4BM8A

Galectin-3c in complex with bisamido-thiogalactoside derivate 3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
ALIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-3
publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bm8A00
1FAYA 1DLLA 1KJRA 4P9YA 2ES3A 1UX6A 1SACA 4BMBA 4YZ2A 1VALA 1LHVA 3GALA 1I3HA 4YGCA 1H9WA 1GBGA 4FOQA 4I30A 5EYXA 1V6KA 1VAVA 4GXLA 3AYAA 2GN7A 2ZKNA 4XYXA 1YYNA 2PHRA 3N35A 2EXKA 1ZA4A 1LESA 2ZMKA 4FPOB 1BJQA 3DGTA 1UMZA 5E88A 1C4RA 2EIGA 4LBOA 1CPNA 1ULEA 1YIFA 1ULCA 4M3CF 4XDQA 5T5JA 4YW3A 3W58A 3OYWB 1ZM1A 4YG6A 1ONAA 4YZ3A 2D6OX 3D5OA 4BMEA 1IS5A 1G9CA 1CVNA 2E53A 2Z42A 2GN3A 5GZEA 3BTAA 3I8TA 4FP2A 4LBKA 3RSJA 5CNAA 4DRRA 3B69A 4P9XA 2UWAA 3POYA 1N47A 3O0VA 1W6MA 1HKDA 3SLIA 1G9BA 3O0WA 4F83A 2R0FA 2ZGLA 1HLCA 1IS6A 3APBA 1BZWA 1MZ6A 4FOVA 4Q26A 4YGDA 1GSLA 4FPFA 1WUVA 1WW7A 2TEPA 2ZGPA 4Q8LA 3AP9A 3AZXA 4YFZA 3IPVA 4LBQB 1IS4A 5BYNA 3IKWA 1G9AA 4R9CA 5EYYA 3AZYA 1S0CA 2NP0A 3ZVXA 1Q56A 4WZFA 4ATFA 1QNYA 2ENRA 5H9SA 5IK7A 2DVAA 3T2TA 2PHTA 4P14A 1GYKA 4BPZA 2DYCA 1IOAA 3SH4A 1LGBA 1SCRA 3KM5A 2PHXA 1LHUA 3M3QA 2DURA 2AH2A 1GICA 5JVVA 4AYUA 4FVVA 3VKMA 1S0BA 3I4IA 4FPCA 1JN2P 3ZYRA 2DUPA 2JKBA 4YZ4A 1JXNA 1RINA 1B09A 5DUXA 3VV1A 4AGRA 2EXHA 3AZWA 4NO4A 1S0GA 3WNXA 1QU0A 1UL9A 2VW2A 3WDYA 1LOFA 2GDFA 1FNYA 2JJ6A 2SLIA 3A0KA 3D6EA 3NV2A 3WG4A 1LJ7A 1OFSA 1URXA 3BIWE 4GKXA 4M3CE 1N3OA 5T50A 1R1ZA 4Y1VA 3AXDA 5JMCA 1G86A 2R1BA 3BODA 3VUOA 2ZZJA 3USUA 1LGCA 1Q8PA 1V6JA 1AXYA 1FV2A 2EXIA 4CRQA 2PHFA 2ZGQA 4XILA 4YM1A 1C1LA 1W6NB 2AREA 2CWSA 4LBNA 1S0DA 4XBLA 3FLRA 1VLNA 5JDBA 2GNMA 3AJZA 3PJQA 2GALA 2GMEA 2DVDA 2R49A 2H0BA 2ZMLA 1EPWA 3SITA 1LOAA 2CYFA 1GZWA 1MR5A 4KBBA 4PBOA 3ZXJA 3V0AA 1ULFA 2KM2A 5T5LA 1SFYA 1H9PA 1SBEA 4DQAA 1AX2A 1BQPA 4PQ9A 1LGNA 2W68A 3ZSKA 3O12A 1WBLA 4XXPA 3B00A 1AX0A 4GALA 1RIRA 3B9CA 2A6ZA 5JOZA 5KXEA 1LODA 3AFKA 1DHKB 4XZPA 5T5PA 3WDVA 3RS6A 1A8DA 1DYKA 2E7TA 4FQ4A 4PF5A 1LEMA 1MS9A 5GLWA 4M3CB 4Q8KA 4BQ1A 2DVBA 2P37A 2ZACA 1DQ0A 4Y1UA 1V00A 5GLTA 5IK4A 1W6OB 4RA0A 5KXBA 1WW5A 3M3CA 1AXKA 1NXD1 2DU0A 1S0FA 2UU8A 2DV9A 4Y20A 1APNA 4AVVA 3DUIA 3NV1A 4FPKA 4UW3A 1N1YA 5T54A 1WLCA 1DIWA 2YZ4A 5IT6A 4YW4A 2A75A 2ZGSA 2LALA 3ENRA 4DRVA 1IKPA 5AVAA 4BLJA 5GM0A 4FOWA 3AZVA 1MZ5A 3SH5A 1ENRA 2ZGTA 4YM0A 2DVGA 1OKQA 1ENQA 1PZ9A 3NWKA 4Y26A 3WOGA 2D43A 5GLUA 2NN8A 1V6OA 2UURA 4UW4A 1G7YA 4XJAA 3TB0A 4AVSA 3WCRA 5DG1A 3PVOA 1MS1A 3ZXFA 3AK0A 3FFZA 3AYCA 3JU9A 4XOGA 1DQ6A 1QOSA 4K1YA 4Z8BA 3MW3A 3PVEA 1PZ7A 4Y22A 2P3JA 2CTVA 4JCKA 3WLUA 1PZ8A 1S1AA 3N7KA 1MS5A 1LU2A 3MW2A 2A3XA 4XJ9A 1D0HA 4XJWA 1GZCA 2EF6A 1WW6A 3POSA 2VXRA 1SLBA 4JC1A 4FPHA 5DUVA 1AJKA 2YMZA 2A7AA 1W6MB 3MW4A 1V6LA 1FYUA 1ULDA 2A71A 5CAZA 3AX4A 3WDXA 2E6VA 1DQ2A 4PCRA 3WVJA 3AYEA 1W6PA 4Y1ZA 3HR9A 3JUUA 3OGGA 5IK8A 5H9QA 2CL2A 5IK5A 3IPVB 4Q2FA 5DG2A 2VUAA 2V5YA 2ZBJA 2AYHA 4L8QA 1LHOA 5T55A 1J1TA 1W6QA 1N1TA 4CTEA 5HCBA 4ASMB 5E89A 5GZDA 1SLTA 1MVEA 4YM2A 5CA6A 1DFQA 5DUUA 4YW5A 3N7JA 2AGSA 1BYHA 1QDCA 1D2SA 5JOWA 3UJOA 3N3HA 2CY6A 3V65A 2AUYA 3B3QE 3T1MA 5L73A 4Q27A 5EXOA 2ZHNA 2PELA 1JHNA 2E7QA 1Z78A 2G4IA 4FOYA 2I2SA 1OQ1A 3H0OA 2D6LX 4NOTA 2R0HA 4DS0A 1DBNA 1Q8VA 1KJLA 1RITA 2JE9A 2ZGNA 1QNWA 2OUJA 2WJSA 3FLTA 4Y1XA 4Q1PA 5T5OA 4XXAA 3SH3A 4BM8A 1N3PA 4P9WA 5IUQA 2ZGMA 4YZ5A 4HANA 4R9AA 1V6MA 2W08A 4DPNA 4AVTA 1LU1A 3USUB 2ZMNA 1JUIA 2D3SA 3A0NA 3IMNA 3ZXLA 1KRIA 5GZGA 2ZA9A 4U36A 4WVVA 3O5SA 2OUHA 2YXSA 4YFWA 2NYYA 3POWA 1CQ9A 4PBPA 4C1XA 3L2YA 2Q5TA 5EWSA 2PHWA 3VKNA 2VW0A 1GZWB 2A6WA 4FQZA 4RL7A 1N1VA 3RMXA 2FHRA 2GMPA 2GNBA 2C5DA 3FUQA 4XHXA 4BLIA 1UN1A 3V0AB 4YW1A 2DVFA 5CB7A 4AGVA 1HQWA 3R05A 1JBCA 3AZZA 4YG3A 1AF9A 3RG0A 3AP6A 2VW1A 2YV8A 4Y24A 2YY1A 4LBQD 3WG2A 2A5ZA 4UW5A 4XIOA 3WDWA 5KXCA 4D69A 1QKQA 4OZXA 4XE9A 1WD3A 3LCPA 1FNZA 1DQ5A 2OW4A 2EXJA 2PHUA 2ARXA 4FP3A 1YRZA 1MS8A 2LTNA 4YW2A 1S0JA 4Y20B 3FLPA 4FPYA 4W65A 1LENA 4M00A 2FMDA 3NV4A 4DFSA 1V6IA 2WT2A 4YGEA 3ZYPA 1NLSA 3M2MA 5HCFA 3V0BA 1G9DA 2VH9A 3D4KA 2WT1A 4K20A 4FPGA 2D6MA 2D6KA 3PMEA 2D6PA 2A6VA 2P3KA 5E8AA 5JLVA 1FX5A 2DTWA 1CPMA 1KDKA 2CWMA 3GNEA 3WHTA 4XBQA 2W39A 4ISRA 4Y1YA 1BXHA 3PVNA 1MS3A 4R9BA 3V64A 5GLVA 1AZDA 5DXDA 5GALA 1SLCA 2UWCA 1XQNA 3WUCA 5DUWA 1IS3A 1C57A 2WSVA 3UJQA 2YROA 2UWBA 3OY8A 1QOTA 3QCWA 1SLAA 4ISQA 4Y22B 2VY0A 1MVQA 1DZQA 3A4UA 2GNDA 2C9AA 4R9DA 3WZ1A 4BOWA 1A78A 2BQPA 3FBYA 4YZ1A 1AJOA 5FREA 1CJPA 5DZEA 3AJYA 2EAKA 2AENA 2D6NA 2SBAA 3ILNA 4LBJA 1WCSA 1GKBA 4ZXKA 1CIWA 1IKQA 1JYIA 3OBRA 1SBDA 1DQ1A 2A70A 1MS0A 1YO8A 2OVUA 5F9TA 1DGLA 2NMOA 2A3YA 4TZDA 2P3IA 3WV6A 2EALA 4M01A 1W6PB 2JE7A 1Q8OA 4LBLA 3VKFC 1SBFA 3N36A 3WG3A 3INAA 1QDOA 2WQZC 2DTYA 4YG0A 4XHBA 4HL0A 1S0EA 4UW6A 5DZGA 1W6QB 1G8WA 1UKGA 1CONA 2P34A 5GZFA 2ZAAA 3TAYA 1Q8SA 4XJUA 3RRDA 1Q8QA 2NZ9A 1MS4A 1W0OA 1QF3A 3OYWA 3LSDA 3IN9A 1G9FA 5T52A 1ENSA 3MEPA 1LOCA 1QOOA 1UZZA 2AR6A 3CNAA 5DZFA 3ZSLA 5GLZA 3WCSA 2NMNA 2CNAA 1S0IA 4U2AA 1LECA 1WLWA 2VU9A 2WNEA 3WDTA 1F9KA 1LHWA 1MACA 3IM0A 1GZ9A 1YI7A 1WD4A 4AWDA 