4BM8A

Galectin-3c in complex with bisamido-thiogalactoside derivate 3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
ALIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords GALECTIN-3
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bm8A00
3AP5A 1U0AA 3FUQA 4BMEA 2P3IA 1F5FA 4XMIA 4Q27A 3D5OA 1CR7A 1ENSA 1V6MA 3WV6A 4BLIA 4YFZA 2ZGLA 4FVVA 4K20A 1C57A 1LOCA 1CPMA 3N35A 1S0CA 1W6NB 1MZ5A 2GN3A 3AP6A 1GKBA 2P3KA 5T52A 1Q8VA 4XIKA 1Q8SA 5F5QA 3V65A 1SBEA 4JRAA 3D6EA 4XJWA 4Y1YA 2D6MA 2NZ9A 1EPWA 1MS4A 2Z42A 4YZ5A 3B01A 3OY8B 1DQ1A 3N7LA 1BZWA 1YYNA 2WSVA 5H9SA 3WZ1A 1ENQA 3WCSA 3T2TA 1G9AA 1FNYA 3O0XA 1ULDA 3MW4A 3RMXA 1MS1A 1WLDA 3AZZA 4XE9A 3RQ0A 2JD4A 1LU2A 1DQ4A 1OKQA 4GKYA 5JMCA 4Y1ZA 3PJQA 2ZGQA 1V6JA 1AX2A 4M3CA 5HCBA 4I30A 5F9TA 5AVAA 3WG1A 2CYFA 3FLRA 3M3QA 3JUUA 1TEIA 3IPVB 1GZ9A 4R9CA 4AGRA 4BOWA 1WBFA 1O4ZA 3FBYA 1SLBA 3HN1A 4Y22B 1WW5A 1CESA 1N1TA 1DBNA 2R1BA 1W6MB 3MW2A 3WHUA 1QU0A 1FV3A 4JC1A 2DU0A 3WCRA 2DVFA 3ASIA 1H9PA 1QMJA 2JKBA 4FPEA 2ZA9A 5T50A 2A3WA 4XYXA 5DG2A 5EXOA 4YGCA 3T1MA 2GNBA 2R1DA 3POSA 2DTYA 1V00A 3N7KA 3VKNA 3WUCA 3WDYA 2A6XA 4R9DA 2XG3A 4LBQD 1UMZA 2ZHMA 3I8TA 1DHKB 3USUA 1HQLA 2V73A 2ARBA 2P2KA 3APBA 1V6LA 1IS5A 3ZYPA 1S0EA 2YZ4A 2P37A 4DPNA 1S1AA 4FPHA 3A4UA 1GNZA 1JW6A 4FPYA 3WDUA 3IN9A 4RL7A 1GNHA 1UX6A 4YM2A 4TYSA 4XILA 3SH4A 5IK4A 4YGEA 2WLQA 5BYNA 4UW6A 3FUOA 3ZPYA 2E7TA 2P34A 3M3CA 3AYCA 2R0HA 3ZYRA 1MS8A 2DUOA 1LJ7A 4XXPA 1DZQA 4FPCA 4P9WA 5CB7A 4BLJA 1F9KA 1PZ8A 1MS5A 1R1ZA 5JOWA 1IKQA 3PVEA 5GZCA 1LHNA 1CONA 3ZXKA 4Y20A 2GMPA 1DQ6A 2ARXA 1H9WA 3R4SA 3ZSLA 4AGGA 4DS0A 1KDMA 3AJYA 1LULA 1N47A 3W58A 2WNEA 1G9CA 4YM1A 2OVUA 1GSLA 1ZA4A 3JU9A 2GMMA 1KITA 4FQ4A 3TB0A 1HKDA 4FP2A 2UU8A 1LOFC 2ZGRA 3ZSMA 1WW4A 2E7QA 1QNWA 1LGNA 2NYYA 3IKWA 4K21A 1MS9A 1UZYA 2AREA 3NV4A 1W6QA 1WLCA 2VY0A 4YG0A 2UWAA 2UWBA 3HMYA 3R05A 5E88A 2EIGA 2PHRA 2R49A 2D6NA 1AXZA 1OFSA 2A6YA 1N3PA 2DVDA 1MVQA 2FHRA 2PELA 4WVWA 4YG6A 2ZAAA 3RS6A 5EYYA 5EWSA 1W0OA 5H9RA 1VIWB 2ZGNA 1YI7A 3OBRA 4ITCA 4YW4A 4L8QA 4MYEA 1AJKA 3AYAA 3ILRA 4YW3A 1N3QA 3ILFA 4TZDA 1HQWA 4FP3A 4M3CF 1AJOA 4H55A 4P9XA 3M3EA 1Z78A 1YXWA 2JE7A 5T5JA 4Y22A 2B7YA 2YY1A 2CWMA 4XBQA 4ATFA 2DV9A 2ZZJA 1LGBA 3AX4A 2VW1A 3H0OA 1LESA 3AZWA 2NP0A 1ULEA 3B69A 4ZKTB 2UWCA 1CJPA 2PHWA 3N7MA 3V0BA 1AXYA 3T1LA 4FOVA 4W65A 4Y24A 2ZMKA 3O0VA 5IK8A 4XJZA 4XBLA 3NV1A 2CTVA 2ENRA 4BPZA 4FPKA 2ZHLA 4FOWA 2P3JA 1CPNA 2GMEA 3AZYA 4AVSA 1GYKA 2SBAA 3OY8A 5KXDA 3BOPA 1N1VA 2ZGOA 4YG3A 1FX5A 2PHXA 3A0NA 1JXNA 3WNXA 1Y7BA 3UK9A 1AX0A 1MACA 3AP4A 3AZVA 3PVOA 4BM8A 1RINA 1VAMA 1QOTA 2EAKA 1HLCA 5SV8A 5KXCA 2JE9A 2A3XA 2D7FA 1LOAA 2DVAA 2ZGKA 4PCRA 4XJ8A 4NO4A 1PZ7A 5DUWA 1O4YA 2WKKA 1S0JA 3LCPA 1V6IA 2D6KA 2FMDA 2ZABA 5GLVA 5T55A 3SITA 2A5ZA 4YW5A 2GALA 1I3HA 2ZKNA 1LGCA 1C4RA 2D6LX 3I4IA 5H9PA 1IS6A 4XIOA 1BKZA 5KXEA 3FLTA 4ISQA 1AZDA 1W6OB 4SLIA 1FATA 2RHPA 2ZGTA 1DGLA 4JCKA 4XXAA 1W6QB 1A3KA 1JYCA 1JYIA 4NOTA 4ZXKA 2NM1A 4FPJA 2JDZA 1JUIA 1ULFA 1KDKA 1SLCA 5DZGA 1DQ0A 3RRDA 4Q8KA 4U36A 2ZGPA 1YO8A 3AYDA 4K1ZA 5DZEA 1LU1A 2PHUA 3R4UA 4XJAA 3AJZA 4Y1XA 1BXHA 2ZGUA 2VU9A 1Q8QA 1LHWA 3VKLA 4XBNA 1B09A 4CRQA 5GLTA 2DU1A 1Q8OA 3ZXJA 5L73A 1WW7A 1YIFA 3USUB 4Y1UA 2G4IA 4GKXA 2WT1A 4FQZA 3IMNA 1LOGA 4AVTA 4XJ9A 5DUVA 2ZMLA 2CNAA 2LTNA 1A78A 1I1EA 2VXRA 1V6KA 2EXJA 2GNDA 4KBBA 3WLUA 3GNEA 3QCWA 2GN7A 1KRIA 2AR6A 1AF9A 4C1WA 5CBLA 1MR5A 2DVGA 2ZHNA 5H9QA 3ZSKA 1FNZA 1D2SA 4Q8LA 3ZXEA 1OQ1A 2A70A 5JOZA 1QOSA 4HANA 2TEPA 4R9AA 4XTMA 4HL0A 2BQPA 2WSUA 3N3HA 1DQ2A 2R0FA 3ATGA 1Q8PA 3MPPG 3SH5A 1UN1A 4C1XA 4GALA 1MS3A 2LALA 2Q5TA 2C5DA 4M3CB 1SCSA 1W6PA 2R16A 1WLWA 3HR9A 3V64A 3U4XA 1UPSA 4PBPA 4Z8BA 3KM5A 1KQRA 3B9CA 4GXLA 1F31A 1QF3A 3WVJA 4WVVA 4YW2A 4U2AA 4XTPA 3ZSJA 5HCFA 3MEPA 1N1SA 3M3OA 2A6WA 2YXSA 4P14A 3WDTA 2EXIA 5DG1A 3O12A 2DURA 3N7JA 4DRVA 1GBGA 1Z0HA 3B00A 4XMAA 1JN2P 2WT2A 1W6PB 1LHUA 1DLLA 1SFYA 1LHOA 1APNA 1IOAA 2DTWA 2ERFA 4RA0A 4FPGA 2A75A 3N36A 3V0BB 4GWMA 1IKPA 3BTAA 1V6OA 2D3SA 2VH9A 1GZWA 5E8AA 4LBJA 1XQNA 4LBMA 4DFSA 3DGTA 1QKQA 1S0GA 2JECA 2AGSA 1NXD1 4YW1A 1G7YA 2EF6A 5JDBA 3AP9A 4ATEA 1W6MA 2GNTA 1N3OA 1DFQA 4YLZA 3VUOA 2H0BA 3C2UA 5IK7A 4LBKA 2GNMA 4YZ2A 2DYCA 2ZHKA 1DYKA 2YROA 4GWNA 1FYUA 1CIWA 3FFZA 4UW3A 1W6OA 5T5LA 5KXBA 2OUHA 5GJ6A 2ZGMA 1MS0A 3IM0A 2GDFA 1WUVA 4LBOA 4XDQA 1C1FA 4FPLA 1UKGA 3O0WA 1GZWB 3NV2A 2DVBA 3UJOA 2UURA 1LEDA 4LBQA 3KQRA 1JBCA 1N1YA 2ZMNA 5CNAA 2EXHA 2EXKA 2PHTA 4UW4A 4XOGA 2W68A 5GLUA 1GANA 5CAZA 4PBOA 3A0KA 2DUPA 2WQZC 1PZ9A 3POYA 1KJLA 1S0DA 4Y26A 5IK5A 3M2MA 2VUAA 4LBNA 4FOYA 1GICA 5T54A 5EYXA 5CA6A 2D3PA 1GV9A 4M3CE 1AXKA 1LOFA 1UAIA 4WV8A 1LTEA 2ZBJA 2VW0A 4K1YA 3VKOA 1WBLA 2AENA 1SBFA 4ISRA 4XZPA 4DRRA 4LBQB 4DQAA 3BIWE 3FLPA 4R9BA 3V0AB 1CN1A 1V6NA 5GZFA 5DZFA 4PQ9A 3VV1A 5IUQA 5GZEA 3RG0A 1MZ6A 4PF5A 1HDKA 2VW2A 2E6VA 1G86A 1ULGA 3RMYA 2W39A 2YV8A 3OYWB 3IPVA 1LCLA 1SBDA 1J1TA 1YRZA 2OW4A 4OZXA 2C9AA 4P9YA 3LSDA 5T5OA 1S0FA 5HCAA 3UJQA 2JJ6A 3WG3A 3WUDA 1RIRA 3Q9OA 2E51A 2DWRA 1SLLA 