3VBSC

Crystal structure of human enterovirus 71
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbsC00
1ZBE1 2IZWA 3VDDB 5J96B 5JZGC 3VBOC 1TME2 5D8AB 1POV1 1QJY2 3ZFFB 4AEDC 1PIV2 4Q4Y1 1K5MA 5A33B 1NCRB 1K5MB 1AR72 2ZZQA 3JD73 1NG0A 1AL0G 2HWF1 4Q4X1 1Z7S1 1AR62 1CJDA 4IV3A 4FTEA 3JD71 1QJU2 4IV3B 1HRI1 2WFF3 5FOJB 3S6PA 1AYM2 1R083 2HWB3 1AUYA 1AYN2 1VBB2 4CDWA 5BNPC 1R081 3JBG3 3NAPC 1H8TA 4CDWB 1VBA1 2HWD1 5L7OA 1D4M3 2WWSA 1H8TB 5L7OB 1VRH1 5J98B 5ABJC 3VBFC 1RUE3 1D4M1 1MQTC 4GB31 3ZXAC 4BCUA 2MEV3 1X33A 4FTSA 5ACA2 4CDUC 1RUI2 1R092 2MEV1 4N53C 1QQP2 2X5IA 2HWC3 2XBO3 4WM8C 4RQPC 2R073 2X5IB 5JZGA 3IDEA 2WFF2 3VBOA 3VBSB 5C8CC 5GKAC 2HWC1 1EV11 2XBO1 3VBOB 2HWB2 5C4WC 1NA1C 2R071 1BEV2 1VBE2 1RMU2 1SMVA 1HRV3 4AEDA 4RS5C 4AEDB 1PO11 1PGL2 2TBVA 1TME3 2FZ2A 1M06G 1HRV1 3CJIC 1POV0 1FMD2 1RUE2 5C9AB 5FMOS 1QJY3 2Y26A 5BNNA 4CDQC 1TME1 1PIV3 1ND2C 1VBD2 5BNNB 1ASJ2 1COV2 2R061 3VBUC 5AC92 1PIV1 1V9U2 3DPRA 1PVC2 1RVF1 5A32A 4Y5Z0 1AR71 3DPRB 1AR63 5A32B 1ND3A 4PDWC 3NAPA 3ZFEC 1VBC2 1QJU3 1ND3B 3NAPB 1AR61 1AYM3 1HXS3 4GH4C 1RUC1 5CFDC 5ABJA 1AYN3 3VBFA 2GH8A 1MQTA 1VBB3 3VBFB 2WZR2 1PGW2 1AYM1 1MQTB 1RB8G 5CFCC 4CDUA 4YVWC 2RM22 1VBB1 4CDUB 4N43A 2ZAHA 4N53A 4N43B 2RR12 4N53B 1RUF2 3LOBA 4WM8A 1B35C 5ACA3 4WM8B 1RUI3 1R093 4QPIC 5C8CA 4IV1C 1AR92 5C4WA 1QQP3 5C8CB 1NA1A 5ACA1 1QJX2 4GMP3 2RS32 1RUI1 4RS5A 1OOPC 1QQP1 4RS5B 4NWWA 3ZFGC 5DDJ3 4GMP1 4YVSC 1HXS2 2PLV2 1DDLA 1BEV3 2BUKA 3HAGA 1VBE3 1RMU3 2WFF1 4CDQA 1ND2A 4Q4W2 4WM7C 2HWB1 4CDQB 1RUH2 1ND2B 1BEV1 1VAKA 3VBUA 1VBE1 2R042 1AR82 3VBUB 4CEYC 4FTBA 1FMD3 3JBG1 3VBRC 1PGL1 3M8LA 1VBD3 1ASJ3 1COV3 1FMD1 4JGYC 5AC93 1RUJ2 1NY72 1RUE1 4PDWA 3ZFEA 1C8M2 1ASJ1 4PDWB 3ZFEB 1COV1 4RHV3 1VB4A 1V9U3 1F2NA 4Q4V2 1TMF2 4GH4A 5CFDA 1PVC3 4QPGC 4GH4B 5CFDB 5D8AC 5DDJ2 3TN93 5JZGB 1V9U1 1VBC3 1AL22 2HWF2 5CFCA 4YVWA 3ZFFC 1EAH2 5CFCB 4YVWB 1VBC1 2WZR3 1NCRC 3JB4C 1B35A 1F8VA 1B35B 2RM23 4QPIA 4IV1A 1A6CA 5LK7B 4CDXC 2WZR1 4QPIB 1VBA2 2HWD2 2RR13 1QJY1 1RUF3 1VRH2 1OOPA 3ZFGA 2RR11 4Y4YA 2GSYA 4RHV2 4GB32 3ZFGB 1HX6A 1AR93 2BFUS 1QJX3 2RS33 3TN92 3JB8A 5BNPA 2RMU2 4WM7A 5BNOC 3J8F3 1AR91 1FOD2 5BNPB 1H8TC 1QJX1 4WM7B 2RS31 1R1A3 4GMP0 1OHFA 1RHI3 2PLV3 4CEYA 1PO23 1QJU1 1WCDJ 5ABJB 1FPN2 1RUG2 4Q4W3 1EV12 1HXS1 2PLV1 4FSJA 1RUD2 1RUH3 4Z92B 1AYN1 4JGYA 2R043 1AR83 4RR3C 4JGYB 1BBT2 1ZBE3 4Q4W1 2BPA2 1PO12 1RUH1 2QQPA 1AR81 1NCQC 2X5IC 4RQPA 4QPGA 4RQPB 2RS52 3VBSC 1RUJ3 5D8AA 4QPGB 2ZTNA 4CEWC 2RS12 1C8M3 3ZFFA 5C4WB 5K0UC 1MEC2 2R062 1NA1B 1NY71 1R091 1RUJ1 4Q4Y3 4Q4V3 1TMF3 3J8F2 3VBHC 1C8M1 2XPJA 5A33A 1R1A2 1NCRA 3CJIA 1RHI2 1TMF1 1ZBA2 2HWE2 4Q4V1 1BMV2 1AL23 1RVF2 2HWF3 5C9AC 3CJIB 1PO22 4Q4X3 1EAH3 1Z7S3 5DDJ1 4JGZC 4CDXA 5BNNC 1OPOA 4CDXB 1AL21 1HRI3 1RMU1 4NWVA 1EAH1 2WS92 1RUC2 1ZBE2 1E57A 3DPRC 1VBA3 2HWD3 1VRH3 5BNOA 1ND3C 1VBD1 5BNOB 1VB2A 5AC91 4Q4Y2 4GB33 5FMOL 3VDDC 2VQ0A 1GFF2 4RHV1 2RMU3 2FZ1A 1FOD3 1PVC1 4Q4X2 3FBMA 1Z7S2 3TN91 4RR3A 2RMU1 4N43C 1X36A 3JD72 4RR3B 2BFUL 1FOD1 1HRI2 1HRV2 1FPN3 1NCQA 1K5MC 1RUG3 1EV13 1RUD3 1C8NA 1NCQB 3VBSA 1BBT3 4CEWA 1FPN1 1PGW1 1RUG1 1R082 4IV1B 1NOVA 1PO13 1RUD1 5K0UA 4CEWB 4EJRA 2RM21 5K0UB 1BBT1 4IV3C 3VBHA 3JBG2 1OOPB 2RS53 1HQNA 1D4M2 4RFT0 3VBHB 2WLPA 4SBVA 4YVSA 1RUF1 2RS13 5C9AA 4YVSB 1MEC3 2R063 2RS51 4JGZA 4CDWC 2MEV2 2RS11 4JGZB 5L7OC 1MEC1 4LLFA 1ZBA3 2HWE3 2BBVA 1RVF3 3J8F1 3VBRA 1AR73 1IHMA 4CEYB 3VBRB 1R1A1 2HWC2 2XBO2 1RHI1 1ZBA1 2HWE1 1BMV1 2R072 1PO21 2DF7A 1W39A 2WS93 1RUC3 1QJZA 2R041 1CD3G 2WS91 1POV3 3VDDA
chains in the Genus database with same CATH superfamily
1ZBE1 4EQVA 5L9VA 2QQOA 1LGNA 3ACFA 4E2QA 1LHUA 3VDDB 3HPNA 2VVEA 4EN0A 1OA2A 2HEYF 2QBXA 2C9KA 1TME2 2PHFA 2W95A 4Y3OA 1REDA 5FPAA 3VBOC 3KT4A 1POV1 4AVVA 2PTMA 4NPLA 1BK0A 1OLQA 2DDUA 3C2UA 1DBNA 1LHOA 1DG6A 2R32A 2JE8A 2VMHA 5DAWA 1QJY2 3ZM8A 1MZ6A 5GZEA 3LQCA 4LHKA 4PT6A 3KS7A 3K77A 3WQBA 2D40A 1IQDC 1JOPA 1YFYA 4MGSA 4Q4Y1 2BNMA 5FYSA 3SH5A 4ET7A 1YQCA 4LE4A 4QDRA 2X53S 2AEZA 3ZSLA 3M7AA 4RSUA 3NJVA 2YBPA 3VDCA 1KJRA 5KWRA 2ORXA 3CO2A 5CADA 3BTYA 3BIEA 2BOIA 1ZYBA 5SV5A 3CNAA 3ZIWA 5G04L 2BNNA 4LKFA 5FZKA 5F9TA 1BJQA 1Z7S1 5DABA 1G9AA 1JUIA 3VZLA 3J7HA 1H2NA 5APAA 2R49A 1UX7A 3Q8EA 4D6SA 5C8WA 5FPXA 3WR0A 1BK1A 4AW7A 4Q8KA 4YZ4A 1R083 4AGRA 2WN3A 1DFQA 1OXCA 3I2KA 1AUYA 1DP0A 1EY2A 3H7JA 2CGNA 1JZ6A 4Z2AA 1OSGA 4ZS2A 1NYWA 3H3UA 4QX7A 3B5LB 4XUPA 3RNSA 1D4M3 4IQPA 1REFA 3OTFA 3LCPA 3O14A 1TEIA 4F83A 1NXMA 3BTXA 3I97A 4O65A 1RUE3 2BP6A 2XH6A 3DYOA 4CP9A 2IFRA 1MQTC 2AC1A 3K2OA 3ZXGA 4CP9B 1H2LA 3ZSMA 4FPLA 1Q8SA 1Y7BA 2XJTA 1RC6A 3I2OA 2YBKA 3CEWA 1ZX5A 3C7EA 3NNJA 3L9JT 3A4UA 3LOIA 5EWSA 4CXWA 1VP6A 2QQWA 4FI9A 1W2NA 2VOWA 2JG9C 4AVSA 3ES4A 2GNDA 4LORA 2QDNA 4RQPC 2BERA 2GP3A 5LA2A 4ATFA 4Z2WA 5JZGA 2WFF2 3ZYRA 1Q8VA 4QPYA 2ZX4A 2VE1A 2NPIA 1LOAA 3FUOA 5A3MA 1EV11 2JEMA 5DQ0A 3ZN5A 2HWB2 2B5HA 4C8DA 3B94A 2E6VA 4QX5A 1BHGA 1HB1A 1RMU2 2VU9A 3MEPA 1SMVA 4P5YA 1HRV3 1KGYA 4AEDA 1F4HA 1GQPA 3A7QA 