4BM8A

Galectin-3c in complex with bisamido-thiogalactoside derivate 3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
ALIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-3
publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bm8A00
1SLLA 2A6WA 3WCRA 3O0XA 3LSEA 3RQ0A 1G8WA 1NXD1 2UWBA 1FV2A 1F5FA 1Z0HA 1QGLA 2VU9A 4H55A 4HL0A 1MS0A 5GZEA 1G9DA 3V0AA 1LGNA 5EXOA 1JXNA 1S1AA 1W6OA 2ARBA 3SISA 1W6QA 3AZVA 1V6KA 1WUVA 1N47A 1GKBA 3AFKA 3D5OA 2AUYA 1Q56A 3OYWA 1Q8SA 2ZBJA 4KBBA 5CBLA 3MW2A 2CNAA 3OY8B 5T5PA 3UJQA 3SITA 3MW4A 3WLUA 4Y1ZA 2R0HA 5DZGA 1AXYA 2DURA 2NN8A 3RSJA 1URXA 2CY6A 3IN9A 4XIKA 1PZ8A 2P3IA 2UWAA 2UU8A 3D4KA 1V6OA 2OUJA 1ULFA 3FLTA 1CQ9A 4Q27A 1RITA 1MS3A 2EXJA 1GSLA 3UJOA 5FRAA 3HR9A 1V6MA 3M3QA 3N7KA 3WDTA 1I3HA 3WZ1A 4FVVA 4Q8KA 2R16A 3ZSKA 5T5OA 1X50A 1S0GA 1YI7A 4OZXA 3AYAA 1QOSA 5DG1A 5IUQA 1CONA 3PMEA 2D3PA 1O4YA 4YZ5A 2ZKNA 3B9CA 3N3HA 4CRQA 5IK5A 3L2YA 1LCLA 2BQPA 2WNEA 2PHFA 1AXZA 4AGVA 1BQPA 1WW6A 4XYXA 2OW4A 2AYHA 5DUVA 1WLWA 1UL9A 2A75A 4ITCA 1BYHA 5T54A 1OKQA 4MYEA 1GZWB 4YGDA 4AVTA 3SNMA 2A3YA 4ZXKA 4Q8LA 2WT1A 1GZ9A 1KDKA 3NV4A 2Z42A 4GALA 4RA0A 3WUCA 1AZDA 2DTWA 4YW4A 1WLCA 1AJKA 4YG6A 5JVVA 2E7QA 4NOTA 1UAIA 5JDBA 3MEPA 2D3RA 1KITA 1SLAA 3USUA 1R1ZA 1MVEA 1TEIA 3M3EA 4XXAA 5L73A 4YM0A 1DHKB 2D6OX 1YRZA 3POYA 3GALA 1IKPA 2ERFA 4WVVA 3UK9A 1ENSA 1V6LA 1W6PB 2A3XA 2ZGPA 3WG4A 2VW1A 4JCKA 5KXEA 4PBPA 1ENQA 2VW2A 3MW3A 1JYCA 3AJYA 5HCFA 3NV2A 3WG1A 1N1SA 3NWKA 1S0JA 4LBMA 1V6NA 1LOBA 2PHXA 1QDCA 1UX6A 2GNDA 1DYKA 1NLSA 5E89A 4YFWA 1LU2A 1W0PA 3O0WA 2A5ZA 2A71A 2C9AA 2W52A 4BMBA 1LU1A 4Y20B 4YGEA 1ULGA 1WW7A 4R9DA 1GYKA 1GBGA 3FFZA 2WKKA 3BTAA 4Y1YA 1VAMA 1SCRA 2DVGA 2GMPA 3V64A 3WNXA 2ZHMA 2V5YA 1ONAA 4L8QA 3RS6A 2GNBA 1G9AA 3VKNA 3IM0A 1FX5A 3VKMA 3U4XA 1MS1A 4XBNA 4BM8A 1QOOA 2DVBA 1MVQA 2FHRA 1UKGA 1LOEA 4LBNA 4SLIA 4U2AA 2XG3A 2NZ9A 1SFYA 4XZPA 5E8AA 2CYFA 4BLJA 1GNHA 5GZGA 2WJSA 5JOYA 2P34A 3M3CA 2ZACA 1WD3A 1N1VA 2FMDA 2WLQA 1SBEA 2YV8A 1O4ZA 1YO8A 5DUXA 1BZWA 3AYEA 2NP0A 4YG0A 3ZSLA 2DUQA 1LTEA 1ULCA 3ILNA 2D6NA 1APNA 3SH3A 2EXHA 4XTMA 3WHUA 2GNTA 4BOWA 1U0AA 1FV3A 3ZVXA 4K20A 2E7TA 3IKWA 4YM3A 4XBLA 2DU1A 1DIWA 1ULDA 4XJWA 3WG3A 4DQAA 4WVWA 3WVJA 3O5SA 5GLVA 5T5JA 1CN1A 3V0BB 1WCSA 2DWRA 4FPGA 3WDUA 5GZCA 3NV3A 2D6LX 3ZXEA 4Y24A 4LBKA 4LBQD 3PVOA 3OBRA 2ZABA 3C2UA 1S0IA 4BLIA 2E51A 1CIWA 1G86A 2PHWA 3FBYA 1N3QA 3D6EA 4FPOB 1H9WA 2EXKA 4AVSA 2CWMA 4LBQB 4YGCA 1YYNA 2ZA9A 1D0HA 4K1ZA 1G9FA 4UW6A 3SH4A 4Y22A 2AREA 4W65A 3M1HA 5DXDA 1SLIA 5BYNA 3ENRA 2SLIA 2DU0A 4XMAA 2JECA 1GANA 1SACA 1W6NA 5T55A 2GDFA 4Y1UA 5IT6A 2ZGMA 4LBOA 1QNYA 3N36A 2W08A 4K1YA 4PQ9A 3WDWA 4XJ9A 1F9KA 4WV8A 4XMIA 4XJAA 3WOGA 4XJUA 2AR6A 4YLZA 4BQ1A 2OVUA 3PJQA 5EYXA 1OFSA 4FPYA 4ISRA 1DFQA 1LJ7A 2Q5TA 3WDYA 5F9TA 3IPVB 4FPLA 2GN7A 3ZXLA 2D6PA 2EF6A 1EPWA 4TZDA 3ZSJA 4XTPA 3ATGA 3ASIA 2JJ6A 3I4IA 1LOFC 3O12A 1MS8A 2GMMA 1MACA 2EIGA 1LHVA 1PZ7A 4PBOA 3ZYRA 5FREA 3HMYA 4M3CA 1W6MA 2ZZJA 3B69A 2ZGRA 4XBQA 4XJ8A 3MPPG 1S0CA 1CR7A 2JD4A 1Q8PA 1C57A 4FOYA 4FQZA 3ZSMA 1VLNA 3INAA 4DFSA 1ZM1A 1OQ1A 2KM2A 2ZGLA 1GV9A 4M3CF 4XILA 1G9CA 1DZQA 1I1EA 3A4UA 2P3KA 3FUQA 1GNZA 1SLTA 2PHRA 1VIWB 1N3OA 2V73A 5GLTA 5GLWA 1S0FA 5T52A 1CPMA 1JYIA 5GLZA 1VAVA 3FUOA 4R9BA 2ZGOA 3WV6A 3B00A 5H9QA 3N7LA 4Q1PA 4YG3A 3O0VA 2D6KA 1LHNA 2ZAAA 1CJPA 2WT0A 5DUUA 4FPKA 1RINA 4GWMA 4YZ3A 2D6MA 2P3JA 4GKYA 2XB6C 4FP3A 4YZ4A 4U36A 1LHWA 1WW5A 4NO4A 3TAYA 5GJ6A 3AJZA 3WG2A 1DQ6A 3AYDA 3AXEA 1S0DA 4AYUA 3RRDA 4Q26A 3R4UA 1DBNA 2DVFA 1C4RA 1SLBA 2VXRA 3V0AB 1CPNA 4LBJA 1AVBA 1AX0A 2ZMNA 1SBDA 1W6OB 3NV1A 1DQ0A 5GZFA 5HCBA 5T5LA 3A0NA 1W6QB 2WSVA 1ENRA 1GICA 2EALA 4FPEA 1S0BA 2A6XA 2DV9A 1VALA 3ILRA 3OPZA 4YM2A 3RMYA 3OYWB 5IK8A 3OBTA 1C1FA 4GWNA 4ASMB 4CTEA 2HYKA 1Z78A 1KJRA 3V65A 3T1MA 2GALA 1MR5A 4GXLA 2EXIA 1HLCA 1AJOA 4XHBA 1MS4A 3AP6A 4DRRA 1LHOA 4DRVA 1LEMA 2A7AA 1LOGA 1LOCA 1ULEA 1WW4A 3LCPA 3M2MA 1SCSA 1W0OA 1GZWA 2YY1A 3QLQA 4LBLA 4P9XA 4FP2A 3TB0A 3ZXFA 2ZHNA 1Y7BA 4PF5A 2A6YA 1IS5A 4P14A 1N3PA 1WD4A 2E53A 2GMEA 2GNMA 3AZZA 1FATA 1UN1A 3PVEA 1V6IA 1LGCA 3ZXJA 1KRIA 2P37A 5CNAA 3VUOA 2DTYA 3AP7A 2SBAA 1FAYA 3IMNA 3AP4A 2WT2A 3DGTA 4FPFA 1HQLA 4XOGA 2D7FA 1IS3A 3JU9A 2AGSA 4BMEA 3I8TA 2E6VA 1DQ5A 1JOJA 3VKFC 2VUAA 1LODA 1WBLA 4Q1RA 5GALA 1Q8VA 1AX1A 1FNZA 1XQNA 2A3WA 3FLPA 4YZ1A 4P9YA 3APBA 1W6PA 2VY0A 2YMZA 3N7JA 2ZGQA 4JRAA 2AH2A 3N7MA 3W58A 1LOFA 2W39A 4FOVA 5JMCA 2W68A 4ATEA 3AX4A 3AXDA 2NM1A 4M3CB 3SH5A 2AENA 5H9RA 1J1TA 2ZGUA 3KM5A 5T50A 3QCWA 5DZEA 1JBCA 1LEDA 1LECA 1BJQA 2ZMLA 4DPNA 2JE9A 1LOAA 1IS4A 3Q9OA 1ZA4A 3SLIA 5KXBA 1QOTA 1YXWA 3USUB 4Y20A 1A3KA 2WQZC 4K21A 3BOPA 1KJLA 1Q8QA 4Y26A 3POWA 4F83A 4Y1XA 4GKXA 1MZ6A 3N35A 2ZGNA 3WDXA 2VW0A 1LENA 4XXPA 2RHPA 3A0KA 1LHUA 4FPCA 4XHXA 2NMNA 5KXDA 1IS6A 4YM1A 5H9PA 1H30A 5HCAA 4TYSA 3ZXKA 2VH9A 2ZGTA 1QNWA 5IK7A 4UW5A 1SLCA 4R9CA 1QDOA 1YIFA 4HANA 5EWSA 3W59A 3POSA 3AZXA 2OUHA 2ZGSA 3BIWE 2ES3A 1FNYA 5GM0A 1G7YA 2NMOA 2D43A 2ZMKA 2JKBA 2H0BA 4YW2A 2DVAA 3HN1A 