4BQXA

Hif prolyl hydroxylase 2 (phd2/ egln1) in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords EGL NINE HOMOLOG 1
publication title Selective small molecule probes for the hypoxia inducible factor (HIF) prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4bqxA00
4BQYA 4KBZA 3MGUA 5LBCA 2HBTA 4XACA 2JIJA 4NAOA 4Y5SA 5LATA 4UWDA 4NHKA 4BQWA 3PL0A 2OPWA 4XAAA 2RDNA 3GJAA 3DKQA 2Y33A 2G1MA 5IATA 4NMIA 2FCTA 2FCUA 2G19A 3ITQA 3NNFA 4MHRA 5DAWA 5L9VA 4J25A 4XC9A 5LBEA 5DAPA 5EP9A 3GJBA 2Y34A 2RDQA 3OUJA 3NNJA 5LBFA 2A1XA 2RDSA 5DAXA 4ZONA 4NHMA 3NNLA 4BQXA 3KT7A 3HQUA 3EMRA 5IAXA 4NHXA 5LB6A 3KT1A 5C5UA 2V4AA 4NHLA 4XCBA 4JZRA 2RDRA 5DAVA 3OUHA 5LBBA 3BVCA 5C5TA 5A3UA 3OBZA 2HBUA 2JIGA 4IW3A 5LA9A 3OUIA 4Y5TA 4XABA 5LASA 2FCVA 3HQRA 3NNMA 5DAQA 4ZPIA 5IAVA 3KT4A 5HV4A 3W21A 5EQUA 5L9BA 2RG4A 5HV0A 5M0TA 5EPAA 3GZEA 4Q5OA 5L9RA 4MHUA 4NHYA 3W20A 4XCAA 5ERLA
chains in the Genus database with same CATH superfamily
4QXKA 3WW1A 3ZN6B 2YPDA 4BB3A 1VBC1 1W8NA 1JI6A 1H1IA 2JE7A 4M3CA 4PI2A 4FPYA 1Y4WA 3AXEA 5JXJA 1YJLA 2KM2A 4ONUA 1EV12 3VDDC 1XOYA 4XTPA 1SEFA 3ZDSA 4MOAA 1CN1A 4PJYA 1FNYA 2VCMA 3S7IA 5DUWA 1UY0A 4IXLA 3M70A 4QQLA 4MGYE 4V2VA 4AVCA 1PM4A 1YI7A 4UW5A 4N43B 1V6JA 5I0UA 5KHGA 5FFOC 4UF0B 5EJZB 5IFTA 1OQ1A 1KEXA 1QXJA 3K2OA 1RUF3 4I0AA 1WW5A 5L9VA 3BODA 2PTMA 3HNMA 2PHDA 4Y22B 2Y6FA 4LE3A 2GDFA 2VNVA 4ASKA 2VUCA 1BHGA 4ES8A 2WLQA 1L3JA 4NWVA 3ZYBA 3K4ZA 1WLTA 4CA9A 1QJX3 5KXEA 4FPJA 5ABJB 1VBA1 5FTTC 2VBBA 2G9ZA 2DFBA 1YQ2A 2CV6A 3O1SA 1OLME 1KS5A 3LEGA 5I8YA 3BU0A 2WDBA 2XJTA 3VHOA 1DQ4A 1VALA 4H7LA 4C1XA 1GP6A 4WM7C 3KT7A 1BEV1 5FRAA 4FFIA 3KD4A 1RUD3 1LHOA 2DDUA 2WJSA 3U75A 1FT9A 3ZIXA 4CDWB 5BNNB 2DWRA 3WQBA 3WVJA 1FYUA 4IGQA 3VZJA 2IXIA 3I3QA 5A1LA 5DDJ3 3CJIA 5FBZA 4A6SA 4LTAA 3M7AA 1D4M3 2P1BA 2VMGA 4ES9A 3TB0A 2VMIA 3HIFA 4OYUA 4MUVA 4OVEA 2C9AA 1X7NA 2HWC1 3WG1A 1KDMA 1MQTA 4XJUA 4RHV2 5EYXA 1OHFA 1I3HA 4B4QA 5LWBA 2YG0A 3TNQA 2RR12 1W6NA 3WDTA 4FP2A 4IDZA 2XBO3 4MV2A 1W6PA 2ARBA 3AMPA 1QWRA 1AR63 2V4VA 3THPA 3WP3A 1QJZA 1ND3B 2XVKA 3OOXA 3R4SA 1GMMA 4OUSA 1RC6A 3ZR6A 1C1LA 1ALYA 1NA1A 2GAUA 2H0BA 4R4ZA 4SBVA 4ZXKA 3T2TA 4D3WA 4Q4W1 3LPFA 1CX4A 2GC0A 1QJY3 1RHI1 2ZOEB 4OUMA 1MZ6A 2JXAA 4ZU4A 3GBWA 5I0TA 3OSDA 1G8WA 1JZ8A 4FPGA 3N7MA 5EQUA 3RWKX 2RG4A 4BOWA 4A3ZA 3I2IA 5FZCA 1VBB3 1B35B 4PF1A 4FP3A 4BA6A 1ZRDA 1JOJA 2DU1A 4LIUA 1RUE3 2A6VA 1QJX2 4DZGA 1KJRA 3B9CA 5IWFA 1UXXX 2AYHA 3FHIB 4QQ2A 1C57A 1N1TA 3AKRA 3HJRA 1N3PA 1LOCA 3PVBB 3FBMA 2JG9A 3H3ZA 1UU6A 3JZVA 5DZGA 3RZLA 1UIKA 3AKSA 3T0BA 3WUDA 4HSLA 3V0BB 2BOIA 4ITCA 3NV2A 1RUD2 4XIKA 2Z5WA 1BBT2 4YZ4A 2YFUA 4YVWB 5LATA 5T5OA 2Q8CA 2L9LA 5BNQA 2AZ5A 4QHOA 1URXA 2C6SA 4MXWA 4LBNA 5DDJ2 1W6MA 2WZEA 5C71A 2BGCA 4QM9A 2C9KA 2CAUA 3C2UA 1W8TA 3B01A 1I1EA 1GOHA 3ZMNA 1D0GA 1CIYA 2HEVF 2ARXA 2YZ4A 3MLKA 5IHRA 4MG2A 1HQLA 5A32A 1ULCA 3ZPYA 4UW3A 5IK8A 2WS91 3NNGA 2ZHNA 4ET7A 2AEYA 1QOSA 2BZDA 3LWCA 5K0UA 3H9AA 2JECA 3B3QE 2XBO2 1WA4A 4LR4A 4N53C 4RFT0 2BUKA 3IAPA 2RS32 4FTSA 1Y43B 2DCZA 2IXLA 2OT7A 2Y6GA 4LO7A 1HLCA 2VJXA 3SLIA 3THTA 4AVTA 2FDHA 3NNJA 2D3RA 5GALA 5DG2A 1DZTA 1OLRA 3H0OA 1QJY2 3ZYRA 2Y6KA 3HN1A 2RS53 1AR93 5JR7B 3DV8A 5T54A 1J1TA 5J98B 1OMIA 3O1RA 1KJLA 1U5YA 2ZGTA 3BALA 1UPSA 4KBBA 3VZMA 3LZZA 1VBB2 4BQXA 1AVBA 2EIEA 2WNUC 1RUE2 3EBRA 3WHUA 5BXXA 2XONA 3U14A 4D7SA 3AMHA 1XPWA 4WVZA 3CBNA 2D43A 3ZYPA 3VDAA 1QQP1 1YUDA 2X10A 3LSDA 4XCBA 2J1EA 3FFQA 1ZBA1 4GA9A 1RUH2 2CGOA 1QMJA 3HPNA 2PN5A 4OI0A 5A3WA 3OCPA 5LBBA 1AR73 2E31A 3TAYA 1S0IA 4UFMA 1W0OA 2BOJA 1DYKA 5C9AA 1HB1A 1LOEA 1W8FA 3MPBA 1HKDA 4OI1A 1JZ7A 1RUJ2 5IK5A 2JIGA 4RR3B 4LLFA 1KGYA 2WINB 2EAKA 5F5AA 5FY8A 5FZ8A 4HXCA 4UFJA 1NCRC 2AEZA 4UFKA 1VMJA 5FZEA 5T3NA 4Y26A 2BP6A 1OOPC 1H6XA 3I3MA 2W68A 1NKGA 5C7GA 3AC0A 4UFHA 3ZXGA 2UU8A 4Y4YA 1HRI3 2VQUA 3CKHA 2A73B 3HQRA 4AQTA 5I93A 3AZVA 3ES4A 4PBOA 2RM23 4XFHA 2E53A 1PNFA 2JICA 1O8SA 3GBGA 4E4SA 3NAPA 3W21A 4P9LA 5KHKA 3OF1A 3AYDA 3BIEA 4LKSA 3BOPA 5FQ0B 5GZDA 3SH5A 1UU4A 4I0WB 3ACFA 2QTWB 4CEWA 3MIGA 5AVAA 1XE0A 1NLSA 1UPIA 3OGRA 5D8AC 2HBUA 3G7DA 4HK8A 3RMYA 3U37A 1LEDA 2E7QA 3AP6A 2KD7A 4I01A 4LIVA 2ZCWA 2W1UA 4XUTA 2Q1MA 2IXKA 3VBHB 1RUG3 2CSGA 3LEMA 4BCUA 5HCHA 2PLV3 1NCQC 3VBOB 4JAAA 1OI6A 4XHBA 2XQRA 1F8VA 1EAH3 1Y9QA 1PVC2 2OS2A 3ST7A 2ORZA 4LK7A 4P5YA 4C1WA 2ZEYA 1KS4A 3WOGA 1WW6A 4QXHA 1IKQA 5A7SA 5IVYA 1AR72 3MPPG 1W2TA 1CQ9A 2R6QA 3GZUC 2BU9A 3M3OA 1LECA 3I3EA 5JIUA 4L99A 1VAVA 2C1FA 2V09A 1WLCA 1X33A 4NMIA 1R091 1RXFA 1TG7A 3IMMA 5B4NA 1R082 5GM0A 1VAKA 1BMV1 3N9PA 2GC1A 1WUVA 3PUIA 4Z8BA 3I59B 2BWAA 5DAWA 3I2JA 2ZKNA 1H0BA 1O6UA 4M4PA 2ZZJA 2UYAA 1ZZCA 4K8RB 4LPLA 4WV8A 1U0AA 2R16A 4W50A 1H6YA 5HCFA 4ZZ8A 1HJFA 4R8HA 3WNOA 4YGCA 4CEYB 4FXKB 2VZVA 4JQTA 1HRI2 5FPBA 4FQZA 4L92A 3CHXA 3RG0A 4QPIA 2RM22 2RDSA 4COVA 4TZDA 3AM2A 4HVRA 5IVJA 2GN7A 3MIDA 4ZONA 2BVVA 2D98A 1J59A 2X5IB 2ZACA 2GN3A 3WZ1A 4OFGA 1CAUA 1J83A 2LM3A 1IPSA 1X8MA 4NIGA 3WNLA 4QU2A 1G9FA 4JGZB 1ZVFA 2W95A 2PQSA 2ZGNA 3J7HA 3KZ4C 2OXBA 1UL9A 1OOPB 1J1LA 5C3QA 1CAVB 2MHFA 5IK4A 1O3SA 4RS5B 4QAWA 2I2SA 3HBZA 5JIAA 2WFF1 4B7KA 5I0DA 1RUG2 2A5ZA 2J42A 4FFGA 4RQPC 3H8XA 1GZCA 5F1RA 5FPXA 1REFA 1SMVA 5IUQA 2IZWA 4LBMA 4NOTA 4C0HA 4YW5A 1ULPA 2KXLA 1BYHA 3H8OA 2QFEA 3S6PA 3KV5A 3S57A 3B5LB 1ZZ8A 5HBAA 3NVCA 2QQLA 3B02A 4JTOA 1U5ZA 2DURA 1V6IA 4HN0A 3VBUA 2H6CA 4PHZA 5C8WA 5FWEA 5CKNA 1EV11 2D40A 3BCWA 1EPWA 4Z2AA 1ULOA 3DN7A 1A78A 3GXUA 4XABA 5FY9A 4C0BA 5J36A 4LBQA 1QIQA 3VKFC 1LNSA 3V64A 2QE3A 1TVGA 3LDBA 2R49A 3W5NA 1H1MA 1EY2A 2VW1A 4FBFA 1K12A 5G04L 1S0CA 1PO23 5CG8A 1TNFA 1SCRA 4BIFA 4OHZA 2ZX4A 1V9U3 4DRVA 3DXTA 3OPTA 1NY72 2XH6A 4WM8A 4BMEA 5FZ3A 4D8MA 2JENA 4Y1UA 3N9MA 1Q5OA 5L9RA 5JOZA 4Q4V3 2YROA 5F37A 3PIGA 5FLIA 3MI8A 1BZWA 3PVOA 4JCKA 4PDWC 4U2AA 2X05A 2P37A 1XBFA 2VE1A 2E9QA 3QACA 2ERFA 1C1FA 2VZ1A 2XB6C 1H9WA 3K51A 1C3HA 5FPAA 2FQPA 2QVSB 2YBKA 4WZCA 5T5JA 3H1YA 4H3WA 4RGKA 4AEDA 5CAZA 2C0ZA 1VAMA 2E7TA 4TN7A 4YRDA 5G05L 4AGGA 1V6NA 2WNVA 5EFUA 4AF9A 1EP0A 4R4XA 1K45A 4CDXA 4Q1PA 2DTWA 2IXJA 2WBKA 3C7EA 4CCNA 4CPBD 3KV4A 2Y33A 5KXDA 4IEWA 1K5MA 2TNFA 1XSRA 4AI3A 4JDMA 3S0MA 2FZ1A 2DF7A 3OD4A 2FD8A 4GIQA 1OQDA 1IPKA 1HV0A 4Q2FA 1QKQA 5FZ0A 1LAJA 5FLJA 3TEXA 3MV01 2NMNA 4JVAA 3FE5A 3IN9A 1HRV3 1W9WA 2Q30A 2Y0IA 3KS7A 4YZ3A 2W39A 3GZTB 4EWDA 1X36A 4Z82A 3WQ0A 4EV0A 2P3JA 3UNPA 1XYNA 4XQDA 4NPMA 2QZ3A 5H9PA 2XJPA 1ZNPA 5E6HA 1D2QA 4FTEA 2ILMA 2RR11 3CJIB 2OVUA 5LBFA 2R073 4LE4A 1PO22 3HT2A 4O61A 4YVSA 3AB0A 1Z0HA 3JB8A 4JDOA 5FLHA 2OYZA 1QNWA 2ZMKA 5T5LA 4A4AA 4BZ4A 1DGRA 1GFF2 1BJQA 4P9WA 2K2SA 4YW4A 2VVFA 2R1DA 4B29A 1S2EA 1W6NB 2GMPA 3RMXA 3ZN4A 3BN6A 3GALA 2YGLA 1CAWA 4GWMA 1MS0A 1UNBA 2CL2A 1W90A 2ADDA 1DQ0A 2ZEXA 1WMXA 4KG0A 3MV11 2JG8A 4ZS3A 4LNVA 4B7EA 1QNYA 3AP7A 4YG0A 3U4XA 1QJX1 2AUYA 1Z7S3 3KF3A 3URFA 2ZGUA 3AVSA 4A41A 2HWD3 2W47A 4ZZ5A 5A3UA 5H9SA 2XOMA 2YXSA 4RYDA 4QGMA 1DCSA 1VBD3 4WZFA 1WKYA 2WO7A 4XFAA 3IIIA 5CFDA 4AGVA 1RUD1 4UOJA 3KCYA 1HW5A 1JYCA 1BBT1 1V6OA 3AZWA 3DF0A 3FX3A 5T50A 4EWAA 3VBFA 2GU9A 1S0JA 2WO3A 2WNOA 4CP1A 3MEPA 4AI2A 1SQ4A 2JDAA 3KVAA 2RS13 1NT0A 4GJZA 4H2AA 4QQPA 1UX6A 4S2HA 5EYYA 5L73A 3GHMA 4CUBA 5DDJ1 4M4RA 3WLUA 3S5AA 3N36A 1YIPA 2XGXA 5GKAC 1RUI3 4IEXA 4I0BA 4AL9A 1KQRA 5AC92 3B93A 4UBGA 4YZ2A 4G4FA 1OLMA 4IV3A 1J3RA 2Y8KA 1UZWA 2XHNA 3WCSA 4ATEA 4C8DA 1UX7A 5JPMB 1XNCA 5F3IA 5EPAA 1KITA 2HWE3 4MXWB 3ATGA 2WA3A 2VR4A 1W6MB 3BTZA 1V70A 2XBO1 2E7AA 1HB2A 2G9GA 2R072 2HWF3 1XNDA 2Y64A 4QB2A 1AR61 2RS31 4GAZA 1NXD1 3PJQA 5FZ9A 4E4DX 4EN9B 4BWOA 2VMDA 4LBLA 5A32B 2VECA 1QJY1 4P9YA 1ZZ7A 3CO2A 4EJRA 4Q0SA 5K0UB 1OT5A 2ZGLA 2GSYA 1A34A 3OBTA 4Q1RA 4BPZA 4OHYA 2XKPA 4NAOA 1PX4A 2ZX2A 1ND2C 4QX2A 1WD3A 1HXS2 2EF6A 4OI2A 1VBB1 1DGRN 4BQWA 5F5CA 3IB3A 1R64A 4PF5A 1RUE1 4MGZE 1IS4A 3OBAA 3G6JB 2XL9A 2HLEA 4XAAA 1Z7S2 3C7HA 4WVWA 2XVGA 2HWD2 1VJ2A 2Q4SA 2VVEA 3POJA 2ZABA 5DUUA 1W2OA 1VB2A 2Y6JA 1POV0 1VBD2 1RUH1 1XNTA 2ZEWA 3KHBA 3RI9A 3ZKYA 1WMDA 4P08A 4E8CA 1F4AA 4QDSA 4JV4A 3R4DB 5FYHA 1AJOA 3I54A 3SH3A 2RS12 1W8ZA 1RUJ1 5B4XA 4DB5A 5CFCA 2PA7A 2RJ2A 1YNAA 1YFYA 3JBG3 2OQ7A 3LFIA 4QB6A 3VKOA 1A8DA 4XHXA 5FYZA 2ARCA 5C9AB 3OEAA 1VBE3 5D21A 2UWCA 3AJYA 3POYA 2HWE2 3AL6A 5FMOS 1DQ1A 4YG3A 4DQAA 2HWF2 2FHRA 4GWNA 2CY6A 4CUCA 3LCPA 4CXXA 2BNOA 2CNAA 4AVSA 4QPGC 2XXZA 4I3GA 4Q29A 1ODMA 3PDQA 5FY0A 1UKGA 2EXKA 2Y0OA 1WMFA 1HV1A 4XOGA 4AQ2A 5A6QA 1GKBA 3WR0A 4WVMA 3NAPB 5JSRA 3FL7A 4XFIA 5LA2A 4XMAA 4CVUA 4RD7A 4N43C 4CCCA 3RRDA 3WW3A 4FFFA 1GLHA 4CEWB 4PI0A 5FZAA 3ZXAC 1OQEA 1CPMA 1PVC1 4AVVA 1IGOA 2GC3A 1YFUA 1DG6A 2Y26A 5LASA 3IAQA 3RI8A 5JAXA 1BKZA 