2VZTA

Complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
850
structure length
850
Chain Sequence
b'GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 275
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vztA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vztA03
3ABZA 2VM9A 4PJBF 1M53A 1G7IA 1IC4L 4R26L 4U1SA 4XCNA 3S35L 3K74B 4I4WB 2DQDH 3WD1A 1KLGA 5A2JH 1INEL 4GW1B 3BN9C 4U4BA 2JLLA 1JPFB 3WY1A 2CDPA 1MFEL 1KF9B 4OB5H 4YXHL 4RIRB 4GQ9L 4KDTA 1KIRB 1QBAA 3T3MF 3DBXB 1GC1L 3B3IB 4X5XA 4LNRB 5C07A 4CVXA 5FO8A 4DXRA 2D3NA 4WDIB 1FYTA 3VIKA 1FZJA 3BO8A 4ZPTA 1J1XH 3CSPA 4IRZL 2YA0A 3U7YL 1NOWA 3MNWB 4WI4A 3NJ3A 4H25B 5GRVL 2DYPD 5DR5L 1JNDA 4L4TE 3CK0L 3KXFE 1FNLA 3MRBB 1HJXA 3GB7B 5C09A 3MLSH 3BZFA 5MEOB 3NZ8B 3HCVA 2D4DA 4L1DA 5HGBA 3ZDZF 2JCCE 3W11C 3U7WL 1CFVH 1VFBA 4Z8FH 4AMKL 5KS9F 2F8VA 1U95B 3ACGA 5DD0H 3UTSA 5ESAB 3AZTA 1YPZA 3QUXC 4CL7A 5HHPA 3KLAA 4PMVA 4RMVA 3JWDH 3WIIL 1CFQB 4K23L 1ZSDB 5E94A 3SKVA 5F3HA 5IEKB 4TSBL 1UB5A 1EEZB 3PXHA 2FR4B 1ZA6A 4JN2B 2XRAH 1RZFH 1MQQA 1Q9KA 3BWAA 4PTVA 3U37A 5HHOA 3QHZL 4UUJA 3DSFL 4NO2B 2D7MA 4LVEA 2DQGH 3K80A 4YDLB 5CILL 1WC7B 1MWAH 2AJVL 3IAQA 4CCEA 3OAZK 1UYXA 2XN9A 4NN6C 3Q6FA 1AFVH 4EUPA 4DN3L 35C8H 4E2OA 5H2BA 3RIKA 5A2LH 5DC0A 2QQMA 3GMRA 3LS5H 2C1OB 3ROLB 3QI9D 5MENA 5A8MA 1JNHA 4U1KA 3EDDA 4JFPA 5J12B 5SWQB 3ULVE 5A6JA 4NNXA 1ORSB 3VIOA 5AWNL 1HILB 4LU5H 5KG9A 4V1DE 1BP3B 5DD1L 3WLBB 43CAB 2OSXA 4LRIC 1GJWA 3TZVD 4X83A 4PYSA 1NC2D 2J8GA 7A3HA 4FQ2L 4D8PB 2VZOA 1UY3A 3ZJ8A 3VKKA 4M6ML 3SKOB 5GGVY 2ZOXA 4BSWA 4Z7OE 2FEDC 2ZWZA 3GUTA 5EUOE 4PJ8D 2C7UB 4O4YL 5E6YA 4M3JA 3CUPA 5E7FA 1JK8A 2YPLA 1CDHA 5CD5C 2EXWD 3ZR5A 1PX4A 2VLLB 1FP8A 2B1AL 4F15B 3U30C 1XGQA 1JGIA 3A6BL 4MJ5B 3MRJB 1A3QA 3JWOH 3GSVB 3B4NA 2Q7NA 3INUH 2R0ZH 4N9OB 2GJXA 4XNMB 1ZT1B 2ZUYA 3UERA 4PSPA 4KKBC 3TO4B 2AJSL 1A7RH 3CFBA 4PPTA 4QB1A 4ZO7A 2UWEA 1FORH 2Z92B 5JMOC 3WFDL 4LSRH 2DL9A 5LAXB 4GRLD 2F8OA 4PJCB 3BD3A 3H9SA 3MJ8B 5EOQL 5J13B 4YDJA 3QUXA 4JDVA 1T2JA 1BVLA 1BD2D 3AS1A 3JWNC 1BX2B 1W2VA 3I6GB 1LILA 5MP6L 5E5UB 4ZS7H 3MV7A 2FYYB 5C08E 1S9WB 3VWKD 2YPVL 1TZIA 1VACA 5I18L 5L7XH 1ZBKA 3B9KA 3OXSB 1XC6A 1NL0L 4X5LA 4XPHH 3PL6B 1JJUA 4QXTA 1YMMB 1HZHL 3LCYA 4PJ5B 4MVBD 3CZFB 2I27N 3QJHA 2P5WA 2HMID 4YPGB 3W0WD 4XCCH 3EO9L 4RRPA 5CD3B 5ETUB 1FZKA 3UZVB 4ZFOL 4FN0A 1MHHB 1TCRA 3ZKMC 2OWWA 2EDWA 3PN8A 1OSPL 4Y4HC 1EJOL 1OTSD 4XC3L 4HKXB 1WFNA 3UJTH 1XGTB 5HGHA 4YDLC 3MMWA 2PWEA 1MAMH 3H6JA 1T0NB 3IS1X 3V0VA 1H3VA 1MCKA 3W5MA 1XCWA 4NI3A 5AAMA 4PB9L 2D3LA 4HK0B 4LRIA 2EE3A 4HK3J 5D7SH 1G6VK 1JWUA 2RCSL 4NWTH 1U8HB 4LPYA 4OZGA 4M7KL 2FD6L 1AXSB 5J12C 3PV7A 3OGSA 4O02H 5C71A 5I16B 1ZLVK 4YHZL 5BJTB 2QQOA 1ZS8B 2ZICA 4JZJC 3W26A 3RHWK 3EB7A 2X89A 4HIIB 3UCQA 5T5FL 4GW1A 3IDJB 1RUKL 2A0LC 5DMIL 1CIUA 5DMKB 1JPFA 5DUPH 1EAPB 3QDHA 4DZBB 4RIRA 1X5GA 1W1YA 1AI1H 1KIRA 2CGRH 2VDPL 3ZKSD 3DBXA 3B3IA 3S37H 4LNRA 4D6GA 5DS8A 5JMOA 4XUPA 1HNGA 4UTBH 4F15C 2WKLA 2CBVA 1TZHB 1EERB 4O9HH 4HKZA 2YC1B 5DEGB 3OL2A 3LQAC 3MNWA 1IGIL 2HN7B 1FQ9C 3MRBA 3DWTA 3LMJL 1LO5B 5T1LD 1HKLL 2X4RB 5JXEC 3NZ8A 5MEOA 1KACB 2A6KB 4M5ZH 5E6IC 1WDPA 4OF5A 3NOIA 1U95A 5DMYA 2WBJB 3CHFA 5D1ZB 5ESAA 5JPNB 3E8UH 3VI3E 1OAKL 2D03H 3KPSD 1CFQA 1ZSDA 5AY7A 1UD3A 5IEKA 3TFKC 2BP3A 1EIBA 1UWXK 1E55A 5HHMB 3RU8L 1EEZA 2FR4A 2G3MA 4JN2A 2XZAH 2EXYD 1LNSA 4XP1L 4CU9A 1ITXA 1KXQA 3PL6C 4LGSB 4Y4HA 4B3KA 5A94A 4KK8C 4NO2A 4KRPB 2WVVB 2PYFB 4FFWC 1WC7A 2MWCA 4Y4FC 1CFNA 1GGCL 1CZTA 3FT3A 3VDAA 2B31A 4L9LB 3CU7A 2X9XA 1QFUH 3DSNA 1KB5L 2C1OA 4XVTL 5DQDL 3ROLA 3C60D 5A6AA 5DYOB 4PR5B 3VM7A 1MCDA 5SWQA 1MW3A 1ORSA 4RGNE 3H7BB 5FYJD 1HILA 2Z4QB 1DSFH 43CAA 1I7RB 3WLBA 2MJWA 4Z2LA 1KIPB 3EJJX 3UYRH 5B3JF 4AD0A 1NGPH 5E4EB 5GGVH 1QG3A 1E4JA 4D8PA 4AEHH 1VAHA 3SKOA 4ZY9A 3F58L 1JGUL 1ND0B 3F5JA 5CP3A 3W5NA 3UO1H 2C7UA 3QFJB 1E4WL 2LAGB 5E56A 5E2VL 4ZENA 1Z5LB 2VLLA 2OZ4H 5IDIA 3LHPH 1KC5H 3UJIL 4MJ5A 3MRJA 2ZX9A 4M1DL 4PRHE 3GSVA 4XNMA 1ZT1A 4JPWL 1QNOA 2IG2L 3HZMB 4P0DA 4TUJB 2OS7A 3TO4A 1RIVH 1SEQH 3ALPA 4AEIH 2Z92A 1RURH 3EYVB 5JXEA 1EAJA 1BJ8A 1TMCB 5IJRA 4HFUL 5E6IA 5LAXA 3SCOA 4PJCA 1F5WA 3BRGC 5C0NC 3MJ8A 2Z4FA 1A6ZB 3CMJA 1UENA 1Y6MR 1QPXA 1V3HA 5I8KH 4MXQD 1BX2A 3I6GA 2EIBA 2IPKB 1LQ0A 1KJ3H 2DD8L 1OWRM 3TNMB 2FYYA 1TJGL 3ZTJG 2ZWYA 4ATDA 1K3IA 1S46A 3OXSA 1R5IB 2VLJE 2WBJC 3PL6A 5D1ZC 5I71B 1BSIA 1YMMA 1ETZB 1W2PA 1OF4A 4GLRI 1Z2KA 4UBDC 2P43B 3CZFA 1VRXA 3WKZA 1VHPA 4H88L 4YPGA 4F58L 3BAXA 5KSBE 3V7MA 2O9RA 2HTLD 1EO8L 5HGDB 5CD3A 2I60L 3QHFH 2P48B 1YY8B 5ETUA 3FY1A 1YQ2A 1MHHA 4PB0L 1H09A 1N6QL 3GJFH 3FZUD 1OD8A 3LZFL 4HKXA 5EU7E 4L1HA 4JANB 1XGTA 2Y23A 3BZ4B 4KRPC 5F7LB 3AJ7A 1T0NA 1JYWA 4TQEL 1AE6H 2XG5A 1TENA 4K71B 1YYLH 2LW8A 4AM0B 4HK0A 4OF0A 3QPXL 2DI9A 2J74A 4Y19E 3T0AA 1U8HA 4XNUH 5CJOH 1AXSA 2GY5A 4ORZC 5I16A 3GXUA 3A3HA 2EEAA 2C8NA 5BJTA 2F5AL 1FA2A 1ZS8A 2CKBH 5DK3A 4JG1H 2YBRB 4HIIA 3L4YA 5E4EC 5DMKA 5E24E 4KHXH 5FYLD 4X98B 1EAPA 4DZBA 1V5JA 1QSFD 5BVPL 4PY8I 5H37H 4A3ZA 3IDNB 