5F5QA 2A6VA 1N1TA 1QU0A 5CAZA 2D3SA 3B01A 3RMXA 2CL2A 2D44A 2G4IA 4ISQA 2CWSA 1DYPA 2DYCA 3T2TA 1RIRA 2EAKA 5E88A 3AZYA 1DLLA 1JW6A 1JHNA 1JN2P 1F31A 1UMZA 3DUIA 3ZPYA 4XDQA 5SV8A 3VKOA 2YZ4A 4I30A 3V0BA 2UWCA 4Q2FA 5H9SA 2PHTA 4FQ4A 4XJZA 1V00A 1BKZA 3BODA 4FOWA 5AVAA 3AZWA 1B09A 3GNEA 5DUWA 3LSDA 3M3OA 3T1LA 4FPHA 5JLVA 3OY8A 1UZYA 2B7YA 4R9AA 1BXHA 3ZYPA 3R4SA 3ILFA 1AXKA 2NYYA 4YW1A 4JC1A 4YW3A 4D69A 1QKQA 4ZKTB 4LBQA 1KQRA 2R1BA 1LESA 3PVNA 3KQRA 4C1WA 3OJBA 5CA6A 5DG2A 2JDZA 1DQ1A 1FYUA 2A70A 3RG0A 3WDVA 2ZHLA 5KXCA 2R0FA 1H9PA 1S0EA 1QMJA 2UURA 4FOQA 1D2SA 3WUDA 2ENRA 1DQ2A 2I2SA 3VV1A 2YROA 4YGBA 1HKDA 1KDMA 2A6ZA 4M01A 1DGLA 4XE9A 3UL2A 2ARXA 2CTVA 3WHTA 4AWDA 3AP5A 4YFZA 4ATFA 1QF3A 3VKLA 1UPSA 5JOXA 2PELA 4M00A 1HDKA 5GLUA 2DUOA 2YXSA 3AP9A 2C5DA 2GN3A 2JE7A 3IPVA 4FPJA 4DS0A 1GLHA 3JUUA 4YW5A 1CESA 4UW4A 3CNAA 1CVNA 4GA9A 1DQ4A 1HQWA 1UZZA 5JOZA 1G9BA 4Y22B 4WZFA 3H0OA 4RL7A 4AGGA 5LK5A 1Q8OA 5EYYA 3B3QE 5GZDA 1V6JA 1W6NB 4XIOA 1SBFA 1LGBA 5IK4A 2R1DA 2LALA 2DVDA 4Z8BA 1AX2A 2PHUA 3FLRA 3AK0A 1MS5A 3AYCA 4AGRA 1MS9A 4UW3A 1A78A 1A8DA 4IQPA 2DUPA 3WCSA 1WLDA 1C1LA 4BPZA 1LULA 2WSUA 2ZGKA 1GZCA 2R49A 5JOWA 5DZFA 2TEPA 4PCRA 1IKQA 2ZHKA 4AVVA 4C1XA 1AF9A 4M3CE 2P2KA 4CZSA 4YZ2A 2LTNA 4P9WA 1N1YA 1WBFA 1JUIA 1MZ5A 3R05A 1IOAA 4Y1VA 1PZ9A 1W6MB 5CB7A 3OGGA
chains in the Genus database with same CATH superfamily
1SLLA 3I2KA 3WCRA 4H14A 2PXJA 3O0XA 3LSEA 4CDWC 4CEWB 3J4UH 1K5JA 3RQ0A 3BKZA 1Z0HA 3HOBA 3THCA 5LW9A 3KB5A 1MS0A 1W03A 4OQ8A 3EXUA 5EXOA 4Q4V1 4CA9A 1OLQA 1W6OA 4P9GA 3SISA 3WQ0A 5IVVA 1W6QA 2V4AA 1WUVA 4BJ0A 2ZEXA 2GP3A 5AC92 4AQ6A 2VZVA 4AEJA 1T2XA 2DBIA 3GM8A 1CZVA 3S5QA 3MW2A 2CNAA 3RGBA 1JODA 2WAAA 5C8CC 2YU1A 4BK4A 4GH4B 4HK9A 3UJQA 3SITA 3ES1A 3WLUA 4DEQA 3VDDA 4Y1ZA 2V4VA 3UYJA 5K7PA 1JZ6A 2R0HA 4KQ7A 4NIHA 4S2GA 3ZDSA 2RM23 2OZ6A 2NN8A 3CJIC 1W39A 4A7KA 1PZ8A 3WF1A 4L92A 4EJRA 5FYTA 1YFWA 2P17A 2ID4A 2Z4FA 1RITA 2BTVC 2VZSA 5FRAA 1NLQA 3KWVA 3NJZA 2F4PA 1OA4A 2B9VA 1PX3A 3MIBA 1D2QA 4BH9A 5KHIA 3JD73 1MEC2 5L9RA 1K42A 1AR81 1XNTA 3MO4A 4RGGA 1ZRCA 2RS32 1O5UA 1LNSA 1YI7A 2W94A 1QOSA 3DYOA 3H3UA 3OGRA 4QPIB 4JKMA 2D3PA 2WRAA 5B4XA 3BTXA 4YZ5A 4P00B 2BFUL 3N3HA 4EN6B 4KWKA 1LCLA 4K6BA 3MYXA 2VM9A 4XYXA 2OW4A 5A33A 4B7KA 3R4DB 4QXHA 3UGHA 1H2NA 1RUC1 3RYRA 3WF3A 4XFBA 5T54A 2L9LA 3TEZA 4MYEA 2J1TA 2WZR3 1OH3A 4IEZA 4RA0A 4LOSA 3WUCA 4QU1A 2WR9A 3U78A 2WNVC 4YW4A 3ZR6A 4EN7B 4IEOA 1W8TA 3VBSB 4BDVB 2RDQA 3R6SA 5B4NA 3OUJA 1SLAA 1VRH1 2K2SA 3LA7A 3JZVA 3USUA 1TEIA 5L73A 3POBA 4RS5C 4YM0A 3D0JA 4A7YA 3MI8A 3GALA 4A7ZA 3UK9A 4QX8A 4BU2A 1V6LA 2IVIB 4QX2A 2G1MA 3MV01 3UGGA 3KV5A 5J7MA 4AVAA 2XLFA 5F6KA 5FMCA 3B93A 3DKQA 3D8CA 3EO6A 1RUD1 3A7QA 1VBC3 3MW3A 3QD6A 5G04L 2C4XA 5FZ3A 4DUVA 3CF6E 5F5AA 1V9U1 2WC2A 3VBHA 3HNYM 5F39A 2CGPA 1ZBE1 4UFJA 2VCCA 3RZMA 1QXPA 1PM7A 1AR83 1W0PA 2QQNA 2W52A 4BQ5A 2AEZA 5FUNA 3ZDVA 5C5UA 1W8FA 1ULGA 4NHXA 3I2IA 1VAKA 1JYVA 1K12A 4BXSV 1NT0A 3BTAA 2R072 4Y1YA 4UBHA 4CP0A 4N9IA 1JYWA 2BZDA 2H6CA 2YPJA 1VBB3 2DVGA 1W8OA 5LA0A 3EJKA 1C8M1 4L8QA 1ONAA 3RS6A 1SMVA 5CEHA 1AYM2 5A3MA 4XFIA 1OOPC 5KHJA 1FX5A 3ZIWA 1MS1A 1HW5A 2PMWB 2VUCA 1H1MA 1KRIA 1FMD3 1W2AX 4LT5A 2WBKA 4IE7A 1UNBA 5SV5A 5GZGA 3H8OA 4I0BA 4HN0A 4ARXA 4COVA 4CU6A 5LRSA 1EY2A 4M4RA 5DMYA 2FMDA 4D3WA 1HXS2 4IGPA 3H1WA 5DUXA 2YC2A 1X82A 1VRH3 2Z5WA 4IW3A 4BISA 4UBGA 4BQ3A 5FMDA 4NN0A 5BY5A 3CLPA 3ZSLA 5C70A 5D8AC 2C6SA 3J7MA 1LTEA 5KC6A 2VCAA 4NJ4A 4PHZA 2XL7A 2ZEYA 2XVGA 2ZX4A 4QM9A 4XURA 4XW3A 5DDJ1 2J7MA 2ATFA 3BPZA 5AVPA 3DXUA 1UZ0A 2LW8A 2JDUA 3ZIXA 3RZJA 2QZ2A 4COUA 3HT2A 4XACA 1U0AA 3RNSA 3ZVXA 1J84A 4GB32 1CAWB 2IXLA 2DU1A 2F6BA 3KQ4B 1Q43A 2IFWA 5IJRA 4DQAA 3FHIB 5LY2A 1LB2A 3WVJA 1ZA7A 2VVEA 2VTFA 1DU3D 1YIPA 4LE3A 1O3SA 4Q4Y3 3V0BB 1EV12 3NAPC 4MX3A 5C6CA 5FP8A 1VP6A 5FY9A 3NV3A 5FZ7A 1H0BA 1H2LA 1R091 3O14A 4LBKA 1RC6A 1W05A 3PVOA 3THPA 5BUVA 4AI8A 4BYYA 2HWD2 4DUXA 4TSVA 3C2UA 4BLIA 3ZFEA 1SPPA 1G86A 4FPOB 4YVWC 1N3QA 3D6EA 4QPGC 4AEKA 2EXKA 4RS5A 5C7GA 4GULA 1Y4WA 1C8M3 1R1A2 3LAGA 5FZDA 3ZFGA 1OURA 3U4SA 3CKHA 3TWIA 2AEYA 4IV3C 3ENRA 2DU0A 4QX0A 2D5HA 2PHDA 5I8SA 5IT6A 4MV2A 4Q4X1 4LBOA 3RJRA 3N36A 1CAVA 2FDFA 2W08A 4K1YA 5JZGB 2JENA 1F9KA 3NNMA 4CDWB 2OVUA 1NCRB 2Y38A 4XQWA 2VECA 4LK6A 4ZPIA 2JWPA 3ORJA 4XZUG 5DDJ3 2GN7A 3AMHA 1JOPA 3KS7A 3J8F2 4IGOA 3T0AA 3H3LA 4NRQA 3VHRA 1Q5OA 1VB4A 1ZYBA 3ZSJA 4FAGA 3ATGA 1H1AA 3AFGA 4YSFA 5C3PA 2B4KA 3O1SA 2WWSA 1XYNA 4XABA 3ALQA 2GMMA 2XXZA 2ZXQA 1PZ7A 2RG4A 3A22A 4M3CA 4IE0A 5FREA 2ZZJA 2XJUA 1BVVA 1VPHA 3HEIA 1AR93 1C57A 2OT7A 5C8CB 5ACA2 1VLNA 5FXWA 3SKJE 1W28A 2KM2A 1W2TA 4QB1A 5FBJA 2LUWA 5J1XA 1DZQA 5LB6A 3AKSA 3A4UA 2O0OA 4OLLA 1OLMA 1R093 4BQXA 3AM2A 3CJIB 4D6QA 5A3WA 2V73A 1WGPA 4LKFA 5FMOL 5GLWA 5T52A 3BOWA 3DEMA 1RJ7A 2ZGOA 3N7LA 4YG3A 1UO9A 3O0VA 4IESA 1LHNA 2ZAAA 2E32A 2WT0A 3MUZ1 1RINA 4W6WA 4YZ3A 3MF9A 4GKYA 2XB6C 3DF0A 1EV11 3ACHA 4YZ4A 4U36A 3TAYA 4COYA 3VHPA 1Z7S3 4UFHA 4LO6B 4Z07A 5FK7A 4LE4A 3ZFFA 1ZZBA 1RUH2 1W9SA 3WG2A 3AYDA 