PA 1RZKC 4AEIL 4ZFFB 1FRGH 2BVPB 32C2A 3P9MB 2FYYB 2C26A 4G9DB 1XGRB 2WINB 5J1SC 4YWGL 3LS5H 5M95B 4MHHG 3AOFA 3MRKB 5T3XD 5E8EB 3EO0A 1CF8L 1GCYA 1Q94B 5BRZE 3CDYA 5HGHA 1OAQL 3NCCB 1UM5H 4F7PB 3LEXA 3RPIA 5EZIL 4OOZA 1RZ8B 1XFPA 2WZHA 3QHZH 5E8NB 3I2JA 4MD0A 6TAAA 3M17A 1UB6A 2NLJB 2BGPA 1MVUA 4JY5L 2DSWA 4GKOA 2Z31A 1MIMH 4MD4A 4P08A 1KN2L 3QH3A 2P48B 4TXEA 4G6KH 3K80A 1MPXA 1YJDH 4ZUTA 3A6CL 3L5IA 4CMHC 2A3CA 3MA7B 5TJWK 4NFBA 4PJHB 3P11L 4U1KB 5BS0B 3TTYA 5JOFA 1A5FH 5B39B 1AC6A 1U8OA 2F54D 5C0CA 1FZOB 3X3GH 5D1XC 5F7EL 1GYAA 4PJFF 2HVMA 4HP5A 1Z9LA 3BW9B 1ZEAH 4W7UA 1ZSDA 3OMZA 3QNZB 3R8QA 3RGVC 1NCTA 3MRBB 4ZFGL 1KBGL 2DLHA 4QRPD 2O5ZH 5JDSA 3N1MC 1U58B 5DWUL 4LSQL 4YHEA 3P4NB 2RGSA 3QPQD 4QCIA 2X9YA 2C8NA 3ROOB 3BDBA 3QDGA 2XTJB 3LDBB 2V3EA 4JAMA 2WAAA 3WF0A 4IRSB 4OI8A 2CYGA 3MLWH 4YFLF 2HFFB 1BQUA 1FLRH 1A6WH 2I5YH 2JIXD 4AG4L 5DO2C 3HMCA 3VRIB 3WIJA 4KDTA 2IAMB 1S7TA 8FABB 1MI5D 4XVSH 3ARRA 1HNFA 3KPSE 3GMLB 4UCFA 4L8DB 5L8LB 4J8RA 5D8JH 5I16B 5T3XL 1D5XB 5DT1H 2EECA 4A6OA 3B3IB 1V3IA 2VZRA 4NDMB 5IVNA 3ULUF 5B4NA 3WMBA 1QBLH 4KI5E 5E6IC 1I9JH 2AGJL 1HJVA 4Q9QH 3F7VA 3NZHH 1G7JA 4XX1G 5T1KA 3CKHA 3GMMB 2FB4H 43C9A 3IFLH 3KYMB 3FB5A 5DSCB 1SY6H 4QRUA 3ELAT 4XWGL 3WFCL 4YFEA 3KGRA 5JHDA 1NAMB 3MO1A 1C12B 4P8XA 4LKXB 1IJ9A 4JFEA 5GJSL 1NDMA 5FUZL 1FJ1B 1QVBA 3LKPA 3PGCA 1NGYA 3GSUA 4JEGB 2ATPA 4D0BA 1W1YA 1YNLH 4R7NB 3O9WB 1AQMA 5DZOA 1LO2H 1OAXL 1E28A 3HE7C 3LEYH 4WUUB 2VQTA 4ZSOE 3PHQB 3SDAA 5FO8A 5DD3H 2RV9A 1AP2A 2CITA 2NZ9C 12E8L 1YEFH 5F3BB 3KS0J 5I1IH 1HCFX 2YWZA 2ARWA 4OGAD 5CD5C 1BX2A 3MRNA 2FEDC 4ODBD 4N0RA 1T80A 4K71C 4OQTA 4F7MB 1INEL 2BSRA 3AIVA 3QFJB 4GG8B 2A3HA 3WUWB 3UR7A 2VABA 3HZKA 1T5WA 4GBXC 4HLJA 4QF1A 1MRDL 3CPLB 1ISWA 5DVNA 2OQJA 4O2FB 4HUKB 1XF4A 4ZAKA 2NY5C 1CFTA 1ZE3C 5HI3D 3OX8B 3BJLA 1UXWA 5ACZB 5F89B 4R9HA 5C0NC 2YOCA 5CZVH 3ZT6A 2X7LA 2IGFH 4YFLI 2FATH 2IEPA 4L4VD 2VDNH 4XNXL 4UFIA 3KYNA 1KB5A 5HY9B 1LP9A 3VIKA 1T6WA 4OZFH 2B5IC 5CLTA 2XRAL 1MW1A 1LE5B 4FTVB 4Z7UA 1JP5A 2NT0A 2PYFA 3GSXB 4HUVA 4ZXBA 4KJYA 4M1CD 2PTUA 1B3JA 3P9LB 1F2QA 4NNXA 5DQ9A 1DL7L 3U9UB 1TQCB 2ZUWA 1YMME 4PTXA 3SKOB 3EYOB 1MFEL 3NH7H 4L8BA 4NQDD 3WH5A 3LKRB 4OUUA 2PI6A 4EN3B 1PZUB 2GITB 3KVQA 2XSBA 3I2CH 2PETA 3DV6A 1B3YA 1ERNA 3WNKA 4D8PB 1BVKB 1YN6B 3ALGA 2ORBH 5EN2A 4GAGH 4DAGH 2DLFH 4PLJC 3EJYC 1GIGL 4AIXA 3L3KA 1BOGA 4NZTL 2MHAB 5C2UB 1UVQA 2IXUA 5D1QB 4UU9A 3W5NA 3AXXA 3FMGH 4HWBH 1FG9C 4GPNA 2GSJA 4UTBL 5SWSB 3E1F1 2AQ3A 2VTFA 3MFFB 4OGZA 3IFOB 2W60A 2BVOB 2AQ2A 2NXYB 1JHLH 3FL7A 4UT7H 5KAQF 2KKQA 1Z3GL 2D0GA 4N0FB 1DANU 1I9EA 1FV1A 5D7KE 1N4XH 3HJRA 4Z7WA 4U0RB 1E71M 2JB6A 1YNTA 