4IQPA 5GLZA 3WDVA 4AGVA 2D6OX 3WG2A 4YZ1A 3V0AA 1UL9A 4F83A 1LOEA 2PHFA 1W0PA 3L2YA 3O5SA 3AZXA 3W59A 1GLHA 1H30A 3M1HA 4Q2FA 1AX1A 3OGGA 1CVNA 5DUXA 5DUUA 1C1LA 3ILNA 3OYWA 3CNAA 4M00A 3QLQA 3OBTA 4BQ1A 3NWKA 3BODA 2AYHA 1URXA 3TAYA 3LSEA 4Q1RA 1S0IA 5JOYA 2D43A 3INAA 3GALA 4YZ4A 1VALA 3AP7A 4YFWA 3SISA 4AVVA 1DQ5A 1SACA 5GALA 1AVBA 1ZM1A 4AWDA 2YMZA 3AFKA 1FV2A 4FOQA 1QDCA 1LHVA 1LODA 1GZCA 1QDOA 2SLIA 1ULCA 4Y20B 1LOBA 1RITA 3WDWA 1CQ9A 4FPFA 1FAYA 1D0HA 3ZVXA 3ENRA 4XJUA 1ENRA 3POWA 2A6ZA 4YZ3A 2I2SA 2CL2A 5GZGA 1A8DA 1S0BA 3D4KA 3ZXLA 3PMEA 2NMOA 4XHBA 1UZZA 2WJSA 1BQPA 1Q56A 4D69A 3RSJA 3VKFC 4M01A 1JOJA 2DUQA 4YM0A 1IS3A 1G9FA 3VKMA 1IS4A 5FRAA 2A7AA 3AXDA 4CTEA 3WG4A 2AH2A 2A3YA 1ONAA 4YGDA 1QGLA 1VAVA 2ZACA 4Q26A 1QNYA 1SLTA 3DUIA 4BMBA 2ES3A 4AYUA 5JVVA 3WOGA 2HYKA 3AXEA 1WD3A 4GA9A 3NV3A 2A6VA 4XHXA 1WW6A 3ZXFA 5JOXA 3WDXA 2ZGSA 4Y1VA 3SLIA 4YM3A 1WD4A 1SCRA 1LECA 4FPOB 2NN8A 2W52A 4LBLA 2XB6C 1BJQA 5E89A 1DIWA 3SNMA 1JHNA 5DXDA 1QOOA 1NLSA 2D44A 1SLAA 1VLNA 1MVEA 5T5PA 5FREA 3B3QE 3WHTA 2W08A 4WZFA 1G9BA 5GM0A 1SLIA 2E53A 3AK0A 2KM2A 1LENA 3MW3A 3UL2A 2EALA 2NMNA 1LEMA 4CZSA 1BYHA 1W6NA 2D3RA 4YGBA 2CY6A 1G9DA 2A71A 1DYPA 5JLVA 5IT6A 1WCSA 3PVNA 2OUJA 1G8WA 2D6PA 5LK5A 4Q1PA 1KJRA 4ASMB 4UW5A 3OPZA 2AUYA 1X50A 5GLWA 3SH3A 3AYEA 3OJBA 5GZDA 2V5YA 2CWSA 2WT0A
chains in the Genus database with same CATH superfamily
1JZ6A 1U0AA 4B8EA 4I02A 1LKNA 2IWGB 1PVC2 2B45X 2O8QA 5A7NA 3B7MA 1ENSA 1YHFA 2YGMA 5BNNB 1U5ZA 4K20A 5EJZB 4BE3A 5J7MA 3TYJA 4K3UA 1CPMA 3IAPA 4AZZA 3N35A 4EN7B 1D4M2 2OPWA 1W6NB 2VZVA 1JZ3A 2ZXQA 1MZ5A 4OZOA 1GKBA 3ZN6B 4AOCA 3VD7A 3I2JA 3Q8BA 5FKCA 1Q8SA 4GMP1 1SBEA 3ECQA 1HV1A 3J8F2 3POEA 4QDQA 1ZBE2 3HQRA 3VBOA 3VBFA 5L7OB 3N4MA 4EN6B 5HXVA 2ORZA 3T2QA 3N7LA 1BZWA 2AZ5A 1YYNA 3H3LA 5A3MA 4IESA 2DDUA 4LUMA 5A70A 3ES4A 1W06A 4GKYA 1OKQA 4AEDB 4Y1ZA 1YCIA 2QQIA 1UOBA 3VBRB 5FLJA 1AX2A 1J58A 1C8M3 4CP9A 3HN3A 4OULA 2XBO1 3M3QA 4KG0A 4DMIA 4Q4W3 3FHAA 3IPVB 3WP5A 1UZWA 2WNUA 4MXWB 4CA9A 3ABZA 2XMLA 4WM8B 4WM7B 2B42B 4L92A 3TRSB 3ZN4A 3S5AA 3POFA 3WCRA 1AR73 1D4VB 2JDUA 5JPNB 2ZZQA 1AR63 2JG8B 3PL0A 2A1XA 1AYM1 3K3NA 3K2OA 1AR72 2CHHA 2GNBA 1OUXA 2WYSA 4MG2A 2I74A 5J1XA 3POSA 3WP6A 5FTTC 4B29A 3I8TA 4Q4W2 2VOTA 1VBE1 2HBTA 2V73A 3ZN6A 1TNRA 1GR3A 5FZMA 3ZM8A 1NQDA 3K48A 1HB3A 3B9IA 3APBA 4AAXA 3ZXAC 1IS5A 2ZTNA 5LA1A 1PVC1 1WCDJ 4FPHA 1JW6A 1U12A 3LGRA 3IN9A 4QGLA 2XUEA 4AFAA 2VZRA 3KGLA 5EPAA 3SH4A 4Y5TA 3MLJA 2E7TA 4BK4A 1O8PA 3M3CA 1M06G 2VVFA 2R0HA 4YVSA 2A73B 5TSWA 3ZYRA 4PI2A 4XXPA 1DZQA 3WR0A 5CB7A 1PNGA 1F9KA 1R1ZA 4LUKA 3KT1A 4QKFA 1AYN2 2JX9A 5APAA 1VBD3 4NWVA 2GMPA 3GF6A 1S2EA 3KSCA 3MIHA 3PTRB 3ZSLA 5LATA 1N47A 1L7RA 1UNBA 3I59B 3DV8A 4IGPA 2VOWA 1OA4A 1ZZ6A 1NE4A 5IVCA 2VMCA 4S2FA 4XABA 4IEYA 1O3QA 4FQ4A 2VTFA 4M4RA 5FZHA 1NOVA 1HKDA 4FP2A 2UU8A 2ZEYA 5IJRA 4CUAA 2X5IA 2UY8A 2RJ2A 3ZSMA 2CSGA 4CU8A 1W9YA 3WQ0A 1JH5A 4RYDA 1LGNA 2NYYA 3H50A 4K21A 5FY1A 5FZAA 2K9ZA 2X5IC 4CEYB 3H8RA 1SFPA 1W9TA 4YG0A 1JU3A 2UWBA 4XVHA 5C9AC 2EIGA 2R49A 4Y5Z0 5FY0A 5HV4A 1AXZA 2A6YA 4TXWA 3AMPA 4BXSV 1MVQA 4I0WB 2FHRA 2PELA 5FYUA 2PAMA 4N7UA 3E6BA 1A6CA 4YG6A 4TLGA 4ZONA 5EYYA 5FZOB 3RS6A 5C3SA 1VIWB 2WFF3 2WINB 2RM21 1PGL1 1AJKA 1EV13 4JQRA 4YW3A 4TZDA 2JDPA 3LPFA 4M3CF 5FZ7A 4Q0UA 1AJOA 1C8NA 1W8NA 5CFDB 4Q0QA 5FO8B 1UW8A 1IHMA 2KR2A 3VZLA 3ZYHA 3VBUC 2ID4A 4AI8A 1FMD2 1Z7S1 1H8TB 2DFBA 2VW1A 3EMRA 4HVQA 2NP0A 3A22A 2RS52 3SCGA 3PNAA 3T09A 4JZRA 4LO6B 4ES9A 4ZKTB 1CJPA 3DYPA 3HIFA 5AC91 3N7MA 4IV3C 4FOVA 4CDQC 4KL1A 3BIEA 2W2IA 3CJIC 3O0VA 2R7EB 4QQLA 5CYYA 3NV1A 4A42A 4JQTA 4BPZA 5JXGA 1E5IA 3AM2A 1YFWA 1OQDA 4FOWA 2P3JA 2GMEA 2QQKA 4P02B 4L0PA 4NPMA 4IE5A 1JZ7A 3QH6A 2YB7A 3KV5A 1ZZ9A 4NWWA 4GH4C 3ZO0B 1H4HA 1Y7BA 4IL7A 5FMCA 4H14A 3JBG3 2EAKA 1ND3C 1HLCA 1W0NA 4P9LA 3VBRC 4NRMA 2XLGA 5DUWA 5G05L 2B46X 1V6IA 2D6KA 4AFCA 2A5ZA 4YW5A 5J96B 1I3HA 3I4IA 4AHYA 3MPBA 3K4AA 5KR7A 4QXBA 1VBB3 4FTBA 1US2A 3K4DA 3WNLA 2GC0A 2WBKA 3WNMA 5CG9A 1SDWA 3FLTA 2Y38A 4UFIA 3SC7X 1T6BX 2RHPA 4JCKA 1RUJ1 3IIAA 1W6QB 4QX0A 4FTSA 4BYYA 1ZYBA 4QQ2A 4LO5B 1IQDC 2WNVA 4MV2A 1DQ0A 2XBO3 2ZGPA 4M0NA 1LU1A 2WO2A 4XJAA 1K5MA 3QBQA 5CEHA 3MICA 3T0DA 3OG2A 2ZGUA 1Q8QA 3KHBA 4CRQA 5GLTA 4LNVA 2ZX2A 3POGA 5HBAA 1WA4A 4CEWB 2XVKA 2VNOA 4KU7A 2ZMLA 5BY5A 2VXRA 4UFJA 1ST8A 3GHNA 4HBNA 4HG6B 4IEOA 2RV9A 1KS5A 2VZ3A 3GNEA 3PIJA 4META 1RUNA 3UNPA 5JI7A 2BOIA 5A1LA 4P08A 4H7MA 3ROUA 1YIPA 2YC2A 2V72A 4CEYA 4KGQA 4W6XA 5A6ZA 1QXRA 3MPPG 1QH6A 3JB8A 4GALA 4W8JA 1B35B 1MS3A 4XF3A 3DPRC 3NW4A 5F3IA 4AQTA 3JB4C 1RHI2 1QH7A 2H6BA 2CV6A 3OUIA 3D3AA 3S6PA 4QPIC 4B7EA 4Y5SA 2F4PA 4PBPA 1DGWX 3KM5A 2BGCA 1GP4A 4PI0A 4QHOA 3UETA 5FR3A 5IVFA 5JXIA 3RJ2X 1XE0A 1X82A 4LPLA 3ZSJA 4NN0A 2YXSA 3KT7A 4UF0A 3THPA 2BVBA 3KVAA 5C5UA 1Z0HA 2TUNA 4FTEA 1JZ2A 4ORFA 1BMV2 1ZA7A 1LHUA 1LHOA 3UGHA 4CCOA 1OPMA 2DTWA 4A6OA 3UKTA 2OIIA 2R073 1DZTA 4OFGA 4GWMA 1IKPA 4V1PA 1OF3A 2VH9A 2P3YA 2VTXJ 4HLTA 2VOVA 5HI0A 4R52A 1YEWA 2QZ2A 1PO11 4W50A 5C9AB 1XQNA 