4YPJA 1UMZA 3WV6A 4DRRA 1AR71 1D4VB 2Z69A 1E5IA 2WZ8A 4NIIA 5CB7A 5FUPA 5J1XA 4K20A 2IVIB 2O8QA 3E1F1 3KVBA 5ABJC 1GSLA 1WLWA 4HK9A 4O9EA 4DEQA 4QKBA 4DUVA 1UXZA 4XUOA 1HDKA 1S0EA 1R081 1TEIA 3H7YA 4FPKA 2I74A 5GLTA 3ROUA 1NZIA 4YM2A 5FIXA 2WWUA 5F6LB 1RJ8A 2W5FA 3K75B 4LHKA 3T09A 1PO13 2QQMA 2R30A 4FI9A 4EZHA 2WC2A 1POV1 5ERLA 2ZZQA 1VBE2 5CU1A 4D0QA 5I0RA 1LODA 2B5HA 4LEJA 4QDQA 3U78A 4CDWC 5BNNC 4K40A 1HRI1 1SDDB 4HFSA 4KU8A 5BYNA 3BU7A 1YQCA 5L7OC 3M2MA 1O3TA 1KDKA 1F5JA 2RM21 3TRSB 4BK4A 3WD5A 4LA3A 3IBMA 1CZSA 4J1XA 1ZM1A 4QKNA 3ZMOA 4E4HA 3E6CC 2HWB3 1NZCA 1RJ7A 3VD3A 3CMGA 4B8EA 4D69A 1BK1A 4COYA 4DMIA 3NWKA 2WT2A 4HLTA 2DCKA 2UYBA 1XB9A 2YFZA 4UW6A 2F6BA 4W6XA 4CDUA 1S55A 3DPRA 4QPIB 4HG6B 1NQDA 4AQ6A 2XJSA 1QHDA 2IWGB 2VOTA 3K46A 3GCWA 2FZ2A 4SLIA 1RVF2 2IFWA 4MGIE 3T1MA 2QQIA 2J1TA 1ND3C 1CAUB 1RUG1 4P9GA 1AR83 3GHNA 3N4MA 1PX3A 3VHNA 5I8SA 1BLZA 1MR5A 3M8LA 4CRQA 4B3NA 3M1HA 4W8JA 3P3NA 2VTFA 4TSVA 5BNOA 2QBXA 3I2DA 3NJYA 1JZ6A 4QPGB 3VD9A 3LIHA 3HEIA 4ISRA 3MIHA 4AQSA 4XQ4A 1LHNA 3TYJA 5FCCA 5IVBA 2Q8DA 5A6YA 3OGJA 2FDGA 1PNGA 1B35C 2A1XA 4YYOA 3KM5A 4NRPA 5C8CA 1TME3 1S0BA 3O0WA 3WG4A 4N7IA 2VCCA 4IE4A 4HKLA 4UFIA 5A33B 2VW2A 4XZUG 3M3EA 3AKQA 1JS9A 1TMF3 1YQ5A 2CHHA 5F32A 2GC2A 3ZR5A 4AI9A 3HQUA 5A3TA 3PMSA 1NLRA 2A75A 1OVPA 2N7GA 3VBUB 1PO12 1WWYA 2LS6A 2P6CA 5DZFA 4BMBA 1V0AA 1AZDA 3ASIA 5JXHA 4NIHA 3IZOA 1UZVA 2V5YA 1NY71 4YVWC 4LBQB 1PMHX 1CWPA 3ZPOA 2FDKA 1AXKA 3LSEA 3I2GA 3WEZA 4CXYA 3S7EA 1HIXA 2QQWA 3N7KA 4NROA 3WP4A 2CDPA 1N3QA 5FXVA 3T2OA 4WM8B 2ZHLA 3HWJA 1NE4A 4LJHA 1PIV3 1UMIA 1LOFC 1HJGA 3HVDA 4CE8A 3SHRA 5A3MA 1OUXA 2GNDA 2YYOA 5FYYA 5C4WC 2FDJA 2VCAA 5E88A 2VU9A 2J1RA 1W8WA 4PIXA 4PCRA 1HX6A 3SCGA 3N9QA 4DNYA 2A70A 1DGLA 1CIWA 1POQA 3NNMA 4AFMA 3W59A 3ZM8A 1W06A 2VMFA 4AEDB 5L7OB 4HOOA 5IAVA 5JSOA 4LA2A 5A7WA 1H8TA 5BNPC 3A0KA 4WVVA 2D3SA 5HV0A 4KNCA 1T6BX 1R1A3 3J4UH 4A3XA 3ORJA 1NG0A 1F5FA 2Z42A 1AJKA 3VBSC 4XBQA 4AR2A 4CDXB 5LEKA 1SHWB 1LJ7A 4HKWA 1TME2 1DQ5A 1ULFA 3S5QA 1JMUB 3T4VA 5BUVA 1UN1A 2ZGQA 4AFBA 4HVQA 2IFRA 2BDRA 1SFPA 3MGUA 3ZXJA 2A3XA 3DYPA 4QX3A 1KXGA 1C5IA 4F3JA 2AH2A 2YDEA 1PO21 3VBRA 3OJBA 3WW4A 4QDRA 3PTRB 1RUF2 2XLGA 5FZBA 4LMFA 4LUKA 3LFMA 2J7MA 4FPOB 5FY5A 2VOWA 1APNA 2EICA 5L36A 3AP9A 4XUNA 4MGQA 1U5XA 3OEBA 4RR3C 1SPPB 2J1SA 2W94A 2XLAA 4GZ9A 4NPLA 2XJVA 1COV3 2W1WA 4YVSB 3O1MA 3N9OA 1SBEA 1GYKA 3D8CA 5FMOL 4K1YA 1ASJ3 2OUJA 2O14A 3PVNA 3VL9A 3K3NA 2BW8A 1L7QA 2YY1A 4HVOA 3UKNA 4LHNA 2VGDA 4FPHA 1CAWB 4MX3A 4OZOA 2R063 4XC9A 1SCSA 1SDWA 1GICA 1SG3A 5A3PA 2MPFA 1X50A 3EHKA 4OULA 3ZYJB 1ZX5A 2JG8B 4Q8LA 3UESA 1D0HA 3KLSA 1FXZA 5F2WA 3UK9A 1UD1A 2E33A 2WO1A 3LE0A 4E2QA 5GZEA 4XF4A 3ZIWA 1UF2C 2ZKLA 1C8NA 1D4M2 5HCAA 1S0GA 4URTA 3QH7A 1XRUA 2XKOA 1R1A2 5EIYB 3OY8A 3MF6A 5LY1A 5A3LA 3GBFA 2VZSA 1W9TA 2JD4A 1LHVA 2PMWB 3RSJA 3M4FA 1AXZA 3VBHC 4AFDA 5AC91 5I0SA 5A3NA 1OLQA 1H2NA 1WLDA 4KG8A 5LA1A 1OC1A 4QPYA 3VBFB 3VBOC 3ACGA 3ETPA 3KT1A 4QXCA 5C4WB 1BQPA 2XWJB 2ZX0A 1XXNA 3AVRA 1AR62 1V6KA 2RDRA 3A23A 2GH8A 4YM3A 1GBGA 1WBFA 1KFUL 5ACA3 5FP3A 1JN2P 3O1VA 1JTZX 2R071 3HR9A 4LOTA 1RUC3 5CKMA 3P6BA 2J1UA 4ASLA 3AYCA 3USSA 1PK6A 4IV3B 4IEYA 4AI0A 5BNPB 1CJDA 2HEWF 3AK0A 3C7FA 2CU5A 3RDIA 5FJKA 2D93A 4O9GA 4UW4A 3ZKUA 4CU7A 4BDVB 1O91A 4XF9A 1H2LA 1AHSA 4XQWA 5H9QA 2H0VA 3SNMA 3P3PA 5LA9A 2PHTA 3VBSB 2O0OA 4CCDA 1RUOA 3H1MA 4CDQA 1G9CA 1LB2A 2D3PA 1VR3A 4K8FA 4COZA 2F4PA 1SLBA 1HXS1 2FMDA 4LKFA 1RB8G 4DOUA 4Y3OA 4CCEA 3M3CA 4OUEA 4CEYC 5FJHA 1Z7S1 1YCIA 2GP3A 1R1ZA 1YC61 2DCTA 4XJWA 2HWD1 3H8RA 2VH9A 2W2IA 2ZX1A 4MO3M 3ZFFA 5F7UA 4HL0A 4ATFA 5FZ6A 5JXGA 3JD73 1BXHA 2VZUA 5JUVA 1CAXA 1VBD1 2W1QA 2X5IC 3PTYA 4YG6A 2VQAA 3R4UA 5HXVA 5IVEA 4LO5B 1OA4A 2DVGA 2VMCA 3MIBA 5FMDA 2ZEZA 1W6OA 2EIBA 3W20A 2Z2SB 4JDNA 4JGZC 4CCJA 1JYNA 2RS11 4DS0A 4IE0A 5K4LA 4NWWA 5FKCA 1W3VA 3PU3A 3WX5A 4RS5C 1DQ6A 3O14A 3BOWA 3T4HB 1Q8QA 4ARXA 2YB7A 2WYSA 3AL5A 2QNKA 5JI9A 3CDZB 1IHMA 4L9BA 4D7YA 4MGTA 1UCXA 2D6MA 2C26A 3IWZA 3SMHA 2HWE1 3L2YA 1Z78A 4NIAA 1REEA 3LAGA 5ACA2 1PGSA 4TWTA 5KXCA 5CFCB 3E6BA 1GP5A 4OLLA 4QT6A 2HWF1 1K3IA 3NL1A 4HT1T 4IV1A 4XF3A 4TTGA 2YUEA 1WW7A 1T6GC 5CBLA 5A70A 1AYN3 1AR92 2EALA 2BTVC 2RS52 3ENRA 3LF7A 4IERA 3SQOA 4XW3A 5KC6A 2EA7A 5DMYA 4XURA 3NJVA 2C5DA 1NUKA 5F6KA 5KHHA 4XMIA 5C3PA 5J37A 3Q8AA 2VTXA 4RA0A 4E2SA 1UO9A 3RYKA 3AFKA 3PUAA 1W0NA 1SZBA 4GKYA 3DYMA 3KMHA 2P3KA 5GZGA 1ZZ6A 3WHTA 1RXGA 3ZFEA 3ZLIA 4DPNA 4IEZA 2BGOA 3ZDVA 1FAYA 4XFGA 3VGIA 2VZRA 1H2KA 2VZTA 2WAOA 2IXHA 1US3A 3AKPA 1F15A 1Q3EA 3LOIA 4WVMB 4FOYA 2JDHA 5J7MA 4KGGA 3UETA 3JD72 1Q8VA 4IEPA 1Y3TA 2YC4A 2DV9A 2PHWA 3POIA 4N9IA 2XDVA 4Y24A 2DUPA 3UJQA 4HZFA 2PAKA 2WYFA 5CG9A 1BVVA 4COUA 1AF9A 3P5BA 5A80A 4F8AA 2XUEA 1HB4A 3WW2A 4MYEA 4LBQD 1O4YA 3AZZA 3MFCA 5C5UA 3F95A 1ZRFA 1JYVA 2RJLA 1RL3A 2LALA 3H42B 4GH4A 2TUNA 4ZS2A 3JBG1 4ZXEA 1ZZBA 2GNTA 3D0JA 4S2FA 3T2QA 4EROA 4A45A 4D6RA 1VBE1 3ZXDA 3LEKA 2WQ4A 3ZFGA 4AI1A 1ST8A 3HN3A 3GNEA 3FBYA 3C7OA 4BJ0A 4PIYA 1ZZ9A 3ZVXA 1LOGA 4CP2A 1D2SA 2P3YA 2SLIA 4LQRA 3RFRA 2FDIA 2AREA 4KWKA 4BXSV 4Y5TA 3K77A 4GMP3 4CCOA 1N1VA 1L7RA 2JWPA 2LRPA 5DPNA 5GZCA 3CLPA 2VBPA 3R0RA 4PBPA 4TYSA 4K1ZA 2ZXQA 4RGGA 5F39A 2WQ8A 3WUCA 3CL1A 3CJIC 2J1VA 3LA3A 4XIOA 5FYVA 2PLV2 2NM1A 3C8XA 1UZ0A 4AG4A 1RVF1 1OVSA 2BNMA 1EAH2 2BRTA 2W08A 3SKVA 4JGYA 2JDPA 3MLJA 4DFSA 1PZ8A 1ULDA 4AHYA 3AJZA 3IDEA 1MQTC 3KV6A 4KGQA 3MLLA 5LY2A 2QQKA 2W3JA 2ETEA 1HN0A 2C24A 3DPRB 3ELNA 2R043 4HMZA 3AMNA 5FZLA 3T08A 3PNAA 4G9SB 2W9XA 1NXMA 3J7MA 2VAUA 3WDWA 4FXGB 4AK3A 1IG0A 4XFFA 4NRMA 2E63A 4PLMA 4F7ZA 2PFWA 4IETA 4O65A 1N1SA 1NA1C 2MEV3 3FUQA 3WF1A 1W8OA 1MVEA 4FOWA 4M3CB 3LKJA 4L8QA 3WF2A 3AMMA 5A1AA 3I4IA 3JU9A 3EYPA 1CVNA 3UKTA 1GWLA 4DXTA 1NQJA 3LDKA 4LO6B 1CPNA 2R1BA 2OX0A 3GJAA 5D1IA 1UW8A 1FV3A 2WNEA 2HWC3 1PO11 4B1MA 5C8CB 4IESA 2GALA 2ATFA 1QU0A 3H3LA 2VNGA 2VOXA 3HT1A 3PJYA 2J22A 4BXFA 5A1FA 4Q4X3 1GZTA 2KR2A 2XQXA 4LOSA 4AFCA 3NO8A 5FY7A 1OD5A 4G3YC 1H9PA 5FREA 3VV1A 2JG9C 4XVHA 2PXJA 5JZGA 2V5DA 3D0SA 3OTFA 2W0XA 3JCIA 5FXXA 4D7TA 1F35A 4NUBA 2AR6A 5DAPA 3THDA 1GUIA 1Q43A 2OQ6A 3NJZA 4GALA 4RGAA 4AI8A 1QH6A 1MZEA 1O8PA 4NAMA 4GKXA 2PELA 1UY2A 4QD2A 1NAEA 4DUXA 1XU1A 3WF4A 3ZN5A 1GZ9A 1ACCA 2IC1A 2RMU3 3IIAA 4P9IA 2K46A 4XJ8A 5JMOA 4YZ5A 5BV6A 3RZKA 2AACA 4BH9A 4BU2A 1WBLA 4S2DA 4OZXA 5K9YA 2ZGKA 2QZ2A 4IEOA 3B69A 2WL1A 4XFBA 1V6LA 2R042 5FYBA 5K0UC 3RNSA 3C7GA 4UFLA 4CYDA 2RV9A 3U11A 4E27A 3UT0A 1WZXA 5C33A 3I7DA 3O1OA 2YC0A 4IGOA 2BV4A 2MEV2 5F3EA 2YBPA 4ISQA 3OBRA 1ODNA 4CU8A 3TEWA 1TME1 2ZAAA 2OZ6A 3BPZA 4LK6A 3ZOIA 5SV5A 3RZZA 5FYMA 1H8TB 2NPIA 4IE7A 2BFUS 3RYRA 2H6BA 2PHUA 1V9U2 1MS3A 5JPNB 2D5FA 1IS6A 1US2A 3MBWA 1IZ3A 1F31A 2VD7A 5F3GA 1MQTB 5LA0A 1BCXA 5H9RA 1RUF1 1DGWA 4Q4V2 2HJIA 3BPSA 1WW4A 4XBLA 2WS93 1W6PB 1JHJA 2YU2A 2QQPA 1DHKB 3A0NA 3KV9A 4LHLA 5ANQA 1OH3A 3VDDA 2DBIA 4NPRA 2X09A 3KCXA 1X9TA 1NA1B 3PMEA 4EWEA 2ET7A 1IS3A 4YFZA 3VBRB 1V6MA 3RJ2X 3CQOA 3LB9A 3QBQA 4JHZA 2I07B 1M06G 3THCA 1YYNA 5C9AC 4CP0A 4QU1A 3ALQA 1PIV1 3WXPA 3IM0A 3X29B 2V72A 3V56A 2VBDA 5JWPA 1VB4A 3VHPA 2JDZA 1MZ5A 2AGSA 2RMU2 3OB8A 4PLNA 3IT8A 4Y1ZA 4CU6A 2QDNA 5ISLA 2LUWA 1YRZA 3BB6A 4YW2A 1C5HA 4Y20A 2GNBA 1UMHA 4LUMA 2R0HA 2BBAA 1YIFA 1EUUA 2JG9B 2Y6LA 3POEA 4HANA 1LU2A 1Q8OA 1D4M1 1HRV2 4DXRA 1J84A 4XEZA 1DIWA 4LLOA 1R1A1 2WIIB 1JYXA 3RPQA 3HMYA 3FJSA 1MZFA 3NAPC 5DUXA 4BQ3A 4CZSA 3TEZA 2VZOA 1J3PA 3M3QA 4B4RA 2XLFA 5FYIA 2R32A 1QDCA 2ES3A 4XDQA 4CEWC 3CJXA 4TLFA 1OA3A 4WM7A 5FPVA 3WQ1A 5KBFA 2CGPA 1OSGA 3F2ZA 2G19A 4YW6A 5FMBA 2WFPA 2A7AA 4FPLA 2VCBA 4YFWA 2ZMNA 2XG3A 2A3YA 4L2NA 1JOBA 3PUHA 5FY1A 1TE1B 4I02A 2X8KA 3TNPB 3ZXFA 1DBNA 1FATA 2D6LX 1BK0A 1GOGA 2RDQA 2ZGOA 4FTBA 3OUJA 4LULA 3L2HA 4X6RB 2FMYA 1ZA4A 4HPKA 2WO2A 5LRSA 3OGSA 5LEJA 4NE9A 3SKJE 1L7LA 1FX5A 2Z79A 4ASMB 1FI2A 5CISA 1VRH3 3PUSA 4OQ8A 1ASJ1 2ZA9A 1UOFA 5A6ZA 3OD0A 1TZOA 4ZY9A 1UKRA 2A6WA 1FMD3 1STMA 1W28A 4AWDA 3FC0A 4CDQB 2WUHA 3RZJA 4TXWA 1EUTA 1FPN3 1S4CA 1CONA 4NHLA 1XYOA 5E8AA 5CVRA 1VRBA 3MW3A 5E89A 3WDYA 2UWAA 1G9DA 3J8F3 3M3IA 5FK8A 3BVCA 3UL2A 3AMQA 5HXMA 1RUI2 4BQ1A 1VMFA 4QPIC 4RL7A 3ZFFB 2ZGPA 1CAXB 5IJRA 4RN5A 4IW3A 4YGDA 4CXWA 4I09A 3E5QA 3USUA 4CCMA 4XDPA 4OQ9A 5ANNA 4AXOA 3D6EA 1QJEA 1J3QA 1MS9A 2WT1A 1WCDJ 5LK5A 3DXUA 3ZYIB 5BY5A 5KXBA 3IMNA 4COWA 1W8HA 3ZX7A 5CYYA 3PIJA 4LKEA 5ACA1 2DCJA 2WLPA 3TBDA 5AFBA 3JQWA 2NZ9A 1LKNA 3HD8B 4IE6A 4K21A 5A7OA 5FQ0A 2RS51 1AR91 5JOXA 3FLPA 3C3VA 1WCUA 1YFXA 3GF6A 2Y60A 2QQNA 2UURA 3IDBB 1ZRRA 5FV3A 5K8SA 1CZVA 1S2KA 1XSQA 2Q1FA 2ZTNA 4IV1B 5JXIA 1DGWX 2XJRA 3R6SA 1LULA 3VBUC 3VHRA 1LCLA 4OHVA 4AYUA 