4PV8A 4AEFA 2Y9RT 1S8DA 4OZGA 2H32B 1OARH 3GI9H 2IWGA 4RMVA 4S1QL 4YBHA 2VRKA 3IIIA 5INCB 1B30A 5JW4M 4UV4L 1ADQA 3VWKA 4MD5B 4X9GA 3JTSA 2YA0A 2J8FA 4LLWB 3BE1H 4CVXB 5FOOA 4X6DF 5EU3B 4WK9A 4QHUB 5HYEA 5T3XE 2CH8A 1VBRA 3U0TB 5SWQA 1DBAL 4NZJA 4GG6B 2EIBA 4G8GD 2APBA 1JPSH 1T7ZA 3QQ9C 3VFTB 1Q0YH 3D39B 1UKQA 3MCKA 5BYWA 2AJXL 2FIKA 3DOSA 1KEMH 5LQBH 4WHYH 1N6VA 1WJ3A 4HJGA 3WQ4A 1RUAH 3WEOA 1DQDH 1BJ8A 2GHWB 1TVHA 3E2HB 5GZNC 1P84K 2A77H 3WNPA 3I75A 1HI6A 3DUUB 3I85A 4LSSL 5IFTA 2CPUA 2DMCA 2QKIB 3HCVB 4YHIB 1JCKA 2VLRB 2VC9A 1CDUA 4BZYA 1KXHA 3IYLW 2GJJA 4LFHD 5JNYA 3VD9A 2XVGA 4UTAL 2F54E 1FYTD 2NY0B 4RFEA 3HZMB 3AHTA 1DDHA 3RWEA 4RSVA 2JF7A 4M24A 4LCWA 3REVA 4QRPE 5HHPB 4TX6A 1QFWM 1E55A 2FR4A 4HWZA 5CEZH 5FHAL 3H9HB 4AZ6A 1W0WA 5FA4A 5FL1A 2RBLA 1DN0B 4JANB 5ENWA 3FQRB 4S1DD 4JL2A 5I1HH 3W27A 2A83B 2YL9A 4BDVB 1UYXA 1TVBA 3C09C 2GK1A 1NL0L 4ZFOL 3QUXA 4JJHA 5TF1H 5KVGH 3MXVH 2IPTL 1A1OA 1Q6FA 1IVLA 4MVBC 1GL4B 1MI5E 2EEBA 5EZLB 3X3FL 4PJEF 5K33A 1W91A 5HDRA 3HA0A 4CU8A 2VDQL 4F57H 2IFFH 4GUPB 3T77B 1X5JA 5EOCJ 2XGBA 2J7LA 1K8DB 3SE3A 1MXGA 3MRMB 5CP7A 4ZQKA 5LVEA 4U6HA 3RVTD 3IDIA 3D6GA 5E70A 5FK9B 3W11C 5B4MD 5DJXA 2NY7H 2WVVB 1AD0A 2HFEA 2VOTA 4WWKC 1HIMH 5FDWB 5DQJB 4JQIH 3RU8L 4NQTA 1F90L 5E2JA 4YEFA 1M53A 1F11A 5J6GB 1CCZA 1FG2A 3MRPA 4K7PX 3S4SB 1FORL 3VA6A 2W46A 5CMAB 4I18C 1GHSA 5KVEL 3OKEA 1OCWL 5E7FA 1YEDA 2PXYD 4TQEH 1OD8A 4NRYB 2AJVH 5IHBA 5FV1L 2OXHA 2VSDA 3B6SB 2BNQD 2WWKO 3RVUC 3X11B 1RYYA 2F61A 4PJFB 3MGOB 3U2SA 5HI5C 4M56A 1GHFL 3ARGB 2J6EH 1PX8A 4QDQA 4G6JH 5IW1B 4XWOD 5ADOL 4ETQB 4U4BA 3C60D 1NMAL 2ZKHL 5DPNA 3I6LE 1A6ZB 5TH2A 2ZUSA 2DQUH 1GOHA 3F8UB 3I2HA 1ED3B 4TOYH 3G6JB 1GCFA 4ODUA 1H9VA 4OI7A 2HH0L 1JGUL 3MV9B 2W1QA 7CGTA 3TPUB 5EC1A 4KRTA 5JLZB 1KCRL 3VM7A 2JE8A 4AZ5A 4LNRA 2ESVB 1U3YA 4LLVA 2CRMA 3ZDYE 1NPUA 1CLCA 2PC8A 2WQ8A 2OL3H 3IAGC 3V6OA 1DTUA 3AZSA 3P1IA 2FCBA 3VUPA 3X13A 3P6BA 4P57A 3VCLA 3EZ8A 2J22A 1KTLB 4PYSA 3AVEA 4DN4L 2DSZA 3EOAA 1CFVH 3VDCA 5BJTA 4P46B 4MA8L 4P3DA 3WL1A 3M8OH 3PWLA 4PPTA 5EORH 1HVXA 3BT2L 5JA8B 3CIQA 3VD4A 4M5ZH 4R4BB 5C6PB 3UESA 2YN3A 2D24A 3KPLB 1EPFA 3BHBA 3PJSB 1C8YA 3MUGA 1K42A 4Y4FB 1DZBA 4D6IA 1LO5A 4BQ4A 4NQDE 4F7EA 1P4IH 2CKNA 3RMEA 1WZ1L 2RHEA 2EIEA 1N8ZB 1QSFA 5D8WA 4I3RL 4L8SB 1HHIB 4DVBA 4EXPX 4ZXEA 4MX7A 3T3MF 5BS0D 3SKMB 1JFHA 1HZHH 4K7PL 5IHLB 4I48A 1MWAH 3VDBA 4M6MH 4Y2DC 1BFVL 1JNNH 3QG6A 3ARUA 1K5NB 1T7YA 5F7FA 1JPGB 4X99B 5BXFA 5DGRA 1QRNB 3N9GH 2D2OA 4HH9A 4L4TD 4NCC1 4XC1L 4A42A 2WB5A 1MY7A 1MRFH 2ZOKA 1VACB 3MV8E 3WDQA 4MO3M 2GJZB 4MCYB 4LLMB 4LF3A 4ZNEA 4Z78A 4IRSD 4NPYB 3UPAA 2R1WA 3AREC 1O7SA 4UNUA 3TBSB 