3VBSC

Crystal structure of human enterovirus 71
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbsC00
4FTEA 2R043 1QJY3 1RUH2 1NCQC 1NG0A 1EAH2 4RS5C 5J98B 3VBOC 4N43C 1QQP1 5K0UA 1RUC2 4Y5Z0 1A6CA 1QQP3 3VBUA 4CEWA 1R092 1ASJ1 1RHI2 2WS92 4IV1C 1ASJ3 5A33B 1FOD2 3CJIA 1RUF2 2RS31 4JGZB 1D4M1 3VBFC 3VBSB 4PDWB 2RS33 1D4M3 1VBB1 5BNPB 2MEV1 3M8LA 1VBB3 4CDXC 4IV3A 5CFDB 2MEV3 4YVSB 2ZTNA 1RUI2 1MQTC 1AYN2 1PIV1 5K0UC 1Z7S2 1NY71 1ND3A 2R061 4WM8C 1PIV3 4QPGB 1POV0 1RUG2 2R063 4AEDB 5C9AA 2PLV1 1PGW2 4RHV1 2PLV3 5J96B 1RUJ1 4RHV3 1VBA1 2HWE2 1RUJ3 3S6PA 5L7OA 3NAPB 1QJU1 1X33A 1ZBE2 3JBG2 4SBVA 1ZBA2 1OPOA 1WCDJ 4Q4W2 5D8AC 1ND3C 1H8TC 2FZ2A 2R042 4N53B 1QJY2 4CEWB 1GFF2 1NA1C 1PO12 1RUE1 5C9AC 1MEC2 1RUE3 1V9U2 3VBHC 3CJIB 1QQP2 3VDDB 1RHI3 4JGYC 5LK7B 5AC92 1ASJ2 3VBRB 1VRH1 4IV3B 3IDEA 1VRH3 4CDWA 2RS32 1D4M2 2HWF1 1OOPC 1FMD1 1NCRA 1TMF1 1VBB2 2HWF3 4RR3C 1TMF3 2VQ0A 2MEV2 1RUI1 4RQPA 3HAGA 1RUI3 5C8CB 4CDUB 1K5MB 5JZGA 1COV1 4LLFA 4Q4Y1 2WFF1 3ZFFA 1PIV2 1C8NA 1HRI1 1NY72 1COV3 4CDQC 2R062 4QPIA 4Q4Y3 2WFF3 1HRI3 1QJZA 2PLV2 4YVWA 3VBOA 4N43A 4NWWA 1VBA2 4CDWC 3JB8A 1B35B 3ZFEB 4WM7A 4GB32 4IV1A 1QJU2 1FPN1 4Q4W1 4RQPC 3LOBA 2FZ1A 3VBFA 1FPN3 4Q4W3 1PVC1 2X5IC 1HX6A 2GH8A 4GH4C 4GMP1 1PO11 4QPIC 4CDXA 4GMP3 1MEC1 1PO13 1V9U1 1MEC3 1RUE2 3DPRB 4YVWC 5BNNC 1ND2B 1V9U3 1MQTA 1BBT1 4WM8A 1CJDA 1CD3G 5AC91 4WM7C 1NCRB 5AC93 5BNPC 1VRH2 5JZGB 3JB4C 1PGL1 2HWF2 1FMD2 1TMF2 3ZFFB 5CFCA 1NCQB 1SMVA 4AEDC 3J8F1 1RMU1 5D8AA 4RS5B 3VBOB 3J8F3 4N43B 5BNOC 1R1A1 5A32A 1H8TA 1COV2 1AL21 3TN91 1EV12 4Q4Y2 2WFF2 1R1A3 1HRI2 1NOVA 1NA1A 3TN93 2HWB1 5GKAC 5C4WC 2HWB3 2WWSA 3VBHA 1AR81 1VBA3 3VBFB 1R081 4GB31 4FTSA 4JGYA 1R083 4GB33 3ZFGA 4CDXB 1QJU3 5CFCC 1VBC1 5DDJ1 4N53C 2R072 1FPN2 2HWC1 1HXS1 4Q4X1 5DDJ3 2TBVA 1VB2A 1OOPA 1POV1 2HWC3 1PVC2 1RUD1 1HXS3 4Q4X3 1IHMA 5K0UB 1DDLA 1POV3 4RR3A 4WM8B 4CEYC 3VBUB 1BEV2 1QJX1 4CDQA 1QJX3 1BBT2 3ZFGC 2HWD2 1VBD1 1OHFA 1VBD3 5C8CC 4CDUC 1ND3B 1FMD3 1H8TB 1PGL2 1TME1 3FBMA 5C9AB 1TME3 2RM21 2X5IA 4FSJA 3J8F2 2RM23 1EV11 3VBHB 1BMV1 1RMU2 2RS51 4GH4A 1EV13 1R1A2 2RS53 1AL22 3TN92 5L7OB 1B35C 3ZFEC 2HWB2 5BNNA 2IZWA 1X36A 5ABJC 5A33A 1AR82 2BFUL 4PDWA 4Y4YA 1R082 4RR3B 2R071 5BNPA 5CFDA 2ZZQA 2R073 1VBC2 5DDJ2 2HWC2 1C8M1 1PVC3 1HXS2 4Q4X2 1ND2C 1RUD2 1AR91 2WZR2 1AR61 1BEV1 1AR93 1HRV1 4QPGA 2QQPA 4AEDA 1AR63 1BEV3 1HRV3 1AR71 4Q4V1 5BNOA 1AR73 1QJX2 4CDWB 4JGZC 1BBT3 3VBSC 4PDWC 2HWD1 5C4WA 2BBVA 2HWD3 3NAPA 5CFDC 4RQPB 1AUYA 4YVSC 1VBD2 2X5IB 1F2NA 1VBE1 4GH4B 4QPIB 1VBE3 4QPGC 1W39A 4N53A 1TME2 1VB4A 4YVWB 5BNNB 1RB8G 2RM22 1PO22 1RMU3 1BMV2 1RVF2 2RS52 4CEYA 2XBO2 1AL23 1VAKA 4WM7B 1F8VA 4IV1B 2RR11 3NAPC 3VDDA 5ACA1 3VBRA 2RR13 5ACA3 1AR83 1HQNA 2RMU1 2RMU3 3VBUC 4CEWC 5FMOL 1AYM1 1VBC3 5FMOS 1AL0G 1MQTB 1AYM3 5C8CA 4CDUA 2WZR1 1C8M2 1RUD3 1K5MA 5BNOB 3CJIC 2WZR3 1AR92 4Z92B 4EJRA 1AR62 1HRV2 3JD71 3VDDC 5C4WB 3JD73 1AR72 2RS12 4RFT0 4IV3C 3VBRC 4Q4V2 2ZAHA 1B35A 3ZFEA 5ABJA 5CFCB 1RUH1 4BCUA 1RUH3 5D8AB 3ZXAC 1EAH1 1K5MC 1RUC1 5A32B 1E57A 1EAH3 1VBE2 4CEYB 1RUC3 1NA1B 1R091 1RHI1 5L7OC 1PO21 2WS91 1R093 1RVF1 1PO23 2WS93 3DPRA 1FOD1 1ND2A 2XBO1 1RUF1 1RVF3 1FOD3 2XBO3 1RUF3 4JGYB 2XPJA 3ZFGB 2RR12 2WLPA 5ACA2 4JGZA 2Y26A 3VBSA 1OOPB 1AYN1 1Z7S1 2BFUS 1AYN3 1Z7S3 1RUG1 2RMU2 1RUG3 4YVSA 1PGW1 4GMP0 1NCQA 1AYM2 3DPRC 1C8M3 4CDQB 4RS5A 4RHV2 2HWE1 4FTBA 1M06G 1RUJ2 2HWE3 4NWVA 2DF7A 1NCRC 2RS11 1ZBE1 2GSYA 3JBG1 3JD72 2RS13 1ZBA1 1ZBE3 5ABJB 4Q4V3 3JBG3 2BUKA 2BPA2 1ZBA3 5FOJB 5JZGC 2R041 3ZFFC 1QJY1
chains in the Genus database with same CATH superfamily
1X50A 3EQEA 4LHKA 4HN0A 4HETA 1NCQC 3CBNA 4HVQA 2QVSB 1LHWA 2WLQA 3KCYA 4Q0PA 3GCWA 4O61A 4QKDA 2Q8EA 4NRQA 4RS5C 1JYXA 5LW9A 3AFKA 1S55A 2PYTA 2OS2A 4H55A 3VBUA 4CEWA 1UN1A 2FDHA 2OQ6A 1D2QA 3MIEA 4QGLA 2R1DA 1RHI2 2ZACA 4IV1C 2E63A 5D21A 4Z1VA 1W8TA 2PHRA 4JHZA 3CJIA 1XNTA 2NPIA 2IXJA 5LK5A 3VBFC 1TZOA 4PDWB 5JIAA 3ETPA 4BQ4A 1HB4A 4D3WA 1UZYA 2B39A 2PHTA 3NW4A 4PT6A 3QH6A 4IEPA 4QHBA 5CFDB 2J22A 2RJLA 4YVSB 2HLEA 2I74A 3KQ4B 3URFA 2YC2A 2XHNA 1W8ZA 3D82A 2D6NA 5LEJA 1JYWA 3A22A 4DMIA 4QPGB 4FP3A 1RUG2 5LASA 4YFZA 4XF9A 4JDMA 3OPWA 4MGTA 1PGW2 1O3SA 1WCUA 1OBNA 3KZ4C 3K46A 4LBLA 4ZY9A 4MYEA 1UMIA 2DU1A 3RYPA 1XNDA 1KEXA 1YJLA 3GHNA 4ZZ5A 2W1SA 3EJKA 4DY3A 1Q8SA 1MS4A 2XQXA 2Y38A 4XQWA 4XDQA 2FQPA 1D7PM 4R4ZA 1QJU1 3T2PA 2BWAA 4UT5A 1ZZ9A 3NJZA 3VZMA 1WGPA 1ZBA2 2DBNA 1OPOA 1WCDJ 3ACIA 3BTYA 2GC0A 1JU3A 1RITA 2RDQA 2RDRA 3ZYBA 3AYCA 3O1SA 1W3XA 4Y20B 2GNTA 4R9CA 1ND3C 1F15A 4X8NA 4YRDA 3WNMA 2R042 3ZR5A 4A7ZA 4CEWB 3MZHA 2Q4SA 4HKWA 3PUQA 2W91A 4MVTA 3UGFA 1SDWA 3I54A 5C3PA 2WNUA 4OQ8A 1S0CA 4UFJA 2QDNA 2VTFA 5JOYA 3CJIB 5E1RA 5FZMA 1QQP2 1X8MA 5C3OA 5CU1A 1XRUA 5JSRA 3WP3A 1VPHA 4IEVA 1RHI3 4JGYC 5C3RA 1MPXA 1HB3A 5IW0A 2GU9A 2OX0A 2DCYA 5AVPA 1S0DA 3CO2A 1GZWB 5FY8A 1DQ5A 4OLLA 5A3UA 2D6PA 1D4M2 3O7OA 4BIFA 1OOPC 2HWF1 4PIZA 3K51A 1HB2A 4TN7A 4C0HA 1JYNA 1FNZA 5DAWA 2HWF3 4LNVA 3Q8BA 4KBZA 5BUVA 