1KGYA 4Q4X3 2ZJCA 3RRDA 3R4UA 3VD9A 1RUG3 1C4RA 2DF7A 1SLBA 4IERA 3V0AB 1C3HA 1AX0A 3GXUA 4LBJA 1SBDA 4YPJA 1B35A 2BW8A 5T5LA 2ZX1A 3N9MA 3HNMA 3LEMA 3LQCA 2EALA 4CUAA 4E27A 2FDHA 3OPZA 2VO5A 3OYWB 5IK8A 4O65A 5CG9A 4OHYA 2ZTNA 2LRPA 3IBMA 1OPOA 3JB8A 2CV6A 2WNVB 1W9YA 3DECA 5FZCA 4CTEA 1EPZA 3PVBB 1UOJA 4MHRA 2OZJA 4NIIA 3I3BA 2O8OA 1SPPB 3CO2A 4GXLA 2EXIA 5FZLA 4HKLA 2EICA 3DPRC 5A7NA 4AEDA 4FTBA 4RS5B 2MNGA 2Y33A 3AP6A 1LEMA 2WL1A 3CU7A 3MDPA 4Y1UA 1WW4A 3M2MA 3QLQA 4LBLA 4P9XA 5CIRA 5IWFA 3VBFA 3WP3A 1NXMA 4PF5A 4PT6A 1IS5A 2OS2A 3WR0A 1FATA 1UN1A 3PVEA 1LGCA 3KCCA 1D0GA 3VUOA 3SQOA 2DTYA 4AXOA 3FX3A 2QUOA 2WT2A 1XOYA 2VZUA 4H7LA 3H8XA 4AI9A 4BMEA 2MEV2 3ZYIB 3VKFC 2FZ1A 1YHFA 3KCXA 5GALA 1RUE1 2A3WA 3U07A 1YC61 1HRI3 1W6PA 5EJ3A 1NAEA 4ASKA 3W58A 4KWLA 1US3A 4AHYA 1JTZX 2JDHA 2W68A 5JMCA 5KHGA 3AX4A 3AXDA 2LROA 4EWDA 5JUVA 3T0DA 4E4HA 2WNUC 2ZCWA 4PQQA 3BGAA 4TN7A 2CGOA 4J1XA 2RVAA 5L7OA 4IL7A 1WCDJ 1ZBA2 3ZN4A 3FN9A 1OOPB 3VD3A 3KD4A 2VBBA 1W2UA 3FFQA 3LB9A 4N7UA 2YC0A 4DPNA 2WO3A 1SZBA 5A7QA 2OPWA 1GQPA 2JE9A 3SLIA 5F6LB 2VC9A 3I3EA 4AFBA 4Y20A 1S4CA 3C7FA 2PQQA 4AK3A 3BOPA 4GJZA 2XH6A 3JBG1 1TMF1 2RR12 1S55A 2YBSA 3AMNA 3I54A 4F83A 4Y1XA 2R30A 4IEPA 1X33A 4IXLA 1ZZCA 5A7OA 1LENA 2GH2A 4HKWA 4XXPA 5D8AB 4AE2A 4GZ9A 4HK8A 5CFDC 3SCGA 4RN5A 4X6QB 3LF7A 2XHKA 1IS6A 4QX3A 1BEV1 4LKDA 4LLOA 1VMJA 5JSOA 1H30A 5J36A 5LASA 5F1RA 2W1QA 1E5RA 2DFCA 3NRUA 3C3VA 3FMGA 3LDRA 1SQ4A 4UW5A 1SLCA 1QDOA 1SG3A 3W59A 5EV7A 4XF9A 5FP7A 3HJRA 3AZXA 4QX1A 5FYYA 3U37A 4AHXA 1RUF1 1OA3A 2ES3A 1POQA 2BV4A 1MQTC 1W0NA 2WFF1 5GM0A 3TBDA 3NAPB 3VDBA 5FPVA 4P02B 4P9JA 2H0BA 4YW2A 5F5QA 5L9VA 1VBD2 2A6VA 1CD3G 3WP4A 3ZMNA 2VL4A 2IC1A 3PL0A 4AFMA 2D3SA 3S6PA 4W4ZA 4WVZA 2D44A 3ZN5A 4ISQA 1W8HA 4QPGB 4YVWB 1QH6A 4MOAA 4RGAA 1DYPA 1QJX2 3T2TA 2EAKA 2LM3A 2MEV1 2H6BA 2FCVA 4O7XA 1UMZA 3I3DA 1NA1A 4GMP0 4Q0VA 1K3IA 4J1WA 5D1IA 5A6XA 4IV3B 2PHTA 2X53S 3ZXDA 1L7RA 2GC3A 4N43C 3IDCB 4KNCA 2EA7A 5DUWA 3LSDA 5JLVA 3CJXA 5FKCA 4UFKA 4WZCA 1TMF3 4I3GA 4QDRA 4AI3A 1BXHA 5HV4A 3PMSA 4I0AA 4QB2A 1W8UA 2VCBA 2G9FA 2BNNA 4OHZA 4LBQA 1L7LA 2WDBA 4OI0A 1BCXA 1LESA 1ZZ8A 3OJBA 1P8JA 2W1UA 1FYUA 2G19A 2B5HA 3U11A 1XJAA 5JWPA 3ZPOA 5CADA 4Y4YA 3CHXA 4HMZA 1D2SA 3WUDA 1DQ2A 3VV1A 5F3EA 1D4M3 2RR11 4H7MA 4YGBA 1HKDA 4OUMA 5IVJA 3BPSA 4AWDA 2ARXA 2WQ8A 3WHTA 2Z69A 3AP5A 4ATFA 5BNOC 2WN3A 2QQKA 4ZHNA 3VKLA 1UPSA 4DOUA 1RUF3 4URAA 2WFF3 3VBUC 3T09A 5LZ6A 1IQDC 5GLUA 5F5CA 2DUOA 1ND3A 3IPVA 4DS0A 4FPJA 4QMAA 3LEGA 1UD1A 1UY4A 4EN9B 4ZU7A 1FOD2 4Q4W1 3GZAA 1WMEA 1DQ4A 1HQWA 1UZZA 4QX5A 1G9BA 1ODNA 2PLV3 4Y22B 3OOXA 3BN6A 2IFRA 1YI9A 2G9GA 1PO21 3AL5A 5LK5A 2ORZA 3X29B 1W6NB 5ABJA 5CKQA 4A45A 1UYXA 4XFGA 1S2EA 1LRHA 2K46A 3NJYA 1Y3TA 2XBO1 3AK0A 3AYCA 4HT1T 2CU5A 5FYSA 4CXXA 3J7LA 4AGRA 5BNPA 4UW3A 1A78A 1A8DA 2RDSA 4BE3A 2DUPA 3MGUA 1WLDA 4GD4A 2BERA 2BWAA 1F35A 2WSUA 5FP4A 1GZCA 3ETQA 1RB8G 5C9AC 2WNOA 4IEWA 1ZVFA 2TEPA 2B8MA 3NNJA 1RUI3 2ZHKA 3NL1A 3PUAA 4CZSA 2P2KA 4YZ2A 1JU3A 4JX0A 4P08A 4P9WA 5FY1A 1N1YA 1WBFA 3GHNA 3UETA 2XDVA 1UMHA 4EYUA 3PU8A 4HETA 1W6MB 4PIXA 5CB7A 1XSQA 3F2ZA 3MLKA 3WEZA 4DO0A 1GQGA 4FI9A 3PDQA 4JKLA 1G8WA 2UWBA 4QXKA 2FDKA 4CYDA 1YQ5A 3NJVA 1O3TA 1CAUA 1A8MA 4CCOA 3DPRB 3J26N 4FFIA 1JXNA 3HVDA 1IGOA 1OLRA 4ZONA 3AZVA 5BNNC 1V6KA 2BJSA 2R062 2YBPA 3SHRA 1GKBA 3AFKA 2X05A 1RMU3 4RR3C 2OQ7A 1OHFA 4Q4W3 5BV6A 2VVFA 1XNCA 1H2MA 2VTXA 2XONA 1YNAA 3LFIA 5T5PA 2PQSA 1RUJ2 2V5DA 5FY4A 1PO23 5DZGA 3E1F1 5FIXA 1AXYA 4XF4A 3ZLIA 2DURA 1KXGA 4IUGA 3RSJA 2CY6A 4MGQA 4R4XA 1ZZ9A 1R081 3VHOA 3IAPA 2VNOA 5FWEA 1PVC3 2P3IA 5FY7A 3D4KA 4BCUA 1V6OA 3DV8A 2XBO3 4FO9A 4Q27A 4A3ZA 5C3QA 2X5IC 3OGJA 4L9BA 1QQP2 5K8SA 4P5HA 2X10A 4MXWB 1K45A 4Q5OA 2WNUB 1J83A 2BYVE 4E4SA 1EAH1 3N4MA 4FVVA 1FXZA 2R16A 3ZSKA 5T5OA 5DG1A 3AYAA 1LKNA 3TN92 4FXKB 4JVAA 5C4WA 2ZKNA 1VR3A 3B9CA 4CRQA 2FBEA 1W2NA 2ZEWA 5IK5A 1BK0A 2WNEA 2PHFA 2WIIB 3BU0A 5DUVA 1WLWA 2HWF2 4IDZA 4A44A 1UL9A 1U12A 4QXCA 4HPKA 2Q1ZB 2VZOA 2WS93 4FT8A 4Q0SA 2A3YA 4Q8LA 1JYXA 2N7GA 3KV4A 1QJY2 3H1YA 3K4ZA 3POFA 1VBE3 3MIDA 4LJHA 1ENXA 5CFDB 1NQDA 2YFZA 3WNLA 2VOTA 4NOTA 2PAEA 1VBA1 3MEPA 1AHSA 3VDDC 1YJKA 2D3RA 3BALA 3EBRA 3JD72 4NAOA 3W5NA 2IXHA 1RHI2 2QQWA 3WNOA 1MVEA 4NWVA 2YPDA 3ZXGA 2JXAA 1DHKB 2D6OX 4PDWC 1W9WA 5FYCA 3T0BA 4BXFA 3CIHA 3S30A 1IKPA 2ERFA 4QKBA 5LBBA 1NCQA 1WKYA 3LPGA 4GWIA 3TRSB 2ZGPA 2VBDA 1MQTB 3WG4A 1HB3A 4NPRA 4JCKA 2R061 5KXEA 1ENQA 1CX4A 1WA6X 2RMU1 2OKXA 1JYCA 5HCFA 3NV2A 4M0NA 4E2GA 4LBMA 4WM8C 4AR2A 5HXMA 3I3QA 2JX9A 2CGNA 4S2DA 1DYKA 4V2WA 2QJVA 4UFMA 5IVYA 2VTXJ 1EAH3 4OQ9A 2XR4A 2BU9A 1XB9A 2A5ZA 3O0WA 4GJYA 4BMBA 4RD7A 2Y6FA 1W90A 2VPVA 4AI2A 3FFZA 5L9BA 2WKKA 5FBZA 1VAMA 1QXRA 1Y9MA 5IFTA 1T6BX 4N43B 1UYPA 2VVDA 3VN4A 2D40A 2QQVA 4L97A 1ZNPA 1YFUA 2GNBA 1QQP1 5KC5A 3IDAA 1DGRA 3K51A 3ETPA 4BM8A 2K9ZA 4TWTA 4JDNA 2FHRA 3VB9A 1X7NA 1VBC2 2BFUS 4HKOA 4U2AA 5E8AA 2NZ9A 2O8QA 4GWJA 4KWJA 4BLJA 1GNHA 2VQTA 3TN91 2WJSA 2OPKA 4LA3A 4QHZA 1TNFA 4DY5A 5JXGA 2XJPA 2WLQA 