2N1KA 3IXTA 2IAMD 3QI9B 2X4RB 3JWOC 2PW2A 1BGGA 3NPSC 1E4KA 1I8IB 3BMVA 3FQNB 4TSBH 3ARPA 3D85B 2K7PA 4HXBH 2Y06H 2IG2H 1MFNA 1OAUL 4LRNL 1N3NB 2Y07L 1S7UA 3R0MA 4Q7NA 4EJ1C 4F8QA 3GSWB 1MCLA 4G8GE 5KVDL 1TIUA 2H3NB 4I0PB 3O8XD 1KYOK 3FT2B 4PJ8B 4JO2H 4P4KB 2WMIA 1AXSA 1KNOB 5F8QC 4FLSA 2LQRA 3FFCB 1M71A 1B6UA 1FH9A 1HT6A 1K9TA 1E4LA 3HR6A 1CR9L 3U83A 2FIRT 4N9GB 1QI2A 2XWBB 5FYKU 1HK6A 3SE8L 3ZDXE 3BRDA 5ECJE 2E7BA 4RFNB 3ARFC 3WXWL 3QHTC 3MJ9A 4KRMB 4LCUA 5KS9E 5EU5B 3CVIH 1FYTE 3QQ3B 5MENA 3EAKA 4WUUD 1IGFL 4KMLB 3D3AA 5JXIA 5TFSL 5GSVB 4W5ZA 1CICA 2IBBA 1I4FA 1CFNA 4CAGA 4QRRB 5LBSL 3P77A 3BWUC 3BKYH 3LB6C 4BH8A 2YLAA 2CRYA 4PJCA 2VRAA 3H7BB 3UXFA 1QI0A 2RJ2A 4IDJH 3BAEH 4BSVA 1EFQA 3R06B 1B2WH 4U1SA 2CPCA 3TZVC 5A6AA 3T0EA 4LCIL 4M62H 4NQEB 4QXTA 4X9HA 5I71C 2UY7A 4FQLL 5IQ9B 3WQWA 2ZUMA 5J11C 1CLOL 3CX5K 3L3GB 2NZIA 3W0KA 5HHQA 4HKXB 1H09A 1G9HA 3GRWL 4UFJA 3KPRD 4X6DB 4OZFG 2WMFA 2P8PA 3CVHB 1U3HA 2EE9A 1N64H 3TNNB 5CP3A 4X5XA 4C83A 3F5WA 4J3VA 4ZUWB 4QB1A 5I2UA 4FTVD 1QYGL 3CZFA 1JDAA 4JKLA 2A3BA 3DMMB 4CUCA 5JXAH 3ARTA 3TYGH 3EHBC 1NGZA 4Z0XB 4TULH 2XWJA 4HZ7A 2GTWA 3PHOA 4DKFH 5C0BD 2WKGA 3E6HB 2W07A 1N2RA 3F7QA 1OW0C 3W39A 1JPTL 4ELMF 4KVNL 4PJGE 1NAML 4R7DA 4C7FA 4DQOH 1CTNA 1NWSA 1ODUA 2A6DB 3TO2B 5IG7A 2NNAB 4AENA 1T4KB 2EYSB 4C56D 2CLVB 3SDCB 2P24B 4TVCA 4KI1A 3M46A 2NY2C 5T33H 1G6RB 2A73A 2BNQE 3S34L 4XBPB 3OPZH 3TA3C 5GZOD 2R4RH 1I85C 4HWUA 4LU5H 5D1QD 1PG7H 3TCLB 4BQCA 5EA0L 5DURB 5D71L 4HGKC 2B2XL 1WF5A 5KSAC 2O61A 1ZMYA 4UDTB 3QZWA 3ZL4H 4W50A 3RUGF 2ZJSH 1J9YA 5C0EB 1XCTA 3DUSB 4O2EA 4HS6B 1NFIA 2VWEE 2FZ3B 4PRAA 1HKLL 1KQYA 1E9LA 3VIIA 2ADIB 4RYDA 5A8QA 3G5XA 3NGBC 1W3KA 3CU1A 4JFFB 5HHVH 4W8AA 1OAZH 2JIWA 5IEKA 4NZRL 4PJ7B 2MCG1 4LPXA 1PVHA 2E6PA 4U49A 4LQFH 1L9MA 4D8MA 4PJEB 4Y5VA 1WAAA 3RL1B 3DRQA 4YNYB 5MP6L 5DR5H 2F58L 1R5VA 4YHZH 3L3IB 1JIBA 4DEVA 2P5EB 3JBG7 1ZLSL 4OZHA 4JG1H 4KI5C 5DK0A 3K0WA 5J56B 4WHYG 2QADD 4E0RB 1BZ9B 1MRCH 4Z6AT 3QIUD 3DHPA 3U36A 2C3VA 4XBGB 5DFTA 1N5YL 3JV4B 5EBLA 1F42A 5ADPH 4NGHH 1Q9LA 4JO1L 3RJXA 4XNYH 1X5AA 3SCWA 4FLQA 3BDYH 4V2XA 3KEHA 2CLRA 4JO3L 2XM1A 1NJ9B 3A4AA 2FX8H 4ZUSA 1MFAH 2FBJL 2EE3A 3C6SA 2R0KL 3D1MC 3HC3H 4DWSD 1PKQE 5BS0E 5GGRA 3VD5A 3ME0A 4PY7B 4HIEB 1BF8A 4XP1H 5DVLA 4NC1C 3FXYA 4AZBA 4AEEA 1RK0B 3P0VH 4TPRL 1HH9B 2BS9A 3KR3L 3DRTA 3NACH 1KC5H 4L4TE 4X4YA 2WVSA 1BBDH 4P5MA 4YBLB 1T1ZB 3O2VL 2NY6D 4QDSA 2P8LA 3AIUA 3HE6B 4XTRD 1CVRA 2B0SH 3OKMB 4FQCH 3BZDA 5CUSL 1UYWH 2DQJL 1UQZA 3GMNB 1CGSH 1G9MH 1FZJA 1AGCB 5IESH 3MNVB 4BJ0A 3A67L 2XHYA 4PJDE 4JRXB 1NC2B 4IOIB 3IJHB 3CCHB 4TNVK 2CSPA 1R24B 4PJ9C 5DJ8B 1KG0A 5DYOB 1ZHBB 4QDMA 