4J1WA 1N1VA 4CE8A 1LCLA 1OF4A 4Q2FA 4AEDB 2AR6A 1MPXA 4ZU5A 4LMFA 3HVDA 1TME3 4K7JA 5FRAA 3B7MA 5A7PA 2GC3A 5JUVA 2EIEA 3C7FA 4NAMA 4WVWA 4A42A 1FMD2 3VZJA 1QOTA 4GJZA 4NO4A 5FZ3A 1QJY3 2WZ8A 4CVUA 5CAZA 1QOSA 3T2TA 2VBDA 3VZMA 1VLNA 4IERA 1VBD2 1ASJ2 3S0MA 1COV2 3H8UA 3BKZA 1GOHA 2LS6A 2R061 4QM9A 1A34A 2VUAA 2W1SA 4KWJA 3ZR5A 3LDKA 4FFFA 2D6MA 2JDMA 2L9LA 2Q30A 4ATEA 1C5HA 3BTZA 3SISA 3BYWA 4LBNA 1MVQA 2WNVC 3AK0A 1DYKA 1RVF1 2ZGTA 3GF6A 3OGRA 4XFFA 5FZLA 4LKSA 2ZGLA 1XSRA 2CWSA 3P3NA 5FYYA 2VW0A 5FZ8A 5LA0A 1HDKA 3ZYHA 2EXJA 5FZ6A 3QCWA 5IYYA 4PDWC 3NAPA 1RITA 1VBC2 2XUEA 5JPMB 3P1IA 3ZDVA 5E6HA 2WWUA 3NAPB 3AZZA 4X8PA 1OF3A 1AR61 2VG9A 1F15A 2BNOA 3CLPA 4XACA 1QNWA 3MV11 4AFAA 1LGCA 5T5JA 1SLIA 3VBFA 1CZTA 3QH6A 4QXKA 3VBFB 3D5OA 3WF0A 4PF5A 3PVNA 4HK8A 1OQEA 1CIWA 4CDUA 2P5BA 1KXGA 4QHZA 4YZ5A 2XGXA 4CDUB 1RUNA 2ZAHA 3FLPA 4A7YA 4LJHA 2DU1A 3AMHA 3ZOIA 4DEQA 5FP3A 4P9WA 3RDIA 2KR2A 4WM8A 3H8XA 2NLRA 4M0HA 1B35C 4WM8B 3O1OA 3WDXA 5FR3A 3GJAA 1DYOA 2CAUA 2JKXA 4NHKA 4P9LA 4Q0PA 4KBZA 4QPIC 5ANNA 3T2QA 1X8EA 2W5FA 4FXKB 4LOSA 3OUIA 2YV8A 3K75B 5ACA1 1QJX2 3W59A 1O4TA 2RS32 2N7GA 1RUI1 3TOJA 1H2MA 5F5QA 1E5HA 1SCRA 2RJKA 2XWJB 2VGDA 4NWWA 3ZFGC 2V4VA 4GMP1 3R4SA 1JS9A 4O61A 3ZSKA 1HW5A 1PMIA 2WBKA 2FMDA 2KA3A 2VZOA 3ATGA 3HT1A 4RN5A 5F6KA 1CWPA 1RMU3 3OEBA 3WQ1A 3WW3A 4K1ZA 4CDQA 4NHXA 2FD8A 3KM5A 4CDQB 1LHVA 4N9HA 1BEV1 1GUIA 2VH9A 1VBE1 2QQLA 2VW1A 3POYA 5LBEA 2CDPA 4YW2A 1AR82 1MACA 4K8RB 3UESA 4FAHA 1YNAA 2DCYA 4JDMA 1OQ1A 4FTBA 1FMD3 1YIPA 1ZREA 4IEZA 1X9TA 5LCWL 4URTA 2Y60A 1GZTA 5AVPA 3HNYM 3M8LA 5C8CB 1HJFA 1QKQA 3HN3A 1VBD3 3QLQA 2E9QA 1ASJ3 3TEYA 1COV3 4NIDA 5FK8A 1LU1A 2JXAA 1NY72 4UWDA 3IB3A 4L2NA 4COZA 1XE7A 1D2QA 2OZJA 1ZA7A 3AYEA 1DQ4A 4JTNA 4I2OA 3GHNA 2BQPA 3MO4A 5FZHA 4COYA 3K4ZA 1F2NA 1C1LA 1GNYA 4Q4V2 1OT5A 5CFDA 4E4HA 5JR2A 4RA0A 4MXVA 1HV0A 4AI1A 5JXIA 4H3WA 4BH9A 4AQSA 4YW1A 4EYUA 4MGIE 4D8MA 5CFDB 4OI0A 2BYVE 1GMMA 1V9U1 3H1MA 2LALA 1SLCA 4B7EA 1VBC3 5CVRA 1IG3A 2HWF2 2GN3A 4XFCA 5CFCA 4NIGA 1K42A 4UF0A 2B42B 4XABA 2ADDA 2P3KA 3ZFFC 1LOGA 3L2YA 5CFCB 1JBCA 4UF0B 4MGYE 1UXXX 4LO7A 5CIRA 3ZKUA 1W2AX 1KS4A 1SBEA 2G19A 3VDBA 4LTAA 1SG3A 2GH2A 3JB4C 1D0HA 4XJAA 3MIBA 5FYVA 5LBFA 4CCKA 1F8VA 3WDYA 3OB8A 4MZUA 1CIYA 3N7MA 4BHPA 5LEJA 5B2GB 1GP4A 3LFIA 4XJWA 4CDXC 2WZR1 1DIWA 1VBA2 1WUVA 4CU8A 2DUOA 4AFCA 2W08A 4OI2A 2V09A 1GANA 1U5ZA 1UMIA 2PHWA 2V5YA 5FBJA 5EP9A 4YSFA 3ETPA 4TXWA 1YFXA 4LA2A 4RHV2 3NV2A 1DLLA 5EFUA 3N9PA 4PLNA 2FDIA 1QJX3 3M3OA 2RS33 4QQPA 4EWDA 3VD9A 1JYWA 3IDCB 3TN92 3DECA 3OSDA 3W5NA 5BNOC 2P6CA 5KHHA 1RYYA 2XDVA 4UFMA 1U5XA 4G9SB 5IAVA 1DZTA 2PHRA 2CGPA 3POGA 4L11A 4KI5M 5JDBA 2EAAA 1XPWA 3GXUA 1JHNA 1S2BA 3OGSA 3IKWA 1LJ7A 4E8DA 3NJXA 3T2OA 1GQHA 1QJU1 3KF5A 4QDQA 1RXFA 4TLFA 4A2UA 1JYVA 1V00A 2EXKA 1HXS1 3NWKA 4I30A 4LITA 2PLV1 5HCFA 4B29A 1V0AA 1J1LA 3TYJA 3WDWA 1ZM1A 5FZBA 2FMYA 1AR83 4FOQA 4PCRA 1HB3A 1BBT2 1UCXA 2QE3A 2R1DA 5CBLA 4EWEA 5JSPA 2XJQA 2JDUA 4QX8A 5A7QA 5J36A 3AMPA 1OMIA 1WWYA 2AENA 2QQPA 1NCQC 2X5IC 4RQPA 2JG9B 2P3JA 3MF9A 4BDVB 3G7DA 4TSVA 1SFYA 2VVFA 4M4PA 2QQIA 2RS52 4RQPB 3FN9A 3GZEA 2Q8CA 1WA4A 3I7DA 3VBSC 4QXBA 4XF3A 5C5UA 2ZTNA 2YG0A 3AMNA 2YXSA 2EXIA 4HSJA 1O5UA 5K0UC 3HWJA 1R091 2ZGKA 1MS3A 2J1TA 4Q4V3 4WZCA 1LTEA 2GNMA 4YPJA 3J8F2 1C8M1 2PXJA 3W9AA 1JN2P 4AI9A 1PNGA 1R1A2 4XDOA 4UW6A 3VKLA 4LUMA 2GZWA 1RHI2 1TMF1 1ZBA2 1K45A 2HWE2 2VM9A 2HWF3 3BN6A 2VTXJ 4OI4A 1US3A 4ASMB 5C9AC 2Q4SA 1H9PA 2C24A 3F2ZA 1W04A 2X10A 4PLMA 3THCA 1R64A 1UYXA 2WO7A 5FYUA 3D82A 1AL21 4XBQA 5LY1A 2Z5WA 2VMGA 2ZBJA 1EAH1 2PHDA 2WS92 3AZXA 2QCSB 2J22A 2XJSA 1Q8PA 1RUC2 2XVLA 1WBFA 2BEOA 3MF6A 4PQQA 3WNNA 4XFBA 2JG8C 5A3PA 5DXDA 5F37A 1GYKA 1RTVA 2OQ6A 2VD7A 3VB9A 4NN0A 5FPBA 1ULOA 4KH9A 2JB8A 2RJLA 3DPRC 1VBA3 1W28A 3POSA 4QKFA 4UOJA 3DGTA 2Z4FA 2VR4A 2Z79A 3PMSA 1GWLA 3RZHA 5HCHA 4MVTA 1F4AA 5IWFA 4YNIA 3GBWA 3SKJE 4Q1PA 2W1WA 2X09A 3MUZ1 5AC91 4DIQA 4JVAA 3KVBA 2D3PA 4J1XA 2WNUA 1V6MA 3WQ7A 4IEWA 3VDDC 1IPJA 1C4RA 2VQ0A 2WNUB 3I3MA 2QTWB 3P5BA 1HKDA 2Z2SB 3WNLA 1RXGA 3J7LA 1PVC1 4FQZA 1W2TA 3R4DB 2VCAA 4MX3A 2FDHA 3BPSA 1OURA 1UKGA 4LHNA 4N43C 3LAGA 3T2PA 4AZZA 4CCMA 1X36A 3JD72 4CPBD 4HVQA 2BFUL 1FOD1 4QQHA 3UKVA 4BXFA 5JI9A 1J3RA 1MZFA 4DS0A 2BBAA 2ID4A 3LEIA 1H1MA 3LE0A 3K4AA 1C8NA 2VCMA 3IPVA 4H7MA 4N7IA 1V6KA 2WQZC 1BBT3 3IPVB 4CEWA 1PGW1 1YYNA 1RJ8A 2WYSA 5FZ4A 3OG2A 4HFSA 4JHZA 4CEWB 4JKMA 4NVPA 4DZGA 2DBNA 1PM7A 5KXEA 3KCYA 1JH5A 3VHRA 3WF1A 3VL8A 3PTYA 5CB7A 2RS53 2OA2A 4RFT0 1ZVFA 2YGMA 1WW6A 3BU0A 4ZU4A 3OPWA 5D1IA 3TAYA 1QH6A 3T4VA 3O7OA 5A3LA 1UZ0A 1XE8A 2PMWB 3AKSA 2WZPP 4ITCA 3OPTA 1GOFA 2MEV2 1SFPA 4CXXA 3GM8A 4GWNA 4P9YA 2P37A 1NUKA 1A78A 1JYNA 1C28A 3A21A 1F5FA 1MEC1 1JYXA 2Q1MA 3U10A 1OQDA 1ZBA3 2HWE3 3K48A 4XTPA 3WDTA 3LB9A 1HB2A 5JOXA 3AMQA 1AR73 1SDDB 3WV6A 3KB5A 3PUQA 3B93A 4E2SA 1GNZA 5E16A 1Q43A 4XHBA 3ZYPA 5AVAA 5A7WA 3OD4A 1U5YA 1UOGA 2R072 3KLSA 1D4VB 4LT5A 1W39A 1LHNA 5A7WB 5F5IA 4BQWA 2WS93 3OYWA 4OVEA 3I2IA 1RUC3 