2E7AA 1SBEA 1WCQA 2YV8A 4WBBA 4LHLA 4CXWA 3ACGA 3DYMA 1U5YA 3QH7A 4FTSA 2WWUA 4KG0A 4W6XA 1HRV2 2FQPA 2JG9A 2BOIA 3WW1A 3MF6A 3DL3A 4NRMA 5BNOB 3ABZA 1APNA 1UOBA 3M8LA 5F3IA 2HWB3 1FPN2 5FY5A 2B45X 1VBB2 4XTMA 3VBUB 2B39A 2GNTA 3OUIA 1JYNA 3OUHA 2RDRA 3VBHC 2PAMA 5K9YA 4YM3A 1CAXB 2B46X 3N9QA 4OI2A 4DMIA 3NW4A 1F4HA 1NYWA 4J6GA 2UY9A 1W8ZA 3O5SA 1UPIA 5T5JA 4EN0A 2HLEA 4Y1VA 3BYWA 3IDBB 4IETA 4I0WB 5GZCA 4AVBA 3KT7A 4NPLA 3WNPA 1PIV2 2ZEZA 2JB4A 2PYTA 2ZX3A 1GUIA 1DG6A 4XUTA 3SEEA 4MG2A 2Q1FA 1O91A 2V72A 2FDJA 1S0IA 2ZX2A 1CIWA 2PHWA 3FBYA 4ZZ8A 4AVSA 3OEAA 5FFOC 4YGCA 4PDWA 1TNRA 5LEJA 1JZ2A 1D0HA 3SH4A 1G9FA 4N9HA 2AREA 5C9AB 1DCSA 4W65A 3WW2A 5FLHA 5BYNA 4XAEA 2SLIA 4XMAA 2JECA 5A7WA 2XHNA 5CZKA 5T55A 5C8WA 1BK1A 5JXHA 2GDFA 5E1RA 4CP1A 1R64A 2GZWA 3IB3A 3T2OA 2BPA2 4PQ9A 1HX6A 2X29A 5J3UA 4XMIA 4Q4Y2 4WV8A 3ZYBA 2WZEA 4WM8A 3ACIA 1AYN3 4DIQA 2DBNA 3PJQA 4GAZA 4IEYA 1OFSA 4FPYA 4NE9A 4AVCA 5F3GA 5EHDA 3WDYA 1XYPA 2W87A 3ZXLA 4OHVA 4HVOA 3M7AA 1COV2 5FZBA 4CCLA 1UKRA 4TZDA 4AFAA 5LRRA 5LA1A 3Q8EA 2BVBA 5BNNB 3E6CC 3UKNA 5FPAA 3NNGA 5I8TA 1IPJA 1MACA 2C24A 2KR2A 4RR3B 5ERLA 3VDAA 4PBOA 4Q4V3 3ZYRA 3HMYA 3BI3A 4XBQA 3B69A 3RPQA 1KS5A 4LXLA 5FWJA 3FC0A 1Q8PA 1QJFA 1WMXA 3G6JB 5I0UA 3INAA 1ZM1A 4XILA 3T3YA 1GV9A 3FHQA 3ZFEC 2P3KA 1OH4A 3FUQA 3WNNA 1BMV1 1FPN1 1VIWB 2Y0IA 3EB7A 4AF9A 5CU1A 3S7IA 5F2WA 4UF0B 1SEFA 2WA3A 2Q8CA 1PK6A 3SXWA 3ZFGC 1S0FA 3SKVA 1US2A 4I2OA 3WV6A 5H9QA 2DDUA 5HPOA 1RXGA 2X5IB 1CJPA 2FCUA 4FPKA 2D6MA 2P3JA 1UY3A 2ZS6B 4XUOA 5AC91 3O1MA 4FP3A 4QGMA 4NO4A 1CZTA 3MV11 1PIV1 5GJ6A 3O1OA 2IXIA 1POV1 2YC4A 4KWUA 1DQ6A 3I3MA 4LK7A 1AR92 2XJQA 1HIXA 3WQ1A 4AFDA 5JCTA 3DN7A 2BVVA 3WY6A 1RUNA 1ASJ2 1AVBA 5GZFA 1TG7A 1W6OB 3VBOA 5I0RA 2IWGB 2XJRA 2Y6GA 1GOHA 1W6QB 1ENRA 4P9LA 1S0BA 3GCXA 4QWNA 5FUIA 2Y6LA 1C1FA 1ODMA 1RUC3 1SDWA 3BU7A 1WCKA 4JTNA 4RFRB 4XUPA 4D7SA 1MEC1 1XNDA 1KJRA 1JOBA 4LLFA 4HFSA 4OUSA 1PNGA 3VDDB 4CDQA 3PUHA 2RS31 4YNIA 3VBRA 2W1SA 4ZU5A 1NUKA 2NPIA 2CAVA 3VZLA 4PDWB 5FQ0A 1W06A 2A7AA 1LOGA 3TB0A 1W0OA 1GZWA 1ZRIA 4Y5Z0 3RJ2X 4FP2A 3ZO0B 4DNYA 4R9DA 2RE9A 4CUCA 3AZZA 5LBFA 2GMEA 4RQPA 1V6IA 4HZFA 4UXAA 4FCAA 4FFFA 3H3ZA 5CNAA 3AP7A 1W8NA 2SBAA 4C0HA 4QPYA 2WO1A 1HQLA 4XOGA 2W5FA 1IS3A 4Z2WA 3OF1A 2JEMA 3ZFFC 1JOJA 1UQXA 3HWJA 2VUAA 1RUD3 3UV9A 1VE0A 1Q8VA 1FNZA 2P1BA 3VZJA 5FMOS 4KGGA 3APBA 2VY0A 2YMZA 1UU4A 1M06G 1V9U3 3SCHA 5FZMA 5A33B 1IPKA 4XUQA 1NQJA 2QTWB 1B35C 5FZOA 4FOVA 1ZBE3 3OD0A 2BBVA 4B3NA 2BRTA 2NM1A 4JDOA 1H2KA 2Y6JA 2ZGUA 3KM5A 5FR3A 1UZWA 4ARYA 3NNFA 1REFA 4QPWA 4H2AA 4AAPA 1BJQA 4K7JA 1XSRA 2Y26A 3GZTB 2VGDA 1IS4A 3Q9OA 1ZA4A 2J22A 2QDNA 4MHUA 1QOTA 3USUB 4AI1A 4AEDC 2QFEA 3I2HA 3TEYA 4K21A 3J7NA 4MZUA 2Q4SA 1MEC3 1OBNA 3B02A 4D94A 3VBFC 4Y26A 2E33A 4QD2A 4FSJA 3NSTA 2RS33 4N8MA 5EJZB 1JUHA 3FL7A 3Q8BA 3D0SA 3WDXA 3WQBA 2VW0A 1HRI2 4EQVA 5FXXA 4Y5TA 2R071 4CUBA 1LHUA 2BWCA 3WP5A 1DYOA 2V09A 1EYBA 1DGWX 1AYM1 3ZXKA 4A6SA 4TLGA 3O1UA 3VBHB 1E5IA 4Z82A 3GGLA 5FPXA 1UW8A 3KVBA 3OG2A 4TLFA 2FMYA 1FNYA 1OXCA 2B42B 2NMOA 5BXXA 3VL9A 2D43A 1HXS1 4QHOA 4QQPA 4QXBA 5A3OA 4UYBA 5HCHA 4OHWA 2DVAA 5FO7B 1YWKA 2Y6HA 3Q8AA 5FZGA 5L7OC 5CAZA 4CPBA 1Q3EA 1XE8A 4OYUA 3RMXA 4CDXA 4CDUA 4QX7A 2BBAA 4V2VA 3GYDA 1OT5A 4ZU4A 1JH5A 1KD7A 5E88A 1IZ3A 3G7DA 1JN2P 2JDPA 1AR62 3DUIA 2GC0A 3KLSA 4XDQA 4GB31 5FK8A 3VKOA 4QQHA 2FZ2A 4Q2FA 3O1TA 4FQ4A 4XJZA 3LGRA 3ACLA 2Q8OA 4B1LA 3N9NA 5E16A 3T1LA 5AVAA 1GFF2 3OY8A 4B7EA 1IQAA 2FD8A 2VUDA 5IAXA 3E5QA 4HVQA 4QB6A 2R1BA 5FLJA 2HWD1 1X36A 3KQRA 1HJGA 5FYHA 1BMV2 2JDZA 2VMGA 1DQ1A 2A70A 5FZ8A 4XUNA 4CUGA 3BB6A 4DXSA 2KA3A 1H9PA 5JIAA 1R1A1 2UURA 1AYM3 3J7HA 2ENRA 4RHV2 2UYAA 1VJ2A 2RDNA 4XF0A 3Q8FA 1O8SA 2A6ZA 4XE9A 1M4WA 1AL0G 3EMRA 2VMFA 3PTRB 5F32A 4KL1A 3PJYA 1QF3A 5JOXA 1F5JA 3RWNA 1TME2 5A7PA 2WZPP 2Q30A 3ZFEB 1QJU2 2JIJA 1GLHA 1CESA 1CVNA 3JXSA 1MPXA 1J58A 4JRLA 3ZFGB 5JOZA 1NA1C 2C26A 1DZRA 1XPWA 1K5MA 5C33A 3E6BA 3DCQA 5FTTC 4AGGA 3J8F1 5A80A 4PIYA 1ALYA 3AKTA 4H3WA 4XFFA 4ZY9A 4LR4A 3K3NA 3UNPA 1SHWB 3PLQA 3LPFA 1CAVB 1V70A 1HV1A 2DVDA 3S0MA 1PGW2 4QU2A 5G05L 1AX2A 3FLRA 2HH9A 5FZ0A 1MS5A 1C8NA 1NE6A 3U75A 4B1MA 1MS9A 3C7EA 3P3PA 4IQPA 5BPXA 5ACA1 4S2FA 3ITQA 2WFPA 1EV13 1AR72 3USSA 1WZXA 5KBFA 4ORFA 5JOWA 4JGYA 5DZFA 2XUEA 4NUBA 3DYPA 1GP6A 2WO2A 3PURA 3LE0A 4OMCA 2Y8KA 4X8NA 1AR61 3GZEA 2P6HA 2LTNA 4Z92B 3OPWA 4CP9A 1OQDA 4CPBD 4XF1A 4AFCA 2PLV2 2QQMA 1JZ8A 1D7PM 3OBZA 1PO12 4M3CB 2I45A 4Q0UA 1DDLA 1R1A3 3M3IA 4BIFA 3IIIA 3CZJA 2XKOA 2QDRA 3KV6A 1NXD1 5A7SA 1FV2A 1F5FA 2HBUA 4RYDA 1QGLA 1ND3C 1G9DA 4QQOA 5GZEA 2XGXA 2ARBA 1RUH1 4AHWA 1OD5A 4JGZA 2VULA 1UX7A 2DCTA 1UU5A 5FMBA 3AMMA 1X9PA 1L3JA 1CX1A 4ONUA 5EJ1B 1PGL2 2ZBJA 5D21A 3D3AA 5CBLA 5FZ1A 5ABJC 1RUI2 4KG8A 2QQIA 3OY8B 3MW4A 1YCIA 4DZGA 3ECQA 3CQOA 2FCTA 3PTYA 2J42A 1YJLA 2YG0A 1WWYA 4G4FA 3ZFFB 5BNPC 2VQUA 4YRDA 4CVUA 3IN9A 1PHMA 3TEWA 2F4LA 1FT9A 3N9PA 4OCTA 2UWAA 2XL9A 4FAHA 2HWE2 2R042 2OUJA 3RWKX 2VOKA 1W8WA 4INDA 3T2PA 3ZN6A 1B35B 1MS3A 2EXJA 1GSLA 5ACA3 1AL22 1NOVA 