4NN7C 4Y5YB 5JPMA 3QUYC 3QO1B 1RZ7L 1HHJB 5BOZG 2JJWA 3HC0A 4XI5D 2BFVL 4F58L 5KSBF 4EQ3A 1T1XB 5F9OL 4ALAH 3C5JB 2LVEA 4M5YH 3TFKD 4LSVL 4KJWD 2VQ1A 1QBMH 5DHVB 1KCUH 5BRPA 4HG4K 3IXAA 5H2BB 1CPUA 4KROC 2N4IA 1G1YA 5DRZB 2R2HB 3CLEH 3BKCH 3RDTC 5LG1A 4M9OA 1PMHX 3BAYA 5AEAA 3JXSA 1LK3L 3TN0A 5FEBA 3RVXC 5BZDB 2Z4FA 3MYJB 3O6MH 4M48L 1T22B 3WFEL 1CYGA 2RAMA 2D7MA 4RGNC 4U6VL 4HFWA 4LHUG 4X6CB 2R1XA 3EDDA 3WXVL 5LA2A 1T7VA 5K9OA 1F4WH 2CO6B 2C4FT 1C16B 2PKDA 1F8TL 2LABA 2YBRA 1CFSA 4WUUE 5D93B 3UROR 5FKYA 4NO5B 3ARGD 2IALA 1O5DT 2W1SA 2MMXA 3OAUH 2XG4A 2OSLB 4L1HA 3ALXA 4G7VH 1CI5A 5JIIA 4PUDA 2NR6D 3D3VD 1I1XA 1MCRA 4YHPA 3R8BB 2YEZA 3EOBA 2BHZA 4N1EA 5MI0B 4U6TA 4O9HL 1MCWM 4OF7A 4FFWC 3E8UL 4PJGF 1ZLWK 4JFDB 1CDJA 3L7EA 3CXDL 3L1OL 3QUZA 5DA0B 1Q9OA 1V3KA 5F9AC 5IMMA 1X5XA 5C0CD 2ESVD 1KIQA 1F4YH 4WTZA 2UY2A 4MNHB 5TPWL 4Q0XH 5J1AB 3KPRE 4MB3A 3HFML 4QT5B 3VFRA 1R3HB 4TNVF 5BQ7A 4MDOA 4YC2C 1JGLL 4HULB 4LP4A 4KPHH 4XCFL 1Z9MA 4PJIE 5LAXB 4JL1A 2H8PB 3GMOB 1I7ZA 2WAGA 3QDGD 2GFTA 1A3RH 4Q6IC 1A1NA 4Y4FD 3P0YH 1WC7B 5BZWA 2P7TB 5C0BE 4ZO6A 3PL6B 1UZ1A 1WZKA 5IVXE 3MRIB 3VGBA 1OGTA 5IHSA 3ARWA 3EMQA 4U33A 1TQBB 2IMMA 1QQDA 2HJKB 4NQCB 1LNUB 3QHFL 5DLML 4Z76A 4YWGH 4C56E 3KL3A 5BXPA 4D6HA 3RNQB 3ACHA 2CDEA 1R5WB 4AH2A 1HJXA 1OAQH 1MYRA 1ORQB 1OP3K 5CWSB 4AZIA 3EYVA 4ODTL 4HC1L 2QMKA 1CU4L 3WFBH 4WHTA 4MCZA 3KPTA 1M03A 2EE6A 2XN9B 3QPQC 4JREB 1B0GA 2VR4A 1KN2H 4LYPA 1ZS2A 4IM8A 3MLVL 4QHKI 3LKNB 4F80A 1JYNA 5F7MC 3VIJA 1U93B 3OAZH 1UJ3C 3BZFA 2QL1A 4KC3B 5I1LB 5C71A 5FM8A 5I8KL 4S1RL 1JNDA 3D85D 3CC5A 1XF2B 3LIZL 3DSNA 1KPVB 4CD5A 2I9LA 3CX2A 1KBGH 5IT2L 4PF1A 4JRYB 2EYRA 3K8MA 4UQ2A 1J5OL 1K9FA 1L7TL 5DWUH 5DJCB 3T3PE 4LSQH 1W72H 5F9JB 3ULUL 2D0HA 4PJ8D 4P4KD 1ZT1B 2GT9A 2NW2B 3TO4B 4ZS6D 3FFCD 3O0RH 3L3JA 2J7MA 1BIHA 4JKPL 3REWA 1HHGA 4YHGA 4AG4H 2WBJA 4RAUA 2UWFA 2W47A 1BQHB 4ELMB 2ED7A 5EBWA 5AG8A 4XNUH 5I9QB 4K7PY 2R23A 1RJLA 2EYTB 2J7BA 5CSZA 4G8FA 2VR9A 3RX8A 2X4NA 1FGNL 4OLVH 5GXBB 4HGMA 1WP6A 2ZX8A 3OGVA 3H9SA 2BHUA 3L95A 3OAYH 3SGKA 2HTKC 4QRRD 1CDIA 4HD9A 4OGAC 4RDQF 4HWEL 2AGJH 3EDJA 3ZDZE 1GQKA 2R15A 4OF5A 4ZXBD 3RUGB 5IFAL 5E6YA 1A6TA 2ARJQ 1G0XA 1V6YA 5HGGS 3X12B 1E43A 2C3GA 3MTRA 2DTML 4XWGH 3WFCH 3CK0L 4PRDA 1RPKA 1IQDC 5HYSB 1KGUA 2XIIA 2CBIA 5GJSH 5IJVB 1L8NA 5FUZH 4U1NB 4W70A 3OXRB 5HI3C 2QTEA 1ACYL 4HOWA 2YD6A 4JPKL 3MUHL 4MDIA 1C08B 1OAXH 2Q87A 3QRFM 4M3JA 4WU5A 1G7QB 4U1JB 3O3AB 4JDVA 2OTWB 1L9NA 1UY0A 3VX1A 2FDBP 5LGJA 4IJ3C 1T20A 5D7LE 5KOMC 2YD9A 2D4DA 4MNJA 5C7GA 3O6LL 5A16A 1Q6EA 4OQTL 3QEGL 5GS1C 3FKUS 2D03L 4YXKL 4M1CC 2EPMX 1E6XM 1EGZA 1XF5B 1RY7B 1KJ2L 3WD4A 3AFBA 