1KQRA 4FPJA 2A6XA 1U0AA 1CN1A 2D44A 3UK9A 3AP5A 1CESA 3T1LA 3SISA 1LULA 3AXEA 3FUOA 4LBQA 4IQPA 1AX1A 4MYEA 5SV8A 2WLQA 2WSUA 2V73A 4WVWA 3M3OA 2R16A 3RMYA 3B01A 1LOEA 1X50A 3M1HA 1LCLA 1DYPA 3ASIA 1O4YA 4JRAA 5H9PA 1LOFC 1F31A 3UL2A 3ZPYA 1BKZA 2ARBA 2XB6C 3NV3A 5GJ6A 2P2KA 1W0PA 3ILRA 1V6NA 1GLHA 3VKOA 4XTMA 2JECA 5CBLA 1WBFA 2ERFA 2ZGRA 2A6YA 4YGBA 3ZXEA 1KITA 2A3WA 3C2UA 1A3KA 3N7MA 4YLZA 2GMMA 1SLIA 2E51A 2NM1A 3AYDA 4ZKTB 4FPEA 4WV8A 1VIWB 3WDUA 4GWMA 4FPLA 5LK5A 4GA9A 1DQ4A 4CZSA 2R1DA 2D7FA 2W52A 3HMYA 3RQ0A 1LEDA 3KQRA 5GZCA 4XJ8A 3OJBA 3QLQA 1C1FA 4ITCA 2ZHLA 1AVBA 1O4ZA 3WUDA 2ZGUA 1GV9A 2ZGKA 4ATEA 1CR7A 3LSEA 3V0BB 1W6NA 1Y7BA 3OPZA 1TEIA 2DUQA 1FV3A 3Q9OA 1FATA 1GNZA 3WHUA 1JOJA 1QMJA 2ZGOA 5HCAA 3VKLA 3ATGA 3R4SA 4XJZA 2ZABA 2HYKA 4GKYA 2JD4A 1UZYA 1GANA 3SNMA 1YXWA 2RHPA 4XBNA 1GNHA 4TYSA 1WLDA 3HN1A 4XMIA 1KDMA 2WT0A 4LBMA 4XTPA 1QGLA 1F5FA 4K21A 4SLIA 4GWNA 3ZSJA 4Q1RA 3N7LA 1ULGA 1WW4A 3AP7A 4AGGA 2ZHMA 2D3RA 5JOXA 3WG1A 1LOBA 1LHNA 3O0XA 2GNTA 3OY8B 3OBTA 3M3EA 5H9RA 4M3CA 2B7YA 4XIKA 1JYCA 1LOGA 3ZXKA 4K1ZA 2XG3A 1JW6A 4XMAA 1HDKA 1Z0HA 2DU1A 4H55A 1W6OA 3ZSMA 4C1WA 2JDZA 3AP4A 2D3PA 1H30A 1N3QA 2ZHKA 5JOYA 1VAMA 1I1EA 1SLLA 5F5QA 1HQLA 3MPPG 3W59A 1UAIA 1UPSA 4YM3A 2DWRA 2DUOA 3BOPA 1N1SA 1SCSA 2WKKA 5KXDA 3U4XA 3R4UA 5FRAA 3ILFA 1AXZA 1LTEA
chains in the Genus database with same CATH superfamily
2OYZA 2QJVA 4LQRA 1DLLA 1IHMA 4P9YA 2ES3A 1RYYA 4A6SA 4YPJA 4FFGA 1K5MA 4PIXA 5JAXA 4BMBA 4YZ2A 2BTVC 4XQWA 4KNCA 1ODMA 3ZOIA 2WNUB 4LHKA 4YGCA 2X5IA 1X9TA 4QKDA 4GXLA 1ZREA 2GN7A 3MPBA 4XYXA 3VDCA 2YGMA 3DGTA 2RS52 3SEEA 4LBOA 1AR72 1NCQB 1TQ5A 4AG4A 2WZR3 2NQYA 4CP9B 3H8UA 4LO6B 3OYWB 4YZ3A 1WMXA 4QD2A 2Q8OA 1G9CA 2E53A 2VMEA 2GN3A 1VRBA 3SMHA 4MHRA 1JOPA 1U5XA 1KFUL 3BTAA 5FKCA 3RSJA 1AR91 3VBSC 1NY71 5CFCC 3GCWA 3B69A 4P9XA 4KG8A 3POYA 3WT3A 5JPNB 2YFZA 1W6MA 5A32A 2R0FA 2ZGLA 1R1A1 2BFUL 1MZ6A 5T3NA 1GSLA 3TEYA 1WUVA 2XL9A 2VULA 2B5HA 3LZZA 1JZ2A 3LGRA 1ND3A 4Q8LA 4HKOA 4LHSA 4AVBA 4UAPA 2IUWA 4ONUA 1ZVFA 5FO9B 3ZFGA 5HXVA 1MZFA 3BVCA 1S0CA 1OQEA 3TEXA 3ZVXA 2BUKA 4WZFA 4ATFA 4D3WA 3IDEA 5DAXA 5H9SA 3ZYFA 4CUGA 3ZYJB 2ID4A 2PHTA 2JG8B 5E6HA 3VDBA 1C8M3 3AL6A 1LGBA 1SCRA 4CCOA 5J1XA 1DU3D 2PHXA 5FZAA 5JZGA 1ZBE1 2AH2A 3MFAA 4AEDB 1KFXL 4MH0E 3I3DA 3I4IA 1GOGA 3UESA 5JUVA 3TNQA 1RINA 1B09A 3JZVA 1E5SA 3OOXA 5BXXA 2VOWA 3GF6A 3AZWA 4JKLA 5CADA 2VNRA 4MGQA 3TNPB 1QXJA 3T2QA 3ME2A 1UL9A 3WDYA 3CJIA 1US3A 2V72A 3KGLA 4WBBA 2GDFA 1VR3A 1FNYA 1UNBA 3D6EA 3NV2A 3SEPA 3W5MA 4HSJA 1EP0A 3I54A 1X8MA 4IE7A 2WC2A 3AMNA 3WXPA 1OFSA 3BIWE 3K46A 1EAH3 1N3OA 3KB5A 3AMPA 4M3CE 4HBNA 4LLFA 4MV2A 3MIEA 5F32A 4LKEA 2R1BA 3OGSA 4PT6A 3USUA 1VBA3 5A7WB 2EXIA 2PHFA 3JD71 3WF0A 2AREA 4BISA 4URAA 2ORXA 1OBNA 1AYM1 1S0DA 3FLRA 4AHXA 1UOJA 5JDBA 2GNMA 3LA3A 5CEHA 2GALA 4XFAA 5FMOL 4H2AA 4OHWA 2R49A 1NA1B 2ZMLA 3L9JT 2HEWF 1EPWA 3E6DA 3KHBA 3NNJA 3SITA 3E6BA 2XDVA 4B3NA 3AFGA 4KWJA 3W5NA 2MNGA 3ZXJA 4PBOA 1RUH3 1ZZ7A 5IVCA 1FMD1 1LNSA 1W8FA 2W68A 2WWUA 1YNAA 1WBLA 3KF3A 1AX0A 2WQ4A 1OA3A 2W0XA 3LAGA 3PUIA 3B9CA 4NVPA 4Q4X1 5LRSA 1XE0A 4NR1A 4A6OA 2PLV2 4RHV1 2B8MA 4IEYA 1NT0A 3J7NA 5EP9A 3AFKA 2VMHA 3LFIA 4HKLA 2E26A 4LOSA 4LE4A 4MGIE 2E7TA 4PF5A 3RZKA 1W9TA 1MS9A 5FZ3A 2P37A 1UOFA 3KMHA 3VHPA 3WF3A 4RA0A 4NIAA 2IXJA 1W3VA 3M3CA 1AXKA 2DU0A 2UYAA 1RHI1 4RS5C 5FR3A 5C5UA 3DUIA 5G05L 4FPKA 4KI5M 2CU5A 3WW2A 1QEXA 1AR61 1WLCA 2HWF3 2RJ2A 4IV1A 5IT6A 3MHZA 4B4PA 3W20A 5FP7A 4OHYA 4MXVA 4MVTA 4DRVA 1IKPA 1UX7A 2XLGA 4QWNA 4Q4W2 5AVAA 4IV3B 4BA6A 4FOWA 3OD4A 1MZ5A 4E4ZA 5C9AB 2O8QA 2VO5A 3LOIA 5FMBA 3ACIA 4LIUA 5K0UB 3RZHA 1E5RA 5F2SA 2UURA 2E9QA 2B42B 3VLBB 2BWAA 3B02A 4UW4A 2Y6JA 5L9RA 5J48A 3LQCA 3KCXA 1BVVA 3EHKA 2DCTA 1R081 2PYTA 5IVFA 3VBHA 3AYCA 3JU9A 4AFMA 4XOGA 4GB33 1MEC2 1QOSA 2QQKA 4Y22A 5D8AC 2P3JA 1HRV3 3ZN6A 3FMGA 2IXIA 3Q8BA 1NCRC 4JGZC 1QJY2 4Z2AA 4I3GA 1NG0A 4HKWA 2A3XA 1D0HA 2A1XA 4XJWA 2EF6A 3POSA 2WR9A 4YVWC 2A7AA 2EIEA 1V6LA 3WQ0A 4BE3A 4NROA 3VHNA 2Q8CA 1T2XA 2FMYA 3M4FA 5CAZA 2YBKA 3WDXA 4Q4Y1 4N43C 2B45X 4CDXC 3BU0A 1W6PA 3H50A 3HR9A 2HWD3 3JUUA 4LK6A 4AFDA 5C3OA 3E6CC 5H9QA 3DPRB 3I2KA 2VMGA 1NZCA 3M8LA 1R092 2R6QA 5DG2A 4Z1VA 2ORZA 3OUIA 2JG9C 4DINB 3WQ1A 1QHDA 3UKTA 2HEVF 5T55A 2IVIB 4M0HA 3HJRA 4AHYA 3VZKA 3H8XA 5E89A 1SLTA 2YBPA 4MXWB 4Q0SA 4XFIA 3N7JA 3LEMA 4NHLA 3IAPA 2RM23 3C7HA 3ZR5A 2O8OA 3BU7A 2V4AA 3TOJA 5FZ1A 4FOYA 3WNNA 1OQ1A 2AACA 3ZYHA 5C33A 4NOTA 4DMIA 2ZJCA 2R0HA 4E4SA 4CEYB 2ZGNA 4C1WA 5EZWA 1MPXA 2XGXA 1U5YA 3FLTA 4CCCA 5BNOC 4NE9A 1GOHA 1TE1B 2ZGMA 4QPIB 4HANA 4I0BA 4YZ5A 1PO23 1H2NA 1ZX5A 1OVSA 1XSRA 1F4AA 2VQ0A 2YPJA 3TN91 1YFUA 1AL21 1DGWX 4P02B 1JUIA 1J1LA 3PHMA 3A0NA 3IMNA 4LJHA 5GZGA 1W05A 3WNLA 4PBPA 1BMV2 1RUF1 1HX6A 1RUG2 1PO13 3L2YA 4A44A 4DB5A 1J59A 1BEV3 2RMU2 1JMUB 4R8HA 2A6WA 4NUBA 4RL7A 4PDWB 4A7ZA 5CKNA 4NJ4A 1UN1A 4LEJA 3NRUA 5F5CA 2GC3A 2VUCA 3LDRA 3KT1A 4CDWA 1WCDJ 5ANNA 1HQWA 1XU1A 2YPDA 2Q30A 1XSQA 3AP6A 2F6BA 3I97A 3BPSA 3T08A 2F4LA 2YU1A 2YV8A 5LA2A 4Y24A 