4AAXA 2RS52 1V6MA 1RUE3 3M3QA 3N7KA 3P6BA 4NMIA 3ROUA 5JXJA 4XF3A 2ZPXA 1QHDA 4Q8KA 1BBT2 1ND2A 1RMU2 1S0GA 3QOPA 4OZXA 3JCIA 5IATA 2R7EB 1CONA 3H9AA 4O61A 2HYXA 1O4YA 4AI0A 5L36A 2Y64A 4MO3M 4AGVA 1WW6A 2AYHA 4K40A 3RDIA 1VB2A 4AEDB 4MUVA 2A75A 3I59A 4ITCA 5LBEA 4B29A 3POIA 3VBFB 2ARAA 3CL1A 3URFA 3SNMA 1VMHA 2XWBB 1ZRRA 2WT1A 1RUH3 2ARCA 1HN1A 1VRBA 1F4AA 5FZ4A 3ST7A 1AZDA 3JBG3 1YQ2A 4QQ2A 3POEA 4YG6A 1WLTA 5JVVA 2E7QA 5JDBA 3WQ7A 3NNLA 3W21A 4LKEA 3PNAA 1PO11 1GNYA 4MLOA 3ZYFA 3RZZA 1OF4A 1ZBA1 2JG8C 3RZGA 1R1ZA 4DUWA 3KVAA 5CFCA 5AFEA 3POYA 1GU3A 1BEV3 3JQWA 1W6PB 3MLJA 4IV1A 2XJVA 5DAQA 5JPMB 4WM7A 3H8RA 4S2HA 3K4DA 3ELNA 3T08A 3WG1A 1N1SA 2WS92 3HQXA 3NWKA 1S0JA 4IEQA 4BHPA 5L7OB 3BIEA 1MZFA 1S2BA 1V6NA 1LOBA 1NX9A 1QDCA 2PHXA 2UY8A 4I01A 5C4WC 2GNDA 3D82A 5E89A 4AQSA 1JI6A 4YFWA 1LU2A 3O1RA 3OGSA 4NROA 4Y20B 5DAXA 3I49A 1WW7A 4DXTA 5A6YA 2RS12 2QKDA 5K0UA 4DB5A 3KGLA 2CDOA 2HWC2 5FZFA 1O3RA 2YUEA 4MGIE 2MEV3 4KBZA 4YVSA 3V64A 3WNXA 5FYVA 2VZQA 1HB2A 1AL21 1RGSA 3E5UA 4LUMA 5FP3A 3AVSA 5BNQA 3IM0A 3VKMA 2AACA 1H6YA 2D93A 2VNVA 2XOMA 1JU4A 4QGLA 2DVBA 1MVQA 1VBD1 1UKGA 2WQ4A 2AZ5A 1RVF2 4LBNA 4SLIA 4WVMA 4AG4A 1SFYA 2XPJA 5F37A 5FZ6A 2O14A 1XNKA 1RTVA 2K0GA 5C3SA 1RL3A 1JHJA 1E5SA 3U14A 1QJX1 4CEYC 3THTA 1NCQC 1BZWA 1ZBA3 1DP0A 3AYEA 5FPUA 4FFGA 3FE5A 3LEKA 3OB8A 4YG0A 2I74A 4LQRA 3O1VA 5LBCA 2W46A 3FJSA 3ILNA 4N53A 2FDIA 2D6NA 3PIGA 1TE1B 2RV9A 3DKWA 3SH3A 2EXHA 1W9TA 2VOVA 2E63A 2VD7A 3WHUA 1KEXA 1CJDA 2RR13 2BUKA 3K75B 4PLOA 4K20A 2VUJA 1JS9A 2E7TA 3IKWA 4HN1A 2Q0AA 3ZMOA 4CCCA 2VJXA 1ULDA 3KV9A 3F95A 4LO4B 4XJWA 5FYZA 3WG3A 4BB3A 1NA1B 5GLVA 4QT6A 3I59B 5FYUA 4FPGA 4E8DA 1DGRN 3ZXEA 1HQNA 3CDZB 1J3RA 1XU1A 4LBQD 4NIDA 3OBRA 1H8TA 3T30A 4NHMA 3UKVA 2ZABA 3UKTA 2E51A 5I93A 2JG8A 1H9WA 4K8RB 3WT3A 5FY0A 1SFNA 2BP6A 4NPMA 4LBQB 1C28A 1YYNA 2ZA9A 4Q0QA 4UW6A 3MICA 4GIQA 3QACA 2MPFA 3M1HA 5DXDA 5LWBA 5LY1A 4NWWA 1FOD1 1VBD3 2P4EA 3H42B 5FZ9A 1GP5A 5CISA 1GANA 1SACA 4QDSA 4HOOA 2FDGA 2HEYF 3EQEA 2ZGMA 1QNYA 1CZSA 1W3XA 2PHLA 2JG9C 3S5AA 4LO8A 4P9IA 3WDWA 1QJX3 4XJAA 4LO5B 2VQAA 3LKJA 4YLZA 1AUYA 2RJLA 4ISRA 1LJ7A 1FI2A 1ND3B 1O4TA 3IPVB 2XJSA 4IEUA 1TVGA 2D6PA 2HBTA 2EF6A 3KF5A 3PU3A 4UOJA 2JE8A 1EPWA 1QEXA 2W47A 2W92A 1SDDB 2VMCA 2YB7A 2YHJA 2RM22 2P3YA 3ASIA 5FAXA 2JJ6A 5CKNA 1S2KA 2EAAA 4LNVA 4HLTA 4ZZ5A 5FO8B 1XBFA 5FZKA 4AW7A 3S57A 2Z79A 2EIGA 4QKNA 2TUNA 4CCNA 5HXVA 4CE8A 5TSWA 4OULA 4XJ8A 4DINB 3MPPG 1S0CA 1CR7A 1DF0A 2JD4A 3ZSMA 3E5XA 4CEWA 4DFSA 3WF4A 5ABJB 4FTEA 2W2IA 1OQ1A 5FZEA 1YLLA 4M3CF 4DXRA 2NLRA 1I1EA 4EZHA 1OPMA 3KGZA 3EHKA 5BNPB 3OD4A 4WVMB 4E4ZA 5JSRA 1N3OA 1AYN2 3I2GA 3MIFA 1OI6A 3OGVA 1JYIA 4CEYA 1IPSA 4A42A 3GBWA 3B00A 4IE5A 2XJTA 2JDKA 4GMP1 4XQDA 4CU7A 1T6GC 5DUUA 1R083 1QJEA 2VZTA 4JAAA 4NIAA 4EWAA 3VLBB 1X8EA 4XPVA 1LHWA 1WW5A 2WZR2 1ZZ7A 3KF3A 4Q4V2 3AJZA 4Q0PA 2XMLA 4HSLA 4B4PA 3AXEA 1RJ8A 1DLCA 1OMIA 4LHNA 4AYUA 2JDAA 1RUJ1 2VNRA 4Q26A 1DBNA 3GHMA 1CAUB 1GWMA 1UU6A 5LEKA 1CPNA 3B9IA 1WA4A 3NV1A 2XUMA 2IXKA 4LORA 4UFLA 1DQ0A 2YDEA 3A0NA 1CIYA 2EIEA 2A6XA 2DV9A 1VALA 3ILRA 4YM2A 3RMYA 3KHBA 1U5ZA 1OVSA 3ZOIA 2HJIA 4GWNA 4FXGB 3AMQA 4D7TA 3MZHA 3QH6A 5DAPA 5FDBA 4QPIA 1A6CA 1O8PA 4JQTA 5A70A 3HBZA 2VMDA 5IVEA 3V65A 3WX5A 3BTZA 2GALA 4MGSA 4XFHA 3ZYGA 1HLCA 1YEWA 4CCJA 4DY3A 4XHBA 1MS4A 4DRRA 4DRVA 3N35A 1ULEA 1PK6C 2F17A 3LCPA 2JIGA 4HBNA 2YY1A 3LDBA 1VBA3 3ZXFA 3K2OA 2UYBA 2ZHNA 1KS4A 2BEOA 1AR82 2A6YA 2RJ2A 2HWF1 1WD4A 2DCYA 4P14A 4CCDA 4HONA 2GC2A 2QE3A 2P37A 1A34A 3VBSA 3IMNA 1FAYA 3AP4A 3DGTA 2D7FA 2KD7A 2BGPA 4ZXEA 1QJY1 4QM8A 3IMMA 3I8TA 2E6VA 4MGYE 2R063 3HBKA 4LA2A 5C4WB 4Q1RA 2RMU3 1OUXA 3AVRA 4MADA 1AX1A 1XQNA 4ES9A 3FLPA 3JD71 1X8MA 4P9YA 3GJAA 4HVRA 4QGNA 4YZ1A 2DFBA 1RHI1 3N7JA 2ZGQA 1FMD2 2AH2A 1PMIA 4ASLA 3VBOC 1OQEA 1BHGA 1XNBA 2VBPA 3RYPA 3C8XA 1JZ4A 4HPKB 3SH5A 2AENA 1J1TA 3P1IA 2C9KA 5T50A 1I5PA 4JTOA 5DZEA 3Q8CA 3B94A 3MHZA 3VZOA 1VRH2 3AKPA 2VZ1A 4R8HA 2ZX0A 1LECA 1J59A 2W95A 1NCRC 1NZIA 2B9UA 4PJYA 5ISLA 3SC7X 1JZ3A 1G6NA 5FY8A 1LOAA 2WZR1 4CDQC 5KXBA 4NIGA 4Y33A 3VBRC 5FXVA 2WQZC 1QQP3 2QNKA 2IZWA 1KJLA 4CEYB 3POWA 1RUD2 4PIZA 1MZ6A 1NCQB 5F2SA 2J1UA 3I97A 4BIOA 2VZ3A 2ZGNA 3TN93 2OIIA 2IVJA 2VG9A 4MVTA 4RQPC 5DN2A 1V9U2 3HQRA 2RHPA 1ZBE2 2G9ZA 4FPCA 4XHXA 4CU8A 5EFUA 4XFCA 2DCZA 4KU8A 4YM1A 4Q29A 5H9PA 3POGA 2HWF3 2VR4A 4QDQA 5A3NA 1BLZA 5HCAA 1RXFA 2WABA 4E4DX 4D6RA 1HJFA 2DCKA 2ZGTA 2XWJB 1QNWA 4UT5A 3ZYHA 5IK7A 1VBC1 4R9CA 4I02A 5EWSA 4NR1A 2J1RA 4P5YA 2LS6A 2OUHA 1QJY3 3B7MA 3BVCA 2GH8A 3KT4A 3HPNA 3LWCA 1C8M2 3WNMA 1G7YA 4KH9A 4OHXA 5D2AA 2Y60A 3HN1A 2CHHA 1RHI3 1QXJA 1F15A 1N1TA 3ME2A 1HRV1 1UOFA 2CL2A 2G4IA 1CAWA 3RZKA 4LUKA 2A73B 4LOTA 5A6ZA 4EV0A 1VBB1 1RIRA 3NJXA 3AZYA 3ZPYA 1JW6A 1JHNA 2PTMA 4G3YC 5SV8A 5FXZA 2W1WA 2YZ4A 4I30A 2UWCA 3V0BA 5DDJ2 5H9SA 4AEMA 4FOWA 3CEWA 3BODA 1FMD1 4EWEA 3AZWA 1B09A 4XCBA 5KR7A 4FPHA 1UZYA 4R9AA 2JG9B 3LDKA 4CXYA 2D97A 2QCSB 2R6QA 4JC1A 4YW3A 4D69A 1O7FA 4ZKTB 3HQUA 5FLIA 1U5XA 3BUCA 1KQRA 3LIGA 1W04A 