4BQYA 3R05A 1VRH2 1QH7A 1SLTA 4IGPA 4N53A 1WCKA 1UQXA 1H1AA 1S0DA 2VZQA 5AFEA 1X9PA 3TN93 5LBCA 2BBVA 2SBAA 4Y33A 5J48A 1FMD2 4XACA 3UJOA 1OF4A 2JIJA 1VMHA 2W52A 2WFF3 4P00B 3JXSA 1RYYA 3JD71 1JHNA 4IE5A 4YWAA 2ORXA 4A6OA 3ZFEB 4KMQA 1YQ8A 5CKQA 4WM8C 4LHSA 3J8F2 3EO6A 3INAA 2WZPP 2WSVA 1AYM3 2OA2A 4XJZA 4Y5Z0 2B46X 5FZHA 3NKTA 4NVPA 1KD7A 2VW0A 2FCTA 3JBG2 2QQOA 4XFCA 2EIGA 2WN3A 2WNUA 3I59A 3TOJA 4OI4A 4GMP0 4TLGA 1E57A 3NNFA 5FYUA 3RZHA 1EV13 1ZRIA 5HCBA 4BISA 5EV7A 2VO5A 4NO4A 2V73A 3N9NA 1MVQA 3J7NA 2VOKA 3T1LA 4AEDC 2UY8A 5IT6A 5LK7B 1LENA 3T3YA 4YGEA 3NSTA 4R9AA 3I3BA 2VZ3A 3Q8BA 4LBKA 1Y9MA 2VUDA 2WNVC 4H55A 2VC9A 3ACHA 3POFA 1CGPA 2LTNA 4GH4B 3W5MA 3BGAA 4CUGA 3E97A 1UU5A 4Q4Y3 1YQ6A 4CDXC 1JYIA 2D97A 5FDBA 1K5MC 1OFNA 3NNLA 2QKDA 4Y1XA 3ZFGB 2BFUL 5LCWL 4JKLA 2HYXA 2GH2A 1NCRA 5FYTA 1IPJA 4IEUA 3P1IA 4Z92B 1OOPA 1JU3A 2ET1A 3EMRA 1QEXA 4HETA 1U5IA 4NRQA 5FPZA 2CTVA 2PLV1 1QJFA 4Q26A 1XE7A 2Y38A 5FZ7A 3LGRA 1H30A 4EQVA 3RZGA 1EAH1 4E4ZA 1PMJX 5FPUA 4JZRA 2Z4FA 4EYUA 1WCSA 1UOJA 4PLOA 5E1RA 3TN92 4H14A 3U1XA 2DVFA 2D6NA 1DF0A 3AZYA 3FHAA 4Z2WA 1IKPA 4FO9A 3QCWA 4B4PA 1LGBA 4QKDA 4YVSC 2ZX3A 2NLRA 4JGYB 1JBCA 4YNIA 2XVLA 3K48A 4UI9L 5FZFA 5D8AA 1UZYA 3VD7A 5FR3A 2JKBA 1JZ2A 1AYM2 2DVBA 1GNYA 4IEVA 5F3CA 1LU1A 5IVFA 3RVHA 5I8TA 1DZRA 1NCQA 4DY5A 2FCVA 3JB4C 4XTMA 5A3OA 1JZ3A 2GMEA 2JG8C 1G9BA 2VZPA 4ZKTB 1JH5A 4I30A 3ETQA 4A7KA 4RHV3 4QX1A 5DG1A 2RR13 5FZOA 1N3OA 2HWB2 2JDYA 5DUVA 3WP5A 4M00A 3VZKA 4KH9A 4XF0A 3T2PA 3ES1A 5FO9B 2JKXA 3VL8A 2OIIA 2QJVA 3D82A 2XWBB 4Q4Y2 2JB4A 4QHZA 4XXAA 4BM8A 5CFDC 1GP4A 1DZQA 1SFNA 4JTNA 4GMP1 5C6CA 1A6CA 1WMEA 2QCSB 4BLIA 3VBFC 3POSA 5FZ4A 3VLBB 2QQVA 2VNOA 4M01A 1RINA 3V65A 2UY9A 3SEEA 2HEYF 4QX7A 4AZZA 1D7PM 3SH4A 5JZGB 1AR82 3JUUA 4J6GA 2AENA 5EHDA 5IVVA 4UT5A 5C3SA 4IV3C 1E5SA 5LW9A 3N9LA 2HYKA 2YMZA 4C90A 5KHIA 1ZREA 4HONA 2WNVB 4XJ9A 5F9TA 5JSPA 1HB3A 3AP4A 3N7LA 3O5SA 4QGNA 3UYJA 3DEMA 2R041 5IK7A 2GP5A 3MUY1 3S30A 4LBOA 1YFWA 4OMCA 1S2BA 2FCUA 4AAPA 1K5MB 3LPGA 1MEC3 1OH4A 4CTEA 2WZR3 1GU3A 3NKGA 4FPEA 3DCQA 3ON7A 1BBT3 2B45X 2MEV1 1PGL1 2DCYA 2WN2A 1TMF2 3MUZ1 1GZWA 3HOBA 3WNNA 2VL4A 3SISA 3KF5A 4AEMA 3WINE 2HKXA 4AEKA 4RQPA 2ZGSA 3OYWA 4XUPA 3TEYA 3WT3A 1V9U1 1F4HA 2BVBA 1YXWA 2WQZC 2WSUA 4OHWA 1OKQA 4Q4V1 3BKZA 3IDAA 1AL23 2OUHA 4NJ4A 4BK5A 1FV2A 4EN0A 1PZ7A 4NHMA 4Q4X1 2WWSA 3ZSEA 4AHWA 4GB33 4V2WA 3OPZA 1AL0G 1XE8A 5FP7A 5BPXA 2VQTA 2RS33 2K9ZA 4I3PA 2VOVA 1SLLA 5FP8A 1UYXA 5FUNA 3WNPA 1PIV2 2JX9A 1W3XA 5EJ3A 4GQ7A 2LW8A 3LEIA 4WBBA 1K5JA 2CWMA 2RHPA 3VN4A 5FOJB 1PGW2 1OFSA 1F2NA 3ILNA 3OUHA 4X8NA 1RMU3 4CP9A 1RTVA 3ZSJA 3VDDB 1QF3A 3K4AA 5FUIA 2DTYA 3I2HA 3Q8EA 3ZXEA 4I2OA 5CFCC 2RMU1 5FK7A 1X82A 2OPKA 5C5TA 1ZBE3 1OURA 1Q56A 1O4TA 1MS4A 4X6QB 4Z07A 3I2OA 3BYWA 3O0VA 3FZ3A 3CF6E 4PDWA 1JYWA 3KHCA 3OUIA 5CA6A 1ZYBA 1ULGA 1OUSA 1W2AX 2KA3A 4DO0A 2A3WA 1JU4A 1HRV1 2BGPA 4Q0QA 5CFDB 5FBJA 3LA7A 5EWSA 1RUH3 3MFAA 2QQUA 4QPWA 1MEC2 1VIWB 4Y20B 2WZR2 4YM1A 4META 2VVDA 1YI9A 3B00A 3BTXA 2PYTA 1W9YA 3ZYHA 3JQXA 1XYPA 2CDOA 4BQ2A 1RUJ3 2NP0A 2D6OX 2Q8EA 2YC2A 2CAVA 1H4HA 5M0TA 4C91A 5FOBB 3GZAA 2NN8A 2EXJA 4EN8B 3MW4A 2JB8A 3SC7X 1O4ZA 2EAAA 3K3OA 1AL22 1SACA 1NE6A 4QM8A 2EIDA 1COV2 4GB32 4OHXA 4WM7B 1V00A 2P17A 2IXCA 5LRRA 2O8OA 4L97A 4E8DA 4AFAA 4KU7A 3CZJA 3RS6A 1UY1A 1ASJ2 1LOBA 5FZGA 5F5IA 4JX0A 4Y5SA 4LT5A 4XBNA 3HBKA 1WD4A 4CUAA 1GWMA 4YW7A 2WR9A 3FMGA 2R062 4XPVA 1RMU2 4AHXA 1EYBA 4QQOA 4FQ4A 4HPKB 2DYCA 1GWKA 1W2NA 2D6KA 4HN1A 4NN0A 3V0AA 1G86A 2G1MA 1O5UA 3WSOA 4MADA 1A3KA 3B9IA 1ZBE2 2ZJCA 4U36A 3WG2A 4Z1VA 5IATA 4J1WA 2P6HA 3EXUA 2WRAA 3VZNA 1FOD3 1PVC3 1I5PA 4MHRA 1JUIA 4IQPA 3PHMA 1YO8A 1RUI1 4LBJA 5APAA 2P5BA 4QQHA 1GNHA 3DECA 1LESA 4AEJA 5FPLA 4DUWA 4EE2A 1GQPA 4FAHA 1OXCA 1C8M3 4XETA 1HQNA 2ZPXA 2VY0A 4URAA 2TBVA 4P9XA 2B9UA 3POGA 5TSWA 4BLJA 1WCQA 1NX9A 2BERA 2OZJA 3SCHA 1QXRA 4CDUC 1R083 1RUC2 3DPRC 1AX2A 2E51A 1H4GA 2P34A 3I2KA 2VMHA 3BIWE 3N3HA 2K0GA 1JZ4A 4EN7B 3WDVA 2XUMA 3D4KA 4X8PA 2VPVA 3KCCA 4FOQA 1POV3 3USUB 5GLVA 4W4ZA 4EZ4A 3E6DA 1LGNA 4HKOA 2BWCA 1TNRA 3HAGA 5DN2A 2V4AA 1QJU3 1QXPA 1XNAA 1QY4A 2VUAA 5BNOC 2TEPA 4KL1A 3T0AA 1JZ5A 4M3CE 3QD6A 4K7JA 4MGKE 4YARA 1LEMA 2NQYA 3LD8A 4NR1A 2OKXA 1W2UA 1OD3A 2ZS6B 5C8CC 2D7FA 1GQGA 1EPZA 1GANA 2BJSA 1VRH1 1XNBA 3PURA 4LO4B 4HSJA 4JQRA 5IFPA 3VD4A 5FZMA 1VLNA 4QHBA 2ZGRA 1Y7BA 2DFCA 5FO7B 3VZOA 1DYPA 1FMD1 1XNKA 4A7YA 2B9VA 2ZBJA 2ZHMA 3NRUA 5T5PA 2WT0A 3IPVA 3Q8FA 4MH0E 3VDBA 1FPN1 4MXVA 1VBC3 4N90A 4N53B 5DAQA 3GDBA 4M3CF 1FOD2 3LIGA 1OBNA 3J8F1 2XHKA 2B7YA 5F8PA 3RWNA 5C3RA 1ND2A 1W6QA 4JHTA 3MIEA 1SBFA 3KT4A 2F4LA 5HV4A 1ENRA 3W9AA 1SLIA 4GXLA 3SEPA 1JODA 2E26A 3ABZA 4A2UA 5CEHA 1OF3A 1C8M2 3GZEA 1W9SA 4Q5OA 2QDRA 1DU3D 3A22A 4Q0VA 4QX5A 4W65A 4AGRA 4QXBA 2XJQA 4AVBA 1JW6A 1UY4A 1C28A 3B7MA 4PT6A 1RUNA 2WNUB 1AYN2 3QOPA 5JI7A 2JEMA 4DEVA 4UAPA 4B1LA 3O0XA 2B4KA 4QX8A 2GNMA 3MICA 4FPCA 2ADEA 5A7QA 3T30A 2A6YA 4MZUA 5FZDA 5JVVA 3UGGA 4A42A 4CCKA 3WP6A 4MGSA 4ARYA 2ENRA 1W9FA 2D5HA 3OGGA 2Q5TA 3NMBA 4H7MA 2A6XA 3O12A 4E2GA 2ZGMA 1H8TC 1QJU2 1DLLA 1FNZA 3A7QA 5CIRA 4FSJA 2O1QA 2E32A 1IS5A 1CZTA 3FUOA 1VBA3 4AHZA 3O7OA 1S0FA 2GZWA 5FMCA 3ILFA 2W87A 1GNZA 3ZN6A 4CDUB 3WCRA 3MDPA 1A8MA 3OGVA 1NCRB 5FYSA 2G4IA 3TN91 2PHRA 3RYPA 1BEV3 4YW3A 1U12A 4QPGA 2VQ0A 5LBEA 1LTEA 4JRLA 4Y1VA 5EP9A 1GOFA 2Y34A 3GJBA 3LDRA 2P2KA 3VBRC 4XXPA 1VBC2 3EJKA 4QWNA 3PUQA 1VPHA 2Q8OA 4Q27A 4K9SA 2HH9A 3NW4A 5BNOB 5A33A 2XL7A 1AYM1 3VZLA 2G9FA 3UGHA 3WF0A 2EXHA 3ILRA 2W91A 1Q8PA 4N43A 5FP4A 3WG3A 3T0DA 1VE0A 2XMLA 1ENQA 3FLRA 2WWJA 4MVTA 3N35A 4QMAA 4UF0A 4XYXA 5HPOA 1ZRCA 3ZXKA 1I9RA 5D8AB 1JUHA 3BTYA 4PQ9A 4LORA 3POBA 4BYYA 4Y22A 2CWSA 2B42B 2RE9A 3ZYGA 1Q8SA 2W46A 3WDXA 3ZYFA 3MW2A 2J1AA 3VDCA 2XJUA 4FOVA 1H2MA 2HWB1 3J7LA 4DINB 5DAVA 1NCQB 3WNMA 5F5QA 3U0ZA 3ECQA 4Q4W3 5CZKA 3KWVA 1ENSA 1AUYA 1RHI3 2W92A 1DP0A 5ABJA 4Q4Y1 2DUQA 2NYYA 1M4WA 2ZHKA 4GD4A 2D44A 3AXDA 3OBZA 2WABA 3UGFA 1ULEA 2P3IA 3KGLA 1DLCA 5F2SA 5FZOB 2BEOA 3BUCA 4N8MA 1DQ2A 1AR81 3CU7A 3ZSKA 1VBA2 2JDUA 2YV8A 1DDLA 4LITA 4CDWA 5BNNA 5CADA 5FZKA 5GZFA 1WA6X 5L7OA 2PQQA 4IL7A 2FBEA 1GQHA 3OPWA 2X29A 5GJ6A 3O1TA 3FN9A 2R7EB 1BEV2 5E16A 3GM8A 2YPJA 4OCTA 4KI5M 1YJKA 4W6WA 3VKMA 1PGL2 1HN1A 1YLLA 2PAMA 2IUWA 1UYYA 2PHLA 4HBNA 5FZIA 5JLVA 1PK6C 3D3AA 5A7WB 5AVPA 2YGMA 1W05A 3KGZA 5A6XA 3WF3A 4A7ZA 1TMF1 2W1SA 3W58A 3KB5A 3RZMA 1YHFA 5FXZA 2BYVE 3SXWA 3EB7A 1UIJA 4XCAA 1CESA 1ND3A 3AX4A 3TWIA 2VMEA 1OKOA 5DAXA 2HWC2 1F9KA 3U4SA 4F83A 3FLTA 3MYXA 4Q0UA 1YEWA 4A44A 2C4XA 1RITA 3Q8CA 4CDQC 5AC93 1O59A 4BIOA 4QB1A 2WA4A 4Q4X2 3MZHA 4FCAA 1G6NA 5FYCA 1GZWB 1PM7A 5DABA 5IW0A 1W04A 2EXIA 3J9SA 1OPOA 4GULA 4RHV1 3U07A 3WNXA 1LR5A 3AYEA 3LA2A 1SPPA 4RQPB 3D5OA 2JE9A 4NHKA 4YM0A 3OYWB 5KWRA 3PL0A 1B35A 1QOOA 3ZFFC 4RFRB 1O3QA 4Q4W2 5FAXA 1RHI2 4FFHA 4IUGA 5DXDA 3DKQA 5GLZA 5IYYA 3DL3A 2ZAHA 3A4UA 3BTAA 4M0NA 2BQPA 5CNAA 1LOAA 4XJAA 4ZU5A 5J96B 1G9AA 5JDBA 1PVXA 4YZ1A 5EZWA 5A7NA 2DUOA 1PGW1 2NMOA 1SLCA 1LRHA 3ITQA 3V0BA 4XUQA 1G7YA 3MF9A 1DYOA 1OA2A 1UAIA 5JMCA 1HXS3 4YVWA 4D6QA 1RGSA 4JC1A 2PHXA 3QH6A 5KC5A 3I49A 4LKDA 3AP5A 2FDFA 1QQP3 2F17A 3ME2A 3H50A 1ZBA3 2P4EA 4CP9B 5FKBA 1UOBA 4CPBA 1UWWA 4AVAA 3MO4A 4FT8A 1W39A 1MS5A 2DVAA 2Q0AA 4IV1C 4DIQA 4Q0PA 1MEC1 3PLQA 1ZA7A 1LOFA 2WZR1 4DY3A 2DBNA 1CR7A 1PMIA 1REDA 3I3DA 4XE9A 2I45A 4QGLA 1ENXA 3IKWA 4PDWB 5JR2A 3OY8B 3PU8A 5C4WA 5IAXA 4NHXA 3H3UA 1SBDA 3ACLA 1IQDC 3E5XA 2JDMA 3E5UA 1AX0A 1JXNA 4FVVA 4R9BA 1GR3A 4PIZA 4R9CA 4NIDA 5JOWA 4XZPA 4LO8A 3NV1A 4YGBA 1UZZA 2WS92 2JDNA 5BNPA 3WQ7A 3ZFEC 1QDOA 2PAEA 1SLAA 1LHWA 1KFXL 2A6ZA 1AX1A 1W99A 2VG9A 3CNAA 3DKWA 5T52A 1AL21 1MACA 4MSVA 5K7PA 2YBSA 3DUIA 1COV1 1X8EA 4GB31 3VBSA 3WNKA 1PK6B 2Y6HA 1IG3A 4YW1A 5C70A 1JYTA 4CU9A 3J26N 4EN6B 1NYWA 1NLQA 3CZUA 1RIRA 5HI0A 3AKTA 3H1WA 4Q8KA 2IVJA 1TQ5A 2MNGA 1CJPA 1B09A 1QGLA 2R061 2WAAA 4KWLA 5GLUA 3OG2A 3RQ0A 2DU0A 1RMU1 1O7FA 4UXAA 5FO8B 2CGNA 4ZPIA 3LOBA 3O1PA 3B94A 3GGLA 1ZBE1 5FY4A 4GH4C 2VULA 1LHUA 4AE2A 3UV9A 4E9KA 1JOPA 4RR3A 1QQP2 3APBA 1W0PA 3ZFGC 1ZBA2 3UKVA 2XR4A 2VXRA 4NHYA 3VD5A 5I91A 3V0AB 1XC6A 3H8UA 4N9HA 1W8UA 1PHMA 2YHJA 2VUJA 4L11A 1E5RA 5T55A 1W6OB 1R093 3GYDA 4CCLA 5EXOA 3ZSMA 4KBZA 3A21A 1VP6A 2Q1ZB 4S2GA 2BPA2 3HNYM 2B8MA 3U10A 1SFYA 2RVAA 2HBTA 1BVP1 2VTXJ 5KR7A 4XAEA 1IQAA 1C4RA 4UBHA 1RUC1 2D6PA 5EJ1B 2ZMLA 1UYPA 1WGPA 4UWDA 1S1AA 4P02B 4V1PA 4JKMA 2OPWA 3I8TA 2RDNA 4CSWA 2JE8A 1CX1A 3MHZA 4JGYC 3N7JA 3VKLA 3IDCB 4R9DA 5J3UA 4IEQA 3NV3A 3GCXA 2A71A 2JDKA 3NV4A 4JRAA 1XQNA 3Q9OA 4QKFA 4W6YA 3SITA 4YLZA 2UWBA 3AZXA 3RGBA 1E5HA 5J09A 3VBHA 4AOCA 3ACIA 2VXJA 3DGTA 2DVDA 1NOVA 4UYBA 4P5HA 3VBOA 3EQEA 4N7UA 4AAXA 5L19A 4P14A 5JOYA 4J25A 5FZ1A 3LQCA 5SV8A 4P9JA 3O1UA 3VKNA 4RSUA 1KRIA 1P8JA 3SCFA 4LXLA 1UYZA 2AC1A 2R0FA 1PZ9A 3NJXA 1MS1A 4KQ7A 3AFGA 1FPN2 4BQ4A 2QUOA 2PHFA 5FXWA 2QQJA 1RVF3 3KQ4B 3NQHA 5IVCA 4XDOA 5KHJA 1DFQA 1I6XA 3CIHA 3FWEA 2WKKA 4GWJA 3KSCA 3H7JA 1FOD1 2X53S 4K3UA 5C3OA 2CYFA 4XILA 5LB6A 5B2GB 5JZGC 3PVEA 2VM9A 4ORFA 4R52A 3IPVB 1XJAA 1R092 4CEYA 4Y4RA 2JD9A 4AW7A 2RJKA 2XPJA 5DQ0A 3VB9A 3WY6A 1MS8A 1BMV2 1C8M1 3I97A 4D94A 4JKKA 4L0PA 1XU2A 1Y9GA 2BNNA 4D6SA 1ND2B 1W6QB 5LZ6A 3ZSLA 1I5ZA 1LGCA 2VNRA 2X5IA 1QOTA 3ZO0B 4KWJA 2ARAA 4BHPA 2E6VA 4O7XA 1N47A 1AYN1 1GV9A 3HNBM 4M0HA 4DXSA 3L9JT 2ID4A 1T2XA 1N1YA 4ZHNA 4INDA 2EVXA 4FPFA 4YSFA 5DZEA 3QLQA 1OPMA 4JGZA 4GJYA 3HQXA 3FFZA 4Y1YA 2LROA 3POWA 1IOAA 1CAVA 2YU1A 4GWIA 3DYOA 4RS5A 1QJU1 1W03A 5GLWA 1UOGA 4XF1A 4ZU7A 3ZXLA 3BI3A 4KWUA 5FP9A 1UY3A 4DXZA 5A7PA 3FHQA 3I2FA 3KQRA 1YWKA 2OW4A 3K4DA 2JJ6A 4MLOA 5D2AA 3VUOA 1J58A 1K42A 4FAGA 4PQQA 5FWJA 5L9BA 3AYAA 1CD3G 4OMDA 4BQ5A 2GMMA 2WFF2 3RJRA 1MPXA 1ONAA 5JCTA 4MHUA 1O5LA 1AXYA 1H8VA 2B39A 3CEWA 1HQWA 3MIFA 4BE3A 1O3RA 3WDUA 4QX0A 4K6BA