4LBQD 2D93A 3WG2A 5A1LA 3AKQA 3WDWA 3NAPC 3UYJA 1J3PA 4AQ2A 4A4AA 3K4DA 4QDSA 5BNPC 4OZXA 2P1BA 2X10A 3DYPA 2VAUA 3FE5A 1RMU3 4IEQA 1YHFA 2CAVA 3ZFEB 2WS92 2XLFA 3ACGA 2PHUA 2ARXA 5EFUA 4FP3A 3H1WA 3ETPA 2C4XA 2ZOEB 3HQXA 2WNVC 1YFYA 4D7TA 4LKSA 3IBMA 3J7HA 2J1UA 1LENA 3AMQA 4XF1A 2FMDA 2G9GA 5C70A 3O1PA 5DQ0A 2FD8A 4QM9A 2C26A 5HCFA 1TG7A 2HBUA 3IMMA 4MZUA 4I0WB 3D0SA 2VM9A 3AKTA 4IGPA 4RGAA 3WF2A 2Y6LA 2A6VA 2IXKA 3SKJE 1AYN1 1X82A 2P3KA 3P5BA 4HFSA 2CWMA 3WHTA 4CEWC 3R6SA 4HOOA 1BXHA 1EY2A 3HVDA 1BBT1 1MS3A 2X09A 4R9BA 2PAMA 4GAZA 5GLVA 1FOD3 3VBOA 3WINE 1AZDA 2CDPA 5DXDA 5FZMA 2BDRA 1XQNA 4XCBA 5LASA 5DUWA 2HWC1 2WSVA 3KV9A 1NLQA 3D3AA 3OY8A 1QJU2 5ABJB 1VRH3 2AEYA 2BERA 4DUWA 5KC5A 1UY1A 5FYZA 5FMCA 5HPOA 1DZQA 4UF0A 2QQMA 3WZ1A 3FBYA 4C90A 1K5MC 4BXSV 2X8KA 1CJPA 3U37A 3UETA 4TSVA 5A3OA 4FFHA 2FZ2A 4JDMA 4LBJA 1WCSA 2X5IC 1CIWA 1IKQA 1OQDA 1UMHA 3PDQA 3J9SA 4OLLA 5LBFA 1YLLA 2NMOA 2WNOA 2A3YA 2QE3A 2V09A 3ACHA 5A7OA 4YVSA 4PLMA 1UYYA 2G19A 1L7QA 4QB2A 2K9ZA 2JE7A 2VTXA 2VZQA 4CCLA 2JWPA 3ZO0B 2WZR2 4XC9A 2Z69A 2WNUA 2WQZC 1OD3A 2DTYA 1OPMA 2E32A 4QB1A 1S0EA 5KHGA 1RUJ3 3CBNA 4LKDA 3U1XA 4DIQA 1W06A 5LY2A 2P34A 2VMIA 5GZFA 1DGRN 2MEV1 5EJZB 4A42A 1NCQA 3RRDA 1Q8QA 2NZ9A 4CP9A 4MGTA 1P8JA 1JHJA 1F15A 3OYWA 3IN9A 1ND3C 5T52A 1ENSA 3NJXA 3ZFGC 4HSLA 2AR6A 3CNAA 5DZFA 2VNVA 4P9GA 3H7YA 5GLZA 1FPN1 3WCSA 1Y43B 3C7GA 3MLLA 4Y4YA 3T0DA 2CNAA 3J26N 5A3WA 4AE2A 1WLWA 4XURA 3BUCA 2OPWA 3THPA 5LEKA 4FSJA 1AHSA 1X9PA 1UO9A 4E27A 1GWMA 1MACA 3WW1A 2HLEA 1RUC3 1UW8A 1C8M2 3VHOA 5FZFA 5JZGC 1CESA 4S2FA 5F3EA 3RJRA 3AXEA 3T1LA 3FUOA 4DXTA 3Q8CA 1BLZA 2WLQA 2WSUA 3JQWA 1CAVB 2V73A 4BHPA 4WVWA 2W5FA 1RVF1 3CL1A 4IE5A 4CPBD 3P3PA 1X50A 3K51A 5DABA 3POJA 4E8CA 2ZCWA 2JG8A 2JKXA 1I6XA 1UY3A 4QGLA 2R071 4UT5A 3ALQA 4A3XA 5HXMA 1HB4A 1E5HA 2TBVA 3K4AA 5A3MA 3UL2A 1CD3G 2J22A 3I49A 4DXZA 5IJRA 4KL1A 1DGWA 2P2KA 3I3EA 4LO4B 4AEDA 2XLAA 2QQWA 4NIHA 1V6NA 1JZ5A 1FXZA 2DCYA 4QKFA 3ZYBA 1EAH2 4UXAA 2W95A 4AQTA 4XF0A 2GMMA 1VBA2 4IETA 4AI3A 1SLIA 2NM1A 3ACLA 5EPAA 1EUTA 3VB9A 1VIWB 3JBG1 4GWMA 1LB2A 5LEJA 4L2NA 5A33B 3RQ0A 4W8JA 2DFCA 5GZCA 2YB7A 2ZTNA 4RSUA 3B93A 3MGUA 5SV5A 3QLQA 1AVBA 4Z07A 2Z79A 5A1AA 1CIYA 5L19A 5A7WA 2ZEXA 1RUH2 5DAWA 3RJ2X 2O0OA 5C3SA 3V0BB 4EZHA 3HOBA 3OGJA 2K46A 1PIV1 1NA1A 2UYBA 4XUOA 2ZABA 2CDOA 4DZGA 1UZYA 1GANA 4M4PA 4DEVA 1YXWA 4CDQB 3ETQA 4CCMA 1WCKA 3CF6E 3NL1A 3POEA 2VZTA 3KV4A 5DDJ1 4LBMA 1QGLA 5CIRA 1Q43A 2RS33 4NWVA 4Q1RA 1DYOA 4IV1C 1WW4A 3AP7A 2ZHMA 1LOBA 2HWF2 3QACA 2GNTA 2XL7A 3VZMA 2VZOA 3M3EA 4NAMA 4FTBA 2KA3A 5H9RA 3I3BA 1OPOA 2XG3A 2E31A 2DU1A 1OKOA 1UIJA 1Z0HA 5LWBA 1W2AX 1R64A 4L9BA 4LORA 1JYTA 3PJYA 2VJXA 1GQGA 2WWSA 1WA6X 5LRRA 4EN0A 1JOBA 3ELNA 4XUQA 4YM3A 1AR71 4GJYA 2DWRA 3MYXA 3PU8A 4FI9A 1N1SA 3U4XA 4IV3A 1REFA 3ZR6A 4DO0A 1AXZA 3MIHA 5FYUA 4ZZ5A 3K75B 5C9AA 2DCKA 5K0UA 4GB32 4EN7B 4CCNA 4K3UA 1UX6A 1SACA 1VALA 3EB7A 3NKGA 4P9IA 1HRV2 5ACA3 1GBGA 2CAUA 2R32A 3PIJA 3AYAA 2Q1MA 5JCTA 3N35A 2EXKA 3C7OA 4LUKA 1UMZA 2EIGA 1YIFA 4M3CF 4XDQA 5T5JA 1GQPA 1HJFA 2A73B 1HQNA 1ZM1A 2W46A 1IS5A 1YUDA 3W21A 4A7YA 2Z42A 3OEAA 1VBC3 4C0HA 3POFA 2XJVA 3I8TA 2HWD2 2ZS6B 4FP2A 4LBKA 5CNAA 4ASKA 4N53B 3GJAA 4DRRA 2VVFA 1TME1 1UZWA 4E8DA 1GWLA 1UU6A 3O0VA 1HKDA 1XPWA 2D97A 3O0WA 5FZ7A 2VE1A 4IEOA 3NJZA 4XFGA 3HBZA 1HLCA 1IS6A 3APBA 1UD1A 3ABZA 3B9IA 3M3IA 2VZUA 4H7MA 3HQRA 5FLJA 1AR83 4Y3OA 4FPFA 5FZHA 2ZGPA 4CYDA 1B35B 4N7UA 2BP6A 2ZEZA 3AP9A 4GJZA 3T2OA 4BWOA 1ZNPA 3DPRA 1JZ4A 1ASJ1 3O7OA 5JSPA 2RM22 1OFNA 1IS4A 2JD9A 1W8NA 4R9CA 1W9FA 1PMIA 1V9U1 2ZEWA 2NP0A 4WZCA 3IIAA 2ENRA 3KCYA 2HWE3 3TEWA 4LMFA 3OUJA 1YWKA 4JKKA 1POV0 2RG4A 1VBE1 4D0QA 4MXWA 1F5JA 1JZ7A 1UZ0A 1IOAA 1VB4A 2DYCA 2QQNA 5FK8A 4UFMA 3TRSB 4AHZA 1C28A 2DURA 5F5AA 4HN0A 5F3IA 1AR93 5JVVA 1ZA7A 4XW3A 4AYUA 1UXXX 5IVEA 3NNMA 3VKMA 4FPCA 1PO22 4QMAA 1O59A 4J25A 1CAXB 4LR4A 1R1A3 1NZIA 2EXHA 4LHLA 3AL5A 1SMVA 5FY7A 5CKQA 2R041 4CP0A 5FZBA 2VW2A 4CEYA 3HT2A 4FFFA 4CDUB 2ZX0A 1LOFA 2SLIA 3A0KA 4LA2A 3HBKA 3OPWA 5FP8A 4DNYA 3WG4A 5EQUA 3M7AA 4QPIA 2HWB1 1URXA 1PO12 1R1ZA 2XOMA 3AXDA 1BEV2 1C5HA 2HH9A 1NUKA 4D8MA 3VUOA 4CDWC 1LGCA 1Q8PA 1YJLA 1AXYA 2PLV1 2VL4A 2ZGQA 1C1LA 1UQXA 1W6NB 4FAHA 1OLRA 3PJQA 2DVDA 1J83A 2PFWA 4BDVB 1TVGA 1PX3A 3VZJA 4FXKB 3DEMA 4OCTA 5L9BA 4B1MA 1DP0A 4PDWA 1RMU2 3KVBA 1ULFA 2XJPA 2BZDA 2WO2A 5T5LA 4UI9L 1H9PA 1SBEA 1YQ5A 4DQAA 5BNNB 1EYBA 1LGNA 1WLTA 2PTMA 3C3VA 3PUSA 3MIFA 4LK7A 3B00A 4XXPA 1OH4A 4GALA 5EV7A 4OQ9A 2IZWA 1J84A 3BB6A 4AI1A 4WVMB 3N9PA 1HIXA 3T4VA 1HJGA 3KV5A 3MF9A 5AC93 5JOZA 1DHKB 1QXPA 1SEFA 4O9GA 4XZPA 2X05A 3VDDB 3WDVA 1DYKA 3U11A 5F3GA 1VE0A 2OT7A 3JD73 5GLTA 4PQQA 1POV3 2QNKA 5A7QA 2VQUA 4IEXA 1WW5A 2WBKA 2DV9A 2WINB 2FDKA 3A7QA 4UW3A 3NV1A 3VBOC 5FYIA 5LA1A 1ZZ9A 4IUGA 1IPJA 3AKRA 4WM8B 2LALA 4AXOA 3ENRA 1WMFA 1FOD2 5IVYA 4EQVA 4BLJA 2ET1A 3WF1A 1OD5A 1DG6A 4META 4JHZA 3RFRA 3U75A 3VGIA 4COVA 1FMD3 3VHRA 3SH5A 2ZGTA 3NQHA 5APAA 1OKQA 1ENQA 1QJY1 2AZ5A 2RS11 4XETA 3WP3A 5IATA 2NN8A 