3HNBM 4PLNA 4C1WA 4EN8B 5FUPA 4DXZA 5DG2A 5FCCA 2XQXA 4CCMA 3WDVA 2ZHLA 3HIFA 2R0FA 5IVCA 1XRUA 1RUOA 1GOFA 1QMJA 3AMPA 1R092 3K77A 2Q1MA 2I2SA 1HB1A 2YROA 1KDMA 2QQOA 2W9XA 4M01A 5JZGA 4UAPA 4RSUA 5DPNA 1LR5A 4E2QA 5T3NA 3K48A 3UESA 1NCRA 1WMDA 4CDWA 4UI9L 2PELA 4M00A 3PUSA 5A1LA 2R32A 2C5DA 3RVHA 4Q4Y1 4CDXC 4AL9A 4BWOA 4CDUC 3RYKA 5A3LA 2KXLA 4K8FA 1NG0A 1OVPA 1Z7S2 1UY0A 3CNAA 4GA9A 4MGZE 2CSGA 2IXJA 5E6HA 1HRV3 4IEVA 2WAOA 1J3QA 3LOBA 2WO7A 4WZFA 3H7JA 1O6UA 4Q4X2 1COV1 1RUG2 1YQCA 5LK7B 1FPN3 5EYYA 4E8CA 2BDRA 5A7WB 2JKXA 3ZM8A 1V6JA 4XIOA 1NY72 1SBFA 5C8CA 5IK4A 2R1DA 3WSOA 2LALA 4W50A 5IW0A 4N7IA 2P5BA 1BVP1 2ZKLA 2VE1A 4WM8B 5A6QA 3K46A 3TNPB 3CJIA 5A32A 4BPZA 1YFXA 5AC93 1LULA 4UWDA 2ET1A 1PIV3 2CAUA 5IVBA 1I9RA 5IFPA 1OKOA 1POV3 1AF9A 4M3CE 1UYYA 4CP2A 5DAWA 1UXXX 2D5FA 1H4GA 1PVXA 3O7OA 1UY1A 4LPLA 1W3VA 4XCAA 1MZ5A 3O1PA 2P6CA 3LIHA 3R05A 2JB8A 4Z8BA 1PZ9A 4I3PA 5FO9B 3OGGA 2A6WA 1OLME 2J1EA 4JQRA 4OMDA 3NKTA 2XQRA 2VU9A 4H55A 1H1IA 4HL0A 3SEPA 4XDOA 4NRPA 1LGNA 3V0AA 1S1AA 3KCYA 5A3UA 3I2OA 3A23A 5C3RA 3LA3A 1AR91 1PK6B 3HAGA 4EZ4A 2HEVF 3MLLA 1N47A 1K5MC 5AFBA 3D5OA 1ASJ1 2YBKA 2AUYA 3WXPA 1GWKA 5JI9A 1Q56A 3OYWA 1Q8SA 5FKBA 4OZOA 4KBBA 2WNVA 1UXZA 1COV3 4HG6B 3VDCA 3JB4C 3W5MA 2X8KA 4OVEA 3I2DA 1URXA 4XIKA 4MXVA 1UF2C 3GCWA 3V56A 3U0ZA 2UU8A 1J1LA 2WUHA 2WN2A 4JGYC 1ULFA 5L19A 3FLTA 1CQ9A 1JZ5A 4LMFA 1Z7S1 3VBOB 5IVFA 4A41A 3TOJA 3UJOA 1STMA 3HR9A 3MIGA 3WDTA 1I3HA 2ETEA 3P5BA 4Y4RA 3WZ1A 5CKMA 4BQ4A 1RUG1 3RI8A 4QAWA 1X50A 5HBAA 5IUQA 1NY71 3PMEA 3L2YA 3SMHA 2BQPA 4EROA 3IIAA 1AXZA 1OA2A 3L2HA 1BQPA 3VBRB 4CDQB 5KHHA 4QQLA 4ZS3A 4JGZC 5FQ0B 3WINE 2WA4A 1BYHA 3L9JT 1ZREA 1GZTA 1OKQA 1GZWB 4YGDA 4AVTA 3WW4A 1SFPA 4ZXKA 1C5HA 4RQPB 4GALA 1GZ9A 1KDKA 3NV4A 2Z42A 4XDPA 3RZHA 4SBVA 2DTWA 1OOPA 4B8EA 4L2NA 1WLCA 3ZX7A 1AJKA 2Q8EA 1YQ6A 5ANQA 1UAIA 4CU9A 1ASJ3 1RUE2 3FZ3A 5CG8A 4R52A 1KITA 4C90A 1TQ5A 3M3EA 4XXAA 2R073 1YRZA 1V0AA 1WCUA 3DXTA 5A32B 5F7UA 1NLRA 4WVVA 1ENSA 2YGMA 2A3XA 2VAUA 3W9AA 2WLPA 3RI9A 5FZOB 2VW1A 3LEIA 5D8AA 2GP5A 2C1FA 5EPAA 3VZMA 4PBPA 2VW2A 4D8MA 3AJYA 4LULA 3WD5A 3WP6A 5LATA 4LTAA 4BA6A 1HRI1 1ND2C 4HXCA 5FYBA 1ZZ6A 3IDEA 3OEBA 1Y9GA 1E5HA 1HXS3 1UX6A 1NLSA 3JBG2 1TMF2 2CDPA 4XC9A 2VZPA 1GMMA 5A3PA 5CYYA 2JD9A 3OCPA 2A71A 3VGIA 2C9AA 1NE4A 3HN3A 1LU1A 4YGEA 3OSDA 5LA9A 1GYKA 5JSPA 1GBGA 5KHKA 4QHBA 2WZ8A 3NAPA 1SCRA 4CCKA 2OXBA 4XETA 4DEVA 5C3OA 1QJZA 1BEV2 2GMPA 5I0SA 3U1XA 2ZHMA 2V5YA 4GB33 3C7HA 1G9AA 3VKNA 3H1MA 3U4XA 4L11A 3JQXA 1D4M2 4XBNA 4YVWA 4QPGA 1QOOA 2VMIA 1NKGA 1LOEA 2H0VA 4OUEA 2XG3A 1UOGA 4XZPA 4MGTA 2CYFA 1O3QA 3LOIA 2OX0A 2WYFA 3CZUA 5JOYA 1RUF2 2P34A 2WFF2 3M3CA 2ZACA 4MH0E 5FPLA 2BGOA 1WD3A 5CFCC 4W8JA 1N1VA 4IV3A 3ZXAC 4URTA 3UGFA 3PUQA 1O4ZA 1YO8A 5J09A 3R0RA 1ZRFA 4IV1C 2Y34A 2HWD3 1H6XA 2VCMA 2NP0A 3T2QA 5HV0A 4WM7C 1GP4A 2DUQA 5JMOA 1ULCA 1UY2A 5FYIA 5C71A 4XEZA 2O1QA 4JDMA 4NAMA 3ACFA 4BOWA 4AZZA 4NHKA 2QBXA 1FV3A 1IHMA 2JDYA 3IZOA 3FWEA 4PLMA 4CDUB 4NVPA 4CDXB 4XBLA 1C5IA 1DIWA 4J25A 2W91A 3CBNA 4LIVA 4WVWA 4G9SB 3OTFA 1CN1A 3C7GA 1WCSA 5K0UC 2DWRA 3WDUA 4COWA 3PUIA 5I8YA 2D6LX 1CWPA 1PX4A 4Y24A 5JR7B 4F7ZA 4YVSC 3LFMA 2WYSA 4RHV1 3AB0A 4A6OA 2PAKA 3WNKA 2VQ0A 5KWRA 4C0BA 1PNFA 4FBFA 3J8F3 1ULOA 2YYOA 3MUY1 2ORXA 5FZAA 1XE0A 1ZX5A 2CWMA 2Q8DA 1H8VA 5A1AA 2WWJA 1TME1 2OA2A 4K1ZA 4Y22A 2E31A 1VMFA 2HKXA 1QJU1 3AL6A 1JZ7A 3H50A 5JR2A 1J3PA 1SLIA 1HB4A 2TBVA 4A4AA 4LHKA 3T4HB 5IHRA 1W6NA 2EIDA 1NZCA 3IWZA 3IAQA 3OBAA 4N53C 5FYMA 4XJ9A 5FPBA 3WOGA 2QZ3A 4XJUA 2AR6A 3MPBA 3THDA 4BQ1A 2W3JA 4AQTA 1AR63 4Q4W2 1YUDA 5EYXA 5J98B 1DFQA 5F9TA 2Q5TA 1XXNA 2Y6KA 4W6YA 1PGW1 4E2SA 4FPLA 1D4M1 1E57A 1QY4A 2YU2A 3AC0A 1UMIA 2E9QA 1PO22 1F8VA 3B5LB 4M4PA 4XTPA 2MHFA 1JMUB 2BGCA 3C7OA 3GBGA 4HSJA 4O9GA 3ZR5A 1AR71 1U5IA 3I4IA 1LOFC 1K5MB 5FZHA 4B4QA 3O12A 1MS8A 3M70A 1X9TA 1PVC2 3EYPA 1LHVA 4L0PA 2ADEA 1W6MA 2XBO2 2ZGRA 3VZKA 1PGSA 5FP9A 1W2OA 4FOYA 4FQZA 4NHYA 4RGKA 2DCJA 1H8TC 2ZGLA 3KZ4C 2PLV1 3VD7A 3LZZA 3I2JA 1G9CA 1LAJA 1GNZA 1SLTA 2Y0OA 2PHRA 3DPRA 4EE2A 2PA7A 3ZYJB 4AOCA 1XC6A 4UFIA 4RHV3 5GLTA 4MSVA 1CPMA 3GDBA 4XFAA 5APAA 1VAVA 5GLZA 5FJHA 4PF1A 4JGYB 3FUOA 4R9BA 1Y43B 3A21A 1L7QA 4Q1PA 3E6DA 2QQPA 3KHCA 2D6KA 4YWAA 1TME3 3BCWA 4GWMA 3VZNA 2BNOA 4CP9B 5FPZA 1QJU3 5J96B 1PGL1 1KFUL 5A1FA 2X09A 1EP0A 4KU7A 4QKFA 5LA2A 1RUI1 2NQYA 5JXIA 1H4HA 1IG3A 1S0DA 3S7EA 1VBE2 4ES8A 1ZRDA 2DVFA 1Y9QA 2GU9A 3GZUC 2VXRA 5J37A 1W99A 3TNQA 2ZMNA 3ZSEA 5HCBA 4K3UA 2QQLA 3NQHA 3FBMA 4JGZB 2HEWF 4XVHA 3P3NA 2WSVA 2XKPA 1GICA 1REEA 2ADDA 2BOJA 2HWE1 2R041 3KT1A 2WNUA 4FPEA 4MXWA 2PFWA 5K4LA 4CSWA 2J1AA 4Z2AA 1XU2A 3OBTA 4BQYA 3I7DA 3E97A 4ASMB 5DQ0A 2RS51 4CEWC 2HYKA 5I91A 1AR73 1GQHA 3NVCA 1Z78A 1R082 2PN5A 3ZKYA 3T1MA 1BBT1 3PIJA 1UCXA 4LEJA 1MR5A 1RMU1 1GWLA 2QQJA 1QIQA 1AJOA 4D0QA 4IE4A 1LHOA 4RFT0 4AHZA 4YW7A 1LOCA 3K4AA 4IGQA 4JHZA 1SCSA 1QH7A 2J1VA 1PO13 4I09A 1Y7BA 1EAH2 2ZZQA 5IAVA 5HI0A 1N3PA 2BNMA 2GNMA 2E53A 2I07B 3ES4A 4KI5M 4V1PA 3ZN6B 2XVKA 3GBFA 3ZXJA 4JHTA 