3UBXA 1VGKB 1WP6A 1TZHA 5DD3L 2WMJA 4N0FB 2GTWB 2YC1A 5DEGA 2OYPA 1NBYB 3TA3C 3OEAA 1VPOL 4JFHD 4QXGH 2HN7A 1W1VA 3BESR 3N1MC 2ADFL 4XMKH 4HLZH 1LO5A 4ESKA 4JB9L 5FK9A 2MKLC 2A6KA 4FABL 4YIQB 5GS3A 1X6LA 3M7SA 3BHBB 3GMQB 1I7TB 2HAZA 2WBJA 5D1ZA 1GC1C 1UZ1A 2NW2B 3OKKB 4JFFD 4RISL 5JPNA 3MV8B 1GW1A 1BF8A 2VZTA 1GUIA 1CDBA 1IC5L 1F6LL 2DLIA 1C7SA 3ZHKA 4F8XA 2DB8A 1OGGA 1OQOA 4XCEB 4HUXB 5IW6B 5I79A 2DTMH 1W0VB 3QO0B 1U36A 3CXHJ 3ZTNL 3UETA 3RKDC 4PGBB 3JUZA 1GGBH 1C8QA 2PYFA 5BOZG 4HPHA 2ZEYA 1X5KA 4L9LA 2WMPA 4X0NA 3A67H 4OTXL 5H8DA 2DQTH 4FOMA 3RGVB 3ARXA 3I6KB 4OIIH 5E5RB 1OGAD 4JFOB 3GBEA 3GIZH 5LBSL 3RWDB 3OPZH 3DNKA 3ZJ7A 5DYOA 1SDDB 1IGFH 4PR5A 1WPCA 1EQCA 4EDXB 2HP4A 4ZFOB 3H7BA 3P9WB 4K71C 2Z4QA 5ESQB 1RMFL 3OTTA 1I7RA 3WO3B 5JUVA 1KIPA 4KUZH 3MGAA 4X9FA 3QOKA 2CR6A 4LDLB 4GO9A 3W24A 4YEFA 4QHKJ 1HIMH 1ND0A 3I6LD 3MUAA 4LCIL 3QFJA 1LWJA 3LIZH 3KPNB 1A1NB 1LHZA 4Z0BL 1Z5LA 5I1IH 1FFRA 4PJIE 4I0CC 2FJHB 1R3KB 2ITDB 4UINH 1F3DH 1HHIB 3HZMA 4TUJA 4J28A 1PBYA 2DLGA 4B5EA 3AMGA 4O2CB 2AK1H 4C56E 4S1DC 2YL6A 3KJ6L 3L3DB 1RIHL 4XAWL 2F54B 2DH3A 4AZ5A 2O5YL 5TDNB 3CDFA 3JVGA 2CBJA 32C2B 5LKNA 2BGPA 1A6ZA 3HJRA 2V2XB 1PZ2A 3DOSA 4KVNH 1FCGA 4AZ8A 1ZANH 2DQIL 4TRPL 1OCWH 1UG6A 4N90E 3MOBH 3EMCA 1TXKA 4MJ6B 4EQ3A 2CO6B 3FFCB 2IANB 2Y36L 1HKKA 2IPKA 4MB4A 3N15A 2QQJA 3TNMA 3NVQA 1UM5L 2UVFA 5KBNC 1RV6X 1U3ZA 5TF0A 3PDDA 1RZJH 4ZYKB 3C9NB 5DFVD 1R5IA 2APBA 1UWSA 2YS4A 3DO3A 3FN0H 4JPVH 4ETQB 1ETZA 4Z7WB 1YEEH 5F7DB 2R1XB 1UMIA 3OKNB 4GAJL 4YXKL 2WHJA 4NUJB 4QRPE 2LVCA 1YY8A 1QTYT 3KPRD 3RVVD 1J1OL 1HYRC 2J6EH 4Z0XB 5T3ZH 5JHDE 2I07B 4L8DB 2CPUA 1AXTL 2ZNWA 1EHAA 3V6OE 4JANA 3BZ4A 5L2JB 4I9WD 1K2DB 4HWBH 4UR9A 4BM7A 2NY3D 4J4PC 3FHAA 5I2UA 3WIFB 2W5FA 3T0XA 4RFOH 1X9QA 5HYJE 4MGQA 4AM0A 2GTZB 2DDQH 4YHMH 2QBXA 1FGVH 1DQMH 4PRIB 1HWGB 2WWKT 3IDIB 2JIEA 2W0LA 3G5YB 1C7TA 2PTTB 1HP4A 1SVZA 4Y16D 3LE0A 5EWIL 4DKFH 1KB5B 1A9BB 2R0LH 3THML 2ORBL 2YBRA 2VXVL 4HOZA 3UROR 1V8HA 4X98A 3VIPA 4FXKB 3MCG1 1X4ZA 1VERA 3MCKB 1KFAL 1QSEE 1WGOA 3GKWL 1F02I 4FTVB 4XNYH 2NXZD 4IOFC 4JFUA 3IDNA 5DHVB 3PJSA 2UZYB 5E0QA 2YLLA 4HXAH 3BYYA 4JY5L 4ERSL 4POYA 1VGKA 1GHFH 1IQDB 2GTWA 4G5ZH 1NBYA 1U91B 2CERA 1MJUL 2EJ1A 4N0RA 1AY1H 4X99B 4P02B 3D0LB 3VGAB 4AAXA 3KYKL 4NQUA 4JHZA 4Y2DB 5FYJL 3T2OA 1HINL 5FKYA 1MFDL 2EDXA 4YGAB 4XVJH 4YIQA 1NANH 3ZQ9A 3BHBA 3GMQA 1I7TA 3QXDB 4NCDA 2NW2A 2X1PA 3OKKA 3AHYA 2J8UB 1A8JH 3WMSA 4P3WA 5HJ3B 4PRDB 3S37X 2XZQL 2IWGA 3PGCB 4XCEA 5IW6A 2VXSL 4HUXA 4WV1B 1W0VA 3QO0A 1EFXB 3SDXB 2DKSA 4QF1B 3BE1H 3LEIA 4PGBA 1QHOA 3VTRA 2AABL 2AQ2A 4IS6B 3EFDH 1DHKA 1GOMA 1QBBA 1HHJB 4MHHI 3RI5F 4J4PA 4OI8A 3I3BA 3QEQE 3GNOA 3G5ZB 3PUHA 5BQ7B 3RGVA 3I6KA 3SUUA 4JFOA 3RWDA 5E08L 5SWZD 3B83A 4TNVK 3MGOB 1NFKA 3QDGD 4TSCH 3WBEA 2F53E 5C0CE 4EDXA 2A83B 2MSPA 1B3XA 4ZFOA 3CUJA 4GBXD 5ESQA 3EHBD 4I3RH 4EBQL 1A9EA 1ZLWH 4OM1H 4NP4L 2DYPB 2JEPA 3BKCH 1F4WL 1AD9B 1MHCB 4UTFA 2K9UA 3QIWD 4U6HB 2E40A 3MLRH 5JR1L 2C3WA 5BCAA 1QA9B 1Q4NX 3QCVL 3MBXL 4KQ3L 3G6DL 3KPNA 5D70L 4CMHB 1A1NA 1TG7A 4L9DA 1F4XH 4KTEL 4LHUD 3ZL4L 3UEZA 3CXDH 3R1GH 2P44B 4CN4A 2FJHA 1HCVA 1R3KA 4N0UB 2ITDA 5T33L 3LEGA 2NTSP 2PR4H 2PXYD 1HHIA 3WIJA 4MD0B 4O2CA 2WWKO 1TVDA 3L3DA 1XSIA 2ZPKL 2F54A 1N6UA 2VQUA 5TDNA 3D9AH 2DEPA 3SO5A 1IQDC 3R0MA 32C2A 4WHCA 3FMGH 1AJ7H 2V2XA 4R8WH 4FQJL 1A7NL 1HQ4B 4B3LA 1UWUA 3VGAC 4HW6A 4Y2DC 2FZ3B 4MJ6A 3FFCA 2IANA 1EJ6A 4LSDA 3VGDA 3EOAB 3QI9B 1PG7X 3HR5B 3SCMB 4ZYKA 3C9NA 3LQCA 3HFML 5FDYA 5FYLL 3LEYH 4ETQA 4Z7WA 1BZQK 5DT1L 2XG4A 2Y9RT 5F7DA 4P5TD 3TZVB 4CDGC 1NC2B 4EOWL 3G9VA 4NUJA 1O5DT 2AJXH 4Z0XA 5IB4B 3HI5H 1P5UA 4PJ8B 2I07A 3QNZB 4L8DA 1RZ8B 4N8VB 5EZOH 4K7FB 4NQEE 2HT3D 3ACFA 3EFFB 1K2DA 1NAMH 3NTCL 3RBSA 3WIFA 2D7NA 1A0QH 3ULVC 2Y8VA 3SEEA 1L7TH 2GTZA 5CSYA 1ZHBB 5HHVH 4PRIA 1MREH 5TE6H 2VZ1A 4Z2HA 1HKJA 1OTTC 5DD5L 3IDIA 1XGRA 1I3RB 3G5YA 1D6VL 3O4LD 2PTTA 4JFQB 3SDDD 1CXFA 4GRLB 3H8NA 5C7XL 1KB5A 1A9BA 1WZKA 3ZE2F 3W27A 1C12B 5MI0B 1XGZA 1SM3H 1FFOA 4EXKA 2GAZB 3W39B 4CCCA 5I75B 1BD2B 2EIDA 4FXKA 1JGVH 3MCKA 2WMGA 2YFUA 2GJPA 4HJ0D 3CBWA 1LVEA 4LCWD 4FTVA 1XGPB 3VWKB 5DI8B 5LGHL 5DHVA 4CMHC 4NPYB 4ZAKC 2NY2B 4GW4B 4GI9A 2VUYA 1UM6H 3UDWC 3O2WH 3APGA 1EHNA 1IQDA 4YHLH 3RWCB 5I8OL 3RILA 3EJYD 4YEEA 1U91A 5F97E 2IXUA 3W0WB 4OFYA 3PTMA 1XD0A 1IVLA 4X99A 1CF8H 5CS7A 4Y2DA 3HN3A 4JGUA 3HC0A 2CDGB 5GJTL 4QX3A 4AIZB 3UBXG 3UTOA 3K3QA 3SPVB 4DXSA 4QCEA 5DQ0A 3VFMB 5EORH 1AQ0A 3MODH 3QG7H 3QXDA 1IT9H 1QLRB 2J8UA 4HUWB 2UY6A 4GMTH 5HJ3A 2ZX8A 4PRDA 3K4ZA 3QI9C 4AG4H 3PGCA 3SCMC 3GHBL 2QJDA 4WV1A 1C5BL 4L29B 5JO5B 5AD0B 3I2KA 5LA1A 1EFXA 1OBAA 2R23B 2D23A 3G6AB 2GVYA 1KQZA 4W8AA 1YUHB 4IS6A 5E4IA 4A2MA 1H8NA 1HHJA 4Q6IC 2LQRA 5GRVK 4CU6A 5I19L 4LLAA 3S4SG 4KMLB 3G5ZA 2YBTA 5BQ7A 2R4SH 1J18A 2BZDA 3LN5B 1S5IL 2J79A 2C1PB 5FCUL 4PRNB 3MGOA 1BFNA 4H1LB 3D69A 1J0YA 1NMCB 4OCWH 3ORJA 3RAJH 4FQIH 4P48A 1QBLH 1S7UB 4OZIF 3QP3A 4HZAA 1P5VA 1OB1A 1U42A 2DYPA 1KGYA 4ZXEA 3MSDA 1IFHL 4DCQB 2I9TB 1GIGH 1MHCA 5EB9A 