4PR5B 5BXTA 2BSSB 5E03A 3FQTB 3NMEA 4BZ2L 1MVFA 2WVUA 5KEZA 1JFXA 1D5ZB 5IB3B 4KKBD 4MXVE 3V0VA 1YN7B 1JAKA 3GO1L 1YEGL 4MXWH 4U1MA 3S5LG 3WIHA 2FX9L 1KFAH 1OHQA 1T0PB 1VDGA 1URLA 3H2WA 4XNXH 3B8YA 5DFWH 2XG9A 5D7JB 5DURD 1KB5L 2EPOA 2P44B 3GMRA 2XRAH 5F97E 3O4OB 4F2MA 1JGVL 1UM6L 4HSQA 1DUZB 4JCMA 3BPOC 5IV2A 1A14L 3D3VE 4DTGL 1UY3A 1DL7H 1YC8A 3F62A 4PJBF 5IVXF 1UR2A 1RI8A 2E7LA 2VISA 3GHEL 3UJIL 5JUVA 1OT5A 4JFFD 5DGQA 5EFIA 3T0BA 3VFVA 2XTLA 1JI2A 1NKRA 3VG9B 5C0CE 2VITB 1CQKA 3QXDA 2ZXDA 3OKLB 4NZTH 4JPVH 5DK3A 5AG9A 4HUUB 1MQQA 1OSEA 3OKOA 5HYJA 1BWWA 5KSBB 3CVHL 1B0WA 1P7QB 6A3HA 1U9KA 2HLAA 4UTBH 3O6FB 3D9AH 2P5ED 5IF0B 1GGBL 1UADC 2AJSL 1EHXA 3ZJKA 2ZOLA 5ID1B 3QDGE 1QR4A 2XM2A 3O41A 3E3QE 5IBUG 3L4YA 1RHHA 1JWUA 4CU6A 3T1FA 3NFNB 3QUXD 5I75B 5J1TC 4XCCL 2PW1A 1IKNA 3CFIC 2O26U 4U1LB 4S1QH 4UV4H 1MUJB 1NGXB 4MQ7A 4PQQA 1ADQL 3D25B 2XJ7A 5IXEA 4E4PA 1X7QA 4IOFD 1G6RL 4GW5B 4J4PA 4LVEA 3ACIA 2DQDL 2IBZX 4N1CA 1K4DB 4XXDA 3WLBB 1JU3A 1TZGL 5TD4A 1UENA 2PBOA 4QLRA 3GJEB 1EDTA 2AJXH 3W37A 5L6YL 4S1DC 4GRLA 4NSBA 3TVMB 4DCQB 4WW2F 4OLYL 4LOUD 3W4RA 3AY4A 3VMNA 5IOPA 5H35A 5JHDE 4NYLA 4QRQB 3N1FC 2HWZL 3EYSL 4JFEE 1GGIL 5HDLA 2XQYK 1W9VA 1AXIB 2MJWA 2H9GA 2K9UA 2OZ4A 3UYPA 1NC2D 1HNGA 5BVJA 4LVHC 4PJ5B 3UG4A 1KPRB 4MXQD 3PQYA 3CHEA 4ZTPL 2D4FA 1MHHB 4NCDA 1RK1A 5D9SB 1AGDB 3OR6B 3BIKA 4DGVL 3WFHB 5B4MC 5FHAH 3LH2H 3MBED 1D6EB 2A6IB 1QR1A 3KPMA 5I1AB 3FOMA 4OZ4B 4NRSA 4CJ1A 2FO4A 3LVEA 4C4KT 5IHZA 1E6QM 2O5XL 5IMKA 3HR5A 2IPTH 4EUPH 5JO5B 1IT9L 1UEMA 2PXYC 3M07A 4R6UA 3UYOD 2DSUA 3L4XA 3OKNA 5FCUL 3GKZA 4MS8D 1BQLL 3LHPL 3X3FH 2VDQH 1KGXA 5F9WB 5C07A 4QCEA 3VFSB 4HS3A 2W0FA 3L5JA 4M43L 5A8NA 4JZJB 4DZ8A 1LP9E 4FQXA 4FZEL 4PV9B 4HKBA 4XWOC 5EUOA 1H8SA 5CD3A 4S1SL 2G2RB 4Z7UE 3UC0L 1TPXC 2C7UA 1HE7A 1JYWA 5ICXB 3C60C 2AJUH 3B9VA 3DC0A 3C8DA 2VWEC 1MJUL 4AMCA 2YUXA 1MJJA 1F90H 2E33A 4D2NA 4NFCA 3BUYA 3QULA 4O2CA 1FORH 3EYFB 1A6UL 4KK5D 5KVEH 1QSFD 4NFDA 4JFDD 1UA3A 1BFOA 4QRTB 5F3HA 2ZUQC 3WJLC 1HILA 2AOSA 1Q4NX 4MXVF 1MEXL 2FJFA 1T5XA 1GOFA 4DGIL 3MMEB 3BGMB 4MSWB 5CJQL 1GHFH 4I2XE 1U36A 3K4DA 3LN5A 4ONHB 4G43A 5FGSA 4GW1B 1W0VA 1HDMA 4PYGA 5ADOH 1QLRB 4P02B 2FRGP 1G9EA 3WN5B 3O45B 4WTXA 3BCFA 2JEPA 1JMXA 1FFQA 1V7NL 5JHLL 5ITFB 1KR1A 4GXUN 1OB1A 3A0OA 4WEBH 2XYLA 2HH0H 1JGUH 4AZ8A 2E9LA 4Z7WE 2VXUL 4X0NA 3MGTA 4E42A 1TJGH 5J13C 4JFPB 3QXAB 4OZGE 3LRSB 4K2UL 4ZFZB 1KLFA 4IISA 3O3EB 1UR1A 5I23A 1KCVL 4YX2L 4PJAA 4NQCD 3RILA 2XV6B 1SJEB 2C4FU 4UFHA 4ATDA 3VTRA 5DRNA 4LRIA 1U8IB 5KZ6A 4B9ZA 4TSAH 5D6DA 2VMFA 3BT2H 3P30L 4U3AA 5I6XB 4HLZH 1T83A 2AXJA 3QXUA 4IS6B 3D2UD 1W32A 1A1MB 4XPTL 4JPWL 1G7LA 5C0RL 