2VZTA

Complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 275
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vztA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vztA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vztA03
5GGTA 4LLVB 3AB0C 2BVDA 4G6MH 3KPSA 5SWSB 3P40A 5E99H 1NC4D 4M80A 1NGPH 5HHMB 3WSQH 5DEZA 5F89B 4DUVA 4LLDA 4UI2A 1S7UA 4GUPA 4JHWH 1JTTA 2C7UB 4G9DB 1XYZA 4XC3L 1ND0B 4Y2DA 1P9MC 1TJIL 4PRPB 3BYTA 3QEHB 4G3YL 4M5YL 4XP6H 3ACFA 2WHMA 5DJ0A 1IAKA 3KWXA 4FZ8L 1GGCH 2QSVA 4KI5D 2RVAA 1XF5B 2UYLB 4MA7H 3QR2A 5DT1H 4GW1B 4F15C 1JZ3A 5IXEA 4C55A 4W8BA 1WCGA 2C3WA 1QKZH 2A6DA 1OL0A 1NAML 4RFEB 3QIBD 3BIKA 3X3FH 4R4FH 5DQ9A 4KK9D 4QTIH 5CJXA 1OD3A 2ZUQB 5F72S 4KI5M 3AIRA 3F5JA 2B39A 2ZKHL 3OGRA 3P4OA 4F9JA 2A3BA 2DKMA 2EYTB 1H3TA 4I4WB 4JFYA 4RMRA 3PWLA 3GMLB 3SUVA 4PRDB 3ULUD 1I5PA 4YDKH 2IQ9L 4WI5A 3UETA 2D3LA 4AC1X 4PMUA 3VGHA 1D5MA 1A9EB 1BBJA 3PHQB 4KVNL 2OZ4A 5M5DA 5C0AA 3ZO0A 4ZFGL 1EVUA 2P5WD 4LHQB 3VRLF 2X1OA 4IDJL 4TQEL 2W60B 1WNOA 4UQ2B 4CN4A 1OQOA 1YMMA 4A3HA 3RMEA 1N4XL 5IJVA 1A6PA 1HCFX 1VIWA 2WBGA 4QRQA 1R5VA 1ONQB 1DQMH 3TYGL 1B88A 1QUNA 1NH6A 2ITDA 1ZS8B 2MPAH 4PJBE 3U79A 3VXUD 1BQCA 4AZCA 4PREB 3HA0A 2X8RA 5ITBH 3QUZB 4H5SB 4WWKA 5E8OA 4Z7NE 3PGDA 1T1WA 1J0YA 2PTVA 2H9GB 4KH2A 1JUFA 1UYWH 3K2UH 1LILA 4YNYB 1MAJA 4JDTL 3TT1L 4J7RA 5GGUA 2XIBA 3MMEA 4H1LH 5IBLD 4L4VD 3QWRA 5F1NB 1HKJA 5JIHA 4RE3A 1C92A 4LDLB 3KPLA 3BXWA 1I3RA 5A6KA 2BHYA 3NFPA 1NCNA 4FXLA 3GMPA 1KTKE 2DCKA 2VLKB 4MA1B 3MRKA 1JMXA 1I3VA 2VDNH 4ZXOA 1IGTB 2R2EB 1MCLA 3STBA 4CGTA 1GONA 4JO3L 4YJZL 1OCWL 1IC5H 3BMVA 2X9WA 2H2SC 3ISWA 5D7LA 4PG2C 2PYFA 3BQUB 3S9DB 2HKFH 4PRNA 2FX9L 5ADPH 1R3JB 4L9LC 2A74A 2D22A 2APVA 5BVJB 4I48A 1CENA 3X11B 4WK9A 1HHHB 3VFSA 2FYYA 4FQXB 6TAAA 1WFOA 4RZCA 4U1GB 5FKPA 3DV6A 4FMFA 5D1XB 4F7TA 4OV5A 3L3OA 1FDLH 4R4BB 4NO3A 5CEZH 2PO6A 1RY7B 3VRIB 2ZG3A 2UZXB 1GOIA 4XNXH 4DZ8B 2PW2B 1FV1B 2XM1A 5JBFA 5BS0A 3EZJB 3RUGE 3AZTA 1IQWH 3FZUD 5DQ0A 5TDNB 4LQRA 3C09C 3N17A 2L4OA 4OTXL 1DJSA 5CP7A 4MSWA 1E9LA 2HLAA 3W81A 5DMJB 2CNCA 1A6VL 5HDQH 1EEQA 1OSPH 4I9WD 5HDOA 3I9GH 4RGNC 1GPOL 4XMPH 5JXJA 1XIWB 5JMOC 3MV8B 4XZUB 2J6EL 2AXGB 3MPCA 4C83A 2V7NB 1FYTD 2QV4A 1T21B 3IJYB 4K55A 4L3EB 4NKMB 4PLJD 3HU7A 5FKAA 3WE6B 1HVQA 4HLJA 3IJSA 1MCNA 1MFCH 1S7XB 4OD3L 4H2CA 3PABA 5ELIA 1VHPA 2E6PA 3L3KB 4XRCB 2JDAA 3R8BB 3HE7A 1N6VA 3T8XB 1F6LL 4D3CH 3CUHA 4H8HA 4M61B 2YR3A 1A9BA 5MEQA 4NO0A 4W50A 2DH3A 1ZEAH 3Q1SL 1X6NA 1PIFA 4NSBA 2H8PB 4X4MA 4XPTL 3FRUA 1RZ7H 2JK5A 1FVEA 5JHLH 1I3UA 1VACA 4NKIH 3AZSA 4XZUG 4P46D 4C54A 4DTGL 1F6FB 1WDQA 4HEME 5D7JA 2X89A 4BKLA 4IOFD 5JHDE 2ED8A 1HL8A 2VTFA 2HG5B 4PGJA 1FVDA 2P43B 4U1SB 4WJ5B 2OSXA 2C3HA 3P11H 3L95A 5ANME 4HGWB 2Q6WB 4HBQA 4JHOA 4V1DE 1G0DA 3H7LA 4I2XB 4PJDE 4LSSL 5EC1A 1HQRA 3TJHC 5ACLA 2AV7A 4Y4KB 2L7UA 2NR6C 3MTRA 3RQ3A 2NY7L 1GOOA 3IDIB 5AUMA 1JU4A 2G2RB 5JW4R 2R0LH 3L3GA 4JQIL 32C2A 4KDTC 1HVXA 3JTSA 3GSUB 4PJ8B 3NJ3A 5TF0A 3LN5B 3N1FC 4YDVA 2Q7YA 3THCA 5C07A 3VFOA 5FL0A 4OSUH 1MFNA 1E6OL 5A16A 5HBBA 1BZ9A 2Q8AL 2QADB 5JIWA 1JN6A 4AZIA 1BGGA 2V5SA 1INDL 5EA0H 5B8CC 3HZMA 4R0LB 2IH3A 2YKLL 2ZX8A 3UTOA 1S9XB 1SEQH 1RV6X 1BFNA 2HVJA 3DX6B 5D2NB 5HGHA 2ZOLB 1MJ8H 1G7LA 4Y5YC 4H1LB 1S9YA 3Q5TA 1HYRC 1REIA 3KL3A 4UAPA 4M24A 5E2VL 4LQ1A 4HKBA 1MWAA 2Y5EA 5JORA 1FE8H 4XH2A 4GBXD 4JZNB 5F8QC 4GMSL 4ATWA 5MHSD 2OLDA 2XT1B 1VFUA 3FT4A 2YKKA 3MV7B 1I7RB 3QDHA 4O4YH 1CD0A 2Y07H 1RUAL 1TZIB 1C3FA 1JDAA 1DDHA 4F7CB 1ZHNA 1TTGA 2E7LC 1QW8A 2HFGL 3DX7A 4P57B 3O4LE 4UV4H 4MB3A 4D6DA 4BM7A 1IGCL 4JM4L 3EUUA 4YFEA 3N0PB 4H0IA 5GHWL 2AK4D 4TVPE 4WFGE 1KEXA 4MAYD 3DHJA 4KRPB 3KEHA 3WJJA 1FFQA 3FY1A 3LEGA 4LLWA 1E3XA 1FNFA 4FQIH 4K3EH 5DS8A 3LPWA 4ZS6C 3U2SB 3L3JA 4PJFA 4F57H 2FX8L 4XWOD 2C1OA 5JR1L 2IANA 3HG1E 5KAQF 3Q3GB 4TVPL 3B2UC 4FQCL 5CBAB 1J05A 2NZ9C 4PGCB 4Z78B 3VGGA 2X41A 1LWHA 4U0RC 1P7QD 1IM9D 1UQSA 1RIVH 3VDBA 1MCRA 2ZPKL 4POUB 1XF4A 3C6LA 4F7MA 4JDVB 4UTAH 2WINA 3SKJH 4P9HH 5D6DA 3MLYL 2L0DA 3LQZB 4HWZB 3WDJA 1TA3B 2IXUA 2OXHA 3S35L 1B3WA 1I7UB 1T2QL 3IIIA 1D5BB 3A4AA 5D72H 5HDLA 4ODWA 5C2BH 3GMQA 3GMNB 5DSCB 2ZUYA 1JF1B 1JPFB 3P0YH 3SKOA 3ZT6A 4CD8A 3AISA 1UXXX 4PBGA 1J18A 3GSWB 3LS4H 2X40A 3MRJA 5A2KH 4BXSV 2DJSA 1FSKC 1X7QB 2XRAH 1B4RA 2C8NA 4A2LA 4PJIB 4BF7A 3F5LA 4W85A 1M7IA 5DJCB 3K74B 2XY2A 3LMJH 3SIMA 1N6QH 2V5RA 1S7WA 5F6IB 3QIWD 3KYOA 4MXWL 5SWQB 1FZKB 4ISVB 3QI9B 3EJJX 2WWKO 3PUIA 1U30A 4F37F 3ILPA 3TVMD 3AMGA 3RKPA 2Z8RA 2H41A 1WTLA 5C7XL 4Y89A 4Q6IA 2C3VB 3RIAK 3DROA 5FO8B 1EEZA 3C5SB 3UTTB 5KS9B 4H88H 2VCBA 5KSAD 4LHUA 4JG0H 1RVFH 3JWDC 4P3DB 1PY9A 2J8UB 4G7VH 4NWTL 5TE6L 3SOBH 3CZJA 3BKYH 5DMKB 5BXFB 2EDQA 1OH4A 4ZUUB 3IAPA 2ITCB 3THDA 4YGAB 5GRUH 5C0NC 1OB1A 2Z1KA 3I3EA 2BNQB 3BOVA 3FQXA 3MCKA 1KPUA 2NY2B 1JRHH 2P8PA 3HPNA 5GGSA 5C71A 1FNGA 4DGIH 4KFZC 4XPGL 1UXWB 4LRIC 3SGEI 1WZMA 1ED3B 3U46A 1UY1A 3RY6A 3ZKNC 1U8NB 2IC2A 5JOFB 5EU6E 2BHUA 1H3VA 5C0BA 2ZWZA 4OM1H 3ARWA 2YBRB 4MQTB 1HOCA 2V3GA 2W67A 