3KM5A 4LBQA 2N7GA 2RJKA 3HAGA 4EN7B 1GQGA 2JENA 4Z07A 1S0BA 1KXGA 5H9QA 1QNWA 2VBBA 1K5MB 4NIGA 1YWKA 4BU2A 3B5LB 2ZGNA 4LLFA 2V4AA 1NQJA 2J1UA 5C5TA 1NY72 2CAUA 2R062 3OEBA 3MV01 1XXNA 5FXWA 3WNKA 1W8NA 1OH4A 2OT7A 1FV3A 1GOFA 1LTEA 5JR7B 4AL9A 4XETA 4CP2A 4YVWA 2VNRA 4OVEA 4COYA 4N43A 3GZUC 3AKSA 4FI9A 2QQWA 1G9DA 3GZEA 1RJ7A 4AQSA 4CDWC 4EV0A 1OUXA 3MIDA 4PIYA 2GMMA 3OBZA 4GB32 2O14A 5FZ1A 3IBMA 1W2UA 2YZ4A 4CCOA 1Q43A 1GU3A 3ZLIA 4EZ4A 2WNVC 5CB7A 1PVC1 1I1EA 5FZ6A 1CWPA 5IT6A 4M4PA 1UMHA 4XUOA 5J48A 4XDPA 2W68A 1DCSA 3IDCB 1A3KA 4MXWB 5GJ6A 5LA2A 4FAGA 4QQHA 3ILFA 1YRZA 1Q3EA 2KR2A 3AP5A 3E6BA 3FZ3A 3I2IA 4IEWA 4QPIC 1T2XA 2BNOA 2VC9A 2A1XA 1DYPA 3V0BA 5BNNC 4YARA 1OT5A 1XSRA 1C5IA 3AZVA 1FI2A 2VMHA 2H0BA 1CIYA 1BBT1 4WM8A 4CDXA 5JIUA 5ANQA 5ACA3 4NR1A 4Q26A 2AR6A 4INDA 3TEWA 2WNOA 1UOJA 4Y1UA 2VU9A 2YGLA 4ISRA 5FY1A 1WLTA 5CG8A 1KFUL 1MACA 2ZGMA 3O0VA 2CU5A 4M3CE 1WW5A 1VRH2 5F3CA 4DUXA 4QPYA 5H9PA 3DCQA 3ZPOA 4BLIA 3JB4C 4KG8A 1PGL1 2TEPA 3DV8A 2VMIA 1TMF2 2VMFA 2XJSA 3OBAA 3THPA 5IATA 1CPNA 1F5FA 4XUNA 3AZZA 4JX0A 1W2TA 2CGNA 5CFCA 5FZBA 1SMVA 3MUY1 3UKNA 3ZVXA 4ARYA 5F8PA 5FZ7A 3WD5A 4N43B 5BNOC 3FJSA 1H8TA 3I2DA 4B1LA 1SQ4A 1ULFA 3TN91 2YROA 4ZZ8A 4KGGA 2HBTA 4AHZA 2QQVA 5F2SA 3TN93 3QH7A 4JAAA 4PCRA 5I0RA 1IQDC 3P6BA 1AXKA 4HVOA 3LE0A 4XFIA 3OD4A 5L73A 3QBQA 3FE5A 1JODA 3KF3A 4LK7A 1H4HA 1J3QA 2P37A 2PQSA 1NQDA 3ZDVA 3BPSA 1R081 4GB31 5FIXA 1Y9MA 2ZMLA 3AMQA 5EJ1B 1GZTA 3WV6A 1R083 4GB33 4BQ2A 4CDXB 3ZSLA 3CHXA 1CAWB 1GP4A 1VBC1 3IDBB 2OPWA 2Z79A 4QX7A 1HXS1 4Q4X1 5JCTA 2TBVA 5T55A 4N7UA 1IZ3A 4WVVA 2Z2SB 1HXS3 3K48A 4KG0A 4Q4X3 3ZXDA 1CIWA 1DLCA 4XCBA 1S0GA 3OUJA 1GWLA 2W87A 4WM8B 1DHKB 2R30A 4H3WA 1Q8QA 5L9RA 4P9GA 3ZM8A 5F5CA 4PI0A 5FPXA 4A3ZA 3OY8A 2BGCA 2AH2A 2D5HA 5EHDA 1EPWA 1ZZBA 4WBBA 1NE6A 1E5SA 2K46A 2VZQA 2WL1A 3HJRA 5FLHA 1URXA 5FP7A 1H9WA 3J4UH 5T5JA 3WW1A 1DZTA 2CAVA 4YM2A 3VD5A 4AGVA 4XBQA 4WV8A 2C9AA 2WIIB 5A7QA 4COVA 1VBD1 4BMEA 2D40A 1S0FA 3M3OA 1VBD3 3DXUA 2VCCA 3D0JA 2QUOA 2ZCWA 2UY8A 5F5QA 1H8TB 3RI8A 3RQ0A 2LRPA 3BYWA 1GWKA 4ONUA 5C9AB 5T5OA 3T09A 3SCGA 4ET7A 4BQ1A 3J8F2 3MPPG 1BMV1 5FBZA 4GH4A 1R1A2 2O1QA 2PFWA 4MGZE 2WC2A 5A1FA 1YC61 1S2KA 3HNBM 3LEGA 4P9IA 1FV2A 4BDVB 1AZDA 2ZX4A 5B4NA 2JX9A 2XHKA 5A70A 5F37A 4WVZA 4LORA 3O1VA 3POIA 5FZAA 5A33A 2I45A 4QX0A 1MVQA 4HLTA 1FNYA 2VQTA 2EIBA 4TTGA 4OUEA 4Y4YA 3ZYRA 5F5IA 1OD3A 1YXWA 5F32A 3AKQA 3WNLA 1LB2A 1GICA 1K42A 3EMRA 2BOIA 1YHFA 2DCZA 2ZMNA 3AL6A 3W21A 2JIJA 1RUD2 3KT1A 1OLRA 4E9KA 2C4XA 5FAXA 4HG6B 5DAPA 1AR61 1CAXA 1LGCA 3C7EA 5DZGA 3WY6A 4GKYA 1QXPA 2B45X 1ONAA 1AR63 2C26A 3PJYA 2O8QA 4O9EA 4BPZA 4NIDA 3VKLA 4Q4V1 3KGZA 5F39A 1H9PA 1QJX2 2CL2A 3BTXA 4U36A 3GGLA 4JGZC 2WYSA 2VQUA 3GBFA 4C8DA 3HR9A 4LA2A 4AI0A 3AKRA 2D3SA 3IDAA 1RTVA 3ACGA 4ZPIA 1QIQA 3PVEA 4RQPB 3JXSA 3UJOA 2EF6A 1JTZX 5F7UA 5FZEA 4AHWA 1C1FA 3PNAA 5FYCA 4AEMA 5C5UA 4YG3A 2D5FA 4M0NA 5DUVA 1OSGA 1VBE1 2GP5A 4GH4B 4COUA 1REFA 2JG8B 2C5DA 1Q8PA 1C1LA 1VBE3 1W39A 2P3IA 4N53A 3B9CA 2VVDA 4QKBA 5IAVA 1O3TA 3GBGA 3RFRA 3H8UA 3T08A 3P3PA 5FP9A 4AI2A 2BBAA 4DQAA 4A44A 2BGOA 3DL3A 2A3YA 2W1QA 3ZPYA 1UO9A 4FT8A 4O65A 3KHBA 1VAKA 3LFMA 3N7JA 3F95A 5ANNA 4CU7A 2Q30A 3AVRA 3OYWA 5KWRA 2E7TA 3HQXA 2CTVA 4S2FA 4E4HA 1ODMA 4YM1A 2GP3A 2VW1A 2PTMA 2WINB 3KVAA 1HJFA 3OCPA 4NRMA 4R4XA 3WP6A 5FOBB 4YW4A 1J1LA 2AGSA 2P6HA 1TE1B 5FDBA 4BH9A 3BTAA 4B7KA 3D0SA 3SEEA 2CGOA 2EIEA 3POSA 3RMXA 5A6QA 1L7QA 1W0PA 2WN3A 3UGGA 5CA6A 5FY4A 4I0BA 1LEDA 3W5MA 2WO2A 3K4AA 2ERFA 1YCIA 3CJXA 3VDBA 1AYM1 2SLIA 4C1WA 1NLSA 3TWIA 1G8WA 3B00A 1AYM3 5A3PA 4BQWA 3A4UA 4CDUA 1RUD3 2A5ZA 3I3DA 3ZSEA 1QOTA 1TQ5A 3MBWA 4Z92B 1DF0A 1LHNA 5I0TA 2JE9A 3RJ2X 1HRV2 1J59A 3VDDC 1IKPA 3A7QA 3NQHA 1O5LA 3RZMA 2RS12 1LGBA 1IPJA 2ZKNA 4NIIA 3RYRA 2FMYA 1XNKA 2XKPA 5FZLA 5GZCA 5E88A 3M3CA 3I2OA 1DBNA 2L9LA 1B35A 5HCBA 4Q1PA 3ZFEA 3ZMOA 3FL7A 4L0PA 3USUA 1G86A 1MZEA 2VULA 5ABJA 1JHNA 3ATGA 2NMOA 4XXPA 3MIFA 4QU2A 5D8AB 3VD3A 1J3PA 1QOSA 1PMHX 2H6BA 5LA0A 1W2AX 2GC3A 1E57A 3M4FA 3PIGA 4FP2A 4W6WA 3N3HA 1PVXA 2XB6C 4E8CA 3UV9A 3VKNA 3WHUA 1NA1B 2O8OA 3I49A 4QU1A 2Q5TA 4Q0UA 3OYWB 2W1UA 4CCCA 1JYVA 1O4YA 5FKCA 5BYNA 1G9AA 4XF3A 1MZ6A 3DPRA 1FOD1 1ND2A 1X9PA 2ARAA 1FOD3 2XUMA 2VUAA 1LEMA 3HMYA 3N9OA 3O1PA 1UIKA 5JUVA 1PM7A 4IE5A 4QPWA 4UFIA 1MS8A 5E6HA 3UYJA 3ZFGB 2Y6FA 3WOGA 2IXHA 1UYZA 2IXCA 3HWJA 3H3UA 2Y26A 3MFAA 5EWSA 1XNCA 3O1MA 1N1VA 3OG2A 4W6YA 3SLIA 1O8SA 1LOEA 2RDSA 1UY3A 3DKQA 1H0BA 3K3OA 4FFGA 1RIRA 2PAEA 2P34A 2A6XA 1NCQA 1PGSA 2NM1A 4M3CF 4LBQD 4BXSV 4A6OA 5GALA 2WNEA 4AHYA 4CDQB 4RS5A 4AVCA 4XHBA 4QT6A 1M06G 1QXJA 1RUJ2 4QHOA 1QEXA 4AYUA 5JPNB 3K3NA 1GMMA 4DEQA 2RS11 1W6MA 1SHWB 1ZBE1 2GSYA 1DYKA 4MGYE 3USUB 2RS13 3LKJA 5I8TA 5M0TA 1ZBE3 1GLHA 1AF9A 5ABJB 2ZAAA 2BUKA 2DBIA 2Z42A 2ZGRA 3MF6A 4HZFA 4XMIA 1AXYA 3EBRA 3AC0A 4I09A 4ZU5A 5A6ZA 1A8DA 3GCXA 4BMBA 4LA3A 1V6LA 2ATFA 2FCTA 5JPMB 2VZRA 1QJY1 4XJUA 1OH3A 2JG8C 4FTEA 1UU5A 2MHFA 2QBXA 1ACCA 1QJY3 4ZS2A 1RUH2 4F8AA 3SKVA 2W92A 