1WZ1H 4IRSC 4HAFA 3VXRB 3MRQB 1H3PL 2UY3A 3TTOA 4I3RH 5KVFL 1IAIH 1GJIA 1VENA 2VKXA 5M3WA 2HP4A 2IAMC 4R97B 1MIEH 4WDIB 2P8MB 1ISXA 4N8VG 3AU1B 4GAFB 1BFVH 1CICD 1FNGA 1M6OA 4QX1A 4FMVA 2A9ML 4AD0A 4W68A 5KG9B 4F9JA 4PTTB 1EH9A 1EUUA 1AQKH 2JF1A 1DFBL 4LCWE 4JRYD 4UNVA 4ODXB 4XC1H 3WV0A 2E9MA 2CKBB 4JG0H 3L2MA 5FM5M 1R86A 2E7CA 1TVNA 1AVAA 1E4XL 5L2KA 4M1GL 2G3JA 2IH3A 1H15A 3VFPA 2V5RA 5CHNB 3GIZL 4HPGA 3W0WD 3T0ED 3N04A 3DIFA 3M7SA 2DQFB 2VRJA 4AAXA 3IDNA 3MUY1 3ECBB 4OLWL 1H6XA 4KI5M 4HUXA 3AB0C 5FGBC 1DQLL 1WKYA 3RWCA 2DIJA 2DCJA 2J1KA 1U3HD 5CGYD 1XH3B 3FT4A 1OAUH 4LRNH 1JPFB 2ID5A 2Y07H 4QOKA 2OTUB 1OWQA 1D5IL 1FGVL 4WCYL 3EMZA 2ITCB 5KVDH 3WQ6A 3DX8A 2PWDA 3AYSA 1Z0MA 1XGTA 4KWUA 1IGML 3VXOA 5I1GL 5A2IH 1LEGA 1OT1A 2OJEA 3WL0A 3FQUA 4IHOA 1FAIL 1ZT4A 1CR9H 4CGTA 4P2RB 4PJBB 1HKIA 4HKZB 4GT7A 4NWUL 2Y6GA 2J1RA 3CLWA 2RFXA 3WXWH 2DM4A 3B9KB 3C5ZA 4NN5B 3HLAA 1ZT7A 5A1AA 1TA3B 3C2AH 3QIBB 2ESCA 5CJ8A 1OVZA 1LO0H 5TFSH 1F6LL 4YDJA 1B4JH 3BAJA 2IQAA 1CQYA 1I3RB 5LBSH 2WXDM 5F71A 4DK6A 1CGXA 1B3VA 4IRJB 5IR1A 1SY6A 1PYWB 5EO0B 2WZPD 4RBPK 3VNYA 1SEQL 1RPQA 2B20A 4HIXL 3U4AA 1BD2B 1AMYA 1ODZA 2O92A 1ODAA 1UKPA 2DSKA 2HN7B 2YN5A 4Z7VA 4JHAH 2XVPA 3OJMB 1JN6B 3NRUA 4WO4A 4WI3A 3BD5A 2J12B 1WV7T 3RFZC 4LCIH 2E4TA 4JHBA 1N0LA 5J57B 2G3MA 4FQLH 4PGDB 5DD6A 3RWDA 4X6EB 3OR7B 1TZHB 3OV6A 1KTKE 1CLOH 2P46B 2V7HA 4PLKD 4XMLL 5CGTA 1U33A 4P3CL 4S11A 2I07B 4X6CE 2BOCA 5DJYB 5FOBA 3GRWH 1S9XA 3QEQA 2F53B 3T2NL 4QXGH 4CADA 3M1BA 5GZOC 3CZKA 5J6HB 5D1QC 1RU9L 3ZE2E 5IMOA 4DVRH 2LAAA 1QYGH 2DAVA 4K3GA 2NXYC 5EWIL 3IJYA 3RWHA 1EOKA 4H41A 3DXAB 3BI9X 2GSIB 3BP7A 3UPRA 1DSFH 3SJVA 3SPVB 1UQSB 1RMFL 4H1LB 1CDYA 4KVNH 5DRWA 1NAMH 4XCNB 1QSFE 3SDXA 1MCWW 3W9EB 4G5ZL 3UTTB 4LEXH 4MJIB 2AJZA 3HI5L 2Z0BA 1YYLL 5DVKA 3OXSB 4LLDA 1P6WA 1ROWA 5SV4A 4NO3B 2DJSA 4OZFA 5C0JB 2V5YA 3P73B 3EZJB 4NHUB 5EA0H 1CE1L 4GO6B 4B16A 4PRPB 5E00B 2B2XH 5KTEL 1QLFA 1P7QD 3BSZH 2ZOXA 4YFDB 3O6FD 4X4XA 4RE2A 3GK8L 2XNAA 1K85A 2QADC 4H26A 2DYPB 3QIUC 1GSMA 1JGDB 5ERWA 3ES6B 4HBCH 3RWGA 5FB8B 3AIBA 1A21A 3NIDF 1HKLH 2X4SB 3BWAA 1MLCA 5HHMD 4HU8A 1S5IL 4ODSL 3I3EA 5IIEB 3E2HC 1NCDL 5EIIA 4D3CH 4QDRA 2IC2A 4X6BB 3A22A 4W89A 5KW9H 4DWSC 4NZRH 4ACZA 2BMKA 4NQCE 5E9AA 3V52L 4HWBA 4WVRA 4FOMA 4FMKA 3N50A 3GMPB 4CW1A 2WN3A 1UYQA 5JMOC 3LRHA 5MP6H 5JR1L 3BPLB 3MRDB 4G42A 3TYFA 2F58H 3CQOA 1RUPH 2YPLB 4PMZA 3VM5A 3ROLB 5AUMA 3HNVH 3QNXB 3CFCH 5FYKD 3EFFB 4HIHA 5E8DL 1UR8A 5E1AA 1N59A 4DFIA 4Y4HB 1SYVB 4LXFA 4YDKL 1N5YH 4PJXA 2NY6C 4Y16B 3TN0D 1MLBB 3FTGA 1DQMH 4XTRC 4XUTA 1Z5LA 1KIRA 1KXQA 4O51A 1BIIA 4XBEL 1IEAB 2NY1B 2FBJH 2ZWLT 2R0KH 4LARL 1HN1A 