1COV1 2E26A 2HWF1 2HEWF 3DGTA 2JECA 4K8FA 1PX4A 3Q8EA 4OUEA 5IWFA 1JYWA 2EF6A 4QB2A 4MGTA 4IEPA 5BPXA 1W6MA 2V5DA 1QJU2 3WP3A 3MIFA 1N3OA 5C8WA 1RB8G 3HEIA 2JXAA 2BU9A 2RMU3 5IK7A 1NCQC 2PAEA 1QXPA 5T5LA 1VP6A 5KXBA 1O6UA 1O3SA 1RJ8A 1NY71 1GU3A 4D94A 3IM0A 3C7GA 1MPXA 4XDQA 4DXTA 1W8UA 1UKGA 1MZEA 5J98B 4Q29A 3VBHA 3NV2A 3W20A 2DVBA 4AVAA 1DLCA 3GBWA 1R083 2EIDA 2EXHA 5K0UB 4UW4A 4LA2A 4XOGA 4CDXA 4E4DX 4JGZA 1AL22 5GLUA 4EN8B 1RUG3 4X8PA 5D8AA 2JB8A 3GM8A 1H6XA 4CDQB 2Q0AA 2VUAA 3WINE 4FFGA 5LBBA 4CCEA 2R042 4GWJA 3WF2A 2W1SA 5HXMA 3CEWA 5LK7B 5DN2A 3OPWA 1AR71 5CA6A 4M3CE 2VO5A 5DAXA 1AXKA 1FI2A 1UAIA 3C8XA 4K1YA 1WBLA 2AENA 1SBFA 3LFMA 5FYCA 4LBQB 3OSDA 2LUWA 2WAOA 4BQ3A 3ELNA 4NIAA 4KWUA 2AACA 1C8M1 5GZFA 4DEVA 5KBFA 2WNVC 4GQ7A 1RXFA 4D6QA 1R092 4KWJA 3T30A 4QB6A 3DXUA 1GP6A 1RUI3 2YV8A 4IUGA 2IZWA 3OYWB 3IPVA 4A7KA 4MGIE 5IFTA 2RVAA 1J3RA 1HIXA 3VLBB 3U14A 1NE6A 2C9AA 4JDOA 2XHKA 3KQ4B 2JG8A 3CDZB 1OA3A 2W9XA 4HN1A 3MBWA 4EZHA 1KEXA 1GNYA 1VMHA 4J25A 4DOUA 4RHV1 2JJ6A 3WG3A 2RS53 3RWKX 3SKVA 3W9AA 5C7GA 2R061 1SLLA 4AGVA 5GLZA 1EAH2 2TNFA 4NAMA 4QPYA 3WG2A 3V0AA 4F83A 1LOEA 1W04A 2PHFA 1GLHA 1H30A 1XBFA 3ZMOA 4AFMA 2WFF2 1OVPA 4QDRA 2XPJA 1WLTA 1HRV3 2YC4A 3CNAA 2GP3A 2VQUA 1W9WA 2QUOA 4URTA 2VMDA 2AYHA 4LHNA 2DBIA 4IDZA 2IXJA 5F8PA 2D43A 3INAA 2CGNA 3T3YA 4YZ4A 2E9QA 4AVVA 5EJ3A 2VQAA 4HT1T 5F32A 2ORXA 1WCQA 4A6SA 2X09A 3LOBA 1UKRA 1FV2A 1KXGA 1L3JA 5EIYB 1QDCA 4BQ5A 3I3MA 2KD7A 2SLIA 3JQXA 1ULPA 4LA3A 3WDWA 3WW1A 2Z5WA 4YRDA 4JKMA 3ZOIA 4CDWA 2GP5A 3BB6A 5A3PA 4C0BA 5L9VA 4J1WA 4YZ3A 1VAKA 4WVMA 5EP9A 3GBFA 1S0BA 2PLV2 3D4KA 3MIBA 2NMOA 4XHBA 1UZZA 5F6LB 1W2UA 2BERA 5CFCB 4AE2A 1Q56A 3T08A 3IMMA 1AYN3 5CZKA 3K4ZA 4KGGA 4XF4A 1G9FA 3I2FA 1NY72 4O65A 1CX1A 1OQEA 1R1A1 4FCAA 4N53B 4QAWA 2F17A 3N9MA 1B35C 4L11A 2ZACA 4CVUA 4Q4W1 3D82A 1YJKA 5LWBA 2IXLA 4O7XA 3I3EA 1KD7A 4L97A 2QFEA 1WW6A 4RFT0 3UV9A 3WDXA 2ZGSA 4Y1VA 5JXJA 1D2QA 2DCYA 1HRI1 5J36A 2JDNA 3I54A 1LECA 4FPOB 4K8RB 2ZEZA 4CCMA 3R0RA 2XB6C 5E89A 1DIWA 1U5XA 1QJY1 1JS9A 4NHMA 4QQOA 1VBC1 4RGAA 1HB1A 1ZRFA 5FIXA 2D44A 5FREA 5EQUA 3UKNA 5K0UC 2W1UA 2BYVE 3VN4A 3CJIB 2RDSA 4HFSA 1QJEA 3FHIB 3NMBA 4KH9A 1COV3 3POJA 2YPJA 1LENA 5BV6A 1PO13 1BYHA 2RS12 1DYOA 2A71A 2VMIA 1DYPA 3ALQA 5DPNA 5FPZA 5A33A 4MGYE 3CJXA 4GH4B 1EPZA 4UW5A 5EV7A 2Q8CA 4Z1VA 1X50A 1PK6A 1H2LA 2W47A 3I2GA 5GLWA 3SH3A 4EJRA 1BEV1 3U0ZA 2V5YA 4M0HA 3AP5A 5F3EA 1RVF3 1ULOA 1C8M2 1J3PA 3WQBA 4Q27A 2LROA 1V6MA 2WABA 1YJLA 2HWB3 2WZR2 2Y8KA 2ZGLA 3I2HA 4PIYA 5KHHA 5AC92 3S57A 2ARAA 1PIV3 2IFWA 1S0CA 4LKEA 1I9RA 3E5UA 4NIHA 4NUBA 4WM7C 1RUE3 4ZPIA 2GN3A 4BZ4A 1FPN3 2DCKA 5C3QA 5T52A 1PGW2 2X5IB 3J8F1 4NIGA 1Q8VA 3J8F3 4MXWA 5C5TA 3KS7A 4EWDA 3JD72 1EPWA 1MS4A 2Z42A 5FY4A 2BJSA 4YZ5A 5A6XA 2WC2A 3OY8B 1AYM2 1DQ1A 3EYPA 3KLSA 2WSVA 5H9SA 3K46A 5K0UA 4AEDC 1D4M3 2J1EA 3E5XA 5FP3A 4DXRA 3O0XA 3MW4A 4CDUA 4JGZB 4Q4X1 1WLDA 3RMXA 1AHSA 4DZGA 4CEWC 3SKJE 1LU2A 5JMCA 1IG0A 3GZEA 3E1F1 2VQ0A 3MGUA 3PJQA 4OI2A 4PF1A 3LE0A 2VZUA 4AI1A 3EBRA 1ACCA 2P1BA 4HXCA 1BEV3 4I30A 3RJRA 3VBUA 1OMIA 2CYFA 2OA2A 3JUUA 1TEIA 4R9CA 4AGRA 4BOWA 1WBFA 4NHLA 1SLBA 4N8MA 1NCQA 1PHMA 1CESA 1WW5A 3FZ3A 4QXKA 3U07A 4CXWA 1DBNA 3PLQA 2R1BA 4LLOA 1W6MB 3WHUA 2JIJA 3VDDA 1UY1A 1PGSA 3O1RA 1PNFA 4JC1A 1O3RA 1ND3A 2DVFA 4WBBA 2DBNA 3ASIA 3VZJA 1QMJA 1VBE3 4QX8A 2LS6A 2J1RA 3VBOC 4ES8A 1LB2A 5T50A 1VBC2 2VZPA 2RJLA 5EXOA 3T1MA 3KCXA 4QKDA 5FWJA 4NE9A 1HXS2 2XJTA 2R1DA 4PLOA 2OT7A 2DTYA 3E6CC 3NNJA 1XE8A 3WUCA 1AYN1 2A6XA 2W95A 1ASJ3 5F2SA 4JGZC 4MUVA 3USUA 4LMFA 1UU5A 1TME2 4E4ZA 4YYOA 2C6SA 2ARBA 5C71A 2RDRA 2P2KA 4GB31 1W8WA 5E1RA 3ZYPA 5KWRA 1S0EA 2PQQA 2YZ4A 1C5HA 5IVBA 5A7QA 1RUC1 4DPNA 3FX3A 4FPYA 4F3JA 4LIVA 1R1A2 2IC1A 1QJU1 4RL7A 4YM2A 1NXMA 4ZXEA 5LASA 5LRRA 3ZDSA 4V2WA 3KGZA 1O8SA 5IK4A 4YGEA 5BYNA 3FUOA 5ISLA 1XPWA 4LO7A 3AYCA 2VCBA 1LAJA 3DN7A 2YHJA 4KG8A 3ACIA 1GWLA 4OMDA 3JXSA 2BP6A 4CP9B 4P9WA 4UFKA 4BLJA 5FOJB 2GC3A 1ZRRA 3FMGA 5FJKA 1ZBA3 2QBXA 4AI2A 3ZXKA 4YPJA 1DQ6A 1GOFA 3MHZA 1V9U1 1KDMA 1LULA 3WX5A 5AC93 2ZPXA 5CFDC 4HKWA 1BMV1 4QMAA 3NJXA 4G4FA 1GFF2 4EWEA 1X9PA 2OYZA 1WMFA 4YM1A 4HKLA 2WAAA 1TMF1 3JU9A 1KITA 1RVF2 1VB4A 1NYWA 2XH6A 4S2GA 4DO0A 5FYBA 2EIEA 2Q1FA 3ES1A 1CIYA 2B9VA 1WW4A 2MPFA 2X05A 5K8SA 4BQXA 2JG9B 1UZYA 4FFFA 4AI0A 3WD5A 1BBT2 3R05A 4COZA 4YNIA 4QM8A 4MHRA 1EP0A 4LTAA 4OHVA 1S4CA 1YQ2A 5DQ0A 4F7ZA 1RUI1 1N3PA 4IE6A 1RUF3 1OC1A 2DCZA 3J9SA 2ZAAA 4PLNA 3NO8A 4QGMA 1ZREA 1YI7A 1HXS1 2BGPA 4YW4A 4MYEA 3ILFA 4FP3A 2JICA 1VMFA 3KCYA 1SPPA 5BUVA 1YI9A 4AHWA 4GJZA 1NCQB 4Y22A 2B7YA 5FZFA 4ATFA 2DV9A 2WNOA 1LGBA 5FQ0B 5AFBA 4CU9A 1LESA 3AZWA 4KI5M 4CP2A 1ULEA 1CAVB 2WNUC 4I01A 2VOXA 4R4ZA 3MF6A 3RNSA 3WSOA 4W65A 4OLLA 4XUNA 4BHPA 2QCSB 3BUCA 5FYIA 4XBLA 1YFYA 2FZ2A 2CTVA 1JYVA 4C90A 2ENRA 4YVWB 3LOIA 2ZHLA 1CPNA 3G6JB 1GYKA 3BYWA 5L7OA 5KXDA 5JMOA 1N1VA 2NPIA 4ZY9A 3O1MA 3WNXA 5ERLA 5FZ0A 3UK9A 1MACA 3PVOA 1QWRA 5FLHA 4BM8A 1RINA 1VAMA 4IE7A 3AVRA 3D0JA 2DVAA 2QZ3A 4XJ8A 4LXLA 2WRAA 3FBMA 