1T2XA 2DVBA 1JOBA 4JKLA 3S5AA 4FBFA 3OYWB 4YYOA 2VNGA 1OH4A 1BVVA 3PU8A 3WD5A 4YLZA 1NZIA 4MSVA 1Q5OA 3NJZA 2GC0A 4HMZA 2PELA 1CPNA 1DQ2A 5JZGC 5BPXA 4ZS3A 1PX3A 5EHDA 4EZ4A 3O1TA 1V6JA 3AKPA 1N1YA 4GKXA 4O7XA 4CU9A 3H3ZA 3MIFA 4NPRA 3Q8CA 5HXVA 5FDBA 2EIBA 1PX4A 1WMDA 3KSCA 1XNDA 1H6XA 3ZFFB 3HQXA 4AEDC 1G9DA 1JU3A 2XLAA 5KBFA 2NMOA 3UJQA 4W50A 2VW2A 4DRVA 2DUPA 3MIDA 4XAAA 4LBKA 2F6BA 4XW3A 1ULDA 1S55A 1K5MA 2HYXA 3KHBA 1ZRIA 5A33B 1AJOA 1YWKA 5EIYB 2F4PA 1FV3A 1K5MB 3OOXA 4EE2A 2VZQA 4Z07A 3RZKA 1ZZ6A 4RD7A 2ZZQA 3HBKA 4QDSA 3JD73 4PBOA 4L92A 1X7NA 4NE9A 2JIJA 4Q4X1 3USSA 4F7ZA 5CG9A 3RYPA 4IV3A 1GZ9A 1JU4A 1JHJA 2ERFA 2XLFA 2Q8EA 4NUBA 2ETEA 4IV3B 1HRI1 3UK9A 3GNEA 3CIHA 3ZN6A 1LOEA 5FOJB 2BZDA 3S6PA 1AYM2 4BJ0A 4V1PA 3N36A 3ZN6B 5JWPA 2VXJA 2Y6JA 5GZDA 1AYN2 3ZX7A 1VALA 2O8OA 2ZOEB 2D3RA 1Z78A 1VBB2 2Y6HA 4INDA 4JC1A 4CDWA 4NIIA 1MZEA 1W8WA 4YG3A 1ODMA 1R081 3I2DA 3NAPC 5FUPA 4CDWB 2HWD1 1OD5A 4DXTA 2B4KA 5J1XA 3HNMA 1J1TA 5JCTA 3IM0A 4C0HA 5K7PA 2A6VA 5FY5A 4OUSA 2VOXA 4FFGA 3VBFC 5C7GA 1D4M1 4AVAA 2GN7A 4GB31 5T55A 2MEV3 1UIKA 3ZXAC 4BIOA 4RGKA 5FCCA 4DXRA 4FTSA 4JQRA 4BE3A 2YBSA 4CDUC 4IGQA 3WF2A 4RFRB 1US2A 4B4RA 3SCHA 5CNAA 3WNPA 4BQ4A 2A6WA 4AI3A 2CAVA 1XQNA 2JECA 3ILFA 4FFHA 4BQXA 5K9YA 1QQP2 1OH3A 1ENRA 2RG4A 4RGGA 4XZPA 3Q8AA 4GWIA 4IE4A 4I02A 2X5IA 2GDFA 5KXCA 1LOBA 4LBQA 4WM8C 4AAPA 3T0DA 2R073 2X5IB 5HV0A 3N7JA 4LBQB 5EJ3A 3SITA 4Q8LA 4QPWA 5A1LA 3MPBA 3VBSB 1MS1A 3QBQA 4IEOA 4C91A 2JDAA 2D93A 5FMBA 2LW8A 2UWAA 1Q8QA 3OCPA 3RFRA 2JDNA 3FHQA 5KC5A 1PO11 1FX5A 2RDQA 1PGL2 3IZOA 5HPOA 1ULPA 1RUOA 1CZSA 1M06G 1HRV1 3GDBA 2VCBA 2W1QA 5EYXA 3I2FA 4P9IA 1UPIA 2VAUA 4LR4A 5FZGA 3KGZA 4NOTA 5I0DA 1IGOA 1RUE2 3LEMA 4PIYA 3RJRA 5C9AB 2D43A 4CDQC 1TME1 4GZ9A 4HKOA 2UWBA 4XTMA 1W90A 1XYNA 2UYBA 2YPJA 4P02B 2JICA 2VBPA 3TEWA 1NE4A 3JCIA 3MV01 4EN7B 3MI8A 2ZS6B 4GWMA 1YEWA 2FDKA 3DUIA 1SLAA 4IDZA 4YM0A 2OYZA 5DMYA 3MLJA 2Y64A 1IKPA 3EBRA 5FOBB 3QOPA 1QMJA 1SLTA 3DPRA 3E6DA 3H50A 3Q9OA 4OQ8A 5EZWA 1GBGA 1XBFA 2EA7A 2J7MA 3DPRB 4Y5Z0 4GA9A 3U11A 3H8OA 1MVEA 2EALA 4Y22A 1NQJA 3H42B 2D6LX 4OCTA 4W8JA 2VZRA 4Y22B 1YO8A 1LHWA 5G05L 3WOGA 5C5TA 2P3IA 2WQ8A 1J84A 5FP7A 1AYM3 2ZGNA 4K40A 1ALYA 1H1IA 2FDGA 5CFDC 4XMIA 5ABJA 1AYN3 1Y9QA 1IOAA 1D2SA 3RSJA 3WG3A 1YLLA 5FLHA 2GH8A 3PU3A 1VBB3 2QFEA 4OMCA 1PM4A 2BOJA 2K0GA 2IXIA 1N3OA 3RZMA 5E89A 5FYZA 2VY0A 5CFCC 4JQTA 2RM22 3RRDA 4ZY9A 5IK8A 3SCFA 1DCSA 3NV1A 4N43A 2VZVA 3LIGA 1UL9A 1MS5A 4JRAA 2EF6A 4N53A 4D94A 4N43B 4FOWA 4ZU7A 2XQXA 4N53B 2RDNA 2ZGUA 1RUF2 1W03A 2XJUA 3MYXA 2E7TA 4EN9B 2WR9A 3NNFA 2QVSB 5I8TA 5H9PA 3EJKA 4PIZA 1SEFA 4YG6A 4D7TA 1ENQA 5C8CA 3RJ2X 2ZXQA 5EJ1B 1AR92 1QQP3 4R52A 1CQ9A 1VR3A 3CF6E 4XOGA 4HETA 3VD3A 4N8MA 3ZVXA 3MBWA 3RZLA 2E31A 4AI8A 4JV4A 4AVCA 3NV3A 5FYMA 2FCVA 2R0HA 2AREA 4RS5A 1GLHA 2V4AA 2TNFA 4RS5B 5DUVA 1C1FA 5LBCA 5DDJ3 4GAZA 4V2VA 4N9IA 2ZHKA 3V56A 3GZUC 5KHJA 1DDLA 2OUHA 2BUKA 4KWLA 2XL9A 3ACHA 3TB0A 4O9EA 2WFF1 3SQOA 3K51A 3AYAA 4QB1A 4DO0A 1CONA 2XXZA 4DMIA 5A3TA 2HWB1 5BV6A 1UOJA 4PI2A 3CHXA 4QKDA 1VAKA 2NYYA 1S0DA 4ZXEA 2R042 4FPGA 4ZZ5A 3RGBA 4OUEA 3HD8B 1LECA 2R16A 4WVMA 3JBG1 5L73A 2Q8OA 3THPA 4WVMB 2VNVA 1SBDA 2JX9A 3M3EA 3VN4A 2VZUA 4JRLA 2BDRA 4MGTA 3T1LA 3O1VA 1FMD1 2R1BA 4QHOA 1J3PA 2OIIA 5FREA 4K1YA 2WNEA 3ZYJB 3DXUA 3QD6A 1VAMA 3DN7A 3ZFEA 2XOMA 3X29B 4LULA 3VKMA 4EZHA 2GAUA 2AACA 5EJZB 1ASJ1 1NE6A 2BGPA 2R7EB 1COV1 1H9WA 3ZFEB 3J7MA 1O7FA 1KFXL 4GH4A 3LSEA 4V2WA 1WGPA 1Q3EA 4LO4B 4GH4B 2XONA 3AKRA 3PL0A 4YW4A 5JZGB 2A3XA 1OKQA 2CNAA 3NKGA 2A75A 4ZPIA 3NVCA 3WDUA 3AL5A 2W2IA 2ES3A 4I0AA 4CP0A 1G8WA 2OXBA 1XYOA 2RHPA 3N9MA 3MZHA 1QEXA 4TTGA 1VBC1 3S5QA 1LKNA 3I59A 1WD4A 4M00A 2P17A 2OW4A 3I3EA 2HH9A 3T0BA 1TVGA 4XCBA 2AGSA 3I59B 4IEPA 4H55A 1H0BA 5HCBA 1J83A 2JDHA 2RM23 1FAYA 4Y1XA 4AEJA 3GYDA 1ULFA 1IPKA 1WW4A 2YGLA 2J1UA 2YY1A 4P5HA 5FKCA 3URFA 4IESA 1YI9A 1W6PA 2VQUA 1WCQA 1W0PA 3ACIA 4HOOA 1KITA 2OKXA 4CCCA 3TEXA 1W6PB 1UF2C 2K46A 1RUF3 4BLIA 3POEA 1JZ3A 3A0KA 1OC1A 1VMHA 4FPFA 3RZJA 4IL7A 5E1RA 2XHNA 2JJ6A 3WXPA 4CUGA 2ARAA 1G7YA 3VDAA 4GKYA 1O91A 2GSYA 3ABZA 1AR93 2O0OA 5DG1A 2BFUS 2AUYA 5FZFA 1PMHX 1H8VA 3V64A 4AHWA 1PNFA 4XQWA 2GMPA 3JB8A 3IIAA 1YIFA 2RMU2 1XSQA 4R9CA 4WM7A 3BODA 3I8TA 1H8TC 1QJX1 4WM7B 2RS31 2UYAA 4UBGA 4FPCA 2JDKA 1HN0A 1BQPA 1OI6A 1YFUA 2WNUC 4CEYA 4DB5A 2ZACA 1PO23 1ZA4A 1LEDA 3EXUA 1QGLA 1B09A 4XC9A 1FPN2 1O4YA 1RUG2 1TZOA 1EV12 4AFBA 4TZDA 2IC1A 3AP7A 3BIWE 4FSJA 3I49A 2R043 1FATA 4UFHA 2J1RA 3PTRB 5BYNA 1ZBE3 4Y26A 3LFMA 3VLBB 4ZONA 4ONUA 5A1AA 4XPVA 5FYTA 4ES8A 2J1VA 3EO6A 3I2HA 4OHWA 1WKYA 1AR81 3PJYA 3LZZA 2E26A 2RDRA 3MICA 5A6ZA 2FHRA 3AX4A 5JR7B 4KL1A 2YFZA 3LSDA 5D8AA 5LW9A 1UOBA 2W9XA 2DVFA 4L8QA 4CEWC 5FZ0A 1UNBA 1DGLA 1JW6A 4YW6A 2P34A 5IK7A 1U12A 5JOYA 2YFUA 2R062 3NQHA 3WY6A 4Q4Y3 1NY71 1JZ5A 3B01A 4MHUA 1XNTA 2YMZA 4KG0A 4LKDA 4XFGA 5JXHA 2ENRA 4XJ9A 3WW4A 3OGVA 1AX0A 1AXYA 1NCRA 2ORZA 2PN5A 4QB2A 4Q4V1 1YXWA 1RVF2 2A3YA 4CU7A 4XE9A 1Z7S3 4HT1T 5C33A 