1S9WB 4AIZB 4ZG1A 1OAYL 2IANA 4YDLB 1IC5H 2DT1A 3U7AA 3TT1L 3MRRA 5MENE 2Q8BL 1ZHNA 4G6ML 4H88L 1LL4A 3EO0B 3FO1B 2QHRL 4XI5C 5D7SL 1VFBB 2QSTA 1IGYA 1P4LB 2BY1A 5C0DA 3TFKC 2WO2A 4KJWC 3LS4L 2C5DC 3RPIB 3CAFA 4NN6B 4S10A 4MD0B 1CDHA 3F7YA 4OKVA 4PJCE 4GBXA 3L4UA 4LCCA 3O2VH 5EUKA 2DL9A 3KPPA 5DEFB 2YRLA 3VG0L 1H41A 4EUPG 3LD8C 5C9KA 1CEOA 1QZ1A 5CUSH 4FFVD 4D71A 2DQJH 1ES0B 3CSYA 1W8OA 3W0WE 1W99A 2A6KB 3T0EE 5ESQA 2LTQC 3A67H 5HI4D 4RCAA 1NLBL 1U8OB 2H32H 5IW3A 4HGWB 3C9NB 6FABL 3NFPA 4Z2GA 4I9WE 3AZTA 4GOSA 2MOVA 4Z7QF 1A7RL 1T0NA 4XRCB 2BFVH 1QPPA 4Z7NF 1OBAA 2W66A 1U41A 4W84A 1U2YA 1ZVHA 2W38A 5GSRB 3W9DA 4RGOL 3ARGC 4LSVH 3MRGA 1VPOL 1YEJL 5MEPA 5FYKL 4GXUM 3VIMA 2BX5A 1GGTA 4ZMAT 4R96A 2NR6C 3NTCH 1WBZA 4XPAL 5FKPB 2AMGA 5GNXA 2D20A 3CSBA 5A2LH 3BP4A 2J1UA 4LASH 1RURH 4TXWA 2V2XA 2R0ZL 3RHWF 5IMLB 3UZEA 3RJQB 1MCEA 5AZEL 3UMTA 3QB7C 2EDOA 1NBZB 3OKDA 3VGGA 4W4ZA 3BVNB 4UIKL 5DJZB 1S7TB 4M48H 4K7FA 3WFEH 1QSEA 3IF1B 4POYA 4U6VH 1TCRB 1AI1L 3KYOA 1TTUA 3U79A 1EBAA 4KKNA 3WXVH 5D7IB 4JDTL 3LQAH 5EJZB 3UEZA 3QEHB 4KJPD 1H0GA 5L0QB 1EEYB 5A3ID 2COQA 2ZEWA 1RZFL 5TE4L 1IC4H 3ULUC 1X4ZA 1XR8A 2V38A 2AV7B 2C1OA 4E8DA 4LPYA 4RMQA 2ZP0T 1CD0A 4XCYA 4RFOL 3GMQA 2R8SL 1D7PM 5LCWL 3E3QC 1ECEA 4O9HH 3W81A 4Y4FC 3E8UH 4NO0B 2QJDA 2EIDA 1RJCA 1OP9A 2RIKA 2CRIA 3CXDH 3L1OH 4KRLB 1SHWB 1NKOA 4L8SC 3WL9B 4LHUA 4LVOB 9CGTA 2XGIA 1Q1JL 1Q9KA 1MF2L 3AFLA 2J6EA 2W3JA 1JNHA 5HGDB 4OLXL 5CXPA 3RWFB 5C6WH 2J4GA 4GMSL 5TPWH 5E0CA 4F7TA 1JK8A 2XFRA 1ZVSA 4JO4H 4HLZG 3TC9A 4FK9A 4GSDL 4OZHE 5E5MB 2NW3A 3MRNB 4N0UA 2ZX9A 3Q2CA 4OV6F 1JGLH 3ZZ1A 3GBMH 2IBZY 1QA9B 2DLTA 2EXYD 1Q6GA 2ENYA 4WU7B 2CQVA 4R2GB 4NSKA 5AYUL 1ZBCA 4BA0A 3T4YA 4GWJA 3U9PL 1FYHB 4LQRA 5IB2A 1GOKA 1LO3L 1K12A 1LWJA 5I8EB 1V03A 1FZMA 4UB0L 2OQJB 3AS3A 4MA1C 2OL3A 1KJ3L 4P5KA 4L3CA 3QHFH 4UUJB 4RIRB 3NN8B 3SDYL 2WO3A 4AM0B 1ZU8A 2WWCA 4MNGB 1FSKC 1V3JA 5LWYL 1XGYL 5ABHA 4Z2IA 4YHNA 5ILTH 2X9WA 4U1IA 3N1PC 2B4KA 4ODTH 1PSKH 4HC1H 4XC3L 3ACFA 4BQ5A 4PJ8C 4P4KC 4PP2B 4B50A 4H0GA 4ZS6C 1ZB5A 2J7CA 5C3LD 2P5WB 3MLVH 1EAPB 5DUBB 5DZLA 2FSEA 3IB4A 3MKKA 5I18L 5HHME 5GGTL 3V6FB 3SKJL 5LCVL 1WBYA 5FKAB 1T89C 1MWAA 3DV6B 1I1RA 1UZ8A 5EOQL 5F96L 4MJ5B 2WV3A 3MPCA 3L3KB 3ECQA 1NDGB 5I8KH 1J05B 4S1RH 5TGBB 1Y18A 2AJ3B 2O9TA 1GMMA 1DYOA 3B9DA 3LIZH 2VL4A 3WD5L 4XNZB 5IT2H 4WWKA 4Y19A 1QI4A 3G6MA 3BZ4A 4HPOL 1J5OH 5FYKE 1KULA 2R9HC 3OJDB 4R4FL 4PJCF 1LEKA 4TTDD 2MTPA 3ULUH 4ZXBC 1WIUA 4Y4KA 5D2NB 4XV0A 4P0DA 1KJMB 1T1WB 4U31A 3C7FA 4I18A 1MAML 4Y89A 4BQ3A 4KY1L 4JKPH 2Q76A 3RVWD 4HMEA 4GO8A 4AT6B 4P2RD 1ZWIA 4E41A 3C08L 3LMYA 1P9MC 1S8DB 5B39G 3MR9B 5HJ3A 2VLME 