1O4YA 3OUJA 4XETA 2VE1A 1XSQA 3LCPA 5GLVA 3SITA 4RFRB 5T55A 5IAVA 4LQRA 2ZKNA 2HWD3 4RQPA 1CAXB 3B94A 3U4SA 4MGKE 1IS6A 5F5IA 2E33A 2VULA 2XDVA 4MH0E 1GQPA 4ISQA 1AZDA 1UZVA 1YUDA 5A3TA 4XXAA 1W8HA 4DY5A 4LKDA 4XUOA 1GQHA 2HLEA 4ZXKA 1JUHA 2NM1A 2MEV3 4FPJA 3RYPA 5CADA 2W91A 4Q4X3 3VGIA 3GJAA 3H7YA 5BNPA 4Q8KA 1CAXA 2W1QA 4U36A 4XFGA 3GHMA 4ZS3A 3UESA 4K1ZA 4B3NA 3R4UA 2PHUA 3AKRA 1HRV2 2JKXA 2X53S 3AJZA 1W8TA 1JZ8A 3VKLA 1W99A 4JX0A 3J26N 3BTXA 4HK9A 4RN5A 4FFIA 5FZIA 1WW7A 2UYBA 2G4IA 4KWKA 5FV3A 2WT1A 4XFAA 1LOGA 1UYZA 3ZN5A 5DUVA 2ILMA 4FXKB 2LTNA 1A78A 3IDEA 1J1LA 4FFHA 1REDA 3SQOA 1V6KA 1UYPA 1FOD1 4N9IA 2GNDA 1I1EA 1UZ0A 1V9U2 4KBBA 1ZRIA 2AR6A 1MQTB 5CBLA 5DAWA 2GU9A 2FCVA 1MR5A 2IVJA 2JG9C 1POV3 2RDQA 4NR1A 1YFXA 2BNOA 5F5CA 5FBZA 1D2SA 5FY8A 4CCDA 2A70A 5JOZA 4AQSA 2TEPA 2ET7A 2WSUA 4WM8C 1E5SA 4BIOA 2R0FA 3VL8A 1S2KA 1Q8PA 3CQOA 3VDCA 1UN1A 4C1XA 4BDVB 1YQCA 5IHRA 2OS2A 4Q4Y2 2VVEA 3WQ7A 4YVSC 5FOBB 2JENA 1SCSA 3HNYM 3HR9A 4LO8A 4A3ZA 1JZ5A 5LW9A 1RHI1 3GYDA 5FP7A 3U4XA 4CXYA 1KQRA 5FXVA 3WT3A 1JU4A 4PT6A 5FK8A 2QKDA 2R32A 3WP4A 2D5HA 4YW2A 4COWA 1WGPA 3T2OA 4AI9A 3M3OA 4CCJA 1WA6X 3N9NA 5JIAA 2EXIA 2WQ4A 1CZTA 2DURA 1WWYA 2QQOA 2ZOEB 3ACHA 4DRVA 3VZNA 1XRUA 3VHRA 2WT2A 5JIUA 2FDHA 1SFYA 4IEZA 1XYOA 2YBKA 2ERFA 4FPGA 2A75A 1DZRA 1QIQA 1HB2A 1RL3A 1V6OA 3LWCA 3PVBB 4BJ0A 3RZJA 1GZWA 4AW7A 3I2DA 3VBFB 4PDWC 1LRHA 4LBMA 3BVCA 2XKPA 4MO3M 1TQ5A 5FO9B 5I93A 5CISA 2Z4FA 1ODMA 3AP9A 1VBA3 1V9U3 4ATEA 4Y3OA 2GNTA 4AEDA 1PO21 3VUOA 4DUXA 3C2UA 2ZHKA 1JMUB 1VBB1 4GAZA 1DYKA 4QPGB 1H2NA 5I0SA 1CIWA 4UW3A 1DGRA 1UMIA 5FUNA 1W6OA 4LIUA 3THCA 2VZ1A 2VMEA 5GJ6A 4IGOA 3ZYIB 1H4GA 1T6GC 2PN5A 2WNUB 3FHQA 3PUSA 1EY2A 4LK6A 1REEA 1UOGA 2RR12 2G1MA 1VBA1 1F4AA 1WUVA 3GZUC 4LBOA 4P9IA 4I3PA 1VRBA 1RYYA 2RDNA 2VCMA 2BBAA 3O0WA 4FPLA 3GGLA 1S2BA 1J3QA 2VNRA 1W90A 2UURA 2R041 3LEMA 3OPTA 4GWIA 1W3XA 3J7MA 1JBCA 3KQRA 4LBQA 4Q4X2 2XWJB 5F39A 5FZCA 3EJKA 3AL5A 2BV4A 5JUVA 3FJSA 4A45A 2P6HA 3LIHA 1ND2B 5CAZA 3LDBA 4PBOA 3O14A 3WNNA 4Q0SA 3POYA 4QPWA 4Y26A 5FYHA 2OZJA 2WFPA 4P9JA 3O1PA 3MUZ1 1UWWA 3LEGA 1H1AA 3IIIA 2ZCWA 2ZX3A 4W4ZA 4LBNA 2VZTA 4IEXA 4FOYA 1GICA 4O61A 3LB9A 2HWD2 1UOJA 2CAUA 1VMJA 4LITA 3TOJA 1QY4A 2J1VA 4HSLA 4HVRA 4R8HA 3ZFEB 1GV9A 5FPAA 1O5LA 3MLLA 1LOFA 4KU8A 3DECA 4CDUB 2AC1A 2Y60A 4HN0A 2BUKA 1DGWA 2ET1A 4OHYA 2BWCA 5BNNA 2P4EA 1CAWA 3TNQA 1EUUA 2ADEA 2PA7A 3W5NA 2VAUA 1RHI3 3PUQA 4R9BA 3V0AB 1H8TA 5DZFA 4PQ9A 3VV1A 3ZKYA 4E9KA 2RR11 4ONUA 2WZEA 4S2DA 3J7LA 1JOBA 5GZEA 3RG0A 2G9GA 3KHCA 4HMZA 4JHTA 1ULGA 2FDFA 1J1TA 3NNMA 4YWAA 1XU2A 2JB4A 5LA0A 4V2VA 1SMVA 5HCAA 1XU1A 2CAVA 2VZQA 5C3OA 4OI1A 4Z07A 4AVCA 5LZ6A 1D4M1 3UYJA 1SFNA 1OKOA 3NJVA 1PVXA 2WO1A 5CU1A 1OXCA 5G04L 5FZGA 2UY9A 4NRQA 4NAOA 3TNPB 3I2OA 4Y4YA 3W59A 1O91A 3M3IA 1ZRCA 1OVSA 4Q2FA 3OGGA 3QH7A 5IVVA 2YU1A 4QQPA 5KHIA 4Q4V2 1UMHA 1P8JA 3AMNA 4M00A 3VDDB 5EHDA 4CCKA 3LEKA 3MV11 3OBTA 5JOYA 1URXA 3TAYA 4Q1RA 4HPKB 3CZJA 1BBT3 3GALA 1PX3A 5AVPA 1SHWB 1VALA 4NIDA 3AFGA 5FMDA 2FDIA 3GZAA 4IXLA 5FXXA 1DQ5A 4BH9A 1SACA 1AVBA 4AWDA 1RVF1 1FOD3 3RZMA 4GD4A 2YMZA 3AFKA 3H1MA 4FOQA 3N9OA 5ANQA 4CE8A 1TME1 4D6RA 5FPVA 3BCWA 4RSUA 1R081 3MZHA 1LHVA 4N9HA 4YVSB 4Y20B 1RITA 5FWEA 2WO7A 2VJXA 1CQ9A 4FPFA 4AF9A 1D0HA 1OLRA 5FZ6A 4XJUA 1ENRA 3X29B 5I8YA 3B93A 5LEKA 4TSVA 1TZOA 1VBD1 3ZXLA 1TG7A 3PMEA 1OT5A 3ZFGB 1DDLA 4LOSA 1JOJA 2DUQA 1YQ6A 4QX2A 4YM0A 2EA7A 1MQTC 4Y33A 3R4DB 1XNAA 3UGFA 3WXPA 2H0VA 4HZFA 1IS4A 4MADA 3VKMA 1ENXA 4GZ9A 3CBNA 1PO22 2HWE3 3AKSA 4CTEA 1HRI3 3TBDA 2AH2A 2WZ8A 2A3YA 3GCWA 3I2KA 4WVMB 4YGDA 1MEC1 4Q26A 1VRH1 5FZ3A 2ES3A 3SEPA 4AYUA 4AVBA 2BWAA 2PQSA 4RR3C 5JVVA 3VD5A 2HYKA 2WDBA 3AXEA 3C7OA 3NV3A 5HCHA 3DCQA 4O9EA 5LBFA 4NPRA 3LDKA 3SLIA 5C4WB 3H9AA 1H2MA 1L7QA 4WZCA 1SCRA 5CG8A 5DAVA 1SEFA 1T2XA 1TME3 2NN8A 2Q4SA 4LBLA 4RQPB 4BXFA 1BJQA 4EWAA 1ASJ2 3SNMA 1EV12 3GBGA 4K9SA 3RVHA 4E27A 5T5PA 5BNOC 3WW4A 1UY4A 5FZ4A 1HXS3 1K5MC 2XLAA 2KM2A 1CAVA 5BNOB 4OHWA 1BVP1 3SCHA 2B4KA 1LEMA 2VC9A 3THDA 4CZSA 1ZRDA 1XOYA 4MGQA 3VHNA 1W6NA 2D3RA 4YGBA 2CY6A 3WQ1A 5KHGA 4AQ2A 2C26A 4LHLA 3BALA 1RUH2 5FYMA 1JYNA 3PVNA 2KA3A 3TN93 1E5RA 4EN0A 4AK3A 3CHXA 2AUYA 1ZVFA 4BISA 5KC5A 3PJYA 1MEC2 4C91A 5GZGA 3H8OA 2RS11 3POIA 3VD3A 3EHKA 3UT0A 2XXZA 1IG3A 3VZOA 3H8XA 3ZPOA 1F5FA 1HX6A 4E8CA 2Y6KA 1CR7A 2WWUA 4IEUA 5I8SA 3WV6A 4YFZA 4FVVA 3KCCA 1C57A 1LOCA 3VBRA 4UFMA 2HBUA 4IV3B 1VBD2 2WNVB 5FPLA 3LPGA 4NIIA 3JD73 4XIKA 5F5QA 4XJWA 3D6EA 3HOBA 2J42A 3LD8A 3DXTA 4L9BA 3LFIA 2QDNA 3B01A 1OFNA 3VDBA 4D6SA 3RI8A 3BU0A 3WZ1A 3TEZA 2WWSA 1ENQA 1UPIA 2G19A 1FNYA 3KF3A 1PIV2 4D3WA 1W2TA 1MS1A 4XE9A 3RQ0A 2VMFA 2HWB2 4MGZE 1DQ4A 5F2WA 4Y4RA 1JYXA 3IDBB 1V6JA 1XNBA 4M3CA 5HCBA 4XF0A 4E2GA 5AVAA 4LHSA 2ZX4A 3USSA 3BI3A 1GZ9A 1VR3A 3PU8A 5FP4A 4GB32 3UKVA 3W5MA 1O4ZA 4Y22B 5C3RA 2Q30A 4A2UA 4UXAA 3MW2A 3U37A 1QU0A 2PLV1 1KFXL 5CKNA 5ACA1 2DU0A 1XNTA 5JSPA 1L7LA 1H9PA 1E5HA 2JKBA 3PIGA 4NHKA 5LA9A 2VBBA 3VD9A 4FPEA 4J6GA 4RGGA 2ZA9A 3RYKA 1ZZ8A 1COV2 2A3WA 1EYBA 