1PM7A 3NNGA 1V6OA 4Q4X3 2XVGA 5FZLA 5LA0A 2QVSB 3ZX7A 4K8FA 1VRH2 4RHV3 3ZKUA 4XJAA 4HMZA 3KT7A 5LA9A 3WCRA 4BU2A 3WEZA 3PVOA 1BCXA 1UMIA 4W6YA 3FFZA 1HN0A 1WZXA 2Y6KA 4TXWA 1JYVA 5B4XA 1DQ6A 2KD7A 2LS6A 4V1PA 3PVEA 2OA2A 1R091 4JCKA 2XJUA 1DZTA 1WCUA 1KXGA 1PZ8A 4GWJA 3QH6A 4YVSC 1JZ3A 3N7KA 1MS5A 1LU2A 1H4GA 1BHGA 1XJAA 2VVEA 3RI9A 2WNUC 5F6KA 1WW6A 5L9VA 5A3NA 1AJKA 2YMZA 5GKAC 2WRAA 3OF1A 1K45A 1XBFA 5F39A 3MDPA 4YARA 4LO8A 1WKYA 1RUJ2 3KLSA 3AVSA 5C6CA 3ZXGA 4PHZA 1RJ8A 1DQ2A 1L3JA 1NCQC 5FPBA 2BNOA 1OT5A 4Y1ZA 1R083 1V0AA 2WZ8A 2VCAA 3OGVA 4OHVA 2N7GA 3SHRA 2V5YA 4AL9A 3H8RA 3J8F1 4GQ7A 4L99A 1J1TA 4D7SA 3VD7A 5DMYA 1N1TA 4GH4B 1HRI3 5D21A 2RJLA 1WMDA 4S2DA 2YC0A 4YM2A 1DFQA 5CA6A 1JTZX 2AGSA 1BYHA 3CMGA 5CVRA 5JOWA 1U12A 4I01A 3UJOA 3ZMOA 2CY6A 3V65A 2JE8A 3B3QE 3T1MA 4I02A 5L73A 2JDYA 1S2EA 1JHNA 1Z78A 2I2SA 2JDKA 1RUC2 2Y0IA 2YGLA 1VMJA 3H3LA 4OMCA 3VD3A 5JSRA 2UY9A 1RUG1 1VBD2 1ENXA 3F95A 4COYA 3MO4A 2RV9A 1DBNA 1RITA 5ERLA 5T5OA 1OSGA 1XNDA 4Y1XA 2P4EA 3PUQA 4XXAA 3S30A 2QQUA 2K0GA 3VBFB 3USSA 1V6MA 4QHZA 4XVHA 3WY6A 2W3JA 4EJRA 5FPZA 1LU1A 1QJX2 4AEDC 4FTSA 5KHKA 5LB6A 4MSVA 1SFPA 2D3SA 1LKNA 2VZPA 3KS7A 3ZXLA 4XUPA 1CAVA 3S0MA 3ZYIB 3VBUB 4U36A 3O5SA 2YXSA 4YFWA 2NYYA 3POWA 4C1XA 4FAGA 1H2MA 1Y9GA 2Q5TA 2W1UA 2PHWA 5FPXA 3CKHA 3Q8AA 4FT8A 4WM7A 1MZEA 4XQDA 3ZIWA 2GMPA 4EWDA 2OZ6A 4YW1A 2DVFA 5CB7A 4LO5B 4AGVA 4IE0A 2WO1A 3AZZA 2GU9A 1O8SA 2FDJA 2VTXJ 1C8NA 3WP4A 4AOCA 4AW7A 5FZ4A 4E2GA 4D94A 4D69A 4XE9A 1SPPB 3LCPA 5DN2A 4CCEA 1FNZA 1COV1 1DQ5A 3TN93 1AL23 4HONA 4EN9B 1YRZA 5A33A 5TSWA 1MS8A 3SCFA 2VD7A 4YW2A 3SC7X 3FLPA 4FPYA 3RZZA 3MBWA 4M00A 2ILMA 3NV4A 2BGCA 4CSWA 1V6IA 1VBB1 2WT2A 4QHOA 4YGEA 1Y9MA 4P5HA 1X7NA 5JXHA 5KWRA 1NLSA 3I3MA 3CZJA 3V0BA 1BVP1 1ZYBA 2VZ1A 4AZZA 3D4KA 1REEA 1QJU1 2WT1A 5HI0A 4UFIA 2RS32 1RUOA 1PVC1 3FBMA 3PTYA 1FX5A 2DTWA 4CDQA 1KDKA 3GNEA 2EVXA 5LK7B 1SHWB 2DCJA 4ISRA 5JWPA 3GCXA 3DL3A 3J4UH 5FPLA 3V64A 3E5QA 2D98A 3GBGA 3ORJA 3RDIA 3IDBB 4V2WA 5FAXA 5A80A 1TNFA 2I45A 3QH7A 4FO9A 4YRDA 5FPUA 4FCAA 2I07B 3MZHA 2P3YA 1DF0A 4O61A 2UWBA 3QCWA 3CU7A 5FUNA 3ZFFC 4RGKA 4IV3C 2JDHA 1RUE3 3N9QA 4PI0A 1DCSA 2OZJA 2TNFA 3A4UA 5K0UC 1A78A 2BQPA 2JICA 1AJOA 3G7DA 5DZEA 2EAKA 1W8ZA 2PQSA 1RUD1 1PHMA 4HVOA 1JYIA 4XACA 5LATA 2OVUA 1YO8A 5ACA2 2WABA 1O3QA 1W2UA 3HNYM 1JI6A 3NKTA 4K7JA 3OPTA 4TZDA 4EWEA 1HB1A 2ET7A 2ZZQA 5FCCA 4QQOA 4YYOA 3THTA 1MQTC 2P17A 2EALA 4M01A 2VZ3A 4V2VA 2RE9A 3EBRA 2O14A 3VKFC 1SBFA 2DDUA 3B7MA 3C7FA 3FJSA 4NHKA 3O1SA 2W1QA 2KXLA 1EUUA 3INAA 4LO7A 4YW6A 2HWC3 2W91A 4Y4RA 4BCUA 4YG0A 1TNRA 4LE3A 2CSGA 2Y26A 3IIIA 1W6QB 3OGRA 2X29A 3HQUA 1FI2A 1UKGA 1VBC2 5IFTA 2ZX2A 2ZAAA 1W9SA 5FY0A 5K4LA 4B4RA 5JR2A 5ISLA 2OQ7A 4QU2A 5FYHA 5ANQA 1CX1A 3QBQA 3ITQA 4TTGA 3LSDA 1NX9A 1UZVA 1CX4A 1UU5A 4HETA 4G9SB 5C8CB 1AR82 2QQPA 3DPRC 2ADEA 4RFRB 2BWCA 3EQEA 4N53A 4AAXA 4E9KA 4P08A 2E7AA 1S0IA 1UOGA 4INDA 2VMCA 1QH6A 2OS2A 4ZHNA 4ES8A 4IE6A 2WNEA 3T30A 2HWE2 3WDTA 1W04A 3DYMA 1LHWA 3UNPA 1GZ9A 1W0NA 1WD4A 4NPRA 1KQRA 4AWDA 2A6XA 5L7OB 1CN1A 1B35A 2E63A 4A7KA 4QM8A 4JV4A 3WP5A 1VBA1 4IW3A 1AR92 2CGPA 1NY72 4N7IA 4UFLA 1PK6B 5C4WB 5CISA 2R16A 1H6XA 3NJVA 4XFBA 3LPFA 3M1HA 3N9NA 1R1A2 2D5HA 2BEOA 1PGW2 3ASIA 3CHXA 2C0ZA 3E1F1 1LOFC 4ZS2A 4AAPA 3ILRA 4S2HA 1GUIA 4Q0VA 4AI8A 4BH9A 2XKOA 5C3RA 1GLHA 2JIGA 4F3JA 5HV0A 2BGPA 5CBLA 1WBFA 1CAXA 1D4VB 1ZZBA 2ERFA 2JENA 2ZGRA 4YGBA 3FN9A 1CZSA 2VZVA 3N7MA 4YLZA 4S2GA 5FZGA 3N4MA 5FZIA 4CDUA 4ZKTB 4FPEA 3WDUA 2YC4A 4LULA 1PM4A 1QIQA 2XJQA 2WYSA 4BQWA 5CG8A 1REDA 2D7FA 2R1DA 2W52A 3HMYA 2WDBA 5FP3A 3BKZA 4D6QA 2Z2SB 4PDWC 4BZ4A 1YQ2A 1C1FA 1NOVA 4ITCA 4BK5A 4CUBA 5BY5A 3T0AA 5CG9A 2ZGUA 3FHIB 1GV9A 2ZGKA 5FWJA 3AM2A 1W6NA 2R073 3BPZA 2Y6HA 3CLPA 4DY3A 1TEIA 2HWF1 2DBIA 3WHUA 1QMJA 5HCAA 1GNYA 5J37A 2YG0A 4LA3A 1X33A 2JD4A 1I5ZA 5CKMA 4Y5SA 2RHPA 4QXCA 3SNMA 4FBFA 5AC92 1HXS3 2BU9A 4OULA 4BIOA 1WLDA 3HN1A 4LNVA 4XMIA 3U14A 5IVJA 5BNNA 2OPKA 3JD72 5FXZA 2QCSB 1Q3EA 4SLIA 3GXUA 3H7JA 5FZEA 3JBG3 3ZSJA 1NE6A 4WVMA 4AGGA 4N8MA 3WG1A 3VDDA 4GB31 3PUHA 2B7YA 4XIKA 3ZXKA 3PTRB 4XAEA 1HV1A 1JW6A 1SFNA 4H55A 3GBFA 3ZSMA 1FMD2 2XJTA 3P1IA 5FZDA 4Q29A 5A6QA 5F37A 1Z7S1 3AP4A 2D3PA 4LKFA 3VL8A 4IDZA 5JOYA 1VAMA 4Q4X2 1I1EA 1HQLA 2CGOA 3MPPG 2BFUS 4RHV2 3KVAA 2J42A 5FV3A 4WM8A 1VPHA 1XNCA 4I3PA 3BI3A 4HK9A 3KZ4C 3ILFA 4YW3A 4IEUA 3ZYGA 1YC61 3T4HB 4N9IA 3T0BA 3LD8A 3UKVA 3ZIXA 3RYRA 4QX7A 4B8EA 5FYBA 2PMWB 1LHVA 3N9MA 3GALA 1O3TA 3I2GA 1H9WA 5HCHA 4I30A 5D2AA 3RZLA 4CP2A 5CYYA 4JHTA 1ZZ8A 4NWWA 1TMF3 2Q0AA 1ZA4A 1LESA 4RYDA 1BJQA 3BCWA 2FDFA 2PN5A 1S55A 1CPNA 1ULEA 2NLRA 1ULCA 3LWCA 4QPYA 3ROUA 3F2ZA 3RYPA 4UFJA 3W58A 3LDKA 2RM21 1ONAA 3HD8B 5A7PA 2B9VA 4FTEA 2QZ2A 4Z92B 1VAKA 3GZAA 4QT6A 1R082 3PIGA 2VGDA 2UWAA 3POGA 5I0DA 1N47A 5FOJB 1G9BA 1RUI1 3GJBA 4FOVA 3T09A 1BZWA 2IXCA 1OA4A 2E33A 4Q26A 3VBRB 1VJ2A 1HRI2 4Q4V1 3RWKX 1PO21 3JB8A 1XNTA 4QPGB 4YFZA 2WO7A 4LBQB 2VCMA 5FMOS 1PMHX 2NPIA 1G9AA 2EIDA 1IPKA 1QQP3 3AZYA 3CO2A 5FZ0A 1VBD3 1Q56A 5AFBA 