5T1LB 4U6HA 2CIPA 2JE8A 4RX4D 2PTUA 1E0OB 4GRLC 4NO5B 5M95B 4GZEA 3RWIB 3PHQB 1REIA 5MI0C 3VW3L 1K45A 1QHZA 4KK9D 1U2CA 4JX0A 1HE7A 2EE9A 3UDWA 2VXQH 1J11A 5TE7H 5I75C 1UYWH 4MA3B 4EI5D 3KPSB 1MPAL 1NEZG 4ZE5A 4QEGA 4NQVB 4MD0A 2XKUA 3VWKC 2PC8A 1NGQH 4XC1H 1RH9A 2NY2C 2VR4A 3MBWA 1U6AL 4PJXF 2OP4L 5IHUH 4J3OC 2VL4A 4MVBC 1CGVA 2HMIC 1IKFH 1T21B 1Y6NR 1HQ4A 4P2RE 5D2LB 5IB3B 1UA6H 3MROB 3PG2A 3EDEA 1CLYL 2FZ3A 3MC0A 3T3ME 5EBLB 1OTSC 3EOAA 1PVHA 1NGWB 3C60B 3QI9A 2WMIB 3HR5A 3SCMA 1G7JB 2YZ8A 5CJXC 1N5AB 1NDGB 2AKRB 3WNPA 4OI7A 3P0YH 2JFEX 4NOBA 4M80A 4U6VH 4M8VA 5A2CA 3OJDB 5C0AD 3TZVA 1NC2A 3PP4L 5F6HI 2ZCKL 5IEHB 4BFIB 1H49A 1ZB5A 4Z2AA 4YNYB 5IVXE 5ITBH 1LP9A 5D7LD 4F37F 3MCLH 5IB4A 5KS9E 1U93B 7FABL 3KHQA 3QNZA 4PJ8A 1RZ8A 3MACH 4K7FA 2L7UA 2W0FB 5ITFB 3GSXB 3EFFA 3C08H 3DHJA 2VLMD 4TOQA 2Z0BA 2WVUA 3VXME 3VCLB 1ZHBA 3ZE0F 1C1EL 2FBOJ 5ICYB 1Z9SA 2X41A 1WCGA 1T2XA 5EA0L 1I3RA 3SCNA 3MLYH 4JFQA 1NMCC 1UZ8A 4JO1H 5INCB 1G94A 4GRLA 4I13B 4S11A 4ZG1A 5FGRA 3PNWB 3QULB 2R0WL 1OSZB 4G9FE 4N0CD 3QYCA 2KL6A 3W39A 3L5XL 4WI9A 4LKXB 1BD2A 4EVNA 1HN1A 1ZBWA 1E6JL 1RU9L 3QDMD 1TZGH 3QWQB 3UNPA 4NT6B 1XGPA 1CXIA 1Z3GH 3VWKA 4TUKH 5DI8A 1RSFA 4WHYG 4XPTL 5DMJB 4MA1B 2R56H 4GW4A 3RA7L 2XACC 4C4KT 5J4MA 3RWCA 1WCBB 3EZ8A 2R69L 3W0WA 4CADB 1KENL 2WXDM 2KDGA 3U2SB 2XNAB 4K3DL 1J87A 2P5ED 2CDGA 3U83A 3HG1D 4AIZA 5IGXL 2O26U 1DP0A 2EYTB 3BIKB 3SPVA 1MI5B 3VFMA 5CJXA 1CGYA 2DF3A 4HG4K 4GW5B 1QLRA 4GLRH 4HUWA 4P7QA 4WKFA 3QA3B 5L0QB 3B9DA 1EGJH 3WHXB 1YN7B 3LVEA 2DLEA 5HHNB 3IXTB 5DURB 5GNYA 5BS0D 4D6EA 2ARJQ 5AD0A 4WI2A 4L29A 5JO5A 3PGFL 4JL2A 2R23A 1KN2L 2BNUB 3VFWB 5CSBA 3G6AA 4EDWH 4QTIL 3K8LA 4WFED 1YUHA 1NGZB 5C70A 3WL1A 5EU7C 4OLVL 3EO1B 3GBNL 4HA3A 1UVQB 1UZ6E 4UQ3B 4J8RB 3EYSL 1TJHL 2EDEA 3LN5A 3NFNB 4GI6A 5DFAA 1EHLL 4JFSA 4MNJA 1E6RA 2C1PA 5ICXB 4MXWL 2WUBH 4PRNA 3RPIB 1UWTA 2CRYA 4H1LA 3KAAA 2XQYK 5JUEH 4OGXL 2ZEZA 1E1EA 2AEPH 1OAYL 2R2EB 1S7UA 3LRSB 1FLRL 3SCPA 4MJ4A 2QF8A 4QY8A 15C8L 4DCQA 2I9TA 5ECUA 3PUIA 2XM2A 3L1OH 3QQ9D 3QJFB 4NO5A 1SBSH 1QFWH 4KQ4L 2P42B 1B4RA 3PWPE 3RWIA 5L2KE 3PHQA 4ZXOA 1BTCA 3HZKB 4X6CE 4JFFB 4XUQA 3STZB 4MA3A 3VRLE 3KPSA 4MXQC 1MPXA 5T1MB 1GZPB 4DAGL 1NCCH 4G6KH 3TV3H 4NQVA 2BFGA 3OGCB 5FXCH 43C9A 5K9JL 1EXPA 2BNRB 2G5RA 4MA1C 4ZNEE 5F96H 3ARBC 1EMTL 2OJEB 1T2QH 2OMBA 3MLVH 5GRUH 1WKYA 5E0CA 4HGWB 1D5BB 5C6TH 3WXVL 3KZSA 1T21A 4KKAC 4C54A 4NZJA 1UJ3C 5IB3A 4D9RE 2VN7A 3K4AA 3MROA 2VRKA 3MA7B 5D7JC 5DVOA 3AIBA 3QEGL 3GNMH 3LB6D 1AGBB 1E71M 1OGAB 5EBLA 3F5KA 2X09A 1NCAH 5DWUH 3FZUC 2XA8L 2WMIA 3C60A 4KJYB 4AD2A 1W8OA 2AP2A 1NCDH 4UQBA 4O58H 1G7JA 3MLXL 2FX9H 1N5AA 1NDGA 2AKRA 3HNTL 3N11A 5D7KE 5GS2H 5SV4A 3WSUA 3CGTA 3HPLB 4C4KO 3OJDA 4ARXA 5L0QC 2BRQA 2VZPA 2Y06H 1CXLA 2Y1VA 4L0PA 2DOCA 5IEHA 5D71L 4NRRA 2EH7H 4YNYA 4R90H 1OQXA 2YOCA 1U93A 2B1HL 2QV2A 3EZJB 3Q5YA 1W3LA 4XX1G 2BOCB 3CC5B 1UZ0A 4GG6E 2DQDL 2W0FA 3ACHA 1KQYA 5HYIA 5ITFA 3GSXA 2DLHA 4KKNA 2CKNA 5KJRH 3NCOA 4PMZA 3TBWA 3VCLA 2XQYG 5GGUB 4H0GA 1WNOA 5ICYA 2K7PA 4X6EB 5IFHH 3C5JB 2X7LB 2JB5L 3IGAB 5BRZE 4PMXA 1EOMA 1G9MH 3AC0A 3U1SL 1J1XL 3EIFA 5INCA 5IVNA 2J1SA 1M7IB 2J88L 2RB8A 4KKLD 4XVUD 1AGDB 3PNWA 3QULA 1OSZA 1CICC 1XH3B 5I8CB 1PSKH 2HA1A 4LKXA 2V38A 4XZUG 1JP5A 1UFUA 4U1NB 3MU7A 5ALBH 1SEBB 1CFVL 4NT6A 1IAKA 3ROOB 1ZGLB 2FWOB 3KL3A 4DUXA 4CN1A 1T20B 3WNMA 1N3NB 3T04D 4HK3N 3CIHA 2IGFL 1ESWA 1WCBA 5F1SA 1EHXA 3BAYA 5F72S 5C92A 4CADA 5KANI 4OLYL 1RZFL 4MQ7B 3AMCA 3D39D 2QQLL 4LL9A 3U2SA 4H8WC 2XNAA 4X0KB 3VDBA 3QCTH 1U8NB 1H1NA 3LRHA 4ZFGH 2DQGL 3VFVB 4RWYH 3SUSA 1MWAL 2EYTA 4IDLA 3BIKA 2VC9A 5ABFB 1MI5A 1AFVL 3R4DA 1VGEH 2NY3B 4W68A 1CNVA 3O9WD 4GW5A 2CK2A 5MHSE 3OGOE 4R27A 1MCPL 3QA3A 5JOFB 3TA9A 3WHXA 1YN7A 4GKNB 3ZYIA 4BJ0A 1IBGH 5HHNA 4YBLC 3Q48A 4QDRA 2LVEA 3IXTA 3ZE1F 4MNQD 4UOJA 4Y16B 3KYAA 2BNUA 3VFWA 2QQNL 4B53A 2DIJA 1NGZA 1WEJL 3V6OC 3EO1A 3O6FD 1UVQA 3PZIA 1A22B 4UQ3A 3KPOB 1MJ8H 2QLVB 1N7ML 5EIYB 2J7EA 1U0QA 4ZTPH 1T03L 4DGIH 1SR0A 5F44A 5ICXA 3RUGB 3RPIA 1EXUB 1NBQA 2NXZB 1LO2H 3ETBF 2C0HA 2OTWB 3TVMD 2ATPB 1NKGA 2W1SA 3JWOL 1WZ1H 4QNPE 4NQDE 4OCRL 2IXVA 2O9PA 3UX9B 2R2EA 3BEVB 3VIIA 3LRSA 4FZEH 4NQCD 4PRPD 5IMLB 1FORL 4PJAB 2XT1B 4S3KA 4LSRL 4JPKH 2R29H 4MMXC 4DKEH 1HI6B 2W47A 4U3CA 1WUNT 3QJFA 3U82B 4OCSH 5FKPB 3HZKA 3BJ91 2DQUH 4JFFA 5DVMA 3BT2H 4PN2A 3STZA 3O6LH 5HVHB 5T1MA 1GZPA 5L7XL 2P47B 1F90H 2ZXQA 3OGCA 1Q38A 5GXBB 4XPHL 3P30L 2QSQA 4LSTH 4PBGA 5HDBF 2BNRA 4DKAA 5DFVC 4PGEB 1E4NA 4OD3H 5FGSA 3CU1A 4H0IA 3VH8B 4QWWC 4XCCL 3DX9B 2YLAA 4HGWA 3WHE1 2WNWA 4FP8H 3CCHA 4K3EH 4PJ7B 1U8QB 3MA7A 2W62A 4XB3A 5CIPH 1F3JB 1OAZL 1AGBA 3C5SB 5KOVC 3RVVC 1G5AA 1BFOB 3WQ5A 1DQDL 1OGAA 2CESA 5SWZB 1MAML 4KJYA 2XZCH 1X5LA 3QDGB 5DUMH 2XY2A 4MD4B 3FO2B 1IC7H 4GBXB 5I74B 3HPLA 2VDML 5D7SL 4PJFF 4WTZA 1I9EA 3CDCA 4YC2C 5DEFB 3D5OF 2F15A 3QISA 3P73B 5ALCL 1MCOH 2E9BA 4LFHD 4Y1AE 4O02L 3RO8A 1M7XA 3QIWB 3RFZC 2CLVB 2HFTA 3UCRA 4BUHA 4Y16C 3CX5J 2BOCA 3CC5A 3BCFA 4JO2L 1KG0B 1HSBB 5DUPL 5EJZB 