5JQHC 4GZIA 5AWNL 2LV4A 4AD1A 1I9JH 2WQ8A 5A2AA 3OB0H 2ZZUT 3BDYL 1ISVA 1DQQA 1JNEA 4LRNH 2A3HA 1T0MB 3NABL 8FABB 1GQJA 1AC0A 1FL5A 5B22A 5E9AA 4MAVA 2QQOA 1DUYA 1JYWA 2XHNA 5L9DL 2V9TA 2F2HA 1HF6A 1F97A 1WC7A 5TFSL 3N13A 5MEOB 3WS6C 3FMGL 3EYFB 1QSZA 3SE9H 3S8WA 4UFJA 3M17B 1JWUA 2HTLC 3EOBB 3NCMA 3TWCH 3F7YB 2KKQA 3WLBA 5C08A 5E2WL 5JOPE 1N2RA 2B4CH 3VXTA 3VFVB 1R24A 3QO0B 1PEWA 4TUFA 2UWEA 4PS4L 4NZCA 4OFYD 4JB9H 3SCSA 3IDXL 5DO8A 5ITFB 1MPXA 3GBMH 3DV4B 3G04A 3I75B 4K23L 3PQYA 3WNMA 4PJ5D 4HXBH 2BBAA 2LE9A 3ABZA 4XUOA 4HXAL 4I0PA 2YN3A 1CGXA 1TTFA 1FVCB 1RJLA 4NZTL 3GNRA 4JL2A 3BHBA 2WMIA 4RAVA 3RDTC 3RIFK 3UTZA 3UX9B 1LNUB 1FZMB 2W46A 4LNRB 1JZ8A 3KLAB 2QJDA 1AGEB 4HIHA 1VFAB 3U57A 5FYKU 5IB2B 2B1AL 5I1EH 3HNBM 1DVFC 2Y2WA 4OKDA 1D3CA 3QFJD 2Q76B 4P23A 3O3AA 1EJ6A 4RCAA 4RFNC 2XVLA 3G6LA 1JHKH 4JRXE 2DAVA 4F9DA 3G6MA 3VWJD 3CIHA 4GMTL 4U2YA 2YOCA 5DURB 2PETA 3ETPA 4PEEA 5JR2A 4HF5L 4HBCL 3BPLB 2VZUA 3QOMA 5F7FA 3FO9B 1BQHA 2AJVH 2M26A 5KVMC 3KDMB 4AMKH 2EDXA 2ERJB 3BJLA 2HYXA 4HIJB 1KCLA 2W9LA 4D6FA 2BP3A 5F96L 4OZIF 3GDBA 3QG6B 4PJDF 5E00A 4JRYB 3HE6C 5DXWA 4ZUTB 4WUKH 4P8UA 2VJXA 2N7BA 1S3KL 2VWEE 2XTKA 3R06B 5DJYA 4NHUA 3OPZL 5LKNA 3I2FA 4RFOH 5ID1B 5CKGA 2ZX6A 5EORL 6FABL 5GRVL 3JSSA 3WFCH 1W72L 1EAJA 1U41A 5CGYC 4K7PX 3CFKB 2DSKA 1OGAE 1EJOL 5I16A 1P4LB 2XPGA 4KAQL 2ORBH 3QIUA 4NRZB 1GXEA 4B16A 4DVRL 4OCWL 1LO0H 1WISA 4Z7UE 3RTQA 1AVAA 5LXGH 4FZEL 1MHEA 1QSEB 2EH7H 4N0YL 4GKNA 2PXYA 2DT3A 4H8WH 5KVFL 4WHCA 2E9JA 3PWVB 4YHNB 1KCUL 5IESL 3WS3A 2ZIDA 2NNAB 4NN5C 4XXCA 1MCKA 5FYLE 5AZ2H 4PTUA 2XSAA 4TSBH 3V7AE 3KWWA 1R8LA 1T2JA 2ZCLH 1OTUC 3MJ8A 4XTRD 2CRYA 3AAZA 2IG2L 1W9BM 1LO2L 2H6PB 4DW2H 3V4UL 2BRRL 3W29A 1A21A 2YUXA 4P2OA 1HSBA 2BSSB 3QCVL 3ZJ6A 1MIEL 3ULVD 3K8LA 2FB4L 4JO4H 5HGDB 5CSYA 1L7IH 2MQCA 1JFQH 5D7IE 5DJDB 3O2VH 3K4DA 3X14B 1NSNH 4HPGA 1MUJA 2AS5M 4P2RB 3C7OA 3VGDA 4JL1A 3BRDA 2UY5A 2XWTB 4D0BA 1NFDA 4F66A 1ETZB 5I1JL 5I6SA 4KJYA 1SBSH 4XNQA 4UCFA 3EYVA 1GW1A 1B2WH 3RO8A 3ZDZF 3QGVA 4JIEA 3OGCA 1WAAE 2NXZB 4G6JL 4Y5XB 4AY1A 1H4PA 2CJUH 5EN2A 4YN5A 4W5UA 1OTSD 3BP6B 4PGBB 1H0GA 1CGUA 1A7NH 1IT9H 1Q0YL 2HJLB 2ADGB 1YEEL 3OKOB 4BA0A 5EZJB 1H5BC 4UBDD 2HISA 4PY7B 5I76B 3ARFA 4XCEB 2M1KA 1DE4A 2FZ3A 4A3ZA 3AMKA 3LKPA 2ICWA 5FA4A 3D2UD 3C6SB 1MFDL 1OIMA 1N26A 2CUIA 2ZUTA 3CLFH 4ZUSB 3GSVA 5I0DA 4LEXL 4Y16B 1G0YR 1CDCA 1A2YA 1OY3B 4JM2C 1XF2B 2VQUA 4X98B 1U3ZA 2HT4C 1N6UA 3F58H 1FPTH 2GTWB 3KPSE 3FB7B 4UQDA 1PVHA 2Z31A 4KTEH 1GSMA 4MX7A 3G5XB 4U6YA 4NRYA 1O59A 3V8CA 2VC2L 4X6DA 5IW1B 4B9ZA 3S88H 1H49A 1PPIA 3HEIA 3TTSA 4JRWA 3CFBB 3WY1A 1JGUL 3V4PL 3VXMD 3P9LA 4FQHB 1AGCB 2BV9A 1LDPL 1UYZA 4YHZH 2WMPA 4PJ7F 4AIOA 1I85A 3EOAA 1LK3H 5K9QG 1QTYT 5AG9A 4P5MB 2CH8A 1AKJD 4R96A 5IMLB 1VBRA 3GO1L 4I77L 1H8SA 1TUXA 2CGRL 3OKNB 5DTFA 4ZAKD 4D2NA 1EFXD 4UT9H 1KXVC 1KJVB 5LGHH 5AC4A 3D85D 3DBXA 2XKUA 3DSFH 5LQBH 2EPMX 3RX8A 1UZ0A 2H3NA 3C60D 4MAZA 4EI5D 3TA3A 2FEDC 3GIZH 4G9FA 2ZNXA 3NA9L 1DLHB 1IEBB 3SDDC 4BA8A 1MH5A 2O5YH 4QXWA 3GH4A 5TPWL 3K0WA 1DBJL 3O11B 1G9NC 3GKWH 4LPUA 3WHE0 1S46A 2LQRA 3LKQB 1DP0A 4HCRH 2YFUA 4NNYB 1JPGB 35C8L 1RZGB 2DBJA 4UT6L 5SWSA 4FF5A 4OI9A 1CVSC 5ISZB 4IMKC 4ONGL 3V6FB 5F89A 1UENA 2FIKB 4P4KB 1ACZA 1KPRB 1R3LB 3BAEH 4KKNA 1YMME 1QA9B 2MKLC 4WO4B 1OSZB 1SVZA 2C7UA 4G9DA 43C9B 4ENED 1ND0A 3P4NB 4Y1AB 3VU2A 4PRPA 4UTBH 3QEHA 3HNYM 5FM5M 2VZPA 3PZUA 1XF5A 2UYLA 2O9TA 1YN7A 2R4RL 5DA4A 4HAGA 2AK1H 1UVQB 2CK0L 3T0XA 4GW1A 3FN3A 3IKKA 5KTEH 1F4YL 3HAEH 3QUXD 1RIUL 5F1SA 2IPKB 4OLVH 3JUZA 1BREA 2OR7A 3QHFH 5CILL 5JO5B 4P02B 1BFVL 4RFEA 2DQDH 5J9PB 2VQ1B 4J6RL 5B39B 3QHZL 1MRFL 5DI8B 2Z4QB 2XZQH 5JLZB 2D7NA 1SDDB 3VD4A 1YUHB 2JEPA 1BPVA 5T3XD 4YBLB 4MGQA 4R8WH 3BH8B 3CIQA 4OLUL 4P49A 1MYRA 4I4WA 2EYTA 3P4MB 4NBYB 2VL5B 3GMLA 4PRDA 3PGCB 4MA3B 4MHHG 4PJ9C 3AXLB 4KQ4H 4NQSB 1A9EA 3PHQA 1GNYA 4XVJH 5D7LE 4DXRA 3D87B 1WAWA 2Q8XA 4AIZB 4OLZL 2W60A 2FCBA 4UQ2A 5AD0B 1J83A 2VE6B 3N9GH 5I1DA 1EIBA 5GRWA 2GITB 2XA8L 1ONQA 3AC0A 5DD3H 3CH1B 4Y4HC 1ZS8A 4YHOL 1SR0A 4XNYH 1EX0A 4PREA 2WZIA 3AXIA 1CFQB 4OJFL 1UWEH 3QUZA 1JGVL 2AQ3A 2W9DL 3FT2B 4GRMB 4H5SA 4ZZ5A 1MSPA 3GHEH 2E32A 4LPVA 2H9GA 4PP1D 3D9AL 2FGWL 2R0ZL 4FP8H 5BS0E 4ZENA 1TJGH 1WEJH 3TBVB 4YNYA 4JR9H 2HLFD 5CSZB 1DBKH 4HMDA 4GWJA 2CMRL 3UTSA 5IWLC 1YEGH 5F1NA 3QJHB 3CHCA 3UBXG 3MFFB 4PFEA 5E8NB 4DKEH 4OBRA 3MNZB 3KPQB 3EO0A 2VLKA 1LDSA 1NBQA 4KJQD 1IGTA 2X6MA 2R2EA 3N18A 5E8DH 4Q9QL 1IKNC 3K81A 1LWJA 4LKCA 1ZGLB 2AJYL 4N5ED 2EDDA 4OFIA 4LLQB 1J88A 1MF2L 2FJGA 3BQUA 4NZDA 1KACB 3MUHL 1Y6MR 1R3JA 5I18L 5BVJA 3X11A 1QFWH 2GK0B 5FF6A 1HHHA 2FLRT 3U1SH 1QLEH 4FQXA 5F7LB 4XUTA 5CPQA 5AZEL 2W1WA 2P5EB 1QI2A 1W1YA 1KB5L 1DFBL 5D1XA 4WEBH 4R4BA 1ZOXA 4WFEE 3VRIA 2XACC 4Z7UF 4DWSC 1UY4A 5I74B 4DZ8A 5GZNC 2PW2A 2C4FT 1FV1A 4BSWB 4ELMB 4KK6D 1OAXH 4WY7H 5ACMA 1IAIH 3DRTB 5BWFA 1KEGH 2A6KB 5C8JB 1UWWA 1HX0A 3ULVF 1NC2D 4D72A 3TV3L 3D3AA 2VXUH 4GI8A 1XIWA 4IM8A 1WLHA 2YMXL 4LKXA 5GSVB 3OLDA 3MLVL 1HNYA 4XZUA 2AXGA 