5DG2A 1W8FA 4YGCA 3ZFFC 3HJRA 2RM22 5IVJA 1V00A 3NRUA 5FMOS 3N7KA 5J48A 1W8ZA 4YARA 1NA1B 2BFUL 3ORJA 2FBEA 4GB33 4QPIA 3PUHA 1UMZA 1DHKB 1NLQA 1ZX5A 1HW5A 3MYXA 2W92A 2FCUA 1RUG1 4JDNA 4QD2A 4S2HA 4JKKA 5K9YA 4BK5A 4XPVA 3M7AA 1UY0A 1V6LA 4NVPA 2P37A 3RZHA 1UIJA 2BFUS 1S1AA 1W9SA 5BNPC 2GC1A 3A4UA 1YNAA 3P3NA 2FDGA 5CFCC 5F6KA 1GNHA 1RUD2 2HWD1 4LO4B 4TYSA 3FFQA 4XILA 5IAXA 4FSJA 2WLQA 2B8MA 2IXCA 1U5YA 1STMA 1GQGA 1OLME 1DU3D 2GSYA 3WNKA 2RJKA 5JAXA 4QDSA 2DUOA 2CDOA 4TLFA 2JEMA 4UT5A 3I3QA 3AMMA 2PTMA 1MS5A 3CL1A 4RR3B 1AR92 5DMYA 1IKQA 3ZX7A 2IVIB 5GZCA 1J59A 3KT4A 4Y20A 5EZWA 4DB5A 4DS0A 4AGGA 2PLV3 2AEZA 2W46A 3GXUA 3OGSA 4XF1A 2W5FA 1XC6A 1W2NA 3W58A 1XNCA 1IZ3A 3S5QA 1ZA4A 3WNPA 4URAA 1BBT1 4DXZA 2GMMA 2ZS6B 3WW3A 2FDJA 3OBZA 4I0BA 1LOFC 3ON7A 2Q8OA 2E7QA 4RQPC 1QNWA 3FWEA 3TN92 4WM7A 1REFA 3IKWA 1MS9A 3CJIA 3TEYA 1W3VA 2AREA 3NV4A 2VY0A 4OCTA 5E16A 1U5IA 4E2SA 3KZ4C 2JDKA 5K7PA 2RG4A 4OI0A 1QHDA 3HMYA 4IEVA 5E88A 4FI9A 2GAUA 3VHPA 1AR82 2D6NA 1WMDA 4Q4Y1 2YFZA 5BXXA 3VBHC 3CO2A 1OLQA 4GH4A 4WVWA 2C9KA 1QQP3 2LW8A 3JD71 2Z79A 2JWPA 2XQXA 3C7HA 4XAAA 5EWSA 5H9RA 5FZLA 2XJPA 2ZGNA 5FPXA 2O8OA 1PK6B 3AYAA 1WMEA 4MVTA 3MFAA 4KMQA 1N3QA 3LAGA 3U11A 3BKZA 4XAEA 5I0RA 4IETA 4H55A 3T0AA 2QVSB 1V70A 1Q3EA 1Z78A 2JE7A 2XQRA 4IV1A 1J84A 4PLMA 1EAH3 2CWMA 4XBQA 4IW3A 3AX4A 2QQLA 1F2NA 2WR9A 1W39A 1XB9A 4AHXA 5DDJ1 2DCTA 1DG6A 4XW3A 1CAUB 5ABJC 2UWCA 3VBUB 5ACA2 4F8AA 1KGYA 4PDWA 3V0BA 1AXYA 5A32A 5LEJA 4XQDA 2FQPA 2QNKA 1HRI2 2ZMKA 2V4AA 2YG0A 3LA3A 4XJZA 3VZMA 4B1LA 5JWPA 5IK8A 1RUI2 4OUSA 2PFWA 3CF6E 2WS92 4AXOA 4Q0VA 4AVSA 2I45A 4AL9A 1OURA 3URFA 3BOPA 3SEEA 1JXNA 2VR4A 1JODA 5FK7A 5A80A 1AX0A 4MXVA 4BQYA 4QWNA 2JIGA 5SV8A 4FO9A 5B4NA 5KXCA 3ZR5A 1OF4A 2A3XA 1LOAA 2ZGKA 3MLKA 4K40A 4PHZA 4ZHNA 2Q1MA 2FMDA 2ZABA 1YLLA 1VB2A 2GALA 1RMU2 4FT8A 1D0GA 2R043 1BKZA 3IDCB 5ABJB 2ZX1A 1FXZA 1FOD2 5BNQA 1ODNA 1W6OB 4SLIA 1FATA 1Q43A 4CP0A 4EROA 2ZGTA 1US3A 4FBFA 3Q8CA 1AL23 1JYCA 1JYIA 4NOTA 2D40A 2F6BA 3F95A 1JTZX 2BW8A 1OLMA 4AAPA 4OVEA 1JUIA 1R082 1ULFA 1KDKA 2E31A 2OQ7A 2Z69A 3HBZA 3M8LA 4UBGA 4UWDA 3RRDA 3S0MA 4I3GA 4ET7A 3IZOA 1YO8A 3AYDA 3MIDA 1RUH1 4Q4V3 4Y1XA 3QACA 2VU9A 4A7YA 5HPOA 1LHWA 2PAKA 1C28A 4XBNA 3JZVA 3ZXGA 4QHZA 3NKGA 1HQNA 1Q8OA 4LKFA 2J1UA 4XFFA 1WCKA 1YIFA 4FXGB 5B4XA 4Y1UA 3DKWA 3USUB 5FYSA 4AVTA 1NAEA 3IMNA 5JCTA 1XNKA 3L9JT 3EXUA 3TEWA 5JSRA 3BPSA 2EXJA 3C7FA 5FPBA 3WLUA 2Y6HA 4N7IA 2FCTA 2R063 3NAPB 3QCWA 4HOOA 3E5QA 4QKNA 5DDJ3 4C1WA 3OOXA 1GOHA 4IEWA 1UX7A 5F1RA 4RHV3 3P6BA 2DVGA 2ZHNA 3KVBA 4LLFA 4GJYA 1H8VA 5H9QA 1FNZA 4XDOA 3ZXEA 1Y9MA 4DINB 1QOSA 5BNOA 4XTMA 4HL0A 2BQPA 1I6XA 4CPBD 2C24A 3LQCA 3OTFA 2R072 1DQ2A 3ATGA 1PMJX 3E6DA 1UYXA 3H3UA 3VBOB 1R091 4B4PA 1BK1A 2CDPA 5L9BA 2XJRA 4JHZA 1ZNPA 2IUWA 2C5DA 4L2NA 1W6PA 1WLWA 1YFUA 1UPSA 4LK7A 5FBJA 1PMHX 5FO7B 4AFDA 4Z8BA 2BBVA 4GXLA 1AR81 2AEYA 4NPLA 2Y26A 1Y4WA 2QQUA 3WVJA 2R6QA 2RS51 4U2AA 1H1IA 2A6WA 1BVVA 1X33A 2WL1A 5LY1A 3O12A 2DF7A 2VM9A 3B00A 3B5LB 1O4TA 2VOKA 3H7JA 4XCAA 1DLLA 3LDRA 4XZUG 3P1IA 5JPMB 3RDIA 3O1VA 2YBSA 1IOAA 3FN9A 3POBA 3V0BB 4AQ6A 4CCLA 3D0SA 3EB7A 4LORA 3VBHB 5E8AA 1OH4A 3AVSA 4LBJA 5D8AC 3OGJA 1QKQA 4X6QB 2CGPA 2AGSA 1GUIA 2RR13 4HPKA 1NXD1 3VBFC 1G7YA 1BCXA 3ETPA 5LY2A 4KWLA 3FC0A 2IFRA 5F7UA 4UAPA 1H2KA 1DFQA 4YLZA 2H0BA 4LBKA 4YZ2A 2OQ6A 1SZBA 2DYCA 3RWNA 3RZZA 3ZXDA 4DIQA 1PMIA 4Q5OA 2HWE1 2MEV1 5LCWL 2XOMA 1VBA2 2RMU1 3B02A 4CYDA 4EE2A 2Y0IA 2BDRA 5FZBA 1YC61 1UYYA 4LE3A 2GDFA 4BU2A 4XDPA 2E63A 2XJVA 2LM3A 4XUQA 3UJOA 4CDXC 1LEDA 2WO3A 5DAQA 1N1YA 1H0BA 1X7NA 2V09A 2PHTA 2DCJA 2GH8A 2E7AA 4K6BA 5A33B 1GANA 2R071 1ND3B 1PZ9A 3K51A 1S0DA 1TMF2 1WZXA 3KF5A 1Y43B 3M2MA 4EQVA 3RYRA 4Z82A 3ZFFA 1SDDB 3DYOA 3AB0A 5C3PA 3VBSC 1RMU3 1K42A 5EYXA 5IW0A 4A41A 2D3PA 3PDQA 5CKQA 5FP8A 1LTEA 4CDQA 2VW0A 3N9QA 3HQUA 3VKOA 2VNGA 4DRRA 5IVEA 1UXZA 2EIBA 3HAGA 1DGRN 4Q4Y3 2C4XA 1F35A 1V6NA 5FQ0A 5LRSA 4CU6A 3O1TA 3DF0A 4TWTA 3U75A 1NCRA 4PF5A 1HDKA 3OGVA 5I8TA 2WS93 1W05A 2XJQA 2K46A 1UXXX 2Y34A 4HK8A 4NRPA 3WF4A 4EN9B 4OYUA 1LCLA 2VBPA 3MO4A 5A7SA 5AFEA 5JR7B 3CMGA 2VXJA 4P9YA 2PMWB 4UBHA 1FT9A 2XVLA 1PIV1 2VUJA 5B2GB 3U78A 1S0FA 2FDKA 2Z2SB 5FZ9A 4CCNA 1M4WA 1H6YA 2Y64A 4EZ4A 3HT2A 4JAAA 1RIRA 1FMD3 3Q9OA 4IQPA 1RUF1 2DWRA 3DYMA 1OOPA 4TN7A 3WDVA 1JZ4A 3ZFEC 1ZZBA 2CGOA 4YZ1A 4E4SA 2P5BA 2BNNA 1W0PA 4N43A 3KD4A 5A3LA 3ZYFA 1OA2A 3OD4A 1OHFA 2K2SA 2Y0OA 1AX1A 1CVNA 3ZFGC 2QQVA 4IV1C 3GJBA 1QQP2 3ILNA 5LBEA 3OYWA 3HPNA 4WVZA 4BQ1A 2Y6JA 4LT5A 3NWKA 3BODA 1W8OA 3RFRA 2MEV2 3WEZA 5C8CB 3AP7A 4YFWA 3SISA 1XXNA 3TN91 2C0ZA 5GALA 3BGAA 2P6CA 3NNGA 1UY3A 4N53A 3CLPA 3C3VA 4DY3A 3PU3A 1LODA 1GZCA 1QDOA 1ZBA1 1ULCA 5A7WA 1LOBA 1W9FA 4CUGA 3T4VA 4Q0PA 5FP9A 2WZR1 1FAYA 1AUYA 1POQA 3I3DA 4YW6A 2A6ZA 5FUIA 2I2SA 4XF9A 4JV4A 4C0HA 4MZUA 1A8DA 2VMHA 2WN3A 5C33A 3KWVA 2BNMA 2WJSA 1BQPA 1PGW1 4D69A 4CDXB 3NJYA 5FZKA 1UU4A 1AR93 3AMQA 1RUC3 3HBKA 3KB5A 3MDPA 1IS3A 1ZZCA 4M4PA 2IXKA 1RGSA 4N43C 5FRAA 3I97A 2A7AA 5A1AA 4I09A 2D5FA 3ZIXA 