4M0NA 4MLOA 3KHCA 2DVAA 3GBWA 3C7EA 4GH4A 4COWA 5FO8B 4A45A 4P14A 4XF3A 4BPZA 3DCQA 3GZEA 5FYTA 1PO11 1ZBA3 5FWEA 1V70A 1BEV1 3K3NA 3THDA 3M3QA 1ZRFA 1O8PA 3CJIC 1Y3TA 1QJX3 3MV11 1TME3 2IWGB 2C9KA 4YZ4A 1W3XA 4AGRA 3CQOA 4P00B 5DUXA 1YFWA 3VD4A 5DAQA 1S0GA 3PMSA 2VUJA 2C6SA 1QU0A 1ZZCA 3Q8EA 4COZA 1HN1A 1RMU1 1ASJ3 4JKMA 4CCDA 3VBFA 1LJ7A 4QX0A 1F8VA 4WM7C 4GKXA 5T50A 1DLCA 1V9U3 1W9WA 2J1VA 3KGZA 2Q1FA 3O1TA 1G86A 3BODA 2ZZJA 4PLOA 4F7ZA 1V6JA 2WA4A 1FV2A 3HWJA 1VBE3 5FZ9A 5BV6A 4YM1A 1F35A 3PLQA 2BBAA 5FZ8A 2XQXA 3AJZA 1F2NA 3AB0A 3VBUA 2GMEA 4AI9A 2H0BA 2R061 2LW8A 1LOAA 4DEQA 4NPMA 4XFCA 2CYFA 1W9YA 4XEZA 2XBO1 2IXHA 1MR5A 4KBBA 4B29A 1W03A 3NNFA 3TN92 1AL22 4D6RA 2R043 1AX2A 1BQPA 4PQ9A 4QXBA 3ZSKA 5HBAA 3BIEA 2VECA 2RR13 3DN7A 4COUA 5A6ZA 3JXSA 1CJDA 2A6ZA 2WFF1 5A6YA 5CFDB 2HWB3 1LODA 5HV4A 3DF0A 1D4M1 1RUF2 5JPMB 3VZOA 1SPPA 5KBFA 1VMHA 2W94A 3I2OA 3ES4A 4FQ4A 1LEMA 5GLWA 4M3CB 2ZACA 1DQ0A 4Y1UA 4CA9A 1V00A 4IEVA 5IK4A 3FC0A 4CDQC 5FKBA 5KXBA 1KS4A 4KU7A 3BALA 4Q0UA 3UGFA 4AVVA 5I0UA 2WIIB 3OBAA 2GC1A 1N1YA 5T54A 2YZ4A 4JGYB 2A75A 4OUEA 4KGGA 1EV13 4KMQA 1ZRIA 4FFIA 1JU4A 4QX8A 4P9LA 4AVAA 4AHWA 1GP6A 1K5JA 4NN0A 2J1AA 2RS51 4ARYA 1IQAA 4YM0A 3AKPA 4DOUA 2QFEA 1PZ9A 3VBHC 1IZ3A 3MUZ1 4Y26A 3V56A 3WOGA 5GLUA 3J7MA 4AK3A 3UV9A 4EN8B 1JYNA 4MG2A 1XOYA 1D2QA 1RUE2 1G7YA 3MFCA 2G9ZA 2WN3A 1CAWB 2VNOA 5JMOA 5DG1A 3IAQA 1MS1A 5JXGA 1OLMA 3AK0A 2XONA 4GIQA 3VZLA 3BN6A 1YJKA 4MADA 1UCXA 1ZZ6A 1YQ6A 3O1OA 4URTA 2CTVA 1H6YA 2JX9A 3IWZA 2XQRA 1S1AA 3RI8A 4CXWA 1WMEA 2EAAA 3MW2A 3JB4C 5FTTC 3H1MA 4XJ9A 5J96B 1PGL2 4OI0A 3PURA 1O6UA 2W1WA 4FPHA 5DUVA 3VN4A 2RS13 1XYOA 2HWC2 1FYUA 1ULDA 2GH2A 2W47A 3KQ4B 4Q5OA 4NIIA 4B7EA 3OBZA 5FPVA 3AX4A 3HNMA 2MPFA 2WA3A 3LIGA 4PCRA 3WVJA 5F2WA 3ES1A 2PQQA 4Y5TA 3OGGA 1RUC1 5FY1A 5IK8A 2CL2A 2F4PA 5IK5A 3IPVB 3NMBA 4Q2FA 4TWTA 5EHDA 2ZBJA 2BYVE 2HEYF 2XH6A 5I0TA 1ALYA 2AYHA 2PA7A 1HV0A 2YC2A 3QD6A 4N9HA 1W6QA 4CTEA 3SCGA 4ASMB 4N53C 5GZDA 2XR4A 3K3OA 1MVEA 3IDAA 5DUUA 4YW5A 3URFA 4GULA 1OA2A 1S2BA 3OSDA 1QDCA 1D2SA 1OUSA 2RDSA 3H3UA 3I59B 4PF1A 2ZAHA 3OB8A 4RR3B 4NIDA 1H8VA 1PMJX 1XE7A 3GHNA 5EXOA 2ZHNA 4I0AA 5AFEA 5C3QA 5C8CA 2XHNA 1B35C 4AQ6A 3S5AA 2RDNA 2D6LX 2OQ6A 2WFPA 4CP1A 2XWJB 3GDBA 1X36A 4AI0A 5L36A 1NYWA 4DS0A 2C24A 1Q8VA 1OOPB 1QNWA 2OUJA 4BM8A 4Q1PA 2GP5A 2XMLA 1N3PA 4GWIA 4K8RB 3G6JB 4EE2A 4AQSA 3EJKA 2W2IA 3H3ZA 2WUHA 3SQOA 2W08A 3J8F3 4KWKA 5L7OA 5BNQA 1ND2B 2PXJA 2R7EB 1F4HA 1X8EA 5IVBA 3ZMNA 4HG6B 4JRLA 5JSOA 4IEWA 1JZ8A 5KHHA 1NE4A 1PK6A 2ZA9A 2EIBA 5C4WA 1A34A 2Q4SA 1CQ9A 1FT9A 2DCZA 1W99A 4LITA 2IFRA 4W50A 3OG2A 3VKNA 3BGAA 4CDUC 1JZ6A 1GZWB 1W2OA 3ST7A 1ZBE3 4FQZA 1N1VA 4NAOA 3RMXA 2FHRA 3ZLIA 1A6CA 2GNBA 5I91A 4XABA 4BLIA 5A3TA 3V0AB 3W9AA 5JXIA 3AMHA 3FX3A 3RG0A 4RQPB 3SKVA 4X8PA 2VW1A 2PHLA 4XIOA 2TUNA 3PNAA 2RS31 5I8TA 5KXCA 3WSOA 1WD3A 2JXAA 1K12A 5A1FA 3HIFA 5C3PA 2VOTA 2R072 4Q4W1 3SXWA 1O4TA 2EXJA 3FZ3A 2H6CA 4QKNA 4EZ4A 4OI4A 4J1WA 1UXZA 1S0JA 4Y20B 3ZFEA 5FYYA 3UGHA 4W65A 1UYXA 2G1MA 1HXS2 4H3WA 4KGQA 1AYM3 3ZYPA 5BNNC 1SZBA 1WWYA 3M2MA 1OURA 2JEMA 1G9DA 3KV6A 4PIYA 2VMFA 3MICA 2VH9A 4A41A 4K20A 3PVBB 2WN2A 4FPGA 1HB2A 4H7LA 4NRPA 2D6MA 2D6KA 2QQJA 3JBG2 1MEC1 5FYCA 3VDDC 1JU3A 2GAUA 3X29B 4LXLA 5E8AA 5JLVA 1UIKA 4NRMA 4LTAA 1CPMA 4OUMA 4BQ3A 5LBCA 1NLRA 2W39A 3IB3A 3PVNA 4XAAA 1H8TB 1RUNA 5GALA 3LE0A 1WCQA 1COV3 3VL9A 1OMIA 2UWCA 5F1RA 4KG0A 3WUCA 1JH5A 5I8YA 1IS3A 1C57A 4KU8A 4WM8C 3DYOA 2YROA 3LF7A 2WAAA 1QOTA 4MGSA 4ISQA 1TZOA 2JDNA 3OCPA 4LT5A 1VBB3 1MVQA 4MOAA 3CDZB 2GNDA 2ZX3A 4R9DA 3WD5A 4BOWA 4CXXA 1RHI3 5DDJ2 5ABJA 2GZWA 5FREA 3FHAA 4MUVA 1AR63 2XHKA 1JS9A 4BQ4A 2PHDA 2SBAA 4OI2A 3D8CA 3ILNA 4GMP1 1GKBA 4ZXKA 1PVC3 1IG0A 3OBRA 3LA2A 2A70A 4QX1A 4QX2A 3U4SA 2VC9A 3NVCA 1VB2A 2OX0A 4OUSA 1O5UA 2WLPA 2YUEA 5M0TA 3WV6A 1TMF2 1W8TA 2WQ8A 3CJXA 4CXYA 1AR81 2Y6GA 5LZ6A 2JDMA 2J1TA 3I2JA 4O9EA 3VBSB 1OF4A 3K77A 5CFCB 3LEKA 1UPIA 4XHBA 5FZOB 2PAEA 4HL0A 1GQHA 3N9OA 4KWUA 5FPAA 3AVRA 2ARCA 3NSTA 1NQDA 2FDGA 1GP4A 2HWE1 1CONA 4ZONA 3CIHA 5FBZA 2JDUA 1Q8SA 3DXTA 5LBBA 1W0OA 3ZKYA 1W8WA 1RUD3 3WQ7A 3ZXDA 1LRHA 5FQ0B 1LOCA 1QOOA 1UZZA 4QDQA 5J3UA 1HB3A 4H14A 4Y33A 2ZX1A 1PGW1 2NMNA 2IC1A 5LY1A 4LLOA 1LECA 2B4KA 1QQP2 4GH4C 1BMV1 4KH9A 2CV6A 3O1MA 2GC0A 2L9LA 4Q4Y3 2RMU1 4XDOA 1F9KA 3VBRA 1QY4A 2Y6FA 3MIDA 5FZ6A 4TLGA 2JG8C 1U0AA 3UK9A 1OHFA 1ZBA2 2W1SA 4QPGA 2Y60A 5JIAA 1ST8A 1OVPA 4LBQA 2WZEA 4ZZ8A 5SV8A 1QJFA 1TME2 3FFQA 3RMYA 2DF7A 1UY2A 2KR2A 1LOEA 3E97A 3D0JA 1RXFA 1DYPA 5H9PA 3RZJA 1GZTA 2WS91 5F6LB 2LUWA 1OF3A 2XB6C 3VBFC 3NV3A 5GJ6A 4D7YA 1ASJ2 1J3QA 3KCCA 3VKOA 1XNKA 2CHHA 1V9U2 3ZDSA 5C71A 3BTYA 1CGPA 1L7LA 2A6YA 4MGYE 1KITA 2A3WA 2Q1ZB 1XE8A 1O7FA 2HYXA 4B1LA 2WL1A 1VBE2 4HVRA 4WVZA 3VBUC 2BNNA 3VD5A 5AC91 5BUVA 1GR3A 3AYDA 3GGLA 4QQLA 4UFKA 4WV8A 3POIA 4X6QB 4CZSA 4GA9A 1DQ4A 2RDQA 4XFFA 4UBHA 3ZSEA 1LEDA 3DKQA 3KQRA 4GD4A 1NA1C 4XJ8A 1POV1 3H1YA 4EWAA 2ZHLA 1O4ZA 4ZXEA 2C1FA 3WUDA 2VZRA 5IFPA 3LOBA 3GYDA 3EO6A 1CR7A 4HVQA 5A7SA 