2ZJCA 3A23A 1CVNA 4BYYA 3MICA 5FYSA 1ENQA 2D93A 4KQ7A 1H2NA 4Y33A 4DOUA 5C6CA 1WWYA 2P3KA 2PHXA 4AQ6A 1SCRA 1SPPA 4Y5Z0 3ZOIA 1H1MA 4S2GA 4DY5A 2CWSA 1Y43B 1BLZA 3HOBA 4XHXA 5ERLA 2VMCA 1R092 4DO0A 4DUVA 1ASJ1 2WSVA 2Y0OA 1JH5A 4AEKA 4YGBA 1ASJ3 1RYYA 5FPLA 5ISLA 1RUF2 3NNFA 4K3UA 4HN1A 1BCXA 2XJPA 1CZTA 5JI7A 5A1AA 1LOFC 2VD7A 4LO6B 1VBB1 1KITA 1OQEA 2MEV1 1REDA 3ILRA 4DRRA 1VBB3 5K9YA 1WLWA 5LRSA 1Y7BA 2MEV3 1FT9A 3AMMA 5IYYA 1EUUA 5L36A 1F35A 2IXLA 1RUI2 3WNNA 3VUOA 3KT7A 2VZUA 1PIV1 3POJA 1XBFA 1AJOA 1ULGA 1Z7S2 3WG1A 1ND3A 5K0UC 4V1PA 1ZZ7A 1PIV3 1WLCA 4LE3A 3WLUA 1JOJA 5SV5A 1LOAA 3I2HA 4AEDB 3LD8A 4EZHA 2VNOA 2FBEA 2PLV1 3W9AA 1POQA 5LRRA 5DABA 3RZGA 1KD7A 4AGGA 2PLV3 4NHYA 2ZABA 1RUJ1 1ZZCA 1VBA1 4K1YA 1ZRIA 2YYOA 3N36A 4YZ1A 5FYMA 3ZDSA 1RUJ3 3BB6A 2QQKA 5DAVA 3UESA 1VLNA 1D0GA 4CUAA 3NAPB 3BVCA 1JZ7A 1UYYA 3JBG2 4AEJA 2XWJB 4EROA 5GLVA 2OUHA 1N1TA 1VR3A 5EYXA 5CNAA 1DP0A 2Z5WA 1UY4A 4IW3A 1DQ2A 5D8AC 5FZOA 2K2SA 5A7SA 2K0GA 2J42A 1SPPB 1W9TA 1JZ2A 4FPGA 3I3QA 5FZDA 4GALA 2BEOA 3M3QA 3N4MA 1NA1C 2XJQA 2CWMA 3AP9A 1V9U2 2DTYA 2YHJA 1UAIA 1YLLA 2B9UA 2C9KA 2X09A 2YBKA 4BQ3A 1G9BA 2CY6A 4S2HA 4XUPA 2X10A 3OTFA 3R05A 1JZ5A 4QQOA 2G19A 1DLLA 1UZ0A 2E51A 1BZWA 3AB0A 1SFPA 3N7MA 1CPMA 3VBRB 3HT1A 3U07A 5LATA 4N90A 2DURA 3VLBB 2ZS6B 4AR2A 4PF5A 4CDWA 4Q8KA 4JQTA 3JQWA 1OD5A 1UMZA 4EN6B 4RR3C 3ZXJA 3I97A 4CU6A 3R6SA 2DV9A 3BU7A 4FQZA 2XLGA 1RUI1 4OCTA 5FYYA 4NPMA 1H4GA 1CAVB 2C1FA 2YFUA 4AOCA 5LEKA 1RUI3 4QXBA 2P3YA 5C8CB 2BYVE 4A7YA 2IFRA 3DYOA 4OI0A 2B5HA 3CZUA 1COV1 4KWLA 4Z2WA 3C2UA 2WFF1 4CDQC 1COV3 1SG3A 5FBJA 4QPIA 5I0UA 3PHMA 1W0OA 4EQVA 2WFF3 3JU9A 4KWJA 1KFXL 2G1MA 3I8TA 3PUSA 5CYYA 2JIGA 3B93A 3U10A 1A34A 3ME2A 1QJZA 2OZJA 2RVAA 3U4XA 5FWJA 4O9GA 3VBOA 4KWUA 2P3JA 2V5DA 3DUIA 2GNBA 5FO9B 3WVJA 2YBSA 4XUQA 1KDKA 4NAMA 3WP4A 2XJVA 3I59A 2LUWA 1P8JA 3NJXA 3T4VA 2RJ2A 1E5HA 2VY0A 3R4DB 1XB9A 3CIHA 1QJU2 3E5QA 5BV6A 1Z0HA 1LULA 2UWCA 1QNYA 5FYZA 2X5IC 2VOTA 1HX6A 4CP9A 3POBA 1QWRA 1N1SA 1S0JA 2GH8A 5BY5A 2LS6A 2VG9A 4MGIE 3RYKA 3S7IA 2XQRA 2UYBA 5FLJA 4GWIA 1V6IA 4JKMA 3RPQA 5A32A 1V9U1 3WQ7A 5JWPA 1T6GC 4XAAA 5HXMA 1W8WA 1V9U3 1MQTA 4E2GA 1ULOA 5FYBA 2VZTA 1JU4A 5D2AA 2LM3A 2DCKA 3LOIA 5HV0A 3WG4A 4I0WB 4EWAA 1QJEA 3B7MA 2EAAA 5HV4A 2XOMA 4CCDA 4AQTA 4WM7C 4XF4A 5JSPA 1UOFA 1GZ9A 1OF3A 3TBDA 4YNIA 2XLFA 4FPLA 4MXVA 2XWBB 3BI3A 3U1XA 5CKMA 4PJYA 1WZXA 4ARXA 1JHJA 1KJRA 1AX2A 4FPHA 1HB1A 4HK9A 3KCXA 5JDBA 2WAAA 1Y9QA 2HWF2 2ZX3A 3BCWA 3DYMA 3WNPA 3FHIB 2VO5A 5F2WA 2BVBA 4AZZA 4CP0A 4Y22B 3RWKX 3EHKA 4AFAA 3PDQA 2VOKA 2Y0IA 4DRVA 2ZMKA 4AEDC 5JMCA 3K2OA 3ES1A 5CBLA 4J1WA 5EQUA 3VBOB 1S2BA 3NNJA 4LOTA 5JXJA 1KGYA 2VCBA 2VR4A 3K4DA 1BQPA 1AL21 1ZNPA 2X53S 1NUKA 3NJVA 4I3GA 4XF0A 3VHPA 4UFKA 5A7WB 4N8MA 1HN0A 2XVKA 4A3XA 4EN9B 2ETEA 5DQ0A 1NXMA 2R6QA 3I59B 2VXJA 4Z82A 3S5QA 1RJ8A 2WWSA 4HKLA 1XE8A 4OI2A 4KH9A 3VBHA 3LWCA 4GQ7A 2P4EA 3HPNA 1AR81 1DGLA 1DQ1A 4NHXA 4PF1A 4YM3A 1ENSA 3FHQA 4FPCA 5CKNA 1K45A 2BGPA 3LSEA 1ULEA 4MGSA 3I2FA 3CF6E 4TLFA 4XBLA 1TNFA 2ZHLA 1QJU3 1LHUA 5DDJ1 2R072 4XFGA 1HN1A 1UX7A 4KU7A 5DDJ3 1PVC2 3AX4A 1GOHA 5IJRA 5A1LA 1YFWA 5LA1A 5KHJA 3KV9A 1F9KA 4CEYC 3VBUB 3WSOA 1O3QA 3CL1A 4FXKB 3AK0A 2ZHNA 4NAOA 4W8JA 3HNMA 1W06A 1UY2A 4XW3A 3HD8B 1UOGA 4AFBA 5C33A 3UNPA 3BUCA 2ZX0A 2VUCA 3SCHA 1Q8OA 3DGTA 4FBFA 3O14A 4QMAA 1RGSA 4QKNA 2CV6A 1BBT2 3MV11 2DFBA 2W0XA 3MGUA 4GWMA 1Y3TA 5FPBA 1UOBA 5HXVA 1YO8A 1HJGA 3SH5A 3PTRB 4NHLA 3VD4A 4R9DA 3ECQA 1N3QA 2F6BA 3FFZA 3RMYA 1YNAA 4MADA 3HT2A 4IEXA 5JLVA 4NPRA 1PK6A 2XGXA 1W99A 4YW7A 2Y34A 5C8CC 5FUPA 5BNQA 4OZXA 4BISA 3TYJA 1UX6A 1PGL2 5L9BA 5I0DA 2Z4FA 1ZREA 2R7EB 5FK7A 2E9QA 3FBMA 1JYIA 2BOJA 2RM21 2HBUA 5GLWA 4FSJA 2PAMA 2E6VA 2RM23 1M4WA 1WMDA 3IKWA 4RA0A 3VBHB 2JDYA 4D0QA 4DPNA 3WF2A 1KRIA 1C4RA 3LA2A 3AL5A 2W3JA 2LROA 4DB5A 2A6ZA 3B01A 3TN92 3JCIA 2ZGTA 1N3PA 2TUNA 3ZN6A 4TSVA 4BE3A 3KV6A 5GLZA 2VL4A 5KHGA 1YQ8A 2VCAA 4XTMA 3APBA 1O6UA 3GXUA 3H7JA 3HIFA 2UYAA 3RVHA 4AAXA 1GWMA 4QM9A 1SEFA 4IGPA 4UBGA 4QQLA 3CQOA 1IS3A 1RL3A 2YG0A 1R082 3KWVA 4Y26A 1ALYA 2NQYA 5T3NA 1ZVFA 2R071 4ASMB 4E4SA 4CU9A 5BNPA 1OA4A 2R073 4AXOA 2D6KA 2VGDA 1VBC2 2W94A 3FUOA 3MYXA 5C3SA 2WNUB 3MLKA 4IL7A 1XNAA 1C8M1 1PVC3 1HXS2 4LKSA 4Q4X2 4QGMA 3J7NA 4AK3A 1UYPA 1LU1A 1V6MA 3WUCA 1AR91 1SBEA 2WZR2 2IXKA 4A2UA 1O59A 2OA2A 4OMDA 5IUQA 1AR93 1WW7A 1US2A 3R4SA 4MOAA 2JJ6A 3TOJA 1AR71 2B9VA 3VD7A 4TWTA 2D6OX 3DEMA 4LO4B 4D69A 2BERA 1AR73 3LSDA 5F6LB 5FYUA 5CISA 3F2ZA 4ES8A 3S0MA 1QHDA 1BBT3 1U5YA 1ZZ8A 2ENRA 3M3IA 4HPKA 1JS9A 1PK6B 4PDWC 2JWPA 3LA7A 2B42B 2VXRA 4LUKA 2VE1A 1S1AA 5C4WA 1JZ4A 4DS0A 2DCJA 5CFDC 4LBQB 3BKZA 4UYBA 1V6OA 2BRTA 4YVSC 4B4RA 3MW3A 1VBD2 1I5PA 4XZUG 5FUNA 3POWA 3IB3A 4P9YA 1HV1A 2BZDA 1UXXX 1A8MA 1UZWA 3O0WA 4QPGC 5JXIA 4XE9A 5EPAA 5KXCA 4L99A 1V70A 2PHDA 1UW8A 4YVWB 1RB8G 1LESA 4B7EA 2VZ1A 4I30A 1PO22 4JQRA 2FMDA 1BMV2 4ITCA 1CAUA 5DZFA 3TNQA 4GJYA 3WCRA 3OUHA 3VDCA 2VMGA 1OLQA 2D98A 2GNDA 1UNBA 3N9QA 3PUHA 3OF1A 4MZUA 