chains in the Genus database with same CATH topology
4BQYA 4KBZA 3MGUA 5LBCA 2HBTA 4XACA 2JIJA 4NAOA 4Y5SA 5LATA 4UWDA 4NHKA 4BQWA 3PL0A 2OPWA 4XAAA 2RDNA 3GJAA 3DKQA 2Y33A 2G1MA 5IATA 4NMIA 2FCTA 2FCUA 2G19A 3ITQA 3NNFA 4MHRA 5DAWA 5L9VA 4J25A 4XC9A 5LBEA 5DAPA 5EP9A 3GJBA 2Y34A 2RDQA 3OUJA 3NNJA 5LBFA 2A1XA 2RDSA 5DAXA 4ZONA 4NHMA 3NNLA 4BQXA 3KT7A 3HQUA 3EMRA 5IAXA 4NHXA 5LB6A 3KT1A 5C5UA 2V4AA 4NHLA 4XCBA 4JZRA 2RDRA 5DAVA 3OUHA 5LBBA 3BVCA 5C5TA 5A3UA 3OBZA 2HBUA 2JIGA 4IW3A 5LA9A 3OUIA 4Y5TA 4XABA 5LASA 2FCVA 3HQRA 3NNMA 5DAQA 4ZPIA 5IAVA 3KT4A 5HV4A 3W21A 5EQUA 5L9BA 2RG4A 5HV0A 5M0TA 5EPAA 3GZEA 4Q5OA 5L9RA 4MHUA 4NHYA 3W20A 4XCAA 5ERLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQY A;  4KBZ A;  3MGU A;  5LBC A;  2HBT A;  4XAC A;  2JIJ A;  4NAO A;  4Y5S A;  5LAT A;  4UWD A;  4NHK A;  4BQW A;  3PL0 A;  2OPW A;  4XAA A;  2RDN A;  3GJA A;  3DKQ A;  2Y33 A;  2G1M A;  5IAT A;  4NMI A;  2FCT A;  2FCU A;  2G19 A;  3ITQ A;  3NNF A;  4MHR A;  5DAW A;  5L9V A;  4J25 A;  4XC9 A;  5LBE A;  5DAP A;  5EP9 A;  3GJB A;  2Y34 A;  2RDQ A;  3OUJ A;  3NNJ A;  5LBF A;  2A1X A;  2RDS A;  5DAX A;  4ZON A;  4NHM A;  3NNL A;  4BQX A;  3KT7 A;  3HQU A;  3EMR A;  5IAX A;  4NHX A;  5LB6 A;  3KT1 A;  5C5U A;  2V4A A;  4NHL A;  4XCB A;  4JZR A;  2RDR A;  5DAV A;  3OUH A;  5LBB A;  3BVC A;  5C5T A;  5A3U A;  3OBZ A;  2HBU A;  2JIG A;  4IW3 A;  5LA9 A;  3OUI A;  4Y5T A;  4XAB A;  5LAS A;  2FCV A;  3HQR A;  3NNM A;  5DAQ A;  4ZPI A;  5IAV A;  3KT4 A;  5HV4 A;  3W21 A;  5EQU A;  5L9B A;  2RG4 A;  5HV0 A;  5M0T A;  5EPA A;  3GZE A;  4Q5O A;  5L9R A;  4MHU A;  4NHY A;  3W20 A;  4XCA A;  5ERL A; 
#chains in the Genus database with same CATH topology
 4QXK A;  3WW1 A;  3ZN6 B;  2YPD A;  4BB3 A;  1VBC 1;  1W8N A;  1JI6 A;  1H1I A;  2JE7 A;  4M3C A;  4PI2 A;  4FPY A;  1Y4W A;  3AXE A;  5JXJ A;  1YJL A;  2KM2 A;  4ONU A;  1EV1 2;  3VDD C;  1XOY A;  4XTP A;  1SEF A;  3ZDS A;  4MOA A;  1CN1 A;  4PJY A;  1FNY A;  2VCM A;  3S7I A;  5DUW A;  1UY0 A;  4IXL A;  3M70 A;  4QQL A;  4MGY E;  4V2V A;  4AVC A;  1PM4 A;  1YI7 A;  4UW5 A;  4N43 B;  1V6J A;  5I0U A;  5KHG A;  5FFO C;  4UF0 B;  5EJZ B;  5IFT A;  1OQ1 A;  1KEX A;  1QXJ A;  3K2O A;  1RUF 3;  4I0A A;  1WW5 A;  5L9V A;  3BOD A;  2PTM A;  3HNM A;  2PHD A;  4Y22 B;  2Y6F A;  4LE3 A;  2GDF A;  2VNV A;  4ASK A;  2VUC A;  1BHG A;  4ES8 A;  2WLQ A;  1L3J A;  4NWV A;  3ZYB A;  3K4Z A;  1WLT A;  4CA9 A;  1QJX 3;  5KXE A;  4FPJ A;  5ABJ B;  1VBA 1;  5FTT C;  2VBB A;  2G9Z A;  2DFB A;  1YQ2 A;  2CV6 A;  3O1S A;  1OLM E;  1KS5 A;  3LEG A;  5I8Y A;  3BU0 A;  2WDB A;  2XJT A;  3VHO A;  1DQ4 A;  1VAL A;  4H7L A;  4C1X A;  1GP6 A;  4WM7 C;  3KT7 A;  1BEV 1;  5FRA A;  4FFI A;  3KD4 A;  1RUD 3;  1LHO A;  2DDU A;  2WJS A;  3U75 A;  1FT9 A;  3ZIX A;  4CDW B;  5BNN B;  2DWR A;  3WQB A;  3WVJ A;  1FYU A;  4IGQ A;  3VZJ A;  2IXI A;  3I3Q A;  5A1L A;  5DDJ 3;  3CJI A;  5FBZ A;  4A6S A;  4LTA A;  3M7A A;  1D4M 3;  2P1B A;  2VMG A;  4ES9 A;  3TB0 A;  2VMI A;  3HIF A;  4OYU A;  4MUV A;  4OVE A;  2C9A A;  1X7N A;  2HWC 1;  3WG1 A;  1KDM A;  1MQT A;  4XJU A;  4RHV 2;  5EYX A;  1OHF A;  1I3H A;  4B4Q A;  5LWB A;  2YG0 A;  3TNQ A;  2RR1 2;  1W6N A;  3WDT A;  4FP2 A;  4IDZ A;  2XBO 3;  4MV2 A;  1W6P A;  2ARB A;  3AMP A;  1QWR A;  1AR6 3;  2V4V A;  3THP A;  3WP3 A;  1QJZ A;  1ND3 B;  2XVK A;  3OOX A;  3R4S A;  1GMM A;  4OUS A;  1RC6 A;  3ZR6 A;  1C1L A;  1ALY A;  1NA1 A;  2GAU A;  2H0B A;  4R4Z A;  4SBV A;  4ZXK A;  3T2T A;  4D3W A;  4Q4W 1;  3LPF A;  1CX4 A;  2GC0 A;  1QJY 3;  1RHI 1;  2ZOE B;  4OUM A;  1MZ6 A;  2JXA A;  4ZU4 A;  3GBW A;  5I0T A;  3OSD A;  1G8W A;  1JZ8 A;  4FPG A;  3N7M A;  5EQU A;  3RWK X;  2RG4 A;  4BOW A;  4A3Z A;  3I2I A;  5FZC A;  1VBB 3;  1B35 B;  4PF1 A;  4FP3 A;  4BA6 A;  1ZRD A;  1JOJ A;  2DU1 A;  4LIU A;  1RUE 3;  2A6V A;  1QJX 2;  4DZG A;  1KJR A;  3B9C A;  5IWF A;  1UXX X;  2AYH A;  3FHI B;  4QQ2 A;  1C57 A;  1N1T A;  3AKR A;  3HJR A;  1N3P A;  1LOC A;  3PVB B;  3FBM A;  2JG9 A;  3H3Z A;  1UU6 A;  3JZV A;  5DZG A;  3RZL A;  1UIK A;  3AKS A;  3T0B A;  3WUD A;  4HSL A;  3V0B B;  2BOI A;  4ITC A;  3NV2 A;  1RUD 2;  4XIK A;  2Z5W A;  1BBT 2;  4YZ4 A;  2YFU A;  4YVW B;  5LAT A;  5T5O A;  2Q8C A;  2L9L A;  5BNQ A;  2AZ5 A;  4QHO A;  1URX A;  2C6S A;  4MXW A;  4LBN A;  5DDJ 2;  1W6M A;  2WZE A;  5C71 A;  2BGC A;  4QM9 A;  2C9K A;  2CAU A;  3C2U A;  1W8T A;  3B01 A;  1I1E A;  1GOH A;  3ZMN A;  1D0G A;  1CIY A;  2HEV F;  2ARX A;  2YZ4 A;  3MLK A;  5IHR A;  4MG2 A;  1HQL A;  5A32 A;  1ULC A;  3ZPY A;  4UW3 A;  5IK8 A;  2WS9 1;  3NNG A;  2ZHN A;  4ET7 A;  2AEY A;  1QOS A;  2BZD A;  3LWC A;  5K0U A;  3H9A A;  2JEC A;  3B3Q E;  2XBO 2;  1WA4 A;  4LR4 A;  4N53 C;  4RFT 0;  2BUK A;  3IAP A;  2RS3 2;  4FTS A;  1Y43 B;  2DCZ A;  2IXL A;  2OT7 A;  2Y6G A;  4LO7 A;  1HLC A;  2VJX A;  3SLI A;  3THT A;  4AVT A;  2FDH A;  3NNJ A;  2D3R A;  5GAL A;  5DG2 A;  1DZT A;  1OLR A;  3H0O A;  1QJY 2;  3ZYR A;  2Y6K A;  3HN1 A;  2RS5 3;  1AR9 3;  5JR7 B;  3DV8 A;  5T54 A;  1J1T A;  5J98 B;  1OMI A;  3O1R A;  1KJL A;  1U5Y A;  2ZGT A;  3BAL A;  1UPS A;  4KBB A;  3VZM A;  3LZZ A;  1VBB 2;  4BQX A;  1AVB A;  2EIE A;  2WNU C;  1RUE 2;  3EBR A;  3WHU A;  5BXX A;  2XON A;  3U14 A;  4D7S A;  3AMH A;  1XPW A;  4WVZ A;  3CBN A;  2D43 A;  3ZYP A;  3VDA A;  1QQP 1;  1YUD A;  2X10 A;  3LSD A;  4XCB A;  2J1E A;  3FFQ A;  1ZBA 1;  4GA9 A;  1RUH 2;  2CGO A;  1QMJ A;  3HPN A;  2PN5 A;  4OI0 A;  5A3W A;  3OCP A;  5LBB A;  1AR7 3;  2E31 A;  3TAY A;  1S0I A;  4UFM A;  1W0O A;  2BOJ A;  1DYK A;  5C9A A;  1HB1 A;  1LOE A;  1W8F A;  3MPB A;  1HKD A;  4OI1 A;  1JZ7 A;  1RUJ 2;  5IK5 A;  2JIG A;  4RR3 B;  4LLF A;  1KGY A;  2WIN B;  2EAK A;  5F5A A;  5FY8 A;  5FZ8 A;  4HXC A;  4UFJ A;  1NCR C;  2AEZ A;  4UFK A;  1VMJ A;  5FZE A;  5T3N A;  4Y26 A;  2BP6 A;  1OOP C;  1H6X A;  3I3M A;  2W68 A;  1NKG A;  5C7G A;  3AC0 A;  4UFH A;  3ZXG A;  2UU8 A;  4Y4Y A;  1HRI 3;  2VQU A;  3CKH A;  2A73 B;  3HQR A;  4AQT A;  5I93 A;  3AZV A;  3ES4 A;  4PBO A;  2RM2 3;  4XFH A;  2E53 A;  1PNF A;  2JIC A;  1O8S A;  3GBG A;  4E4S A;  3NAP A;  3W21 A;  4P9L A;  5KHK A;  3OF1 A;  3AYD A;  3BIE A;  4LKS A;  3BOP A;  5FQ0 B;  5GZD A;  3SH5 A;  1UU4 A;  4I0W B;  3ACF A;  2QTW B;  4CEW A;  3MIG A;  5AVA A;  1XE0 A;  1NLS A;  1UPI A;  3OGR A;  5D8A C;  2HBU A;  3G7D A;  4HK8 A;  3RMY A;  3U37 A;  1LED A;  2E7Q A;  3AP6 A;  2KD7 A;  4I01 A;  4LIV A;  2ZCW A;  2W1U A;  4XUT A;  2Q1M A;  2IXK A;  3VBH B;  1RUG 3;  2CSG A;  3LEM A;  4BCU A;  5HCH A;  2PLV 3;  1NCQ C;  3VBO B;  4JAA A;  1OI6 A;  4XHB A;  2XQR A;  1F8V A;  1EAH 3;  1Y9Q A;  1PVC 2;  2OS2 A;  3ST7 A;  2ORZ A;  4LK7 A;  4P5Y A;  4C1W A;  2ZEY A;  1KS4 A;  3WOG A;  1WW6 A;  4QXH A;  1IKQ A;  5A7S A;  5IVY A;  1AR7 2;  3MPP G;  1W2T A;  1CQ9 A;  2R6Q A;  3GZU C;  2BU9 A;  3M3O A;  1LEC A;  3I3E A;  5JIU A;  4L99 A;  1VAV A;  2C1F A;  2V09 A;  1WLC A;  1X33 A;  4NMI A;  1R09 1;  1RXF A;  1TG7 A;  3IMM A;  5B4N A;  1R08 2;  5GM0 A;  1VAK A;  1BMV 1;  3N9P A;  2GC1 A;  1WUV A;  3PUI A;  4Z8B A;  3I59 B;  2BWA A;  5DAW A;  3I2J A;  2ZKN A;  1H0B A;  1O6U A;  4M4P A;  2ZZJ A;  2UYA A;  1ZZC A;  4K8R B;  4LPL A;  4WV8 A;  1U0A A;  2R16 A;  4W50 A;  1H6Y A;  5HCF A;  4ZZ8 A;  1HJF A;  4R8H A;  3WNO A;  4YGC A;  4CEY B;  4FXK B;  2VZV A;  4JQT A;  