1Y7BA 4P5YA 2DUQA 2R042 1FV3A 3P3NA 1FATA 1RUF3 4K9SA 4DUVA 2ZGOA 2RR12 1H1MA 3MI8A 3VKLA 3ATGA 5FXWA 4AVCA 2VR4A 1NAEA 1JYWA 1ULPA 2HWB2 5FP9A 3RYKA 5B4NA 1GNHA 1SG3A 2VPVA 4KQ7A 4RS5B 1QJZA 2ADDA 3WNOA 4AI2A 5C5TA 2WT0A 1S2KA 3LIHA 1H1IA 2FCUA 2GSYA 1F5FA 1W2NA 1H2LA 2BJSA 2XJRA 3N7LA 5FFOC 3HPNA 4MX3A 5CFDA 4ZS3A 5AVPA 4HZFA 3H42B 5JOXA 1LAJA 5IWFA 2HKXA 4KWLA 4OHXA 2YHJA 3OBTA 2LM3A 1NXMA 2D40A 2VQAA 3I7DA 1EV12 3OUHA 4M3CA 1U5ZA 2OXBA 1JYCA 4R4XA 3WNMA 4A3ZA 1CWPA 3ACFA 1HDKA 2O1QA 1KGYA 5FDBA 2XJSA 4R4ZA 1UU4A 2JB8A 3WW4A 2JDZA 1J58A 2WZR1 1H30A 4NHMA 4XUTA 2ZHKA 4R52A 5C9AC 3ZFFB 1SLLA 4YSFA 4JGYA 3W59A 1GWKA 3GM8A 3S6PA 4UYBA 3BOPA 2QKDA 2WKKA 5KXDA 1AYN3 3MIBA 4F8AA 3R4UA 5D8AB 4JDNA 1W8HA 4YGDA 3MUY1 4EYUA 1NCRB 1FAYA 4JGZB 1KJRA 1WA4A 5FYSA 1UKRA 3DXUA 3LPGA 1BBT3 4O7XA 1AUYA 4E4DX 2H0VA 2W92A 1I3HA 3THCA 5K7PA 4C91A 3MF6A 3DV8A 1US2A 1BK0A 4YVWB 4FOQA 5EYXA 3ZN5A 5F7UA 1CAWA 1V6KA 2R30A 1VAVA 1MQTB 2ZKNA 3ZXAC 1YYNA 2PHRA 3U78A 2FCVA 1HRI1 2ZMKA 4FPOB 3EMRA 3JQXA 2EICA 1C4RA 5E88A 1UOBA 4N43B 2WZPP 3TWIA 4CDXB 2RS12 1Z7S3 5J09A 4YG6A 4QXKA 4BMEA 2D6OX 3D5OA 1C8M1 2FZ1A 2XVKA 5LBEA 2JG9B 4AR2A 1CVNA 2EA7A 2F17A 1NQJA 3BYWA 4L97A 5GZEA 4AFBA 4DXSA 4J1XA 1IGOA 2P6CA 4CPBA 4QPWA 4OYUA 3SLIA 1K3IA 2YBSA 4ZY9A 4IL7A 1LR5A 4QX3A 1YFXA 4PI2A 3U0ZA 3B94A 4RN5A 4YW7A 2H6BA 3WQBA 1WW7A 2TEPA 3AZXA 1C3HA 5A7NA 5IYYA 5FUIA 3IPVA 5BYNA 5DAPA 5C8CC 3IKWA 5EYYA 2YFUA 1EAH1 3SCHA 4CUCA 3R0RA 1KEXA 5K8SA 5IK7A 1QNYA 3WX5A 1OXCA 5G04L 3T2TA 1ACCA 4CUAA 2IVJA 3JCIA 4XDPA 5BNOB 4ASLA 2MEV3 3TBDA 4J6GA 1GYKA 1M06G 5I8SA 3SH4A 4CCKA 4X8NA 4W6WA 1QXRA 2BOJA 3KM5A 2B46X 1RJ7A 1LHUA 3I59A 4IESA 2RDRA 4RR3A 4CEYC 1J3RA 3LB9A 1GICA 5FLHA 4FVVA 4IEZA 1S0BA 1YIPA 5L7OC 1JN2P 3TYJA 4QPIC 2DUPA 2JKBA 3ZYRA 1JXNA 2JDPA 1RUI3 2ZX4A 5D1IA 3VV1A 4QGMA 1FPN3 3UT0A 4BQYA 1RUH1 2OIIA 3J8F2 4JTNA 3J7LA 2VOVA 4NO4A 5K9YA 4ZU7A 4Q4V3 1PK6C 1OLQA 4G3YC 3WNXA 4QGNA 5C4WC 3I3QA 2G9FA 1OOPA 2JJ6A 2W9XA 4NMIA 3RVHA 4D6SA 5EIYB 5JXJA 3NO8A 3RGBA 3IZOA 4ARXA 1D0GA 5F3CA 3OD0A 4Y1VA 5JMCA 1ND2A 1XRUA 1ZBE2 1YCIA 2XVLA 3CZUA 3FHQA 4XILA 3NAPB 4CRQA 4XBLA 2CWSA 1RVF3 4LBNA 5LW9A 1T6GC 1VLNA 5BNPB 5FZKA 4QX5A 1IG3A 4XF9A 4I09A 4XUNA 4QB6A 2VXJA 1GZWA 1SQ4A 1ULOA 2WNVB 3O14A 5KR7A 4NHXA 4ES9A 1Y9QA 3V0AA 3HAGA 1XB9A 2KM2A 1SFYA 2BRTA 1NKGA 3ZFEC 5CZKA 1UF2C 1UY0A 1W2TA 2WYFA 3O12A 4TLFA 4RQPA 2VOXA 2BPA2 1RIRA 4L92A 1CAUB 4E2QA 5FLIA 1S4CA 4HPKB 3DKWA 5EJ1B 5KXEA 1AYM2 3K4ZA 3WNKA 3ZDVA 5T5PA 3RS6A 1A8DA 5JI9A 4Q8KA 3P6BA 1OI6A 2DVBA 4BQ1A 4CEWB 3FWEA 5FOBB 5FJHA 3LA7A 1RL3A 1RUE1 4CU8A 5FK7A 1W6OB 2LRPA 2Q8DA 1NXD1 4Y20A 5A3PA 1S0FA 2UU8A 1APNA 1HRV1 5FY4A 2R063 4AEJA 1I5PA 1DIWA 1I9RA 4YW4A 2IFWA 2Q8EA 4ORFA 2ZGSA 3A23A 4JVAA 1PIV3 3VZNA 2XBO3 4F83A 5GM0A 1COV2 3FL7A 2J7MA 3AZVA 1ENRA 3VD9A 1XNAA 2DVGA 3NWKA 2P5BA 4ZU4A 4OVEA 2D43A 2P6HA 1K5MB 5DDJ3 4NIGA 4W4ZA 2QQOA 2WFF3 4QAWA 4MGKE 1PGL1 5ABJC 1VBB2 1D4M3 1H8TA 2FQPA 5FP4A 5IHRA 1IPSA 2X5IB 3TB0A 4AVSA 2HWD1 3GHMA 3A21A 1RHI2 2W87A 1C5IA 3ZXFA 2QUOA 1AR62 4EV0A 5FO7B 4BQ5A 4LPLA 4Q0PA 3R4DB 4K1YA 2IXLA 4Z8BA 1PVC2 3MW3A 1O3SA 1PZ7A 2ATFA 2XUMA 3B5LB 4O65A 3WLUA 3PU3A 2V5DA 2UY8A 4UFHA 3I2DA 3RZMA 1L7RA 4UOJA 2CGNA 1YQ8A 1BK1A 4XCAA 3ZN4A 3U10A 1RC6A 1PGSA 1GZCA 2RS53 2QQVA 2VXRA 1SLBA 1AR73 4JC1A 2J1SA 1VMFA 1UY4A 1W6MB 3HT1A 3MW4A 4Y5Z0 5EJ3A 5A32B 2QQIA 2A71A 2DBNA 3EXUA 3D82A 4BQXA 1UYZA 2HJIA 4JDOA 1VP6A 2E6VA 3POBA 2XWBB 4IXLA 1SDWA 3AYEA 1ND3B 4FXGB 3BOWA 2YU2A 3AC0A 3ZFGB 3KWVA 2GH8A 2JB4A 2FDIA 2VUAA 4UWDA 3ZM8A 3VBSA 1UWWA 3TEZA 3LEGA 4L8QA 1LHOA 2I74A 4CU9A 2Y33A 5CFCA 5FZOA 1RUD2 3T2PA 5FJKA 4JQTA 5HCBA 4NPLA 1JUHA 4UBGA 5DAVA 3N9LA 2Z5WA 5FYVA 4JX0A 5KC6A 4CU7A 5JZGB 3N3HA 2LROA 2BVVA 3VBRC 2AUYA 3ON7A 3MV01 4PJYA 4OFGA 3O1VA 4QXHA 4HT1T 4Q27A 4Q4Y2 4I2OA 2PELA 4K6BA 2E7QA 2G4IA 3RNSA 1H4HA 4QPGC 5FQ0A 3H0OA 2WAOA 4Q0QA 5FXVA 2VQTA 3CJIB 2VCBA 1KJLA 2JE9A 4GWNA 4BK4A 3SH3A 2WJSA 3MLKA 4P9WA 1OC1A 3KSCA 4QHBA 5IUQA 4R9AA 2HBTA 4N90A 3DECA 4DPNA 4BXFA 1XU2A 3UKNA 4AVTA 3USUB 2VUDA 4QQ2A 3K48A 5LCWL 4Z2WA 2ZMNA 4AFAA 2FBEA 4B4QA 1WGPA 1KRIA 5F8PA 4W6XA 1ZRDA 3E5XA 4WVVA 2OUHA 4WM7B 2VBBA 3OTFA 5EWSA 2VCCA 3Q8FA 2GC2A 4CE8A 2VW0A 3GZUC 1PNGA 2PAKA 2C5DA 3FUQA 4XHXA 1HXS1 2K2SA 3AKSA 1XC6A 5E1RA 2J1EA 3LFMA 3R05A 1JBCA 4YG3A 1AF9A 2Z4FA 5A6XA 4A2UA 2QZ3A 4IGOA 2YY1A 2A5ZA 4UW5A 3IDCB 2ZXQA 1OUXA 3BTXA 2DFBA 3NJYA 1QKQA 1FOD1 5C7GA 1OLME 2Y64A 4HK8A 1O91A 1H2KA 2OW4A 5FY8A 3A22A 3HN3A 4IERA 2QDNA 2LTNA 1W8UA 4EN6B 4ZPIA 1VRH1 2PLV3 4DFSA 4BJ0A 4CCJA 4Z82A 4JAAA 4JZRA 2B39A 1XNBA 4IV1B 3I2FA 3QOPA 4IEPA 4LIVA 4IGQA 3L2HA 3K2OA 4OI1A 3PL0A 3AMMA 5A3UA 2OKXA 5CFDC 4GMP0 3PMEA 4XQ4A 4ET7A 2D6PA 4MHUA 3MIGA 2XKPA 5FXXA 4XBQA 2BGOA 4Y1YA 2BVBA 4RS5A 1KD7A 1E57A 3BTZA 2V4VA 4OZOA 4Q4W3 1SLCA 1G6NA 5I0SA 3VBHB 3WR0A 4KBZA 1POQA 4JGYC 3O1RA 2RJKA 3WP6A 5F5IA 2FCTA 1TMF1 1D7PM 3UJQA 1RUJ1 1SLAA 4Y22B 2Y38A 2VY0A 3ZN6B 4HXCA 4C8DA 1H1AA 1O3RA 2C9AA 1AYN2 3O1UA 3KF5A 4YZ1A 2ZKLA 4P9JA 5C8WA 3U07A 