4LHUB 5GS0H 5D7IF 2UUDH 5GGUA 2WABA 1AI1L 2PXYB 3O3UN 2CGRL 4NJAH 3S37L 4X6EA 4WW2F 1JNJA 4XXCA 1CIDA 3C5JA 2X7LA 4F79A 3IGAA 5DK2B 1KGXA 1QRNB 1IM9B 5T3ZD 4LKSA 3QR2A 3SKUD 3A47A 1M7IA 1CLOH 3AS0A 3MV9E 1AGDA 1KCKA 2E9IA 3WQ6A 4F7MA 1MYRA 5DF0A 5J3HD 1XH3A 2VLKD 5I8CA 4P2OB 1XH0A 4GOSA 5BVJA 1P2CB 1F3DJ 4U1NA 1SEBA 1WAAE 1OLZA 3ROOA 2HRPL 5F70A 1ZGLA 2QHAA 1R6VA 4YHYB 2FDBP 12E8H 2FWOA 1IJ9A 3T0WA 4JQIH 5JW4R 1T20A 5CGMA 1N3NA 1AO7D 2D03L 5IYYA 3L4XA 2ICWJ 4HWNA 1ZLSH 5HVHC 2XIDA 2XPGB 1QR1A 4P5TB 4S1QH 2ZUUA 4HS6B 5CEZE 1KTDA 4MQ7A 3II1A 1MXDA 4JFDD 3GSUB 4X0KA 3HMXA 1U8NA 1JF6A 3VFVA 1FO0H 1GGUA 1IE5A 3WSQH 1BOGB 2Y8KA 5ABFA 4TUOB 5D5MA 3CVHH 2JJWA 3HPJB 4YDKH 4MX7B 2W60B 5JOFA 1I9IL 2EPKX 4A44A 5BO1L 3RTQD 3U79A 1WTGT 4GKNA 4PJGE 3CQOA 2XJ7A 2ZEWA 1WLHA 1H4PA 3SDDB 1DSFL 4Y16A 3OR7B 2FX8L 4GBXC 5I74C 3EHBC 3SUTA 1HIZA 2NY5H 3FFDB 3UYRL 3WKMH 1NGPL 3PQYD 3ZDYE 3F7QA 5CP7B 1UD5A 4AEHL 1QOXA 1KELH 1S9YA 2IQAB 3KPOA 4Z5RB 2A3CA 1FGNL 3UO1L 3QIWC 2GSIB 4MB1A 2LU4A 4TNWK 4LCWB 4UFKA 3RUGA 1EXUA 4H5SA 1PG7L 3LKOB 2OTWA 3NUKA 1KC5L 3T1WA 2ATPA 4I2XB 4HP5A 1BZ9B 4AZIA 4HOWA 5GNXA 4NUGH 5F7NC 3BPLB 3BEVA 2FGWL 2RGLA 1BFTA 2ILLA 3CH9A 2PXYC 5E2TH 4X9HA 5IMLA 4EN3C 4W85A 1FFPB 4PJAA 5EN2B 3C7OA 1HI6A 5FL1A 3CD4A 5FECB 5IBTH 4U3AA 3NZHH 1B2WL 1UH4A 3GH4A 2A6IB 3MUY1 5FKPA 4PJBB 5FUCC 5IQ7H 4P2OC 1OARL 3AIUA 1FVCB 3WV0A 4G8EB 5AG8A 5J1SC 1VIWA 2KQNA 4ODTL 4YHYC 4DOHE 2B8OT 3CIQA 2VJXA 3B2UC 5HHQB 4PGEA 3FT4B 4LLDB 1MFCL 1MQ8A 4XCFL 3VH8A 2GFBB 3HAEB 2DIAA 1NWTA 3DX9A 2A73B 4IRSD 4MNLA 4P5TC 2OLDA 3BDXA 3TP4A 2EDOA 5JA8B 3QHFL 5TFSH 3T3PE 5I3DA 1G84A 4PJ7A 1U8QA 3D0VB 1F3JA 1HOCB 5F71A 1BFOA 3ARQA 2DQEH 5SWZA 4XWGL 4YHEA 2Y07H 1W0WB 1MQRA 2VXTL 2AXJA 1MRCH 1PQZB 3U7AA 2HT3C 3TTYA 2X4PB 3ISWA 1YYLL 1KGCD 4MD4A 3FO2A 4UILH 4GBXA 4EJ1C 4AZ6A 2GQHA 5DEFA 4P23D 1MWAB 4ZMAT 4F3FB 3P73A 4M6AA 5CJOL 4DWSD 4G7YH 3JUYA 4KY1L 3QIWA 5JNYB 2CLVA 2B4KA 3SDDC 2CKBL 3UXFA 1QZ1A 3KYNB 1LEGB 3WUWB 4L3AA 4NF7A 3HUJF 4D94A 2XV6B 4JG1L 4N42A 1KG0A 3RZCD 1HSBA 3V2AR 4LHUA 3ARED 1NMAH 2Z31C 3L7EA 3WF3A 4EI5B 2IPUK 2AEWA 2LE9A 1JPGB 3QQ3B 1VEOA 5CEXB 2PXYA 4Q9BA 5DQ9B 1FYHB 3VI4F 5JW4Q 4W7WA 1JN6B 3LS4H 2DT0A 4LOUD 5DK2A 3PTQA 2YD9A 1E0WA 1QRNA 1IM9A 2VDNH 3VXRE 2XWBB 4NKDB 3OKLB 2E27L 3GBDA 5HYJD 5ELIA 1OOAA 1L7IL 1B31A 3F2ZA 3CZKA 3I2CL 4P2OA 4IOIB 4KI5F 1IV8A 2EEBA 1P2CA 4LQFL 1I7UB 3ARZA 2D1ZA 3AIVA 3WJLC 2WHMA 1OWQA 4QXUH 3L5JA 3NPSB 1VFUA 2VDOH 3QT2A 5CZXD 2CUMA 4WCYH 3FQWB 1JFXA 3WH6A 2VLRE 1CN4A 2VVNA 2XQBH 4IBLT 5CEZH 1Y7VA 2G41A 4L4VE 1QSZA 4OLZL 3MOAL 4X9GA 1CGWA 2XPGA 4P5TA 4B0MM 4HS6A 1U8OB 1QSED 1K9EA 4AIOA 3W9DA 2H1PL 2VISB 3GSUA 5D7LB 2GUOB 1JF1B 4Z2JA 1GGBL 5FIEA 1IAOB 3PWUB 1BOGA 2UYLA 4XPAH 1F2XK 2NCMA 1FAIL 3NA9H 4V2CB 4TUOA 3AU1B 4BQ8A 2DQTL 3ARTA 1VJSA 1S7SB 3HPJA 4OIIL 5CKAA 4MX7A 2WIIB 2W60A 1BBJB 3OPZL 1CEOA 2NY0D 4URTB 4YBQC 1IGFL 5EZJA 4TULH 5ANME 1FJ1B 2IAMD 3MUGB 3BZDA 3SDDA 3D3VE 3QHMA 1BGGA 3OR7A 2VH5H 1JGLH 5F7FA 3FFDA 4QOKE 3BPOB 1GOQA 5CP7A 2HJKB 4ATWA 3BSHA 1HIML 2Z31A 2IQAA 5DEZA 5D2NB 5BV7H 2XQXA 5CEYB 4Q0XH 3ARFD 4ARYA 4QRSB 3DMMD 1P69B 3QDMB 4RAUB 4Y8AA 3THDA 2GSIA 3ZKXB 1P6AB 3LIZL 1B3VA 4MNGB 4LCWA 3CX2A 4FXGB 2IPUG 4WTXA 4P4KD 4UCFA 4PMRA 1FZOA 1E4KA 3FO9B 4JY4A 4I2XA 3L4WA 1JYVA 1BZ9A 4HOXA 1M7DB 2OBGA 4QRUB 3EAKA 4F80A 1NLDL 5DLML 1U8IB 1W9WA 2YC4A 1JIBA 4LLVB 5KZCD 3F8UB 1X5XA 3WDHA 1V7ML 4P2YA 5EN2A 3FO0H 3HOBA 5L8JB 4JG0H 2P5EB 2IH3B 4GAGH 4JHAL 5CINH 3HG1B 5FECA 5C8JB 2NSXA 3ALWA 3VA2C 3CPUA 2IF7A 3MRNB 4KRLB 4KVNL 2CIIB 3ULSB 2FBJH 2A6IA 1ZANL 4KHTH 3ULUE 1EOKA 4PJBA 4XMLH 1QFPA 3MOBL 4PGZA 3T0DA 4LEXH 3DGGA 2CLZA 4Z7UF 2WZHA 1FVCA 4NKMB 3PABB 3G6JE 1RZJL 3TCLB 2J1VA 2AEQL 1WWCA 3NPSC 1F6AB 3MLZH 4XP4H 5BS0B 1TETL 4JPVL 4HUNB 4BKLB 5A1AA 5HHQA 4K7PY 4LLDA 1GQLA 2GFBA 1BM3H 3HAEA 4HPGA 4X7SH 2A73A 5J1XA 4HS3B 1K3ZA 1UR8A 4CU7A 2W67A 1VEMA 5A8QA 3GH7A 4MDPA 2VI0A 4YK4B 2YRPA 5T3ZL 1HOCA 3OKEB 1AGFB 1IAIL 3VU2A 1UM4H 1W0WA 1SMAA 1YEGL 4PGDB 2X4PA 2QQLA 2CKSA 1KCUL 4RFOL 3S5LB 4DFHA 4DZ8B 5TE4H 3RX7A 2DDQL 4YHML 3ILPB 4OCXH 5KS9A 3VM5A 3BSZL 2PI6A 1F6FB 4HIXH 5EZIL 1MWAA 2ZKHH 4F66A 2PKDA 1VKXB 2WVSA 5JXJA 4QRRD 4GS7B 4DKFL 4RX4A 3KYNA 1LEGA 3WUWA 1K6QH 1WWBX 3DXAE 1T22B 4WTZG 1DN0B 3IYLW 4R9HA 5D2NC 1EDTA 1BGAA 4EI5A 1JPGA 2DCKA 4MGSA 3QQ3A 4NC2B 3ZKXC 5CEXA 2QQNA 2D9QB 1NM9A 2H9GB 5JHLH 1JN6A 4LSVL 1VFMA 3CFDA 4HXAL 1B0RB 4NQED 4ZXBC 3PZGA 2XI9A 2XWBA 4NKDA 3OKLA 5T1DH 4ZTOL 5HBFA 4EKJA 4OUEA 4QDSA 1HT6A 1L0QA 1AY1L 4YZFF 2CSPA 4G6FD 5FV1L 1KTKE 1CD8A 2VZRA 5BYWA 3LRGA 4OD1H 4IOIA 1W3HA 4PS4H 1BHGA 4PTMA 3UTPD 1I7UA 1J8HD 3MSGA 2VQ1B 3Q6GL 3S36H 1A7BA 4GXUN 3PUCA 3DJ9A 1P7KB 2NR6C 2HT2C 3RIFK 3FQWA 1KCSH 4Z76B 1LMKA 1TE1A 1CU4H 1QBMH 2NQCA 2D0FA 4X6FB 3V52L 1OM0A 3M8OL 1U8OA 4XUTA 2Y4SA 1J05B 2Y64A 3MBEB 2VISA 1RJCA 2A9ML 2X1OA 5D7LA 1L6XA 2GUOA 1JF1A 4LLQB 3IIIA 2P24B 2WWCA 2PWGA 5JA9A 3MA9H 3EFDL 1IAOA 4L8BB 3PWUA 1OD9A 2IUZA 4RSVA 4ZZ8A 1QACA 3AU1A 2YUZA 4W6WB 3VRIA 