1VE0A 4GULA 1QGLA 1VAVA 1SLTA 5SV5A 4BMBA 1RUD3 3RZLA 3EQEA 1PK6C 4QGNA 4N90A 2HWC1 1NKGA 1XYNA 2YU2A 4FAHA 4QX5A 5JOXA 2A6VA 2VCCA 2QE3A 1WD4A 4QPGC 4XFHA 2JDYA 1Z7S3 1F15A 1MQTA 3H1WA 3IWZA 5FXZA 5A3UA 2W52A 1HN1A 3BN6A 3C7EA 2YBPA 4QX1A 5C9AA 1LNSA 1OI6A 1SLAA 1VLNA 4LEJA 3WHTA 4PQQA 5F37A 2RM23 1RUF2 5GM0A 4ZZ5A 3DKQA 1SLIA 2E53A 1Y3TA 1NT0A 3UL2A 4AEMA 3U1XA 2NMNA 4H3WA 5FY7A 5KHKA 1AR62 4H7LA 3ZLIA 3KV6A 1HRV1 1EUTA 4PIXA 5JLVA 2QQPA 2PHDA 1WCSA 1G8WA 3CU7A 4QB1A 5LK5A 4Q1PA 4LJHA 3RZKA 4HVOA 1TE1B 3PMSA 5JR2A 3AYEA 3ZFGA 5GZDA 2CWSA 3BPZA 4MOAA 3FUQA 4BMEA 1NLRA 2P3IA 1NZCA 3IB3A 3LKJA 3Q8FA 4XMIA 2GC2A 2WFF1 3D5OA 3RI9A 3S30A 3S7IA 2VVDA 2ZX0A 4BLIA 2YYOA 1IPJA 1OOPB 3L2HA 4P5HA 4D7SA 4XQWA 4INDA 4RS5B 3N9PA 1JYTA 5FKBA 3AC0A 3AP6A 2P3KA 4HONA 5KHJA 3WW2A 1ZBE3 4QU2A 1GMMA 2OX0A 3PUIA 5LA2A 3V65A 4OQ8A 4JRLA 4JRAA 4W6YA 4Y1YA 2D6MA 4IERA 3OD0A 2QTWB 2NZ9A 3ZFFB 2D93A 3E97A 3I7DA 3AKPA 3KV9A 1SG3A 4R4XA 2EVXA 3VB9A 1D7PM 3WCSA 3T2TA 2RE9A 1G9AA 5CVRA 1ULDA 5LB6A 3AZZA 1KS4A 3LF7A 3HNMA 2JD4A 4JDMA 3ZMNA 5D2AA 4QT6A 4ASKA 4C8DA 2ZGQA 1PVC3 5FZ1A 1W2AX 2NQYA 1DF0A 2VNVA 4P5YA 3DEMA 3R6SA 5F9TA 1J83A 5E6HA 1CGPA 3WG1A 2WA4A 3FLRA 1BK0A 1MEC3 4D7YA 5J09A 3FBYA 3ACLA 3HN1A 4IV1B 2EAAA 1N1TA 2HKXA 5M0TA 2VGDA 2J7MA 3I59A 1FV3A 1VBC3 5T3NA 1GP5A 1RUH3 2JDHA 4Q4V1 5C8CC 1QJY3 4UYBA 1QJX2 3ZYJB 4NROA 3DPRB 3F2ZA 2XUMA 4CU7A 1VBE2 4AFBA 1BLZA 4MSVA 4LE4A 1NZIA 2WN2A 4L99A 4CCCA 2XONA 4XYXA 3NQHA 4DEQA 1AL21 5D21A 2BOJA 3VKNA 1XNDA 1AR91 2RS33 3WDYA 4R9DA 2XG3A 4LBQD 2ZHMA 4UFLA 4CEWA 1HQLA 1XE7A 3LA7A 4LKSA 4IE0A 4COYA 1BEV2 1NA1C 3OCPA 4E4HA 5LBCA 2OZ6A 4E2QA 2CU5A 5EFUA 1RUD1 1HV0A 2HWC2 5JXHA 3MF9A 3T0BA 1GNZA 2HWF3 5DABA 3WDUA 2XWBB 1UX6A 1RJ7A 4I0AA 3RZGA 5D1IA 1AYM3 4UW6A 1GOGA 5FLIA 5I0UA 3ZPYA 3MIGA 3ZSEA 1PO23 2P34A 2HWE2 2XL9A 1E57A 4KBZA 2XLFA 1MS8A 4JTNA 3A21A 2YUEA 1LJ7A 2J1AA 4FPCA 1NG0A 5A3WA 1PZ8A 3JBG1 3P3PA 2Q1ZB 3N9LA 1FPN2 3PVEA 2QQJA 4GMP3 4KQ7A 3W21A 4Z2WA 5I91A 5JOWA 1LHNA 1CONA 1RUE2 1XYPA 2DFCA 2XGXA 2WA3A 2ARXA 1H9WA 3R4SA 2LRPA 4COUA 5C8CA 4Z92B 3AJYA 3G7DA 3M4FA 5CFCA 4MX3A 2WZR3 4B7KA 4D0QA 1UY2A 2O0OA 3JCIA 5A7PA 2OKXA 4XACA 2YFUA 2WNEA 1G9CA 3ZIWA 2OVUA 4W6WA 2VCAA 1GSLA 5A7OA 1X9TA 1CWPA 1UF2C 1VRH2 1CD3G 3TB0A 4G9SB 5A7WB 1VPHA 5A3OA 3K75B 1SPPB 2ZGRA 4OUMA 5IVYA 2WWJA 3J7NA 4NHXA 1RXGA 1OBNA 4PIZA 2VECA 1C3HA 2PHLA 1W6QA 1WLCA 1CAUA 5FMOL 2HJIA 3K77A 2UWAA 4GMP0 2WUHA 3BTYA 2OPKA 2RS13 4PDWB 2IXIA 1PO12 2PHRA 2W3JA 4N43B 1OFSA 1NCRC 2BRTA 2DVDA 5FJHA 5GKAC 4EV0A 4HSJA 4DXSA 2J1TA 4FAGA 5FYVA 1W0OA 1POV0 2C1FA 2WIIB 3OBRA 3NKTA 4ITCA 4L8QA 3ILRA 3LIGA 1HQWA 3ST7A 4XCBA 4P9XA 3M3EA 2UYAA 3J7HA 1FMD1 1Z7S2 1YXWA 2PYTA 5T5JA 2YY1A 1POV1 3CZUA 3PURA 2ZZJA 4CP1A 2H6CA 3H0OA 2VTXA 3B69A 1DCSA 2PHWA 2JDMA 3QD6A 2QQMA 5FCCA 5FFOC 3T1LA 3A7QA 3WY6A 2FZ1A 4Y24A 2WS91 5FXWA 2WQ8A 4ZZ8A 4HETA 4FPKA 2YGLA 1RUJ3 1RUC2 2VMGA 3AZYA 3MIEA 3PTYA 3OB8A 1TVGA 2SBAA 5FDBA 1XJAA 3OY8A 4JGYB 5FZEA 1NCRB 2ZGOA 1FX5A 2PHXA 3A0NA 4YG3A 2WZPP 2N7GA 5HV0A 4OI4A 3JQWA 3AP4A 3AZVA 4QXHA 1QOTA 2JE8A 2JE9A 2D7FA 4PCRA 3HD8B 4XUPA 4NO4A 1PZ7A 3NL1A 4QQHA 2WKKA 3ACFA 5FAXA 1S0JA 3LA2A 4PJYA 3EO6A 1RMU1 1UOFA 2XR4A 1HN0A 3OUHA 1Y9QA 3NNLA 5J3UA 3SMHA 5H9PA 5L19A 1LGCA 1C4RA 1OUSA 1QXJA 2D6LX 3NAPC 4IEQA 4XIOA 3VDDC 4DUWA 5KXEA 2WLPA 4X8NA 2X29A 2G9FA 3OEBA 1DGLA 4ARXA 4XURA 1A3KA 3PUAA 3ZR6A 4GIQA 3D8CA 4CXXA 5IYYA 2JDZA 4ASLA 4JTOA 5DZGA 1SLCA 3A23A 3TEXA 4QKBA 2W94A 4P9GA 5DZEA 4AG4A 5J37A 2KXLA 1X8MA 4XFIA 4NJ4A 1BXHA 2JD9A 2B5HA 1B09A 1NA1A 2X10A 5A32B 2DU1A 3ZXJA 3M70A 4NMIA 5L73A 5FY5A 1QQP1 4ZU7A 1ZBE1 1AR61 4GKXA 4A7ZA 2NLRA 2QDRA 4FQZA 1ZZ7A 4XJ9A 2I07B 3HWJA 2CNAA 5A1FA 2Q8DA 4LR4A 4AEKA 1KRIA 2GN7A 1Q5OA 1AF9A 5JZGC 2YDEA 1RC6A 3KV4A 1FPN1 4EYUA 4J1XA 3V56A 3I49A 3ZDVA 3ZSKA 4D8MA 2ZEWA 4Q8LA 1OD5A 1OQ1A 2JDAA 4HANA 2EICA 4R9AA 1KFUL 2GZWA 1A34A 3N3HA 4UI9L 1R093 3ZYGA 2VG9A 3S7EA 3SH5A 1VJ2A 1W2OA 2JG8C 1YQ5A 2LALA 2BGOA 5FZDA 4CPBA 1CX4A 2Q5TA 4M3CB 4P00B 4DUVA 2R16A 3OEAA 3V64A 1O3TA 2QQNA 5FYYA 3IT8A 3VDAA 3B9CA 1F31A 1QF3A 4COVA 1QEXA 3ZFEA 1UCXA 4HKOA 4QPIB 4WVVA 3K3OA 4MHUA 4I2OA 3H42B 4XTPA 1X8EA 5HCFA 2HYXA 3MEPA 1N1SA 2XL7A 5FYTA 4OHZA 3WDTA 4P14A 5DG1A 3VHOA 3QOPA 3H3ZA 1CAWB 3N7JA 1GBGA 3NSTA 4O9GA 4XMAA 1JN2P 3IDAA 3OGRA 1W6PB 4YVWA 1ALYA 4IV3A 1TMF3 5IATA 1RUG2 3BU7A 5KC6A 2JG9A 3PHMA 1APNA 4ZU4A 2XJSA 4MLOA 4RA0A 3N36A 1QJZA 4BQWA 1CJDA 3BTAA 3DL3A 1JOPA 2D3SA 4ZS2A 5K4LA 5A3NA 1ND2C 1O5UA 3MUY1 4OMCA 4XC9A 1AL0G 1PM7A 3HQXA 4CDWC 3P5BA 4DFSA 1S0GA 4YW1A 5C4WC 2VQTA 5JDBA 3MFCA 1QJX1 5CFDA 4AR2A 1PGL2 4ARYA 3WF1A 5C4WA 4B1MA 2GNMA 5FYZA 2VZOA 3U10A 2YROA 4GWNA 4BA6A 1FYUA 2RMU2 3FFZA 5F3CA 2J1SA 1QJU3 2HEVF 1OOPC 4BIFA 1NUKA 4QXCA 5L9RA 2OUHA 2ZGMA 1MS0A 3WNOA 2VZSA 3IBMA 1WKYA 1F5JA 4UFHA 4YW7A 1IQAA 2ZKLA 1C1FA 2BEOA 3O1SA 4IGQA 4LOTA 1GZWB 4CEYC 1IGOA 4BB3A 1UO9A 1K5MB 2QQWA 2ZMNA 5CNAA 2EXKA 1K5JA 1C5IA 2XHNA 4XUTA 1K12A 2W68A 5ANNA 3RPQA 4QX7A 4QM9A 3A0KA 2DUPA 2WQZC 1HJGA 