4L0PA 4NPMA 4HN0A 1OPOA 5A6XA 3ZXFA 5GLTA 4YM1A 1W9SA 2ZGRA 2EIGA 1EUUA 4PF1A 5JPNB 3CU7A 1QWRA 5FKBA 1XNBA 3FX3A 1W6OA 4NROA 4FAGA 3N9NA 5FO8B 2OQ7A 1KEXA 3RI8A 1W6OB 2GMMA 4B4PA 2YU1A 2YPDA 2ZEWA 2XR4A 4Y1YA 4BMEA 3GALA 3MUY1 5FP8A 4HVOA 2AZ5A 1NLQA 2ARXA 2C9AA 2ZA9A 3B3QE 2JWPA 4DRRA 5A7OA 5IK4A 3I3DA 4XF9A 5JVVA 3BALA 2QNKA 1W8NA 1XYPA 1ZRDA 1URXA 2QDRA 1CAXA 4PHZA 2IUWA 1GZCA 2DTWA 3M2MA 4MLOA 1XXNA 4Y24A 4LO8A 1CAXB 3R6SA 4WBBA 3OJBA 1PK6A 3BTAA 4A6SA 1GKBA 4IEXA 4RHV1 4YW5A 2RMU3 2YC0A 1PK6B 2UWCA 5JXJA 2FZ1A 5FYBA 2VMIA 3LDRA 3PVBB 4CPBA 1NX9A 3WEZA 5FPUA 2PFWA 1Y43B 2GU9A 2IXJA 4XDPA 1JXNA 4LHLA 3TN91 4XF4A 3UJOA 2DBIA 2WUHA 4BMBA 4H2AA 2Q0AA 5LWBA 4MOAA 3EQEA 2HBUA 1KD7A 4LKEA 3BU7A 1AZDA 2H0VA 1FPN3 1RUG3 1K5MC 1EV13 5CG8A 3SMHA 1VIWB 3AXEA 4QX1A 4BQYA 2ZEZA 3C3VA 4UXAA 4AFMA 1OUXA 1KRIA 3VGIA 1FNZA 2MHFA 3UYJA 1UAIA 2DVDA 3O12A 3IAQA 1GP5A 1LESA 4CRQA 3GGLA 3AZVA 1NLSA 1BBT1 4IV3C 4YM2A 3UGFA 1W6NA 2PAEA 5A3WA 5BUVA 3RMXA 3BCWA 4FFIA 5GLWA 1MS8A 1W6NB 1O6UA 3LD8A 3MLKA 5IFPA 1AXZA 2OS2A 5LY2A 1S2KA 4XUNA 4M3CA 1O8PA 2RS51 2R063 1A8DA 3GZAA 2VVDA 3H0OA 4JGZA 4CDWC 5DN2A 4BYYA 1HV1A 4OFGA 3KMHA 1OFSA 4JGZB 4NRMA 1ZZBA 4BIFA 3WW1A 3AXDA 2YDEA 1HQLA 3H1WA 4LPLA 3LGRA 4LLFA 4MH0E 3FC0A 1RVF3 2PHTA 3J8F1 1U0AA 4LO5B 1IHMA 3LEGA 2CU5A 1XC6A 4Z82A 1R1A1 1W6MA 2HWC2 1UZVA 5DUWA 2XBO2 1RHI1 1ZBA1 2HWE1 3T08A 1NAEA 1L7QA 4J6GA 4ASLA 5JI7A 5LA1A 1IS4A 4KU8A 3O1PA 4ISQA 2A3WA 1UZYA 3ZXEA 3DYMA 4BQ5A 3B69A 1CR7A 2Y0IA 5KHGA 2WS91 1ONAA 5IVJA 2VUCA 2WT0A 2O8QA 5J96B 4Q0UA 1YI7A 1W9TA 3POIA 1QOOA 5J37A 4YGDA 1WLTA 3ZYIB 2MPFA 3N9LA 3AP6A 3BB6A 4QQ2A 5GLVA 3HT2A 3WF4A 1UN1A 1FT9A 5CEHA 5F2SA 1QXRA 3U4SA 4LXLA 2XVKA 1PIV2 2I45A 1DGRN 2YZ4A 3PLQA 4EN8B 4JKKA 2ZX0A 2P4EA 4XFHA 3RWKX 4LBLA 4P08A 1JZ8A 4U2AA 1I1EA 4P9XA 4UAPA 5FPVA 1UY0A 3HR9A 4BPZA 1PVXA 1AR72 2VCCA 3AM2A 3JXSA 4A7KA 1TNFA 2A6YA 1C5IA 4XJUA 1L7RA 3WVJA 1NG0A 3RWNA 4A6OA 1F31A 3PUAA 4K21A 4OHXA 4EN6B 1CJDA 4B8EA 5ERLA 3NNMA 3KWVA 4JZRA 3GZTB 1OBNA 1UMHA 3JD71 1QJU2 2ET1A 2OUJA 4HXCA 3AJZA 4FPOB 3S7IA 3T4HB 5F5AA 1GWKA 2HEVF 5T5PA 1UXZA 2TEPA 4JX0A 3KT1A 1KFUL 1ZZ8A 3WCSA 5FZMA 4XYXA 2DCTA 1NT0A 3UETA 3VV1A 1H8TA 4AI0A 3O5SA 4G4FA 3GJBA 4WZFA 4XUQA 2JENA 4KQ7A 3IMMA 1H8TB 2VUJA 1VRH1 3PVOA 3V0AA 5FJHA 1JYCA 1W2UA 4NHMA 3Q8FA 4YGBA 5ABJC 2CYFA 3V0AB 2BGOA 2CTVA 3ILNA 2XUMA 4YARA 2JE9A 3V65A 1XNKA 3CQOA 4QM8A 2D3SA 3ELNA 3AB0A 1QF3A 3IN9A 5IVVA 3KCCA 1H4HA 5C6CA 2WA4A 4AF9A 1JI6A 1W3VA 4AGGA 1R092 2C0ZA 3FLRA 4FPYA 3WHUA 3VD7A 3QACA 2Y6KA 2MEV1 2WNOA 5F3CA 2P2KA 4N53C 3O1SA 3C7OA 3FJSA 4XQDA 1DZQA 1UY4A 1S1AA 4FQ4A 4XQ4A 3VD4A 4CA9A 5DUXA 2HWC3 1N3QA 2XBO3 4Y5SA 2A6XA 1ZRFA 2FDJA 4M0NA 3OF1A 1ULCA 1O4ZA 1BZWA 1UWWA 2BWAA 3J9SA 5C8CC 3P6BA 1POQA 2QKDA 3NSTA 4NRQA 5GKAC 4MO3M 3OPZA 4QAWA 5E88A 3FHIB 3HQUA 3ZLIA 2R071 2NN8A 4XMAA 3BVCA 2ILMA 3PMEA 4W6XA 2JIGA 4RS5C 4LBJA 3USUA 4B3NA 3ZN4A 4X8NA 4FPJA 3ILRA 3LEKA 3E6CC 3Q8BA 1O59A 4LBOA 2P1BA 1SZBA 1O8SA 4ZHNA 1J58A 1POV0 3PHMA 3LA3A 1ACCA 4AXOA 3JU9A 1PIV3 2DVGA 2QZ2A 1LNSA 1O3RA 4CUAA 3MHZA 3AKTA 4IW3A 1JYTA 1UX6A 1OUSA 2DFCA 1STMA 5AC92 3UV9A 4I01A 3W20A 3FHAA 5LA9A 3PJQA 4ES9A 2GC1A 5LRRA 4AVTA 4XHXA 3GBGA 4P9GA 2QQVA 1LR5A 1QIQA 4OULA 5B4XA 4OQ9A 5CISA 1V70A 3E6BA 3LIHA 4UYBA 3SHRA 2W94A 4BQ2A 1PVC2 5A32A 4Y20A 1JODA 3D6EA 1ENSA 5A3UA 4HSLA 5A32B 3FLTA 2WDBA 4XURA 4Y20B 2O1QA 3FFZA 4GXLA 3ZFEC 4Z1VA 5L9BA 1QJU3 4YW7A 2I07B 3LKJA 3WNKA 2CHHA 2D97A 4YFWA 1JZ4A 5FY0A 2YC2A 1W9FA 1HXS3 4OLLA 2B9UA 4GH4C 5FZ1A 4E4ZA 3J26N 4NIAA 1GSLA 4S2HA 4GQ7A 3KCXA 3MIHA 3EHKA 4GJYA 1QNYA 1PGW2 1AYM1 4QX3A 2D98A 2FCTA 2BVBA 2AYHA 3M3IA 3BGAA 1VBB1 2OVUA 2JDPA 1S0GA 3D0SA 3DKQA 4ASKA 5F8PA 3SH4A 1GR3A 2GNBA 2RR12 4NRPA 2WAOA 3UKTA 2VPVA 2I2SA 1WCSA 3SKVA 1R1ZA 1H2KA 2XB6C 3FWEA 1I6XA 5IW0A 1W0NA 2E33A 1R093 2W92A 2EIDA 3BI3A 5C4WA 2H6CA 1NA1A 4AAXA 3AYCA 4SLIA 2JB4A 1GICA 4M3CF 5FXWA 4CP2A 2TUNA 2BGCA 5H9SA 4TLGA 1QQP1 1Y9GA 1K12A 2ZKNA 2CV6A 4IE6A 4XJ8A 3PIGA 1W8UA 1YJLA 2VO5A 1W8TA 5C3PA 4HBNA 5FZOA 1NQDA 1NLRA 5CYYA 3HAGA 4LUKA 3D4KA 3QH7A 4P9JA 5T54A 2VZPA 5FZOB 1H1AA 1I9RA 1GWMA 1YQ5A 5DG2A 5A6QA 5DZEA 1ND2A 1V6LA 4Q4W2 4NAOA 4WM7C 4Y5TA 4IEVA 2ZAAA 1RUH2 1ND2B 1CAWA 1T6GC 4YZ2A 4CXYA 3VBUA 2FQPA 2A70A 3MIEA 1CJPA 3VZNA 5AFBA 4OUMA 1CAWB 3IAPA 3VBUB 5DAPA 4CEYC 2J1SA 3NO8A 4XUTA 5FXVA 3WG4A 3RMYA 1S0IA 5ISLA 3CJXA 1G86A 1PGL1 5K4LA 2ZGQA 1WLDA 3E5XA 5IK5A 4YW3A 4DINB 3THTA 3WG1A 3ZXKA 1WCUA 5CA6A 2VMFA 4XEZA 1QHDA 3NW4A 5FPLA 5JIUA 1QH7A 3DEMA 5AC93 1RUJ2 1RUE1 2ZHNA 5EQUA 4C90A 4IE5A 2VL4A 3HEIA 2G9ZA 5HXMA 3WNMA 2KD7A 3AP9A 3T1MA 4HANA 4GIQA 4RYDA 1PVC3 2WINB 2SLIA 3GHMA 2O14A 5D8AC 5DDJ2 4NJ4A 5EXOA 3DL3A 4QMAA 4F8AA 4Y1ZA 2Q5TA 2WRAA 2H0BA 1SHWB 3UGHA 4MUVA 3DXTA 4YVWA 4BM8A 2AH2A 1YQ6A 5I0RA 2YB7A 3AVRA 4YVWB 1XE0A 4K20A 1OFNA 5FWJA 1AJKA 4Q26A 3N9QA 1SCSA 3KQ4B 4IETA 3VKFC 4NMIA 3M3QA 4XJZA 1NCRC 2PHXA 3MDPA 1XOYA 4UW3A 3RS6A 3FL7A 4BXSV 4Y33A 1XB9A 5I0TA 2OT7A 1A6CA 1CAUA 2UU8A 4IV1A 