3MREA 2V7NA 4QF1B 1OF2B 3KYAA 5KZ6A 1T21A 1MXDA 3ZT5A 5L8JB 4MDPA 1S7VA 2JB5H 1CU4L 3IJYA 4Y19B 4QPWA 4QRUA 2CQVA 4L3EA 3WE6A 4HS3B 4QXGH 1VERA 4OZGB 3WD5L 2VZSA 3ULSB 5A6LA 3AM8C 2VUYA 4CDHA 5EOCL 1PMHX 3L3KA 4XRCA 4KUZH 3OXSB 3NH7L 1FG9C 4PV9B 1RZKH 1TPXB 4MJ6B 3U7AA 1GVYA 2AJ3A 4M61A 3WNKA 1V6YA 5K33A 3CSYA 4PY8I 1NLBH 5EO9B 3HAEB 4TN9A 2P45B 4HU0A 3TZVC 1UKTA 5EU3B 1E56A 1WDPA 4LCWD 1KTDA 2V72A 1I4FA 1ISXA 1NWRA 4NC1C 3V0WH 1KELL 3TTOA 4KZDL 3HPJB 1WAAF 2JTDA 5KEZA 5DFWH 4K7PY 4XCNB 2HG5A 2QKIB 4U1SA 3KXFB 1RZJL 1YNLL 1OT2A 3IDYB 4WJ5A 4XVTH 2EYRA 4AEHL 4BH8A 4HGWA 2Q6WA 1HINL 4DGYH 2DTSA 4Z18A 4I2XA 2XTJE 3W39B 3BPCA 5JXAL 1EH9A 1GGIH 1RFDH 3VNZA 4KVCL 3K7UA 4PJAE 4Y4KA 2A6JB 3T0WA 3WLWD 1LEGB 4PYGA 5I6XC 3PBGA 3IDIA 1QBMH 2G2RA 4G8EB 4P5TC 4LGXA 5L6YL 1OP5H 5DDHB 3EBAA 3M7SA 4PJ8A 3GSUA 4YE4L 3WFBH 1VJSA 1AD9B 3LN5A 4LCCC 2YRPA 1UWIA 4LPWA 4GG8B 4JHZA 3MXWL 1F4WL 3GXUA 4PJFE 1E0XA 4XMLL 3WKZA 1HNFA 4LDOB 1N0XH 2IANE 1KCVL 3PGFL 4YHLH 2HH0L 3L3HB 2Y6KA 5F1IB 3C7GA 4R0LA 4G8GA 2B9VA 1S9XA 2YRZA 1GIGH 3HMXL 5E0FA 3QXUA 3DX6A 1H3XA 4MGXA 2ZOLA 5D2NA 15C8H 1I8KB 3C2SA 5J6GB 2VMDA 5DT5A 3FAWA 1F3JB 4H1LA 4MJ4A 3SCNA 3V5DB 2VMCA 3RNQB 5I19H 4JZNA 3BKCH 4ONFH 2BVPB 5IBTH 1IAMA 1OAYH 2EDBA 5A43C 2WBJD 4L8SB 4HIIA 4OCLC 1CTOA 5KW9H 3WJLA 1R3IH 5EIVA 3MV7A 1I7RA 4Q9RL 3VIFA 1TZIA 3ARED 3ZKXC 4F7CA 4YHML 2J25A 1PBGA 1FOBA 2GK1B 4CKVX 4OF0A 2XXMB 2MHAB 2P7TB 4P57A 3OTTA 5CBEB 1UUQA 3OA5A 3DHUA 2OI9C 1QFUL 1UEYA 5CZXD 2XIDA 5FXCH 5HSFA 4FMKA 3AXXA 1CR9H 5INDB 3L4YA 3FW6A 2XGIA 2EDKA 4ODTH 4OFDA 3U2SA 3VD3A 1MEXH 3DI3B 1A6TB 3QG7L 2NY3D 4Y4FD 1DHKA 3Q3GA 3WFDL 4XVSL 2UY7A 3QT2A 2ESCA 2J1EA 3IU4L 4ATLA 3HC4H 1IC7H 3NAAH 4DK6A 5CBAA 1QQDB 2BK8A 1A3QA 2ICWJ 4LYPA 5CJBA 4Z78A 1U8MB 1V7MH 2VC9A 2YWZA 2J1VA 1VDGA 5FKYA 3KJ6L 5CIPH 5E9DB 5EOTB 1I1FB 2MQ3A 4JDVA 1J9CT 1CFVH 3DIFA 5E4IA 5LCVH 3PTQA 3D1MC 3JV4A 4S11A 2PN5A 3LQZA 4HWZA 5EOQL 3T2NH 1K85A 3I50H 4X0VA 5CG0A 1TA3A 3SDXB 4A6YB 3QXVA 4W4NA 2DMCA 1D5BA 2J5LB 3VI4F 3SDCD 3X3GH 3JZ7A 3GMNA 5DSCA 3UZQA 1JF1A 1JPFA 1MW1A 4XP5L 4WHYH 4MQXC 4BFIB 3WN5C 3DOSA 5KZCD 2PQSA 1D6EB 4ORGB 1FORH 1T89A 3GSWA 2AI0H 2E33A 1NCAL 4WTXA 4HLZH 4UDTB 2K7PA 1X7QA 4YXKH 1DANU 3CHDA 4TVSa 1S7TB 2B1HH 4TX6A 2OBGA 4ODXB 5GJTH 1KCSH 1EPFA 2RGMA 5FUZL 2X4OB 2Y25A 4P08A 4OIIH 4X5LA 4XPFL 1UD8A 5C0BE 1N59B 3D39B 2NW0A 1FZKA 1K5NB 4ISVA 3QI9A 5E70A 1RUML 2Q7NA 1GZJA 2CKNA 5F7EH 5KSBB 5T1KB 1RH9A 4V28A 1KJMB 5C0GB 3QP3A 1JZ2A 2C3VA 3D0LB 2D0HA 3CJJA 5SWZA 5FO8A 5KS9A 3C5SA 3UTTA 1MQPA 3OJMB 1ZLSL 1L7TL 5T1MA 5JQ6L 3HB3D 4P3DA 1JJUA 4IRJB 1RHHB 3WMBA 3RL2B 2DT1A 1A1MB 2J8UA 1MFAL 3OF6D 3RVWD 3SEEA 5DMKA 4YPGB 3UTPE 1AY1H 5DD6B 2ITCA 5E6ID 2A77H 4JCLA 2BNQA 3BUYB 3A3HA 2JELL 3SCMD 2WMKA 4OCSH 5C08E 5IG7B 1KJ2B 2G60H 3C87A 1J1OH 1GC1C 3U7YL 3MNWB 3QOKA 3PHOB 4DN3H 1UXWA 2BVOB 2C7FA 4UOQA 2R69H 1ED3A 1V3IA 4NUGL 5DJ6B 3PQYE 1C5BL 1JAEA 1CG9B 1U8NA 5I15L 4DKFH 4OLYH 5JOFA 3ARDB 3QCTH 4PMRA 4B53A 2R2CA 3RY4A 5C0CD 1Q9KB 3EJYD 3ARGB 4G6AD 4QXUL 1DWIM 2YBRA 4UOJA 4K71B 4IOSD 1NAKH 1S5IL 4KJPD 1KENH 4GS7C 3DHMA 4W81A 3ZL4H 1EK3A 2GJ6B 3RZCA 1K3IA 4UQ9A 3DPBA 2J7HA 1W2VA 4UINL 4PG9B 4BQ9A 1U8KB 1RUQL 2LABA 5ECJE 3WYRA 1HHJA 8FABA 1LL6A 1AI1H 2GEEA 3HI6L 3N85H 2OL3L 1DWFM 4N1EA 5IROA 4M5ZH 2WWKT 1GC1H 3KS0J 3ZKSD 5HYSB 2C3GA 3VIKA 1XZ0B 5MEOA 1UHVA 1EAPA 4HFUH 3I2JA 3EYFA 2X44D 3M17A 3LD8C 2WCSA 2F53D 4NF7A 3F7YA 3PV7A 4M7LT 5IYYA 3L7EA 2V17L 4FLRA 3RA7H 3S36X 1CZ8L 3VFVA 1VFFA 2WAHA 1CE1L 3QO0A 1NCDH 2J74A 4KKAD 2P47B 3A6BH 1LEIB 2LS6A 3DV4A 2DOCA 3C5ZB 3I75A 3QB7C 4NZUH 2VB5A 2CUMA 3NZHL 1GHSA 3H0TA 2VZ3A 2CR6A 4O51A 1O0VA 1UADC 2D0GA 2EECA 2ESVE 3EFFB 1T7XA 1FVCA 3BE1H 4J8RB 2XJ7A 3KR3L 5HYSG 5ECUA 3HC3H 1SM3H 1LNUA 1FZMA 3CLEL 4LNRA 3KLAA 3VA2C 1F3RB 1LMKA 1AGEA 3HZKB 4D9LL 1JNHA 3EMCA 4MXQD 1PZ5B 1JI1A 1IC4L 1X4YA 4ZPTB 1NUFA 1KPVB 4W84A 4GQRA 1NFIB 2Q76A 1QW9A 3S5LB 1OM0A 3OKDB 3S97C 5FA3B 4FQPA 1QPKA 5I9QB 2B5IB 3UP1A 3O6LL 3BT2H 2XWDA 2PWEA 3UPRB 3ULUH 4HC1H 3FO9A 2OM5A 1WWCA 2PXYD 2Q20A 2DIBA 4Z77A 2OP4L 4HS8H 5KSVB 4HIJA 2YBUA 1QRND 4TSAL 3VKKA 4MD4B 4ZUTA 3QG6A 3VFWB 3O6AA 4JRYA 4ET7A 3IB4A 3RRQA 4M6MH 2R9HC 5IMOA 2BC4A 1B0IA 1FYHB 3R06A 3W37A 5CGMA 2J88H 2Y6SD 1XGUB 5E03A 2CEQA 3QEQB 4OQTL 3UJTH 4UAOB 4WU5B 1UACL 5AYQA 1INEL 1VEPA 3CFKA 4JVWA 4UFMA 1P4LA 4YX2L 4NRZA 3RGVB 3RWJB 2VURA 2ZOKB 1QSEA 4K7PH 5I73B 5C70A 4FFYH 1IQDB 2DPEA 3RFZC 3P30L 5D8JL 2XFXB 4M81A 4G80B 5IP4A 5I1HH 4CD6A 4ZEPA 2NNAA 3EYUL 3STLB 4MNQA 4AZHA 4DQOH 3GRWH 1MI5D 2DD8H 5BCAA 2FH8A 1LO3H 3NCFB 3AMDA 1J1XL 3AB0B 4LEOA 1A7RL 4OF5A 4HUWB 1AGDB 2BVTA 1ULOA 5DK0B 2A83B 1TCMA 5DFTA 5ABHA 4Z7OF 1MCBA 1QSFB 2BSSA 5DUPL 1EHXA 1V0NA 2R0KL 5L8KB 5HGDA 5DJDA 2JF6A 4URTB 4U6VH 3X14A 1ADQH 1BX2B 4K8RL 2RV9A 1U95B 5A2FA 3H9HB 1I8IB 3PXJA 4P2RA 5GGVY 3ILQD 4QDRA 2QSCH 2XWTA 3DGGB 1CFSB 1RUPL 4F15B 1UH4A 4X6DE 1ETZA 4FQ2L 3U7WH 5DD5H 4J3OC 4V1DD 3CFIC 1W0NA 1CE6A 1G6RL 3M45A 5D1QD 3ARVA 1CFNB 4JFWA 1KFWA 2NY1D 