1HRI 2;  5FPB A;  4FQZ A;  4L92 A;  3CHX A;  3RG0 A;  4QPI A;  2RM2 2;  2RDS A;  4COV A;  4TZD A;  3AM2 A;  4HVR A;  5IVJ A;  2GN7 A;  3MID A;  4ZON A;  2BVV A;  2D98 A;  1J59 A;  2X5I B;  2ZAC A;  2GN3 A;  3WZ1 A;  4OFG A;  1CAU A;  1J83 A;  2LM3 A;  1IPS A;  1X8M A;  4NIG A;  3WNL A;  4QU2 A;  1G9F A;  4JGZ B;  1ZVF A;  2W95 A;  2PQS A;  2ZGN A;  3J7H A;  3KZ4 C;  2OXB A;  1UL9 A;  1OOP B;  1J1L A;  5C3Q A;  1CAV B;  2MHF A;  5IK4 A;  1O3S A;  4RS5 B;  4QAW A;  2I2S A;  3HBZ A;  5JIA A;  2WFF 1;  4B7K A;  5I0D A;  1RUG 2;  2A5Z A;  2J42 A;  4FFG A;  4RQP C;  3H8X A;  1GZC A;  5F1R A;  5FPX A;  1REF A;  1SMV A;  5IUQ A;  2IZW A;  4LBM A;  4NOT A;  4C0H A;  4YW5 A;  1ULP A;  2KXL A;  1BYH A;  3H8O A;  2QFE A;  3S6P A;  3KV5 A;  3S57 A;  3B5L B;  1ZZ8 A;  5HBA A;  3NVC A;  2QQL A;  3B02 A;  4JTO A;  1U5Z A;  2DUR A;  1V6I A;  4HN0 A;  3VBU A;  2H6C A;  4PHZ A;  5C8W A;  5FWE A;  5CKN A;  1EV1 1;  2D40 A;  3BCW A;  1EPW A;  4Z2A A;  1ULO A;  3DN7 A;  1A78 A;  3GXU A;  4XAB A;  5FY9 A;  4C0B A;  5J36 A;  4LBQ A;  1QIQ A;  3VKF C;  1LNS A;  3V64 A;  2QE3 A;  1TVG A;  3LDB A;  2R49 A;  3W5N A;  1H1M A;  1EY2 A;  2VW1 A;  4FBF A;  1K12 A;  5G04 L;  1S0C A;  1PO2 3;  5CG8 A;  1TNF A;  1SCR A;  4BIF A;  4OHZ A;  2ZX4 A;  1V9U 3;  4DRV A;  3DXT A;  3OPT A;  1NY7 2;  2XH6 A;  4WM8 A;  4BME A;  5FZ3 A;  4D8M A;  2JEN A;  4Y1U A;  3N9M A;  1Q5O A;  5L9R A;  5JOZ A;  4Q4V 3;  2YRO A;  5F37 A;  3PIG A;  5FLI A;  3MI8 A;  1BZW A;  3PVO A;  4JCK A;  4PDW C;  4U2A A;  2X05 A;  2P37 A;  1XBF A;  2VE1 A;  2E9Q A;  3QAC A;  2ERF A;  1C1F A;  2VZ1 A;  2XB6 C;  1H9W A;  3K51 A;  1C3H A;  5FPA A;  2FQP A;  2QVS B;  2YBK A;  4WZC A;  5T5J A;  3H1Y A;  4H3W A;  4RGK A;  4AED A;  5CAZ A;  2C0Z A;  1VAM A;  2E7T A;  4TN7 A;  4YRD A;  5G05 L;  4AGG A;  1V6N A;  2WNV A;  5EFU A;  4AF9 A;  1EP0 A;  4R4X A;  1K45 A;  4CDX A;  4Q1P A;  2DTW A;  2IXJ A;  2WBK A;  3C7E A;  4CCN A;  4CPB D;  3KV4 A;  2Y33 A;  5KXD A;  4IEW A;  1K5M A;  2TNF A;  1XSR A;  4AI3 A;  4JDM A;  3S0M A;  2FZ1 A;  2DF7 A;  3OD4 A;  2FD8 A;  4GIQ A;  1OQD A;  1IPK A;  1HV0 A;  4Q2F A;  1QKQ A;  5FZ0 A;  1LAJ A;  5FLJ A;  3TEX A;  3MV0 1;  2NMN A;  4JVA A;  3FE5 A;  3IN9 A;  1HRV 3;  1W9W A;  2Q30 A;  2Y0I A;  3KS7 A;  4YZ3 A;  2W39 A;  3GZT B;  4EWD A;  1X36 A;  4Z82 A;  3WQ0 A;  4EV0 A;  2P3J A;  3UNP A;  1XYN A;  4XQD A;  4NPM A;  2QZ3 A;  5H9P A;  2XJP A;  1ZNP A;  5E6H A;  1D2Q A;  4FTE A;  2ILM A;  2RR1 1;  3CJI B;  2OVU A;  5LBF A;  2R07 3;  4LE4 A;  1PO2 2;  3HT2 A;  4O61 A;  4YVS A;  3AB0 A;  1Z0H A;  3JB8 A;  4JDO A;  5FLH A;  2OYZ A;  1QNW A;  2ZMK A;  5T5L A;  4A4A A;  4BZ4 A;  1DGR A;  1GFF 2;  1BJQ A;  4P9W A;  2K2S A;  4YW4 A;  2VVF A;  2R1D A;  4B29 A;  1S2E A;  1W6N B;  2GMP A;  3RMX A;  3ZN4 A;  3BN6 A;  3GAL A;  2YGL A;  1CAW A;  4GWM A;  1MS0 A;  1UNB A;  2CL2 A;  1W90 A;  2ADD A;  1DQ0 A;  2ZEX A;  1WMX A;  4KG0 A;  3MV1 1;  2JG8 A;  4ZS3 A;  4LNV A;  4B7E A;  1QNY A;  3AP7 A;  4YG0 A;  3U4X A;  1QJX 1;  2AUY A;  1Z7S 3;  3KF3 A;  3URF A;  2ZGU A;  3AVS A;  4A41 A;  2HWD 3;  2W47 A;  4ZZ5 A;  5A3U A;  5H9S A;  2XOM A;  2YXS A;  4RYD A;  4QGM A;  1DCS A;  1VBD 3;  4WZF A;  1WKY A;  2WO7 A;  4XFA A;  3III A;  5CFD A;  4AGV A;  1RUD 1;  4UOJ A;  3KCY A;  1HW5 A;  1JYC A;  1BBT 1;  1V6O A;  3AZW A;  3DF0 A;  3FX3 A;  5T50 A;  4EWA A;  3VBF A;  2GU9 A;  1S0J A;  2WO3 A;  2WNO A;  4CP1 A;  3MEP A;  4AI2 A;  1SQ4 A;  2JDA A;  3KVA A;  2RS1 3;  1NT0 A;  4GJZ A;  4H2A A;  4QQP A;  1UX6 A;  4S2H A;  5EYY A;  5L73 A;  3GHM A;  4CUB A;  5DDJ 1;  4M4R A;  3WLU A;  3S5A A;  3N36 A;  1YIP A;  2XGX A;  5GKA C;  1RUI 3;  4IEX A;  4I0B A;  4AL9 A;  1KQR A;  5AC9 2;  3B93 A;  4UBG A;  4YZ2 A;  4G4F A;  1OLM A;  4IV3 A;  1J3R A;  2Y8K A;  1UZW A;  2XHN A;  3WCS A;  4ATE A;  4C8D A;  1UX7 A;  5JPM B;  1XNC A;  5F3I A;  5EPA A;  1KIT A;  2HWE 3;  4MXW B;  3ATG A;  2WA3 A;  2VR4 A;  1W6M B;  3BTZ A;  1V70 A;  2XBO 1;  2E7A A;  1HB2 A;  2G9G A;  2R07 2;  2HWF 3;  1XND A;  2Y64 A;  4QB2 A;  1AR6 1;  2RS3 1;  4GAZ A;  1NXD 1;  3PJQ A;  5FZ9 A;  4E4D X;  4EN9 B;  4BWO A;  2VMD A;  4LBL A;  5A32 B;  2VEC A;  1QJY 1;  4P9Y A;  1ZZ7 A;  3CO2 A;  4EJR A;  4Q0S A;  5K0U B;  1OT5 A;  2ZGL A;  2GSY A;  1A34 A;  3OBT A;  4Q1R A;  4BPZ A;  4OHY A;  2XKP A;  4NAO A;  1PX4 A;  2ZX2 A;  1ND2 C;  4QX2 A;  1WD3 A;  1HXS 2;  2EF6 A;  4OI2 A;  1VBB 1;  1DGR N;  4BQW A;  5F5C A;  3IB3 A;  1R64 A;  4PF5 A;  1RUE 1;  4MGZ E;  1IS4 A;  3OBA A;  3G6J B;  2XL9 A;  2HLE A;  4XAA A;  1Z7S 2;  3C7H A;  4WVW A;  2XVG A;  2HWD 2;  1VJ2 A;  2Q4S A;  2VVE A;  3POJ A;  2ZAB A;  5DUU A;  1W2O A;  1VB2 A;  2Y6J A;  1POV 0;  1VBD 2;  1RUH 1;  1XNT A;  2ZEW A;  3KHB A;  3RI9 A;  3ZKY A;  1WMD A;  4P08 A;  4E8C A;  1F4A A;  4QDS A;  4JV4 A;  3R4D B;  5FYH A;  1AJO A;  3I54 A;  3SH3 A;  2RS1 2;  1W8Z A;  1RUJ 1;  5B4X A;  4DB5 A;  5CFC A;  2PA7 A;  2RJ2 A;  1YNA A;  1YFY A;  3JBG 3;  2OQ7 A;  3LFI A;  4QB6 A;  3VKO A;  1A8D A;  4XHX A;  5FYZ A;  2ARC A;  5C9A B;  3OEA A;  1VBE 3;  5D21 A;  2UWC A;  3AJY A;  3POY A;  2HWE 2;  3AL6 A;  5FMO S;  1DQ1 A;  4YG3 A;  4DQA A;  2HWF 2;  2FHR A;  4GWN A;  2CY6 A;  4CUC A;  3LCP A;  4CXX A;  2BNO A;  2CNA A;  4AVS A;  4QPG C;  2XXZ A;  4I3G A;  4Q29 A;  1ODM A;  3PDQ A;  5FY0 A;  1UKG A;  2EXK A;  2Y0O A;  1WMF A;  1HV1 A;  4XOG A;  4AQ2 A;  5A6Q A;  1GKB A;  3WR0 A;  4WVM A;  3NAP B;  5JSR A;  3FL7 A;  4XFI A;  5LA2 A;  4XMA A;  4CVU A;  4RD7 A;  4N43 C;  4CCC A;  3RRD A;  3WW3 A;  4FFF A;  1GLH A;  4CEW B;  4PI0 A;  5FZA A;  3ZXA C;  1OQE A;  1CPM A;  1PVC 1;  4AVV A;  1IGO A;  2GC3 A;  1YFU A;  1DG6 A;  2Y26 A;  5LAS A;  3IAQ A;  3RI8 A;  5JAX A;  1BKZ A;  4YPJ A;  1UMZ A;  3WV6 A;  4DRR A;  1AR7 1;  1D4V B;  2Z69 A;  1E5I A;  2WZ8 A;  4NII A;  5CB7 A;  5FUP A;  5J1X A;  4K20 A;  2IVI B;  2O8Q A;  3E1F 1;  3KVB A;  5ABJ C;  1GSL A;  1WLW A;  4HK9 A;  4O9E A;  4DEQ A;  4QKB A;  4DUV A;  1UXZ A;  4XUO A;  1HDK A;  1S0E A;  1R08 1;  1TEI A;  3H7Y A;  4FPK A;  2I74 A;  5GLT A;  3ROU A;  1NZI A;  4YM2 A;  5FIX A;  2WWU A;  5F6L B;  1RJ8 A;  2W5F A;  3K75 B;  4LHK A;  3T09 A;  1PO1 3;  2QQM A;  2R30 A;  4FI9 A;  4EZH A;  2WC2 A;  1POV 1;  5ERL A;  2ZZQ A;  1VBE 2;  5CU1 A;  4D0Q A;  5I0R A;  1LOD A;  2B5H A;  4LEJ A;  4QDQ A;  3U78 A;  4CDW C;  5BNN C;  4K40 A;  1HRI 1;  1SDD B;  4HFS A;  4KU8 A;  5BYN A;  3BU7 A;  1YQC A;  5L7O C;  3M2M A;  1O3T A;  1KDK A;  1F5J A;  2RM2 1;  3TRS B;  4BK4 A;  3WD5 A;  4LA3 A;  3IBM A;  1CZS A;  4J1X A;  1ZM1 A;  4QKN A;  3ZMO A;  4E4H A;  3E6C C;  2HWB 3;  1NZC A;  1RJ7 A;  3VD3 A;  3CMG A;  4B8E A;  4D69 A;  1BK1 A;  4COY A;  4DMI A;  3NWK A;  2WT2 A;  4HLT A;  2DCK A;  2UYB A;  1XB9 A;  2YFZ A;  4UW6 A;  2F6B A;  4W6X A;  4CDU A;  1S55 A;  3DPR A;  4QPI B;  4HG6 B;  1NQD A;  4AQ6 A;  2XJS A;  1QHD A;  2IWG B;  2VOT A;  3K46 A;  3GCW A;  2FZ2 A;  4SLI A;  1RVF 2;  2IFW A;  4MGI E;  3T1M A;  2QQI A;  2J1T A;  1ND3 C;  1CAU B;  1RUG 1;  4P9G A;  1AR8 3;  3GHN A;  3N4M A;  1PX3 A;  3VHN A;  5I8S A;  1BLZ A;  1MR5 A;  3M8L A;  4CRQ A;  4B3N A;  3M1H A;  4W8J A;  3P3N A;  2VTF A;  4TSV A;  5BNO A;  2QBX A;  3I2D A;  3NJY A;  1JZ6 A;  4QPG B;  3VD9 A;  3LIH A;  3HEI A;  4ISR A;  3MIH A;  4AQS A;  4XQ4 A;  1LHN A;  3TYJ A;  5FCC A;  5IVB A;  2Q8D A;  5A6Y A;  3OGJ A;  2FDG A;  1PNG A;  1B35 C;  2A1X A;  4YYO A;  3KM5 A;  4NRP A;  5C8C A;  1TME 3;  1S0B A;  3O0W A;  3WG4 A;  4N7I A;  2VCC A;  4IE4 A;  4HKL A;  4UFI A;  5A33 B;  2VW2 A;  4XZU G;  3M3E A;  3AKQ A;  1JS9 A;  1TMF 3;  1YQ5 A;  2CHH A;  5F32 A;  2GC2 A;  3ZR5 A;  4AI9 A;  3HQU A;  5A3T A;  3PMS A;  1NLR A;  2A75 A;  1OVP A;  2N7G A;  3VBU B;  1PO1 2;  1WWY A;  2LS6 A;  2P6C A;  5DZF A;  4BMB A;  1V0A A;  1AZD A;  3ASI A;  5JXH A;  4NIH A;  3IZO A;  1UZV A;  2V5Y A;  1NY7 1;  4YVW C;  4LBQ B;  1PMH X;  1CWP A;  3ZPO A;  2FDK A;  1AXK A;  3LSE A;  3I2G A;  3WEZ A;  4CXY A;  3S7E A;  1HIX A;  2QQW A;  3N7K A;  4NRO A;  3WP4 A;  2CDP A;  1N3Q A;  5FXV A;  3T2O A;  4WM8 B;  2ZHL A;  3HWJ A;  1NE4 A;  4LJH A;  1PIV 3;  1UMI A;  1LOF C;  1HJG A;  3HVD A;  4CE8 A;  3SHR A;  5A3M A;  1OUX A;  2GND A;  2YYO A;  5FYY A;  5C4W C;  2FDJ A;  2VCA A;  5E88 A;  2VU9 A;  2J1R A;  1W8W A;  4PIX A;  4PCR A;  1HX6 A;  3SCG A;  3N9Q A;  4DNY A;  2A70 A;  1DGL A;  1CIW A;  1POQ A;  3NNM A;  4AFM A;  3W59 A;  3ZM8 A;  1W06 A;  2VMF A;  4AED B;  5L7O B;  4HOO A;  5IAV A;  5JSO A;  4LA2 A;  5A7W A;  1H8T A;  5BNP C;  3A0K A;  4WVV A;  2D3S A;  5HV0 