1S7SA 2X9YA 2R0KH 4YK4C 2WIIA 4X6DE 4XT1C 5D9OA 3PWJB 1W3KA 1JNLL 2VCCA 2EE2A 1A6WL 5EO1B 1HYSD 3AAZB 1FJ1A 3MUGA 4DTGL 3ZKND 4I3RL 3GSNH 5M3WA 3ZJ6A 5ENWB 1DZBA 1H5BB 4PYHA 2VERN 3BKCL 3A4XA 3UG4A 2HJKA 5DRNB 5I15H 1BEYH 3WBDA 4MJ2A 5D2NA 1G1YA 4QRTB 3NABH 4QRSA 3G04A 1OAXH 3QDMA 4RAUA 3V0WL 4GS7C 4MNGA 1JZ2A 3QQ9C 2HVKB 4FXGA 4G8GD 1TQCC 3T0EE 4GSDH 4U5IA 5E99H 3FO9A 3CXDL 3R1GL 2DQXA 4EE9A 4XCYB 1A64A 2CKBB 4QRUA 2PR4L 5SX4I 1E0VA 2F8QA 3UESA 3VIFA 1U8IA 4OUUB 4GKLA 1KUMA 2ZCHH 5FM5M 3SE8H 4HWEH 3D39B 3UYPA 3IAGC 4RMQA 3SE9H 3KJ4C 4IMLB 3BSGA 3GXIA 4DN4H 4XAKE 1K6AA 4OV5B 3ULUH 3E0GA 2P5EA 2IH3A 5LXGL 3D9AL 3HG1A 4G42B 4OT1H 5C8JA 1W91A 2ID5A 1UA3A 1BQLL 1CBGA 3MRNA 4R8WL 3ULSA 1ZVHA 2CIIA 1KWGA 2W9EH 4MJID 4H04A 3O9WB 3LKRB 4OZOA 2VR5A 1G9NC 4BZ1H 4L3EE 3LB6C 3CZJA 4NKMA 3HMWL 3PABA 2P4AB 3TCLA 3FCTB 4OKVB 4DW2H 3O2DH 1MY7A 1F6AA 3CAFA 4K7PH 5DO2D 3VXOB 5BS0A 4UNVA 3LEYL 4E8CA 2EO1A 1P7QD 3NCMA 2YSSA 4HIEB 1MFVA 2GITB 4MNQB 4HGKC 1BG9A 1DE4B 5IHSA 3BGAA 5HHXH 3SDXF 4HS3A 4MTVA 1MFBL 3O6FB 2AJXL 1GHSA 3OAZH 3MBEC 4K2UL 3HI5L 1J9YA 1JWMB 5EZOL 3VILA 4I0PD 3OKEA 1AGFA 1FPTL 1IGMH 1QNSA 3ZOAA 1NAML 4PGDA 1UZ4A 4RAHA 5I30H 4PMUA 1CDUA 3T4YB 3N13A 4JO3H 3TVMB 3S5LA 1F4YH 4DZ8A 5JQ6L 3S88H 3ILPA 2OSLB 4GKZB 4OSUH 4A6OA 1X5JA 3OF6D 4BUGA 1QPKA 5AC4A 5BZDA 2ZSWB 4NQCB 3WUZA 4PRPB 3X3GL 1VKXA 4EXPX 1E3XA 4C57C 3MANA 1NAEA 3U5UA 4M61B 1DR9A 4X7DC 4YXLL 1ZHLB 4U49A 2XHNA 1SM3L 4KKLC 3ET9F 1SY6H 1T22A 4OFVA 2CJUH 1LNUB 2Z91B 1DN0A 1RZIB 5GS2D 2E26A 3LAFA 2YWYA 5A2BA 1T5WB 3L4ZA 4KC3B 1E70M 1Q72H 2H9GA 3EOBB 5ABDE 1RJLB 5GRJH 2DBJA 1MXGA 4HPYH 1B0RA 2HT4C 5HTSA 1N0LA 1UM6L 5C0EB 3BC9A 1I9JH 2NTFB 3HRPA 2MTPA 4AISA 4KUCD 1IARB 3VXMD 3IXAB 2J8OA 1CF8L 3DYMA 3HE6B 5K9KB 4MA8H 1M01A 5GHWH 1UY1A 1M05B 1LO4H 2AGJH 5C07E 1SBBA 2VQ1A 1HX0A 2H45A 2G75B 3MODL 3QG7L 3DHPA 1P7KA 1IT9L 1FYTE 4GMTL 4EIZC 4Z76A 3O9WC 2ICWB 1C8XA 2P7TB 5KSAD 2NY7L 3N1AA 5EMYA 1I75A 4LLUB 1J05A 3MBEA 5C09E 1E5NA 2A6DB 5DD6B 4N68A 2B4CC 2XPKA 2JK5B 1YEIH 1K8DB 4LLQA 2P24A 4KI1A 1MCRA 2W94A 4L8BA 3UTSE 1MCIA 4PG9B 1YPZE 5TJWK 4K8RH 4Z95H 2H2PD 3AHXA 4P8VA 3QUML 2R4SL 1BREA 4R7DB 3V4UL 3V5DB 3QUZD 2A77H 3U9UB 3PWJA 4X0VA 1MCLA 2WMHA 2Y6LA 1PG7W 1T66D 1KJ2L 2J5LB 2PTVA 5EO1A 3AAZA 5HHOE 4HMCA 2BVOB 3E3QC 3RAJL 4FQIL 3U7BA 3TVMC 4OQTH 4DK6A 4Q9RH 1QBLL 4PJEF 1DANT 1ZLVH 1YDPB 2IALB 4FHBD 5ENWA 1GPOH 2XN9E 3WN5C 2ZUVA 1H5BA 3MRPB 2CNCA 2WC3A 2AMGA 5DRNA 1XHGA 2VLKB 1GIGL 3ZKQD 4AK1A 1A14L 4PJDF 1O8SA 2VSDA 2EXOA 3PV6B 4QRTA 1XT5A 4MAYD 3TJEH 5MENE 2BVYA 1LL6A 2HVKA 5A95A 3IJ9A 5ADPL 2VXUL 1YEKL 1DLFL 2VXQL 3RWFB 1UYWL 1AO7B 4XCYA 3LPFA 5L6YH 3U0WH 1BFVH 2DCJA 4UT7L 3X17A 5I1JH 4H26B 4OUUA 3OX8B 4XC1L 1XD1A 4PRAB 1V6UA 3D39A 3BXNA 3UEQA 4IMLA 3U4BH 4JFDB 2O5ZH 4OV5A 1BPLB 5IHUL 3OQ3B 2VL5B 4G42A 2VZVA 5TQ2L 2YPLE 1IKFL 4G8FB 4RGMB 3AHZA 3ZT6A 4HT1L 3KG5A 3P6BA 4D1IA 1QRKA 4RCAA 1URLA 1ZWIA 4MZ3A 5DRZB 3O9WA 3LKRA 3HE6C 1BYBA 3BH4A 4W6YB 4KZDH 4HDIB 3EYPA 4LX4A 5I24A 5EC1A 3RTQB 3ZTJH 1H0GA 5KTEH 1P53A 1D9KD 1UWXH 2UWEE 3FCTA 4OKVA 2FJGB 3GRWH 3VXOA 3CSYB 2XIBA 1IKNC 4P8WA 4HIEA 2GITA 4MNQA 4OFDA 4U6VL 1DE4A 3H9SE 3QDJD 4PRWA 3Q0HA 4Z7QF 3HNVH 1RJZB 1EBPA 3PQYB 3O6FA 3GBML 4ODWB 5ITBL 5JIPA 2J78A 4ZDHB 3MCLL 1X7QB 1JWMA 3T0BA 3SGKC 1N8ZA 3MV7E 3MACL 2NW3B 3F7VB 1JPTL 3VXPA 3W81A 1W9PA 2P8MB 5LCVH 1JDDA 4YQXL 3C08L 2V6HA 3I84A 4R4FL 5TGBB 3DVGB 3T4YA 3TVMA 4Y1AA 2IPTH 3VPLA 1DBML 3F5LA 4G7VL 2P5WE 1Q0YH 4OUOA 2OSLA 2N7AA 4GKZA 3HZVB 1UQYA 3DPBA 4RE3A 2ZSWA 1N26A 4NQCA 4TVPH 1SHWB 4PRPA 4BFBD 1MNUH 5DA0B 4JO1L 4M61A 1XH2A 4Q58C 4MXVE 1PZUB 2OXHA 1ZHLA 3CKHA 5FUOH 3CZ8A 5IUSA 5C2BH 2I24N 5HI4D 2Z91A 1LNUA 4GIAA 1RZIA 2HFFA 2ZEXA 5J3HC 1EV2E 5HYSG 4G6AD 4S1RL 2W4XA 4QDMA 3IDXH 4L8CB 1TZGL 3NSMA 4XPGH 1T5WA 4H20H 5FYKE 4D6CA 1Z3GL 4NZRH 4OZGE 5DJ2B 1P4BL 1RJLA 2R56L 3ECBB 4D8MA 3QRFM 5C0EA 1U8MB 1NH6A 4OZHF 1XF5B 3V4VH 2NTFA 2XSBA 2Z1KA 3H3PL 4YFEA 1CFSB 4IRSB 5FDWB 1CCZA 1UWIA 3IXAA 3RWJB 1CK0H 4PP2B 4A6YL 3SKJE 4LSUH 3HE6A 5K9KA 5D2LF 3TJHD 4Q9QH 3SDCD 1C90A 1F13A 5JTWA 2KD7A 2WC4A 4WFGE 3AB0B 3VXSD 4AXNA 2BRRL 4D2NA 2G75A 1JWSB 2YHGA 4ZD3H 1UYZA 3HE7D 3N50A 2MANA 1T80A 3SDAC 2ICWA 2VO5A 1E6SM 4AZCB 4KJWD 4GXVL 2P7TA 1MRFL 2JJTC 3HNSH 2R1WB 1NLBH 4LLUA 2Q3ZA 4P23B 3RTQC 4R2GD 4DWSB 1KEMH 4U1IB 3GKZA 1G6RL 2A6DA 3SGKA 5DD6A 1LWHA 1DFBH 2JK5A 1K8DA 3WD5H 3T77B 4EDWL 4JFED 4PG9A 2JF7A 3RZCB 1JHTB 2DMBA 2VTFA 1CDGA 3AREB 4R7DA 4AZGA 2DLFL 1MF2H 3MRCB 3V5DA 3H42H 3GK8H 3U9UA 1C08B 3S36X 3WF2A 1KXQE 1KR1A 2YL5A 3O2VH 4LPVA 2VABB 4JKPH 2BVOA 3VFGL 4FRWA 25C8H 1A6UH 4JM4L 1HF6A 2APXA 5A6SA 3EJZC 5E0FA 1V7NH 4AZBA 3H9ZA 4Q9CA 1R64A 2NXYD 2IALA 4QTHB 5HYJB 5E2WH 5K93A 1NAMB 2GJ6D 3MRPA 5CQ1A 4PMNA 2D0GA 2OJZH 2VLKA 3OR6B 4DWHA 4KTDH 5IT2H 2ESVD 5IOPB 1LD9B 3PV6A 2YA2A 2DJUA 1G7MB 1QFWL 2OCFD 4ELMB 1YNLH 3RWFA 3PWVB 4JRWA 1AO7A 2Y6SD 3FQNB 1INDL 3TV3L 1C5CH 1T5XB 4M43H 4H26A 1R8LA 5IJVB 3OX8A 4BA8A 1A3RH 3N1QC 1GQKA 4PRAA 1SYVB 3RWGA 5F96L 3O6KH 