1UPSA 4AYUA 2VQAA 1CAUB 2HWD2 2RR13 4TWTA 2WWJA 4L99A 3ZPOA 2XL7A 1IZ3A 4QKNA 1NXD1 4IGOA 4COWA 1DGRA 1DQ1A 2HKXA 1QJY1 2PAKA 2YC4A 2ZGSA 4IE0A 1OOPA 1WCKA 4A3XA 4A44A 2HBTA 4PQ9A 4DY5A 4L9BA 5LBBA 1H4GA 2G9GA 2YYOA 3M70A 4LHSA 5F5CA 2A73B 3RVHA 4M3CE 3IBMA 5L19A 4GB32 1EPZA 4CTEA 1E5IA 1IS3A 1HX6A 5CKMA 3ZYGA 3BOPA 5FLIA 4I0BA 2OPKA 1AVBA 4OHVA 2D5HA 2VC9A 1W9YA 1OLRA 1QDCA 1AR91 1QU0A 1WMXA 3W58A 1TQ5A 3HQRA 5JMCA 4GMP0 1RGSA 1S0EA 4AQTA 1L7LA 3A22A 5C3RA 1UZZA 3AFKA 3HBZA 5DAVA 3H9AA 1E5SA 2W1UA 1WCDJ 1PK6C 2DVAA 1UY3A 3D0JA 2MNGA 1W06A 1OLMA 4Y4RA 5ABJB 2E51A 4Q4W3 3K3OA 3ZSJA 2VBBA 1RUD2 1RUH3 2VOVA 3HIFA 5FWEA 4Z92B 1APNA 4JGYA 3E5QA 1JUHA 4J25A 4JGYB 1YRZA 4CCDA 5FO7B 1UO9A 3IT8A 2G9FA 3IMNA 2BPA2 4D69A 1PO12 1PGSA 3AFGA 1X82A 1ST8A 2C5DA 1GOGA 3NV4A 5LASA 5FP4A 3PUIA 1QDOA 2ZPXA 4QPGA 2WZEA 4H14A 3NNLA 5A3OA 4UT5A 3WT3A 1RUJ3 3M4FA 4QPGB 2K9ZA 4AEMA 3POFA 5IVEA 3SEPA 3KD4A 2Y0OA 1UU4A 2RS12 2ZZJA 5CKQA 1MR5A 4E8CA 2BW8A 4AQ2A 1CESA 4QGLA 4FVVA 4NR1A 3W21A 3ZPYA 2C6SA 1W8OA 4AI2A 3WSOA 2PA7A 1XU1A 3OBRA 4C0BA 3WCRA 1FNYA 5A1FA 2ZCWA 3VKNA 4MXWA 4DUXA 1BMV2 3WQ0A 1HQWA 3JQXA 5J09A 4Q4X3 1PO22 4I09A 4MXWB 5IVBA 1O3TA 3ES1A 1TG7A 1NZCA 2DCZA 4OZXA 5EYYA 1BKZA 4JGZC 4OMDA 3WZ1A 4YFZA 1UW8A 5BNNC 2IWGB 5I8SA 1HRI3 1N1SA 3PIJA 4LA3A 4AQ6A 4PI0A 1RMU1 1XNAA 2B9VA 3MIGA 4IGPA 4NWVA 4D0QA 5A80A 5FY1A 3CDZB 1KS5A 4I3GA 3ZYBA 1ZBE2 5KXDA 5DZGA 3DF0A 5IJRA 1CGPA 2WC2A 4IUGA 1V6OA 1MS0A 1N47A 4FPEA 3ACLA 3H7YA 3OY8A 1H30A 3ZIXA 3ALQA 2QQJA 2HWD3 5IVYA 2WFPA 1KDMA 2DUQA 2B8MA 3OGJA 3OY8B 5C70A 5K8SA 2E63A 2ZHMA 3N4MA 1L3JA 3SCGA 4XILA 1PHMA 2XWBB 1ND3C 2W52A 2WSVA 1VBD1 5FZIA 4AFDA 4UW5A 4CCNA 4IE7A 4MGZE 2XKPA 3AP5A 5IATA 1LRHA 4Q4Y2 1CX1A 4GB33 4R9DA 2W0XA 4DY3A 4DPNA 3O1UA 4PLOA 5JSOA 5F6LB 2PAMA 4HN1A 4LBMA 3T0AA 2C26A 2VTFA 3N35A 1WLCA 4MGQA 4Q29A 3CKHA 4ZZ8A 3WP3A 2UURA 3ST7A 3OUJA 2Y8KA 4JDNA 3FBMA 1QXPA 1Z7S2 3E1F1 3HOBA 1VAVA 2WO3A 4FPKA 4RR3A 1ODNA 3O0WA 2RMU1 5I8YA 1VJ2A 5KHKA 4R4XA 1HIXA 2ZMNA 2RV9A 3AZWA 2NM1A 4LO6B 4QHBA 4RR3B 5GALA 3ZXDA 4R9BA 4E4SA 1A8MA 5FAXA 3ORJA 5DUUA 2EXHA 4AOCA 2BTVC 1FYUA 3BPZA 2NMNA 1RUD3 2F4LA 3BOWA 2WYFA 4XIOA 2A71A 1M4WA 2DYCA 3VD5A 5FY9A 1SQ4A 4LNVA 4LBQD 3LDBA 1FPN1 1RUG1 1W8HA 1RL3A 1PO13 4EJRA 2E53A 3ENRA 4JHTA 1RJ7A 3APBA 3OBTA 5J3UA 2HYKA 2DV9A 4FP2A 3WDVA 2GNTA 4QKBA 4LK6A 3VBHA 3KT7A 3JBG2 3DV8A 5IVFA 2NP0A 4JTOA 1HQNA 2DCJA 3VBHB 1EPWA 4KGGA 2BRTA 1F5JA 3RQ0A 1EP0A 3S57A 1HLCA 5FO9B 2RS13 1J59A 4HKLA 4B7KA 2CL2A 4DEVA 1S4CA 5FLJA 2IXLA 2BV4A 2QQUA 1DZRA 2VTXA 1WZXA 3FBYA 4BQ1A 5IVCA 3WNXA 1LB2A 1GU3A 1SBFA 2F17A 4NHLA 4QX2A 2BBVA 5A6YA 5C3OA 5GM0A 3DKWA 5KC6A 3PVEA 4CEYB 1E5RA 2ZGPA 3LA2A 2XHKA 3TEZA 4KWKA 2GC2A 2D5FA 2XMLA 1LOFA 4Q5OA 3TRSB 4WV8A 1YQ8A 3O1MA 2DF7A 4S2FA 1DHKB 3ZXJA 2LTNA 4ZXKA 1GP6A 4FT8A 3UNPA 1Y9MA 1QJZA 4XXPA 2YROA 5DPNA 1CD3G 1S2EA 1POV3 5A70A 1RB8G 3P3PA 2VNRA 2IZWA 5F39A 2WJSA 1U5IA 3U75A 4Q0QA 1CN1A 1NKGA 3N7LA 5D2AA 5D8AB 1QXJA 2UY9A 4W65A 3ZO0B 3I54A 2Q8DA 4AGVA 4BQ3A 3IDAA 3ZDSA 2P3YA 1K3IA 1F35A 3I2GA 4YGEA 5FIXA 3KGLA 2EAKA 1WW5A 1UZWA 1TNRA 1VMJA 4BWOA 2P6HA 5BNQA 1OVSA 3LPGA 4CUBA 2VNOA 1NCRB 1KDKA 4MGKE 3POBA 5FZDA 1PZ9A 1YCIA 5GLUA 4FP3A 1DQ0A 1AL0G 2HWF1 4X6QB 3U4XA 4LEJA 4XF1A 3IDBB 5FUNA 5LEKA 3KZ4C 1AR62 2D44A 1S0BA 2E32A 4YM3A 3I2JA 4FTEA 3AL6A 4XBLA 4EV0A 4YZ1A 3I3QA 5M0TA 4W4ZA 2WFF3 2RJ2A 2IVIB 5FZAA 5HBAA 1DQ5A 2GP5A 1ZRCA 4ARYA 3FZ3A 1WW7A 2HWB3 4QGMA 1IG0A 4UBHA 1G9CA 5FFOC 4UFKA 5FPZA 1AX2A 3H8RA 3UGGA 2VMDA 3FMGA 3V0BA 5JXGA 3CL1A 2XQRA 4KGQA 1UU6A 3N7KA 4XXAA 5BNPC 2PHLA 3V0BB 3JBG3 1ZZCA 1VBA1 3MFCA 3EMRA 5L7OA 3GCWA 2WWSA 5L7OB 4DXZA 3F95A 5J98B 1XJAA 2D6OX 4Y1UA 3ZKYA 2XVGA 4HVRA 4BCUA 5CZKA 1X33A 2QQKA 3I4IA 4E2GA 1X50A 2ATFA 5ACA2 3N9OA 5FTTC 3WUCA 2FCUA 4MADA 5A7NA 1RUI2 4R4ZA 4EROA 2DCKA 1CPMA 2RDSA 5HI0A 5F3IA 2WT1A 4FOYA 1T6BX 3ACGA 4MHRA 4A45A 1VMFA 2VOTA 4I3PA 4HPKA 4N7UA 4TN7A 1WD3A 2JKBA 1IS6A 3VHNA 4HPKB 2VXRA 1QJEA 1XNCA 1UD1A 5F2WA 3IDEA 3RG0A 4OI1A 4DFSA 3VBOA 2ZGOA 1MZ5A 4COUA 2HLEA 2HWC1 2X8KA 2FBEA 2XBO1 3VBOB 5C4WC 5A3NA 1NA1C 2C1FA 1BEV2 1Q56A 3POWA 3PUHA 1VBE2 5DAXA 2PHUA 2VULA 3TBDA 3ITQA 4MYEA 5SV8A 3AC0A 5IHRA 5CKNA 4TYSA 3KVAA 1G9FA 2ZX1A 2TBVA 3B02A 5FMDA 2FZ2A 3KV9A 3CJIC 2A1XA 1W8ZA 2ZKLA 2YU2A 2WQ4A 1REEA 1DYPA 4K9SA 4CCLA 2PYTA 3OEAA 4M3CB 5FMOS 4CYDA 2VZTA 1WMEA 2Y26A 1C3HA 4ORFA 4BLJA 5BNNA 2XJRA 1ND2C 2Q1ZB 3POJA 5BNNB 4COVA 2A7AA 3SC7X 3VBUC 2IXCA 3LA7A 1F9KA 2BVVA 3J7NA 3HN1A 4XETA 1PIV1 3ZSEA 1V6IA 4URAA 2E7QA 3AKQA 2ARCA 2FDFA 4KU7A 2XJVA 4QXCA 4F3JA 1BLZA 1V9U2 3L2HA 4W6YA 1G9BA 2ZGMA 1DLCA 4O9GA 3H1YA 4XVHA 5I0UA 4CZSA 1W6MB 5FZ7A 4EWAA 1AR71 4LIVA 4BK5A 3ZXLA 5T5LA 3I3BA 4DNYA 1AR63 3S30A 2VECA 3DYPA 3R05A 1ND3A 1GZWA 2AEYA 2NQYA 1GNHA 1X8MA 3O0VA 3SH3A 4CUCA 1WLWA 2E7AA 2VJXA 1ND3B 1GZWB 4AEKA 2WT2A 5H9RA 1EYBA 1LENA 2CGOA 1WMFA 1HJGA 1SFNA 3R4UA 4QT6A 4UI9L 5JOZA 4FXGB 2W68A 2VMCA 4Z8BA 1RUC1 2OX0A 3AYDA 4MG2A 1OLME 4BISA 5LZ6A 4XZUG 2PQSA 3D8CA 4AHXA 