A;  4KNC A;  1T6B X;  1R1A 3;  3J4U H;  4A3X A;  3ORJ A;  1NG0 A;  1F5F A;  2Z42 A;  1AJK A;  3VBS C;  4XBQ A;  4AR2 A;  4CDX B;  5LEK A;  1SHW B;  1LJ7 A;  4HKW A;  1TME 2;  1DQ5 A;  1ULF A;  3S5Q A;  1JMU B;  3T4V A;  5BUV A;  1UN1 A;  2ZGQ A;  4AFB A;  4HVQ A;  2IFR A;  2BDR A;  1SFP A;  3MGU A;  3ZXJ A;  2A3X A;  3DYP A;  4QX3 A;  1KXG A;  1C5I A;  4F3J A;  2AH2 A;  2YDE A;  1PO2 1;  3VBR A;  3OJB A;  3WW4 A;  4QDR A;  3PTR B;  1RUF 2;  2XLG A;  5FZB A;  4LMF A;  4LUK A;  3LFM A;  2J7M A;  4FPO B;  5FY5 A;  2VOW A;  1APN A;  2EIC A;  5L36 A;  3AP9 A;  4XUN A;  4MGQ A;  1U5X A;  3OEB A;  4RR3 C;  1SPP B;  2J1S A;  2W94 A;  2XLA A;  4GZ9 A;  4NPL A;  2XJV A;  1COV 3;  2W1W A;  4YVS B;  3O1M A;  3N9O A;  1SBE A;  1GYK A;  3D8C A;  5FMO L;  4K1Y A;  1ASJ 3;  2OUJ A;  2O14 A;  3PVN A;  3VL9 A;  3K3N A;  2BW8 A;  1L7Q A;  2YY1 A;  4HVO A;  3UKN A;  4LHN A;  2VGD A;  4FPH A;  1CAW B;  4MX3 A;  4OZO A;  2R06 3;  4XC9 A;  1SCS A;  1SDW A;  1GIC A;  1SG3 A;  5A3P A;  2MPF A;  1X50 A;  3EHK A;  4OUL A;  3ZYJ B;  1ZX5 A;  2JG8 B;  4Q8L A;  3UES A;  1D0H A;  3KLS A;  1FXZ A;  5F2W A;  3UK9 A;  1UD1 A;  2E33 A;  2WO1 A;  3LE0 A;  4E2Q A;  5GZE A;  4XF4 A;  3ZIW A;  1UF2 C;  2ZKL A;  1C8N A;  1D4M 2;  5HCA A;  1S0G A;  4URT A;  3QH7 A;  1XRU A;  2XKO A;  1R1A 2;  5EIY B;  3OY8 A;  3MF6 A;  5LY1 A;  5A3L A;  3GBF A;  2VZS A;  1W9T A;  2JD4 A;  1LHV A;  2PMW B;  3RSJ A;  3M4F A;  1AXZ A;  3VBH C;  4AFD A;  5AC9 1;  5I0S A;  5A3N A;  1OLQ A;  1H2N A;  1WLD A;  4KG8 A;  5LA1 A;  1OC1 A;  4QPY A;  3VBF B;  3VBO C;  3ACG A;  3ETP A;  3KT1 A;  4QXC A;  5C4W B;  1BQP A;  2XWJ B;  2ZX0 A;  1XXN A;  3AVR A;  1AR6 2;  1V6K A;  2RDR A;  3A23 A;  2GH8 A;  4YM3 A;  1GBG A;  1WBF A;  1KFU L;  5ACA 3;  5FP3 A;  1JN2 P;  3O1V A;  1JTZ X;  2R07 1;  3HR9 A;  4LOT A;  1RUC 3;  5CKM A;  3P6B A;  2J1U A;  4ASL A;  3AYC A;  3USS A;  1PK6 A;  4IV3 B;  4IEY A;  4AI0 A;  5BNP B;  1CJD A;  2HEW F;  3AK0 A;  3C7F A;  2CU5 A;  3RDI A;  5FJK A;  2D93 A;  4O9G A;  4UW4 A;  3ZKU A;  4CU7 A;  4BDV B;  1O91 A;  4XF9 A;  1H2L A;  1AHS A;  4XQW A;  5H9Q A;  2H0V A;  3SNM A;  3P3P A;  5LA9 A;  2PHT A;  3VBS B;  2O0O A;  4CCD A;  1RUO A;  3H1M A;  4CDQ A;  1G9C A;  1LB2 A;  2D3P A;  1VR3 A;  4K8F A;  4COZ A;  2F4P A;  1SLB A;  1HXS 1;  2FMD A;  4LKF A;  1RB8 G;  4DOU A;  4Y3O A;  4CCE A;  3M3C A;  4OUE A;  4CEY C;  5FJH A;  1Z7S 1;  1YCI A;  2GP3 A;  1R1Z A;  1YC6 1;  2DCT A;  4XJW A;  2HWD 1;  3H8R A;  2VH9 A;  2W2I A;  2ZX1 A;  4MO3 M;  3ZFF A;  5F7U A;  4HL0 A;  4ATF A;  5FZ6 A;  5JXG A;  3JD7 3;  1BXH A;  2VZU A;  5JUV A;  1CAX A;  1VBD 1;  2W1Q A;  2X5I C;  3PTY A;  4YG6 A;  2VQA A;  3R4U A;  5HXV A;  5IVE A;  4LO5 B;  1OA4 A;  2DVG A;  2VMC A;  3MIB A;  5FMD A;  2ZEZ A;  1W6O A;  2EIB A;  3W20 A;  2Z2S B;  4JDN A;  4JGZ C;  4CCJ A;  1JYN A;  2RS1 1;  4DS0 A;  4IE0 A;  5K4L A;  4NWW A;  5FKC A;  1W3V A;  3PU3 A;  3WX5 A;  4RS5 C;  1DQ6 A;  3O14 A;  3BOW A;  3T4H B;  1Q8Q A;  4ARX A;  2YB7 A;  2WYS A;  3AL5 A;  2QNK A;  5JI9 A;  3CDZ B;  1IHM A;  4L9B A;  4D7Y A;  4MGT A;  1UCX A;  2D6M A;  2C26 A;  3IWZ A;  3SMH A;  2HWE 1;  3L2Y A;  1Z78 A;  4NIA A;  1REE A;  3LAG A;  5ACA 2;  1PGS A;  4TWT A;  5KXC A;  5CFC B;  3E6B A;  1GP5 A;  4OLL A;  4QT6 A;  2HWF 1;  1K3I A;  3NL1 A;  4HT1 T;  4IV1 A;  4XF3 A;  4TTG A;  2YUE A;  1WW7 A;  1T6G C;  5CBL A;  5A70 A;  1AYN 3;  1AR9 2;  2EAL A;  2BTV C;  2RS5 2;  3ENR A;  3LF7 A;  4IER A;  3SQO A;  4XW3 A;  5KC6 A;  2EA7 A;  5DMY A;  4XUR A;  3NJV A;  2C5D A;  1NUK A;  5F6K A;  5KHH A;  4XMI A;  5C3P A;  5J37 A;  3Q8A A;  2VTX A;  4RA0 A;  4E2S A;  1UO9 A;  3RYK A;  3AFK A;  3PUA A;  1W0N A;  1SZB A;  4GKY A;  3DYM A;  3KMH A;  2P3K A;  5GZG A;  1ZZ6 A;  3WHT A;  1RXG A;  3ZFE A;  3ZLI A;  4DPN A;  4IEZ A;  2BGO A;  3ZDV A;  1FAY A;  4XFG A;  3VGI A;  2VZR A;  1H2K A;  2VZT A;  2WAO A;  2IXH A;  1US3 A;  3AKP A;  1F15 A;  1Q3E A;  3LOI A;  4WVM B;  4FOY A;  2JDH A;  5J7M A;  4KGG A;  3UET A;  3JD7 2;  1Q8V A;  4IEP A;  1Y3T A;  2YC4 A;  2DV9 A;  2PHW A;  3POI A;  4N9I A;  2XDV A;  4Y24 A;  2DUP A;  3UJQ A;  4HZF A;  2PAK A;  2WYF A;  5CG9 A;  1BVV A;  4COU A;  1AF9 A;  3P5B A;  5A80 A;  4F8A A;  2XUE A;  1HB4 A;  3WW2 A;  4MYE A;  4LBQ D;  1O4Y A;  3AZZ A;  3MFC A;  5C5U A;  3F95 A;  1ZRF A;  1JYV A;  2RJL A;  1RL3 A;  2LAL A;  3H42 B;  4GH4 A;  2TUN A;  4ZS2 A;  3JBG 1;  4ZXE A;  1ZZB A;  2GNT A;  3D0J A;  4S2F A;  3T2Q A;  4ERO A;  4A45 A;  4D6R A;  1VBE 1;  3ZXD A;  3LEK A;  2WQ4 A;  3ZFG A;  4AI1 A;  1ST8 A;  3HN3 A;  3GNE A;  3FBY A;  3C7O A;  4BJ0 A;  4PIY A;  1ZZ9 A;  3ZVX A;  1LOG A;  4CP2 A;  1D2S A;  2P3Y A;  2SLI A;  4LQR A;  3RFR A;  2FDI A;  2ARE A;  4KWK A;  4BXS V;  4Y5T A;  3K77 A;  4GMP 3;  4CCO A;  1N1V A;  1L7R A;  2JWP A;  2LRP A;  5DPN A;  5GZC A;  3CLP A;  2VBP A;  3R0R A;  4PBP A;  4TYS A;  4K1Z A;  2ZXQ A;  4RGG A;  5F39 A;  2WQ8 A;  3WUC A;  3CL1 A;  3CJI C;  2J1V A;  3LA3 A;  4XIO A;  5FYV A;  2PLV 2;  2NM1 A;  3C8X A;  1UZ0 A;  4AG4 A;  1RVF 1;  1OVS A;  2BNM A;  1EAH 2;  2BRT A;  2W08 A;  3SKV A;  4JGY A;  2JDP A;  3MLJ A;  4DFS A;  1PZ8 A;  1ULD A;  4AHY A;  3AJZ A;  3IDE A;  1MQT C;  3KV6 A;  4KGQ A;  3MLL A;  5LY2 A;  2QQK A;  2W3J A;  2ETE A;  1HN0 A;  2C24 A;  3DPR B;  3ELN A;  2R04 3;  4HMZ A;  3AMN A;  5FZL A;  3T08 A;  3PNA A;  4G9S B;  2W9X A;  1NXM A;  3J7M A;  2VAU A;  3WDW A;  4FXG B;  4AK3 A;  1IG0 A;  4XFF A;  4NRM A;  2E63 A;  4PLM A;  4F7Z A;  2PFW A;  4IET A;  4O65 A;  1N1S A;  1NA1 C;  2MEV 3;  3FUQ A;  3WF1 A;  1W8O A;  1MVE A;  4FOW A;  4M3C B;  3LKJ A;  4L8Q A;  3WF2 A;  3AMM A;  5A1A A;  3I4I A;  3JU9 A;  3EYP A;  1CVN A;  3UKT A;  1GWL A;  4DXT A;  1NQJ A;  3LDK A;  4LO6 B;  1CPN A;  2R1B A;  2OX0 A;  3GJA A;  5D1I A;  1UW8 A;  1FV3 A;  2WNE A;  2HWC 3;  1PO1 1;  4B1M A;  5C8C B;  4IES A;  2GAL A;  2ATF A;  1QU0 A;  3H3L A;  2VNG A;  2VOX A;  3HT1 A;  3PJY A;  2J22 A;  4BXF A;  5A1F A;  4Q4X 3;  1GZT A;  2KR2 A;  2XQX A;  4LOS A;  4AFC A;  3NO8 A;  5FY7 A;  1OD5 A;  4G3Y C;  1H9P A;  5FRE A;  3VV1 A;  2JG9 C;  4XVH A;  2PXJ A;  5JZG A;  2V5D A;  3D0S A;  3OTF A;  2W0X A;  3JCI A;  5FXX A;  4D7T A;  1F35 A;  4NUB A;  2AR6 A;  5DAP A;  3THD A;  1GUI A;  1Q43 A;  2OQ6 A;  3NJZ A;  4GAL A;  4RGA A;  4AI8 A;  1QH6 A;  1MZE A;  1O8P A;  4NAM A;  4GKX A;  2PEL A;  1UY2 A;  4QD2 A;  1NAE A;  4DUX A;  1XU1 A;  3WF4 A;  3ZN5 A;  1GZ9 A;  1ACC A;  2IC1 A;  2RMU 3;  3IIA A;  4P9I A;  2K46 A;  4XJ8 A;  5JMO A;  4YZ5 A;  5BV6 A;  3RZK A;  2AAC A;  4BH9 A;  4BU2 A;  1WBL A;  4S2D A;  4OZX A;  5K9Y A;  2ZGK A;  2QZ2 A;  4IEO A;  3B69 A;  2WL1 A;  4XFB A;  1V6L A;  2R04 2;  5FYB A;  5K0U C;  3RNS A;  3C7G A;  4UFL A;  4CYD A;  2RV9 A;  3U11 A;  4E27 A;  3UT0 A;  1WZX A;  5C33 A;  3I7D A;  3O1O A;  2YC0 A;  4IGO A;  2BV4 A;  2MEV 2;  5F3E A;  2YBP A;  4ISQ A;  3OBR A;  1ODN A;  4CU8 A;  3TEW A;  1TME 1;  2ZAA A;  2OZ6 A;  3BPZ A;  4LK6 A;  3ZOI A;  5SV5 A;  3RZZ A;  5FYM A;  1H8T B;  2NPI A;  4IE7 A;  2BFU S;  3RYR A;  2H6B A;  2PHU A;  1V9U 2;  1MS3 A;  5JPN B;  2D5F A;  1IS6 A;  1US2 A;  3MBW A;  1IZ3 A;  1F31 A;  2VD7 A;  5F3G A;  1MQT B;  5LA0 A;  1BCX A;  5H9R A;  1RUF 1;  1DGW A;  4Q4V 2;  2HJI A;  3BPS A;  1WW4 A;  4XBL A;  2WS9 3;  1W6P B;  1JHJ A;  2YU2 A;  2QQP A;  1DHK B;  3A0N A;  3KV9 A;  4LHL A;  5ANQ A;  1OH3 A;  3VDD A;  2DBI A;  4NPR A;  2X09 A;  3KCX A;  1X9T A;  1NA1 B;  3PME A;  4EWE A;  2ET7 A;  1IS3 A;  4YFZ A;  3VBR B;  1V6M A;  3RJ2 X;  3CQO A;  3LB9 A;  3QBQ A;  4JHZ A;  2I07 B;  1M06 G;  3THC A;  1YYN A;  5C9A C;  4CP0 A;  4QU1 A;  3ALQ A;  1PIV 1;  3WXP A;  3IM0 A;  3X29 B;  2V72 A;  3V56 A;  2VBD A;  5JWP A;  1VB4 A;  3VHP A;  2JDZ A;  1MZ5 A;  2AGS A;  2RMU 2;  3OB8 A;  4PLN A;  3IT8 A;  4Y1Z A;  4CU6 A;  2QDN A;  5ISL A;  2LUW A;  1YRZ A;  3BB6 A;  4YW2 A;  1C5H A;  4Y20 A;  2GNB A;  1UMH A;  4LUM A;  2R0H A;  2BBA A;  1YIF A;  1EUU A;  2JG9 B;  2Y6L A;  3POE A;  4HAN A;  1LU2 A;  1Q8O A;  1D4M 1;  1HRV 2;  4DXR A;  1J84 A;  4XEZ A;  1DIW A;  4LLO A;  1R1A 1;  2WII B;  1JYX A;  3RPQ A;  3HMY A;  3FJS A;  1MZF A;  3NAP C;  5DUX A;  4BQ3 A;  4CZS A;  3TEZ A;  2VZO A;  1J3P A;  3M3Q A;  4B4R A;  2XLF A;  5FYI A;  2R32 A;  1QDC A;  2ES3 A;  4XDQ A;  4CEW C;  3CJX A;  4TLF A;  1OA3 A;  4WM7 A;  5FPV A;  3WQ1 A;  5KBF A;  2CGP A;  1OSG A;  3F2Z A;  2G19 A;  4YW6 A;  5FMB A;  2WFP A;  2A7A A;  4FPL A;  2VCB A;  4YFW A;  2ZMN A;  2XG3 A;  2A3Y A;  4L2N A;  1JOB A;  3PUH A;  5FY1 A;  1TE1 B;  4I02 A;  