4NHLA 2E26A 5CFDA 3AKRA 4IE6A 1YFYA 3KSCA 4GH4C 5CVRA 5JI7A 4FPFA 1PVC1 1XYOA 2J1SA 4C8DA 1ND2B 1WMFA 3JU9A 2AGSA 3MBWA 2JICA 3N9OA 1DQ5A 1HV0A 1LODA 1WBLA 2ZOEB 3PHMA 1O5LA 4YYOA 3VD4A 1UZVA 4JRAA 1REDA 1QWRA 3N7MA 3ON7A 5JPNB 1LOFA 1MQTA 2W39A 2VNGA 4ATEA 4E9KA 5J48A 3GF6A 2GSYA 3KMHA 2D98A 4LIUA 2A1XA 5H9RA 3QCWA 4O9EA 1UYZA 1VBA2 2JDMA 1JBCA 1LEDA 3NO8A 5M0TA 4QPIC 5EP9A 3QBQA 4XAAA 4BK5A 2ZMLA 3MIEA 5I0TA 4BQ2A 2HWE3 2R043 4COZA 2WS91 4JZRA 1YXWA 1XNAA 1EUTA 4FFHA 1AL23 2HWB2 1A3KA 3SCFA 5F3CA 2RS53 3J9SA 1D4VB 5CFCB 4LITA 1VBE1 4PI2A 3WW3A 4ZS2A 1GOGA 1HN0A 1Q8QA 1BBT3 2RMU2 3LA2A 4GKXA 5ANNA 4IV1B 4N43A 1OFNA 4YW6A 3W20A 4F3JA 2RS11 4WM7B 2QQUA 5FJKA 2VMEA 3A0KA 1PM4A 3VBSC 1OSGA 2HWC1 2NMNA 5KXDA 4F8AA 3BTYA 1GR3A 1PMJX 4D6SA 4TYSA 2JDNA 4KMQA 2VH9A 4MGKE 4X8PA 1RVF1 3T4VA 1YIFA 3HD8B 1XE7A 4HANA 3POSA 5LCWL 3K3OA 5B2GB 2ZGSA 2Z2SB 3BIWE 4LHSA 1UIJA 5I0DA 2EVXA 5K0UB 2IUWA 3VHNA 2QVSB 4XQ4A 3WF2A 2ZMKA 4X6RB 4A3XA 2JKBA 3MFCA 5BNOA 1YQ8A 3VL8A 4YVSB 1QU0A 3HT1A 1JYTA 4QKDA 2OQ6A 2RJKA 3VBUA 3TYJA 1MZEA 3CMGA 3B01A 4L99A 1CAXA 4META 2CWSA 4D7YA 2DYCA 4Z1VA 2XLGA 1DLLA 4KGQA 2AC1A 1F31A 1TZOA 3TEXA 5IYYA 5JIUA 4JKKA 1CGPA 1V00A 1BKZA 3RFRA 2VMHA 3UL2A 3GNEA 4AQ2A 3M3OA 3FHAA 4GH4A 2B7YA 4N53B 4PI0A 1POV0 3ZYPA 1FOD3 3R4SA 4BQWA 4BZ4A 3ILFA 1AXKA 2NYYA 4YW1A 1QKQA 2TNFA 4OFGA 5EIYB 2RS13 4A2UA 3PVNA 3LD8A 1UIKA 4B4RA 5CA6A 2VZRA 5C9AA 4YARA 2HWC3 3RG0A 1UWWA 5KXCA 4LKSA 4JV4A 5JAXA 1S0EA 2XLAA 2HWB1 1ACCA 4FOQA 2ZAHA 2GC1A 1I5ZA 2VXJA 5GKAC 5DAVA 1OD3A 1DGLA 3AKQA 4TXWA 1RVF3 2CTVA 3H8UA 4YFZA 1OUSA 2C0ZA 2XVLA 4CCEA 2W0XA 4TTGA 1H8TB 5F5IA 3ZKUA 1HDKA 4IEXA 2YXSA 3AP9A 2GN3A 2JE7A 5DABA 4R4ZA 5FV3A 2JG8B 3M4FA 4YW5A 3JUUA 1DGWA 4N90A 2WINB 4UW4A 2ET7A 4K9SA 4Y3OA 1OC1A 5EQUA 5BNNA 3IT8A 5A3TA 1W9FA 1I6XA 1RYYA 3H0OA 4Y5SA 4RL7A 4RR3A 3WF0A 1DZTA 3MFAA 1Q8OA 2YFUA 3B3QE 3I2FA 3OPTA 5GZDA 3N9LA 2RM21 2EIBA 1EUUA 2YGLA 4ET7A 3RZLA 3UT0A 3GJBA 1LGBA 3POJA 4GQ7A 2PHUA 3NMBA 4GMP3 4M0HA 5C5TA 5FOJB 4LO7A 5F8PA 2ILMA 1KFXL 1IG0A 3WCSA 1RUC2 1C1LA 5FOBB 4UF0A 1O59A 5FZIA 3NKGA 2ZGKA 4OI4A 3U10A 2R49A 4PCRA 3H7YA 3VD5A 1F2NA 1IKQA 4AVVA 1AYN1 4C1XA 2OYZA 2X5IA 2VOWA 1RUJ3 1ULPA 2VOXA 1JUIA 1OF3A 4C91A 1IOAA 4OI1A 2IXCA 1PMHX 2GAUA 1ST8A 5JZGC 3MIHA 5EZWA
chains in the Genus database with same CATH topology
1SLLA 3WCRA 4H14A 3O0XA 4CDWC 3LSEA 4CEWB 3J4UH 3RQ0A 1Z0HA 3KB5A 1MS0A 3EXUA 5EXOA 4Q4V1 1OLQA 1W6OA 4P9GA 3SISA 3WQ0A 1W6QA 1WUVA 5AC92 4AQ6A 4AEJA 3MW2A 2CNAA 5C8CC 4GH4B 4HK9A 3UJQA 3SITA 3ES1A 3WLUA 3VDDA 4Y1ZA 5K7PA 2R0HA 4KQ7A 4S2GA 3ZDSA 2RM23 2OZ6A 2NN8A 3CJIC 1W39A 4A7KA 1PZ8A 4L92A 4EJRA 1YFWA 2P17A 1RITA 2BTVC 5FRAA 3NJZA 2F4PA 1OA4A 3MIBA 1D2QA 4BH9A 5KHIA 3JD73 1MEC2 1AR81 4RGGA 1ZRCA 2RS32 1O5UA 1YI7A 4EN7B 3H3UA 1QOSA 4QPIB 2D3PA 4YZ5A 2BFUL 3N3HA 4EN6B 4KWKA 1LCLA 4K6BA 3MYXA 4XYXA 2OW4A 5A33A 4B7KA 3R4DB 1H2NA 1RUC1 3RYRA 4XFBA 5T54A 4MYEA 2WZR3 4IEZA 4RA0A 3WUCA 2WNVC 4YW4A 4IEOA 3VBSB 3R6SA 1SLAA 1VRH1 2K2SA 3LA7A 3JZVA 3USUA 1TEIA 5L73A 4RS5C 4YM0A 3D0JA 4A7YA 3MI8A 3GALA 4A7ZA 3UK9A 1V6LA 5J7MA 4AVAA 2XLFA 5F6KA 3B93A 3D8CA 3EO6A 1RUD1 3MW3A 1VBC3 3QD6A 3CF6E 1V9U1 2WC2A 3VBHA 2CGPA 1ZBE1 1QXPA 1PM7A 1AR83 1W0PA 2W52A 1ULGA 1VAKA 3BTAA 2R072 4Y1YA 4UBHA 4CP0A 4N9IA 2H6CA 2YPJA 1VBB3 2DVGA 3EJKA 1C8M1 4L8QA 1ONAA 3RS6A 1SMVA 1AYM2 5A3MA 4XFIA 1OOPC 5KHJA 1FX5A 3ZIWA 1MS1A 1HW5A 1H1MA 1KRIA 1FMD3 4LT5A 5SV5A 5GZGA 4I0BA 4HN0A 4COVA 5LRSA 1EY2A 2FMDA 4D3WA 1HXS2 3H1WA 5DUXA 2Z5WA 1X82A 1VRH3 4UBGA 5BY5A 4NN0A 3CLPA 3ZSLA 5D8AC 1LTEA 5KC6A 4XW3A 2XL7A 5DDJ1 2XVGA 2ZX4A 4QM9A 2ATFA 3BPZA 5AVPA 3ZIXA 2QZ2A 4COUA 3HT2A 1U0AA 3RNSA 3ZVXA 4GB32 1CAWB 2IXLA 2DU1A 2F6BA 1Q43A 2IFWA 4DQAA 3FHIB 1LB2A 3WVJA 2VVEA 1DU3D 1YIPA 4LE3A 1O3SA 4Q4Y3 3V0BB 1EV12 3NAPC 4MX3A 5C6CA 1VP6A 3NV3A 1H0BA 1H2LA 1R091 3O14A 4LBKA 1RC6A 3PVOA 3THPA 5BUVA 4AI8A 4BYYA 2HWD2 4TSVA 3C2UA 4BLIA 3ZFEA 1G86A 4FPOB 4YVWC 1N3QA 3D6EA 4QPGC 4AEKA 2EXKA 4RS5A 4GULA 1C8M3 1R1A2 3LAGA 3ZFGA 3TWIA 4IV3C 3ENRA 2DU0A 2D5HA 2PHDA 5I8SA 5IT6A 4MV2A 4Q4X1 4LBOA 3RJRA 3N36A 1CAVA 2W08A 4K1YA 5JZGB 2JENA 1F9KA 4CDWB 2OVUA 1NCRB 2Y38A 4XQWA 2VECA 5DDJ3 2GN7A 3AMHA 3KS7A 3J8F2 3VHRA 4FAGA 1Q5OA 1VB4A 1ZYBA 3ZSJA 3ATGA 1H1AA 3AFGA 4YSFA 2WWSA 1XYNA 3ALQA 2GMMA 1PZ7A 5FREA 4M3CA 2ZZJA 2XJUA 1BVVA 1AR93 1C57A 5C8CB 5ACA2 1VLNA 2KM2A 2LUWA 1DZQA 3AKSA 3A4UA 2O0OA 4OLLA 1R093 3AM2A 3CJIB 2V73A 1WGPA 5GLWA 5FMOL 5T52A 3BOWA 1RJ7A 2ZGOA 3N7LA 4YG3A 3O0VA 4IESA 1LHNA 2ZAAA 2WT0A 1RINA 4W6WA 4YZ3A 3MF9A 4GKYA 2XB6C 3DF0A 1EV11 4YZ4A 4U36A 3TAYA 4COYA 3VHPA 1Z7S3 4LO6B 4Z07A 4LE4A 3ZFFA 1ZZBA 1RUH2 3WG2A 3AYDA 4Q4X3 2ZJCA 3RRDA 3R4UA 1RUG3 1C4RA 2DF7A 1SLBA 4IERA 3V0AB 1C3HA 1AX0A 4LBJA 1SBDA 1B35A 2BW8A 5T5LA 2ZX1A 2EALA 4E27A 3OPZA 3OYWB 5IK8A 4OHYA 5CG9A 2ZTNA 3IBMA 1OPOA 3JB8A 2CV6A 2WNVB 4CTEA 1EPZA 3PVBB 2OZJA 2O8OA 3CO2A 4GXLA 2EXIA 4HKLA 3DPRC 4AEDA 4FTBA 4RS5B 2MNGA 3AP6A 1LEMA 2WL1A 3CU7A 3MDPA 4Y1UA 1WW4A 3M2MA 3QLQA 4LBLA 4P9XA 