1ZLVK 4LVNC 5CD5D 5JW3H 4Y5XA 4V2CB 4UIMB 3CNKA 3MOAH 5GSRB 3BP6A 4OLXH 4PGBA 5IHSA 2C9KA 5GZOC 4QX3A 1FCCA 2HJLA 3IFLH 4TUOB 5I1IL 2ADGA 4WKFA 2ZP0T 3OKOA 2G5RA 4PY7A 3INUL 5I76A 2E9MA 1NC4B 4GSDH 4G9FE 4HUKB 5CINL 3PDOB 4JPVH 3DSNA 3CBWA 4KK5D 3C6SA 3OGVA 4TOQA 2NXYC 1GOHA 4POZC 5F44A 1E1EA 4ZUSA 1E4KA 4Y16A 1QP1A 3QNXB 1XF2A 3DTXB 4X98A 1JTOA 1QOXA 3HI5L 5FHBH 4ZYKB 4J3WA 4ETQB 2GTWA 3AHXA 5SWSE 1F90L 3FB7A 4ZS7L 3L1OL 3OKMB 4KQ3L 2AEQL 4ZOEA 5AC5A 4LYRA 3G5XA 4BJLA 3S6TA 1PEZA 5IW1A 1U8PB 4R7NB 4JGJA 1XD1A 3B83A 4LMQI 4APQD 1FGVH 1HZHH 3CFBA 4WTWA 4M82A 4XX6A 2A38A 3LKRB 4LNVA 3QIBB 2BNRB 1YYML 5L2JB 1CX1A 1AXTH 3KNBB 1AGCA 4FQHA 4PBXA 4R90L 4WIWA 4WI6A 4CN6A 1BGXH 3VXRD 4J4PC 4BCEA 4KC3B 4LARL 5I8OH 2VAJA 2CKBH 5HHMD 3G6JA 1YQ2A 4TVPD 3VXPB 3OKNA 3MRGB 1KJVA 4O02H 4G8IA 3SDAD 3MJGX 1NOWA 2ZG2A 4HG4J 1Z9OA 2DSUA 4EIGB 2R15A 3GB7A 3TT3L 1SJHB 1ZE3C 5J1AB 4X6CE 4OGYL 5BJTB 4NQEA 2X4UB 3ZYJA 4U1IB 5T33L 1MFEL 2FJFB 2OSLB 2P5WB 3QDGD 4QWWC 1KJ3H 4F2MB 4E0RB 2C1PB 1MHPL 4JY5H 1DLHA 1IEBA 1W2PA 3DMMD 3MRFB 1W3JA 1UM4H 1Q1JH 3O11A 5FV2A 1F11B 2K1MA 3CDZB 4AZ8A 3O9WC 5DHVH 3LKQA 1K3ZA 2HJKA 5D1ZC 3VXUB 2H26B 3W0WB 3WBAA 2IFFH 4MZ3A 1JPGA 1V8HA 1RZGA 1Z9SA 3IANA 1W9WA 2UWEF 4M7ZC 2PYEA 2X4NB 3RDKA 5ISZA 2W9XA 1IAOB 4MAYC 3V6FA 1TVGA 2FIKA 4P4KA 1KPRA 1R3LA 4HS6B 3MFGB 1DLFH 4GKSB 1OSZA 4HKZB 3FT3A 4WO4A 3V4VL 4BQ6A 4I18B 43C9A 4CADB 1WDSA 3P4NA 4Y1AA 4ODBD 1A3LH 3ARBD 4L4VB 3LMYA 3ZSTA 1FBIL 1ORSB 3O6FC 2R29H 4JFDE 4OCXH 1UVQA 2DQEH 3STZB 4LGSB 5C1MB 1XCXA 1IFHL 3MZTA 4XX1G 3ZIZA 4FQLL 3T0EE 4BUHA 1D9KD 2IPKA 5J1XA 1MAKA 2W0LA 4M02A 2VDLL 2OK0H 2QQNH 5JO5A 2CBIA 1PG7X 2Z0BA 1CNVA 3IS1X 3BIAX 3UTSE 3QXTA 3PV6B 2QPSA 3P4LA 2CLZB 2VQ1A 5B39A 4LMQE 2Z4QA 5JLZA 3FXYA 2GFBB 1YUHA 1NFKA 1YHTA 4NN6C 3LKSB 3BH8A 2ZUMA 4HDIB 2G9HB 2D23A 2VLKE 3P4MA 4IRSD 3ARXA 2VL5A 3QPQD 4JFHE 2YIHA 3VM7A 1S78D 4MD0B 3PGCA 1B4JH 2X4PB 1GHFL 1RZ8B 5CQ1A 3EMQA 4NQSA 1IGIL 1EMTL 3BKML 1NMBL 1A6AA 5DK2B 1J84A 1UM6H 1JXKA 2VX6A 3MRIB 3SQBA 3CSBA 1H6YA 2ZXBA 1CIDA 2FD6H 4YDLC 5DMGC 4AIZA 1FHLA 1F58H 5AD0A 2QQLH 1FH5H 4W7VA 2VE6A 3OHXA 3MRNB 2GITA 2G3MA 3QPXL 3CH1A 1HKLL 4N90D 3P77B 3GH7A 3PUCA 3VRJB 5I77A 2GW5A 1CFQA 1B6UA 4GRMA 3HMWL 2FO4B 4Z8FH 1A5FH 3TPUB 3UJJH 1KUMA 4XMKH 3BQUD 3QUYC 2VCAA 1KIRB 4GKZB 4R27A 1YN6B 3H3PL 5IHZB 1A3RL 2WK2A 4H20L 4U0QB 3TBVA 4YHKL 5EJZB 2IPUG 1MFVA 3DNKA 4XPBH 4JPKL 5CJ5A 4FQXD 4NJAL 1F8TH 2X1QA 5EU6D 1KN2L 3RVVD 2COQA 2I24N 3HS0B 5IR1B 3MFFA 4UB0H 3MBEA 5E8NA 1OD7A 3D3VA 3KPQA 1V5JA 2HT2D 3OLEA 1A1OB 4A4AA 4FNLH 4AIEA 1B30A 2HT3C 5HD8C 4GH7B 4OFKA 3PP4H 4K68A 5LYRA 2V5TA 3AIUA 1HJSA 4J12A 1ZGLA 8CGTA 1AHWB 3WXWH 3NUKA 4ZD3H 4LLQA 4QX0A 2XM2A 5GS0L 5J57B 2OSYA 1BLIA 2VZ1A 4RMSA 3EZ8A 3S96B 4UMGA 3CU7A 2EZ0C 5A3ID 4N0CD 4P46B 2DI8A 2GK0A 2KH2B 4FQJL 4D0QA 3JVGC 4G6ML 4JG1H 2P5EA 3MV8D 1ACYH 2FH6A 1T1XB 1MJJB 3MLZH 1AR1D 4FQ1H 4YZFE 4LYQA 1NFDF 1TNMA 2LTQB 4JHWL 5E24E 5E8EB 2NTSP 2GJXB 1CS6A 2ATPB 1CDUA 2YA1A 3VD5A 3O2LA 3JWOC 4NHCL 1D5IH 3WIIL 5FDYA 4ELMA 3LQAH 5CSBA 3RVTD 2FECL 4GAJH 4S1SH 3DRTA 4MA7L 3W9DB 4RA0C 2B8OT 5EC2B 5DT1L 5C8JA 4D6HA 4MJIB 3MCLH 2W91A 2CK2A 1ZWIA 3IJHB 2L7JA 5DJAB 4I2XE 3RHWK 3SO3C 1UR8A 3TO4D 5JXED 4WW2F 5DHVB 1KTLB 1PKQB 3LZFL 4CUBA 4HCRA 1H3GA 1Y6KR 4QTIL 5GSVA 4QF1A 1OF2A 4XNUL 3MJ7B 1H15B 1C90A 4Y19A 2V2WB 1LF1A 4GRLC 3BGAA 3T04D 1PBYA 1W3KA 1MCJA 1FGNL 3WFLA 1UT9A 4HS3A 4K3DH 1RMFH 4OZGA 1P2CA 3ULSA 3SKNB 3G5ZB 3RJQB 2BOCB 1X5KA 5DJXB 2GIYA 1JIBA 3OXSA 2ADJB 4PV9A 2CBVA 4D6CA 3SCVA 5IDIA 1KBGH 4GW5A 4YHEA 5EO9A 1NCWL 1FCGA 12E8H 3HAEA 4RGMC 4G8GE 1N64L 2ZXQA 5EU3A 1SVCP 1W0YT 5D2NE 5C0DB 1IKFH 4BQ2A 3TYFB 2D7QA 4OBSA 3HPJA 5HI5C 4XP9H 3A6CH 3FFCA 4XCNA 5KANI 2NX5B 2Z93B 2QADD 2AK4B 2QKIA 2ATKB 3KXFA 4GI6A 3PZ9A 4R26H 3SDYL 1FSKB 2Q1EA 4AD3A 1B0GB 3B9KC 5EZLB 3EBVA 1OGAD 3MYJB 4V2XA 2MANA 3MV7E 2VXSL 3WEXB 1AH1A 1A1NB 4PB0L 4HPYH 1RD6A 3W39A 2DQHL 4TULH 4LX4A 1K42A 3V79C 1MAML 4ERSH 2A6JA 1U8LB 1LEGA 4HUMB 5LJYH 4EZMA 1WIUA 5M7QA 1J01A 1TCRB 2YUZA 3LQMA 4RGOH 4LSQH 4TSCH 1IBGH 5A6BD 2VDNL 1AD9A 5I23A 3ZKMC 2W66A 3AUVA 2XKSA 4XCFH 4QNPE 5EB9A 4GG8A 3ZOAA 5I30L 1BHGA 4MZ2A 1P7QB 1ITXA 5FHAL 4EN3D 5I1KH 2BNJA 2FIRT 5D70L 1VEOA 4QRTB 1WKYA 3G5YB 4OCNC 2X4TB 3OKKA 4IDLA 4JO2H 5IVZA 2BY3A 3I6KB 3L3HA 3TF7C 5F1IA 3MJ9H 3W6MA 1UR9A 1KB3A 1QNPA 4YC2C 5J6GA 4URIA 3M8OH 3ESVF 3QCUH 3B5GA 4Q74A 4XZWA 1F3JA 2GSIA 3MV9B 4WCYH 3V5DA 2VOTA 4ZODA 2KPNA 4HMCA 1MFBL 2FDMA 3RNQA 3IT8D 4K94C 1NEUA 4PYSA 4L8SA 1E4JA 2Z92B 4CVZB 4F3FB 2EIZB 4S2SB 5J1SC 4FOMA 3REVB 4JFUA 5DD1L 4WLCA 3UCQA 3PL6D 4D8PA 3LAFA 3LEIA 1UWXK 2YA2A 2GK1A 1GQKA 5EPMB 2BJML 2MHAA 2P7TA 4XCYB 5CBEA 1MPAH 4GQ9L 3SY0B 3CZKA 1M05B 1UKSA 1UM5H 2VH5L 3TN0B 1I1AD 1URLA 5MENB 1T66C 3F7VB 2OJZH 3TVMB 2BSED 4BQCA 1BFTA 5INDA 4D94A 5C09E 5K9KB 3VG0L 4JN1L 4XC1H 5KSAB 5A3HA 1A6TA 1U93A 1JMZA 5M95B 1MFCL 3RWCB 1ZK9A 3FB8B 4JY6B 4Z7VB 2E40A 1T83C 1DN2A 4HZAA 3UJIH 1QQDA 2W0FB 3MUGB 1UC6A 4D3CL 4RWYH 5DF0A 3O41B 1AJ7H 