5I93A 1MQTA 5E8AA 2WZR2 3LPFA 4UFLA 1MQTB 4R8HA 5C3SA 2X05A 1UQXA 2G4IA 4KMQA 4YVWC 3OBAA 5GJ6A 2GMEA 3ECQA 1XU2A 3B9IA 2ET7A 4KNCA 2RE9A 3MW2A 4GALA 2K2SA 1UY2A 1YFWA 2JG9A 4BA6A 1PMJX 3LOBA 1A3KA 4I0WB 1N3PA 1MS4A 2DTYA 5ACA3 4AHYA 4OZOA 3ZYFA 2LROA 1V6NA 3IWZA 1RUI3 4DQAA 5ANQA 2W47A 4IV1C 5T50A 2VOKA 5F3EA 3RYKA 2ZMLA 2IVJA 4GMP3 3OBZA 1AXKA 1MS9A 1HB4A 3H3LA 2NZ9A 4Q0SA 5FY8A 1CAVA 3PURA 1OOPC 3THDA 1KQRA 1CAVB 4HKWA 3GBFA 4QX0A 4HZFA 2BWCA 4YVSC 1HXS2 4BB3A 5J48A 4BZ4A 2PLV2 2IFWA 3C7HA 4B1LA 4CCEA 1JZ2A 1BEV3 2J1AA 5FQ0A 1BCXA 1LGBA 1VBE3 5IAXA 2Y6LA 2KXLA 3IIIA 1AHSA 3NMBA 3ON7A 2YUEA 1YUDA 5FQ0B 2V73A 3HJRA 2QUOA 3CZUA 3AZYA 4YG0A 1JMUB 3B9CA 3JUUA 5EPAA 1ZRRA 4ARXA 3VHOA 4P00B 1QJFA 2ZX3A 4GULA 5GZFA 1Q8OA 3KF3A 1O3QA 3TWIA 2Q1FA 5KHIA 1LEMA 4PIXA 1VE0A 4QU1A 4XIKA 2UY8A 3VBRC 3W5MA 1UU5A 2VQTA 1W05A 2WNVA 4LE3A 2W46A 1SLBA 4LK7A 4X6RB 2PQQA 1ZZ9A 2WNVB 2D6KA 5IUQA 4JGYC 4RGAA 2ZMKA 3MW4A 3SXWA 1VPHA 2VUDA 4GWJA 4PDWA 3VHPA 1WA6X 2IXHA 2DWRA 4AWDA 1C8M2 1K5JA 4PDWB 5KXBA 1GQGA 1PZ8A 1OKOA 1DGWA 3MW3A 1VB4A 1TE1B 1V9U3 4RHV3 3VL9A 5HV4A 5FMCA 1TMF2 2XLGA 4QQOA 4QPGC 4D7YA 2OZ6A 3EB7A 4XUOA 2B46X 3K46A 4RL7A 3TN93 3KV6A 3U07A 1SLLA 4W6WA 4AHZA 5GZCA 1S0JA 1C57A 2ZX2A 4YRDA 1D7PM 1AL22 2A6ZA 3ETQA 4IEYA 3ROUA 3OUHA 4UW4A 1EAH2 1DF0A 3OGGA 4U36A 1O5LA 4HK9A 5T5OA 5IT6A 3AVSA 2JD9A 4ZKTB 2C4XA 2CSGA 4XFIA 4AL9A 5JMOA 3USUB 2XJPA 3ZMOA 2JE7A 1UY1A 2WZR3 3VZOA 2J42A 1LULA 1B35A 1XRUA 3FFQA 4HL0A 3NNGA 4IXLA 4WVZA 1DU3D 2ZEYA 1W3XA 4M4RA 1JOJA 2Y6FA 1B35B 1W99A 5FXZA 4QPIA 4UFIA 3J4UH 4N90A 3MPPG 1EUTA 3E97A 2ZEXA 5LK7B 1BXHA 1I3HA 4QPIB 4OHYA 4FPHA 2W3JA 5FYIA 3WP4A 3VZKA 4C1XA 2B39A 1RINA 1OD3A 3WP6A 5HCAA 1VRH2 2WO2A 5T52A 2EVXA 3WUDA 2Y6GA 3K4DA 3ZFGA 2QQMA 2KM2A 2RR11 3CBNA 4Y4YA 5FYHA 4XDQA 3LWCA 3WNOA 2HJIA 3U78A 5FYCA 1SPPA 3T3YA 3ZFGB 4S2GA 2R30A 4K3UA 4LOTA 1UKRA 4CCJA 2WLQA 3AP4A 1SPPB 4D6QA 1OA3A 1FXZA 5I91A 3RI9A 2V5DA 4XBNA 3C7GA 5BNPA 4NHYA 5IFTA 3S7EA 1IKQA 2R6QA 4G3YC 2BJSA 3J8F3 1ULEA 4K6BA 3VDDA 4DUWA 1FOD2 2QQNA 3GCXA 5BNPB 2DURA 2Y34A 5D21A 1R1A3 5T3NA 1OHFA 2ARBA 1RHI3 2PLV3 3KV4A 2GALA 2W87A 1J3QA 2WKKA 4KBBA 1DQ6A 2J1EA 4JCKA 2JD4A 5BXXA 4QU2A 5GZGA 4YZ3A 1BYHA 5FJKA 5LK5A 3WF3A 2LRPA 4Y1VA 5FY7A 1AYN1 1IS5A 2W39A 3B00A 4PJYA 4RR3C 3NJYA 2DFBA 3M1HA 4META 1Y4WA 3SNMA 4Q4W1 1GV9A 1QY4A 1YQ2A 2D7FA 2G1MA 3KHCA 2LUWA 4CSWA 1RUH1 1LU2A 5TSWA 1KJLA 3T09A 5AFEA 1BVP1 1ULGA 2XKOA 5FV3A 3RYRA 3VUOA 2OPWA 2QJVA 5FK7A 4M01A 3HNBM 2ZHLA 3AMMA 3TNPB 1LOCA 4DOUA 2CDOA 1C8M3 3C8XA 4JDOA 4XAEA 4E4DX 3CZJA 1CZVA 2IXKA 3WW2A 3ZFFA 1MEC2 5C4WB 1NA1B 1D0GA 1RUJ1 3KV5A 1TMF3 2EICA 1IQAA 3A0NA 4B1MA 2WA3A 3VBHC 1PZ7A 1SDWA 4FCAA 2XPJA 2D6NA 5A33A 4A3ZA 1JYIA 1W8FA 2JDZA 3FE5A 4S2DA 3VKOA 4BOWA 3U1XA 3RZGA 4NIHA 2DU0A 3CJIA 2RVAA 1AL23 4R9AA 3SEEA 3ZMNA 2A5ZA 3CJIB 4PBPA 2WIIB 1N1TA 1EAH3 1I5ZA 1W2OA 4Q27A 1IPSA 5DDJ1 5L9RA 2WN2A 3OD0A 5FBZA 3ME2A 4CDXA 3U0ZA 2JDYA 3G6JB 2W91A 2CY6A 4D6RA 3AJYA 3R0RA 4CDXB 3BUCA 1HN1A 1AF9A 4UFJA 4YWAA 3D3AA 4LLOA 3E5UA 3ZR6A 4FO9A 1S0CA 4B4QA 4Q0VA 3CMGA 4CCOA 5FZCA 5LATA 1CX4A 5C71A 2Z69A 1O3SA 1E57A 1UMZA 1UYZA 2V72A 2H6BA 2CWMA 1RIRA 5LB6A 3WX5A 3WG2A 4AR2A 3A23A 1LOFC 3KQRA 4QXHA 1X9PA 3N3HA 5JAXA 1JTZX 3U14A 3INAA 4A7ZA 1P8JA 1VRH3 1CVNA 4WVVA 3O1RA 3NL1A 4C1WA 5BNOA 3LF7A 3MGUA 3U37A 1JZ7A 4QQLA 4AVBA 2X29A 3DCQA 3UT0A 1VB2A 3WLUA 5BNOB 5C3QA 3FUQA 5FMOL 4XCAA 5FUIA 2B7YA 1ZZ7A 3NKTA 5JLVA 1W6QA 2B45X 1GFF2 3WINE 4LIUA 1W6QB 1ENXA 1G6NA 4A4AA 4LQRA 5BY5A 5DAQA 1FOD3 1FV2A 4Q1RA 4Q4X2 4CP1A 5FXXA 2WAAA 4HONA 2WABA 2Z42A 5J7MA 2I74A 3WHTA 2LM3A 1HRI2 1I5PA 3M3CA 4KG8A 3PDQA 5CU1A 4HLTA 5H9QA 1NCQA 1H6YA 2R0FA 3NRUA 4FOVA 4D7SA 1S0FA 5EV7A 1NCQB 4MV2A 4IEQA 3VBSA 4AK3A 3WP5A 5F7UA 1DGWX 2Y38A 5JSRA 1OVPA 1W0OA 1VRBA 1R082 4BU2A 1AX1A 4IV1B 4A41A 4H7LA 4OHZA 1NOVA 1RUD1 5K0UA 1WBLA 1OPMA 5FP9A 2RM21 3EYPA 5FY4A 3UL2A 4AE2A 5JOWA 4QB6A 5K0UB 2QZ3A 2VZSA 4KWUA 5F1RA 5F32A 5L36A 5KR7A 1FI2A 1OOPB 3PNAA 1D4M2 2YHJA 4CU6A 2WO1A 3JQWA 2WLPA 4ISRA 4HG6B 4SBVA 4XF0A 1RUF1 4P14A 1UIJA 4YVSA 1YHFA 2VZ3A 5FZ9A 4D3WA 4JAAA 5C9AA 4K8FA 4E27A 3T30A 2BU9A 3JZVA 4YVSB 1LAJA 5LRSA 1UYYA 1MEC3 2VZ1A 4DXSA 1UYPA 2Y33A 2D6PA 4YGCA 2WSUA 3PUSA 2RS11 1Y3TA 1UOFA 5F3GA 5L7OC 3RZZA 5B4NA 2SBAA 2VMEA 3MLLA 3O0XA 1LODA 4QD2A 2WL1A 3ASIA 1YC61 3VBRA 2JG8A 4IEUA 5A7SA 1W9WA 4BK4A 5DZFA 4OYUA 3VBRB 4QWNA 2JG8B 2ADEA 4DUVA 3RPQA 4E9KA 5I0SA 2HEWF 1BMV1 4QGNA 1PO21 4GD4A 1Z0HA 1SACA 4L97A 3K3NA 2ZABA 2ZJCA 2XG3A 3SLIA 4AG4A 1OA4A 3HMYA 1YJKA 3UKNA 5GLZA 5FZEA 1ZNPA 2R041 4XFAA 5JIAA 1HRV2 3TNQA 3MFAA
chains in the Genus database with same CATH topology