3AJYA 5JR7B 2AENA 2D6NA 4AFCA 4E4HA 1MEC3 4QQPA 1BBT2 3ZFFA 3LEIA 3CEWA 2AC1A 1GOFA 1H0BA 2YDEA 1SBDA 4LHNA 1DQ1A 5F9TA 1MS0A 5DPNA 5IVVA 1DGLA 3OEBA 1AL0G 1QWRA 2QQLA 4ZU5A 2P3IA 5FY5A 5D8AA 1JYXA 1QJY3 4OMDA 1NCRA 1W6PB 3RPQA 4JGZA 1E5IA 1Q8OA 4LBLA 1RGSA 3VDAA 3N36A 1K42A 1Z7S2 3WG3A 1QDOA 2BBVA 2BNMA 2XUEA 3I2HA 4NHYA 4YVWA 2D5FA 1QQP1 4UW6A 5DZGA 1A8MA 1G8WA 1VBD1 5J98B 1MQTA 3KD4A 3TAYA 2ARAA 5FYMA 4XJUA 3H8OA 4N43A 1R093 1STMA 4CDXA 1MS4A 1ZBA1 1Q5OA 1QF3A 5JI7A 1DZRA 4GMP3 1G9FA 2JIJA 5KHIA 2JDAA 2JG9A 4EROA 1QJX1 3MEPA 1JODA 2VG9A 1IQDC 3ZSLA 2VTFA 1W39A 2VOKA 4U2AA 3T3YA 4L0PA 4L11A 3H9AA 5FUPA 4AEKA 1GU3A 2VU9A 4HLTA 4JTOA 4XPVA 4XZUG 3WW3A 4IE4A 2X53S 2ZPXA 1Y4WA 3IM0A 4XFHA 3IT8A 5A3LA 2MEV2 4QU1A 2XPJA 1YI7A 1M4WA 2BV4A 1YQCA 1ZRRA 4FPJA 5B2GB 4RR3C 2D44A 1QH7A 3AP5A 3SISA 1LULA 4OQ8A 3S7EA 4IQPA 1AX1A 4MYEA 5FY9A 3E5UA 3LDBA 1YI9A 3M3OA 3I2IA 4C0BA 1W28A 3WF4A 1XXNA 1DGRA 2AEZA 3B01A 3NNLA 2FDHA 1RUI2 5BNOA 1ZRCA 1LCLA 5CU1A 1FPN2 2Y8KA 4CVUA 2BW8A 4AEMA 4E2SA 1O4YA 4JRAA 3RWNA 1GP5A 1KS5A 1OOPC 2MHFA 2RVAA 4M4RA 5A70A 4Q4V2 1F31A 3ZPYA 1RB8G 1BKZA 2ARBA 5IAXA 4CDWB 1GFF2 4X6RB 1W0PA 5J36A 5FBJA 5JIUA 1YEWA 3LKJA 2VVDA 2QBXA 4XTMA 2JECA 1ND2C 4DUXA 2Y34A 1RUG3 2VNGA 2RR11 2RMU3 2VZSA 3ZXEA 4QQHA 3C2UA 1A3KA 1GMMA 3EYPA 3UGGA 2QDRA 1RXGA 2E51A 5E16A 1RVF2 4TN7A 1XYNA 3C8XA 4FPLA 5LK5A 4BB3A 3S57A 1PX4A 4YVSB 5FMDA 2VBDA 5KHJA 1CZVA 2ETEA 3OJBA 4MO3M 3HNBM 4YWAA 4ATEA 4NRQA 2YYOA 3LSEA 3NAPA 5I0RA 5I93A 3OPZA 4RQPC 5FIXA 4BQ2A 5BNPA 3NW4A 2WS93 3Q9OA 5BPXA 1GNZA 2XXZA 5IAVA 4OHZA 4DXRA 1PNFA 1JOJA 3M70A 1EV11 1T6BX 3R4SA 4XJZA 2HYKA 4G4FA 4GKYA 3HEIA 2WNVA 4XBNA 1W8OA 4B7KA 1HW5A 4TYSA 3VBOB 1KDMA 2Y0OA 2ZEYA 4XTPA 1U5IA 4K21A 3PUAA 1CZTA 4SBVA 5IW0A 1CAUA 1EPZA 1ULGA 4HPKA 3MLJA 4DY5A 5J7MA 2D3RA 1OH3A 1O5LA 2WO3A 2R062 3ZPOA 1LHNA 4AF9A 3O0XA 5ACA1 2J1RA 4RD7A 3OY8B 3S7IA 3KT4A 5FZCA 4MGZE 4XF4A 1QJEA 1PIV2 2XBO2 1RTVA 4CEWA 4UF0B 2VMDA 1LOGA 4K1ZA 4XMAA 3WNPA 2B9UA 1XYPA 1W6OA 4GZ9A 4JQRA 4QDRA 1DDLA 1UYPA 4RGGA 4RFT0 3GZTB 4CU6A 4PIZA 4LOTA 2QTWB 1N3QA 2WWJA 1H8TC 3ECQA 1W90A 2GP3A 4LUMA 4K40A 5F5QA 1ODNA 2BOIA 2VBPA 1PVXA 1QJU3 1UAIA 2WFF2 1UPSA 4QKBA 4YNIA 3S5QA 1D4M2 4BYYA 2DUOA 1SCSA 1SDDB 1VBC1 4BIFA 4HN1A 3RZGA 5FRAA 4PLNA 1LTEA
chains in the Genus database with same CATH topology
2OYZA 2QJVA 1DLLA 1IHMA 4P9YA 2ES3A 1K5MA 4PIXA 5JAXA 4BMBA 4YZ2A 2BTVC 4XQWA 4KNCA 2WNUB 4LHKA 4YGCA 2X5IA 4GXLA 1ZREA 2GN7A 3MPBA 4XYXA 2YGMA 3DGTA 2RS52 4LBOA 1AR72 1NCQB 1TQ5A 4AG4A 2WZR3 2NQYA 3H8UA 4LO6B 3OYWB 4YZ3A 4QD2A 2Q8OA 1G9CA 2E53A 2GN3A 3SMHA 1U5XA 3BTAA 1KFUL 3RSJA 1AR91 3VBSC 1NY71 5CFCC 3B69A 4P9XA 4KG8A 3POYA 3WT3A 5JPNB 1W6MA 5A32A 2R0FA 2ZGLA 1R1A1 2BFUL 1MZ6A 5T3NA 1GSLA 1WUVA 2XL9A 2VULA 2B5HA 3LZZA 3LGRA 1ND3A 4Q8LA 4HKOA 4AVBA 5FO9B 4ONUA 1ZVFA 3ZFGA 5HXVA 1MZFA 1S0CA 1OQEA 4D3WA 3ZVXA 2BUKA 4WZFA 4ATFA 3IDEA 5H9SA 3ZYJB 2PHTA 2JG8B 1C8M3 1LGBA 1SCRA 1DU3D 2PHXA 5JZGA 1ZBE1 2AH2A 3MFAA 4AEDB 1KFXL 4MH0E 3I4IA 3TNQA 1RINA 1B09A 3JZVA 5BXXA 2VOWA 3GF6A 3AZWA 5CADA 2VNRA 3TNPB 1QXJA 3ME2A 1UL9A 3WDYA 3CJIA 3KGLA 4WBBA 2GDFA 1VR3A 1FNYA 3NV2A 3D6EA 4HSJA 1EP0A 3I54A 1X8MA 2WC2A 3AMNA 3WXPA 1OFSA 3BIWE 4M3CE 1EAH3 1N3OA 3KB5A 3AMPA 4HBNA 4LLFA 4MV2A 3MIEA 2R1BA 3USUA 1VBA3 2EXIA 2PHFA 3JD71 2AREA 4AHXA 1AYM1 1S0DA 3FLRA 5JDBA 2GNMA 3LA3A 2GALA 4XFAA 5FMOL 4OHWA 2R49A 1NA1B 2ZMLA 3L9JT 2HEWF 1EPWA 3E6DA 3SITA 4B3NA 3E6BA 3AFGA 4KWJA 2MNGA 3ZXJA 4PBOA 1RUH3 1ZZ7A 1FMD1 2W68A 1YNAA 1WBLA 1AX0A 2WQ4A 1OA3A 2W0XA 3LAGA 4NVPA 3B9CA 4Q4X1 5LRSA 4NR1A 2PLV2 4RHV1 2B8MA 4IEYA 3AFKA 2VMHA 4HKLA 4MGIE 4LE4A 2E7TA 4PF5A 1MS9A 2P37A 3KMHA 3VHPA 4RA0A 2IXJA 3M3CA 1AXKA 2DU0A 2UYAA 1RHI1 4RS5C 3DUIA 4FPKA 3WW2A 1AR61 1WLCA 2HWF3 4IV1A 5IT6A 4B4PA 4OHYA 4MXVA 4MVTA 4DRVA 1IKPA 2XLGA 5AVAA 4BA6A 4Q4W2 4IV3B 4FOWA 3OD4A 1MZ5A 4E4ZA 5C9AB 2O8QA 3LOIA 5K0UB 2UURA 2E9QA 2B42B 3VLBB 2BWAA 3B02A 4UW4A 5J48A 3KCXA 1BVVA 3EHKA 2DCTA 1R081 2PYTA 3VBHA 3AYCA 3JU9A 4AFMA 4XOGA 4GB33 1MEC2 1QOSA 4Y22A 5D8AC 2P3JA 1HRV3 3ZN6A 3FMGA 2IXIA 1NCRC 4JGZC 1QJY2 4I3GA 1NG0A 4HKWA 2A3XA 1D0HA 4XJWA 2EF6A 3POSA 4YVWC 2A7AA 1V6LA 3WQ0A 4BE3A 3VHNA 2FMYA 3M4FA 5CAZA 3WDXA 4Q4Y1 4N43C 2B45X 4CDXC 1W6PA 3H50A 3HR9A 2HWD3 3JUUA 4AFDA 3E6CC 5H9QA 3DPRB 4Z1VA 2VMGA 1NZCA 3M8LA 1R092 2R6QA 5DG2A 4DINB 2JG9C 3WQ1A 1QHDA 3UKTA 2HEVF 5T55A 4M0HA 4AHYA 3VZKA 5E89A 1SLTA 4MXWB 4Q0SA 4XFIA 3N7JA 4NHLA 2RM23 2O8OA 3BU7A 3TOJA 4FOYA 1OQ1A 5C33A 4NOTA 4DMIA 2ZJCA 2R0HA 4E4SA 4CEYB 2ZGNA 4C1WA 5EZWA 2XGXA 1U5YA 3FLTA 5BNOC 1TE1B 4QPIB 2ZGMA 4YZ5A 4HANA 4I0BA 1PO23 1H2NA 1ZX5A 2VQ0A 2YPJA 3TN91 1YFUA 1AL21 1DGWX 1JUIA 1J1LA 3PHMA 3A0NA 3IMNA 5GZGA 4PBPA 1BMV2 1RUF1 1HX6A 1RUG2 1PO13 3L2YA 4DB5A 1J59A 1BEV3 2RMU2 4R8HA 2A6WA 4RL7A 4PDWB 4A7ZA 1UN1A 4LEJA 2GC3A 4CDWA 3KT1A 1WCDJ 1HQWA 1XU1A 2Q30A 3AP6A 2F6BA 2YV8A 4Y24A 4LBQD 2D93A 3WG2A 3AKQA 3WDWA 3NAPC 1J3PA 4AQ2A 5BNPC 4OZXA 3FE5A 1RMU3 4IEQA 1YHFA 2CAVA 3ZFEB 2WS92 2XLFA 2PHUA 2ARXA 5EFUA 