1KJLA 5IK5A 3VBSB 1K45A 2Y6LA 3TWIA 5I0TA 2HH9A 3T2PA 5T54A 2RS31 3AKQA 4AEJA 4A44A 2YPDA 3IAQA 4OHXA 2O1QA 3H8UA 3OBAA 2L9LA 2OXBA 1OSGA 4WV8A 4YSFA 2ZBJA 2X8KA 2W1WA 5EJ1B 5I0DA 4SBVA 3ETQA 1H8TC 4XZPA 4ISRA 3LZZA 1UQXA 1UIKA 2VUDA 5CKMA 2IXHA 4DQAA 3BIWE 1I5PA 3FLPA 5FPUA 1CN1A 4B4QA 4UOJA 1OD3A 1WCUA 3ME2A 5IUQA 4D7TA 3NVCA 1SQ4A 4RS5C 4ZU5A 1MZ6A 1RUJ2 2VW2A 4LULA 2E6VA 5FUPA 5C70A 1G86A 3WF0A 3RMYA 2W39A 3NJZA 4QX3A 1SBDA 1RTVA 1YRZA 2OW4A 1MZFA 4OZXA 3T4HB 5L7OC 3LSDA 4JGYC 3DPRA 4RHV2 5FZOA 3LEIA 1K3IA 2XJUA 5T5OA 4Z2AA 3UJQA 1EV11 1O59A 2VL4A 1LR5A 2B9UA 2R062 3AKTA 5DDJ2 4E8DA 2W87A 3HT1A 2ADDA 2VBDA 3WUDA 4DNYA 5A6QA 1EAH1 4JVAA 1NX9A 3OF1A 5IFPA 2K0GA 2E51A 1YWKA 1UD1A 1PM4A 1V0AA 1Y9GA 2D6OX 2G9ZA 1F8VA 3HVDA 1RUE1 1UL9A 4K7JA 4QU1A 5FY9A 3THTA 3L2YA 3O5SA 3AZXA 1X36A 4BCUA 4CUBA 5BNPB 5BNNC 3MI8A 4LHKA 4JKLA 1BHGA 3M1HA 5DUXA 5DUUA 3VL9A 1R64A 1C1LA 2MHFA 2PXJA 2Y6FA 4B4RA 2MNGA 4BQ4A 2O14A 3QLQA 2XBO2 3Q8AA 5FMBA 4RS5A 3LSEA 1S0IA 2BPA2 3O1OA 1IPSA 2TBVA 2BTVC 1QJFA 4KNCA 1IPKA 1DP0A 2HEYF 3O7OA 4X6RB 2W0XA 1ZM1A 3ACGA 3FL7A 3GCXA 1HB4A 3HNBM 3ITQA 1YQ8A 2ZJCA 2R30A 1F4HA 3SXWA 1H1MA 1VBB2 1G6NA 5CIRA 5F5AA 3MV01 1UU6A 1VRH3 5L36A 1CZVA 5JZGA 1ASJ1 3I2IA 2BZDA 2Y33A 3RGBA 1I5ZA 4JGYA 3ZVXA 3ENRA 4UF0B 2XVGA 2Y6GA 3H1YA 3POWA 3VD4A 1OH3A 1GWMA 2CL2A 3JBG2 2D97A 5A6YA 2V4VA 4XFBA 4RD7A 4QHBA 1W28A 1GWKA 3UGGA 3GZTB 3RSJA 3GDBA 3VKFC 1ZBA2 4BQ2A 2YC0A 3AL6A 4M01A 3SCFA 2ZEXA 5JI9A 1S55A 2ZAHA 4N53C 2P17A 3NAPA 2QJVA 2VD7A 5JZGB 3NNFA 5D8AB 2J22A 4IE4A 1HJFA 2XKOA 3AXDA 4TTGA 3WG4A 1ONAA 2ATFA 4RR3A 4AI3A 2BVVA 3J4UH 1QNYA 3DUIA 5DAPA 5ACA3 1R1A3 3ZKUA 2HWF2 4CDWB 4RGKA 4A3XA 2HWC3 3WOGA 1WD3A 4GA9A 4XHXA 4MGSA 3VBSA 1O7FA 3ZXFA 3BTZA 4YM3A 4OQ9A 4A4AA 1NQJA 2FMYA 3I3BA 4CUCA 4AHZA 2F4LA 1JI6A 3ZYBA 1GZTA 1JHNA 3SHRA 5DXDA 1QOOA 2RS32 1NLSA 5C6CA 4CSWA 5JSOA 1MVEA 3B3QE 4YVWC 3BOWA 2W08A 2VPVA 4WZFA 4XQ4A 1W03A 3FE5A 1G9BA 4G3YC 4H2AA 3AK0A 3CKHA 3MW3A 1JHJA 1AR83 5ABJA 2EALA 1TNFA 3O1UA 1A8MA 2ARCA 2B39A 2GH2A 1WMXA 4XFCA 5F3GA 3AMHA 1QJX3 1CZSA 1QJY2 3WF3A 3KMHA 1ND2A 4QPGA 1G9DA 1RUOA 1B35A 1XSRA 2ETEA 4BWOA 5IT6A 2OUJA 1OPOA 2D6PA 2VUCA 3VZKA 4ASMB 2HWB1 1KJRA 3CIHA 5FZ8A 2WYFA 3OPZA 2FD8A 4WM8A 4XEZA 4NHYA 2Q8EA 2D98A 3OJBA 4CDUC 2E32A 2WT0A
chains in the Genus database with same CATH topology
1U0AA 4B8EA 4I02A 1LKNA 2IWGB 1PVC2 2B45X 2O8QA 3B7MA 1ENSA 1YHFA 2YGMA 5BNNB 1U5ZA 4K20A 4BE3A 5J7MA 3TYJA 4K3UA 1CPMA 3N35A 4EN7B 1D4M2 1W6NB 1MZ5A 1GKBA 3ZN6B 1Q8SA 4GMP1 1SBEA 3ECQA 1HV1A 3J8F2 1ZBE2 3VBOA 3VBFA 5L7OB 3N4MA 4EN6B 5HXVA 3N7LA 1BZWA 2AZ5A 1YYNA 5A3MA 4IESA 4LUMA 3ES4A 4GKYA 1OKQA 4AEDB 4Y1ZA 1YCIA 3VBRB 5FLJA 1AX2A 1J58A 1C8M3 4OULA 2XBO1 3M3QA 4KG0A 4DMIA 4Q4W3 3IPVB 3WP5A 2WNUA 4MXWB 4WM8B 4WM7B 2B42B 4L92A 3TRSB 3ZN4A 3WCRA 1AR73 1D4VB 5JPNB 2ZZQA 1AR63 2JG8B 1AYM1 1AR72 2GNBA 2I74A 3POSA 3WP6A 5FTTC 4B29A 3I8TA 4Q4W2 1VBE1 2V73A 3ZN6A 1TNRA 1GR3A 1NQDA 3K48A 3B9IA 3APBA 3ZXAC 1IS5A 2ZTNA 1PVC1 1WCDJ 4FPHA 1JW6A 1U12A 3LGRA 3IN9A 4QGLA 4AFAA 3KGLA 3SH4A 3MLJA 2E7TA 3M3CA 1M06G 2VVFA 2R0HA 4YVSA 2A73B 5TSWA 3ZYRA 4XXPA 1DZQA 3WR0A 5CB7A 1PNGA 1F9KA 1R1ZA 4LUKA 3KT1A 1AYN2 2JX9A 1VBD3 4NWVA 2GMPA 3GF6A 3KSCA 3MIHA 3ZSLA 1N47A 3I59B 3DV8A 2VOWA 1OA4A 1ZZ6A 1NE4A 4S2FA 4IEYA 1O3QA 4FQ4A 1NOVA 1HKDA 4FP2A 2UU8A 2X5IA 2UY8A 3ZSMA 3WQ0A 4CDQB 1JH5A 1LGNA 2NYYA 3H50A 4K21A 4CEYB 2K9ZA 2X5IC 4YG0A 2UWBA 5C9AC 2EIGA 2R49A 4Y5Z0 1AXZA 2A6YA 3AMPA 1MVQA 4I0WB 2FHRA 2PELA 2PAMA 4N7UA 3E6BA 1A6CA 4YG6A 3RS6A 5EYYA 1VIWB 2WFF3 2WINB 2RM21 1PGL1 1AJKA 1EV13 4JQRA 4YW3A 4TZDA 4M3CF 5CFDB 4Q0UA 1AJOA 1C8NA 5FO8B 4Q0QA 1UW8A 1IHMA 3VZLA 3VBUC 4AI8A 1FMD2 1Z7S1 1H8TB 2DFBA 2VW1A 4HVQA 2NP0A 2RS52 3SCGA 3PNAA 4LO6B 4ES9A 4ZKTB 1CJPA 3HIFA 5AC91 3N7MA 4IV3C 4FOVA 4CDQC 4KL1A 3O0VA 3CJIC 4QQLA 3NV1A 4BPZA 3AM2A 1YFWA 1OQDA 4FOWA 2P3JA 2GMEA 3QH6A 1ZZ9A 4NWWA 4GH4C 1H4HA 1Y7BA 4IL7A 4H14A 3JBG3 2EAKA 1ND3C 1HLCA 4P9LA 3VBRC 2XLGA 5DUWA 2B46X 1V6IA 2D6KA 4AFCA 2A5ZA 4YW5A 5J96B 1I3HA 3I4IA 4AHYA 3MPBA 1VBB3 4FTBA 2GC0A 5CG9A 1SDWA 3FLTA 2Y38A 2RHPA 4JCKA 1RUJ1 3IIAA 1W6QB 4FTSA 4BYYA 1ZYBA 4QQ2A 4LO5B 2WNVA 4MV2A 1DQ0A 2XBO3 2ZGPA 4M0NA 1LU1A 4XJAA 1K5MA 3QBQA 3MICA 2ZGUA 1Q8QA 4CRQA 5GLTA 4LNVA 2ZX2A 5HBAA 1WA4A 4CEWB 2XVKA 2VNOA 4KU7A 2ZMLA 5BY5A 2VXRA 3GHNA 4HBNA 4IEOA 1KS5A 3GNEA 4META 1RUNA 5JI7A 4H7MA 3ROUA 1YIPA 4CEYA 4KGQA 4W6XA 1QXRA 3MPPG 1QH6A 3JB8A 4GALA 1B35B 1MS3A 4XF3A 3DPRC 3NW4A 4AQTA 3JB4C 1RHI2 1QH7A 2H6BA 2CV6A 3S6PA 4QPIC 4B7EA 2F4PA 4PBPA 1DGWX 3KM5A 2BGCA 3RJ2X 1X82A 3ZSJA 4NN0A 2YXSA 3KT7A 3THPA 2BVBA 1Z0HA 2TUNA 4FTEA 4ORFA 1BMV2 1LHUA 1LHOA 1OPMA 2DTWA 3UKTA 2OIIA 2R073 1DZTA 4OFGA 4GWMA 1IKPA 4V1PA 2VH9A 4HLTA 2VOVA 5HI0A 4R52A 2QZ2A 1PO11 5C9AB 1XQNA 1COV1 2HWF1 2HEWF 3DGTA 2JECA 4K8FA 2EF6A 4IEPA 5BPXA 1W6MA 3WP3A 1QJU2 1RB8G 3MIFA 1N3OA 5C8WA 2JXAA 2RMU3 5IK7A 1NCQC 2PAEA 1QXPA 5T5LA 1VP6A 5KXBA 1O3SA 1RJ8A 1NY71 4D94A 3IM0A 4XDQA 1UKGA 1MZEA 5J98B 4Q29A 3VBHA 3NV2A 2DVBA 