1U8MA 5F6HI 4P48A 2HTKC 3AXHA 4JFTA 1D2KA 3L4UA 4NZRL 1ZEAL 5SWZE 5KS9E 2E9LA 2LU4A 2XQXA 4PTMA 4YPJA 3FTGB 2O5ZH 1BWMA 5E9DA 5EOTA 2OMBA 1I1FA 5JHLL 1X5IA 2K3TA 1KQYA 4NT6B 1BBDH 1OF4A 1E3ZA 4KUCD 3K4ZA 3A7QA 1E72M 2JLLA 2E9BA 3ULVH 4XB8A 4A6YA 5TH2B 2FBJH 1X1NA 1ZT7B 2BNQE 2EXYD 2W65B 2VDPH 2DT0A 1N0LA 1D6EA 4ORGA 4QP0A 4A41A 1KQZA 4UDTA 1P4IH 1PZ2A 2KUTA 1U91B 3AY4C 1DEEA 5KVGH 5HHNA 1WWWX 1S7TA 3WFEH 2P8MB 4ODXA 1HN1A 3UO1L 3ZJ7A 4JFZH 4QHKJ 3RVXD 5DQJB 2X4OA 5EBWB 3PNWB 1TIUA 1N59A 3D39A 5JXHA 1UX7A 1K5NA 2NY2D 2VDOL 4KPHL 1V02A 4MO3M 3H8NA 1G7MB 1IGFH 5T1KA 1A4JB 3ZYIA 4YFDB 5GS2D 2BY1A 5GNXA 1HIZA 5A8PA 5C0GA 3D0LA 3X17A 1G84A 4RMVA 2HKHH 3W2DL 2G4FA 1CDIA 5HVHC 5EA0L 5JMRA 1A7QH 2DKUA 2V9QA 3MSDA 4KTDL 2VT0A 4IRJA 5E08L 1RHHA 1C91A 3RL2A 4AMCA 3EGSB 2DL9A 4RX4A 4Z95L 5DRXB 4U1HB 1GJWA 4YPGA 1JZ7A 5DD6A 1NAEA 4OT1H 2H1PH 1IEHA 1F13A 4PJ5B 4Y2DC 4MPKA 1EZVX 5IG7A 2LAAA 1NBYB 4EI5C 1ZTXH 4JHBA 4L4TD 1MRCH 2CIIA 4IS6B 3D25B 3TNNB 5KJRH 4ZFZB 3MNWA 5H8DA 3PHOA 4JZ5A 1CXKA 1KCRH 1MCQA 2BVOA 1IM3B 1H09A 3MLSL 2TAAA 4ZMAT 2DM3A 2IGFH 5IMKB 4ZXEA 1YEJH 3BCFA 4I3SL 5DJ6A 1W2KT 4PGZA 2DGAA 1UWSA 3QDMA 1BF8A 1J1PL 2ADFL 1CG9A 2W1NA 3CVHH 3LS5L 1EOKA 3FQTB 5ACZB 1YQVL 2O5XL 3ARDA 3QFJB 1L0YA 2Z4FA 2P46B 1HKMA 5GGTH 5F88B 1KGXA 5CJXC 1MIML 3ARGA 1MLCB 1G7QB 1WBYB 2BXYA 3VWJB 3BO8A 3KHQA 1JRHI 1NUDA 2GJ6A 5J7CC 3CXDH 2CKSA 3F65A 1WF5A 1CDGA 2ZXAA 4PG9A 4WGVB 1OVZA 2HVKB 1DLCA 4F57L 5A6JA 2DQJL 5HI4D 2NCMA 4YZFF 3H9SD 4D6EA 3MJ6A 3EYPA 4AG4H 1XZ0A 4Z7QE 4PP2B 2DBLH 2XGBA 4ETYA 4LHSA 1LP9E 1BD2B 2WMGA 5HBFA 1J9YA 5CHNB 2APFA 3GMMB 3RCNA 1RSFA 1TETH 3L5IA 4X9HA 2EC8A 4WWKC 5I2IB 2CPUA 3VIIA 3SHSA 4Q22A 3S36H 3LHPL 1LEIA 1XV8A 2X1IA 4FABH 1IC1A 3C5ZA 3SGKA 5DURD 4QCFA 1J8HD 3QH3B 1U2YA 2XONA 4NPYB 3PTMA 4ODHL 5HYIA 2B4KA 2YL8A 5CPSA 5FOOA 2D03H 4WUUB 3EFFA 3L5XH 3LS4L 3P9MB 4J8RA 5HYJB 4CD4A 4DK3A 3MRCB 3GZAA 1NJ9B 4PYHA 3VX0A 1QSEE 3LMJL 4K9EC 4H41A 3HZKA 2DDXA 2GKIA 1PZ5A 4AIXA 3QWQB 3GTNA 1JU3A 4ZPTA 1KPVA 5CIPA 3PG2A 5IOPB 1NFIA 2YLAA 3BZEB 4PJXB 3S5LA 4A2MA 3NJXA 1W1PA 3OKDA 1U8JB 1A64A 1W9XA 1T20A 5T3XH 4L8CB 4B41A 4MNQE 3AS0A 4FTVA 2IPTH 4CCEA 1IZKA 2WSPA 2XVPA 2GAZB 1Q9LB 2X2YA 3DYPA 2XQYK 3UPRA 2WUHA 1PLGH 3SKVA 4YR6B 2QMJA 4M6OL 1R87A 1NBZA 1R0AL 4R7DB 2V3DA 4NCDA 3KJ4B 4JZOA 5D93C 1IGMH 3UR7A 1L9NA 2NY0C 3ZLQC 2PO6C 1NCBL 4WTZG 4CN1A 4MD4A 2FR4B 3VFWA 4WWID 5JW4Q 1PD6A 3U9PL 1MREH 3WDQA 5F7KC 5MI0B 4HULB 2M2DA 3Q6GH 3PXHA 1DL7L 4UNUA 2G5BB 4JFEA 2ORXA 2ADIB 4N5EC 1JNNL 1XGUA 1R5WB 2KZ1B 3QEQA 4N1HB 4QRRD 4B7IA 4DGIL 4KRLB 5BV7H 4JJHA 3POHA 4WU5A 1W0WA 5DZOA 1UB6B 3U4BH 5J1TC 3RGVA 3VA6A 3RWJA 4PSPA 2ZOKA 3GBNL 5LWYL 4Z6AT 4I0KA 3GUTB 4KWUA 4QLKA 3IDAA 2W07A 2XFXA 2VLJA 4G80A 3SURA 3JWDL 4Y7MA 3D2UB 3PWUB 3STLA 4LRNL 5C86A 1BZQK 4CMHC 1GUIA 1AO7D 4L8BB 2G8ZA 1FLRH 1D6VH 2CDPA 2NY6D 2D20A 3HE7C 2H32H 3KPRB 4LIQH 4HUWA 1AGDA 4MMXC 5DK0A 2A83A 1HCVA 4UIKH 4NSKB 3S4SG 3SE9L 1BQLH 2ZCKH 1UFUA 2B4CL 2AXHA 1JPTL 3H3KA 3LRSB 4PRHE 1AGBB 1K8DB 3MZGB 1P84J 1KT2B 1U95A 5D7JC 3H9HA 1I8IA 4QT5B 3MLPA 1WK0A 1YECH 1AKJB 2N56A 4LSDA 1GOGA 1CFSA 4PJIF 4UOW1 3LH2H 5J3HC 4HQQH 2BOBB 4ZY9A 3O3EB 4ZAKB 4QHLB 2DB8A 3PHAA 4B0MM 3T09A 3IXAA 2XTJD 4Y16D 3L2LA 1SYVA 1MHCB 1CFNA 2AV1B 2DQGL 5DVOA 2CHOA 4Q0XL 1R6VA 2EO9A 1UD2A 4LLUB 4UIMA 4O2FB 5GSRA 3G6JE 4OCRL 3CSPA 1A4KB 1WZ1H 5INCB 4R2GC 1UZ6E 4ACYA 1K4DA 4TUOA 3EOTL 2Z91B 3VXQB 3NIFE 4LF3B 2E8YA 3L5JA 5KS9F 3BPNB 1JHKL 4JN2B 4RMUA 4M1GH 4NQEE 2D7TH 2YHGA 1NC4A 5DRZB 1FL3B 3DGCR 2WWMD 2J8UF 3PDOA 4CJ1A 3FFDB 4JFOB 5DVKA 3EKCA 4EXPX 2BSTB 4PUEA 4CCCA 3DTXA 1OARH 3RKDC 4I5BB 5CEXB 1XH0A 4ZYKA 4O00A 3PWNB 2CUHA 3EYSL 5EJ1B 1FZJB 2E5EA 3ESUF 1QFHA 2PYEE 4KDVA 4KKCD 5F9OH 3OKMA 5BQ7B 2QBXA 3QUXB 4WUKL 1PG7W 1FRGH 3KVQA 4FFVC 4R7NA 4KKLC 1CK0H 2AQ1A 4N8VG 3NTCL 4B5EA 3LKRA 3QIBA 5I79A 5L2JA 3WFCL 3U83A 3KNBA 4F33B 4HMEA 2G3NA 3REWB 4ZOAA 2EIEA 2ORBL 3WUFA 2EKSB 4D0CB 4F8XA 4LSVH 1WP6A 4IPNB 4PJHE 4UOW0 4XAWL 3MRGA 4LSRH 4XP4L 3WJJC 5FCUH 3R4DA 4HC1A 3Q48A 2DLFL 2VERN 5EZOL 3UERA 3NSMA 3WQ5A 3ZE2E 5FV1L 2X4QA 1GVIA 5I1CH 1SJHA 5J1AA 1RU9L 5JUEL 2X4UA 1CFTB 1NLDH 3FOLB 2DS4A 4U1IA 4U7KA 2FJFA 1FO0L 2P5WA 4R6UA 4E0RA 1OGGA 4F2MA 2C1PA 1W9PA 1RJZB 3MRFA 3MLWH 1V6UA 1GGUA 1F11A 4JE4B 3FCTB 1FNHA 1R7OA 2YEZB 4NWUL 3V0VB 3VXUA 2YK1L 2H26A 1KGWA 4W89A 5DJ2B 5CZVH 3QAZC 4YAQB 1R64A 2WP3T 5BV7B 1XGYL 2R4SH 4DCQB 2X4NA 2XA3A 4NCC2 3DETC 2BNUB 3C6LC 3S34H 4S1RL 2CDGB 4OZOA 4J1UA 2ZCHH 2EDNA 4HS6A 5D6DC 4U3AA 2JJTA 4GKSA 4HKZA 1TQCC 4PJEB 3EDEA 4CADA 4I18A 5I75C 1QBAA 5CAYB 1P4BH 1FC2D 4Y5VA 4L4VA 2DIEA 2YC1B 1ORSA 3G5VB 1ZSDB 1H2JA 2DQXA 3STZA 2G3IA 2WLZA 3F8UB 4YWGL 3GRWA 1CZ1A 4HA3A 4NKDA 3CHFA 4ATDA 2HWZH 1HEZB 3VDAA 1V0MA 5DFVC 3U4EA 2JJVA 1WBXB 1HJQA 5C0FA 3MS8A 5GJSH 4W4OA 3PV6A 2I9TB 1DCLA 2NZIA 2CLZA 5J8OA 1PG7H 3RP1A 1RULL 4NFBA 2VX4A 2PI6A 4XP1L 3LKSA 2VQTA 1KC5L 3D3VE 3ZTNL 3NN8B 4HDIA 2G9HA 2R56H 5EUOE 3BSHA 4M7JL 2CYGA 1ADQA 4MD0A 2X4PA 5GQBA 4ZXBD 4ACZA 