5CIRA 3VBFA 3WP3A 1NXMA 4PF5A 1IS5A 3WR0A 1FATA 1UN1A 3PVEA 1LGCA 3KCCA 1D0GA 3VUOA 2DTYA 4AXOA 3FX3A 2QUOA 2WT2A 4H7LA 4BMEA 2MEV2 3ZYIB 3VKFC 2FZ1A 1YHFA 3KCXA 5GALA 1RUE1 2A3WA 3U07A 1HRI3 1W6PA 5EJ3A 3W58A 4KWLA 4AHYA 1JTZX 2W68A 5JMCA 5KHGA 3AX4A 3AXDA 4EWDA 2WNUC 2ZCWA 2CGOA 4J1XA 5L7OA 4IL7A 1WCDJ 1ZBA2 3ZN4A 1OOPB 3KD4A 1W2UA 3FFQA 3LB9A 4N7UA 2YC0A 4DPNA 2JE9A 3SLIA 5F6LB 4AFBA 4Y20A 2PQQA 4AK3A 3BOPA 2XH6A 3JBG1 1TMF1 2RR12 1S55A 3AMNA 3I54A 4F83A 4Y1XA 2R30A 4IEPA 1X33A 4IXLA 1ZZCA 1LENA 2GH2A 4HKWA 4XXPA 5D8AB 4AE2A 4HK8A 5CFDC 3SCGA 4X6QB 2XHKA 1IS6A 1BEV1 4LLOA 5JSOA 1H30A 5J36A 5F1RA 2DFCA 3C3VA 3FMGA 1SQ4A 4UW5A 1SLCA 1QDOA 3W59A 5EV7A 4XF9A 3AZXA 4AHXA 1RUF1 1OA3A 2ES3A 2WFF1 1MQTC 5GM0A 3TBDA 3NAPB 4P9JA 2H0BA 4YW2A 5F5QA 1VBD2 2A6VA 1CD3G 3WP4A 3ZMNA 2IC1A 4AFMA 2D3SA 3S6PA 3ZN5A 4WVZA 2D44A 4ISQA 4QPGB 4YVWB 1QH6A 4RGAA 1DYPA 1QJX2 3T2TA 2EAKA 2LM3A 2MEV1 2H6BA 1UMZA 4GMP0 1NA1A 4Q0VA 4J1WA 5D1IA 4IV3B 2PHTA 2X53S 3ZXDA 2GC3A 4N43C 3IDCB 4KNCA 2EA7A 5DUWA 3LSDA 5JLVA 3CJXA 4WZCA 1TMF3 4I3GA 4AI3A 1BXHA 3PMSA 4I0AA 2G9FA 2BNNA 4OHZA 4LBQA 4OI0A 1BCXA 1LESA 1ZZ8A 3OJBA 1FYUA 2B5HA 3U11A 5JWPA 5CADA 4Y4YA 4HMZA 1D2SA 3WUDA 1DQ2A 3VV1A 1D4M3 2RR11 4H7MA 4YGBA 1HKDA 4OUMA 4AWDA 2ARXA 3WHTA 2Z69A 3AP5A 4ATFA 5BNOC 3VKLA 1UPSA 4DOUA 1RUF3 2WFF3 3VBUC 5GLUA 2DUOA 1ND3A 3IPVA 4DS0A 4FPJA 4QMAA 1UD1A 4EN9B 4ZU7A 1FOD2 4Q4W1 3GZAA 1WMEA 1DQ4A 1HQWA 1UZZA 4QX5A 1G9BA 2PLV3 4Y22B 2IFRA 1YI9A 2G9GA 1PO21 5LK5A 3X29B 1W6NB 5ABJA 4XFGA 1LRHA 1Y3TA 2XBO1 3AK0A 3AYCA 4HT1T 4AGRA 5BNPA 4UW3A 1A78A 1A8DA 4BE3A 2DUPA 3MGUA 1WLDA 2BWAA 2WSUA 1GZCA 3ETQA 1RB8G 5C9AC 4IEWA 1ZVFA 2TEPA 2B8MA 1RUI3 2ZHKA 3NL1A 4CZSA 2P2KA 4YZ2A 4P9WA 1N1YA 1WBFA 3GHNA 4HETA 1W6MB 4PIXA 5CB7A 3MLKA 1GQGA 1G8WA 2UWBA 4QXKA 4CYDA 1O3TA 1CAUA 1A8MA 3DPRB 3J26N 1JXNA 1IGOA 1OLRA 3AZVA 5BNNC 1V6KA 2R062 3SHRA 1GKBA 3AFKA 1RMU3 4RR3C 1OHFA 4Q4W3 5BV6A 2VVFA 1XNCA 1H2MA 1YNAA 5T5PA 1RUJ2 1PO23 5DZGA 1AXYA 4XF4A 2DURA 1KXGA 3RSJA 2CY6A 4R4XA 1ZZ9A 1R081 3VHOA 2VNOA 4BCUA 1PVC3 2P3IA 3D4KA 1V6OA 3DV8A 2XBO3 4FO9A 4Q27A 2X5IC 3OGJA 4L9BA 1QQP2 5K8SA 4P5HA 4MXWB 3N4MA 2WNUB 4E4SA 2BYVE 1EAH1 4FVVA 1FXZA 2R16A 3ZSKA 5T5OA 5DG1A 3AYAA 1LKNA 3TN92 4FXKB 4JVAA 5C4WA 2ZKNA 1VR3A 3B9CA 4CRQA 2FBEA 5IK5A 2WNEA 2PHFA 2WIIB 5DUVA 1WLWA 2HWF2 1UL9A 1U12A 4HPKA 2Q1ZB 2WS93 4FT8A 4Q0SA 2A3YA 4Q8LA 2N7GA 1QJY2 3H1YA 1VBE3 3MIDA 5CFDB 1ENXA 1NQDA 4NOTA 2PAEA 1VBA1 3MEPA 1AHSA 3VDDC 1YJKA 2D3RA 3BALA 3EBRA 3JD72 1O3RA 2IXHA 1RHI2 3ZXGA 1MVEA 4NWVA 2JXAA 1DHKB 2D6OX 4PDWC 3S30A 1IKPA 2ERFA 1NCQA 3TRSB 2ZGPA 3WG4A 1MQTB 4NPRA 4JCKA 2R061 5KXEA 1ENQA 1CX4A 2RMU1 1JYCA 5HCFA 3NV2A 4M0NA 4E2GA 4LBMA 4WM8C 2JX9A 2CGNA 4S2DA 1DYKA 2QJVA 1EAH3 3O0WA 2A5ZA 4BMBA 4RD7A 2VPVA 4AI2A 3FFZA 2WKKA 5FBZA 1VAMA 1QXRA 4N43B 2VVDA 3VN4A 2D40A 4L97A 1ZNPA 1YFUA 2GNBA 1QQP1 5KC5A 1DGRA 3K51A 4BM8A 2K9ZA 4TWTA 4JDNA 2FHRA 1X7NA 1VBC2 2BFUS 4HKOA 4U2AA 5E8AA 2NZ9A 2O8QA 4KWJA 4BLJA 1GNHA 3TN91 2WJSA 2OPKA 4LA3A 1TNFA 4DY5A 2XJPA 2WLQA 2E7AA 1SBEA 2YV8A 4WBBA 4LHLA 1U5YA 3QH7A 4FTSA 4KG0A 4W6XA 1HRV2 2FQPA 2JG9A 3WW1A 3MF6A 3DL3A 5BNOB 1APNA 3M8LA 2HWB3 1FPN2 2B45X 1VBB2 4XTMA 3VBUB 2B39A 2GNTA 3VBHC 2PAMA 5K9YA 4YM3A 1CAXB 2B46X 4OI2A 4DMIA 3NW4A 1NYWA 4J6GA 2UY9A 3O5SA 1UPIA 5T5JA 4EN0A 4Y1VA 3IDBB 4IETA 4I0WB 5GZCA 4AVBA 3KT7A 1PIV2 2PYTA 2ZX3A 1DG6A 1O91A 1S0IA 2ZX2A 1CIWA 2PHWA 3FBYA 4AVSA 5FFOC 4YGCA 4PDWA 1TNRA 5LEJA 1D0HA 3SH4A 1G9FA 4N9HA 2AREA 5C9AB 4W65A 3WW2A 5FLHA 5BYNA 2SLIA 4XMAA 2JECA 5T55A 5C8WA 1BK1A 2GDFA 5E1RA 4CP1A 2GZWA 2BPA2 4PQ9A 1HX6A 2X29A 5J3UA 4XMIA 4Q4Y2 4WV8A 4WM8A 1AYN3 3PJQA 4IEYA 1OFSA 4FPYA 4AVCA 3WDYA 1XYPA 3ZXLA 4OHVA 4HVOA 3M7AA 1COV2 1UKRA 4TZDA 4AFAA 5LRRA 2BVBA 5BNNB 3E6CC 3UKNA 5I8TA 1IPJA 1MACA 4RR3B 3ZYRA 4PBOA 4Q4V3 3HMYA 4XBQA 3B69A 3RPQA 1KS5A 3FC0A 1Q8PA 5I0UA 3G6JB 3INAA 1ZM1A 4XILA 1GV9A 3ZFEC 2P3KA 3FUQA 1BMV1 1FPN1 1VIWB 2Y0IA 4AF9A 5CU1A 3S7IA 1SEFA 2WA3A 3SXWA 1PK6A 3ZFGC 1S0FA 4I2OA 3WV6A 5H9QA 2X5IB 1CJPA 4FPKA 2D6MA 2P3JA 2ZS6B 5AC91 4FP3A 4QGMA 4NO4A 1PIV1 5GJ6A 2IXIA 1POV1 1DQ6A 1AR92 2XJQA 1HIXA 3WQ1A 4AFDA 5JCTA 3DN7A 2BVVA 3WY6A 1RUNA 1ASJ2 1AVBA 5GZFA 1W6OB 3VBOA 5I0RA 2IWGB 2XJRA 1W6QB 1ENRA 4P9LA 1S0BA 1C1FA 1RUC3 1SDWA 3BU7A 1WCKA 4JTNA 4D7SA 1MEC1 1XNDA 1KJRA 4LLFA 4HFSA 4OUSA 1PNGA 3VDDB 4CDQA 2RS31 4YNIA 3VBRA 4ZU5A 2NPIA 2CAVA 3VZLA 4PDWB 5FQ0A 2A7AA 1LOGA 3TB0A 1W0OA 1GZWA 4Y5Z0 3RJ2X 4FP2A 3ZO0B 4DNYA 4R9DA 2RE9A 3AZZA 2GMEA 4RQPA 1V6IA 4HZFA 4UXAA 4FCAA 5CNAA 3H3ZA 3AP7A 2SBAA 4C0HA 4QPYA 1HQLA 4XOGA 1IS3A 4Z2WA 3OF1A 2JEMA 3ZFFC 1JOJA 3HWJA 2VUAA 1RUD3 3UV9A 1Q8VA 1FNZA 3VZJA 5FMOS 4KGGA 3APBA 2VY0A 2YMZA 1UU4A 1M06G 1V9U3 3SCHA 5A33B 1IPKA 1NQJA 1B35C 4FOVA 1ZBE3 3OD0A 2BBVA 4B3NA 2NM1A 4JDOA 1H2KA 2ZGUA 3KM5A 1REFA 1BJQA 4K7JA 2Y26A 3GZTB 2VGDA 1IS4A 3Q9OA 1ZA4A 2QDNA 4AI1A 1QOTA 3USUB 4AEDC 2QFEA 4K21A 4MZUA 2Q4SA 1MEC3 3B02A 4D94A 3VBFC 4Y26A 4QD2A 4FSJA 3NSTA 2RS33 1JUHA 3WDXA 3D0SA 2VW0A 1HRI2 2R071