1S7QA 1BLNB 1NKRA 4JFDA 2F19H 3MLVL 5GRUL 2VL5A 1DL7L 1H0DB 2GY7B 5EFDA 5C6TL 2XA3A 4G8FA 3BPNC 1GSMA 4IRSC 1T7YA 5DRZA 3GNML 4DGVH 3SDAA 2ZCLL 5FCZA 1O7VA 2QR0B 1QNZH 4P59H 4HDIA 4HQQL 1CZSA 3F7YB 4GKOA 3RTQA 3ARGD 3G9AB 3VX1A 2NY0B 3VRJB 1E40A 4ATLA 4O58L 3AB0C 4BELD 2AOSA 3ECQA 2FJGA 2FX9L 4UB0H 3CSYA 2IAMB 5TF1L 4UOQA 4J7RA 4PJCE 4YR6B 2E32A 1BFSA 4JHBA 4R4ND 1RJZA 2Y06L 1CXHA 1INQB 4P23C 1XPWA 3PQYA 5TPWH 4R90L 4DWSC 2G60H 4ZDHA 1X7QA 4JKWA 3ARFB 3TTSA 4WUUD 3DMMB 3F7VA 2NW3A 1EK3A 1A7OH 3NIFE 2P8MA 3POHA 5GSVB 2Y25A 1MQKH 2YBUA 4P4KB 5KJRL 2YPKA 5TGBA 3DVGA 2JELH 1YMME 2FL5B 5I76B 1FP9A 3S2CA 3RZCC 5EU5B 4PJ5E 2VR9A 3QWRD 4AD3A 2EYSB 3HZVA 5EJ1B 2WSPA 5IFHL 1S7WB 4PUDA 4HKBB 4K7PX 1ROWA 3OAUL 4AJ0A 2CLRB 2J1TA 5I1HH 3QUMB 4LOUC 1NSNL 3MRKB 1NQBA 4W88A 1ITBB 1XR9B 4MS8C 1GOFA 1BMGA 3U4EB 2V3GA 4MHHG 4WY7H 1KJ2B 1UOKA 2HLAB 4V2XA 3V4PL 1OT2A 2VZUA 1V3MA 2LFGA 3VFTB 5C0RH 4L8CA 3K8KA 4PREB 3CZLA 4RBPK 4LIQE 3GXDA 4AEFA 2WLZA 4JCLA 5DJ2A 3F12B 5GPRA 5CUSH 5ESVB 4L4PA 5CZXC 3ECBA 2DQJL 4LGPB 4HZ8A 3PZMA 1U8MA 1VA9A 1XF5A 2J1EA 1DDHB 5DVKA 4IEFB 1CFSA 4IRSA 2WO2A 5IIEB 1WJ3A 3RWJA 4XX6A 2QQKL 2IBGA 2V5MA 4W70A 2F74B 5SV3A 3PHOA 3ALFA 3QCTL 2WN2A 5HPCA 2E7BA 4OZIB 2AW2A 3TH3T 1BOYA 4GRWF 1UYQA 1K9DA 4UNUA 2W07A 1JWSA 4L8SC 1UEYA 4PTUB 4WGVB 4UZUA 4AZCA 2V9RA 4KV5E 3DUSA 4OM0H 2X44D 4TTDD 5EBAA 2R1WA 1IBGL 1P84J 4MDJB 4P23A 2Z8VC 2NY0C 3PWNB 4XPBH 2CITA 3H7LA 3SN6N 4S0SD 4DWSA 1WTLA 2BC4B 4U1IA 4JDZB 2QADD 4YJZL 3NFSL 4GRWH 1OF2B 4QRRB 4UDTB 2ARJB 4XP6H 3SGEI 3T77A 4Z77B 1Z32X 4PTXA 5BOPA 1XYZA 2X0HA 4JR9H 4M62H 4P5YA 4D3CH 2J22A 1SG3A 4YGVB 3RZCA 3P11H 1UA7A 2FSEB 1MJ8L 4PJXB 1JHTA 1YQVH 2YRLA 3V6FB 4UZSA 3MRCA 2HYMA 4XHJD 5HHME 1C08A 5T1KB 4DGIL 1JVKA 3ELAT 1OP3K 2A9NH 2ZX6A 3ZO0A 1QKZL 1LO2L 1AP2A 4KI5D 5EOTB 5A16B 3ACIA 1JV5B 2O61B 2GFTA 2BFVH 5DZOA 3TWCH 4PCTA 1JHKH 4NGHL 3C8KB 3LKQB 4QTHA 3ZDXE 1LEKB 2BXYA 4PV9B 1NAMA 2QSCL 4G6FB 1PLGH 3TO2B 1CGXA 2EDKA 1MCWW 2X4QA 5A2KH 3OR6A 4JPKL 4DKEL 5D1XD 2XVKA 4BA0A 5IOPA 1LD9A 2FLBT 4M6NH 3Q5TA 1GJIA 3NCEB 1G7MA 2YK1L 1ZLUK 1V08A 1J8HB 5H35B 5JW4M 2LU7A 2HVJB 2EIZB 4AIXA 4N9GB 3D85D 4E41D 3MLWH 3OB0K 4NDMB 2K7QA 2HH0H 5AYUL 2V2TB 3BT2L 1FBIH 3PWVA 2GYSA 3FQNA 4DFIA 1XF2B 1DCLA 3VD7A 1ZHNA 1T5XA 1F90L 4Q2ZB 3NSXA 1LGVA 5CP3H 3CPLB 1WF5A 5IJVA 2KZ1B 1SYVA 1WZAA 1E28B 1BLNA 3QFJE 1H0DA 1W0NA 1HL8A 4JAWA 3W53A 4FP8L 1V02A 4HV8B 4YWGH 5CCKH 4K3EL 1KEGL 4KROC 4JRYD 3B5TA 3I75B 5KVFL 1FFNB 2QR0A 1S7XB 1WWWX 2NY1D 2YR3A 1P9MC 2OL3H 3VRJA 3WELA 2CDOA 4U1LA 5DUML 4A6YB 3WEOA 2BY3A 1Q6EA 4TNVF 4APQD 3DX8B 1IC7L 4YR6A 2Q3AA 1J5OH 2EDHA 2QMJA 5F3BA 1HNFA 1US3A 2XSAA 1INQA 1MCOL 1OP5K 2I5YH 1RAMA 5F1IB 4RFNC 5E8NB 4FNLH 5B4MC 2Z93B 3WNLA 1BGXL 2IQ9L 3ARFA 4LLYA 5HD8C 2XM1A 1JZ5A 1FNEB 1MJ7L 5GSVA 4OYUA 2XHYA 4P4KA 4G8GB 1MFAH 2FL5A 1MCSA 5I76A 2JJUA 2UZIH 1GHRA 1G6RB 2E9MA 2UY3A 5EU5A 1DQJB 1Q94B 3OMZA 3UG5A 2W65B 1KPUB 3HA0A 1CBVH 2EYSA 1XCXA 3P9MB 1AD0B 4BQ9A 1JZ3A 4NJAL 3IJHB 1ZOXA 5B38G 4D1JA 1S7WA 4JAMB 1WBZB 4HKBA 1XAUA 2CLRA 3B8SA 5I1AB 3QUMA 5ADOH 3MRKA 4LARH 5E8EB 4W89A 1CLOL 4WUKL 3UTTD 2D20A 1XR9A 3KYMB 3IRZA 4X4ZA 3W2DH 3U4EA 5L88H 1QVOB 1KJ2A 2P45B 5CJ8A 4MJIB 2HLAA 4LIQH 3V6BR 4ACZB 4W5ZA 3VFTA 5SX4H 4AWEA 4I3GA 1U92B 2QSVA 4RMSA 4PREA 3W9EB 4J3SA 1X4XA 4JY6B 1EPFA 3F12A 4NQXB 2J62A 3ARSA 5ESVA 4ODHH 1JPSH 3MRDB 1NMBH 1P7QB 3IJSB 3MUIA 3GDBA 4AH2B 4S1QL 4YHKL 5IIEA 3IFLH 3L3OB 3L3GB 1NCBH 2F74A 4KXZH 1JTTA 5J1TC 4O00A 4JHWH 3GFUA 4OZIA 5GNZA 1T7VA 5F9AC 2WYSA 1P9MA 1UKQA 4I0PB 4PLKD 3T2NL 4NJ9H 2W87A 3WSQL 5TH2B 3FL7A 2KH2B 4PTUA 4Q22A 4YDKL 4JM2C 4MAUL 2YL9A 3UTQB 3WEZA 1TIUA 3QIBD 3IU3B 4H8UA 1KN4L 3BH8B 5CKGA 1O6IA 4MDJA 3MLUH 4WVRA 2ZUXA 4LSPL 2DT1A 1JXKA 3TYFB 2BC4A 4JDZA 4F57H 3BKJH 1HYSC 4JQVC 3QXVA 1BBDH 1A6VH 1OF2A 4UDTA 3UAJD 2ARJA 3ZKNC 4QRRA 4Z77A 2F8XC 3MXWH 3D3AA 2NY5L 3IJ7A 1CD9B 2Q86B 3VMOA 4Z7NF 3MV8E 4YGVA 4ZUUB 5FL0A 2IADB 4PJXA 3DROB 1GJUA 4LVOB 1ACYH 3SOBH 5DUBB 5DJDB 3V6FA 4KZEH 5T1KA 1XF1A 1UYYA 4AL8L 1WBXA 1DBBH 2JB6B 5EOTA 4PTTB 5A16A 1JV5A 2O61A 1LG2A 4KRNA 5DZLA 3WXWH 3C8KA 5JPMB 3LKQA 1LEKA 5EB8A 2W1NA 4HXBH 4PV9A 1BQSA 4GO8A 4YPJA 1ZT7B 3SO3B 3TO2A 2HWZH 2Y7QB 4GZIA 3IDAA 3E6HB 1HSAB 5E7BA 1JFHA 4UTAL 1J8HA 5H35A 1FN4B 4BZ2H 3D3VD 2XTLA 3ZSSA 2HVJA 2EIZA 3DLQR 4N9GA 1BZ7B 4OV6F 4NDMA 5IQ7L 3FQRB 2V2TA 5C0FB 4YAQB 3WH7A 4WJXA 1AQKH 4U7MA 2COQA 1TVNA 4MDOA 4Q2ZA 4LASH 2G3IA 2FECL 5FHBH 1ZMYA 2BK8A 1KIQB 2UY4A 3SE4C 5JW5B 1IL1B 1E28A 3C6LD 1H0IA 1WT5C 3UJJH 3QUYB 3RI5K 4CN6A 4R26H 1IC4H 1HDMB 2E7HA 4RQQB 5T3XL 4HV8A 3STBA 4BFEA 3S35H 1N0XH 3RDKA 1YN6B 1Z9LA 3I75A 3RRQA 4AY1A 2YXMA 2DGAA 3RQ3A 4HU8A 1EFQA 4NRXB 1H6YA 2DQEL 1Q6FA 1S7XA 1DTUA 5AZ2L 1L4IA 3ZIZA 4YXHH 3IETB 1MRCL 4GQ9H 4RFEB 4UV4L 2IFFH 2XYLA 4A6YA 1E4XL 2F54E 4JQVA 1GC1H 4IM4A 3DX8A 1GZQB 3ULUD 3TGXA 2W1WA 1KB9J 4P9MH 1CLCA 4IRZH 4G7YL 3SCUA 1TVGA 5F1IA 1NC4D 1F58L 5FD0A 3FFCE 5E8NA 2IANE 3IDGB 1UGNA 2Z93A 5CYYA 1JG9A 1UQSB 3NIDF 5GGSY 4MAYB 1A21A 