1YI9A 5FRAA 2JE7A 2BDRA 3VDDA 1Y9GA 2WR9A 5KC6A 3SHRA 5CAZA 1EUTA 5JAXA 5FXXA 4ZONA 4MHUA 4GZ9A 2D7FA 1LOGA 1X7NA 3QOPA 4FFHA 4HK8A 2RMU1 2VJXA 1QMJA 4D6QA 3ENRA 1S0IA 4AVAA 2ZA9A 1OI6A 2JECA 2RMU3 3VBUC 1FAYA 2MNGA 1VBC3 2IVIB 4CEWC 3W58A 5JI9A 3V0BB 2VW2A 4PIXA 4RN5A 4UFMA 4B4QA 4R52A 2WZR1 4I3PA 4YW6A 4U2AA 3D3AA 4BXFA 5FZ8A 3CJIC 2WZR3 4HPKB 4OI4A 4NIHA 3OJBA 2Q8CA 3MPBA 2XH6A 3EB7A 3IIIA 1W9SA 3JD71 4ZS3A 3M3EA 1AR62 2GMPA 5C4WB 4F7ZA 3JD73 3E6CC 1CONA 4Q4V2 2VOVA 3U75A 5F6KA 2ZAHA 3WF1A 4CUGA 1OA3A 2XJTA 1K12A 1XPWA 2GZWA 5J7MA 2W9XA 3ZIWA 2PELA 4YM0A 1HV0A 2H6CA 2HJIA 3M2MA 5CFCB 4BCUA 2PXJA 2EXJA 4WZFA 3AVSA 4IEUA 1EAH1 1MS1A 1YJKA 5SV8A 3RZLA 1K5MC 1RUC1 2P17A 4IXLA 1EAH3 4P9WA 4EWEA 2B7YA 3NKGA 3AJZA 4LUMA 4XIOA 3KV5A 1VBE2 3EO6A 1RUC3 3ALQA 2UY9A 4CCJA 1YQ6A 2XMLA 4JDNA 1I6XA 4CZSA 1PO21 2WS91 4Y5SA 5FMBA 3D5OA 4N9HA 4OMCA 2JDNA 1PO23 2WS93 4UW5A 1KQRA 4COWA 2BNNA 5I8YA 3VZNA 2HKXA 3LDBA 2JDAA 3VHNA 1ZYBA 2PA7A 2W08A 1E5IA 1W6NA 2JDUA 5JOZA 4QQPA 4CSWA 5J37A 4QX8A 1IGOA 3SITA 4AI3A 3AKTA 3H3LA 5BPXA 3VBSA 1AYN1 1JUIA 4UAPA 3C7FA 5A7NA 1AJKA 1S2EA 2VZOA 3E97A 5FZ0A 1AYN3 1UL9A 3EYPA 3RDIA 4J25A 5FYVA 1F31A 3WDWA 3A0KA 1YFYA 4X8PA 1SZBA 2WRAA 4KNCA 1NZIA 1AYM2 2YGMA 1G6NA 3ACHA 4RGGA 3ACLA 3KVBA 3OY8B 4CUBA 2AEYA 4XOGA 4JTNA 4H7LA 2Y6GA 4RHV2 2HWE1 4RGKA 3WZ1A 4FTBA 5HCFA 2A6WA 2VOWA 5FXVA 2GC1A 2HWE3 3PIJA 2CHHA 5FCCA 4DXRA 5CADA 1OF4A 3OPZA 3IPVA 5HCHA 2NMNA 3AMNA 4Q4V3 2BPA2 4FPOB 4Q2FA 3H1WA 4A41A 5A7PA 1MZ5A 3QCWA 5FY0A 5FY7A 5LWBA 1MS5A 2JXAA 2DDUA 3RJRA 4K20A 1SBDA 2VMEA 1ZX5A 1H1AA 3ITQA 5FREA 1KJLA 4XFFA 5FJHA 3ZO0B 4JZRA 1K3IA 1US3A 5IAXA 2IWGB 5LBEA 2H0VA 4NHKA 3VL9A 3LF7A 1A78A 4Y5TA 4R9AA 3KB5A 3HEIA 5J98B 5GLTA 4N43C 5F9TA 5K0UA 2J1RA 4DZGA 5B2GB 4CXXA 3CZJA 3ZXFA 2G9ZA 2XDVA 5IVCA 5KBFA 1W9FA 4OHVA 1MS3A 1V6JA 4JRAA 3RS6A 3H8RA 5A33B 1FOD2 2RS31 3N9MA 4XACA 3MIHA 3VBSB 1BK0A 2JDHA 4IGOA 1ZRCA 2RS33 3T2OA 2YB7A 1H2KA 3DKWA 4HANA 5L9VA 4OHYA 1UIJA 3M8LA 4BOWA 4CDXC 4IV3A 3NWKA 5F3GA 5EXOA 3ORJA 2NN8A 2E31A 3DXTA 4YFWA 5EJ3A 4NRPA 2ZTNA 3DF0A 3U14A 5HBAA 3X29B 2QQOA 4ASKA 4GULA 2GDFA 3WUDA 4WM8C 4XABA 3RZHA 1CAXB 4AI9A 3VKMA 4BK4A 2GNMA 1ZM1A 2DVBA 3IT8A 4RHV1 5D1IA 4BB3A 4S2DA 3W20A 3T1LA 5J96B 1RUOA 3AXEA 2X29A 3CDZB 1APNA 4RHV3 5IVFA 3NNGA 1O7FA 1W6OA 1RINA 3LGRA 4KGQA 4LKEA 5L7OA 2DU0A 4PLMA 3BIEA 1O4TA 1X33A 2D97A 1ZBE2 3AMHA 4UXAA 2D43A 2VCMA 4M4RA 5FR3A 4IERA 3B02A 3MDPA 4QQ2A 1LODA 4FQ4A 2ZGOA 5FPZA 1SDDB 4HT1T 5FP3A 4YW3A 1H8TC 2FZ2A 2YU1A 4WZCA 4A7KA 4D7SA 1BYHA 4KL1A 4N53B 4KMQA 5I91A 1J3RA 1QJY2 4NJ4A 5IFPA 1PO12 1YQ2A 2QZ3A 1RUE1 4YWAA 5C9AC 4CA9A 1MEC2 4D94A 4K8FA 1RUE3 4LXLA 5I0SA 3I3BA 1FATA 1JMUB 3T2TA 3WX5A 1GKBA 4D7YA 5F3IA 1D0HA 3QACA 3KD4A 3I7DA 5KXEA 4YW1A 3ZXKA 2BQPA 5JSOA 3VZLA 2ZEWA 5LK7B 5AC92 1PM4A 3P5BA 4LBKA 1ASJ2 4GA9A 3I4IA 3WHTA 4IV3B 2XUEA 3IDEA 1TNRA 1LGNA 1RUNA 2A7AA 2QJVA 2XVGA 4YZ2A 4WVMA 2OKXA 4X6RB 1FMD1 1NCRA 2ZGLA 4Y4RA 1QXRA 4LBOA 1MR5A 1VBB2 2EALA 2ZGQA 4P5YA 5LY1A 1IG3A 1UU4A 2MEV2 1H30A 4EN0A 1W8UA 5K7PA 5FP8A 1Q8VA 3M70A 4W4ZA 2JG9A 4CDUB 4F83A 1SBFA 3UT0A 5JZGA 3TEYA 2QQJA 4Q4Y1 3ZFFA 4BK5A 1PIV2 1C8NA 1HRI1 2QKDA 2XKOA 5HI0A 4Q4Y3 1VJ2A 1O91A 1W6OB 3KCCA 1HRI3 2O0OA 5A3TA 1WMFA 3AP7A 5C71A 1MS9A 2X05A 1VP6A 2PLV2 1W6QA 2P1BA 4P9JA 3UKVA 3OB8A 3C7HA 3S57A 1GUIA 1IPSA 2FCUA 1VBA2 2WUHA 5IVVA 3H8OA 1B35B 3ZFEB 4TXWA 4UF0A 3PVNA 4WM7A 4Y1XA 1ZZ6A 4AVTA 4IV1A 3TEXA 5KC5A 1JBCA 2WFPA 4V2VA 4FPKA 4YW5A 1FPN1 2ZX1A 4RQPC 1NT0A 3LOBA 1WLDA 4ZU7A 2FZ1A 2C6SA 3UK9A 1N1YA 4OFGA 1FPN3 3VBFA 5J36A 1WD3A 3PTYA 1MVEA 3RG0A 4ATFA 4C90A 4GH4C 1OUSA 1CGPA 1PO11 2E7AA 3N7LA 5EJZB 3MF9A 4GKXA 5K4LA 5A80A 1MEC1 1PO13 2W47A 3LEKA 4DIQA 1MEC3 5FKBA 3DPRB 3PVOA 2I07B 1ND2B 4NO4A 5A3OA 3VN4A 4BQ5A 2AEZA 4ZXEA 4A6SA 5IFTA 3LDRA 1CD3G 4L9BA 5JXHA 2RV9A 4QD2A 1E5RA 4YGDA 1YI7A 2V09A 5AC91 1NCRB 4FOYA 4AFCA 4LBNA 4LEJA 5AC93 1I5ZA 3RWNA 1DU3D 3E5UA 5FJKA 4G4FA 3VD9A 3GZTB 3NO8A 3FHAA 4CXYA 1WCQA 5C8WA 5E16A 3N9PA 3KSCA 2DVGA 1SACA 3ZR6A 5JZGB 4OQ9A 2YV8A 4HL0A 4A42A 1OA2A 5BXXA 3ZFFB 2E53A 3INAA 2Y6LA 2W39A 3POFA 4LKFA 5IK7A 1HDKA 2VZVA 1NCQB 2YFZA 1LCLA 4FCAA 1H6XA 2XJRA 1QY4A 1WA6X 1SLTA 1VALA 1RMU1 3SISA 3CMGA 1DQ4A 1QH7A 4RS5B 3WW2A 4QXHA 4ZHNA 1COV2 4UW4A 4XJAA 1IS6A 2WFF2 3ST7A 4LIVA 3VZOA 1W6MB 2HWB1 2ZEZA 3G7DA 2QQIA 5FZHA 1J84A 2J1EA 2ZHKA 5GKAC 1XOYA 3LDKA 4NVPA 2CDOA 2HWB3 3NV3A 4TYSA 1W90A 4QX2A 3W5NA 4YGCA 4YPJA 3UETA 2CNAA 2AACA 1O4ZA 1HLCA 5LA9A 1VBA3 2AZ5A 4IETA 5DXDA 1JW6A 1D2SA 1W2OA 3VBFB 1H2MA 2PHLA 4BIOA 4JGYA 4LR4A 4CTEA 3MUZ1 5G05L 3PL0A 4YSFA 2ZZJA 4FOWA 3AMPA 4Q8LA 4N53C 5IK4A 4QB2A 2QZ2A 4UW3A 5FO8B 4B3NA 2HWC1 3MW2A 3MO4A 3NKTA 4Q5OA 5GZDA 4CVUA 1QDCA 1VB2A 2A3XA 1DFQA 1OOPA 1RXGA 2HWC3 1O8PA 2W52A 4QDSA 1IHMA 4XILA 4XXAA 5CIRA 4LIUA 2WA3A 1DDLA 2XL7A 3DECA 4M3CA 3RRDA 4HSLA 5FPAA 1DQ6A 3RNSA 1WW4A 5DMYA 5E89A 5TSWA 4IDZA 3LZZA 3H3ZA 1IG0A 1WMEA 3NV4A 5FTTC 3ZYJB 1J58A 1ST8A 1NLQA 1GSLA 3KHCA 1W8OA 2W1WA 4PBOA 3ZFGC 2F4LA 