4Q6IC 2OYKA 1RZ8A 3K1DA 3RIKA 1E6QM 3MRIA 4HUUB 3QYCA 3CZLA 1B3VA 1SYTA 3CLFL 3NQHA 4QHUB 4PRID 2MQ0A 4G42B 5BO1L 4OCYL 4X7SL 5FFLA 1KIPB 2HJFB 4NM4L 3AOFA 2BHZA 1J10A 1EZVY 2IJ0C 2PKDA 2ZEXA 5JW4N 5H35B 2CCRA 3GNMH 1K8IA 4FQQB 3EYOA 2P5EE 1WWBX 3VRJA 4O2EB 1MLBA 3MGTA 2F5AL 3QQ9C 3KPMB 1Q6CA 1OAQL 4N1CA 1Q72H 1NC2B 2FO4A 4GQPH 3TPUA 1YY9C 4NNPH 2XG9A 1KIRA 4GKZA 4XBPB 5EULV 1PDKA 4Z0BH 3RY6C 1EO8H 2P8LB 3B5TA 3NPZB 5ESVA 3H3BC 1FYTA 3A22A 5KVEL 4NYLB 3N04A 3D18B 1LK3L 4QYOA 2NW2B 4U3HA 1XFPA 1DSFH 3VGBA 3MMUA 5IR1A 1KGCD 3NCJH 2QQMA 3AS3A 1U3HD 2WCAA 4Z0XB 2VLRE 5L7XH 4HWBH 4JY4B 3FQWA 1ZGLM 5I0ZA 4WW1B 3U36B 1A1OA 1GORA 5LQBL 4KRUA 4DZBB 4GLRI 2C3XA 3NA4A 3WBDA 1L7RA 3QNYB 1AHWA 3EOYG 1E0WA 2PCPB 3TO2B 2JJSA 4Y19E 4CU8A 3MANA 4HUVB 5F9DC 2OWWA 5LGJB 1U92B 3S96A 2VITB 2J7CA 4P46A 5J4MA 3OV6A 3CKHA 1T4KB 2HRLA 4KDWA 1TJIH 1T1XA 1MJJA 3EJYC 3ZDXF 1E6XM 4M1RA 1ZU8A 4FZ8H 5IEKB 2CKBA 1ZL1A 2P48B 2IAMD 1VEMA 1CFBA 5E8EA 2GJXA 1YEIL 2ATPA 1XC6A 3DRQB 4UTBL 4U5KA 2XOTA 2RR3A 3WMSA 4NJ9H 3CGTA 1DWGM 5IVNA 5JNYB 2Y5TB 4HHAB 4JHAL 2AXFB 4HIXH 3W9DA 2AK1L 1QFWI 5BXTA 1A7PL 3FFCE 5EC2A 3ZYZA 3I3DA 4UZGA 3SUSA 2IBGA 3BEVB 2OI9B 4X7FC 3KXFE 4O58H 3IJHA 4BH7A 4EOWL 1PFCA 4Z2GA 1IZJA 1S5HB 1G9NL 4F8TA 3TBTB 1FZOB 5DHVA 1KTLA 1PKQA 1YMHB 2ZKHH 2DQDL 2D24A 2VN7A 3O6MH 3KAAA 2W59A 4KROD 4W70A 4TPRL 1S7RB 3MJ7A 4LOUD 4P23C 2W62A 5GS1B 4NM8L 1V6XA 2V2WA 4Z76B 1T7WA 4IIQB 2VKWA 4KVNH 5DRNB 4HZ8A 2E4TA 2WAGA 4ZFGH 4WSJA 4Y7EA 3FQNB 4TQEH 4IDJH 3L3IB 3SKNA 2J7BA 3G5ZA 3WUBA 2BOCA 3HZVB 5DJXA 3KL5A 1N4XH 2ADJA 4PLKC 3I2HA 1LEKB 1U3JA 2E3ZA 2O93L 2WW8A 1QHPA 4GBXA 4QRSB 1YEFL 3TYGH 1A6ZB 5T1DL 2WBJB 4PR5B 3AU1B 3U5YA 4PUBL 4N0UE 1G7HB 1PQZB 3FQRA 1P53A 2QQNA 4LAQH 2V38A 5C0DA 4LSUL 3AREB 1TVNA 4XNYL 1SMAA 5E4EC 4YXLL 1RURL 4NOBA 1BIIB 1A02N 1UWEL 3TYFA 2BY2A 1DWHM 1JK8B 1HH6B 3GHEL 2W9EL 3TFKD 1CICD 2A1WH 2NX5A 2Z93A 3ARQA 2D7OA 5CCKL 2AK4A 2XFRA 2ATKA 2PF6A 4MAYA 4AH2B 1UZ6F 2YPVL 3HI1B 4S1QL 1B0GA 4HJGA 5EZLA 3BN6A 3MYJA 3QIUC 4TVUA 1G9MC 3WEXA 3NIFF 3RTQC 1EERB 3NJVA 4FMVA 3T1FB 2W0KA 2Q8BL 1OD9A 2PXYC 4UT7L 5DC4B 4C7FA 1E27B 1U8LA 4AZGA 2NY3B 4Y4FB 4JQXA 1TCRA 4JO3H 1HYSD 2QQLA 5C2UB 1I1YB 1Q9OB 4XXCC 4PMZA 5HYQB 4R9HA 5E8DL 3WNPA 2W0PA 2FX9H 3VH8B 4PCTA 4NCC1 4M7LL 1ZB5A 1P7QA 1EDQA 1IM9A 3EYQD 4NKQB 4U6XB 4RWHA 3QISA 3CUPB 2FEEI 3G5YA 2X4TA 4WF7A 4FG6C 5JUVA 2DQUL 3CFEB 3I6KA 4GXVL 4LL9A 1Q6GA 4P2OC 2E7CA 1QLEL 2YZ1A 4XVUD 4EKJA 2GSJA 4JFSA 5F7MC 3I6LE 4NN7C 3SDCB 3H2WA 3UR8A 4WEBL 3MMDA 4HKXB 5L2KE 1I7ZB 1KN4L 6A3HA 4QRPE 1AR2A 3MCG1 5E9DE 5KZCB 1G5AA 4NKOB 4Z7WE 4ZPVB 3E6HB 1VFMA 4QHMA 4ZTPL 4KGLA 2Z92A 3VH8G 4CVZA 4F3FA 1CD9B 4S2SA 1OAXL 4TUKL 5ERWB 3REVA 4OAWB 1OTTD 1T7YA 4M9OA 4P3CL 3O3DA 1BSIA 5EPMA 3QIWA 2EYSB 3JTTA 2OJEB 4L4OA 1F5WA 3SY0A 2J6EH 3DXAD 4ZOCA 4M1DL 3TN0A 1XNAA 1DWJM 3F7VA 3FNDA 3TVMA 1YJDH 2C4FU 1VGKB 2DDQH 1CZSA 5IQ9B 4WW2C 4OD3H 2JB5L 5K9KA 1RZFL 2WNGA 3EHBC 3ETBF 5KSAA 1GUVA 1W32A 1PW3A 4PJGB 4PF1A 3ARFC 1VADB 1QVBA 1IAIM 1JTPA 4GXPA 4PJ7A 3NIGE 1V02E 3RWCA 3FB8A 4JY6A 4Z7VA 2O9PA 5K59E 4XPTH 2W0FA 5E6IB 4FFWD 1RZKL 2CLVA 3MUGA 5DHYA 3VXNB 3O41A 1Z6JT 4AD5A 3AHVA 3HNVL 4ZZ8A 5CD5C 3CXHJ 2MCG1 1NAMB 3FTGA 4MJ2A 2KL6A 3RX7A 3UC0H 4DTGH 1LE5B 2CDEB 2HA1A 3BAYA 2E27L 4CKQA 4NT6A 2Z31C 1G0XA 3VI3F 2HLEA 1XGPB 1QLFA 3KLHC 3OG6B 1ZLWH 5ICYB 2F54E 3V0WL 2LW8A 3ARSA 5TH2A 3VMPA 2EEDA 3U48A 5EUKB 4WI2A 2VABB 5C0CB 1O7AA 3FRPA 2AERT 4KK5C 5ESQA 4DGYL 2E31A 1VCAA 2D9QB 3N1AA 1P1ZB 5GGRY 1RFDL 3L7FA 4ALAH 3X13B 2P8MA 1DYOA 2E7BA 2ENSA 4OZFG 2JB6B 3OR6B 3QDME 4MGSA 2VXTL 4O5LL 4A44A 5CP3H 4H8VA 5DQJA 2OSWA 1XH3B 5EBWA 1YEHH 1KBKA 1KULA 2DSZA 3TA3C 3RGHA 2OS7A 3NFNB 1CBGA 4X6FB 5EU4B 3DI2B 1G7MA 2GJ6E 3U30C 4K3GA 1AIFB 1INDH 4JFXA 1A4JA 3NCCB 1FP9A 3BPOC 1QR4A 2YKLH 5TGBA 2NY4B 5KOMC 3RM8A 4PJBB 4MADA 1INQB 1NMCB 4MD5B 4MS8D 4YK4C 5ALCH 3WQBA 5HI3D 4OFYA 3DVFA 1YC8A 3B9DA 3E3QE 4E41E 4EI6B 3EGSA 3DJ9A 1O7SA 4GMSH 15C8L 1JVKA 4ELMF 4PJ5A 4MVBD 5I19L 2VRKA 3BKCL 4P2QD 1NBYA 5GRYA 1UB5B 1RUAH 4IS6A 2R7EB 2VISB 3D25A 4NQCE 1DR9A 3TTQA 4ZFZA 3HN3A 3PTKA 3RVUD 3TM6A 1JNDA 4JFDD 1IM3A 1C8PA 5C0RL 4JM4H 4CRPA 5IMKA 4IEFB 5GHWH 3QNZB 3UYRL 3T0ED 3LDBB 5JOEA 1NOUA 3MUIA 1C12B 4IMLB 2XQBH 1LK2B 5CKAA 2VCCA 5ACZA 3QFJA 4NOFA 5F88A 1G7QA 1WBYA 3VWJA 2OTUB 3MJ9A 3TBYA 3OLGA 2BVQB 1CR9L 4DEPB 4OZGF 3GXMA 5I1GH 3I02B 1K4CB 4TVPH 3W11C 2B7DT 1LL7A 4OGAC 1GAFL 1KWGA 4X6BA 2Y6JA 2Y6LA 3FOMB 5HY9B 4FQCH 2HVKA 3R8QA 4MTVA 2VSDA 3SQOH 4M1CC 4I1NB 3UDWA 1JD7A 2ZPKH 5A1AA 4JGUA 3LIZL 2WW5A 1N5YH 1EO5A 2UY6A 4FTVE 1V7ML 4KRNA 4PP2A 3MLYH 3U7BA 4ZO8A 1BD2A 5EBLB 3RUGB 4P8XA 3ARZA 5CHNA 3GMMA 4G5ZL 1ZLWK 3LB6D 2APWA 2AP2A 3GSNL 3ZE0E 1T2QH 5LCVL 3QUZC 1R3HB 3T3MF 2XN9D 3MGOB 3T2NL 3MROA 3R0NA 3UAJC 3I50L 1ZVSB 5E2UL 3V2AR 1I8MB 3NRUA 1H11A 3QUML 3L4VA 4D1IA 5ENWB 3MACH 5CXPA 3SCQA 1EFQA 4NPYA 4JFEE 3WO4B 5HYEA 3T08A 1EA9C 1BVLB 1XT5A 1FORL 3NBNA 2AI0L 2OX5A 3CDCA 3QEQE 3V6OA 3P9MA 2J12B 3UZEA 4MAUL 5KSUB 2R1XB 