4M7LH 3SCQA 1DWIM 4W84A 3NMEA 1FNEA 3RCNA 1VCAA 3O81A 3SQOH 1NCNA 1UWGL 4G8GA 3U7WH 2O92A 4Z7WE 4FMVA 4B41A 1G6RA 1DQJA 1A7QH 1Q94A 4LVOC 3TBSB 2W65A 1KPUA 1Q9LB 3GO1H 3P9MA 1AD0A 3FRUB 3WIIH 3AIWA 3IJHA 4JAMA 2W0PA 1WBZA 4U6XB 3AIEA 2R2HB 4TSBH 5I1AA 5E09A 4WTWA 5E8EA 1RYYA 2HKHH 3TBTB 2XFXB 2XOMA 3QHZH 4EANA 1QVOA 5CILH 3SO3C 2V17H 2AJVH 4ACZA 1FL6B 1F8TH 1U92A 1WIUA 4PRIE 1C92A 5FIPA 3W9EA 4QXUL 1CZ1A 5F9DC 4I77H 3SE4A 4JY6A 2VDOL 4WHYH 3G6MA 3VXUB 1D9KB 3G5VB 3RX8A 1VBRA 4NKQB 3MRDA 1P7QA 3IJSA 1WT5A 3QDJB 3PWLB 1UXZA 4AH2A 1PKQB 3BMVA 2J8HA 3SCSA 3L3OA 3L3GA 4AENB 1U30A 1XIWD 4ONGH 5HBBA 4FQ2H 1A5FH 1DQLL 4FTVE 4M6MH 1QSVA 2DKMA 4I0PA 1I5PA 4M1RA 1MUJB 5SWSD 3QUYC 5TH2A 5T5NG 3RX5A 5JORB 3ESUF 4P99A 1NKOA 3VIJA 2OK0H 4WFFE 3UTQA 4WKAA 3A6BH 4X4YB 1GCFA 3IU3A 5EIIB 3OF6A 3BH8A 1D2KA 2ZUNA 4TULL 3QDAA 1YYML 1LQSR 3T4AB 1T66C 2DWDB 3TYFA 3NFPB 1MCNA 3UMTA 5CIPB 4Z2KA 2AJSH 4MCZB 2VH5L 1GH7A 4WI3A 4D9QD 1KCVH 4ZS6C 3WFEL 4GJTB 3WFDH 1Z6JT 3CSBA 1NWRA 4UMGA 3BYTA 5F1KC 1RHHB 1WBYB 2CIKB 1HCFX 3F6LA 5AUMB 2J8UE 1E27B 3B9KC 3IAPA 4ZUUA 5BV7L 1JGEB 2IADA 3DROA 3BAJA 5DUBA 5DJDA 3OKOB 5C6WH 3DHUA 4MAYC 5J6HB 1FE8L 3FN3A 2JB6A 2NLJB 5DJ6B 2YPVH 5I18H 5GGTL 5DHYB 4PTTA 3ARUA 3P9LB 3SDXE 1A02N 4RGOL 2NY6D 4UFJA 3V7AG 5JPMA 3C2AH 3IDMB 3POCA 3LH2L 3O0RH 1E56A 3DYPA 4NZTL 1ZT7A 2LAAA 4EEEA 1QNPA 2Y7QA 3EO9H 2XY1A 3QQNA 5DJYB 4PJFB 1ZJBA 3E6HA 4JG0L 4GAGL 5CINL 1B0WA 1HSAA 2DN7A 3SDCB 4QX2A 1DWHM 3VG9B 1FN4A 1GXEA 1OSPH 1RUPL 4LKCA 3VXSB 2VCAA 4KHTL 1EJOH 5E95B 1BZ7A 4XC3H 3RDTD 2J1KA 4JCMA 3FQRA 1MAKA 2PYED 1ISWA 3D25B 3HE7B 5C0FA 4YAQA 4LEXL 1J9CT 2FB4L 2HVMA 4FZ8H 1KIQA 4XP4L 3MLZL 4R2GB 4Z7VF 5JW5A 5SX5K 1D9KC 2RCSH 2HKFH 5D7IB 1JFQH 1IL1A 5F7UA 1SVCP 4LGXA 2FD6H 3AISA 3A4AA 3PZOA 4WW2B 4JFEB 4X7SL 2QEJA 3QUYA 1WO2A 4FFVD 4YHZH 4RQQA 1HDMA 4LAQL 4F7EB 5BMFH 1RIUL 3BQUD 2YMXH 1YN6A 1ZXQA 5T5FH 4N0UE 3P0VH 4NRXA 1CL7H 2BVPB 3LY6A 1UM4L 1CE6B 4TX6A 3CMOH 4M03A 3P2TA 3IETA 4RFEA 3DETC 3WQ8A 1I3VA 1JUFB 2DBLL 3L3JB 2QQKA 1HKIA 5GZOC 1KOAA 3AQUA 4D6FA 1CS6A 5TE4L 1GZQA 1RZ7L 2D24A 3QPQD 5J7CC 4HIXL 2NXYB 5KAQF 5D4QA 2ZXDA 2FDMA 2K1MA 2GJ6B 5KANG 3WF4A 1NCUA 1U2HA 1IGIH 1OHQA 4YBHA 3LDBB 2NZIA 3CFCL 2ESVB 3IDGA 1UHVA 4JO4L 4A3YA 1UQSA 3LMJH 4MAYA 1HKLH 1K6QL 1RUML 2VDLH 1HJWA 1GGTA 4AY0A 3RL1A 4KRMB 2Z35B 4M56A 2FH8A 2VAJA 3JV0A 4YUEH 5HI4C 1IZJA 4DK3A 2FCBA 1Q9LA 1TZ7A 2J7FA 3HMCA 1OAKH 3FRUA 5DZNA 4MQXD 1U9KA 2ED7A 3O41B 4NBZB 5JHLL 1CGUA 2LTQB 4HU0A 4B15A 1T89C 2R2HA 4HEME 1LP9E 3RU8H 3AZSA 4OF3A 4ZSOB 4O51B 3TBTA 2XFXA 3GM0A 3ZR6A 1QYGH 1HH6B 2HFGL 1OTUC 5F9WB 4LLMB 4MAVA 1MRDL 3KWXA 1GGCH 4PS4L 1QOKA 1T1ZB 5IB2B 2D7TL 1FL6A 1NBVH 3SDCC 4PJHB 2KZWA 1CD1B 4I4WA 2X70B 3S36L 2WLYA 4TVPD 1G0YR 3VXUA 2WW5A 1D9KA 3G5VA 3MUZ1 1T1XB 1KCSL 2JCCF 5IFJB 5B4NA 3GYCA 3HE7C 3U9PH 2OTPA 4GG8B 3QDJA 1IC1A 1QO3B 3PWLA 1AC6A 4KJWC 3DX6B 1PKQA 1CDYA 1GL4B 4OJYA 1F45A 1BD2E 1PYWB 4F37K 4WDIA 2A2QT 3WKNA 5DHVH 2ESCA 5GRYA 3DO7B 3C7GA 2ZUWA 3IVKB 3MA9L 4WUUB 3F58H 1JGUH 2VITB 4H25A 1MUJA 3RNKB 3TO4C 3M17B 5JORA 5LYRA 2ORXA 3GB7A 1YEJH 2F61A 5J89A 4AEEA 2JF1A 1EDQA 2BNQD 3X14B 4X4YA 3W0WE 5EIIA 3MV11 5FHAL 2ZIDA 5J13C 4X7TB 5C0GB 3QRGH 5C3TA 3T4AA 1QI5A 2DWDA 3EOTH 3FB7B 3NFPA 5CIPA 4U6YB 2DI7A 4LCCB 3L3IB 1R7AA 2OYLA 2R8SH 1G7HB 4HFUH 3ULVF 1OB0A 2EH8H 5GSRB 2NXYC 1D3CA 1N5YH 4MLIA 1RHHA 1WBYA 2CIKA 2NX5B 5D96B 3OZOA 5AUMA 1ULOA 1BEYL 1E27A 2G3NA 1JGEA 4P9HH 3BW9B 3GI8L 4HJJH 4NO0D 3LDBC 3NABL 1OAXL 3OKOA 5CJ5A 2JDAA 5J6HA 2VZSA 3X12B 3HLAB 5EUKB 1T89A 2DD8H 3MZGB 2NLJA 5DJ6A 4Z7OF 1TJGH 5EUOF 5DHYA 3P9LA 3IKKA 1BAGA 4EZMA 1UY4A 2MOVA 1E6OH 2YEZB 2Y6SC 3ULVH 2J7DA 4LCYB 3WIHA 4NN5B 3IDMA 2JALA 2DL2A 4LSSL 4UOW0 1CGSL 4HWEL 3SE8L 2YKLH 2LTQC 4P3CH 2PBOA 4DN4L 5DJYA 2XWJB 4PJFA 4YDVB 3RJQB 1NARA 1GUVA 3QCUH 1WAWA 3OGVA 3SY0B 4CVUA 1BQHB 4OT1L 2E31A 3SDCA 1NPUA 2WINB 2W9EL 5LGKA 3VXSA 1N6QH 2DSWA 2H3NB 2XTJD 2NT1A 3LZFH 4FQ1H 5F9WC 3RVXD 2XN9D 4OKDA 3D25A 2CR3A 2ZOLB 3HE7A 3NH7H 3HUJB 5IKCB 4TQEH 1E4MM 1CX1A 3KNBB 1BYAA 3WH8A 1WFUA 4DW2L 1LDPH 3DC0A 3O2DL 4NRYB 4K7PL 4MADA 5D7IA 2LU3A 6FABL 4R0LB 3CFIC 2QADB 4NM8H 2JIWA 4H41A 1EO7A 1G9HA 4XP9L 3O6AA 4WW2A 4JFEA 1SJHB 1DUZB 3MNVB 3VFOB 2F5AH 4R4NC 5HGGS 2BGOA 1NAKL 4F7EA 1X5FA 4MNHB 5DXWA 5GGQL 2B0SH 3KPSE 4HUVB 3MJ9A 1T1YB 2BVPA 5C6PB 1CE6A 2R4RL 4TOYH 1V6XA 4AMCA 4RYDA 1R86A 4OZFB 3L3JA 1JUFA 3DURB 2YPLD 2X05A 3U0TB 5BVPH 2HFEB 1OVZA 3S88L 2A1WL 3DV4B 1H3PL 3GMLB 1M03A 3SGEH 4POZC 4JJHA 4OSUL 2NYYD 3QGVA 1S9WA 1I85A 1B30A 2GT9B 1QPPA 2BDNH 5DD3H 2C3XA 3T1FB 3LPPA 3O11B 2GJ6A 4K3JL 4S0TD 1KXVC 5I1LB 1VPOH 1VBUA 2ICES 3TONA 2E9WA 2ADFH 2BMKB 4BQ4A 3HC3H 1VADB 4BK4A 4M02A 4PJ5A 1AVAA 4LCCC 5I9QB 3CLFH 1FNSL 2V7HB 2JKXA 2Z35A 3D85B 3VNZA 4E41B 1W9BM 5FKAB 5D96C 5FYJE 3OLIA 2QLYA 1MHPH 4RISH 3T08A 2OKXA 3SGDH 1N2RB 4UDUB 4LHJB 2CD0A 5A3HA 1Q72L 3MXVH 2VDRH 3TH2T 3O41A 1CLXA 5JOPD 4ETYA 2PO6D 2XXMB 4L9LC 3MQIA 4ZSOA 4TSAH 1IT0A 4K9EC 3C6SB 4O51A 1GGYA 3AHTA 4JN1H 3O4OB 4Y5YB 