2Y60A 2BU9A 3G6JB 3ZMNA 4UOJA 1WBLA 2DVAA 3GDBA 4DINB 3CU7A 2Y6HA 3D4KA 3FWEA 4OULA 4RL7A 3JZVA 1L7RA 5F5AA 1HKDA 3U37A 3ON7A 4CDUC 1ND3B 5DUUA 4DNYA 1CZSA 1T6BX 3B9IA 4Y1VA 3GJAA 3GJBA 1TME1 2ARXA 4RD7A 4Q29A 4YW2A 2WNVA 1YFUA 4MGKE 1TME3 3T1MA 1ODNA 2WWUA 4Z2AA 1AHSA 2JD9A 5IVJA 2RS51 2BNMA 1GNZA 3BIWE 2RS53 5CVRA 1AL22 1LENA 4FPYA 2WN2A 3OPTA 1OPMA 3POGA 1B35C 1W8FA 1ENXA 3ZFEC 5LCWL 5FWEA 4ZXKA 1LAJA 3FLPA 3ZIXA 2IZWA 5BNNA 2Z69A 2EVXA 3WXPA 3AZXA 3O1OA 2XJUA 5ABJC 3WW3A 1H1IA 1AR82 1QF3A 3MHZA 3N9NA 4K7JA 3PU3A 1JZ6A 1W3VA 2BFUL 2Y8KA 1VMFA 4PDWA 5FZOB 3O12A 1B09A 2R32A 3OUIA 4QXCA 4HSJA 3MLJA 4R8HA 1PNGA 2ZKLA 5IVEA 1PNFA 5CFDA 5KXDA 5DDJ2 2R1BA 3U78A 2PAKA 2QFEA 2Y6JA 1CZVA 3NJYA 4LBMA 5T50A 1ND2C 4H14A 2GC2A 3DN7A 3MW4A 3IAQA 3WF0A 4BA6A 2CDPA 4QPGA 2E7QA 4CE8A 4LT5A 2XXZA 2A6VA 1F5JA 4YZ3A 1QH6A 3VDAA 1HQWA 4D7TA 2ARCA 5EFUA 5FZGA 4A45A 5BNOA 2PQQA 4BJ0A 1WD4A 2WZ8A 5EP9A 3PVBB 4XJWA 1PX4A 4CDWB 2ZGPA 4FAHA 4NPLA 4LULA 2DCTA 4RYDA 3MI8A 3FX3A 2BBVA 1YQ5A 1OQ1A 1STMA 5FV3A 4BWOA 4E8DA 2WAOA 3JUUA 3OBTA 1BKZA 3IN9A 3IMNA 1IQAA 4UFHA 1R64A 2WNVB 5FZ4A 1UY0A 3ACFA 2C24A 3RZZA 1OLME 4Y20A 4LO7A 2CYFA 4QPIB 2QQMA 1CR7A 4OZOA 2VH9A 1UQXA 1K5JA 2QQLA 1G9FA 4XTPA 4L11A 4D6RA 5KHKA 1PZ8A 1QJFA 1CJPA 1W28A 3IAPA 3T0DA 5BNNB 2RM22 4Y1ZA 1NLRA 2FDKA 4L92A 5FZCA 5T54A 2KXLA 1RVF2 4ZKTB 2NLRA 2JDPA 4YYOA 2EXHA 2NP0A 1AL23 1UF2C 4UI9L 3IIAA 3SC7X 1XYPA 2ZOEB 3I3EA 2VNGA 3UGHA 1TVGA 2ET1A 2RR11 3NAPC 4P02B 5ACA1 3NRUA 2AUYA 4ZU4A 2RR13 5GZFA 1AVBA 2VW0A 5IWFA 2QCSB 3KT4A 2WWJA 1AR83 2VNVA 2R0FA 1GZWA 4XUTA 3E5XA 3FN9A 1J83A 5IVYA 4CCKA 4CP9B 3H1YA 4AI1A 3T2QA 4HOOA 1C28A 2JDKA 1JOBA 4PI2A 1HQNA 4LQRA 2Q8OA 1XE0A 3WDVA 1QDOA 2FDGA 4Y1YA 2RG4A 2ZGKA 4IE7A 1W9YA 2ZEXA 3H0OA 3KF5A 4LO8A 5FMOL 2VUDA 5FMOS 1AL0G 1MQTB 1V0AA 3FUQA 2AENA 4B29A 1C8M2 4DXZA 1K5MA 5BNOB 4MX3A 5E8AA 5CG9A 1UZZA 4HONA 1AR92 3BN6A 2MPFA 4EJRA 3FLRA 5A6YA 2FDIA 4EE2A 3VBRC 1AR72 4XEZA 2D3PA 3GF6A 3J26N 4LLOA 5IHRA 3HN3A 3I2KA 3E1F1 3NSTA 1SFNA 2W46A 2YUEA 4LBJA 2ZX2A 3GBWA 2ARBA 3GNEA 2J7MA 2FHRA 2VBDA 3NVCA 4IE4A 2EXIA 4XFAA 4CCMA 4W50A 4Z8BA 1X9TA 4YZ5A 1LU2A 2WZPP 2LW8A 3WINE 1MS0A 4CU8A 1EPZA 5J09A 1IOAA 4QDRA 3ZXLA 5A32B 4I02A 2P2KA 1OQDA 4MXWA 3NL1A 5DUWA 2F17A 3LPGA 4OUMA 3AP6A 3BTZA 1RHI1 4M00A 4FFIA 4JHTA 1RVF1 2IUWA 3FFQA 2D3RA 1DZRA 4JRLA 4QAWA 1RVF3 2PMWB 3GALA 3HNYM 2JDZA 3MLLA 1JZ8A 1LNSA 2YC4A 2WT2A 5A3WA 4AVSA 4IEOA 4AF9A 3GYDA 4YG0A 2JDMA 5EYYA 3LB9A 2XPJA 3DYPA 1ZA4A 2Q1MA 3OGRA 1U0AA 4CYDA 4EWDA 2WLPA 2HEYF 3TB0A 1QKQA 4JGZA 5DZEA 3V56A 3ZN4A 1SLAA 3WT3A 4LO5B 2IVJA 4GWNA 4QM8A 1CN1A 5LB6A 3QD6A 3SQOA 1RUG1 1H2LA 5J1XA 2RMU2 4Q1RA 2GH2A 1JI6A 3ZKUA 1H6YA 1RUG3 1PGW1 4GMP0 2VM9A 3T4HB 3OOXA 2A71A 2E33A 1X8EA 1YUDA 2OW4A 2ZHMA 3BOWA 5DG2A 4TZDA 1C8M3 2FDFA 4MUVA 5FFOC 2ADDA 1NX9A 2TNFA 3UL2A 4ASLA 3M1HA 4QXKA 4NWVA 2YXSA 1OURA 3WG2A 3V0AA 4IEZA 1CQ9A 1GZCA 3JD72 4CP1A 4TLGA 1ZBA1 1N3OA 5FMDA 3ZX7A 5AFEA 1YIPA 1ZBA3 3FC0A 4GWJA 3AYDA 3AKPA 2VOXA 3D8CA 4NN0A 2WO3A 4NHMA 2DUQA 4E2QA 1DQ0A 3RZJA 3CKHA 2PN5A 1XYOA 4AG4A 1OFNA 2GMEA 1DIWA 1VAMA 2R041 1HIXA 1WMXA 1CX1A 2QTWB 2R043 2VZSA 1CAWA 4YGEA 4HVRA 2ZPXA 5FYTA 3VL8A 4AWDA 2DWRA 1NG0A 4ATEA 5FZ3A 3IMMA 5LBFA 4QDQA 1WCSA 1EAH2 1HQLA 5FXZA 3VBOC 4OI1A 4BQXA 1QQP1 2KA3A 5GLUA 4LK6A 1RUC2 5CZKA 3S7EA 4CXWA 2JICA 1A6CA 1QQP3 4AQ2A 3BODA 5HCAA 3OGSA 2ORXA 4XURA 1SLCA 3ZN6B 1V6NA 2WS92 4XJ9A 4QKFA 2G4IA 3GZAA 2A75A 3WW4A 3O1UA 1WA4A 5APAA 3MFCA 2IXIA 4GAZA 5LBCA 4BHPA 4EYUA 4JGZB 2WYFA 1D4M1 4J6GA 1XE7A 1VMJA 1GANA 3S30A 2WQZC 1D4M3 3WDTA 4QX3A 3C7GA 1G9CA 5BNPB 2ZGSA 1QU0A 3OEAA 4PLNA 2G9GA 2FDJA 1BK1A 2BWCA 1YQCA 4XF1A 1DGWX 1SCSA 5B4XA 3MIGA 3VKFC 5C70A 3WNXA 3WQ0A 3ZN5A 4D6SA 3VHRA 2DUPA 1MQTC 1AYN2 2WSUA 2BJSA 3PUIA 1NY71 4XFHA 2R061 3KS7A 2HYXA 4H2AA 1POV0 2ZXQA 1IKQA 1W2NA 2PHWA 2R063 4L8QA 5H9SA 3CEWA 5C9AA 2YPJA 4FOQA 4IEYA 4QB1A 3WEZA 4LMFA 3V0AB 5JOWA 2FCVA 4FFFA 4LHSA 4E27A 5I93A 5A7OA 5A3LA 2R49A 3A0NA 4NUBA 5K8SA 3CNAA 2HWE2 5JR2A 3RZKA 2ADEA 2JB4A 2J1TA 3WNOA 3S6PA 2P6CA 1NE4A 4XQDA 5FY5A 3VB9A 4DFSA 4CPBA 1BVVA 2XR4A 4HKOA 2JEMA 2UU8A 3R4UA 4SBVA 1REEA 4X6QB 4YG6A 4Q4W2 1FXZA 4P5HA 3ZSJA 1N47A 3H50A 4B8EA 4LHLA 3H1MA 3OSDA 1AX1A 3ASIA 4JTOA 1UD1A 2HEVF 2RDNA 3QLQA 3WF3A 3FLTA 4AFDA 1GFF2 1HW5A 2DYCA 3PLQA 1W0NA 4COZA 2ID4A 1PHMA 2OQ7A 1XQNA 2YU2A 1I9RA 3VBHC 2AREA 1CAUB 2VTXJ 1DZQA 2WABA 4CCEA 3VHOA 1Q56A 4O7XA 4WVWA 3C3VA 3L9JT 3LIHA 5DN2A 3VDDB 4MG2A 1SFYA 4FVVA 1PX3A 1VRH1 2R16A 4NOTA 1VRH3 2HEWF 2V4VA 4L2NA 2B46X 4IUGA 4QWNA 1LOBA 3ROUA 2RS32 4D8MA 3K4ZA 2E32A 5IVBA 1TMF1 2V73A 1GV9A 2D6LX 1BXHA 1DYOA 1UPIA 1TMF3 2B4KA 3UKTA 2VQ0A 1ZRFA 1GR3A 1XU1A 4PQQA 4RQPA 2CSGA 5T5PA 2WBKA 3NV1A 3TEZA 2WNUC 1NZCA 1LOCA 5T52A 4ES9A 1L7LA 5KXBA 2JB8A 2W5FA 4LKDA 2JG8A 5CEHA 4SLIA 3N35A 1U5XA 2J1AA 5FUIA 3S5AA 3SCFA 2YPDA 3BGAA 5C7GA 1QOOA 2Q0AA 4AVVA 4C91A 4I01A 3O1RA 1JN2P 2V5YA 3V65A 1JYCA 4NWWA 2DTWA 5HPOA 2YBPA 3THCA 4FPJA 5GZGA 3JB8A 1Z78A 1PK6C 2A6YA 2WO7A 