1ZBE1 1LGNA 4E2QA 1LHUA 3VDDB 4EN0A 2VVEA 1OA2A 2HEYF 3TB0A 3VBOC 1TME2 2PHFA 1REDA 4AVVA 3KT4A 1POV1 2PTMA 1OLQA 3C2UA 1DBNA 1LHOA 1DG6A 2R32A 2VMHA 1QJY2 1MZ6A 5GZEA 4LHKA 3KS7A 2D40A 1YFYA 4Q4Y1 2BNMA 3SH5A 4LE4A 2X53S 3ZSLA 3M7AA 4RSUA 1KJRA 5KWRA 3CO2A 5CADA 1ZYBA 5SV5A 3CNAA 3ZIWA 2BNNA 5F9TA 1BJQA 1Z7S1 1G9AA 1JUIA 3VZLA 1H2NA 2R49A 5FPXA 5C8WA 3WR0A 1BK1A 4AW7A 4Q8KA 4YZ4A 1R083 4AGRA 1DFQA 1AUYA 1EY2A 3H7JA 2CGNA 1OSGA 1NYWA 3H3UA 3B5LB 3RNSA 1D4M3 4IQPA 1REFA 3OTFA 3LCPA 3O14A 1TEIA 4F83A 1NXMA 1RUE3 2XH6A 2IFRA 1MQTC 3ZXGA 1H2LA 3ZSMA 4FPLA 1Q8SA 1Y7BA 2XJTA 1RC6A 3CEWA 1ZX5A 3L9JT 3A4UA 3LOIA 5EWSA 1VP6A 2VOWA 2JG9C 4AVSA 3ES4A 2GNDA 2QDNA 4RQPC 4Z2WA 4ATFA 5JZGA 2WFF2 3ZYRA 1Q8VA 4QPYA 2ZX4A 2NPIA 1LOAA 3FUOA 5A3MA 1EV11 2JEMA 3ZN5A 2HWB2 2B5HA 3B94A 2E6VA 4QX5A 2VU9A 1RMU2 3MEPA 1SMVA 1HRV3 4AEDA 4J1WA 1N1VA 1LCLA 4Q2FA 4AEDB 2AR6A 4ZU5A 1TME3 4K7JA 5FRAA 3B7MA 2GC3A 4WVWA 1FMD2 3VZJA 1QOTA 4NO4A 5CAZA 1QJY3 1QOSA 3T2TA 3VZMA 1VLNA 4IERA 1VBD2 1ASJ2 3S0MA 1COV2 3H8UA 2R061 4QM9A 2VUAA 4KWJA 2D6MA 2Q30A 4ATEA 1C5HA 3SISA 4LBNA 1MVQA 2WNVC 3AK0A 1DYKA 1RVF1 2ZGTA 3GF6A 4XFFA 2ZGLA 2CWSA 3P3NA 2VW0A 1HDKA 2EXJA 3QCWA 4PDWC 3NAPA 1RITA 1VBC2 5JPMB 3NAPB 3AZZA 4X8PA 2VG9A 1AR61 3CLPA 2BNOA 1QNWA 4AFAA 1LGCA 5T5JA 1SLIA 3VBFA 3QH6A 4QXKA 3VBFB 3D5OA 4PF5A 3PVNA 4HK8A 1OQEA 1CIWA 4CDUA 1KXGA 4YZ5A 2XGXA 4CDUB 1RUNA 2ZAHA 3FLPA 4A7YA 2DU1A 3AMHA 4P9WA 3RDIA 4WM8A 2NLRA 4M0HA 1B35C 4WM8B 3WDXA 4QPIC 2CAUA 4NHKA 4P9LA 4Q0PA 1X8EA 4FXKB 2YV8A 5ACA1 1QJX2 3W59A 1O4TA 2RS32 2N7GA 1RUI1 3TOJA 1H2MA 5F5QA 1SCRA 2RJKA 2XWJB 2VGDA 4NWWA 3ZFGC 4GMP1 3R4SA 3ZSKA 1HW5A 1PMIA 2FMDA 2KA3A 3HT1A 3ATGA 5F6KA 1RMU3 3WQ1A 3WW3A 4K1ZA 4CDQA 3KM5A 4CDQB 1LHVA 4N9HA 1BEV1 2VH9A 1VBE1 2VW1A 3POYA 4FAHA 4YW2A 1AR82 1MACA 1YNAA 2DCYA 4JDMA 1OQ1A 4FTBA 1FMD3 1YIPA 1ZREA 4IEZA 4URTA 5AVPA 3M8LA 1QKQA 3QLQA 1VBD3 2E9QA 1ASJ3 1COV3 1LU1A 2JXAA 1NY72 4L2NA 4COZA 1XE7A 1D2QA 2OZJA 3AYEA 1DQ4A 4JTNA 4I2OA 3GHNA 2BQPA 4COYA 1F2NA 1C1LA 4Q4V2 5CFDA 4RA0A 4MXVA 1HV0A 4AI1A 4H3WA 4BH9A 4AQSA 4YW1A 4MGIE 5CFDB 4OI0A 2BYVE 1V9U1 3H1MA 2LALA 1SLCA 4B7EA 1VBC3 5CVRA 2HWF2 2GN3A 4XFCA 5CFCA 3ZFFC 2B42B 2P3KA 1LOGA 3L2YA 5CFCB 1JBCA 4MGYE 4LO7A 5CIRA 1KS4A 1SBEA 4LTAA 2GH2A 3JB4C 1D0HA 4XJAA 3MIBA 1F8VA 3WDYA 4MZUA 4BHPA 3N7MA 5LEJA 5B2GB 4XJWA 4CDXC 2WZR1 1DIWA 1VBA2 1WUVA 2DUOA 4AFCA 2W08A 4OI2A 2V09A 1GANA 1U5ZA 2PHWA 2V5YA 4YSFA 1YFXA 4LA2A 4RHV2 3NV2A 1DLLA 5EFUA 4PLNA 1QJX3 3M3OA 2RS33 4QQPA 4EWDA 3IDCB 3TN92 5BNOC 5KHHA 1U5XA 4G9SB 1DZTA 2PHRA 2CGPA 4L11A 5JDBA 2EAAA 1JHNA 1S2BA 3IKWA 1LJ7A 1GQHA 1QJU1 4TLFA 4A2UA 1V00A 2EXKA 1HXS1 3NWKA 4I30A 4B29A 2PLV1 5HCFA 1J1LA 3TYJA 3WDWA 1ZM1A 2FMYA 1AR83 4FOQA 4PCRA 1BBT2 1UCXA 2QE3A 2R1DA 5CBLA 4EWEA 5JSPA 2XJQA 5J36A 3AMPA 1OMIA 2AENA 2QQPA 1NCQC 2X5IC 4RQPA 2JG9B 2P3JA 3MF9A 3G7DA 4TSVA 1SFYA 2VVFA 4RQPB 2RS52 3VBSC 1WA4A 3I7DA 4XF3A 2ZTNA 3AMNA 2YXSA 2EXIA 4HSJA 1O5UA 5K0UC 3HWJA 1R091 2ZGKA 1MS3A 4Q4V3 4WZCA 1LTEA 2GNMA 3J8F2 1C8M1 3W9AA 1JN2P 1PNGA 1R1A2 4UW6A 3VKLA 4LUMA 2GZWA 1RHI2 1TMF1 1ZBA2 2HWE2 4ASMB 2HWF3 4OI4A 5C9AC 2Q4SA 1H9PA 4PLMA 3D82A 1AL21 4XBQA 2Z5WA 2VMGA 2ZBJA 1EAH1 2PHDA 2WS92 3AZXA 2QCSB 2XJSA 1Q8PA 1RUC2 2XVLA 1WBFA 2BEOA 3MF6A 4XFBA 2JG8C 5DXDA 1GYKA 1RTVA 4NN0A 4KH9A 2RJLA 3DPRC 1VBA3 3POSA 3DGTA 3PMSA 2Z79A 4MVTA 4YNIA 3GBWA 4Q1PA 5AC91 4JVAA 2D3PA 4J1XA 2WNUA 1V6MA 3WQ7A 4IEWA 3VDDC 1IPJA 1C4RA 2VQ0A 2WNUB 1HKDA 2Z2SB 1PVC1 4FQZA 3R4DB 4MX3A 1UKGA 4LHNA 4N43C 3LAGA 1X36A 3JD72 4HVQA 2BFUL 1FOD1 4QQHA 3UKVA 5JI9A 1J3RA 1MZFA 4DS0A 1H1MA 1C8NA 3IPVA 4H7MA 4N7IA 1V6KA 2WQZC 1BBT3 3IPVB 4CEWA 1PGW1 1YYNA 1RJ8A 5KXEA 4HFSA 4CEWB 4NVPA 4DZGA 1PM7A 3KCYA 1JH5A 3VHRA 3VL8A 3PTYA 5CB7A 2RS53 2OA2A 4RFT0 1ZVFA 2YGMA 1WW6A 4ZU4A 5D1IA 3TAYA 1QH6A 3O7OA 5A3LA 1XE8A 3AKSA 2WZPP 4ITCA 2MEV2 4GWNA 4P9YA 2P37A 1A78A 1C28A 1F5FA 1MEC1 2Q1MA 3U10A 1OQDA 1ZBA3 2HWE3 3K48A 4XTPA 3WDTA 3LB9A 5JOXA 3AMQA 1AR73 3WV6A 3KB5A 4E2SA 3B93A 1GNZA 5E16A 1Q43A 4XHBA 3ZYPA 5AVAA 3OD4A 1U5YA 2R072 3KLSA 1D4VB 4LT5A 1W39A 1LHNA 2WS93 3OYWA 4OVEA 1RUC3 2DVBA 4FBFA 3OYWB 4YYOA 2VNGA 1BVVA 3WD5A 4YLZA 4MSVA 1Q5OA 3NJZA 2GC0A 4HMZA 2PELA 1CPNA 1DQ2A 5JZGC 5BPXA 1V6JA 3AKPA 1N1YA 4GKXA 3H3ZA 3MIFA 4NPRA 5HXVA 5FDBA 1WMDA 3KSCA 1XNDA 3ZFFB 3HQXA 4AEDC 1G9DA 2XLAA 5KBFA 2NMOA 3UJQA 2VW2A 4DRVA 2DUPA 3MIDA 4LBKA 2F6BA 4XW3A 1ULDA 1S55A 1K5MA 5A33B 1AJOA 1YWKA 2F4PA 1FV3A 1K5MB 4Z07A 1ZZ6A 4RD7A 2ZZQA 3JD73 4PBOA 4L92A 1X7NA 4Q4X1 3USSA 4F7ZA 5CG9A 3RYPA 4IV3A 1GZ9A 2ERFA 2XLFA 2ETEA 4IV3B 1HRI1 3UK9A 3GNEA 3ZN6A 1LOEA 5FOJB 3S6PA 1AYM2 4V1PA 3N36A 3ZN6B 5JWPA 5GZDA 1AYN2 3ZX7A 1VALA 2O8OA 2ZOEB 2D3RA 1Z78A 1VBB2 4CDWA 4INDA 4JC1A 1MZEA 4YG3A 1R081 3I2DA 3NAPC 4CDWB 2HWD1 1OD5A 1J1TA 5JCTA 3IM0A 4C0HA 5K7PA 2A6VA 4OUSA 2VOXA 3VBFC 1D4M1 4AVAA 2GN7A 4GB31 5T55A 2MEV3 1UIKA 3ZXAC 4BIOA 5FCCA 4FTSA 4JQRA 4BE3A 4CDUC 4B4RA 3SCHA 5CNAA 2A6WA 4AI3A 2CAVA 1XQNA 2JECA 3ILFA 5K9YA 1QQP2 1ENRA 4RGGA 4XZPA 4I02A 2X5IA 2GDFA 5KXCA 1LOBA 4LBQA 4WM8C 2R073 2X5IB 3N7JA 4LBQB 5EJ3A 3SITA 4Q8LA 3MPBA 3VBSB 1MS1A 3QBQA 4IEOA 4C91A 2D93A 2UWAA 1Q8QA 3OCPA 5KC5A 1PO11 1FX5A 1PGL2 1RUOA 1M06G 1HRV1 5EYXA 4P9IA 1UPIA 4LR4A 3KGZA 4NOTA 1IGOA 1RUE2 4PIYA 5C9AB 3RJRA 2D43A 4CDQC 1TME1 4HKOA 2UWBA 4XTMA 1XYNA 2UYBA 2YPJA 2JICA 