4NKOB 1HH6A 4NN5C 2E8ZA 2P5WD 1ADQL 3CNKA 3NIGF 5DRXB 3ZTNH 4U5KA 3AICA 4LLMA 4G9DB 4PBWD 5I1GL 3IU4L 3RVWD 4L4JA 4JRYB 5HDQL 2XFRA 4E5XB 1T1ZA 5GHWL 5JDJA 2E3VA 4GQPH 2NY1B 1CD1A 4MA7L 2X70A 1VJZA 2DJSA 3GBLA 4UQ9A 4LK4A 5LBSH 2AXFB 2HTKD 3IDJA 4B7LA 3P40A 4PTWA 1T1XA 2VIRB 3TYGH 1KCRH 4APQB 5JW3L 2Y2WA 5IFJA 3JSSA 3KL0A 4GG8A 4A41A 1QO3A 4WIWA 3DX6A 3MSPA 4TTDC 3THCA 1JGDB 4AD1A 3VI3F 1MSPA 5TQ0H 5JR2A 3B8YA 4B50A 3TTOA 1YEIL 4E42B 4R0LC 4ACPA 3DO7A 4N0YL 2QADC 2FEDD 2WZEA 3BH9B 4WUUA 1JPST 2WO1A 4XV0A 4HC1H 4WU7B 4BQ5A 1MCJA 4YFLF 3RNKA 3M17A 3D2UD 1BAFH 3RIAF 1CVSC 2X4RA 3NBNA 4JVWA 4Z0BH 3AMKA 2QMKA 3QWRA 2A77L 4W8LA 3SJVD 1YECH 3X14A 1JRHH 1QI2A 3BAWA 1DLHB 1B6DA 1XCTB 3JVGC 4XHJC 4KKBD 1H2JA 4PLOB 4X7TA 1KXVA 5DJ0B 1B4JL 5HY9B 4KI5C 1O7AA 4Z7UB 4U6YA 4W81A 3KJ6H 4LCCA 1RIHH 3L3IA 4XAWH 3UTTB 4OIAA 1G7HA 1GPOL 2FRGP 1MI5E 1A1OB 5IBUB 5GSRA 2O5YH 3MMEB 2NX5A 3WLWC 2MQCA 5IROA 3BLPX 3EGSB 5I71C 3BW9A 5K9OB 3IJ8A 2DQIH 3VXQB 3TJEL 3P0GB 3AXHA 2WVVA 3WEMA 1JF5A 1LEIB 1CR9L 5F8QC 4ZO9A 3X12A 2P8PB 5I9QC 3HLAA 5EUKA 3JXSA 4CW1B 5DA4A 3WQ4A 4G80B 1UM5H 4JRXD 5E9DD 1LDSA 2CBUA 2BVTA 3QOMA 5L6YL 1CENA 2J2ZA 2YEZA 4Y89A 1H9VA 4LCYA 1DBJL 5ERWB 3VUPA 2SEBB 4HCRL 5FYLE 3BKYL 3U4BL 1ODAA 5CWSB 4YXKH 2D7QA 2O5ZL 2XWJA 3BOVA 4YDVA 3W82A 4NKIL 2VQTA 3SY0A 3KDMB 1BQHA 1H15B 5DC9B 4Y4HD 5TD4A 3QEUB 1J1OH 4EUPG 1UQZA 3PP3K 3O4OC 2WINA 2BNJA 1F3RB 3VFPB 2H3NA 1AXTH 2WQ8A 4FLSA 1ZT4B 2EC9U 4HH9B 4B9ZA 2Q8AH 5HGAB 2ZOLA 1CDIA 2AXHA 2VOTA 1PMJX 2YKKA 2QPSA 3HUJA 1C3FA 5IKCA 2H8PB 3KNBA 3QIBB 1UD8A 4JFHE 1SJEB 3UYOD 4NSKB 1CD0A 4X80H 3D5HA 4NRYA 1ZAGA 4R0LA 2WAOA 3KYOB 4QKXB 3SCWA 2MCG1 3HNVL 1SJHA 1DUZA 2Z1SA 1N64L 3VFOA 3UP1A 1J83A 4OJFH 4JFFE 3MNZB 3PXJA 4MNHA 3THMH 3EYVA 5B39B 2UWFA 5F1OB 2VXVH 4HUVA 5D9PA 3V9FA 5KSBF 1T1YA 5JXHA 1AQMA 1CFTB 3QH3B 4PY7B 1XH1A 3K2UH 1KFAH 3GKWH 1EUTA 2BNRE 4OZFA 4QX0A 3WD2A 4TNWF 3U0TA 1KSRA 2HFEA 5B8CB 4E8DA 3DV4A 3GMLA 3FRPA 4UQEA 1BLIA 4UQCA 1PX8A 4ERSH 5BW7C 4FFYH 4TVPL 5EU6B 3T1FA 4QGYA 2OMNA 3MRIB 4O2FB 3BPCB 3DIFB 2YRZA 1B0GB 2BMKA 1OGAE 1VADA 1K4CB 1QW8A 1EEYB 3K7UA 5FUOL 5E6ID 1RK0B 1HINH 1MFDH 2E33A 5C2BL 4UT6L 2V7HA 5HGDA 3D85A 4E41A 4C58B 5FKAA 5HYFA 5C0BD 1W9UA 1IGCH 4GAYB 3WNNA 3W25A 1W8NA 1KGWA 4H20L 1ZVYA 1N2RA 4UDUA 4MQTB 3L95B 2AV7B 4P7NA 3JV4B 3IS0X 1TNNA 1LJYA 4PMOA 4M7LT 5K59E 2XZQH 4NM4L 3I6LE 3C6LB 4RRPG 5HVGB 2QBWA 1PGRB 3C6SA 3RGVC 3GI9L 4DM2A 4NKOA 4S2SB 1SHMA 1IEBB 1E43A 4KMTL 4G9DA 4LSUL 4Y4FD 2AABH 4OCYH 2ARWA 5GGTA 2EDLA 4JRYA 4E5XA 2V4VA 2Q8BH 4HAGA 2XICA 2VVSA 4LMQI 4AYSA 1JMXA 4GFTB 5GZNC 2DWEB 4PBVC 2DMKA 4YLQT 2AXFA 2VCBA 2VIRA 4PGJA 4APQA 3W0KA 3VFNB 1MCCA 3UPRB 3L2MA 4DEQA 2UUDK 2J25A 3S3JA 3WQWA 1NLBL 2Z8RA 1JGDA 1WZLA 3OG2A 4GMSH 5JW4N 1NC4B 1B88A 4NP4H 2YUVA 2J75A 1DFBL 5IW1B 4E42A 3WD5L 1T4KB 4Z78B 4N0FA 3BH9A 4WI8A 4WU7A 4HPOL 3QCVH 4UQ2B 4KU1A 5GGRY 4IISA 3G6DH 2WHLA 1MIML 3NPZB 2GJRA 1L0XA 3GK8L 5BW7A 4N8CL 3ETPA 1VF8A 3GHEH 3NGBB 3N1FC 4QO1A 3WH5A 1XCTA 3DI3B 1RHFA 5T33H 5HY9A 4P2QD 4JKPL 25C8L 1A6UL 2IFGA 3MV8A 4S1SL 4Z7UA 1QI4A 1BYCA 1V7NL 4K55A 3UTTA 5ISZD 5E2WL 5C0ND 4Y7EA 1A1OA 4I9WE 3KGRA 4U33A 5CPTA 3WF0A 5BXFB 3MMEA 4ODUB 5D5ME 2OJZL 4KTDL 3EGSA 4MO3M 4O5LH 3HHRB 1A7NH 1L6ZA 5K9OA 3VXQA 1OPGH 2ZXBA 1LWRA 1P4LB 1LEIA 5CGYC 1TJIL 2P8PA 1FHDA 1QFOA 4G80A 4OMCA 4U1JB 3V6ZB 4YH6A 5AEAA 3SUVA 3HFMH 4UBDD 4M43L 1S7VB 1G0DA 1K85A 5DT1H 5ERWA 1EX0A 3I97A 3PHSA 2SEBA 1A3RL 3CHDA 1I3UA 1RK1B 4PJIF 2OXGA 5CWSA 4EOWH 2PBGA 1XIWB 2F19L 4XUYA 1T1WB 3C6LC 1H15A 5G04L 2DQHH 3QEUA 3RUGE 5GJSL 1ZL1A 4AIEA 3ZMRA 2IMMA 2EBNA 5SWSB 2D31B 3VFPA 3KL5A 1BJMA 1ZT4A 4UV7L 5CJBA 2OWCA 3I3DA 4HH9A 4U0RB 4CDHA 3PHAA 3QR3A 1QNZL 1Q1JL 1YEDB 1U8PB 3QIBA 1SJEA 4NSKA 1JHJA 4I18B 4PJAE 4KVCH 2MCPH 3V5KB 3KYOA 4HZLB 5DD5H 4E4PA 1D6VH 2OWXA 1OW0C 2PF6A 3SKMB 1OD0A 4IRJD 5C7XH 5TPWL 2QPUA 1HKFA 5I78A 3MNZA 5IVZB 2G60L 4LRNL 5B39A 1R3HB 4J12A 4H8WH 1CFTA 3QH3A 2A3EA 1A7OL 5D8WA 4PY7A 1MQKL 4OFIA 3WD0A 4PD4K 2ZX7A 3MJ6A 5B8CA 3E6FB 2AVGA 2PETA 3MZTA 1TTFA 2NY6B 2BSRB 4W86A 3TA3D 2J47A 3NGBC 5IHLB 5EU6A 1ULVA 3MRIA 1HH9B 4PJ7E 3CUHA 3BISA 4O2FA 5I1HL 1YMHB 3BPCA 4BK5A 3DIFA 1B0GA 1LO0H 4WFHD 1K4CA 1EEYA 2H2SD 5SWZE 2A3HA 3W37A 2R1XA 1RK0A 5DPNA 3IK2A 3DHMA 3OKNA 3GSOB 3PIQB 4FFZH 4CD6A 1MFUA 4XVSL 3QXTA 3FAWA 3RDTB 4ELMF 2D9CA 4ISVB 2PYEB 3BZEB 4GAYA 1MW0A 4X7EC 4WV1C 3AVEA 3OAYK 2BHYA 1P4IL 1H5VA 2W59A 4OGYL 3L95A 5L2JA 2AV7A 2EKJA 1RVFH 2FX7H 3HNYM 3H0TB 2J1AA 2YDSA 1ZVSB 5FYKU 3C6LA 1AR1D 3S7GA 3IFNH 3GHBH 4CD5A 2GSJA 1YNKH 1F11B 3B2VH 2OSWA 4S2SA 1IEBA 1RZKL 4QX1A 1E5JA 2X5PA 3BQUB 4PJEB 4R7NB 1J0IA 2FATH 4M1CD 1XIWC 3B5HA 5MEQB 3OEBA 1G01A 1YJDL 2NMSA 5A2FA 3HI6L 1E6PA 4TXEA 2DWEA 4IDJH 3WDQA 1S5IH 5GIRB 4PJDB 2O9TA 5BXPA 2LV4A 3V95A 1QRNE 4UT9L 2AAVA 1UB6B 3LEVL 4U0RC 3UPRA 4OM0L 3KLHD 1OW0A 5BRQA 3ZM8A 2X1WL 5FUCE 4XPBL 2J1UA 1S9KC 2V3EA 4I18C 1NC4A 2BJML 5IW1A 4CMMB 4IMKA 4X4MA 3TBYB 1J0HA 1T4KA 4Z78A 4YX2L 4CCDA 1SJXA 2Y5EA 4M62L 5IK3B 3G5X