5I1DA 1E6JH 2VDRH 2GY7B 4XPFL 3GBDA 4YR6A 4PBVC 1L7RA 2BVQB 1BFNA 3IJSB 1NGWA 3B9KD 3GSVB 1W9WA 4MMXC 5T1MB 3V4UL 1EXUA 2APFA 4AEHL 3QIBD 1WQVT 4YZFE 4JGUA 1FIEA 4NQSA 2A1WL 1MCQA 3GNRA 1WB0A 2XTKA 1K8IA 3GBLA 3ETBF 1V0MA 4TUOA 1CG9A 1CGTA 2ATKA 5FYLE 5TDOB 4KXZH 4YUEL 4HWEH 4IRJD 5IFAH 4DW2L 5KBNC 3BX7C 1WVZA 2CKBL 4ZUVA 3DMMC 2WM0A 3VFOB 1ISZA 4UFLA 5EBGA 2MNUA 1V8HA 1QI3A 4NQVA 4MQTB 3CK0H 2GCYA 1WZMA 1LL7A 3PV6B 4CMMB 5GRZA 4AJ0A 4GAJL 3SKUD 1H4PA 3WQ8A 3RWIB 1PG7W 1ACYH 4ZUUA 3LAFA 1E0OB 1G7MA 4KKBC 5I17A 2ED9A 2F53D 5J89A 1IILE 4TTGA 3FO2A 3BH8A 3VI4E 3O6LH 3U1SH 5F1IB 5GJTL 2YL5A 5EZJA 2NX5A 1KELL 3NA4A 3QEGH 1ZV5A 2M2DA 1UX7A 1YEIH 4OD2A 3QNYB 3QJHA 3MREA 3APGA 4W85A 3TF7C 4P7RA 2X4PB 4W4NA 1TUXA 1R85A 1NOUA 4RA0C 5DD0H 3QDMB 4BZ2H 1JZ7A 1V0KA 3ZKQD 1A1OB 5HPMA 4UBDD 1QSVA 3FO9B 1RIVL 4Y2DA 4XAKD 2OBGA 2YA1A 1XZ0A 5FO9B 1YMHB 1WAAF 2XA8L 3GO1H 1YEGH 2XXMB 3BJ91 2D7OA 3MRHA 2BSTA 3BCDA 4FZ8L 1FFNB 2NXZD 2Z4QB 4J4PD 4XX6A 3RIFK 2MKWA 1FZKA 2YR3A 3LZFH 1E6RA 1E6NA 5JOEA 3T1WA 4OZHF 5K9QI 2BOBB 2WAHA 1JGVH 1UM6H 1AD0B 2H26A 2D31A 3WUWG 3CHCA 4HUWB 1CZ1A 1X6LA 3ZKSD 4FHBD 4N9OB 2R0LL 5F7WC 1F11B 1XMWA 3HZYA 4GXVL 4OCRL 3MRPB 5GISH 3BN6A 5CKGA 1BEYH 3CUPB 1DVFA 3GEWB 3QUXC 4LBEB 4PRIA 5INDA 3GHEH 4K3HA 2WWKT 4JM2A 1MCHA 5ELIA 4V1DB 2OYMA 1AE6L 4GKNA 4YLQT 4OIIL 1JZ4A 4NZUL 3VI3F 1CD1B 1DEDA 4ERSL 2PYEA 5IGXL 5JORB 3S5LA 1RIUH 1PBYA 3HUJA 4QTHB 4K23L 3PQYD 3MLSL 4IOFC 1INQA 3SE3C 3CVHH 1SG3A 4LKCA 2J78A 4LMQE 5HVFB 2VIRB 4GRMA 1GGBH 4JPIB 2J79A 3VX0A 5GRVL 7A3HA 3CFEA 4LX4A 2HVKB 3BLKA 3WDPP 3IS0X 2AJSH 1P84J 1UWTA 2YSSA 2NCMA 4WJXA 4YBLC 2Q6WA 1UH3A 4HDIA 5C09B 4JKMA 3BH9A 5IFPA 3RAJL 4LOUC 2YK1L 1OM3H 5E9DA 2PCPB 2DIBA 5B8CC 5L7XL 2VVNA 4U7MA 2NY1D 4NWTL 5IB5A 4M6NL 2ZICA 2D3VA 4Z2AA 1EXPA 2J5LB 1AH1A 2M8XA 1P53A 5I8CA 1UR0A 1G6RH 4Y5YC 2L7UA 4GMTL 4MXQC 3H9SE 2G4FA 4OZOA 4JFOA 2QV4A 5I76B 4FQXD 5A8OA 2DB8A 5BJTB 3BEVB 2QQOA 1YPZB 4RX4D 4G9FA 3K3QA 4UMGA 4AZCB 5CEYA 3DPBA 3GHBL 3FB7A 5A8MA 3MBEC 5L6YH 3RIFF 3RTQB 3TZVA 5K9KB 2ZG1A 4HKJA 5T3ZD 4OLYH 4XVJL 3AJ7A 4AK1A 4F7EB 3U0WL 5I30L 1GHRA 2HWZH 3EYSH 3LPWA 3OLGA 1NBYB 1GGIH 2FD6L 2V3DA 1CIYA 2CUHA 3OGRA 3QXWA 2J8UF 1P7KB 2A3AA 2O9OA 1V5JA 2C1PB 5KN5A 4K8RD 3MANA 5JW3H 5C3TA 1QNQA 4MS8C 5GRJL 1FO0B 4J3WA 3TJEL 1H3GA 1U95B 2FL5A 5F7HA 4KAQL 1G7PB 3QUKB 3NSNA 4JFUA 4XMPL 5CLWA 2GFBA 3T08A 4FA8A 3VXUA 2Z8VC 4DGVH 4TVSa 1UZ6F 4W8JA 3MRCB 4XX1E 2BVYA 4XCEB 2DF3A 4IMLA 2YL8A 2QBWA 3U4BL 2OP4H 4JVWA 4L1DA 3QEUA 1C93A 3GNMH 4PSPA 2O5XH 3BIBX 4EQ2A 4KK5C 2VE6A 4GI6A 1IV8A 5I2IA 4OOUA 1IT9H 5GGRY 5FCUH 4QX3A 3I84A 1UKTA 3CFJB 2JCCB 5FXCH 1FLTX 1I85A 3JZ7A