2X8K A;  3TNP B;  3ZXF A;  1DBN A;  1FAT A;  2D6L X;  1BK0 A;  1GOG A;  2RDQ A;  2ZGO A;  4FTB A;  3OUJ A;  4LUL A;  3L2H A;  4X6R B;  2FMY A;  1ZA4 A;  4HPK A;  2WO2 A;  5LRS A;  3OGS A;  5LEJ A;  4NE9 A;  3SKJ E;  1L7L A;  1FX5 A;  2Z79 A;  4ASM B;  1FI2 A;  5CIS A;  1VRH 3;  3PUS A;  4OQ8 A;  1ASJ 1;  2ZA9 A;  1UOF A;  5A6Z A;  3OD0 A;  1TZO A;  4ZY9 A;  1UKR A;  2A6W A;  1FMD 3;  1STM A;  1W28 A;  4AWD A;  3FC0 A;  4CDQ B;  2WUH A;  3RZJ A;  4TXW A;  1EUT A;  1FPN 3;  1S4C A;  1CON A;  4NHL A;  1XYO A;  5E8A A;  5CVR A;  1VRB A;  3MW3 A;  5E89 A;  3WDY A;  2UWA A;  1G9D A;  3J8F 3;  3M3I A;  5FK8 A;  3BVC A;  3UL2 A;  3AMQ A;  5HXM A;  1RUI 2;  4BQ1 A;  1VMF A;  4QPI C;  4RL7 A;  3ZFF B;  2ZGP A;  1CAX B;  5IJR A;  4RN5 A;  4IW3 A;  4YGD A;  4CXW A;  4I09 A;  3E5Q A;  3USU A;  4CCM A;  4XDP A;  4OQ9 A;  5ANN A;  4AXO A;  3D6E A;  1QJE A;  1J3Q A;  1MS9 A;  2WT1 A;  1WCD J;  5LK5 A;  3DXU A;  3ZYI B;  5BY5 A;  5KXB A;  3IMN A;  4COW A;  1W8H A;  3ZX7 A;  5CYY A;  3PIJ A;  4LKE A;  5ACA 1;  2DCJ A;  2WLP A;  3TBD A;  5AFB A;  3JQW A;  2NZ9 A;  1LKN A;  3HD8 B;  4IE6 A;  4K21 A;  5A7O A;  5FQ0 A;  2RS5 1;  1AR9 1;  5JOX A;  3FLP A;  3C3V A;  1WCU A;  1YFX A;  3GF6 A;  2Y60 A;  2QQN A;  2UUR A;  3IDB B;  1ZRR A;  5FV3 A;  5K8S A;  1CZV A;  1S2K A;  1XSQ A;  2Q1F A;  2ZTN A;  4IV1 B;  5JXI A;  1DGW X;  2XJR A;  3R6S A;  1LUL A;  3VBU C;  3VHR A;  1LCL A;  4OHV A;  4AYU A;  4BQY A;  3R05 A;  1VRH 2;  1QH7 A;  1SLT A;  4IGP A;  4N53 A;  1WCK A;  1UQX A;  1H1A A;  1S0D A;  2VZQ A;  5AFE A;  1X9P A;  3TN9 3;  5LBC A;  2BBV A;  2SBA A;  4Y33 A;  5J48 A;  1FMD 2;  4XAC A;  3UJO A;  1OF4 A;  2JIJ A;  1VMH A;  2W52 A;  2WFF 3;  4P00 B;  3JXS A;  1RYY A;  3JD7 1;  1JHN A;  4IE5 A;  4YWA A;  2ORX A;  4A6O A;  3ZFE B;  4KMQ A;  1YQ8 A;  5CKQ A;  4WM8 C;  4LHS A;  3J8F 2;  3EO6 A;  3INA A;  2WZP P;  2WSV A;  1AYM 3;  2OA2 A;  4XJZ A;  4Y5Z 0;  2B46 X;  5FZH A;  3NKT A;  4NVP A;  1KD7 A;  2VW0 A;  2FCT A;  3JBG 2;  2QQO A;  4XFC A;  2EIG A;  2WN3 A;  2WNU A;  3I59 A;  3TOJ A;  4OI4 A;  4GMP 0;  4TLG A;  1E57 A;  3NNF A;  5FYU A;  3RZH A;  1EV1 3;  1ZRI A;  5HCB A;  4BIS A;  5EV7 A;  2VO5 A;  4NO4 A;  2V73 A;  3N9N A;  1MVQ A;  3J7N A;  2VOK A;  3T1L A;  4AED C;  2UY8 A;  5IT6 A;  5LK7 B;  1LEN A;  3T3Y A;  4YGE A;  3NST A;  4R9A A;  3I3B A;  2VZ3 A;  3Q8B A;  4LBK A;  1Y9M A;  2VUD A;  2WNV C;  4H55 A;  2VC9 A;  3ACH A;  3POF A;  1CGP A;  2LTN A;  4GH4 B;  3W5M A;  3BGA A;  4CUG A;  3E97 A;  1UU5 A;  4Q4Y 3;  1YQ6 A;  4CDX C;  1JYI A;  2D97 A;  5FDB A;  1K5M C;  1OFN A;  3NNL A;  2QKD A;  4Y1X A;  3ZFG B;  2BFU L;  5LCW L;  4JKL A;  2HYX A;  2GH2 A;  1NCR A;  5FYT A;  1IPJ A;  4IEU A;  3P1I A;  4Z92 B;  1OOP A;  1JU3 A;  2ET1 A;  3EMR A;  1QEX A;  4HET A;  1U5I A;  4NRQ A;  5FPZ A;  2CTV A;  2PLV 1;  1QJF A;  4Q26 A;  1XE7 A;  2Y38 A;  5FZ7 A;  3LGR A;  1H30 A;  4EQV A;  3RZG A;  1EAH 1;  4E4Z A;  1PMJ X;  5FPU A;  4JZR A;  2Z4F A;  4EYU A;  1WCS A;  1UOJ A;  4PLO A;  5E1R A;  3TN9 2;  4H14 A;  3U1X A;  2DVF A;  2D6N A;  1DF0 A;  3AZY A;  3FHA A;  4Z2W A;  1IKP A;  4FO9 A;  3QCW A;  4B4P A;  1LGB A;  4QKD A;  4YVS C;  2ZX3 A;  2NLR A;  4JGY B;  1JBC A;  4YNI A;  2XVL A;  3K48 A;  4UI9 L;  5FZF A;  5D8A A;  1UZY A;  3VD7 A;  5FR3 A;  2JKB A;  1JZ2 A;  1AYM 2;  2DVB A;  1GNY A;  4IEV A;  5F3C A;  1LU1 A;  5IVF A;  3RVH A;  5I8T A;  1DZR A;  1NCQ A;  4DY5 A;  2FCV A;  3JB4 C;  4XTM A;  5A3O A;  1JZ3 A;  2GME A;  2JG8 C;  1G9B A;  2VZP A;  4ZKT B;  1JH5 A;  4I30 A;  3ETQ A;  4A7K A;  4RHV 3;  4QX1 A;  5DG1 A;  2RR1 3;  5FZO A;  1N3O A;  2HWB 2;  2JDY A;  5DUV A;  3WP5 A;  4M00 A;  3VZK A;  4KH9 A;  4XF0 A;  3T2P A;  3ES1 A;  5FO9 B;  2JKX A;  3VL8 A;  2OII A;  2QJV A;  3D82 A;  2XWB B;  4Q4Y 2;  2JB4 A;  4QHZ A;  4XXA A;  4BM8 A;  5CFD C;  1GP4 A;  1DZQ A;  1SFN A;  4JTN A;  4GMP 1;  5C6C A;  1A6C A;  1WME A;  2QCS B;  4BLI A;  3VBF C;  3POS A;  5FZ4 A;  3VLB B;  2QQV A;  2VNO A;  4M01 A;  1RIN A;  3V65 A;  2UY9 A;  3SEE A;  2HEY F;  4QX7 A;  4AZZ A;  1D7P M;  3SH4 A;  5JZG B;  1AR8 2;  3JUU A;  4J6G A;  2AEN A;  5EHD A;  5IVV A;  4UT5 A;  5C3S A;  4IV3 C;  1E5S A;  5LW9 A;  3N9L A;  2HYK A;  2YMZ A;  4C90 A;  5KHI A;  1ZRE A;  4HON A;  2WNV B;  4XJ9 A;  5F9T A;  5JSP A;  1HB3 A;  3AP4 A;  3N7L A;  3O5S A;  4QGN A;  3UYJ A;  3DEM A;  2R04 1;  5IK7 A;  2GP5 A;  3MUY 1;  3S30 A;  4LBO A;  1YFW A;  4OMC A;  1S2B A;  2FCU A;  4AAP A;  1K5M B;  3LPG A;  1MEC 3;  1OH4 A;  4CTE A;  2WZR 3;  1GU3 A;  3NKG A;  4FPE A;  3DCQ A;  3ON7 A;  1BBT 3;  2B45 X;  2MEV 1;  1PGL 1;  2DCY A;  2WN2 A;  1TMF 2;  3MUZ 1;  1GZW A;  3HOB A;  3WNN A;  2VL4 A;  3SIS A;  3KF5 A;  4AEM A;  3WIN E;  2HKX A;  4AEK A;  4RQP A;  2ZGS A;  3OYW A;  4XUP A;  3TEY A;  3WT3 A;  1V9U 1;  1F4H A;  2BVB A;  1YXW A;  2WQZ C;  2WSU A;  4OHW A;  1OKQ A;  4Q4V 1;  3BKZ A;  3IDA A;  1AL2 3;  2OUH A;  4NJ4 A;  4BK5 A;  1FV2 A;  4EN0 A;  1PZ7 A;  4NHM A;  4Q4X 1;  2WWS A;  3ZSE A;  4AHW A;  4GB3 3;  4V2W A;  3OPZ A;  1AL0 G;  1XE8 A;  5FP7 A;  5BPX A;  2VQT A;  2RS3 3;  2K9Z A;  4I3P A;  2VOV A;  1SLL A;  5FP8 A;  1UYX A;  5FUN A;  3WNP A;  1PIV 2;  2JX9 A;  1W3X A;  5EJ3 A;  4GQ7 A;  2LW8 A;  3LEI A;  4WBB A;  1K5J A;  2CWM A;  2RHP A;  3VN4 A;  5FOJ B;  1PGW 2;  1OFS A;  1F2N A;  3ILN A;  3OUH A;  4X8N A;  1RMU 3;  4CP9 A;  1RTV A;  3ZSJ A;  3VDD B;  1QF3 A;  3K4A A;  5FUI A;  2DTY A;  3I2H A;  3Q8E A;  3ZXE A;  4I2O A;  5CFC C;  2RMU 1;  5FK7 A;  1X82 A;  2OPK A;  5C5T A;  1ZBE 3;  1OUR A;  1Q56 A;  1O4T A;  1MS4 A;  4X6Q B;  4Z07 A;  3I2O A;  3BYW A;  3O0V A;  3FZ3 A;  3CF6 E;  4PDW A;  1JYW A;  3KHC A;  3OUI A;  5CA6 A;  1ZYB A;  1ULG A;  1OUS A;  1W2A X;  2KA3 A;  4DO0 A;  2A3W A;  1JU4 A;  1HRV 1;  2BGP A;  4Q0Q A;  5CFD B;  5FBJ A;  3LA7 A;  5EWS A;  1RUH 3;  3MFA A;  2QQU A;  4QPW A;  1MEC 2;  1VIW B;  4Y20 B;  2WZR 2;  4YM1 A;  4MET A;  2VVD A;  1YI9 A;  3B00 A;  3BTX A;  2PYT A;  1W9Y A;  3ZYH A;  3JQX A;  1XYP A;  2CDO A;  4BQ2 A;  1RUJ 3;  2NP0 A;  2D6O X;  2Q8E A;  2YC2 A;  2CAV A;  1H4H A;  5M0T A;  4C91 A;  5FOB B;  3GZA A;  2NN8 A;  2EXJ A;  4EN8 B;  3MW4 A;  2JB8 A;  3SC7 X;  1O4Z A;  2EAA A;  3K3O A;  1AL2 2;  1SAC A;  1NE6 A;  4QM8 A;  2EID A;  1COV 2;  4GB3 2;  4OHX A;  4WM7 B;  1V00 A;  2P17 A;  2IXC A;  5LRR A;  2O8O A;  4L97 A;  4E8D A;  4AFA A;  4KU7 A;  3CZJ A;  3RS6 A;  1UY1 A;  1ASJ 2;  1LOB A;  5FZG A;  5F5I A;  4JX0 A;  4Y5S A;  4LT5 A;  4XBN A;  3HBK A;  1WD4 A;  4CUA A;  1GWM A;  4YW7 A;  2WR9 A;  3FMG A;  2R06 2;  4XPV A;  1RMU 2;  4AHX A;  1EYB A;  4QQO A;  4FQ4 A;  4HPK B;  2DYC A;  1GWK A;  1W2N A;  2D6K A;  4HN1 A;  4NN0 A;  3V0A A;  1G86 A;  2G1M A;  1O5U A;  3WSO A;  4MAD A;  1A3K A;  3B9I A;  1ZBE 2;  2ZJC A;  4U36 A;  3WG2 A;  4Z1V A;  5IAT A;  4J1W A;  2P6H A;  3EXU A;  2WRA A;  3VZN A;  1FOD 3;  1PVC 3;  1I5P A;  4MHR A;  1JUI A;  4IQP A;  3PHM A;  1YO8 A;  1RUI 1;  4LBJ A;  5APA A;  2P5B A;  4QQH A;  1GNH A;  3DEC A;  1LES A;  4AEJ A;  5FPL A;  4DUW A;  4EE2 A;  1GQP A;  4FAH A;  1OXC A;  1C8M 3;  4XET A;  1HQN A;  2ZPX A;  2VY0 A;  4URA A;  2TBV A;  4P9X A;  2B9U A;  3POG A;  5TSW A;  4BLJ A;  1WCQ A;  1NX9 A;  2BER A;  2OZJ A;  3SCH A;  1QXR A;  4CDU C;  1R08 3;  1RUC 2;  3DPR C;  1AX2 A;  2E51 A;  1H4G A;  2P34 A;  3I2K A;  2VMH A;  3BIW E;  3N3H A;  2K0G A;  1JZ4 A;  4EN7 B;  3WDV A;  2XUM A;  3D4K A;  4X8P A;  2VPV A;  3KCC A;  4FOQ A;  1POV 3;  3USU B;  5GLV A;  4W4Z A;  4EZ4 A;  3E6D A;  1LGN A;  4HKO A;  2BWC A;  1TNR A;  3HAG A;  5DN2 A;  2V4A A;  1QJU 3;  1QXP A;  1XNA A;  1QY4 A;  2VUA A;  5BNO C;  2TEP A;  4KL1 A;  3T0A A;  1JZ5 A;  4M3C E;  3QD6 A;  4K7J A;  4MGK E;  4YAR A;  1LEM A;  2NQY A;  3LD8 A;  4NR1 A;  2OKX A;  1W2U A;  1OD3 A;  2ZS6 B;  5C8C C;  2D7F A;  1GQG A;  1EPZ A;  1GAN A;  2BJS A;  1VRH 1;  1XNB A;  3PUR A;  4LO4 B;  4HSJ A;  4JQR A;  5IFP A;  3VD4 A;  5FZM A;  1VLN A;  4QHB A;  2ZGR A;  1Y7B A;  2DFC A;  5FO7 B;  3VZO A;  1DYP A;  1FMD 1;  1XNK A;  4A7Y A;  2B9V A;  2ZBJ A;  2ZHM A;  3NRU A;  5T5P A;  2WT0 A;  3IPV A;  3Q8F A;  4MH0 E;  3VDB A;  1FPN 1;  4MXV A;  1VBC 3;  4N90 A;  4N53 B;  5DAQ A;  3GDB A;  4M3C F;  1FOD 2;  3LIG A;  1OBN A;  3J8F 1;  2XHK A;  2B7Y A;  5F8P A;  3RWN A;  5C3R A;  1ND2 A;  1W6Q A;  4JHT A;  3MIE A;  1SBF A;  3KT4 A;  2F4L A;  5HV4 A;  1ENR A;  3W9A A;  1SLI A;  4GXL A;  3SEP A;  1JOD A;  2E26 A;  3ABZ A;  4A2U A;  5CEH A;  1OF3 A;  1C8M 2;  3GZE A;  1W9S A;  4Q5O A;  2QDR A;  1DU3 D;  3A22 A;  4Q0V A;  4QX5 