1NE4A 3JCIA 4EN7B 3MI8A 2ZS6B 4GWMA 3DUIA 1SLAA 4YM0A 2OYZA 3MLJA 1IKPA 3EBRA 5FOBB 3QOPA 1QMJA 1SLTA 3DPRA 3E6DA 3H50A 3Q9OA 5EZWA 1GBGA 2EA7A 4Y5Z0 3DPRB 3U11A 4GA9A 1MVEA 2EALA 4Y22A 1NQJA 2D6LX 4Y22B 1YO8A 1LHWA 3WOGA 2P3IA 1AYM3 2ZGNA 4K40A 1ALYA 1H1IA 5CFDC 4XMIA 5ABJA 1AYN3 1Y9QA 1IOAA 1D2SA 3RSJA 3WG3A 1YLLA 5FLHA 2GH8A 1VBB3 2QFEA 2K0GA 2IXIA 1N3OA 5E89A 2VY0A 5CFCC 2RM22 3RRDA 5IK8A 3SCFA 3NV1A 4N43A 1UL9A 1MS5A 4JRAA 2EF6A 4N53A 4D94A 4N43B 4FOWA 4ZU7A 4N53B 2ZGUA 1RUF2 2XJUA 3MYXA 2E7TA 4EN9B 5I8TA 2QVSB 5H9PA 3EJKA 4PIZA 1SEFA 4YG6A 4D7TA 1ENQA 5C8CA 3RJ2X 1AR92 1QQP3 4R52A 1CQ9A 1VR3A 3CF6E 4XOGA 4HETA 3ZVXA 5C8CB 4AI8A 4JV4A 4AVCA 3NV3A 2R0HA 2AREA 4RS5A 1GLHA 2TNFA 4RS5B 5DUVA 1C1FA 5DDJ3 4N9IA 2ZHKA 3V56A 3GZUC 5KHJA 1DDLA 2OUHA 2BUKA 4KWLA 2XL9A 4O9EA 2WFF1 3K51A 3AYAA 1CONA 4DMIA 2HWB1 5BV6A 1VAKA 2NYYA 1S0DA 2R042 4FPGA 3HD8B 1LECA 2R16A 4WVMA 3JBG1 5L73A 2Q8OA 3THPA 4WVMB 1SBDA 2JX9A 3M3EA 3VN4A 4JRLA 3T1LA 1FMD1 2R1BA 1J3PA 2OIIA 5FREA 4K1YA 2WNEA 3ZYJB 3QD6A 1VAMA 3DN7A 3ZFEA 3X29B 4LULA 3VKMA 2GAUA 1ASJ1 1NE6A 3ZFEB 1COV1 1H9WA 1O7FA 1KFXL 4GH4A 3LSEA 1WGPA 1Q3EA 4LO4B 4GH4B 3AKRA 4YW4A 5JZGB 2A3XA 1OKQA 2CNAA 3NKGA 2A75A 3WDUA 3NVCA 2ES3A 4I0AA 4CP0A 1G8WA 2RHPA 1XYOA 3MZHA 1VBC1 1LKNA 3I59A 1WD4A 4M00A 2P17A 2OW4A 2AGSA 3I59B 4IEPA 4H55A 1H0BA 5HCBA 2RM23 1FAYA 4Y1XA 4AEJA 3GYDA 1ULFA 1IPKA 1WW4A 2YGLA 2YY1A 4P5HA 3URFA 4IESA 1YI9A 1W6PA 1W0PA 1KITA 1W6PB 1UF2C 1RUF3 4BLIA 3A0KA 4FPFA 4IL7A 5E1RA 2JJ6A 3WXPA 1G7YA 4GKYA 1O91A 2GSYA 1AR93 2O0OA 5DG1A 2BFUS 2AUYA 1H8VA 3V64A 4AHWA 1PNFA 4XQWA 2GMPA 3JB8A 3IIAA 1YIFA 2RMU2 4R9CA 4WM7A 3BODA 3I8TA 1H8TC 1QJX1 4WM7B 2RS31 2UYAA 4UBGA 4FPCA 1BQPA 1OI6A 1YFUA 2WNUC 4CEYA 4DB5A 2ZACA 1PO23 1ZA4A 1LEDA 3EXUA 1QGLA 1B09A 4AFBA 1FPN2 1O4YA 1RUG2 4TZDA 1EV12 2IC1A 3AP7A 3BIWE 4FSJA 2R043 1FATA 5BYNA 1ZBE3 4Y26A 3VLBB 4ONUA 4XPVA 4ES8A 3EO6A 4OHWA 1AR81 3PJYA 3LZZA 3MICA 2FHRA 3AX4A 5JR7B 4KL1A 3LSDA 5D8AA 2DVFA 4L8QA 4CEWC 1DGLA 1JW6A 2P34A 5IK7A 1U12A 5JOYA 2R062 3WY6A 4Q4Y3 1NY71 3B01A 2YMZA 4KG0A 4XFGA 2ENRA 4XJ9A 3WW4A 1AX0A 1AXYA 1NCRA 2PN5A 4Q4V1 1YXWA 1RVF2 2A3YA 4XE9A 1Z7S3 4HT1T 5C33A 4HN0A 1OPOA 3ZXFA 5GLTA 4YM1A 2ZGRA 2EIGA 5JPNB 3CU7A 1QWRA 1XNBA 3FX3A 1W6OA 4FAGA 5FO8B 3RI8A 1W6OB 2GMMA 4B4PA 4Y1YA 4BMEA 3GALA 4HVOA 2AZ5A 4DRRA 2ARXA 2C9AA 2ZA9A 3B3QE 5IK4A 4XF9A 5JVVA 3BALA 2QNKA 1XYPA 1ZRDA 1URXA 2QDRA 1CAXA 1GZCA 2DTWA 3M2MA 4MLOA 1XXNA 4Y24A 4LO8A 1CAXB 3R6SA 4WBBA 3OJBA 1PK6A 3BTAA 1GKBA 4IEXA 4RHV1 4YW5A 2RMU3 2YC0A 1PK6B 2UWCA 2FZ1A 2VMIA 3PVBB 2PFWA 1Y43B 2GU9A 2IXJA 1JXNA 4LHLA 3TN91 4XF4A 3UJOA 4BMBA 2Q0AA 3EQEA 1KD7A 3BU7A 1AZDA 2H0VA 1FPN3 1RUG3 1K5MC 1EV13 5CG8A 3SMHA 1VIWB 3AXEA 3C3VA 4UXAA 4AFMA 1KRIA 3VGIA 1FNZA 2MHFA 1UAIA 2DVDA 3O12A 1LESA 4CRQA 3AZVA 1NLSA 1BBT1 4IV3C 4YM2A 1W6NA 2PAEA 5BUVA 3RMXA 3BCWA 5GLWA 1MS8A 1W6NB 3MLKA 1AXZA 1S2KA 4M3CA 2RS51 2R063 1A8DA 3GZAA 2VVDA 3H0OA 4JGZA 4CDWC 4BYYA 1HV1A 4OFGA 3KMHA 1OFSA 4JGZB 4BIFA 1ZZBA 3WW1A 3AXDA 2YDEA 1HQLA 3H1WA 3LGRA 4LLFA 4MH0E 3FC0A 1RVF3 2PHTA 3J8F1 1U0AA 4LO5B 1IHMA 4Z82A 1R1A1 1W6MA 2HWC2 5DUWA 2XBO2 1RHI1 1ZBA1 2HWE1 4J6GA 4ASLA 5JI7A 1IS4A 4KU8A 4ISQA 2A3WA 1UZYA 3ZXEA 3B69A 1CR7A 2Y0IA 5KHGA 2WS91 1ONAA 2WT0A 5J96B 2O8QA 4Q0UA 1YI7A 1QOOA 5J37A 4YGDA 1WLTA 3ZYIB 2MPFA 3AP6A 3BB6A 4QQ2A 5GLVA 3HT2A 1UN1A 1FT9A 1QXRA 2XVKA 1PIV2 2I45A 1DGRN 2YZ4A 3PLQA 4EN8B 2ZX0A 4XFHA 4LBLA 4U2AA 1I1EA 4P9XA 4BPZA 3HR9A 1PVXA 1AR72 3AM2A 4A7KA 1TNFA 2A6YA 1C5IA 4XJUA 3WVJA 1NG0A 3RWNA 1F31A 4OHXA 4K21A 4EN6B 1CJDA 4B8EA 3GZTB 3JD71 1QJU2 2ET1A 2OUJA 3AJZA 4FPOB 3S7IA 2HEVF 5T5PA 2TEPA 3KT1A 1KFUL 1ZZ8A 3WCSA 4XYXA 2DCTA 3VV1A 1H8TA 4AI0A 3O5SA 4G4FA 4WZFA 2JENA 4KQ7A 1H8TB 2VUJA 1VRH1 3PVOA 3V0AA 1JYCA 1W2UA 4NHMA 4YGBA 5ABJC 2CYFA 3V0AB 2CTVA 3ILNA 2XUMA 4YARA 2JE9A 3V65A 1XNKA 4QM8A 2D3SA 3ELNA 3AB0A 1QF3A 3IN9A 3KCCA 1H4HA 5C6CA 2WA4A 4AF9A 4AGGA 1R092 2C0ZA 3FLRA 4FPYA 3WHUA 3QACA 2MEV1 2P2KA 4N53C 4XQDA 3FJSA 1DZQA 4FQ4A 1S1AA 4XQ4A 5DUXA 2HWC3 1N3QA 2XBO3 2A6XA 1ZRFA 4M0NA 3OF1A 1ULCA 1O4ZA 1BZWA 2BWAA 3J9SA 5C8CC 2QKDA 3NSTA 5GKAC 3OPZA 5E88A 3FHIB 2R071 2NN8A 4XMAA 2ILMA 3PMEA 4W6XA 4RS5C 4LBJA 3USUA 4B3NA 3ZN4A 4X8NA 4FPJA 3ILRA 3E6CC 4LBOA 1J58A 1POV0 3PHMA 3LA3A 4AXOA 3JU9A 1PIV3 2DVGA 2QZ2A 1O3RA 3AKTA 1UX6A 2DFCA 5AC92 3UV9A 4I01A 3PJQA 4ES9A 2GC1A 5LRRA 4AVTA 4XHXA 3GBGA 4P9GA 4OULA 1LR5A 1V70A 3E6BA 3SHRA 1PVC2 5A32A 4Y20A 3D6EA 1ENSA 4HSLA 5A32B 3FLTA 4Y20B 2O1QA 3FFZA 4GXLA 3ZFEC 4Z1VA 1QJU3 2I07B 3LKJA 2D97A 4YFWA 4OLLA 1HXS3 2B9UA 4GH4C 4E4ZA 3J26N 1GSLA 4S2HA 4GQ7A 3KCXA 3MIHA 3EHKA 1QNYA 1PGW2 1AYM1 2D98A 2BVBA 2AYHA 3M3IA 1VBB1 2OVUA 3D0SA 1S0GA 3SH4A 1GR3A 2GNBA 2RR12 3UKTA 2VPVA 2I2SA 1WCSA 1R1ZA 1H2KA 2XB6C 3FWEA 1I6XA 1R093 5C4WA 2H6CA 1NA1A 3AYCA 4SLIA 1GICA 4M3CF 4CP2A 2TUNA 2BGCA 5H9SA 1QQP1 2ZKNA 2CV6A 4XJ8A 1YJLA 4HBNA 1NQDA 1NLRA 3HAGA 4LUKA 3D4KA 3QH7A 4P9JA 5T54A 1H1AA 1I9RA 5DG2A 5DZEA 1ND2A 1V6LA 4Q4W2 4WM7C