2WJSA 1YEWA 5A3MA 1GYKA 4Q4W1 1ZA7A 4NIAA 1JYTA 5EV7A 4Q4W3 1OVPA 2ZGUA 4KU8A 3TRSB 1LOFA 3CLPA 3SH4A 5DG1A 2DFCA 1XYNA 2OXBA 4I0AA 3GM8A 4LJHA 5JVVA 3ZYGA 3PMEA 4GMP1 1H8VA 4IE6A 3ZXEA 4GMP3 5EZWA 3T0AA 3KLSA 2Q8DA 3VKOA 2VBPA 4MH0E 4NROA 4A4AA 1RUE2 4Y24A 4YVWC 3AXDA 4V2WA 4Q0QA 2JKBA 4CCLA 3H42B 4OHWA 1XJAA 3ABZA 4PBPA 3WQBA 1CJDA 2LALA 2VPVA 3H8XA 1V00A 3H9AA 3W59A 1W6NB 3U4SA 1OC1A 1MZFA 4LPLA 4QX1A 5FYHA 3AYEA 4JKLA 5BNPC 4MGQA 4XCAA 4LHNA 4XVHA 4PHZA 3ZYIB 2VQAA 3T30A 2B8MA 3BOPA 2BVVA 4UWDA 3ETQA 1R1ZA 2IC1A 1FMD2 3VV1A 5KHIA 3WP5A 4ORFA 2ORZA 1ZRDA 1LHOA 3LQCA 1V6KA 4KBBA 1U5IA 2WO1A 3LAGA 3J8F1 1GP5A 5D8AA 4DEVA 3ES4A 3AZYA 3D6EA 2F4PA 3J8F3 4G9SB 1CX4A 5H9RA 1R1A1 2JE8A 5FQ0A 2W95A 4IGQA 1JOPA 4URAA 3BPZA 3U0ZA 1EV12 3IM0A 1NYWA 3LFIA 4Q4Y2 1R1A3 4IE0A 1HRI2 1X82A 1NOVA 1TG7A 1NA1A 2D44A 2EAKA 2OVUA 4HBNA 1YYNA 4AVBA 1CESA 4MHRA 5C4WC 3J7HA 4FOVA 3IPVB 2ILMA 2WT0A 2DVFA 2XVLA 4QB6A 4BQYA 1XSQA 4JCKA 4JKKA 1S4CA 5DPNA 5DUXA 2Y64A 3KQRA 4FPFA 4XDOA 4KI5M 4MSVA 1Q5OA 3OGGA 4FTSA 1OMIA 2YC0A 5A3NA 1C5HA 2WT1A 2EIDA 2WKKA 3JQXA 4KWKA 3LEMA 2AYHA 1LKNA 4GJZA 3TNPB 3ZFGA 2XLAA 2YY1A 5CFCC 1FPN2 4LOSA 2KM2A 3AYAA 2WQ8A 2WDBA 2Y33A 3I2GA 2J1SA 3OD0A 1POV1 1RUD1 2VZPA 4FPEA 1JZ3A 1UKRA 5K0UB 4K1ZA 1C3HA 1GQHA 1POV3 3KV4A 4RR3A 5FZKA 4LTAA 2LTNA 1ULPA 1WCKA 5IK5A 3K75B 4M0HA 2GN3A 1S0EA 3Q8EA 1BEV2 4URTA 3OGVA 4XFCA 4Q0VA 2RHPA 3EXUA 1QJX1 4XPVA 1NXD1 1OLMA 2DVDA 3FMGA 3LEIA 3LIGA 4IQPA 3ZXGA 3ZYPA 4CDQA 1QJX3 1EYBA 1UYXA 2UWBA 1Y4WA 3P1IA 1UZVA 1UPSA 4AFMA 4XQ4A 4N7IA 1YFXA 4C1XA 2HWD2 4OHXA 4P08A 3WCSA 3J7MA 2ES3A 4W65A 5T5LA 2VTXA 3B69A 4W6XA 1W8HA 1VAVA 1OHFA 3U11A 2RE9A 5JMOA 3POYA 4BLJA 3M7AA 4JDOA 3Q8CA 1WUVA 2VZ3A 1FMD3 5FQ0B 4NMIA 3SXWA 1XNBA 4LE4A 2JD4A 4IEQA 4L97A 1VE0A 1WBFA 3KMHA 4AE2A 1XU2A 1U12A 2OUJA 1LHVA 3HBZA 5FP4A 3THTA 5LZ6A 2X5IA 1YIFA 1EV11 1RMU2 5KHHA 1UCXA 2G9FA 5LY2A 3WF4A 1EV13 3AP4A 1BJQA 2OYZA 5L7OB 2BTVC 1PZ9A 3NV2A 2HWB2 3ZYHA 3OGJA 4GXLA 1OKOA 1ULCA 3I2JA 5FZFA 1X36A 4LITA 4NE9A 4XAEA 5FZ9A 2R0HA 3PMSA 4CCNA 4JV4A 5JXGA 4H7MA 1DGRN 1JUHA 2HYKA 2QQUA 2NZ9A 4FXGB 4OYUA 1LJ7A 4P00B 2VECA 4RR3B 4YZ4A 3THDA 4PQ9A 4B1MA 1J1TA 2BP6A 2ZZQA 4XJZA 2ZEYA 2YMZA 2SBAA 4K21A 1RXFA 2HWC2 1XC6A 1WKYA 2J1VA 3PJQA 2WA4A 3WDXA 3BALA 3BU0A 4ISQA 1KS5A 2ET7A 1NAEA 2V72A 3B94A 3SMHA 2BW8A 2VAUA 1BEV1 1HRV1 4DXTA 2P5BA 2QE3A 1EP0A 2QQPA 3HN1A 4AEDA 4DXSA 1UU6A 1BEV3 1HRV3 2QNKA 2EICA 1U5ZA 3HQUA 5DAQA 4I2OA 3PUAA 4K9SA 4OHZA 2A3WA 2VMDA 4P9XA 4WVMB 3VBSC 3WQ1A 2HWD1 2VVFA 4MLOA 2QDRA 4XZPA 1LR5A 4AI8A 1OXCA 4Y3OA 2HWD3 3WDUA 3NAPA 1W9WA 3NMBA 3RGBA 1GOGA 2Q1FA 3J7LA 5F3EA 1AUYA 2IFWA 1VRBA 3AFGA 3FBYA 3WR0A 2Q1ZB 2GAUA 2JG9B 5FPVA 2X5IB 4AGRA 1F2NA 2E26A 2K9ZA 3HVDA 1FYUA 4META 4XBNA 5I8SA 1BVP1 1AXZA 1GBGA 4RFRB 5CKQA 2NYYA 3ZSMA 1TME2 1VB4A 1W6QB 2X8KA 2D6MA 4P14A 3A21A 1RMU3 4K40A 4MO3M 1GP6A 3AZWA 5FLIA 2RS52 4CEYA 2GALA 3C8XA 2XBO2 4J1XA 4JVAA 1WW6A 4UF0B 3V64A 5FZIA 5G04L 4WM7B 3NNLA 1L3JA 3SKJE 4K8RB 5FPUA 2DUOA 2GN7A 4IV1B 1F8VA 4BM8A 1BHGA 3MIBA 4C0BA 2KD7A 4RGAA 3ZYFA 3VBRA 1GNYA 2AC1A 4UBHA 2A70A 2OIIA 4DUWA 3Q8AA 3IWZA 4M01A 3SH3A 4CRQA 2PHFA 2UURA 2VVEA 1W04A 4AHXA 2C0ZA 1FX5A 5GZEA 3VZJA 3LPFA 3OBRA 2YDEA 3TAYA 2QQNA 5KR7A 2ZBJA 1PMJX 1I3HA 3N9LA 4B4PA 1CAVA 3K77A 4N9IA 5C8CA 3I3MA 1IPKA 3NNMA 2UWAA 4P9LA 2OPKA 5A6XA 2HH9A 2EIGA 3VGIA 5EIYB 1O3RA 1VIWB 3GHMA 2XONA 3O5SA 4RSUA 4Q0SA 1OFSA 3ILNA 4RFT0 1NKGA 4IV3C 1W05A 4XMAA 3ZSKA 1W6PA 3L2HA 4GIQA 1F4HA 1VMHA 4AAPA 4Q27A 1SLIA 5L19A 4E2SA 5FO7B 3SNMA 1OKQA 1DGWA 2XL9A 4QHZA 5AVAA 4HMZA 3UJQA 4G3YC 5IK8A 1RUH1 1PZ7A 4CPBD 3O1TA 1UY1A 1RC6A 2Y6KA 2PHUA 3ELNA 1RUH3 4QGNA 5FMCA 3H7YA 3ZXAC 5FYIA 4CUCA 4K6BA 3ZFFC 4XFBA 3HBKA 1ULDA 1UXZA 4QX5A 3LA3A 3LCPA 5FY9A 4CEYB 1AX0A 2WZEA 2EXKA 3L2YA 1R091 1W03A 3AJYA 3WG3A 1GNHA 5L7OC 1ENRA 1UWWA 1R093 3C7OA 4EN8B 5J3UA 3VZKA 3PURA 3E6DA 1G7YA 2XBO1 3O0XA 1RUF1 2FD8A 1KS4A 4OUSA 1F4AA 2XBO3 1RUF3 4JC1A 1DGRA 1GQPA 3HQRA 4JGYB 4E4ZA 2W2IA 1TEIA 3POEA 2RR12 3AM2A 4YLZA 1JXNA 5ACA2 1PMIA 2WQ4A 3N7KA 4UW6A 3ZKYA 5LBBA 5C3QA 1OOPB 4BZ4A 2EA7A 1Z7S1 2BFUS 2XG3A 3J9SA 3KGLA 1SLBA 3T0BA 3P3NA 4E4DX 4FO9A 1Z7S3 3B3QE 4M3CB 4MV2A 1IS5A 2A73B 1ZRRA 2I2SA 2JKXA 4XYXA 4Y22A 3RSJA 4YVSA 4XC9A 4UFLA 1EY2A 3USSA 1O5UA 5AFBA 3R0RA 3DPRC 3IZOA 1C57A 1UKGA 2BV4A 3RI9A 1IS4A 4HXCA 1W6PB 1KDMA 1LRHA 4AW7A 4IESA 1DG6A 2OZ6A 3PU8A 1QGLA 2DF7A 5A7WA 4R9BA 4F3JA 1NCRC 3Q8FA 4HFSA 5JOXA 3Q9OA 1LECA 3JBG1 5GM0A 4XJ8A 2VUJA 3T3YA 5F1RA 5FK8A 3JBG3 4PLOA 1D4VB 2CGPA 1OVSA 4XIKA 3WDYA 5DAXA 3SEPA 2JG9C 5FOJB 5JZGC 1SLLA 4GD4A 3MEPA
chains in the Genus database with same CATH topology