A;  4W65 A;  4AGR A;  4QXB A;  2XJQ A;  4AVB A;  1JW6 A;  1UY4 A;  1C28 A;  3B7M A;  4PT6 A;  1RUN A;  2WNU B;  1AYN 2;  3QOP A;  5JI7 A;  2JEM A;  4DEV A;  4UAP A;  4B1L A;  3O0X A;  2B4K A;  4QX8 A;  2GNM A;  3MIC A;  4FPC A;  2ADE A;  5A7Q A;  3T30 A;  2A6Y A;  4MZU A;  5FZD A;  5JVV A;  3UGG A;  4A42 A;  4CCK A;  3WP6 A;  4MGS A;  4ARY A;  2ENR A;  1W9F A;  2D5H A;  3OGG A;  2Q5T A;  3NMB A;  4H7M A;  2A6X A;  3O12 A;  4E2G A;  2ZGM A;  1H8T C;  1QJU 2;  1DLL A;  1FNZ A;  3A7Q A;  5CIR A;  4FSJ A;  2O1Q A;  2E32 A;  1IS5 A;  1CZT A;  3FUO A;  1VBA 3;  4AHZ A;  3O7O A;  1S0F A;  2GZW A;  5FMC A;  3ILF A;  2W87 A;  1GNZ A;  3ZN6 A;  4CDU B;  3WCR A;  3MDP A;  1A8M A;  3OGV A;  1NCR B;  5FYS A;  2G4I A;  3TN9 1;  2PHR A;  3RYP A;  1BEV 3;  4YW3 A;  1U12 A;  4QPG A;  2VQ0 A;  5LBE A;  1LTE A;  4JRL A;  4Y1V A;  5EP9 A;  1GOF A;  2Y34 A;  3GJB A;  3LDR A;  2P2K A;  3VBR C;  4XXP A;  1VBC 2;  3EJK A;  4QWN A;  3PUQ A;  1VPH A;  2Q8O A;  4Q27 A;  4K9S A;  2HH9 A;  3NW4 A;  5BNO B;  5A33 A;  2XL7 A;  1AYM 1;  3VZL A;  2G9F A;  3UGH A;  3WF0 A;  2EXH A;  3ILR A;  2W91 A;  1Q8P A;  4N43 A;  5FP4 A;  3WG3 A;  3T0D A;  1VE0 A;  2XML A;  1ENQ A;  3FLR A;  2WWJ A;  4MVT A;  3N35 A;  4QMA A;  4UF0 A;  4XYX A;  5HPO A;  1ZRC A;  3ZXK A;  1I9R A;  5D8A B;  1JUH A;  3BTY A;  4PQ9 A;  4LOR A;  3POB A;  4BYY A;  4Y22 A;  2CWS A;  2B42 B;  2RE9 A;  3ZYG A;  1Q8S A;  2W46 A;  3WDX A;  3ZYF A;  3MW2 A;  2J1A A;  3VDC A;  2XJU A;  4FOV A;  1H2M A;  2HWB 1;  3J7L A;  4DIN B;  5DAV A;  1NCQ B;  3WNM A;  5F5Q A;  3U0Z A;  3ECQ A;  4Q4W 3;  5CZK A;  3KWV A;  1ENS A;  1AUY A;  1RHI 3;  2W92 A;  1DP0 A;  5ABJ A;  4Q4Y 1;  2DUQ A;  2NYY A;  1M4W A;  2ZHK A;  4GD4 A;  2D44 A;  3AXD A;  3OBZ A;  2WAB A;  3UGF A;  1ULE A;  2P3I A;  3KGL A;  1DLC A;  5F2S A;  5FZO B;  2BEO A;  3BUC A;  4N8M A;  1DQ2 A;  1AR8 1;  3CU7 A;  3ZSK A;  1VBA 2;  2JDU A;  2YV8 A;  1DDL A;  4LIT A;  4CDW A;  5BNN A;  5CAD A;  5FZK A;  5GZF A;  1WA6 X;  5L7O A;  2PQQ A;  4IL7 A;  2FBE A;  1GQH A;  3OPW A;  2X29 A;  5GJ6 A;  3O1T A;  3FN9 A;  2R7E B;  1BEV 2;  5E16 A;  3GM8 A;  2YPJ A;  4OCT A;  4KI5 M;  1YJK A;  4W6W A;  3VKM A;  1PGL 2;  1HN1 A;  1YLL A;  2PAM A;  2IUW A;  1UYY A;  2PHL A;  4HBN A;  5FZI A;  5JLV A;  1PK6 C;  3D3A A;  5A7W B;  5AVP A;  2YGM A;  1W05 A;  3KGZ A;  5A6X A;  3WF3 A;  4A7Z A;  1TMF 1;  2W1S A;  3W58 A;  3KB5 A;  3RZM A;  1YHF A;  5FXZ A;  2BYV E;  3SXW A;  3EB7 A;  1UIJ A;  4XCA A;  1CES A;  1ND3 A;  3AX4 A;  3TWI A;  2VME A;  1OKO A;  5DAX A;  2HWC 2;  1F9K A;  3U4S A;  4F83 A;  3FLT A;  3MYX A;  4Q0U A;  1YEW A;  4A44 A;  2C4X A;  1RIT A;  3Q8C A;  4CDQ C;  5AC9 3;  1O59 A;  4BIO A;  4QB1 A;  2WA4 A;  4Q4X 2;  3MZH A;  4FCA A;  1G6N A;  5FYC A;  1GZW B;  1PM7 A;  5DAB A;  5IW0 A;  1W04 A;  2EXI A;  3J9S A;  1OPO A;  4GUL A;  4RHV 1;  3U07 A;  3WNX A;  1LR5 A;  3AYE A;  3LA2 A;  1SPP A;  4RQP B;  3D5O A;  2JE9 A;  4NHK A;  4YM0 A;  3OYW B;  5KWR A;  3PL0 A;  1B35 A;  1QOO A;  3ZFF C;  4RFR B;  1O3Q A;  4Q4W 2;  5FAX A;  1RHI 2;  4FFH A;  4IUG A;  5DXD A;  3DKQ A;  5GLZ A;  5IYY A;  3DL3 A;  2ZAH A;  3A4U A;  3BTA A;  4M0N A;  2BQP A;  5CNA A;  1LOA A;  4XJA A;  4ZU5 A;  5J96 B;  1G9A A;  5JDB A;  1PVX A;  4YZ1 A;  5EZW A;  5A7N A;  2DUO A;  1PGW 1;  2NMO A;  1SLC A;  1LRH A;  3ITQ A;  3V0B A;  4XUQ A;  1G7Y A;  3MF9 A;  1DYO A;  1OA2 A;  1UAI A;  5JMC A;  1HXS 3;  4YVW A;  4D6Q A;  1RGS A;  4JC1 A;  2PHX A;  3QH6 A;  5KC5 A;  3I49 A;  4LKD A;  3AP5 A;  2FDF A;  1QQP 3;  2F17 A;  3ME2 A;  3H50 A;  1ZBA 3;  2P4E A;  4CP9 B;  5FKB A;  1UOB A;  4CPB A;  1UWW A;  4AVA A;  3MO4 A;  4FT8 A;  1W39 A;  1MS5 A;  2DVA A;  2Q0A A;  4IV1 C;  4DIQ A;  4Q0P A;  1MEC 1;  3PLQ A;  1ZA7 A;  1LOF A;  2WZR 1;  4DY3 A;  2DBN A;  1CR7 A;  1PMI A;  1RED A;  3I3D A;  4XE9 A;  2I45 A;  4QGL A;  1ENX A;  3IKW A;  4PDW B;  5JR2 A;  3OY8 B;  3PU8 A;  5C4W A;  5IAX A;  4NHX A;  3H3U A;  1SBD A;  3ACL A;  1IQD C;  3E5X A;  2JDM A;  3E5U A;  1AX0 A;  1JXN A;  4FVV A;  4R9B A;  1GR3 A;  4PIZ A;  4R9C A;  4NID A;  5JOW A;  4XZP A;  4LO8 A;  3NV1 A;  4YGB A;  1UZZ A;  2WS9 2;  2JDN A;  5BNP A;  3WQ7 A;  3ZFE C;  1QDO A;  2PAE A;  1SLA A;  1LHW A;  1KFX L;  2A6Z A;  1AX1 A;  1W99 A;  2VG9 A;  3CNA A;  3DKW A;  5T52 A;  1AL2 1;  1MAC A;  4MSV A;  5K7P A;  2YBS A;  3DUI A;  1COV 1;  1X8E A;  4GB3 1;  3VBS A;  3WNK A;  1PK6 B;  2Y6H A;  1IG3 A;  4YW1 A;  5C70 A;  1JYT A;  4CU9 A;  3J26 N;  4EN6 B;  1NYW A;  1NLQ A;  3CZU A;  1RIR A;  5HI0 A;  3AKT A;  3H1W A;  4Q8K A;  2IVJ A;  1TQ5 A;  2MNG A;  1CJP A;  1B09 A;  1QGL A;  2R06 1;  2WAA A;  4KWL A;  5GLU A;  3OG2 A;  3RQ0 A;  2DU0 A;  1RMU 1;  1O7F A;  4UXA A;  5FO8 B;  2CGN A;  4ZPI A;  3LOB A;  3O1P A;  3B94 A;  3GGL A;  1ZBE 1;  5FY4 A;  4GH4 C;  2VUL A;  1LHU A;  4AE2 A;  3UV9 A;  4E9K A;  1JOP A;  4RR3 A;  1QQP 2;  3APB A;  1W0P A;  3ZFG C;  1ZBA 2;  3UKV A;  2XR4 A;  2VXR A;  4NHY A;  3VD5 A;  5I91 A;  3V0A B;  1XC6 A;  3H8U A;  4N9H A;  1W8U A;  1PHM A;  2YHJ A;  2VUJ A;  4L11 A;  1E5R A;  5T55 A;  1W6O B;  1R09 3;  3GYD A;  4CCL A;  5EXO A;  3ZSM A;  4KBZ A;  3A21 A;  1VP6 A;  2Q1Z B;  4S2G A;  2BPA 2;  3HNY M;  2B8M A;  3U10 A;  1SFY A;  2RVA A;  2HBT A;  1BVP 1;  2VTX J;  5KR7 A;  4XAE A;  1IQA A;  1C4R A;  4UBH A;  1RUC 1;  2D6P A;  5EJ1 B;  2ZML A;  1UYP A;  1WGP A;  4UWD A;  1S1A A;  4P02 B;  4V1P A;  4JKM A;  2OPW A;  3I8T A;  2RDN A;  4CSW A;  2JE8 A;  1CX1 A;  3MHZ A;  4JGY C;  3N7J A;  3VKL A;  3IDC B;  4R9D A;  5J3U A;  4IEQ A;  3NV3 A;  3GCX A;  2A71 A;  2JDK A;  3NV4 A;  4JRA A;  1XQN A;  3Q9O A;  4QKF A;  4W6Y A;  3SIT A;  4YLZ A;  2UWB A;  3AZX A;  3RGB A;  1E5H A;  5J09 A;  3VBH A;  4AOC A;  3ACI A;  2VXJ A;  3DGT A;  2DVD A;  1NOV A;  4UYB A;  4P5H A;  3VBO A;  3EQE A;  4N7U A;  4AAX A;  5L19 A;  4P14 A;  5JOY A;  4J25 A;  5FZ1 A;  3LQC A;  5SV8 A;  4P9J A;  3O1U A;  3VKN A;  4RSU A;  1KRI A;  1P8J A;  3SCF A;  4LXL A;  1UYZ A;  2AC1 A;  2R0F A;  1PZ9 A;  3NJX A;  1MS1 A;  4KQ7 A;  3AFG A;  1FPN 2;  4BQ4 A;  2QUO A;  2PHF A;  5FXW A;  2QQJ A;  1RVF 3;  3KQ4 B;  3NQH A;  5IVC A;  4XDO A;  5KHJ A;  1DFQ A;  1I6X A;  3CIH A;  3FWE A;  2WKK A;  4GWJ A;  3KSC A;  3H7J A;  1FOD 1;  2X53 S;  4K3U A;  5C3O A;  2CYF A;  4XIL A;  5LB6 A;  5B2G B;  5JZG C;  3PVE A;  2VM9 A;  4ORF A;  4R52 A;  3IPV B;  1XJA A;  1R09 2;  4CEY A;  4Y4R A;  2JD9 A;  4AW7 A;  2RJK A;  2XPJ A;  5DQ0 A;  3VB9 A;  3WY6 A;  1MS8 A;  1BMV 2;  1C8M 1;  3I97 A;  4D94 A;  4JKK A;  4L0P A;  1XU2 A;  1Y9G A;  2BNN A;  4D6S A;  1ND2 B;  1W6Q B;  5LZ6 A;  3ZSL A;  1I5Z A;  1LGC A;  2VNR A;  2X5I A;  1QOT A;  3ZO0 B;  4KWJ A;  2ARA A;  4BHP A;  2E6V A;  4O7X A;  1N47 A;  1AYN 1;  1GV9 A;  3HNB M;  4M0H A;  4DXS A;  3L9J T;  2ID4 A;  1T2X A;  1N1Y A;  4ZHN A;  4IND A;  2EVX A;  4FPF A;  4YSF A;  5DZE A;  3QLQ A;  1OPM A;  4JGZ A;  4GJY A;  3HQX A;  3FFZ A;  4Y1Y A;  2LRO A;  3POW A;  1IOA A;  1CAV A;  2YU1 A;  4GWI A;  3DYO A;  4RS5 A;  1QJU 1;  1W03 A;  5GLW A;  1UOG A;  4XF1 A;  4ZU7 A;  3ZXL A;  3BI3 A;  4KWU A;  5FP9 A;  1UY3 A;  4DXZ A;  5A7P A;  3FHQ A;  3I2F A;  3KQR A;  1YWK A;  2OW4 A;  3K4D A;  2JJ6 A;  4MLO A;  5D2A A;  3VUO A;  1J58 A;  1K42 A;  4FAG A;  4PQQ A;  5FWJ A;  5L9B A;  3AYA A;  1CD3 G;  4OMD A;  4BQ5 A;  2GMM A;  2WFF 2;  3RJR A;  1MPX A;  1ONA A;  5JCT A;  4MHU A;  1O5L A;  1AXY A;  1H8V A;  2B39 A;  3CEW A;  1HQW A;  3MIF A;  4BE3 A;  1O3R A;  3WDU A;  4QX0 A;  4K6B A; 
#chains in the Genus database with same CATH homology
 4BQY A;  4KBZ A;  3MGU A;  5LBC A;  2HBT A;  4XAC A;  2JIJ A;  4NAO A;  4Y5S A;  5LAT A;  4UWD A;  4NHK A;  4BQW A;  3PL0 A;  2OPW A;  4XAA A;  2RDN A;  3GJA A;  3DKQ A;  2Y33 A;  2G1M A;  5IAT A;  4NMI A;  2FCT A;  2FCU A;  2G19 A;  3ITQ A;  3NNF A;  4MHR A;  5DAW A;  5L9V A;  4J25 A;  4XC9 A;  5LBE A;  5DAP A;  5EP9 A;  3GJB A;  2Y34 A;  2RDQ A;  3OUJ A;  3NNJ A;  5LBF A;  2A1X A;  2RDS A;  5DAX A;  4ZON A;  4NHM A;  3NNL A;  4BQX A;  3KT7 A;  3HQU A;  3EMR A;  5IAX A;  4NHX A;  5LB6 A;  3KT1 A;  5C5U A;  2V4A A;  4NHL A;  4XCB A;  4JZR A;  2RDR A;  5DAV A;  3OUH A;  5LBB A;  3BVC A;  5C5T A;  5A3U A;  3OBZ A;  2HBU A;  2JIG A;  4IW3 A;  5LA9 A;  3OUI A;  4Y5T A;  4XAB A;  5LAS A;  2FCV A;  3HQR A;  3NNM A;  5DAQ A;  4ZPI A;  5IAV A;  3KT4 A;  5HV4 A;  3W21 A;  5EQU A;  5L9B A;  2RG4 A;  5HV0 A;  5M0T A;  5EPA A;  3GZE A;  4Q5O A;  5L9R A;  4MHU A;  4NHY A;  3W20 A;  4XCA A;  5ERL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...