3GBWA 1R083 2EXHA 5K0UB 4UW4A 4LA2A 4XOGA 4CDXA 4E4DX 4JGZA 1AL22 5GLUA 4EN8B 1RUG3 4X8PA 5D8AA 2Q0AA 2VUAA 3WINE 2R042 5LK7B 3CEWA 1AR71 5CA6A 4M3CE 1AXKA 1FI2A 1UAIA 4K1YA 1WBLA 2AENA 1SBFA 4LBQB 2LUWA 3ELNA 5KBFA 1C8M1 5GZFA 2WNVC 4GQ7A 1R092 4KWJA 1RUI3 2YV8A 2IZWA 3OYWB 3IPVA 4A7KA 4MGIE 1J3RA 1HIXA 3VLBB 1NE6A 2C9AA 4JDOA 2XHKA 2JG8A 1OA3A 4HN1A 4DOUA 4RHV1 2JJ6A 3WG3A 2RS53 3W9AA 2R061 1SLLA 4AGVA 5GLZA 1EAH2 2TNFA 4QPYA 3WG2A 3V0AA 4F83A 1LOEA 2PHFA 1GLHA 1H30A 3ZMOA 4AFMA 2WFF2 2XPJA 1WLTA 1HRV3 3CNAA 2QUOA 4URTA 2AYHA 4LHNA 2IXJA 2D43A 3INAA 2CGNA 4YZ4A 2E9QA 4AVVA 5EJ3A 2VQAA 4HT1T 3LOBA 1UKRA 1FV2A 1KXGA 1L3JA 1QDCA 2SLIA 3JQXA 4LA3A 3WDWA 3WW1A 2Z5WA 4YRDA 4CDWA 3BB6A 4C0BA 4J1WA 4YZ3A 1VAKA 4WVMA 5GZGA 3GBFA 1S0BA 2PLV2 3D4KA 3MIBA 2NMOA 4XHBA 1UZZA 5F6LB 1W2UA 5CFCB 4AE2A 1Q56A 1AYN3 4KGGA 4XF4A 1G9FA 1NY72 1OQEA 1R1A1 4FCAA 4N53B 1B35C 4L11A 2ZACA 4Q4W1 3D82A 1YJKA 2IXLA 1KD7A 4L97A 2QFEA 1WW6A 4RFT0 3UV9A 3WDXA 2ZGSA 4Y1VA 1D2QA 2DCYA 1HRI1 5J36A 3I54A 1LECA 4FPOB 3R0RA 2XB6C 5E89A 1DIWA 1U5XA 1QJY1 4NHMA 4QQOA 1VBC1 4RGAA 1ZRFA 2D44A 5FREA 3UKNA 5K0UC 2BYVE 3VN4A 3CJIB 4HFSA 4KH9A 3FHIB 5BV6A 1COV3 2YPJA 1LENA 1PO13 1BYHA 2RS12 2A71A 2VMIA 1DYPA 3ALQA 5FPZA 5A33A 4MGYE 3CJXA 4GH4B 1EPZA 4UW5A 5EV7A 4Z1VA 1X50A 1PK6A 1H2LA 5GLWA 3SH3A 4EJRA 1BEV1 3U0ZA 2V5YA 4M0HA 3AP5A 1RVF3 1C8M2 1J3PA 4Q27A 1V6MA 1YJLA 2HWB3 2WZR2 2ZGLA 5KHHA 4PIYA 5AC92 1PIV3 2IFWA 1S0CA 1I9RA 3E5UA 4WM7C 1RUE3 2GN3A 4BZ4A 1FPN3 2DCKA 5T52A 1PGW2 2X5IB 3J8F1 1Q8VA 3J8F3 4MXWA 3KS7A 4EWDA 3JD72 1EPWA 1MS4A 2Z42A 4YZ5A 2WC2A 3OY8B 1AYM2 1DQ1A 3KLSA 2WSVA 5H9SA 5K0UA 4AEDC 1D4M3 3E5XA 3O0XA 3MW4A 4CDUA 4JGZB 4Q4X1 1WLDA 3RMXA 1AHSA 4DZGA 4CEWC 1LU2A 5JMCA 2VQ0A 3MGUA 3PJQA 4OI2A 4AI1A 3EBRA 4I30A 3VBUA 1BEV3 3RJRA 1OMIA 2CYFA 2OA2A 3JUUA 1TEIA 4R9CA 4AGRA 4BOWA 1WBFA 4NHLA 1SLBA 1NCQA 1PHMA 1CESA 1WW5A 3FZ3A 4QXKA 3U07A 1DBNA 3PLQA 2R1BA 4LLOA 1W6MB 3WHUA 3VDDA 1PGSA 1PNFA 4JC1A 1O3RA 1ND3A 2DVFA 4WBBA 3ASIA 3VZJA 1QMJA 1VBE3 3VBOC 4ES8A 1LB2A 5T50A 1VBC2 2RJLA 5EXOA 3T1MA 3KCXA 1HXS2 2XJTA 2R1DA 4PLOA 3E6CC 2DTYA 1XE8A 3WUCA 1AYN1 2A6XA 1ASJ3 4JGZC 4MUVA 3USUA 4E4ZA 1UU5A 1TME2 4YYOA 2ARBA 2P2KA 4GB31 5E1RA 3ZYPA 5KWRA 1S0EA 2PQQA 2YZ4A 1C5HA 1RUC1 4DPNA 3FX3A 4FPYA 4F3JA 1R1A2 2IC1A 1QJU1 4RL7A 4YM2A 1NXMA 5LRRA 3ZDSA 3KGZA 5IK4A 4YGEA 5BYNA 3FUOA 4LO7A 3AYCA 3DN7A 2YHJA 4KG8A 4P9WA 4BLJA 5FOJB 2GC3A 1ZRRA 3FMGA 1ZBA3 4AI2A 3ZXKA 1DQ6A 1V9U1 1KDMA 1LULA 3WX5A 5AC93 2ZPXA 5CFDC 4HKWA 1BMV1 4QMAA 4G4FA 1GFF2 4EWEA 2OYZA 1WMFA 4YM1A 4HKLA 1TMF1 3JU9A 1KITA 1RVF2 1VB4A 1NYWA 2XH6A 4S2GA 3ES1A 1WW4A 2MPFA 5K8SA 2JG9B 1UZYA 4AI0A 3WD5A 1BBT2 3R05A 4COZA 4YNIA 4QM8A 1EP0A 4LTAA 4OHVA 4F7ZA 1RUI1 1N3PA 1RUF3 2DCZA 3J9SA 2ZAAA 4PLNA 3NO8A 4QGMA 1ZREA 1YI7A 1HXS1 4YW4A 4MYEA 3ILFA 4FP3A 2JICA 3KCYA 5BUVA 1YI9A 4AHWA 1NCQB 4Y22A 2B7YA 4ATFA 2DV9A 1LGBA 5FQ0B 5AFBA 1LESA 3AZWA 4CP2A 1ULEA 1CAVB 2WNUC 4I01A 2VOXA 4R4ZA 3MF6A 3RNSA 4W65A 4OLLA 4BHPA 2QCSB 4XBLA 1YFYA 2FZ2A 2CTVA 4C90A 2ENRA 4YVWB 3LOIA 2ZHLA 1CPNA 3G6JB 1GYKA 5L7OA 5KXDA 1N1VA 2NPIA 3WNXA 3UK9A 1MACA 3PVOA 1QWRA 5FLHA 4BM8A 1RINA 1VAMA 3D0JA 2DVAA 2QZ3A 4XJ8A 4XETA 3FBMA 1O4YA 3LCPA 5GLVA 3SITA 5T55A 2ZKNA 2HWD3 4RQPA 1CAXB 3B94A 4MGKE 1IS6A 2VULA 4MH0E 4ISQA 1AZDA 1YUDA 4XXAA 4DY5A 1GQHA 4ZXKA 1JUHA 2NM1A 2MEV3 4FPJA 3RYPA 5CADA 4Q4X3 3VGIA 3H7YA 5BNPA 4Q8KA 1CAXA 4U36A 4XFGA 3GHMA 4K1ZA 4B3NA 3R4UA 2PHUA 3AKRA 1HRV2 2X53S 3AJZA 3VKLA 3J26N 4HK9A 1WW7A 2UYBA 2G4IA 4KWKA 2WT1A 4XFAA 1LOGA 3ZN5A 5DUVA 2ILMA 4FXKB 2LTNA 1A78A 3IDEA 1J1LA 1I1EA 1REDA 1O3TA 1V6KA 1FOD1 4N9IA 2GNDA 1V9U2 4KBBA 2AR6A 1MQTB 5CBLA 2GU9A 4NR1A 1MR5A 1POV3 2JG9C 1YFXA 2BNOA 5FBZA 1D2SA 2A70A 5JOZA 4AQSA 2TEPA 2ET7A 2WSUA 4WM8C 4BIOA 2R0FA 3VL8A 1S2KA 1Q8PA 1UN1A 4C1XA 4Q4Y2 2VVEA 3WQ7A 4YVSC 5FOBB 2JENA 1SCSA 3HR9A 4LO8A 1RHI1 3GYDA 3U4XA 1KQRA 3WT3A 2QKDA 2R32A 3WP4A 2D5HA 4YW2A 4COWA 1WGPA 3M3OA 5JIAA 2EXIA 2WQ4A 2DURA 2ZOEB 4DRVA 3VZNA 1XRUA 3VHRA 2WT2A 5JIUA 1SFYA 4IEZA 1XYOA 2ERFA 4FPGA 2A75A 1DZRA 1RL3A 1V6OA 3LWCA 3PVBB 1GZWA 4AW7A 3I2DA 3VBFB 4PDWC 1LRHA 4LBMA 2XKPA 5FO9B 1TQ5A 5I93A 3AP9A 1VBA3 1V9U3 4ATEA 2GNTA 4AEDA 1PO21 3VUOA 3C2UA 2ZHKA 1VBB1 5I0SA 1DYKA 4QPGB 1H2NA 1CIWA 4UW3A 1DGRA 1W6OA 5GJ6A 3ZYIB 1H4GA 1T6GC 2PN5A 2WNUB 3ZO0B 1EY2A 1REEA 2RR12 4P9IA 1VBA1 4LBOA 1WUVA 3GZUC 4I3PA 4FPLA 3O0WA 1S2BA 1J3QA 2VNRA 2UURA 2R041 4LBQA 3KQRA 1JBCA 4Q4X2 2XWJB 3EJKA 3FJSA 1ND2B 5CAZA 4PBOA 3O14A 4Q0SA 3POYA 4Y26A 2OZJA 2WFPA 4P9JA 1H1AA 2ZCWA 2ZX3A 4LBNA 4IEXA 4FOYA 1GICA 3LB9A 2HWD2 2CAUA 3TOJA 1QY4A 4HSLA 4HVRA 4R8HA 3ZFEB 1GV9A 1O5LA 3MLLA 1LOFA 4KU8A 4CDUB 4HN0A 2BUKA 1DGWA 2ET1A 4OHYA 2BWCA 5BNNA 1CAWA 3TNQA 2PA7A 1RHI3 4R9BA 3V0AB 1H8TA 5DZFA 4PQ9A 3VV1A 4E9KA 2RR11 4ONUA 4S2DA 5GZEA 3RG0A 2G9GA 4HMZA 1ULGA 1J1TA 1XU2A 1SMVA 5HCAA 1XU1A 2CAVA 4OI1A 4Z07A 4AVCA 1D4M1 1SFNA 1PVXA 5CU1A 2UY9A 3TNPB 4Y4YA 3W59A 1O91A 3M3IA 1ZRCA 4Q2FA 3OGGA 3QH7A 4QQPA 5KHIA 4Q4V2 3AMNA 4M00A 3VDDB