4FP3A 3H1WA 3HQXA 2ZOEB 2WNVC 1YFYA 4D7TA 3IBMA 3AMQA 1LENA 4XF1A 2FMDA 2G9GA 4QM9A 5HCFA 4MZUA 4I0WB 3D0SA 4RGAA 3AKTA 2A6VA 2IXKA 1AYN1 1X82A 2P3KA 4HFSA 2CWMA 3WHTA 4CEWC 3R6SA 1BXHA 1EY2A 1BBT1 1MS3A 4R9BA 3VBOA 2PAMA 5JI9A 5GLVA 1FOD3 3WINE 1AZDA 5DXDA 1XQNA 5DUWA 2HWC1 2WSVA 3OY8A 1QJU2 5ABJB 1VRH3 5KC5A 1DZQA 3WZ1A 3FBYA 4C90A 1K5MC 2X8KA 1CJPA 4TSVA 2FZ2A 4JDMA 4LBJA 1WCSA 2X5IC 1CIWA 1IKQA 1OQDA 4OLLA 3J9SA 1YLLA 2NMOA 2A3YA 2QE3A 2V09A 4YVSA 4PLMA 2K9ZA 2JE7A 3ZO0B 2WZR2 2Z69A 2WNUA 2WQZC 2DTYA 1OPMA 5KHGA 1S0EA 1RUJ3 2P34A 2VMIA 5GZFA 1DGRN 2MEV1 1NCQA 3RRDA 1Q8QA 2NZ9A 3OYWA 3IN9A 1ND3C 5T52A 1ENSA 3ZFGC 4HSLA 2AR6A 3CNAA 5DZFA 4P9GA 3H7YA 5GLZA 1FPN1 3WCSA 1Y43B 4Y4YA 3MLLA 2CNAA 3J26N 4AE2A 1WLWA 3THPA 5LEKA 4FSJA 1AHSA 4E27A 1MACA 3WW1A 1RUC3 1UW8A 1C8M2 3VHOA 5JZGC 1CESA 4S2FA 3RJRA 3T1LA 3AXEA 3FUOA 2WLQA 2WSUA 3JQWA 1CAVB 2V73A 4BHPA 4WVWA 1RVF1 3CL1A 3P3PA 1X50A 3K51A 2ZCWA 2JG8A 1I6XA 4QGLA 2R071 4A3XA 3ALQA 2TBVA 5A3MA 3UL2A 1CD3G 4DXZA 4KL1A 1DGWA 2P2KA 4LO4B 4AEDA 2XLAA 1V6NA 1FXZA 2DCYA 1EAH2 4UXAA 4AQTA 4XF0A 2GMMA 1VBA2 4IETA 4AI3A 1SLIA 2NM1A 3ACLA 1VIWB 3JBG1 4GWMA 1LB2A 5LEJA 4L2NA 5A33B 3RQ0A 2DFCA 5GZCA 2ZTNA 4RSUA 3B93A 3MGUA 5SV5A 3QLQA 1AVBA 4Z07A 2Z79A 5L19A 1RUH2 3RJ2X 3V0BB 2O0OA 3OGJA 1PIV1 1NA1A 2UYBA 2ZABA 4DZGA 1UZYA 1GANA 1YXWA 4CDQB 3ETQA 1WCKA 3CF6E 3NL1A 5DDJ1 4LBMA 1QGLA 5CIRA 1Q43A 2RS33 4NWVA 4Q1RA 4IV1C 1WW4A 3AP7A 2ZHMA 1LOBA 2HWF2 3QACA 2GNTA 2XL7A 3VZMA 4FTBA 3M3EA 2KA3A 5H9RA 1OPOA 2XG3A 1UIJA 1Z0HA 2DU1A 4L9BA 3PJYA 1GQGA 2WWSA 5LRRA 4EN0A 3ELNA 4YM3A 1AR71 2DWRA 3MYXA 3U4XA 1N1SA 4IV3A 1REFA 1AXZA 3MIHA 5C9AA 2DCKA 5K0UA 4GB32 4EN7B 4K3UA 1UX6A 1SACA 1VALA 3NKGA 4P9IA 1HRV2 5ACA3 1GBGA 2CAUA 2R32A 3AYAA 2Q1MA 5JCTA 3N35A 2EXKA 4LUKA 1UMZA 2EIGA 1YIFA 4M3CF 4XDQA 5T5JA 2A73B 1HQNA 1ZM1A 1IS5A 1YUDA 4A7YA 2Z42A 1VBC3 4C0HA 4FP2A 2XJVA 3I8TA 2HWD2 2ZS6B 4LBKA 5CNAA 4N53B 4DRRA 2VVFA 1TME1 1UU6A 3O0VA 1HKDA 2D97A 3O0WA 4F83A 4IEOA 4XFGA 3NJZA 3HBZA 1HLCA 1IS6A 3APBA 1UD1A 3B9IA 3M3IA 4H7MA 5FLJA 1AR83 4FPFA 2ZGPA 4CYDA 1B35B 4N7UA 3AP9A 4BWOA 1ZNPA 3DPRA 1ASJ1 3O7OA 5JSPA 2RM22 1OFNA 1IS4A 4R9CA 1PMIA 1V9U1 2NP0A 4WZCA 3IIAA 2ENRA 3KCYA 2HWE3 1YWKA 1POV0 1VBE1 4MXWA 1F5JA 2DYCA 1IOAA 1VB4A 3TRSB 4AHZA 1C28A 2DURA 4HN0A 1AR93 5JVVA 4XW3A 4AYUA 3VKMA 4FPCA 1PO22 4QMAA 1CAXB 4LR4A 1R1A3 2EXHA 4LHLA 1SMVA 4CP0A 2R041 4CEYA 2VW2A 4CDUB 3HT2A 2ZX0A 1LOFA 2SLIA 3A0KA 4LA2A 4DNYA 3WG4A 3M7AA 4QPIA 2HWB1 1URXA 1PO12 1R1ZA 3AXDA 1BEV2 1C5HA 3VUOA 4CDWC 1LGCA 1Q8PA 1YJLA 1AXYA 2PLV1 2ZGQA 1C1LA 1W6NB 4FAHA 1OLRA 3PJQA 2DVDA 2PFWA 3VZJA 4FXKB 4PDWA 1RMU2 1ULFA 2XJPA 5T5LA 1H9PA 1SBEA 4DQAA 5BNNB 1EYBA 1LGNA 1WLTA 2PTMA 3C3VA 5EV7A 3MIFA 4XXPA 3B00A 4GALA 2IZWA 3BB6A 4AI1A 4WVMB 5JOZA 1HIXA 3MF9A 5AC93 1DHKB 1QXPA 1SEFA 4O9GA 4XZPA 3VDDB 3WDVA 1DYKA 3U11A 3JD73 5GLTA 1POV3 2QNKA 4IEXA 1WW5A 2DV9A 2WINB 4UW3A 3NV1A 3VBOC 1ZZ9A 1IPJA 3AKRA 4WM8B 2LALA 4AXOA 3ENRA 1WMFA 1FOD2 4BLJA 2ET1A 1OD5A 1DG6A 4META 3VGIA 4COVA 1FMD3 3VHRA 3SH5A 2ZGTA 1OKQA 1ENQA 1QJY1 2AZ5A 2RS11 4XETA 3WP3A 2NN8A 1PM7A 4Q4X3 1V6OA 2XVGA 2QVSB 3ZX7A 4K8FA 1VRH2 4RHV3 4XJAA 4HMZA 3KT7A 3WCRA 3PVOA 1BCXA 4W6YA 3FFZA 1DQ6A 4V1PA 3PVEA 2OA2A 1R091 4JCKA 2XJUA 1DZTA 1KXGA 1PZ8A 4YVSC 3QH6A 3N7KA 1MS5A 1LU2A 1H4GA 2VVEA 3RI9A 2WNUC 5F6KA 1WW6A 1AJKA 2YMZA 5GKAC 3OF1A 4YARA 3MDPA 4LO8A 1RUJ2 3KLSA 5C6CA 3ZXGA 1RJ8A 1DQ2A 1L3JA 1NCQC 2BNOA 4Y1ZA 1R083 4OHVA 2N7GA 3SHRA 2V5YA 3J8F1 4GQ7A 4L99A 1J1TA 4D7SA 1N1TA 4GH4B 1HRI3 2RJLA 1WMDA 4S2DA 2YC0A 4YM2A 1DFQA 5CA6A 1JTZX 2AGSA 1BYHA 5CVRA 5JOWA 1U12A 4I01A 3UJOA 3ZMOA 2CY6A 3V65A 3B3QE 3T1MA 4I02A 5L73A 1JHNA 1Z78A 2I2SA 2Y0IA 1RUC2 2YGLA 5JSRA 2UY9A 1RUG1 1VBD2 1ENXA 4COYA 1DBNA 1RITA 5T5OA 1OSGA 1XNDA 4Y1XA 3S30A 4XXAA 2K0GA 3VBFB 3USSA 1V6MA 3WY6A 4EJRA 5FPZA 1LU1A 1QJX2 4AEDC 4FTSA 5KHKA 4MSVA 2D3SA 1LKNA 3KS7A 3ZXLA 1CAVA 3S0MA 3ZYIB 3VBUB 4U36A 3O5SA 2YXSA 4YFWA 2NYYA 3POWA 4C1XA 4FAGA 1H2MA 2Q5TA 2PHWA 5FPXA 4FT8A 4WM7A 1MZEA 4XQDA 3ZIWA 2GMPA 4EWDA 2OZ6A 4YW1A 2DVFA 5CB7A 4LO5B 4AGVA 3AZZA 2GU9A 1C8NA 3WP4A 4AW7A 4E2GA 4D94A 4D69A 4XE9A 3LCPA 1FNZA 1COV1 1DQ5A 3TN93 1AL23 4EN9B 1YRZA 5A33A 5TSWA 1MS8A 3SCFA 4YW2A 3FLPA 4FPYA 3RZZA 4M00A 2ILMA 3NV4A 2BGCA 1V6IA 1VBB1 2WT2A 4YGEA 4P5HA 1X7NA 5KWRA 1NLSA 3V0BA 1BVP1 1ZYBA 3D4KA 1REEA 1QJU1 2WT1A 5HI0A 2RS32 1RUOA 1PVC1 3FBMA 3PTYA 1FX5A 2DTWA 4CDQA 1KDKA 3GNEA 2EVXA 5LK7B 2DCJA 4ISRA 5JWPA 3DL3A 3J4UH 3V64A 3E5QA 2D98A 3GBGA 3RDIA 3IDBB 5FAXA 1TNFA 2I45A 3QH7A 4FO9A 4YRDA 3MZHA 4FCAA 2I07B 1DF0A 2UWBA 3QCWA 3CU7A 3ZFFC 4IV3C 1RUE3 2OZJA 2TNFA 3A4UA 5K0UC 1A78A 2BQPA 2JICA 1AJOA 3G7DA 5DZEA 2EAKA 1RUD1 1PHMA 4HVOA 1JYIA 2OVUA 1YO8A 5ACA2 1O3QA 1W2UA 3NKTA 4K7JA 4TZDA 4EWEA 2ET7A 2ZZQA 5FCCA 4QQOA 4YYOA 3THTA 1MQTC 2P17A 2EALA 4M01A 2RE9A 3EBRA 3VKFC 1SBFA 3B7MA 4NHKA 3FJSA 4LO7A 2KXLA 3INAA 4BCUA 2HWC3 4YG0A 1TNRA 4LE3A 2Y26A 1W6QB 2X29A 1FI2A 1UKGA 1VBC2 2ZX2A 2ZAAA 4B4RA 4QU2A 3QBQA 3LSDA 1CX4A </