1ZT4B 3KS0H 2WBKA 4NO5A 1Y0LB 3MRCA 4MXWH 1DQJB 4DOHE 1UA6H 1NJ9A 1R85A 4KTYA 4QTHB 2OWXA 3S3SA 3BSGA 5A8NA 3SJVE 4S1DC 4WV1B 3TIDB 1M6OA 4M8QB 4F9PA 4GO9A 3EO1B 5FGBA 2FLBT 1D5XA 5J12B 2VLJE 5IOPA 3BZEA 4PJXA 5C7XH 2WN3A 3O8XD 5EO1B 1U8JA 4YLQT 4HWNA 3HJEA 3ES6B 1L6XA 5F8RC 3BQUC 4L8CA 4DEQA 1A8JH 1AQKL 1UG9A 2ICES 1T7ZA 3RGVD 4NWTH 2GAZA 5EFIB 4YDJB 5TE6H 3QEUB 2W47A 4AD4A 4FQXC 4YR6A 2MWCA 4MLIA 4ZFOL 1M71B 3GH5A 3Q2CA 4U1GC 5D1XC 3NCBB 1I9EA 5JHDB 1FL6B 3L4XA 1P6AB 4UZSA 2PWGA 1AY1L 4XUYA 1D7PM 2FR4A 1T83A 5ANMB 1ZS2A 3IFNL 1BTCA 5ALBL 4V1DB 4XPGH 5D1QB 5ETUB 3N9KA 2G60L 2NY1B 2Q3ZA 2G5BA 2ADIA 1R5WA 3I2CL 4BSVB 4EQ2A 3I2KA 4DN3L 4K2UH 2R69L 3M6DA 1UB6A 4NRSA 2IEPA 2IMMA 4DKFL 1QSFD 2AEWA 1XIWC 1ZHLB 2VLLB 5AWNH 3HZYB 3AMLA 4N5UA 3BDYH 3WN6A 3NABH 4I3GA 3LEYL 3D2UA 1RP8A 3RWFB 4JQVA 5GRXG 2J4GA 4NQXB 3BISA 2MJWA 1CLVA 3CSGA 4AZ5A 3FO0H 5L9DH 3N1PC 2ZOXA 5I1AB 4L8BA 4NFDA 2EJ1A 2R1YB 5TFSH 3FMGH 1W0VA 3N85L 4AISA 3VW3L 3IDNB 1AP2B 5ILTL 1MCFA 1VFBB 1GNXA 1Y18B 3CK0L 1GC1L 5E2WH 1HI6B 2H2PC 3OGOE 3ZJKA 4NSKA 3E1F1 1LD9B 4PS4H 3SDXF 3FJTA 1ITCA 4BZYA 4APQB 3IDXH 2XWEA 4GXUN 2GSGB 3CVHA 3GI9L 5IHRA 3SPVB 3VXMA 1MJUH 3LRSA 4KI5E 2YDRA 3W27A 1AGBA 1K8DA 1L0XA 4PRBA 1KT2A 3VXRB 5IFPA 4QT5A 1NUGA 2RAMA 4TRPL 2YA0A 3A6BL 3O4LB 4HXAH 1AKJA 2AJUL 3WMCA 3SKMB 1Z3GL 2BOBA 3VE0B 5B3NA 3O3EA 4NZTH 4QHLA 3P2TA 4ZAKA 3RY5A 1EFXA 3SDAB 4GINA 4F7PB 3D85A 1JBJA 4WI8A 1H0DB 1MHCA 3C60A 2AV1A 3FL7A 3LE0A 3BJ91 4LSTH 1XGRB 3HC3L 4Y4KC 4EI5A 4HAFA 3KPNB 3QDGB 2B1AH 4OMDA 4YUEH 2YB7A 3NIGF 4LLUA 2YG0A 4AG4A 1XMWA 2F8OA 1UYYA 3HG1B 3DMMB 5A6MA 5KSBF 5INCA 1E0OB 1A4KA 5K59F 4PJ8C 5F3HA 1XYFA 1HIML 4N8PA 4DKAA 3W0KA 3ULUE 3FN0H 1E1FA 3BZDA 4GMTH 2EXWC 4MQSB 1ZHKB 3BGFB 3U82B 3VXQA 1EDGA 2EO7A 4GWIA 2ZSWB 4U1LB 2PBOA 1HXYA 4HBCH 4JFFE 4JN2A 2UWFA 1JFHA 2XVKA 2BNRD 1GRWA 3WF4A 5DRZA 1S9VB 2QADC 1FL3A 3SGEH 4AQ1B 2D3NA 2P5WE 2D0FA 1KXTB 5DVLA 3FFDA 4JFOA 1I1RA 1AQHA 4X80L 3EDKA 2BSTA 3JUYA 4R0LC 1RUKH 3CDGB 3SCUA 5F96H 5D2NC 5CEXA 4I5BA 3ARBB 1IARB 2BFVL 4AY0A 3WH8A 3PWNA 2WV3A 4HS8L 4OGXL 5JIIA 1FZJA 1MRDL 1S3KH 4HX1B 3QRGL 4JO1L 3BYYA 3OPZH 5BQ7A 2H2SD 4JLRB 5EORH 3WD0A 3QUXA 4Q2ZB 2GDVA 6FABH 1D9KB 4M6ML 2OR8A 4YHPB 3NPSB 4QB6A 1LE9A 3TBSB 3WJLC 1UY2A 5CGTA 4KAQH 4UQBA 4DVRH 4OCWH 3VWKB 3C08L 4L4VE 4FZEH 3MUZ1 2DM4A 3RPKA 3W0WD 4F33A 3REWA 3SGJA 4N0YH 4LCIL 3S98A 5A6SA 1NDGA 5KVFH 5DGQA 2EKSA 4D0CA 1JGLL 3BAKA 1KB9J 4FK9A 4IRSB 4KRPC 4NUJA 4KK8C 3T65A 2X0HA 1EUTA 2D2OA 4FFYL 1BOYA 1IE5A 3VVGA 1UD6A 4P59L 2AW2A 5C09D 1CFTA 3HCVB 5TDPA 3FOLA 1UEMA 1DTUA 3HPLB 5L0QB 4LVOB 1QNOA 3JXAA 1RJZA 3SE8L 2IG2H 5TQ2L 1QPXA 4HWEH 4XPHH 3L9RB 3KHOA 2BRRH 4PTXA 4RGND 1SEBB 3V0VA 3QCVH 1MIEH 2L9LA 5TQ0H 2FB4H 4YAQA 4TTGA 1OIFA 1BLNB 3I84A 4H8UA 2DIAA 4DCQA 4HK3J 3IFOB 5EZIL 1LLOA 2BNUA 2CDGA 4JZJB 2DF3A 5F7WC 2M8XA 4HZ7A 4PJEA 4LPXA 4BYHA 4TTUA 3O2DL 5I1JH 4ZFFB 2O9RA 5KBNC 5GISL 2XNAA 2QSCL 4C56E 2WM0A 2YC1A 5EU6B 4OJYA 4YFLF 3G5VA 3KYKH 5E7FA 4GW4B 4AK1A 1FH7A 1T89C 1PAMA 1ZXQA 4G6JH 1DZBA 1HNGA 1PJ9A 4PGEA 3K80A 2V2XA 1HEZA 4QDSA 4FFZL 1FYTE 1Q0YH 4L5FL 2I9TA 2H32A 3CZFB 1YEEH 5F6IC 1TVHB 3QI9C 2AEIT 1CPUA 2I9LA 2F61A 3NN8A 3JBG7 3V95A 5CFHA 4HJJH 5CSGA 5EMYA 1IGJB 1TZ7A 1NPUA 4CMMB 2J1SA 4N0FB 1JHTB 3ZE0F 1Q6DA 2OQJB 3WL0A 3TJHD 4JPVL 3EO9L 4RRPG 4JFQB 4HUUA 2NR6D 1HJXA 1NGXB 1E40A 5FDWA 1KYOJ 4W5ZA 2IBBA 4QHUA 4HPOL 3HMCA 4G42A 5GXBB 2GT9A 1KIPA 2HJFA 3MO4A 5FHBL 1N7MH 2QR0A 4M03A 5H35A 1YPZB 4DAGL 1A0QL 3TJEL 1KEMH 2I25N 4O2EA 1ZAGA 3RPIA 2DWDB 2YBTA 2XIIA 1JGUH 5CUSL 1B31A 3KPMA 2D4DA 2F74B 1NC2A 5ABEA 4WGWB 1T3FB 1N5AA 4MDIB 1FGVL 3TO4B 3QFDB 1BAFL 5IB3A 3GO1H 5JW5B 1CZTA 2CGRH 2DM7A 2P8LA 3PIQB 5F71A 3CD4A 4NYLA 4D1JA 3D18A 3ORJA 3PWPD 5I8OL 2CKBL 4R4NC 2RCSH 2WBWB 5L88L 4Z0XA 1CLOH 3VFTA 4JY4A 3V5HB 2ZE0A 4WW1A 3U36A 3NA9H 3A4XA 2ZUWA 5IB1B 1PKQE 1XPWA 2WUBL 3RZCC 4DZBA 1OPGL 4OZIE 25C8L 1OB0A 1DBJH 4WEUD 4H7VA 1JWSB 3QNYA 4FRWA 3BAXA 2EDTA 2PCPA 4GAGL 3TO2A 4O2CA 5D5MB 3D6GA 4P5YA 2YD3A 4HUVA 1W72B 5IROC 1TZHB 5LGJA 4MJID 1U92A 2VITA 4LCWA 4ONGH 1NWUA 3F7PC 5GS2H 1T4KA 1ULVA 2DJ4A 4HG4K 3UROR 1JHLL 4NQVA 4ZS6D 2F5BH 4HV8B 4F9LA 5IEKA 5CEYB 2JIEA 1DLFL 2I07B 4YGVB 1CDBA 4WU7B 2R4RH 1OGAB 3B2UD 5E94B 4F58L 1E6SM 2CK0H 3DRQA 4XHJC 4MJ5B 1JNLH 5BVPL 3GBDA 3WBEA 1F4YH 4KMTL 1US3A 1RIUH 2NZ9D 2Y5TA 4HHAA 2AXFA 4G7YH 5HI4C 1P7HL 2JIXD 1BYCA 5D71L 5CILH 4OCXL 4JVPA 5GGRB 1BFVH 1S8DB 3BEVA 2WO1A 4HH9B 5FB8B 1UGNA 4OB5L 2VR4A 3H42H 3MRHB 4J6RH 1MRFH 2VDML 1PY4A 1S5HA 4NGHL 3TBTA 1FZOA 1Y7VA 1YMHA 4OLUH 3WUEA 4EN3B 1P69B 5IIEB 3VFRA 1M03A 2WMHA 2D7MA 1GGYA 1WE5A 3QHOA 1S7RA 4HTYA 3WD2A 4QDMA 4AW7A 5GS1A 1UXSB 1A14L 4Z76A 1GJIA 4IIQA 4P9HC 1MCWM 2NX5D 2V2TB 5DRNA 1QBLH 4RMQA 3C8KB 4RE4A 3WF0A 3FQNA 3L3IA 2R23B 4OLZH 3WIHL 5D9MA 3OAUL 3HZVA 3BPLC 4KI5F 5D7IB 2XA8H 4MNLA 3ZDZE 3ALWA 1OLLA 1LEKA 3UTQB 3ACHA 4QRSA 2ERJC 2QQLL 1FH5L 4YHOH 1FN4B 1HQ4B 2WBJA 4PR5A 3AU1A 1WUNT 3AROA 3IB3A 4N42A 1PQZA 2HAZA 3V7AG 3FB6B 5JDSA 5A8QA 