1X50A 3EQEA 4LHKA 4HN0A 4HETA 1NCQC 4HVQA 2QVSB 1LHWA 2WLQA 3KCYA 4Q0PA 4RS5C 3AFKA 1S55A 2PYTA 4H55A 3VBUA 4CEWA 1UN1A 3MIEA 1D2QA 4QGLA 2R1DA 1RHI2 2ZACA 4IV1C 2E63A 4Z1VA 2PHRA 3CJIA 2NPIA 2IXJA 5LK5A 3VBFC 4PDWB 5JIAA 4D3WA 1UZYA 2B39A 2PHTA 3NW4A 3QH6A 4IEPA 4QHBA 5CFDB 2RJLA 4YVSB 2I74A 3URFA 3D82A 2D6NA 5LEJA 4DMIA 4QPGB 4FP3A 1RUG2 4YFZA 4XF9A 4JDMA 1PGW2 1O3SA 3KZ4C 4LBLA 3RYPA 4MYEA 2DU1A 1XNDA 1YJLA 3GHNA 3EJKA 4DY3A 1Q8SA 1MS4A 4XQWA 2Y38A 4XDQA 2FQPA 4R4ZA 1QJU1 2BWAA 1ZZ9A 3NJZA 3VZMA 1WGPA 1ZBA2 1OPOA 1WCDJ 2GC0A 1RITA 3AYCA 4Y20B 2GNTA 4R9CA 1ND3C 4X8NA 4YRDA 2R042 4A7ZA 4CEWB 3MZHA 2Q4SA 4HKWA 4MVTA 1SDWA 3I54A 2WNUA 1S0CA 2QDNA 5JOYA 3CJIB 5E1RA 1QQP2 1X8MA 5CU1A 1XRUA 5JSRA 3WP3A 4IEVA 1RHI3 4JGYC 2GU9A 2DCYA 5AVPA 1S0DA 3CO2A 1GZWB 1DQ5A 4OLLA 2D6PA 1D4M2 3O7OA 4BIFA 1OOPC 2HWF1 4PIZA 3K51A 4C0HA 1FNZA 2HWF3 4LNVA 5BUVA 3KM5A 4LBQA 2N7GA 2RJKA 3HAGA 4EN7B 1GQGA 2JENA 4Z07A 1S0BA 1KXGA 5H9QA 1QNWA 1K5MB 1YWKA 3B5LB 2ZGNA 4LLFA 1NQJA 1NY72 2CAUA 2R062 1XXNA 1FV3A 1LTEA 5JR7B 4XETA 4CP2A 4YVWA 2VNRA 4OVEA 4COYA 4N43A 3GZUC 3AKSA 1G9DA 1RJ7A 4AQSA 4CDWC 4EV0A 3MIDA 4PIYA 2GMMA 4GB32 3IBMA 1W2UA 2YZ4A 1Q43A 2WNVC 5CB7A 1PVC1 1I1EA 5IT6A 5J48A 2W68A 3IDCB 1A3KA 4MXWB 5GJ6A 4FAGA 4QQHA 3ILFA 1YRZA 1Q3EA 3AP5A 3E6BA 3FZ3A 4QPIC 4IEWA 4CDXA 2BNOA 1DYPA 3V0BA 5BNNC 4YARA 1C5IA 3AZVA 1FI2A 2VMHA 2H0BA 1BBT1 4WM8A 5JIUA 4NR1A 4Q26A 2AR6A 4INDA 4Y1UA 2VU9A 2YGLA 4ISRA 5CG8A 1WLTA 1KFUL 1MACA 2ZGMA 3O0VA 4M3CE 1WW5A 1VRH2 4QPYA 5H9PA 4BLIA 3JB4C 4KG8A 1PGL1 2TEPA 3DV8A 2VMIA 1TMF2 2XJSA 3THPA 1CPNA 1F5FA 3AZZA 5CFCA 2CGNA 1SMVA 3UKNA 3ZVXA 3WD5A 5BNOC 4N43B 3FJSA 1H8TA 3I2DA 1SQ4A 1ULFA 3TN91 2YROA 4KGGA 4AHZA 3TN93 3QH7A 4JAAA 4PCRA 5I0RA 1AXKA 4HVOA 4XFIA 3OD4A 5L73A 3QBQA 3FE5A 1H4HA 1J3QA 2P37A 1NQDA 1R081 4GB31 2ZMLA 3AMQA 3WV6A 1R083 4GB33 4CDXB 3ZSLA 1CAWB 1VBC1 3IDBB 2Z79A 1HXS1 4Q4X1 5JCTA 2TBVA 5T55A 4N7UA 1IZ3A 4WVVA 2Z2SB 1HXS3 3K48A 4KG0A 4Q4X3 3ZXDA 1CIWA 1S0GA 4WM8B 1DHKB 2R30A 4H3WA 1Q8QA 4P9GA 5FPXA 3OY8A 2BGCA 2AH2A 2D5HA 1EPWA 1ZZBA 4WBBA 1NE6A 2WL1A 5FLHA 1URXA 1H9WA 3J4UH 5T5JA 3WW1A 1DZTA 2CAVA 4YM2A 4AGVA 4XBQA 4WV8A 2C9AA 2WIIB 4COVA 1VBD1 4BMEA 2D40A 1S0FA 3M3OA 1VBD3 3D0JA 2QUOA 2ZCWA 2UY8A 5F5QA 1H8TB 3RI8A 3RQ0A 4ONUA 5C9AB 5T5OA 3SCGA 4BQ1A 3J8F2 3MPPG 1BMV1 5FBZA 4GH4A 1R1A2 2O1QA 2PFWA 4MGZE 2WC2A 1S2KA 4P9IA 1FV2A 1AZDA 2ZX4A 2JX9A 2XHKA 4WVZA 5A33A 2I45A 1MVQA 4HLTA 1FNYA 4Y4YA 3ZYRA 1YXWA 3AKQA 1LB2A 1GICA 1YHFA 2DCZA 2ZMNA 1RUD2 3KT1A 1OLRA 4E9KA 5FAXA 1AR61 1CAXA 1LGCA 3WY6A 5DZGA 4GKYA 1QXPA 2B45X 1ONAA 1AR63 4BPZA 3PJYA 2O8QA 4O9EA 3VKLA 4Q4V1 3KGZA 1H9PA 1QJX2 2CL2A 4U36A 4JGZC 3GBFA 3HR9A 4LA2A 4AI0A 3AKRA 2D3SA 1RTVA 3PVEA 4RQPB 3UJOA 2EF6A 1JTZX 4AHWA 1C1FA 3PNAA 4AEMA 4YG3A 2D5FA 4M0NA 5DUVA 1OSGA 1VBE1 4GH4B 4COUA 1REFA 2JG8B 2C5DA 1Q8PA 1C1LA 1VBE3 1W39A 2P3IA 4N53A 3B9CA 2VVDA 1O3TA 3GBGA 3H8UA 3P3PA 4AI2A 4DQAA 3DL3A 2A3YA 3ZPYA 4FT8A 1VAKA 3N7JA 2Q30A 5KWRA 3OYWA 2E7TA 3HQXA 2CTVA 4S2FA 4YM1A 2VW1A 2PTMA 2WINB 3OCPA 4R4XA 5FOBB 3WP6A 4YW4A 1J1LA 2AGSA 1TE1B 5FDBA 4BH9A 3BTAA 4B7KA 3D0SA 2CGOA 3POSA 3RMXA 1W0PA 5CA6A 4I0BA 1LEDA 2ERFA 1YCIA 3CJXA 1AYM1 2SLIA 4C1WA 1NLSA 3TWIA 1G8WA 3B00A 1AYM3 3A4UA 4CDUA 1RUD3 2A5ZA 3ZSEA 1QOTA 1TQ5A 4Z92B 1DF0A 1LHNA 5I0TA 2JE9A 3RJ2X 1HRV2 1J59A 3VDDC 1IKPA 1O5LA 2RS12 1LGBA 1IPJA 2ZKNA 3RYRA 5GZCA 2FMYA 1XNKA 2XKPA 5E88A 3M3CA 1DBNA 1B35A 5HCBA 4Q1PA 3ZFEA 3ZMOA 3USUA 1G86A 1MZEA 2VULA 5ABJA 1JHNA 3ATGA 2NMOA 4XXPA 3MIFA 4QU2A 5D8AB 1J3PA 1QOSA 2H6BA 2GC3A 4FP2A 1E57A 3M4FA 4W6WA 3N3HA 1PVXA 2XB6C 3UV9A 3VKNA 3WHUA 1NA1B 2O8OA 2Q5TA 4Q0UA 3OYWB 1O4YA 5BYNA 1G9AA 4XF3A 1MZ6A 3DPRA 1FOD1 1ND2A 1FOD3 2XUMA 2VUAA 1LEMA 3HMYA 1UIKA 1PM7A 1MS8A 3ZFGB 3WOGA 2IXHA 2IXCA 3HWJA 3H3UA 2Y26A 3MFAA 5EWSA 1XNCA 1N1VA 3SLIA 4W6YA 1LOEA 1H0BA 1RIRA 2PAEA 2P34A 2A6XA 1NCQA 1PGSA 2NM1A 4M3CF 4LBQD 5GALA 2WNEA 4AHYA 4CDQB 4RS5A 4AVCA 4XHBA 4QT6A 1M06G 1QXJA 1RUJ2 4AYUA 5JPNB 2RS11 1W6MA 1ZBE1 2GSYA 1DYKA 4MGYE 3USUB 2RS13 3LKJA 5I8TA 1ZBE3 1GLHA 1AF9A 5ABJB 2ZAAA 2BUKA 2Z42A 2ZGRA 3MF6A 4HZFA 4XMIA 4ZU5A 1AXYA 3EBRA 4I09A 1A8DA 4BMBA 4LA3A 1V6LA 2ATFA 5JPMB 1QJY1 4XJUA 2JG8C 4FTEA 1UU5A 2MHFA 1QJY3 1RUH2 4F8AA 2ZJCA 4BYYA 1CVNA 3MICA 1ENQA 2D93A 4KQ7A 1H2NA 4DOUA 5C6CA 2P3KA 2PHXA 4AQ6A 1SCRA 4Y5Z0 1H1MA 4S2GA 4DY5A 2CWSA 1Y43B 4XHXA 1R092 1ASJ1 2WSVA 2Y0OA 1JH5A 4AEKA 4YGBA 1ASJ3 1RUF2 4K3UA 4HN1A 1BCXA 2XJPA 5JI7A 1LOFC 4LO6B 1VBB1 1KITA 1OQEA 2MEV1 1REDA 3ILRA 4DRRA 1VBB3 5K9YA 1WLWA 5LRSA 1Y7BA 2MEV3 1FT9A 3AMMA 5L36A 2IXLA 1RUI2 3VUOA 3KT7A 1PIV1 5K0UC 1Z7S2 1AJOA 1ULGA 3WG1A 1ND3A 4V1PA 1ZZ7A 1PIV3 1WLCA 4LE3A 3WLUA 1JOJA 5SV5A 1LOAA 4AEDB 2VNOA 2FBEA 2PLV1 3W9AA 5LRRA 1KD7A 4AGGA 2PLV3 2ZABA 1RUJ1 1ZZCA 1VBA1 4K1YA 2YYOA 3N36A 4YZ1A 3ZDSA 1RUJ3 3BB6A 1VLNA 1D0GA 3NAPB 3JBG2 4AEJA 2XWJB 4EROA 5GLVA 2OUHA 1N1TA 1VR3A 5EYXA 5CNAA 2Z5WA 1DQ2A 5D8AC 2K2SA 2K0GA 4FPGA 4GALA 2BEOA 3M3QA 3N4MA 1NA1C 2XJQA 2CWMA 3AP9A 1V9U2 2DTYA 2YHJA 1UAIA 1YLLA 2B9UA 1G9BA 2CY6A 4S2HA 3OTFA 3R05A 4QQOA 1DLLA 2E51A 1BZWA 3AB0A 3N7MA 1CPMA 3VBRB 3HT1A 3U07A 4N90A 2DURA 3VLBB 2ZS6B 4CDWA 4PF5A 4Q8KA 3JQWA 1OD5A 1UMZA 4EN6B 4RR3C 3ZXJA 3R6SA 2DV9A 3BU7A 4FQZA 2XLGA 1RUI1 1H4GA 1CAVB 2C1FA 5LEKA 1RUI3 5C8CB 2BYVE 4A7YA 2IFRA 4OI0A 2B5HA 4KWLA 1COV1 4Z2WA 