3PL6B 1EXUB 1T0NB 3AREA 3LSOB 7FABL 2XFFA 1BIIA 4PB9L 3P6BA 4PBWD 3S6CA 3JV6B 1S9KC 1HH6A 1HK6A 4Z8FL 2CMRH 1MHHB 1I1AB 5FGCB 3MA7B 4AH2A 1Q6EA 2HN7A 3HI1A 1CD8A 1BGAA 3ULUF 4XUPA 3NGBB 5H94A 1LG1A 2DEPA 3VO0A 3RILA 1UWRA 2CDOA 1F8TL 5EWIH 1DQTA 3A0OA 2W1UA 3T1FA 3MBXH 5C0ND 2UV3A 5I71C 1E27A 3MV9D 4Y4FA 4NDMB 1EEUA 5F9JA 1A6WL 1I1YA 1Q9OA 2AJYH 5BRZE 5HYQA 5MP6L 1MF2H 1DN0B 1Z5LB 1FG2B 4CBPA 3U0TB 4MB5A 2ICEB 4YHYB 5I18H 1UR1A 4EE9A 3K77A 4S3KA 3WXWL 1KWKA 1J7VR 3ZKND 4U6XA 1NL0L 1LG2A 3KPSB 2V4VA 4ODSH 3NSXA 5AY7A 3WH9A 1KB5H 4PJ7E 3CFEA 1IMHC 5FYJE 3DLQR 4Z7VE 1W9VA 3TN0D 5MEND 4XCCH 5FIEA 4RAHA 5F1OB 2R8SL 5AAMA 4KGJA 5DFAA 3MLZL 3SDCA 4X9GA 2ED9A 2X0YA 2WABA 4HKXA 1I7ZA 3UCRA 3N50A 3EDDA 3AGVA 4PRHD 4B15A 1T2XA 4NKOA 4ZPVA 3E6HA 1GZPB 5FYJL 4HWBA 5A2IH 5E09A 1M1SA 2HMIC 2X1PA 3BLPX 4XNMB 1TVBB 4HH8A 5ERWA 5HJ3B 4OAWA 4FXKA 4GAJL 2QEJA 1V3MA 2HTLD 3BIKB 3PWJB 2J1UA 3MCLL 5DQ9B 4AYFA 1T03L 2OJEA 3MLVH 1FHDA 3ZZ1A 3HNTL 4RBPH 2NXZC 4OLWL 1B0RB 4Y5XC 4U33A 3QO1B 2VAAB 3OZ9L 3P4OB 5IF0A 4OIAA 1DQDL 1TLKA 5IQ9A 2WVVA 3WD5H 1DEDA 2B4CC 5EO0B 1D5MB 3NH7H 4PJGA 4MCYB 4K3DL 2C4XA 3H7BB 3OF6A 4MNHB 3JWOL 2AJSL 5E6IA 3RDTD 5IK3B 1E4KC 4Y16C 4J28A 4QRQB 3VXNA 2MSPA 5FM4A 3SCMA 1KBGL 2ZJSL 1QPPA 3E2HB 1B3XA 4L4TB 2GY7B 2JCCB 1DVFD 1S7SB 2CDEA 3GEWB 2C0HA 2J7DA 3PGDB 4ONHB 3TIEB 3NDYA 1XGPA 5M03A 1YNLH 4A3YA 5ICYA 1IKFL 2XYLA 3SBWA 3CZ8A 1HINH 3FKUS 4XP9L 3A6CL 3F7QA 4L8DB 4X4YB 3MMEB 5EUKA 5JXAH 2VABA 5C0CA 3K75B 2WWCA 4KVCH 4R26L 3UESA 3WELA 3JV0A 1TE1A 2APBA 1C7SA 4AEIL 2CBUA 5C6PB 4JPWL 1P1ZA 1EGJL 5L6YH 3UMTA 3X13A 4ERSL 2JB6A 3HE6D 3OR6A 4YE4H 3QDJD 2R0WH 3RM9A 1XH3A 3Q6FB 4MNJA 4N8CH 4X4XB 3H9SB 1M01A 1PX8A 1RI8A 1MY7A 4TSCL 1NQ6A 3MXWH 1F4WH 4HWUA 2VVNA 4LLYB 3V0AC 4XMLH 3NFNA 3GJEB 4PRNB 3T3PE 4X6FA 3GSQB 4XCFL 5CGYD 4MYWB 5EU4A 1KCVH 3QZWB 4YXHL 1WZAA 3PGFH 1WV7T 2A74B 1AIFA 2AEPL 1CDJA 2HH0H 4N9OB 3AHTA 3BN9C 1XR8B 2WVUA 3CFCH 4UU9B 2F53A 2A0LC 2Q3AA 1CI5A 2FYYB 5G04L 3HMXH 1CN4A 1EQCA 1AGFB 1A7OH 4PJBA 4JKPL 2OXGA 3DV6B 4MD5A 2Y06L 2EXOA 2IBZX 4KRMB 2YFZA 4P4KC 7TAAA 3VGFA 3QCUL 3N1QC 1QVOB 1DUZA 1CQKA 3CDYA 1J8HB 4WO4C 3O81A 5BS0B 2QMKA 4XNZB 3T0AA 1W9DM 3PZGA 4H8WC 1ISYA 4Q9RH 3HNMA 4C57C 3DC0A 1UB5A 2VISA 3G6AB 4OUEA 4AJ0A 5IFHH 3QZWG 1QACA 4IOIA 4DKDC 4WNQB 4RBPK 2IADB 1QFUH 3GK8L 4PRAA 3QNZA 3W5NA 1C1EL 1QNQA 3SCPA 3F7RA 1C12A 4IMLA 1XSJA 1MPAL 2PNDA 3RAJL 1GQIA 1BD2D 4M43H 3V6OE 3VTRA 3RWGA 2UZIL 1KB5B 2JEQA 4ZNEA 2OTUA 1VA9A 3MRPA 5F7DA 4YBLC 4DWHA 2VDQL 3I02A 1K4CA 3IJSB 3WFDH 1C5CL 2LAGB 2X4RB 4XVSH 3IU4H 3BWUC 2YL6A 3FOMA 5DQDL 2XZCL 5HY9A 1JF6A 1EXPA 3WEOA 3VIGA 3OGSA 4KKBC 4K94L 4PCSA 2Z8WC 3OB0K 1C16B 3ZMRA 4WUUD 3UJIL 1QRNA 3KJ6H 5HYJD 1NP0A 3QJFB 4OZHB 2X42A 3ULVE 2JK5B 5EIIB 3EDFA 3RUGA 4IHOB 5EOQH 2DDUA 3RHWF 2J6EA 4QRRB 5D7JB 1LO4L 4WI3A 5ADOL 3MGOA 3OJVC 3VXOA 4MA8L 4XP5H 1ZVSA 3ULVL 1I8MA 3L95B 3MOBL 5FYLL 4FLQA 4PSRA 4FS0A 1CGVA 1NCAH 2YS4A 5GIRB 4AYSA 1P7KB 1V3KA 4U1NB 1OAUL 5HGBB 4EXKA 2EH8L 3WDIA 4JM2D 4GG6B 4XPAL 2HT4D 2IF7A 1BVLA 2AV7B 1HXJA 4MXVF 2D31B 5FUZH 4HT1L 1P4IL 1B9ZA 2R1XA 1ZT4A 1B6DA 2J1KA 3MBEC 5CJOL 1OT5A 4XPFH 1CBVL 1Y0LA 3F4VA 1DQJA 3WENA 4GAYB 1MI5A 4FXGB 2VLRD 1AO7B 4QTHA 2OMNA 4IM4A 1I1WA 4WV1A 3TIDA 4X99A 2NY6B 2NYYC 4X9FA 4FLSA 2JFEX 2WB5A 5CMAB 1C93A 4UILL 5EO1A 4M62L 3NFSL 3QDAA 1JGEB 2WCGA 1Q38A 3S3PA 1L7TH 1ZGLP 3RJXA 1XGTB 5JQ6H 2IH3B 2RGSA 2HVJB 1ZANL 1JPSH 4YDJA 5EFIA 4CNIB 5CPTA 3QEUA 3T1WA 4WW2A 1OBAA 5JPMA 1M71A 5FUCE 2DMBA 1CF8L 2JELH 3SUTA 1FL6A 3NMEA 3A23A 1RHFA 3VXSE 1FAIH 2FEDD 4U31A 1W91A 2VDRL 4OT1L 2H1PL 5ANMA 3SDDD 3U7YH 3MU7A 5I74C 2DTML 1TJHH 2BSRB 1E71M 3FT4B 4M9PA 1MXGA 4V1DA 2XTJB 1V7NH 5CP3A 1DBAL 5D1QA 3TH4T 3VXME 1CXHA 1ZHNB 4NUGH 1C5BH 1HDMB 4PJAB 4BSVA 4BJ0A 4M3JA 1KCRL 5I15H 5A8MA 5IW6B 2FHFA 1WQVT 3KPRD 5ICXA 2Q86B 2HRPL 1JG9A 4QLJA 5GNYA 4QXUH 4W8JA 3CVHL 1JYXA 1ZHLA 2VLLA 3T77B 2DYPD 3HZYA 5DMYA 5GGTL 4CU9A 3OG4B 1IL1B 2KD7A 3L3JB 4PJFB 4CU7A 2RFXB 3VGEA 4WSKA 1GOMA 3EFDH 2IANB 3B2VH 4YHGA 3BWAA 3F62A 4Z7VF 4BZ1L 5HHPA 4E9LA 4NQXA 3HI6H 1QNZL 4RDQG 1CECA 2OL3H 2YWYA 3D69B 4DM1A 1UY3A 1OAKL 4P99A 4U1KB 4A6OA 5I1AA 4QXTB 4TX8A 2R1YA 4J2XA 2PBGA 1FFPA 1UJTA 4Z2HA 1EBPA 1TPXC 1AP2A 3IDNA 4Q97A 4JREB 1EHLH 1VFBA 1Y18A 1NCCH 2P1YA 1HI6A 4JKLA 2B0SH 1CZ8H 3KPPB 1CGYA 3VJ6B 1CE1H 1ZV5A 1LD9A 3BKJL 1KV3A 4APQA 1U33A 2VL4A 1FHGA 2GSGA 5DC0A 3SPVA 4U1JB 4TNWF 1YYLH 1TETL 2D1ZA 4LLVA 1UYXA 3VXRA 4PJ9D 1WITA 4J27A 2X9YA 3NZHH 3APGA 3K8MA 2J7MA 5C0AE 3SKMA 5LVEA 3IDYC 4ODVL 4CL7A 5IKCB 3VE0A 3KR3H 3O9NA 2EC9T 2LU7A 1H3UA 3SDAA 5ABDE 1FFNB 4F7PA 1QG3A 3D0VB 2DQTH 4L9DA 1FC1A 1M7IB 3CLEH 4WENB 1H0DA 4BS0A 3T0VA 3L5XL 5IM7B 4D9LH 1XGRA 4Y4HD 5ABFB 1S7WB 1QI5A 3KPNA 2V7HB 1HH9B 3QDGA 2OZ4L 3VDHA 3DMMA 2LFGA 2UY3A 3MUJA 3VFGL 1MCHA 4NQUA 2D4FA 1AFVL 1Q8MA 3OIHA 1ZHKA 3TGXA 2ZSWA 4U1LA 1X5XA 4EKXA 1O5DT 3O6LH 5FUIA 3DROB 1EEZB 3VI4E 1S9VA 1H6XA 5FUOL 3V52L 1UJ3B 5B3JF 1R3KB 1HKKA 3HUJB 4LBEB 4UQ3B 5ESAB 1XCWA 5LA2A