3C2UA 2WFF1 4CDQC 1COV3 4QPIA 5I0UA 3PHMA 1W0OA 2WFF3 3JU9A 4KWJA 1KFXL 3I8TA 3U10A 3B93A 3ME2A 1QJZA 2OZJA 3U4XA 4O9GA 3VBOA 2P3JA 3DUIA 2GNBA 5FO9B 3WVJA 1KDKA 3WP4A 2XJVA 3I59A 2LUWA 3R4DB 2VY0A 3E5QA 1QJU2 5BV6A 1Z0HA 1LULA 2UWCA 1QNYA 2X5IC 1HX6A 5BY5A 1QWRA 1N1SA 1S0JA 2GH8A 2VG9A 3S7IA 4MGIE 3RYKA 2UYBA 5FLJA 1V6IA 3RPQA 1V9U1 3WQ7A 5JWPA 1T6GC 1V9U3 1MQTA 4E2GA 2LM3A 2DCKA 3LOIA 3WG4A 4I0WB 4EWAA 3B7MA 2EAAA 4AQTA 4WM7C 4XF4A 5JSPA 1GZ9A 3TBDA 4YNIA 2XLFA 4FPLA 4MXVA 2XWBB 4PJYA 1KJRA 1AX2A 4FPHA 4HK9A 3KCXA 5JDBA 1Y9QA 2HWF2 2ZX3A 3BCWA 3FHIB 4CP0A 2BVBA 4Y22B 4AFAA 3EHKA 2VOKA 2Y0IA 4DRVA 2ZMKA 4AEDC 5JMCA 3ES1A 5CBLA 4J1WA 3VBOB 1S2BA 5A32A 2X53S 1BQPA 1AL21 1ZNPA 4I3GA 4XF0A 3VHPA 2XVKA 4A3XA 4EN9B 2ETEA 1NXMA 2R6QA 3I59B 4Z82A 1RJ8A 2WWSA 4HKLA 1XE8A 4OI2A 4KH9A 3VBHA 3LWCA 4GQ7A 1AR81 1DGLA 1DQ1A 4YM3A 1ENSA 4FPCA 3LSEA 1ULEA 3CF6E 4TLFA 4XBLA 1TNFA 2ZHLA 1QJU3 1LHUA 5DDJ1 2R072 4XFGA 5DDJ3 4KU7A 1PVC2 3AX4A 1YFWA 5KHJA 1F9KA 4CEYC 3VBUB 1O3QA 3CL1A 4FXKB 3AK0A 2ZHNA 4XW3A 3HD8B 4AFBA 5C33A 2ZX0A 1Q8OA 3DGTA 4FBFA 3O14A 4QMAA 1RGSA 2CV6A 1BBT2 2DFBA 2W0XA 3MGUA 4GWMA 1Y3TA 5HXVA 1YO8A 3SH5A 4NHLA 4R9DA 3ECQA 1N3QA 2F6BA 3FFZA 3RMYA 1YNAA 3HT2A 4IEXA 5JLVA 4NPRA 1PK6A 2XGXA 5C8CC 5BNQA 4OZXA 3TYJA 1UX6A 1PGL2 1ZREA 2E9QA 3FBMA 1JYIA 2RM21 5GLWA 4FSJA 2PAMA 2E6VA 2RM23 1M4WA 1WMDA 3IKWA 4RA0A 3VBHB 4DPNA 1KRIA 1C4RA 3LA2A 4DB5A 2A6ZA 3B01A 3TN92 3JCIA 2ZGTA 1N3PA 2TUNA 3ZN6A 4TSVA 4BE3A 5GLZA 5KHGA 4XTMA 3APBA 3H7JA 3HIFA 2UYAA 4QM9A 1SEFA 4UBGA 4QQLA 1IS3A 1RL3A 1R082 4Y26A 1ALYA 2NQYA 5T3NA 1ZVFA 2R071 4ASMB 4E4SA 5BNPA 1OA4A 2R073 4AXOA 2D6KA 2VGDA 1VBC2 3MYXA 3FUOA 2WNUB 3MLKA 4IL7A 4QGMA 1C8M1 1PVC3 1HXS2 4Q4X2 4AK3A 1LU1A 1V6MA 3WUCA 1AR91 1SBEA 2WZR2 2IXKA 4A2UA 2OA2A 5IUQA 1AR93 1WW7A 3R4SA 2JJ6A 3TOJA 1AR71 4TWTA 2D6OX 4LO4B 4D69A 1AR73 3LSDA 5F6LB 4ES8A 3S0MA 1QHDA 1BBT3 1U5YA 1ZZ8A 2ENRA 3M3IA 4HPKA 1PK6B 4PDWC 3SCHA 3LA7A 2B42B 2VXRA 1S1AA 5C4WA 4DS0A 2DCJA 5CFDC 4LBQB 1V6OA 4YVSC 4B4RA 3MW3A 1VBD2 3POWA 4P9YA 1HV1A 1A8MA 3O0WA 4QPGC 4XE9A 5KXCA 4L99A 1V70A 2PHDA 1UW8A 4YVWB 1RB8G 1LESA 4B7EA 4I30A 1PO22 4JQRA 2FMDA 1BMV2 4ITCA 1CAUA 5DZFA 3TNQA 3WCRA 2VMGA 1OLQA 2D98A 2GNDA 4MZUA 3OF1A 1YI9A 5FRAA 2JE7A 3VDDA 5KC6A 3SHRA 5CAZA 2D7FA 1LOGA 1X7NA 3QOPA 4HK8A 2RMU1 1QMJA 3ENRA 1S0IA 4AVAA 2ZA9A 1OI6A 2JECA 2RMU3 3VBUC 1FAYA 2MNGA 1VBC3 4CEWC 5JI9A 3W58A 3V0BB 2VW2A 4PIXA 4B4QA 4R52A 2WZR1 4I3PA 4U2AA 3CJIC 2WZR3 4HPKB 4OI4A 3OJBA 3MPBA 2XH6A 1AR62 3JD71 3M3EA 2GMPA 5C4WB 4F7ZA 3JD73 3E6CC 1CONA 4Q4V2 2VOVA 5F6KA 2ZAHA 1OA3A 2XJTA 2GZWA 5J7MA 3ZIWA 2PELA 4YM0A 1HV0A 2H6CA 2HJIA 3M2MA 5CFCB 4BCUA 2EXJA 4WZFA 4IEUA 1EAH1 1MS1A 1YJKA 5SV8A 1K5MC 1RUC1 2P17A 4IXLA 1EAH3 4P9WA 4EWEA 2B7YA 3NKGA 3AJZA 4LUMA 4XIOA 1VBE2 3EO6A 1RUC3 3ALQA 2UY9A 4JDNA 1I6XA 4CZSA 1PO21 2WS91 3D5OA 4N9HA 1PO23 2WS93 4UW5A 1KQRA 4COWA 2BNNA 5I8YA 3VZNA 2HKXA 3VHNA 1ZYBA 2PA7A 2W08A 1W6NA 5JOZA 4QQPA 5J37A 1IGOA 3SITA 4AI3A 3AKTA 5BPXA 3VBSA 1AYN1 1JUIA 1AJKA 3E97A 3RDIA 1AYN3 1UL9A 1F31A 3WDWA 3A0KA 1YFYA 4X8PA 4KNCA 2YGMA 1AYM2 1G6NA 4RGGA 3ACLA 3OY8B 4XOGA 4JTNA 4H7LA 4RHV2 2HWE1 3WZ1A 4FTBA 5HCFA 2A6WA 2VOWA 2GC1A 2HWE3 5FCCA 5CADA 3OPZA 3IPVA 2NMNA 3AMNA 4Q4V3 2BPA2 4FPOB 4Q2FA 3H1WA 1MZ5A 3QCWA 1MS5A 2JXAA 3RJRA 4K20A 1SBDA 1ZX5A 1H1AA 5FREA 1KJLA 4XFFA 3ZO0B 2IWGB 2H0VA 4NHKA 3VL9A 1A78A 4R9AA 3KB5A 5J98B 5GLTA 4N43C 5F9TA 5K0UA 4DZGA 5B2GB 3ZXFA 5KBFA 4OHVA 1MS3A 1V6JA 4JRAA 3RS6A 5A33B 1FOD2 2RS31 3MIHA 3VBSB 1ZRCA 2RS33 4OHYA 1H2KA 3DKWA 4HANA 1UIJA 3M8LA 4BOWA 4CDXC 4IV3A 3NWKA 5EXOA 5EJ3A 2NN8A 4YFWA 2ZTNA 3DF0A 5HBAA 3X29B 4GULA 2GDFA 3WUDA 4WM8C 1CAXB 3VKMA 2GNMA 1ZM1A 2DVBA 3IT8A 4RHV1 5D1IA 4S2DA 3T1LA 5J96B 1RUOA 3AXEA 2X29A 4RHV3 1APNA 1O7FA 1W6OA 1RINA 3LGRA 4KGQA 5L7OA 2DU0A 4PLMA 1O4TA 1X33A 2D97A 1ZBE2 3AMHA 4UXAA 2D43A 4IERA 3B02A 3MDPA 4QQ2A 1LODA 4FQ4A 2ZGOA 5FPZA 4HT1T 4YW3A 1H8TC 2FZ2A 4WZCA 4A7KA 4D7SA 1BYHA 4KL1A 4N53B 5I91A 1J3RA 1QJY2 1PO12 2QZ3A 5C9AC 1RUE1 1MEC2 4D94A 4K8FA 1RUE3 5I0SA 1FATA 3T2TA 3WX5A 1GKBA 4D7YA 1D0HA 3QACA 3KD4A 3I7DA 5KXEA 4YW1A 3ZXKA 2BQPA 5JSOA 3VZLA 5LK7B 5AC92 4LBKA 1ASJ2 4GA9A 3I4IA 3WHTA 4IV3B 3IDEA 1TNRA 1LGNA 1RUNA 2A7AA 2QJVA 2XVGA 4YZ2A 4WVMA 4X6RB 1FMD1 1NCRA 2ZGLA 1QXRA 4LBOA 1MR5A 1VBB2 2EALA 2ZGQA 4EN0A 1UU4A 2MEV2 1H30A 5K7PA 1Q8VA 3M70A 2JG9A 4CDUB 4F83A 1SBFA 5JZGA 4Q4Y1 3ZFFA 5HI0A 1PIV2 1C8NA 1HRI1 2QKDA 2XKOA 4Q4Y3 1VJ2A 1O91A 1W6OB 3KCCA 1HRI3 2O0OA 1WMFA 3AP7A 1MS9A 1VP6A 2PLV2 1W6QA 4P9JA 3UKVA 1VBA2 1B35B 3ZFEB 3PVNA 4WM7A 4Y1XA 1ZZ6A 4AVTA 4IV1A 5KC5A 1JBCA 2WFPA 4FPKA 4YW5A 1FPN1 2ZX1A 4RQPC 3LOBA 1WLDA 4ZU7A 2FZ1A 3UK9A 5J36A 1N1YA 4OFGA 1FPN3 3VBFA 1WD3A 3PTYA 1MVEA 3RG0A 4ATFA 4C90A 4GH4C 1CGPA 1PO11 2E7AA 3N7LA 3MF9A 4GKXA 1MEC1 1PO13 1MEC3 3DPRB 3PVOA 2I07B 1ND2B 4NO4A 3VN4A 1CD3G 4L9BA 4QD2A 4YGDA 5AC91 1YI7A 2V09A 1NCRB 4FOYA 4AFCA 4LBNA 4LEJA 5AC93 1I5ZA 3RWNA 1DU3D 3E5UA 4G4FA 3GZTB 3NO8A 5C8WA 5E16A 3KSC